3DGEC

Structure of a histidine kinase-response regulator complex reveals insights into two-component signaling and a novel cis-autophosphorylation mechanism
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
122
structure length
122
Chain Sequence
MSKKVLLVDDSAVLRKIVSFNLKKEGYEVIEAENGQIALEKLSEFTPDLIVLDIMMPVMDGFTVLKKLQEKEEWKRIPVIVLTAKGGEEDESLALSLGARKVMRKPFSPSQFIEEVKHLLNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein
publication title Structural Insight into Partner Specificity and Phosphoryl Transfer in Two-Component Signal Transduction.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/signaling protein
total genus 33
structure length 122
sequence length 122
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3dgeC00
4D6XA 1JDPA 3DGFC 3QK7A 2FMIA 3GRCA 3G1WA 5JNSA 3C3WA 5EWLB 1IIBA 3NHMA 3HUUA 4MRMA 1TLFA 1NATA 5TPWA 1GLGA 1U04A 4MR9B 6CHYA 5GQSA 1SXGA 3TB6A 1D5WA 3IP5A 1ZVVA 3F73A 2BGGA 2WJWA 3RVJA 4YLEA 1DP4A 2DRIA 3RVPA 2NUBA 1ZAYA 5KQMA 5TQJA 3TO5A 3LUGA 2O20A 3ILHA 2VYCA 4RXMA 1DG9A 2GBPA 3H5TA 4RDCA 3RVMA 1AB5A 1OXKB 2QV0A 3OLZA 2HPHA 3IPCA 4Z0NA 4NV3A 4ZMRA 5ED4A 1SRRA 4LE0A 4JB2A 1TM2A 4D74A 1EHCA 3MYYA 1GUBA 2OENG 1BDHA 2F8TA 1CYEA 3NNDA 1ISRA 3D02A 3LUDA 4F12A 3LOPA 2P9HA 1FFGA 3NHZA 3KYIB 1DZ3A 5FWYB 1SXHA 1Z26A 4F06A 4LE1A 4XARA 4FB4A 4XFKA 5CNMA 1YMUA 5JNRA 3QX8A 2FXIA 4F8JA 1H9CA 3CKMA 1QQAA 3I45A 1FFWA 4RV5A 4MR8A 4Z99A 5F64A 4W5NA 2B4AA 7ABPA 1U2PA 2LPMA 4HYEA 1FQWA 4N47A 4RS3A 2MSWA 3CRNA 3IP6A 2PKXA 1EWKA 3E3MA 4W5QA 3QEKA 3HV2A 4ETNA 4MQEB 5JNUA 2IOYA 4RXUA 3C6QA 4TLMB 3P9YA 3H6HA 2LBPA 2X7XA 2RGYA 4OLAA 1DC7A 1SD5A 3FDFA 2HQBA 2QW1A 4WXMA 2NT4A 2WWVD 2ZAYA 4WT7A 3MIZA 4DADA 1QNLA 3S99A 3CHYA 4HNSA 3OLYA 1EFAA 1GCGA 1ZGGA 3H5LA 1MB3A 3LKVA 1M5TA 3Q7TA 3O75A 4MGEA 2FMKA 3ILYA 1KGSA 1Z2EA 4KFCA 2PLNA 4NICA 4RSMA 2TMYA 1RXIA 2A9QA 1WETA 4KNYA 2L19A 2LUOA 4N0QA 4B09A 4W5RA 3KTOA 3IP9A 2IPLA 4MS1A 1SXIA 4QYWA 2JRLA 2VUIB 5CHYA 4RK7A 3OM0A 4IMIB 2LP4Y 1NTRA 4G0YA 2Q5CA 4MS4B 4P98A 1K66A 1XWWA 4LX8A 4RY0A 2PUCA 3OQNA 3H1EA 3B2NA 3QEMA 4XASA 1EWTA 1JYFA 2IPMA 3CU5A 5BRJA 3MF4A 4RY9A 4W5OA 2B1JA 3SY8A 3MA0A 3OQMA 1ZDMA 1JYEA 2CHFA 4EVSA 3HCWA 3O1IC 1Z2DA 4KZKA 1Z25A 3LKBA 1U2QA 4MS3B 1F51E 1QQBA 2PUDA 1S8NA 1LK0A 2FEWB 5KI6A 3FFXA 2R47A 4MRMB 1KRWA 1NXSA 1YK1A 3HSYA 3K9CA 4KQCA 1AB6A 2ID9A 3RVSA 4D6YA 1CHNA 4RK0A 2E4WA 4MLDA 3OLXA 1JF8A 3EQ2A 3C97A 4OBBA 1J56A 2JBAA 3Q9SA 3Q7SA 3N0WA 4Y9TA 2FLKA 4TN5A 4Z4CA 4XLTA 1R8JA 1YIOA 1ABEA 4XXHA 1Z16A 2WJAA 1RXEA 1ZN2A 1TMYA 2IPNA 3OMXA 3QLTA 3QLUA 4ML3A 1VRVA 2QR3A 4O1HA 4YGXB 2QXYA 1Y1LA 4IMJB 4G97A 2RDMA 1JDNA 4RK4A 1KRXA 3CG0A 3KLOA 5BQ3A 1QP4A 1NXOA 1JHZA 2FTKE 2QU7A 3D8UA 3HS3A 3LUJA 1QMPA 4EVQA 5BRAA 1Z17A 4UHKA 2WMYA 4W5TA 3T38A 1JL3A 2JVIA 3K4HA 4KK3A 4Z4EA 2R4QA 5IUKC 1USIA 4MQFA 4P1ZA 2MSLA 5CNJA 4MR8B 1B00A 2FMFA 4RK6A 3O1JC 4YR7A 1YK0A 3T95A 1DBWA 3H5OA 4Z9BA 3HM9A 2PL9A 3QLVC 3DLBA 2A9RA 3HXMA 4L85A 3EAFA 4EYKA 1ZY2A 4RKRA 2IYNA 3HEBA 4MLCA 1D2AA 2L17A 5JNWA 3QLVA 1LBHA 1Z13A 5I4CA 2P4UA 3LUHA 1UDRA 4RU1A 1A2OA 3DBIA 4IF4A 3GBVA 2W42A 4EY3A 3H5VA 4G0MA 2YHBA 3KLNA 3QELB 4JAVC 1M2FA 3L49A 1XHEA 4YS6A 3OQOA 3KKEA 4RZSA 4Z4FA 4OG2A 1QKKA 2HJ9A 3EGCA 4Z4HA 4EVRA 4LRQA 5TPZA 5KC9A 1DBQA 2CWDA 3MQ4A 4Q7EA 4DN6A 2M98A 4RWEA 4DQDA 2E4ZA 2JVKA 3ROTA 3OMWA 1E2BA 5TPZD 1YTUA 2FEKA 3EDCA 3KJXA 5DCLA 1C4WA 3H5IA 5JS2A 2M1ZA 5TE9A 1GCAA 1TVMA 1PUXA 4Z4IA 2N9UA 4MR7A 4FE4A 5IEBA 3F6PA 1NXTA 2PAFA 2AYXA 5B3JA 3FMVA 4WZZA 4KPYA 1E6KA 3JY6A 1C0EA 2E4VA 3EODA 3KCNA 3QEMB 4UHJA 5TQ2A 2FN8A 5CNIA 3KHTA 5TQ0B 5C5CA 3O1HB 1QO0A 3NNNA 3F7NA 4H3HB 3LUKA 3LUCA 4LE2A 4XAQA 4CBVA 4YCSA 5IX8A 2HQRA 2FSPA 1MAVA 2IKSA 1QO0D 3CZCA 2L18A 3O2JA 2JB9A 2A9OA 1ZHHA 3JPYA 2IPAB 2FLWA 3H1FA 3KYJB 4IILA 3T6KA 3A0RB 4WUTA 1MB0A 2LIVA 2RJOA 3OM1A 4OTZA 1P6QA 1ZGZA 4LZLA 4HNRA 3SG0A 3A3KA 4N03A 1GUDA 1L5ZA 3RQIA 1RNLA 2FMHA 4WXEA 3C3KA 2H3HA 4JB0A 3M9WA 5ABPA 2JBAB 9ABPA 1JFSA 3LTEA 3OLWA 3CLKA 4JA2A 3JS5A 2JCGA 4S04A 3KSMA 3Q15C 3SNKA 1W25A 1OXBB 2E4UA 2PJUA 5T7BA 1FSPA 2MYPA 1QPZA 3BREA 2R25B 4RY8A 4PZ0A 3CTPA 5IC5A 1YMVA 1JBEA 1EWVA 3BILA 1EAYA 4TMYA 1D4ZA 3GA5A 4KRFA 3RH0A 5IEJA 3RVQA 4G0PA 8ABPA 3BBLA 1K68A 2YHAA 3HDGA 4ZJPA 5HSGA 4E7PA 2GKGA 3I42A 2FQYA 5TPWB 3CS3A 3A0UA 3A10A 5HKOA 3M6MD 3CG4A 1ZH2A 3NNSA 5FBKA 1LJUA 1ZH4A 3ROFA 4YO7A 2FVYA 3Q7RA 1USGA 1HEYA 1ABFA 4G0ZA 2KYRA 3SAJA 5CNKA 3QLUC 2HSGA 4IGAA 5EWMA 4NCBA 3CFYA 3EQZA 4OATA 5IULC 1BDIA 2QSJA 4KV7A 2FW0A 4Z9AA 3MM4A 4ZPJA 5KQGA 2QVGA 2FKAA 2J48A 3RVRA 1BVHA 4G0OA 3I09A 1LJLA 2QVCA 2JK1A 5FWXA 2E4XA 5E3JA 4WWHA 5JNVA 2JVJA 4JASB 4ZMSA 2AYZA 4KMRA 4PYRA 2ID7A 3HUTA 2MSKA 1D1QA 5D2CA 4EYGA 5KQLA 4MS4A 1F4VA 3LUAA 3NBMA 3G85A 1KMIY 3IDOA 4PEVA 1D1PA 1DCFA 3SM9A 1PNTA 4ETIA 1Z12A 3URMA 5KWSA 4JOQA 3QX9A 1BA2A 2PMCA 2VK2A 4MS3A 2CHEA 4FE7A 5TQ2B 1DRKA 4ETMA 5PNTA 2PUAA 5DTEA 5IUJC 2GWRA 4MAAA 2PUGA 1DRJA 1APBA 4S05A 4MPTA 3HZHA 3JPWA 3JVDA 5EWJA 3H1GA 3N0RA 4KVFA 4NQRA 1ZITA 3OO0A 2FN9A 4N0PA 5DLEA 3RVNA 5JS1A 1VLZA 1JH9A 3I5AA 5KQPA 5HQJA 3N8IA 4GNRA 1TJYA 1FFSA 1U0SY 1JFVA 3HVRA 2I6FA 4HNQA 4N41A 4MYRA 4L4UA 3O74A 4RK5A 2R48A 5GOTA 3DGEC 3CNBA 1RZRA 3H6GA 3MMNA 5B3JC 3EULA 3O2QB 4MS1B 4M88A 1E6LA 4YWHA 2PUBA 3SQNA 1RZRD 4Q6BA 4QICA 3H5WA 3HJFA 3RVLA 1NXVA 4IRXA 1T34A 6ABPA 4EYOA 2V0NA 3HK2A 5EWLA 3IP7A 3JVIA 3N75A 4F11A 3TMYA 1BDJA 1JFTA 1NXWA 3GWGA 1DC8A 2FQXA 5BR1A 2PL1A 4EYQA 4MR9A 1USKA 3C3MA 2QZJA 4EGSA 3TX6A 4PE5B 5FBHA 1YS7A 3N0XA 1LBIA 4YRZA 4OLBA 4NCAA 5C5EA 1Z15A 3EJWA 4YP9A 2NZUG 3OO1A 4O1IA 2PUEA 3IPAA 3W9SA 2FEPA 3DZDA 2PUFA 4JP1A 3L6UA 3HO1A 3DLHA 1W9HA 4QYMA 1Z18A 1U8TA 4KREA 3FFTA 1QP0A 5IUNC 1ISSA 4LDZA 1XHFA 5EWMB 3QELA 4LDAA 4RK1A 1MIHA 4G86A 4TLLB 1QP7A 4RXTA 2ZWMA 2E4YA 3RVKA 1YVUA 1DBPA 5FWYA 3GBPA 4PICA 1NXPA 3M9XA 4QPJC 5HM6A 1P8AA 1VPWA 2OQRA 3E61A 5FWXB 1URPA 2CD7A 4F3TA 4KK4A 3GV0A 1A0OA 4GPAA 3VNBA 2NZVG 3O21A 2IDMA 1PNRA 1P6UA 2XDYA 4YV7A 2VUHB 3T8YA 3GL9A 3KG2A 2F8SA 1CEYA 3N53A 1A04A 1I3CA 5KC8A 1L5YA 3UUGA 2RJNA 1JX6A 1NXXA 2MYTA 2WRZA 3HDVA 4MQEA 4MQFB 1YS6A 1JWLA 3N6VA 2A9PA 5TQ0A 3O2SB 4KQ9A 1ZESA 5DGCA 5DKFA 3RVOA 3VNAA 4O5AA 2GI4A 1VKRA 1NY5A 1E6MA 3BRQA 3GT7A 5T3YA 1MVOA 2PE5A 4G0XA 1RPJA 1BAPA 3JTEA 5JNTA 4Z4GA 4ZYLA 4G0QA 3LMKA 3OLVA 3H75A 3BRSA 3TD9A 3FFWA 1M5UA 2MYNA 3UKJA 2FQWA 5EWJB 2WY2D 4H60A 1P2FA 3F6CA 1PEAA 4EUKA 3CZ5A 5IBQA 1PEYA 2GX6A 2HQOA 4RKQA 2L2QA 4H3KB 1DJMA 3UK0A 4E7OA 4Q6WA 3KS9A 1DCMA 4N76A 3LFTA 3LUFA 2H0AA 3FGZA 1M2EA 3Q41A 2NT3A 4MR7B 2WB4A 1JLKA 1PHRA 1DCKA 2MYUA 3GYBA 3R0JA
chains in the Genus database with same CATH superfamily
4F92B 3I5UA 2GCPA 4PC1A 2YMLA 1P18A 3D8RA 5IDVA 1SOUA 5KU1A 1C80A 2ZTSA 4GI1A 4QJBA 3MFQA 4BNUA 3WTCA 2AXPA 2QLJA 3C87A 1OFHA 1T0BA 4AMBA 4ENUA 2FF7A 3TF5A 3HFSA 3N7UA 3UANA 3V5NA 3VYSB 1ZVVA 2CFOA 5JAIA 3HLKA 2WJWA 1Q7RA 2V5UA 2NV0A 2PMKA 2H17A 5JAPA 3GLGB 5JY1A 3O8QB 2RAPA 2VT6A 3SHVA 5H81A 3CWQA 3VKGA 3Q7PA 2ZYSA 1OXKB 1MX1A 2PKQP 3OLZA 4Q3AA 4UTPA 2QAGC 1U3FA 2I6GA 1NNI1 4KXVA 4WJKB 3K0HA 5KWJA 4GIBA 3MFYA 4QPZA 1Z7BA 1RHQA 2GBGA 2J0UB 3NNDA 3V1KA 3PRJA 2IUEA 4PFQA 2F43A 4O5OA 1DELA 1DI0A 3R74A 4G63A 1E5TA 4X5OA 2IU6A 1DZ3A 3RK0A 1GDTA 4D42A 3BEOA 2IYZA 3ZTTA 1A88A 2HA0A 1YMUA 1ND5A 4YRCA 4G5OA 4ER7A 3QX8A 1QBGA 4F0JA 1E1QD 2I55A 1IHDA 3ND6A 1F3OA 4FEAA 5LC1A 3S27A 1RPAA 2YQZA 4DUYB 1W76A 5TF4A 4DAOA 5EQJB 4DB2A 3SJAA 2Q3FA 3JWPA 2B4AA 2OGTA 1K5HA 2X2PA 5FTJA 3ETDA 3NGLA 5JE8A 1YC5A 4CI0B 1YFKA 5BOVA 4ER3A 1DAGA 1NSTA 3MCWA 4XVRA 3ZWYA 1CY7A 4U9UA 5DYNA 5ER9A 2RGGA 1DWUA 2TMKA 2OWEA 1B2LA 3ND8A 1TM4E 2I78A 4N0MA 4Z8YA 1KI3A 2FSSA 3O4RA 1BJTA 2HDOA 4R68A 3LF2A 3U60B 3D3KA 1UAAA 1WHTA 4HAYA 3S70A 5LQJA 2GRAA 2YWBA 1QG0A 2QS9A 2HEGA 2IP4A 3ODGA 1TIBA 1SXJA 4YBRA 5TSDA 1UMDA 4BWYA 3KKZA 5KDLA 2W2VA 2BDEA 4I4TF 4MLPA 3WV5A 1K63A 3EH1A 3LP5A 1CETA 2BR3A 1ZOLA 2COEA 2GFIA 3AMVA 5HS6A 5I7AA 1HYEA 2O2XA 2P9TA 2V3WA 4KVGA 3MOSA 3VNRA 4MEJA 1RXIA 1LLDA 2OESA 2W00A 4PBSA 4F1WA 3MCTA 3GAFA 1CR4A 1R2QA 3JYHA 4O4IB 5JSZA 5KVSA 1ULAA 3ZQJA 2F1KA 4NLLA 4W5RA 2FUKA 3OTOB 4RKFA 1DAMA 2JRLA 4Q4JA 4CCSA 1BMFA 1FLNA 3FDXA 3FAZA 5AKGA 4U2BA 2DHCA 2QJFA 3E18A 2OOSA 3LGXA 2Q5CA 4JUDX 3RC9A 4FGZA 1P61B 6Q21A 5K4HA 4M7PA 3GNSA 3OQNA 4G0WA 3B2NA 4J1NA 4MLZA 4OH1A 3INYA 5EUQB 1U0LA 3EIHA 3L7YA 4G4IA 4RY9A 3ZIDA 1ICIA 4D9GA 1ZX1A 4EI2A 4HZIA 1FDOA 2RGRA 2ZSJA 4Q47A 4G5QA 3CUEF 2OP1A 5JWOA 3LDGA 1F51E 3I04M 4MXDA 4AXBA 3AFGA 3EA5A 4GF5A 1G8KA 1N0UA 3H1BA 4TKUB 3AHCA 1EK1A 1S9DA 2IUTA 2QZ9A 3INGA 3JR7A 1F20A 4OK3A 4BKQA 4D8TA 3JQAD 4WXRA 1FSSA 3BMOA 4QIHA 1TUBB 1QOPB 1AB6A 3GB9A 2ZBFA 3QYFA 3RVSA 4CF6A 4ND8A 2JJQA 2L69A 3E9CA 1NTOA 1QCYA 1TCBA 2WWFA 4I50F 4KVZA 1Q1EA 4PRZA 2WD7B 4OLJA 4RQTA 3E7PA 3A2LA 3B2QA 2XR1A 1WLYA 3E22B 4M1OA 1YFJA 4AZ0A 1WXWA 3SC2A 1J70A 4N8EA 3NTOA 4OK6A 4J9VA 1BS2A 2OYRA 1BH2A 1SU4A 3C7AA 2HSWA 3NZEA 1OCEA 4XJTA 1O5IA 1R6TA 1IH8A 2OTCA 3ICCA 4FSDA 4HEJA 5DFAA 1EQUA 4J43A 3AKDA 1NUUA 3GPIA 1W1UA 1JSZA 1Y1LA 3AR6A 3OKCA 3QWAA 4IMJB 2PO7A 4CMEA 1Y48E 2HSEA 3CBGA 1JT9A 2PH3A 3PFCA 3IAHA 2F43B 2QU7A 4U4AA 3LQKA 5AKEA 1L7MA 5E1MA 1ST2A 2Z83A 3BWYA 4OSOA 4ZO4A 1RQXA 8MHTA 4N5IX 2DKFA 5EE1A 4AIRA 3R0ZA 3G9UA 4WGFA 2PGOA 2NADA 1OLSA 2IFTA 4QRDA 1M6HA 3TW4A 2Q6TA 2P7HA 4Z4EA 1CEQA 1M1NB 1PK7A 1V0JA 2CF5A 4QEKA 5F7JA 5IUKC 2JHCA 4ZYZA 1A4UA 4M1TA 4G1MB 1L4MA 4LEIA 3H9JA 1DJQA 2WTNA 1C8VB 2XYRA 4WN3A 5DPMA 4BB0A 4CM9A 3NT4A 3W06A 4UFNA 3SQDA 4BB6A 3KHSA 4UU1A 3OIUA 5JARA 3UFXA 1Y4UA 3BZBA 3DEFA 3GCXA 3ZDFA 4RTRA 2O0LA 3ZGZA 1XEFA 3QLVA 3QITA 2GPBA 5HCUA 1U2TA 5J5VA 3E1KA 1YMQA 3JZFA 1ISFA 5F98A 4C4ZA 3C1TA 4I8DA 1EQ2A 3TQQA 1N8SA 1EEXB 1WHTB 4WADA 3ZXXA 1X1EA 1NBWB 4EQ6A 4G0MA 4NNOA 3RTGA 2W37A 1I30A 5L7TA 3L49A 1SXJB 3G49A 4LI3X 1Q20A 1UMDB 2NUTA 3T3MB 3OQOA 3FBGA 1G66A 4FT2A 1E64A 3E70C 4GR9A 1F5NA 2G77B 4M0KA 3WIDA 2O1XA 3MQ4A 3TZKA 4IUYA 4URYR 4Q7EA 1GCIA 1NUSA 2J3EA 4IFTA 2YVQA 3P5SA 4LZNA 5I7VA 3LVBA 4KFRA 4NF2A 1N2GA 2XODA 3FHOA 3ETJA 1SGWA 1YHYA 3FPFA 3H5IA 5DCLA 4POOA 4ZT2A 5JSZB 2VZ8A 3K0FA 1Q0HA 4RF4A 2GA8A 2ZB2A 4YV2A 1I6MA 4D5GA 5DBEX 1KARA 3H3FA 5D7BA 4NZOA 2F4VB 2VP5A 4IIVA 2WPNA 5B6PA 4OY3A 5DHRA 2R65A 2Q6IA 4CTOA 1G8HA 2CYBA 2IYOA 4EPVA 3KCNA 4FKZA 2FN8A 2VPIA 3NOVA 4E0BA 2NO9A 4O0MA 2P5TB 5KYXB 1J0EA 3UAGA 4FD2A 4TGLA 4OQFA 2X0IA 3CRMA 1XAJA 2E6KA 3O94A 4Q9AA 2V7QD 4XE5A 3LOQA 3NM6B 2A9OA 2JB9A 3R6TA 2P4SA 1IK6A 1R4NA 4AKSA 1C7RA 4U2EA 1K97A 3P9NA 5UKDA 4K6CA 4UHCA 4Z54A 1KO7A 1WMSA 1D07A 4M0EA 2XT0A 1GNRA 3PXBA 1W29A 1RXCA 5A1JA 1D09A 1WMFA 4LCBA 4ND8B 3K9QO 3O4FA 4PCLA 3EAQA 4X1KA 3MIIA 4UM5A 1Z8NA 2IHBA 4LX0A 4WXEA 4Y2GA 5CIWA 3I5XA 5FOVA 4B9EA 1MJNA 1N57A 2FRVA 5EYPA 1IXRC 1FTNA 1JG6A 3QHPA 3CZPA 4LHEA 4AZ0B 3HRIA 3L8EA 1AK2A 1R8QA 1VG8A 1VHTA 3D8BA 4WFQA 1CP2A 2WHQA 3KOYA 4ZCSA 3LQYA 2W71A 3NXKA 3OPXA 3P5BA 3PA6A 1VBKA 4WOJA 4D0LB 4BMNA 2OV2A 3WLEA 2XYVA 1EFRA 1KXZA 3GQBA 5BW6B 1HFJA 1QX4A 2ATXA 2C8KA 3H9EO 4LUCA 1R0YA 1Z36A 3BIXA 5D6OA 3HU5A 2PWBA 1E5DA 5JWHA 5U1PA 3WO1A 5C7IO 3WK6A 1EAYA 1L6IA 3G7SA 3QNMA 3ROXA 4KRFA 1QIKA 2YV3A 2C99A 1PJ3A 3VH3A 1HT2E 4DMGA 3EFEA 1YL6A 2FH5B 3HABA 2YHAA 4NMLA 1FU7A 5JXIA 3L6CA 4WY2A 1QUFA 3RUEA 1OLSB 3A0UA 2GM9A 3FKSA 1RCTE 2XGMA 2Q4OA 3K9LA 4E2YA 2ZCJA 4EPYA 2HQSA 1P4HA 4L27A 2H18A 2JGIA 3C43A 4HLUC 1MUUA 1AKWA 3CZRA 2C07A 2C0QA 3GCWA 4JSRA 4LY3A 2XT9A 2GJAA 3FVWA 2B9VA 4PZ9A 4BCDA 4MKFA 4D3FA 1AOXA 1AQJA 1JHUA 1XI2A 2ANCA 4LNHA 4IGAA 1BU5A 3LVQE 1GL9B 1WULS 4R8VA 1J7JA 2FXVA 2LR0A 2CCJA 2WQZA 4JX8A 3VVLA 1G21A 4LDRA 4QT4A 5IULC 1VDZA 4KV7A 1PJ8A 2ZSAA 5DXFA 3CWZA 3ICEA 2DM6A 1IHOA 3ZG6A 5SYAA 4HWRA 3STYA 3EVGA 1E2FA 3RRYA 3OF3A 3ZCVA 1QIFA 4EQ6B 1FW6A 4AY6A 1ZCFA 2CE2X 1YFZA 2TMGA 2WIBA 3LI2A 4EZIA 2NUTB 3CSUA 2Z6VA 1L5LA 3W6OA 3BH0A 2Z1NA 2JZNA 2CHGA 3DOEA 1ZK1A 1Y8CA 4XIYA 4YONB 3DL4A 2XCIA 3OE4A 1V9CA 3ZEIA 4DLXA 2B4KA 4C89A 1Q21A 1D1QA 2DFNA 1SQFA 2XVMA 2P0EA 3C45A 4L7VA 2WP8J 1WQ1R 2J3KA 1BYUA 3W78A 4DEVA 1E3IA 1QR6A 1RACA 2WJPA 3PGLA 4X44A 4E5NA 2YIVX 2EAUA 4E33A 1ZVQA 5SZIA 4HUJA 4ARVA 3PKIA 2C2GA 2JKYA 4JWKA 2RH8A 2MSCB 5AIAA 3RARA 3IA2A 1IQUA 5CK5A 4RD0A 2G08A 1N8NA 2CLFB 1NE2A 3OX3A 5PNTA 3TXXA 1NVBA 1GL3A 1I4OA 2RK4A 3A9VA 3B70A 4WHMA 3FF1A 5LB2A 5DRTA 3FCAA 3TRDA 1N5KA 4E30A 4HZUA 4F1KA 1KQFA 2FA9A 2WG0A 3V4FA 2GCGA 1P1CA 5F7XA 1XNRB 3EZ6A 4R1QA 5K0LA 5JMOA 3H1GA 4KVFA 1U63A 4JH0A 1TIPA 5C1BA 1AKVA 1W4ZA 1R4NB 1J9GA 3MILA 4P08A 4ZVKA 1VECA 3RVNA 3TSZA 2AOUA 4L4XA 4HFRA 1DX6A 1XZ8A 3IQHX 3B78A 4RTNA 2NSHA 3KKLA 1HG1A 2HA6A 1EUYA 4IUBS 1ORRA 1NBHA 1E61A 3PCTA 4GP6A 3IURA 2OBLA 3G9ZA 4C7KA 1MC5A 1Y89A 3NDJA 2R48A 2FPOA 1IJFA 4WI1A 5EYPB 2AQ8A 2OOKA 3AG5A 1QHEA 1Y5IA 4OUDB 1Z7EA 2B83A 2HCJB 4LGCA 5T4HA 1FNCA 2PX3A 3A05A 1F0PA 2OP0A 1XF9A 5DXAA 5B58T 2ESRA 5EJMA 4B74A 3L1IA 4IIEA 2UUOA 3ZNQA 3AIIA 4DM4A 4F11A 3VHXB 5LYYA 3EZGA 5LUAA 5BR1A 3BF8A 3WLAA 1W4AA 5KNLA 4DSTA 4MR9A 2G40A 3GCZA 3TKAA 1UZNA 1EHYA 3RVDA 1U8CB 1OLOA 1RWVA 2BW0A 2ZGVA 4BNYA 4PLFA 4RPJA 5K1ZA 2HZ7A 3G7UA 5C5EA 4O6VA 4QSMA 2XA1A 4B3XA 5C2JB 5I45A 1I1QB 2AOWA 2H5JA 3NW9A 2P40A 4UKDA 3EDMA 2R4TA 3SSMA 5BWLA 3KU4A 4Y1RA 1N34B 3W9SA 3DEHA 2WWIA 3EIQA 3DLHA 1P7YA 2UZIR 3VNUA 1HE3A 1X74A 4AURA 3K6KA 3VHLB 5TS3A 4CG2A 1KEKA 5ALHA 4YJ2A 1Y7LA 3UMMA 5JMWA 3SOZA 4RELA 5KYVA 3PRKE 1XHFA 3K8QA 4FX2A 5ISMA 2HT1A 1G21B 4G24A 4NZ9A 4OFWA 2NYAA 4KYTA 4NOKA 4OP1A 4A03A 2I4RA 1Z28A 4C88A 1QTIA 3A9RA 1I0ZA 1PQ4A 2NU7B 3H2SA 4P58A 4E15A 5K0SA 3W6NA 4L5BA 5K6RA 4CGZA 1K2VN 4DLUA 4YJKA 2O0JA 3GELA 1UKCA 3Q0TA 1RYMA 4O4HA 4YMGA 3VNBA 1HZZA 4KKXB 2IDMA 2XXJA 3S7ZA 1OXMA 4QELA 3U4DA 5A06A 1ORWA 3UQYS 5KJ6A 1OR8A 1P2SA 4FZRA 1KDYA 3IQWA 1O4WA 3HR4A 4R84A 4PNZA 3TDMA 2X2FA 2YOFA 4QXRA 3A6KA 3O91A 4RIFA 4U7JA 4WLVA 2KJQA 2WRZA 4MQEA 4P4LA 2OBBA 3T9FA 5A03A 5FX2A 4I9UA 2NUAA 4EARA 3G9XA 3O2SB 5DKFA 3V2HA 5DOVA 1DPGA 5JCZA 1N0VC 1VSTA 1XB2A 3PV0A 1E6MA 4RMNA 4E1AA 5C81A 3HUEA 1V35A 4PAQA 1NYQA 1QFXA 5JNTA 5JXHA 5F2KA 4TTJA 3PR2B 2JDID 1Y63A 2N42A 2WMDA 3H75A 3K73O 2F3RA 4FGWA 4GKKB 4NEHB 1JYSA 1K89A 2DHRA 5BSUA 5T8KA 5E6RA 4BO3A 4GE3A 1TC1A 1N92A 2ZJ1A 1P2FA 1UJBA 1K7SN 1RW4A 2XKAA 4W9RA 4DGQA 5AESA 2JLAA 5B37A 4GBED 4QUEA 1F6DA 1PJ4A 5MF6A 3KQYA 3ETEA 4KJZA 1XZMA 4OXQA 4R98A 4EJSA 5M04A 4QOHA 2JGDB 1U3TA 2EIHA 3K5WA 5HKKA 1DC6A 1E2DA 3I2IA 5L9AA 2AMJA 1BHQ1 3FNQA 3PHIA 3OEYA 2H0AA 2XLCA 4UBIA 4ESOA 4PG5A 1R0BA 4MR7B 5KO2A 3IULA 1GPWB 3D1JA 5EIWA 3CUSA 2P90A 4URVR 3TLGA 2RJ3A 1CUUA 2LKCA 3ITKA 1BCRA 4ENPA 1W49A 2O14A 1I2DA 2RHMA 3G1WA 1Z7GA 3PZBA 1X3SA 2D4HA 2HPVA 3HXTA 4YRMA 4FNGA 1AKEA 2I2FA 3DTYA 3OA0A 1KAOA 4UHHA 3RFVA 4HFMA 2R0QC 4F2GA 5KNDH 4MR9B 4ZQFA 5HOEA 4I5DA 4DEYA 3TECE 3U09A 1JKMA 3MCZA 1D5WA 3F73A 2BGGA 1GKLA 2ICAA 3GJ8A 4OQXA 4DLYA 4YMTA 1JDUA 1BWSA 4ZVMA 5TJHA 2AFIA 2HADA 5TQJA 3PFIA 5KJ1A 2O20A 5B64A 2D1FA 1Y6ZA 4PAWA 2XF2A 4OP2A 3QNUA 3NAGA 4OHKA 1H2YA 5ED4A 4TYQA 4HDQB 1NDQA 4ES6A 4UU7A 3QWBA 4O8CA 3KCQA 1EDBA 4YJ2B 3KP1A 4B80A 4D74A 1FQOA 1ZEMA 3MYYA 1CNEA 4XI9A 2IHUA 3NAMA 1A5AB 5GM2A 1ZH8A 1N25A 4OHMA 3ZWPA 2P9HA 3EXHC 4QHYA 2J0VA 3CW2A 1OTYA 1XJQA 2PGDA 3NQ41 3DOUA 4RQBA 4XFKA 3KB1A 4BNGA 4JB8A 2WAXA 5CNMA 1V5IA 3GOHA 1NY6A 1CRLA 3C85A 4NP6A 2RH4A 1NT2A 3DAOA 3ESZA 3PTLA 1LZKA 5AJWA 3NVKI 4Z99A 1KEVA 2Q8QA 2X3FA 1N2BA 3RTCA 5ALSA 5F2EA 3IT1A 3RJTA 1UEIA 1WZUA 4OL0A 3D0KA 4YEDA 4C4AA 3CRNA 5TRTA 4H7JA 3EFHA 4LYJA 4MQEB 4O4IF 5JNUA 1TEZA 2RC5A 3S55A 3FMFA 3M6VA 4KOEC 4OH7A 1D4AA 4XVQA 2MDTA 2BKAA 1DC7A 2BI4A 2HRRA 5I9LA 2W11A 3AF1A 4JGBA 5CDHA 3CHYA 4UFOA 1XKTA 5EFZA 3U3XA 4EPWA 1QK3A 2XMPA 2M6SA 2CLEB 4C0WA 1TCUA 1M5TA 1G63A 4MRSA 1NT4A 5E6RB 3R23A 3Q8KA 2NACA 4YAIA 3N6XA 1DEOA 2VDOB 2Y3IA 4LMPA 5J43A 3C98A 1Z2OX 4NU8X 1WUKS 3DXFA 4FFSA 1E66A 3LSYA 1W8DA 3L5KA 4ZWNA 3VKUA 1L8XA 3WGNA 4EJSB 1E2PA 1VB5A 3IR5A 2ZVPX 3AUTA 3D6AA 4JNKA 1POXA 1X7YA 3FLEA 4W6ZA 4RK7A 2PKRA 5FNVA 2JATA 3B5JA 5LN1A 1GTMA 1PN3A 3E15A 1FX0B 4IVNA 5FTWA 1T9HA 2ZZNA 4P5EA 5JEDA 4I6JA 3A70A 4DMUB 1OC4A 2FMUA 1XTBA 4JBHA 2GF2A 1NBMA 1PDOA 2I1LA 2WLSA 2XB4A 3N39C 4MYSA 4LYAA 4D9MA 1RJ9A 4F5YA 5KKNB 3I1JA 3D4OA 3EN0A 3R44A 5DBHX 3TH5A 3H2HA 3T9EA 4PAGA 1UOOA 4JJKA 1BCRB 5CCXA 3LKBA 1E92A 4NU0A 4JYBA 4BJ5A 1GA4A 1RAIA 2LDXA 3TWOA 1ESDA 1K7FB 3IUMA 5DLQC 2PUDA 3RRNA 2V6JA 5LM3A 3KSZO 4MULA 4DCUA 4DG9A 2R47A 2E2WA 5HFJA 3CW8X 1V25A 1WVIA 5FV4A 1VCNA 3P27A 4GYYA 1CUWA 3I8SA 4DPMA 5TX7A 5ITVA 3D6TB 3HP1A 2GYVA 4RF2A 3DBHA 3IIIA 3OLXA 4PLVA 4QBKA 1LBTA 1Z68A 3B82A 3DEKA 1EVJA 2FK8A 2ZCVA 2WF7A 4YP0A 1D9ZA 3VGPA 4LDQA 2AFIB 4D9HA 3SD7A 4B87A 4Y9TA 5A4KA 2ODWA 5L6MB 3C5HA 4Z4CA 4TN5A 1W4RA 1HQCA 5D3MA 4HLUA 5KWIA 4RE5A 1R18A 3GEGA 4EGFA 3L82B 1M0TA 5CPFA 2I4LA 3D4PA 5E8JA 3IB6A 3VVCA 3WGZA 1NXQA 1E3DA 4R8LA 2EXXA 2W70A 1TYBE 3HGQA 1J0AA 2RFLA 5ALQA 3DB2A 1SVNA 2DQ4A 2P1DA 2RDMA 4L5JA 3WQBA 4GDMA 2WNIA 3EG9A 1WVMA 3NHRA 2B2NA 2FEAA 3Q0IA 4ZRDA 4WKNA 3WAJA 1HTBA 4W7HA 4TPKA 3H6KA 1PG5A 4DPKA 5JVDA 4R9VA 2JAPA 1P1RA 4AB1A 2GBLC 4W5TA 2O8DA 3T7TA 9LDTA 3FLAA 2PUTA 4CKYA 3FIUA 1V6AA 2ERCA 3KTAA 5TVKA 5A9RA 4P1ZA 5CNJA 3TN7A 3UY4A 1DRUA 1HE4A 1UBGA 2KPOA 2IOFA 3WFIA 3NV7A 4AUMA 4E2ZA 1ZUIA 1TA9A 1AURA 5DNWA 3W6PA 4V1CA 1CPYA 3W2TA 5KCZA 4Z9BA 3JAMA 2PL9A 3EEFA 4JP8A 2W2OA 1GQFA 1Q15A 4G2NA 1G5QA 4EYKA 3QSYA 3E53A 2C2WA 3QBTA 2EP7A 3KR2A 4LJKA 4N65A 4U5QA 2QP3A 1Z13A 2C20A 2HN9A 1E2MA 3L7NA 1UDRA 1RC1A 4BWGA 1KSFX 2DQZA 3QTBA 5JXJA 4PPGA 1DUVG 1E1RA 3QELB 1CFZA 1N1EA 3C3YA 4Y9UA 3DKIA 1YDMA 3WZMA 1QKKA 1MU0A 1TLTA 1BFUA 2JLZA 3S2ZA 1WDMA 3CZMA 1VIDA 1UWVA 1ZMBA 2BMWA 4ZO6A 4IZ6A 5HMLA 2WSYB 4BNLA 5LWHA 2WYIA 2XMSA 4EKNB 1GM5A 4D4IA 2WT8A 3QYPA 4KXYA 5K4AA 4YCLA 2BLLA 4QBIA 2I6TA 3P2JA 5ALLA 4F8EA 3OD5A 3RUAA 1UPUA 1X7YB 3FH0A 1OA0A 5FNVB 2Q21A 1N0IA 1G8AA 3RKRA 5THXA 2AYXA 3FCOA 4A10A 1R1DA 3AO0B 3JALB 1NOKA 2PWPA 1G0NA 2YV1A 3OCUA 1OIWA 1C0EA 2O3SA 4CFYA 4EFKA 2CNOA 1AGRA 2X15A 2W90A 4KU4A 5CNIA 3EGIA 2GO7A 2G5TA 1QO0A 3QKIA 1RJ9B 3V42A 4U39A 1LLFA 4PYIA 1WLSA 1LX7A 1BE0A 2JJ1A 3K09C 2R4UA 3EZFA 2YXPX 4MZXA 3TFWA 3VUFA 4BGUA 2IVFA 4WUTA 3B36A 3ORRA 3HKBA 2LIVA 4EHFA 5BVHA 3FD8A 4HH0A 3VPSA 3GDHA 2NYRA 5C46F 3LA8A 1ZGZA 1OBOA 1Z5UA 4HNRA 3S81A 1MVLA 1GZ4A 1NQOA 3W8EA 2NO4A 3GRYA 4B4DA 1RNLA 4ZVNA 3DBHB 4YRRA 4CIXA 1I33A 2GEDA 2Y77A 2OAGA 1RQGA 1JMYA 2EJCA 1E79A 2IEYA 3DL2A 1GTZA 3KQQA 4U00A 3STHA 4EA6A 4EHLA 4RSGA 4ROTA 4PZUA 4PO8A 4UZEA 3LQ1A 5KVQA 3DOFA 1KSHA 4NPCA 4XWOA 3RIEA 2XUPA 3ET5A 2EC5A 2J3JA 3WYNA 1JDBC 3UV6A 1W46A 2O0MA 3BREA 3SHQA 5KNBA 3MNFA 1WJGA 3Q3GE 2XKBA 4IDNA 1YMVA 3ANTA 4QBHA 1RRVA 4MPDA 1L3BA 2OAQ1 1CDOA 4EAAA 4JI0B 2G63A 1RABA 2HXGA 3PGVA 1FX1A 2E3JA 4QOFA 5LNK1 4TMKA 3WFZA 2AI1A 3BBLA 4A6EA 4KGVA 4ZEWA 2FW6A 3JQEA 5JVDB 2VJNA 1C41A 3DEZA 4LI0A 4DJEC 1LY1A 1OZGA 2Y2UA 1VL2A 4JJFA 3G8YA 3C5CA 4XR4A 1NG1A 1NLFA 5H82A 2B8NA 3KZMA 4I46A 4UJ3A 3BWDD 1Z4JA 2F3PA 3KTAB 5G1PA 5I7FA 1MABA 1ZEJA 3BD6A 3FHTA 1IB6A 1WXEA 1ZD3A 3BSWA 4V1CB 3AVUA 1YFLA 3EUEA 1K88A 4JJ7A 4WKCA 2BFDA 2R751 3DQPA 4M0DA 4EAQA 1HRKA 4S0ZA 1YR3A 2H9IA 1CY6A 2F8MA 1LD3A 4YAFA 5IAGA 4ZJZA 4ZPJA 3S1SA 4MUKA 2ZANA 1L8AA 1EG2A 4MVYA 5FPTA 3RVRA 3WOHA 3X43A 4UTVA 3RW9A 1N6OA 1TK3A 2GCIA 4N7JA 3VO9A 1IUOA 1RYEA 3Q9LA 2YL2A 4KXMA 3JWEA 5KQSA 1F1BA 1L8QA 1WX1A 4HI0E 1PVDA 1PW5A 2FSFA 2WKWA 3IP8A 4LXQA 2V1UA 3MLAA 4BE4A 1SKMA 2FPLA 1PBTA 3W77A 3G2HA 3CTMA 3QPDA 2IUYA 4OEHA 1U65A 3I01M 3K4QA 6PFKA 4RTPA 1VKZA 3G85A 1KMIY 2OK8A 3PWSA 2JKVA 5C7OO 1M66A 1YRLA 2XZLA 1DCFA 2ZWAA 3OI7A 1JR6A 1ODTC 1C4OA 4GL4A 2XWPA 1K5GA 3C16C 4G81A 4QAJA 4QXPA 5G1NA 3MAGA 3FUUA 2EKPA 2RCYA 1FMTA 3U39A 1ONSA 1EJBA 3ZWBA 5C1PA 2NZ2A 1OPXA 1PZGA 3MJHA 1QDLB 1XMOB 4MPTA 1PFKA 1SKYB 2Z2YA 4YROA 1Q95A 4M0FA 5E9WA 1M6NA 3QJGA 5DIZA 4C2BA 2PZEA 2O7VA 1WDLA 2XVAA 4TLBA 3W04A 1YE8A 4LC9A 4Q1CA 4UUPA 1QRUA 1MEOA 3IH5A 3L8GA 4Z8XA 4D41A 4P34A 4ZOLB 3P2MA 3RT9A 3KE9A 4ZCRA 3AGPA 5LL6P 1VBNA 3P0RA 4DIKA 1EG7A 3VJRA 5I9TA 5B3JC 3O2QB 2B7BA 1B8VA 2WWXA 4PGFA 4ALMA 2OECA 4YQEA 4Y1EA 2FSGA 4X85A 3O95A 1TB4A 4HQFA 4G2TA 4QDZA 5IN5A 1KZ7B 4PFSA 4CKBA 2BSQA 3ESXA 3LQ4A 4AJ1A 4FFOA 1F0YA 4QXOA 3SF8B 1P31A 5EWLA 3GT3A 4JT4A 1GAQA 1HI9A 4AY4A 2IYQA 3EXHA 3X1MA 4CIBA 1ISMA 2E89A 4FOLA 3BDAA 4G89A 2HNAA 4ICIA 4QUGA 4YMIA 2HMWA 3JW8A 1DAHA 5E1OA 4BVHA 2GPNA 3C3MA 3GEIA 4KO2S 4XB2A 2QHXA 5JD5A 1RVV1 2O8VA 3HYCA 3TFOA 4DG8A 3U3ZA 4G0NA 5B3KA 5CB4A 3VYRB 4EM6A 3DDSA 4IFEA 1KGDA 1TECE 2GVZC 3RU7A 3S6JA 2P9EA 3RANA 3AFMA 3SI7A 1SURA 2WFZA 3PJEA 5AOCA 1GUAA 4EMTA 4OMUA 1DV1A 1ZVMA 3N3BC 5B7PA 4BB5A 4ZVTA 3MJDA 3HYRA 2F1RA 1B0ZA 4B8WA 3HO1A 2A2ZA 2C04A 5FH9A 3OT4A 2Q2WA 2RGXA 3ZD6A 4L57A 3T5PA 2DBZA 4BMSA 3OTIA 2PMBA 1QIDA 4X0EA 4C87A 1XKQA 2V59A 4BQNA 3BSYA 2XGJA 3MHTA 4UMEA 2HRBA 4Q9DA 5I3CA 4B6EA 2D2EA 1XDUA 1TJNA 3WLMA 2YDXA 5H68A 2W6QA 5FPQA 2VHTA 3TSAA 3SDZA 4NZYA 2PSFA 3TW6A 1TCVA 4QXAA 3FKJA 1FUYB 5F5LA 3VHRA 5DBGA 2G4CA 2ASVA 2XRFA 3AHFA 3GFBA 3KR1A 1C1YA 3EGXB 3P20A 3SE7A 4FGLA 5GZ3A 3E1GA 3GAAA 2F8SA 3MTGA 3K32A 1PV2A 3A9UA 4YJFA 2HL6A 1YO6A 1WCV1 4R7GA 4I3GA 2JA2A 3HYTA 3KQSA 4JMPA 2C4NA 4HDRA 3VDNB 4MPJA 5KC8A 2X2OA 4N4AA 1MT3A 4KPFC 1F2UA 1ZMXA 4MVJH 5J5CA 1IZ0A 2YKGA 1YWGO 1Q7EA 2P41A 1V7PC 4JFAA 1EGVB 2ZAMA 4JLBA 3RV4A 2GD6A 3O7WA 4C4RA 4PLPA 3VC1A 3HFRA 2AUNA 4KSYA 1Y7IA 3NRBA 5KOJB 1ZLXA 1J2YA 1OHHD 4HTAA 1RBZA 3QOWA 4JLDA 5HCIA 2BKLA 5CG1A 2JCVA 3LD9A 1NI4A 2YDYA 3B7WA 4UE2A 2MYNA 1CR1A 1YRHA 3NVDA 2WY2D 2NP6A 3AR3A 2P2NA 1SBZA 3AESA 3DBLA 3HNRA 3LOUA 1NZDA 2PIDA 1BC5A 1WB5A 2OHIA 3ISJA 5JJCA 1G291 2Y27A 4HB2A 2I91A 2YS6A 2OY0A 3LY5A 3TQCA 4FIDA 1A2BA 2QIPA 2YHIB 4HQ6A 4D92A 1DCMA 7YASA 1GA1A 3P9KA 4QUBA 3L0PA 3GDOA 2DY0A 3IQXA 3MT9A 4A8JC 4EPRA 2Q5HA 1GTL1 2WB4A 1QU3A 2QVBA 3KEOA 3VR2A 4B7XA 3A6GA 4NBUA 3OZFA 4X60A 4X3PA 1JZQA 4B71A 4XCQA 3D2CA 2VNKA 4FMDB 2WJVA 2IS1A 5IC4A 1HE2A 2I2WA 1ZQ1A 2I1QA 2AHRA 4B3BA 5EWLB 4JJ6A 1C8KA 4G1UC 4D0NA 3N28A 4LF4B 1J5PA 2O19A 3EXHB 4UAUA 2X0EA 2Z6UA 4EBBA 2BRUA 2GBCA 4X6UA 2DU8A 1L8OA 1XX6A 3M83A 3U19A 4XEUA 4XM2A 2BUBA 4IDAA 4D8XA 1V39A 3OE1A 4J7UA 3VR5H 4DQUA 5NULA 2GAOA 4GECA 1FXSA 4IOKA 4CQLA 2QTWB 3RVJA 4DQVA 5C8ZA 4YQYA 2QTVA 1ZOPA 3SHFA 3I9JA 5E2BA 2ZPUA 2PT9A 3PQ8A 2VYCA 2CBXA 2GZHA 5BSFA 2DTEA 4LJ9A 3UMFA 1JEYB 4US2R 4KDRA 5C8VA 4BV9A 3G89A 1UFRA 5DJ5A 3TLXA 3VZSA 4FW8A 5CEJA 4GEGA 1CNMA 3SSOA 1GP2A 1ZHOA 4ZOCA 4D9BA 4L28A 1W7AA 1HETA 2ZI6A 1GRQA 3KTFA 4G26A 4BQQA 1H4QA 1JDSA 4CM8B 2HSDA 1Z47A 3HB1A 4MW2A 2EIXA 2K5UA 3E3LA 2RG7A 3TIGA 3JYOA 3UGTA 4MKHA 5LCXA 4KQJA 4LE1A 1LPOA 1ODCA 3UWDA 2ZBGA 1ZD5A 5AVYA 3WQHA 4GS5A 1JJVA 3GNTA 4L74A 5J4YA 4DV6B 5C0OE 1BMQA 2I6QA 1FCJA 2GAIA 3GLTA 3IDSA 1E98A 3WE7A 4QU9A 5LNK6 1RZ3A 3A32A 1O95D 4JR2A 4YJFB 4MCJA 3RU9A 3Q98A 3UA4A 3ILVA 1E0JA 1IQPA 1OUMA 1BE6A 4B33A 1AQLA 1FSZA 4XUDA 5JFGA 4GI2A 1XEWY 3B2EA 3PR1A 1CHDA 2YWEA 2DTDA 3RBAA 3FDFA 3CSDA 1UEXC 2R87A 3BX1A 2WWVD 3FLBA 2BKUA 3MIZA 3MMZA 1QNLA 1U0FA 2M6KA 2K87A 1NU6A 4I2NA 3A3YA 2P77A 4CMAA 2FCRA 5EIEA 1MB3A 2FZ5A 2QTBA 3EFOA 3IEPA 1ENPA 1I7NA 4PSCA 1NI3A 4ZO7A 3TKLA 4DDWA 1C9YA 1D2HA 1UR5A 3FCSB 4B6RA 1T29A 1NUAA 4ZP1A 4CDNA 5SYMA 2J1LA 2Y05A 2JI6A 5G02A 1DJNA 3AESB 3DBLB 2HHLA 4S3MA 5BN5A 4FHCA 5TMBA 4OAQA 4OFXA 2ODTX 4OJQA 1XZJA 1QIIA 2EQBA 2ZYDA 3OSZA 5AUQA 5GV7A 4KRYA 5TXGA 2AWOA 2H2WA 2OZVA 3IEXA 4R9SA 1VYVA 4FSXA 3QH4A 5LBIA 5HDQA 3PE4A 4MS4B 4ZO9A 4J0JA 3F9IA 3VTKA 3DS8A 2JJ2D 1UQTA 2IPMA 3Q88A 2VPZA 3GZTB 4MUHA 1ONOA 2J3QA 3DYBA 3GPCA 1DE0A 3K6JA 2W5UA 3CH4B 3QFRA 5ALGA 4AWXA 4Q1BA 3SDSA 3DG9A 5CRIA 1OYWA 1KK1A 1U1CA 4UEKA 2V45A 5I7OA 4F6RA 4DV3B 1N8KA 3T1OA 2FOIA 3VX4A 5JXWA 4Q4AB 1DXOA 1Z34A 3E9QA 4W9NA 5JDCA 3CX8A 5JS6A 5JXGA 1RI3A 4MK4A 4KQIA 2A0WA 1SC3A 1CZKA 1ZCZA 4J0QA 1B8NA 2C5GA 4W4TA 2QWXA 2YOHA 4CEJA 4L5YA 4GH5A 4CQLB 4DC0A 4H1WA 3ERCA 5CCEA 1Q0LA 3IO5A 4DDVA 1UJMA 1RM3A 3VPAA 2K7ZA 1PV1A 4C43A 4NXMB 4XFJA 3D2BA 2QJOA 5COAA 1XMPA 3TVTA 4GR4A 3VC2A 3CVVA 3AONB 3R5JA 3OMXA 4Q18A 1LPNA 2VHYA 1NVXQ 3VHQA 3VZQA 2I7TA 4IXDA 3ZU2A 5TMEA 5KYYA 1K7EB 3EF3A 1IOWA 2Z5GA 3Q8LA 3R3HA 1SHJA 4D5EA 2ZM5A 2P3QA 3AGQA 3L1UA 5BV7A 4F85A 2DWOA 4IJ5A 5E0KB 2DWCA 3HBFA 1QIGA 4DF3A 4L8LA 2C82A 3FGOA 3PIIA 5CFPA 1PR2A 3C15C 1F48A 4KE7A 2CLSA 5BWMA 1VE3A 3S0JA 4ZI2A 3TOVA 3QSGA 3KKOA 5EQDA 1QDEA 3L4BA 3ZX4A 1ZGAA 4PYKA 1JHPA 4JC4A 5LLDA 4Y9RA 5JAOA 1HFEL 3HM9A 2HK6A 3DDHA 3GCDA 1WPRA 3EAFA 4N7BA 3AM3A 2IC5A 5KYUA 4S2UA 3GJ3A 1CWUA 5JNWA 4DABA 2JLUA 4DV1B 2MR6A 5DBOA 3L0IB 4PHFA 5FA8A 1NW6A 3NPMA 3UWKA 4BOYA 4K2AA 2ZJ4A 3KAPA 4QL3A 2FG5A 4U9IS 4NIMA 4B82A 4I1SA 4GGMX 3OCVA 3R7AA 4N6NA 4DLAA 4PX5A 3HDYA 5KNDA 4KR9A 2ONKA 3KKPA 1KO4A 2P5UA 5TPZA 3F97A 2CWDA 1LU9A 3G8DA 1LZLA 2VK1A 3JQRA 4KGDA 3GDWA 4EELA 2OQIA 1CERA 1XEAA 2ZUUA 4Z4QA 1QHGA 2I6UA 5G4KB 4KMSA 5GPBA 4RKYA 1ZW1A 3UJPA 3JQ7A 2H16A 4ENRA 4GPTA 4X24A 2WF5A 5G41A 3HFGA 4O02B 3ROKA 1KAQA 3RC7A 3T5BA 2F17A 4JGGA 3CLVA 2O54A 3CUTA 1BEEA 1K4MA 1QF7A 5B3JA 2JBHA 1N5MA 4EGQA 1RJFA 1Z88A 1QWSA 2FWMX 3B6EA 2BDUA 3PVSA 4TLDA 4KSBA 4UCXA 1NVUQ 3IO3A 4R3UC 3HCNA 5DNCA 3V48A 2R6CA 3DEAA 1WKCA 1B3BA 1YDGA 2PH1A 2EERA 3HBMA 4I9GA 4AECA 1G19A 3WMRA 1KVTA 4ZICA 1TEXA 4F6RB 4ZXFA 3ANXA 2N3ZA 1XZCA 3X44A 4A1OA 1N6NA 2NNLD 4TXLA 3R7WA 2QMHA 2JFWA 2FUNB 4KW7A 2ZRBA 4L76A 3WHIA 4K86A 4BBAA 3S2UA 3KBOA 3TZ6A 4EUKA 2VJKA 1C29B 3R5TA 4WV3A 2QEQA 1JZSA 1AN0A 4Q5IA 5COQA 1YZQA 4CEJB 3ER9A 1VMIA 1U7ZA 3M9WA 5JVDF 4DNFA 2W2KB 2Y0EA 4E5UA 5JNLA 4BGVA 1BNCA 2XA2A 3L1JA 3Q15C 4ZOAA 1XDZA 2O6HA 3CLRD 4MW1A 1QV7A 2XTZA 2E1PA 1MHTA 3AUFA 3JTMA 2Q41A 2Z4SA 3DVLA 5ITWA 1E20A 2VQSA 1JQLB 4LW8A 4RVFA 5AHKA 5KHLB 4YRLA 1HK7A 3KNZA 1QDUA 1R0SA 3CTPA 5KYYB 4JQSA 2AEEA 4ITRC 4QTZA 1MX9A 2P2GA 3ACDA 5EIBC 5AI5A 4PYLA 1RAGA 3UJBA 1JQJC 2QRKA 3ITEA 2O9JA 3JAKA 1T6NA 1EFVA 1V16A 1V3UA 1H8HD 2HU2A 4N3GA 2P30A 3UGJA 2RHTA 4L6CA 2A9JA 3F98A 4DHWA 1LLUA 1MTOA 2CL6X 3GCGA 5TPWB 1UC9A 2E37A 4AQDA 2DWPA 3LZ6A 5FBKA 2RK6A 4IS2A 3ZEAA 5DTMA 3IV6A 3BPSA 1NIPA 3NHUA 3DE7X 4M8NE 3T7SA 4H7DA 5K8CA 1FP2A 1O94C 3GJSA 3UJ6A 4W63A 5DHPA 1DKOA 1T2NA 2C2XA 4B76A 4QWMA 1P1IA 4D8UA 5EUMA 3KFLA 4KO4S 1QGED 5CVEA 1JJ7A 2VR1A 2R11A 5KYUB 3RYCA 1SNYA 3EQZA 2JBWA 3Q4GA 5DYTA 1N9KA 1TQDA 1Z38A 4XYBA 3U6KA 3QPAA 2VKQA 3TRHA 1L4EA 3UKOA 4AF6A 5HIKA 3HU2A 1SG6A 1GYRA 3ESBA 5JJBA 3CXRA 1A3CA 4CKZA 3ZR4B 5JS7A 4XH9B 1J9ZA 4JBXA 4EBFA 4HPWA 1GAWA 3ABSB 3IVCA 1QH8B 3PEUA 1JAHA 4L73A 3NC1C 2QNIA 3CKLA 1NVGA 4HPJB 1DIBA 2JIDA 3TIFA 4MTLA 4DIEA 4XQ9A 2FPIA 4KFTA 1HEIA 3BQMB 1FNMA 4E5SA 4GLLA 5D2CA 5DGIA 3HI4A 5CM8B 3JQ7B 1TYCA 3AEZA 3ZCQA 1QF6A 4DCJA 2ZRGA 3K1JA 3KBBA 5AKKA 3UV3A 5HBRA 2GR9A 1YZ3A 4W8OA 4B6GA 4PG7A 2A5DA 4Z86A 1LNZA 3GROA 1RTKA 5IS2A 3TEMA 2Y1GA 4ZOLF 5CX1A 4A8JA 1LSJA 3AP1A 2WU1A 3KT8A 2ZXFA 4RYDA 5C34B 1YZTA 3VR2D 1WL8A 2RMKA 3O84A 2C0CA 3B38A 2XE7A 2EQ5A 4V0OA 2XWSA 5DTRA 1DRKA 4IYJA 4M53A 4NJMB 3V46A 2JJMA 4J0CA 1TTQB 2WTAA 1CJTC 1NLYA 3L7JA 3QIAA 3ELDA 1APBA 1WB9A 4OLFA 1PYDA 3ISVA 1NVEA 2PXAA 3S2SA 1VIYA 4NQRA 3SYNA 1M2HA 1TPZA 4N0PA 2FDXA 4MRNA 4PNHA 4Y1FA 5K8TA 5JS1A 1MOSA 1FC0A 1WU8A 3ABIA 2HWXA 3G3EA 2C9ZA 3NIGB 3NX4A 3OIFA 2QN2A 5CT9A 3V1NA 1F8UA 5IVKA 2FPSA 3GJRA 1JFVA 4DCPA 4NHOA 3VFDA 1VKNA 3H8SA 3ICPA 4POAA 4XJVA 1GZHB 4RYLA 1EB8A 1X8JA 3H5NA 1JH8A 3BXXA 2C8VA 3HGMA 3LBAA 3VSDA 4TTTS 3TRJA 1QJCA 5LQRA 2H59A 3EOBI 1ZIYA 4FOPA 3W7VA 1OT5A 1TRKA 3LCJA 2VRCD 4BN4A 2D2VA 3EDOA 4BNJA 1COWA 3UYKA 1JDTA 1A97A 1OE0A 5T64A 1TF5A 3RHSA 5D87A 4NBTA 1P4SA 1H8ED 1XCGB 3JVIA 2ZKIA 4PYOA 4ZDIA 4AP9A 1LSUA 1XTKA 1E9RA 1CUHA 3D8TA 4U3JB 4FWTA 4V24A 1JFTA 2IF0A 2XBLA 4L8WB 4ZI7B 2IS6A 5ANRB 2QZJA 1V16B 5BSRA 3TX6A 3QM1A 3GJTA 3IAM1 4TOIA 1EVIA 3K16A 1NJFA 2FSHA 3E3NA 3LCUA 5HIJA 4CU5A 2VF4X 2FRDC 1OTHA 4FLFA 5FI5A 4ZHQA 4KAJA 1E8DA 4LYFA 5EJFA 2VHJA 1G7SA 1EX9A 4DM3A 3VKHA 2IYFA 3TD2A 3BG5A 1CS4C 2ZRIA 2DJIA 4YUAA 1GEGA 2QTAA 2GXAA 3CZ9A 3SNHA 1Z4LA 1A2KC 4YP1A 1RC0A 4Q21A 4MWTA 2O2DA 3VR3A 4PRKA 1WF6A 2BCEA 1JV2B 2QZSA 1K8YB 3V1TC 4DGSA 3RYCB 5CH5A 1GT91 4W6QA 1DEAA 1MIHA 3KKMA 1K6XA 4RXTA 1VLMA 5KDOA 5JU6A 2YXDA 1CD5A 3D5EA 2WW8A 4UHBA 1LPMA 3PWTA 3K1ZA 2EFHB 1X38A 1P8AA 4Y0VA 3UXEA 4ZI3A 2O8BB 3M5DA 1SQGA 2QD5A 2ZJZA 4F3TA 3RS7A 2FP3A 4KE6A 4WD3A 4EATA 2Q2NA 4EFNA 4I8IA 4UUNA 1FYVA 3CC8A 1T1JA 4WXYB 4QYIB 3N53A 2BBOA 1XROA 1TW3A 1ZI9A 4GG1A 2C1XA 2GPAA 2XB2A 2QQ0A 2AH5A 4G01B 3X0DA 1JWLA 1TZJA 1EP9A 2BMEA 2J3HA 4H1VA 2Z6QA 2AFHE 1IIRA 4DR3B 1RT9A 4MEBA 2QJTA 2ZS8A 3BHNA 1Z4PX 1MVOA 3GT7A 4RVHA 5DCYA 5HA5A 4P7KA 1DDIA 1XZLA 3ZBUA 1EUCB 1SMKA 1XA0A 5CM9C 1FNDA 1NULA 2VYVA 4ZYLA 3EVEA 2B61A 2FEMA 2ZJBA 4ARAA 2QAJA 1EK0A 2NZ8A 4RMGA 4RVOA 3D6VA 1YQQA 5CVUA 3V8BA 1MW8X 1M6EX 2H06A 3ABZA 3FRHA 5AVKA 4F3KA 3UYLA 2WHPB 3B8EA 2JFZA 3O6VA 4FE3A 4FMDF 5IHPA 4DL9A 4F21A 1LGYA 4KIJA 4BASA 3RRMA 4O3MA 4X6XA 2V3VA 3L5OA 3WLLA 4K6GA 4K46A 4H3KB 4DG5A 1Z5VA 2WM9B 4YQFA 4OK5A 2GEFA 3JZDA 1IRXA 4TXJA 1SZPA 4NE7A 1BHO1 3GJYA 1WMDA 5KYNA 2ZUWA 4P7FA 5KNCH 2FW7A 3H1AA 4BP9A 3I5YA 3M6UA 1B6RA 1QVRA 4WKGA 3SJBA 3DZHA 4WDQA 4HL6A 3PFKA 4OI0A 1PHRA 3GJ5A 5JJKA 3RG2A 3AIKA 1AS0A 1L7DA 1S8OA 4YPFA 3BXOA 3SPXA 3EF0A 1U90A 4NEQA 2WPDA 3JWGA 3L07A 3SP1A 4ALLA 1ZW6A 1Y1SA 4BKOA 3TG2A 3T5DA 5H0IA 5F73A 3K1YA 2X86A 4H7KA 5ALJA 4G1VA 4B6JA 2EX1A 3CF4A 4F4DA 2OSBA 3LDAA 4FU0A 4INZA 2J6IA 2Q0QA 3ONDA 4WVLA 2D8MA 3WLFA 4ZVOA 3O0DA 4D96A 4G8BA 2GYYA 4BEWA 1LRJA 2AJCA 1FFCA 3JQBC 3BSFA 3QXGA 4LNUA 5ADWA 3EA4A 4G9EA 1D9XA 1TCAA 3EIXA 3L79A 4GSKA 3PJRA 4GC9A 2PFKA 4RC9A 2I8AA 4Q3NA 2CF6A 4AULA 1KU0A 4TV8A 3H99A 3V2GA 4ZYTA 2DMRA 1PT5A 4Z1MA 2C7GA 1NG9A 2HPHA 1QKIA 2HBQA 4LBZA 3A04A 1H93A 4BV3A 5AQEA 1E0KA 3QUCA 4YXWD 1EHCA 3PTZA 3WAGA 5LR6A 4R5MA 3B3FA 3NHBA 4ZEMA 3GJZA 2PAAA 4LDPA 4S1WA 1LPBB 3RYHB 2A57A 1A9TA 3RF6A 1H9AA 1N2HA 2C9DA 3X1WA 4ARSA 3W5HA 2QD2A 1HQDA 5K0CA 2E1RA 1AA9A 3ZU6A 1EK5A 1GNQA 1E1DA 3B6KA 3C48A 1QYDA 2ISCA 3HEAA 1R5NA 2IL1A 3ZKWB 2FXIA 1H9CA 3CKMA 1EYZA 5DYIA 1E3WA 2FN7A 1J42A 2QN1A 3LQFA 2E18A 2OHHA 3KPJA 4O2AA 3VO2A 2VP0A 4KR2A 1XNGA 4B34A 1J97A 4Q3EA 3VVMA 3TXYA 1U2PA 4BQOA 4N47A 2Q3DA 3KJIA 4NU5A 1U1FA 3UJHA 3OOHA 1S9HA 3B1ZA 3TOZA 3QEKA 3D5QA 4YTEA 2QY9A 1GGJA 3DFMA 1MJGA 4G5GA 3EZYA 4C20A 2ZJ6A 3GU3A 5J9FA 1QQTA 3OLCX 4RD1A 5LFAA 2B8EA 2FUG1 3FF4A 4J90A 3RE1A 5MDHA 3TW8A 4E4YA 1KZ1A 4DIFA 1EVEA 2J85A 4IJWA 5DBIA 4Q1AA 4J1TC 3EC1A 2VTKA 3GIDA 4RPGA 3U13A 1UPBA 2YJTD 3NDIA 5E6SB 4DV5B 2CL7X 2IX9A 2OO3A 3ZBQA 2DQKA 1Q74A 4IIUA 2FMKA 3NC4A 5E8RA 1CR6A 2CC2A 2B94A 1L4UA 2PLNA 3OQ6A 1ZC4A 4LWPA 5BUCA 2G82A 1I3OA 1T0HB 1UKEA 1WU7A 1U80A 4MUJA 3ANNA 3IHLA 4XWKA 1PS0A 2PX8A 4MS1A 1SXIA 1XN4A 3JYQA 2GD0A 4BBJA 3I32A 3CVYA 3C4VA 2ODNA 5FHQA 1M34A 1XRPA 4FN5A 3PF8A 1ORVA 2JNWA 1XNHA 3TIVA 2NVUA 2CLCX 3LWBA 1G3MA 1QG2A 1XZGA 3UAYA 1NR5A 4H4DA 2I6SA 2YYZA 5F9MA 3SLGA 2OHOA 4I1YA 4U1RA 5AP9A 3WDKA 4ARZA 3WMXA 5CFRA 3ZDBA 5JDIC 1T8RA 4BN0A 1EUZA 1MBZA 3QU2A 5EEHA 1P9WA 1LPSA 3HP4A 2ZAIA 4KZKA 3A26A 4IJQA 1SBQA 1NFRA 3LTNC 3ZDRA 3F6EX 4M1ZA 4ILEA 4BMVA 3FYDA 5D3ZA 1S8NA 4XZ3A 5B1SA 1HSOA 3WO0A 3DAPA 4QFBA 4EKDA 4RABA 1Q0QA 1N7JA 1VG0B 1Q6ZA 4I5IA 1EFUA 1NXSA 1QVVA 3PDHA 1QCDA 2EZ4A 1JILA 3E3OA 3K9CA 3T7DA 3PL1A 4BNFA 1XZPA 4LMBA 3K9GA 3PUXA 2EZUA 3D59A 1GTSA 4LNUB 2Z4TA 2I2XB 3K2QA 1EGQA 4Y98A 2XDAA 1HLPA 2J8ZA 4MKRA 2RSLA 5CB6A 3RWMB 2CBGA 4TV8B 4MVJA 2AR0A 4RQAA 1BGXT 1O94A 1ZM4A 4E22A 1OQAA 3BFPA 3Q5GA 1KBOA 1T9BA 1MO5A 4N8SA 4TYMA 1KQNA 4LOJA 3L6EA 5JADA 2VP9A 3LZCA 2JFUA 3KWJA 3HA5A 2GQ0A 3ASVA 3LDHA 3R24A 2YZNA 1S0UA 4YV0A 3T7KA 1YA6A 1ESZA 2AK3A 4IICA 6REQB 5JS8A 1CZRA 1DEKA 4PYMA 4TVKA 1T9CA 2ZRDA 2C4UA 4AQ7A 2QL5A 1QMPA 4IV8A 4K9SA 4Q39A 2YRFA 5JYDA 2PGAA 4XPIA 3RC1A 5D5PA 2WMYA 3PXEA 4KITB 1K7YA 3UWMA 1X7GA 4EHKA 4KK3A 4D9KA 1PNQA 1A5ZA 4C5AA 1E3WB 3CRVA 1RXYA 3KJNA 4FGSA 4O2AB 1YHNA 4PX9A 4B3JA 2PV0A 2A5GA 2ZB4A 3FPKA 2HLNA 1VJDA 5EHQA 3IAM6 4HGYA 4NYIR 4RNDB 4JHLA 4JEMA 1U9JA 4I66A 4L85A 1N7HA 5SY6A 3K0KA 4RKRA 1QIJA 2IYNA 3HEBA 1J8DA 5DHFA 3BJRA 1L3CA 1LBSA 2EFCB 3D3NA 3FVQA 5DM60 1U2GA 4MI6A 1T5BA 4UM9B 2Q7DA 1AXGA 1P77A 3QMVA 2C9YA 1R6DA 1FP6A 2D5CA 2W42A 3HCPA 5CT4A 1LI4A 3BK2A 4YS6A 3UB2A 1M7HA 2B4YA 2ZRJA 4JUCA 4OG2A 2HJ9A 3KOUA 1GV1A 2PSEA 3DJFA 621PA 3R8FA 1UBEA 3ETHA 3VR5A 1L7VC 4RGBA 2RB4A 1RVDA 3TVYA 2E4ZA 2H4FA 4R40A 3HB9A 5ES4B 5K0BA 1ZK3A 4HG2A 3NOQA 1C4WA 3BWMA 3RKSA 3GFPA 2KW5A 3FXAA 2POQX 4WFIA 1U2DA 1WPQA 4KQKA 2EOAA 3J81A 1VMEA 4WINA 1U4SA 4FHGA 1WXHA 1K0UA 5FYQA 1LI7A 1EWYA 1H0HA 2ZE6A 3HVKA 4X9XA 1M34B 5CT8A 3OKPA 4BNKA 3VU8A 4NMHA 4CKCA 5C5DA 4D0SA 4B48A 1SVKA 3OIYA 1E6KA 3H8WA 2NVUB 3UBMA 2V1XA 2P2CA 2FWJA 1PZNA 1TA4A 3G0HA 1FMJA 1Z6GA 3KHTA 3IP3A 2H6EA 3RNLA 3UK7A 4FYYA 4HLQB 4ARZB 5KTNA 2Q3BA 1E2UA 1XRMA 4HDSA 4P6VF 5IP5A 5C1DA 3UK1A 3GLGE 4HX5A 1BX3A 1PL0A 2ACVA 2FOXA 3F5SA 3MTBA 1E3TA 1Y7TA 4FQ8A 4MGYR 1OVMA 4TT3D 5KREA 1ZHHA 3PEEA 1R0XA 2FLWA 3UWOA 4NENA 2C7BA 4P7BA 4LRXA 3AYZB 1Y3FE 3CZAA 2JF0A 1FJXA 1T1RA 9LDBA 3ZKAA 3L7KA 2JGNA 3IX7A 4OTZA 1E2GA 1J1UA 1GN8A 2WABA 3EVTA 3JD1A 1IQ0A 1GUDA 5EKTA 4FJ0A 5BV8A 2FRDA 1DEXA 1FJHA 3COYA 3GN1A 4XGNA 4RO0A 1G3QA 2O8CA 1VL6A 5FHRA 5CFQA 4B3TB 3Q3CA 1DEHA 3I53A 3LPNA 4JSTA 4I4NA 3KJGA 3RUIA 4DR7B 4HT3B 1QJ4A 5K6TA 4HBZA 1TQ4A 4X1YB 4F4JA 4W5HA 1C3VA 3WL6A 5E2AA 2JFVA 3KOMA 2A4KA 2J3DA 1GU7A 5F1OA 4MA4A 1Q7CA 4B44A 3H97A 2CUZA 5F9FA 2L42A 4FK8A 2EW2A 4NCKA 4R0VA 4D46A 4FN4A 4MV1A 1KJYA 4JLPA 1L7XA 1WDTA 1JAYA 4WUVA 3KAKA 4MRAA 5BQ5A 4CM6A 4F5EA 1XVIA 2Y76A 1BXKA 4IDHA 1GGKA 1A76A 1SBTA 3PC8C 4ERXA 2DR3A 3OIGA 1LK7A 1AMNA 3QVGB 1V95A 4LJSA 1YJXA 4NZMA 3UJNA 1NF2A 1X42A 1BQEA 1DMRA 3C8DA 5EUBA 3DZFA 1FS4A 2OD9A 2H9YA 2QTTA 3NUQA 5F7OA 2M2IA 1DTWA 4RVSA 2OXEA 1TJ5A 3C14C 3I4FA 4BZWA 1NKSA 1Q1AA 4LK3A 1JJIA 3O1LA 2HJSA 2IZ5A 3LDUA 3FTEA 4K9RA 4B75A 2PBLA 1BH6A 1EBFA 1SCNE 2PV7A 2VQDA 1W6UA 3B7GA 5IASA 3PQFA 2N0SA 4P35A 4M6WA 1X7XA 1ETUA 3ED5A 2P5YA 3CZ4A 4S0XA 2E4XA 1D2MA 3SC3A 1RBMA 1V9LA 1KS2A 1ND6A 5AICA 1E7QA 2OD7A 4HX9A 4EG7A 1EHIA 3AXTA 1XRSB 2AZTA 2XD9A 2O8EA 3ITDA 2P9FA 5C32A 1JU3A 2VBGA 4WMLA 4GPEA 2JHPA 2O2ZA 1I1OA 5ALXA 4RTQA 821PA 4ZGBA 1WSWA 1V37A 4OCZA 1AJEA 3DL7A 2IYAA 4P0QB 2SHKA 1WEHA 2Q1XA 3AI7A 1C7EA 4MS3A 1P2DA 3PPIA 1Q7BA 5IUJC 3TUZC 1CZNA 1F6WA 3AJDA 5IKOA 2GHTA 3HY6A 1QTQA 2VDUE 1IQRA 2FUG6 3HZHA 3JPWA 2CLKB 1BEUB 2D13A 3EZ9A 3JVDA 3PHBE 3C5WP 4IGEA 4F6CA 3C8ZA 4QULA 3GQVA 4C7JA 4X65B 3AY7A 3PICA 2O8FA 3Q8XB 5LZ9A 1SQSA 2O2HA 1XIVA 1DG1G 1XHLA 2HWUA 5ALYA 2ERYA 2XXBA 1W0JD 3KJZA 2YWJA 2YCLA 5LA6A 4AZ3A 5DH9A 4MIKA 4ZI7F 2Z2ZA 2RKWA 1VG1A 1ESEA 4MARA 5H4HA 2R8RA 1A9RA 2O8CB 4F4FA 1KI2A 2PYDA 1Z4MA 3D54D 4Q7JB 2R8YA 1Z74A 1SBYA 1TRHA 2C5EA 2VYND 3OZSA 2AC2A 3N5CA 4M0MA 1L5FA 4RL6A 1UFKA 3ZY3A 2PA3A 4AY5A 2LCQA 2NAPA 3HR7A 1H3EA 1NXVA 1M2KA 3IIJA 2WF6A 4IRXA 3PSHA 1C2TA 3ND7A 3UJCA 1SIUA 4C0LA 1SHUX 4DLVA 1JZTA 4KDCA 1ZXLA 4D8YA 1U2RA 3IP7A 1V47A 1CUVA 4MB0A 3O8RA 2H0QA 2WA2A 3AXSA 2R1TB 5T5QA 1M10A 1ZGHA 4YJGA 3EBPA 4N1AA 3QKTA 2PUWA 1QTNA 1G9SA 4FYVA 3ZXYA 5HZKA 3L7IA 1ZUD1 1E77A 1TFUA 4YRZA 2GZ1A 4JI4B 4LBYA 3DT6A 2IXDA 3I2KA 4GP9A 2MWMA 4MQ6A 4A27A 1LDYA 3OO1A 1EXVA 2I3BA 3QU9A 1E4VA 2PK3A 1Q83A 2NOAA 3A11A 5HP4A 1VPDA 1X94A 5BSVA 1UDCA 1ZLYA 3IRVA 1SXJE 3LZDA 5BYAA 4L78A 2IH4A 4JP1A 5KYWA 3C3PA 3THSA 3BERA 1MAUA 2Z30A 4AJ4A 3O9MA 5BWOA 4Q15A 1H0RA 1NVKA 4LDZA 3RVBA 3G88A 2WKPA 4UM9D 1YDWA 2QQFA 4DSUA 3IESA 4DYDA 3RPEA 1YCFA 3RUFA 5JH7A 3NRCA 2GN2A 2ZYVX 3DKVA 4J1TA 3F47A 2GJKA 4QUAA 1XZFA 5P8WA 4ER5A 1A9OA 4QPJC 3SQMA 4DLTA 4UFPA 1X7XB 3H16A 1K7XB 2Q5LA 3E61A 4MCAA 3SXPA 3W5IA 2AKEA 5DM70 1KWGA 2JGEA 2NZVG 4LN1A 4PS1A 5F4ZA 4YMHA 5CVTA 2XCSB 2JG3A 5DLYA 5D84A 4RUKA 2CVZA 2YWDA 3AY6A 5DNVA 3LJKA 3TCNA 4GOMD 3ULKA 3V1LA 2C78A 4KL8S 1NP3A 3ZE6A 5J63A 4PNEA 1PJAA 1H23A 4KMOA 2ZUTA 1L5YA 3LHDA 5HWSA 3BE6A 1RYNA 4MQFB 2DF8A 1JPNA 1YR1A 3UK6A 5KTSA 4DWWA 5GIOE 4NV1A 1X19A 2CXXA 1AUXA 3F2VA 1NZJA 4DBVO 2UUAB 1QZUA 1AF7A 2YFHA 2QMYA 3U7JA 3SQOA 4B46A 4QJ5A 3EWAA 2ZS7A 4TQAA 5KTPA 3MGKA 3FETA 2FPGA 1JA1A 1AQNA 2XCQA 3PX2A 1Y1PA 2BGJA 2YWRA 3ML1A 3UIEA 3V1YA 2KS6A 3TD9A 1E2QA 4A0SA 1XF1A 4BO2A 1PVOA 1S02A 2V7WA 2XOEA 1ADJA 4KPUA 4N0DA 4DCNA 4QBFA 2BFNA 2D5AA 3RYIA 1WCIB 2ODEA 3EK2A 5LXTB 2GS9A 4AD8A 2O8FB 3F5MA 5YASA 3TOCA 3TQSA 1SHLA 1Y9EA 2I6XA 1K92A 3NDRA 4M7OA 3SZOA 1ZAKA 2BR5A 5AVXA 5TEVA 1J07A 3KO8A 1OBFO 4P22A 1W6RA 4PLWA 2ST1A 4O4JB 4OJTA 1N5JA 4IM7A 4E3ZA 4ZOEA 2JIQA 1ZKDA 1CQIB 1HYGA 4FYWA 2NTNA 3IVRA 1US8A 4FT4A 3KXPA 4M21A 4X93A 1Q5PA 2ZYAA 3BDVA 3MUFA 4UMVA 4BIMA 4L9SA 5D3KA 1DCKA 1SCJA 4DE5A 1SQ6A 1ZKMA 2W2LA 4G5SA 4JJAA 4EDFA 4EG1A 3EXAA 3I1YA 3JYNA 3PT5A 1ZO8A 2H1CA 1OC2A 4XLZA 1GPMA 2WTMA 4Y9DA 2FWBA 3K0BA 1QONA 4B6QA 1EE2A 1UWCA 1ODLA 1SWWA 3R75A 3T61A 4EH1A 1II9A 3QPCA 3D7LA 2Y99A 4WEOA 5BW4A 3M6FA 1SY7A 3HY4A 4WNYA 4EA9A 2OG2A 3WP0A 3P52A 3STWA 5EP4A 1OI3A 2AN3A 3FNEA 5BYBA 3WNZA 5HUQA 3AB3A 1N8TA 2O7SA 4OMFG 1E62A 4WERA 1OXSC 2ET6A 1VI5A 2GA9A 4Y0AA 4YLEA 4NAUA 3RHFA 3NBAA 3ZY5A 1P0IA 2H2AA 2O6LA 3HBJA 7REQA 3B3QA 3USCS 2B8JA 4PZEA 2P6UA 4Y2QA 5BSEA 1E5QA 1XRLA 3P4UA 3R09A 4ZQEA 3WJ1A 2G7MC 1KO8A 1T13A 3IVAA 4GM1A 4MEAA 5KYWB 3VR4H 3MPUA 5EZYF 3OU7A 3VPGA 3GLVA 4HPXB 3GIWA 2F62A 1UBSB 2PT6A 2HIMA 3QVOA 3CUUA 1BD3A 2LTAA 3WADA 1UDXA 2PBFA 4FD3A 3RTDA 3I9MA 1B4DA 2OFXA 3SE0A 2JAWA 1A8UA 3HM2A 4HMQA 1FRFS 1F17A 1HDEA 1B1CA 1PJRA 4HRXA 4OHUA 1O6BA 4FB4A 2HWYA 1WOYA 3CLSC 5BN4A 1VP3A 3O9VA 2B8TA 2VHZA 3HDJA 4BTVA 4BRUA 1J0XO 2ZPTX 3H0EA 4ZZ2A 5B4UA 4BX9A 5HBGA 4C7VA 5CCBA 1R9GA 1CJBA 2ZSKA 1KJ8A 1A7AA 4LKRA 3FUVA 4JJEA 1XP8A 4MV0A 1O54A 2Y6VA 2NXJA 1MNQA 2Q2QA 3V1UA 1PSWA 2RB5A 3H3JA 5ALMA 3VR6D 5C8XA 1XAHA 2PDAA 5AVSA 3S8EA 4GL2A 3P2YA 2P2SA 2A9FA 3IP6A 3OQ1A 3U7FB 1BMTA 1N78A 4DQKA 2A0FA 1E1YA 4BE7B 3S1LA 1EK6A 3WBBA 3QA3E 2NQ8A 2D06A 1ABBA 1P19A 2GNAA 1G9XA 4BEBA 1FJGB 3GFFA 3LT2A 2QW1A 4IH1A 3WZLA 3D7SA 2I4TA 3SXUA 1MKYA 1N5OX 2FPGB 3K0AB 4QA9A 2PPLA 2IA5A 3S99A 4D97A 2H00A 4OUKX 4YRTA 1U3UA 1ZGGA 1EESA 3EIOA 1YBFA 4JK3A 4F9GA 1NWHA 3PQ4A 3Q7TA 2G6BA 4I1PA 5ALIA 3OFNA 3RYIB 4HATA 1OYYA 3H2YA 1E63A 3I1FA 3VC7A 3WBFA 3DD5A 4ZOBA 3MD0A 3ORSA 3OPNA 5L3QA 4B09A 4YCMA 1BOOA 2MTBA 3BCUA 2R8ZA 3OICA 4II2A 4N82A 5H9WA 3UGQA 1JDJA 1Z6AA 3ZGOA 4OBXA 4OL9A 1U7DA 2CXQA 2G9ZA 4QQFA 5J2TF 4HBGA 4QQKA 4WW0A 5DMHA 1S2IA 2VDWA 3G8AA 1VTKA 3HBLA 3CH6A 3QHAA 1QANA 1XTZA 2OBXA 2QI9C 2OXFA 1GUFA 4YMUA 1SH7A 3CU5A 3MOGA 3CJRA 5FOUA 2XWQA 2B1JA 2I3DA 2M32A 2RI0A 3SY8A 5ICGA 1GEEA 2YFQA 4TV8F 4XOIA 4AZSA 1ZDMA 1RLUA 2CHFA 2ZRLA 4R16A 2X1VA 4E5DA 1JR2A 2WQ7A 2ON6A 5LBTA 3MWYW 3OQVA 5IJ9A 1QAOA 1PQYA 4G4SP 4C07A 4UARA 2HR1A 4H0CA 2JI4A 3BB3A 2Q6KA 1J00A 2VDVE 3UAXA 3E05A 4J16A 2XUFA 1XTSA 5CIQA 3H7IA 4EA8A 4KDEA 1UBOS 4L5AA 3RUPA 2ID9A 2BJVA 4HWTA 2C3UA 4N7RA 2J9FA 3TOSA 2C5FA 2PZJA 4MV5A 1G21E 3TLYA 4HFNA 3C3BA 3BWBA 5IXSA 2EBUA 4BVFA 1LDMA 1I2MA 7REQB 3U9SA 1XLVA 4KQXA 5JY6A 3C0KA 1WA5A 2UZAA 5IWAB 1QLWA 1YDFA 3M8KA 1CDZA 1PQPA 4NAHA 2EEZA 4O2AF 2AHOA 3IELA 4BFXA 2QR3A 1XE3A 4YGXB 4YLGA 3NDBB 2Q2OA 4G97A 5KBYA 5AT1A 3RT7A 3CIOA 4HYQA 5ECYA 1ADGA 3CBQA 3ISTA 3M82A 3B20A 3FVTA 3KKQA 4IAOA 3WI7A 1E9AA 1JG1A 2RHWA 2XTAA 2R6HA 1YCDA 3EDRA 4PONA 1MCZA 4HNGA 3VC3A 3N0TA 1AV6A 4BUJA 2HJGA 4CMIA 4F9FA 4KMMA 3UPTA 4E11A 2UZ0A 1P72A 3T3EA 3ZJ4A 1GFSA 3SS7X 3EPPA 3AG6A 5LMNB 3TLCA 1ES9A 4GSLA 5E2IA 3QXHA 1NMEA 4HQ0A 2EHJA 2Q29A 3DXXA 3DLTA 3DWGA 3IAS1 1KU6A 3KSUA 4JHXA 4DB4A 2ZJ0A 3H2GA 3BICA 1MFPA 4XJSA 3OJWA 3THXA 1Q19A 1RWBA 3T9AA 4ENWA 5KNCA 2WI8A 3BIOA 2RHDA 4JC0A 1XVTA 4UM7A 3L6RA 5A7HA 9ATCA 2OV4A 1K6JA 1TAGA 1NMQA 2A9RA 2GMWA 2QBYA 2PRKA 3UC9A 2FRXA 4H3VA 3VX3A 4IDCA 4YBZA 2GO1A 3VV3A 1KK3A 1GNLA 1QU2A 2PMWB 1HPLA 1B26A 4OQYA 2FMTA 3HJRA 4HEA1 2HY7A 1Y81A 4B8ZA 2Y1EA 1Q77A 2IHYA 3G13A 3SXUB 1QMGA 4ZU3A 4EW2A 1IY2A 2Z04A 1I80A 4FC6A 4YGYA 1JEDA 2IF2A 5F33A 3LO8A 3O5AA 1TTPB 5JFOA 5F7ZA 5KC9A 1J0BA 1TYAE 4MI3A 4EUNA 3L8YA 1B0UA 2DXIA 2E82A 1D0IA 2J0SA 1CZOA 4QGAA 2OLEA 3ZGNA 4NYJR 2B35A 4RCYA 2DLNA 1P4AA 5L3QB 5I4BA 3BCRA 3Q11A 5T6BA 3C70A 3JYLA 5IEBA 3OCJA 1YI0A 1NXTA 4PCUA 4X91A 4YYZA 1EB9A 1CBUA 5A0TA 1NHWA 4QTUB 4AT1A 3AW8A 3D2AA 2G0AA 2VDWB 3SM3A 1V4NA 4EKYA 1G64A 3TE7A 2ZETA 4A16A 1M72A 4DLNA 4CRWB 1I32A 3A1TA 1IG3A 4INPA 4DRZA 1LW6E 2O3RA 1BE8A 2EP8A 2YY5A 4OQQA 1QH0A 4GBGA 4L8GA 3LUCA 3ZCPA 1S4QA 2IOQA 2LGJA 4IDEA 2IKSA 4RAOA 5IJ9B 2AXEA 4FCWA 3QXXA 3ZIUA 4XGIA 3L0SA 3RQSA 3DNFA 4FBGA 5JLAA 4NBVA 4XFDA 4NECA 3AP2A 3T6KA 1MB0A 1OT3A 1V48A 1HLGA 5IRCD 1JEOA 2AQHA 2GETA 3KXIA 1OH6A 4WZBA 3WRXA 2FW8A 2BCJQ 1R15A 1RQRA 3DFFA 1H6AA 3NU1A 4QX6A 4EJMA 2YZ2A 3LH5A 4UNNA 3C3KA 1X7HA 2H3HA 3BXHA 2W2TA 4GPIB 1DKLA 1W5FA 2XDQB 3RK4A 3SZGA 4BYGA 3EHDA 1NGSA 1HLFA 4XPZA 2IHNA 2D5LA 2WIAA 2O23A 3KYDA 1YBMA 5CXSA 2ZJFA 2D59A 4UOEA 1QFYA 4LCJA 4RIGA 2J41A 1GXSB 2QF7A 3SFVA 2DX7A 1H5UA 5DT2A 2MYPA 4Y2YA 3KR9A 1QPZA 1IAVA 1RE1A 2SCUA 3AKYA 3MQFA 1ZH6A 2GD2A 3LCRA 3UC5A 1SQ0A 1AC5A 2NSJA 4KWEA 4OSEA 4EW1A 3W5VA 2NU6A 3V00A 1AZWA 1VXRA