2FMIA

Crystal structure of chey in complex with chez 200-214 solved from a f432 crystal grown in tris (ph 8.4)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELLKTIRADSAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein cheY
publication title Crystal Structures of Beryllium Fluoride-free and Beryllium Fluoride-bound CheY in Complex with the Conserved C-terminal Peptide of CheZ Reveal Dual Binding Modes Specific to CheY Conformation.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Signaling protein
total genus 47
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fmiA00
1RXIA 4RXUA 6ABPA 1GCGA 4DN6A 4GPAA 2PJUA 5PNTA 2JK1A 3CRNA 5FBKA 2MSKA 1NTRA 3UK0A 3ROFA 4RZSA 2PUBA 4RDCA 1DBWA 1ABFA 2PUFA 4F3TA 5CNMA 1ZITA 3H6GA 1QP0A 3OM1A 1FFWA 4M88A 4EGSA 4ETMA 3N0WA 3HDVA 2LPMA 3QK7A 5JS2A 4RK4A 4TN5A 1EHCA 3OO1A 3QX9A 4KK3A 3N0XA 4P1ZA 2PUEA 4JB0A 2V0NA 5B3JA 7ABPA 4NCAA 4RKRA 2QW1A 2VUIB 3LUKA 2HQBA 4N0QA 1KGSA 1U2QA 4XFKA 4ZPJA 4CBVA 3NNSA 4EUKA 2IPAB 3IP5A 1DCKA 3N75A 4S05A 1YIOA 1KMIY 1JHZA 3CTPA 4IRXA 2QXYA 1JF8A 2R4QA 1SXGA 1F4VA 2CWDA 3KS9A 4RU1A 4H60A 3JPWA 9ABPA 1JH9A 1P6UA 5C5CA 2ZWMA 3CLKA 5E3JA 2FTKE 2WB4A 4MR8B 2JVKA 2QU7A 4IMIB 4OATA 1L5ZA 4LE2A 2CHEA 4OTZA 2XDYA 3OQMA 3RH0A 5BRAA 3NHZA 2MYUA 3GL9A 3FFWA 3RVOA 4EYKA 3LUJA 5FWYA 4JASB 3I45A 4Q7EA 1EWVA 4Q6BA 3KLNA 3LUGA 3N53A 1GLGA 1ZHHA 1OXBB 3H5OA 2FMFA 4WT7A 2QVCA 3FGZA 2GX6A 4RS3A 3NHMA 1WETA 3G85A 4L85A 5IEBA 2ZAYA 3CS3A 1FSPA 4Z9BA 3Q7RA 2FMHA 4MS4B 1BDJA 1J56A 2IPMA 3CKMA 3QLTA 4MS3B 1YS6A 2E4VA 4OLAA 1D4ZA 2E4UA 2M1ZA 2GI4A 4Z99A 1NXVA 1Z16A 1M5UA 1ZY2A 2JB9A 3IPAA 1QMPA 3KHTA 1MB0A 5KQLA 3JPYA 4UHKA 4HYEA 4JOQA 3L6UA 1LBHA 1Z13A 3NNNA 4MS4A 4N03A 3Q41A 3EODA 1TLFA 1MB3A 1P8AA 3LUAA 1E2BA 2PUDA 3RVLA 1GUBA 2HQRA 2PKXA 2KYRA 2ID9A 5JNSA 5BR1A 2L18A 3CZCA 2GBPA 4YS6A 1W9HA 3I5AA 1USKA 3ROTA 1VRVA 5KC9A 5T3YA 1D1PA 1JYEA 1NXWA 1YK0A 5TE9A 1QP7A 1D5WA 2FKAA 3DBIA 4MPTA 4MGEA 5TQ2A 3Q7SA 4GNRA 4OG2A 1U04A 2E4XA 2H0AA 3URMA 1LK0A 1SD5A 3A3KA 3DLBA 3RVJA 3O1HB 3M9WA 2M98A 4MYRA 3OLZA 5KQPA 1PUXA 3M6MD 2L17A 3O1JC 2LBPA 3G1WA 1BVHA 3DGFC 5DLEA 4G0XA 2AYZA 4O1HA 4XASA 1Z18A 3GV0A 4JP1A 2J48A 5IUNC 1JFTA 3EGCA 4HNRA 1B00A 5EWJB 2RJNA 2PUAA 2JVJA 4KMRA 3B2NA 3TX6A 2WRZA 3CZ5A 3LUCA 4PEVA 2R48A 4KVFA 2FW0A 4FB4A 1K68A 2I6FA 3T38A 1PNTA 1DRKA 1MVOA 4H3HB 4RXMA 2MYNA 1I3CA 2TMYA 1TVMA 5CNIA 4NCBA 4W5OA 3F6CA 3EQ2A 1SRRA 3LTEA 4F11A 3HUTA 4N47A 1L5YA 4ML3A 4YWHA 3C3WA 1D1QA 4LE1A 3C6QA 4MR7B 2QR3A 1ZGGA 3N0RA 4RK0A 2AYXA 2CHFA 4KK4A 2GKGA 4NICA 4Z4CA 5HQJA 3CNBA 1CEYA 2VK2A 1PHRA 2YHBA 2WJAA 1DC8A 3LKBA 4OLBA 1TMYA 3BRQA 2QZJA 1JLKA 4YP9A 3VNAA 2FMIA 1Z17A 2JBAA 1SXIA 2PL9A 3HJFA 3M9XA 3H5TA 3GT7A 4MR7A 3D8UA 3OMWA 2VUHB 1IIBA 4G0PA 5F64A 4TLLB 1U0SY 3O74A 2BGGA 3A10A 1YS7A 3QLUC 4G97A 2N9UA 3EDCA 3OLYA 3OLVA 2FEWB 2PMCA 1EWTA 2A9RA 4YR7A 2MYTA 3QELB 1DJMA 3GBVA 1R8JA 3KCNA 1JDNA 1UDRA 3A0RB 4Q6WA 5FWYB 1Z12A 2HQOA 2WJWA 3CHYA 3CFYA 4YRZA 1C0EA 1M5TA 2A9OA 2VYCA 3K4HA 4WXEA 5T7BA 3GA5A 2PE5A 4YGXB 4KFCA 1MIHA 3SM9A 3QELA 1GUDA 3OMXA 4QPJC 4MLCA 1JWLA 2JVIA 3MF4A 1Z26A 1RNLA 5JNRA 3HVRA 1ZVVA 4JA2A 3F73A 4LRQA 2JRLA 2GWRA 3H5LA 1QO0A 5JNWA 5HKOA 4W5NA 5B3JC 3CG4A 4NQRA 5JNVA 4PZ0A 5DCLA 4G86A 1NXXA 2DRIA 5KQGA 3A0UA 5KQMA 1VLZA 3LOPA 4RWEA 5GQSA 1SXHA 3QLVA 4XARA 1XHFA 4RY8A 4MAAA 5FBHA 4W5RA 1DG9A 1QQBA 1ZH2A 4LDZA 3OQNA 3JVDA 4WWHA 4PYRA 4TLMB 4Z9AA 2CD7A 4DQDA 3Q7TA 3OLWA 4FE4A 3VNBA 5CNJA 2L2QA 2FQYA 4IGAA 4YO7A 2R47A 3KKEA 1AB6A 5TQ2B 5IC5A 3HUUA 4RK5A 1K66A 1JL3A 2Q5CA 3DLHA 2IPNA 5TPZA 4G0YA 2OQRA 4B09A 3I09A 4NV3A 2LUOA 3FFXA 5GOTA 5CNKA 4KNYA 3O75A 4EY3A 2B4AA 1Y1LA 4KREA 1BAPA 3OLXA 3O21A 5EWLA 3RVNA 4YLEA 2FXIA 4KQCA 3HEBA 1TJYA 2PLNA 4WZZA 3ILYA 3QX8A 4MQFA 3K9CA 3DGEC 2P9HA 1A2OA 5EWMB 8ABPA 3O2JA 3BBLA 6CHYA 4O5AA 4KZKA 2OENG 5BQ3A 4RK7A 3Q15C 3RVKA 3KTOA 2FEPA 2F8TA 3S99A 2PUGA 2FN8A 1RPJA 2W42A 5IUKC 1JFVA 1YK1A 3RVPA 1DZ3A 1Z25A 1ISSA 2IKSA 4QICA 3GBPA 1RXEA 4G0ZA 3H1EA 3JS5A 4RK6A 2FN9A 5EWMA 1HEYA 1NATA 4RXTA 5JNUA 3C97A 2F8SA 1LJLA 4E7OA 1YVUA 4EYOA 4ZMSA 1EWKA 3RQIA 3LUFA 4Z0NA 3IP9A 4TMYA 4MR9A 1DP4A 3H5WA 2WWVD 1GCAA 3IPCA 1BA2A 1XWWA 2E4YA 2YHAA 4ETIA 5IX8A 1MAVA 1JYFA 2JBAB 1H9CA 3CG0A 5IUJC 5TPWA 3N8IA 4YV7A 3HZHA 4EVSA 2NUBA 3C3KA 4KRFA 3BILA 1EFAA 1P6QA 4S04A 4N41A 1URPA 3D02A 4F06A 4JAVC 2MYPA 1XHEA 2RJOA 3H1GA 2FLKA 5BRJA 3KYJB 2L19A 3QLUA 3SQNA 4HNQA 2FQWA 2FMKA 1TM2A 1S8NA 5D2CA 3GYBA 2IDMA 3ILHA 2IPLA 4QYMA 1EAYA 2P4UA 3HS3A 5DKFA 1Z15A 4LE0A 1A0OA 4IILA 1AB5A 4EYQA 3TB6A 3HSYA 1CYEA 3MM4A 3IP6A 1ZAYA 4KQ9A 3LUDA 4WXMA 3JY6A 3E61A 1QQAA 2A9PA 4EVRA 1NXSA 1ZN2A 4L4UA 1RZRD 1JFSA 5TQ0A 5C5EA 4ETNA 2E4ZA 3EULA 4H3KB 4MQEB 2B1JA 3IDOA 1DC7A 4IMJB 4RY9A 4Z4FA 4Z4GA 3RVRA 2WMYA 3C3MA 3F6PA 1QPZA 1KRXA 3EJWA 4Y9TA 2HPHA 2X7XA 3OM0A 1C4WA 1U2PA 3O2SB 3MMNA 4XLTA 3QEMB 3HXMA 1ZGZA 3LMKA 2FLWA 3FDFA 2NT3A 2MSWA 3W9SA 3H75A 4LZLA 3MQ4A 2ID7A 5DGCA 4MQEA 3EQZA 4P98A 2FVYA 4YCSA 1DCMA 1W25A 1YMUA 5KI6A 4E7PA 1KRWA 3LUHA 1PEYA 3QEMA 3L49A 3R0JA 2NZUG 2LIVA 1U8TA 3EAFA 3KLOA 1BDIA 1ZH4A 3KJXA 4LDAA 2QSJA 4ZYLA 3RVQA 1OXKB 3F7NA 3IP7A 1NXOA 3T95A 4MLDA 1QNLA 4WUTA 3T8YA 5JS1A 2IYNA 3KSMA 3SG0A 5HSGA 1E6KA 4LX8A 1FFGA 3GWGA 4D6YA 4IF4A 3HM9A 4MR8A 1BDHA 3SY8A 5JNTA 4DADA 1E6MA 1PEAA 4KPYA 4N0PA 4W5TA 2FSPA 2PAFA 1DBQA 4MS1B 3TD9A 3N6VA 3KG2A 5EWLB 1P2FA 4D6XA 3P9YA 3RVSA 1ZDMA 2RDMA 4ZJPA 1QKKA 1NXPA 1ABEA 1M2EA 1DCFA 3HV2A 1NXTA 5DTEA 2FQXA 4MQFB 1FFSA 4F12A 1Z2EA 1YTUA 1M2FA 1D2AA 4MS1A 4Z4IA 3OO0A 3HO1A 4EYGA 3UKJA 3OQOA 3HK2A 3O1IC 4D74A 4MS3A 4JB2A 2QV0A 3H5VA 3QLVC 3O2QB 5IEJA 4F8JA 1VPWA 1DRJA 4PE5B 2NZVG 4W5QA 4UHJA 3E3MA 1APBA 3MA0A 4O1IA 3JVIA 1LJUA 3Q9SA 3MYYA 4OBBA 4G0OA 2WY2D 3TMYA 4G0QA 5FWXB 2NT4A 4RK1A 1F51E 1QO0D 5ABPA 4MR9B 3NNDA 4RV5A 3JTEA 3H5IA 1JBEA 3LFTA 3KYIB 3CU5A 2HSGA 2QVGA 3BRSA 5CHYA 5TPWB 2RGYA 1NY5A 4HNSA 4ZMRA 3LKVA 1YMVA 4G0MA 5KC8A 3TO5A 1CHNA 5FWXA 3HCWA 4EVQA 2LP4Y 2HJ9A 1T34A 3FMVA 3FFTA 3HDGA 2H3HA 5TQJA 1RZRA 5HM6A 3SAJA 5IBQA 1JDPA 2A9QA 4MRMB 3GRCA 4RY0A 3BREA 4KV7A 4FE7A 4RKQA 3T6KA 5KWSA 4RSMA 2PL1A 5I4CA 1A04A 4Z4HA 3NBMA 2E4WA 2MSLA 5TPZD 2PUCA 2FEKA 1USGA 3DZDA 3RVMA 1PNRA 3MIZA 4XAQA 5EWJA 4XXHA 3SNKA 2IOYA 4MRMA 3UUGA 5IULC 5ED4A 4N76A 4QYWA 2R25B 1USIA 1DBPA 2O20A 1E6LA 1LBIA 3H1FA 5TQ0B 3I42A 1QP4A 1FQWA 1Z2DA 1ISRA 2JCGA 4Z4EA 4PICA 3H6HA 1VKRA 3QEKA 1JX6A 1ZESA
chains in the Genus database with same CATH superfamily
4DUGD 1ODTC 1H3FA 3BS4A 2HHHB 2Q9CA 4IIJF 3AKZA 2Z43A 4FFDA 1XQ6A 5IDWA 2G40A 2OOSA 3SEAA 3HFSA 4HZIA 4QJIA 4H31A 4AQDA 1NVEA 3NGMA 4MI9A 1TE2A 1Y8RB 1ZITA 1CUEA 2C97A 2Q3BA 3ELWA 4L28A 4MKZA 3WAKA 1E9BA 2PO5A 4N9QA 2JLZA 2ZU0C 4X3PA 4HNHA 1X2EA 4FGSA 2W9XA 4X1KB 4LWQA 4CMCA 4X94A 4Q0MA 4UAVA 3QX9A 4L75A 4KK3A 3RF7A 4CKEB 3NBAA 3TAHA 3P52A 4NCAA 2W2PA 1IOVA 2V59A 1H1DA 2VUIB 3BGSA 2IZ0A 1M8KA 3JQRA 1V7ZA 5E9WA 4EUKA 2IPAB 4K0KB 1ZA2A 3R24A 2H1WA 4CQMB 2ZBUA 3KV3O 3N2NA 3E0QA 4FHDA 4LYDA 4PCLA 1F7UA 1U5BB 2VRBA 1PZFA 1SXGA 3GFPA 4FNGA 3I53A 3P2KA 4D98A 5JATA 2JH8A 5LQJA 1IRIA 2FZWA 3EBOA 4XX1A 3ZJ4A 3T7TA 3OZCA 2V4UA 3DXYA 2CYCA 2ONZA 3R20A 4OQMA 4DWWA 4OATA 4KR0A 3DFUA 1IHUA 1YZTA 2VDKB 1O6GA 3LF2A 3PDHA 4CMAA 4BN5A 3I01M 4UREA 3SC2B 1RLJA 1V6SA 2IZZA 1HLPA 2IBTA 3GRAA 1W44A 4WZBB 1KFCB 2IOFK 4RADA 3BC1A 2ERCA 1TAQA 2VWPA 5K0CA 4HHEA 3CUKA 4QIHA 1B93A 3ADDA 5L3RA 1KQOA 3R8XA 3WLRA 4QUDA 4HXFB 1QS0A 3G2QA 3NBZC 4RQBA 3BRCA 4ZT3A 1AGPA 1V1MA 4Z8XA 1N1DA 3EWIA 3A1NA 1FSPA 2FMHA 1UKEA 3NJRA 1ZMTA 2QZZA 4H3SA 2Y1WA 3HCEA 2X22A 3OE7A 4XUGB 1WS6A 3SC3A 1XLTC 5CVDA 5JXGA 3FNEA 4UASA 2F43B 1Z16A 3NJ4A 3AUYA 1Q3HA 1QMPA 1Y4AE 1RPAA 2QAGB 2RHOA 2Y77A 4XTCS 5B6PA 4HRXA 4IDPA 2GWHA 4XUEA 2D2IA 3DVRX 5ADVA 5K8TA 2WWRA 2HX1A 4DW8A 5F7XA 5KSOA 1NHWA 5JCJD 2AJ8A 3T9DA 1JDZA 2OG2A 1FVXA 3DWEX 2C3OA 1XKTA 2I22A 3BL8A 3Q41A 4P7GA 4PYIA 1E2BA 1G6KA 1Y1KE 2AEMA 2Z5GA 1W85A 2VHCA 2HQRA 3X1DA 1UDWA 1NGSA 4DMLA 1LGYA 3HNPA 4BYGA 1TMOA 2XLCA 2OXEA 2VK1A 1W9HA 1Z0JA 2J85A 3OJ0A 4IIBA 3V46A 2W90A 3FDZA 4AB1A 2PZKA 4CL2A 1JJFA 1ILEA 2FJ0A 1MJHA 4DTCA 1ATIA 3PVSA 5EFOA 4B46A 1JYEA 1XVUA 2W00A 3B6ZA 4N3CA 1FSZA 3TJMA 1JQDA 3WYGA 5JJ5A 2IA5A 5TXGA 1FXWA 5LZ4A 4PZDA 3S55A 4X6XA 5AVRA 3FYSA 4Z1MA 1GGMA 3GNLA 2YYZA 5K3BA 3T9FA 4RHYA 2FPGA 6PFKA 2CL0X 1Z38A 2D7JA 1L5NA 3USES 3ELUA 3SFVA 3O1HB 3WG9A 4EB8A 2O0JA 2JGDB 1KQFA 2C99A 3DF9A 4DUGA 1BS2A 3L6BA 5IAAA 4JROA 3LPMA 3ELBA 5K3FB 1FDOA 1RBMA 3LBFA 3QV2A 5HE9A 3SYNA 2ZM5A 2VQEB 3BSYA 4DAEA 2RAVA 5TS2A 4RL6A 5HE8A 1NF3A 4F2HA 2EAUA 5GM2A 1RYYA 3LUPA 2YOGA 2PGNA 2J48A 3GPIA 4ER0A 2VLBA 4NECA 5FNVA 4AO6A 3N3BC 4KMRA 3QU5A 4ZEOA 4C7KA 4M2LA 2R60A 4TWBA 4B3BA 1DPFA 1O7JA 3CPEA 1DIAA 1ZONA 1QIGA 3Q4GA 2R6JA 4YMHA 2JGFA 3GZTB 1UBJS 4BKMA 4FWBA 1J70A 2OV1A 1YDEA 2IHNA 1E4EA 2DSTA 1SRRA 2QTVB 4MUHA 2Z2IA 1ZVKA 4NPAA 2OGSA 5C31A 1N6RA 4I3GA 1UMCB 2QR5A 3OCCA 4R16A 1UDXA 2Q1XA 2F1JA 4UPVA 4HX5A 4FOSA 4ZQFA 721PA 4RWZA 1IL0A 3QOWA 4QKQA 4X62B 2C1ZA 2NTVA 3C6MA 3HCCA 3JARB 3M0EA 4IV0A 1YRWA 3EHDA 5GZ3A 2R8ZA 1Z7BA 2QTTA 4H1UA 1P7VA 4OK6A 3AVWA 1OLXA 3IUPA 2PH3A 4S1WA 1D2CA 2QTLA 2Y1XA 3AR2A 1I30A 3CNBA 5F21A 3UENA 4J3JA 1YA8A 1ESCA 1HDYA 4OYLA 3ZCTA 1XZLA 1O87A 2ZRJA 3O84A 5CLQA 2J7KA 4YP9A 2ZJ3A 1SXIA 3IVGA 3VNAA 2V5UA 5K99A 3S70A 1WMSA 3OKFA 1Q84A 1W8IA 1T9BA 3A7DA 4P7FA 2O8NA 2ZIXB 3ZX5A 4WOJA 3PD1A 3SDSA 1C50A 5KYNA 3ZCRA 3IVCA 5EMHA 1KS2A 2HIMA 1FIUA 4KXFB 1L5LA 2HU7A 3VJLA 1XA3A 5DWDA 1JKJB 2B35A 1EWTA 2JLBA 4AZSA 1H3NA 4RFVA 4YHBA 3U4IA 1Z88A 3PG5A 1O77A 4M98A 1XA0A 1O6FA 2PXHA 4S35A 3NPAA 2FPPA 1U6IA 2IHBA 2HEIA 1L4YA 2YOHA 3LHKA 2CVFA 1UBLS 1DLJA 3V4VB 1DT5A 4MVJI 1GNLA 5ENVA 5I9SA 5T7BA 2JRCA 4GX1A 1V37A 2F8MA 4DLAA 1A72A 1P1CA 1PZMA 1R3DA 1IK6A 3HP7A 3KM0A 1B2RA 2VZ8A 4HFNA 4PHCA 3OMXA 2HDNB 2XSZD 3FKSD 4NYIQ 3IO3A 4YO8A 2DT8A 3X2EA 3CR7A 1U7WA 3EXFB 2PPVA 1N5JA 5I5GA 4CEIB 1USWA 3K96A 4LRYA 4PGAA 3STWA 2OEPA 3DS8A 3QLEA 4TM7A 2A1TS 3WV4A 4J7UA 1DHTA 1PD0A 3OPNA 2HRZA 2XCUA 3TM4A 9MHTA 3W5DA 1QV7A 2QQ5A 2O5EA 1KYIA 2OG1A 3F67A 3HGMA 3ODGA 1TI7A 2NADA 3Q2IA 3ZNQA 4F04A 2JF0A 1ZIYA 2RBEA 2CUZA 4XQEA 3G0HA 1UFVA 3ZU5A 3BXGA 4EOGA 1XZNA 5A04A 1CZLA 2BFAA 1NXXA 3CNEA 3D9QX 5HFAA 4EY4A 3MG9A 4GRIA 3LOPA 2H2HA 4RWEA 2HOQA 1CY0A 3E8SA 4GOOD 4JKIA 4TPKA 4RY8A 1XZMA 5C37A 3AJ9A 1DG9A 1KXJA 2Q3MA 4Q9JA 3TLGB 3OT4A 3LLCA 1TFUA 2O8BA 1E2PA 4NESA 5AXDA 3RARA 2ERYA 1T2DA 4QT4A 1MN6A 4MV8A 4DNFA 1Q11A 1KI7A 1P5HA 1HYHA 4OO3A 4CI9A 3W5BA 4WQMA 4X90A 1QCZA 3OQPA 2QRNA 1T8TA 1LDGA 3FBTA 1QANA 1SIOA 2PGIA 3WDLA 4BX9A 3DMDA 1RRFA 2PX5A 5A9TA 5CVEA 1VJDA 4RD1A 3D7LA 3ZLTA 4OQZA 3ZTWA 1ZS9A 1JT2A 1AN9A 1BXGA 3OF2A 4PGHA 4XM0A 5GOTA 4OHVA 4CDGA 2VEDA 4IICA 1XMVA 4XWKA 1OFHA 4KREA 2JGMA 3BUSA 3COZA 1XNQB 3PGXA 3S2YA 4CM4B 2BYTA 3CTMA 2IPXA 5MF6A 1PR5A 3IDZA 3ZCQA 1SXPA 5ALDA 1SUAA 4YI3A 4BB5A 2G63A 3BFXA 2YXNA 1CQJA 1E0KA 1FFXA 1WUIS 1CF4A 4ND3A 3RK0A 2PCLA 3NIBA 3O2JA 4CMKA 2ZI3A 3KXIA 3ED1A 4K40A 4DHEA 4DIMA 4KZKA 1X3LA 2V74B 3CLTD 2XXJA 2ZE7A 5JU6A 1HMPA 3EIQA 3IXMA 3K2BA 3KYDB 4NV0A 3VKGA 2I03A 3PDCA 5SICE 4XWAA 3V8BA 1JFVA 1F5SA 2C04A 2PR7A 1H9BA 4KQHA 1C1HA 1M6VB 1QQ7A 1UEJA 1BYUA 4JVSB 4TRJA 4WY2A 3RIYA 2C4HA 1JIIA 2J67A 4HGPA 2XLBA 3J80A 4I08A 4YCLA 4QPPA 2VDPB 3NMUF 4KGZA 4H6VA 2KHZA 5J5VA 1S01A 2PCJA 2Z08A 5HKAA 3AOGA 5IZCC 5BUZA 5CU7A 1H1TA 4TZTA 2QENA 4ETIA 5IX8A 4JQOA 3PC6A 3C3XA 3RC3A 1Z0ZA 2PQ0A 3EGIA 3R3HA 4W99A 1E1MA 4PZ9A 5ALJA 1E0JA 4W9NA 4NF2A 3WY9A 4EVSA 4JMPA 3LDUA 2CHGA 4LZWA 4DT1A 4G84A 4RGYA 4PLCA 2I80A 1Y63A 1LK7A 2MT9A 2EZ4A 4B81A 2XSZA 3BDIA 5FCDA 4MLPA 2FWMX 5FA5A 3U37A 3QLUA 3GVCA 1GTZA 5FIUA 3JYNA 5TVGA 3OEYA 2RGEA 3ETLA 3QV1A 1EK5A 3R3YA 3UUEA 2HWYA 1Q16A 4BJ6A 5KTNA 1IZ7A 4QYMA 2VNHA 5MGBA 3OZIA 3T1QA 2NAPA 2HO5A 2D5CA 2O1WA 1Z15A 2NSYA 3ZXYA 2XTNA 4V1CA 4JR2A 2YZKA 3CSDA 4KW7A 3PPIA 3T7CA 4UNQA 2WJJA 3RWOA 1RJEA 2JZOA 4P4SB 3VXKA 1XU4A 2E4AA 4JQSA 1R15A 3QBEA 4I55B 4UOEA 1DAIA 1QQAA 3ZDCA 5I47A 5ITWA 2XYHA 3QUAA 3DHVA 2DAPA 3M8KA 3SDBA 5BV1A 5CFPA 1T4DA 2NPOA 4I99A 3OECA 3QU7A 2JGKA 3DEKA 3C3MA 1KRXA 5EIXA 3OCXA 2Z1DA 4MQ4A 3L1JA 3L4EA 1T8UA 3O2SB 3UT6A 1YZFA 3JCZA 3QIAA 3JASB 4I6JA 1ZOOA 1ZGZA 2X4DA 2XB9A 3AR5A 4F3KA 2GCIA 2OD7A 1PQUA 1JDVA 2IFTA 2P2SA 1N7GA 4FT2A 4BNYA 1ETUA 1GLVA 4BMXA 4RLHA 2AOUB 1F06A 3HVHA 3HI6A 4IDNA 5SYMA 1BS1A 2Q4RA 2WKWA 2QG4A 2ZZMA 2H1SA 2EW1A 4A6XA 1PR6A 3L18A 3QPAA 1AMUA 2HK9A 3IL2A 4H7KA 4CT5A 3I5XA 3BQ9A 1KH3A 4R2WA 5JS1A 5HMLA 4R05A 4XJSA 3RYCB 2I7VA 5BN5A 1JR6A 5DB4A 2JIRA 5B1HA 1J9GA 1QHSA 3M3PA 1HH4A 3DV0B 3BX1A 2VOEA 1MR3F 4QAQA 1C4XA 1CBUA 1T43A 1PEAA 1Z6XA 2R8EA 3D3NA 2IYUA 4L72A 4RPCA 4G9BA 1FA9A 2EZ9A 5JEDA 3E0XA 2X0DA 3PK0A 4DSZA 3ZNOA 3AETA 3BHIA 4HRYA 1ZZEA 4EHKA 1V0JA 2ZATA 5DYTA 5KYKA 4GOMD 2PSHA 5KJ6A 1Y4ZA 1CQPA 4DVGA 3TGLA 3DLCA 3UK7A 1FFSA 5K8UA 4BLSA 3L9WA 3KT0A 4EHIA 4YX9A 1W2GA 3SYMA 3DBRB 4HAZA 3GLQA 4JGIA 4UCXA 5G3YA 4TSKA 2HBYA 3UN1A 4S2EA 4HWKA 3VISA 1QTQA 3MWJA 1R5JA 3R5FA 1TU0A 2AN5A 5DHFA 3TQFA 3NTXA 3G79A 3K9GA 2WWHA 3LSTA 5HRAA 1XTJA 2FPOA 1DRJA 2GK4A 3P8ZA 3QBDA 4MXDA 5F5LA 4UHJA 5FTKA 1DKUA 1E7MA 1EP2B 3PNMA 1KOLA 4JYAB 1MX1A 3DZIA 4IZOA 4JLJA 1KEEA 2WPDD 2F59A 2PPLA 4QGSA 4TV9F 2WF6A 4AQYB 1ULAA 4D9KA 2CLCX 3GAFA 3GMSA 3KX2A 4M22A 2ZT8A 2Y1OA 3SC4A 1ZCBA 3H5IA 3WLTA 5JBNA 2A67A 5JH7B 3COSA 1GZHB 2A1TR 1YGPA 2ISSD 5F2KA 4RM3A 5FLXA 2LV8A 2JL1A 1ZIXA 3BRSA 3WB1A 4G56A 1X86B 1EFRA 4LHWA 1H66A 5A9RA 2P8SA 3LX8A 1N75A 3LQ4A 4MGHA 1NNI1 2O4CA 4EFLA 5JPDA 4DJFC 4P4NA 2OZEA 4Y2TA 4II2A 4A23A 1MU0A 4NH0A 1NSTA 4MZDA 2HH9A 4M7PA 4DB2A 1MX5A 3K09A 1WHSA 5KO2A 1L7QA 5F77A 1FP4B 1KR2A 5ALOA 5B1SA 3UK1A 4X8LA 4DWOA 1VI2A 2PUHA 3HXTA 4WN9B 2RAUA 1IM5A 2NUTA 1YL7A 4E30A 2I0FA 4M49A 5BRNA 2ZJFA 2GS9A 2J9XB 1DPGA 1MDBA 4IIXA 4MAFA 4L5JA 3ZZUA 2VP5A 1BMFA 5TIIA 1B14A 4V0KA 1CF2O 1Y8QA 2CLMB 5EKTA 3WLLA 3PFNA 2COEA 4E2ZA 3T5BA 2NVWA 3L7IA 1J2RA 1KDZA 3TR6A 3AVTA 2QW8A 2NZWA 4PX3A 5A5DA 3OPYB 2NVUB 3EZ9A 3LRPA 3A4LA 1I33A 4PICA 3H6HA 3W7AA 4KQWA 4G0YA 1JPJA 1S2OA 2ABWA 4YMWA 3RSSA 1HG1A 3QNWA 1JA0A 3AF5A 2I2BA 2EW8A 3AVOA 2H7XA 1B1AA 2Q2WA 4FZ5A 4NC9A 5FBKA 2QRHA 3HGTA 1K6IA 4ENPA 3U6KA 1C3LA 3ROFA 2VT2A 4YFYA 4YDRA 3I76A 1BE6A 2W22A 3M1AA 2IUTA 5D5QA 1SKYE 4DPLA 3V1LA 5B6IA 1G98A 4M38A 5AYVA 1X7ZA 2XD9A 1YU6A 1TZMA 3Q1KA 3MT7A 3GZ4A 4ZT2A 5HF6A 1X6VA 5HUHA 3PHJA 3Q9UA 1DFGA 4K6CA 1CY4A 5L6LB 3H4TA 2VNSA 3WMXA 3CX6A 1X7WB 3OU7A 1J5EB 2ATVA 5DHTA 4HK4A 2HQBA 4NYMR 1G6Q1 2LCIA 1AKWA 3HN7A 4M0MA 4K6GA 1LW7A 3L1VA 3HDTA 2VP9A 5AHWA 4ZTBA 4Z7NB 4F4HA 4IRXA 4WSOA 5DTRA 3I5UA 2XGOA 2YL2A 1NMXA 3TKLA 1XL1A 3GPLA 2VWGA 4C06A 2ZTHA 3SEZA 1XZJA 2B8WA 4IJWA 1IQRA 3EOZA 3LBIA 4ALJA 2FAXA 2Q8NA 1EA5A 3OQMA 1NBME 5JRJA 4LGYA 3RIEA 1Z36A 4MO9A 1E59A 3L07A 2Y0PA 3ZIDA 5BRAA 5DHRA 3FFWA 4H4EA 2DKFA 2JI7A 3KAKA 2W2KB 2A2ZA 3UT0A 3K7EA 2WUFA 3OY7A 4L7VA 2BHSA 1VPTA 4OBWA 1GDDA 1KNQA 4Q6BA 3NV9A 4S24A 2UZ4A 4EDHA 1R37A 2R1TA 1VTKA 3T94A 3T4EA 5EJGA 4J2HA 3AKYA 3CEAA 1P4HA 2FWJA 5EFZA 3UWOA 3D1VA 5JD3A 1OBVA 4CLRA 3JW8A 2JLAA 4EB6A 5I48A 1TTTA 3UIEA 1LFDB 1U0OC 4OLAA 2E4VA 2NNLD 3BSFA 5K3CA 4AJ9A 4FHZA 4FJ0A 4MJLA 1FLDA 2Q6OA 4CETA 1YQQA 2C78A 2OHFA 1XWFA 3H65A 4D8TA 5JQGB 4G5XA 1X7YB 1UKYA 1RHRA 2LKDA 4DLTA 1XAGA 4UHDA 3ICEA 3BBPA 2NTJA 4MS4A 2EZTA 1VJGA 2FFQA 1K4MA 2H1CA 3EODA 3U31A 3ZUGA 1GZ4A 2FZ4A 5I7AA 5EHNA 4ZKDA 2PUDA 3SBOA 5CBPB 5AK0A 1N5IA 2P0AA 2R96A 4LY6A 3SLGA 1YRLA 4PYLA 4R7ZA 3OICA 4CRWB 2AVNA 2OWEA 2P9CA 4B74A 4B73A 3WYBA 5C8VA 2Y68A 4Y6OA 5J58A 3GVHA 3GLHB 4JUCA 4V0QA 5T3YA 1BJTA 3DD5A 3MLBA 1TCCA 5HBRA 4UC0A 4ZOAA 1E3EA 3F9RA 4MPTA 3KQTA 1O94C 3JVUA 3ZNNA 2X5KO 1OE0A 2I6UA 4GNRA 4Q3KA 4MP8A 1RS0A 4R81A 1W0KA 3I0MA 2ZS9A 5H70A 1AQJA 4US2R 3ZVKA 4FJ1A 1Y6GA 2XCLA 3DMHA 4ITUA 3RVJA 3ZIUA 3TRHA 1XX6A 3O1JC 3QVGA 4FQ7A 5LZ7A 4DCJA 3OIWA 4F1KA 2FWIA 4WBNA 2UZ1B 4INPA 4UDYX 3TKAA 4CMJA 2QSUA 5KS2A 1GFIA 1ZM7A 1VFNA 3R7FA 1U9IC 2BEUB 4GM4A 4YDHB 1KFEB 5DGDA 1Y98A 5JJLA 2B82A 2X14A 3KYCA 1K08A 2JVJA 2RK3A 3TX6A 1W88B 4KQ1A 1DEHA 2KI5A 3ECSA 4KVFA 3KEQA 1AKRA 1AUPA 4RV5A 5IYZF 3RCBA 3WDSA 4EHJA 4CIWA 5IJ0B 1Z33A 3WIOA 4HGZA 5CH8A 1E2FA 2MYNA 3E1GA 3D5QA 4GMDA 1A50B 5CNIA 3ZHOA 4PAMA 2B3DA 3K30A 3R3XA 1VL6A 4CM5A 2XHZA 4MINA 5AK4A 2ZT7A 4LY0A 4BZZA 1P4JA 2FFAA 2ZZNA 4JVOA 2J31A 2HHAA 3SIPA 3I05A 3OSZA 1WZEA 4PNEA 4FILA 5C7IO 1GGKA 1AGRA 4BBZA 3REOA 1D1SA 3NKFA 4JLPA 4Q18A 2CNDA 1UK8A 4P3PA 4Q3CA 4Q12A 2Q8QA 2ZG6A 2J7PD 3VPXA 2R8XA 2FJPA 1U8AA 5DNDA 1QWOA 5IJAA 1GV0A 4CWAA 2XIQA 3B9RA 4D9FA 2ZWPA 3G2MA 2OORC 1F8YA 1XTIA 1RBQA 2REQB 3PX3A 4RGBA 2I3DA 4IHJA 5E3HA 3BRQA 3EZFA 4N5LA 1I0LA 1V6CA 2DCMA 1H69A 1RM4A 1E1CB 3IHWA 2A58A 3H5TA 1T4CB 3C7TA 3K53A 4YJGA 2M9MA 4BDSA 5JC8A 1G5RA 2OFOA 2CE7A 2HUPA 3AM4A 2ZRHA 3MWEA 1QQ5A 4Z7QB 1A5SB 1NNUA 2I2FA 4I4TA 1PSWA 3PL5A 4GE0A 3Q5DA 5JE8A 3GPDG 1IN5A 5BWOA 2OXFA 4O4IB 4DLVA 5IVIA 2HMYB 3OLVA 3NBFA 4D3FA 1XRLA 4PR3A 3UA3A 4ARIA 4ZC8A 1GU7A 3ODPA 1MENA 3AKEA 3OEHA 4GMFA 4H35A 4BVJA 4AT1A 4PAQA 4L50A 4QUJA 6AT1A 4D9NA 4YRZA 3AHIA 3FVRA 4KLZA 1ONSA 1TD1A 3ZHTA 1L1FA 3TZBA 2IX9A 1VE6A 2MU1A 4EMUA 5LA6F 4YJ3A 3WB2A 3IV9A 1NUAA 2YWJA 1PK8A 3GLFE 2GBLC 1XXHB 4KLNA 1C3EA 5KYYA 4PGGA 1KI6B 1OH7A 3PQ6A 3BWDD 1X74A 2O2IA 2FP4B 2C2GA 3AINA 1XLUA 1ZVVA 1NU8A 1OT3A 1M2WA 2PSJA 2X8BA 4LDJA 3K5IA 1NAIA 1JMYA 2ZI7A 1EINA 2PRKA 4BOYA 5E6UA 3EC2A 1CIPA 1U3UA 2FCRA 2QYTA 3T7IA 2A0UA 4IFEA 4AW9A 5DCLA 4OA8A 1US8A 4JUDX 4ENVA 1WPXA 4XDYA 2WKSA 3BCRA 3S44A 3ZNPA 3ZCUA 2A5LA 4BNDB 2IPOA 4E5MA 5KJ1A 1CHDA 5CMLA 2JNWA 3ITEA 3ZDXB 4D8UA 2PUWA 1XHFA 1REQB 5NLLA 3T3MB 1O8CA 4DLNA 4BV2A 4C07A 2FUNB 1L6IA 1XRPA 2C3MA 1M1ZA 1YC2A 3D0RA 3IQXA 2WJ4A 1ZSYA 3C1TA 3WNCA 2JA2A 4N7BA 1WP9A 2PRIA 3LNTA 4FE4A 2GCNA 5FQNA 4E51A 4LF5B 3ZD7A 5HIKA 3WRVA 5AM3A 4Q7LA 3ER6A 1SCAA 1HOXA 2Q3FA 3T1VA 1XMPA 3VR6H 1W35A 1HORA 4MQ5A 3CE6A 1YI8A 1K66A 3OSUA 1JL3A 4LTDA 621PA 1XMQB 4RM2A 3GCWA 3F3MA 5K09A 2I4TA 3I09A 4M9SA 3AF6A 1SIBE 2YHIB 2VP0A 3KRTA 4LPKA 1RWNA 1P8JA 2KM1A 1JHUA 2Q4DA 2Z1NA 1K92A 1T5DX 3A4YA 3T7SA 4EY3A 5ARBA 3FPFA 4WNCA 1BFKA 1E3LA 1VG1A 3DCNA 4N49A 2H5IA 2I1QA 4E2WA 1RQNA 5B36A 4ARZA 1FY2A 1BKSB 1FMTA 2XCSB 4BPBA 4LN1A 1XNRB 3V4FA 3A3YA 4ZQCB 5A0TA 4UUNA 5L7TA 2J7PA 3ER9A 2AJDA 1FYFA 2P9GA 1JG2A 1LXCA 1ZOPA 1WXEA 2GCGA 1Z8DA 2Y0DA 2Q46A 4WKGA 3CN7A 3DOJA 3WISA 3GJZA 3LVFO 4BN4A 4YMUA 5K8IA 5EIFA 1I4TD 3DFIA 3WGNA 1GGJA 3EOAI 1O89A 5M29A 4KHPB 1E9SA 2HT1A 1MOQA 3RVKA 3WA6A 3ZE2B 1CW2B 1OAOA 5EZSA 5INTA 2WYUA 3LFUA 4FR0A 2W42A 2H0RA 4UAUA 3KT3A 4M0CA 3RRYA 2PRZA 1N4AA 1Q77A 3DKVA 4PHFA 3B8EA 5I9BA 5B1IA 2NO1A 5C8YF 1OMOA 4JBWA 2C8LA 5FO1A 4Y2VA 1JJ7A 4LDQA 3THWB 4PG6A 1MJGA 4IZIA 3VU3A 3DVSX 2C5GA 1M72A 1P7WA 2JFHA 3H5WA 3RKUA 4YAUA 3DKIA 3W2EA 2PO7A 2E4YA 2YHAA 4INOA 5JROA 1DRVA 3E2PA 2V1UA 2XTZA 1NQUA 2ZUDA 3AV0B 2XI4A 3LGAA 1JHPA 4HRAA 4QU8A 3MWKA 4LBZA 4LJ9A 3E3LA 3PNOA 4N41A 4PNHA 1CJMA 1NI3A 4MVYA 2X58A 1M9NA 4R3NA 1XHEA 1UBEA 5IT0A 3CVVA 1HF3A 2CEKA 2A5FA 3KEOA 3BIXA 3EPJA 4GS5A 1ZD4A 1H8HD 2FQWA 4UFPA 2B20A 3QFFA 2ZJYA 2IDMA 2ZQZA 2OZPA 3LQQA 2JARA 1KU0A 1NFRA 4FGLA 4FR5A 1ACMA 3KBOA 2OP1A 4XIFA 2I3ZA 1I8TA 1N2JA 2GYVA 3ASYA 1QLJA 3L7DA 4YUAA 1XT6A 3A1FA 1U9ZA 4L57A 2WF9A 1OWMA 4YCMA 2SICE 4OM8A 5BNZA 1GG9A 2ZRPA 3EEBA 4LOJA 1A8HA 1I9GA 2FW8A 5H82A 3P9XA 1CDOA 1CR2A 3DFZA 3RAGA 2BBWA 1GU0A 3MWFA 4K6MA 4CMGA 4MWOA 2LCQA 3H99A 4HMQA 1CQIB 4N6NA 5HVNA 4C0LA 5ITSA 1SVKA 2R3SA 2QTCA 2ZYHA 1DC7A 1FFAA 4RGVA 1DHRA 3DV9A 3OM0A 1K06A 3NUZA 1YOVB 1ZI9A 4OQFA 1G2QA 3GLRA 1ECFA 4DG5A 2NMVA 3IPXA 3L43A 3MELA 5DU2A 3LM8A 4R9RA 6LDHA 4RELA 5KTMA 2I6SA 3FCXA 4XD7A 3ICOA 3WGGA 5HKKA 4M1SA 3GGCA 1Q1NA 1XCMA 1TQ6A 4JMLA 4LYGA 3DPUA 3LPAA 4U7FA 1KAGA 1U81A 3H18A 5HDQA 2J9ZB 2EARA 4TXJA 2CLSA 1RYMA 2IYLD 5AJZA 5FF9A 4C29A 5HRCA 1ZD1A 3R0JA 1ZMOA 2XCRB 4A3SA 2NZXA 4BC1A 4R8RA 4UNPA 4RH3A 2GZRA 1I4DD 4P3KA 3AZPA 3U81A 5BSFA 2CCKA 3RJ9A 3RK4A 1Y1SA 3V1UA 4LDAA 2CLKB 5KAMA 5C52B 1P81A 1OXKB 1K86A 1DKLA 3A1UA 4PBTA 4HB0A 3M3DA 1DJLA 1F20A 3T8YA 3KLPX 4M1WA 3L7MA 4CM8A 1TO2E 4BQEA 5LVAA 2IYOA 4D9IA 2LVBA 5BSTA 4NMWA 3CE9A 4J4BA 3PQ2A 3OPVA 1TUGA 4AFNA 3D7MA 2R44A 3W79A 2RI6A 4LJ4A 4FFBA 1E6MA 1TYBE 1V9CA 2X9LA 3IOCA 3D3QA 4WNAB 3SJCA 3U7RA 4AZ3A 2C9CA 4ETWA 1FX0B 4LOAA 2RGDA 1M1UA 4PIMA 2YJNA 2DWCA 5LU9A 3DAPA 1B0PA 2W8BA 3B6IA 5LMCA 1M2EA 1R8SA 1XWIA 1E92A 3VSCA 2GF0A 1FTQA 5FL7D 3UH0A 2HCJB 3MOSA 4TOIA 5DTEA 3ZCXA 2YNMC 1SXJB 2VATA 3P9SA 4CLEA 2FN7A 4FR2A 4PZEA 1ADGA 5CP8A 4EI7A 3DZHA 3RBVA 1BJKA 1EIWA 3FIJA 4BVEA 3PSHA 1UM9A 3AUKA 2HGZA 2W6PA 2IXAA 3OH8A 3U4GA 2IW1A 3MJTA 3OPYI 1CS0B 2A0XA 3M2PA 4YLGA 1OCEA 1D8AA 3WJAA 1R4AA 5DNYB 1KS9A 8LDHA 3C4VA 1Z4PX 2D8MA 1WSAA 1F12A 1EI9A 2MTBA 4LVUA 1UJBA 3QY9A 3CKYA 3CUTA 4HDNB 5AT1A 1GNSA 2BKUA 3FGOA 4ZXFA 4B3CA 4WEQA 1NYQA 1H8HA 2WYVA 3RRNA 3TMYA 1QO0D 4XR4A 4X1IB 4AJNA 3PGA1 3D8BA 4N3NA 3USZA 2OHIA 3RASA 3DNPA 4NZ9A 4OM7A 3A25A 1E9VA 2FSUA 4KR9A 3EA4A 2P3QA 1ZOLA 4LZNA 2P69A 5ALVA 3M2TA 2WZDA 4X64B 1F9EA 2BIFA 4CLOA 1XVAA 4KG7A 4E3WA 4GI2A 1XL0A 2BHRA 4TKUA 1G3IA 2A4MA 3P26A 1JTVA 3UAVA 5BXQC 1X8LA 1AQYA 1Y81A 2WVGA 4NCXA 2DBZA 4F38A 5TQJA 1C7EA 3SHFA 2DLNA 2XE4A 5L3QA 3UWMA 3RAEC 4FCVA 3SQMA 1L5VA 1CY6A 4ENUA 5CFZA 3HP1A 4RHUA 1JEQB 3T6KA 1Z4JA 3ZE1B 1QHXA 3GH3A 2WSSD 5LQRA 1P9WA 3PC4A 2VN8A 421PA 1VYHA 2GLUA 2PBFA 4GP7A 1D6JA 1TPZA 2F8LA 4EABA 2IL1A 4JXJA 1NYRA 1R50A 3G02A 3LU1A 4OUDB 4XA8A 1E2EA 3AY0A 3IJPA 2IODA 2NACA 1RQGA 2FPRA 3NOOA 4PPFA 3QW4B 4FVTA 1A95A 4JR1A 2XMBA 3K3PA 5HFNA 2Q6IA 4X63A 3DA8A 1YXMA 1FQWA 2A7XA 2EX4A 2KQUA 3TOZA 5LOVB 1KZ1A 1NR1A 1A5AB 2VR1A 4URVR 4HDAA 4U6NA 5H7XA 2JHPA 3A4IA 3WP0A 6ABPA 3D7RA 1I5RA 3L4JA 1IPFA 1HWYA 1EK6A 1LQ2A 2PJUA 3QFRA 4NABA 4ZVTA 4CV2A 1GSAA 4IDFA 1G21B 3ZQ4A 2R7NA 1MH9A 4Q24A 2IWHA 5LP6C 3HCNA 3JQ9C 5CNMA 2Q6TA 3W8EA 4HFJA 1N0UA 1E69A 1TJ5A 2PX6A 1VG9B 2VYFA 5JFGA 4JYPA 3ME5A 2ZE5A 4ZEMA 4NJMB 2D2XA 3W9UA 3UJNA 5JS2A 1GPMA 1UKVY 2FN3A 4RDXA 3CURA 1EHCA 4KQGA 1C1YA 3PDUA 2DM6A 3TEFA 5K0GA 2VS1A 3IODA 1XDDA 5DVZA 1W8DA 5TR9A 4K9OA 3VYSB 1N3YA 3GEDA 3RQSA 3IAAA 4OXQA 4JBNA 3PLNA 4Q00A 3SM9A 1R6TA 1YR2A 4OB6A 1RWOA 5GZ6A 5CA1A 1IMOA 2VPXA 5J2UF 2KE5A 1Y80A 1CERA 2GM4A 4CEHA 1ZVJA 1UXKA 1N4DA 2H06A 3KJHA 4C0JA 3PVZA 1SCNE 3WLQA 1GRCA 1A9TA 3CLKA 3KEGA 4FOOA 3GEEA 3R0ZA 1IG3A 4BRZA 4FHFA 1N5LA 4MI6A 1V11A 1FTWA 1SQFA 2GZ2A 4MUBA 3RH0A 1QS0B 3V8PA 4O1MA 3VM6A 5TLSA 1V1MB 2J1LA 3I6IA 1JGTA 4BFTA 4OAQA 5AOVA 5CH3A 5LQMA 1QC5B 1FZQA 2A86A 5F9FA 1SVWA 1QHFA 5CDHA 3ANYB 3W3AA 3G8CA 1QCYA 3WVNA 3D4PA 3ROQA 2J09A 1WXFA 2GEJA 3G2HA 2PZAA 3MMXA 4L4YA 3K6SA 4A91A 2FMFA 2IRWA 3VDQA 4ENSA 3FGZA 5EZQA 4TXHA 3Q8XB 1GT91 1X19A 3G85A 1VDMA 4EITA 4EY7A 4G5FA 3U7HB 3IEKA 4WCFA 3GGDA 2YWFA 2I65A 3KWLA 4JJEA 4KSYA 3ZHUA 2W6MA 2PM8A 3A6PC 1GQYA 3OFND 4HWTA 1SA0B 4W5TA 4Z99A 1KIMA 1VP3A 2JB9A 3UWPA 2NSJA 5CXUA 3QG5A 2XDQA 4Y2GA 1N0VC 1JXOA 2HDHA 3LVQE 2AI3A 1I1QB 2BZSA 1T1SA 4HEA6 4LSMA 1CY8A 2QDKA 1VE5A 3HADA 1NVBA 2Z8YA 2P62A 2PZLA 3MGCA 1ODKA 1P33A 1Z13A 1W96A 4YRFA 5D3QA 3WB0A 1QV9A 3DULA 4EJ0A 1J9ZA 2RKOA 1XV5A 1UC5B 2HLHA 3LI2A 2VUSA 3QF7A 3ZDRA 3PEWA 1G20A 1S5PA 1XZEA 4CQLA 1OASA 4J1SA 3FDJA 1EFVA 5EESA 2FWPA 2WSSA 1Z45A 3QXCA 2FPGB 4K05A 4YS6A 5IKOA 3PUJA 3OOHA 1LRJA 3I9OA 4IXTA 1O8BA 1ADYA 1LSOA 3SS9X 1MJ5A 4H1VA 2C58A 3C85A 4U6SA 2P2LA 3FNBA 2V9PA 2GZ3A 1D5WA 3DDSA 2WP8J 4OVKA 2FKAA 3ONDA 1ZCAA 2EGHA 4WK2B 2D5IA 1QPBA 1T1EA 3CUEF 4BGUA 1FBNA 4BJHB 4EY6A 1ZBQA 3WMEA 1DEKA 1T1JA 3A3KA 1U99A 4O2AF 4OJQA 5AVJA 2Z3ZA 4ZP1A 4YVFA 5I7RA 1U3WA 3TECE 1PUXA 2QMQA 2X9QA 2RH8A 1JB9A 3P7MA 2YWEA 3QU9A 2UV8A 4FLFA 1UJMA 1R6XA 3OOYA 5FJIA 3AGQA 4DLPA 5CDUA 5HFJA 1CVIA 3VPDA 4B87A 1PWYE 1ZD3A 4W82A 2D1FA 4F86A 2JAXA 3H2YA 3Q6MA 2ET6A 5EPEA 5JO0A 3F7MA 3F4BA 5AW1A 1JFTA 5EWJB 3LCVB 2B8EA 4GPIB 1FB5A 1LV7A 3W9YA 3Q3GE 2XKBA 3U4MA 2X9NA 1JKXA 3RS8A 1N6LA 2XWSA 1LTQA 5IP5A 3NWPA 4HMPA 4R2JA 3MJ4A 4OGFA 2P5SA 3M1IA 1BKDR 4MYCA 3ZWBA 1FUYB 2C8JA 2RGWA 3DL0A 3UJHA 3S3TA 2VUTA 3QHQA 2DH5A 2V7PA 3C3PA 3HUTA 4OCZA 1O08A 1KU6A 2EYQA 4BQPA 2LR0A 2VDJA 4J3NA 3F7TA 4B80A 1S2NA 4Q7JB 1PFGA 1R0KA 2G4LA 1PL8A 3FNRA 4PHGA 1TAGA 3BZBA 5HZGA 2X6RA 3OEED 3RFVA 4BX2A 4M55A 4O33A 3ZWPA 2VHXA 1AKEA 4Q3EA 4X1OA 5AVZA 3T06B 2XKAA 4NYMQ 3DZ8A 1YE5A 1UIMA 4D4JA 2G5TA 3JQFC 3MTGA 3KZVA 5JR3A 2YHBA 4OLBA 2CC2A 2MMCA 1RLMA 4WFKA 5EKSA 4ZEWA 3HKBA 1Z28A 1G0OA 2QM3A 1EE9A 4PZYA 3AEYA 4OMCA 1C1XB 2EP7A 3GT7A 5JO9A 1IIBA 1H93A 4H77A 1XGKA 4DR6B 2OAEA 5CPFA 1WQ3A 4EECA 4WRRA 3PUWA 4BIMA 5F3WB 1WQ1R 1DBIA 2FPPB 1RLIA 1Z0DA 2IF2A 2VH1A 3D4OA 4J1TA 4LYFA 4PNPA 4RZXA 3CMCO 2RHCA 4H16A 3EDCA 4HS9A 4CFZA 3I0ZA 3V6MA 2CNWD 2FEWB 2WFZA 1J0XO 2IUUA 2BHLA 4F0JA 1PR0A 3E22B 4K1LA 3COJA 1LU9A 3OFNA 3U39A 2ZIFA 1Q2XA 3W5SA 5JZ9A 3Q7PA 1BTOA 2Y6VA 2GKOA 4LYAA 3ZE6A 2HCTA 1LKZA 2YQZA 4RABA 5GIOE 1M73E 2W5UA 3BVPA 2FF7A 2G36A 2RGNA 2XNJA 2G76A 2ACVA 7ADHA 2VYCA 3DC7A 3EGVA 1U90A 5FAXA 4IINA 4H6XA 3B48A 1QGUA 4YAEA 2CZCA 1SAYA 1AV7A 1VMKA 2JGJA 1KI4A 4YRCA 4CIBA 1UFOA 2B9VA 3FJYA 3MF4A 3TD2A 1VSBA 4BNVA 1XFDA 3IUJA 1KVTA 3UM9A 3WLHA 4B5KA 1KZGB 3UHOA 4LRQA 3GFRA 1L5HB 4AP9A 2IEAA 2C4KA 1ZWKA 5E4JA 4C05A 3LZDA 1EM6A 1U3FA 2HKIA 4FXPA 3W6PA 5HKOA 1EDZA 2QBYB 2IEDA 2O8BB 2RBKA 3U4DA 3RU3A 2PKQO 2V0GA 1N5KA 5F9MA 1XC7A 3O3CA 4OFXA 4AG6A 1VLZA 4YQFA 1NE7A 4FBLA 4PCAA 4XD2A 3DLHA 1NJ2A 3OAAA 4TKVA 3R7DA 5LZ8A 5J47A 1OH8A 3BWMA 1RHJA 1ZH2A 2GNAA 3OQNA 3S29A 2BSQA 4FWIB 4WNIA 4FCWA 1JTFA 1BXGB 2APJA 3ENNA 3VHLB 2CB9A 3CEPB 3DT8A 3FTCA 5DXJA 5FNVF 4RZUA 5JDIA 1BN7A 2EFHB 2ZUWA 2YQ5A 2DMRA 1SKAA 1XKXA 4WGFA 3SYKA 3HYTA 3UNXA 3L46A 1NL3A 2MJLA 1KY2A 3HCFA 3K5WA 1W4BA 1PR4A 2Z95A 4NZMA 4DJAA 4DBZA 2BLLA 1JJBA 2AOWA 1II9A 2BLNA 3IDFA 2BFEB 3ONNA 4D5EA 1TEZA 4AIIA 1CVLA 4TQ9A 4W7IA 1NW3A 3VNSA 1CQJB 4BIIA 1XDWA 1DU4A 1VIDA 2XADA 4BFZA 5IHXA 1MUUA 2AVDA 1DV1A 2BONA 1ZUD1 1N3IA 1O4VA 2QZSA 2IV7A 2XT0A 1EP9A 1PUIA 2HMVA 1ES9A 1FNMA 3GOQA 3KVRA 1MP0A 2CKMA 2D3TA 3DHNA 4FNOA 1PX2A 4KR2A 3HUEA 4TL9A 2Y9PB 4B4OA 2K2WA 4CM1A 2WOJA 3CJRA 1WUKS 1XRMA 1I2BA 1GYRA 4P0TA 3TNDA 5JTUA 1Q92A 4PM4A 1G291 5AOAA 3C5VA 5JJKA 2O2GA 3ONVA 4L5CA 1B73A 3FSGD 4Y6QA 2Y3IA 2ZJAA 3BK7A 3G3EA 5EJMA 3S99A 3WLEA 1ML3A 2JBHA 1KVQA 3BWCA 4B4DA 3C5WP 4ZRDA 3WK8A 2O7NA 2VQ3A 1BD4A 5AFSA 4RXTA 1OXTA 5JNUA 1KNXA 3A6DA 4GMHA 1C9DB 4IV5A 2UUPA 4RF2A 3ZN2A 2Q3DA 4H7DA 4DT1B 2CNWA 3S8EA 1GEGA 3FPHA 1CRZA 2OSVA 5K03A 4FEAA 2KWIA 2Q5IA 2W6ZA 4Z0NA 1NZFA 2YX1A 4MR9A 3GLIA 3HNOA 3MS4A 4GMKA 1CT9A 3FF4A 1Q74A 4BAGA 3X2SA 1F9AA 3CG0A 2G5GX 2AZDA 2FN4A 4A2WA 4Q4CA 1F8XA 2GPTA 2NXEA 2WT8A 3EPPA 4FONA 3PEEA 3ZVNA 4S04A 2XYRA 3DQZA 3ZE9A 2ZREA 1KHHA 4CUZA 1HQYE 1S1CA 4QWWA 3TQIA 4JAVC 1UEXC 1YBHA 2RJOA 1Q2UA 3L8CA 1N5OX 2X15A 4QU5A 4V24A 3AGPA 3CJTA 4YJ2A 3FGPA 1EJBA 1L1RA 3E9ZA 1B4DA 4AYTA 4G3XA 2OD2A 5TS3A 5CDSA 2XRZA 2ORVA 2QF7A 4LA4A 3UXYA 2HBQA 3BJIC 4RSGA 4XVRA 1EAYA 2X6QA 3PIIA 2VXYA 2INGX 3R5SA 4ARBA 5JAUA 3WHPA 4WEOA 2IYXA 3K94A 5CLIA 5ARCA 3IULA 1G8HA 2DUWA 5MFZA 1E1DA 1HQCA 1H4TA 1Q5PA 3TB6A 2JFZA 4LAFA 3HCAA 3AFNA 2IC5A 3DE1X 3DMRA 3B3GA 3A4VA 3E23A 4ZCMA 1DX9A 1UAGA 5KUTA 1JHVA 3SQXA 1GZ6A 1P1KA 1LPOA 4A8TA 2V7WA 3EPRA 2PFKA 3L4BC 4JKYA 1IZ9A 4WN3A 1U0NA 5PGMA 2ON6A 3VDMA 3U16A 2H5EA 4BQNA 3EJWA 4WBXC 4URWR 5A5EA 1OR8A 3PHIA 4KMMA 1WQ4A 2O14A 3O3NB 5LQUA 1G59A 4N5HX 1OXVA 3SIRA 3W9SA 1LWNA 4O4LA 4B3MB 4IXWA 4ND6A 3PFHA 3D81A 5H5JA 3MK31 3OE4A 2BHTA 2ORIA 4MQEA 5REQA 2YRFA 3TL6A 3P97A 1FUEA 1CEEA 4N39A 4A10A 2NTYC 2GF2A 2XDWA 5ENDA 1W25A 2J3DA 3JQAD 3WLNA 2GN8A 1PEYA 5BN5B 3QTLA 4QGBA 3LQ2A 5COAA 2WQ7A 3MUFA 2X4IA 3JQCA 2QT9A 1E2DA 2Z0MA 3DMNA 4OSEA 2PV0A 3JAKA 1E5DA 3MBIA 2CXSA 1T24A 5HSGA 3ZDAA 3EMVA 4QLBA 1SCKA 3AETB 4Q1VA 1V8OA 1QHHA 2GN0A 1F2UB 1IPEA 2XGGA 3ELYA 3HKCB 1RC8A 3MVEA 2XCQA 1E3IA 1SHJA 4YBRA 4KMOA 2P7IA 5HWSA 2WSLA 1Z39A 2O7VA 3FSGA 3QU2A 2W71A 4AP6A 2Y0EA 4DCOA 4S1TA 1ZL2A 3MCVA 4TV8A 2GETA 1XF9A 5IVDA 2IEZA 1JU4A 2DE0X 4GP9A 3QQPA 5EIBC 5ILOA 2UZIR 2WG1A 2G8LA 1DCFA 3NASA 3NTLA 3SGLA 3I1YA 4JIMA 5BSVA 2JPDA 3DAFA 4Y30A 3REFA 4Y8VA 4DM3A 2HYIC 4NVRA 1E4OA 2EFEB 5ESWA 1T5HX 1JR3D 1ACLA 1RXYA 5FNZA 3ZOZA 1NVKA 2BI8A 3GGGA 4HZGA 1JNXX 4NZNA 4DL9A 1KK1A 2FR8C 2X0RA 3OQVA 3TTXA 3PFKA 3QF4A 2PRYA 5K0LA 4CDMA 3WRXA 4DYHA 1XSEA 1PL7A 1RIIA 1E1KA 1EBUA 2GN9A 3OZSA 4GKBA 3OE1A 5AVQA 1Z75A 4C4RA 5J9FA 1PP4A 1NV8A 1QIDA 2IYRA 3QRWA 4AZ0A 4NNOA 1UBNA 4XCQA 4HVTA 3ZVLA 4ALIA 4RACA 1YZNA 3PL1A 4ZVSA 4LQDA 1T9ZA 1D03A 3BE8A 2DPYA 3PF8A 3TAUA 2HXSA 4NFHA 3F4LA 4P80A 2AG1A 1MV8A 2VCHA 3JYQA 3ECCA 3NNDA 4G41A 4XR9A 4DC0A 5LMZA 2AEFA 3GN2A 1YJBA 5CJJA 2X4GA 1WHSB 3P0HA 3VPBA 3X1MA 4LJSA 1AG9A 2XRFA 2QA5A 4BFSA 5FTWA 3AIMA 3BAZA 5HJEA 3T1NA 2NUTB 1TUIA 2G72A 3TL3A 4Q1DA 1JG4A 5AD1A 4EUEA 1M3SA 1QVAA 1GEEA 4JWKA 1FDRA 1BWQA 4LVCA 2H8GA 1X42A 3Q3VA 2J9FB 3T5TA 3UV6A 2A92A 4GLOA 1GN8A 1FL9A 1Y8QB 3F3SA 5IBQA 5BUQA 3K32A 4J6FA 1YFKA 3PCXA 2VPQA 3AI1A 1LPBB 4N8SA 4D6PA 4D9CA 3SR0A 3WK5A 3V2HA 2VF7A 3DONA 1NVWQ 3DP9A 1TEVA 4RQTA 5IC4A 1QFJA 2HHLA 2D0IA 4PVCA 2MSLA 4EO7A 1QRUA 3RYFB 2NX2A 3ZDQA 4C01A 1OHHA 4IJ6A 4KKVA 1RXUA 3G5LA 1JQEA 3D2BA 3IEUA 3RIMA 4G25A 4QDOA 2IOYA 1R7RA 4LS3A 3AYZB 4D8YA 4K7JA 1K0UA 5A4FS 1IK4A 1QHEA 1I7NA 3RK1A 4FE3A 3F5FA 1FPQA 1LBIA 2A14A 1KYQA 2H07A 2WV7A 4IEEA 1DDGA 2WWFA 4ITVA 1NULA 2V5AA 2PLAA 4A0SA 5JFTA 2ZJ4A 2EJUA 2I7XA 3QFCA 4FKBA 3W6NA 1AV6A 5BWLA 3VR4D 5E4FA 1VMAA 1Z2NX 4WA8A 5A4KA 5DW3A 1TLLA 3CLUD 3OQIA 3V8MA 1N2OA 5B7PA 3ZHCA 4ZCIA 1W75A 1XE3A 1UWLA 5EHQA 2GPNA 3M4NA 3E15A 1EPUA 4BMOB 3HSKA 4RDCA 2WUGA 1DEOA 1SUBA 5DM60 1U6JA 3TLKA 2C54A 5IT9A 3OIDA 2BGLA 4FHGA 1FFWA 4MUKA 2GYUA 4HDOB 2JATA 2NZYA 4E22A 1IMJA 4KGXA 2B25A 1ZU4A 1W1IA 5KAPA 2JBWA 3O82A 5EJAA 3UANA 2JLXA 4BVBA 1E3QA 1CIVA 1H0KA 3VDNB 2PUEA 2COKA 5CCXA 4H1TA 5JG7A 2OBFA 3PB3A 2WJZB 4PC1A 1CNFA 3QEAZ 4G26A 4BFVA 1PJLA 3KZCA 2WB2A 4WUVA 1AHHA 1NASA 1TNDA 2HCBA 1KMIY 4FU0A 3GGSA 2GRJA 2QV7A 1YZLA 1RZVA 1ZOIA 2IY9A 1JR3A 9ABPA 5LDDC 1Z7YA 4RZQA 2QIPA 5I7EA 1NQXA 2HA5A 2FTKE 2R1TB 2QGFA 5L7YA 4YACA 2QK4A 1AX9A 5CVCA 3VSBA 2HI0A 3HXKA 1HE5A 3AHFA 1JI3A 3G0BA 3TYXA 5JARA 1UZLA 2X7JA 3G9UA 2FUKA 2XNKA 5AOCA 3ZGYA 3H0EA 3QMWA 4M0DA 1F3OA 4CLRB 2TMKA 3NGLA 4IYRA 3WGJA 4EB6B 4PZLA 1LTHR 3D3WA 1VIYA 3F49S 4EFMA 4Z3OA 3O8OA 3V1YA 1E64A 1ZHHA 1NP3A 4PAOA 3OZBA 3WS7A 1Q1ZA 3NKVA 4WT7A 1CJKC 3NHMA 2C7OA 4FW8A 5J3JA 1CZUA 2XE6A 3CX8A 4GECA 3T1YB 1SVNA 5BOVA 4MS4B 5FKJA 3ANLA 1HTBA 1LPPA 1YS6A 2QUAA 3GJ7A 3TRFA 1C7IA 3V8NA 4ZHSA 2VRWA 1UIRA 1ZM2A 4LIPD 2XWBF 2BP7B 2QMHA 1VSQA 3Q72A 3VR5H 2SKDA 4BBJA 4C6RA 1OI4A 3H1AA 3PEUA 4WJKB 3EXG1 3S5JA 2ZRFA 3WL6A 4BEBA 4CIXA 2CMGA 4FEEA 4KPGA 3TH5A 5BYKA 3N05A 2VDRB 4F3RA 1X13A 1U0JA 4UE3S 1CDDA 2WPNA 4FYJA 2RG1A 3RU7A 4KVGA 2ID9A 5CDTA 1B7GO 3A04A 3ZZTA 2IIPA 2J3HA 3VKHA 3RTEA 4XRRA 3B51X 1U94A 2C3PA 3ZV5A 3KHUA 4MUJA 4IVNA 3N8HA 3K8ZA 3ZHXA 3D6MA 5KPDA 2ZVJA 2CT8A 2AD5A 4E33A 2ACKA 1P62B 1XQVA 4BECA 4WBNB 5KWEA 1ZW6A 5TQ2A 4BQQA 1ZN8A 4ZI7F 1X87A 2IELA 2Q6VA 4I8DA 5GIPE 3V8RA 4EL0A 3IP3A 3KYCB 2ZKIA 1BHO1 3HV0A 2FYTA 4B6PA 5HNKA 1RHMA 3L04A 1CEQA 3KVNA 4QELA 3VR4A 3IAXA 3GB9A 1OGYA 2WP0A 2H18A 4A1FA 1QJCA 2Y1GA 2EP5A 2PBZA 1MT3A 4MIEA 3PXGA 2Y05A 3F1KA 2ENUA 2O8VA 3FHCB 3HH8A 2C61A 4PPNA 1Y8AA 3T1OA 1HUQA 2ZW9A 3FETA 2PUAA 2PKRA 3GRRA 4QTZA 1SVOA 2H2WA 2R48A 3KXKA 5JMOA 2TS1A 4U9HS 3WYAA 1Z4KA 1YCFA 5KDLA 1IHOA 2W2TA 1TM4E 2ZB4A 3EWAA 4ENTA 1KMQA 1PX0A 2QUIA 2R1UA 1JEDA 1PFVA 2RIPA 3IOEA 2IIQA 3PGJA 4QOJA 4LNUB 2WM9B 5F76A 3E4CA 1QG2A 5SZIA 3RSFA 2ECQA 5CRIA 3U4HA 4NULA 4B75A 4CT4B 1SKQA 3S68A 1J7JA 3M6VA 4CFSA 1KDOA 2C7VA 2OHVA 5IZ4A 1J24A 2Q4TA 3C5CA 4IHJB 1HDXA 4LY3A 1J1UA 4JQYA 2O05A 3C3WA 2ZYGA 1E7QA 1XQXA 3FLBA 1B8VA 1IXKA 5B57C 2R4TA 3NVAA 2EJTA 4JP3A 2R5NA 3QVXA 1KO8A 2PH1A 2Q28A 4M8KA 4RK0A 4UJ5A 2HAEA 3WMGA 3MWEB 1EXNA 1P61B 2AMLA 2QX4A 4FZRA 2XXBA 4KUGA 4Z4CA 1CDZA 4JVNA 1CUZA 4DUYB 5HBGA 3UMSA 4QUKA 2J33A 4N3BA 4E5VA 5BW8A 5C7LO 5EE3A 2EKPA 2JBAA 5TNXA 4KHZA 2WDZA 1SU7A 1ZD5A 3IESA 3FA2A 3OMWA 3I23A 2HRDA 4HQFA 4O3FA 4NK5A 4QJBA 5CT4A 1MV5A 3SLKA 3UMVA 1NJ8A 5FHRA 3D1JA 3ZI0A 1EVYA 5EZYB 2WU0A 1XQYA 4JX8A 1YI1A 4TRNA 1NXQA 3RFUA 2BGGA 3KJIA 2PD6A 3QI7A 1FXUA 4GVLA 3TNLA 4DSTA 1Q83A 4CV3A 4DBLE 1Y3BE 1DTSA 4E08A 3AERB 1MB4A 4XQ0A 3D6TB 4JU9A 4DG8A 4YJ3B 4LV6A 4ZI2A 5J59A 1RT9A 2WAMA 1PHPA 1UDRA 1L2TA 5EY5B 1EFPA 5KHLB 3AR9A 1E3TA 4NK4A 2AK3A 2H65A 1RMTA 1RADA 2JW5A 3NHWA 1V2HE 2PMWB 1E3WA 4QPCA 3GA0A 4TL7A 2B5WA 1U31A 3GA5A 3HCRA 3I12A 4OLFA 4U1RA 5E9QA 5EUBA 1MIHA 2HMSA 2BAGA 2YCBA 2F9MA 4YQEA 5E6UB 4QDZA 3K70C 1CUSA 1GUDA 1Z5GA 3IDQA 5IBRA 3KXPA 2IUSA 1KE1A 4MUFA 4MLCA 3UJ9A 1US8B 2HHJA 3CZMA 3OOSA 1XYVA 2EG5A 2YJ4A 4Q3NA 4FNMA 5LQNA 1M74A 3FPBA 1KYYA 2ZWIA 2EIHA 3I39X 1UPBA 3P5SA 2E5LB 2QLBA 3AILA 2VH2A 3MTQA 4S12A 1AKNA 3RJMA 3N3AC 5L8VA 1K7FB 2P5UA 1QE0A 3MT8A 2I8AA 2GBCA 1JHYA 1PDOA 1G5FA 4PZ0A 5FPHA 3TW6A 5DI3A 1X0VA 3JX9A 3DXXA 2WZBA 3WWPA 4MEBA 2IJGX 2J3EA 4LDNA 3ZGOA 1SXHA 4KXWA 1JAZA 1PJRA 1R6DA 2L82A 1PJBA 1YB1A 2PY6A 4G9EA 3D2LA 4WFQA 3GEHA 4NATA 4X6UA 4BTLA 1QUFA 1R9NA 2QX8A 4WWHA 4CMBA 1QGED 5TVKA 3RVDA 3MUNA 1FDVA 1L4FA 3ORRA 3T3EA 4KNWA 3DWFA 2BR4A 3F8SA 4IGAA 4JLBA 5A2QA 1TL7C 5H8WA 1RLUA 2ZIWB 2A84A 4YAOA 2VCEA 2IY7A 2WJGA 4RLQA 5CT9A 2IHTA 3LC7O 3EH2A 2ZIAA 4IO1A 1ZGAA 1XZPA 3NHYA 1LEHA 1L5SA 2BFCA 4OUKX 1E9AA 4A8JB 3BFVA 4AKHA 2ZJ2A 1DIGA 1XMXA 3MWGA 4DM7A 2BZ0A 4LGMA 5A3VA 4WXRA 4BCDA 5CB4A 3WJ7A 4V1CI 2P5TB 1PI3A 1QWSA 4E2FA 5JMTA 6NULA 4MPPA 3O21A 5E2BA 4ARAA 4C3UA 4K88A 1KKMA 4K3UA 5CX1A 4JLVA 1MAWA 2GOYA 3HEBA 4DJTA 2PSSA 2PMKA 3DHYA 6REQA 1U8FO 1W34A 4C22A 4NCHA 3FUWA 3IMCA 3FRIA 4O4HA 2G70A 2HYDA 1FUIA 4HDSA 4KAXA 4AK9A 5KNDD 3FOFC 5B53A 1OLUA 3BFJA 3DTNA 1C7RA 4O5AA 2QLJA 3QVWA 1H2YA 1BNCA 2CNLA 3IT3A 4KPUA 5C3UA 3ISVA 5A6VA 4HDKA 4L73A 1OKKA 1T6NA 2H29A 2J4DA 2Q3JA 2F8TA 4MQUA 5BN3A 4JBYA 2AC2A 1VMDA 4M60A 4W6QA 3Q8LA 5HG0A 2XITA 3O38A 3GFSA 3OTHA 3TQOA 1QE3A 1OBCA 1U7DA 3UHPA 4JT9A 1DWOA 3LKZA 5K0TA 4D0RA 3WRWA 1XELA 1XTUA 1YVUA 1C80A 3HCBA 2YN4A 2RI0A 2DF8A 1BMDA 3MOIA 4DAOA 5KQRA 4RV4A 5E3IA 2E82A 3LUFA 4YEDA 3SHQA 3CH6A 4HAVA 2R6R1 2B8JA 3E9MA 4DEXA 3QLJA 3CB2A 2D5BA 3T41A 1QLWA 1PZNA 4QXMA 3A1CA 2GJKA 5DBHX 3REQA 2IUEA 1NW8A 1O5TA 3CV3A 1GT6A 3NJ8A 3CLHA 4OOEA 3G88A 4ZT6A 3OOJA 5FORA 5H3CA 2A5JA 1A2BA 1OYYA 3D6UA 3PJGA 4F5YA 1Y3HA 4Z7JA 2ZYAA 4LISA 5CLGA 1R5BA 2QGNA 3R0QA 5DXAA 2C82A 2YFYA 4LK3A 5BMVA 4X00A 5TT0A 4AXXA 2ZYIA 4R1UA 3OVMA 4UTXA 2OYSA 3TLMA 3ZK7A 3BD6A 1JBQA 1N8SA 4WZAA 4AJ2A 4CI0B 1GNPA 1OFIA 4JNCA 4ZO4A 3PWZA 1H8EA 3VTAA 4B6SA 4BKQA 3QYJA 2CK3A 2XE8A 5IAKA 1PVOA 2DR2A 1OFVA 3HSYA 4DV3B 3BTOA 5JY6A 5DHUA 1WMBA 4KYUA 4AMVA 1E98A 2NTEA 3HZRA 1JEEA 5C7YA 5HX7A 4C7BA 1RCFA 4TTPA 4ALNA 3BGVA 4R1TA 4DCNA 4CV0A 5C5EA 4LFCB 2E87A 3NH6A 3ZGXA 1NQ5A 4D45A 5M04A 4Z4FA 4BATA 4ER6A 1X1DA 3VJRA 4AROA 4QBIA 2R6FA 2VAPA 2VWQA 1LK5A 1C4WA 3UAGA 1M7HA 1U2GC 2XF8A 3MMNA 4WPGA 3V9PA 3ROEA 2Y71A 3NEAA 1N36B 3QM1A 3PIDA 5AKZA 4JYCA 3UAXA 2QPLA 5IK2D 1YQXA 5ALWA 1QVRA 4J0FA 3UC9A 4ZGBA 2XZDA 2FSVC 2ID7A 4ZYVA 2UVPA 4GMXA 1ODIA 2YHSA 3PIRA 4P53A 5EXTA 1PV1A 3PXEA 2PKQP 521PA 1GIAA 4GGPA 3BWXA 2CDRA 1LLQA 3ABSB 4CM8B 1RXSA 3S7ZA 2IQ5A 1Y5RA 2F3SA 3B38A 4IQFA 4NMMA 4U6QA 5AKXA 3TVTA 5BV0A 2ZSBA 3MWDA 2XT9A 3DW3X 3TIVA 2CL5A 4AY5A 1YFZA 4BP8A 1AY0A 3OA2A 3PQ7A 1O9GA 4QG3A 1ICIA 2TSYB 4ZYUA 1KE2A 4FFBB 4ZT5A 1A5BB 2QJTA 3ILXA 1NXOA 1Y82A 1J0AA 4QEKA 3ABQB 4HBGA 4J7XA 2G09A 1E6KA 2VPTA 5JD4A 1OXMA 1CF9A 2W8BB 3FWNA 4HDRB 4RYDA 4WKNA 4RFLA 4ZQEA 2BFWA 5M3BA 4O0MA 2VT7A 3TNYA 4OHPA 3DWGA 2RKWA 2RARA 1L4EA 2QL5A 2WD7B 4IM7A 2WKRA 4ARCA 4BNUA 4RD3A 3SY8A 1WEKA 1HRKA 2QMEA 3BMQB 4R3WA 4DLBA 4DZTA 2ZRCA 2VTBA 2W0SA 1FS5A 3IBSA 3O1LA 5I9NA 1Z9BA 4CKBA 1EGAA 1O94A 3FVWA 2ID8A 2QY6A 4XIIA 1VM6A 1BGWA 1GPLA 4E14A 4Z7OB 3RADC 1UXJA 2TYSB 3IE2A 1WNTA 3NWJA 1YRHA 1PT5A 3QYAA 3T9EA 4DG9A 3NAZA 1LDMA 4BQIA 4MQLA 2GR9A 3N6RA 1M2FA 4A0GA 5JAMA 4YA6A 5E8RA 4HWOA 1J0BA 2V9CA 2VF2A 3I30X 4I7EA 3T5CA 4LGCA 3DOHA 1G4HA 1DADA 2PWZA 2WTEA 3DYVA 4B34A 4IDGA 5BT9A 1WM1A 1U9IA 2ZQ5A 4FBMA 3MCTA 3H5VA 2X76A 2J3LA 3HEAA 5DTJA 3N0VA 5JCPA 1VB5A 3BM5A 3JALA 4LJ8A 5KKCA 2XYPA 1A2QA 4O1IA 1Z06A 3MS7A 3LL7A 3MYYA 4ZZIA 5FD8A 4GBED 5HP4A 3KETA 2HUNA 1E58A 4NMXB 3LECA 3PNPA 4TKUB 2AG8A 1CYDA 2ZRNA 4X7RA 3SSOA 3UV3A 2P6RA 1H3EA 1PTJA 3AB3A 4B33A 3WX0A 2GBFA 4BX3A 3EDRA 4DV2B 3KYIB 1SQ6A 5L3QB 4FOTA 4MDFA 2JIPA 1V5EA 3EIUA 2WQ6A 3B78A 4GXNA 3V4SA 1I51A 1ZZGA 1XYGA 4J2OA 1T1GA 5BV2P 3U7QA 3WIEA 1J99A 4KQMA 1D4AA 2XQJA 1B23P 4JVLA 3ZDDA 1W87A 2QRUA 1LNQA 3HWX1 4BE4A 4B43A 1Z4LA 5P21A 1L8LA 1UOQA 3CRZA 4PY2A 2FMUA 1P45A 3M4YA 2BR3A 3V1KA 1MCZA 4ENQA 4KV7A 4NZZA 1Z2PX 1SU4A 4HUTA 2IIVA 4P7BA 2BKAA 3KWJA 1F4PA 1XZQA 2YY6A 5GP1A 2GD6A 1LNZA 4C3OB 3RRFA 2OCDA 3RVMA 2JJQA 3GRPA 1SCUA 2DFTA 5T4EA 5C1PA 2O1SA 3OQ1A 3DOOA 1WUTA 4UNIA 5ED4A 3HY4A 1P75A 3L7BA 4N76A 4DC9A 3S27A 1K7SN 4WHMA 4UMDA 1T8RA 1T6ZA 3EPLA 2G1PA 4AVYA 2JHAA 1FQJA 1Z2DA 3K9WA 4H0NA 1QH1A 4Y6RA 4BO5A 3HJBA 5LJLA 1L0BA 1QIHA 2GBGA 1VXOA 3CWCA 3T3NA 4RVUA 4PAGA 1T9HA 3SHVA 5J4HA 4REMA 4ESEA 1JSLA 2QTRA 4MVJD 4ZTZB 1WLSA 10MHA 2ZE6A 3CRNA 3ABZA 2CLDX 2GBLA 4UTVA 1GAJA 1T1IA 2A33A 2ODNA 1MG0A 1QZUA 3GJQA 3GUUA 5TQ0B 3GVXA 5IW8A 3JQPA 5DHPA 4EJSC 3D6HA 3NUQA 5CA1B 4NE9A 4EGSA 1RPTA 5HF5A 3HJRA 2J6HA 3O83A 4CEHB 1JYSA 1T2NA 1DXHA 1VJTA 3EF0A 4L8LA 4PCVA 4X1YA 2J0EA 3K5HA 4FWTA 1GQQA 4OFWA 4E1AA 4OL9A 4RKRA 3U80A 2YDYA 3PUXA 3VPCA 2JG3A 4CBVA 2C2WA 4TTJA 5K5EA 3NNSA 1IZZA 1V11B 1S2IA 1GGEA 1SBHA 3OFJA 4JJAA 2DZDA 4CU5A 3EFEA 1ZYUA 2HMAA 2ZQYA 4RF5A 3DM9B 2ZCJA 2PX4A 4MB0A 3TZ6A 1RWWA 4DJJA 4H60A 3CRW1 4D0NA 3VU8A 1Q1GA 1QZ3A 2QVLA 3UJAA 1K7XB 4ZVNA 5JSUA 3AJAA 2PV7A 3E8XA 1WMEA 3IBYA 1YCGA 4MR8B 3ZY4A 2QU7A 4IMIB 5DZSA 3OZWA 3K6SB 5HKLA 3SSNA 4XVQA 1BG6A 2G71A 3ESCA 1X1AA 1BU5A 3ZBTA 1WDWB 2WVJA 2XX3A 1KJ8A 4WCFB 2E89A 1SCBA 3IRVA 2HMWA 2AN4A 2R1VA 3O2NA 1JFRA 1EVQA 3C3CA 3EXG2 4UOZA 1B8UA 2VIIA 4EKNB 2NV6A 1FLNA 4RNDB 4RS3A 1WETA 3FMOB 2FSIA 3QHAA 4C2BA 3CMMA 4FUTA 3TD6A 3RYIB 4J0IA 1X7DA 1JHAA 1CWUA 3E4DA 1G6HA 4UEQA 4RIGA 4TVKA 4PU0A 3N2YA 2V7VA 1G20B 1VJ0A 1COWD 4FINA 3DHWC 4IMPA 4NENA 1M5UA 4AS2A 1EFVB 4B83A 1KSHA 3FB1A 1N6KA 1Y3FE 3AFHA 4YECA 4EUHA 3EAGA 1I7SB 3H16A 2ZJ8A 2QJOA 3UW3A 2PMEA 1G8JA 3CSSA 4HYEA 4XFJA 3HJCA 5EJFA 1T0HB 4DA0A 2AOTA 2QX6A 3ND9A 1TLFA 1P8AA 1T8PA 1Z35A 2GDZA 3G2JA 1TIKA 2DHQA 5AXAA 3RVLA 2EL7A 3ILSA 3VU9A 3C6YA 1VL8A 1X9GA 4PV7A 2V7TA 4NOJA 4PZCA 4WD3A 5CK4A 2Z6UA 4Y1EA 4EL5A 3R2JA 2GM5A 2ODBA 1QZTA 2GXUA 5KC9A 3EEYA 3K73O 2IYTA 2VZEA 1KFBB 5KX5F 5CTJA 1F0YA 1FFYA 1DQSA 1BFUA 3GUZA 1OZFA 4Y18A 3W06A 4QU0A 3T52A 3H3JA 4URFA 4KZPA 4OG2A 1L4LA 1GNQA 4TYNA 3X44A 1WL8A 1AMNA 2WAYA 2ADFA 1IEQA 2QZPA 2DWPA 5CXSA 5FTMA 3WFJA 1AN0A 4ZYYA 2N3ZA 3BCSA 3OWXA 4DJDC 5HHTA 3RHTA 2Q6KA 1HKUA 1TUBA 4ZZ3A 2P1DA 1SHKA 2PU5A 2FPKA 2VJKA 2PKWA 2V6IA 3QVKA 5AKHA 4H7JA 1P60A 1T9DA 1N9GB 3UMCA 4D0LB 1D2EA 1Z0SA 3PQ4A 2GN4A 1P1HA 2NZJA 2H17A 1H4VB 3EGXA 3O3MB 4II7A 3G13A 4JZKA 4Q3OA 4DIDA 1CR4A 1KO7A 1T5LA 2O19A 4PFSA 2AYYA 4DCGA 4H4DA 5JSKA 5C32A 1PNTA 2C83A 3PYMA 1NF8A 3GBSA 2DETA 1TB4A 1TVMA 1CUAA 3F98A 3SC6A 4XVUA 4LMBA 3SZGA 3TCKA 4EG8A 2GSDA 4KQ2A 3EBPA 1RXCA 1VCHA 3FNHA 4NQZA 4MHTA 1O57A 1VHTA 2I1LA 2C3YA 3ISJA 5ULLA 2Q7DA 4XSGA 5ITVA 1CFZA 1XMIA 4IKEA 3AJRA 2OGTA 3CN9A 4Y3UA 2ST1A 4WIAA 5AKKA 2PZJA 4BO0A 4DMCA 2XUPA 3M49A 1U2EA 3Q10A 1MKYA 1XJ0A 2EJCA 2A8YA 5I7FA 5LLDA 5HQJA 2E6KA 1YBAA 2HN9A 3JWIA 2CSXA 4FFVA 4JLOA 1Q21A 2FMIA 5E9AA 1U1IA 4LHEA 3U17A 4ENRA 5KCZA 1JHDA 5E4YA 4K8RB 4TTIA 1J2EA 2ZDGA 2Q5EA 1YDMA 1DZIA 2I34A 3BH6A 5F64A 3HXQA 2YJZA 2FDRA 2O3JA 3BK1A 4NCIA 5AVWA 4Q4HB 4Y6LA 4G4SO 4KUEA 3STYA 4DUZB 4ZD6A 4XGKA 3HWWA 5AW7A 5I8PA 2VNJA 1F3LA 4FI3F 1BWRA 1CX9B 2WHRA 1U4SA 2OO5C 4I5EA 4MV1A 4PZAA 2AMVA 4MHSA 1G38A 3RSHA 1U9CA 2NLOA 4KACA 2FRDC 4JT2A 4OP2A 3DDCA 1ITZA 3CWZA 1Z6PA 3GBVA 3TGWA 5K0SA 3KSZO 4XJTA 4JGBA 3ESXA 2YV1A 4M9UA 2ECOA 3ZJ5A 4RKEA 4OHFA 1L4NA 2VVTA 3BTUA 3O3OB 2VTDA 2CWWA 3BFKA 3QPCA 4CR8A 2IUFA 3K4HA 4L0CA 2SCUA 3KQVA 1PLJA 2NZ8A 1IY0A 4IQGA 1XRQA 1P31A 4K2HA 2LTAA 1CZHA 3GD5A 1RNLA 1KERA 2ORED 2ZPUA 2QN6A 3NONA 5JNRA 2NOAA 4IO0A 5J2UB 1N2XA 2DXIA 5EPOA 2JRLA 3HKDA 4NU6A 5EKXA 1T25A 2ZR9A 2Q3LA 2YNMA 1TQ2A 4H7IA 1PSDA 1CJBA 4MA4A 4RD0A 2AWNA 1HZZC 4MCAA 3DMPA 4LRSB 1W581 1SHLA 1W6UA 3RIHA 3VVCA 1IHDA 2DRIA 2FI1A 3ZZNA 3A0UA 3BXFA 3FBGA 3PXAA 1OH5A 2IS6A 1DJNA 5GQSA 4MIKA 3ZEAA 4P7JA 4UHFA 1E6UA 1P4GA 3MRTA 4MV5A 5L40A 4H3VA 4FGJA 4YV0A 3TDMA 3UJCA 1TAUA 2BL4A 5F5XA 4CIVA 2HK8A 1AZWA 4WA7A 1N77A 2PGDA 3C0KA 3FTPA 2CD7A 2DFLA 4A2QA 5AUNB 1TMKA 3PQ3A 1G8KA 1PWEA 1EFLA 3Q7TA 1Z4OA 1HDZA 1ZGJA 2EKQA 3EXHC 4QOFA 4ZEXA 3V1TC</