4JLKA

Human dck c4s-s74e mutant in complex with udp and the f2.2.1 inhibitor (2-[({2-[3-(2-fluoroethoxy)-4-methoxyphenyl]-5-methyl-1,3-thiazol-4-yl}methyl)sulfanyl]pyrimidine-4,6-diamine)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
241
structure length
229
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNLTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
publication title Development of new deoxycytidine kinase inhibitors and noninvasive in vivo evaluation using positron emission tomography.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 91
structure length 229
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jlkA00
2V3CC 4D4MA 4X8MA 2IUTA 2J7PD 5FUYA 3RRMA 5D3MA 3SEAA 3RWOA 5G3YA 3KUCA 4IOJA 1YZNA 4URWR 3FOZA 5FUWA 1Z28A 4PSAA 1SHKA 4DSOA 1JPJA 2IYXA 4AK9A 1UDWA 3MWYW 3REFA 2ZSEA 1KDTA 1OH8A 2R62A 3U7GA 4G5OA 4GOJA 2NO6A 3QXJA 2MMCA 4FMCF 2X2EA 5ELXA 3K0AA 1W7AA 1D2EA 1X8KA 5AJZA 2PZFA 2FFQA 1NN1A 3EZ6A 2HCBA 4AKGA 2P2LA 4RZUA 5BN3A 4OQNA 4E5UA 2ZSBA 1FOEB 2HF9A 4LJYA 4OI4A 3THOA 1XNJA 3KXLA 3N2IA 4PPFA 2GA8A 3LD9A 2FFHA 1A7JA 5B2ZA 3W6NA 4MKGA 1WP9A 3QVUA 4HAVA 3KB1A 5FBWB 4OQXA 2O8CB 4TMVA 2J0QA 2ZJ8A 4KFUA 5H8WA 4AKHA 2B7BA 5JSZA 3RHFA 3Q7QA 3UMFA 1N0WA 3RANA 5IRCD 3MAAC 2Q9AA 4IKEA 1G5RA 2VP2A 4C4PA 4BEBA 1N5LA 3IO5A 2Q21A 2YKGA 1DO2A 5KDOA 4NYIR 2Z4SA 3D7MA 1PZNA 4IOKA 2QL6A 5CDFA 2OAQ1 3VHLB 2J46A 1IN6A 3O8DA 5FPTA 4NCNA 1PLLA 2QENA 1I4TD 1SVOA 3L0SA 3GLIA 5TXGA 2BC9A 1L2TA 3CNNA 5CIWA 5DH9A 1GNQA 3EARA 4RFVA 5UKDA 2IWHA 5LPNA 2L0XA 2REOA 2CE2X 3EXAA 4HEJA 3CO5A 4BRWA 5JMTA 2W58A 2QRZA 3C4JA 1VG9B 3H86A 4PR0A 4Q47A 2FSGA 1P62B 2ZAMA 3GLHB 3A8TA 3BB4A 1W0KD 2CL6X 2EVWX 3UWOA 4F93B 2JLYA 4HZUB 1ZNYA 2VH5R 1W46A 3LLMA 5GJVC 3KTAA 1R10A 3PUYA 5LBIA 3B7GA 1UKZA 3ZJYA 1G8HA 4IFEA 5FUVA 2H92A 1II9A 4JLJA 4D6PA 3QEJA 5DHFA 1CEEA 4QOSA 2A9KA 4CYMA 2ZJBA 2OBMA 1E1RD 1YE8A 2PZEA 5JWOA 1DAEA 4Q7KA 1D9ZA 1U2RA 1LS1A 2KSQA 2R6AA 2ZRIA 3TK1A 1TQ6A 3K0CC 4YDHB 2WTUA 1D8TA 5FUXA 2ZITA 3O8BA 1KNXA 2A5YB 5EP4A 1E2NA 3OF5A 3O8RA 1WE2A 2VHQA 4ZCMA 1T3SA 2J3EA 1FNMA 3EA5A 2PEYA 2WJGA 2V4ZA 2C9YA 3LNCA 2HF8A 2ZR0A 4KO8A 3T1VA 2OCBA 4JKIA 5M04A 3HPQA 4QGGA 4OHWA 2DWQA 4V02A 3HDTA 1XD9A 2VSXA 1J90A 1ZBDA 4ON9A 4B71A 4ITRC 2QAGA 3B1VA 1ZD9A 4LJ5A 4TTPA 3A36A 5BN5A 2BM1A 1XTRA 2ZYWX 2RGEA 4MRVA 4C30A 4C0KA 1P73A 2JASA 3K53A 4GZLA 3VNUA 1N6RA 2IYZA 1SULA 3FHCB 4CEJB 5J4KA 1TX4B 1GNPA 2GJ9A 4Q1CA 4DSTA 1IAQA 5FOSA 2C03A 3FB4A 3GFOA 3I1FA 3RVBA 1WA5A 1GL9B 2JJ1A 3QPWA 4M9QA 5J4LA 5JWRA 1Q1ZA 1G291 4QGFA 4YMWA 3NKVA 3GFTA 2PBRA 1OIWA 4GT1A 2CMKA 4GP7A 4W5WA 5FOTA 4C7OB 5J4YA 4F38A 1FX0A 3P32A 4BPBA 1XJQA 4NPHA 2BOVA 4RY2A 4C0JA 5K8LA 2GAOA 3CNLA 2IF2A 2ZRDA 3GJXC 3Q5EA 3O8CA 2QY9A 3ASYA 1PUJA 5JECA 3MMPA 1US8A 1QBKC 2GWHA 1S3SA 4JZKA 1OB5A 2VP5A 1CTQA 3VR1A 3E2IA 3U60B 2GAAA 1GIAA 3D8BA 1G5PA 1Q22A 4ZIRB 1L7VC 3CRQA 4AG6A 3ECCA 3BAFA 4UNSA 3WYGA 4B34A 2QMHA 1M6NA 3CX6A 3VR3A 1RE0A 3NTUA 1DAIA 2NTYC 5IDVA 3NG1A 3REGA 1E6CA 4NMMA 3ZH9B 4BFSA 1HQYE 5HE9A 3AGQA 4IVPA 1C1YA 1XU4A 2PL3A 2WAXA 1OIXA 4LYJA 4EPRA 5K8TA 5KSZA 1R5OA 4A2QA 1AM4D 1Z06A 3A4MA 1C9KA 2J0UB 3NDBB 3EZ7A 1MR3F 1KZGB 1E9SA 4IVRA 4RCZA 2DYKA 4B3FX 4A0RA 3AKYA 1CBUA 1N5JA 1M1YE 1HYQA 1P9RA 3IQXA 4DRZA 3FKQA 1KO8A 1VTKA 2GCNA 2GK6A 2QTHA 1TQDA 3F0TA 1OYYA 2ZSAA 3EAQA 1NL3A 3F5FA 1N2CE 4KSCA 2QQEA 2R2AA 1FMJA 3OZXA 4EFNA 3MSXA 1KSJA 5DHAA 2ZRAA 1ZU4A 2O8CA 3IKJA 5L3VA 1KYIA 2UVQA 5JRJA 4R71A 2BBSA 1WMSA 1UBEA 3THWB 3NBZC 2JA1A 2WSSA 3ND8A 3IBYA 2YWFA 5CM9C 1KY2A 5DI3B 5G40A 1OFHA 4A82A 4CW7A 3WYFA 2CHQA 3LVRE 2J7KA 2ZRHA 4AD8A 4TYYA 2CL0X 2VRWA 4R9UC 2OLKA 3AF1A 4FD2A 4I1VA 2AXNA 3KKMA 1P7CA 1X1SA 2QP9X 1T3HA 4V0OA 3SJBA 4LBVA 1B23P 4RSGA 1CRQA 1E98A 1F5NA 4UQOA 2BKUA 5GADl 2C96A 1GNRA 2OBNA 3A4LA 3GEHA 4CT5A 3R9WA 4FI3C 1MRSA 2HV8A 1IHUA 5AUPB 4DLWA 3ONWA 2OFWA 2BDTA 2QN6A 2V7QA 1HA3A 1ZW6A 3AVPA 4XOIA 3C8UA 3H84A 4UXIA 4TZ6A 5K8UA 1Y3AA 3MJHA 4NBSA 3BH6A 3HU3A 5F9HA 1YVDA 4TYQA 3I5XA 1FUUA 4OK5A 4JBYA 4Q9HA 1O3YA 5DSZA 1W36C 3K70D 1U9IC 3R7WB 5CDFE 1ZNWA 1U0HC 2JJ1D 2VYFA 3AUYA 4S35A 3GLHA 5AK0A 5KNBA 3B1XA 2ZSFA 3LBHA 4ILEA 4HZUA 1GVNB 3KQLA 1U81A 3AVVA 1Q3HA 1GKIA 1LVGA 5KHOC 4A2PA 1SVLA 2PX0A 1G1MA 1IN5A 1XJ0A 3X1YA 4JVSB 2W6JA 2DFKB 1Q21A 4WBSA 1E1QA 4QBFA 3A4NA 2OCAA 4K46A 3ZVLA 4QBHA 5DN6A 1XEFA 5SZIA 1S1MA 3KJIA 3W6OA 4AURA 4E03A 3T34A 3EC1A 2CCKA 1G8YA 2MSDB 4PHFA 2NO0A 3QBTA 4XVQA 5H70A 1H8HA 3Q9LA 4LY6A 3DOEA 5JI3E 2D06A 4HB4A 4L4UA 5FTKA 3U3OA 5EZ6B 2QU8A 2EWVA 4P4UA 4EPWA 3LXRA 4R2IA 5FTMA 3KUDA 4QM7A 5GJWC 4C0QC 1K8RA 4XD7A 1E9DA 1E0SA 3CLVA 3VNVA 4NCKA 3S1AB 1WF3A 2ZM5A 4B3DA 1U0LA 2N42A 4URVR 3KZ1E 2O8FB 2GF9A 2RHMA 5IK2A 3IGFA 3AVWA 1JALA 5AUOB 1YJ5A 3BK7A 1SVSA 3TR0A 3UWKA 4TYNA 1XEWX 1XPOA 4QNMA 1OFTA 4PSVA 4CEJA 3FWYA 4CT4B 3T61A 2PCJA 4DDWA 2RGGA 1KI7A 3FMPB 3CF0A 4JIMA 3SBDA 5J5CA 5EE9A 4ZCIA 1T3LA 4C9BA 3L43A 1MRNA 4FWTA 2ZRPA 4IXNA 3GD7A 4C7OA 3IHLA 2IYRA 3C15C 3CX8A 3T06B 3KKQA 5EE1A 1N6IA 1NMXA 1QHXA 4TSFA 1G8PA 4KSBA 3KKOA 2WSSD 3P4XA 4YMUA 2ERXA 2IYTA 5TARA 2PT5A 3X1DA 2ATXA 1U94A 1VYVA 2YOHA 3QG5A 5EZ5A 4CF7A 4XWKA 3R9XA 4JJKA 4Q66C 5G3ZA 1Z29A 4X8LA 2QI9C 2C04A 1Q57A 3LO5A 3RS5A 8OHMA 1LY1A 1YRAA 2GNOA 4HLQB 3WP0A 4ZIRA 1R8SA 3B5JA 3AVQA 3IDQA 3VKWA 3BB3A 5HKKA 1W36D 1R0WA 5J47A 2I3BA 1AK2A 4D0LB 4OQFA 4HZIA 4BZXA 2IK8A 5TB5A 4GMXA 3ZS8A 2VA8A 1OH7A 1Z6TA 3PG5A 4Q19A 1KK0A 1XMIA 3R8CA 1N6KA 3AF3A 4KFSA 4HLDA 1IN4A 3K9LA 4V0NA 3CZQA 5JRZA 3FE2A 3FVQA 4XWOA 2J45A 3VR6A 1Q0UA 2BEJA 4BFVA 1W49A 4BLTA 2ZI6A 5SZKB 2IS4A 1TMKA 4LWZA 4MYUA 2YJTD 2LWIA 1KKMA 4RD4A 1KO7A 1GP2A 4POAA 1AQUA 2H5EA 1KJZA 3E1SA 4C0BA 2GCPA 2UZIR 1DG1G 4JL8A 3H0KA 5BQ5A 2W6JD 3IIMA 3M6AA 5CJPA 621PA 1ZMXA 1E1QD 4DCUA 3IEVA 5EXSA 2W6ID 5FPSA 2D7DA 5DN6D 1E0JA 1P75A 1D6JA 2EU8A 5F9FA 4II7A 3BFVA 4QGAA 1LV7A 2YWEA 3PUXA 4BECA 2CLDX 3FMOB 3THWA 1FTSA 1ZUNB 3A1VA 1H8HD 3CZPA 3NEYA 4FMDF 3TW4A 3WMEA 4Q9IA 1OF1A 4S2EA 3B60A 1NRJB 5DI3A 3IILA 4NCJA 1H8EA 2BCGY 2FF7A 1RPZA 2V6IA 2QTVB 2C78A 2VTKA 2FPLA 2G77B 1OLOA 4MGIR 4Q1AA 2RAPA 2WIAA 4D82A 3B9PA 2ZRLA 1ODFA 4WAUA 4M4SA 3GQBA 2CJWB 4XD7D 1KAGA 1SZPA 5CK4A 2ZS7A 2JLWA 4Q1FA 5L3SB 4UNPA 2IW3A 4XSHA 1OXXK 2B92A 2ZJ5A 4EFMA 1VYTA 5IK2D 1Z2AA 3T12A 1XB2A 3IO3A 3L8YA 3JZMA 2ECKA 3M1IA 4B43A 4LZZA 3G0HA 3MJRA 2IX3A 1D2NA 4Z54A 4G0NA 3R7WA 3KFXA 2PMKA 4Q5IA 2J0VA 1G6HA 4DC9A 3FMIA 3A37A 1NNEA 3THXB 1ZM9A 1FW6A 1T6NA 2OUKA 1MO6A 4PQYA 5JCZA 3PV0A 4IVQA 3OIYA 1G8FA 1FP7A 4AG5A 2JAQA 2QE7A 4Q7LA 2YOGA 4TSFD 4OHYA 2VSFA 3SJCA 3NIBA 1RFLA 2HDNB 2QAJA 4L16A 1NVWQ 4OHVA 3C14C 2Z4RA 1T0HB 1ONBA 1N6HA 4HB3A 3T1OA 1UKEA 1XZQA 1GM5A 4IRUB 3SYNA 4FN5A 1ESNA 3A1UA 2AK2A 2ZREA 3ZYCA 1T0JB 2ZUBA 2OCYC 5HKKD 2Z6VA 3LH5A 4YONB 4M21A 421PA 3B1ZA 1R0YA 2A2ZA 1VIYA 2G6BA 5C4MA 1A5TA 4C0SA 3ZZUA 4B33A 4U00A 4QXAA 1DOAA 3S1AA 4YDSA 3H2YA 1FL9A 1CJTC 1RW4A 3ZQ6A 2RGXA 2FE4A 3PEWA 2O8FA 2OHFA 1KI3A 4N3NA 2YC2C 3CF2A 3AB3A 5E7MA 1EESA 4GDFA 4R7ZA 4B48A 4LK2A 2D4HA 1KJYA 1W2GA 4B35A 5CK5A 3IIKA 4XIGS 3THYA 2J0SA 1UPTA 1FMLA 3DDCA 4LGMA 3L2OB 1D9XA 4V0KA 1NMYA 4RZ3A 5TMPA 2P65A 3W8NA 3KL4A 4DCVA 1F60A 3BRWD 3DM5A 2VP0A 3K9HA 4U5XA 2K5UA 4RKFA 3EIQA 4HDQB 3CPEA 4QFMA 2XJ4A 4R98A 4Q9LA 1E9RA 4PC1A 4WW0A 3WNDA 4LUCA 2E87A 3NBFA 3B2EA 4LHXA 3PENA 4NCHA 1JQLB 1H8ED 3SC3A 1IJFA 3SNHA 1R7RA 3IPYA 1UEJA 3QE0A 3TSZA 1E69A 4UKDA 3B1WA 4CRWB 1IXRC 4ASUD 4DT1B 2Q3MA 3IHWA 4Q01A 4IDHA 4Z8YA 3I8SA 3AKDA 4Q4HB 3AF4A 5FBLB 4LPKA 1Z0IA 2B7CA 4I4LA 1MV5A 2B8WA 1W1WA 3F3YA 1VCMA 3OEEA 4MH0R 3VMFA 4LDJA 5K8IA 2REXB 3ADCA 5KNDA 2GZAA 4JVNA 3JVUA 2NQ2C 3K9GA 1XFAA 2GBLA 4TQ9A 4PO8A 1X1RA 3AKCA 1SVWA 1X8LA 1VG8A 1SVIA 5BYJA 3KJHA 4AY2A 2O52A 5A4JA 4KXFB 2R65A 3K8YA 4M9XA 1KI2A 4MYTA 4BGDA 3BIFA 4YQFA 2ZE7A 3TSOA 4QM6A 3CONA 4N0EA 5EP2A 4LBWA 3EC2A 2GJSA 1ZNXA 4GP6A 5AUQA 3BC1A 2QE7D 2GZHA 1KK2A 1VCNA 4Z8XA 1E2JA 1E9FA 1KMHA 4M1TA 4A8JC 4DVGA 5BXQC 1S9DA 4TLAA 5F2EA 2IYWA 2YWGA 1VHTA 4JLAA 2GXAA 1G5TA 3HR8A 1S1CA 5HPYB 2OFOA 4I1SA 1ZUIA 2HT6A 5SZJA 1R6BX 1PJRA 3KXIA 2PLRA 2GJKA 2ZI3A 4AI6A 2GHIA 4PC6A 4Q1EA 1E2MA 4TMKA 1KMQA 3B6EA 4C0LA 1GL7A 4Q4AB 3ADDA 3R9IA 2A78A 2IXFA 4PAQA 3EWSA 2CJWA 4M1KA 5EE0A 4TQAA 1G64A 1XXHE 3SS8A 1F3OA 2ZYVX 3GFPA 4OJKA 1T91A 5L3SA 2AKAB 2WKPA 2QBYB 1Z6AA 4US1R 2OG2A 2RGNC 4BFUA 1SKYE 4B75A 4TLCA 3TVTA 5BWMA 1P2SA 4V0LA 1F2TA 4JL6A 4CIDA 2OFXA 3BFXA 3I5YA 4EAQA 1JBKA 3MD0A 1XEXB 2AD5A 4A1FA 1E9CA 1Z83A 3CPHA 1EX7A 3TJZA 4LX0A 4URZR 5JS8A 1D2MA 4L5BA 1KO4A 3OIUA 2Q6TA 1HT1E 5FPYA 3U7FB 2ZE6A 1DG3A 2GCOB 3PUWA 1VECA 1MABB 4ZDWA 4B3CA 3THXA 5CJ2A 5AJXA 2Z5FA 2WZQA 1ETUA 2NZ8A 4YLGA 3EPHA 4PZYA 2VF8A 1U8YA 4IHQA 2XB2A 3LQQA 4PC3A 3KQKA 5EP3A 4TMTA 1CXZA 3N2EA 4HDCA 2CVHA 4LJ9A 4UNRA 2ZR9A 5GVSA 1W36B 1NY6A 3VX4A 1NN3A 2H18A 3WMGA 2Z43A 1LF5A 1HE8B 2CNWA 5KDDA 3GP8A 4RD0A 2F1IA 2Q9BA 2W2VA 1EGAA 1U8ZA 4CEIB 2CE7A 4Q9KA 2JLRA 2YHSA 4C2UA 2H1LA 4IDQA 3KQHA 1LTQA 5DISB 3R20A 4JYCA 1AKEA 4OJQA 1Z22A 3RS7A 3OEED 4HB0A 2HYDA 4IEEA 1EX6A 1VKJA 1Z6GA 4XWAA 4DCSA 4TMXA 1E4VA 1KDOA 2P5SA 4BRUA 2WAYA 2ZJZA 1K5DA 2F7SA 2CXXA 1TNDA 1TU4A 3CUEF 3U7EB 3K0CA 1IXZA 4IDOA 2QTFA 2MMGA 4DUGA 4E09A 4A4DA 2YINC 1CR1A 1XEWY 5DNYB 1ZCBA 4HLUA 2F3TA 5SZHB 5JFGA 4B6EA 2XX3A 2A7QA 5KSYA 1RRCA 4NKRA 4GSYA 4BFYA 4DDUA 1N25A 2XOKA 3JVVA 1CJMA 2AD1A 1YZQA 2QMUA 1IXSB 2PT7A 4E22A 4HLUC 1QHHB 2XNSA 2O8BB 1JECA 4X8OA 1A1VA 3UIEA 2IXGA 3C41J 4PXAA 3AV0B 2WWWA 5FTLA 2VHUA 1S96A 1YZUA 4KV9A 3TLXA 1SXJC 2O5VA 3Q85A 4EPTA 3UANA 3I32A 3TRFA 3GLFE 2P6UA 3CX7A 1U98A 2ZPTX 1IN8A 1JXMA 4JSYA 2BMEA 2VP9A 1HE1C 2IWRA 1H65A 3Q5DA 5AUNB 4FMBB 2ODBA 3AF2A 1U0JA 4HI0E 1AA9A 4IEIA 4OBEA 5AJVB 4KYIB 4DT1A 3SHWA 4D81A 4TMWA 4Q4HA 5FBVB 3DHWC 3DKPA 4G5SA 2GVZC 2QPAA 2C5LA 3FDIA 2ZJOA 1ZIPA 1I4LD 3WP1B 2WOOA 3PR1A 1GTVA 4O2RA 4YXWA 4JT2A 2FU5C 2DFTA 2J1LA 1MO5A 4PANA 4EJSC 4DLZA 4B3BA 5JCPA 3SJZA 5JS7A 3OFNA 1DADA 3LDAA 5L3QB 1ANKA 2GJ8A 2HJVA 2IYVA 2JLZA 5CM8B 3EPKA 3X1XA 4DDVA 5BN4A 1X86B 4OK3A 2GKSA 2IHYA 4IXMA 1XMSA 3P27A 5JJLA 4KBGA 1NN5A 3V4FA 2J87A 1I2DA 3AP2A 1A4RA 1NLYA 3QJYA 4ESVA 1Z63A 1SKQA 2PMDA 4PHHA 2XZOA 1VCIA 2Y8EA 2GTPA 1KSHA 1UFQA 2X77A 3FYHA 3DZ8A 4TWZA 5HZKA 1EWQA 1JAIA 4RFSB 4A6XA 1OXUA 1W44A 2ZI9A 1GFIA 2ZS9A 2H16A 1CJUC 2G1KA 2CNWD 1G3MA 2QA5A 2QQ0A 2PJRA 4JBWA 2A5JA 3GLGE 3EIHA 4KCGA 4CVNA 2FEMA 3RABA 5LDDC 1ZINA 2XXAA 2W2XA 2IEYA 5FH9A 2FFBA 3DZDA 4B2IA 4AKEA 3CWZA 4LI0A 2GEDA 2ZJYA 4BQSA 1XZPA 3P26A 3SFZA 1E99A 2WWIA 2ONJA 4Q4AA 2YVUA 2ZYTX 4Q1BA 2BVNA 1MKYA 3BERA 2CDNA 4LHYA 4Q03A 2WV9A 2E1RA 2FV8A 3LA6A 1DO0A 2QPTA 1OH6A 3HP1A 3TH5A 2EFCB 3T1TA 3BORA 2OCPA 2QBYA 1T8TA 1OIVA 4DUGD 2WOJA 3QKRB 5AR1A 1KAOA 4DIDA 3I4LA 1X8JA 2V1UA 5JHHB 1YRBA 1QHYA 1XEXA 4RD2A 1JJ7A 2XOKD 2J9RA 4V0ME 1XXHB 2DBYA 3TQCA 4ACAA 4LV8B 1HT2E 2W0SA 1DEKA 4JKYA 1KJWA 3AVOA 4JLBA 4MUAA 4BE7B 4EIWA 1N5KA 1QDEA 1TTTA 3ZVRA 2RKOA 2GCOA 4QJ4A 1MABA 1SKYB 2QNRA 3Q8XB 2VSOA 1KZ7B 3IPXA 3FFBA 3T5GA 5KYKA 3W34A 1IBRA 2VHJA 5E3HA 3CWQA 4NU0A 3N5CA 1BKDR 1N6OA 2IT1A 1KTVA 4V03A 4UJ5A 5KSOA 4D4KA 1XP8A 3FHTA 2GXQA 4AKIA 1YZKA 5BW8A 1PV4A 1G6OA 3UG6A 3SHFA 3U61B 1U9IA 4O2LA 5E4FA 3UMRA 4E07A 1PLJA 3K09C 4AYXA 2C98A 4MKHA 5FI1B 3AH8A 1E9BA 4BUJA 4W5JA 4GRAA 1F2UB 4GOKA 4CEIA 2FG5A 2FSFA 3OE7A 2GZDA 3FTQA 1NLFA 2RGDA 4LHVA 4QJ5A 4F92B 1ZP6A 1RKBA 4YXWD 1JB1A 2NO9A 1FZQA 2BBWA 2IEZA 1GITA 5DYIA 3SQXA 3BOSA 3RRYA 1JJVA 5IF9A 4FMCB 3OFND 3FFAA 4ARZB 4KYUA 5JEEA 2IXEA 2B6HA 2WMOB 1RYFA 2D7CA 4BLQA 5BYKA 1EFHA 1EFCA 1L4UA 4OHZA 4WZ6A 4FCTA 1N0UA 2XTZA 3IQWA 4TYPA 2F55A 2EFEB 2W6IA 1E2GA 4F4IA 4LSGA 1TEVA 1QHGA 4Q1DA 4FCVA 5TV2A 5FPKA 4KVGA 3NBXX 1AIPA 4PHTA 4BLRA 4JBXA 4YC7A 4H1UA 4QGHA 1A2BA 3FMFA 4M9ZA 5G53C 2QMOA 1QHHA 3FHOA 3UXMA 3CR7A 2O8BA 5C1BA 2OILA 4LV5B 3BD9A 3IEUA 4D80A 1U99A 4MRPA 3ADBA 1OYWA 3NVAA 4ZI3A 2O0HA 4IW3B 3K9NA 3QKSB 3B1YA 1XCPA 2OV2A 5DIFA 1XD2B 2G83A 4KHZA 3L8ZA 1SXJE 2J59A 4RVCA 4XTCS 4RZ2A 3ZZTA 1S3GA 1SGWA 1CKEA 2O8EB 2IBMA 5L3RA 3ZDQA 4CEHB 1GOTA 4QC2A 4JL5A 2B8TA 2GXSA 2IHBA 2ORWA 2QP4A 5CB6A 3LW8A 3TGPA 4D4JA 1XMJA 2QGZA 4NTZA 3GLFB 2A30A 2O0JA 2WJJA 3NEJA 3NHBA 3THYB 1NVUQ 1R0ZA 1UDXA 3QY0A 4B3XA 2FZLA 2LCFA 2JLVA 2OESA 2QORA 2YWHA 3CBQA 2AWNA 3U2QA 1JQJC 1CS4C 1XTJA 1GWNA 3NH6A 1NKTA 4KLNA 4F7WA 1TQ2A 5L3QA 2IC5A 2QT0A 4KFTA 2ANCA 2DY1A 3OEHA 3RAPR 1VMAA 2KBEA 2F3RA 4A0GA 5AWFC 1F6BA 3AP1A 4IOMA 4WXPA 3EZFA 2MSEB 2GXUA 2CL7X 4PPNA 1Z2CA 1XF9A 2DFLA 4J0QA 1M8PA 1XBTA 3DMNA 4MGKR 2BBTA 3SYKA 3TAUA 4P4TA 4JLVA 1NY5A 2XITA 2F1JA 3B85A 4DLXA 1J8YF 3RSOA 1YQTA 2ZEJA 4RFSA 4QHSA 3VKGA 2GEUA 2I1VB 3OESA 3WRYC 4EQ6A 3QKTA 3EZ2A 4OL0A 4LYHA 2JJ2D 2JLSA 3AP3A 2ZVPX 4MKIA 1NVVQ 3WHLA 4EPYA 1ZM7A 1KDRA 3OE7D 4NH0A 5EE5B 1P9WA 2BWJA 2ZU6A 3NC0C 5C46F 1MO3A 1G18A 3ICEA 3PXGA 2ZE5A 1WXQA 4DLTA 3BE4A 4A8JB 1C4OA 2GEVA 2QSZA 4HAXA 4JLOA 4ZPXA 4DCNA 1NMZA 2GETA 1Z6YA 3RS3A 4PZZA 3GLGB 4HYYA 1EFTA 4YMVA 4IDNA 1JR6A 1N6LA 4NZYA 3P1JA 4D25A 1NBMA 2VHCA 4CGZA 1TEXA 2WICA 1WBBA 4JT4A 1KMHB 3QKRA 4NHOA 3VR5A 2VQSA 5ANRB 3KB2A 4Q7JB 4PZLA 1XWIA 1BYUA 3E5HA 4M22A 3MWJA 4KU4A 3LX5A 4GFDA 5HCNA 4A0FA 1LF0A 2ZIAA 1XXHA 3ZVNA 3QNUA 1HY3A 4MA4A 1OSNA 5JI2E 4KODA 4DLYA 1CP2A 4B73A 2OLJA 1WRBA 2ZVQX 3EPJA 3EIEA 4H9GA 5EP1A 3ICQB 1UBCA 4RD3A 4LJ4A 1G9XA 2PJZA 4JYBA 5LB4A 5TY0A 2WWXA 1G4UR 4LHWA 4ASUA 4DIEA 4I99A 4A2WA 3HYRA 2P6RA 2G3YA 2O0KA 1VPLA 3NDPA 4PX9A 1DAKA 3C5CA 2N46A 3RRNA 3TUJC 2EFGA 3UK6A 3UMSA 2JLQA 4Y0AA 5D3QA 2XSZA 1P2TA 2AN9A 1OFUX 1F2UA 1UBFA 1F2TB 1IY2A 1ZCAA 2ZS8A 1UKVY 3MWLA 3PIRA 4OKSA 3V4RA 1NSFA 1JAHA 4M1MA 1Z07A 3W5JA 4DZZA 3U44B 3P20A 2W2TA 3TKLA 4QL3A 2C8VA 4ZI2A 1ZM4A 2EFDB 4M1YA 2AHOA 4WXRA 1TUIA 2WIBA 5C2JB 1E2QA 3PUZA 3ZD7A 4P3YA 1VYUA 5EXTA 521PA 1S9HA 3MGCA 1E79A 1QG4A 2ASEA 2AFIE 3LRPA 2GVDC 4PFSA 1OJLA 2XB4A 1P61B 1RRPA 2H8KA 3A1TA 3WXMA 1CR4A 3RLFA 4ARZA 3BS4A 4B2PA 4D0NA 1BOFA 1KI6B 2CLSA 1E2HA 1G19A 1W5SA 1SVMA 3OEHD 4BFXA 1NF3A 2KI5A 2N1BA 3HU2A 1G16A 2JDIA 2Q9CA 3I3SR 5C18A 4PQFA 2ZR7A 4HUQB 4ZKEA 3D3QA 1GRRA 2PX3A 3L0PA 1GRQA 1SVKA 2CCJA 3LW7A 3EW9A 4X8HA 3DEFA 4QHYA 3CW2A 2CK3A 1LS6A 2HUPA 2ZU0C 2V9PA 4B2LA 1Z5ZA 4MDFA 2ZJAA 3I61A 2QM7A 3P4YA 4Q00A 1OHHA 4ZO4A 2GF0A 4EPXA 3Q7PA 5DE3A 1NSTA 3HR7A 3QKSA 4DSUA 2OT3B 1Z08A 4MQBA 4Q21A 2QP3A 1XD2A 3T5DA 2EQBA 1OXTA 2BEKA 3CB4A 3BH7A 3QXXA 4LC0A 4BZQA 3TUZC 2DFNA 1YR6A 4C0HA 1BMFA 1NI3A 2IA5A 1MT0A 3TVDA 3PEYA 3MCAA 2O8EA 1OT3A 2C99A 4CEHA 2BHRA 3QUSA 4I81A 2D74A 3SR0A 1IOZA 4PQRA 1R2QA 4PAOA 1P5ZB 1I2MA 1NBMD 1GZSA 1IY1A 1K6MA 1IQPA 3GLFA 4Q18A 4L9WA 3PFIA 1SXJB 3DVLA 3EASA 3GMTA 3EA0A 3UATA 3U3JA 1MOZA 2GRJA 4TN1A 5FR1A 2R44A 2JGNA 4AIIA 5F98A 1Z0KA 5HTKA 2ZETA 1YHNA 2OBLA 4WZAE 4BFTA 2FPMA 2Q3HA 3LV8A 4M9SA 5FOXA 1G7CA 1E94E 2HEIA 2RB4A 3LLUA 2PEZA 3G82C 1CR0A 5H1YA 1DELA 4OK6A 5L8VA 3PITA 1MH1A 2NPIA 2RGBA 2QRNA 3HWSA 5LB2A 2ORVA 5TVKA 5JBQA 4BLPA 2G88A 2W0MA 4GMDA 1KIMA 4LBYA 1G3QA 2SHKA 3TBKA 2KWIA 4EJSB 5KOYA 2A5FA 1TAGA 1QG2A 2A5DA 4C3ZA 2DWPA 5KTYA 3CIOA 1Q20A 3AVYA 4QBGB 4UJ3A 2R6FA 4RD1A 3H1TA 1DTSA 1ZYUA 2QPOA 2XSZD 3ASZA 3HU1A 1E9AA 4TLBA 1QHIA 2FPKA 1FPMA 1NIPA 2D62A 1WDTA 4DCTA 4K8OA 4KAXA 2YOFA 2ZQ5A 2V1XA 2HCJB 3F8TA 2ZRNA 2FNAA 5AJWA 2VF7A 1JNYA 2JLXA 4A8JA 5E95A 3X2SA 4ESHA 1OE0A 1E79D 1JR3A 3AM1A 3GLGA 2I4IA 3QI2A 1RC8A 1W5TA 2BV3A 3HPRA 5FL7A 5HCIA 4MUBA 3I62A 4BFZA 1Z6XA 1AZTA 2F9LA 2HXYA 2Q3FA 3SI7A 2BM0A 4HLCA 1LB1B 4M2LA 1W4RA 2JDID 4RCYA 2VLIA 3GJ6A 4KLZA 1EG7A 2WWYA 3KJEA 3ETLA 3BBPA 4G1UC 1P9NA 4HATA 3IUYA 2AR7A 1KK3A 2P5TB 3X1WA 2X2FA 1NBME 5KPDA 1KKLA 3QF4B 2CK3D 2WKQA 2E9SA 1UEIA 2AKYA 5B58C 2XXAB 4NYJQ 1X3SA 1XRJA 5GJCA 4BLSA 1NN0A 1ZD1A 5JLJA 2NG1A 1E32A 1EXMA 2QMEA 4PAMA 1OHHD 4A0HA 5JJKA 4O3MA 2IS1A 2RGNA 4NYMR 4Q4LA 1TQ4A 4RKEA 4V0MA 3SZRA 3TMKA 5DO9A 1G4AE 1CU1A 1QVAA 3K0EA 4HAUA 5EUQB 2G1JA 2F1HA 3LFUA 2ZXUA 2REBA 4QBIA 5J4VA 3L0OA 1BMFD 1XCMA 3NH9A 3MFYA 5FOVA 1TF2A 2P0EA 3LBIA 2R8RA 3UPUA 2XAUA 4FCWA 1ZNZA 3LVQE 2WSMA 3VKHA 1PUIA 3WBJA 4JLDA 1AN0A 3BGWA 1QZXA 1AS0A 1TL7C 2BJWA 3B9QA 4HAYA 3U44A 2FOLA 3W9YA 4HAWA 2X19A 1WCV1 1XCGB 3RC3A 3SU8A 4R2HA 3PUVA 2J5XA 4F91B 1P72A 3QXHA 2JLUA 1W0JA 3MG9A 4NCIA 3VQTA 4UNNA 1TF5A 3C16C 2EW1A 2G0TA 1HTWA 2IUUA 1E3MA 3NHAA 1AJEA 1E96A 1KI6A 2HJGA 5FOUA 3SDZA 1KOFA 3V00A 1P60A 4TLEA 4B32A 1S4QA 2IF0A 1IY0A 4HAZA 1Z0JA 5JWHA 3AQ4A 2RHDA 2PLFA 4NDZA 3VR2A 3X1ZA 4UXHA 3RWMB 1UM8A 4HUQA 5GJBA 1DPFA 1NG1A 1S0UA 2CVFA 2XTNA 5H68A 5EQTA 2V54A 4GPTA 4ZCLA 1G3RA 1QRAA 4TL6A 2XTMA 1NVXQ 2HT1A 5KO2A 2D2FA 4IJMA 5DLQC 3CRMA 3WYAA 121PA 2ZUDA 5HE8A 3TNFA 1NP6A 1ESMA 3PEUA 4FMDB 1M34E 4GNKA 4W9MC 3EX7C 1G3IA 2OM2A 4Q4JB 2GESA 4KFRA 2CLCX 1KO1A 4PO9A 1Z0DA 3KFVA 3RS4A 1OKKA 2ZRMA 4JLKA 4LV6A 1NG9A 3KKNA 3M0EA 5FOWA 4WZBE 1JR3D 2B21A 3QG1A 1PVOA 3RDPA 2VPPA 3SBEA 5KU1A 5FL7D 3OHMA 2O8DB 3KX2A 5KDLA 1KDPA 1SXJA 2H17A 5EXPA 2ZUCA 1DVRA 4LCBA 3PVSA 3CH5A 1E2PA 2JEOA 3GJ3A 2FFAA 3U6KA 1W4BA 2JATA 2GK7A 3ZQJA 4EPVA 1CRPA 4PC7A 1OPXA 4DSNA 4OHXA 5CLLA 2WJVA 4LJAA 3TIFA 2TMKA 1MO4A 2NOAA 4I1OA 4NP6A 2HXSA 2VL7A 4JSTA 2JCSA 2ODEA 3AF0A 3J81k 4ZV4A 4TTRA 1A82A 1HURA 1DAGA 1NVVR 1P2UA 4OYHA 1NJGA 2BIFA 1P2VA 2MSCB 2WWFA 4WA7A 2ODNA 2ZRGA 1D5CA 1XTSA 2P3SA 1HQCA 4F4JA 3GCGA 4EJSA 1EFRA 6Q21A 1OFIA 2GJAA 4DBLC 5E7IA 4DLUA 3W6PA 3U5ZB 4TZ0A 4EUNA 2OZEA 3W3AA 2P67A 2VP6A 2ZI4A 3VU9B 4LPSA 1HEIA 4MKFA 5LD2B 1OXVA 3CNOA 1W4AA 4WIAA 2OXRA 2AK3A 4G5GA 1RYHA 3CRW1 1R0XA 1GAJA 5EJEA 4P4SB 1DAFA 4W7SA 2C95A 4MITA 2XZPA 1FNNA 4MDEA 1TADA 2WPDA 3CR8A 2EWWA 1R4AA 1R5BA 3I73A 721PA 821PA 1KI4A 1W0JD 1OV4A 1V5WA 4NE2A 4EKDA 2QAGC 1G17A 4MRSA 3OAAA 4KJZA 3NBYC 2PCLA 2XGJA 5J40A 4JMPA 5IT5A 2DCUA 1VIAA 4FINA 1AKYA 1Z0FA 1M74A 3E70C 4BZPA 3AVXA 1RJ9B 4PC2A 1JXOA 3VR4A 4TYWA 2F43B 1SQ5A 2WJIA 4JLNA 1G20E 3K70C 1WQ1R 2FA9A 4EQ6B 4IDPA 4OI1A 1GRNA 4HSEA 2ZI5A 1UJ2A 4TLDA 1JR3E 4GBMA 1DAMA 2ZRFA 2YC4C 1ELOA 3GJ8A 5A0FA 4A9AA 1RIFA 1LNZA 221PA 3QF4A 1OB2A 2DHRA 2BCJQ 1GG2A 4ZDIA 3I92A 3M4YA 4BFWA 5F3WB 2NPFA 4A6PA 4DDTA 2XZLA 4B44A 2ATVA 2QGNA 3TR5A 4LOAA 4Z51A 1AGPA 5HZHA 3QKUA 4WVFA 2FX3A 2IYQA 2V8OA 3NXSA 4LHZA 3CRRA 2BKEA 1TUEA 4UXJA 1OKKD 4CZ2A 4LBZA 3NWJA 4H1VA 2FWRA 1O87A 1OXSC 5KNCA 5FBRB 1U8AA 2X8AA 4JJZA 2C77A 3TSWA 4DEXA 4DEYA 4UNQA 4KVAA 1Q44A 1SXJD 1YZLA 4W5HA 2HYIC 1XJCA 2JIZA 3DMDA 5CYOA 3G5UA 1P4SA 3BWDD 3W90A 2YYZA 2FEOA 2ZYUX 2CCGA 3W8RA 3QXCA 2ZI7A 1T5IA 4MGYR 4G5RA 3TE6A 2RH5A 4A92A 1XMVA 1G41A 5FBQB 5GVRA 3ND9A 3K09A 3QQ5A 1XPUA 4KBFA 1G7TA 1DBSA 1N6NA 1PLKA 2JJ8A 2FDCA 2G0NA 5EXXA 4LJ8A 1RZ3A 1Z47A 2ZANA 3EWAA 4G3XA 5E7JA 4US2R 1G21E 4G5QA 1Q1BA 5FTNA 4JLPA 1IN7A 3AEZA 1ZJ6A 3GEIA 4AC9A 1WB9A 3QPVA 5FPHA 1GKYA 2JJ2A 2ZJ2A 2OXCA 3KJGA 3QF7A 3GJ7A 2BMFA 4OI0A 2P6NA 5A5GA 1EFRD 1KK1A 1F48A 2IS6A 1E2EA 5EUMA 4NYMQ 3ZLJA 4U02A 1II0A 1XTIA 4XVUA 4WOPA 5IHPA 1JPNA 4M1WA 4QJ3A 2ZRCA 3GPLA 1U90A 3VHXA 4TT3A 1KSFX 1N0VC 2FSHA 2RGCA 3N70A 4JLMA 2VIIA 2ZRJA 4Q4JA 3CKLA 4RD6A 3T35A 4BWYA 3KDSE 4BASA 4QNRA 4DXAA 2A5GA 2WJYA 1T8UA 4N1AA 3FPAA 2WPDD 4L15A 4DKXA 2VHTA 4BEJA 2AFHE 3B8HA 5DGXA 4LRWA 3WY9A 2NO1A 2AWOA 4XH9B 1J7KA 2BBOA 3OAAD 1W47A 1RVDA 2IYUA 2O8DA 1EK0A 3D31A 3QEOA 4XSGA 2H7VA 5AJYA 1KNQA 1KY3A 3AGPA 4TQUS 3RNLA 3U6BA 3GLIE 1CF4A 1XPRA 2FGJA 1E2DA 1YR8A 1AS2A 1E2LA 4QG7A 3V9PA 1N5IA 4Q02A 1OH5A 1E2KA 2R6DA 4B3GA 4LC1A 5J4HA 2FJUA 2FN4A 1FFHA 4JVLA 3K0FB 3LWNA 1J70A 3U4QB 1KI9A 4HDOB 3A1WA 1Y63A 4DLVA 3CPJB 5JZVA 3ZIAA 3EG5A 4AWXA 4DWJA 3L82B 1NKSA 3TW8B 2Z83A 4NYIQ 2F9MA 2OEPA 2W00A 1ZIOA 4M1SA 3RSLA 1XTQA 1XX6A 1GUAA 3K1JA 3MWKA 4Q9JA 2EFHB 3RS2A 1QVRA 3VU9A 1QF9A 1BYIA 1L4YA 1KGDA 2OSBA 3B13B 4MGZR 1VG0B 3TUIC 2VEDA 3RRZA 4P4SA 4LYFA 5CYPA 1G3UA 1YKSA 1COWA 1Q1QA 1QHSA 1GDDA 3GJ0A 4M1OA 5FI0B 1QHNA 1JEEA 1Z3IX 4YMTA 3BJIC 1X6VA 2JIZD 4AYTA 4CDGA 2KE5A 5JEDA 2NZJA 5LD2C 5FL3A 1A2KC 2IUSA 3EPLA 1YR9A 4BLOA 1G7RA 1DS6A 1R8QA 1ZUHA 3DL0A 3WHKA 1GSIA 2GILA 3QVVA 4NYJR 2ZROA 2ZE8A 5G41A 4IOLA 3GEEA 1RJ9A 1V43A 5HR5A 1UADA 2F43A 1S2MA 2ODWA 4DJTA 2AL7A 2D3WA 1I4DD 2YZ2A 2G9NA 3ZD6A 2BJVA 1XDBA 4XVRA 1RRFA 3PCRB 1T9HA 1FP6A 5C4GB 3W3ZB 2DWOA 3Q72A 3D6TB 1J8MF 1Q1EA 1II8B 3WNCA 4G01B 2OAP1 3LAWA 4PTLA 2XNDA 4HB2A 3AUXA 3DOFA 4HUTA 3IBGA 3LBNA 5JHGB 2R6GA 2C2HA 1ZVQA 5CB8A 4MYHA 4Q7MB 3AKEA 4Z1MA 4M0LA 3KKPA 4P33A 4GZMA 4TT3D 2RCNA 2W83A 3C7KA 4M8NE 2KBFA 3U3RA 2OO7A 4U7DA 1CULC 2F1RA 2V7QD 2ERYA 2QSYA 1ZAKA 2V55B 2XJ9A 2IS2A 1W48A 2RGAA 2QEQA 1E4YA 1P6XA 2NMVA 3BXZA 1HH4A 1ZU5A 1KI1A 3KQUA 4Q48A 3I8XA 2J0UA 2H57A 2VO1A 5DYGA 1NIJA 2C9CA 3QBVA 2WJHA 1KI8A 4O0MA 4D2IA 4QHTA 3UG7A 4RJLA 4OQLA 3ZS9A 2EYQA 1ZM3A 1N6PA 3AVTA 1P3JA 1IM2A 1UAAA 3B82A 3BB1A 3HJNA 1FQJA 4GOXA 1M7BA 3ZZ0A 2DPXA 2GDJA 3RYTC 5D3MB 3PQCA 4KITB 1ZM2A 3T1QA 4RZXA 3SFVA 2ZTSA 1IONA 3FGNA 3HYTA 4US0R 1M7GA 4B6FA 1N3BA 4OQMA 5KUTA 5KPJA 3ZIAD 2DR3A 3U3MA 4DB2A 2DB3A 3QENA 5B64A 2NO7A 2J41A 1T4GA 4QKQA 2XEXA 2ANBA 4ZKDA 3LQRA 4AYWA 1GL6A 1YU9A 1KSGA 2AX4A 1J2JA 1HV8A 1L8QA 4L8GA 4XJXA 3CRVA 3K0AB 3U3KA 2WMNB 3K0SA 4DLRA 3FKSA 1OW3B 1Z8FA 1DAHA 4ACBA 4B74A 3KQNA 1NJFA 2ONKA 1Z0AA 3GJ4A 3OIVA 4D26A 2FZ4A 1NLZA 1R5NA 2C9OA 4OI2A 4C2TA 1VG1A 5B30A 4ERNA 2QT1A 2ZAOA 3TAHA 4K81B 2WWHA 2IL1A 1COWD 1G8GA 1VHLA 3BH0A 3DKVA 4LYAA 1K5GA 4MRRA 3VTKA 4EFLA 2FH5B 2WBLC 4PPGA 4IFBA 1AGRA 1XD8A 1Q12A 3SN6A 3OIWA 2YV5A 4D4LA 4GI7A 1EWRA 1W4CA 3QXSA 3B78A 5JSZB 3MRSA 2NGRA 5KSPA 2AXPA 3DO6A 3CF6R 1LFDB 1FTNA 1S8FA 3WNBA 2NIPA 1YZGA 4L9SA 4YMSA 1UKYA 4EDHA 1BIFA 1T5LA 4B76A 1E0KA 2HLDA 4MRNA 4N0DA 2UZ3A 1TF7A 2WM9B 2LKCA 3H4MA 4JVMA 3L0IB 4TL8A 4C0AC 5JJIA 2QUZA 1B0UA 2VBCA 4NONA 4PHGA 3TQFA 3WBKA 3WMFA 2KJQA 3DPUA 2J7PA 3K0FA 3SJAA 3U4QA 3AVUA 3MUFA 3GLIB 2XNDD 2A3RA 3GLHE 4FWIB 2Z0MA 4TL9A 3MLEA 3CM0A 1BH2A 1TPZA 2V6JA 4GL2A 4NL4H 3Q3JB 3JZAA 4ZDKA 5FFMA 2FMXA 4Z1MD 3WRXC 3VX3A 2QM8A 3VAAA 1XTKA 3SE0A 3EZ9A 1AZSC 1CJKC 2BMDA 1CLUA 4PSKA 1KHTA 1ZC3A 1VDZA 1FQKA 2QG6A 1CR2A 5B57C 1M2OB 2ZRBA 1DARA 3KTAB 4ZDJA 4JS0A 3O47A 2QZ4A 4A15A 1ZRHA 2KB0A 3RC8A 3W5IA 1VCOA 3QOFA 2F6RA 4ABYA 1Q3TA 2WWGA 1WBDA 1E0AA 2ORIA 3ZVMA 1GKUB 4XTRA 2I1QA 3ADKA 1W2HA 2X1VA 4TL7A 1IJEA 2R6CA 4MYCA 2EYUA 2FSIA 3RS0A 3R8FA 3SOPA 1JI0A 1M7HA 2BMJA 2ZSDA 2CEAA 2D2EA 2ZRKA 1E2IA 1YR7A 2WHXA 1LW7A 1JEDA 4PPQA 1UBGA 2Q0HA 2UKDA 3CH4B 5CLQA 5FR2A 1YZTA 2VP4A 4TMZA 4O25A 2LKDA 3NC1C 1DE0A 3LXXA 1E9EA 4D0GA 2RMKA 3A58B 3DM9B 3VFDA 1TU3A 1II8A 1BS1A 3UKDA 2QAGB 1AQYA 3LX8A 4FW9A 1E2FA 1EFUA 4URUR 3I72A 5CIQA 5EE3A 4DB4A 3FKSD 2IYLD 1ZC4A 2IYSA 3SQWA 2CHGA 1GILA 4Y0VA 3A1SA 2QROA 5P21A 3ZGXA 4P31A 4LJ6A 3U7HB 1CJVC 2FGKA 3T15A 3QIAA 4DLSA 3QSYA 3IIJA 3PEVA 3K70B 3QPUA 5FTJA 1G7SA 3BFKA 4QRHA 1KO5A 4B47A 1W0KA 4FXPA 4P32A 4M53A 4DHEA 1CIPA 4F4CA 1ZD8A 1SHZA 1AS3A 1FX0B 2CBZA 4P0TA 4A36A 3KXKA 4LJ7A 2YNMA 3LY5A 4FIDA 4URYR 2WKRA 2WVJA 4KI0A 3PJRA 1UF9A 2PH1A 1BO6A 3C5HA 5CITA 1J99A 1RRGA 5TDHA 4URXR 1E1RA 2GBLC 1US8B 2HLDD 2R9VA 2OE2A 3SYLA 3GJ5A 1FUKA 2CHVA 4I1UA 2IYYA 5DI9A 3A6PC 4TTQA 1HUQA 4PO1A 2PZGA
chains in the Genus database with same CATH superfamily
4HYEA 1M1YA 1Z13A 4X8MA 3RRMA 3EJ6A 3E8XA 2JFOA 1BN7A 2GPWA 2X8BA 4MVYA 5FUYA 3RWOA 3WLAA 2EKPA 4M99A 3TDNA 3VISA 1YZNA 4LVOA 5EJ5A 2ODPA 3H5OA 4F7DA 5FUWA 1JEYB 1T8YA 4J6EA 3RHZA 3CUKA 1JPJA 4KQEA 1JEJA 3IT0A 1UDWA 3MWYW 4KPEC 3EHEA 3JYNA 4KBYA 3AERA 1IBSA 2CMHA 4RVSA 5EHNA 5ALPA 2Q4EA 1ZUWA 3GP5A 3P0FA 4FGUA 4L22A 4L1KA 5KTSA 4GOJA 3WLEA 4IHKA 2NO6A 5ESWA 1SUDA 4FMCF 3OT1B 4BVBA 2C4UA 4MV8A 3AL2A 5ELXA 4YAIA 4CM7A 2PZFA 1DBPA 3SNKA 3TLGB 1BWPA 1EXVA 5L9AA 1NATA 3UN1A 1Z68A 4AKGA 3RAJA 2P2LA 2MINB 4Q7EA 3BIXA 1EXWA 1FUYB 1T13A 4OI4A 4P98A 3AY3A 4BS9A 3N2IA 4WBNF 3JD1A 3IDZA 3FZEA 1PTJC 2X8WA 3LD9A 2FFHA 4PE5B 4JK3A 4PPFA 1HE2A 4ZODA 1K08A 4FMPA 1NVGA 4MKGA 5ITWA 4DPMA 1PS0A 3KB1A 3DMTC 3B53X 4Z7JA 5B4UA 1OBHA 1NA5A 4MHSA 4H7PA 2DBVO 5EIHA 3ENVA 1LLUA 2QZSA 5H8WA 4LGYA 1CNFA 1EP3B 1NX9A 4RV5A 4XWYA 5JSZA 5K0JA 2F17A 3RHFA 3Q7QA 2UUCB 1UFOA 5HDQA 1V1RA 2QV0A 3MAAC 4IKEA 2VP2A 3IRUA 1J2YA 4BEBA 1PK8A 1N5LA 2PA0A 1GZ3A 4Y6QA 4AO8A 3B6KA 4DE5A 4I6JA 5KWJA 3ZJUA 3E8SA 1QK3A 4Z2YA 5M3BA 2YKGA 1N34B 2PSHA 1SBYA 3UVEA 2VUSA 5C5CA 1QQ7A 4C5BA 3NTVA 4IOKA 4MQUA 3W5BA 2IBSA 4L75A 3RC9A 3TLJA 4V2UA 1Y5MA 3ESBA 1HL3A 4NE9A 3VHLB 2GUWA 8ABPA 2BEVB 2XLCA 3L0SA 3U7QB 3QYFA 1U1GA 3PI7A 2PBFA 1DTEA 5C37A 2XZDA 5DH9A 4XJVA 2EBWA 1GNQA 3A06A 2I6FA 2XE6A 3GMIA 1ABBA 4QASA 3DL4A 2FN3A 1IK4A 2G71A 3GJTA 1ORIA 3COJA 2ETXA 1DKOA 3RB8A 3WGHA 3WX0A 5LQSA 1ZMOA 3CO5A 1DX9A 3RSQA 5KHLB 3DZKA 4RC9A 3SYRA 3O9ZA 4Q47A 2FSGA 3P9PA 3GNQA 4W82A 3RRJA 5KQMA 2W2KA 1RJEA 1ZH2A 3A8TA 1W0KD 1QFZA 3FWZA 3G5TA 3GLHB 1JEQA 1YKGA 3LUFA 3QMMA 2J07A 5CURA 4ZVMA 4A27A 4F93B 1R12A 3GT3A 5GJVC 1R10A 3B7GA 1UKZA 2X0FA 1RP7A 5K0FA 2QZJA 5JZMA 2PGLA 2MIIA 3QPBA 3OE5A 4GLOA 3BBLA 1ZK0A 2I0FA 5DHFA 5GPBA 4MW9A 5A71A 1NVKA 1ULZA 2FZCA 2J4CA 1YGPA 1R4ZA 4QOSA 3W0LB 5DLPA 4BNJA 3UT6A 5CXUA 2PZEA 2X6RA 2VYVA 3VVCA 5TF0A 4BRZA 3PHBE 3K0CC 3ZY2A 2FN8A 1X80A 4C6TB 2DAPA 3C1AA 1KYQA 3CEPB 4Y30A 2WTUA 4RVUA 5JYCA 2RHOA 2IDMA 1KYTA 2LUOA 3O8BA 3FIJA 2C84A 4J0JA 1NVTA 4YJ3F 1OD6A 2Q5QA 2O07A 2VHQA 3NIGB 2J3IA 1Y82A 3WC4A 4ZCMA 4PG4A 1T3SA 2FWAA 1VRWA 2C54A 2RSLA 2Q99A 4MZDA 2HREA 3QVGB 2PEYA 2WJGA 4UHCA 5J63A 1OWPA 3PPYA 3LNCA 2X0DA 1EGMB 1U7WA 2HF8A 2XI4A 4FSDA 3RO7A 3CLSC 3K5PA 3L8HA 3T1VA 1KJNA 2QM0A 3KJQA 4G0ZA 4K9LA 4OHWA 5FWXA 1ZR2A 1XD9A 3H4TA 4K9NA 1WU7A 1TZMA 1KETA 2ZTLA 3IP5A 3U26A 3BMOA 1BWQA 2WP0A 4S1VA 3HMQA 5J59A 3FJ1A 4PINA 2GLUA 2AHRA 1YB7A 3D5TA 5ALYA 2REQB 4PYOA 4FZ3A 3A36A 3OOEA 3MHTA 5IZCA 4U7JA 1ISRA 3D2CA 1M0TA 1NSYA 1TJ4A 1N6RA 3QNMA 1SULA 3HK2A 5IJXA 1EBBA 2GZ3A 4JITA 2V9ZA 4I08A 4ZREA 1GNPA 2GJ9A 1CPYA 3PYLA 4PG5A 4DSTA 5JYDA 2H2DA 2HRCA 2R1VB 3AIOA 4ES6A 5I45A 3D81A 4BMDA 3IDSA 3PGXA 3WLIA 3PF8A 6LDHA 1BA2A 1G291 1ECGA 2PQ2A 1AU9A 4ZAXA 4TSKA 3V4ZA 4YMWA 4AICA 2C7RA 4I66A 4YP0A 3GFTA 1G0NA 2BP7B 2CMKA 4MLCA 3CCBA 5AKZA 1ATIA 3T5AA 4F38A 2AH5A 1L5HB 1RJFA 2FDRA 1WXXA 1FX0A 3P32A 4DNOA 3T9BA 2BOVA 1SFRA 2AW3A 3O0TA 2ZJ4A 4GWGA 4I8DA 4RY2A 5IFLA 4HDNB 3Q5EA 1ZN8A 4FUTA 1YBMA 1AQIA 3Q12A 3B6IA 4JOBA 5CH5A 2R3SA 2QE6A 1UK8A 3PDCA 5FTWA 1C9YA 3V8PA 3VSDA 4NICA 1WDKA 5ALVA 2VP5A 4MYRA 3VR1A 1Y1RA 2Y05A 3TRDA 4BN4A 1MCZA 1G5PA 10MHA 1NU6A 2OHHA 4N8SA 4LOKA 5DM0A 1Q22A 3T3PB 2J3DA 1K06A 1ULHA 2PLWA 4AG6A 3ECCA 3WGJA 4D8VA 3HXOA 3CX6A 4MLPA 3V1YA 3NTUA 3MGKA 2LE0A 4UHFA 3RBZA 3U3DA 2NTYC 1R6AA 2OR3A 5EZYA 5IDVA 3REGA 2I2FA 3R5HA 3U3ZA 5LSAA 1SBHA 3ZV6A 1K5PA 1HQYE 4FFVA 4RKWA 4BQRA 3AGQA 3WGLA 2Y76A 1C1YA 1PR3A 1ONSA 1QYWA 2OZLB 1DKQA 2J08A 2P9CA 3I9LA 3L07A 1WDLA 2JL1A 4LDPA 3TFWA 4A2QA 4INPA 3UJ9A 5WRFA 1Z06A 3QVKA 5K8JB 4YJDA 3ZHBA 4IVRA 3R3SA 4RCZA 4UBIA 2C9MA 2VQDA 3AKYA 2SNIE 4TS1A 3DD1A 5DCYA 1YIOA 1P9RA 5LKRA 5ICGA 2WU1A 1E1NA 3DBIA 5AOVA 4M0UA 3LFHA 3NHYA 5BQXA 3BG5A 3ONDA 3IP6A 2X4LA 1OYYA 1SC3A 2R4QA 4ETWA 2WF9A 1M8FA 2DUMA 4YPVA 1N2CE 5BVHB 2BEUB 4KSCA 3W78A 5IT4A 2X8LA 3MSXA 1KSJA 3STXA 4AX4A 2R8OA 3I6IA 1DKNA 2PD3A 5K0NA 1ZU4A 2YZMA 1VXOA 2MDTA 2HK9A 3CNHA 3UJPA 4JQSA 1DCKA 4DJDC 3U62A 5AW3A 1Z5PA 4BYGA 2XCQA 4DG9A 3ND8A 4EG7A 3IBYA 3LUCA 2YWFA 1PJ8A 4DNFA 3CF4A 3MMXA 2J5QA 5G40A 4A82A 3WYFA 4CW7A 3B89A 3P9IA 2YMLA 1GUDA 2J7KA 2QHXA 3FGPA 1QH9A 1LGYA 2CL0X 3LVRE 2OLKA 3AF1A 4R9UC 1FU7A 3GB9A 1P8JA 1BU8A 1BHQ1 3DVAA 1FP4A 3FVWA 3S2EA 1TZBA 5IHXA 4U9IS 3DCIA 3SJBA 4WX2B 4I55A 1WAMA 4BY9E 4FTWA 3KO8A 1E98A 3D1VA 2PRZA 1XWWA 1QF6A 2CDCA 1IZZA 2OBNA 3GEHA 3IQFA 1T4MA 4R51A 1Z15A 2X0IA 1IHUA 1VE9A 1YD7A 4C05A 5AUPB 5C3MA 2BGTA 3ONWA 2QN6A 2BDTA 3ZWDA 4XOIA 2P4HX 1NVMB 1ULSA 2OV1A 4ENVA 2QG9A 1M75A 1O97D 3COVA 3ZDXB 2D1FA 4D4GA 2JGFA 2J8ZA 1V4VA 3BIWA 1Z8HA 4ND8A 1DWUA 1M9NA 5I4BA 5D1HA 4B82A 1O96A 4NBSA 5IDQA 3BH6A 2Q0XA 3MW8A 1D3AA 4ND4A 1TXGA 2VBFA 3I5XA 3HVIA 4OK5A 5HOQA 1FYVA 3VOBA 4K3UA 1CR6A 3OIDA 1U9IC 4YGXB 2EOAA 4HDRA 3RSFA 4DL9A 4I2VA 1JXAA 3QFCA 3D3JA 4S35A 1G1AA 1JMYA 4WBXC 3N2ZB 2D5BA 2V7BA 3WZMA 2ZJ7A 2QLTA 4HZUA 5FLYA 1K8QA 1Q3HA 3RVRA 1C7IA 4KAAA 4AZVA 2PFKA 2Q4RA 3DKRA 1WV1A 1HBJA 3OQVA 9MHTA 1GZ4A 1XJ0A 3GGDA 3BULA 3D6HA 4IR7A 5H16A 4MS3A 2W6JA 4UAVA 4UU1A 4EAAA 1Q21A 3M5WA 5B3JC 5CG1A 5C34B 3NQ41 1F6DA 1T5BA 2JW5A 4K46A 3ZVLA 3HL4A 3FLEA 3T0GA 4QUIA 5SZIA 2Q5LA 3FFWA 2Y66A 3CZRA 4KQ6A 5IXSA 5HM8A 3T34A 3ZKAA 3P2JA 2CCKA 2XCTB 1G8YA 3TRIA 2X1LA 4RENA 3SDBA 4KXMA 5LIPA 3Q9LA 1W19A 2GYYA 4W1SA 2DFVA 3NHWA 3IB3A 5JI3E 2RE8A 1RQNA 2YXPX 2AOTB 3DE2X 5FTKA 3QBDA 4QBKA 1HFWA 2F67A 4S3MA 1Q0RA 2QU8A 5EZ6B 5F52A 5LYJA 4EG8A 2C3OA 4R2IA 4G0UA 2O3RA 3NOQA 2BFEB 4P22A 1Z4PX 1R37A 1OPRA 1FA9A 1I13A 1LKZA 1U1DA 3GY0A 3HRHA 2K7ZA 3OY2A 2ZUFA 2H4HA 3FCXA 2O05A 3NPAA 5TPWB 2FUG1 2VJQA 2FZEA 4R31A 2QN9A 3OEYA 5F33A 2C3YA 1H5QA 2RIPA 3LP6A 1W25A 2CJPA 1NI4A 4D9IA 3NV7A 1VMEA 5AXCA 4B3DA 3T3IA 2VPYA 3FVTA 4FONA 1HC7A 3EF1A 4BB0A 4BP3A 2C8LA 3EZNA 5ITVA 5AUOB 3TR0A 1E60A 1SVSA 3ZKWA 4EF4A 4QNMA 1CZRA 4CEJA 4QNNA 2NU7B 2HIHA 3KOMA 1IWBB 5EIEA 1Q0SA 1YI8A 3DAOA 1SVNA 3T61A 2X23A 1Z6QA 4IDAA 2PCJA 1TO2E 2D0OB 1KI7A 3AUAA 3SBDA 1UMCB 5EE9A 3SYTA 5EKTA 3IOBA 1QVWA 2A4KA 2PA3A 3N59A 5B37A 4FWTA 4UZFA 3ZEIA 4IXNA 1E1YA 1RHRA 3EZYA 4U0KA 3SLKA 2JRCA 3G8CA 4QTYA 2LV8A 2PX8A 4WFIA 4X20B 4NV1A 3CX8A 3KSUA 2X0KA 5ALLA 3LP5A 4YRSA 1PD0A 4L0QA 4CM9A 5K01A 3C87A 4GQIA 1X7HA 1RXEA 2GEJA 1VI2A 2PT5A 3BIJA 3EVBA 2ATXA 4MV7A 4WESB 5A3QA 5F3DA 4S1TA 5EZ5A 4CF7A 3GPDG 1U0TA 1XDZA 1PEAA 4IMRA 4JJKA 4C0WA 2VUHB 5G3ZA 3PLAE 1JKXA 5BRJA 1T1RA 3LO5A 4FHGA 5TIIA 4KLRA 2QVYX 3ZK7A 4U39A 2O7RA 1E59A 1RU3A 3I6QA 3DB2A 4QXQA 4G36A 4HL6A 1U28C 2WJ6A 4ZOLA 4UC0A 1ZGHA 4KO4S 2PGDA 4IDDA 3RIYA 4XFDA 2PY6A 4EA6A 3KKKA 2F48A 3CLTD 1L6RA 3L1VA 3OSZA 5J47A 3BXPA 1K7YA 4D0LB 2OB1A 3O1IC 4OQFA 4HZIA 2G9QA 1XF1A 2EKDA 4BZXA 5I7UA 5ALEA 2CFTA 4GMXA 2PAFA 5ECYA 1N6KA 3R6WA 3UH1A 1UWLA 5K3EA 2H85A 1QNFA 1R9GA 1SUEA 3FE2A 1XQ6A 3ZWVA 4KXXA 3G9QA 1NYTA 3VM6A 5BXYA 2J45A 3VR6A 5KNBH 4UBNA 1W49A 4X7PA 1R4NB 4BLTA 4C3OB 2P3OA 2YJTD 2WUEA 1NUUA 4KVZA 4XASA 1KO7A 2GNPA 2PL5A 4CKEB 9ATCA 1KJZA 3E1SA 2GCPA 4U0JA 3BSSA 1ML3A 4JL8A 2W6JD 3IIMA 3M6AA 621PA 1A2OA 3HJFA 4JJFA 1ZMXA 2AJBA 4GLBA 3ZDDA 1RWMA 5L4LA 4BL5A 1LUAA 1XQ9A 5DGIA 4KSYA 2GTHA 2EU8A 2GARA 1Z17A 3IXMA 2AGVA 3JVEA 3N8DA 3PUXA 3VH3A 4YRTA 4ER7A 2CLDX 1ULUA 1YT5A 1I9GA 2POQX 1ZUNB 3A1VA 2BLNA 4PYKA 1YAHA 3FCSB 4FMDF 4Y2TA 4DVJA 2G40A 3IQGX 2Q3CA 1F8GA 3WMEA 3DNMA 3K9WA 3S1SA 4LAFA 1RPZA 1OGYA 5DNAA 1K2WA 5EMKA 3C1OA 3ZV7A 4EY5A 5JYBA 2JIPA 3IEXA 2V5AA 2R66A 4NXNB 1MMFB 2WNHA 1TKBA 2C92A 1T1EA 2RAPA 4IV8A 3JQPA 5D51S 4D82A 5D8DA 2ZRLA 3TZLA 1JWLA 3GQBA 2CJWB 5CK4A 1C1DA 3GGOA 4D0RA 3ZNPA 2ZS7A 2JLWA 4Q1FA 1KYXA 1JIQA 3UB4A 1GTL1 3R0ZA 1JG2A 4U6NA 4QUHA 4UNPA 3N6VA 2IW3A 1OU0A 4XSHA 2CB0A 3STTA 4EHLA 5IXYA 4FYXA 3U56A 2B92A 3PVZA 3K4PA 1C0KA 2ZJ5A 4RK7A 5KX5B 2NAPA 3WWDA 3MTBA 3VZQA 1PL6A 2QJWA 3L8YA 1FQOA 4GRDA 3FUXA 2VJMA 3JZMA 3STUA 5HRCA 2Q5CA 3KWLA 1XA3A 4LZZA 1E9VA 3RAGA 2R00C 1BWSA 4Y6PA 2VPTA 1F0PA 1C8LA 3BTUA 4L3WA 4DILA 3R7WA 1U0FA 1JFLA 3KFXA 3OOYA 4I9GA 3LRTA 1U7DA 4Q5IA 1SEPA 3QE2A 3O8OA 4B9EA 4DC9A 4DQDA 2H2GA 5HS4A 3JQGA 1L1EA 1T24A 3STYA 4D8WA 4E5YA 3R6GA 5JSKA 1RC0A 3THXB 1ZM9A 2P9ZA 2VNSA 1FW6A 1MO6A 4I5DA 3QH4A 2I6GA 3NHUA 4PQYA 4LY3A 1SBQA 4YFYA 3S2GA 2FR0A 3B5EA 2WTBA 1G8FA 1FP7A 2J5RA 3FJOA 4J1TA 4AG5A 2JAQA 4CM9D 2A8YA 1AV6A 2YOGA 4OHYA 5CAEA 2EATA 1H2RS 1E6MA 4OUDB 4PU0A 3RQIA 3SJCA 3NIBA 2HJRA 3AL3A 4MV5A 4L16A 1JEAA 3M6VA 1ZCFA 4I6EA 3VC1A 1U2GC 2JGKA 1T0HB 3C3CA 1IC6A 1N6HA 1XZQA 2NUPA 3DA8A 4L78A 4FN5A 1ESNA 5INTA 1ZWKA 1JHDA 4HNAA 1KIFA 2G04A 4JWKA 4QIHA 4F4FA 2ZUBA 1TJ5A 1YZYA 3AM4A 3KSZO 5F1KA 4C89A 2YMMA 1NVBA 1EHYA 5KVQA 1QIEA 2GPTA 4OYLA 5A03A 4XIJA 3MBOA 5B1IA 4UUNA 5A4DA 5AVXA 1Z33A 3UJCA 3WIOA 2GM9A 2Q8NA 4MQMA 4OLJA 5ABPA 1W88A 1PWHA 4OQZA 4A5SA 4U00A 4QXAA 1PFKA 1OJ7A 1NAIA 4GR9A 3ZCSA 1EG2A 2ZZKA 1OX4A 5AKYA 2UXCB 2A1UA 2AR0A 1ZSYA 2RGXA 2FE4A 5BSGA 1KHHA 1PGQA 4FB5A 3L77A 2OHFA 3VR6D 4OM8A 2YC2C 3CF2A 3H2KA 1IDN1 4NPAA 3FNHA 3LK7A 5EQFA 2B4AA 5IG2A 3QX3A 2XA9A 4LK2A 4MCJA 3BJZA 1W2GA 1B00A 3NV9A 4B35A 3UXHA 4MWDA 1N0HA 3L1HA 3IIKA 2E21A 3TXXA 3THYA 1B3RA 2O2GA 3C6KA 2CKDA 1FMLA 3RFXA 3S2ZA 4D7AA 4BO3A 3QBEA 5K5EA 3VR5D 4M8KA 3EOBI 5C35A 2WF8A 3DJYA 1YR2A 2R5NA 5DBGA 4DCVA 5FI5A 2YHIB 1F60A 3DM5A 4OAOA 1OASA 2AC4A 2IEIA 4TKMA 3Q87B 1XO1A 3HL0A 2D5AA 2K5UA 2GD2A 2C7BA 2D1TA 3CPEA 4Q9LA 5DV9A 3FX2A 1A97A 2Y6VA 1B1CA 3LRXA 4FGJA 3PHIA 4JNCA 4LUCA 4PC1A 2QRLA 2XCRB 3NZEA 3B2EA 3TDKA 3F1KA 4CKCA 2H11A 3ETEA 3GDWA 3KT0A 2D6FA 1VE6A 5IDYA 4GM4A 1R7RA 1I2CA 3IPYA 1DJMA 4GYJA 3QE0A 3QI7A 1E69A 1SB8A 4OM7A 4BAUA 4ASUD 3AG6A 4BV9A 3R5JA 2I2BA 5FBKA 2G5CA 4IDHA 1SUSA 3AKDA 3K9BA 1F06A 4I4LA 4UDYX 5CA1B 2AW5A 2XV1A 2V5VA 4L07A 4O4JA 1JR4A 2NV6A 2RB5A 4Z1OA 3ADCA 4MP6A 4CKWB 1JH9A 4LIPD 3K9GA 5KOHB 2V0CA 1XFAA 5HP4A 2E82A 2JA2A 1DINA 4BE4A 1VLQA 4EATA 3RM3A 4CODB 4G81A 1X1RA 5DM1A 1AMNA 1SVWA 1X8LA 3DZJA 2AMLA 3B6MA 5BN4B 3KJHA 5BYJA 5JZ9A 2ZJ3A 4KWIA 5FAXA 4AN0A 1U2QA 1JHQA 4KXFB 3HXMA 3BL8A 5ERGB 4GPEA 4B6QA 3Q2IA 2DQ4A 4GI3A 2I99A 3WDSA 4YQFA 1EE1A 1UJ4A 2ZE7A 2D2XA 1A0OA 3FUCA 4X85A 4QM6A 2DQKA 3MQFA 4N0EA 3KD3A 4LBWA 5BQPA 1ZNXA 2WRZA 2HTEA 3WLMA 1EP2B 4BBJA 2NUAB 1RZUA 1DT5A 2BFOA 4DVGA 5BXQC 1S9DA 4TLAA 1VL1A 3HG7A 3NX4A 1USKA 5IVDA 3AWDA 5FPQA 1ZZEA 3TLBA 2GXAA 1Q92A 1UJCA 3EEIA 3NLLA 1D4AA 2FVXA 3TI9A 1LPNA 3WV5A 4JYAB 4ZQHA 2CD7A 2QNBA 4XPIB 2J6CA 1BQ4A 1EAMA 1Y6RA 4UBMA 5JJBA 3OOHA 1U7ZA 1RS0A 2AC7A 4IS2A 1A4IA 2ILTA 2GJKA 1USWA 2DBQA 4AI6A 2Q49A 4CL8A 4CQLA 3WB9A 5CDGA 4K9QA 2Q4DA 1RXUA 1SN7A 3FBTA 3L7LA 4CHGA 1TO6A 1SHJA 3E9QA 3EDQA 4HDMA 3AI7A 4U1RA 4XWTA 3VC3A 1BE1A 3ADDA 1K86A 2IXFA 2ADOA 3AEKB 3K72B 4B3RB 1OWMA 2QTLA 1Y37A 1PWEA 3VPFA 1F0YA 1WV0A 2DC1A 1XXHE 2B1JA 1J00A 2B2NA 2ZYVX 3HCDA 3R3ZA 1R16A 2WD9A 5L3ZA 4BNHA 1YFJA 4XDYA 2AKAB 1NNSA 4XUEA 1KVRA 3OTIA 3HZRA 3GLSA 3V80A 4H27A 3FPBA 3QHAA 4AN1A 4BFUA 3EA4A 5LLTA 2QQGA 4G0OA 4B4KA 4V0LA 1JQKA 4JL6A 4YJKA 2SKDA 4EAQA 1BTOA 3G7UA 1XEXB 4MW0A 1PZXA 1XZBA 3UT0A 3ZK8A 3KG2A 1E9CA 3TJZA 1EX7A 3W2HA 4LX0A 1P19A 5JARA 2IITA 3HP4A 4EA7A 2V7XA 2IEAA 3D5QA 2IXBA 2V7EA 4J94A 3U7FB 3EVFA 3PUWA 1RTKA 4ZDWA 3OM0A 2JCXA 3UH0A 4Z6KA 3O7WA 3M2PA 1AQNA 4IBOA 3PQ7A 5G0UA 7GPBA 4XCVA 5NULA 3KETA 4OAPA 4PGFA 1CQXA 3ZLUA 4LKOA 2OQVA 3G59A 4X84A 6ABPA 2NYAA 1ZDMA 3TPCA 5CEEA 2ZSKA 2YN4A 1ZH8A 4TMTA 5EJ7A 4QREA 5HQJA 4N5MA 3NHSA 3VRHA 4HMQA 1JHVA 4AVYA 2DXIA 1NN3A 2ATCA 2EBFX 2QTWB 2OHGA 3K1TA 5EIXA 1T3ZA 1GADO 4R83A 2CNWA 4U2DA 5IANA 2NYVA 3TL2A 4YB8A 2Q9BA 3ESQA 4LE2A 4UHKA 4HRVA 3S0JA 4MV0A 5HKLA 3SZOA 1EGAA 1S02A 1Y48E 3B6JA 4Q6WA 3CXUA 4MJ7A 3EN0A 5MFPA 4Q9KA 3EXFB 4Y8VA 5B6PA 4AF6A 1FF9A 1PDVA 4PS0A 3TIGA 2H1LA 2P68A 2XPCA 4IDQA 4C5AA 1LTQA 1N8KA 3RPEA 4W5QA 3R20A 4LE0A 1AKEA 3M9XA 1Z22A 3CNQS 1T9CA 1NWHA 4EF6A 4NJEB 5BW6B 1A88A 4OFWA 3NUQA 2OORC 4YCDA 4Q37A 4XWAA 2FKNA 4XWGA 1U3GA 1G59A 1E4VA 3QV1A 5CA0F 1G2OA 3UQZA 3S2UA 1K5DA 2F7SA 1V3QE 2CXXA 3HJTA 2UZ1B 4LYEA 1SUFA 3A9UA 4LYYA 2QSJA 3ZHXA 1O5TA 5JFGA 2WAMA 1NBEA 2NWQA 2EJBA 2XX3A 3KEQA 1RMQA 1WABA 5IVPA 1RI1A 2QAIA 3GCWA 4DQKA 1N25A 4H6VA 2XOKA 3JVVA 1CJMA 2AD1A 2QMUA 4MSUA 3KD2A 3I1IA 3QU4A 4YJGB 3VC7A 3CYFA 5A4IS 4HLUC 1A8UA 2DFPA 4G0VA 4AAYA 3E7DA 4RTOA 2BGGA 3EH2A 3GXOA 2ZSHA 3HCNA 4X8OA 3TX2A 4MW5A 4CV0A 4HVLA 2FUNB 3OJWA 5D5HA 3K4HA 5ALHA 4EUEA 1YZUA 3PA8A 3VKVA 2O5VA 4OOFA 5JU6A 3Q85A 4CLDA 3VAZA 2XKBA 4NZPA 5IJ9B 5C8ZA 1U1EA 3OZEA 3I32A 3ABRB 4I8IA 4MUFA 2P6UA 2H54A 4F2PA 1I3NA 3TLAA 2ZPTX 1KYYA 3K32A 5FWAA 1JXMA 2HK7A 3BF7A 3EQ6A 3GJSA 2GPAA 3FLAA 1GL3A 1HE1C 2FR8A 3L79A 2YJ4A 3DTVA 1L4LA 3MB8A 4FMBB 2ODBA 4YJHB 4OBEA 5AJVB 4FM9A 5HOEA 4IEIA 5AKEA 2W93A 1K63A 5F5XA 4CKBB 5HKAA 1E89A 4PN3A 4D81A 5CYGA 1JVSA 1JIUA 2DR2A 4IGKA 1N5OX 1JHUA 4J0FA 2C5LA 4AZ0A 4OXKA 1FFDA 1ZIPA 4HNGA 4P34A 2GPJA 3WP1B 5BVGA 4QXPA 3ANYB 1DDOA 4TMYA 5DP1A 4YXWA 4BJ3A 3KTOA 1Q1AA 4KN9S 2DFTA 2J1LA 4GPD1 2ES4A 1LK7A 5H81A 2IU0A 4UUBA 3RUIA 3V42A 4ZVNA 4B3BA 4PR3A 4WN9A 4DLZA 1TFUA 2CEKA 1Y8CA 1YONA 1XKXA 2HRRA 1DADA 1FFBA 1N2HA 2VDKB 1JQ3A 3CUSA 3GLKA 4NY1A 3WLLA 2C4TA 3QY9A 4RPCA 1UAGA 2X9VA 3O4GA 1QQTA 5CM8B 4DDVA 5KTRA 3EPKA 1YF3A 1CRLA 2GKSA 1XNHA 3HDYA 3NT5A 5JJLA 1IEXA 4ZEWA 1WY7A 1IJKA 3AP2A 1T0PA 5EIWA 1NLYA 3QJYA 4UCQA 1SKQA 3VZRA 2GQ0A 5ILGA 1VCIA 4QU0A 2WQ7A 3OZDA 2ONYA 5ALUA 4ND6A 4YRBA 1YDFA 4CE6A 3NI2A 3HDQA 5BUZA 3PXUA 1X0VA 1QAOA 2R60A 3PK0A 2COKA 3DONA 4A6XA 1U8EA 1ORHA 1W44A 5KWIA 1M6VA 2C20A 3RE1A 2ZS9A 5AJTA 3N2GA 1F4LA 1L7NA 2BE9A 2CNWD 3FSEA 2H0QA 1IUNA 2WU3A 4JBWA 5K3CA 5JUWA 1ZW1A 5LZ8A 4QECA 3I30X 3EIHA 3VTZA 5BWLA 3DGEC 4UHBA 5T4EA 3RABA 1BC5A 3PQ5A 2AS0A 4OHOA 2JAPA 1A8QA 2KYRA 2QXYA 2IEYA 2W2XA 4QWWA 2F62A 4QTZA 4TM7A 1RQGA 3LPCA 4KIFA 1F8XA 1R0CA 4MQEA 5BV7A 1LPAB 3IV6A 4L6AA 4D8UA 3ZHQA 2XDYA 2NQTA 2F3QA 1E99A 2JPDA 2P1ZA 2ONJA 1CW2B 1AHNA 3JAKA 4FGWA 4D3SA 3L5KA 5GZ6A 3DLIA 2GN9A 4Q03A 1SK9A 2FV8A 4JQZA 4Y6OA 3V8BA 5FAKA 1OH6A 3HP1A 5IN5A 1IMJA 2FPGA 5A9RA 1B42A 4UQPA 2OCPA 1Q83A 2JBHA 1OIVA 2WOJA 3P96A 1N7HA 4Z3KA 1E8DA 1WEHA 4R6XA 2HA5A 3V4OA 4BVJA 1HRKA 5JOQA 2Q41A 2FE1A 2B30A 3ZJ5A 3ABQB 1SBZA 2OCXA 3D5EA 4EP1A 4YT2A 2QR3A 2XOKD 3ZBTA 1CS0A 3KR2A 3LK6A 3TQCA 4WJZA 5HMMA 1UQRA 1EFPB 3HCWA 3KYCB 4K9DA 1HSZA 1KJWA 4JLBA 5F7JA 4BE7B 1N5KA 1C7RA 2GCOA 3ZY4A 1UJMA 1YDMA 3JTMA 2QNRA 5LL6P 3EYAA 1KZ7B 2XGSA 1K4KA 1USVA 3ANSA 3D54D 2JAOA 5A6SB 1IBRA 1VMDA 2IPMA 3FF1A 3JASA 5A7GA 4XVHA 1GPAA 2FQXA 3B3JA 3QGMA 4IDFA 4V03A 4CLHA 4DZTA 5KSOA 3C3YA 3FWPA 1TMOA 2WT8A 4EUHA 2GFHA 3ROPA 4A73A 1HNWB 2II6A 4YAWA 1ZHHA 4ITVA 3SHFA 4O2LA 4C22A 1GXSA 5E4FA 2H9YA 2TMDA 1PLJA 2QGFA 1B6SA 3K5IA 4MKHA 4BUJA 2YFYA 3AH8A 4GRAA 1KL7A 3KCQA 1X7YB 4HTFA 2G8NA 3QVWA 2DULA 1ZRMA 1ISSA 3COWA 5E6RB 4Z4CA 2FSFA 4K9SA 2E37A 3OE7A 5ED0A 2JCYA 2GVNA 1IVYA 1ODIA 2WVHA 4OXXA 2Q5IA 1A5ZA 2RGDA 1L7PA 5GQSA 1WVIA 2AKEA 4QJ5A 5BYAA 1CQJB 1N5MA 1NBIA 2QIPA 3IKTA 4YXWD 3KYBA 2NO9A 2FQQA 3G9XA 1M0SA 4WV3A 1RPTA 1Y3IA 1GITA 1G2IA 1Z5WA 5DYIA 1JJVA 4YS6A 4JP1A 3OFND 3A4TA 5JEEA 3NP9A 3TAXA 3AETA 2B6HA 5K3DA 4BLQA 3QIVA 5BYKA 1L4UA 4FCTA 1Z39A 4YQZA 1E2GA 3WK6A 5L45A 4S05A 1CUGA 5AQ1A 4FCVA 5FPKA 3NBXX 1NURA 4XDHA 3FXAA 4II2A 1QGUB 3L84A 2JI4A 2Y1FA 3CLUC 4JBXA 3ZD8A 1A2BA 3NETA 4M9ZA 5DI3A 3VV2A 1REQB 2C0PA 4N76A 3ZCQA 3CXRA 2OGZA 4F2GA 5F7OA 2YYAA 2HA2A 4MRPA 3ADBA 1GSHA 5CEJA 1AVTA 1JJIA 2C5AA 2QIOA 4HDSA 2JJMA 4OLHA 2X6QA 3K9NA 1CZNA 4L95C 3B1YA 4CU5A 4RA6A 1XKLA 1XD2B 2G83A 3RKUA 4ZYYA 2JARA 1ZO8A 2O7VA 3H2BA 3L8ZA 4N48A 3E0XA 1UOPA 5FCDA 3GBVA 4PRYA 4RGVA 1YJ8A 4XTCS 4RZ2A 3ZZTA 4M7RA 2QSUA 3CCCA 5EGNA 4RO0A 5BSMA 5A9SA 2O8EB 3WL3A 3ZDQA 1SD1A 1GOTA 4P4GA 2BRUC 1Y8QB 4EGQA 3AHDA 1XMJA 4MUHA 5KAPA 1DJOA 1ZGGA 5ESRA 1XCLA 1JG7A 3NHLA 1I7LA 3I12A 3NHFA 3GLFB 2A30A 2WJJA 3H6GA 3JX9A 4QYIB 2E5WA 1HLPA 2YYSA 3FF4A 3LT0A 1V41E 1QDUA 1NM5C 2X9LA 1E6EA 2DPHA 2LCFA 4CG2A 1XZFA 3DBOB 5K3BA 4DIBA 4CIAA 2EFJA 3C85A 3CBQA 1Q95A 4DJFC 2IE8A 1CS4C 4MEBA 2ERCA 3VSBA 1AKVA 4DKJA 3ZXSA 1YH3A 3C4QA 5CCBA 4KFTA 5C80A 5DNDA 3GFSA 2ANCA 2DX7A 3GLRA 1UXOA 3HTXA 1E62A 2V3WA 3IVAA 2DQZA 2DQSA 3VSEA 3RAPR 1ISGA 4FEYA 2HNBA 1RCUA 2WE7A 3M1YA 4M88A 3OQ6A 4RXTA 1K4MA 1B7GO 1NUPA 5EZYF 1NI5A 3HI6A 5ARBA 3E7PA 1OLSB 1GGVA 1BE0A 1Q0LA 5AWFC 5AVYA 1ULBA 4UOZA 4P5PA 3UWSA 1MDBA 1Q11A 1I3LA 1CJBA 2HQRA 4F4IA 4LGVA 1FXWA 3G0IA 1SRRA 3PXDA 1WU8A 4DLXA 1HSOA 3RSOA 1YQTA 2FB9A 2QR2A 3FUTA 3JATA 1GSOA 1SMKA 1YMUA 4G1MB 1WKBA 3PQFA 3EB9A 4ALMA 5JSFA 5K8CA 3VKGA 3UJHA 1L5MA 3V2UA 1TYCA 4RH3A 2JC3A 1V47A 4EQ6A 5E7QA 1E4EA 5EGSA 3PKZA 2RBEA 3CZCA 5AKHA 1JPUA 3L4BC 2QTTA 2JLSA 2WU0A 4L5AA 1UPXA 1DZ3A 1NVVQ 4EPYA 5I01A 3BMNA 1KDRA 1BEEA 3OE7D 4IJ5A 5EE5B 2BWJA 1MW8X 1FUIA 2PKQO 3GARA 4Z0HO 4W1RA 1PZGA 3HLKA 2QZ9A 4ZPXA 3AIIA 4JLOA 5KHAA 1ESDA 5L6LB 1O77A 2GETA 4XLLA 3RS3A 4XEUA 3U1VA 2OBYA 3V2IA 2AVNA 4YMVA 1DQPA 4NZYA 3KQPA 3VJMA 5KYWB 1ORVA 1ZQ9A 3R6TA 5E6UB 1M6WA 1FDVA 1KMHB 4NHOA 3WR5A 3T3MB 5JIBA 4PNZA 1AXEA 1VIDA 3KB2A 5ANRB 3E5HA 1TVCA 4KU4A 5BUSA 5E1DA 2MR5A 2MJLA 1CUCA 3VNBA 2J0EA 3OFJA 5J2UF 1NFQA 4HBZA 3EF3A 5KQRA 4I55F 2NUTA 1CUUA 1HY3A 1KARA 3UC9A 2DZDA 3CGWA 3DBLA 1TA0A 3KYJB 1Z26A 5LQRA 1N8NA 1KTIA 4KODA 4DLYA 4DTIA 1XJWA 4B73A 2GT1A 3EIEA 4H9GA 4JC5A 4MR7A 5EP1A 3HLTA 3H3JA 5G1OA 4F9TA 4RD3A 3GUUA 3KBOA 4LJ4A 3KRTA 2I6SA 1R1DA 2PJZA 3PJFA 4WACA 1G4UR 4NS1A 4MV6A 3HE3A 3F7NA 4ODIA 4YRNA 3U5TA 3DG9A 3NAMA 4DIEA 2E7ZA 2GN8A 5I3ZA 2P6RA 3L8DA 4E32A 4M8IA 2O0KA 3OTWA 3NDPA 2ORED 1GLVA 1WW8A 1U9CA 3KHUA 3R3WA 4PLYA 1QRTA 3EGOA 4DR4B 5A5VA 3GEBA 3NDJA 3RRNA 4P9NA 5CW1A 3IQIX 5HWSA 1U8XX 2X5KO 4J75A 2Y0CA 2ZS8A 4AZTA 4DFDA 3T94A 1UM9B 1JFVA 3A9VA 4DZZA 1Z07A 3UMBA 2VHXA 4W5TA 5T8KC 3U44B 1J24A 5H7XA 4QL3A 3TKLA 4DIUA 1UK7A 3H5WA 2GHTA 3V8MA 5ES4B 4ZI2A 1T6ZA 3SR4A 4ME6A