2FMIA

Crystal structure of chey in complex with chez 200-214 solved from a f432 crystal grown in tris (ph 8.4)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELLKTIRADSAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Chemotaxis protein cheY
publication title Crystal Structures of Beryllium Fluoride-free and Beryllium Fluoride-bound CheY in Complex with the Conserved C-terminal Peptide of CheZ Reveal Dual Binding Modes Specific to CheY Conformation.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 47
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fmiA00
4QICA 2HQOA 3BILA 1K66A 3LUHA 2PUGA 4ZMRA 5JNVA 5DLEA 3JPWA 2Q5CA 2R48A 4DN6A 3O21A 3DLHA 1T34A 4ZPJA 5KI6A 4O1HA 5BRJA 1NXVA 5D2CA 4IGAA 4P98A 1A0OA 1OXBB 2E4XA 2KYRA 4LRQA 4RZSA 5CNJA 4MS3B 2FMHA 5DTEA 1QQBA 1NTRA 2DRIA 2JBAA 3DGEC 5KC9A 2A9QA 4DQDA 2VUHB 3EDCA 3JS5A 2F8TA 4G0XA 3ROTA 2LIVA 1Z26A 3H5WA 4WXMA 4RWEA 4FB4A 2E4YA 3KLNA 3L49A 5HSGA 1ZH2A 3MQ4A 4G0QA 3OM1A 2PL1A 3BREA 3HSYA 3NNNA 3Q9SA 2LUOA 1NXWA 2JVIA 1ZESA 4RK6A 1ZAYA 4G0MA 1DC8A 1J56A 5ABPA 1Y1LA 5TPZA 4Z4FA 3OQMA 4MS3A 4RXUA 1Z18A 4MS1A 2MSWA 3LMKA 3F73A 1TM2A 3T6KA 3FDFA 3I45A 2M1ZA 3N0XA 5CNMA 3LUFA 3KYIB 3O1HB 3GT7A 3N0RA 3LUAA 4LE2A 1MAVA 1XHFA 3MM4A 3CFYA 4PICA 3FGZA 4Y9TA 4EVQA 4W5QA 3QLVA 1JFSA 3UKJA 4OLAA 3DZDA 4KPYA 2PUDA 2ID7A 3T95A 1ZHHA 4G97A 2PE5A 3O2JA 3MMNA 3BBLA 3HJFA 4GNRA 5HQJA 4N03A 1CHNA 9ABPA 2QVGA 1R8JA 1URPA 4MR8B 2R4QA 1PEYA 4YV7A 4MRMB 1TVMA 1DBQA 1DCFA 5JNUA 4RK5A 4O1IA 4Z9BA 4CBVA 3TMYA 5CNIA 1JX6A 3IPCA 4ZYLA 1MB0A 1P6QA 3SQNA 3RVMA 4D6YA 4Z4CA 3QLVC 4XFKA 4JB2A 4O5AA 1L5YA 3RVSA 1XWWA 2ID9A 2WRZA 5IEJA 1YS6A 4S05A 2NZUG 4JAVC 5I4CA 4Z4EA 1E2BA 3I42A 3OLVA 1P2FA 4MYRA 3O75A 1D1PA 3CZ5A 3S99A 3SM9A 1DBPA 2FLKA 3GV0A 1DRKA 3OLWA 4QYWA 4H60A 4ML3A 1EFAA 4LDAA 4N0QA 3C3WA 1GCGA 1NXSA 4LDZA 1ZGGA 1EWKA 1IIBA 1K68A 1EWVA 4RK1A 3DGFC 5KWSA 4KRFA 4YS6A 1BDHA 4N76A 2NT3A 3H5TA 2L17A 1KRXA 2V0NA 2GBPA 4JA2A 3KYJB 2H3HA 4EGSA 2MSKA 1M2FA 5E3JA 3RVOA 3C97A 5IULC 3HK2A 3CTPA 4NCAA 5IX8A 3OQOA 4YR7A 4G0PA 3QX8A 5FWXB 4Z4GA 1NXPA 3IDOA 3MIZA 5KQGA 3M9XA 5DKFA 1QP4A 4D74A 4EY3A 4MR9A 3OO1A 4KK4A 5TQ0B 4EUKA 3CLKA 5TQ2B 1DCKA 1HEYA 1KRWA 4JB0A 3EAFA 4XXHA 4LX8A 1FFSA 2LP4Y 3HV2A 2QZJA 5CNKA 5DCLA 1EHCA 5CHYA 4F8JA 3QEMA 3D02A 2FMFA 1TLFA 5FWYA 3SAJA 4MAAA 2CHFA 1YK1A 5BQ3A 2QV0A 3I09A 3CG0A 1B00A 4KQ9A 1W25A 2RDMA 3FFXA 1MB3A 3FMVA 3K4HA 2FQYA 3W9SA 5TQ0A 2FXIA 3Q15C 1E6KA 1SXHA 3OM0A 3QELB 4H3HB 4XASA 4E7OA 1Z25A 1RZRA 4Z99A 1ZVVA 2XDYA 4L4UA 2PUEA 4FE7A 2JB9A 4NQRA 2OQRA 3OLYA 2N9UA 2J48A 1LBIA 1D1QA 5EWLB 1ISSA 1JDNA 4P1ZA 4RK7A 3D8UA 3G1WA 4KV7A 4YO7A 3LUDA 1C4WA 3GWGA 4TLMB 1LK0A 2IOYA 3SG0A 1DZ3A 1JF8A 4KREA 2L19A 3OMXA 2B4AA 2HQRA 4RV5A 2MYTA 2NUBA 2PAFA 3O2SB 3OQNA 3HXMA 2IKSA 1VPWA 3OO0A 1JWLA 1QP7A 4PZ0A 3K9CA 2PMCA 4N47A 3NBMA 5EWLA 2FSPA 7ABPA 1U2PA 2JCGA 2NT4A 3CNBA 4OATA 2JRLA 2FEKA 5KQLA 4M88A 3JPYA 3A0RB 4YLEA 1YTUA 4IMJB 2IDMA 1PHRA 4FE4A 1QQAA 2VUIB 1JH9A 2WB4A 4HNQA 4G0YA 4WXEA 3UK0A 2CWDA 3TO5A 4TN5A 1CEYA 3KTOA 4RSMA 2P4UA 1AB5A 2M98A 3ROFA 4RXTA 4W5RA 4Z0NA 1FQWA 1FFGA 1ZDMA 2E4WA 4Q6BA 1PEAA 2JVJA 1XHEA 2LPMA 1SRRA 3EGCA 3O1JC 3QLUC 5JNWA 3H5LA 3F7NA 1RNLA 4EYOA 8ABPA 1E6MA 2GX6A 4RKQA 3RVKA 2GKGA 3H1EA 3LKVA 2OENG 2HPHA 2L2QA 4JP1A 5TPZD 4ETNA 1NATA 4G86A 4L85A 4YWHA 3IP5A 4YP9A 4XLTA 1U2QA 3RVLA 4EVRA 3EJWA 2A9PA 4GPAA 4QPJC 1A04A 1F51E 1ABEA 5IBQA 3VNBA 3MF4A 3B2NA 3E61A 1M5UA 4H3KB 1GUDA 4F06A 4MR8A 3GBPA 4W5TA 3T38A 4MRMA 1JBEA 2IPLA 5B3JA 4ETIA 3NHMA 1GLGA 2FN9A 1Z16A 2R25B 3DBIA 4KVFA 4KQCA 3JVDA 2YHAA 2WY2D 5BR1A 5TPWB 3LUKA 1USIA 3RVJA 2WJWA 4PE5B 2IPNA 2VYCA 4RKRA 3C3MA 3GA5A 1GUBA 3IPAA 4KK3A 5B3JC 4OTZA 2PJUA 1YMVA 3RVNA 3HDGA 3OLXA 3SY8A 4EYQA 4LE0A 5JNSA 4F3TA 1QPZA 4MS4B 1I3CA 3I5AA 1RPJA 5JS1A 4MLDA 4IF4A 2FW0A 3N8IA 2MSLA 1QMPA 4E7PA 2QSJA 4RY9A 4LZLA 3CS3A 3OMWA 2NZVG 1PNTA 4UHKA 3HUTA 2PKXA 4JASB 1RXIA 4F11A 1TMYA 4YCSA 1KMIY 5EWMB 3H6GA 3H5OA 2CD7A 2FMIA 1APBA 2CHEA 4Z9AA 5KC8A 4OLBA 5FWXA 1ZY2A 3RVRA 5BRAA 3LUJA 1JFTA 4RK4A 3HEBA 3KLOA 3TX6A 3RVQA 1WETA 3GRCA 3NHZA 4MQFB 4MS4A 4Q6WA 3H75A 3CKMA 3KSMA 3GYBA 5TQ2A 3LUCA 2MYPA 4MQEB 5HKOA 4RXMA 1VKRA 2A9RA 2E4UA 3JVIA 5T7BA 2QR3A 3N6VA 4MR7B 4KNYA 1MIHA 2E4VA 4DADA 2HJ9A 2FQXA 5JNTA 2I6FA 1Z2DA 1RXEA 4NV3A 5TQJA 5IUKC 3RVPA 1Z13A 2B1JA 1U04A 4OBBA 2QVCA 1AB6A 3JY6A 1FSPA 3VNAA 5GOTA 1NXOA 3ILYA 3Q7TA 4MQFA 4PYRA 1NY5A 2FKAA 3HVRA 3QELA 3H5VA 1MVOA 4B09A 3IP9A 1JFVA 1L5ZA 4MR7A 1SXGA 1LJUA 1U0SY 2QXYA 4WT7A 3NNDA 1RZRD 3TB6A 2AYZA 1YK0A 2BGGA 3A0UA 3H6HA 1BAPA 2MYUA 3CU5A 2FQWA 4XAQA 3URMA 4QYMA 5IUJC 4RS3A 2RJNA 1E6LA 2PUBA 4N0PA 5IC5A 3QLUA 1D4ZA 1USKA 3IP7A 5DGCA 5F64A 4MS1B 2WWVD 2FEPA 1Z2EA 1JYFA 6CHYA 1F4VA 4KZKA 4W5NA 4KFCA 2RJOA 1ZH4A 3LOPA 4NCBA 1Z15A 3CRNA 4EYKA 2QU7A 3LFTA 1USGA 6ABPA 1H9CA 1LJLA 1KGSA 4TLLB 1YIOA 1QO0A 1LBHA 3Q7SA 2JVKA 1ABFA 2LBPA 3NNSA 2E4ZA 3T8YA 1JDPA 3EQ2A 2PLNA 3BRQA 2W42A 1GCAA 3GBVA 5PNTA 1JL3A 3O74A 3JTEA 3MYYA 2ZAYA 3M9WA 2PUFA 5TE9A 1Z12A 3LTEA 1PUXA 3N53A 3UUGA 3KJXA 2WJAA 4TMYA 3F6CA 1BDJA 3H1GA 3Q41A 2IPMA 2IPAB 1A2OA 3E3MA 1Z17A 2R47A 3KG2A 3ILHA 3HM9A 4RK0A 5GQSA 3TD9A 2QW1A 4JOQA 1VLZA 4IILA 1QKKA 1DG9A 4Q7EA 3OLZA 1C0EA 3QX9A 1QO0D 2GWRA 4MGEA 4NICA 2PUCA 4ZMSA 2X7XA 4YGXB 2FEWB 4Z4IA 3Q7RA 3P9YA 3A3KA 3HUUA 5KQPA 4F12A 2O20A 4ZJPA 2YHBA 4YRZA 1M2EA 2FVYA 4G0ZA 1YVUA 2WMYA 5C5EA 4IRXA 3LUGA 1DRJA 1JHZA 4RY8A 1TJYA 4EYGA 4G0OA 1ZN2A 3EQZA 3IP6A 4N41A 2FTKE 3GL9A 4RDCA 1YS7A 1BVHA 1JYEA 1JLKA 3HZHA 3QK7A 1P6UA 3C3KA 4HYEA 4UHJA 4RY0A 1W9HA 1ISRA 1SXIA 3CZCA 2AYXA 3KHTA 3MA0A 1DBWA 1BDIA 1YMUA 3CG4A 5JNRA 2L18A 4MR9B 3HDVA 4RU1A 1BA2A 1OXKB 2RGYA 3BRSA 2A9OA 5T3YA 3RH0A 1U8TA 1DC7A 1SD5A 3EODA 3KKEA 5TPWA 3L6UA 5KQMA 3SNKA 3C6QA 2JK1A 3HS3A 5IEBA 1D2AA 3DLBA 1PNRA 4MPTA 3A10A 1ZITA 4EVSA 1EWTA 3CHYA 3M6MD 3QEMB 3H1FA 2ZWMA 3N75A 5FWYB 5EWJB 3LKBA 5JS2A 5ED4A 3FFTA 1UDRA 4OG2A 3KS9A 4XARA 2GI4A 2TMYA 3R0JA 3N0WA 3HCWA 3O2QB 4KMRA 4WWHA 3F6PA 5FBKA 2PUAA 4HNRA 4HNSA 3EULA 4WUTA 2H0AA 5FBHA 3QEKA 1CYEA 1FFWA 2FMKA 3O1IC 1D5WA 1ZGZA 5HM6A 1P8AA 4ETMA 2MYNA 2PL9A 1VRVA 4LE1A 1DCMA 3FFWA 1NXTA 3KCNA 1S8NA 2FLWA 1QP0A 1QNLA 4MLCA 4D6XA 5C5CA 4W5OA 5EWMA 1DP4A 2VK2A 2FN8A 2F8SA 5EWJA 1EAYA 1M5TA 2HSGA 3G85A 3HO1A 4IMIB 4PEVA 3QLTA 4S04A 5IUNC 2HQBA 2P9HA 4WZZA 1NXXA 2IYNA 3RQIA 2JBAB 4Z4HA 4MQEA 3H5IA 1DJMA
chains in the Genus database with same CATH superfamily
4BQQA 3KHSA 2HHJA 3PI7A 1Y7LA 3LLVA 3KLBA 3ZU3A 4ZDIA 4F7WA 1VA4A 1ZQ9A 2QI9C 1W5TA 3E9ZA 1V95A 1J9ZA 4G1BA 4YJGA 3TVDA 1FNDA 2Q1SA 1YZVA 3JPWA 3EH2A 3OEED 5AVUA 1CV2A 1NFRA 3GXBA 2WEKA 2XCOA 4KDFA 3S2YA 5JXJA 3CVYA 1RQ2A 5BRJA 1NXVA 1PJLA 1YJXA 2LKDA 1G20A 3HA5A 4RLSA 4WA7A 1CLEA 1D0IA 2V7XA 2E4XA 4XM0A 4IIXA 4RHYA 5LQKA 4C4SA 1N2HA 3DGEC 4PZCA 2WAXA 4DA4A 3L7OA 1JU3A 3JRXA 2YWEA 5EJIA 4IX9A 5EHQA 1NBEA 2PPVA 3CE9A 4M99A 3H5WA 3ZWDA 1YKFA 3PRKE 1XDWA 3ZLTA 1CD5A 4I3GA 1E5LA 1F7UA 2XWQA 1XTSA 2WIFA 3ZEAA 3VFDA 1MTOA 4HLUA 1Y5RA 3ZDCA 3UK1A 2BDTA 2WU0A 1BXKA 1GQRA 4KJXA 4OB7A 5C7LO 3AVPA 3MXOA 1FEZA 4OP3A 1DC8A 1SVSA 4WOPA 4B7UA 1ANKA 1TLLA 3HG7A 3QENA 3TLAA 1UBNA 1OH6A 2X8JA 4K7JA 3OQMA 4AKHA 1OLXB 4YUVA 2YW9A 3NFRA 3FDFA 3I45A 1QQ7A 3F6EX 4GEGA 5ILGA 1OROA 2ZG6A 2ZRQA 3EMDA 3LXUX 1M9NA 3KYIB 3TQOA 3W78A 3BWXA 4EVQA 4FHDA 3WP0A 1E4EB 1AH2A 5DCYA 1V8DA 4TSKA 1C3EA 3UKJA 3DZDA 5C7OO 2Z8ZA 3IJRA 1FFEA 2VYVA 2GN1A 3KSZO 1EVZA 4O33A 5HOEA 1B8PA 2WWWA 3MRSA 4ZREA 3WWZA 5K8TA 3BXHA 2ERCA 1DEHA 2AKAB 3EFEA 2XGSA 1N2GA 2ZIVB 4RK5A 3BICA 2PSFA 2BEWA 2E5WA 1QH1B 1WXGA 2GMWA 2FEXA 4RVGA 5TMDA 3RC1A 3DZJA 3C8UA 3REOA 3E9YA 4B7ZA 4WNAB 5JHHB 4UEKA 3ZZMA 3OLVA 2R79A 4XYBA 4QSMA 2NO0A 1X1AA 3RIHA 4D4KA 1GG9A 1ISPA 1K2WA 4DGQA 3ESXA 4RANA 4NKRA 3OT1B 4X1KB 4CLEA 3SYLA 2HRDA 1ZSYA 2P4HX 4M8NE 3LSTA 5HW0A 5L4NA 3DVAB 1J8VA 1P29A 2AFIA 3VM6A 4F1KA 4N1AA 5EIFA 1RYDA 3AUFA 1M2KA 3QWBA 3CW9A 4LK2A 3ZNQA 3KUCA 4RH1A 5AP9A 5FRDA 3BC1A 1P1RA 1X7GA 2AOTA 4I9NA 4LK3A 3R44A 3FLEA 5FI0B 1LJ8A 3S70A 1E0AA 4KKXB 4NEQA 1MEJA 2NYRA 3I28A 1FP4B 5EFOA 2H2AA 5B1DA 3ENQA 3EC1A 3H5TA 4JA2A 2FW9A 1MZPA 4GVXA 4NE7A 3UT6A 4H1UA 1Y6ZA 3IOEA 1T36B 3I9LA 3EEOA 1LNQA 2AX3A 1ZISA 3I9KA 3LCCA 3D2AA 3HK2A 2XMDA 2C1XA 1CUUA 1OYYA 2IHVA 5KCMA 1WUTA 1OZGA 3O82A 5J2TA 3KLMX 3HKCB 4D8VA 1KQPA 5BSWA 5LUAA 3GJZA 2VNHA 1PGOA 4URXR 5J23A 3NT4A 4HUQB 2UVPA 1KVSA 2XHEA 3D43A 1GGKA 4HYYA 4D43A 1U11A 3R4VA 2I9PA 3FOCA 1XZKA 3LLMA 3RSHA 1OX5A 4FX2A 5K3AA 5G1PA 1QHFA 3Q4GA 3WQBA 1FFSA 2FPRA 4KQIA 2J5RA 2J30A 2OCAA 1ZSVA 5B53A 3PI6A 3RBAA 3GLUA 1CJKC 2R7LA 4XOIA 2OCPA 3TPZA 3R0XA 1CQZA 4PSDA 3RRMA 2HJHA 1P4HA 4E2ZA 4IIGA 2ZXUA 3OJXA 2LV8A 2CLEB 4GHWA 2GJ4A 3BL8A 4IVQA 2VP0A 4GMHA 1L1EA 3VSBA 5AW7A 3F9CA 1I01A 3KAQA 3G8BA 2PG3A 4J7CA 4CKBB 4F2HA 5JXWA 1FFHA 3ZY6A 3VHRA 2QPAA 1X2BA 3UJ6A 3QBDA 3UFBA 1J1ZA 3LV8A 1SXHA 4NFSA 4XASA 6REQA 3KZOA 3TUZC 3AEXA 3H04A 4KH1A 4Z99A 1KJWA 1XO1A 5JRZA 1JVNA 1KK0A 1XP8A 3JWPA 4WI1A 4XB6B 4ZKEA 4JI6B 3GLFE 2B25A 2EKZA 3AUAA 4NK4A 5CXXA 3ENNA 3LF2A 3SHWA 4JP3A 2JFPA 2NNLD 2F3RA 3ISTA 4C6SA 1YJ8A 2YCLA 2RB4A 5EWLB 4ZYUA 1PGNA 4Q1BA 3E15A 2G04A 5E6SA 3G1WA 3AF3A 3X1ZA 3CNEA 4RHCA 3WK4A 2XCUA 3M2PA 2NPOA 3D4NA 1P3Y1 4UEWA 1JHVA 3B52X 4RV5A 2P30A 4GW3A 5E4TA 2CVHA 4M0LA 4JYAB 1EX1A 2QJWA 3D0RA 5LDGA 4CKZA 1KIFA 5K7SA 3FYDA 3ZV4A 1BEZA 3RHFA 1Z0AA 10MHA 4Q4CA 5IH7A 2R7AA 1LDNA 1KH2A 1FS6A 4KTTE 4TV9A 3D2CA 1PJCA 3N8DA 1X0VA 1YZGA 1VIDA 2BSXA 3F46A 1XROA 2FEKA 2IUSA 1V11A 3R9IA 3I5XA 3D59A 1CS4C 1X87A 4DY4A 1R4AA 4IMJB 3RC3A 1M2VB 1XJWA 3RBXA 2ECKA 1JJ7A 1YRQA 1HT1E 1YBHA 3DT9A 1IDOA 2VK8A 3EGDA 1U6KA 4FGUA 3WWDA 4RLQA 4D6PA 1UAGA 2QL9A 4MUBA 1RLUA 1L5KA 2DYKA 2QRPA 1A88A 3ROFA 4WH0A 4ZCIA 1Z8HA 1BGWA 3L8GA 7YASA 5DK4A 4DT1A 1AXGA 1HE8B 1J22A 2O2SA 2CD9A 3EGCA 1MXHA 1XHEA 1SRRA 3QLUC 3RYIB 1GKYA 4OX9Y 4LQ4A 3GLHB 4K86A 2J9FB 1VL8A 2BUAA 2CVOA 3V2HA 3A11A 2ZP1A 1Q74A 4AL4A 4HQNA 4PFJA 3DP9A 4HAXA 1E3IA 3LT5A 2HPHA 4QECA 5AKKA 1VGVA 1DTWA 2PXCA 4Q4HB 3JYLA 4RJLA 5AI9A 1G63A 1PQ4A 1XZQA 1UBCA 5BOSB 2WSIA 4EJSA 1KTVA 5EMHA 4ZI2A 3BWYA 1KF0A 1A9XB 1F38A 4QPJC 2WJ6A 1EMDA 4BWYA 4DC9A 1JEDA 1EX6A 1VHLA 3AR5A 1JHXA 1A4IA 4IOKA 1XHLA 2W2KA 4F4CA 2WF7A 3ZDEA 4WMLA 4K1XA 4F06A 1ADCA 3MWEA 2VF7A 1K3TA 2HPVA 2BM1A 4BKQA 4DUGA 2BEKA 1J8MF 1PI3A 2A0YA 3IRVA 4TKZA 4EKDA 4ENWA 3EY4A 5HRAA 1QYCA 3ILVA 2B1QA 1LSJA 2OL4A 1QIHA 1HC7A 5B1YA 3IXLA 1E6WA 1FMLA 2FF5A 4DSUA 5AM0A 2LXNA 3LUKA 2AYYA 3ZI7A 3RVJA 2LE0A 5C2JB 4ARSA 2JASA 4TOIA 3T3PB 4EABA 1VMEA 2ODBA 3QVJA 4PAOA 4HF7A 2PX5A 3ESBA 3FG9A 4QG7A 4LI3X 1I14A 5C8YF 4US0R 5EZSA 3PKIA 5EUMA 4MITA 4C0QC 1F7VA 4FOLA 1C1XA 2HZBA 1TEHA 1L3BA 4TSRA 3Q11A 4E5UA 4HDKB 1Z63A 4UUOA 13PKA 2EF0A 4CKXA 1RPJA 4CUKA 1JVBA 2DQZA 3VAAA 3PDWA 4I55B 2QTHA 1AV7A 5LA6F 2AI2A 2BE7A 4COKA 3DDCA 4OQFA 3T1OA 1V6CA 2OGSA 4M1MA 3T34A 3WXBA 1PEDA 1U0FA 3E2IA 3AJ9A 1NVEA 3I9V1 2I34A 3ZZ1A 2QE7D 4LBVA 4RJIA 5D84A 5BV1A 1APBA 2Z8YA 3B2QA 4M9RA 1EB9A 5KC8A 2CXPA 3F3MA 5DK6A 1ZY2A 1Z3CA 4N7JA 1QK3A 4R9SA 5ALJA 4HXYA 2R00A 4JYMA 4JENA 4PCUA 3QWHA 5B7NA 2CLKB 2RB5A 3S68A 1TCCA 1ZMXA 3E23A 2YIMA 2CDCA 2YVUA 1L4HA 2A9RA 4I6GA 3KOUA 4X7RA 2FI1A 3ZU4A 4NDAA 4X91A 2QYSA 3TLKA 1A7AA 1GPJA 1QPGA 2DY1A 3LQ4A 1AXEA 1CC1S 4MI3A 3OOYA 4M1QA 4O3MA 5DX8A 1I30A 2H5IA 2GKOA 3NS7A 3EC2A 1EDOA 2WF8A 4MRRA 3RUCA 4KFTA 2IXDA 3Q40A 1WSAA 5H4GA 4QBTA 1JAIA 1EUDA 3OKFA 1EJ6A 3AI3A 4NEGA 5EP1A 3RSLA 3LI2A 3W3ZB 3OCZA 2XTMA 2C7OA 4ECAA 4FIZA 4ZYYA 5PGMA 2FEAA 3F0TA 3KKKA 2OO5C 1MJGA 5D1NA 4PGMA 2JZNA 3H8WA 4GICA 1WOYA 2OBNA 3DC7A 2Y93A 4P0TA 5CXUA 3P0JA 4OGWA 2PVPA 1UMCA 3WLOA 1YF3A 1XCLA 5EXDA 4E2WA 5A71A 3E70C 4MR7A 4TN1A 3RIMA 1IPEA 1O9GA 1RQLA 2AMVA 1M76A 5AKYA 2GAAA 1JYSA 2JD1A 4O2LA 2I99A 4AY3A 4DL9A 2OVBA 4IHKA 3ZYZA 1RZRD 4P3YA 5IKPA 1IQUA 2H9AA 2BM0A 2OHXA 1YRBA 1OW3B 4TS4A 3VBEA 1JDBC 1MC4A 4TS1A 3P9PA 3LWDA 3A32A 4WBNF 1KAEA 4KVGA 5FOVA 1I1NA 2PFSA 4QTTB 3QEBZ 4PC7A 4JJ6A 3Q3GE 5IH3A 2ZYRA 1AC5A 4X71A 2EX0A 1HM5A 5KAPA 4ZCMA 3L77A 4KP7A 2ZLBA 3HBFA 1Z38A 3I4FA 3KQVA 5AI6A 3RGWS 5F98A 3MWLA 1KYVA 2HMWA 5LQUA 4Q00A 3ZXXA 2HMYB 2I2AA 3HA7A 1XTKA 4GLJA 3QG5A 5LXTB 1ZL2A 2RJOA 1ZH4A 4QBHA 1YOVA 4IHQA 1EAMA 2Y8EA 1Z7YA 1Y6QA 3A7DA 1J1IA 1USGA 3C4JA 3QBJA 4QOEA 3PC3A 4KGVA 4LF5B 1FMCA 3QXSA 4KLAA 1R8QA 1L7RA 1ABFA 3T8YA 3E27A 3MW8A 3QKRB 4EPTA 1T9HA 4V0MA 4I6JA 5CIWA 2O4UX 1DJLA 3G5TA 1QWOA 3ET4A 1BMTA 1Y5NA 5C4MA 3MYYA 2O7QA 1Q3TA 1VL5A 2GLXA 2VAWA 1C81A 3KT0A 5HG0A 2CXSA 3ZCTA 5HCNA 2IS4A 3BH7A 5CRIA 4H6XA 5F73A 1NJ8A 3NEPX 1N9GA 1QIFA 5B4TA 2DEUA 1IVSA 3KXLA 1GR0A 1H3FA 1NMZA 2ETVA 1LX6A 2NTVA 5EIAA 3LBHA 4X63A 1NI5A 1X92A 1XKLA 3ZD6A 4IHAA 2RJ3A 4BDTA 2PKWA 5FT9A 1Y8RA 4MPJA 1NNSA 3OZXA 5CFQA 2DUUA 2F00A 2IGBA 4FR2A 4ASUD 1WVIA 5CUQA 2RKBA 1TYBE 1YL5A 2CK3A 4B0PA 2JLBA 3WB1A 2FUCA 1BWQA 1I4EB 2OE2A 1JT9A 3DAGA 1RJGA 3G0HA 2DHQA 4HGPA 4AFNA 1M73E 1DFHA 1Q20A 5MN4A 5CCEA 2N1BA 5KQPA 3NFYA 4G26A 1BD4A 2XA2A 4PZYA 3SJCA 3NPAA 3W6OA 1J0CA 1MVNA 1VBMA 3QUAA 4CT5A 3HCEA 4IRXA 5HZHA 1Y1KE 2Z4RA 4DR3B 3PITA 2YWBA 5ALKA 3UKOA 5K0JA 5L40A 1JLKA 3QK7A 3F8SA 4FP9A 4TSFD 4HYEA 2D2IA 4GBJA 3STUA 1E2PA 3ZOZA 1POWA 2VT7A 4Q05A 1G6KA 1TMOA 5EHGA 3UPUA 3ZCRA 2XDQB 2O0KA 4MW0A 5EA2A 1H6AA 3ZWBA 3AMVA 1FTNA 4MP8A 1TK3A 5KMGB 3A9TA 1QQTA 3OZGA 4UUMA 4RVDA 2QQGA 4L02A 4NOJA 3M1LA 2R6AA 1VPTA 1QG6A 3AF5A 3NOVA 3VI4B 3C8ZA 3WK5A 3D81A 4ZYWA 2UXCB 1I9GA 3I2YX 1OXTA 3I2KA 3KJEA 4JBGA 3BF7A 2BHRA 2JATA 2VTKA 2JL1A 4XOUA 4EVSA 2Z3ZA 2X0IA 1JILA 3DUWA 3FFTA 3A3PA 4OUKX 3RC9A 3AI7A 4WZAE 1GAJA 1TC1A 4EQZA 4P4SA 4EUNA 3DYBA 3QMWA 1NP7A 2GEDA 1P1CA 5AKHA 2HLDD 4AS2A 1HDEA 5IRCD 2NO4A 4PGAA 3V6LA 3EDYA 2VQSA 4C0XA 1ACLA 4CG2A 4JP8A 3WAGA 1SXJE 3DEIA 2OB1A 2ZBGA 3SC3A 1SZDA 4IV0A 1SG9A 3TOCA 1G19A 1VJCA 2YV5A 4QQNA 4PFQA 1DP4A 1U8CB 2ZRMA 1MO3A 1MV5A 1UFOA 1EXDA 3PGJA 1HPLA 3KQTA 1D1TA 4B32A 1O8CA 5EMJA 5CDTA 4P9NA 3G1UA 5BMOA 3LA8A 5CM9C 2BHTA 2ZE7A 1ML3A 1Z2PX 1Z5PA 1OWNA 4Q9KA 2B36A 3RTBA 3BXGA 1DLJA 2GZAA 2GK3A 2IYEA 3SSMA 1V47A 3OJ0A 5DZSA 2W8BA 2AG6A 3RYFA 3GK3A 2PZAA 5F7XA 4ARZA 2HQOA 1NF9A 5DHQA 3U9LA 4B74A 1ISIA 1E6CA 4FW9A 2H0RA 3W8RA 2OHGA 3QIVA 1G8AA 1OE0A 1FDUA 1XKTA 2DPXA 1IUNA 3KVOA 2ILVA 5BUQA 2FR1A 4L0DA 1ZD3A 3E53A 3MWKA 4CIBA 1NNEA 4IDBA 3DDSA 2NMVA 3O21A 3T7RA 4LQCA 5I3ZA 4EA9A 4F6LA 2QSZA 1L4MA 2PQMA 3FCEA 4JR0A 4ZPJA 5TQVA 3TQSA 5KYWB 1C4OA 2JJMA 3BSYA 4Q7LA 3U81A 3DTTA 3QUCA 3SKYA 3ETHA 1JR3E 4LZJA 4TMXA 5FOSA 4FM9A 1YDGA 3EF3A 4JZYA 5AVWA 1Y81A 1X94A 1VJRA 2PWBA 5C8XA 2H1WA 3R3YA 1RRFA 2LIVA 3NVMB 2VNSA 3GPDG 4I4TF 2WWXA 1LEHA 4QQ8A 4XUGB 5EIEA 4JGGA 2P11A 3GGDA 1N3IA 5BQPA 3SHFA 3QVUA 1VDZA 3E7FA 5HSGA 3ZCSA 3B1ZA 4FMCB 2WUEA 4X6YA 1QFSA 2WSMA 2WZQA 4K9QA 4YHBA 3W7VA 4ES6A 1SN7A 3CW8X 1D2RA 2COKA 4MPPA 4WNIA 2QN6A 3CH7A 1N2XA 1P5HA 1XKXA 1KJNA 5FBWB 4EGQA 1IJEA 2E7ZA 1XA0A 4EPXA 2P6UA 4YMGA 5HCUA 1Y9ZA 2BEVA 4RM3A 3P0RA 4QKQA 2C5EA 2E85A 2R6CA 3U0BA 3UXMA 1MENA 4JQZA 4KH0A 1DXOA 4MYSA 2QLBA 2C5GA 4F3NA 4YCNA 4PICA 1HMPA 2IYLD 4GD3Q 1CY6A 2ZWPA 1HDXA 1X1DA 2ZXEA 1GCOA 3FGZA 5K1ZA 3T5BA 4B7AA 1MC8A 3NC1C 1CFZA 3MMNA 3WGGA 4IWXA 2V98A 4GZ5A 2XQJA 4N03A 3U3MA 3D6FA 4DLZA 2NNWB 2GZHA 1DC6A 1PEYA 4EDHA 5WRFA 5JSHA 4XYMA 5A03A 1SAYA 4B3SB 3DO8A 1DBRA 1E61A 1JQKA 1YRAA 3STYA 3WSTA 3ICEA 4I2VA 5A3RA 2DFPA 1E64A 1UINA 4D6YA 2D2FA 3QRWA 2ODPA 2Q6OA 3LX5A 1KL7A 3KZVA 3N7TA 1YS2X 1SCIA 4JAVC 4LJYA 4S0ZA 4A6XA 4ZAFA 4Z4EA 2JFBA 4JV5B 2XUFA 1DAGA 4V02A 2CNOA 3ZDRA 5K8LA 3PD0A 4KLCA 1Q91A 1PW7A 4HS9A 5TGDA 5BR4A 1X1SA 3ZQJA 1OB2A 5JG7A 1ZA1A 2IUUA 3UATA 1KEUA 5M04A 1GPBA 3VPSA 3ESYA 1U7DA 4GX1A 4IXWA 2AN5A 2GETA 2PLRA 4HOYA 4N5MA 1ADJA 1ZBDA 2WNHA 3ABZA 4CKWB 1P5FA 1UBFA 3IODA 1ZRHA 4R81A 4IV5A 1GTVA 4JLJA 3T3EA 4N76A 2JJ1D 3AXTA 2IUEA 4GX5A 4F04A 5J2UA 2JGJA 2PRSA 3IO3A 1N3BA 3KYJB 3NBXX 1S3SA 1YJCA 3G7UA 3K0CA 1OCEA 1C3OB 3CTPA 3MRTA 2DF8A 1EVLA 4OM7A 4OJYA 4JD5A 3WNDA 2VQ6A 3WY9A 3QVWA 2FR8C 4G0PA 4EQ6B 4A5SA 1P9LA 1ECBA 1VMIA 5COQA 4E70A 3NWPA 1D04A 4JUFA 5JZSA 4MWGA 3IIKA 2LIPA 1CQJB 1AZWA 1CZKA 4LJLA 5AKZA 3TTWA 3ZH9B 2B7LA 2P67A 2RHOA 2VJCA 5HFAA 2PD3A 2VATA 4A8TA 3HYNA 4B4OA 3HBLA 1J7KA 1LPMA 1V0JA 2O1WA 3EUFA 4JB0A 5E8RA 1QYXA 3EAFA 1OH8A 2ASEA 1ICIA 1DBVO 1L5RA 3IVMA 3IR5A 3QBVA 3KEFA 3RTEA 3WRVA 4A8JA 3NDRA 4QO7A 2DR3A 2PLFA 2CCJA 4NQZA 5CD9A 5HILA 3GLTA 3SF0A 4EKIA 1DAKA 1KMNA 1WF6A 3A3NA 2HC9A 2G9NA 1FTGA 3H8SA 3JAKA 1UH5A 3DBOB 2N42A 3I1IA 4R7ZA 1CUHA 3LZCA 4UBIA 3UQZA 1IEXA 5F3RA 3RV4A 4E2YA 5JZBA 2ASVA 4FGKA 4BNNA 4M1SA 3JQAA 5HK9A 3I5YA 2PJDA 3GLVA 1E6KA 4MIKA 4AJHA 2B30A 3PXEA 1J9EA 2ZUUA 4XPZA 2CMGA 1DQPA 2XDYA 3M6FA 3SQOA 4A23A 1S89A 1VPDA 4CL3A 4YRGA 5LKAA 4JC8A 3OOEA 1SIBE 2R68A 1S8FA 2PR7A 3O8RA 2A58A 2Y2VA 1E2FA 4GI5A 3R7BA 2Q3EA 4PX3A 1OFIA 3T1VA 4PN7A 3ZN2A 4UBMA 3FIJA 3EGXB 4YO7A 2KW5A 3WGKA 3NT5A 4BMVA 2EP7A 3BB3A 3COYA 3LUPA 1GJRA 3OMXA 3THXA 2YMQA 3H9CA 3UJHA 1E0JA 5K8VA 1HOTA 3FBGA 3TRHA 2HYDA 1IZ7A 1NT2A 1SCUA 2EP8A 2X4LA 3E4CA 3OQNA 3CZQA 4WKNA 3HCOA 1RKVA 5DTRA 5BVHA 1K92A 4L27A 4JXZA 1NDQA 1LVGA 3ZNOA 1V7PC 3LPCA 1UBUS 4MO9A 1L8XA 4XIGS 2CXHA 2PN1A 1KI4A 2CFOA 4NBNA 2PE5A 4CDNA 1UC9A 1XMXA 3V4OA 3JPYA 3MRXA 3IDSA 4INZA 4MUYA 5IAGA 4FI3F 3SVLA 3JQDA 3RTCA 3EHEA 1XDDA 2BL4A 2G3YA 2VZ9A 4K9KA 2E48A 5JY6A 1E2UA 2EGGA 1L8QA 1RE1A 2OLKA 4H6PA 4OF4A 3ZQ6A 4CCYB 2IYXA 4UJ3A 1YR6A 1WXQA 5LOVB 5EKXA 3CX8A 5LZ2A 5JYCA 1IEWA 1RFGE 1MRZA 4BIIA 4YMIA 3MZ0A 4JGIA 1K7CA 4PBSA 5BV8A 1Y9DA 5TARA 2C03A 1WSBA 5C52B 4W5RA 5CFLA 2ZUCA 2VHCA 2OXRA 3HCBA 3KWLA 4IDHA 2LPMA 5ETJA 5CA0F 1TZJA 1M6NA 2PSSA 3TNFA 2XNCA 2QM7A 4B47A 5K8IA 1K7XB 1PJAA 3A6FA 3AEYA 5ILOA 4Z2YA 4OXIA 3CUKA 2J7PD 1T9KA 3A25A 4J4BA 3HB4X 3FB1A 4DHWA 5TPZD 1A2BA 3GHHA 1CS0A 4G86A 1W94A 2JH3A 2QTVA 5DN6A 4M3NA 1YACA 3BN3A 2JBWA 1R5JA 1QJCA 3DUFB 3GLHE 4DBZA 2HA3A 3NHFA 2Q2QA 3BK2A 2C96A 4Q39A 4EKEA 2HADA 5MFPA 4FOPA 1F51E 1RRVA 2QM8A 1L4NA 3GUCA 3HN2A 5LZ7A 4D9MA 3VKWA 1M5UA 3GGOA 5IAAA 3EVAA 3CURA 2P7HA 1FFXB 1MQ9A 1JBEA 2IPLA 2VYND 3S2UA 3D6MA 2XZOA 1X8KA 4UJ5A 5G4LA 2ZS7A 2Z1DA 5AVSA 2DXIA 1VG9B 2DHCA 2C7GA 2R7MA 2D1RA 1Q1ZA 4FCTA 3GQBA 2NSYA 4RIEA 3HJTA 3ELUA 2R1TB 3SE0A 1M2GA 5AVTA 1Y3AA 1RPNA 1K6MA 4G8JA 1YZTA 3WGUA 2XUZA 3IQFA 1KO8A 3IH5A 1RAAA 2TMDA 3A4IA 2WU3A 5CX4A 1USWA 4RKRA 5DSXA 3ZCUA 3GA5A 4J43A 5E7QA 5J59A 3WLFA 4B75A 3TH5A 4DQKA 1JG1A 2J3DA 3MTBA 2B78A 5TRTA 3JQBA 2FX2A 3NDBB 1E3JA 3NPMA 4CG0A 1NJ5A 1IXSB 3I1FA 1NVVQ 3M5DA 1PTJC 3ZK9A 1CEEA 3IHLA 2Q4EA 4OHUA 4YUYA 1IN6A 4KQEA 1JZSA 1T2AA 2BKUA 4L5YA 1QGDA 3PUJA 5G0TA 3U7QB 4J1TC 4REQA 1JKJA 3FWYA 1C7ZA 4WOCA 1LLQA 1E98A 1PZEA 4PAQA 4GOXA 3CY6A 4YCSA 4B40A 4YAOA 2JS7A 4JI5B 4IOLA 3DE7X 2JLYA 3NTQA 3HU3A 1K97A 2WP8J 1F2UB 1UIRA 2YV2A 2YOHA 1Z2CA 2XRFA 2CUZA 3IJ5A 3N2IA 4LC9A 1Q1EA 4YP0A 3KLOA 5KYUA 3PWZA 1JFTA 2VJLA 5JCOA 3AUUA 2FETA 3IURA 2I6GA 2WC1A 4UXHA 1M34A 3H9JA 1GFWA 3IAHA 2CJYA 2G5PA 4E2FA 1GAXA 1QRAA 3AU9A 2DG2A 4F96A 2RG1A 1UC8A 3GAMA 4O08A 4OPMA 3CH6A 4ZQFA 4C22A 3LT1A 3SS7X 3S7ZA 4V3CA 5HBGA 1A82A 2J3KA 1P44A 1KVRA 2C4WA 3VOBA 1EVIA 2CLIB 2HI0A 1QFMA 2PUJA 3D7MA 3JD2A 2Z4SA 1JHYA 4GZLA 4U9IS 1TTQB 2G67A 3ILYA 1P3JA 2AVDA 2YZ7A 1G18A 2XMPA 1GZVA 1Z6AA 4WW0A 5TGTA 4YBRA 4UTZA 1WR8A 3KR2A 4JI1B 4NP6A 1EJ0A 1G8FA 3REGA 1XZDA 4IEEA 3WL3A 5AO9A 2GLTA 2F8MA 4EZEA 5AD1A 1E20A 3JVUA 2HMUA 1FVHA 4NZOA 5B36A 4QPNA 5EJ5A 1FXWF 5IJXA 3P96A 5LQAA 4Q19A 1ZRNA 3MWFA 2PUBA 4ZVSA 3TL3A 4IGIA 1TDJA 721PA 2DWUA 4X6UA 4HWGA 1KY4A 1MAWA 4IIDA 1M6HA 5J2TF 5G3YA 2NO9A 3N2KB 4V0OA 4EA7A 2GZ2A 2VCHA 3R5JA 2YV3A 4I1UA 1GFSA 4L78A 4CEHB 1BS9A 3ECAA 3HFSA 1JTVA 1RYHA 1CRWG 3BQMB 3NWOA 3SIPA 2N46A 4RL6A 3SMVA 2QU7A 3LFTA 3QYJA 1OC2A 2Y68A 4AYWA 2OHHA 3NX4A 2DUNA 4L3OA 1NM5A 4MVJH 2IYTA 4BBPA 9ATCA 5HIKA 3FRHA 2I3DA 1UBEA 2LBPA 1X9IA 2IZZA 5MN5A 5GVSA 4AJ2A 7MHTA 3QEOA 1GCAA 3WMGA 5PNTA 3PU6A 3D4BA 1JL3A 4INAA 4RVUA 1U7XA 1Z73A 2A0UA 2HDHA 3AESB 3HYSA 3G89A 2JIOA 4U2BA 4WCFB 3QFRA 1AKRA 5J58A 2P1DA 1UKEA 1ZIOA 5B2ZA 3RS8A 2HRCA 4XKJA 3BOSA 5IDQA 3RS9A 4EP1A 4URHA 3OBIA 1FLDA 2B4YA 3OC0A 3SIWA 4JROA 2NSLA 3D2LA 1XXHA 2R84A 4U7JA 1WUJS 2A9FA 3KG2A 1BHSA 5TVGA 3FYTA 3UA4A 2X8BA 4JOQA 4ACBA 3WRXC 1JZTA 2XRMA 2CLSA 3SLGA 3NHPA 3KX2A 4Q9HA 1V1RA 3GGSA 2GPNA 4GEKA 4AQYB 2EGHA 1D4FA 3EXG1 1YCFA 1EA5A 1ID8A 2XTAA 3CRMA 3SHQA 4EF4A 4RVNA 1U0GA 1RCFA 1SMKA 2OOKA 3DVQX 4FVTA 4KQMA 4LSWA 4LISA 3TSCA 5KNLA 2VTBB 3BHNA 3CGWA 5JAIA 4JZKA 1I2MA 1XT6A 5AK4A 1XD2B 3L1KA 1P73A 1LTQA 2NTEA 4GRAA 3IKMB 2OILA 4KGZA 3WKBA 2CLCX 3NASA 4GOMD 2MDTA 3T15A 2FWIA 5LQRA 2EHJA 5D01A 2QPLA 4E5DA 1BVHA 2NQTA 3G59A 1PX2A 5A4FS 1GGMA 1A9OA 3EGVA 2I7DA 3ITKA 5L3VA 1KOLA 2X7JA 2CDBA 2YVKA 3DOHA 3TRIA 1Y42X 2IA5A 3SXUA 3CZCA 1NVUQ 3N9IA 1AGRA 2GNAA 2PEZA 2ZTHA 3NKFA 3N74A 4LJ4A 3KSUA 5JT1A 2HB6A 3R3VA 1A8QA 1EFUA 1Q83A 4TV9F 3F98A 5T3YA 3PDIB 5C80A 1SD5A 1WXIA 2PQ6A 4YP6A 1PHPA 4C7JA 2JFQA 3SNKA 1KQOA 2ODNA 3K4PA 4X3PA 2WW8A 5DNUA 3VKGA 3P4UA 4R31A 3K09C 3TKLA 1PJ4A 4FWBA 2ZWMA 3DZIA 1DIOB 2PMWB 3K5WA 1I2CA 4OG2A 1ZK4A 2GI4A 1NN3A 4N5NA 2I65A 1H2FA 2W11A 3UK7A 5LWHA 2ATCA 1XCMA 1XAGA 3K6SB 4XGIA 1CF2O 2I66A 2RAVA 1VHTA 2W7TA 5AW9A 4M1KA 1ZGZA 1GFIA 1GFZA 3VX4A 3ZWOA 4BLVA 1XVLA 4L7VA 1G7RA 4BS9A 5KNDH 1QLWA 1CW2B 1ZUHA 3BXZA 4BXOA 5EXTA 4BBJA 4QU8A 3DM9B 2UZ3A 1T9DA 5TVKA 3R7WB 1E63A 4F56A 5T4HA 1X7DA 1HTBA 1LDMA 2AOWA 4PG4A 1M5TA 4W7IA 3DV9A 4AIIA 1K0UA 5JSKA 1UBLS 5HQTA 3ICWA 4D0NA 2QL7A 3OTHA 4P0PB 1OX4A 1N92A 4MB0A 1F8FA 3C39A 1Z5WA 4X41A 4CEIB 2IYNA 1XMJA 3I9JA 2WUWE 3U3JA 4TKVA 3TLCA 621PA 2ON6A 1HDIA 5JS7A 2CVFA 3H5IA 5LIPA 3TFOA 3VHXB 2OGUA 1V8PA 2VHZA 4Y1RB 2IEDA 5E3HA 1UBKS 4DYDA 1K66A 3KOMA 4JY7A 4O2BB 4Q3NA 4PZZA 3BE6A 1NPDA 5I47A 3GYGA 2VAVA 4O4LA 4DMHA 4L8FA 1G98A 1NQUA 2E49A 3RRBA 2YVLA 4K6MA 5LA6B 2WR8A 4WEOA 1L8AA 4HV4A 2EJWA 3P9SA 1TQ4A 4BP9A 3P2MA 3HM2A 4OI1A 3DONA 3I04A 3TBFA 3HC7A 3B78A 3PFFA 4RPLA 2XOEA 3JS5A 3TYXA 2QA5A 5FFMA 3HA3A 2G9VA 3D3KA 4NBSA 2MIIA 1YGYA 5JJBA 1UBGA 1ZJ5A 4JKIA 4TTTS 4V0RA 1V3VA 4N8SA 1YR3A 1US8A 2BMFA 1HNZB 4S1PA 4HDNB 4OXXA 2I55A 4G0WA 2PD6A 4B7XA 1N8KA 1C2YA 4KUEA 1AJEA 2BFBB 2GN6A 3PXAA 2WTBA 1QS0B 1Z4JA 3DXFA 3W6PA 2HREA 2NSDA 2C8KA 3M34A 3OSZA 4C1NA 2J5XA 2QUHA 3BH6A 4ER3A 1I0IA 1QIGA 1TUBB 5DGDA 1IXZA 1RQXA 5G53C 5IYZA 1T9GR 1Y6JA 4CMIA 1BE8A 3IIJA 2ARKA 3NWJA 5CHEA 4JX9A 4XSGA 5F1YA 3I3OA 4BLUA 4XVUA 5CYGA 3MGAA 2VHWA 4ZJYA 4OY3A 1Q12A 2FDXA 2OGTA 3LUAA 1ZA2A 4PO3X 1MAVA 1Q11A 1OBCA 1XIVA 4I6EA 3OPNA 2WWGA 4P7FA 1X1CA 4K5QA 5EL0A 4ZYXA 3T95A 5IKOA 1T4CA 2IPXA 4BLOA 3AGQA 3A3YA 3KJZA 4DQ0A 1DIHA 4YMUA 2HTFA 1B3RA 9ABPA 5DHSA 3BMQA 2KLBA 4YV7A 4CGZA 1H1LA 3W5VA 2BRUA 2EDAA 4GPIB 5FTJA 2BI4A 4OJNA 2WD7B 3F4BA 3NH9A 1K4KA 1HETA 1LY1A 3FUXA 4OFBA 3SQNA 4WKBA 5KHOC 1GM5A 1Z35A 1N6RA 4YJ2F 5H7XA 1SVLA 2DUWA 4S05A 1NFQA 4QVIA 1E5XA 3NHLA 4WL0A 1AGXA 2GZMA 3NAZA 1ULBA 4P7GA 1VPEA 1Q19A 3AQ4A 3EYAA 2FUKA 1Z0SA 4YAEA 5BWOA 3HCFA 3DTYA 3OLWA 2FLKA 1EFRD 3BIWA 1F8UA 1V8ZA 2YFKA 4B3DA 1PZHA 5J4VA 4TLEA 3IQHX 4MGHA 3IMKA 4HI0E 5E1MA 2G1PA 1FYVA 2QNIA 5DI9A 3TX2A 1YRLA 4B7CA 2VWPA 1M6WA 3LK6A 3INGA 4HGQA 1D6JA 1U9CA 3OJCA 4JEIA 3S2GA 1A8IA 3T1HB 1ODCA 2PJZA 2I6QA 2JCXA 3N3AC 3A2LA 4Y2PA 2I6SA 4GI1A 4QTXA 1CTQA 3O3OB 4IQGA 2PGIA 3GARA 3H9BA 1WXHA 3U49A 3AKZA 2J9YB 1JBKA 5EQTA 3ZYCA 3OQOA 3FLBA 3HFJA 4YR7A 4XX0A 5A7GA 1YA8A 3IUEA 5AJTA 1JRLA 2O8VA 4EPYA 4ZRNA 3OQPA 1GZSA 3IE1A 1E1CA 4KNWA 3ZVNA 3O0TA 3G7NA 4ZQBA 5FI5A 3CWQA 3SN6A 1XDBA 1VL6A 2Z57A 3WLJA 4GWLA 4EUKA 2X4GA 1EFKA 1DS6A 1PFKA 1A1SA 1MHTA 1IN5A 4TGLA 2G4CA 2VDRB 3BHJA 2R5WA 2WHQA 3HMQA 3WRYC 1VJGA 2YS6A 2IX3A 3VBCA 5BYJA 1J49A 1A69A 1FUYB 4KN9S 4UM8B 4ZVKA 1UKVY 5IDWA 4LN1A 2FMFA 4IFBA 4OMFG 2CHFA 1H9BA 5IT4A 2P41A 3QPUA 5AUPB 1UAAA 3IT3A 2ZYWX 4I14A 4FNGA 4MGZR 4UNSA 3VH4A 1MX3A 1Q0TA 3B2EA 2DCUA 1DOHA 2ZIUB 4X7BA 4QJ5A 3V6MA 2FWRA 5FUXA 3EVGA 1YRYE 1JIXA 3GZNA 2RHTA 3JR7A 2EGUA 3ORFA 1GLNA 4ID3A 4KAAA 4Z0TA 1FA9A 4RPKA 2ZJ4A 2OO7A 3AY3A 4MQMA 4E4YA 5JI3E 2WYOA 3VH1A 4KO1S 4CLRA 5FPYA 2NXNA 2Q0XA 5CXSA 5EN4A 3KETA 2CFIA 1K8XB 1KP9A 1Q14A 3QI2A 2VS1A 4UKDA 3BWMA 1Z5NA 2G9RA 3VPCA 1DQZA 1QDUA 2QQ0A 4KWHA 3PPXA 4QUEA 2VPTA 4U7GA 5E7JA 3U2QA 3DOFA 2B5WA 1FTWA 1XQ6A 2IOYA 4Q1FA 3PB3A 4U7FA 1JF8A 4AMZA 2VT3A 1F0YA 4FR5A 1AKMA 3LY9A 4MDHA 5JANA 1R3DA 3UWOA 4HFNA 4ZTUB 2BKVA 3E8MA 1HX7A 3GT0A 2O1XA 3QVTA 1RADA 4ZICA 1T0HB 3DMHA 1OKKA 1Z47A 4A03A 3L8FA 1KO5A 3OO0A 5ANRB 5JRDS 1JWLA 3TSAA 1QHHA 1I3MA 3L7NA 5K5EA 3GG2A 4FDMA 3HPRA 4YLGA 4M1TA 1KRHA 3V1KA 3CNBA 3R5HA 4ND6A 1T3LA 3B1VA 1VE6A 5THQA 3M6UA 3TSOA 1JU4A 4J90A 4R2LA 4KWCA 3GMSA 3K73O 5DXFA 1J70A 1XRNA 2X5OA 4BKMA 4DLXA 5CVVA 4J0KA 4LC1A 1I1QB 3PL5A 4LMAA 3UW3A 4D5GA 4XD7D 3CCFA 3W2GA 4EG5A 2DJ5A 1FZQA 4RSMA 4F6RB 3ETJA 2WQ7A 3W06A 1F2DA 4KBFA 1N2JA 1H2YA 4QLAA 3CVUA 4RABA 1SELA 1L7DA 1YMQA 5LR6A 2FG7C 3RK1A 5FO1A 4POAA 3D3NA 1TFRA 2Z6VA 3QQ5A 2EFYA 4QDJA 1VJ1A 3ZBPA 1ZINA 1QF7A 2ZOSA 1E6MA 1ZN9A 2ERYA 5F33A 8ABPA 3LKVA 3VPAA 3OTOB 4EGAA 4IZOA 2O9JA 4POOA 1T1IA 2DCMA 1BWRA 2ZRCA 4V2UA 2X40A 4R8KA 1Y5LA 2HJVA 3IPYA 1I8TA 3LW8A 5DBFA 4D0RA 4DM3A 5H02A 1QVRA 2GF9A 2RGEA 3ZWXA 5BY2A 4WNYA 2QQ5A 5CB0A 1U28A 4YRLA 5FUWA 3SX4A 1JQ5A 3U60B 1DARA 1FF9A 4HQRA 4RBNA 4MARA 5IBQA 4DCCA 4BYGA 2W2TA 5BSKA 5IN5A 2I22A 2H8GA 3GGJA 2GAIA 1WKVA 2BIFA 1BE1A 1KXJA 1H5NA 4UU7A 4BX0A 2VSXA 3AEUA 3ID6C 4GFDA 4LJRA 4LYJA 1ODTC 3R9KA 4MIYA 3V1LA 2H1LA 3UHOA 1CDOA 3IBGA 4PONA 4GGPA 4II2A 4DDUA 3OZSA 3RU3A 4JOBA 3DE6X 1W581 1GILA 1SEPA 3C85A 1BJRE 1V96A 2NPFA 2Z6UA 1W8DA 4HBZA 4LDNA 1E1MA 5IN4A 3I9OA 4WK0B 5TV2A 1W49A 5EOVA 3TW0A 3RWMB 4C1BA 3PYXA 2GPWA 1FU4A 5IG2A 4OTZA 2PH5A 2ODEA 2WVGA 1LI4A 1T8PA 3EZ7A 4WN9B 4DWOA 3UWSA 4LBWA 1VMAA 5HUHA 2E9SA 2IBSA 2AR0A 4F3TA 1V9SA 4X90A 4AXXA 1E7QA 1ZG3A 5ADHA 5K9ZA 2FGJA 4Z3OA 3LQQA 1I3CA 4O5OA 2WKPA 1OB5A 4OB6A 1JA0A 3THSA 4OHCA 4AMBA 1E59A 2AZ4A 5AM2A 3DBHA 1WCYA 4GPTA 3CS3A 3EQ9A 2QL5A 1PNTA 5K4HA 3K94A 3U4HA 1VI5A 3EIEA 1D7OA 4KXNA 4MMXB 5DCWA 1S2OA 1RT9A 5ALLA 1XA4A 2ZE8A 3MAGA 1U5BA 1T1EA 3H6GA 1N0WA 5EWMB 3BGVA 2O7SA 1SBNE 3A06A 3C0KA 4RZQA 1NW8A 2H4FA 3NU1A 2W58A 3KQUA 1KDRA 3HGMA 5BRAA 4G5QA 3HYRA 2FWMX 1GXSA 4UXIA 2Z2JA 4HDMA 4EG7A 1KVQA 4S35A 3AV0B 4YJFB 2VYQA 5FA8A 2JEOA 1N5MA 3P2IA 1JH8A 3FTCA 2KLHA 5JD6A 2QR3A 1BEUB 4KNYA 1CK4A 3DT6A 2V0CA 3C7AA 4UDNA 3IQIX 1PKEA 1U3DA 2OCDA 2SECE 1NW7A 1BOOA 4Y2TA 5AXCA 4NV3A 4EUFA 1PG5A 1M0TA 3DZGA 4TUYA 4V03A 2PT6A 1XEXB 2RH8A 2DOKA 1EXMA 3DOJA 3WO1A 4ED9A 1X7XA 1AB6A 3QVVA 5FL7A 3IL2A 1CLUA 2F55A 2XUDA 1FX0A 2DKFA 2PRYA 4Y7DA 5D3ZA 4FONA 1E1NA 2AD1A 4K9RA 4MQFA 4ZEXA 2JK0A 5SZHB 4EHIA 4BFWA 5I4BA 3ZBUA 1JAZA 3QWIA 3VR0A 2EC5A 4HWOA 1MVOA 1RMQA 4F38A 1FLAA 3WYEA 3NV9A 2ADFA 2R6ZA 4H7FA 2GO1A 4YTEA 4XEHA 4R5MA 1KE1A 3ESDA 3GLKA 3PSHA 3UAXA 4QM6A 5DHTA 3TB6A 2Q8PA 4DQXA 4Z3KA 1OBOA 2CL6X 1Y82A 2FQWA 2X2PA 1KKMA 3T54A 2V7PA 2FWAA 3K35A 1GGJA 4G1MB 1PG0A 5J2UF 3QKSB 4D9NA 3DEFA 3IQWA 1ZJYA 1EM8A 2VP3A 3L4KA 2B3TA 3I72A 4MW1A 2AF4C 2WNSA 4GH5A 3ED1A 4RJKA 5DGCA 2C0QA 1X1RA 3Q5DA 3RKRA 2C2HA 2VTVA 1JSZA 4CODB 2H3EA 2NP7A 4TVOA 2QMOA 4CV0A 2IXGA 4BATA 1OJLA 3ZTWA 3OWHA 3DQPA 5FPSA 1NN5A 3MPOA 2I2CA 5IJWA 3BE4A 4AU1A 2PL5A 4OMCA 2BVNA 4JDUA 1I2ZA 1Z07A 1HA3A 2D1YA 2DPYA 3IPRA 2M6LA 3CLSD 3O38A 3REQB 2VFAA 2C5FA 3DLTA 1UK9A 4ESEA 5LZ9A 3U5ZB 4S1NA 3KLPX 4WVLA 3EWAA 4PNHA 3V9AA 5K03A 2GJ9A 4KN8A 3HKDA 1GVHA 1Z12A 3R5FA 3WLMA 5BT8A 1GDTA 3DWIA 4IOJA 3JQ8B 2AEEA 4LV6A 1E5TA 1IBKB 1S3FA 3DBRB 4MNTA 4RV9A 1YE5A 4FDVA 3EG9B 2IPMA 4LI0A 1BE6A 1BMFA 2AQHA 4RNCA 3ZW8A 2XB4A 2JC3A 3GRFA 3NKVA 3OUUA 1VCNA 3BCSA 2VH5R 1FTYA 5K05A 1AQYA 3A6DA 2RGXA 1QGZA 3PXXA 4N5HX 3S2IA 1A71A 1SVOA 4R7TA 2D5CA 1C0EA 1SQSA 2FGKA 3AB8A 3JZDA 5CT6A 5BXYA 1ZL0A 4UU8A 4K40A 4F8EA 5DW3A 3OQIA 1T5TA 4PR3A 4WDRA 2Z6QA 2PWAA 3DOOA 4GR5A 2V3VA 3N8KA 3TLEA 3ZWCA 4FWTA 4E5NA 3KSDO 2FVYA 1HYEA 1CUJA 4DA6A 3E3LA 1MJFA 3CPSA 4EYGA 5BOVA 2XOXA 3L02A 4IMRA 1OY1A 5KWJA 3N6XA 1QGED 3V4LA 4X66B 4FCCA 1N5JA 4GOKA 4A6DA 3OZWA 3ZY5A 4JI2B 1VP3A 3CF4A 4HY3A 4S12A 2OZLA 3L8YA 4UMFA 5IXSA 1JKFA 1Q21A 4MRAA 1YWGO 1A9PA 1IVNA 4ZIRA 2EZTA 1SJ9A 4P33A 2ZYGA 3KPUA 3PUVA 4MR9B 3HDVA 1X7YB 1XJ5A 5LQCA 1DIGA 3ULKA 3WMWA 1PFWA 2Q7OE 2A67A 2HZ7A 1GQFA 1KI6B 1PGQA 3L7DA 4RLFA 3CRVA 3QI7A 3QLJA 3QMPA 5T4BA 4HLCA 2W22A 4RKEA 1DAHA 1Y8QA 3DV0A 3ZDBA 1ODSA 5CGZA 3O83A 3BM5A 5DNDA 3JQRA 3OETA 3FYUB 3WZLA 3J7TA 5M34A 1Z8DA 2G1KA 4WWHA 4D99A 3CEPB 3JQ9A 1ZICA 2V8OA 4HNRA 2Z04A 5LQSA 3TXXA 3QEKA 4IFTA 1C7JA 3NXSA 1E1DA 1Y3IA 2BJHA 3GOQA 5K2MA 3V00A 3L7YA 5HP4A 5F76A 2O2DA 4MW5A 3TLJA 2VNAA 3W79A 4EY8A 2PX3A 3GP5A 2XQGA 2O52A 4ZU3A 1QO9A 1ORHA 1NTOA 1GCUA 3LUBA 3JWJA 1PV4A 4YJGB 3HJUA 2GBGA 1QH0A 2K2WA 1KS9A 3DJYA 3Q9UA 2AN3A 3DVSX 1XBTA 3BTUA 5CVEA 2WD9A 4ISBA 2DH5A 2Y92A 5HFNA 4A82A 3UCEA 4E07A 4YRIA 3U19A 4FC7A 4FUTA 2ZSHA 3AY6A 3PDHA 5BYAA 1Y1TA 5K20A 2MMCA 2P9HA 3FVQA 1EK6A 3RQIA 3TWOA 2V3CC 1TB4A 2X4IA 2Q5OA 1ZGCA 3CT4A 4WZBB 1H2HA 3SZUA 2X6TA 4BFVA 1UBHS 1RR6A 2G0TA 3KK0A 3NOXA 1G9SA 3RUAA 2XCSB 4OGGA 4HO1X 2CVPA 4OO3A 4ZT5A 4CQNA 4AP9A 4F93B 3WS7A 2NG1A 2PBLA 2QW0X 3B5JA 1AY0A 5JEDA 4HNTA 2VUTA 1PJ8A 1O0BA 4EJMA 2FWJA 1BXZA 3DHWC 1J0AA 3KVYA 3OE7D 3P2YA 2AC2A 1RM5A 3HB1A 2AWOA 5ECYA 2CNBA 4O1HA 5EKDA 3WNZA 1TQ2A 1HTWA 2J3LA 3B6IA 1HSOA 2ZSBA 3ETEA 3GMDA 4IGAA 4JN6B 4RY2A 1Z4NA 2NSJA 2KYRA 2YICA 4AZVA 8ATCA 2X8JB 5I8PA 2WJYA 4JLOA 3KQNA 5HTOA 1QRSA 3H05A 4UE2A 2JGLA 1RXYA 1FLNA 2A9QA 3LP5A 5ECGC 5KC9A 2QN9A 3ZWYA 2UUAB 5DFAA 1DKLA 4RKFA 2FJUA 3M2TA 1USVA 3FM9A 2BTEA 3QVKA 4AUEA 4JBHA 3LFUA 2ZU0C 4RWEA 3T35A 5KOJB 5LM3A 1M8KA 4TTQA 3PR1A 1H0KA 5CAEA 2P6MA 4H7DA 3OM9A 1ZH2A 2YJGA 3MQ4A 2HCJB 2BGIA 2FPWA 2IVZA 4G0QA 4LDQA 4WJKB 3U4QA 1NONA 3NNNA 1UPTA 4CM9D 2BR5A 3Q8KA 4I9UA 1ZESA 1U3UA 3ZE0B 1ZAYA 4DNXA 1J56A 2OHOA 4DM7A 1DWUA 2IL1A 4JHLA 5FOQA 4N48A 2YFHA 1I7NA 3ODPA 4BGDA 1HQCA 1KI3A 1NRWA 3O4VA 3PHIA 4P2GA 3B6JA 3IDZA 3LMKA 5EIHA 1TM2A 4ND2A 2K7ZA 1FRNA 1VGQA 1H93A 4PZPA 1E2GA 3GT7A 3PJFA 4OAQA 1O6FA 1VJ0A 2ZRHA 1H22A 2PCJA 4ISCA 4PZUA 5EI5A 3BH0A 3TRJA 1TZ2A 1OI2A 2ID7A 2PA0A 1GQOA 3OFSA 2CLMB 1N2CA 4M76B 3HJFA 2YXPX 3ZE9A 2I03A 2Q5IA 1R8JA 1XU7A 2QVGA 4MR8B 5COBA 3CWZA 3VVMA 3WFIA 1NPTO 4KIJA 2GZRA 3BSFA 5BVGA 4O1IA 3RS7A 5BR7A 4CBVA 2AOTB 1G8YA 1MR3F 4MI1A 1N8SA 4YDSA 5KYVA 4HMOA 3ZW7A 3I2IA 3C8MA 4JB2A 1EUZA 5IHXA 2BFCA 4LXHA 1Z0ZA 3L7LA 2BKXA 2HD4A 3QPCA 4K6CA 4QDUA 5H3LA 5J4YA 3IBSA 2MSCB 3ABRB 3ND9A 1E32A 4N49A 2IU0A 2EARA 1OXMA 4NARA 4N5DA 1UODA 3O75A 3SFZA 2UVQA 2ZREA 4RQAA 3WLHA 2HV9A 2GA8A 3GV0A 3V32A 2ZVPX 3KTAA 5J2TB 3KU4A 4MQLA 4TLBA 4KR7A 5EXPA 1IAQA 4UUBA 1IM5A 1NN0A 4N0QA 3C3WA 3IBTA 3B9PA 2ZRAA 2CL7X 4U7HA 1ZGGA 4WXHA 5ALWA 3OPVA 4CMCA 5EJ9A 3FMIA 5IJ9A 2ZAIA 1QHSA 1K68A 1G21A 3D2BA 1EWVA 4C03A 3G17A 1LF5A 3VA7A 3ZHTA 3NRCA 2DT5A 5MF6A 4YMLA 3SSAA 4UE6A 4YGYA 2BWJA 2TMKA 3QVMA 1KRXA 1E62A 3VH2A 3VI3B 4I1YA 2PS1A 4DEVA 1JIQA 4YUAA 2XLCA 1VHDA 1EEHA 4M8LA 5E3JA 2V45A 3CF4G 1VKOA 1GQSA 2SKDA 3BCUA 5DGIA 2OP0A 1FYXA 5JWOA 3ANNA 1M2WA 2FW8A 4RCZA 4D4MA 5DKFA 2B8JA 2WQZA 1RLMA 4UNNA 5AVYA 4K6OA 4IGEA 5TQ2B 2Y66A 6REQB 1KPHA 4ARIA 1GNQA 2AHRA 1M3SA 2FP4A 3PWKA 1T24A 3DL0A 1EHCA 3VKHA 1Z6PA 2X13A 2VDUE 3P9NA 1NLUA 2CXRA 4DNOA 4M1WA 3GJRA 5BQ3A 4GMXA 4I5IA 1IB0A 4HXGA 4TMTA 4TWRA 2O2HA 1BA3A 3K0EA 4OSPA 3FPHA 5BSHA 4IICA 2VAMA 3DDWA 3ZXYA 2SCUB 4G89A 1SC6A 1U8UA 3RF6A 3UM9A 1YI0A 2X9QA 5AJWA 4F91B 1U9ZA 4PYNA 3FD8A 3Q15C 3GRRA 5D7NA 4H3HB 2POCA 1KWGA 1IQPA 1LS6A 3KUXA 5LYJF 1T6YA 1MEOA 1TM4E 2JB9A 4LXGA 1DG3A 1WEHA 4D3YA 3F67A 3GEDA 4JLUA 3MJFA 3W5CA 3E05A 3BFKA 1K0FA 3M4YA 1C7RA 1JXMA 4AG6A 4KV7A 1AK2A 4FFMA 1E2EA 2CBGA 3Q9LA 4NULA 4PY2A 3HSKA 1SXJD 2CMHA 2JFYA 3QKUA 1CF9A 3OIGA 4KQ2A 4RPJA 4FPXA 4WASA 5JW6A 3TOZA 2FG5A 1F1JA 2C58A 3TLBA 2ID8A 1DZIA 1MKYA 3RFFA 2NUBA 3SR4A 4Z1MD 2CF6A 1TEVA 3OHSX 4JJ8A 1Y3BE 3IQEA 1DT3A 3QVLA 2ZSFA 3T41A 1LRLA 4XCQA 3KT3A 2J9ZB 3IJEB 4B3TB 2AH5A 3FI9A 2N0SA 4LQLA 4PZ0A 5I4IA 4FFVA 1BFDA 1L7PA 1N2IA 4MYHA 1X6VA 3UC5A 2CJWA 2FSPA 1UMKA 3EDMA 4TMWA 4OATA 3VJLA 3KSBC 1YB7A 3S8MA 1OI7A 5TNXA 4B2IA 4W8HA 1PGJA 3AHJA 3ENVA 3C16C 4CN8A 2UXDB 1DKQA 3II6X 3VDRA 2J07A 4BX8A 4PTZA 2JLZA 4M38A 5HNKA 3N2LA 3FAKA 3U62A 1SUWA 2C78A 4I1OA 3UK0A 1W88B 2Q1XA 3WADA 4TN5A 4PHHA 4RKYA 4EJSB 4TS3A 2WVAA 2B9VA 3X3HA 2CY0A 2QY6A 4KEAA 1ES9A 3DE1X 1ECLA 1P5RA 2E89A 4I1PA 1F8XA 1RHKA 4RIIA 2BTQA 3T12A 2CE2X 2W2KB 1KJ8A 3I3SR 5LBTA 2NSHA 1JR3D 3MWEB 4MV7A 4U2EA 4KN6A 4R2HA 3SDBA 1ZCZA 2V9CA 2ZRJA 4RAQA 4YRFA 6ADHA 2O19A 3B9BA 3IIMA 1V5WA 2IP1A 3L01A 1E18A 2DFTA 3LK7A 4IDCA 4MPRA 3SQLA 3VTAA 4A5OA 1KJYA 2IZ6A 4PNPA 2R9VA 1M5RA 1GADO 5P21A 2C0CA 1AIPA 3OPXA 4F3KA 4V0QA 3PSAA 5EHIA 5DRYA 1OAKA 5KREA 2YBEA 5LC1A 4UEJA 1ABEA 2O0LA 1Q17A 4PAMA 2C54A 1GKLA 3QFHA 1LPBB 2Q62A 2VOJA 3A1UA 1N3YA 3QTBA 4OHBA 5EP3A 1KSFX 4L15A 4M7OA 4TQAA 1WCIB 1N0HA 2BOVA 1HE5A 1YUBA 3R5TA 3VJMA 3IERA 3RT9A 2GRUA 2OTCA 4PX2A 2DH6A 3EXHC 4CKEB 2QD1A 5ERGB 3COJA 2PR2A 2GN2A 2B8WA 2WMOB 2CGEA 4WZ6A 4O4LF 5B1SA 1C0LA 1YQGA 2QRUA 2YHAA 4L76A 4I50B 1CP3A 4V0ME 4F45A 5ES4B 2VP4A 4NL4H 3FPLA 3N5KA 5H80A 2WJWA 2X7HA 4EO7A 1JDTA 1QUFA 4KO3S 2IEZA 3C1AA 3QVGA 3ACDA 3A6ZA 1E3WA 4AM8A 5EESA 5K0ZA 4KMMA 2J0VA 1KBOA 1TA9A 2NTYC 3G79A 3EE6A 4LYEA 1GUYA 4UTOA 3TKAA 3ASZA 3U7RA 2IH5A 3EPJA 3O4HA 3IUMA 1T5IA 3KAPA 1A5ZA 3K6KA 2VZLA 2FW0A 2JJ8A 1ZWKA 1SOAA 1NJFA 3AERB 5HQ3B 1VKNA 1VFPA 3R0ZA 3ZV3A 3D0QA 4RTOA 2JD0A 5LVAA 3EIFA 4Z3DA 2WLTA 3HUTA 4OJQA 3LCVB 1NULA 2PSHA 1UXHA 4HN2A 3N2NA 4L4RA 1QLHA 3ASVA 1PS9A 1NBOA 4MWCA 5IYZF 1I94B 2WE8A 1EUDB 1LPPA 4YJ2B 4RFSB 5JXGA 4HCJA 4IJ5A 1C7IA 3RYTC 3TIIA 4JT8A 5ERYA 1TD9A 3LZDA 4TWIA 3T06B 4CM4A 1T5SA 2P9YA 2OBFA 2O5EA 2BGLA 3F9RA 1BS1A 4DWJA 1KWKA 4LDRA 2JI6A 2RMKA 1N34B 1SNYA 1RU3A 5A7HA 1W59A 2FRVA 2R8XA 3UHAA 1UMCB 3DFZA 4LOJA 4PPYA 1HMYA 1EB8A 4ME6A 1ZU5A 1L6IA 4NK5A 3ZDFA 4A26A 3UT5B 1DJQA 4MR7B 3HFGA 3I6YA 4B1FA 2R6FA 4P3NA 2HJ9A 2CCGA 1QRDA 3ESZA 4YAJA 3ER6A 4ABTA 1BSVA 5DDIP 5IUKC 1XZPA 5FL3A 3HKEA 3CSSA 1HURA 4CV3A 4OBBA 1H6BA 1XLVA 2ATIA 4MW6A 4FZVA 1GQ2A 2J3IA 2X5JO 2VF5X 2XE8A 4W1PA 2FPSA 3HB9A 3ONFA 3R77A 3M70A 1Y9AA 4QC2A 2H4YA 1JIVA 4BNJA 4EW3A 2C7PA 1HLPA 1NPYA 3ZZ0A 3H5VA 2NUTB 2ADOA 3I0MA 4P92A 1FIUA 2PUHA 4OQPA 3NVDA 3HDYA 4P4GA 2J6IA 2XKKA 2ZM6B 4MCIA 3VOAA 5KINB 1A5AB 2OLJA 1C30A 2ONZA 3TECE 3KBBA 1VG1A 1LQUA 4MW7A 1B2LA 3R3UA 1PNOA 1JMKC 2ZUFA 2E5LB 5TEVA 3URMA 1ESDA 3VO2A 4AO7A 1R9JA 1SUFA 1TJPB 2ZRDA 5FP0A 2CXXA 3R1IA 2RI1A 1M2NA 4PIVA 5F2OA 1L5NA 3PIDA 1G8JA 1AUOA 1RMTA 1T1RA 3NUGA 4HAOA 1U9JA 4IDPA 2CJPA 1JYFA 4KQ1A 5EERA 1V5EA 3RROA 4EUSA 4XJXA 5KKAA 1F4VA 1ZS9A 2I8AA 2EVWX 3D0KA 3OZRA 3SZOA 1C50A 2O6HA 3C8DA 3HXOA 1JMYA 3C7KA 2A5DA 3G5MA 1PWHA 8ADHA 3FZYA 4LVNA 2GFIA 3L7MA 2VXCA 4EG6A 5FUMA 1EX9A 5D6NA 1N2SA 4ZZIA 2HGZA 3O94A 2QP4A 4PSCA 4FYXA 2WIJA 1T9GS 3MLAA 3NNSA 4PC2A 1YR8A 1GGFA 2W42A 3BWCA 2GM4A 1L7MA 2J3MA 1DIBA 2HF2A 1FSGA 4XJVA 3HB7A 3B5EA 1QIEA 4MV0A 3PQ3A 2B5VA 1ZX1A 3BIOA 2AFHA 3JQ6A 4URFA 2QT9A 1H6DA 1L4LA 4LNUA 2CC2A 5KYGA 1J00A 4PPQA 3I2HA 4KAJA 1EH5A 1QXSA 1TQ6A 2YUTA 7AT1A 3WL8A 4RULA 2Y6VA 2ZULA 4C29A 5GV8A 4TSFA 4IAOA 1WDKA 1PYOA 4FDUA 1W52X 3S5JA 2YNMD 5GQSA 2OKGA 4TTVA 3DPIA 3VYUB 3ADOA 5GINE 2VK4A 2JLWA 4FSXA 2Q5EA 2OEPA 2Q49A 1ZP6A 2XNDD 4GYKA 1XYYA 4XA8A 3ZX5A 1P6XA 1UXOA 3CUTA 5GM2A 2PUCA 1A7UA 1UUFA 1TJ5A 1IG0A 1DVRA 2GT1A 1E1LA 2CLDX 2HY7A 2PZMA 3CR8A 5CFRA 1CETA 3LSYA 2QROA 3OQBA 5EVJA 1AKNA 2NADA 1FB5A 2NZJA 1YE3A 4GMFA 5DASA 4B5KA 3KWMA 4WCVA 4D41A 5AK5A 2QORA 1XLTA 1JHPA 4FU0A 1E8MA 2HA6A 4LRWA 3BRWD 4ZV7A 1R8YA 1POXA 4GOLD 3F3KA 5SY4A 4JA0A 4D4GA 1XPJA 1ZM3A 1QYWA 5D87A 5KTSA 1YS7A 4JLVA 1ZNZA 1FBNA 2NU7B 3I52A 5KVSA 2HLDA 4MDFA 1K5PA 2EV9A 2GD0A 5BSVA 2Q5HA 3DTVB 2HRZA 4L6AA 4G41A 1KXZA 1SXIA 2B82A 2AYXA 3WL6A 1AV6A 1P7PA 3QZUA 1NIPA 2HWKA 1QH8A 4KCGA 4P4SB 4QEZA 4ENRA 4PRKA 2PA3A 1XZNA 3A6LA 4M9CA 3V33A 3ICPA 1G8GA 3F5QA 4GP6A 1U8TA 4RHEA 3FR8A 4BV9A 4F5DA 1DUVG 3ZXSA 5KQMA 5JJIA 1Z0KA 2OFXA 3B1KA 5HE8A 1SUIA 3PFKA 2LD4A 4MUEA 3S4YA 2NU9A 3K8YA 3DM5A 3GFOA 1CRZA 3KQPA 3VMMA 1NU6A 1ELOA 2PRIA 3BF8A 1UDRA 2JAOA 4Z49A 3GB9A 3CUYA 2BFFA 3CLHA 5LJLA 4ZXPA 1W0JD 4RORA 3T7TA 4QZVA 1XZIA 5LNK6 1B41A 2PUAA 3BVPA 1F17A 3CO5A 4WNCA 4X1OA 3M49A 4YC7A 1OZHA 2V6MA 3PC8A 3OZUA 1IPHA 5H3CA 5C5IA 4GC5A 4RDIA 5GIOE 3EEYA 1L6RA 2G63A 1GYRA 1ZMBA 3RYFB 3W3AH 5NLLA 5REQA 1J2RA 3RARA 3K0CC 3KCNA 3LW7A 4YY3B 1NQVA 3AVQA 3ORSA 2VDVE 2O5CA 4MLCA 1MF7A 4BRZA 4DKXA 1E3DA 2VPIA 1NXQA 5U4QA 5DM2A 3H8JA 2FG6C 5TF4A 2WWYA 4IMIB 3WDKA 5CG1A 3B1FA 5F35A 5IS2A 2F90A 5CVCA 3CZAA 4EDFA 1JEOA 3GZTB 2PIDA 4Y2QA 1SKMA 1II8A 1U81A 4AW9A 3IXQA 4BZZA 4HDRA 3OESA 4BNYA 3QF4B 4Z4HA 2CV2A 5GJBA 1U1GA 3P9ZA 3R0VA 3TVTA 2CNLA 2AQIA 1C7FA 1DJMA 4A8JC 1T2DA 2R4UA 1NMQA 1P72A 1UXJA 1P80A 3QU2A 4LNAA 4MW4A 3LT2A 4S2EA 3GP3A 4GWKA 1YAJA 4DLPA 5EE3A 2HIAA 2CBZA 2VPYA 3ND5A 4WZBE 3DYIA 4CT4B 2FZLA 1MA0A 2IVFA 4D02A 1XAHA 4H7IA 1Q6ZA 2E21A 5FNZA 4BJ5A 1ZOOA 2GM5A 3GFQA 2DFVA 1RKBA 4BLTA 1NTRA 2QVLA 1ORRA 4W6QA 5CXQA 2Z2ZA 2Y71A 2PFKA 1GPH1 1E2QA 1VHQA 2WMNB 5LSAA 2QLTA 5U1PA 1N1EA 1UL1X 3C14C 1ADGA 4CN9A 2AZTA 3PNOA 2BONA 2IUTA 3P0EA 3QM1A 4M0CA 3RASA 4D3ZA 1OGJA 4U3JB 4OQNA 2ZQYA 3OLCX 5LP1A 3TNLA 1N1GA 1A9SA 1KDYA 3UT0A 1XQYA 1JIIA 3OM1A 5LD2B 4OYHA 4RQTA 1F14A 1LS1A 1YAHA 2PL3A 3H19A 4I1IA 4JJZA 4ZVQA 3WLRA 2QVYX 3ZGYA 3K6RA 2D74A 4C30A 1EGMB 2C1EA 3ZJTA 2HHCA 3F73A 1LFDB 2MSWA 3H18A 5FOUA 2JGMA 4DIOA 2F9LA 1MABA 4R0VA 4ENTA 5IAOA 3U1VA 3H83A 1OFUX 2W0MA 4KQKA 4AULA 4RD1A 3BIFA 3NG1A 2BD0A 3PGVA 3CT6A 1SCKA 3CUVA 4G97A 1O77A 5AM1A 4KE9A 1EK1A 4WY8A 3BHIA 4LY6A 1EP1B 1AXRA 2Z2XA 3K8ZA 2GCOA 2TS1A 3P0HA 3OQ6A 3FF1A 4G1UC 2G9ZA 2VJYA 3QGMA 4OAOA 3H1PA 3BUSA 1I2DA 2UYOA 3MSXA 3OEYA 3NM6B 2PMDA 2R8BA 4KRYA 1K8QA 4TTPA 2JJ1A 4CQLA 3TMYA 2WMDA 4DJJA 1A4XA 1E2HA 1XFAA 2F3UA 4NE9A 4TUYF 2HK6A 3VZDA 3DR3A 4AO8A 2JIZD 2W37A 2R8ZA 2GCIA 4KODA 2PLAA 3FNIA 1EE2A 2NZUG 1E2BA 2R7KA 4DV2B 2BCJQ 2OA0A 2BUBA 2YWJA 2HQSA 3ZI0A 4CWAA 4D46A 1HL3A 2O54A 1QVVA 4OQEA 4Q66C 4C7XA 2BW0A 4QOJA 1HGXA 3CZ5A 3OA0A 4RHUA 3SM9A 5CCDA 4OA5A 3PD1A 5TSDA 3DD1A 3B82A 3LVRE 3MAJA 4GPZA 1BMDA 4L75A 4H60A 4R9RA 4UE3S 4UNQA 1VBNA 4YYEA 3E5HA 3QFTA 2C77A 1XTPA 4X8OA 5GY7A 4D3DA 2GEBA 1UMDA 3BSWA 1JSRA 3RKSA 5JCXA 1JB1A 1B23P 4KRFA 4CJXA 1XQ9A 3WO0A 3SKVA 5FTMA 1J1UA 1NYQA 1ZNWA 4PWZA 3N0TA 1B4DA 4NU0A 4RYDA 1WDTA 3QNUA 5BSTA 3WYCA 2MSKA 4ALLA 2C7BA 2ECPA 3HTXA 2CKMA 4BNDB 5BW4A 3AFIA 3PE3A 1DIRA 3RHZA 3ZU2A 5C35A 2QPTA 4C0SA 3ELBA 1L4GA 3AF0A 3LX8A 4RMIA 1M6VA 3UMGA 2AW3A 3MIZA 3K70B 4MKFA 1ZPDA 2GA9A 5IDYA 4DQVA 3V9PA 5I51A 3UMMA 1D6MA 3JQAB 5BQXA 1YH3A 1DJPA 3BXEA 4N5LA 1CKEA 1TKBA 2GS9A 3EK2A 1RI5A 3FLAA 3K2QA 3DZKA 2KMLA 3EHDA 2B5OA 5FH9A 4ZZ0A 2XKJE 3JARA 4LNHA 1NHGA 2X1VA 1DU4A 2ZBDA 3FXAA 4M98A 2O2CA 1RQRA 5KAMA 2C95A 4O4JA 2JAWA 3AR9A 3L6BA 1DAIA 4J2OA 3TL2A 1S01A 3DAPA 3FDZA 3PEUA 5AMXA 3RC2A 4DV3B 3LLCA 3GJYA 2F6RA 2JLRA 1OH7A 4GE0A 3JQ7B 1QK4A 3PZRA 1UZMA 3GFFA 3RLIA 5HZMA 3VZBA 4LYHA 1YJQA 3EMBA 1MQ8B 2OYRA 3NAQA 2HLHA 1RIIA 3QELB 1ZK3A 2YYSA 1ZM4A 1QIIA 3Q2KA 3UYLA 4K2HA 1JTEA 1SCUB 1TL7C 1NVAA 3AVOA 1P1HA 2BMWA 2BR3A 5SV2A 3TIGA 3WBFA 3VAZA 2GPAA 1NYTA 3HI6A 1UK8A 2PY6A 1Y4DE 3EAGA 3KQWA 3NTUA 2J48A 4ICIA 5FAKA 4NOLA 4RGYA 4BNMA 5LWQA 4HX5A 4XGRA 3PHLA 1J0BA 2IW3A 1U7WA 1R0SA 5DTQA 2QTCA 1JDNA 1YU6A 3I73A 2HIGA 2QXUA 5JCOC 1QR6A 2AMYA 3GNQA 3UJCA 4B4VA 3PPWA 1A27A 3E2PA 4GUAA 4NYJR 4YRDA 5EJ2A 4US1R 1DRVA 5L95A 4F3CA 3BXOA 1R16A 2XWJI 2VPXA 2NLOA 2IOFK 2GPYA 1F0NA 3FAZA 1B14A 1ACMA 3PNMA 2HYIC 4OFWA 3I5UA 4LTNA 4AMVA 2ZIEA 1R0WA 1K3FA 1SK8A 3EGEA 2ETXA 2LDBA 4M0EA 3UYKA 4LJ8A 4HKTA 2MINB 2JCGA 3OTGA 1RAIA 2VJMB 1VC2A 2ONKA 5E1BA 5EKSA 3THYB 1Q0ZA 4EFNA 1DC4A 1PZFA 2Y0DA 1HE1C 3BXFA 5KJEA 5CDFE 1AKTA 3NM4A 4MUIA 1Q0SA 2QL6A 3OICA 5KYYA 1PLLA 3GFTA 3FR7A 4IS3A 2XSZD 4NV0A 2IODA 3ZI4A 3RM3A 5FWNA 2YR0A 4TKLA 1Y3CE 2VLIA 3I53A 2AXQA 1BYIA 3DMYA 4L9SA 1ZBQA 5CJPA 2WB2A 2M98A 3N70A 2IU3A 4RDHA 4ZCTA 3DOIA 5FEUA 1O5TA 2D8MA 3U3OA 2CL5A 4M6WA 4UCXA 3U3XA 3WNVA 3W5AA 4FYVA 1FFGA 1XDGA 2G17A 2VYNA 4FNAA 1FFDA 3AV3A 1K6JA 1M0SA 4I8IA 4OQYA 5IVKA 1PSWA 1D9ZA 1Z28A 2KE5A 3FF4A 3K1TA 1CUSA 2XZLA 2C8LA 3DMFA 3LQKA 2QD4A 3MIIA 4NOMA 5K3FB 5I01A 3JSAA 3FYHA 3AM1A 1CCWA 4YPFA 2JLAA 2OENG 2QAGB 5F9MA 5FYDA 3KJFA 2FPKA 1SA0A 1ZWLA 2G9QA 1NATA 4XB1A 1UOOA 2BM9A 3ROXA 1HEUA 4RMJA 3A2KA 3HB5X 2DMRA 1F12A 1U0OC 4FBGA 2HA0A 5JFTA 2F3PA 2RCYA 4FFBA 1K4MA 5CDGA 3T9EA 1U1EA 1IU9A 4R8LA 2AMLA 1NAIA 2Y1WA 2Y3IA 1CIJA 3C5VA 3EUWA 1IY2A 1TQDA 1FRZA 3EY9A 3HJGA 4TPKA 4QSHA 4DUZB 3EPLA 3MT9A 3U44B 3FMGA 3GFVA 1NBIA 4LG1A 4LCEA 1DO2A 1XEWX 2GTIA 1M1ZA 2C04A 3CYFA 5KU1A 3ZLVA 4YCBA 4Q01A 3D8NA 2GWHA 1BU8A 1YC5A 1FNC