3DGEC

Structure of a histidine kinase-response regulator complex reveals insights into two-component signaling and a novel cis-autophosphorylation mechanism
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
122
structure length
122
Chain Sequence
MSKKVLLVDDSAVLRKIVSFNLKKEGYEVIEAENGQIALEKLSEFTPDLIVLDIMMPVMDGFTVLKKLQEKEEWKRIPVIVLTAKGGEEDESLALSLGARKVMRKPFSPSQFIEEVKHLLNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/signaling protein
molecule keywords Sensor protein
publication title Structural Insight into Partner Specificity and Phosphoryl Transfer in Two-Component Signal Transduction.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 33
structure length 122
sequence length 122
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3dgeC00
3IPAA 3KKEA 3H5LA 5KC9A 1ZN2A 1E6KA 5HSGA 4ZMSA 3KYIB 5IUKC 1YS6A 1T34A 3N0XA 1Z26A 3UK0A 4EUKA 1JH9A 3VNBA 3EDCA 4N76A 3HO1A 2FQYA 4IMIB 1RXEA 2B1JA 3QEKA 3H1EA 1PEAA 4D6YA 3O21A 2YHAA 4RK4A 3IP7A 1AB6A 4N03A 4W5QA 1QO0D 1LJLA 1YIOA 2WJWA 2PUCA 3L6UA 5IUNC 5JNSA 2FVYA 4Q7EA 4LZLA 4Q6BA 5HKOA 4EVQA 5JNRA 3IP6A 1DRKA 3A0UA 4MGEA 5JS2A 4Z4FA 4YRZA 3A0RB 3LUDA 4MPTA 3ILHA 1GCAA 3HK2A 3I5AA 2MYUA 2FLKA 3C3WA 3LTEA 1Z25A 3JY6A 4RK6A 4ETNA 1JFSA 1JL3A 3FMVA 2MYPA 2YHBA 3A3KA 5C5CA 5KQLA 1QQAA 3OLZA 1GLGA 3C3MA 4RXUA 3H5OA 4W5RA 1EFAA 3RVOA 1NATA 3OQNA 1UDRA 2JVKA 1YK1A 2FEWB 1XHEA 2J48A 3RVRA 1JDNA 3JTEA 2JVJA 4NV3A 2VUHB 3T6KA 5GOTA 2DRIA 3QX8A 2PUFA 2GKGA 2IPNA 1GCGA 3LKBA 2E4ZA 5JNUA 3GWGA 4Y9TA 3NNNA 3L49A 5TQ2B 3S99A 4MYRA 1OXBB 1ZHHA 4GPAA 3LUFA 3NBMA 4RWEA 2HQOA 1ZAYA 4RDCA 2TMYA 4LDAA 1QQBA 1L5YA 1ZDMA 1NXTA 1ZY2A 1ISSA 4FE7A 4W5OA 2MSLA 4B09A 4F06A 4N0PA 1TVMA 5IX8A 2VUIB 4DADA 5TE9A 1RZRA 3IPCA 3F6CA 1LBIA 3KS9A 3FFWA 4RU1A 2E4UA 2E4VA 2PUDA 3EGCA 3JVDA 4RK7A 3T38A 1KMIY 2CD7A 2M1ZA 4JA2A 4TMYA 1OXKB 3EULA 1FFGA 4O1HA 4MQEB 2VK2A 1BVHA 4PEVA 3HEBA 4WZZA 1LBHA 1YMVA 5CNMA 4MAAA 2NT4A 1Z2DA 2JBAB 2FMHA 2HQBA 1DBQA 2H0AA 2IOYA 2O20A 4RXMA 2RGYA 5T3YA 1BAPA 5KQPA 2HPHA 3OQOA 4H60A 2QU7A 2XDYA 4MQEA 4QYWA 1LJUA 3JPYA 4G86A 3CHYA 3HCWA 1CYEA 1GUDA 1QNLA 1DBPA 3HM9A 3KHTA 2PUGA 1BDIA 2QVGA 4YP9A 3O1HB 5TPZA 5CNIA 2F8SA 4G0MA 2LBPA 3O1JC 1SXGA 1U04A 9ABPA 4KK4A 4YR7A 3OLWA 3OMWA 1JBEA 4YV7A 3O2JA 3OM0A 3HUTA 1QP0A 1H9CA 5JNTA 1JX6A 4CBVA 2L2QA 3Q7SA 5KI6A 3D02A 1IIBA 2MSKA 5TQ0B 4L4UA 2WMYA 1KRXA 1RNLA 1DC7A 3G85A 4MS3A 1JDPA 4YLEA 4KZKA 2QR3A 8ABPA 2GBPA 2ZAYA 3MYYA 4EYGA 3MMNA 4O5AA 1RZRD 3QLUC 2B4AA 3TD9A 1ISRA 5IUJC 5TQ0A 4E7PA 4QYMA 3QLVA 4TLLB 3SNKA 3QEMB 3MIZA 5DLEA 1KGSA 1U8TA 2FW0A 3LUAA 3IDOA 4HNQA 2OQRA 3C3KA 2PJUA 4KV7A 1YVUA 1M5UA 3CZ5A 3DLHA 1KRWA 1MB3A 3CNBA 3QLTA 3RVMA 4EYOA 4OTZA 1DCFA 2H3HA 2R47A 3IP9A 2ID7A 2ID9A 3K9CA 4Z4IA 4W5NA 2GX6A 1PEYA 5DTEA 1RXIA 2FQWA 3HDGA 4JB2A 1Z16A 2R25B 4UHKA 1JF8A 4EGSA 2MYNA 1SRRA 3OM1A 1F51E 3D8UA 2CHFA 2PLNA 4G0QA 3NNSA 3QLUA 4NQRA 4MQFB 2VYCA 2FN8A 4Q6WA 5JS1A 2FLWA 3LUCA 1I3CA 2AYZA 2JK1A 3SM9A 2JCGA 3URMA 4RS3A 3KYJB 1WETA 2QSJA 1SD5A 3GV0A 3O2QB 2R4QA 5IC5A 4IF4A 4P1ZA 1QP7A 3HS3A 4IMJB 1F4VA 3O74A 2WWVD 5CHYA 3JPWA 3LUGA 3OLYA 1JYFA 1DG9A 1USKA 1YS7A 3G1WA 4WWHA 2P4UA 3H1GA 3SAJA 4MR8B 1MIHA 2CWDA 2FQXA 4MR7B 4LDZA 2MSWA 4RSMA 2FKAA 3OLVA 2E4YA 3FDFA 3O75A 1FFWA 4G97A 1DP4A 4IRXA 1L5ZA 5I4CA 4MR8A 1MAVA 1TJYA 2PMCA 2WRZA 4MR7A 2I6FA 3C6QA 3GBPA 3SY8A 1HEYA 1NXVA 1R8JA 2AYXA 2ZWMA 3RVSA 2LPMA 3CS3A 2QV0A 1PNTA 1Y1LA 2V0NA 4G0ZA 4TLMB 3M6MD 4XASA 3ROFA 1QKKA 3FGZA 5T7BA 2PUAA 4MS4B 4PYRA 4Z99A 3IP5A 1XWWA 3CTPA 4F12A 4E7OA 1JFTA 4D6XA 1SXHA 3HVRA 4JOQA 1D1QA 2IPMA 3EQ2A 3O1IC 5TQ2A 3KJXA 4XLTA 3DGEC 1Z13A 3I45A 1MB0A 1K68A 1M2FA 4O1IA 2PE5A 3A10A 1APBA 3Q41A 1C4WA 4EY3A 4Z4GA 4M88A 4D74A 3TO5A 1DCMA 1C0EA 1U0SY 4DQDA 4G0XA 1DZ3A 1E6MA 2QW1A 4LX8A 4PE5B 5IBQA 3CRNA 2GWRA 5FWYB 3MF4A 1J56A 2A9PA 3R0JA 3LFTA 1M5TA 4RK5A 1NY5A 4L85A 3KG2A 3QLVC 5DKFA 1DBWA 4YCSA 1PUXA 3Q7TA 2FN9A 3MA0A 1S8NA 2JBAA 1NXOA 5FWYA 4YGXB 3HJFA 4KPYA 4RZSA 4MLCA 2IKSA 3FFTA 3TB6A 4JP1A 2M98A 4YO7A 4KREA 4RK0A 1Z15A 1JWLA 4HNRA 3H5IA 3QX9A 4EYKA 4RXTA 4ZPJA 3CFYA 2X7XA 4Z0NA 1TM2A 4Z9AA 4MS1B 3BBLA 4OATA 1EAYA 3HXMA 2A9OA 2A9QA 2FEPA 5BQ3A 3E61A 3JVIA 4F11A 3EQZA 4JASB 4UHJA 3T95A 5ED4A 1Z17A 3N6VA 3LUJA 3QELB 4QICA 5HM6A 1M2EA 4MS1A 4RKQA 4IGAA 3M9XA 4MR9B 1SXIA 4XAQA 1JHZA 2MYTA 4XARA 3MM4A 2P9HA 2HSGA 1ABFA 1USIA 1VLZA 3EAFA 4JAVC 4MLDA 2PL9A 4WT7A 4PZ0A 1ZITA 2NUBA 2GI4A 4KNYA 3TX6A 3SQNA 2HJ9A 1VKRA 3GA5A 3B2NA 3RVNA 4MR9A 3T8YA 2PUBA 3QEMA 1E6LA 2FTKE 2QXYA 5JNWA 2RJNA 3OLXA 5DGCA 1BDHA 2FMKA 3HDVA 3CG0A 5PNTA 4PICA 5FBHA 1NXPA 2L18A 1TMYA 4DN6A 3H1FA 4Z4HA 1EWTA 4OBBA 5TPZD 1USGA 3DZDA 2F8TA 1NXWA 5F64A 1XHFA 3I42A 2BGGA 3Q7RA 4JB0A 3QK7A 3HUUA 4RK1A 3F6PA 3CLKA 2IYNA 4N41A 1Z12A 4H3HB 5D2CA 4W5TA 4S04A 4Z4EA 4OLAA 2RDMA 3Q9SA 1P6QA 3UUGA 5EWMB 5BR1A 1NTRA 2FSPA 3C97A 4FE4A 3OO1A 1W25A 4KMRA 2QVCA 1FQWA 2FEKA 3GT7A 3CU5A 5CNJA 3E3MA 4MQFA 5KWSA 3ILYA 3CZCA 3GRCA 3N0RA 3NHZA 5FWXB 4ETMA 5B3JC 1ZGZA 1YMUA 4KVFA 5E3JA 5EWMA 3M9WA 2NZUG 4F8JA 1YTUA 1DRJA 1D2AA 4NCBA 2FMFA 1ZVVA 1P6UA 5FWXA 1ZH2A 2QZJA 6CHYA 4IILA 1ABEA 1ZGGA 3H5TA 3K4HA 3LKVA 4LE0A 3Q15C 3JS5A 1PHRA 4F3TA 1JFVA 4KQCA 3SG0A 1P8AA 2FMIA 5HQJA 1DC8A 1A2OA 2FXIA 3DGFC 4EVRA 1Z18A 4OG2A 3KTOA 1U2PA 2JRLA 3LUHA 4LE2A 5IULC 2RJOA 2IDMA 3KCNA 4ZMRA 3H6GA 3P9YA 2A9RA 5TPWB 4MRMB 5B3JA 4FB4A 1U2QA 1QPZA 3CKMA 1ZESA 3RVPA 1Z2EA 4S05A 1D5WA 1MVOA 2HQRA 4MS4A 3F73A 1NXSA 4HNSA 3F7NA 1JLKA 1P2FA 6ABPA 5TPWA 3BREA 3NNDA 4H3KB 4MRMA 2PUEA 5DCLA 3DLBA 2NT3A 1BA2A 1BDJA 3EJWA 5KQGA 3RH0A 3W9SA 2LIVA 4EVSA 1CEYA 2WY2D 2PL1A 5C5EA 1DJMA 5BRJA 4Z4CA 3RVJA 3MQ4A 3HSYA 4RY8A 4ETIA 4YS6A 5JNVA 3LUKA 1ZH4A 1A04A 2WB4A 5TQJA 2L19A 4XFKA 3BRQA 5EWJB 4N47A 2OENG 3UKJA 5FBKA 3CG4A 4G0PA 3GL9A 4N0QA 5EWLB 3RVQA 3EODA 1EWVA 2LUOA 3H5VA 3LMKA 1TLFA 3HZHA 4KQ9A 1B00A 2PAFA 2W42A 1FFSA 2JVIA 5KC8A 3OMXA 2PKXA 4WXEA 4KFCA 1E2BA 5EWJA 1EHCA 3TMYA 1QMPA 3ROTA 2JB9A 3BILA 4NICA 3RVKA 5EWLA 4NCAA 1DCKA 3RVLA 2E4WA 4RV5A 1A0OA 1GUBA 2R48A 3VNAA 1URPA 1EWKA 3KLOA 4WXMA 1VRVA 2CHEA 4OLBA 3KLNA 4KK3A 3H5WA 4EYQA 2WJAA 4WUTA 1VPWA 4MS3B 3O2SB 2N9UA 4GNRA 1JYEA 4YWHA 5GQSA 4LE1A 4Z9BA 1QO0A 3RQIA 1LK0A 2IPLA 7ABPA 2LP4Y 1PNRA 3QELA 1AB5A 2L17A 1QP4A 4G0OA 4XXHA 3GBVA 2Q5CA 2IPAB 1D4ZA 4RY9A 4G0YA 1YK0A 2NZVG 3H6HA 3N75A 3OQMA 2E4XA 4TN5A 1K66A 1D1PA 3N53A 3NHMA 5ABPA 5IEJA 1RPJA 3KSMA 4ZYLA 3HV2A 4P98A 5KQMA 5IEBA 3FFXA 4RY0A 4LRQA 4HYEA 4KRFA 1W9HA 3OO0A 3GYBA 1NXXA 3DBIA 2KYRA 5CNKA 3N0WA 4QPJC 4ML3A 1FSPA 3BRSA 3N8IA 3H75A 4RKRA 3I09A 4ZJPA 1CHNA 5BRAA 3LOPA
chains in the Genus database with same CATH superfamily
3URKA 3B2EA 3IAFA 2O8VA 2ZYGA 4WOBA 4OIMA 3VTAA 1HBJA 3DE4X 4KO4S 1E6KA 4PLPA 1DIBA 2CVPA 2B8WA 1Q84A 2WVAA 4JI1B 1E18A 1JHDA 1UZLA 2LNDA 4FONA 1WZIA 4DSUA 4HEA1 1IOWA 2EIXA 1JXMA 3B8HA 3IHWA 1XPOA 2DXIA 2MINB 1DARA 1PEAA 2WWTA 2PD6A 1L9XA 2F43B 3FETA 2IQ5A 4D6YA 4G5FA 1EJ6A 2FG5A 2QLFA 3P0FA 1U3VA 3S70A 4RTPA 2W2MA 2ZPTX 4WBSA 1L4KA 5DEOA 5J5AA 2F4VB 3NAQA 1UOOA 1Z6ZA 1KMCA 3KWFA 1CP2A 5K6TA 2C4KA 4HL6A 3EWSA 5LLDA 2QU8A 3PRYA 3ZWYA 4AY2A 5HKBA 1T8PA 2BFWA 1C4XA 3ZI7A 2Y99A 1GPKA 4U7JA 3L8ZA 3RHTA 2VG8A 2JBHA 1U6KA 4ZU6X 3MILA 5HE8A 4EA7A 4PWYA 3QWHA 3EPJA 2IP1A 5E4YA 4UBOA 2GZAA 5KQLA 4V2IA 3O4IA 2B7LA 5JT1A 2DQYA 3SSAA 1FP4B 2DX7A 2UUPA 3CEAA 2E85A 3T3PB 2DUUA 1R6VA 3E5HA 4I0WB 1PR4A 1HETA 4Y2UA 1IONA 4EPVA 1P91A 1KK1A 3C5WP 2V4ZA 3N2EA 4RTJA 3OY7A 1NUSA 4NV3A 2PBRA 2ZRQA 3L6RA 1I5OA 2I76A 3CRMA 3Q72A 4X45A 4AIIA 4CMGA 4UJ3A 5AXDA 1Y1TA 4ZOLA 5GZ3A 1XELA 4BNVA 3KQVA 2IU0A 4Y2YA 1H5UA 3MCUA 4E88A 1JYSA 4FZJA 4DV5B 1GP2A 2OAEA 2YL2A 1OXBB 3ELBA 3LT2A 3TTTA 2IYUA 1PNVA 4RVCA 4BLWA 2OZEA 4UVEA 3ZBQA 1P9OA 2BMEA 1SXQA 2OV1A 2R5NA 3P9CA 3PGA1 4U6SA 1YC2A 5KVVA 3H3XA 2ZWIA 5ILOA 5TRTA 3BD6A 1TTPB 3AQIA 3CV3A 1RZRA 1ODTC 1X8LA 4P7GA 1GQOA 4GXQA 2C1EA 2P0YA 3GNSA 5D1HA 4BVLA 4ZT4A 5KVSA 1VL8A 4CIBA 4NC9A 3PEWA 3EPLA 1M3SA 5D3QA 5GONB 4X1KA 2SCUA 5JD6A 1ANKA 1GJRA 2C95A 4OH7A 4O4LF 4P33A 3TGLA 2F17A 4TMZA 4GSLA 3WIDA 4EJMA 5JSQA 2VL7A 5T3YA 4Y7DA 1VHQA 5F76A 2IHVA 2QLNA 3D2AA 1UC5B 1O4VA 4HI0E 1TT5B 1KJJA 2I8LA 2CEAA 1WPGA 4N5DA 5EGSA 2I3GA 3PG5A 3FOCA 2HU7A 3PUXA 1JDTA 4GD3Q 2O8CA 1WUIS 4MQEA 1A77A 1J7JA 3OCWA 2F55A 2G1UA 1R9NA 3CHYA 3PI6A 1L5QA 1GUDA 1QNLA 2GEKA 1NKVA 1IY2A 1Q15A 3KTAB 4YJFB 3UWMA 3HKBB 4BBAA 5C2JB 4N01A 3C2QA 4DC9A 1R6BX 3UJ3X 2QVGA 3CVJA 1H23A 4NARA 2JLCA 2IYWA 3SLGA 2C0PA 4MRSA 1JIQA 2YQ5A 3OZFA 1U04A 3MWKA 1KOLA 1Y7PA 1DZIA 2QLJA 3VPDA 3A27A 4KFRA 3HUTA 1XDSA 3DEYX 1JX6A 1CJMA 2Y1XA 1RAGA 3JWGA 4BV9A 2J09A 5C7OO 1KC1A 1HZJA 2WHPB 2GXAA 1OGJA 2PH3A 2Q4RA 4X00A 4IPTA 3X2EA 4CCWA 3SHQA 2V7TA 1GZ3A 2ET6A 3PFKA 1MORA 1C0LA 1H8HD 1PL6A 2I2AA 1QHEA 2IU4A 4GOJA 4JR1A 4KZKA 4MIOA 4DL9A 2I99A 1LB1B 3PKJA 1MQ8B 2AMFA 3WDMA 1XDUA 4CIDA 4LJRA 1H0HA 4ZT6A 1P2GA 4DXDA 1YJQA 2B4AA 2AOXA 3DWFA 1ISRA 3NT5A 3OFKA 5G4LA 5JMOA 2XEXA 3CBQA 1CY0A 2PWAA 3A26A 4Y2RA 3EXHC 5T3UA 4Y2SA 3QBJA 4N6NA 4MV0A 5LA6F 3V4SA 3R0VA 5EJGA 1OUMA 1CWUA 1W88B 4D8VA 1B1AA 4KU4A 3CNEA 4YXWA 5TDHA 1XRNA 2DHQA 5EERA 3MWDA 4EF5A 3DFUA 5KTNA 4A0SA 4FFBA 4K9KA 3J7TA 4DV4B 2CUTA 3WL3A 1KOJA 3KXLA 4X93A 4QUIA 2JIZA 1U11A 4EI8A 2NNWB 2IZ1A 3I73A 1UOPA 2R8OA 3MCWA 1VG9B 2R47A 3KOOA 2OSBA 1EG7A 1CF4A 2B8NA 5DX1A 1V3TA 1WQ3A 2OVFA 2GX6A 1MAAA 4I6GA 3SOPA 2BFPA 4D8XA 1Y98A 2CMGA 2JAUA 4GWLA 5AKKA 2R8RA 1Z16A 2UYYA 3ZD9A 3NATA 1SHTX 3CC8A 3Q0IA 3I4LA 421PA 4JGIA 1SVWA 1AUVA 4DNQA 4I7EA 4QRHA 3R7WB 1LV8A 1T25A 1GWNA 3CR8A 3IIJA 4Q6WA 4LPKA 1AUXA 4EG3A 3GP3A 1ZQ9A 4N0DA 2Q5FA 3ORSA 1DELA 3N2GA 2ZIFA 3G49A 4UD2A 2XDWA 3DMNA 3RIHA 4RACA 4HRAA 1M6HA 1QYIA 5K9ZA 4K6MA 3VV2A 4MO2A 2MT9A 4CLRB 4OP2A 1BVUA 3KZXA 4GXNA 4I5EA 4XA8A 2QP4A 1O9GA 2P0AA 1AQJA 4FMDB 1VHWA 5IP5A 2F3PA 1FYWA 1SCKA 2BHLA 4JCCA 4Q00A 4CMJA 2FB9A 4MR7B 1FRNA 1AC5A 1EQ2A 1UBLS 2H8GA 3IVGA 4GM4A 4RSMA 4F5YA 1NNSA 1VJ5A 1HRDA 1UMKA 5DK4A 5IBCA 3FDFA 5LU8A 3O75A 1U3FA 1VBKA 4GPBA 4TTRA 4BFWA 1DKUA 1I0IA 1YB2A 4MJ3A 1DKMA 1ZGAA 2UVPA 2ZE8A 3QPAA 4A8TA 1XZKA 1C7JA 3SS7X 1ZCBA 3VHLB 3QVMA 4UPEA 2ZITA 2LZ0A 5EPOA 1R8JA 5CBPB 3GARA 3D4BA 4GRAA 1MJGA 2DR3A 2P4SA 1ZK3A 3S28A 1P9NA 2ZI9A 3SX0A 3SXJA 1OHHA 5KJCA 4GDFA 1MTZA 1G8GA 4H4CA 1JT9A 2VH5R 4MSUA 1TUEA 5L4LA 2K7FA 4MS4B 4NDAA 3DYIA 2HIGA 2NXWA 2H06A 1MKYA 3A2NA 3DXXA 4A8PA 4U6NA 5ALNA 4RZHA 1G5PA 1CDEA 4TXLA 4ES6A 2W7TA 2PUHA 3MBKA 1Q91A 3ETDA 3OC0A 2VXBA 3P45A 4U9IS 5KWEA 1TVKA 5L7TA 4MV3A 1T26A 2R3SA 5EIFA 3NP9A 4WL0A 3A1FA 1VMKA 5EZYA 2X7JA 4W1SA 2JLVA 5IH3A 1JHQA 3LZ6A 5LMNB 1RBQA 3TQIA 4BGVA 4ARVA 3ETEA 1DZ3A 1Z6PA 2VZ9A 3PE6A 4PYOA 3HCRA 2HPVA 5K7SA 2PX2A 2BI4A 3FMIA 2AR7A 1I4TD 2EDAA 1NW5A 2R751 3EIXA 3LFTA 4F72A 5B7GA 4A0RA 4WEQA 1GFSA 1OAKA 2A0FA 2D3WA 2HUPA 3OKPA 1RP7A 2IV7A 1YBHA 4B46A 4ZT3A 1SHUX 1VKHA 3W06A 3KUDA 4BEJA 1F0KA 4JLMA 4S1NA 3TLGB 2BI8A 1CRLA 3Q5DA 1GCOA 3ET4A 5DGTA 3F74A 4RZSA 5DCUA 3AF0A 1OGYA 1JIUA 3DZGA 3WTCA 2RKBA 4RGBA 4LVCA 4XWGA 3SZLA 2JFOA 3ZGOA 1A7KA 2BFMA 4CG1A 1F20A 2EFGA 3LIPA 4JBIA 3WKDA 3TK1A 4C0JA 2AQKA 1VDMA 3LT5A 3NCHA 2PFSA 3E61A 3R5FA 3ZZ0A 1OTYA 3EQ8A 3PQ3A 4W5WA 3CLRD 1LPBB 1YL5A 3VZDA 2ZRAA 4HX5A 3PA6A 1Z17A 1N1MA 3KFVA 2XVXA 3QKSB 1F2UA 1P2BA 1M2EA 2OLEA 4NECA 1WMBA 1MV5A 2B4YA 3ECSA 5ALZA 4AIRA 2QBYA 1NW7A 1GLNA 4ZICA 5EESA 4F6LA 4A6XA 3WIBA 2R1UA 1ZWLA 2Y0DA 3ZV5A 5T8KA 5A3RA 1G7CA 5B1DA 2FFQA 2CD9A 2NYRA 4GR9A 1RBMA 3B2NA 4W63A 1GILA 2CV0A 1QLJA 1FJHA 3JZAA 1LQ2A 2DTXA 3Q40A 3BGVA 4N7BA 4MUHA 2I34A 2HC9A 3RAJA 2BHSA 3U61B 2RJNA 4KIFA 2O07A 3D6AA 4NL4H 4O4JF 1ZAKA 1PR2A 4PLVA 5LYJA 4HRVA 1P1BA 4JC0A 4PYNA 4TUYF 4WFJA 5J4KA 1A1VA 3C8MA 4JBXA 2YYZA 1G6HA 4L07A 1HFEL 1AO3A 1NXPA 1KEVA 3JASA 3PR2B 3PTZA 4PFKA 5PGMA 4NG5A 1BOFA 3P2EA 1USGA 4UXJA 1Z6AA 2G9UA 3WFJA 4BHTA 4ZPXA 3E8SA 3VJLA 4XFDA 4CQJA 1F2TA 2YMQA 1Y82A 1A82A 4D3SA 1BRTA 2H6EA 5L45A 3ZV3A 1PRYA 2NUPB 4C7OA 4OQQA 1QH1A 5EJ2A 3HZRA 1FEZA 1JDSA 4RTSA 1Q21A 2EFYA 4CFYA 4S04A 2H85A 3E9EA 3OQ1A 4I3GA 4MVJP 1IEWA 5KSPA 1QGYA 3TSWA 2HF2A 1ST2A 3NFRA 1TW2A 3FPJA 3D4IA 2XCOA 2YICA 3QFHA 4H1VA 4J03A 5JEDA 2PKEA 2ZTUA 4I6EA 2QX8A 1V39A 3QI7A 4Q1DA 2FR8C 2VRWA 5G0SA 4G0VA 5LXTF 1X7WA 2ASEA 2C5AA 3GA7A 3C3AA 2JHAA 1HT1E 3G8CA 4KVFA 1W5FA 2ZU0C 5AW0A 5BVHB 4U1RA 1Y1PA 3VNSA 1CU1A 1TF5A 4DEXA 1ZICA 4ZAVA 1Y9EA 2YW9A 4QGSA 1JECA 3OH8A 2F90A 3ZVNA 4TTTS 2JHGA 1O8BA 3GIDA 2DQSA 2VDWB 2IHTA 3J81A 1CSEE 4DHEA 4ZAZA 4DY6A 5ILGA 4B87A 1K3UB 4FN4A 1L7MA 2QOEA 3K4HA 5EHNA 2GHQA 1PGNA 2WM9B 4GXRA 2O8BA 6ADHA 4DCCA 4X90A 2PFGA 2C5FA 2X9VA 2WE7A 1DRVA 1KO4A 2CLFB 2XWSA 3PE3A 3P4XA 1SOVA 4FEAA 4J1QA 4R68A 3ZWBA 1SC3A 4UVHA 2ZZNA 1CC1S 1WTCA 2Z8YM 3IEKA 1P0MA 2IVZA 4UXHA 5BNWA 3JQAB 4YRSA 3W6ZA 4JJ4A 5KOJB 3L7YA 2CFCA 1E3EA 4OFWA 2O2GA 2Z1MA 2YHUA 3QLEA 4BVAA 2G4VA 5K0CA 1EMDA 1OA0A 1THTA 2ZSFA 3I2FA 2NYUA 2FWPA 3IKLA 1QVVA 1Z2EA 3VOBA 1FRQA 4S05A 1JNYA 3KQYA 3GJ4A 3IQHX 5DEIA 4PIVA 1FU4A 2I8AA 2DFPA 1Y4ZA 2YXEA 3TIGA 3CVOA 4QREA 2XUIA 1J1IA 4FWIB 3WL5A 1BX0A 1Y1SA 2XMPA 2VP4A 1F1BA 3O4HA 4E1BA 5CR9A 3EN0A 3ONWA 5CXXA 3LFUA 4BDSA 3ENKA 1JE1A 1Q14A 4EMTA 1R0RE 4EL0A 1EM8B 1PE0A 2R66A 2IYLD 3FYUB 4UE2A 2VUTA 2B61A 4DQKA 5CT4A 4BO6A 1JR3D 2X2FA 4NG4A 4P4SA 4H1WA 3RC2A 1XD2B 1SQSA 2AFIE 3FTCA 2OXEA 1S2MA 1ZH4A 1B93A 1TKBA 2XKAA 4N3BA 5CA0A 3W8EA 4R8VA 2OV4A 2WI8A 4YJ2B 1VPVA 3JQ9C 2ZS8A 1B15A 4RJKA 1EDDA 3GUUA 3WK7A 5ALKA 2OAP1 5K05A 4KQ9A 5AM4A 5IJWA 1JR3E 4Y9SA 1S4QA 2Q5JA 1CR1A 5EFZA 4AM8A 1NSTA 3I30X 4G5OA 2PZGA 5MF6A 1I3MA 4RO0A 1LNSA 4LPSA 3R7LA 5LOVB 4NCAA 4ID9A 4CGYA 1MT3A 1DCKA 3R75A 2P41A 4PN7A 2BSQA 3AC0A 3MELA 1HSOA 4PHCA 4QUDA 4UMEA 1COWA 1EWKA 4FHGA 1M1YA 1T91A 3AFNA 1K7CA 1DAHA 2GJ4A 3GPCA 4IJ6A 1QZXA 1CFJA 3BHJA 2EGHA 4NYJQ 1KDZA 3WK9A 1GGMA 3V4LA 2H2IA 2R8EA 3IMFA 4P54A 2FWBA 4JLUA 2YV4A 4C87A 3O83A 3O95A 4YRRA 4LDQA 2VEOA 3B53X 4XSVA 3GPBA 4DLWA 3EAGA 1PL0A 1QFZA 1CUGA 1J0EA 2KI5A 4J3FA 4KXVA 5B64A 1GAWA 3N75A 4RZ2A 1JHOA 5GJWC 4PBTA 1MJNA 3E8XA 5EIOA 4MIEA 3JYLA 4WCFC 3CGWA 3ZE7A 1O6CA 1NP3A 1ES9A 3PX2A 1EGMB 4QWWA 4F2WA 4O3MA 4B9EA 2BGWA 3RFFA 1N9KA 3OO0A 1EH5A 1J24A 4NMXB 3ZWVA 3RC3A 1FSPA 1C8VB 1V0JA 2EFHB 3BTVA 3NBAA 2B6NA 3SJZA 3TH5A 1EUZA 3W2HA 1WJGA 2C2BA 3F97A 3WB1A 2VSYA 2ZYVX 3D2LA 3GN2A 4ABYA 2IHNA 4D0SA 1V5GA 3GUVA 4W82A 2VS1A 4Q3NA 4UASA 4BX0A 5EQJB 1C3XA 2LE0A 5IJ9A 4TROA 3UXMA 3KKEA 3WSWA 3GGPA 5L8VA 3H5LA 2I1WA 3G7NA 4NLLA 3VI4B 2I65A 2WU3A 4KQ6A 4ZMSA 5AI5A 2Q29A 3EDOA 1L4GA 4BWGA 1XEAA 1Q0TA 3TNYA 3RK1A 4RZ3A 3PGLA 5EMJA 1QG4A 1SWVA 3SYKA 2YVLA 4Y1GA 3QEKA 1VRWA 4IBOA 3SQMA 2YHAA 2JLWA 3UIEA 3IP7A 3D3WA 4F56A 4DSTA 2RGRA 4MLPA 3GK3A 1T36A 2FK7A 1N75A 1L4UA 2ZU6A 5AJUA 3C7AA 3RIXA 5JALA 4OBXA 5A9SA 4QE3A 3ETLA 3DOFA 3K1TA 3EVBA 4AURA 3T1YB 1RRCA 1XMIA 1LEHA 1B8OA 2I2FA 4PLZA 3E1GA 4EUEA 4CI0B 1EJ0A 3IR6A 1WXWA 3L7NA 1J90A 5EPUA 3IT0A 3LWNA 2Z83A 3TLEA 1JTEA 4AW9A 1PNQA 3IT2A 1ZH8A 3TMAA 4WLEA 3SDSA 3QZUA 3TZKA 2QNRA 3KQLA 4ND1A 4I50A 2F1IA 1E79A 2Y6VA 5AI8A 4B35A 4OLFA 4MUEA 2OFXA 3D0KA 4PZUA 2X2PA 1AHNA 2VCYA 4ZOLB 3I92A 3PZBA 1JZSA 2IE0A 4OL9A 1PWZA 1E3DA 2IT1A 4V1CB 2I4NA 5ETJA 5D3MB 2I0FA 1Z39A 2IU6A 2ZRPA 2QMHA 2YWJA 1QFJA 3FXAA 4IH9A 4WD3A 2HMSA 4NZZA 3MHPA 3EF1A 3NEPX 2FZ5A 1KFKB 3FWKA 5JATA 2XSZA 1XFAA 4KUEA 4L16A 1V6CA 3QVXA 1CRWG 2ATIA 5G3YA 2RGUA 5BXYA 4HNTA 4GMDA 2HSJA 3U3ZA 1E5QA 3LCUA 3L7BA 2IL1A 1SU6A 3K35A 1QGOA 2RI6A 1N8TA 4AJPA 2P9GA 4RDXA 2PX5A 5EKTA 1QK5A 1XTIA 1RCUA 2D1FA 2QXTA 3ZK7A 2ILTA 2SCUB 3PYXA 3MZ0A 1BD4A 2J67A 5BWCA 1UXJA 2CJFA 3GLHE 3IQIX 1A2QA 1UQUA 2SKEA 1GRVA 1W49A 2AMYA 5JI2E 1QUFA 2KPOA 2QEQA 3QXXA 1I7PA 4KMSA 3UHFA 2IYOA 2G72A 3ZD8A 1BU8A 1WD7A 3T9DA 4A4DA 4JOBA 4YDHB 3ZU4A 5LQRA 7AT1A 4MQEB 3S0JA 2O8CB 2VK2A 1MUUA 4B3HA 3DR3A 1NBMA 4WGFA 3VZQA 3GRRA 2G1JA 1USUA 3ORFA 3N5CA 2PG3A 3DULA 4AK9A 3L1HA 2Q07A 1RKXA 3DEJA 5L9AA 2AXPA 1KDYA 1QCZA 2EHDA 5IXYA 3KAJA 2XGSA 1IYZA 1YBFA 2VVTA 1SFRA 2PH1A 3EEQA 5FHQA 5FNZA 3CWZA 2K2WA 2Y9MB 4PHHA 3DO8A 1OJ7A 3FYTA 5CX1A 5SYNA 1EHYA 1HT0A 1U90A 2ZDQA 3FSGD 4CFSA 2PYIA 4BFSA 4YP9A 4DG9A 3FPAA 4HUQA 1C9EA 4K05A 3VDXA 1SXGA 2A9VA 4YRIA 5ELMA 1WP4A 4URFA 4PSAA 3BWMA 3EIEA 1A88A 4ZQHA 4PAMA 2PVPA 1KEPA 3TUIC 1OASA 4FNGA 1E1KA 4LDPA 1EFDN 1XTKA 1UMCA 2CVOA 8ATCA 1GGHA 2VUSA 3NOXA 4WASA 4DDTA 3RSQA 5TVKA 1RNLA 1NN0A 3CW2A 1NQVA 1U0LA 2B82A 2AOVA 2EZ8A 4MDFA 1EQUA 1JDPA 3KOYA 2QR3A 1NVUQ 4IEEA 3D7LA 1DAMA 3RHFA 4C2BA 5AT1A 3UGJA 4LBYA 3SFVA 5IG2A 3BXGA 4GR4A 4M7PA 2BSAA 4YTEA 3EY4A 1IZ8A 2FJ0A 2V7WA 4HWTA 1HKHA 4ZIRA 4RVNA 1KPHA 3RJZA 1NC1A 1K98A 1UP4A 2CF6A 2RIRA 3AZPA 3QEMB 2VSQA 2GGSA 1IRIA 4NZ9A 1JU9A 4I4LA 3ZXSA 5C35A 5KDOA 2FW0A 4EECA 4RF2A 3DQQA 2ZUFA 4CKEA 3O92A 3MGKA 2RD2A 1GCUA 4B1FA 2CLSA 4CFZA 4E4TA 3WIOA 4OM8A 4QTTB 3ZJ5A 2QROA 4CE6A 1YSCA 2XT9A 1JQAA 4XPIB 3A6ZA 1GPDG 2Z9DA 5KYVA 3U2QA 1G2QA 3NIFB 1Y34E 3MERA 5ALQA 3T06B 2MMCA 4CDMA 4F21A 3DM5A 3EBLA 3LXXA 4N12A 2AMJA 5A1TA 2C9BA 2OUKA 3PB3A 2I9KA 3GQVA 1QYCA 5F7ZA 2V6JA 2XYVA 2Q5EA 3WADA 3N2GB 1B2RA 1O96A 2VSXA 2VCEA 4COOA 1JR4A 1D6SA 4M0UA 1U3CA 5K8UA 1MA3A 2QPLA 2EBUA 4KRYA 4G1UC 2G77B 4OXKA 4E31A 1Z0JA 1IHUA 4M98A 4QFBA 3KKLA 3FYDA 3OMLA 4Y30A 3DVRX 3VTZA 4R9NA 2V65A 3IJ5A 4MYUA 1GAJA 1NONA 3MNFA 5BPHA 1VE1A 1V25A 1WOYA 3GG9A 2DYKA 5ECYA 5JPIA 4J4BA 3U7EB 1NVEA 4C0HA 2ZK7A 1Q3TA 2AZMA 2PWZA 4R2MA 3SKYA 2XCRB 2I2CA 1N6OA 2C4UA 3ER9A 2C61A 4WCFB 2W6JD 3JR7A 4YN3A 3ADOA 5EHQA 3OOEA 4ZN6A 3OFVA 4YASA 3L4EA 3C98A 3G2QA 4R2IA 4U6QA 4EEXA 1OTHA 1NQ5A 3H16A 2KSQA 2G7MC 2HT6A 1EX7A 2D5BA 4BP8A 1P6XA 5ECGC 3OLVA 1TXGA 3DS8A 1FFWA 4FR5A 4Z2YA 2BHTA 1Z6QA 3A9TA 3OQ6A 2G28A 4X41A 1P80A 2JLUA 5DI3B 1RM4A 2WUEA 5J4HA 3PX7A 4URVR 2HTFA 3ZCTA 4LXQA 1WXQA 4TV8F 3SY8A 2IODA 4CV1A 1HMPA 1E92A 1SELA 2OKGA 1VE7A 5I47A 1Y1LA 1AZLA 4RFSA 2A2ZA 2EFEB 5JSZA 4KPGA 4W9NA 2O2JA 4ASUD 4JJZA 3ETJA 2E9SA 1QIJA 4YJFA 1P1KA 1VE5A 3T7EA 4AECA 1P5HA 1DXOA 1XWWA 1AU9A 2CYBA 3A1EA 5EZYB 5TJ9A 2AOUA 2B6HA 3B9BA 1LC3A 5AVSA 4UBLA 3ZUGA 4GDMA 3CLTD 3U49A 3WKEA 2C3UA 3Q1KA 5EA2A 4DCNA 2NWQA 3VR4D 5HIAA 4NMLA 3S55A 3N8KA 5SYAA 1DGQA 3REOA 4G9GA 4B6RA 3DMYA 3C41J 3V00A 4DR2B 3SOZA 2Q9AA 4O1IA 1BEEA 2PXAA 5B6IA 3AERB 1O4WA 2GSDA 2EP8A 2Q6IA 4QAJA 2P77A 3RSFA 1XCJA 4A92A 3AUYA 1IZ0A 1GDDA 1PR1A 1E6MA 1EFVA 2W0MA 1GIAA 2DQZA 1OYVA 5ECWA 2OESA 5D8DA 5ITSA 2I4OA 3PQDA 4OUDB 5EAIA 1VA5A 2DQ4A 2GZMA 4HQRA 2BBWA 2GF9A 2J0UA 5HGJA 3TQSA 4QTYA 1ZI6A 4FP9A 2WTAA 4G6ZA 3UAOA 2B0CA 1XCMA 2H51A 4JUFA 4NH4A 1VKJA 1UWLA 2H16A 2IU3A 2WUGA 3QUTA 4PG5A 4QU8A 3QMPA 3DFIA 3RBVA 2VDJA 4FQ5A 2C9OA 2CT8A 1NL3A 1MC4A 2I6XA 3MYRA 4BX2A 3FY4A 4D43A 4K40A 4HSGA 1JWLA 2YFHA 1KYXA 3H2GA 3H9BA 1M33A 4D8TA 5K99A 4ZPJA 4M37A 2WTNA 3CFYA 4DABA 4E15A 1HV8A 2GRJA 2X15A 3N58A 1XNRB 2PEYA 3LX8A 1YVRA 4S12A 3RS0A 1KE2A 3PRJA 4BMDA 3PYLA 5DPMA 3AZOA 1NV9A 4LRTB 2FPPB 1X2BA 4YONB 3K2BA 5G1OA 1KMNA 5HMMA 2X0DA 3T95A 4F6RB 4I55B 1T3LA 1M66A 3QELB 2UDPA 1PHPA 2FEAA 3QKWA 2R97A 4A0FA 1P60A 2ZBUA 1NR7A 2EFJA 3QU7A 1OB2A 4KSYA 2QSZA 3GMDA 5KTRA 1K4KA 1JHZA 2D2IA 2GA9A 2VAMA 1DU4A 1NLYA 1LBTA 2POCA 4HAZA 4JAVC 4MUJA 4RZIA 5DISB 3T7CA 1NSFA 1AY0A 2AV6A 2EL7A 2J3HA 2PBZA 2NUBA 1BOOA 3O6VA 4NBKA 5AI0A 1PZNA 5DRYA 4CKCA 4F04A 1UC4B 1T3TA 2P8JA 2QGNA 1ZM9A 2QZSA 2YJ3A 3GH1A 3IQEA 4IWNA 4W1PA 1C5KA 1TMOA 1RBZA 5B1YA 3ZZNA 1E6LA 5KINB 2PVCA 2FTKE 1F2TB 2MR5A 2R6R1 3NH9A 1EFTA 2VJOA 2ZYWX 4ILKA 1JA9A 1NFQA 4L50A 2XRZA 2PH7A 1YH3A 3FHLA 5JAPA 5EGNA 5A3JA 5FWNA 3VKGA 1KSJA 3B1WA 5COBA 4YROA 3SJAA 2XCUA 4D98A 3QXSA 4TTJA 5IPFA 1N8SA 1NN3A 2FN7A 1CUBA 4RK1A 2W6MA 1KARA 1JMYA 2PYDA 1X42A 2PS0A 3ZUPA 4HXGA 4C3OB 3K6KA 3E5MA 2YXDA 4N41A 1UKBA 1X7WB 1JPUA 1QDUA 1JDUA 1KEUA 1QFSA 1Y80A 1ZUD1 1W30A 3FDZB 3NHYA 3TUJC 4B34A 1E0AA 2V3WA 3DNFA 4YV2A 5WRFA 3SZOA 3BIWA 5H0IA 4OAOA 1R0XA 4CR8A 1H2HA 4R40A 2FRXA 3LECA 4YJHB 5LNK6 5G0TA 1CUZA 4W7IA 3NHZA 1XI2A 2YOFA 3DPUA 2W90A 4Q82A 4V0OA 4ETMA 2BP7B 2JLYA 2ZIEA 2PZKA 2PZ8A 3M9WA 4WOKA 1QO7A 2ZI3A 4X9XA 4A6PA 1N2XA 1KR2A 2PKWA 2QK4A 2YXPX 3L77A 3M4JA 4P3XA 4URZR 3TNLA 3UHOA 4F4JA 5I7RA 2XUOA 2DECA 3JAMA 2G82A 2R1VA 4RCYA 1TFUA 3VAZA 1NPTO 1ZH2A 6CHYA 3BSFA 2MR6A 4BO7A 1NJ5A 4CUJA 1W6UA 1CDOA 4BNFA 3ADBA 1CD5A 1VGRA 3AP1A 3BSSA 4CM7A 1PL7A 1ZU4A 2XDAA 3EZ2A 2YY6A 3K0CA 3LT4A 4Z1MA 4URWR 2I7VA 1YZYA 3DVLA 2NYAA 4V0LA 1FSZA 3T9FA 3G2NA 3KTOA 3NOQA 4QQRA 1E2FA 3ZCRA 1GPWB 1WTAA 2YZNA 4G01B 3HN6A 3LE8A 1QE5A 4RQUA 4UPDA 3LKDA 1D03A 2FPUA 2PBFA 3DZKA 2IC5A 4TKZA 2HDNB 3I6YA 1J8DA 2HA2A 5IMBA 4TXMA 3LPMA 2HADA 5GV8A 4BNUA 3I62A 4MQLA 4Q3EA 3QENA 4NNOA 2WA2A 3AM3A 3GJQA 1RYYA 5REQA 1N6HA 3VC2A 4MPRA 2PBLA 5TC4A 5J2UA 4ZAXA 4LWZA 3WHKA 5A4MS 1RQPA 4D82A 1M0SA 2BSXA 3MRXA 4X6XA 4F93B 3IEXA 3WGNA 4P4SB 3R7NA 4ER6A 1HEIA 2Q4TA 2G09A 4G07A 4K5QA 5LA6B 5BPFA 3K1YA 1PW7A 1XZNA 3AR3A 3KKNA 4WE3A 2BFDA 3O2NA 4I9GA 5EIAA 3W9SA 5NLLA 3I9V1 3RS9A 1D7OA 2WYIA 2I8CA 1IWPB 1SU4A 2WB2A 2BISA 1Z7BA 2HHAA 3RVJA 2AN1A 3H0EA 5AVTA 5GGXA 1OX4A 2QDXA 3GN1A 4Y18A 1A04A 2ZSJA 1JZTA 2BHNA 3LVFO 1PD0A 1N1DA 3NI2A 1PEKE 2C7GA 4QATA 2P78A 2ORIA 2Z4SA 4FFDA 1OY1A 3RVQA 3TCKA 4M9RA 2NADA 4MKHA 4I99A 5EHIA 1SKMA 3L0IB 1VPTA 3HZHA 3TDNA 1FFSA 5GM1A 1YVEI 1SBTA 4RTQA 2RHRA 5CBKA 4KB5A 1MV8A 1RHKA 2PO7A 5C52B 2VP5A 4IV5A 3MWGA 3AVTA 1T9HA 1UK8A 2C8LA 5JCJA 1S3GA 2DPMA 3DV0A 4IIDA 4XKJA 3MCZA 3PUZA 5DHUA 3T52A 2OCAA 1HY3A 2BGKA 3P97A 4BQNA 2WQ7A 4EI7A 5A4IS 1I7SB 4ROTA 5ARDA 1DV1A 2CEKA 3RLIA 5B30A 4LHEA 3DM9B 4JYMA 3RV4A 5F35A 4Z2AA 1P7PA 1ZXBA 2SHKA 1FBTA 1YR9A 3L9XA 4BZPA 3HNPA 2ANCA 4MA0A 4CTJA 1XZAA 1E4OA 3D7RA 4XXHA 2JFPA 1T13A 5J2TB 4C2TA 4M83A 1NBEA 2XUQA 3JVVA 4F38A 2CV1A 1U2GA 2GLUA 3E48A 4OYYA 1VIMA 2DCMA 3OQMA 1I2CA 2I7CA 1ECLA 3P20A 5ESDA 4BO9A 3S81A 4KPEC 4R0MA 3DDNA 3F96A 4Y6QA 2YFYA 3BFKA 1KKMA 4F46A 3B85A 4PG4A 3IOBA 2FOLA 2C94A 2BGRA 4L6AA 5BP7A 1T8WA 1XF9A 4U5XA 2VJDA 4OLHA 4RKRA 1W1WA 4H6XA 5F3DA 5EE3A 3ZE1B 3TTXA 1PZGA 2PO5A 2PPVA 3L8YA 4IM7A 1T1IA 4R2HA 3UKDA 5KAMA 4JJ6A 1DWPA 4INJA 2X0FA 4HJXA 3OJ0A 4B3RB 2JI7A 2OUIA 1AKUA 5TGTA 3RG8A 5M04A 3KYIB 4GI1A 4ZGWA 1VJDA 1LY1A 2H54A 2YRXA 3D3WB 3EW7A 4TTPA 5MGNA 1T36B 2C9MA 2OWEA 4BPRA 4JMPA 5KNLA 4O4HA 1AXGA 2B4TO 4BNTA 3AH8A 2XNCA 3QFFA 1JXQA 1O0SA 1BGVA 3HL4A 1JHUA 1Q3HA 1PD1A 4D44A 1ZU5A 2DLDA 5BW8A 4U8HA 1QVZA 2EBHX 3KOXA 2X9QA 4HCJA 4EZEA 4RC9A 1CFZA 3L1JA 4JX8A 1N33B 3L7DA 3L6UA 1A4XA 4GX5A 5L6MB 2J5BA 4TZ0A 4I50B 3V1LA 4ZRMA 5HKOA 1SXPA 4LNAA 1W34A 5IAKA 3ETCA 3D3NA 4X20A 4ADSG 2G9VA 2HRCA 4IG4A 4MPTA 3VR5H 1A9QA 4CV3A 1JLLB 4ZHQB 1SQ6A 2BVNA 2A1TR 2GZRA 1J09A 1N7JA 2HOQA 3LTEA 4RK6A 4RNCA 5EEHA 5CFRA 1AKRA 2BFEA 2ID8A 2Y0EA 4D9CA 3Q6NA 2RG7A 1ZM2A 3OVMA 3MWEB 1DSSG 2GH1A 2X8BA 2ZUUA 1UZNA 3ASVA 4HYQA 5EKXA 1STOA 1V1RA 2OYRA 4LOLA 1EFAA 1FMFA 1ZK4A 1G5QA 1YDGA 1MNQA 1XB2A 1P29A 1Z0KA 3QVUA 1YK1A 4QXMA 3RVRA 4GKJB 2QP3A 3GDGA 3MJFA 5EZ5A 1GKLA 2Z8YA 3VH2A 2XJ4A 3VKVA 4E2XA 2H1VA 5IC4A 1R74A 3NBFA 3SFZA 4E5NA 4XJSA 5KX5B 1KWKA 3LRPA 2XH8A 3BN3A 2QT0A 3SHWA 3PZRA 3KQWA 3TAUA 5JTTA 2Y0BA 2ZUWA 1XAGA 2QRVB 4MYRA 1W29A 4GPAA 4X1YB 4XWYA 2N0SA 2PS3A 4AG6A 3ND5A 4R8KA 1U99A 2ZAMA 2FXVA 3DDSA 2HI0A 1ADJA 1EUQA 3B1FA 4N82A 2CNWA 4V0KA 1PL8A 2WHQA 3ICOA 4L8GA 4PO8A 3ZE6A 1YZTA 1R12A 2QZPA 5ECDA 1E2DA 4KOEC 1FK8A 4BE7B 2IS1A 2PS9A 1W52X 1XYVA 5FXMA 1WDKA 3H84A 4QOEA 2ZIZA 3IUQA 1ZSVA 3NHPA 4O4JB 3U4AA 3VI3B 4DQ0A 4O63O 2M1ZA 3KQPA 3NXKA 5BOSB 5KVQA 2RHMA 4ND6A 3MLEA 3ZGYA 2JS7A 1VE3A 3BMCA 5A03A 2D74A 5DF1A 3SYNA 5KKNB 5CX1B 2ADFA 4KX3A 3C6BA 1DBQA 3EZLA 4II2A 3MS7A 4RXMA 1TUBA 2W2PA 5JJLA 1BAPA 1DMRA 3GU3A 1H8EA 4HUQB 1UMBA 2HPHA 3BTUA 4UHDA 4Y1EA 4D5EA 2WU4A 1U7DA 5AVRA 2UUAB 4X8LA 3G9TA 4U3JA 4HVCA 1CUEA 1DUVG 3NC1C 2BL4A 1HYEA 4RAOA 3QKRA 4DFDA 5HZHA 4QG7A 4YI3A 4LCJA 3NDPA 3LF1A 1PJ4A 3JRNA 4KDFA 4X63A 4EKYA 5LU9A 3UPUA 3G2OA 3HVHA 4XWWA 3NWBA 1T4BA 4LOKA 4HH0A 4X7RA 5HCNA 4CT0A 1VOTA 3AF2A 1CKEA 4EENA 5TQVA 3OT1A 3B7PA 3FLEA 2YZMA 3BC1A 4DLVA 3AMVA 3Q7SA 5L3VA 4HMPA 3KFXA 3T4XA 4IVPA 4P7FA 4MI1A 1YQDA 2V0GA 4UCXA 4MUNA 1EXWA 4JZKA 1NFRA 1PT7A 3RS7A 3F78A 3M7IA 3MMNA 4P93A 4S1OA 1OTXA 2I62A 4N3AA 2V58A 2WILA 5I5EA 4AJ1A 2DBRA 1FXWA 4C7BA 1VZ3A 3PFCA 2X1HA 3PQ4A 1Y1KE 4ZAYA 3KXPA 3VU0A 4B48A 2J87A 4EPTA 1T24A 1HDYA 4DQVA 3IDOA 1PZEA 3UV7A 3HP1A 5LZ7A 4GWGA 1Z7YA 8ADHA 1B43A 4RA9A 3P4UA 4IVRA 1O96B 3DTVA 1BVYF 1WMSA 1FPQA 2R00C 2Y1GA 4GOLD 1DCFA 5K51A 4EYOA 1CS4C 1DHRA 3MPUA 3OQIA 1GNVA 4MGZR 1NULA 3RUIA 2Q2QA 2AFVA 2R1TA 3DQPA 3HVJA 1T5HX 2RGBA 4WCDA 4YRGA 2ZRKA 3OZAA 3BS4A 2WJJA 2B2CA 2XMSA 2QG4A 3KB2A 1BA3A 1TAQA 2O2SA 3HG7A 3P0JA 3PEEA 2HJSA 4PQRA 4M38A 5FL7D 2PLNA 4S0XA 4DGQA 1E2QA 1MW9X 1SQFA 4J4HA 4LZZA 5EUCA 5JS1A 5GVSA 1LK5A 2J5RA 1E8NA 3EXHA 4TV9F 3ZHXA 4ALIA 1Y3IA 4CMIA 2X2EA 3Q7PA 4P1ZA 3WJ1A 1YKGA 2G67A 3HS3A 5B2FA 1U0GA 4TRMA 2PRZA 4BFUA 1RJDA 1ZA1A 3DOJA 1O0BA 1C9NA 1YS7A 1L8XA 1GAEO 1PS0A 4Q66C 4KW7A 1HRKA 3TW0A 3ZQKA 3M70A 1B14A 3PPVA 3ZU2A 2RGXA 2VDNB 1R8QA 3T5BA 2J3DA 4UD6A 1AQIA 3MT7A 1U8ZA 3GW8A 2VHWA 4LXXA 5CPBA 4ZDWA 3SI7A 3GVCA 3PFWO 4G5SA 5DE3A 3OQBA 2XMRA 5HZMA 4UCWA 4B3GA 4RFSB 4IQ8A 4UTZA 1SCQA 4P3PA 1YQTA 4DRYA 4O33A 5KHOC 2FP3A 2FW9A 1TJYA 2ZULA 3P9QA 4INAA 1E9VA 1ODFA 1E6WA 2QNIA 3CUVA 1NUAA 3K9LA 2IELA 1K6EA 4RKEA 1QHFA 2ZQYA 1OZ0A 2E82A 2VJBA 3G9ZA 4YY3B 2UXDB 3H2YA 1A69A 1V3VA 1X9IA 2A57A 4PC3A 2GCOA 3AFOA 4TLMB 2ZB2A 2AWOA 5AVZA 2P11A 2RC5A 1DTEA 4PYRA 4N7MA 3DEAA 2WYVA 7REQA 2P4HX 3FCXA 4YIKA 3K8OE 2BFAA 3TR6A 4DUGD 3WO1A 3FVWA 4OYHA 2C9DA 2O3JA 4Q05A 3O1IC 3C16C 3EMDA 4I6JA 2Z95A 4XDYA 4C0BA 2IHYA 5AVUA 4B0PA 4MVJD 2OB2A 1M2FA 3A6PC 2XB9A 3GHHA 2HXSA 1DKNA 1RQGA 5KSOA 3IAS6 1KVQA 4B4VA 2B1IA 5E95A 3OJOA 5FBRB 3KJFA 2HEIA 4YR7A 5A3QA 4XIJA 5DNYB 1U9CA 5DM1A 4YMLA 4NCIA 1GQ2A 2P4EA 1G38A 2C2ZA 2J9ZB 3JD3A 1W76A 3CLHA 1FUIA 3FPSA 4YPOA 3GMIA 1SK8A 3GFOA 1IAVA 1TC1A 4MVJE 2BFFB 5EL0A 4D9BA 3M6IA 2NUTB 1FOEB 3EGEA 5K09A 3KG2A 3JQFC 1FW8A 2DAPA 3AL3A 3FPKA 3NVMB 1JEEA 4HEA6 1U8EA 3LYLA 2DBVO 2F3SA 2FN9A 2C0CA 4L6CA 3ETNA 3VTFA 5LPNA 4TYMA 4MW2A 4OHRA 3A58B 1JEOA 2VEDA 3CSUA 3KDPA 1F8XA 2IYVA 1A2KC 4J90A 4PW0A 4D9IA 4KPYA 3GNLA 3KJQA 3MBIA 3K4QA 1QONA 2JIMA 2Q3HA 1DOHA 3ESCA 1X9GA 4HHEA 3U3KA 3VXKA 2CBGA 3VUEA 5HNKA 4XDHA 4KVAA 3RSOA 3BD7A 4NE7A 1VL2A 7ADHA 3ANXA 1M34A 3ABOB 3DKRA 2CKDA 2CLMB 3C7KA 1X3SA 4QNNA 3L93A 3V8BA 4AQYB 8AT1A 1EAYA 4DDHA 4C04A 1WM1A 4RV4A 1JBQA 1SCIA 3AIMA 1W4BA 3JVIA 3OQJA 4LTDA 3SIXA 3UOGA 5K3OA 1YC5A 5JECA 3ZLVA 6AT1A 2PX3A 5DYIA 5TEWA 1XZQA 4KQGA 4XTRA 3S2YA 1K9VF 2Z0MA 3QIVA 1M2VB 1Q17A 3BAZA 2CMKA 5SICE 2CK3D 1D9XA 3C6MA 3WI7A 1GEEA 1OOEA 4XUEA 1WEKA 5G0UA 4FKMA 4IXDA 2KX7A 2XECA 3HSKA 2FCAA 4CL2A 4FQ7A 1YZQA 5K3DA 2ZWVA 1TA9A 2BN4A 1EX1A 4DIKA 2QR2A 2C2YA 4YAOA 3BIFA 4CEHA 3GI1A 4YJ3A 5BQ5A 4JT9A 2RGGA 2B78A 2YWGA 3OM8A 3UWPA 4RZQA 2B4KA 2C8KA 1RLTA 2IP4A 4JLAA 2EKLA 1S89A 3BF7A 2OFOA 3PFGA 5CHEA 3IBCA 5T4EA 3RE1A 1BDHA 3ELWA 3WMGA 1RC0A 2WSMA 4CF5A 2OZKA 1K3FA 4HH1A 4AU1A 3EDQA 3PPWA 4BV8A 4HQLA 2J5QA 1YA8A 2VPIA 5AVJA 1MG5A 2HJRA 4PZEA 1HXHA 3KEGA 1DTWA 3I58A 3IEPA 3LGXA 4JB0A 3V2UA 2PY6A 5E1OA 4ZEXA 1WU8A 2AB0A 3UG6A 3GGGA 2VHZA 2X4IA 2YYSA 3V80A 2DH5A 2BY4A 1HDZA 2WAMA 1D04A 4RJJA 5EIBD 4DIFA 5LZ2A 5F2KA 3HE3A 2HW8A 3KWJA 2F1KA 2JJMA 4EJ6A 1U7UA 2YXLA 2BM9A 3DF7A 3I0ZA 3ND7A 4KDRA 2QVCA 2AX3A 3WB9A 3CVWA 3CEMA 1WX1A 2PD3A 3E3MA 3HCBA 3G17A 3AK4A 4IJKA 5AJVB 3UAVA 4OVKA 2I22A 3HXQA 1RLIA 2VH2A 1J0AA 3PFHA 4L4ZA 4UREA 5F2NA 5F23A 4XM2A 1VDZA 1UKVY 1ZJZA 3W78A 4B3FX 5D6NA 4AZ0A 3I5XA 2AI2A 1D2AA 5MDHA 1JXOA 2ZTLA 2INGX 3HYTA 3FGOA 3QEJA 1JHYA 1XAJA 4C0LA 4KBFA 1X74A 2RHCA 2WDPA 4XVRA 3WLQA 4DWJA 5KYWA 1HMYA 3UJPA 1ZGGA 5ERGB 2G07A 5DP2A 3IB3A 2KHZA 5FPYA 1I7QB 1HFWA 2X6QA 2NTNA 5E7IA 4UMFA 1Y5IA 4TRJA 3OTOB 4IW3B 1ULBA 1U8AA 3V8MA 3A25A 3V7UA 1G5TA 1DEAA 3HJAA 4H7PA 1OKKD 4IICA 2XQGA 4L8WB 3WLMA 3W2TA 3W5DA 2BD0A 1J5PA 2AKAB 1G7SA 3CF6R 3H2IA 4HR7A 4JNCA 3H8WA 1XKXA 2Y68A 1N9GB 4L28A 2P3OA 5REQB 4CKZA 4R1LA 1W5TA 4IXMA 5J2UB 1X8KA 1AX9A 1GNTA 1CZNA 3VO9A 4Y7CA 2UXBB 2FR8A 1GL9B 3F5FA 4X62B 3OTHA 1UC9A 3RFVA 4BXOA 2GR9A 4IFEA 4RZXA 1QPZA 1E6UA 1YA4A 5IM4A 2ZJ5A 4P81A 1PV1A 3CMMA 1YDWA 3ABRB 1E89A 5D1NA 1P1HA 2YXBA 3PHIA 4WY8A 3OA2A 3W5UA 2P5YA 4M6WB 1M7HA 2BFCA 4FYJA 4B6GA 1JLKA 4ZYXA 1I1OA 1XSEA 4JDUA 3WGVA 5AJWA 4LZAA 2VRCA 4PLYA 1W0JD 2X58A 1GZDA 1PJCA 2IIBA 4A5OA 3H87A 1DKQA 1I6MA 1PW5A 2CJWB 3D1VA 4O6VA 4NENA 1UUFA 2ZCJA 2WY2D 1NJGA 2YN0A 1RWMA 3EOBI 1D3AA 2C4HA 2O8NA 4I1UA 3E5RA 1IOZA 2NO6A 4M7OA 2D1YA 4D3YA 1I3KA 3GJ5A 3B60A 3U3MA 3DBOB 1ENOA 1XLTC 2H5LA 4ITRC 1PK8A 4HMQA 2GCEA 4Q1CA 2ZQZA 1XU9A 2H9IA 2L19A 1XTUA 5EFOA 1PX0A 3KSZO 4ZXFA 3UG7A 4C14A 2Y8EA 4JI3B 2W8ZA 3O7WA 2ZRGA 5JDCA 3ND8A 3H5VA 3UJDA 2WUDA 1T5SA 4BN0A 3DV0B 3ZY5A 2JVIA 1WOMA 1UC8A 1RKBA 3AVPA 3CF4G 3I72A 3K1JA 1L5OA 1N0UA 2EEZA 2QN9A 3DBVO 2JNWA 3BCHA 3L4BC 3BBPA 4BTVA 4N5IX 1IHOA 4R05A 5B1IA 1UZMA 3GH3A 4PNHA 1W75A 3CX6A 2Z4RA 1IEVA 2RGAA 4HNHA 4P8RA 4XGIA 4MKGA 2WSBA 1GV0A 1OCEA 1ZRMA 4NYMQ 3FTPA 5JBNA 1VRVA 3OFSA 1X19A 1YZLA 3LUBA 2WJAA 2J6BA 3B1XA 5DBIA 2QJFA 5E38A 1Z5OA 2C84A 3JQAD 3SE7A 1R7RA 1JYEA 4ZODA 4UCQA 3QBVA 5GQSA 3RQIA 5B37A 4N1AA 3CISA 3AG6A 5JO0A 4PYKA 1SUWA 4EHBA 2TSYB 1OLXB 1EYZA 3BRCA 4S1TA 4HLQB 5KVAA 3C0KA 2PSDA 1T29A 2WSLA 4X6LA 5ABPA 4QIHA 4TWIA 2QAGC 4FDVA 1HUQA 3FYSA 3R3HA 4N5LA 4P98A 1JSZA 1A5BB 1Q0RA 4KXXA 2D1RA 3HFGA 4KO1S 2NZYA 4RSRA 4B7CA 3BHNA 2VCHA 1H05A 3FVRA 3G0DA 3OIYA 1CUFA 2YOHA 2VNJA 1L1FA 4JXZA 1W2WB 3N0WA 2PX6A 1L5KA 1EFKA 2EJWA 1JKFA 1KERA 4L08A 5JAQA 4B76A 3NIGB 4DMMA 1UJ4A 3WRYA 4B6SA 4MWDA 1IE3A 4WZAA 3Q8LA 3NM4A 3UOWA 1K63A 1CHNA 3D5EA 4O4HB 3GO4A 4IZHA 2AD1A 4NAVA 3FSEA 2PS1A 3V3KA 2F9MA 1U6IA 1VIAA 4YCMA 3HKCB 1YS6A 3H4IA 5DCYA 4X7MA 1T6BY 1TVCA 2R4TA 3TLJA 1TQHA 2AR9A 1G3RA 4EQZA 4Y6OA 1L5RA 4QOHA 3TRJA 2XCLA 3CB4A 3WMWA 3FPLA 3RODA 1QIHA 2FR1A 4TQGA 4B17A 3X1DA 5HF9A 5F1PA 3H7IA 1E9FA 1P62B 4IIGA 3ST7A 1XQXA 2A0KA 1ZZEA 4G1BA 4NULA 4R6WA 1E66A 1XLWA 3PEVA 4HNVA 2W2LA 3R9KA 3EGDA 2BFEB 2OORA 4C0AC 4NBSA 4RE6A 3GVPA 4NBLA 3U62A 4I5IA 5KCMA 1DEHA 3DZ8A 1V1RB 3R7AA 1L1EA 4Z9YA 5K0FA 3R4VA 1O94C 1I3OA 2RBGA 3PIRA 4G5XA 1XZIA 4ZAWA 2XD4A 2BYTA 4JYAB 3ZTWA 1BMTA 1HG0A 3G8BA 4DNPA 4EB3A 5ITVA 2QYOA 1Q0ZA 4RXUA 3NBYC 3BGSA 1SGWA 3S4YA 5KSWB 1YNOA 1K5DA 1YR6A 5DBOA 3HRHA 4XQEA 3UBMA 5JOQA 4KDEA 4KXMA 1XNJA 4PLWA 1PGOA 2G83A 2CVFA 1L4EA 3GLKA 2PKRA 1BHJA 1H2RS 2Y4NA 2PTGA 4M53A 5FNVA 5KU1A 2OOKA 4O59O 221PA 1RJWA 5AM3A 3CCBA 4RMNA 4NE9A 3I01M 2PYZA 4ND7A 3MOIA 4BNKA 5K2OA 3EMVA 3TE6A 3VDRA 1QGUA 3FJOA 4P9NA 5FWDA 5GM2A 1IBLB 1NQAO 1KOGA 2VK8A 1JEDA 3T7SA 3REQB 2PLFA 3ZEAA 2QPAA 2XUZA 2Z2JA 3NBMA 4KQJA 3QVGA 4MUYA 4EI2A 5IU6A 4B6PA 4RIFA 3L7AA 4BRZA 1IN4A 2DPYA 1S02A 3JARB 5AUOB 3IC5A 2ZSAA 3TQCA 3TFOA 1SUBA 1XQWA 1CNFA 1BEUB 2A5YB 3T9BA 1TVMA 1CV2A 3LBAA 5IX8A 3BMCB 5TE9A 1SVSA 3KK0A 1UEIA 3HFSA 1A8HA 2QUBA 3FFWA 2GERA 4DG5A 3K8QA 5EE1A 1TUBB 3R20A 4DUPA 2Y1EA 4JA2A 1UMBB 3KXKA 1R1DA 4IDDA 4FS3A 3H11B 5E4JA 1CBUA 2WFLB 4RM2A 1TYEB 2IBMA 1W4CA 3NTUA 1L3CA 4TTAA 4E03A 1CUAA 1A4UA 4EEKA 1HQKA 2CVHA 5F7XA 3EIFA 1XXLA 3K30A 5CW1A 4DKJA 2IEBA 1P45A 1SZJG 3QW2A 5CB8A 3UZUA 2YNMC 5BSEA 3LC2O 1ITZA 2XI4A 3JQBC 3FR8A 5CFPA 3TG2A 3FMGA 1U4SA 3SBXA 2PPLA 1ECFA 1NNEA 1DJOA 2Q9CA 4OHOA 4WFKA 3GROA 3OT1B 1H9AA 5BYKA 5J47A 3T34A 1RM5A 1JH8A 1TLTA 2AQHA 1EINA 2DHRA 2H18A 2N42A 3OFJA 5TPZA 2NO0A 4F3RA 4JSTA 3F8SA 1E7QA 1US8A 4FLMA 2GZDA 1TZJA 3O1JC 3QVSA 4G0MA 4NYIR 2V1XA 4IDFA 4PY2A 4OY3A 5IVKA 1DFIA 3THSA 4QM6A 1QF6A 2QMEA 3ZHYA 4V2UA 2OC4A 1KDVA 2HBYA 1FP2A 4CM3A 4YMHA 3G2HA 3T94A 1ZL2A 4QUEA 4O2BF 2FSVA 4UHEA 3FNIA 2BHRA 1TJPB 4LISA 4LF9B 3BL8A 1X7XA 2GB4A 4BMZA 3GCDA 2YCLA 3W04A 1SKQA 2VF7A 5JWOA 1ORVA 3TFWA 1UPCA 4RQTA 5TJHA 1RZRD 2BMWA 4DA4A 4RLQA 1IJKA 1R5NA 2JGAA 1ZH6A 4DCTA 3IP3A 2CB0A 4J0JA 3DTVB 4IP0A 4TL7A 4MW4A 2RK4A 4HBGA 2ORED 2P4QA 1QGED 4FGJA 1PFVA 1BHQ1 2HCFA 3JYPA 4HG2A 2D0DA 1LNQA 1XAIA 2ZTMA 3IXMA 1DO8A 1RMQA 2ZZKA 3C3KA 5FOXA 3WOHA 2UVQA 1FNSA 2HJVA 2I4IA 3GRAA 1QLWA 4NMHA 4DNOA 1G16A 1M1XB 3IVMA 1AE1A 1N2SA 1L5NA 2I66A 1VKZA 1L7RA 4Y2TA 3ADCA 2FFBA 4GRIA 2OLJA 2IEDA 1RQRA 3S1AA 5KS2A 4HBZA 4DNXA 4DDWA 3OPNA 4R2WA 3ZWOA 3PHLA 4W5NA 3BX1A 3MJEA 2W0SA 2FZGA 2L82A 1QHIA 1LNZA 2WHEA 4L75A 1LI4A 3D8HA 1D09A 3L0SA 4MRRA 3F6EX 4QFDA 5JH7B 2C3PA 2R87A 3BUSA 3OCZA 4UHKA 1RHMA 1MQAA 1P3JA 4WAUA 1S2LA 1UPXA 5FO0A 3RU9A 4GMKA 5E8JA 1CJSA 3DMTC 1OA1A 2J3KA 2FLWA 1J9GA 1UH5A 3LUCA 3OZGA 2WBLC 1RAEA 2QAGB 3DVSX 4O4LA 2HT1A 3GEGA 1E61A 3KQSA 2Z8XA 2HMAA 3U60B 1PR3A 4PXAA 1WUTA 1VI5A 3UCEA 1DC6A 3JPWA 1J4AA 4FJ2A 5CYOA 3U7RA 621PA 1UOEA 4LG1A 4AJJA 2AFHA 3ZDRA 5J43A 5DLDA 1UZAA 3CUYA 2EQAA 2FPMA 5IKMA 4WRRA 4X95A 4A2WA 1RAHA 4MINA 5CLLA 5HE9A 4A0HA 4F2HA 2VTBB 4NHOA 4G97A 5IWAB 1CT9A 1Z4QA 2G36A 2ZAOA 4OIFA 2WJIA 4QX6A 4J3NA 1IY1A 4C3UA 4F1JA 3IUYA 4YXWD 1PVDA 4MR8A 1C1XB 1Z0DA 3PUJA 2OWDA 2CE2X 1NXVA 1H0RA 2ZWMA 2JIZD 4CLXA 1R66A 1DBRA 1KH1A 2OCBA 3HYRA 3B9PA 3KTDA 4G0ZA 1A50B 3GGJA 3M6MD 4XASA 3F4LA 1P0QA 4QNRA 4DRXA 1TRKA 2AQ8A 2FW1A 2Z2ZA 3V6MA 4C4YA 3A6LA 4CW7A 2IH4A 4K9OA 3AXSA 4HEQA 5JAUA 4B6QA 1TVEA 3UK6A 3PQEA 4HGOA 1IY9A 2VDLB 3QU9A 2JJ1A 3H83A 2BBOA 3JWPA 2NSYA 3BGOS 3PD1A 4X64B 2IPMA 2QMOA 1RMYA 1JI3A 1EXMA 2QPTA 2YWXA 3HWRA 3P5BA 4K9SA 5HEKA 1LS6A 1P7WA 2CVQA 2ZWAA 4K3UA 1XZMA 5LL6P 3ICQB 4FZVA 2XF2A 1SULA 2ISSD 4K86A 1APBA 5THXA 3K0BA 3RRNA 2GWHA 2JFHA 3TO5A 1DCMA 1ILWA 2O4CA 1EBUA 5AW2A 3NVKI 4MA5A 1AN0A 4PN3A 3OZCA 5F12A 1BVRA 4FBGA 5JJKA 1ZUIA 4DR6B 3JX9A 1CUIA 1JDBC 1Y7HA 4NCHA 4D9GA 2BEWB 1I0ZA 5LQMA 3GZNB 3D6TB 4Z8XA 3T9CA 4HX9A 2BDEA 2D2EA 5KYUB 3WX0A 1WW8A 5ADUS 1NY5A 2HHHB 4AUMA 1U0NA 3OBBA 1IUOA 1KNXA 1PTJC 2OV2A 5FT9A 3HB9A 3GT3A 3QE0A 1UM8A 4KYTA 5AICA 4Q7MB 1WCYA 3HDJA 3IEMA 1TK2A 3HJFA 4W8OA 5G53C 4ARUA 2V7QA 3TZEA 3FFTA 1GO2A 2FUNB 3VR5A 3O9VA 1D1TA 3VR3A 1VJRA 4AJOA 4EHDA 5HS4A 4Y6RA 3IH5A 5ESWA 2GM3A 5K0BA 4BX3A 2REXB 4Q9HA 1ZONA 3LG2A 3SNHA 4GLFA 1DJLA 1OHHD 2ZPAA 3P2OA 5JZMA 1RACA 3ES9A 1LPSA 3NKLA 4G5HA 4JHLA 4K7JA 3OLCX 2ODQA 3WMEA 4F1WA 5AO9A 4NZMA 3UOAB 4A3SA 3VOAA 4IFBA 4C06A 1KZ9A 2PGXA 4RJTA 5L7WA 5DW3A 1AKWA 5GPBA 3N6VA 5D3ZA 1V45E 1JKMA 3DC7A 1DKPA 4EABA 1XZHA 1VJCA 2HK6A 2VK1A 4K87A 3FZGA 3JQEA 1K1EA 4OGLA 1KAQA 3RRYA 2H9AA 5KQRA 4AZTA 1AMUA 4YAFA 2BKUA 1P7ZA 1T10A 3HQ4O 4CEHB 1I2MA 2WJ4A 2K7ZA 2HSGA 2XV1A 3CPHA 5DTIA 3EAFA 5CYGA 4BVFA 1GADO 2FW8A 1LTKA 2BF7A 2I6SA 2Q1SA 2R62A 3LA6A 1BMDA 3GFRA 1H66A 1WU7A 3S5JA 3TM4A 4DUYB 1YJ5A 2Z30A 1PP4A 3SS9X 3B48A 3B9RA 1PFYA 1E4EB 5FIUA 3NIDB 2H48A 3K6JA 4KNWA 1BQ3A 3OLXA 1BD3A 1DTWB 4LDRA 4ZVMA 3WGGA 4ESEA 2XGOA 3NHRA 1K5PA 1FX0A 1DQPA 5K45A 4BV2A 5CM2Z 2AC2A 2PQ6A 1K3TA 3GEEA 5H80A 3EVGA 4OBBA 2F8TA 1AK9A 1GZSA 1ZGCA 3O93A 5CPFA 1N32B 3M4XA 4E07A 1WHSA 1JVNA 1OILA 4EBBA 1VSVA 4HGQA 4Q9LA 1R15A 3Q7RA 1RXWA 3ICEA 4PC1A 3C8HA 1E9CA 4TKVA 3ADDA 3BHIA 2FRDA 3F6PA 2HLPA 4IIYA 3WGUA 3PFFA 2PUTA 3QFTA 1U6JA 2QSYA 3Q9SA 3A2LA 4MGKR 3WE7A 1GYRA 2YJGA 2F8LA 4GT1A 4YRQA 1TYBE 4AZ0B 1FQWA 2N3ZA 4GSKA 2ASVA 2DFLA 1FCJA 5FADA 5DHFA 5EJ9A 1GN9A 1EFCA 4Q4DA 1UDWA 1L8OA 1QG6A 1R9GA 1ESDA 3OJXA 3QU2A 1SVOA 3PC3A 1R8XA 1FDVA 2HIMA 3ROEA 4D80A 4RPIA 5ITZB 5CCXA 2OBXA 3ZX5A 1CVRA 2GJ9A 1JKJA 3SIPA 1G1MA 5FTLA 4OV6B 1LX7A 1FPMA 1NJSA 1W19A 3A3PA 1NE2A 4JVNA 3HFJA 4Y2GA 4NCBA 2JRCA 1L7XA 3H4MA 4KIUA 3PGKA 1GTMA 4AROA 5JS8A 3ADKA 3LLUA 2BGLA 2I1QA 4ZEMA 1JSCA 3DXYA 1UQTA 3GLGB 4L57A 1TM1E 2II6A 2X0JA 2HN9A 4Q1VA 4RFLA 4F3TA 2DU8A 4XVUA 1NW8A 3DW3X 4QUGA 3ZCUA 1A2OA 1MX1A 4BXOB 1BGXT 4AXBA 3HDQA 1GPLA 1VIVA 2O7SA 4KLZA 4OG2A 5AOBA 2VJQA 3Q1LA 1PIWA 4LKRA 1U9ZA 1E6EA 4AO7A 3IQGX 1XQ9A 1UAGA 1XO1A 2AG0A 3UXEA 4H31A 3DLHA 1YIAA 1WDTA 2J08A 2KJQA 1PR5A 4PNZA 3RASA 1V5IA 3VYUB 4L0DA 3JRWA 3HZOA 1H3FA 2WJPA 4PF1A 1AHHA 1ZCAA 3NTRA 3K15A 4G0WA 2VKQA 4Q1BA 1DAFA 1WCWA 1N5JA 1Z7WA 2VTVA 4L73A 4NENB 1R0KA 3I28A 3O8RA 1YT5A 3TCXB 3K70D 1T0PA 3BGIA 2YHIA 3LHDA 2QM0A 2QTAA 1KAHA 4BY9E 3AETB 4QTUB 2E6KA 2PUEA 4UPVA 5DSZA 3M8KA 3O94A 2OGZA 3EG5A 1KI1A 1K2WA 3Q8XB 5KQGA 1QTIA 2IZ6A 3DZFA 3RH0A 3ZKAA 3G2LA 4DF3A 4JQYA 4NJMB 4BIIA 2Q3EA 3C6XA 3RYFA 1CR4A 4WLOA 2IXTA 4TUYA 1QAQA 4IAOA 4MYCA 4RD6A 3QG1A 1JA0A 1O95C 1YB6A 3HV0A 4KAFA 4CQMB 4C05A 3A9CA 1C30B 2XKJE 3DSRA 2EW8A 2GLTA 3LUPA 3TLZA 1Y3HA 3EE6A 4TLAA 3U3JA 1C8LA 5GZ1A 4ZYUA 3CH6A 3JYQA 4CM1A 1FTYA 2OHXA 3ZDXB 3L7LA 3JQGA 2FPGB 1ODSA 1VG0B 2QAJA 4LMPA 4CWAA 1OWOA 5FPKA 1Y3AA 1HEUA 4JN6B 2YR0A 5ER9A 1I80A 3H86A 3GC6A 2F7SA 4B83A 1OQAA 2QP9X 3ZK9A 1EHCA 4DYHA 1BZYA 2CXXA 1GPMA 3NASA 4WESA 1P31A 3RVKA 3NR2A 3QE3A 4ROSA 1ZJJA 1OX5A 2I6TA 2VP6A 3BXPA 4M87A 1U63A 2D54A 1N3YA 3BA6A 2XA9A 2P6PA 1ML4A 1URPA 1Y4SA 2PGIA 2FZEA 3A9WA 1QCDA 4EY8A 4D45A 3UWKA 5C18A 1DWUA 4JI8B 1SIBE 1TW3A 3GEBA 5JE8A 5TVGA 3R3YA 1YJBA 1GT6A 2QUKA 3COZA 2EKBA 4LBZA 1PSWA 4NATA 1I1HA 3CF0A 2X2OA 1AB5A 3TEFA 2J5KA 3BIOA 1DQZA 4UDNA 5CVJA 1YR1A 1JHAA 5KNDH 3THWA 5ES4B 2Q5CA 2IPAB 2OV6A 4PHFA 4DLXA 4NBNA 5K0EA 1FTWA 5EG5A 2XMQA 3B1ZA 1Z38A 3L8FA 4PSDA 1EP9A 3KEQA 3FCCA 4EATA 1SOAA 3C3JA 4WZAB 1XTSA 5HILA 3PWSA 1ZSNA 4YRMA 4ZGBA 2W2KB 3CWCA 4KITB 1NOKA 2RBKA 4LGCA 4REQA 1OE0A 5EI5A 2Y27A 5D51S 3IESA 5EUMA 2ONCA 3I37X 4GLOA 1QOZA 4X6YA 4CM8A 4B32A 3OBIA 2P30A 3E7WA 4DT1A 5AH0A 3CW9A 3CYFA 5IANA 4G5RA 1L3IA 4D42A 3PJDA 3MMXA 1ESEA 1F4PA 1Z3IX 2AC7A 2JFXA 4ND5A 1YRYE 3MEQA 1L5HA 2OV8A 2WIBA 4YAIA 4WNAA 4JVMA 3WFZA 4JDPA 2BKLA 4UM9B 1Q92A 1TEVA 4S3MA 2OK7A 5CFLA 4TLBA 3K05A 1DT3A 5AOAA 3OF5A 1COWD 1G5FA 2ODBA 3RGGA 3CLUC 1UBHS 3L18A 3VNBA 2FGJA 3ZLBA 2PKYX 4HWRA 3ZNOA 2HDWA 1A9RA 4EJ0A 1F3LA 1INLA 2AVNA 3G6KA 4RK4A 3E58A 4MRPA 4B7AA 2QYTA 1AB6A 1D7AA 1RWKA 1U80A 3QMMA 4N03A 4BWFB 2WKQA 3BJIC 4W5QA 4A6DA 2R1ZA 3PC8C 5SZIA 3B3FA 1E1CA 2Z58A 3DMPA 4WMLA 4Q3DA 1R88A 2VAPA 3BEOA 1M1YE 4KEAA 1A9XB 4DYVA 1E9EA 5JNRA 1Y5RA 1NN1A 3O9ZA 5DXFA 1KH3A 3BXXA 1AGPA 2H5IA 2B37A 5G4KB 3HPQA 3HK2A 3VBCA 4PWZA 4HN4B 4ITVA 1UBUS 1U0HC 4EO7A 1FXUA 1Z0FA 3V7WA 1FIUA 3E9NA 2IW1A 2MYPA 4DA6A 1AQUA 1O6FA 4E1AA 1QQAA 1N1EA 1GLGA 2B83A 2CF5A 2OAQ1 3B7WA 1S1MA 3FDXA 3ELYA 3F2VA 4Q7KA 1TF2A 3KYDB 1I4LD 3L92A 4CL3A 5MHTA 3JALA 4IFTA 2WZBA 2XUDA 4EARA 2FY8A 1G5IA 1BFDA 4GSYA 4JV5B 5TY0A 3UCXA 3KEFA 3QVGB 1GV1A 2EJCA 3NYQA 3ORHA 1Y8RB 2O8DA 1Z75A 3BE5A 3UO8B 4NYJR 3WLEA 4CR6A 5JIBA 5L3QA 4XDGA 2HMTA 5HDBB 3R74A 4BU1A 2FI1A 1ZMRA 3S2IA 2K5UA 3L06A 3EVEA 2BLLA 5EIWA 1J49A 2FUG1 3JYOA 2D06A 4YAUA 4DB4A 1XNQB 1B74A 3EEYA 4ENVA 3SDZA 4WIAA 3LU1A 1L5YA 2I87A 1KZHA 4JR2A 2MSLA 4LDNA 3OWXA 4OFZA 1DEOA 1X1SA 1O5IA 1VFNA 2VUIB 4Y9DA 2H7YA 4U7FA 4DV6B 4DR1B 1E3WA 4CYMA 1ISHA 2IHUA 3S2EA 4G0NA 4TS4A 5ALPA 2PUDA 4PR3A 2VWQA 1YCGA 4CM9A 3GWZA 3JAKA 5A06A 4AZWA 2CL5A 4R2KA 4FOLA 5ALLA 3ASYA 2JIPA 3F4BA 4OP1A 1UAAA 2I1LA 3MTEA 5LCXA 2Y76A 5CB4F 4UZSA 3JQCA 1XD8A 2MOKA 2OD2A 3DD1A 4I4TF 1E79D 1JWBB 5HFNA 1KA9H 5TF0A 1US8B 3JRXA 4PYQA 1Z33A 1WR8A 4LJ8A 3W6PA 1X7ZA 1ZMXA 3UMGA 2REBA 4HZIA 3BF8A 1XMQB 3DAHA 3VSAA 3K9BA 5AKJA 3FZNA 2B92A 3NGLA 4CJXA 5F9HA 3UBTA 1V96A 4PXSA 4KWHA 3CUSA 4AN1A 2BZSA 3NUQA 4E0BA 1XTVA 4Z3KA 4JKIA 2XSZD 2F62A 3C70A 3HDTA 3N8GA 2DH6A 2RGEA 3M1LA 3L79A 1Y8AA 4YV7A 2HWKA 2E1PA 1H2FA 3A9RA 3B3JA 2IXDA 3T5GA 5JD4A 1LLUA 4FS8A 1KRXA 1U7PA 2ZVQX 2OR3A 2C77A 4M76B 3KHSA 4LOHA 4N7JA 1P2TA 5U9CA 1PO7A 3IOMA 1AD2A 3A4VA 4CLHA 2ZAYA 3B20A 2B8TA 1ZOPA 1KZ6A 2NU9B 1FYVA 4B73A 3K5IA 3D9QX 1FNBA 1IK4A 3LM8A 4E7PA 1CZLA 1XDWA 2C5SA 4YMWA 4ZDKA 1GLVA 4GG1A 2V9ZA 5C31A 3TX2A 2Y93A 4LYFA 2XA2A 3S1AB 5JBIA 4ARIA 1W0KA 3T1TA 4LC9A 5CFMA 4ERXA 2OQRA 3M49A 4KO2S 1HDIA 1NBMD 2PUVA 2YWCA 1G1AA 4L8FA 4BO2A 1M5UA 1CJVC 1T1SA 1Y42X 3C8DA 1KRWA 1GSIA 1M74A 1I5EA 4IIEA 5IH7A 1U1DA 1PNOA 2JGNA 2FWMX 4YUZA 1DMSA 4I1YA 4W6QA 4S24A 4QJ4A 1V8DA 1TJ5A 4IHJF 2X5XA 4Q3KA 3B9QA 1GYPA 3QMWA 3QRWA 3SZGA 1CUDA 3CZMA 2X41A 5ALRA 3W4JA 2BM8A 1NVVQ 3I9V6 3JD4A 5AP9A 4NQZA 1T1GA 4KKXB 5B53A 1M75A 3K2IA 2BPOA 3K3PA 4JLPA 1PT8A 3OM1A 3CNQS 3D8UA 1EP1B 2CHFA 2EATA 4FD2A 4FU0A 4G0QA 1CJKC 4IS2A 1H0KA 3HA7A 4M8NE 4NQRA 1D6MA 3KVNA 4QJ5A 1R6UA 2FN8A 4O4IA 5EP3A 3UK1A 5K03A 5BNTA 1FY2A 5L4NA 4L9WA 2HA3A 2QM8A 1IUPA 4MB6A 1G5RA 3NJ4A 3VKHA 3L7JA 3UGQA 4DSAA 1H0SA 5JTUA 1DQRA 3GAAA 2WWVD 4OBEA 1ODCA 1VLJA 5D5HA 1DG9A 3PD0A 2HKIA 5CVDA 5CEFA 1E2EA 4PG6A 4EO9A 4MR8B 4Q4HA 2FQXA 3GNQA 4MVXA 1MX5A 4I66A 1ATIA 5CFQA 2G8LA 1XCBA 1S01A 4AYXA 5C80A 3JQ7B 1VBFA 2Q41A 3CPEA 3LF2A 4ER0A 3B1KA 1CNMA 4OF4A 4EPRA 1YVDA 5EJMA 1GU0A 3WRXC 3V97A 2WD8A 6Q21A 3O4GA 4HNGA 1FQJA 3AINA 1OU0A 3AHGA 4Y6SA 4FILA 3HA2A 4AKEA 3D81A 3KZVA 4R7TA 1KBQA 2JIQA 3AHCA 2LPMA 2ZJYA 3I2IA 1P0IA 1W2HA 4HAOA 1D4FA 2IEGA 3VVMA 2A9KA 5HTOA 1RKUA 4LYAA 4NMMA 2GAFA 1UKAA 2I2XB 2PXCA 3I01A 2PUAA 5LQAA 4ZKEA 3BORA 2JHCA 2JCBA 4LJYA 5AHWA 1KQOA 1U0EA 5C37A 3K72B 3C14C 2A5LA 4OI0A 4CTOA 3HM2A 3RAFC 1JHMA 3QBDA 2PVSA 4H4DA 3KJXA 3NRJA 3IVAA 2A59A 1P7CA 3DGEC 4JWKA 4QC2A 2IHBA 3H05A 4WTOA 5I6DA 1JSRA 1Z8FA 1UDBA 3C8UA 4V24A 5KMGA 3FPHA 2PRKA