4JLKA

Human dck c4s-s74e mutant in complex with udp and the f2.2.1 inhibitor (2-[({2-[3-(2-fluoroethoxy)-4-methoxyphenyl]-5-methyl-1,3-thiazol-4-yl}methyl)sulfanyl]pyrimidine-4,6-diamine)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
241
structure length
229
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLSEDWEVVPEPVARWSNLTMEQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESESMNETEWTIYQDWHDWMNNGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Deoxycytidine kinase
publication title Development of new deoxycytidine kinase inhibitors and noninvasive in vivo evaluation using positron emission tomography.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 229
sequence length 241
chains with identical sequence B
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jlkA00
3P4XA 1MKYA 821PA 1D5CA 1U8AA 2GXSA 2JDID 1GAJA 4NONA 3RHFA 2GILA 2OHFA 4A6XA 4L5BA 1G7CA 4C7OA 4MKIA 4TTRA 4Q4HB 2GZAA 3A36A 3EXAA 4LJAA 1AJEA 1JXMA 1N6HA 3D8BA 3GJ3A 5CM9C 4B3GA 4I1SA 5KNDA 1VCIA 1OHHA 3WBKA 2UZ3A 4YQFA 4R9UC 3JVVA 4PZLA 2ZTSA 4M9SA 3EZ7A 4ARZB 3GP8A 5DN6D 5K8UA 3QIAA 1KI1A 1J8YF 2VO1A 3CPHA 3OESA 1S1CA 5E4FA 3W90A 3KQNA 1X6VA 1W2GA 1ZM3A 4DUGD 3C16C 2A30A 2ZJ5A 3RSLA 4X8HA 3E5HA 4Q9JA 4US1R 5KYKA 1NVUQ 4HI0E 4L4UA 2C04A 1CULC 4NYIR 2QMHA 1OB2A 4OK5A 2NZ8A 4FWTA 2F55A 4KSBA 4LYHA 4DB4A 2HCBA 4AYXA 3LW7A 3WRYC 4DB2A 2XXAB 1ZNWA 3M1IA 1II8B 1XEXB 4ZKEA 2SHKA 1N5IA 4Q01A 5FPSA 4LHVA 4G0NA 3TR0A 1JEEA 1YZQA 2H5EA 2WOOA 2V3CC 1DS6A 3QKUA 3V9PA 2ZRAA 3PJRA 2ZJAA 3IEVA 4TTPA 3ZYCA 3KKPA 1VMAA 4ON9A 5D3MA 3ND9A 4DLXA 5AK0A 1E2JA 3AVYA 4TZ6A 3ZJYA 3C15C 2JA1A 4XWKA 2Q9CA 4DXAA 5GJCA 3NDBB 4Q18A 4W9MC 3NC0C 2VSOA 2FSGA 3HR7A 1JR6A 1JQJC 4OYHA 4RJLA 2RGAA 3RS2A 2BCGY 1YZGA 1HT1E 5J5CA 4B71A 2JLXA 3A4MA 1XMJA 2FH5B 2TMKA 3RS7A 4QHSA 2H17A 1KMHA 3I5YA 2QQEA 5H1YA 2P5TB 1VECA 2B92A 2QRNA 4C0AC 3GLIA 4M1YA 5AR1A 1TADA 2DR3A 2YVUA 1GG2A 2YZ2A 4CW7A 1CF4A 1Z28A 2G3YA 3B8HA 2BEKA 2VBCA 1CTQA 1A82A 3WYFA 2W00A 1I4DD 3OIWA 4US2R 3U7GA 1OKKA 5DI3A 2HLDA 1W47A 4ZCIA 2C96A 3CX7A 2XZLA 3AVWA 1L4YA 1UBEA 1BO6A 1KDOA 2D74A 2QI9C 2XB2A 2P6UA 2PBRA 1XZPA 1E0KA 1HQYE 2FZ4A 5JI2E 1T6NA 4TQAA 5JRJA 4W5JA 3T1OA 2XZPA 4QNMA 4TQUS 2I4IA 2A5FA 1GRQA 4ZO4A 2WOJA 3SBEA 1E9SA 4A2PA 3JVUA 1P5ZB 3W3AA 1H8EA 2OUKA 1QZXA 2QSZA 2RHMA 1C1YA 1OFIA 4Q4HA 3K09A 1GVNB 2DFTA 2VSFA 4M53A 1D6JA 5HCIA 4O2LA 4H1UA 5GVRA 4C0QC 2GVDC 2QPOA 3L0PA 4TSFA 4AD8A 1Q44A 4PSVA 3NIBA 4BZXA 2QMUA 1XMIA 3Q8XB 1FX0A 1C4OA 3BFVA 1AKEA 4TQ9A 4YXWD 2EFCB 3EX7C 3DDCA 5IK2D 2GJSA 1BMFA 2VRWA 1N6OA 2QU8A 5KO2A 1U0HC 2A5GA 1E4YA 2AL7A 3SEAA 3W6NA 4AWXA 4ESHA 5A5GA 3THXA 4LY6A 3TRFA 2CXXA 3OF5A 4UXIA 3E2IA 521PA 2XB4A 4BLRA 2WTUA 4Q1DA 2MMCA 1N5LA 5JMTA 2UVQA 4FCWA 1JAIA 3LV8A 4JLNA 1FNNA 4PANA 3AF3A 3RS0A 1S4QA 4II7A 4R2IA 3RSOA 4RVCA 2XXAA 5TDHA 1BH2A 2ZEJA 4UNSA 5LB4A 2ZITA 1MO3A 1XEXA 4GOJA 2ATVA 3VKWA 2QENA 2OZEA 1NLZA 3B5JA 2GJ9A 2VP9A 1ZD9A 4Q7KA 2JAQA 4QBHA 1F2TA 4LYAA 5EP4A 2FOLA 5FPHA 3THWB 1ZIOA 4IDOA 3KB1A 3I8XA 3RRMA 2QL6A 4C0HA 1K6MA 2CK3D 5FH9A 4BFXA 3ZH9B 4A4DA 5HZHA 1UADA 1Z0IA 1Z22A 1PZNA 1NLYA 3K53A 3FWYA 5JEDA 4QJ5A 4D6PA 3SOPA 3QENA 1UM8A 3FMOB 4QBGB 4V0LA 1OFTA 4DWJA 4LYJA 1X8LA 3FPAA 4URYR 3SDZA 3SQXA 1SXJB 1UEJA 3LO5A 1IOZA 1P6XA 1T8UA 2CVFA 3NHAA 4P0TA 1KNQA 1G6HA 2OO7A 3LH5A 3PFIA 4YMTA 1OIWA 2KBEA 2PX3A 1NN3A 2ODEA 3WYGA 5JCZA 4KODA 1SXJC 1L8QA 4JKIA 4BUJA 1CR2A 2GESA 1XTKA 4RZUA 3CBQA 5FBQB 3BWDD 4UKDA 2WJYA 4N0DA 2XSZA 4KSCA 2QA5A 3K0CC 5E7IA 1KDPA 3KB2A 2J3EA 2J87A 3GJ0A 4NZYA 1E69A 4CEJB 2IS4A 2HT1A 1E1RA 3GEHA 4YMVA 3NC1C 4TN1A 2QE7A 3M0EA 4ZDIA 2DHRA 1R4AA 1KOFA 3KDSE 2ZSDA 1MV5A 1E9AA 2W2XA 5FOSA 1CRPA 2J0UB 1E6CA 1II0A 3LVRE 2YOFA 4ERNA 3PQCA 4JYCA 5GJBA 4ASUA 2GEUA 3QXJA 3U60B 3W34A 4DC9A 1DAGA 1W0KD 3K9LA 3SJCA 4DLUA 4MUAA 3L82B 4NBSA 1US8B 4HLQB 1G7SA 2ZRKA 5CDFA 1KI9A 1VYVA 1G7RA 2BMDA 1DVRA 1JNYA 2YOHA 2R9VA 1XMVA 3S1AA 2JLWA 4B6EA 1XJ0A 1XTSA 4B48A 3U5ZB 4TLBA 2FX3A 4M1TA 3RLFA 1KHTA 4XVUA 1Z3IX 5AJXA 2R6CA 4V0KA 1EFTA 4ILEA 4Z8YA 1NNEA 4Q48A 2QT1A 4M1MA 4Q00A 1GFIA 1BOFA 4B75A 1G21E 3O47A 5FUVA 4ZDWA 1P3JA 1QG4A 2WAYA 1XZQA 4MKHA 4O3MA 2ZUBA 2J9RA 1N6PA 5JZVA 2ZE8A 1LF5A 3A37A 1AQYA 3WNCA 2JJ8A 5JHGB 1GNQA 3K70C 1HYQA 3P4YA 1X3SA 2OE2A 4FCTA 1Z0DA 2B7BA 1O3YA 3I32A 1GRRA 1FUKA 1SZPA 2ZE6A 3SZRA 2JIZA 2F1RA 1KAGA 1VG1A 5FTKA 421PA 3H86A 3LXXA 1YU9A 4LBZA 4QC2A 1KSGA 4Q1EA 2IBMA 2RKOA 3IO5A 2X1VA 2JGNA 4TYWA 5CIWA 2HV8A 4KHZA 2GVZC 3JZAA 4Q5IA 2IX3A 2D4HA 4OQFA 1ZJ6A 3VU9B 3GQBA 3RC3A 5J4HA 4BZPA 1Z6XA 3UKDA 2C77A 2GNOA 2ASEA 4FINA 1RYFA 2RHDA 4GOXA 1PUIA 1Q1EA 4Q4AB 3IPXA 4OL0A 1LV7A 1OKKD 2GJ8A 2ZYTX 4M9ZA 3A1TA 3U6KA 4IXNA 3F5FA 1G19A 4TMWA 2FFQA 3A1SA 1NVVQ 2IL1A 3THWA 4Q66C 1VCNA 1GDDA 3QXXA 3AVTA 1WQ1R 2V8OA 4KVAA 4DZZA 1JALA 2IS1A 1H8ED 5KTYA 3MJRA 2WBLC 4DSUA 3B1ZA 2O8DB 3A8TA 4FMCF 2XJ4A 1NJGA 5DHAA 2HCJB 1L2TA 3FTQA 1AZTA 3IIKA 4ZIRA 1ZBDA 3L0IB 3B1WA 2WPDA 2O8CB 1F6BA 4XOIA 5HTKA 4D0GA 3GLFB 4TSFD 4A2WA 1QHIA 4JSTA 3UMSA 2P67A 1B23P 4XJXA 2VSXA 4Q7JB 4CIDA 3A6PC 4EKDA 2CL0X 2WIBA 1E79A 5SZKB 4URUR 2ZRFA 3GEIA 1ELOA 3U3OA 4CEJA 1BMFD 1XJQA 4EJSB 2ODBA 1FTSA 3EA0A 3WY9A 2GZDA 2XTZA 3NTUA 2IK8A 2R65A 3NBFA 3ZVLA 1W4RA 5SZIA 3BK7A 1AGRA 1KO7A 2P5SA 4N3NA 1LF0A 1KGDA 2B21A 1Z0JA 3KQHA 3LLMA 1J99A 2YC2C 3F8TA 3NBYC 4DT1A 3LW8A 3MUFA 1R6BX 121PA 4HUTA 1US8A 2IC5A 2XTMA 3I3SR 4Q19A 4P33A 1TQ2A 3T5DA 3LBHA 2IT1A 2YYZA 2YOGA 1E2NA 3DZ8A 1D2EA 2FE4A 1JR3A 4DVGA 3RRZA 2VHJA 1RKBA 4MYTA 4Z54A 4GSYA 4JBYA 3TAHA 3QF7A 4HYYA 5LB2A 2WV9A 4DDUA 1N6LA 2WZQA 2CCGA 1S96A 2GK7A 2QP9X 4LC1A 3X1YA 1NI3A 2VPPA 4PO1A 1NN5A 2GK6A 1Q0UA 3WMEA 3BD9A 3KJHA 5J4VA 1R0XA 4OKSA 1NL3A 4JLBA 2O0KA 1OYYA 2GXUA 4KO8A 1AN0A 1E99A 1SKQA 3SHWA 4LJ7A 4QRHA 1S3SA 2G88A 1KDRA 2OESA 4HATA 1Z2CA 2WKPA 2JLSA 1M1YE 4QL3A 2D06A 1Z6TA 3BGWA 3CKLA 4RZ3A 5FI0B 4D25A 2XSZD 2GEDA 5DHFA 4BFSA 5FBVB 3RS5A 1SXJE 5JHHB 4KXFB 1G3RA 1T3SA 2ANCA 1AS0A 1T3HA 2C9CA 3T15A 1E0JA 2V54A 2F3TA 4OHVA 5H68A 2QE7D 3MFYA 2O8BB 3AVUA 5ANRB 2JDIA 3GFPA 4PHFA 1NJFA 5HKKD 4QGAA 2VHUA 5BYKA 1IXZA 3CNOA 3AP1A 2LWIA 4E03A 3GJ5A 4CEHA 1D8TA 4OK3A 5DIFA 4ASUD 2WWWA 4L16A 4OI2A 1C9KA 2VH5R 2EVWX 1ZNZA 2IXGA 4Y0VA 2ODNA 4I1UA 5BXQC 1GL6A 3LLUA 3TUZC 1G8PA 1WBBA 3LNCA 2GDJA 5EP3A 4IDNA 1FP7A 1CJKC 1PVOA 2OT3B 4M1WA 2JLQA 1Q1BA 5IDVA 3GLHE 1ZC4A 8OHMA 1G291 4CGZA 1GNPA 2I1VB 4HAVA 4P4UA 4DUGA 2YNMA 2QUZA 3BBPA 4DIDA 2QTFA 1OH8A 5K8LA 3FHCB 5KSZA 2WJHA 4JBWA 4V0NA 1KI6B 2FPLA 2O8DA 2QP3A 4WXRA 4FN5A 4RD1A 1WMSA 2C9OA 2XAUA 5FOWA 3X1WA 4AYWA 3GLFA 4HZUB 3BFKA 5EUMA 1RVDA 2NPFA 3LXRA 3EWAA 1KDTA 1RPZA 4Q4JA 3HPRA 2WIAA 4EDHA 1ETUA 2BMJA 3CONA 1E3MA 4GBMA 1Y63A 2G0TA 3OZXA 2HF8A 3RRYA 3NH6A 3FYHA 2JIZD 2FPMA 1TL7C 2JCSA 1DPFA 2F9LA 5FUWA 4OHXA 4OQMA 4XWAA 4QJ3A 2HYIC 2GCOA 3DKPA 4KU4A 3T34A 5BW8A 2EFGA 4FI3C 2LKDA 2D3WA 4BFTA 4TZ0A 4QM6A 2QN6A 1DAIA 2REOA 4WXPA 2GXQA 4EAQA 4RKEA 3U2QA 1IBRA 1OSNA 5HE9A 1S9DA 3VX4A 2R8RA 5FUYA 3GJ4A 3G0HA 1S2MA 4WAUA 2J59A 2PX0A 1KKLA 2VA8A 1RYHA 3T35A 2W6JD 1WBDA 3OEEA 1U8YA 1UBCA 4M1KA 4PZYA 3SR0A 2Q21A 4AIIA 4HSEA 3NDPA 2MMGA 3O8BA 5IRCD 1FOEB 3HDTA 3T12A 2VTKA 1X8KA 3QEJA 4MRVA 4YDSA 2XGJA 2NO7A 2XITA 2N42A 2O8EA 4HLDA 4WZAE 3BS4A 2EFDB 3PUVA 5A4JA 3BC1A 1E2MA 1PLKA 4B43A 2ZRCA 5JJKA 4EQ6B 3GJ6A 2A9KA 2RB4A 5E7MA 1X8JA 1OJLA 1XX6A 2MSDB 1KSHA 2WPDD 4F4CA 4CVNA 3D6TB 4IOLA 2FDCA 4I1VA 2IHYA 5UKDA 2VF7A 2FSFA 3UPUA 1RRGA 5EP1A 2BJVA 4GL2A 2IF0A 4DSTA 1E79D 1R5BA 1WA5A 2J0VA 2DFNA 4I81A 2IUTA 3CRQA 4PX9A 3R20A 5EE3A 1F5NA 2ZUDA 4TMKA 4JLAA 5E7JA 1PLLA 1U94A 3CRW1 3VKHA 2LKCA 1FFHA 1A7JA 1U90A 1TMKA 3PEVA 4Q1AA 3ZS9A 3IHLA 1YKSA 4XSHA 5KNCA 1Z6AA 4NYMQ 4EIWA 5KSPA 2A5JA 3A1VA 1XBTA 3L2OB 2OFWA 3QVVA 2PJRA 3FHTA 2ZR9A 5CM8B 5JRZA 1DARA 2ZI5A 5EXSA 5EE5B 5KDLA 4LV8B 1JJ7A 1Z0AA 1OIVA 4DLRA 2G6BA 4BLQA 3KUDA 1JR3D 4QKQA 2ZRPA 5JWHA 2ZR7A 3LAWA 1XNJA 2NQ2C 2ZYVX 3WNBA 3KKOA 1M7GA 2P0EA 2ZVQX 1AA9A 1GL7A 1NKSA 3AV0B 3B7GA 4URZR 2KBFA 1W36C 2I1QA 2C98A 1TQ4A 2HF9A 4NCIA 2CJWA 3DOFA 1KI6A 2AXPA 4JL5A 2ERXA 1NBME 3QPWA 3VR5A 1P9NA 2JLVA 1N6IA 3RS3A 4LBWA 4TMTA 2C8VA 1OB5A 2ZAMA 4MDFA 3BH0A 3AVVA 4M1SA 1ZD8A 4DDVA 5B57C 2QROA 2G77B 2IYLD 4M21A 1U9IA 3N2IA 2EYQA 4G01B 1V43A 3U44B 4HLCA 2ORIA 1JJVA 5IT5A 2A3RA 4AYTA 2XTNA 5FUXA 3FB4A 4KFSA 2ZSAA 4IDHA 2CDNA 3MGCA 4Q1BA 1Z07A 4CYMA 1NY5A 4DCUA 2PCJA 4GPTA 3QQ5A 1SVOA 4E07A 4PC1A 5LD2C 1YR9A 4TYYA 3ZVMA 2IEYA 1DO0A 2IWHA 4HUQA 1FW6A 3VMFA 3THYB 3VFDA 4LZZA 4R2HA 3LBNA 4D82A 3QUSA 3AKYA 2BKUA 3IEUA 2V9PA 4PPNA 2OLKA 3PENA 2PZEA 2ANBA 3BFXA 3T1QA 2NO1A 4JVMA 2BWJA 4DLVA 4QBFA 3F3YA 1W5SA 3Q5EA 4IJMA 3FOZA 4JVNA 4XVRA 3CM0A 4E22A 3KJGA 1VG9B 4QOSA 4Q4LA 5P21A 4A2QA 1FZQA 1FL9A 1TPZA 4HB4A 4NCHA 4AI6A 1IHUA 4D4LA 4JSYA 4V0ME 1HUQA 1Q3TA 3D31A 3M4YA 4PQRA 1W0KA 2DPXA 2BBTA 4QJ4A 1G8GA 1DADA 4M1OA 1TF5A 1MRNA 1N5KA 3RRNA 1SVMA 2FZLA 1NF3A 3BJIC 5GJWC 1QF9A 1XD2B 1SGWA 1AK2A 2ZJ2A 2RGNA 5HR5A 4YLGA 3NEJA 2H18A 3B13B 3W9YA 5AUOB 4Y0AA 4W5HA 3NH9A 3VQTA 1NIJA 1NRJB 1FUUA 1ZC3A 3SN6A 1OE0A 3AF0A 4PAQA 3H84A 1KI7A 3H1TA 2ZROA 1CU1A 2F43B 3EAQA 5TB5A 3TH5A 4XWOA 1UBGA 3GMTA 1U99A 3VR1A 1M7HA 2CL7X 5JJLA 2QORA 2R6AA 5JSZB 2RH5A 1Q20A 3HYRA 2ZIAA 4LDJA 4DCNA 1QRAA 1EK0A 4L9SA 2K5UA 3I72A 4W5WA 1HV8A 2CCKA 3HU1A 4B33A 3U61B 3MSXA 3QXHA 1E2FA 4PHHA 4BFUA 2DCUA 1ANKA 2HXSA 1KZ7B 1E2HA 2AD1A 5J4YA 1YZLA 2Q9AA 3KFVA 4YDHB 2PJZA 3WMFA 1IXSB 1GTVA 1VHTA 1EWQA 1WCV1 3OEED 5TXGA 1WRBA 4C0KA 4LC0A 3SU8A 4MRPA 1S9HA 2GEVA 3ICQB 3SYLA 2C95A 3QKSA 4O0MA 1W0JA 1S8FA 2QAGA 4UNRA 2OSBA 3B60A 2BM0A 3MMPA 4POAA 3Q7PA 4R98A 5JI3E 1KJYA 4OI4A 2ZRBA 3R8CA 3I5XA 3QVUA 3U4QA 4LBYA 3MRSA 1WXQA 4BFZA 5JEEA 4O2RA 1N6KA 4LRWA 3U44A 4XD7A 4FMBB 3RABA 3N70A 1O87A 1KTVA 1UBFA 3U7FB 2CHVA 3BH6A 2H8KA 5EXTA 4DDWA 3SJZA 1G41A 3QJYA 1MOZA 3W3ZB 5FL7D 2J0QA 4C3ZA 3QKTA 4PQFA 3TUIC 1OXSC 4ZKDA 1ZMXA 3EG5A 4OHZA 2AK2A 3LA6A 2GCNA 1Z63A 4DRZA 2ZI9A 4N1AA 1BIFA 4GZLA 3EPLA 1CP2A 2QMEA 1P62B 1UKYA 5GJVC 1TUIA 2YJTD 1CJMA 1PLJA 3CNLA 5B2ZA 2FN4A 5TMPA 3THYA 4DSNA 1F60A 2PL3A 2L0XA 5JBQA 1TQ6A 1ZNXA 4ZI3A 3LD9A 4GP6A 1Z5ZA 1RW4A 1AS3A 1GKUB 4ARZA 2GZHA 4CT4B 5FL3A 4S2EA 5AUPB 2IXEA 3CWQA 2W0SA 3A58B 1W44A 4PFSA 2XJ9A 5KNBA 1FMLA 3OIUA 3NXSA 1G4UR 1VIAA 3B78A 4JMPA 1COWA 3EWSA 4DLSA 5F9HA 1GKYA 1YR7A 5FTNA 2BOVA 3MAAC 4AKGA 1ZM9A 4PAOA 4QGHA 4RD3A 3TR5A 4G5OA 4YMWA 1LFDB 4HAZA 2REBA 3QE0A 3ICEA 1PUJA 1TUEA 4QNRA 3MLEA 1GNRA 1II8A 1AM4D 1KO5A 2G0NA 3FMPB 5D3QA 3KQUA 3D3QA 2BBSA 3VTKA 1AS2A 3GFOA 1M2OB 5DNYB 1OXVA 3KX2A 1DBSA 1VYUA 1W7AA 5F3WB 2C78A 2QM8A 2ZSBA 2DFLA 4RFSB 2H7VA 2WHXA 1OT3A 1NG1A 1TEVA 3WRXC 3B9PA 2ZRJA 2AWOA 4E09A 3DMDA 1JB1A 2AX4A 2Q9BA 1L7VC 5IHPA 4MKFA 2OCYC 1P61B 2DB3A 1H65A 3ASZA 5FTJA 4G3XA 2VP5A 1Q1ZA 4CEIB 3AVXA 2Z0MA 1RJ9B 1S0UA 4UJ5A 3NG1A 4JLDA 3SBDA 4Q9HA 1P2UA 5EE9A 2FWRA 1HE1C 2AXNA 3ADKA 1NLFA 2IEZA 4DIEA 1NVVR 1G17A 1D2NA 3HPQA 3SJAA 4ZDKA 5HKKA 5TVKA 1Z8FA 3P27A 1WDTA 2ZRIA 1YE8A 4RZXA 1R10A 2ZS7A 3GLHB 3NVAA 3QPVA 4NYJQ 4NCNA 3TGPA 4K81B 4JVSB 1AZSC 2EW1A 2W2TA 1MR3F 4JLPA 2ONJA 3RNLA 2BMFA 2GA8A 2NGRA 3ETLA 3PUWA 4YMUA 4G5QA 2NPIA 3FKSA 4QXAA 5EP2A 3CPJB 1TF7A 4BLSA 4DLWA 4A0FA 3ZZ0A 3C5HA 3O8RA 4LHZA 1SVIA 4DCSA 3KTAB 1NN1A 4FWIB 2DY1A 1Z08A 3UWKA 2ZUCA 5AUNB 1S3GA 1XJCA 1GITA 4PR0A 5FOTA 1G4AE 1TEXA 1HE8B 4TLCA 3RWMB 2RGBA 1PV4A 1FQKA 2OBMA 1OPXA 1TQDA 3C14C 3K0EA 4URVR 2WM9B 3NHBA 3K70B 1YQTA 5KU1A 221PA 2ZJZA 5G3YA 1QHHB 4A92A 3GFTA 4EFLA 2EU8A 1CR4A 3LX8A 1S1MA 4DDTA 3QG1A 4HB2A 2IA5A 4BZQA 3V4FA 3CF0A 4PPQA 3CIOA 2AKAB 2NMVA 4P4SB 4JL6A 1OLOA 1EX7A 4PAMA 4FIDA 2CHGA 4JLJA 1P75A 3QEOA 1DO2A 4D4KA 1EG7A 1HQCA 1IM2A 4LWZA 4AKIA 2ZI3A 5DLQC 1YRBA 1BYIA 2GAOA 4DLZA 1OH6A 5JECA 3P32A 1W0JD 1K5GA 4QBIA 2PZFA 3FE2A 4LUCA 4IEIA 2V6IA 1RZ3A 3UMFA 3UG6A 3RC8A 1OF1A 3RDPA 4Q7MB 3PEYA 1W46A 4W7SA 3PEUA 2C9YA 4Z51A 1G3MA 2D2FA 3QKRB 1U0LA 3WHLA 5C1BA 3TVTA 1ZNYA 4XD7D 4ABYA 1JECA 2GWHA 4BGDA 5C4GB 1E9FA 1KNXA 2W6JA 4PHTA 2X8AA 3T1TA 4IFBA 3K0FB 2OCPA 1ZIPA 3SFZA 1SVLA 3WP0A 3TQFA 4D0LB 3ZS8A 1CR0A 2Q0HA 1NSFA 1XTIA 1XRJA 3EPHA 2PT5A 3PR1A 1J70A 2QBYB 1XP8A 2ZSEA 3LDAA 2ZYWX 1OYWA 4I99A 1ZAKA 1SXJA 4EPRA 1DOAA 2DFKB 2EFHB 3Q72A 4JJZA 1ONBA 4NU0A 2J1LA 5FPYA 4RZ2A 1RRCA 3PCRB 2UKDA 3K0CA 2OILA 4PO8A 4GMDA 3F0TA 2HT6A 3FDIA 3C4JA 4NTZA 3EPJA 2P6NA 3A1UA 4JIMA 5CIQA 1GM5A 4KFUA 5BWMA 1QVRA 1YRAA 4TYQA 3CRRA 1XPUA 5KSOA 3PIRA 4UQOA 4ACBA 4MKGA 3RANA 2VHCA 2J0UA 1COWD 2VYFA 4B3FX 1E2GA 3GLHA 5TV2A 3I62A 1V5WA 4AY2A 4D26A 1IN8A 621PA 1CKEA 1DG3A 3AEZA 3HWSA 1OXUA 2V4ZA 5DH9A 4A8JC 4DCTA 3ZD7A 1Q1QA 3VHLB 2CHQA 3PUYA 1G8FA 1XTQA 3RYTC 4BECA 2P2LA 4WA7A 4GDFA 1NN0A 4QGGA 2OLJA 5KSYA 2OXRA 3AKEA 3AUYA 2JLRA 1TTTA 3BORA 1HH4A 2ZRGA 1G20E 4OQNA 5G53C 3KTAA 2X2EA 3FVQA 2FEOA 3DM9B 2OAQ1 4ACAA 1MABB 3DKVA 1P2SA 2KWIA 3O8DA 5CB6A 4A0GA 1IN4A 1N0VC 2J41A 4FMCB 1TU3A 4IVPA 5L3QB 3GD7A 5KDDA 1OXTA 3EA5A 4NE2A 1EFCA 4BPBA 1RE0A 1ZYUA 2ZE5A 4LYFA 1UFQA 3SE0A 2E1RA 2PMKA 1UKZA 4F4JA 2FU5C 3QBTA 1M7BA 3K0AB 3NBXX 3IQWA 4ZV4A 3ZZUA 3EIQA 4Z8XA 1XPOA 4L15A 4AK9A 3P26A 2IYUA 4MITA 3DMNA 3L0OA 1NIPA 4PC3A 3R9XA 3HU2A 4JS0A 1I4LD 3W6PA 1R8SA 1TF2A 2V7QA 3GEEA 1FTNA 3FKQA 1XCMA 1BS1A 4BQSA 3H0KA 3H2YA 2J5XA 2FJUA 5LDDC 1E9EA 1KI8A 1VHLA 2VIIA 1GSIA 4M8NE 2W0MA 1CS4C 2ZRHA 4B3XA 3AH8A 3VU9A 4MGIR 4TL7A 2CNWA 2BHRA 2GETA 3EIHA 4EFMA 4WZBE 3D7MA 4Q4AA 2GBLC 1IN6A 3DOEA 4LK2A 4U5XA 3FFBA 3FKSD 4EPWA 3QKRA 5G41A 1HURA 2YWGA 4PTLA 4Q47A 4V03A 4KLNA 4P3YA 3KXKA 3HJNA 3R9WA 4WIAA 3NBZC 3AGQA 3IBYA 1G8YA 2REXB 4C0BA 5JFGA 2F3RA 2Q3HA 3UIEA 5C4MA 1KO8A 1VCOA 3SJBA 5EE0A 3QF4B 2NO6A 2ZI4A 1N25A 3G82C 1FPMA 3DPUA 3DVLA 2CLSA 4C0SA 1SHZA 4D4MA 4F38A 1Q3HA 1ZP6A 4BE7B 1IN5A 2NO0A 4M9QA 2O8CA 3X1ZA 1XEFA 4CF7A 3FFAA 4NYMR 3W5JA 1XXHB 3CPEA 2IW3A 2ZYUX 3PV0A 3OAAA 4KYIB 4RD6A 4M4SA 3IUYA 1FQJA 1XDBA 2WJIA 4GOKA 3CLVA 1E96A 2OXCA 3HU3A 2OM2A 3Q5DA 4EJSA 2C2HA 2KSQA 1DAEA 3UMRA 3MG9A 1N2CE 1E9CA 3LY5A 4AURA 1G6OA 4IEEA 5FI1B 5FTMA 3BOSA 1KZGB 4QFMA 1Z47A 4LBVA 4Z1MA 5E3HA 4IOMA 1DG1G 1JXOA 1LB1B 4GI7A 3X1XA 3L43A 3LBIA 4D81A 4TYNA 2VL7A 2AN9A 2ZS9A 3OEHD 4XTCS 4IHQA 2QGNA 4BEBA 3OE7A 1NBMA 2YC4C 4L8GA 5HCNA 5DI9A 1U9IC 5L8VA 4DHEA 3CUEF 3EARA 1T9HA 2PCLA 4KVGA 1KSFX 4BEJA 1E9RA 4B73A 2FV8A 5DISB 1MABA 2BC9A 2WJJA 3IO3A 4X8OA 3ZIAA 4M9XA 5BN5A 5DE3A 1A5TA 1G16A 4JL8A 3Q3JB 1A2KC 3NEYA 4P32A 4F93B 5FTLA 3SQWA 1EX6A 3IHWA 2PLFA 1I2MA 4A0RA 2P65A 2ZSFA 2QSYA 3JZMA 3AP3A 5BN3A 1G9XA 3OIVA 1SXJD 3OHMA 5DYGA 5EQTA 3U6BA 2OBNA 4LCBA 3A4NA 2NZJA 3K0AA 4TLAA 5GVSA 5L3SB 3VKGA 3FGNA 3ZVNA 3ECCA 4IXMA 5CJPA 1U0JA 2ZE7A 1AQUA 1SULA 3TSWA 4PPFA 5IF9A 2IUUA 4RD4A 4PSKA 1R2QA 5JCPA 3AF2A 3K1JA 4PC2A 5FFMA 1GZSA 1EFRA 1MO6A 1JAHA 5FL7A 2O8BA 4MUBA 4A1FA 4GP7A 3U3JA 3QOFA 2AK3A 1SKYB 3DEFA 4GZMA 4OJQA 1NVXQ 3CX8A 2OAP1 3QY0A 2ZREA 3C8UA 1CEEA 3EZ2A 2OEPA 4NCJA 5DSZA 2HYDA 1Z2AA 5B30A 1IN7A 2UZIR 5G3ZA 5J47A 4J0QA 4X8MA 1D2MA 4KBFA 5F9FA 3K9HA 3QI2A 3WYAA 2RMKA 2J7PA 4JBXA 2RGNC 4V0MA 4KAXA 5FBRB 1W36B 2G1JA 4L9WA 2OG2A 1G5TA 1LS6A 1P7CA 1UEIA 3P1JA 4GT1A 3I1FA 4NPHA 3VR6A 3TW8B 4PZZA 3REFA 4TMVA 4F7WA 1MH1A 4KI0A 3QF4A 4EPXA 2P6RA 2GF9A 3ADDA 3B1XA 3GPLA 3DM5A 2C99A 4YC7A 1KK1A 2F7SA 3FMFA 5FPTA 2I3BA 4V0OA 3G5UA 3TK1A 5AWFC 2JATA 2P3SA 1E4VA 2H57A 2J46A 5BYJA 4UNNA 3CW2A 4HLUA 4C0LA 1X1SA 3AKDA 3QXCA 1IY1A 1TX4B 4HZUA 2E9SA 3MWYW 3CWZA 3IBGA 5FOVA 3BE4A 4OQLA 1E2IA 3L0SA 5J4KA 4K8OA 2N46A 4WBSA 1Z06A 2EWVA 2QRZA 4P4TA 4DKXA 3EPKA 1KMHB 2QY9A 3Q85A 1OW3B 3GLGB 1T4GA 4NH0A 4M2LA 2EYUA 2V7QD 2VLIA 4JVLA 3GLIB 3E1SA 2ECKA 1IXRC 5LD2B 2GCPA 5AJZA 4DEXA 3Q7QA 5KPDA 3KZ1E 4IOJA 2R6FA 1E94E 1T5LA 2J7KA 3VR4A 3V4RA 4A15A 3CF2A 2YWHA 3BB3A 1GP2A 1N5JA 4HDCA 4KCGA 4M0LA 1R0YA 4JT2A 2XNSA 2FEMA 5DI3B 3LVQE 2J45A 2BBWA 2CNWD 3AF1A 2BCJQ 2QPAA 3IGFA 4FMDB 5CITA 1DELA 1FMJA 1XCGB 3X1DA 1QVAA 4ESVA 2BDTA 5BN4A 2DYKA 3EW9A 2BV3A 1ZUIA 1EFHA 2ZJBA 4PXAA 5HPYB 4Q9LA 3CNNA 3R7WB 4IDPA 3AVOA 4BRUA 5B58C 1NG9A 4ZCLA 1NKTA 2ZI6A 3EC2A 4CRWB 3CF6R 3QG5A 2Z5FA 5CK4A 1KI4A 1M8PA 1Z29A 1Z83A 3CRVA 1CJTC 3ZQ6A 3K09C 1YZNA 2IYZA 4A82A 1VPLA 3I92A 1FX0B 4EQ6A 5L3SA 4MRNA 4AKHA 2D62A 4O25A 4PHGA 4IOKA 1F2UB 2VHQA 2IWRA 4B2LA 3KXIA 5L3VA 3PG5A 3A4LA 4FXPA 3OAAD 4IW3B 4Q1CA 1KY2A 3PUZA 4UNPA 3THXB 2D2EA 1ZRHA 4OI0A 2OCAA 2Z83A 3KKQA 1DEKA 2O0HA 4LJ5A 5FBLB 2IS2A 2OBLA 1G3IA 1LY1A 3R8FA 4NMMA 3DHWC 1XD8A 1XXHE 2BMEA 4H1VA 2HUPA 2A2ZA 2O0JA 1G5PA 3ZDQA 2IHBA 3SNHA 3VR2A 4LX0A 4LPSA 4AG6A 4Z1MD 4MDEA 1GUAA 4UXJA 2XNDA 3WXMA 1DAMA 3DO6A 1ZINA 2BVNA 2GTPA 2A5DA 2WJGA 2AFHE 1F2TB 4HB0A 2FG5A 2YKGA 4JLKA 2FFHA 3OE7D 1NBMD 5FOUA 3QBVA 2NO9A 1G5RA 3BIFA 1E2KA 4BLPA 3PXGA 3AVQA 1XB2A 1GIAA 4Q9KA 2JJ2A 1Q22A 4AG5A 1E2PA 3ZIAD 3TUJC 5EE1A 2YWFA 1UAAA 1MT0A 3SYNA 4OBEA 1JQLB 2GHIA 4QHYA 2W6IA 2J0SA 2ATXA 4TLDA 1TNDA 4WOPA 2RGDA 3EZFA 1XFAA 2R6GA 3UWOA 3ZVRA 2QQ0A 5CB8A 5C18A 5AUQA 2XEXA 3CR7A 1VKJA 4C9BA 1E1QA 1KSJA 5CJ2A 1XCPA 1YZUA 2XOKA 2WKRA 4HAXA 4DCVA 3SFVA 2VP6A 1KY3A 2HXYA 4KBGA 2R2AA 4RKFA 3MCAA 3GLGA 1LW7A 1YVDA 3CH5A 4HZIA 1Z0FA 3A1WA 2EQBA 2V6JA 1EFRD 2AKYA 5DO9A 1U81A 1UDXA 2CBZA 2IYQA 2FNAA 1Z0KA 4IRUB 2B7CA 1YHNA 4LGMA 2ZM5A 2ODWA 1A4RA 1P73A 1P72A 3C7KA 2JASA 3VR3A 4HAUA 1E0AA 2VP0A 3S1AB 1E98A 4NYJR 4B2IA 3P20A 2QNRA 3SS8A 2ERYA 4I1OA 4TT3D 3GJXC 5SZHB 1CIPA 3T5GA 2IYXA 1SKYE 4ZCMA 2J7PD 1GRNA 3L8ZA 4NYIQ 3R7WA 5JWRA 1ESMA 2R62A 3TBKA 4M22A 4H9GA 1CR1A 1W4BA 3ZGXA 3CB4A 1VYTA 5C2JB 5EUQB 5GADl 4BLOA 1II9A 4FCVA 1QHGA 3LX5A 1Q21A 1RC8A 2FFAA 3U7HB 1YZKA 2FSHA 3RWOA 2ZAOA 1TAGA 5KDOA 2DWOA 1GOTA 4S35A 5TARA 1Y3AA 4E5UA 2JLYA 1IQPA 1E2LA 1XEWX 1F2UA 3VHXA 2H92A 3W8NA 4A9AA 2IYVA 1T8TA 3TJZA 4EPYA 1XD2A 2WSSA 5EZ5A 3CZPA 2ZRLA 3FMIA 4GNKA 1F3OA 2W58A 2F9MA 1JBKA 2FFBA 4JT4A 5BQ5A 4YMSA 2HEIA 4F91B 1XEWY 5HZKA 5F98A 3KQKA 1GKIA 3CH4B 1BYUA 2F43A 3ADCA 5SZJA 2VP2A 1HTWA 3GJ7A 3AUXA 3PVSA 2OFXA 3TQCA 1U98A 1MO4A 1Q57A 1GWNA 3NWJA 2JJ1D 2WWFA 5JSZA 5KOYA 3AM1A 4UJ3A 1T3LA 4KFTA 1RIFA 3AB3A 4N0EA 4MGZR 3GLGE 3QXSA 1LNZA 2RGCA 2CL6X 3PITA 4URWR 4Q03A 1HEIA 3GLIE 2GJKA 4MQBA 1XD9A 2C5LA 3TW4A 4XSGA 4AC9A 1E2EA 3VNVA 3UK6A 4BASA 1XTRA 2ZI7A 5KPJA 1NMXA 3L8YA 5K8TA 5EXPA 4MRSA 4F92B 4KYUA 1GILA 2IYRA 1L4UA 2G1KA 1HA3A 1OFHA 2IYWA 1E9BA 1SVWA 3V00A 4LJYA 1DAKA 1VTKA 2AR7A 5FR1A 4ZIRB 1FNMA 1CJUC 1YJ5A 2IF2A 4ITRC 4RD2A 1OHHD 2FMXA 2PLRA 1T91A 2ZQ5A 3WHKA 4US0R 2QP4A 2O5VA 1J90A 4OHWA 1UDWA 4B3BA 4OQXA 4B35A 5CLLA 4IKEA 4B2PA 1YZTA 4JLMA 2CEAA 4CT5A 4WVFA 1WB9A 2H16A 1OFUX 2HJVA 5FR2A 1B0UA 4PSAA 1OIXA 2O8FB 2BBOA 3AP2A 3BERA 5JS7A 1IJEA 1XWIA 2F1JA 4WZ6A 1JPJA 2YV5A 4EPTA 6Q21A 3IPYA 2ZJ8A 4QG7A 1UKEA 4GMXA 1KK3A 3AVPA 4U02A 1SVSA 4BRWA 4LOAA 4B44A 4DT1B 1QG2A 1SQ5A 5EJEA 3SHFA 4GFDA 2FA9A 3B1VA 1E2QA 5KUTA 2GXAA 3KFXA 3TSOA 2QTVB 2XNDD 2V1UA 3IIJA 2DWPA 5LBIA 2X2FA 4B74A 1X86B 2LCFA 4R71A 5FOXA 1N0WA 4CDGA 1W36D 4KITB 1ZUNB 3X2SA 1P9RA 5JLJA 1ZU4A 2EFEB 5E95A 4Q9IA 3PUXA 2JJ2D 4OJKA 3TSZA 4AKEA 4OHYA 1LS1A 4B34A 1RRPA 1SVKA 1E0SA 4G5RA 4TL9A 3RVBA 1KK0A 2H1LA 2Z4RA 4MGYR 2QM7A 2WICA 1NVWQ 4MYHA 1T5IA 2F6RA 2W6ID 4MRRA 2E87A 2OCBA 2OV2A 1EXMA 1EGAA 2PEYA 2VF8A 2Q6TA 2A78A 4KJZA 1D9ZA 1ZUHA 4MYCA 1R0WA 3OEHA 4KFRA 4D0NA 1J7KA 2CE2X 3SI7A 3U7EB 1E1QD 1KJWA 1CLUA 2Z4SA 2XOKD 2PEZA 1NMZA 3T06B 1M74A 1JI0A 3TAUA 3FHOA 4DBLC 1MO5A 3HP1A 1WF3A 4HB3A 3LRPA 2B6HA 4LJ8A 2R6DA 4X8LA 4LJ9A 2X77A 3TNFA 4NHOA 4CEHB 2QMOA 1EWRA 4RFSA 4G5SA 2FPKA 2KI5A 3KUCA 4XTRA 2WJVA 4NP6A 4RCYA 3W6OA 2ORVA 1X1RA 1E32A 2ONKA 2ZPTX 4Q02A 3UATA 4PPGA 2HLDD 1KKMA 4BLTA 3UANA 3EASA 1QHXA 2DBYA 4D80A 1VG0B 2ORWA 1YR6A 1UPTA 3KXLA 4TL8A 1G3QA 4CEIA 721PA 2JLZA 3ZQJA 1RJ9A 2HJGA 2WMNB 4B32A 2G83A 1W5TA 5CDFE 4TTQA 1ZM4A 4MA4A 3AF4A 1W1WA 2GRJA 4IDQA 1OXXK 4LV6A 2WWYA 2ZRMA 2CMKA 3CO5A 3HYTA 1EFUA 4PO9A 4LHWA 4JKYA 4NL4H 3T1VA 3THOA 1P9WA 4A8JB 4HDQB 2QTHA 1KYIA 2JLUA 3ASYA 4FW9A 1CJVC 3SYKA 2IYSA 4P31A 4Q4JB 5F2EA 2BJWA 3OFNA 4KV9A 2MSEB 2FF7A 2QGZA 4JLVA 5DYIA 3BH7A 3U3KA 1UF9A 1NY6A 2EWWA 1RFLA 2CLDX 4XIGS 1W49A 2NIPA 2WSSD 2NG1A 4C2TA 4LJ6A 1G8HA 4HAWA 2KJQA 4DLYA 1N6RA 1J2JA 4B6FA 4PC7A 2O8FA 1IAQA 2GCOB 2WWIA 1H8HA 5B64A 4EJSC 2AFIE 1KK2A 4F4IA 3LWNA 2F1HA 1SHKA 1KAOA 4BFVA 3KJEA 1VDZA 2W83A 2ZJYA 3LQQA 3W5IA 2VHTA 2QT0A 1VCMA 3MWJA 5EXXA 4A36A 1E2DA 3TVDA 1DAHA 1Z6YA 1QHHA 3BRWD 2AHOA 3ADBA 4A6PA 1N0UA 3MWLA 3J81k 2QAJA 3TE6A 3UG7A 3WP1B 4B47A 3BB4A 2ZU0C 2VEDA 4IVRA 3K0SA 1FP6A 3I8SA 4FD2A 2PH1A 3M6AA 4P4SA 2RGXA 3GCGA 2ZRNA 1U2RA 2O8EB 2G9NA 3KJIA 3WBJA 1MRSA 4KLZA 3RAPR 1LVGA 2QPTA 1A2BA 1TU4A 5DGXA 1W4AA 1ODFA 4A0HA 4DSOA 2AWNA 4HEJA 4UXHA 2ZVPX 1QHSA 2FGJA 1ZCAA 2YHSA 5H8WA 1KI3A 1N3BA 4C30A 3LFUA 3HR8A 2WMOB 4BFWA 3ONWA 4RY2A 1P60A 2BM1A 4TMZA 1N6NA 3DZDA 5K8IA 4MYUA 4I4LA 2CE7A 5FPKA 2W2VA 2Q3FA 1NMYA 1I2DA 1Q12A 1OH7A 1E1RD 4DEYA 2GJAA 2WAXA 1QDEA 4JYBA 5AJVB 3N5CA 4URXR 1ZCBA 3IDQA 3KL4A 1ESNA 3K0FA 5JWOA 2N1BA 3C5CA 1RRFA 2QG6A 4RD0A 3EIEA 4NCKA 1T0JB 4C4PA 5CK5A 1QHYA 2CCJA 1LTQA 2QBYA 1ZD1A 4LHXA 3WMGA 1J8MF 2WKQA 2RAPA 2IS6A 2BIFA 5CYOA 3TIFA 3KQLA 3CX6A 2XZOA 3AGPA 3NKVA 1XU4A 1QBKC 1KO4A 2ZS8A 2KE5A 2V1XA 1ZVQA 2WVJA 4TYPA 2PZGA 1G64A 2B8TA 2ZJOA 4C2UA 3W8RA 5DN6A 4PC6A 4WW0A 5JS8A 3KKNA 5G40A 1UKVY 4LSGA 1K8RA 3DL0A 4LHYA 4GRAA 3K9GA 1KJZA 3B85A 4EUNA 2CJWB 3SC3A 1G7TA 5H70A 1ZW6A 2KB0A 4OI1A 1HT2E 4B3CA 1JR3E 4HAYA 2WWXA 4QHTA 4UNQA 1OH5A 3ZLJA 1KO1A 2A5YB 3E70C 4A8JA 3O8CA 1U8ZA 2X19A 3U3RA 2MSCB 2BEJA 4LJ4A 1T0HB 1W48A 1W4CA 3EZ9A 3B6EA 4HLUC 1W2HA 3IQXA 4RCZA 2DWQA 3IIMA 4QM7A 2ZANA 4B76A 3UXMA 1JEDA 2IUSA 4EFNA 2CLCX 3ZD6A 5ELXA 4NKRA 4B3DA 5LPNA 4TL6A 2Z6VA 5AJWA 4TWZA 4PQYA 5M04A 4BFYA 1HY3A 3CR8A 1XMSA 1IY0A 3PEWA 2A7QA 1G1MA 2IXFA 3LQRA 1I4TD 2ZETA 4C7OB 4JZKA 1K5DA 5AJYA 3EZ6A 5L3QA 1R8QA 3C41J 3ZZTA 3WNDA 4HUQB 1VIYA 2NOAA 4OK6A 4Q21A 4G5GA 1DAFA 1GL9B 2FGKA 4ZI2A 1KI2A 2F1IA 2PT7A 3N2EA 4XVQA 2V55B 3QSYA 4TMXA 2QZ4A 1AKYA 4NDZA 4QGFA 2NTYC 3VAAA 2ZRDA 1WP9A 1IJFA 4Q7LA 4RFVA 1WE2A 3OIYA 2WWGA 1IONA 3TLXA 2BKEA 3K8YA 2OFOA 3EC1A 1EESA 1Z6GA 3TMKA 5CLQA 4RSGA 4LPKA 2IYTA 2GAAA 3MJHA 2Y8EA 1BKDR 4Q1FA 4K46A 3REGA 5CYPA 3CRMA 1R7RA 3IKJA 4MH0R 5C46F 2Q3MA 3R9IA 1OV4A 2GBLA 2JEOA 4U00A 4EPVA 4U7DA 1IY2A 1P2VA 4IVQA 1DE0A 3I61A 1PJRA 4C0JA 5FBWB 1VG8A 1E9DA 3I4LA 3MWKA 3OFND 4TT3A 5KHOC 2GF0A 1CBUA 3B1YA 4HDOB 4ZDJA 1KIMA 3AKCA 5J4LA 1R5OA 3B2EA 3AQ4A 3IILA 1QHNA 2D7CA 3ND8A 3GLFE 5D3MB 3CZQA 4XH9B 1UJ2A 2RGGA 4IFEA 4LV5B 1H8HD 2WWHA 1D9XA 2YINC 3BXZA 2D7DA 1KMQA 1P4SA 4DJTA 5EZ6B 2HDNB 1YR8A 1AIPA 2VQSA 4JLOA 4V02A 5J40A 3B9QA 2WSMA 1ZM2A 2ZU6A 3KKMA 2FSIA 5JJIA 3K70D 3GJ8A 1A1VA 2C03A 3BB1A 3H4MA 4FMDF 1ZU5A 3K9NA 4YXWA 5A0FA 4ZPXA 4CZ2A 1R0ZA 1XF9A 1XXHA 3BAFA 1DTSA 5IK2A 3RS4A 1XPRA 2QEQA 1NP6A 3U3MA 4D4JA 1NSTA 1G18A 4MGKR 1M6NA 2O52A 5TY0A 2XX3A 1XTJA 4BWYA 2ZR0A 2RCNA 2VP4A 3QKSB 4YONB 1F48A 3QPUA 2QAGB 3Q9LA 2R44A 4G1UC 1P2TA 2AD5A 2B8WA 3TKLA 4DLTA 3QNUA 2JJ1A 1JPNA 1M34E 4R7ZA 2QAGC 1CRQA 3T61A 3U4QB 2PMDA 3B82A 5HE8A 3I73A 1ZM7A 3VNUA 2RGEA 2ZXUA 2Z43A 1G3UA 2YWEA 4LI0A 3VX3A 5L3RA 4D2IA 1CXZA 1AGPA 1R5NA 2CK3A 4JJKA 2GKSA 2IYYA 2CVHA 4TLEA 3MD0A
chains in the Genus database with same CATH superfamily
1KH2A 2OMEA 1MKYA 3BJMA 3G9XA 1M6WA 3L9WA 3NM6B 4K1XA 821PA 2AN1A 4NONA 3ZY2A 2GILA 4E5VA 4RF5A 1JZSA 5H16A 5AHKA 2CFSA 2WF8A 5IJAA 4MKIA 4Q4HB 1MXFA 5EKTA 1K2VN 1PT5A 3A36A 5F4BA 1AJEA 1Z18A 4S05A 1N6HA 3H7IA 3GJ3A 3PGJA 1QOZA 1A50B 4AJLA 5HZMA 1VCIA 1A9XA 1YV9A 5LC1A 3QVKA 2V6GA 3JTEA 2PQ0A 3Q15C 3JVVA 4PZLA 2RGYA 5FNVF 3VPDA 4H77A 3I9NA 5MGNA 3I2YX 4M9SA 1LPOA 2HV9A 2PXXA 3HHEA 1QK4A 1PG2A 3E81A 4Y9RA 1JX6A 2NT4A 4G84A 3SBOA 2XA9A 3CPHA 3PGA1 3S0JA 4K05A 4F5EA 1ZESA 1W2GA 1PT6A 3UEOA 3PWZA 4CIWA 1LQUA 2ZJ5A 4ZAZA 1R1DA 4X8HA 2XUQA 4E5DA 1Z4LA 3DHYA 5HKBA 4MRMA 3X1JA 1UPFA 1S2DA 3FFWA 4L4UA 2VAXA 1WM1A 2C04A 1CULC 4WOBA 2HOQA 3IODA 1T9GR 5EGSA 5EIFA 1MHPA 1P2BA 2WP8J 5ELLA 2NZ8A 5JQWA 3KJFA 4L76A 1GRCA 1SXIA 1VB5A 4KSBA 4RJ2A 4NDNE 5HFNA 3IDOA 3WGLA 4CE6A 4YAKA 4GI5A 5EEHA 2UZ1A 2VBGA 5WRFA 3R8XA 3LVFO 1SC1A 1SOWA 1EIZA 1Z68A 3CJQA 2O57A 3OCWA 1N5IA 2HJRA 3P2MA 3RUCA 4LHVA 5LR6A 1BRMA 2PDAA 3TR0A 4MSUA 3Q7TA 2R1UA 3QTBA 3O95A 1TK2A 4R9VA 1I8TA 3IKLA 4OTZA 2H5EA 3IOEA 2Q5HA 3GJSA 3QKUA 2JGDB 1XHFA 4DWWA 3WKCA 4TTPA 2WV7A 1PT9A 1VMAA 2J9FA 3G8DA 1XHEA 4IJ5A 2JI8A 2WE8A 5D3MA 1VXOA 2C2BA 3PNPA 3L79A 4DLXA 4UDOA 3AVYA 3DE1X 4L1KA 5F5LA 2EAUA 3TW8A 4Z7NB 3QVGA 3HM9A 2O6HA 4ER7A 2F3PA 1D5WA 2GPSA 2Q9CA 3W5BA 2FEAA 3GP3A 3B6JA 4JYAB 2ZYHA 4G0OA 3WDMA 5FWAA 1QF6A 2AMLA 1E60A 2V5AA 2IDKA 3ODGA 4ZCPA 2XUKA 4W9MC 1ADYA 3JQFA 4OGWA 5LQKA 2XYHA 3M33A 1OWOA 4MB2A 4L51A 2NP7A 3JQPA 5BORA 3AR9A 1EU1A 1HQKA 3PL1A 4V3CA 2TMGA 2LVBA 1YRYE 2WSYB 5FWXA 8ADHA 3WGVA 4XVCA 2C7PA 3S7TA 3DUFA 3C0KA 3BFJA 1U7HA 2LDXA 2P77A 1H22A 1LFAA 1HL7A 1WKVA 2QQEA 1V5FA 1QYWA 3GGCA 3KXDA 1JSCA 2QRNA 1VECA 3CPSA 2OHJA 3OC6A 4ZHQF 5B2EA 4M1YA 3U1VA 4JBHA 1UQTA 1YGPA 4OD0A 2YVUA 2DR3A 3GCWA 3W5HA 5ALKA 5IM5A 5JAQA 1M0WA 5EQDA 3B8HA 5FEUA 1A8IA 1LLQA 1A82A 1VGVA 1CFJA 3PIIA 2CGEA 1I4DD 3U7GA 3UQZA 4B79A 1OKKA 4WADA 4B4KA 2HLDA 1W47A 2GD2A 4FHCA 4DV4B 2Q2QA 2XZLA 4EVIA 3AVWA 5AJUA 4DJFC 1NQAO 1BO6A 1Y7HA 1PJZA 4HQOA 2P6UA 1J0CA 1UFOA 4M88A 1XZPA 4WN9A 1HQYE 4D44A 3G79A 3T1OA 4RIEA 3CX4A 2Q7XA 1K5HA 2GN4A 2WVGA 2I4IA 4TQUS 4EL5A 4NU5A 1CQWA 3GYBA 6REQB 2XXBA 3HVIA 1BE8A 1P5ZB 1V35A 4RGYA 1T2UA 1IWPB 3AHHA 3BMQB 1WR8A 4TV9A 1K08A 1XWFA 3TDKA 1NR7A 1QZXA 3NORA 4CMEC 5CX4A 1GYRA 1G4HA 2QSZA 2XQVA 3SE0A 3ZYZA 2RHMA 4IQFA 4EW1A 5JCOC 3ABRB 4YNBA 2VJBA 4MB0A 3WQRA 2DFTA 2VSFA 2WR8A 3KEFA 4XX1A 5HK9A 5JISA 4H1UA 5CGQB 3PFCA 3O3MB 3L0PA 4MYSA 4TSFA 4XDZA 4AD8A 2Z3VA 3MD9A 2Z6UA 2PPVA 3TG8A 4B7AA 3NIBA 4EHBA 1XMIA 1I24A 2FDXA 2YWBA 2F4NA 1MX3A 1C4OA 5GINE 4YXWD 1NDHA 5I7EA 2B1IA 3NONA 4G9EA 4LISA 3FYDA 1BMFA 1YBMA 5HUQA 5HNKA 2VNIA 3DMPA 1W19A 3MIIA 3R3VA 1QGYA 2C20A 1LKZA 6YASA 1JHPA 4DQXA 3VO8A 3F4LA 1UDBA 2I7TA 2JIMA 3H1BA 4Q34A 521PA 1R6AA 2P6OA 3ZOZA 3WGKA 4BLRA 4IIJA 3VH2A 3GVIA 1TAHA 1N5LA 2J5RA 3MLBA 2WHPB 1M67A 3LK6A 1Y89A 4MIOA 4JLNA 5FCDA 2R0QC 2Z9DA 2RD2A 4M8SA 2ACKA 4DLKA 1V47A 2OUIA 2ZUWA 3L0BA 4R2IA 3PLRA 5TDHA 3TEMA 1B73A 3BKWA 1XEXA 2P3QA 3R6LA 1A69A 1JDJA 4Z86A 5CVDA 3BRWA 3SX2A 5B3JA 5C51B 2BP7B 2GJ9A 2BH9A 4UOEA 5DZSA 1GTRA 3OH8A 3VYVA 4LYAA 1PK9A 5EPOA 3EQ2A 4IDOA 3CIFA 5EZQA 3LRTA 1ZK0A 1FYWA 3CLSD 4AFNA 4Y2XA 4FIZA 3TDMA 2OR3A 4OSEA 1O6CA 2CLMB 1Z0IA 1PZNA 3DXFA 1LDYA 1I5EA 3TNDA 3MS7A 3SOPA 1KYVA 2A1TS 3FMOB 3BXHA 2FZEA 4FEYA 4MPPA 4QBGB 4UM7A 4F4DA 5EJ7A 3H9QA 2B2CA 5K99A 1AY0A 1SXJB 2XT0A 1T8UA 1ADJA 1MF7A 3NHAA 4GRIA 4D79A 1D07A 1G6HA 1D4ZA 1Z16A 2OO7A 1E4EA 3EEBA 3LH5A 3NNNA 3PFIA 2ZM6B 5JCZA 1Q7BA 3K92A 2BAGA 1XLUA 4KODA 2JVKA 4JKIA 1L1FA 1TDJA 1RS0A 5BURA 2Q5LA 2WG0A 2D7JA 2PV0A 4FFBB 2D8AA 3BWDD 4UKDA 2CBGA 2ESRA 3L6DA 1KDPA 1CVLA 2FLKA 1GKLA 1ZG3A 3G5TA 3GJ0A 3ZDXB 5DDIP 3WB0A 1H2HA 2P7HA 1ISHA 2QE7A 5KTMA 1ZEMA 2DHRA 1BWQA 1R4AA 2J08A 3TD2A 2ZSDA 1MV5A 2W2XA 5AVQA 1CRPA 1RP1A 1DCTA 2ZDGA 2P1RA 3LVRE 5GJBA 3KZVA 4ASUA 2GEUA 3WLRA 4UPEA 3U60B 1M0TA 1W0KD 4HH4A 3LQ1A 5KWVA 1IZ7A 1Y1KE 1ZJZA 3HO8A 3L82B 4HDNA 2X0FA 5BR1A 1KI9A 3BMNA 2JD0A 1RQLA 4O4HA 2LIVA 2DUWA 2O2SA 4JB8A 2VXYA 1N2IA 4IJUA 1XMVA 4NS1A 2JLWA 4DJAA 3BIJA 2RAVA 1Z74A 4X94A 1Z35A 4M1TA 3VPFA 3ADPA 3W9BA 4RK7A 4XVUA 1BMDA 1I80A 1Z3IX 3NFYA 3GJRA 2DZDA 4V0KA 5HTOA 2FMFA 1T8PA 4MLZA 3A1CA 3BWCA 2QT1A 3IV7A 4M1MA 3S8YA 2FB9A 2QM3A 2OGWA 4WTOA 3EXG1 1G21E 3O47A 4FJ2A 4ZDWA 4B75A 4F6LA 5ADWA 4RTJA 1XZQA 3NKFA 2WINI 1S89A 4ZRNA 1CB7A 2PRKA 1T4BA 1LWOA 3B70A 3DKIA 1A8HA 2HADA 2DVMA 3KR9A 4XDYA 3KUKA 2QDKA 4KGZA 1I6WA 3TE7A 4JC8A 1S7GA 2PL9A 4F9EA 1ULAA 5C8VA 5HKAA 1GNQA 4CU2A 1HYQA 4BYGA 5K9ZA 2JFGA 3F78A 4J0KA 2FW1A 1Z38A 2QRJA 4J16C 1Z0DA 4H1HA 4OQYA 4ZQCB 3LECA 5F7OA 4QUGA 3I32A 3HP7A 4LNHA 1GRRA 4HP8A 2I4LA 3SZRA 4EENA 4YR7A 4RS3A 5MDHA 3IH5A 4QFBA 5L4NA 3HU5A 2XHEA 1VPWA 1WB4A 4E0BA 3SSMA 1ZIYA 2RKOA 3P9PA 2IOQA 4O2AF 5THKA 3DBVO 3C7DB 2HV8A 1UT5A 1DBWA 3G7NA 1L4MA 3GCZA 3EVDA 4Q5IA 3SY8A 2D4HA 2L19A 4FDLA 3E8SA 2WDZA 3SZOA 3VI3B 3NWEA 4TN5A 2ZQZA 2B1RA 5J4HA 2AI2A 2INGX 3PFNA 4NOJA 1WUHS 2WHEA 2C77A 3H6KA 3UKDA 2ASEA 5CA1A 1OWPA 3HA7A 1QFYA 1SXGA 2RHDA 4GOXA 2D0IA 1PUIA 3SXPA 1NTRA 1A8PA 4YJHA 3S2UA 2ACWA 3D1JA 3BTUA 1PJ2A 3U4HA 1GT91 2VNAA 4M9ZA 3A1TA 2O23A 3HGTA 3F5FA 3OM8A 1EB9A 2J6BA 1BXKA 3C6KA 3SDSA 1FC0A 1FU7A 4ZEXA 3Q6MA 4AULA 3THWA 1QRTA 3AVTA 3HJRA 2UZAA 4RY9A 5AKYA 3UQYS 3V1YA 1FLNA 2FUNB 3BYZA 1JALA 2B35A 4BGEA 3G8CA 4CTMA 1DWOA 3H18A 5I7VA 3OTOB 3T8YA 1QFSA 2WBLC 4MICA 5DXFA 5CIYA 1UBSB 3B1ZA 2B8EA 2HWYA 2HMSA 3A8TA 4S0XA 2XJ4A 4UFOA 2DUNA 2HCJB 1NV9A 1QYVA 3CZRA 2HJWA 1AZTA 3PPXA 2PWAA 3A04A 1KBOA 3SZGA 3KYCB 1D1QA 1E1CB 4GGMX 3WDLA 4XOIA 1VE5A 3GLFB 1YC2A 1YQWA 3KKEA 4X63A 1T2CA 2M2IA 2OBBA 4CKEB 3JQGB 5FADA 4ZPJA 3UMSA 4C7JA 5C8YF 4DR2B 4DABA 4MHOA 4HCJA 1DOZA 4CIDA 5LXTF 3R1IA 1JGTA 5A7GA 3A6PC 4EKDA 2YV3A 2IEBA 1J97A 1RKVA 2WABA 1UJNA 3LUGA 5H4HA 4PFJA 3GEIA 1D1PA 2P11A 4RTRA 1U1DA 4ZT5A 1JU9A 3K9FC 4OUDB 3EA0A 3ROMA 1WUKS 4PXYA 4JBGA 3R7BA 1NR5A 2PBLA 2V59A 3W7BA 3WXBA 4IDBA 5ICCA 4X62B 5SZIA 4UDXX 1RQXA 2MSLA 5AHXA 1BHQ1 3DBLA 1MOQA 5M34A 2X86A 2X0DA 1Z45A 2YC2C 4E2WA 2PS1A 2G5PA 1Z5UA 3NBYC 3LW8A 1J07A 1KQOA 1PR3A 1R6BX 3L7CA 1US8A 1GLVA 4I55B 4WK0B 3I3SR 3T7KA 5KQLA 2PX2A 4Q19A 3LYLA 1TQ2A 2C5SA 2K6GA 4XPIA 3EMKA 1QYRA 2YOGA 1XNGA 1D2EA 2FE4A 3HABA 1JR3A 4IDCA 4UVEA 4S1PA 3JZDA 4GSYA 4JBYA 3TZKA 4Z54A 5I4CA 1TO1E 3AIOA 3OX4A 3QF7A 2YJ5A 5L45A 3BHIA 3U4IA 1Y42X 3ORQA 2UUPA 2OQIA 1E3LA 4NBKA 5DHSA 4FFWA 1NI3A 5DRTA 2EBWA 1NRXA 2EZ8A 5HIIA 2QHXA 1H2YA 3O82A 2MINB 2P5YA 3TRDA 2VPQA 3KBBA 4HG2A 2Q8PA 5J4VA 2YDXA 1QGED 4TOIA 2O0KA 1YDMA 1MC5A 2GXUA 4XD2A 5SV2A 3MRTA 1SKQA 4ERXA 3RUPA 2O05A 3TL3A 4CG1A 2D6FA 4QRHA 1RWWA 2OESA 4G4SP 3R0IA 3I09A 2MIIA 2ZCVA 3I01M 4HATA 2WKPA 4QL3A 2GBCA 3L04A 1UDRA 3DTVD 2D06A 2O8VA 2YHIA 4E6PA 1FJHA 3DOIA 1RWNA 4D25A 2XSZD 3EVNA 1JWLA 3PKZA 3PC3A 1Z6PA 3D3EA 4OHRA 4D3DA 3L8CA 5E7QA 4M7RA 4ZT6A 5K6AC 4KXFB 1T3SA 2JA2A 5COAA 5DNDA 1F06A 2DPHA 2F3TA 4GL4A 5KINB 2W6MA 5A0TA 2Q3EA 4RTMA 5ANRB 4JUBA 3GFPA 2NXNA 3FY4A 4MMXB 4PGFA 2JFFA 2VHUA 3PJGA 3PQ8A 4DZRA 1QFXA 3IJPA 5JNSA 5CCXA 4I1PA 4LF5B 2H2WA 1DBIA 1N2JA 3JRNA 4DL9A 4CEHA 1ZD5A 5CPFA 3KLPX 2WWVD 3ZU3A 4O1HA 3OSZA 5IXSA 2VH5R 4UE6A 2EVWX 3K73O 3UM9A 4K7JA 1E3QA 3TUZC 1OTYA 2JJMA 3LNCA 1NBEA 1FXWA 3DZBA 1WIWA 1XTVA 3DHVA 2PT6A 1G2PA 4FDUA 4EARA 2RHTA 2Z2KA 1Q1BA 4E2FA 4YRIA 5AMXA 1ZC4A 3G13A 1TQHA 4OBXA 4ZJZA 8OHMA 2XGSA 3KKLA 3L01A 1G291 2WB2A 2VOJA 3CUVA 4R01A 3ABIA 4HAVA 3HCEA 4FGJA 2NSDA 2DE0X 3RK1A 3ZHTA 5IUNC 4OXYA 1C3EA 1Y3BE 3FHCB 5LLTA 2WJHA 1FU8A 4HFJA 1ZLXA 1UXGA 1KWKA 2FPLA 1XDGA 4WBNB 1J2YA 4KQJA 2O8DA 4BX8A 2X58A 4TKZA 1Y9DA 4POOA 2FCRA 1ONPA 2HIHA 4EO7A 1WDKA 1BQ4A 2V45A 2WPNA 4PFQA 2C9OA 1POWA 3CWCA 4I6EA 3TQIA 4HZUB 1EWTA 2O14A 1RVDA 3HJGA 2F3SA 2NPFA 1MVNA 1QFMA 1GXSA 5EYPB 3W5DA 1RPZA 3HPRA 1YOVB 1NJ1A 2BMJA 1E3MA 3G1WA 4J90A 3A9CA 1CP3A 2H9YA 4ZCSA 3NH6A 4RIHA 4PGMA 3S6JA 2JIZD 2EZUA 4U9HS 1TJNA 1DPFA 2F9LA 4FGLA 3CU5A 1MEOA 1P5HA 2E7ZA 2ZXFA 4X97A 4MR7A 4QJ3A 2GCOA 2LDBA 2BZ1A 3DEAA 3P0JA 4KU4A 2C0QA 4M8KA 4HY3A 3H4TA 4N6NA 4YRFA 3PEFA 3U5TA 4B5KA 2H08A 1HNZB 5JPDA 3KPUA 1N1MA 3FUTA 3LUCA 5CDUA 2CSXA 2D3WA 5KMGB 1E3TA 1WUTA 3NZEA 2IIVA 3DWIA 3OKCA 3ETGA 1D4OA 2QN6A 1DAIA 2OGSA 3IPLA 3U48A 4AP6A 3K5HA 3KAKA 4NR0A 3K6JA 5CUQA 5BN4B 3PC2A 1PQPA 5FAKA 4RKEA 4D9IA 5E8JA 5TLSA 1H3NA 1VJ1A 1ZN7A 3UMRA 1NURA 3W2GA 4F3RA 3VR6H 1QO0A 3VX4A 5FUYA 4D9BA 3WTBA 2CZQA 3UY4A 4NI5A 5FPQA 1KKLA 2VA8A 2GCGA 5KB3A 3OEEA 1UBCA 5ALYA 4M1KA 2P79A 1V7CA 1W73A 4FE7A 3S2EA 3SR0A 4DQVA 1FOEB 3ITNA 1JYFA 5TJHA 1PFWA 1X8KA 2VTKA 3QEJA 3TI7A 3G2KA 4AWBA 1WXHA 4M9RA 4WZAE 3T3HA 3RUFA 4QARA 1T36A 2WAAA 3T5TA 2WZCA 5A4JA 1ZCFA 5KU7A 4FOPA 1PLKA 3ED5A 3PRYA 5JJKA 3ZWDA 2CLIB 1XX6A 5JPCA 4RV5A 3SVTA 3J80A 1FFCA 1E5DA 3VAYA 3ZU4A 4IKOA 5UKDA 4EKYA 2VF7A 5FA6A 3JASA 2FSFA 3UPUA 1RRGA 1ESCA 1OXKB 4FZ3A 1K3TA 1L1QA 2O2GA 5FV4A 1AB5A 1P0CA 2J0VA 1OXBB 2L18A 2YMLA 3B6ZA 1ISRA 2JFQA 4RHUA 4UUMA 3WGYA 2IUTA 4IX9A 4G26A 1ZGCA 2BFDA 5D5QA 4F7WA 2A57A 2PFGA 4MW1A 3JR7A 1L5YA 5HOQA 1HWYA 1P7ZA 2XQJA 3TZEA 2HHLA 1UJBA 3DBIA 1UXIA 4Q1AA 5DKFA 5BT9A 3ZXYA 4FDVA 1YKSA 2IBSA 1L4BA 4DJ5X 1SHTX 2V65A 1FP1D 1SEPA 1KVTA 4HD8A 2ZR9A 5CM8B 1YCGA 1ZRNA 2XBLA 2HU7A 5FUQA 4YRQA 4IFTA 1E89A 1WJGA 2FW7A 3EVBA 5EXSA 5KDLA 3MEQA 4KLCA 1VJTA 2NNWB 2PSSA 3TTUA 4BLQA 4CIBA 2WTXA 4ROTA 1T43A 2W71A 2Z5GA 3H5LA 3SYTA 2ZRPA 4LVNA 3WS7A 1E5LA 2BMAA 1XNJA 3LAWA 1BA2A 4XQGA 5JXGA 3PLNA 1M7GA 1R15A 2QN8A 2ZVQX 1AA9A 1NKSA 1C7EA 1DX6A 4K6HA 4U6SA 4M37A 1QYXA 5EJ2A 4RK0A 3SXUA 1NVGA 2W2KB 4UCXA 2HF9A 4LGYA 3SKVA 4EUEA 3PXEA 1KI6A 1I9GA 1XHLA 1MFPA 2ERXA 2ET6A 1ND5A 1XN4A 4JL5A 5JMOA 1J1IA 4LS3A 3QPWA 5L53A 3QFTA 3PNBA 4DY4A 1P9NA 2IDMA 3GRVA 4MWBA 2JLVA 1GGVA 1NW8A 2YIJA 1PQUA 2VXCA 3LHFA 3PSHA 4GLBA 4TMTA 2G70A 5F1YA 1A97A 1SKMA 4RULA 1JVSA 4TVBA 4XGKA 3UB3A 3IP6A 3K8OE 2FZCA 5LKRA 4QBTA 1PAUA 4CKCA 3JYNA 3VZRA 2DWCA 3KU4A 4KIWA 4TTAA 5A0VA 3U44B 2XUAA 4KB5A 2FWMX 3TL6A 1BFUA 2XTNA 1CE8A 3K2EA 5EUBA 4IIHA 2FR8C 1C30A 2R6R1 2HZBA 4IHJF 1R74A 4KFSA 5GP1A 2CDNA 2HO5A 3AJEA 2H07A 4JJ8A 3GDOA 4AJ1A 4XYMA 4CYMA 3WIDA 1UOPA 3QQ5A 1SVOA 3TQRA 4E07A 4KXWA 4RE6A 4DQDA 5ISMA 5IVHA 2WJZB 3GLQA 3GRRA 3UK1A 3DMHA 1TUGA 1N2OA 2P4UA 1CYEA 3W5VA 4D9NA 4TYYA 4L08A 3ZVMA 3QX8A 2RGUA 4FEGA 4FYXA 3GFBA 2IEYA 1PJAA 1DO0A 3I58A 4S1WA 3TLKA 5B6PA 1NHGA 4UUAA 1AZWA 1C1HA 1UBJS 4FSXA 1DBQA 4UDNA 3M6WA 4C07A 1X74A 3LBNA 3R40A 2H63A 3QUSA 1U2PA 1J21A 4R2HA 4X1KB 4CPDA 3IEUA 3IOYA 5CG1A 3QE3A 1LI5A 4P7JA 5K3FA 1GV0A 3UGKA 3PENA 4EW3A 4D1YA 4E5YA 2F4VB 2FMKA 3L7OA 3CISA 3JVIA 3U3ZA 4B0PA 2GMWA 2NO1A 5AVTA 4PQGA 2FFRA 4IFIA 4QBFA 3F3YA 1WW3A 1I6LA 4X00A 2GA9A 3JATA 4JVNA 4XVRA 3CM0A 5JXIA 4TSKA 4E22A 2VAWA 2ZB7A 4IICA 3VRHA 1RYZA 3HXLA 3WISA 2VK4A 5TMDA 1IHUA 3SSAA 1DXQA 5AHWA 1HUQA 1RXVA 2ZPAA 4DLAA 3HZHA 5E8RA 3TI9A 1W0KA 2DPXA 4MUEA 5E4JA 2BBTA 1JIIA 3A1DA 3HLYA 4LC9A 4QJ4A 2CKDA 2HTEA 3KAPA 3O93A 3ETJA 3SPXA 2QUKA 2Z58A 4I08A 1PWXA 2EG5A 4L5JA 3VHXB 3KXPA 1ECLA 3RRNA 1I13A 4AKTA 3BJIC 2CDBA 4N48A 4TS4A 2DSNA 3AWIA 4LXGA 1BN6A 2JFOA 2RGNA 2OOKA 3NEJA 3UUEA 1YKFA 3UC5A 4AJ2A 1AQJA 2JGLA 3E23A 4TUYF 4W5HA 4Y0AA 3L7JA 1FUUA 1ZC3A 3PBKA 4YMLA 3YASA 1NXXA 3LQ2A 3PC8A 3IALA 2ZROA 1YHYA 3BA6A 3DAFA 4EF4A 1VIDA 1UBGA 3GMTA 3OQOA 1QLHA 4LDRA 2AA3A 4BIIA 2QORA 3STUA 2QLLA 1FF9A 2H1VA 3ID6C 4M55A 1GPWB 1YIOA 1ZQ9A 2ZIAA 2E85A 4TQGA 4F21A 1LNSA 1VLQA 2XCOA 4OBWA 1UJCA 3ACDA 1XTUA 3PJFA 1K63A 4TMYA 5A5FA 3GQVA 2ACVA 3QXHA 2DCUA 3OZGA 4JYZA 3TSAA 2AD1A 1YZLA 2Q9AA 3KFVA 4KREA 2PJZA 3H8WA 2V6FA 4RY0A 5J9FA 4KXXA 5LLDA 4GYWA 3MTJA 4K6OA 2V74B 1X39A 3CCFA 3N6XA 3HJBA 1J6UA 4HDKB 4MRPA 4MW7A 4BJ5A 2GEVA 2PSFA 4Z9YA 4CM6A 1CRZA 4RLFA 4O0MA 4LFAB 1W0JA 3DLPX 3IBTA 3MMPA 4N54A 4FFPA 1W6UA 4HNGA 4POAA 4R98A 1IBLB 3N53A 2BZ0A 2NZ2A 1GPLA 4OI4A 3UUGA 1CEQA 1O6FA 3EGEA 1ZONA 4L8VA 4DCCA 3U09A 5BR8B 4LBYA 1N1EA 4RUKA 2WWTA 3KEMA 1ZITA 4JJIA 5K3CA 5L95A 2VNJA 3WIVA 1M2GA 4IJQA 1TVKA 3OO0A 3V8VA 4N8SA 4LJKA 4B8ZA 1Z3CA 4KDRA 3RABA 1IXKA 3U49A 1UWKA 4YWHA 1TCUA 4L4RA 8ABPA 3DGEC 3ANMA 3IAM1 2CHVA 3BH6A 2FJPA 3ORFA 1JN0A 4DDWA 1ZGBA 1L7AA 3SJZA 2C1XA 3AUAA 3W3ZB 1FRNA 1MOZA 3KWJA 3NBAA 5FL7D 1TMYA 3QKTA 1NQTA 4FNGA 4RGBA 1AA6A 2WTBA 1NE2A 1NJ8A 1OXSC 2IPAB 2QTNA 3EG5A 5IMSA 2GCNA 1Z63A 4U2CA 2ZI9A 4N1AA 4DRZA 4YCMA 5KNCD 4AW9A 4BQNA 4EB6B 4CQLB 1PR1A 2QMEA 4RK1A 3OHSX 3H2IA 3PSAA 1PLJA 3RD5A 2ZIXB 5KHAA 3EN0A 3H05A 3N8HA 1F60A 5GIOE 1GZ6A 1ZNXA 3ZNOA 3LC2O 3RVOA 1U9JA 3K9WA 4LX8A 1P7WA 4RYLA 1EDOA 2VWHA 1DQZA 4FNAA 2B4AA 3VYTB 4BX3A 1KS9A 5IF3A 1LV8A 3D1VA 1PV1A 1REQB 1M8JA 3KD2A 3RS9A 3LWZA 2ZJ4A 2W0SA 2QJTA 3HFSA 5CNKA 4ZHQB 2XJ9A 2PGIA 5DM70 4U7WA 1GLGA 1IEXA 1LNQA 2EDCA 1YS7A 1RT9A 3E58A 1UEXC 1VIAA 2O2XA 3B78A 4H7FA 3TZQA 5A04A 3DZJA 2FUKA 2JCGA 2PN1A 1GKYA 1MBZA 4KDCA 4YRCA 5FTNA 4DLSA 1ZM9A 5ARBA 2OV1A 2Y1LA 3DKKA 4H16A 4IIUA 1ARZA 3TR5A 4G5OA 5BNZA 2IY8A 3E7FA 5KAPA 2J4FA 1KYQA 3ICEA 3UGJA 2M1XA 1W87A 3D81A 2CN1A 5EUCA 3RIMA 4CLRB 3MLEA 1QQBA 2BZGA 1GNRA 1P31A 3JD1A 1CJSA 4N6GA 2I4OA 3FPBA 3OIGA 3PDWA 2B2NA 5HF9A 1ONNA 3VZSA 5DFAA 4MUNA 1LX7A 3VTKA 2IXBA 3G5AA 4PZ9A 5CGZA 2FQYA 1VHJA 3DLBA 1Q0SA 4U1RA 4YFYA 1OXMA 1VC2A 2JGDA 1W7AA 2QM8A 4A3SA 1DRJA 4DAOA 1J33A 4HFNA 5F12A 2DFLA 4HLNA 3NAGA 4XA8A 3A0RB 3ZHQA 4DG5A 2EJWA 5IVDA 4BV2A 2C4MA 2XB8A 2PSDA 5A4AA 2Q2OA 3I6QA 2ZBDA 1T4MA 2AX4A 1U8EA 1X3LA 3H9EO 4K9PA 4MKFA 5ALGA 3D6HA 2E49A 4OXIA 1UK9A 2I2WA 5FWYB 2C4NA 1CW2B 3V4RA 1IZ9A 3HBNA 4G3XA 5FTJA 9ABPA 1RM3A 1PZFA 3D3JA 5LQMA 4L4YA 4KXVA 4C78A 1L3IA 1LDBA 2QRKA 4Z3DA 3CZ5A 2ATEA 1JZQA 4RL6A 5JC8A 3NG1A 2XMGA 4DSAA 3TZLA 5LKAA 2AXNA 4AXXA 1NLFA 1XTTA 5TT1A 1NVVR 4L95C 3MK31 1TD1A 2IEIA 2YIDA 4WKOA 3COVA 3SJAA 2QJFA 4CG2A 1NBHA 1XDUA 3TKYA 1WDTA 5KSYA 1XZLA 3NVAA 1FNSA 3TGPA 3F7OA 4NMHA 2R79A 2IIQA 1AZSC 3F3KA 3M9LA 2EW1A 2W2TA 4GYJA 4W4TA 3DEZA 3RAEC 3RNLA 3LL7A 4XE5A 2P7IA 1AKVA 1WG8A 2Y1WA 3ETLA 3QEKA 3U13A 4G5QA 2H1FA 4MAMA 5GAJA 5CB4F 3CPJB 4EZIA 3WKAA 1LDNA 1U1GA 4BMDA 4D0RA 1RWOA 1I0LA 2D5AA 3OPMA 4Q3OA 2DY1A 3ZKWA 3F67A 5JSQA 2IP4A 2ZUCA 3OUUA 4ALLA 4ZOBA 6REQA 1XJCA 2ZP1A 3FTFA 3BMQA 3E22B 4BPRA 3ESRA 3T3PB 3BCUA 4RGVA 2RGBA 2X0EA 1FUYB 1N0IA 1NULA 1IAVA 3A1FA 1PV4A 1LPSA 3PLAE 1JMYA 3C14C 4O4IF 4URVR 2X8WA 2CDRA 5I7OA 3G2JA 4P22A 1AXEA 4L3OA 2ZJZA 2P2NA 4X24A 1H2XA 1XAHA 5AKHA 3T3MB 4PQEA 4UEJA 4A92A 3R0QA 3F6EX 2VLBA 2EU8A 5JS2A 3RF6A 3U3XA 3GNSA 4MV8A 4DDTA 1NZJA 4DDHA 1VKNA 1ORTA 1RYEA 4RDHA 4Z4GA 4HB2A 4G56A 4NOMA 4BVGA 4BZQA 2QJOA 4KFCA 3CF0A 3PB3A 4JLSA 3JPWA 3MBOA 1LBQA 4P4SB 3VU0A 1EX7A 1CDEA 5GGXA 4HNAA 4KYVA 4ZQHA 4K9OA 4JLJA 3UT5B 1DO2A 3S5JA 2PSEA 2HA5A 3DFIA 4D4KA 4Y30A 5HDQA 2V9ZA 2MDTA 3I42A 4LMRA 2ZI3A 4LWZA 1XA3A 2GAOA 1XWWA 4WOJA 4JQCA 5E2AA 4AKIA 1Z2EA 3PNMA 4GNRA 3TTXA 3GFRA 5BVHB 3P32A 2XUFA 3FYSA 1K5GA 2WHPA 1G8KA 4MNTA 4QBIA 5D6OA 1WCWA 1BD3A 3A6JA 3FE2A 1L4LA 2CNDA 2V6IA 2Q1UA 3IV6A 3UMFA 3D02A 3KJQA 2IYNA 2NQTA 3MWFA 2OP0A 1ZL0A 4ME6A 3MN1A 4W7SA 1KZ9A 2PBZA 1F12A 4KWTA 1DRWA 4Z51A 4FYVA 2D2FA 1WLYA 1QV7A 1DQYA 4KQFA 2AR9A 1ZNYA 4QDUA 3ONFA 1RQGA 2YFHA 5CNIA 5JZOA 3RJ9A 1DIAA 3HFGA 1KNXA 3ZNQA 3MWDB 3G5LA 2OCPA 3GT3A 4OLJA 4R7GA 1SVLA 2VUHB 1F0KA 1YI8A 1INLA 3HUDA 4RK4A 4IYRA 4XWYA 3ZCUA 4BL5A 5GIPE 2Q0HA 1Y8ZA 2BGGA 3RYIB 1ZOSA 3DUWA 1PQ4A 5DEIA 4KQWA 3HVKA 3PR1A 5EC8A 2YW2A 2ZSEA 3ZBQA 1SXJA 4EPRA 1MB2A 2CUTA 1DOAA 1ONSA 2XDWA 3H2BA 3KZNA 5A4DA 1IBMB 4Z9XA 1CX9B 3H2ZA 2JKVA 4NENB 2SICE 2QUIA 5KAMA 1CUIA 1NWCA 3NNDA 4AJPA 4D9MA 4H3SA 2PWPA 3QOXA 3R6TA 5C5EA 4FFBA 1Z6ZA 3BTSA 2EZTA 3BF7A 1P1HA 3MT7A 3AR8A 1KWGA 5CIQA 2ILTA 1GM5A 3MTGA 2BI8A 5I7WA 1BXRB 4NZZA 1PFYA 3D4LA 2QUAA 2XLBA 3RJTA 4JD5A 1T4CA 3G0GA 2DLNA 1NTOA 3L18A 3PIRA 1U2DA 1N8SA 1ZQ1A 4R4JA 4MKGA 1K97A 1XLTA 3L7LA 4HDSB 2H06A 2R00C 3W5CA 3T3NA 3RANA 2VHCA 5J63A 1COWD 2FWBA 2A0KA 3M6VA 5TV2A 4DPKA 3B6MA 5EJMA 3MQ2A 1V5WA 4Z2YA 3WK4A 1F51E 5C7OO 1T1SA 1ODKA 1CF2O 4FSHA 4S1VA 621PA 2P2ZA 3AEZA 2V4ZA 4NNJA 4QYSA 3VHLB 1QNLA 2CHQA 4N5NA 4WFJA 3RYTC 1T3GA 3WQBA 2YFYA 4U39A 1S01A 2N47A 5BWNA 2P68A 1RAIA 5F23A 3I2JA 1L4FA 2VH2A 4YAEA 3PEEA 4JB0A 4QFCA 3AUYA 4R2XA 5A5DA 1TTTA 4UMVA 1HH4A 1QX3A 4I50A 3R75A 3WGMA 1ZHOA 3V8NA 4RHCA 2CNBA 2HSZA 3FVQA 4PYQA 1R4MB 1QQTA 2LXNA 5JE8A 2GARA 1P77A 4QUEA 1P2SA 4UARA 2BT4A 2UVDA 5TQ2B 3O8DA 2UZ0A 1QRSA 5LP6F 4QYXA 1BJTA 3CKYA 1Z62A 2XIQA 3WYDA 1XKXA 3IEIA 1LTKA 3CT4A 3HBAA 3AY0A 3ZE8A 4YUXA 4F72A 1ZYUA 1UFQA 5M5BA 1F5SA 2PMKA 1L3BA 3DOOA 3E3MA 3PX2A 3QBTA 1M7BA 3K0AB 4L3VA 1PJQA 3JQQA 3NBXX 2VH1A 2BEWB 2ODAA 1MW8X 1LVUA 2PA3A 1XPOA 3W1EA 1CNEA 3QM1A 4RSHA 3P26A 4FNOA 3TJMA 2ZIZA 4DNFA 5AI4A 1I5RA 1NIPA 4LG1A 4PC3A 3R9XA 1AXRA 1YA6A 1R8SA 1KEEB 1TF2A 2V7QA 3GEEA 3FKQA 2NZXA 4XWGA 3P9ZA 1C4XA 1BS1A 1QR2A 3E82A 3EXEB 4NMWA 2ODPA 4IJ6A 1C7FA 3SKYA 5BV8A 1QFJA 1ZSYA 2FJUA 1XK6A 3TOSA 4G5YA 5LDDC 2FN8A 1VHLA 2JBHA 2VIIA 4M8NE 4RVGA 5AKXA 1VLJA 1YONA 3L1UA 2ZRHA 3OVMA 4ICIA 1YNOA 3N2LA 2WFAA 1SM4A 4FHDA 2CYBA 4MGIR 2IV2X 1KL7A 2MSKA 3SHVA 2BHRA 2OVBA 3BD7A 4EFMA 1WXIA 3ANXA 5AVKA 5EJ8A 5KJCA 4WZBE 1BFDA 3D2BA 3H6GA 4G0VA 1F9AA 2IOFK 1OFGA 3JQ8B 1D6SA 4QPDA 1A4XA 2Z57A 3UJAA 3KVNA 4ENVA 2VP3A 5FUBA 4PTLA 4V03A 4NECA 1ZK1A 2P0AA 1FDUA 1WPXA 3HJNA 3VOBA 3U9LA 1ULSA 1X13A 3UKJA 4UE2A 4XSVA 3EZNA 4C0BA 5JFGA 3INYA 1DC6A 1KVSA 1E59A 5C4MA 4QOJA 5HMLA 3HZRA 1BWRA 1O96B 2Y6UA 3D0OA 5EE0A 2R8OA 1RAAA 3G82C 4MVCA 1FPMA 1Q7TA 3QEBZ 3LKZA 1J9ZA 3GBSA 2DC1A 2RGWA 4B81A 4BE7B 5IZCC 3STXA 4YI5A 4BN5A 1E1CA 1I36A 1T5TA 2NNLD 3DOUA 1X7HA 5A9RA 1K6IA 1K75A 4CKWA 3GELA 3UJ6A 4NYMR 1ENPA 3EJ6A 4AJHA 5BQPA 4CKEA 1EZ4A 1YS6A 1PL7A 2IW3A 4AUMA 1FNCA 4NJEB 4F04A 4AS2A 3OAAA 1FYEA 4KYIB 3B5IA 3FNHA 5B12A 4RD6A 2WSBA 3IUYA 1FQJA 5JS1A 1MNAA 2WJIA 3L1IA 4G2TA 4OKIA 2Q62A 4F3TA