2FMIA

Crystal structure of chey in complex with chez 200-214 solved from a f432 crystal grown in tris (ph 8.4)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
128
structure length
128
Chain Sequence
b'ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELLKTIRADSAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein cheY
molecule tags Signaling protein
source organism Salmonella typhimurium
publication title Crystal Structures of Beryllium Fluoride-free and Beryllium Fluoride-bound CheY in Complex with the Conserved C-terminal Peptide of CheZ Reveal Dual Binding Modes Specific to CheY Conformation.
pubmed doi rcsb
total genus 47
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fmiA00
3BRQA 3KJXA 4MGEA 1DBWA 5KQLA 3NNDA 2TMYA 2PLNA 4JA2A 3I45A 2PUEA 2VUIB 4MRMA 4Q6BA 3K9CA 4LE1A 3O74A 3C3MA 1GLGA 2WWVD 1RNLA 3EODA 3KYJB 4Z4CA 4IF4A 3HJFA 3UK0A 3EQ2A 1C4WA 1L5ZA 2H3HA 3Q41A 1P2FA 3F73A 2L17A 3LUDA 2WB4A 4LDZA 4F8JA 3CG4A 2NUBA 4NV3A 3FDFA 4HYEA 1PHRA 2FMKA 3F6CA 3NNSA 4Z9AA 3ROFA 2M98A 5ABPA 1URPA 2NZVG 4ZJPA 1JX6A 1RZRA 2WMYA 2OQRA 3RVKA 4YRZA 1NXPA 3M6MD 4OLAA 1ABEA 2O20A 3LKBA 2JVKA 3OQNA 4L4UA 3IPCA 5PNTA 1VPWA 1TLFA 2IYNA 5EWMA 1B00A 5T3YA 5IUKC 1DC8A 1F4VA 5BRJA 5TPZA 4FE7A 2MSLA 1L5YA 5IUJC 5KQPA 1DCFA 2WRZA 1EFAA 4Z4IA 5KI6A 2L18A 3I09A 3P9YA 3N0RA 4MQEA 3IDOA 3EAFA 4OBBA 4ETIA 1FFSA 3KTOA 4JB2A 4MQFA 1Z2DA 3HXMA 8ABPA 3IP5A 3OLWA 4HNQA 4TN5A 1USIA 4MYRA 5TPZD 1QP7A 4IMJB 3N8IA 4JAVC 4YR7A 2PUCA 2FEPA 2FQYA 3L6UA 3C6QA 3QX9A 3RVMA 5JS1A 2GI4A 4B09A 4KRFA 1JWLA 5KQMA 4G0QA 2R47A 1H9CA 1QO0D 3TO5A 1YS6A 4KFCA 3HK2A 3MQ4A 4Y9TA 2HQOA 4EUKA 4RY9A 4LDAA 5GQSA 2BGGA 1RXIA 3DBIA 3KSMA 3R0JA 5EWMB 2WY2D 3EDCA 3O2QB 4NICA 1XHEA 1E2BA 2M1ZA 5TQ2A 5BR1A 1BAPA 1OXBB 1Z18A 2ID9A 4RK7A 4XARA 1A04A 1NXSA 5IEBA 4YCSA 1QP4A 1K68A 3FFWA 1EWTA 4MS3A 1JF8A 5IULC 2PAFA 1TM2A 3FFTA 1EWKA 4PYRA 5B3JC 2A9QA 1QO0A 3OMXA 5C5EA 1QP0A 2LBPA 2CHFA 3KCNA 3CZCA 4RK1A 3RQIA 5KQGA 3HVRA 1NATA 2MYTA 2X7XA 3C97A 1Y1LA 2IKSA 2PMCA 4YWHA 2JVIA 3KG2A 4LE2A 5JNVA 1DC7A 2YHAA 3O2SB 3OLVA 5CNMA 1CEYA 1MB0A 3CNBA 4JASB 4F11A 4H60A 1ZGGA 3CTPA 1E6LA 4G0OA 5DLEA 2FLKA 4RKRA 4LZLA 3HM9A 2QV0A 2VYCA 2PKXA 1GUDA 4EYKA 5CNJA 4MLDA 4W5RA 2FTKE 4FE4A 1MIHA 2VK2A 5FBKA 1E6KA 2JCGA 3QLUA 2LIVA 4QPJC 4RK4A 2DRIA 1JFTA 1VKRA 3TX6A 2GKGA 3N53A 4RXUA 4WXMA 5FWXB 3GV0A 4PEVA 3M9XA 4MR7A 4EYOA 5IC5A 1YK0A 4EY3A 3HS3A 2F8TA 1FSPA 3SNKA 2B4AA 3IPAA 4WT7A 4IRXA 3RVLA 1FQWA 2P4UA 4N41A 4MS3B 1F51E 2HJ9A 1DP4A 3SAJA 4NQRA 1DBQA 3FGZA 1QPZA 2E4WA 1JBEA 2HPHA 3I42A 3CS3A 1U2PA 2RJNA 4O1IA 4S05A 3A3KA 4Z4GA 1BDIA 1NTRA 3CKMA 4NCBA 5EWJA 2FMIA 3OO1A 1QQBA 3BREA 3KS9A 3FMVA 4ML3A 1EWVA 1PNTA 2ID7A 2MSKA 5IUNC 3A0RB 3GBVA 4CBVA 2JBAB 2GWRA 4KNYA 2RGYA 4OATA 1QKKA 5EWJB 2A9PA 5B3JA 4RV5A 1JFVA 1WETA 4OG2A 4KPYA 1DBPA 1JHZA 5D2CA 3QEKA 2QVCA 1UDRA 4O1HA 3VNBA 1ZY2A 2JBAA 3LKVA 4MAAA 2FW0A 4GNRA 4KREA 3N75A 1ZH4A 3FFXA 3E3MA 3H75A 3F6PA 3LUHA 2LUOA 3M9WA 3QELA 1SXHA 4G86A 2JRLA 2JB9A 4JB0A 3T6KA 4GPAA 5FWYA 1TJYA 3A0UA 4F06A 4Z99A 1JFSA 3O75A 1U0SY 4KMRA 4KK3A 4RY8A 5GOTA 3Q9SA 1J56A 1YMVA 3EGCA 3N6VA 4G97A 4RK6A 2PUDA 1K66A 1USKA 2IPMA 3ROTA 3UKJA 4DQDA 1YTUA 4XAQA 2XDYA 3HSYA 4W5OA 2A9OA 3RVQA 2MYNA 1USGA 1PUXA 4ETMA 4EYQA 3E61A 4W5QA 1DJMA 3LUFA 4P1ZA 1EHCA 3S99A 5JS2A 4MR9B 4XLTA 4Z4HA 1W25A 2B1JA 4NCAA 5TE9A 3OM1A 3HZHA 4Z0NA 2FLWA 3SQNA 4G0XA 1SRRA 3OMWA 4KVFA 3URMA 3ILHA 1HEYA 1QQAA 3Q7TA 3OM0A 3Q7RA 3IP7A 4TLLB 5HQJA 5CNIA 3RVRA 3O1HB 4EVQA 3F7NA 3BBLA 3RH0A 4RZSA 1P6UA 5HSGA 2NZUG 1NXWA 4O5AA 4P98A 4JP1A 1BDHA 4RK5A 4RWEA 4KQCA 3LTEA 5TPWA 2Q5CA 4WWHA 2YHBA 4Z4FA 1MVOA 2MYPA 3D02A 1QMPA 1LBIA 3Q7SA 3CZ5A 4Z9BA 5JNSA 4MR7B 4WZZA 5CHYA 1ZESA 1BVHA 3LUCA 5TPWB 3IP6A 1KRXA 1U8TA 1Z15A 2QU7A 1D1PA 3EQZA 3H5TA 4H3KB 3SY8A 4F12A 1A2OA 3QLTA 2HQRA 3T38A 2QW1A 3CLKA 1LJUA 4XASA 4TLMB 1SXIA 1SXGA 1S8NA 3BILA 3RVJA 3LUKA 3HUTA 4DN6A 4MLCA 1Z2EA 2JK1A 2QR3A 1AB5A 2LP4Y 1Z12A 2FEWB 2H0AA 2IPAB 1JLKA 4ZMSA 5KC8A 3MA0A 3JTEA 3OQMA 1JH9A 4PICA 3UUGA 5DCLA 1A0OA 1KGSA 3G1WA 2FKAA 1Z26A 3HEBA 1ISSA 4H3HB 1GUBA 3OO0A 3SM9A 1Z16A 2R48A 5FWXA 1ZHHA 3MIZA 2E4VA 3O2JA 1P8AA 4G0YA 1M5TA 1TMYA 2PJUA 1Z25A 2PUAA 1DCMA 4MR8B 2HSGA 3SG0A 2FXIA 5JNRA 2F8SA 1PEYA 2HQBA 3NHMA 3KLNA 3QLUC 4RS3A 1U04A 3CRNA 3GL9A 1DCKA 1NXXA 3N0XA 1ZVVA 2VUHB 1RXEA 2W42A 1PEAA 1BA2A 4UHKA 1VRVA 4RU1A 1R8JA 1YS7A 1DRJA 3DZDA 4PE5B 3IP9A 5DTEA 1JDPA 3DLBA 5HM6A 2QXYA 3L49A 2J48A 2L2QA 2WJWA 1MAVA 1YMUA 4YV7A 4WXEA 3H5LA 5JNTA 1EAYA 5BQ3A 4G0ZA 4G0MA 4KQ9A 3HO1A 3H6GA 1KMIY 2JVJA 2PL1A 4M88A 1YIOA 2FMHA 9ABPA 1YVUA 1C0EA 2FSPA 3RVPA 1Z17A 5E3JA 4D6XA 3HCWA 4MS4B 4MPTA 5TQJA 3T8YA 5IX8A 4E7PA 5F64A 1DZ3A 3JVDA 3QLVC 3Q15C 4E7OA 2FN9A 2IDMA 1ZH2A 2MYUA 3RVNA 2GBPA 2NT3A 2ZAYA 3CG0A 3GYBA 4MR8A 3H5OA 3H5WA 4RXMA 5DGCA 2L19A 4YLEA 3QX8A 1AB6A 1KRWA 2PUGA 3H5VA 1ISRA 4WUTA 1I3CA 1W9HA 1U2QA 1P6QA 1T34A 2IPNA 3HDGA 1MB3A 4W5TA 3DGFC 1ZN2A 3CFYA 2A9RA 2R4QA 3D8UA 1D5WA 1ABFA 3EJWA 3C3WA 4MQEB 1PNRA 3MF4A 4N0QA 3VNAA 3CHYA 2E4YA 1JL3A 4MS1B 4L85A 2E4UA 4HNSA 3LFTA 3LUGA 3TB6A 4LRQA 4QICA 3LUJA 4EYGA 2CHEA 3GT7A 3RVSA 5KC9A 1XWWA 1APBA 4RDCA 3DLHA 5KWSA 1NXVA 4MS4A 4ETNA 2QVGA 1JYEA 3W9SA 5FBHA 2FQWA 1NY5A 5I4CA 1QNLA 3HV2A 4HNRA 3H1EA 5FWYB 3CU5A 2FMFA 3BRSA 3KLOA 1RPJA 1D1QA 2FQXA 2CWDA 2IPLA 3GRCA 5TQ2B 4RY0A 2PUFA 5CNKA 3JS5A 3EULA 4QYMA 3OLXA 4MRMB 1LBHA 2AYXA 4RK0A 3TMYA 1RZRD 3QK7A 5TQ0A 5BRAA 3G85A 4D6YA 3MM4A 4RKQA 4OTZA 4ZYLA 3OLZA 5IBQA 5T7BA 3OQOA 2GX6A 1GCGA 3QEMB 5TQ0B 2WJAA 1E6MA 4W5NA 1OXKB 4IGAA 4YP9A 1NXTA 5IEJA 3GBPA 2PE5A 4LE0A 3JY6A 4MQFB 4F3TA 1M5UA 1ZDMA 2FN8A 1YK1A 3H5IA 2LPMA 2E4XA 1XHFA 3QEMA 1Z13A 4YS6A 5DKFA 3C3KA 3QELB 1CHNA 3B2NA 4Q6WA 3TD9A 4ZMRA 4N76A 4QYWA 3O1JC 3RVOA 4EVRA 2KYRA 2N9UA 3KYIB 2I6FA 2QZJA 5ED4A 2CD7A 4RSMA 1DRKA 3OLYA 2AYZA 5JNUA 4Z4EA 3QLVA 4DADA 2P9HA 4N47A 6ABPA 1M2EA 4D74A 4FB4A 4UHJA 4KV7A 4TMYA 4ZPJA 1ZGZA 3KKEA 3H1FA 5HKOA 2R25B 5EWLA 1JDNA 1SD5A 3NBMA 1TVMA 3JVIA 3A10A 3JPYA 2NT4A 1VLZA 1LJLA 4EGSA 7ABPA 2QSJA 2PUBA 3LUAA 1D2AA 3KHTA 1LK0A 3LMKA 5EWLB 4N0PA 1DG9A 2RJOA 2IOYA 3DGEC 4XXHA 2E4ZA 3I5AA 5JNWA 3MMNA 4IILA 1JYFA 1GCAA 2ZWMA 3NNNA 4KK4A 4G0PA 3HDVA 3NHZA 4EVSA 1D4ZA 5C5CA 3GWGA 4MS1A 2FEKA 4MR9A 2RDMA 2OENG 2V0NA 3MYYA 4N03A 1BDJA 3GA5A 4JOQA 3K4HA 2MSWA 3JPWA 4YGXB 1ZAYA 3ILYA 4IMIB 3H1GA 3O21A 4Q7EA 3H6HA 4LX8A 3O1IC 4KZKA 6CHYA 1CYEA 4S04A 2FVYA 2PL9A 3T95A 1M2FA 3HUUA 1NXOA 1ZITA 3N0WA 4XFKA 4YO7A 4OLBA 1FFGA 4RXTA 1IIBA 1FFWA 4PZ0A 3LOPA
chains in the Genus database with same CATH superfamily
1UANA 3BRQA 1FDTA 3D4PA 3OPYA 4LHWA 1E96A 4UEWA 3AM5A 2GJ4A 3B2QA 1YASA 5F21A 4L1KA 1Q21A 3HJUA 1YZNA 3HH8A 4L5IA 4S2UA 4E5DA 4F9FA 3JVVA 2ZS7A 1ZINA 1SZJG 2J41A 3PNYA 3VNUA 1RQ2A 3A6EA 1QGOA 1XZAA 3O31A 2HTEA 3ZEAA 1Y7TA 3V8EA 4OA8A 5LIRA 2QG9A 1ZCJA 4W99A 1NVGA 1K5HA 3G2PA 3JYNA 3QHAA 4PTYA 5AQEA 2AN9A 2H1VA 4CKBB 4GM1A 4F8JA 4DDUA 3L7DA 2QRVB 3OU7A 4DCUA 2GZDA 4ND1A 4NARA 3FMIA 1TZMA 3SX2A 4E11A 3GFFA 1ZK0A 4JR2A 4DCTA 1RWNA 2B8NA 3KPJA 2DZDA 4V1CI 2G17A 2XA1A 2XUJA 3FXAA 3SCZA 3TRJA 3ZGLA 5AESA 3W2IA 4NZPA 1ONPA 3AVOA 1JLLA 1N3YA 3F98A 1ODJA 1XEWX 3U7GA 5ELLA 2CJYA 2X0IA 4X93A 5DVZA 4ASUA 1T4DA 3HCBA 4GF5A 1OLSB 2R6FA 1Z35A 1IHDA 4RHEA 3DW1X 4ICIA 4HRYA 1Q0PA 4UEQA 5BYAA 1LUAA 1PYDA 5IUKC 1EGHA 4XQ9A 1UOEA 3N6RA 5IKEA 1TU3A 1BXZA 2XCQA 2ZYGA 4FUTA 3BMCB 2OXIA 4F46A 5HS4A 1NURA 5H80A 5KOJB 5KOHB 5KBYA 3JQFC 3THXA 4J2HA 4CFZA 1VXRA 1GSHA 4Y6PA 3QPUA 5CCEA 4ALKA 5AI6A 4AXXA 5KKCA 3RKRA 2D0DA 3ENKA 3FVTA 1F06A 1GUFA 1NBWB 1I4OA 1B42A 5BWCA 1TD9A 2O8VA 2R8YA 2W2KB 5LQSA 3V4OA 1R6AA 2L69A 3ZJ5A 3QUAA 2D5LA 4BECA 2H57A 1LI7A 2VBIA 3FOWA 5KSOA 1RCFA 2OK8A 4JAVC 4MVJP 1TZ2A 2FEPA 1N5KA 4YMUA 3NBAA 3TSYA 1TZBA 2GI4A 4C0JA 1JS1X 3DOCA 4P8RA 4YROA 1ENPA 4YQEA 5CA0A 2QM3A 1U8XX 4JKYA 3AVUA 5B1HA 5JCOC 1WZNA 3EMVA 3Q3GE 4IDPA 5GONF 2IK8A 1MFZA 1MJNA 5KB3A 3BH0A 1UXOA 2QR5A 5CPFA 3W5UA 4JJGA 1RIFA 1XX6A 3HA2A 3PUVA 3HGMA 5AW8A 1MX9A 4HAIA 3B82A 2A92A 4XARA 1A04A 1KDYA 4BQIA 3GLIA 2Z4TA 2X13A 1EFUA 1MRZA 1O9BA 4COKA 1DJQA 1OVMA 1CF4A 2AG5A 1H22A 4XQEA 3U7HB 1RJEA 4PZCA 3SYNA 2PVSA 4S1WA 4V0MA 3DPSA 1F2UA 1P62B 3G7SA 2WM2A 1ZYUA 4W9NC 5T4HA 4ES6A 1QFYA 2IU6A 1AGYA 4RMJA 3ELWA 5HBRA 2PMCA 1WZ2A 5HF6A 2AN5A 1JLSA 4Q19A 1YZHA 4HDKB 4RSHA 4PCVA 2G5PA 1PZFA 4ZVSA 2H4WA 2EW2A 5HR5A 2XE4A 4C7KA 4RD4A 2JGKA 1Q3TA 3FWPA 4RGVA 5ITZA 1N32B 2IHUA 1II8A 1GYRA 2XMZA 5EXDA 2VHZA 1DO2A 4RL6A 5G41A 4Z1OA 5HWSA 2BFCB 4K6GA 5BSVA 2J59A 4W5RA 2ADOA 3CPHA 1FIUA 3PQ4A 3WYCA 3O83A 1QP8A 5H02A 2GZRA 3PFFA 1KO8A 2QT0A 3VOTA 3AVQA 4W5WA 3HKEA 2HHJA 1U7UA 4KE8A 4NEHB 3CWQA 2FX5A 4H1UA 1L3IA 2NXWA 1KZ9A 2AG1A 1WBBA 2F3RA 2WV7A 2YV4A 5CJ2A 5TGDA 4NK4A 3ZIAA 1OUMA 1V8BA 1WU7A 2P5TB 3DTVD 4NS4A 5IC5A 3LT0A 4YVFA 4A15A 3SNKA 2ZSAA 3DMYA 3RJ5A 1V5IA 4QA9A 4N41A 5B53A 2JASA 1X7XA 4CMKA 1FMTA 4DIOA 4G37A 4L57A 4NABA 5H3LA 3FNFA 4YJFB 3UN1A 2J4DA 3OF3A 1E32A 3HMKA 4P54A 3DHYA 5ES3A 3U26A 4AO7A 4EHNA 5K8VA 3PX2A 4LFBB 1E6EA 1VBKA 3L1JA 1M2OA 1O5TA 2EKBA 4OH7A 3IHWA 2ZK7A 3BQNB 3AETA 5DHQA 1TO2E 1Z29A 3AUJB 4IY1A 4N18A 3B9RA 2LCQA 2D59A 3EHDA 5B1DA 4CLXA 1BU5A 4J94A 1UXJA 3A1VA 1EWVA 4LTMA 2P2LA 2QRNA 4RA6B 4RM2A 1BOFA 4DJTA 2EJUA 2IBTA 2EFGA 2HJGA 3NB0A 1M1XB 1UZAA 4BHTA 1GFSA 2E1PA 4N40A 3Q2IA 3RK0A 2JCYA 3RO7A 4FJ2A 3WNZA 4AG5A 4C5BA 2B8JA 2C5LA 3H13A 1DQRA 1MJGA 2JHPA 1T3LA 4I5GA 1OPRA 3P5SA 4GZ5A 4WGFA 4EA7A 3DBRB 3SVLA 2PU5A 3P4XA 1OH7A 1GKUB 2XNKA 3L0YA 5DGXA 1A8HA 4Y1EA 1G2PA 4D8TA 1DB3A 4PC1A 5AD1A 1KQFA 1I4TD 1YZGA 4G86A 4JJZA 2OHJA 3HVJA 2RJ3A 4KXXA 5A6VA 4GPAA 1SBCA 2YJ4A 4WX2B 1S1MA 5FWYA 1DAEA 1GD1O 4FP9A 4JJ8A 4RA9A 5D7NA 4JLBA 4D99A 3IE1A 3LG2A 5AI4A 4HDRB 1JVSA 3L18A 1SVLA 4MGKR 4OMDA 3M3DA 3CGWA 3KNZA 1JHOA 1AHIA 4A8JA 4NYMQ 4CTMA 1K66A 2P67A 2IEAA 3GDOA 3QY0A 1C1DA 3ROTA 5BW4A 1S2NA 3RI3A 4WJLA 3AIMA 1CUDA 1XHLA 4UDYX 5IH7A 3FVWA 4ETMA 2XH8A 4GOKA 4NZZA 5ALMA 2W7TA 3BMXA 3ENNA 1CY8A 2CJWA 4OAPA 3O7MA 4KSCA 2R11A 4HDQB 3WK9A 2I2FA 4ON9A 1X1QA 3EFOA 3K6SA 4PFKA 1HEYA 5TY0A 2C4TA 1KERA 4FSXA 4O2AA 3QF4B 2WU8A 3WHIA 1NBME 3CLHA 4DDWA 4OGWA 5E6UB 4MQMA 1D7AA 3MTJA 2I1VB 4MV9A 1GADO 2CUTA 1MTZA 4TLBA 3RT7A 4F5EA 5CDGA 5FDFA 2O7QA 2ORED 1W5BA 4Q1CA 3L84A 4N8EA 1ZRNA 4KLNA 4F93B 3E3OA 2HQSA 2CLKB 1LSJA 3OCWA 4A16A 1G8FA 1T1JA 3AERB 2WFLB 3JZAA 3EHEA 2NUAB 3ZWVA 1IBCA 4XRGA 4XJXA 1CX9B 1W2GA 1FRQA 2DWUA 1LBIA 2QLBA 3FETA 1A95A 4TV8B 3RNOA 2HA2A 3CE6A 2W2LA 4BFCA 3C7TA 5JHGB 5KYYA 5H81A 2NO4A 2WJGA 4H3KB 4ND7A 3G49A 3OJWA 1U2SA 1Z0IA 3NIBA 4PWZA 4W7SA 4E2FA 4EY5A 4L51A 1QK5A 3PGXA 1F2TB 1U3GA 4P4NA 4JVSB 3U80A 3BMOB 3WISA 2C4NA 2GCNA 2X8AA 3GRPA 3MAGA 5AKLA 5DW3A 1PL7A 5AVQA 3LUKA 3HUTA 4QVKA 1E9BA 2HWKA 1ZSVA 1E1KA 2YV2A 3EIWA 1E8NA 3IEPA 4GQIA 4UHBA 4B6FA 2IH4A 1I4EB 3FF1A 3HNOA 4DSNA 1Y42X 1QO7A 2WJJA 4QECA 3A6JA 2CV1A 4BRUA 1GRQA 4XSGA 5KTSA 1XDGA 3RAFC 2PLRA 2YOGA 2O7RA 1NVVR 2YMQA 1XJWA 4WNAA 4WIAA 5CD1A 1GAEO 2HWUA 1FYVA 2ZRHA 4L02A 1MB2A 4AJHA 1YV9A 3B12A 2PJUA 2FGKA 1E1CB 1T24A 1FE8A 3BL6A 2IYAA 3DNMA 4MR8B 4NDZA 4D56A 2PZGA 4RIEA 3UCXA 4HDNB 1VRWA 1ZRSA 3KLNA 4HWPA 2F9LA 4HL6A 3KEGA 3K16A 4HB4A 4I55A 2W43A 2JFGA 4FGUA 1DAGA 1VRVA 3EXIB 1YS7A 5JAHA 4IEFB 4YDSA 3BK7A 2YWGA 2NIPA 1ZA2A 4MYSA 3CBQA 2OC9A 4XVHA 1NQTA 4HXFB 1E60A 3WQBA 3CLSD 4LHVA 3DZGA 5CYOA 3ZTTA 3O4GA 4WXEA 4XYEA 5FPTA 2OD9A 2XQVA 3HJGA 3JQ9A 1H3NA 2HNAA 1MG5A 5DNWA 3SXJA 3IVAA 3WGHA 4NE7A 5ENZA 2EFHB 2P35A 3JQGB 4HEHA 3NH6A 3R2JA 3NBFA 2FSPA 2BLNA 5LMCA 1JXMA 1NLZA 4TKZA 4I46A 3JQBC 2BFWA 2J6IA 4ZCIA 5K09A 1A9QA 1ORHA 2NO0A 3B36A 1J8MF 1GVNB 4K9KA 2XYVA 5ALEA 1JJFA 4Y2RA 5P8WA 2HMTA 4LMPA 4C4SA 1UPTA 3MIIA 4FC7A 4NMMA 2RBGA 2W2OA 4OOFA 2C8LA 2GMWA 3G2MA 3N7AA 3HP1A 3JZFA 2ZTSA 3RLFA 4C7VA 1J24A 4I8DA 2OYRA 3LD9A 4C7BA 4C7OA 4LXTA 2ZSJA 1VYHA 3TFWA 2OT3B 1V11B 2XE6A 1AB6A 3PC2A 2O1WA 1C9YA 2A94A 2P4SA 3CZRA 1L8LA 3D3JA 3TSAA 5GVSA 4B47A 1UC8A 2XZTA 3D8TA 2OV8A 1HNWB 5ECGC 4FMCB 3PCTA 2IV7A 3E2IA 4KO1S 3O8DA 1SR8A 1SUAA 1DEOA 3LXUX 1J4AA 2I4MA 2JAWA 1CR1A 1SZCA 3B85A 3PQ8A 4KPFC 4XDGA 1BGXT 1BKSB 4IFEA 1XZQA 4N0QA 4QJBA 3WWPA 4BB6A 2RHBA 1F0KA 1OMOA 4L85A 3TB6A 1ADBA 1GL7A 4WBSA 3A58B 2AK2A 4O4IA 2NWQA 3HY3A 4ZU3A 2BYTA 3CVWA 4MQ6A 1VBMA 5DGHA 3ZD9A 1CRPA 5C5DA 3KQKA 2PY6A 1QR2A 1TM4E 2O3SA 1YDMA 2QTFA 3AL2A 3O8NA 3NHLA 3NONA 5EMMA 2HPZA 5BV8A 5LQCA 4IJ6A 3T7IA 1Z4OA 4YIKA 5IJWA 3G5MA 2QPOA 2YHSA 4UDNA 1G18A 3ROQA 3D6JA 1QGDA 3NOQA 5CFNA 2L0XA 4QXRA 4GLLA 3U3RA 5I4CA 1MJHA 1T2NA 4BLRA 1ESNA 2C7VA 4OI4A 3NEAA 4S2EA 4UCXA 4TRJA 2XUDA 2YV1A 5A0FA 3JS5A 2DG2A 2O7NA 2Q9CA 3OZWA 3PX3A 4MRMB 4NU8X 4R8LA 1HYGA 4WZBA 4Y30A 2QAGB 2EFCB 5ETJA 1E3SA 2P9FA 4FOSA 3R5TA 5TQ0A 2IYFA 2HMUA 1J8VA 3B13B 1UIMA 1SHLA 4HF7A 4HNTA 3LPDA 4P36A 2Q29A 5FFMA 3FF4A 3FGOA 3MJVA 1NNEA 4R2KA 1QM5A 3W77A 1BGWA 5GGYA 4FONA 3CEPB 1ZJ5A 4WCVA 2CXQA 3CE9A 1TUGA 3OCXA 4AG3A 4W5NA 1II8B 2VIIA 3K70C 3DLIA 4J0QA 2Q6OA 3HBMA 3ZG6A 4CKCB 2XPCA 4AKHA 4KACA 4K9NA 221PA 5EIHA 3COPA 3JY6A 4AECA 2R84A 4LVOA 2NAPA 3QEMA 4JJKA 4ETWA 4UM9D 1WY5A 2HCTA 2E1RA 3HSSA 4CV1A 1UC4B 2GCGA 1ES9A 1NVBA 1FSFA 3K6SB 4JY7A 4AY6A 3LFHA 3SBDA 5GAJA 2XNJA 3DD1A 3GJYA 1XO1A 2QSUA 3L9WA 4G5XA 2N9UA 5FO1A 1Z45A 1YZYA 2VJMA 1K8QA 3THRA 1N4AA 4DARA 5CM9C 1HQKA 3S1AA 5JNUA 5IBPA 4Z4EA 4PFSA 4DADA 1QFJA 1VA5A 2QPTA 3BDIA 3PV0A 4NYIQ 3TQQA 1IOWA 4CL2A 3JAMA 4O3MA 2WAMA 3IQXA 1FTQA 3L7AA 4RVGA 2C1XA 3TDNA 4E21A 4F5WA 4MJXA 2VJNA 1JLRA 1Y34E 2HMSA 3NBMA 3HJBA 4LJKA 4KJXA 3R6WA 4KDRA 2I3BA 1WXGA 2CVHA 5GZ6A 4CG2A 5FOWA 5BV1A 3BHMA 2VQFB 4YXFA 2I7TA 1ZN9A 4J0HA 1N8SA 2I3AA 2Q0HA 5I7EA 2NUPB 1M0TA 1WB9A 4RAOA 4UNIA 3KHTA 4R1TA 1PNOA 2O5VA 4WNCA 1BJKA 2CSUA 2QL6A 3LK6A 4DLLA 2XXAB 1TA4A 4X7RA 2EFJA 1OBHA 1PQ4A 2XIJA 3P26A 1C81A 4B2LA 1BMDA 2QZZA 1JXAA 1N6KA 1NXQA 3HP7A 4H16A 3I34X 2Q3EA 4RZIA 1JWAB 4YRQA 3BYZA 4YMHA 4D4GA 4LTNA 3ONFA 1D4AA 1G66A 4BQRA 4E31A 2ZIWB 3C5CA 4EF6A 1RWKA 5FNZA 4Y1FA 3T5PA 1AZTA 1DE0A 3L7YA 4KSYA 4O5OA 4B76A 3M6LA 4I4NA 5J3JA 2HCRA 4B84A 4F5DA 2XCSB 1BDJA 2A5GA 3TLGB 3K4HA 5DIFA 2XMCA 2WFAA 3GCWA 4KQ2A 4F6RA 2XWBF 4YRSA 1H8HD 2XRMA 3UV6A 1YB1A 3IMGA 4IPTA 4CR7A 1T0IA 3GNTA 2B5OA 2A59A 3TI7A 4YX9A 4US2R 2WJVA 5F52A 2GO1A 3Q3VA 5HQ3B 2QMEA 4A6XA 4Y18A 5D1HA 1N8NA 2IXTA 2V3CC 1I6KA 3VR5D 3B7PA 3D3QA 1U2GC 2OBXA 3OWOA 2C3OA 2HI0A 1J9ZA 4N5LA 5FPSA 4C01A 3ZD8A 1MPTA 1GRVA 2PNFA 1DIBA 2EZ4A 1JP7A 2R6GA 3RS9A 1VP3A 2IXEA 5IZCC 2IIQA 4QDJA 4W9NA 3A1EA 4BMCA 3EUAA 5MHTA 4YH1A 3OH8A 3RSOA 4GMXA 1KMMA 4YB8A 1FZTA 4WE3A 1PT7A 3FDFA 4PLFA 3U37A 2B9EA 4B82A 1HG0A 2W6ID 2HA0A 1AHPA 5FUBA 5B3LA 4PNHA 1AV6A 1Q0TA 1T4CA 1FTNA 4HGNA 4DBVO 3H2IA 5MDHA 3IB6A 4FHGA 2VUSA 3FMPB 4OI1A 4YBZA 2FPGB 5IC6A 3ZJTA 4CM1A 1WHTA 2Y9MB 2EJCA 1U1EA 3BE5A 1JHUA 1W2HA 2NACA 2DH5A 1JZSA 2O14A 2R5FA 2XXBA 3GLVA 4X45A 5EWMA 2XA2A 4MV1A 2A78A 1BRMA 1LNQA 6PFKA 3M1AA 1QOQB 4EARA 2OCLA 3W6UA 2VL7A 2BFFB 2CN1A 4BDTA 4CG3A 1OI3A 4HVTA 5FEMA 2I62A 4O4LF 1M34B 2EX0A 4HVCA 4G5HA 1EKXA 3AHDA 1QLHA 3ZV5A 3M2PA 5IXSA 2H4HA 4JB2A 3DTNA 2RHLA 3LCCA 1OI7A 5DLPA 2FEAA 1ZOOA 2GNOA 3S2GA 3HXMA 1BKYA 3O4IA 2GXAA 1DBIA 1HXHA 1C0PA 5HK9A 4CKBA 1H0SA 5COAA 2FFQA 1PQUA 4YQFA 3V48A 4HAZA 2JLQA 3CN7A 4TV9B 4MGHA 3PFBA 5FP0A 3O3NB 4B81A 4ROTA 3KHKA 3IA7A 5DRYA 4XWWA 2NU9B 1FP1D 1WOYA 1L7XA 1NULA 3CZQA 1FY2A 2HWXA 2OBYA 2V7QA 3KKPA 4GYJA 4KBFA 1QO0D 5AJYA 3FNRA 5DLQC 3WMFA 5JAMA 2HF8A 2F1JA 2X6RA 4FJ1A 4LCEA 4HDNA 2LWIA 1R15A 3W7BA 3QEBZ 2BGGA 1BXKA 2J0EA 4NICA 3I5UA 4DV5B 1T8WA 2V7PA 1R8SA 2ZSHA 1PFVA 1XKTA 5DV9A 3U81A 1EB9A 1M8JA 3K0SA 3E03A 4RK7A 4K0RA 1RC0A 2FG6C 4YV2A 1OZAA 3NJ4A 1ZHOA 1HUQA 3I2HA 1M0SA 2LBPA 3PUJA 3S3TA 2YXDA 4BMYA 4ZJYA 2J5KA 3E7DA 2JI8A 1VMKA 4RD3A 3WQQA 4EDFA 5HYVA 2I91A 3WGMA 4J0JA 2X4DA 1KPIA 3FYHA 2QM7A 1KIAA 1ZGGA 4RPGA 4ND2A 1RXYA 2E48A 3AG6A 5AI0A 5LLDA 4ADSG 3N58A 4ZJUA 4LJLA 1G7CA 3EISA 5U9CA 3SEFA 1KY4A 1SVKA 1NHGA 2F3SA 2P11A 3IDFA 4QBGB 5GM1A 1Y82A 1OWMA 4RCZA 4ZEOA 3ZJUA 3SHOA 4HRXA 3LV8A 2UVPB 4QUJA 1HBJA 2H8GA 3CLUD 3MINA 4OHMA 1DKOA 2GRAA 2QGFA 1YC5A 1N9KA 1KAOA 1YDHA 4QQRA 3OQ6A 5EXPA 3O8CA 2EKZA 2LIVA 4J91A 4PZLA 4XTRA 1H1LA 3KRTA 3LVQE 3VR5A 2P5YA 4H1HA 4YT5A 1RADA 4Q03A 2BMDA 3HLKA 2JJ2A 3TX6A 1IMJA 1R6VA 1NLYA 1T4CB 3CUUA 5LWQA 1A9ZA 1OVGA 4OPMA 2F8TA 1P1HA 5FO0A 1NLUA 1LF0A 1WB4A 2C9MA 3I6YA 1E3EA 3KPUA 4MPRA 4YMIA 1I24A 2GJ8A 1GL6A 1Z4QA 2CJFA 4XE5A 1RRPA 3F7OA 4RKYA 4ZVKA 2O2ZA 2ZCVA 3IEUA 5TEWA 2O0LA 4A8JB 5IXJA 1TCVA 2SCUA 1BS2A 4JOCA 1EUYA 5JWRA 4G1EB 3OIYA 4HPJB 2V7WA 2YJ5A 4B46A 2HAEA 3L7IA 4IHKA 4HWGA 3TM4A 3V33A 3B9BA 3L92A 1E4EB 3BREA 1NW3A 3IERA 1JQBA 2NZ8A 4CMIB 2P2CA 4Q7JB 1X1RA 1N2OA 2OXTA 4L4RA 4CUJA 5JCJD 4CBVA 1FRFS 5DN6A 4B5LA 5HZKA 4NYMR 1P4SA 1TTQB 2JJMA 1IVNA 2GKSA 1OU4A 2FPPA 3B8HA 3AVPA 4QARA 3VOBA 3JQDA 2B20A 1N3IA 3PFNA 4MV7A 1RI5A 1RXWA 2B8WA 2Y93A 3QSYA 1KARA 1M8GA 1NVEA 2QROA 2OGSA 4AUKA 4M89A 3VYRB 2VSNA 2JI7A 2X15A 5DNAA 1CRWG 3VVCA 1CXZA 4TN1A 4R7GA 5FUYA 2PRYA 2XTZA 2O2HA 3GAMA 3IR7A 4MHTA 3CF6R 3I1IA 5CVDA 5AXAA 1TJYA 3IEVA 1Z07A 3IESA 1DOHA 1Q12A 2ZVDA 4CN9A 2BFOA 4C0QC 3I37X 5IW8A 3I8SA 3Q88A 3QXSA 3TTXA 2YC2C 1V26A 2B4YA 4UNNA 3GQBB 1P7YA 2XD9A 3F8TA 3K7EA 1PFKA 2POCA 5A7HA 1QG0A 1FCJA 1Z0ZA 2VP0A 3SZOA 3UJ7A 4D82A 2QAIA 4JBHA 1W1IA 5JJBA 2Q3HA 4UUAA 5BSWA 2C82A 5LD2C 5J40A 3HSYA 4Q66C 5DIZA 3FOEC 3RIXA 3AEUA 1GXSA 1ZWLA 3DULA 2PKWA 1VI2A 3QVOA 4BC1A 4WCFC 3W04A 3ZLBA 4F6LA 1PJSA 1E77A 4NCAA 4JFAA 5TE9A 3SS9X 5DYYA 4D3YA 4UTRA 2JG3A 1SRRA 1UMKA 4Y6GB 3X1JA 1AUQA 1SHKA 2A9JA 4URXR 1YTLA 1K06A 3AUUA 1AUXA 5JD6A 2ERCA 3R6TA 3K20A 2Z6UA 5L4LA 3WNQA 4E5NA 1YR9A 2OO3A 3BBLA 2PR2A 3NC1C 2VDNB 3CR3C 2Q9UA 4R84A 3WNBA 3I6MA 2Q2NA 4EP1A 1J7JA 5JI3E 2AZXA 4Q4AA 3JQAA 1KA9H 4DXAA 5EGSA 1B8VA 2OLKA 3K09C 1MH1A 1R6XA 2ZS8A 4DJ5X 3ASYA 3HDYA 1GPLA 2X9VA 5F5LA 2GXSA 1I13A 3ZDZB 2OZVA 2NXCA 1CR0A 2I54A 3EARA 3H5RA 3OCVA 3SU8A 4P92A 2EHJA 3JYQA 4Z9BA 3QMWA 1XTSA 1CQWA 1XCJA 2H51A 2Z8ZA 3G9ZA 3K0BA 1Z7WA 3BHJA 3KVOA 5DX1A 4GI2A 5K0EA 4PX5A 3LQFA 4AURA 4JBYA 4WDRA 4EA8A 2OL4A 3T9DA 2IYEA 3EPKA 1OAOA 4XQGA 5JSZB 1AKQA 3FSEA 4L8VA 4XFDA 1G7RA 1T2FA 2WZCA 4XASA 5KIAA 3RS2A 1NC3A 4E6PA 2BJVA 3NTVA 1P7CA 1QSGA 1UEIA 3RVJA 4PZDA 4KGDA 4C7MA 4EGAA 4OP1A 3IUEA 1YB2A 3EYWA 4K8OA 1ATZA 1EXVA 1BKDR 1LRKA 2B2CA 1E1MA 2CVFA 3FR8A 2ERYA 3HKEB 2ISQA 1X77A 4MKFA 4PVCA 4V03A 1A0OA 4ZP1A 1UCFA 2XXJA 1SC3A 2Q5JA 5K8TA 2XUHA 3FSGD 1DTWA 2UZ0A 3OFND 5FLKA 3SM9A 2R48A 4OLJA 2F4NA 2DBVO 1IAQA 2XMBA 4YT4A 1C8KA 3H1PA 1JIQA 1U0FA 5KJFA 1E4VA 2VN8A 4CEIA 4K1LA 5E1MA 1OBCA 3F3KA 2C0CA 3NDPA 4D9MA 1USUA 1F17A 2HD4A 3B78A 2KQUA 3PDHA 4ENSA 5SY9A 5JNRA 3AUFA 4YAJA 3KXIA 3TINA 2W8BB 3KYBA 3PDUA 4EG3A 1G9XA 2RGNC 2WT4A 5DCYA 3WP1B 1K2WA 3IAM1 1JDSA 2QN3A 4KLZA 1RXEA 2XTJA 4NCKA 5CB8A 5LJLA 3ETGA 4TLAA 2ZUBA 1EJ0A 4HGYA 4ARVA 5CFQA 5FV4A 3STWA 5FOSA 4G1BA 1R8JA 3A6LA 3OIFA 3EZXA 4TKVA 3X1DA 1P9OA 3OP4A 1ECBA 2QQFA 3HRKA 4YRTA 4FZ3A 1QHNA 2Z43A 4LOAA 2JA1A 3U62A 4XYMA 2KPOA 3VO9A 5CP8A 2JHFA 3BB1A 2RE8A 3A2LA 1YJCA 1K88A 3SKYA 5T64A 3EDMA 4EGQA 4ZHQB 4DM7A 5JY6A 1UZUA 5CT9A 1EK5A 4KQGA 5LQJA 1VL8A 2UVPA 4C0BA 1Z5ZA 3ETLA 1WEHA 2BV3A 1USVA 3NAQA 4G4IA 4MPTA 1LY1A 4TRMA 1NF8A 2JLZA 5FH9A 1H1LB 1OILA 1LBQA 2Q41A 1NRIA 3E7PA 4MJLA 3WQSB 3T3EA 3MT8A 1XBTA 3H0EA 1CZRA 3U39A 3EY4A 2Z08A 2WJZB 2PX2A 3PDCA 3KOOA 3CO0S 3D5QA 3GFPA 3QU5A 1QYRA 4P08A 1HFEL 3QX8A 4F04A 4EY7A 4Y2YA 4PO9A 1KBZA 2IYLD 1JZQA 3EBPA 3IOYA 4B17A 4BE7B 3OJOA 4ZEVA 3ZGNA 2RONA 3W5VA 5JBNA 1NYRA 1P7PA 4NH4A 4RQBA 1E5XA 3AVXA 3O92A 3IPLA 3GEIA 3O3CA 1LDMA 3RYHA 1ZD2P 4FOLA 3GIWA 1MEJA 2YY6A 5KQRA 5G0VA 1NW8A 1SZDA 1K4MA 3TQSA 4C0SA 4MA4A 2HV8A 2W98A 4BNHA 2QQ0A 3B5IA 2PYDA 3BJMA 2D1YA 3EDOA 1AOXA 3BFVA 3PXAA 4KGVA 4V2IA 4MAMA 2OM2A 1TJNA 2C3MA 3DE3X 3NRCA 4JLVA 1PR4A 3EPRA 3UMCA 3WFJA 1CQPA 2FF5A 5IN5A 4HNSA 2XW6A 1ECLA 1F8XA 1P0CA 3AF5A 2ECFA 1PS9A 4YACA 5AVOA 3KO8A 1GDHA 5EHXA 1YRLA 2QKYA 1NX6A 4EI9A 1OX4B 1VBNA 4FKBA 1W36D 2X86A 3NMUF 4RLFA 3NLLA 3EXHA 1NBHA 4MYCA 4YCMA 5B1IA 3NHUA 1SG6A 2EL9A 5DI9A 1W4CA 4F91B 5E1OA 4BZWA 1NMYA 3AHHA 2QS9A 1X3SA 3FAKA 1IOZA 2NSLA 1QGAA 1VCOA 3H1EA 3MWKA 5FWYB 3TSOA 1NMXA 1D1QA 2A5JA 2GK7A 2ZWPA 3PDIB 4L73A 5FULA 3NVAA 4B3FX 3TX2A 2W70A 1C7RA 5LDDC 1H9BA 2MIIA 1NJFA 3JD4A 4C6TB 3GEHA 4X7PA 4D0LB 3NBYC 2ZUDA 4O2LA 2X5JO 3EVNA 1GN9A 4CDRA 3D2AA 1ZD4A 3UCFA 3LLVA 3TSWA 2VP6A 5JNLA 5JYBA 4HX9A 3GMIA 1P31A 3H0KA 3K8OE 3B3FA 3PI6A 2QRKA 4JVMA 3U1VA 3I01A 3WL6A 2Q4TA 2Y68A 4QT4A 1EUCA 1O94D 4MVXA 2Y1FA 3ITDA 2ONJA 1I3KA 5H9WA 2G9ZA 1XU4A 3OPVA 3T61A 1WDTA 3C6ZA 2JLCA 2OCBA 1ZDMA 3H5IA 2F17A 1Z13A 2C5EA 1KYIA 3B3JA 5I7SA 1I2ZA 3GUHA 3OT1A 2DBRA 1EZZA 2W4IA 2A84A 2WG2A 4DVJA 2PX4A 2C5AA 2CXSA 1WMEA 2KYRA 5FBLB 3NBXX 4W8HA 1ZG3A 3TZHA 1F8GA 4NZ9A 4UMFA 3QA3E 3LHFA 4BP3A 5AHRA 1M2EA 1OAOC 2XVXA 2FRVA 3GDGA 1ZBDA 2FOLA 2NUTB 4KV7A 1ZGZA 5EQJB 1R4MB 3IAHA 3AEZA 4U6NA 1RE1A 4D45A 4ZXPA 3AFOA 1PTKA 3A06A 3FRIA 1M2VB 4BAGA 4DC1A 2CMHA 2QUKA 2EQ5A 3ZHZA 2B98A 5EG5A 1JE0A 1G6Q1 4DUGA 3JVIA 3A10A 1P45A 3IHTA 4DC9A 2Y2VA 3E1SA 4NG5A 3RGGA 1KXZA 2AQHA 3HFJA 4K0KB 4JOSA 4NG4A 4WN3A 4OHBA 4LOJA 5L3QB 4LMAA 5HIKA 1YB6A 4N3NA 4FOOA 5DMXA 5IT4A 5C4MA 4OJQA 4UJ3A 1JYFA 1GCAA 1YUMA 3EPJA 1W8IA 3OJEA 2F3PA 4HDKA 5AVRA 1SMKA 2I3DA 1ULZA 3LH5A 2AFHB 3VTAA 3RC8A 3NHZA 2AG8A 1D4ZA 2Y8EA 4H59A 3ZQUA 4KYVA 4OJNA 4L95C 4LF8B 3IULA 4FKMA 2X3FA 1CDDA 3FPHA 4HRVA 1KWKA 1JJ7A 1OFUA 2PTHA 2TMKA 3KE8A 1E1NA 2QTHA 2PUHA 3FPAA 4K6KA 1OR8A 4X1YA 1DCTA 3RW9A 3AP2A 2VNSA 1O54A 2X4IA 4HHEA 2JRCA 3HVIA 5CM2Z 4Z7NB 5B2FA 3BGOS 3H6HA 3QWHA 4OD0A 4J03A 2D2FA 1ZD5A 4ZGWA 2FNAA 2WWHA 4QJ4A 3HUUA 1NXOA 1ZITA 4ZAYA 1JECA 3M4XA 2WSIA 4XVUA 3JTEA 2D0IA 1C80A 2B2NA 3N5CA 4WZBE 3CX7A 3W3AH 2AHRA 4CM9D 4RCVA 2HXYA 3DR3A 3HA7A 1XKQA 2WPDD 2JA2A 2I6UA 3MPUA 1I2AA 2KMLA 4A0QA 2XCRB 1UT6A 3VVMA 5EUMA 1L8QA 4DA7A 4EPVA 3V4RA 1COWD 3EODA 2H4ZA 4LXYA 4PLGA 5CT5A 1BCRB 2X0FA 2YWBA 4QUDA 3SI7A 3JQ7B 1DG1G 1IE3A 1M66A 3AO0B 2FLVA 1QIFA 2Z4RA 4C6RA 4EG0A 3FPCA 2WB4A 2PZBA 4GX5A 3EIHA 1LPNA 3AHJA 1RD4A 2O8DB 1A9PA 4NV3A 1ZSYA 4H1WA 4EH1A 4YT2A 5ALPA 3DFFA 2RARA 3ICWA 4YHHB 3PDJA 4Q3OA 2GZAA 2RGBA 3LDAA 3RJMA 4AT1A 2GXQA 3EVFA 3IS3A 3KFVA 4M9UA 4CUZA 3ETNA 1KTVA 1TQ6A 1XYVA 3PNPA 1GV1A 3NHAA 3M6MD 2YN2A 1NDHA 4IMRA 1IQ0A 521PA 1ZD1A 2A5FA 2GILA 1JH8A 3P0JA 1P1CA 4LRUA 4E88A 1BX1A 4IR7A 2R65A 4B8ZA 1ESMA 1XK6A 3DQZA 3FPGA 3SIPA 3I64A 3SHWA 1B00A 2CLEB 2JJ1D 5D6NA 3VVLA 4DTCA 1YGYA 3N9IA 3PPWA 4KNVA 5JAZA 5KYUA 2YWDA 5ICCA 4FT2A 1LRJA 2GWHA 1SN7A 4EJ0A 2D5IA 5C4IA 2O48X 2ZI9A 1PWZA 2BGWA 4EO9A 1AKUA 3A6ZA 3QU4A 4EYOA 4ENTA 3ZHQA 2PZKA 4Q9AA 4M7OA 3HZZA 5LOVB 3P9SA 4MQFA 3RE1A 1OB5A 2Z2KA 3JR3A 4ATNA 5JMOA 3ZIDA 2GA8A 5A4AA 4JKOA 1GKIA 8LDHA 5L3SA 3ILVA 3N86A 3CISA 4FMCF 4YC7A 4ZQCB 4YWJA 3KETA 1SHUX 4C4RA 1QF7A 4EI7A 1YTUA 3DA8A 3VI4B 2YWJA 1B41A 2PG3A 2OVBA 2QN8A 1XZKA 4ERNA 4ZCPA 3STUA 4EUKA 2RBEA 2Y1KA 4OXQA 4BO3A 1KQGA 1T0PA 2PVCA 1JSRA 2RHRA 3DBIA 4XLZA 1T8SA 1V0JA 1WPRA 1ILWA 1FYXA 1UBGA 3BICA 1DC3A 4LUCA 4QGBA 1GZSA 1KNXA 3QQ5A 1AMNA 1E2BA 2ZI6A 4AIRA 1AIPA 4Q4DA 3PXCX 1KEEB 2AJ8A 3AU8A 2FFBA 2A7QA 5J2UA 1JF8A 1JW9B 1M2NA 1Q1QA 2PAFA 3QLJA 4KQHA 1JB9A 4PHHA 4FYVA 4AN0A 2A9QA 4QQ8A 4R71A 5C5EA 4F92B 5CBPA 3ADOA 3TXYA 4QRHA 2ZU6A 4D8WA 1WKCA 1T8PA 1AS3A 1E1RA 2NTEA 2Z8XA 3NI2A 4PRLA 4UNPA 1QVZA 3TFQA 3QIAA 1O03A 5AXBA 4GX0A 2BCJQ 5CT8A 3WNVA 4DR3B 4KR0A 1THZA 1QS0A 5C7YA 4UXJA 1WPQA 2AKYA 5JTUA 4ER7A 2O1EA 5AT1A 1M7HA 1OC4A 1W88B 1T6NA 1KR2A 3AI7A 3FUXA 5FOXA 5HGJA 4E5MA 5L7WA 3IEMA 1E2DA 3HA3A 5CNJA 3I3OA 2IHNA 1MVNA 4PY2A 1TD1A 4M9XA 5FL7A 4B2PA 3BIOA 1U9ZA 3C3CA 2ZOSA 4GMDA 4KDCA 1X1CA 4BLUA 3QI7A 1R8XA 1AG9A 1TEXA 1SD2A 5E1BA 1EDDA 1T0UA 2GKGA 1NW4A 1D2GA 1UMDB 3GV0A 1A5ZA 5F9MA 2VOEA 1YK0A 1PR5A 2BBSA 4MQLA 4W6QA 1Z5NA 3DP7A 4BFXA 1QBKC 4LVUA 4RIIA 4IRXA 5A9RA 5D7BA 3RC7A 1F51E 1A2KC 1I9CA 3I28A 2XMSA 4HAUA 5H1YA 4KR9A 3WYAA 4WRRA 3BTOA 3MPOA 4IGKA 1QE0A 4CG0A 4F85A 5JISA 5GADl 2E6UX 3NQ41 1UAYA 2G25A 4NK5A 3KQQA 5KWJA 3KZVA 5IT9A 1Z9BA 4O1IA 2HF2A 1QF9A 4FX2A 1P72A 4S05A 1P5ZB 1I4WA 1LDGA 1CUJA 1CRQA 3C6KA 5L3QA 2GZ3A 3NP7A 1EQ2A 3I2GA 3A2KA 2IELA 4DDTA 3ZN2A 1ZIOA 2C7PA 4NCBA 1IPEA 1S8AA 4M83A 2QJTA 1ESDA 4ZVPA 3ZE2B 5B37A 1QAOA 2C2ZA 4HP8A 4V0ME 3LKZA 5IUNC 1TIKA 3DFUA 1J2EA 1Z5UA 2OAQ1 3P2EA 2JBAB 1N25A 2GWRA 2ZBVA 3WIUA 2DR0A 4U2BA 4WNIA 1UAAA 4PRZA 1WQ4A 4HGZA 4C04A 3L0CA 4DNFA 2YH2A 3AXSA 3DMHA 4OG2A 3EFOB 4KPYA 1WUJS 1F8UA 3CZMA 4EQ6A 2J32A 1ZR2A 3AGPA 2QTVA 5F3WB 3E58A 4X94A 4ZHQF 2XNSA 2BN4A 2Z5VA 1FJ2A 4C30A 3L01A 1L1QA 1NJ2A 2YX1A 3EQ7A 4RKEA 1SXHA 1CUXA 2R9VA 3CLRD 5DM4A 4EBBA 1CR2A 4FHZA 1ZCZA 3A0UA 2NUAA 2WFLA 4BJ6A 1X39A 3K1TA 3II6X 3OM9A 1W5EA 4RHFA 4BE9A 2I4OA 4CQMA 1UWKA 1MBZA 1FRVA 4KWCA 1BHQ1 4S24A 2K2WA 5DOVA 3REOA 3PK0A 2B30A 3T5AA 4OHXA 4BWGA 3ZDFA 1M6VB 4OQLA 4FYKA 1GIAA 4H2DA 5JH7A 4L08A 2V3WA 1P9RA 3I6BA 5CXSA 4PQRA 2XHEA 3EN0A 4DIMA 1TT7A 2R79A 2IYUA 3C2QA 1UBFA 3DBOB 3DBLB 2HMAA 3HKBB 1AZWA 5AR1A 3O0TA 4K40A 3KHUA 3EQ8A 3ZBTA 1GU1A 5ALVA 3ILHA 4MWTA 1UWVA 3HLTA 4PFJA 5HKAA 4YCNA 4KE7A 1YQXA 3ICPA 2WHPA 1T1EA 2FR8C 4G5RA 3RVRA 5I5EA 4O8ZA 1RQ7A 3DEHA 1XDSA 1FDOA 3AESB 4DLNA 2PGLA 2WWWA 5LP6B 1XYGA 4O5AA 2JAQA 5KVCA 2GH1A 3R7BA 1OAKA 3VNSA 3ZHVA 3VO2A 3OLQA 3PDWA 5TPWA 1T1IA 5ICFA 1KEUA 4MVJH 4EPYA 1JQDA 2UXCB 3N59A 1E9CA 1YBHA 1TC1A 1IBMB 1QU3A 2OXEA 3TD2A 1P1IA 1GHTA 2CZQA 1A1VA 1Q0QA 3EC7A 2DFDA 2ZRPA 1HMPA 1Z8DA 2EKPA 4OJKA 4XD7D 2HDOA 2LCIA 2Z5LA 3C5EA 4JUIA 4J75A 5IFKA 1L7RA 2HMWA 1WF6A 2OMEA 5JAQA 2P3QA 3MFYA 4J43A 2DWCA 1RJDA 1EG7A 2AXQA 1LJUA 3ORYA 3O8RA 2Q5LA 1FNSA 4XWOA 4BMSA 4XDHA 3BD8A 1J0BA 1S8NA 1UDWA 2P65A 2F6RA 3PJGA 4M1TA 4MLCA 4IQGA 3OSUA 3DL0A 4FMDB 5SY4A 5B30A 4Z1MA 3BAFA 3OJFA 3OBBA 5SYAA 2D5CA 1E2IA 1DBVO 2AZMA 3I01M 3OO0A 3D0OA 1IM5A 5EIEA 4IS2A 4DCCA 1VTKA 2EF1A 1ZHHA 3EWAA 1MIOB 4U3JB 3RJTA 5HUJA 2DUMA 5DSZA 5ICGA 2BWJA 2IHVA 1A50B 1HT1E 3KOYA 3PNVA 2XYGA 3I32A 4MJ3A 4IIDA 4PLVA 5GGXA 1KI6A 1MEOA 1W0KA 2ACWA 1DCMA 3CMMA 2PUAA 1Q0SA 1UK8A 4CM8A 1PEYA 3OWHA 3TLAA 5CVEA 3BK1A 2YNMA 3BWYA 3TIGA 4IS3A 3CRNA 2FPMA 4N01A 4B2YA 3DYIA 3GJSA 2PYZA 4HY3A 2GN9A 2PZAA 4LVCA 3RV4A 5F3RA 2F48A 3UAXA 4V0QA 4D1YA 2G4LA 3AL0C 3ETHA 5C2JB 4OV6B 4V2UA 1ZM7A 2P7HA 1J1ZA 3U4GA 4DC0A 2C2WA 3AEQB 3CZ4A 4ZPXA 3R8CA 3E23A 4EG7A 1Q0UA 4NPHA 3NEJA 2CLIB 4OHRA 5J1SB 2ZJBA 2I9KA 3NVMB 1VL6A 2Y1WA 3O3OB 5D3ZA 4GO1A 4LOIA 2P75A 2D06A 2H0QA 4PTLA 1L8XA 5HF8A 2PUWA 2NO6A 1POWA 4HH3C 5ITWA 3ETCA 1RKQA 2CDAA 4D9GA 4GWLA 4KL8S 1RHJA 2Y76A 3PNSA 3VU9B 5EAIA 5GOZA 1L5SA 3UWOA 1PYGA 3V7NA 1K89A 1ADJA 1YL7A 2AC4A 2FMHA 1LX7A 4P7KA 4MV3A 2RIRA 3E8XA 1FX0A 3GGOA 4N5HX 5KUTA 4XDZA 3CRZA 4RYDA 4CQMD 3VYWA 5LQDA 1EINA 4QNMA 4GYWA 4DV1B 2EJVA 1T2DA 3P94A 5C8XA 1QAQA 3FA2A 1GZ5A 3R5FA 4M1QA 3NWPA 2ALJA 1LEHA 3USZA 1CJTC 4O63O 3NXKA 1EQAA 1YQQA 3WK7A 4F9EA 4DV7B 2H1FA 3R3WA 5AXDA 4GKBA 4J8PA 4MOWA 5BV2P 1S2GA 3B1ZA 1DUVG 4YLEA 1XZGA 4BJ5A 2GZHA 6REQA 4KR3A 1X6VA 4XIYA 2V7VA 3K9NA 5H4GA 3A27A 1CUZA 2RMKA 1T34A 2ROQA 3KQOA 3MWYW 3IBTA 5CH8A 1MB3A 4US1R 4PX9A 5TJ9A 1QZTA 2G0AA 3P32A 1IH8A 1W73A 4WLFA 1P73A 1ABFA 3L43A 2GAJA 3K6JA 4F5ZA 3OBIA 3L41A 2D7CA 1BJTA 3RSLA 4B2IA 1C1HA 1GA1A 3IDZA 5MFPA 5KNLA 5ELXA 4X84A 2P2ZA 4L72A 2NYAA 4DV4B 1FW6A 4KXMA 2RGAA 3LUJA 4HDSA 1X7HA 1XVIA 5BUZA 1HDXA 3GT7A 4I36A 5B1YA 2AEEA 3SX4A 3KZMA 1XWWA 3BZWA 5AM0A 4HLCA 3G0GA 5BPFA 2FJPA 1B1CA 1QB7A 1SVOA 2FZGA 2QRVA 2VPYA 1FFCA 3MT0A 4FD2A 1UDAA 4B6PA 1KH1A 2EBHX 2Q5OA 5LMZA 2GFQA 3S27A 1L8AA 2AEJA 4GVXA 1Q17A 2VXCA 5C8DA 3CU5A 3FYUB 4WA8A 2GPYA 3NC0C 5AUQA 3U31A 4AX4A 4CIWA 2LD4A 5FI1B 1JIXA 5IP5A 1KI6B 4N4AA 1S02A 1UWLA 1AA9A 1GTJ1 3QG1A 4DOMA 2RGDA 1A5SB 4D98A 3QEJA 3FE2A 4BGIA 2J3HA 3MGKA 5HBGA 1IATA 1B76A 3IIEA 2JHAA 3H2HA 3JZMA 3QVMA 4U1RA 3GAAA 2P68A 2WIGA 4IXTA 3TFOA 3FNQA 3PQ6A 4WY8A 4FFWA 1HFKA 3ZKWB 1Y9AA 2ZT8A 4DDKA 1UFVA 2I71A 5AHOA 3RAGA 1RYYA 5BV0A 1W36C 4BQNA 3IKVA 5EPOA 2PT6A 2PE5A 1WPXA 1XA4A 1WV1A 2RC5A 2PZLA 2ZTVA 4NCJA 2LPMA 3PD1A 1XHFA 3N6XA 3LC1O 3TGLA 3OMLA 1Y9ZA 1P1FA 2OG2A 3B2NA 1S8FA 1HA3A 1PD1A 5HCUA 1I6WA 3OA0A 5DYGA 4ZAVA 1GGNA 3AKYA 1GPAA 1JA0A 4MPDA 1V8PA 5EXTA 5EYPA 1E3WB 2A5YB 2CHUA 1C0KA 1RWPA 4INJA 2ORWA 4RSMA 5AW5A 2ZB8A 2VTDA 2NSJA 2WUFA 4CKYA 4JFRA 4UQOA 1B8OA 2GBFA 3VV3A 2BHTA 3ZU2A 4RH0A 2QAGA 3H1FA 3BXHA 4OYLA 1A96A 3OZBA 1U9IC 4M1ZA 5GP1A 5B6JA 4AN1A 1JDUA 1QHHA 1WDKA 4WEOA 1G3IA 5ECYA 3O0DA 4IYRA 3C1UA 2XBMA 3N2IA 1TVMA 4ACBA 4HR7A 1VJ1A 2Y1EA 2A0FA 3IXLA 5H0IA 4O0LA 5DU2A 1Z4JA 3DDUA 2GSDA 1SCDA 3IVCA 2ZLBA 3MFQA 2I9PA 1FW8A 1TAGA 4JLPA 5HMMA 4QNRA 4EHKA 1T2CA 1U63A 1DG9A 3CURA 4CKCA 2JJYA 3SP1A 2WJIA 5DYIA 2ABWA 3UMSA 1WW2A 1O95C 1RMTA 3P9RA 3IUNA 2XB8A 4IIXA 1NV9A 2P9TA 2HOQA 4D79A 3I92A 1ZJ4A 1GNTA 3KB2A 4TTQA 3P71T 4UEOA 4ZCQA 4KQFA 3H42B 3IE2A 4MUKA 1WW3A 5DN9A 2GCIA 3M81A 4MKRA 4QULA 1L5OA 4PYNA 1CZKA 4GOMD 1KNQA 4GZMA 3ZWDA 3I76A 1I36A 4UBNA 1A69A 2H1LA 2JLXA 2GLXA 2AFHA 4V38A 3EF3A 3DC7A 2H48A 2O3TA 1N1GA 3I6IA 3ELDA 3OKPA 2VRCD 4KO3S 4KZKA 2X19A 4LXGA 1CYEA 3LIPA 3PZRA 5JSHA 3N0WA 3RYHB 1YF3A 1N2ZA 4MXDA 2BAGA 4GXRA 4E51A 4MUBA 4EJMA 2D3TA 2H2HA 2FW9A 3FYTA 5J4VA 1FFWA 1WXWA 3IQEA 3WLOA 3OQPA 5EE9A 1W85A 1RZUA 3LHIA 5KQLA 3OC0A 2R62A 2VG8A 1R64A 3PNOA 3RHSA 4LE1A 3LWBA 2VJPA 4GLJA 4BB9A 2JATA 2Q4RA 2H00A 1P44A 4N5DA 3OFVA 2VDWB 1E89A 5BSHA 1LPSA 3H8VA 1ND5A 2R4UA 1X1EA 1IJEA 5DP2A 1O9GA 4ENPA 4PYIA 1E99A 4BLTA 1ESEA 2HK7A 1I32A 1SCNE 2M6RA 2V58A 5DBOA 1RRFA 3EW9A 2NUBA 2IUEA 1CIPA 2PLFA 3DBVO 4GD3Q 5TF0A 4F7WA 2FMKA 1DFIA 3GGSA 1PG0A 1FRNA 2F62A 1X1SA 2JD1A 4QTYA 3QF4A 3KPVA 5CIWA 5JPDA 4Z4QA 1WPGA 3RUCA 4GRAA 3VC2A 3H8WA 1XZFA 3MLEA 1I4DD 2VZ8A 3T06B 2ET6A 4EG1A 1GV0A 1XRPA 2A5LA 2EXXA 2O8CB 1H4SA 1Z3CA 2R8OA 5EGNA 2ADMA 2VPIA 3E0QA 4I81A 5PNTA 1TLFA 3GJ5A 1E2UA 3ZWAA 2XE7A 2WJ6A 4OHOA 1YRBA 1ZK2A 5IK2D 3LA8A 5KJCA 2PMKA 3K0EA 2IXDA 4BBAA 2WUEA 3GJ8A 4ZN6A 3T3OA 2IEBA 4KFSA 1Q1BA 3ZKAA 3AVYA 3WGYA 3ESRA 2RB5A 2BFBB 2O2GA 2XGMA 4PSVA 1A27A 1QG2A 1GNPA 2J6HA 1R27A 1X7YB 4AJ1A 1OXUA 4BBJA 4DRZA 4TZ6A 5JMTA 2GPNA 5DXAA 2GESA 5GV8A 4AULA 1R16A 2Z9BA 3LBNA 1SUCA 1M8KA 3NHRA 1F2TA 1MDFA 1OV6A 4KWTA 5ALKA 3K5PA 4D3XA 3IP5A 2C5SA 1QP7A 3HYSA 1U98A 2CLOB 3TOXA 3KVVA 3OD1A 4QSHA 1LTHR 3GFRA 1EGMB 1W581 3PUZA 3FZEA 4FGSA 2RGWA 4HDSB 4HS4A 1OYVA 1XA0A 3A70A 3I04M 4PC3A 4UPVA 2G7ZA 5F2EA 4BEBA 4B85A 1SCKA 1KJ8A 2QK4A 3PIIA 4I2NA 2IQIA 5AJUA 2C5BA 5EWMB 5G3YA 4YRAA 3VTFA 2M1ZA 2XWPA 4ZO8A 4AQDA 2OB1A 2NSHA 1AM4D 1R00A 1X9GA 3CEAA 1NXSA 2NVUB 4CMEC 4B31A 2YIVX 4UU7A 1SXJE 4AK9A 4TTAA 2XZDA 4K9SA 1L1EA 3RIMA 7REQB 4YCCA 4QOEA 2PKEA 3SKVA 5DBEX 3OQBA 1IY1A 5MN4A 1O96A 1QH8B 2V5VA 3RRFA 4ZK6A 5JU6A 1VE9A 3LUBA 1EGAA 2AQIA 4J07A 4Y2QA 5KVQA 1JT9A 1OLXA 3MTIA 1AGPA 3AZQA 4G5YA 2X1HA 2M9MA 5G02A 2Q4DA 1YS2X 4MWGA 2WU4A 5JASA 1S01A 2QUJA 4OBEA 1KZYC 1JR3A 5G1NA 3X1MA 4XWKA 4B34A 3G02A 1LI4A 3NHWA 4Q9HA 1R6UA 3ZZMA 4XGKA 1TJ3A 3K9GA 3N7UA 3WV5A 1W87A 1XI2A 3TLJA 4CMJA 4D81A 1IN1A 2VDPB 4QPJC 2JDID 3DTVB 3EH1A 1JFTA 5I4IA 1PEKE 2J3QA 1RKXA 4IIEA 2O2SA 4EJ6A 3WLHA 1SXQA 4G1CA 3MEQA 4KX5A 3V3TA 3PKZA 1IEXA 3UW3A 1J0AA 3LCVB 3PFKA 2ZBRA 1AS2A 1B43A 2VTKA 1ZMRA 2ZWOA 1UJ6A 4W7IA 1T5OA 3TZQA 2IUTA 3DF9A 3GWZA 3N1UA 3OZXA 2M6KA 3ZUPA 1ZL0A 4IFBA 4Q3DA 1TW2A 5ERGB 1KDRA 2OD2A 1KIFA 1YIAA 2HPHA 5FADA 3O94A 2DWOA 1U2PA 3UFBA 4UTVA 2XOKA 4L5CA 1U2EA 1BDIA 4MWSA 3AB3A 4V0NA 2JIDA 3AEUB 3FFBA 4A2WA 2VT6A 3J7AC 3MJHA 4CIBA 1EHYA 1UXGA 1MO6A 4FFRA 1I1OA 1N2IA 3H97A 4CF5A 3WDSA 1XTBA 4WEQA 3B5JA 4UEKA 3NGXA 3GLGA 1GGJA 1UBCA 3COZA 1P2TA 2G04A 2LKCA 2WU0A 5JPIA 2C1ZA 2WKQA 4DDHA 4DE5A 4K6CA 3UGQA 4CKWB 1QC5A 2IH2A 1M6NA 3JW8A 4KX3A 1J9EA 5DHFA 3A6GA 1QBGA 4A0FA 3B51X 1XAIA 5L4NA 5EJ6A 3UBTA 3H9UA 2OV2A 5I8ZA 4HKTA 3PQFA 5EZ5A 4RESA 4UFNA 3PR1A 3O5AA 2O23A 1KQPA 1I7SB 2JGRA 2QRHA 1THTA 4EI8A 3MJSA 1CY6A 1N2CB 1DC6A 2PANA 1HM5A 3F3YA 4JB0A 4LY6A 2O0JA 5DYTA 1VYUA 4YP1A 5DN6D 1NN5A 1GNSA 4KYUA 3T1NA 4KMRA 1QCYA 2G4VA 1UDCA 1BMFD 2O7VA 3C3PA 4MI9A 3FZYA 2XX3A 3DONA 4FFSA 4J0GA 1P3DA 2QD2A 2QVZX 4YRRA 4O25A 1NN0A 2Q5QA 3L7MA 2Q50A 4JUFA 4TZKA 4R51A 3QXCA 3ENZA 4DA8A 1IDN1 1LI5A 5AWFC 5K8UA 4G0UA 1R9MA 1I01A 3OCZA 1Z7EA 1FNCA 2H4JA 3OZUA 4NIMA 4B3XA 1KJNA 5HPYB 5IT5A 3KJZA 1VKOA 3PFWO 4YEDA 1Z5OA 3LO8A 4Q7KA 4PZAA 4EJSA 5JWOA 3QJ5A 1YS1X 4P1ZA 4AJ2A 4QJ3A 2PDAA 2XIQA 3MD9A 2Q0SA 4MR9B 1KEPA 1P2UA 1KVQA 3O2NA 2OFOA 2E18A 4HJXA 2VQDA 4PIPA 4E94A 1UAGA 1KJYA 4DCJA 4DLBA 2XMPA 3F90A 1VL2A 1TEZA 3U7FB 1T5HX 4IP0A 2BM0A 1N5OX 3ZU6A 3ZY3A 4TQ9A 5BQXA 1KVUA 3QYFA 1OYWA 3DAPA 4EHFA 1Z34A 5DM0A 4YV7A 4YPFA 8ATCA 4C6SA 1PGJA 1GNLA 3SIXA 4QWMA 3D54D 4DBLE 1EVEA 2PX6A 4K2AA 3PGKA 2G1UA 1HE3A 4IKEA 3RJZA 2V7BA 1MF7A 3LLSA 4G5FA 1SFRA 4MCIA 1TQ8A 1UINA 4C3VA 1YZQA 2AC7A 4OQYA 2IE0A 3WDLA 1QMPA 2PD6A 2Z2XA 3CZ5A 4QEKA 4CEJA 4MR7B 5I6DA 5HOEA 3BFXA 4PSCA 4B8YA 2ZYVX 4LSMA 4DLPA 5EVCA 4ECAA 3HTXA 2VH2A 1F0NA 1U8TA 2DP4E 4OY3A 2FXVA 3P2IA 1TT5A 5E9JA 4X1KB 1CUYA 3Q8WA 5ADHA 1E7SA 4QODA 1TM7E 2HYDA 5FL7D 4FW8A 1QCDA 2GD0A 3AKDA 4BZQA 3O4FA 2QUBA 3P4UA 4DN6A 1KYWA 1C2YA 4DPMA 1ZIPA 3ZE6A 4ZMSA 1A7AA 2Q7DA 3VDXA 5G2OA 4D6PA 2IP4A 4QXPA 2D2IA 3VYTB 3HR8A 2X2PA 3AZOA 4BATA 4X63A 3HEBA 2KE5A 1PK7A 2PGOA 5AVTA 1FX0B 2Y0BA 1H3EA 2IYVA 3OZSA 3LX4A 4G01B 4WOBA 1TCAA 4FI3F 2EKQA 2OO5C 3IUQA 5TT0A 1M5TA 4AN4A 4BO8A 3IAAA 4ZYVA 1CV2A 3JWEA 5HKLA 4MWZA 3QUBA 2NG1A 3IFSA 1E0KA 5B12A 3E3AA 3I72A 5FB3A 4DSTA 3KKZA 5E2BA 5ILGA 1OC2A 4HDOB 4LRSB 3VOAA 2XAUA 2A0YA 3ORHA 4CM4A 3DFKA 2Y1XA 1KAQA 2G5CA 2PL3A 5EXXA 1N77A 1QE3A 1WB5A 1JIJA 4L4SA 5C7OO 5J4YA 5B7QA 2MINB 2B6NA 2AB0A 4O8CA 3RFFA 2G9UA 3V42A 3PD7A 4P58A 4EHHA 5KOHA 1EE2A 5HE8A 3L6EA 3IP9A 2FZLA 1QIHA 3DDHA 1SCUA 2REOA 3KBOA 4N5MA 1U8AA 4JJ7A 1C3XA 5G0WA 1S3IA 2QTZA 4L9RA 5K9ZA 1A8SA 1C1DB 1YMUA 4ALNA 2Z58A 4JB8A 3PE6A 2CNNA 3BGSA 1Q3HA 2FOXA 4BRWA 1CQZA 3PGLA 3HU5A 5A2GA 2QXTA 5AW4A 5DXJA 2AKEA 2VCHA 5REQB 3RHFA 4DZTA 1BFKA 3DAFA 1U7XA 4LQDA 2OXCA 3DO8A 2ZJ4A 4L0CA 1NMSA 1DC4A 3NKFA 4NYJQ 5E3JA 4EHBA 2V59A 4N54A 4RD0A 1PVDA 4R3UC 3UXHA 1Y8AA 1EXNA 1ZUD1 4B4KA 2CXXA 1K7CA 3L2OB 4E7PA 1UK9A 1ZRHA 5B1EA 1E9AA 3GFSA 1AD2A 1P0PA 3AJAA 2KJQA 3T3DA 3UF0A 3ZDCA 5F3DA 3HEMA 1N0IA 2IDMA 4ZI7B 3JYLA 1QIEA 3HCEA 5AUNB 3DDZX 4JEHA 1YJ8A 1K5GA 1NTOA 4CT5A 3VHRA 1ZL2A 4MVJA 2RK4A 3ANTA 4POAA 1ATIA 4WINA 4U2KA 2ZRJA 3KV1A 5EUBA 1ORIA 1SCAA 3Q7PA 3GPIA 4R8RA 4ZT3A 5KWEA 2QTWB 1HOTA 3Q8LA 2BBTA 2YVKA 4AKIA 3CJTA 1OREA 1ZRMA 4KXWA 5I4KA 3LLMA 3WGGA 3YASA 3S81A 2ZYUX 3A6PC 1ETUA 2X9QA 4AY3A 1XL0A 2UZAA 4ZZIA 3GNSA 2CB9A 3UWPA 1FNDA 2FMXA 1SCJA 3L0ZA 4I4CA 4DRXB 3GLGB 1UQTA 2XUPA 3SYLA 4C29A 3DE1X 4MS1B 2LKDA 1TX4B 1SKBA 3D7NA 3IE0A 2EHDA 2RB4A 3AY6A 3HCNA 4NDAA 4DPKA 3I9V6 2CHEA 3GO4A 2QVXX 1VIAA 1KDPA 2Q28A 4GLBA 3C24A 4CV0A 2Q2QA 3B6IA 2VNHA 5IJZA 2VTBA 5AKHA 3ZLJA 2NU9A 3QE2A 1R5JA 4BNTA 1F7VA 2WP8J 3LP6A 4YJDA 4EUFA 1U7DA 3RIGA 1N3BA 5I9BA 3C3AA 1L5HA 4W9RA 2R1TA 1HTTA 1Q1GA 4BNDB 4R1OA 3V6MA 3DW3X 4IZIA 3I8OA 2A4KA 3CX4A 4NJMB 3GDHA 3ZGVA 1RPJA 3WLNA 4HN9A 3Q98A 1BDBA 3NHSA 3QQPA 4KN9S 4Q9KA 3T35A 4EMTA 2JLWA 3KJFA 3AR5A 1W7AA 4JT2A 3PEVA 3V8PA 4N7RA 1NI4B 1TZKA 3JWHA 3MS4A 2Y77A 3MHPA 3IMFA 3O95A 5FTWA 5BRAA 5FAKA 2HYIC 2Q3DA 1ODFA 3AF0A 5KYTA 4Z1MD 4CWAA 3RIHA 4N9QA 5DBFA 4B6EA 4DWVA 5JD5A 5L9AA 4JLJA 1W0JD 2REXB 3VC7A 3KXKA 4KUHA 4F38A 2J31A 2WQ6A 1D6MA 2I6TA 3UMVA 3DZHA 4RQAA 2DXIA 2JGJA 1Y7PA 4IOKA 3ABOB 1JHYA 4ITRC 4E5YA 3WP0A 2GNPA 3HWSA 2JARA 2R5NA 4MQFB 2ST1A 4BKOA 4K6FA 4RELA 2VF4X 3KSAC 2RGRA 4QAQA 3A4MA 1TW3A 4GMKA 3GLIE 1BXRB 1M10A 1OSNA 3L46A 1AH2A 4ZMRA 3QVGA 3D0RA 4IOMA 5DPMA 2GPSA 1RP7A 2QRJA 5DISB 3CVJA 2LZ0A 4M8NE 1RRMA 2M2IA 5F7OA 5D8DA 2Z0MA 2VHTA 1JAXA 3CC8A 3OLCX 4EPRA 3FWYA 2P9HA 3C85A 3ZU4A 2Z9CA 1KZHA 2CFOA 5G0SA 4IIVA 1GKLA 4ND8A 1WABA 1MV8A 2QEQA 1RKUA 4RKFA 3OFSA 3ZEIA 2H4FA 3IQZA 2COKA 5IABA 5K6TA 3VBCA 1JBKA 5JQGB 1GPDG 5HKBA 1LJLA 2VDLB 4JSRA 4DSZA 3HEAA 2C77A 2ZEJA 4RJ2A 2XADA 5JS7A 3QHPA 3EZ9A 5E3HA 3RRXA 3OVMA 3TE6A 3SSOA 4UPDA 1LJ8A 4YXWD 2ECQA 4FWIB 3C3XA 3DVLA 2PJZA 1B74A 2ZITA 3EIEA 5DSXA 4BFTA 4YP5A 3C41J 4TWZA 5HK8A 1KQNA 2R66A 5LQAA 1BH6A 2VQ6A 4KK4A 1HT2E 3HB9A 5ALUA 4P3KA 5EHNA 4DUGD 4TROA 2CDBA 3PC8A 4JI1B 3RTDA 3ENQA 1Q7EA 2IW3A 1GDTA 3EVGA 1VHJA 2B99A 1V35A 4KBYA 3BB3A 2HZ7A 3WB1A 3ESYA 4N03A 5E4YA 5CB4B 4N0MA 5AIAA 1Q0RA 1WXHA 3NBQA 3G8YA 2Y71A 1XTKA 1JG4A 4BYMA 4DR6B 1Z5GA 4Q7EA 1WX1A 3PTAA 3SKXA 1VE7A 4MKHA 3GVPA 4XTCS 4OKNA 1O94C 2PL9A 3C4QA 3TVTA 4UM7A 1JMYA 2GM9A 4QUKA 3I0NA 1XYYA 4NMLA 4MUYA 2P2SA 1FFYA 1J5EB 1U0TA 3F2IA 4RACA 2AUTA 3JRNA 1FUIA 2PKQP 2KI5A 3M5WA 4WOKA 5AK4A 1KY5A 2JANA 3DWIA 2VUIB 2NNWB 3MBKA 3MWJA 4JA2A 1D5CA 2PA3A 4IQ4A 4K9DA 4MRMA 3W7AA 3OKAA 2VRCA 1JPJA 4L3OA 3TW8B 1IL0A 1H4TA 4MDFA 4J2OA 4KE6A 1K8ZB 8AT1A 2G6BA 1G21B 1DC5A 1C4WA 1N6RA 2C84A 2GUWA 3IAUA 4ZICA 1U3DA 2G8LA 4XCVA 3UJ9A 4LDZA 5EL0A 5BP7A 4OXYA 4YRGA 1C7JA 1AQJA 2G83A 4TLCA 3U9TA 3HL4A 2IF2A 1GPYA 2A57A 3FPLA 1NKTA 4ED9A 1F38A 1XMJA 2V4MA 2IHTA 2Y1GA 2ZIGA 3L8MA 3NKLA 4ZKEA 5JZBA 3K2BA 1Q74A 5LQKA 1NMZA 3ANYB 4ZZ2A 4QBKA 3DOHA 3RREA 1A7JA 4ARZA 2QB5A 4BVEA 4LF4B 1FVOA 2EFEB 3F96A 5CB6A 1S4MA 4BKRA 4MLZA 3WA7A 3MG9A 3LKBA 3W2EA 2WFZA 3EGIA 2DC1A 1X7ZA 5KDOA 4YJKA 1YULA 1KP3A 1QDLB 3P4YA 2J30A 4N3BA 1WNTA 4QXAA 2H5LA 4IV0A 1Q1NA 2HHAA 3L1UA 2O0HA 1KVTA 3IEXA 4GLFA 3IJ5A 3EVTA 4EKGA 3E48A 3TJZA 1GQQA 1ZMOA 1SUIA 3PL5A 4BLPA 4RTNA 3ND6A 2HHCA 1KOFA 3RD5A 4FFBA 4FD3A 2ZDQA 1V71A 3A3OA 4A1OA 1TJPB 4JNKA 4MVYA 5EJMA 3VU1A 1OH5A 1CFZA 4PZPA 4IJQA 4AL4A 3FTDA 1OROA 4HWOA 1SQ5A 4W5JA 3WTBA 1S9DA 3I39X 4QXOA 4UOQA 4MYDA 3ZNPA 2IDZA 4G5GA 4LC9A 2XD4A 5TPZD 4I3HA 4BFUA 1PI3A 3QE0A 4TXLA 3WJ7A 4WY5A 4IWXA 1EA5A 2CLSA 3PQ3A 2FQYA 2RHMA 1J9GA 4ZEMA 4Y2VA 4LXUA 1W93A 4MEBA 4O2BA 3G8CA 4LNAA 3GQVA 3IAS1 4QFBA 4U7GA 2I2BA 3PKJA 4Q9JA 3TMKA 1YB5A 1H9CA 3V4VB 4KO8A 1U2TA 4PQFA 1UJNA 1DJOA 2PO7A 3L7JA 4FFPA 2HU2A 1PV1A 3DDOA 4NKRA 3WAJA 1J6UA 2WY2D 5HRCA 4NAUA 4ZDJA 4ZQIA 2OGWA 4ZZ1A 2DT8A 3QUTA 3A1CA 5TS2A 1KY2A 3ZZUA 3D5EA 3EXIA 1SQ0A 4G3XA 2PRSA 4QYXA 3TOSA 3ZK7A 5A3QA 1SXJC 3JQAD 3UMJA 4E4TA 3RQIA 4YDRA 2JGDB 3SOZA 3MSCA 1DV2A 4O02B 1M1YE 3C97A 1XCOA 4ILEA 1T9HA 1X7YA 3B52X 3CF4A 3N2KB 4QTTB 4RZHA 4X90A 4WGGA 1DC7A 1MC4A 4AZVA 1TEVA 2GD6A 1LQTA 3CNHA 2JKYA 4KIGA 1IZZA 3H99A 5REQA 3TYXA 7REQA 5JV5A 2FLKA 1E3MA 4NOLA 3CUVA 4YDHB 1ID8A 5LB2A 1O6FA 1TKBA 4V0OA 3VR3D 5KTMA 2GPWA 2YC4C 5K51A 4AF8A 3O9ZA 2FWIA 4DBZA 4AX8A 4EKDA 1P2SA 4G81A 4JZKA 4GXNA 4L8LA 4EYKA 2BGTA 1XZPA 3RAEC 2IYWA 4XWGA 5ALLA 1RRGA 1Y3HA 2QTMA 2VC2B 3P0RA 5AP9A 4Q1VA 1GT6A 1M6WA 2PWAA 3V3KA 2DRIA 2FN3A 1IYZA 2Q6LA 2W6MA 3SZUA 3SFZA 3V97A 3ORRA 4S1NA 1N1DA 3N53A 3CMCO 4OQ4A 1V1RB 1MABA 3DAOA 3OIUA 5HQ3A 1W29A 1Q0HA 1PWEA 3CNLA 2O8NA 1KFJB 3M5CA 5FR1A 2B4AA 5TQVA 4AP5A 4CQMB 5CA0F 1FQWA 1AUOA 1ONSA 3ZWMA 3MXOA 1IQUA 4AJ4A 3BIXA 3S4YA 3C7KA 4RJKA 4OP2A 2DUJA 2W4QA 2W8BA 2VDWA 5JUWA 3MGBA 4YRPA 3C6YA 1PT8A 1ITZA 2YIJA 4LSWA 4YGYA 3UPDA 1R6TA 3B6MA 3DLAA 3PT9A 4H7KA 4HXGA 4KIFA 2VFAA 2G82A 4KWHA 4P7BA 2FZWA 5C1PA 2R7LA 2BISA 4OUKX 5JH7B 3EAQA 3NT5A 1YVEI 3WSWA 1TF7A 4DSUA 1H23A 4ZOLA 3F5DA 1CY2A 1GILA 421PA 2IZ5A 3PYXA 4A91A 4DVGA 3G0CA 3AETB 3ZHBA 5EJGA 3DEKA 2HNKA 1GEGA 1G3MA 1OX4A 2AI3A 1G8GA 4A2QA 4LJRA 3ZWKA 1NRWA 2EW8A 2P0AA 1RI4A 1FYWA 2EATA 3I9NA 1O8BA 3UM9A 5HF5A 3EOZA 3EZ2A 2C3YA 3FCUB 1QHFA 4LZZA 3F6PA 4GOLD 1DMSA 4OO3A 5CRIA 1BVRA 4RFSA 4Y7CA 2HB6A 2UUCB 3EIOA 2PX3A 3OPYI 1E0AA 2FQ1A 3Q9SA 1LC0A 2PV0A 4UBIA 2VA8A 3WK6A 3PKIA 5K0FA 3VKHA 1ONBA 3IT1A 4L5JA 2QX7A 1USKA 3GJ6A 1JEQB 1ZVQA 1XDZA 1EFRD 3N2GA 1NVDA 3STHA 1TK2A 4DQDA 4ESVA 2YRFA 4RNDB 2HGSA 4TYMA 3KB6A 4UBKA 2OCKA 1Y1RA 1K92A 2WJYA 3K1JA 3ZTYA 2O57A 4PLZA 4ZAFA 1Q0ZA 3I3SR 3MUFA 4URUR 1PUXA 1YH3A 2GETA 1G21A 3BKWA 4X1KA 1U8ZA 3EA4A 5JARA 1RC8A 4RVUA 5J4KA 1HNZB 4JVLA 4JMPA 4HZUA 3N8GA 3W5IA 4EK9A 3V2HA 3BWBA 2IIBA 2XUZA 1DIRA 3DPUA 4BX0A 3Q7RA 3OTOB 4XIIA 4A8TA 1G0OA 1SBNE 3BH7A 1EHIA 4PAGA 5CVUA 1DZIA 1HPLA 3TE7A 3TI9A 5J23A 3VHQA 2NZUG 3H2KA 3MTAA 2QN7A 1N6PA 3EC2A 5CDUA 4RK5A 4UU1A 4RWEA 4ENWA 4FYWA 3NBUA 3AR8A 1OY1A 4B4WA 1RM4A 3MQ2A 3AUAA 3OHSX 3ITEA 4JC0A 2V6IA 5K0ZA 4PGGA 1QOPB 5JR3A 3TIVA 1JQJC 4WXHA 3D02A 4BYGA 2BJWA 5CHYA 1JYSA 2GUGA 3DE0X 4M54A 4X3CA 3V8BA 5L3VA 2JH3A 1BVYF 1R12A 4UTNA 1Z15A 2QU7A 2C92A 3THSA 2CXHA 4ND4A 1YS9A 4XIGS 1YZUA 3P9IA 3T38A 4P84A 3S2EA 3TVYA 1R50A 2B35A 1UPUA 1DHTA 4KQIA 1C4OA 1P8JA 1PW7A 1R18A 1SXGA 3PPVA 3VR4D 5LMUB 2XB2A 3UJ3X 2UYHA 3GRZA 4DJDC 2XB6A 2LP4Y 4HEJA 5JAIA 1Z12A 3FZNA 3MA0A 1CJCA 1OI4A 3QVLA 1PR9A 1BIFA 3DTVA 4QGFA 1GP2A 2CDNA 3TLGA 5D1NA 3WLFA 2FKAA 1EBUA 2HCBA 4CU2A 3VISA 4F71A 2VEDA 3DT8A 1GZ3A 3KB1A 2E4VA 2GAFA 2WABA 3IBGA 3OIWA 1XKLA 1QJCA 2I0FA 2QMOA 3ORFA 3L0PA 4GECA 2YQ5A 1T9BA 5A4JA 2OAEA 2C88A 4H4EA 5J2TF 1FU7A 1K0UA 1UEJA 1ORVA 2H7VA 2WYI