3DGEC

Structure of a histidine kinase-response regulator complex reveals insights into two-component signaling and a novel cis-autophosphorylation mechanism
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
122
structure length
122
Chain Sequence
MSKKVLLVDDSAVLRKIVSFNLKKEGYEVIEAENGQIALEKLSEFTPDLIVLDIMMPVMDGFTVLKKLQEKEEWKRIPVIVLTAKGGEEDESLALSLGARKVMRKPFSPSQFIEEVKHLLNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein
publication title Structural Insight into Partner Specificity and Phosphoryl Transfer in Two-Component Signal Transduction.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/signaling protein
total genus 33
structure length 122
sequence length 122
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3dgeC00
3LKBA 4G86A 1NXOA 1ZITA 5IUJC 3H5WA 4YRZA 1QP0A 1R8JA 5TQ0A 3DGFC 3QELB 3IP5A 4YO7A 5TPWB 5TQJA 1MVOA 1USGA 1Z2EA 3S99A 2AYZA 1QQAA 1AB6A 3OLXA 2HPHA 2CHEA 1U8TA 4KK3A 5JNVA 1DJMA 5ED4A 2E4UA 4O1IA 3IPAA 5FBHA 5GOTA 3LUDA 1JFSA 4G0MA 1TVMA 1EWVA 1U2PA 1URPA 2FN8A 2NT4A 4P98A 4N76A 2M1ZA 4N41A 1E6LA 1QMPA 2CWDA 5TE9A 3HVRA 4P1ZA 5T3YA 4OG2A 3CS3A 2PKXA 5KQLA 2IPAB 3HS3A 3G1WA 4WXEA 5FWXA 4M88A 5FWYB 3GRCA 2QR3A 4Q6BA 4Q6WA 3W9SA 1RPJA 2E4VA 2JCGA 2MSWA 3A10A 5FBKA 3SG0A 1MB3A 4YGXB 2NZUG 4MR7A 3L6UA 4Z4HA 2FEWB 4RK1A 1PHRA 1K68A 1PNTA 4JAVC 4KMRA 3C6QA 3RH0A 1RXEA 4PYRA 4WZZA 4RDCA 4LE2A 5CNJA 1WETA 2H3HA 3EAFA 3I45A 3LOPA 3QEMA 5TQ0B 3HXMA 1I3CA 3G85A 2MYNA 3GV0A 3HCWA 4ML3A 2HQBA 1H9CA 1TM2A 2OENG 4RXMA 1UDRA 3O1JC 1D1QA 2MYUA 4IRXA 4TN5A 1L5YA 3H5VA 3ROFA 5KC8A 3OQOA 3EDCA 3KKEA 3FFWA 6CHYA 3L49A 4ZYLA 4KPYA 2BGGA 4EGSA 1JWLA 1VRVA 1D1PA 4NV3A 4MYRA 4Z9BA 1GCAA 3Q15C 4MRMA 2JK1A 5BRJA 2WMYA 4RK4A 1E6KA 4MLDA 3I09A 3KCNA 1VPWA 3VNBA 5BQ3A 1BAPA 2O20A 3HZHA 2WY2D 3C3WA 3FFXA 2L17A 2HJ9A 4XFKA 5CHYA 1TLFA 5ABPA 5B3JA 1NXXA 3OLYA 1BVHA 4OATA 4KREA 3CKMA 1QP4A 4RWEA 2P4UA 1FFWA 3O21A 1FFSA 1U2QA 1QNLA 2KYRA 2LIVA 3KLOA 3ROTA 3T38A 2FEPA 2GX6A 3TX6A 1C0EA 2IYNA 2JVKA 3DBIA 4KQ9A 3KTOA 1EAYA 1DCMA 2VUIB 4OBBA 1NXSA 3O75A 5JNTA 4MR8B 4WXMA 5EWLB 3MQ4A 2GBPA 1RZRA 1DZ3A 3MM4A 4ZMSA 2R25B 3QLVA 4KQCA 5JNUA 1DG9A 4G0QA 3HDVA 1E6MA 5B3JC 3HDGA 5IULC 3BBLA 3OLVA 1JBEA 4XARA 3RVQA 3FDFA 5DCLA 3BREA 1M5TA 1SD5A 1ZGZA 2QVCA 2PMCA 3QELA 1L5ZA 2ID7A 3KHTA 5TPWA 1Z15A 1ABFA 4DN6A 4MS1B 1Z12A 1TMYA 1JYFA 3LUAA 2WJAA 5HKOA 2A9PA 2PUGA 3DLHA 3SAJA 4DADA 1GUDA 4H3KB 5HM6A 1GCGA 3N75A 4JP1A 3DLBA 3IP7A 4W5RA 1Y1LA 4EYKA 3HJFA 1NXWA 3JS5A 3HUUA 4KFCA 5C5CA 3QLVC 3H5IA 4Q7EA 4Z9AA 2ZWMA 3TD9A 1XHFA 2FTKE 2NT3A 5DGCA 3TB6A 4N03A 4KRFA 4QYMA 5FWYA 1SRRA 3HV2A 3HO1A 3LUGA 3IP6A 4F8JA 2PUDA 3LUCA 1GLGA 1OXBB 1ZN2A 3Q7TA 3R0JA 4YV7A 3HK2A 2QZJA 3N0RA 3LUFA 4QPJC 4RSMA 4EYOA 1LBIA 3UKJA 1YVUA 1YS6A 4CBVA 2LPMA 2MYPA 2FLKA 5TPZA 1JF8A 5DKFA 3T95A 3LTEA 1LK0A 3N53A 1NXVA 4JB0A 1USKA 3GT7A 3F6PA 1EWKA 5KQPA 1YK0A 1JDNA 3JPWA 3NHZA 1BA2A 1EHCA 2IPMA 3Q9SA 2MSLA 9ABPA 4KZKA 1LBHA 1Z17A 3E61A 2JRLA 3NHMA 3CG4A 1A2OA 2Q5CA 4RY9A 5BR1A 3JVDA 3K4HA 1JX6A 1M2EA 4F06A 3RVSA 1QO0D 1APBA 2FN9A 2R48A 1PEAA 4Z4EA 3DZDA 3H5TA 4EVQA 3Q41A 1DRKA 1P6UA 2FEKA 2MYTA 3RVMA 4YR7A 1HEYA 3N6VA 4EVRA 2QVGA 1D4ZA 1KGSA 3I5AA 1NATA 2CD7A 2QW1A 3RVRA 4L4UA 2DRIA 4OLAA 2PLNA 1PEYA 4MS4B 3CHYA 4N0QA 3NNDA 4RY0A 4NCBA 3QK7A 4RKQA 1P6QA 4ZMRA 1QO0A 3OLZA 1MIHA 3QLUA 2PE5A 3EODA 3KYIB 4G97A 4Z0NA 5CNKA 4EYQA 3RVNA 1D2AA 4MR8A 1DC7A 5C5EA 5KWSA 5EWLA 5D2CA 4PZ0A 3O74A 2PL9A 1YS7A 2PJUA 3LUKA 2PL1A 1A04A 3QX9A 1JDPA 4D6XA 5T7BA 5EWMB 2QU7A 3RVPA 4Z4FA 4MQEB 3F6CA 1BDJA 2HQRA 3MF4A 2NUBA 3C97A 3IDOA 4KNYA 5CNIA 4MS1A 4XLTA 2FMKA 3QLUC 4YP9A 1NTRA 4RS3A 8ABPA 2LBPA 2VUHB 4IF4A 1YTUA 5CNMA 1E2BA 1J56A 3NNNA 4LE1A 4G0PA 5KQMA 3OO1A 4RV5A 1SXGA 2IPNA 4G0YA 2OQRA 3A3KA 4Z4GA 2FXIA 2E4ZA 3KYJB 1GUBA 5JNWA 3JVIA 1U04A 3O2JA 3SNKA 2PUAA 2F8TA 3OO0A 4D6YA 3SM9A 3BILA 2FW0A 1M5UA 2FKAA 1W25A 2L19A 3JPYA 4EY3A 3BRSA 3MYYA 3CU5A 1FQWA 2LUOA 1DRJA 3RVOA 1CHNA 1BDHA 2YHBA 1ZH2A 2VYCA 4Z99A 2N9UA 4RXTA 3P9YA 4PEVA 5HSGA 1CEYA 1CYEA 4LX8A 3NBMA 4PICA 1TJYA 1NXTA 4B09A 1RXIA 1C4WA 3CLKA 4RK0A 1OXKB 4EUKA 4XAQA 2A9RA 3LUJA 4S05A 4F11A 2IPLA 1NXPA 4FE4A 3SQNA 2F8SA 2FMIA 4O5AA 4IMJB 2I6FA 3O1IC 4HNSA 4IGAA 2GWRA 3H5LA 1YMUA 5IBQA 5IUNC 2X7XA 1Z25A 2E4XA 3QEKA 3O2SB 3GYBA 3H5OA 4OLBA 1A0OA 5KI6A 1DCKA 3LMKA 4TLLB 2FLWA 3H75A 1LJUA 1P2FA 1ZDMA 4MQFB 5I4CA 1KRWA 4E7PA 4MLCA 4MS4A 4RU1A 1IIBA 3CZCA 3MMNA 4MPTA 4H60A 3OM0A 4LRQA 2JBAB 2QV0A 2WWVD 1KRXA 1ZVVA 1KMIY 5E3JA 2LP4Y 2HQOA 3FFTA 3I42A 3EQZA 3C3MA 3M6MD 5HQJA 1U0SY 1JYEA 1JFVA 2QSJA 3H1GA 2FMFA 2MSKA 3MA0A 4RY8A 4ETNA 3LKVA 1ZESA 3OLWA 4NICA 3E3MA 4W5OA 1YMVA 5EWMA 4MGEA 4MQEA 3M9WA 4RXUA 4KVFA 2IKSA 2PUCA 1DCFA 1FSPA 2ZAYA 3H6HA 4JOQA 5DTEA 3TO5A 1XWWA 4MS3A 1ZHHA 3CNBA 4KK4A 3GA5A 3K9CA 1M2FA 5KQGA 2P9HA 4MAAA 3JY6A 3OQMA 1ZH4A 4W5TA 4IILA 3NNSA 1F51E 2R47A 4ZPJA 3OM1A 3A0RB 4QYWA 1T34A 3RVJA 4XXHA 1SXHA 3N8IA 1ZGGA 3CFYA 4FB4A 3CTPA 5IUKC 3LFTA 4WWHA 2B1JA 4H3HB 3LUHA 3T6KA 7ABPA 3OMXA 5TQ2B 3KSMA 1ISRA 3RVKA 2H0AA 3KG2A 2JB9A 1MB0A 1BDIA 3D02A 1B00A 4YS6A 3HSYA 2RJNA 4ETIA 4GPAA 3Q7RA 4JB2A 4TMYA 1JFTA 5JS1A 1SXIA 4QICA 4Z4IA 3VNAA 4PE5B 2L2QA 2XDYA 4MS3B 3GBPA 2FSPA 1EWTA 1K66A 1DBQA 4RK6A 3CZ5A 3IPCA 5JNSA 3OQNA 1DC8A 2WB4A 3TMYA 3ILYA 3M9XA 1Z13A 4WUTA 4XASA 2JVIA 3F7NA 4N47A 4RZSA 4NCAA 3H6GA 2AYXA 4G0XA 3UUGA 1FFGA 2ID9A 1ABEA 5IC5A 1F4VA 4YWHA 5IX8A 2A9OA 3F73A 2E4YA 1Z26A 4Z4CA 3QX8A 3EJWA 3EULA 4F3TA 5KC9A 5FWXB 3O1HB 2J48A 4OTZA 3RVLA 1QPZA 5PNTA 4RK5A 3QLTA 4HNQA 4EVSA 1YK1A 1RZRD 3IP9A 1JL3A 3URMA 4UHJA 4MQFA 2NZVG 2PAFA 2RJOA 3H1FA 3HUTA 2GI4A 4JA2A 4MR7B 3D8UA 5IEJA 4TLMB 4RK7A 2A9QA 1JH9A 3ILHA 4YLEA 3UK0A 5JNRA 1YIOA 2YHAA 3N0WA 1S8NA 5EWJA 3QEMB 1MAVA 3CRNA 3EGCA 2JBAA 3OMWA 3JTEA 2IDMA 4N0PA 3KJXA 3RQIA 5IEBA 5GQSA 4MR9A 1RNLA 1LJLA 2WJWA 3Q7SA 2FVYA 5BRAA 4GNRA 3SY8A 3HEBA 5F64A 1QP7A 2QXYA 2JVJA 2E4WA 2FMHA 3KS9A 4EYGA 2IOYA 4HYEA 4G0ZA 2HSGA 1QKKA 3BRQA 4LDZA 1ZAYA 1QQBA 1Z18A 1AB5A 1PNRA 4L85A 2WRZA 1ISSA 4MRMB 4LZLA 4E7OA 3EQ2A 1JLKA 1JHZA 4G0OA 4RKRA 2B4AA 1EFAA 2PUFA 3MIZA 1DBWA 2GKGA 1DP4A 3GBVA 6ABPA 3N0XA 1NY5A 2FQXA 4O1HA 3O2QB 2M98A 1D5WA 4D74A 2TMYA 2V0NA 1ZY2A 1VKRA 3A0UA 3GL9A 4JASB 4IMIB 2FQWA 3FMVA 4FE7A 5TPZD 4W5QA 5EWJB 2FQYA 1Z2DA 4KV7A 3H1EA 5DLEA 1Z16A 4S04A 1USIA 2L18A 2RGYA 4Y9TA 3T8YA 3KLNA 4NQRA 2PUEA 3C3KA 4MR9B 4ZJPA 2R4QA 4F12A 1PUXA 3DGEC 3B2NA 5JS2A 3FGZA 2VK2A 3GWGA 4LDAA 1VLZA 1XHEA 4YCSA 1DBPA 2RDMA 5TQ2A 3HM9A 2PUBA 4W5NA 1P8AA 4LE0A 1W9HA 4DQDA 4UHKA 2CHFA 4WT7A 4HNRA 4ETMA 2W42A 3CG0A
chains in the Genus database with same CATH superfamily
5B2ZA 3KJGA 4MX8A 4G86A 4R51A 2R1ZA 4E46A 3X1XA 3BF7A 5I8PA 1BDBA 2J31A 5HKLA 5IUJC 4ZOEA 3VPSA 3EMKA 3P9XA 4QGAA 4DZTA 2H1OA 4BUZA 2AYZA 4I4TA 3STVA 2J9RA 2H2FA 3BXOA 1RQRA 1AGRA 3ZI7A 3S8YA 4Q7KA 3H1TA 2MIIA 1GEEA 3II6X 1Q1ZA 2EKZA 3J80A 2P6PA 4AWXA 2G8LA 2XCUA 3ZHYA 1EWVA 3NTLA 4P98A 3VUFA 3V5NA 2ODNA 4BFVA 1AGXA 2DFLA 3L0YA 3D6FA 2R68A 3C1OA 4OG2A 1U6KA 3EAGA 1F8GA 2BZ0A 3KEQA 3OLCX 1MLDA 4EEKA 4EL0A 5C1PA 3JAWA 1B6SA 3RWOA 4JJKA 4G84A 2AZ4A 5JJIA 1V7CA 3T7KA 5JJLA 1JZSA 1LTHR 1DXHA 1DKRA 5FBKA 4X8LA 4YJHB 4BWVA 1CRWG 5JZBA 5LLSA 4FFRA 1DWPA 3M5DA 4PO9A 2OV8A 2ZREA 4D92A 3FHOA 2ZYHA 2MMCA 4LWZA 1OYVA 1K68A 2E55A 2KE5A 2R8OA 3RHSA 1FFEA 3PRJA 1BGWA 4JJZA 4JGGA 4UMDA 4WZBA 5E4JA 5IKEA 3WLPA 4WZZA 2QRUA 3TCKA 3I83A 4Y30A 1G4HA 1OLUB 3CRQA 3BTUA 3SC2B 5EINA 2O5VA 1R27A 1E4VA 2X13A 3MCTA 1V1MA 221PA 1QDLB 1OC4A 3MOGA 4JYMA 1YZTA 1OW3B 2JANA 4WCVA 4WECA 5CX1A 5EC8A 1AZWA 3W4KA 4C0AC 4B3JA 1OWMA 1GQSA 1Y34E 3L49A 2EYQA 3TLYA 2AG0A 4HZIA 3NCHA 3ZGLA 1O4VA 1E3DA 3FYDA 3A3PA 3BL5A 4TL6A 5DW3A 4C2AA 1JT2A 3W5IA 4D3ZA 3GPLA 3M6UA 1S01A 3GCXA 1E6KA 2CMKA 1ZS9A 4YK7A 5FEMA 4YJ2A 5EZYA 2O57A 2GD0A 3I09A 5FUWA 4DA6A 3GLIA 1WAMA 2EC5A 2H1SA 3FLEA 1P2DA 3CN9A 4B2IA 1E92A 4DREA 4GMGA 2Z98A 3AR3A 3TW8B 1JJVA 3C3WA 1SN7A 1X7HA 2OHXA 3EFOA 4INZA 3VR0A 1T10A 10MHA 4FR2A 5HJ5A 5ABPA 1E58A 1KBQA 3FNHA 2FEXA 3CKMA 3K2BA 4EJSC 2FPWA 2FSIA 2NAFA 3WRVA 2LIVA 4UQOA 2AKAB 3TSCA 4BVEA 4CKWA 4M9SA 4P7FA 2GX6A 1ZJYA 4KTVE 1XMSA 4TXMA 1GNVA 4YUWA 2J9ZB 4PHCA 1P72A 4TMTA 1EJ6A 2JJ8A 4YAJA 1DEXA 2LE0A 3QRWA 1FSSA 2C4TA 3QY0A 4PRKA 3QXXA 1E94E 1KYWA 5JD6A 1R0BA 2ODPA 3INRA 5AW7A 4FZ5A 4F2HA 2Z83A 1RZRA 4EG3A 3W5AA 4LVOA 3MM4A 5SZKB 3STWA 1OH8A 1JAZA 4Q82A 2XUFA 3I2JA 5DHFA 7REQA 1XEXB 5C7YA 2P8SA 6LDHA 3EPHA 3JWJA 4JJIA 3P0RA 5JSKA 1RBYA 4FSDA 1R4AA 4ZOAA 4IOLA 5HEKA 5TNXA 3WYBA 1T8YA 2H06A 3TLZA 3NC4A 2NUTA 3NEJA 4N5NA 5ITWA 2HCTA 3P2YA 2VJPA 1X9IA 3PENA 3EPLA 1XHLA 5BN5B 1Z7YA 1GUDA 2LW7A 1A5BB 1W8DA 4HNGA 4G37A 4NAUA 1TLLA 4NYJR 4JP1A 4Q1DA 5E9WA 5B4VA 3P2IA 2H4YA 1Z83A 3HV0A 4HO1X 4EYKA 2ZKLA 5IABA 5ALNA 4XOUA 3GGGA 3SLKA 1FTGA 1G4AE 2CNBA 4LOLA 4UU8A 1XQ9A 2ORED 3QLVC 5HBRA 4BN5A 1P3Y1 2HAEA 1IOVA 2YH2A 2ZWMA 1XHFA 4UBJA 4KR3A 1XRMA 4OV6B 1WBDA 3WGNA 4IV0A 2I2DA 5JWRA 2CYBA 4CU5A 2Q29A 1EG7A 3NKFA 2HPAA 4FR0A 2DBRA 2RGBA 4RF5A 1IJBA 3CR8A 2VYQA 1DJLA 3OZGA 4NOKA 3LDGA 3KD2A 3TTSA 1Y1RA 2P67A 1XU9A 4AY6A 1RJEA 3LQ1A 3U3XA 3OJEA 4BPBA 1PL0A 1YS6A 3DM9B 4BFCA 2HA6A 3ZDXB 2VP4A 1T29A 3EX7C 3M3DA 5B58C 2A0YA 1YCFA 3SEZA 2DY0A 1SVIA 3N53A 3EBPA 4GVXA 1R8QA 2CLHB 1USKA 5AJHA 1G17A 4QZVA 3ELDA 1EWKA 4MIEA 4PG8A 1RI4A 1YK0A 2X76A 4K9KA 4UMVA 1UJBA 3TE6A 1IL0A 2HLNA 5KS2A 2YXBA 4MCIA 2FX3A 3S27A 4EY7A 1LBHA 3DT8A 1Z17A 1SU8A 3HU3A 2BRUA 2C96A 3QVMA 2BKEA 4DY6A 3FCEA 3L8EA 4RPHA 3JVDA 4COKA 1W48A 1U0LA 2B1RA 4NLLA 3PWTA 5AKIA 4OHBA 1J5EB 2UU9B 4ID9A 3E81A 1NYTA 4DHWA 1SY7A 2DPGA 3BK1A 1UM8A 3K0HA 2FW6A 3PQ6A 4ZCIA 1NN0A 1P6UA 5D86A 2X8JB 1NE7A 4FHDA 2OPHA 1CJUC 4GMDA 4UBOA 5FHQA 3QE3A 5IYZB 1UZMA 1F17A 4V2IA 1ISJA 3D2CA 3GLQA 3K1TA 1H2YA 3HA5A 4ATNA 4F3KA 1GY8A 4N0QA 4ZPXA 2XYGA 3CW8X 3SJAA 3GLFB 2RB4A 1E3WB 4EX6A 4WY8A 3WAKA 1H3EA 2AR0A 2H3EA 3VR2D 1JDBB 1FCJA 3WKDA 1L7BA 2C00A 5JR3A 2I7CA 2DJ5A 3OZXA 1Y6QA 4KH1A 5CT9A 5LBTA 3ZEIA 3HFSA 3Q2OA 5U9CA 4ZK2A 4P58A 4PVCA 3KAKA 4UU7A 2J1LA 2R8EA 1U9IA 3DZFA 1ZRMA 4IHKA 4QE3A 3OCWA 2IU0A 2GCOA 4O2AA 3IKTA 3MRSA 2B8JA 1G6HA 3ZK7A 1KMHB 1F3LA 1EVLA 3Q8WA 4MQEB 3T94A 1SUBA 4RD0A 4KI0A 4D8TA 3NETA 3HR7A 2NLOA 1FC0A 4XB6B 4FZ3A 3IBYA 5M34A 1UFRA 3PZRA 4FMDF 3I72A 3LDFA 1K5HA 3A05A 3NASA 1PG5A 2HF2A 3PXUA 4U9IS 4YAFA 3S2EA 3S5JA 1FDUA 4Z8XA 2XXAA 1F5NA 3RTEA 4M60A 1EUCB 3KOZA 5AI6A 1D1SA 4C0XA 4LCJA 5LQSA 3RRMA 5I7WA 2GM3A 1V2GA 2WKSA 2X9VA 4LJSA 2CFOA 4ENTA 4LBYA 2XMPA 3IGFA 4IDPA 1TA0A 5F9MA 4ZVVA 5LQDA 3DLIA 4UVHA 1W4CA 4P32A 3LYLA 4ZI7F 1E9SA 4HRXA 4B45A 3KVYA 4I7EA 1N1DA 4CMIA 4IVQA 4NE9A 2X0KA 4GD3Q 3PL5A 3VC2A 1EWYA 1Y3IA 4TPKA 4BU1A 1ZH8A 2YCLA 3CH4B 2O1EA 2IXGA 4NIMA 2XVYA 4H6VA 5LQKA 5IAKA 1ZG3A 4E4RA 2Z4SA 3UJHA 4R5HA 2IYEA 3B53X 3LPLA 2ZWAA 3PXAA 4I46A 4D4LA 1I7DA 5TT1A 5LQUA 4BXOB 3ZHXA 1C8BA 3CU5A 3D8HA 1Q0TA 3RJTA 3G3EA 2XMQA 1F6WA 1T1IA 3EIOA 2YRFA 2ZT8A 4KO4S 2D2IA 3EZ7A 2Q3FA 2O1SA 3UOAB 1NW5A 2NZJA 2XLCA 3CN7A 4P4LA 4U2FA 1UQRA 3FZGA 1JEJA 4NAVA 1G291 2Q7OE 5D6OA 1ZMTA 4F1JA 1EVKA 4BZXA 2IBTA 1OXKB 2YOHA 3H17A 3SGLA 2YJNA 3RARA 1KXJA 2BMDA 2I6GA 4LNHA 4GOOD 4M1EA 4MSUA 4O2LA 4BKUA 4R6XA 1QHIA 4AKGA 5CXQA 4UVGA 1MB9A 1PTJC 1XD8A 3FKQA 2PFGA 2BFCA 4KW7A 3ILXA 4FILA 1NC1A 1UOQA 3I01M 4H17A 4IIVA 4KVZA 4L0QA 4MUXA 4EARA 5LIRA 1OVMA 2MHCA 1ANKA 4YP7A 1A0OA 1L5MA 1WW3A 3RFFA 3V1MA 2P3QA 3C16C 1UWLA 5GVSA 3PVSA 3DDCA 2PMEA 3A6ZA 4TQUS 3EBOA 1DKUA 2Z9BA 4JDUA 2BMJA 3DE2X 4M0DA 1KA9H 1JAIA 1Y4ZA 1PYDA 1PR1A 3B5EA 5B30A 4LRWA 5BYAA 2DQZA 2YXNA 1NN3A 4JB8A 5KJ1A 3N3AC 5E2IA 3RS3A 4NFYA 3A4YA 3K8QA 1P1BA 1R37A 3L7KA 3PEUA 1CDOA 3QKTA 1XX6A 3LF2A 4WH0A 2IEAA 3TNJA 3RTBA 1X92A 1YZQA 2NW6A 2FN4A 3PG5A 5D3MA 5JE8A 2YASA 3NIBA 3VPBA 3ZBQA 1SC6A 2C2HA 3GPBA 4K6CA 4DZRA 4HUJA 1EXNA 4MW4A 5E3JA 3O0DA 4OQQA 3PJGA 4WKCA 4CIBA 2FRDA 3C3MA 3CNNA 1M2OB 4X90A 1RJGA 2NZXA 4B0PA 2ZSAA 3C6ZA 2BFWA 1E5VA 3B6IA 3NLLA 1U0SY 1YR2A 1QWSA 1U8XX 2G6BA 3OU7A 1IEWA 4JC8A 4L0CA 5FOUA 4CFSA 1MTOA 2C8LA 4GYWA 5JSHA 2B78A 2DH5A 3R8FA 1DQYA 3PHJA 3SDBA 4NICA 4M38A 1SKQA 1T0UA 1Z7EA 2HJWA 2J59A 2V45A 3L6EA 2EERA 3AVTA 3SN6A 2N47A 2R8RA 1TZBA 2X7HA 2O6LA 3BMXA 4MV8A 4R8LA 1ADYA 4RE6A 4CHTA 1VL0A 5KU1A 4FOTA 4KPEC 2Z8YM 4FHEA 4PFKA 4REMA 1IUPA 1VLJA 2AV6A 4GPIB 4KIUA 4MWSA 2CUTA 1QPGA 2XNDA 2AB0A 4X9XA 1US8A 2GZDA 3TL6A 1N32B 2IHYA 3M1AA 3MBKA 2RK6A 1PWZA 1R4MA 3A4NA 4W5JA 4PHHA 3I4LA 4OIMA 4YLGA 4XXHA 4GMFA 4BEJA 2OLJA 3WJ1A 3KZCA 3WFJA 3CTPA 5IUKC 1G20A 9LDBA 4JH0A 3GMTA 3ZN2A 2HREA 4GIBA 2WU0A 4CV2A 7ABPA 3RSSA 3NHYA 2IP1A 2ONYA 2VCHA 3W5VA 5TV2A 3QOXA 3L5KA 5DT2A 3DTTA 1VSQA 3WNDA 3THRA 2HFKA 4KODA 2R84A 4TQ9A 1VMAA 4HKTA 1E2QA 2RJNA 4ETIA 4CF7A 4LJRA 4M0EA 4DGSA 5IPFA 1ZR2A 3BFKA 4C5BA 3EZ2A 5KYUA 3QUQA 1KPHA 4LJLA 4NE7A 2ICAA 5LQAA 4OM8A 4RKFA 1AC5A 4HDMA 4YVFA 1MJGA 3IEMA 3S3TA 2Q4TA 4AUKA 4EG7A 3PUZA 4UUBA 3UMSA 3BXEA 3WL5A 1R0ZA 5EPOA 1FFDA 5FOXA 3U4QA 2XCIA 1E7RA 2WA2A 4OQXA 4ILEA 1Z13A 3MW8A 1ZN7A 2J67A 1IRXA 1RP1A 1JILA 1DSSG 4Z49A 2ZRDA 2C2ZA 4F6LA 2BD0A 2BKAA 5L7YA 1UAYA 4U8HA 3ZTYA 3OE1A 4RA9A 2HA2A 5FWXB 1CZRA 4J3FA 2HY7A 2X4GA 1SFRA 2Q9CA 3EEFA 1GAJA 1DX6A 2B82A 2YJ4A 3PEVA 5P8WA 5U1PA 2DJIA 4D4IA 2IYUA 1TX4B 1TO1E 1TU4A 2EU8A 4EUFA 4MQFA 1O7JA 4RDXA 3UJBA 4BO9A 4H7EA 4ASUA 4QATA 3PYMA 3CF6R 3GB9A 5JHHB 3ZIAD 4RA6B 3K6JA 3DJFA 5ADWA 2E1RA 1LD3A 2ERCA 1P5RA 4EW1A 4MXDA 2QQEA 3RIMA 5EJEA 3VOBA 5IEBA 3HKEA 3MINB 1NLZA 2IYAA 2YN2A 3BQMB 3DEHA 4LDRA 1SUIA 3R0QA 3QHPA 1RXWA 4EF5A 1WRBA 1GPAA 2WG2A 5BYBA 2D2VA 1L4MA 1E5TA 1BW9A 2E4WA 2FMHA 4JJEA 4K26A 4RL4A 3UAXA 4NZPA 3SWWA 1HDIA 5AT1A 2PX5A 2YMMA 2VDRB 1NW7A 4ID3A 3I2YX 3B1YA 4B3XA 3T3IA 2GRAA 2JFPA 3D5TA 2HJRA 2Q2WA 4LZLA 3HJUA 1BH6A 5I7VA 4BC1A 5HW0A 2PR7A 2HIMA 2ZM6B 5KKAA 4JWKA 3ASYA 1CKEA 4F9TA 4KVAA 4L4RA 4Z5XA 2Q4BA 4EECA 1EGMB 1ORRA 4D81A 3AMVA 4UHCA 4DIKA 3V2IA 4ZHSA 5CXUA 5KNBH 1JQDA 4QLOA 1CEQA 1GTVA 1RYYA 1SURA 3OIGA 5KPJA 2ZRHA 3PGKA 2FWJA 1LGYA 4IMIB 3WWYA 4PZPA 4WDQA 4AF8A 1K7YA 2IZ0A 4MW7A 3ETEA 2SBTA 3LRXA 5SZJA 3UWKA 2VKTA 2QJRA 2JS7A 2E48A 3MT0A 4R2MA 1FXUA 1U0NA 2OYCA 4CCAA 5JD5A 3ZU2A 2PUEA 1LI7A 3Q7EA 5F23A 1FMLA 5K3DA 3DGEC 1CF2O 1FQOA 3JYLA 3D3KA 3DPIA 3UWOA 3BXZA 3HCOA 1Q2XA 4S24A 1DBPA 2JFUA 3O4VA 4WNCA 3WBKA 3G7NA 3WB1A 4B48A 2R6CA 1RC0A 2AN3A 1KAEA 4QBGB 4RZ3A 4MW2A 1V5FA 2EF0A 4S1WA 1KJNA 2RD2A 1JAYA 3A36A 3DO6A 3H2HA 4WKOA 4XGRA 5F7XA 2Q9AA 2ZE7A 3EZXA 1LQTA 4ES6A 4O3FA 1E1RD 3K0SA 2ZJFA 4MRSA 4YO7A 1E3MA 5J23A 3KKPA 3IXMA 3LU1A 3ZCPA 4F21A 2GQ0A 4O0MA 5AKXA 3RRXA 3OLXA 3PEWA 1Y98A 3RCBA 4EQZA 3RABA 4MI3A 3LHKA 4DLXA 5CB8A 4A82A 4ENQA 1K7XB 3OOSA 3OJLA 4YEDA 3EVAA 5CXSA 5CFZA 5TE9A 4LBVA 3WLKX 1NI4B 1JA1A 1IAVA 2PKXA 3DE1X 3DT9A 5JAMA 3WX0A 1HQDA 3FDIA 1GZ7A 4KQMA 2VAXA 5AHKA 1G55A 4Q6BA 2JNWA 4XWAA 1ZOIA 1BCSB 2G63A 4PNPA 1ZGAA 3UFXB 2E4VA 4LY3A 3PEFA 2PVSA 3GLSA 2GJSA 1MB3A 4KN9S 4Q3BA 3HHPA 4S0XA 4A0HA 2BFAA 2OBBA 2P1DA 3GA7A 2F48A 4YECA 4D4HA 2NU9B 2SICE 3K09A 2A0WA 1P1IA 3K9NA 3OI7A 4MI6A 2MINA 4H6WA 4TMWA 4AUMA 2NO9A 2G1KA 2JI6A 4DCNA 1AUXA 1VLMA 4OHZA 2ODBA 2QTVA 3RRBA 1L7RA 4H7IA 3ZS9A 4G85A 2XZPA 4J8PA 1EFPA 3GPCA 3LPNA 3E9NA 5AVYA 3Q98A 2HW8A 4G56A 4HYQA 4BEWA 3IMKA 4FDTA 2PYIA 4HADA 1YS2X 3N3BC 3QI7A 5H83A 2ZJ0A 3IVAA 4A6XA 3PX7A 1AXGA 4B1FA 4LZAA 2JFZA 2BHTA 2E6KA 5CK5A 2LR0A 4ZZIA 4HDKB 4JROA 2XTAA 3EEIA 1WIWA 3HYSA 3OEYA 4QNMA 1L4KA 2Y0EA 5BNFA 3VV2A 1SXJD 2V58A 2JRCA 3FHJA 1UK8A 2VFAA 3EHDA 2YWHA 1YFKA 3SXUA 2X0RA 4FU0A 1RCUA 1BYUA 1SVKA 3L0OA 4I4IA 4IO0A 5FP0A 5A0FA 4LMAA 5K51A 1V6CA 3MCUA 5GWXA 3HCPA 5KYKA 2L17A 1LH0A 1UR5A 2YY5A 3D7KA 2HJ9A 4WK0B 3GH3A 4YASA 5KAMA 4LJKA 3VR3A 3ZWDA 1EQAA 2YMLA 4Y0NA 1X9HA 2W8BA 3STHA 3IILA 4JYPA 4KAAA 5G0WA 4PRLA 5KNCH 3V80A 2VJAA 1MXHA 3DC2A 1Z28A 4G36A 3ICOA 3WP0A 1VOTA 1F60A 3HKCA 4K8RB 4YQEA 4UZSA 2I76A 4CFZA 5IFKA 5IVDA 1KVTA 2ISCA 3B8EA 3DMTC 4DRZA 3TUZC 2XMGA 2GZRA 5AKZA 3HVIA 1EIWA 4M8NE 5ALZA 1E99A 4NE2A 1KJYA 3N2NA 4WBSA 4ZMSA 3FYUA 2WR8A 1XEWY 2Q0HA 3HDVA 3QPUA 1E6MA 2RMKA 3R76A 1U3CA 5B3JC 3GFOA 1WL8A 5DP1A 2CK3D 2O7QA 5J2TA 2WQ6A 2ZWPA 4IJMA 1H42A 1GYQA 3BS4A 1KH1A 3HXKA 3B7GA 4LJ5A 3QSYA 4DM3A 1USWA 3PRKE 3I1FA 4QDKA 2D5LA 1Z5ZA 4BC0A 4A16A 5B36A 1G2QA 3BB1A 1OPXA 4Q9NA 2C3UA 3R4CA 1JNYA 3WKCA 2AI3A 4Q00A 4B8YA 3ESDA 3SDZA 1X7YA 3TM5A 4OHYA 1FS5A 1I7LA 3B48A 3QY9A 5KOJB 3RVBA 3LLSA 1L7PA 4QDTA 2NXJA 1HWYA 1QOPB 1DIOB 3LAWA 1R9MA 1W75A 4RE5A 2Q1YA 4OP1A 4Z9AA 4QXRA 3VI4B 1ZXXA 2G40A 1IRIA 2JEZA 4QQFA 3Q5DA 5D3QA 4QEZA 1VJ5A 3FPAA 1G3QA 3RSHA 2O52A 3SE7A 3HO1A 3GLGE 4YV7A 1ZN2A 4PSKA 2VJMB 4YMIA 1IBCA 3Q8LA 2V4MA 3PICA 3M3HA 5HDQA 1TGVA 2X9LA 3N0RA 3LUFA 1OV6A 3S2FA 1BGXT 1F0YA 4B4VA 1GG5A 1O6GA 3MG9A 4BMVA 1UJ6A 1MRNA 1VCMA 1PVVA 2QAIA 2XIQA 2BFBA 4QOIA 3RT7A 4ARAA 4BJ1A 1W1IA 1JHUA 3ETCA 1QH8B 4EHHA 4YROA 1JDZA 1R7RA 1YHYA 4MUYA 3DOCA 4CMJA 2G9VA 2FH5B 2IQIA 1UDWA 5C5IA 1TF2A 4MRPA 3N2GB 2ODEA 2BGIA 3AHJA 3W77A 5GY7A 3PFBA 1QFJA 2VH2A 4KSCA 1YFZA 5D01A 2D7DA 2Q4RA 1JIXA 2VCEA 3BWYA 1CRPA 1FZQA 2RBEA 4RGYA 2PG3A 4LJ7A 1WM1A 3PNLA 1IOZA 3TTVA 3W6PA 2C83A 1DOHA 2ZI7A 4D9KA 5B57C 2B36A 3IIJA 4FM9A 1SH7A 3BEDA 2EDAA 1ZWKA 5JFTA 1TM1E 1V1RB 1XCOA 3W6UA 4FDLA 4HG2A 5G3ZA 1NUTA 1OLXA 3BTVA 5DWQA 1U4NA 4HAUA 3T7RA 1NV9A 1UMCB 5E2BA 4YMTA 3DTVD 4C2BA 5HR5A 1DARA 1UJCA 2KLBA 3CM0A 4KE6A 4AZWA 2IHJA 1UZUA 5CM2Z 2QTNA 3M8KA 3JVUA 1EFRD 1B16A 2GYVA 1OTYA 3A9CA 4X1KA 2PX3A 5EEGA 3AF6A 5CAEA 2WPDA 2HU5A 1T24A 1BXRA 1WV1A 2WYOA 3B1FA 2O2JA 3PR2B 1TT5A 3H9UA 2XJ4A 3LW8A 2B94A 3PTZA 4HWGA 4L5JA 3RIHA 3UPDA 4CDGA 5K3BA 4BZQA 4OFBA 3LWDA 2H7CA 1VB3A 1QYDA 4IR7A 4CETA 4JI2B 3EZFA 3WIUA 1I1QB 1FXSA 1I1NA 1QZZA 4JKIA 1D2AA 2QL7A 4LI0A 4NBRA 3SS8A 1A4UA 3UAZA 4F04A 3P9NA 5FBZA 2INGX 4H4EA 3ZVMA 4LSZA 1ST2A 2JASA 1XK7A 2DKOA 2PTGA 4FFOA 2FW7A 5F1OA 4DT1B 3ZDDA 2FEAA 4PSCA 4INPA 4Q93A 2R97A 4AJEA 2IS6A 2CHGA 2K87A 2VQ3A 1FYFA 4LCBA 4Q3CA 4Y6RA 2RGNA 5K1ZA 3UJ3X 5AVVA 4LF9B 2GB4A 3PUXA 2W2NA 2VA9A 3IDOA 3T5CA 1AQJA 1P31A 1D2EA 4D6PA 5IJWA 1DTWA 2CDNA 1DAOA 4URWR 2DERA 4WVLA 1P2GA 2UYQA 4U6SA 2FWRA 3ZVRA 1QHHB 2OLKA 1XZIA 1OFGA 4E4YA 3IE1A 4LMRA 4YRCA 3PCRB 8ABPA 5HOEA 3O0TA 1A1VA 4R31A 1WHTA 5TF0A 1JBQA 2O2XA 2XLBA 1KP2A 3EIQA 1ZP6A 2ECOA 2GLUA 3DXXA 3HJNA 4LE1A 4XM1A 3VZCA 4D79A 2V3CC 4EKNB 2QUKA 3KJHA 2YVAA 2IPOA 5JSZB 4Q37A 4QT4A 4EUSA 4UCWA 1PQYA 2I33A 3MTAA 4DRXB 5DVZA 1VE6A 2HMTA 1WXEA 3G9ZA 3OJOA 1U5BB 3BGDA 1JHOA 3N9IA 2G5TA 2VWHA 3PPVA 1QKJA 1SG9A 4RACA 4BVKA 5J47A 2VNHA 1R66A 4ZK6A 2IGTA 3H2ZA 3E22B 1FMFA 1JDSA 1NC3A 1N1MA 1V0JA 2FKAA 1SBTA 2JLRA 4EZIA 1J97A 3T41A 4C0JA 4EPVA 1ZL0A 4FHCA 1IM2A 3LGAA 5CDTA 3DONA 1ZH2A 1MRSA 5D51S 3O8BA 4XDHA 5HSGA 1DCTA 4X1IB 2OKGA 3JQBC 2OXIA 2B4QA 1SQ6A 4TV9B 4LJ8A 2ODAA 3BHIA 5JMWA 1PNOA 5AHWA 5BY2A 1U2GC 4B3SB 2ZFUA 1RR6A 1R8SA 2XDWA 2GXAA 4E32A 2AZMA 3FMGA 4UEWA 3I6BA 1K1EA 2FMIA 2ZKIA 4CUZA 1HFJA 1WDTA 1FTYA 3S28A 1IN4A 2C2KA 1XTZA 3KB6A 2BBSA 3AVWA 1G8HA 4JJAA 2QP9X 1L7QA 3ER9A 3BC1A 3ND9A 5CLIA 2GYWA 2WM8A 3G2PA 5BQFA 3MJVA 4R69A 4W7IA 1Y8QB 3OP4A 3IPLA 3JATA 4KXVA 2GAAA 1YZ3A 2V8BA 3DLCA 1TVEA 5CG2A 5LUAA 1IONA 2XIJA 1IN6A 1ZJZA 3P8ZA 5D8DA 5L4SA 3R24A 3G2IA 4ZT6A 5JDCC 3RAFC 4CU2A 1T9KA 2I4NA 3EGDA 3A4VA 4XD7A 1V16B 4NDAA 1NVKA 3PK0A 1Z2OX 1VBKA 4H60A 4EKDA 1KK0A 4LRQA 5AW0A 5HIMA 3H97A 4JP2A 2FOLA 2NAPA 5F98A 1ZIYA 1PX0A 1QIMA 3R7DA 4BLWA 2JLCA 2IH5A 2C5LA 4Q7MB 5BW6B 4RIGA 2PBZA 5E1OA 1DXOA 1JDVA 2W9XA 3PRYA 2ZRNA 1E0JA 1FS4A 2QSJA 3AEUA 2X8BA 4V0ME 4TM7A 4JQOA 3UH0A 4A6EA 4AZ0B 4UUPA 1GLNA 1ZESA 5EJMA 1C0KA 1JG2A 2GZ2A 4UDNA 5AOVA 1F4PA 3GEBA 1KVRA 3X1YA 4WSOA 3L1UA 3FVRA 1H23A 1WVMA 2ORWA 1YFLA 2FP3A 4JOQA 4LSWA 4PG5A 4RHXA 2P68A 4OB7A 1FFXB 4ZEOA 1X9GA 2FPIB 3WOVA 3LUBA 5CVEA 4D7AA 4TQGA 3BJRA 1IPFA 3WYFA 1WCXA 4LXTA 3NHKA 3HKDA 2VP5A 1A4IA 2FPUA 4B4UA 3F7OA 4F92B 3M5CA 3PDCA 4ON9A 3OU6A 1EQ2A 4CKBA 4AK9A 1XL0A 2CXXA 4W8OA 5JISA 1AK1A 3HVHA 4MCJA 2ZBFA 2CXUA 1EK6A 3D7NA 1GGJA 2CGEA 5ALRA 2OE2A 3GDWA 4OXXA 3O8RA 1XEWX 3BD9A 2XQJA 3RIGA 5TGDA 5LYYA 4DMCA 3OMXA 4XSGA 5BR4A 2DT5A 4LA4A 1ISRA 4REQB 3U3RA 1NMSA 5HF5A 1MJGM 2X1LA 1PFKA 2ZJAA 5EXXA 4ZWNA 5JCJA 1GTZA 3BJIC 4JIGA 4J3JA 3J7TA 4KLRA 3CF2A 2XMBA 3ZH2A 4GPAA 4KYIB 4DLBA 2NP6A 4IDEA 1EWRA 1MG5A 1RQ2A 3RS9A 4X62B 4HNAB 1ZM3A 2BUAA 4WW0A 3MERA 1BXGB 1BEEA 1HF3A 1VKOA 2CZGA 4MS3B 3SLGA 3TR6A 2EEPA 1A7UA 2JAHA 1VIVA 2KX7A 2RFLA 4EY8A 5KOHB 4BVJA 2YHIB 1K66A 4FD2A 3DWIA 4GPEA 1OZ0A 4M87A 3IQXA 2RGRA 4ZVLA 4BLSA 4GM0A 3V00A 3KKNA 2ASVA 1BGVA 3OQBA 3M9XA 3Q7PA 4ZDWA 5I5EA 3F7NA 1QX3A 2ZB7A 5F5LA 1RPZA 2VJCA 3TQOA 3QH4A 1ZX1A 3AIIA 3OHMA 5H59A 2IGBA 3WO1A 4BRZA 1IWBB 5F7OA 1T0PA 4Z4CA 1FTSA 4CMGA 5JQGB 1O87A 1IXYA 3TSAA 3SIPA 1LKZA 1REQB 5L3QB 3KQVA 5NLLA 3GT3A 2Q1XA 2J3EA 1K7CA 1U2SA 3L07A 3QZUA 2HL6A 4IXWA 5LMUB 4I6JA 2J9FB 3ZHQA 3CKYA 3H9QA 3R40A 4DIFA 3ONEA 2H4WA 4RVUA 4MWBA 1GGHA 1WULS 4UUQA 3O8CA 2XWJI 3PI7A 2B0CA 3RG8A 3L01A 4NHOA 3ECCA 3TMAA 2FF5A 3CUKA 4NJEA 2A58A 1QSGA 4PYQA 3KPVA 1B73A 1D0IA 3SY8A 2FXVA 5E2AA 3TZKA 1FDSA 2DGDA 3ZJYA 3IPYA 3EPKA 4DUYB 1PBTA 4UNRA 1L4YA 3LT2A 2IHBA 2BY4A 3BF8A 3PB3A 4F4DA 2J4CA 1XTVA 2JH3A 2C2YA 3BRQA 3DE5X 4GI2A 1KSFX 3OEED 4EHBA 3TSOA 4ZQCB 3HR4A 4JUDX 2E85A 3V1UA 1T13A 2VBGA 1EJBA 4BFZA 2WWWA 1CUBA 2ABWA 2IW3A 3ZHTA 3EF0A 1VPEA 3D59A 1YF3A 4JXKA 3V7FA 3Q8KA 1YZVA 2ZBQA 3GBVA 3OETA 3W5SA 4BMSA 4H0FA 1T5HX 4L6CA 5CFLA 3V1LA 5A5GA 1YRAA 2M98A 2TMYA 3EMVA 3NDRA 1VKRA 5A4DA 4P3PA 1ZUNA 3RBAA 3H7IA 2HU7A 3Q8XB 2QTWB 2IY9A 2Q5IA 2L42A 3G8YA 2BFDA 4BWGA 3QXSA 2B30A 4RX1A 3H1EA 3LDAA 1OAKA 3PIIA 4Y9TA 3W2TA 2YIJA 3AI1A 1DADA 1J9GA 3Q85A 4V24A 2BGWA 1E69A 3C3KA 1Q3KA 4DG8A 1G8YA 1KERA 2CW5A 2OEPA 1SBIA 3WMXA 3DE7X 5JS2A 1N6NA 2DZDA 2IUYA 3PHIA 4Y9RA 1ZPDA 4DCOA 1NQ5A 4Y1FA 4PINA 3HKBB 3ZZMA 2B4YA 4MVXA 4X54A 4TUYA 5BQXA 1NLMA 3HU1A 3ZZUA 4DMRA 2YWBA 3W9UA 5ICMA 4KH0A 1RFLA 3KKLA 5A5EA 2QSUA 3HYNA 1JDUA 1U0GA 3IUBA 4F93B 3FHTA 2GF9A 4ZALA 1E6UA 1KY4A 4C01A 3E9QA 5H3LA 1GV1A 3OCVA 3U0BA 3ACDA 1Z2EA 2FB9A 3ZK8A 1ODTC 2A6PA 3C7KA 2PMWB 4N6NA 4L2IB 3F6BX 5AW8A 3IUPA 3W1VA 4X45A 2AK3A 4WEOA 1AGNA 1UBNA 5EQTA 1BDMA 3ADKA 3AF1A 1O97D 1OI3A 3HWX1 4IJUA 4JZYA 4DSZA 2X0IA 1B14A 1B2LA 4YIKA 5DXFA 2K4MA 2O7RA 3I76A 4UTVA 1NQVA 1PZEA 3QJYA 4G0MA 1VDMA 4HQNA 4KSYA 4UBIA 5FUBA 3PPYA 4Q24A 4E5DA 2G7ZA 3D54D 3MTJA 4RMIA 1G5QA 3A7EA 4KXWA 3ZDQA 4AZSA 5EJ8A 3PHBE 2A86A 2ORIA 1Y4AE 2GN0A 2Q1TA 4PN7A 3W78A 5KQLA 5COBA 3KSBC 4R01A 4MYSA 2B34A 3O5AA 1XTQA 4M3NA 2F3UA 3VNRA 4B3IA 4FS8A 1O9GA 5JCOA 3R3XA 1PR4A 2YUIA 3A6DA 3BRCA 3OSUA 1X3LA 3O3MB 1C0LA 3PQ2A 3TW8A 4AL4A 3TG2A 4OMCA 4DY4A 1TE2A 5JXJA 4N0MA 5AKGA 2FEWB 3EQ8A 3NJ8A 1U0RA 3GLKA 3K32A 4BO7A 4J2TA 1Z6GA 1KPIA 4AJJA 4PYRA 4GZMA 4LE2A 1J8VA 2H3HA 1VE7A 2VSQA 1PT7A 3BVPA 3MGGA 5KX5A 3GV0A 3KXLA 2HQBA 2W0MA 5K5EA 2JL1A 3WDSA 1D1QA 1KFKB 1UPCA 2C95A 2GEVA 4XUGB 4YMHA 1EYZA 4RD1A 3UWPA 1H2FA 3FXAA 2J0UB 5T8KA 5LZ5A 5B3LA 3GP8A 5KTYA 5JU6A 1CUAA 4A36A 4GSKA 3EEYA 3P27A 1VSBA 3OQOA 1NDUA 4N3CA 5LLDA 3VYUB 1PV4A 3DDUA 5K0EA 1XRJA 5E95A 3SBEA 1SIUA 3UK2A 1O6FA 3KOWA 3FPBA 5G4KA 2NVUA 3RC3A 1JMKC 2JI7A 3EUFA 1A82A 2BFFA 3IKMB 1RQGA 1VYHA 3G23A 4JLSA 4ZICA 1C5KA 2XA2A 3WC4A 4YONB 2JHCA 4QFMA 1YOVB 2FFJA 2VI5A 5CIYA 4FHZA 2VJOA 1JNXX 1JR3D 2MOKA 2OZKA 4LHVA 1WHSA 4FDUA 3ZVKA 1SBCA 1T2VA 3ITNA 3KLOA 5SZHB 3GDFA 4NU8X 1W0JD 1XMXA 2FEPA 3TH5A 3IX7A 3AX6A 4ZO7A 2CJWB 3C87A 1GUAA 4P80A 1XCGB 3P94A 1CQXA 5FTWA 4MV4A 4ZVPA 1AGPA 1LPSA 5I7SA 2OGZA 2QD3A 4MR8B 4EI7A 5CA1A 2GEUA 3LBAA 2JW5A 3GCWA 3LFHA 4RSHA 3GMSA 4KQCA 1QCCA 1DJQA 3ANNA 5LP6C 1QFYA 4G1FA 3EUAA 4HQKA 3UMMA 2AOUA 3NV9A 3R5HA 1RQXA 4A26A 4X65B 3T99A 2YYYA 3SJ7A 4ND8B 3L43A 4DJTA 2P2CA 2QVXX 2GBCA 3LQ4A 2XYQA 1XKQA 1BD3A 1ABFA 4U2EA 2JIOA 1BMFA 2YXLA 3RRFA 3F71A 4XR9A 5BVHA 1Y9EA 1JLHA 2H7VA 1F2TB 3K4QA 4IOKA 5JNLA 1JEDA 1NM5A 1C1HA 3QWAA 5EMNA 3VHLB 1UKVY 5EIEA 2OMEA 1NKVA 3I9OA 4WOKA 3S55A 1BFKA 4NH4A 4MHSA 1WB9A 1ZMXA 5CPBA 1P9LA 2RKOA 1KP3A 1DUIA 1YQUA 3CGGA 1TM7E 4FUQA 5AVKA 1KH3A 1M34E 2ZT5A 1DO2A 2OM6A 3DE6X 3TPZA 3NDBB 2WQ7A 4L3VA 3ZI0A 4XGKA 1TQ4A 1GLGA 1QF7A 2QE6A 1IJFA 2YV5A 4JVMA 5EQFA 4RNDB 4PYNA 2Q9BA 5CLLA 2C4VA 2SKCA 1NBIA 1P2VA 5A2QA 4HWSA 4WMLA 4PZYA 4QTZA 5CA0F 3UATA 5L3SA 2UZ1A 1PJ8A 3GLFA 4L51A 2OZPA 5TPZA 4F60A 4MRVA 3IAEA 5HFJA 1F1BA 1OR8A 4G4SP 3G8CA 1QRSA 3FTPA 1GFZA 4TS1A 3GT7A 1C50A 1XF1A 4I55F 4OI4A 2BELA 4P33A 4B3CA 3DE4X 1EDDA 1EHCA 4FBGA 2QN2A 4WKBA 5K0BA 1JECA 3WQSB 4DR3B 2I4MA 3LH5A 1Q12A 3W5HA 4KMOA 1IWOA 5EPUA 4LJ4A 4YN3A 3TJZA 3MPOA 1II0A 1N7JA 2IU3A 2HCRA 2IOQA 1EK1A 4RV9A 5GTDA 4D4MA 4J0FA 1IAQA 1QO0D 1P4HA 1WMFA 3JU3A 1A7KA 3T1HB 1EPUA 3CNOA 1LJ8A 1CNFA 1PCXA 3M6XA 3N58A 3NG1A 4HQLA 5F2EA 2D06A 3WB0A 1XELA 4DVJA 2PQ6A 4AWAA 4AUEA 1JVBA 4DCTA 4F91B 2QVGA 4O4LF 1LXCA 4ZA2A 5JBNA 3ZV4A 3LVRE 4EGAA 3B13B 5IAOA 1PJ2A 2DU8A 4DA7A 4KTTE 4C3UA 1EUCA 1VYVA 5LXTB 2FW1A 3RU3A 1JEQB 1AG9A 1T6ZA 2HRRA 1Z06A 3DOHA 3IQEA 1NNUA 4Y2PA 1V26A 3INNA 3WI7A 1MB4A 4P7JA 4PAWA 4BCCA 4U6QA 3TE7A 2OYRA 1GZ3A 4IGKA 4ZMRA 3ORFA 1WE2A 3EDOA 3P20A 2F3TA 3DLPX 2VJDA 1Q1GA 2QM3A 1LTKA 1S4MA 2W4MA 3EA4A 3IBCA 3TVTA 1PUIA 3OHSX 4MROA 1KKLA 4G1CA 1F2VA 2VKQA 4EJSA 4ZFNA 2O54A 2JHGA 2AOTA 4HUQB 4CMEA 1IMJA 4YMWA 3QMMA 1AHIA 3OPNA 1TMGE 2R6FA 1GL9B 1M7HA 3MOIA 2Z6QA 1WTCA 3K5WA 1JIKA 1FP4B 1WCIA 1WS6A 3LNTA 2H4XA 2D4AA 3WGKA 1SHTX 3C97A 1PGQA 2G9NA 2VQFB 4F9FA 4IINA 1JFFB 4K2AA 1BA3A 4XLTA 4DLSA 5DI3A 4E0BA 1E1DA 1G19A 5DM2A 1YV9A 2UDPA 2AMLA 1I33A 2P4SA 2V7EA 2VUHB 4H2DA 4TYMA 5E9AA 5C34B 3NNNA 1RWVA 4NP6A 1YB4A 2I6SA 2P65A 4FZVA 2Q3JA 3T5BA 3KEOA 5F3DA 2VR1A 5J4VA 2DECA 4KRYA 2I8CA 4CLDA 3QXCA 3JVIA 3L7CA 1IBLB 2A5YB 2PUAA 2V7PA 4LV6A 4TRMA 5EE5B 3UO8B 1SB8A 3QF4B 2G0NA 2JDIA 3QXHA 3RB8A 2WABA 4L6IA 2HHJA 2PGJA 5TMBA 1JAXA 1PFGA 1WDWB 2ET6A 1NZFA 1QVRA 3NXSA 3OJ0A 3JPYA 5LYJA 2AG1A 4GPZA 4W7HA 3BWXA 3I3SR 4L4XA 4PQRA 3WMRA 2TMKA 2W6JD 1MHTA 4PHTA 4A6PA 4NCHA 3W79A 3T0FA 1Q0SA 3PF8A 1PVOA 2RHHA 3CURA 2QT9A 3K3PA 3IQDB 3GVIA 1FFBA 4Z7NB 4F11A 2SKDA 3VC7A 3PUHA 4MUIA 3K9LA 5DSXA 5GJCA 3FTEA 1EMDA 2O8EA 3SQNA 3IVRA 3KYDB 3OWXA 3G89A 4R1NA 1QC5A 2XW6A 3E7WA 2YS7A 5CU7A 1RZUA 2NUAA 3A3OA 3O1IC 5DTJA 1HR0B 3LL4A 4NZOA 4PY2A 1QHNA 3G82C 3INGA 1TZ2A 4EGFA 3C6KA 3F3MA 3FPLA 1H2EA 1ZOOA 1VGQA 3N28A 5ARCA 2G76A 1Z08A 2GD6A 2LDXA 2Y1CA 4MP8A 4CUJA 2C7PA 4RHUA 3AESB 3MTDA 2FZVA 1A8SA 4TLLB 2V59A 3T9BA 4BNTA 1P2FA 4N40A 4BASA 4YHHB 2Q2NA 2Z58A 4H77A 5ELXA 2ATCA 2NSDA 3C3YA 5JY1A 1RKQA 1TZJA 1OPRA 1D9ZA 2Q8QA 2RI0A 3VH2A 2CFCA 1FDOA 1COWA 4Q05A 2YFHA 5KWJA 1T35A 3ILSA 4OYHA 4AF6A 1W29A 1YAHA 2ZBPA 2OCPA 4K81B 2NPIA 2XKJE 2HJGA 2IYPA 3EDYA 1B26A 1XV5A 2HN9A 4FBMA 3WDKA 2J46A 1WVIA 1NOIA 1Y3AA 2R5NA 4U6NA 5CX4A 3EGEA 3E2IA 4DDKA 3W5BA 4C3OB 4LGYA 3L0BA 4LJ9A 1CK4A 1K75A 2Q99A 3CC8A 3CZPA 4OX9B 1HFEL 2AE2A 1K86A 1R4NB 2G09A 2W2XA 4ALMA 2YVLA 2PU7A 3GROA 3N2KB 2GCGA 1H5UA 2QW8A 3KB8A 4JUBA 2OXTA 2E1PA 4HRAA 2WMOB 4M22A 4FFPA 3I58A 3U5ZB 3QKSA 1IOLA 4GUAA 4KYVA 2V1UA 4A7PA 3AV0B 2FP4B 2GKSA 4LC0A 1DCFA 4QFDA 1X1RA 5G2OA 2QP4A 3W8FA 3VU0A 4EF6A 2Q7DA 2J9XB 5BSEA 1UXOA 3VZSA 1JDBC 3UG6A 2EL7A 4AP6A 4UAJA 4WIAA 1S2OA 2DCMA 1DWOA 3N39C 3K5IA 4CM9D 1SO8A 4BLPA 2I2WA 1Z07A 1Y80A 4G6ZA 1II9A 4QYWA 2XF2A 2R62A 4J94A 1KAGA 3E1SA 1HMPA 4KCGA 5AJXA 1YE3A 2JGLA 3FMOB 4MUJA 4S1OA 5BQOA 4URVR 1YVDA 2D2FA 1EVJA 3LZ6A 1LFAA 5A4FS 4E3WA 3BMNB 3GDOA 4JR0A 3BXPA 4XIIA 1WUTA 2PFKA 4LHZA 3PXEA 4Y2UA 3UCXA 1M2NA 4RQAA 3RYFB 3N2EA 4ZKDA 4CM4A 2XE6A 3KG2A 3DVLA 2KLHA 3LOUA 4G1BA 2JKYA 5CYFA 2XYPA 4PPQA 3A2KA 3M5PA 4XPIA 4Y67A 4HFMA 2JFHA 2NU7A 2BFNA 1PRYA 2I7TA 2Y93A 3FHCB 4GZ5A 2OGUA 1BVUA 4PE5B 2FR8C 5DHPA 4KOEC 4LZNA 5JPCA 3WBJA 4WOPA 2WUWE 3BE5A 2C98A 4RH3A 4FQ8A 4GT1A 4XYGA 3B9RA 4FOSA 5SY4A 4EY5A 5GJVC 4O5OA 4F4UA 3QUBA 1P5ZB 3RYCB 1WQ4A 2I8AA 4RK6A 1ORHA 4FFBB 4F6RA 4B87A 1E62A 4O4JA 4G4SO 3Q11A 5E6UA 5CB4F 1B8OA 1T1GA 2I1VB 2WT9A 1H1DA 1TPYA 4DB2A 1JR2A 2C4NA 2AUTA 5L3ZA 4DDHA 2W6NA 1M1ZA 1DMRA 2XMSA 1U2DC 1O94C 1A9TA 3ID6C 5EYPA 4L76A 5AKEA 1DG3A 1EFCA 4CMAA 1UZNA 2GN9A 5KWVA 3MTGA 1OROA 4QNRA 2JF0A 2REOA 4RKEA 1QTIA 3BAZA 5HQ3A 5PNTA 2Q3BA 3EYAA 2VTVA 1ZRSA 3G0OA 3VKGA 1H8HD 1JJFA 5JYBA 3RC9A 2P0EA 3IERA 5ESRA 4ZARA 1B3BA 1JL3A 1NJ2A 2HTEA 4N3GA 821PA 3ZGZA 4UPEA 4MR7B 3JW8A 3OPXA 1G2PA 1I4WA 4X3CA 3UB4A 3NFRA 4RHFA 5J59A 4CGZA 4X3OA 3X1ZA 2F7SA 4FEYA 5FLEX 3UK0A 3IRVA 2YHAA 1Y42X 3L1JA 3N0WA 2HT1A 1VJGA 3ESZA 1L4EA 1E1CA 1E0AA 2R9VA 3A06A 4C0SA 5MGBA 2H9AA 3C3JA 2J5XA 4YRPA 3HG7A 4EG4A 1F9EA 3PTAA 2JFYA 3RR2A 4L8GA 3U6BA 4N54A 4Q02A 3VTAA 3D3EA 1NYRA 2RGWA 3HEBA 3DR3A 1G8MA 3L0PA 2XNKA 3AOGA 2PJDA 5B37A 4C0LA 4XYLA 4U2CA 1V7QA 5FBVB 4RZ2A 1PL6A 1LB1B 4PLZA 2G9ZA 1GTL1 3VSDA 1XDDA 3O8DA 5IAEA 5A7FA 1QQBA 3S2GA 3ZNQA 4HQRA 3UAYA 4E7OA 5E9JA 1E9AA 1RAAA 1VMKA 3D7SA 4XQGA 4QGBA 4XWGA 4C7BA 3UCFA 1DDIA 1LWOA 2IH2A 5AJTA 3H8SA 2NACA 3PCXA 2R6HA 4XQCA 5JY6A 4FPXA 1DEAA 1KC1A 4LJYA 4WN9B 3F6YA 5A1TA 3WLHA 3FX2A 3HNPA 4Z1MA 3U80A 3W90A 1V9SA 2JBHA 2Y2VA 3KU4A 3PFHA 5FNZA 1MQAA 4PV7A 4D74A 3URKA 2P2YA 3W9YA 4YCNA 5I7HA 5E4TA 4KQIA 2HHLA 2XCLA 1MAAA 4XTCS 3FUTA 3PGLA 5JWHA 4MVJI 1VHWA 1CR4A 3AKEA 4CQMD 2W7TA 3PQ7A 4Q7LA 5AJVB 3TRIA 3CPJB 5FLXA 1J0AA 4P3KA 1FDRA 4F12A 5IP5A 1BRMA 2AWNA 1XYGA 2WTEA 4LXQA 3FGZA 3GOQA 2VDKB 3FOEC 1DTEA 4DDMA 4YCSA 2ZT7A 1T6YA 1ZSYA 2DFKB 1BCSA 4IX9A 1MUUA 2A4KA 6ADHA 3P9QA 4WT7A 5GGXA 4IVPA 3OFJA 5ALTA 1TFRA 2I1LA 5DSTA 3FKSD 1DS6A 4QYIA 1ZW1A 2ZDQA 1PR6A 2QT1A 4DV5B 1S8FA 4WK6A 4CPDA 3ENWA 5MN6A 5CLFA 2WV7A 3H5AA 2FWIA 1G42A 4HH3C 2OTCA 4NZZA 3QEAZ 4BE9A 2UUBB 2GHRA 1A8IA 3GLHB 1TI7A 1KNQA 3B6KA 5AUQA 2D3TA 4A5OA 3R7SA 3G0BA 4GVPA 2DWCA 2OO5A 4M1YA 1U31A 2AOVA 1XVAA 3IPAA 3P9ZA 2ZUUA 3GBSA 2QF7A 2KPOA 3M70A 5BSUA 3OY7A 3C7CB 4HDKA 1XG5A 1T43A 2YDYA 2YTZA 1U2PA 5LZ7A 1K88A 3L6CA 3R0IA 3RUFA 4JLUA 2FOXA 2ZJ8A 3DG9A 3PXDA 4X1YB 1EM6A 4CV0A 4YMVA 3QE0A 4YQYA 3VA7A 1TYZA 4L3WA 2QRLA 4ITUA 3ACBA 4HVLA 2R11A 3WB9A 4P2BA 1E0SA 2N1BA 3ZDEA 5A5DA 4HGZA 2GTIA 3BMCB 4BFYA 2JCGA 4XJSA 4WLUA 5A06A 3A32A 2QL5A 1W4BA 4Z0PA 1W44A 4Z4HA 4G0NA 4UAGA 2XGJA 3CLRD 2V7GA 1RAHA 1E7WA 1X94A 4PM4A 3R5KA 3IDSA 1V41E 4GI7A 5COAA 5HE8A 4CLRB 4BY9E 4CG2A 5TQ0B 4B80A 1QLJA 1N9ZA 3ZKWA 1E79A 1TM2A 2WIBA 1IY2A 3ZQKA 1UJ5A 1X77A 4EFDA 5C2JB 1UK6A 5EXPA 2UVPB 4PPYA 2WTMA 2R751 2I99A 4JC0A 3CVUA 2HWUA 1R4ZA 5KUTA 1QQTA 5BVGA 4UHDA 3VTZA 5FEUA 2GR9A 3WLLA 3L7LA 3TUIC 4A92A 4CM1A 4E12A 4I9GA 5H8WA 1CQZA 1D1PA 5HYVA 3PUVA 1YVRA 2IUSA 1ADBA 3OF5A 2IY8A 3SD7A 2WUFA 3DWFA 2C99A 2R8XA 4K0RA 2X0DA 2I29A 3GFFA 2AEJA 3OPYA 1LLCA 1PJAA 3F2IA 5KNDD 7MHTA 3MMXA 1OGYA 2H4HA 4G9GA 2Q45A 4JEMA 4DJAA 5FH9A 4CJXA 3WB2A 4QVGA 1MFPA 3HYTA 3QFFA 2IUEA 3QTLA 1JXOA 1DBRA 1K9SA 4QBTA 4B6SA 4I3GA 1AJEA 4JYBA 1DAFA 1F1JA 3HBNA 1XTJA 3BDIA 4K3VA 1FFWA 4HAZA 4W1QA 4JT4A 2GRJA 1UBGA 1FF9A 3L6DA 4A4DA 3R9XB 1BTOA 5CGQB 1NVGA 1U7PA 3H16A 3C4QA 5CBPB 1KZ7B 4AU1A 4C7OA 1C0EA 2IYNA 1KZHA 4MUHA 1NVEA 1N33B 1MO4A 2AFRA 3UGQA 4NOMA 3J81k 2FSSA 2OV4A 3GHHA 3QLEA 5JPDA 3GLUA 4G81A 3V6MA 1J6UA 2FEMA 2W2OA 1X8KA 2OHGA 3GUUA 4KDRA 4FDVA 3T7JA 1PK9A 1KORA 4ER7A 3MILA 5KZMB 2CNDA 4HF7A 1CZKA 4I1YA 3RTGA 1CUDA 4B71A 5FIUA 3H2KA 1IY8A 3OTWA 1Z4MA 2ANBA 1R10A 3GT0A 3MJDA 2C57A 1PS8A 2QAGB 5JZVA 3QM1A 3W0LB 3CX3A 2O3QA 3BREA 2JI9A 1QH8A 4Q12A 3WBFA 1E2IA 5KCZA 1JEYB 1TC2A 1XZHA 2W6OA 1LC3A 1U63A 4IIUA 1Z0SA 2XRFA 4PIVA 1V6AA 3N2GA 3B5IA 4DEXA 1U8YA 1XQ1A 2NQ2C 1QP8A 5CW2A 1C3JA 3SF0A 3IP7A 3ZLTA 5NULA 3DBHB 4DMKA 1L3BA 2P0AA 2ZB8A 2VHCA 2WIAA 3Q9LA 3HJGA 4EUHA 3LXXA 4HEHA 4QTXA 4GXNA 1N36B 3G0IA 5A3SA 2WSSD 2REQB 2ZJBA 1SULA 1VSUA 1ZICA 1STOA 1YA8A 4G09A 4H6PA 2R6AA 5TS3A 3WV4A 2QZ9A 1XCBA 4J76A 1OUMA 1OI2A 2PUHA 2PUDA 2OC9A 3AM5A 3LT0A 1GZ4A 1S2IA 3GGDA 4OSEA 5DZSA 4C2TA 4UCQA 2VAVA 3QVGB 3HK2A 4NS4A 3FMFA 2IZOA 1AZTA 2JFBA 3NQ41 4UXIA 1UODA 2H4JA 3REGA 4OA5A 3K30A 4WD3A 3DBVO 3NBUA 3I0MA 3QNMA 1GSOA 4RJLA 2W2MA 2QUHA 2J3MA 4C9BA 1ABBA 2AFIE 4GOLD 2H17A 5GONB 2V7BA 1J9ZA 1GKKA 1P39A 1PFVA 1TK2A 3FNFA 4KZKA 1E3EA 4PPGA 1WXFA 2HBRA 3G59A 4RVHA 2WP0A 1X86B 2YZ2A 1W4RA 2G9QA 4NCIA 3CX7A 4GKBA 4AN4A 4IJWA 1SPBS 5THXA 4BGVA 1A5ZA 2QVBA 3KLPX 1W35A 1OLSA 1S02A 3ZPXA 1N0VC 3OQ1A 5BV7A 2Y0BA 3S6JA 1TRKA 2AJCA 1IOWA 1MC4A 2WWRA 3QUSA 1D09A 3Q3HA 3RJMA 2BEWB 3O73A 4OLAA 3PA8A 3L0SA 2PLNA 3MD0A 4G5HA 4WJZA 5U4XA 3MCAA 3TW4A 3FSGD 3ADBA 1PZFA 2VQEB 4M1TA 3FLMA 4JWTA 1P17A 5ALFA 2VZ0A 5H70A 3NNDA 4FHFA 1OFIA 4LI3X 3R44A 3RODA 1WMBA 3GEMA 1KEWA 5ALKA 4ZVSA 1P6QA 1QS0A 1RZVA 1ZYUA 2DBZA 2GILA 3QLUA 2PD6A 2QP3A 3I8XA 4TS9A 4D8VA 2FPRA 2XBMA 2DP4E 2EEZA 3TLMA 4CM8B 1L5HB 4CG3A 4DR5B 5HBGA 3WLMA 1EDBA 1NW6A 1BMDA 3A4IA 2QT0A 4H0CA 5DX8A 2ATVA 4MPJA 4D9MA 5YASA 2E2WA 3G7UA 2VAMA 2AI2A 1ZD4A 3NI2A 4FSHA 3BXXA 2OB1A 3H11A 4MUKA 5LFAA 4OMDA 1HNWB 3REOA 3CA8A 2I78A 1UPAA 2C9MA 3L06A 1YZFA 4BO2A 1ZEJA 4YUAA 2C5HA 3L8DA 4M1SA 1Q2UA 1BN7A 4NF2A 4PR3A 4R8SA 1O6BA 4IUCS 1K98A 5AW9A 3DAOA 1J2UA 1L1EA 1NFRA 2C58A 4HH4A 3ITEA 1PJSA 3CF4G 4KQFA 3ND7A 3JQAD 5E1DA 1KJ9A 2WNHA 3LYAA 1GRRA 4PSVA 1NTRA 1FQKA 1FTNA 4XZ3A 5IW8A 2PSFA 3AVUA 1IHUA 3BD8A 4HX5A 4AXXA 3OQIB 3ADPA 1OTHA 3TEMA 4G0PA 1V5IA 4MWTA 3UV7A 1WEHA 2I22A 1YJXA 2QTZA 3DMNA 3NJRA 2CV2A 2CNLA 4YCLA 2E4ZA 1O89A 2EJVA 2QVYX 5GM1A 1H9AA 1TT7A 1F3OA 3DO8A 3HL0A 3N8HA 4PXSA 1SK9A 3TKYA 4QBHA 3UH1A 3QW4B 4J16C 5BPFA 1E77A 1PK7A 2ZIFA 3OIYA 2F64A 3HBLA 2JJ2A 3SZUA 2IOFA 3DVRX 5BW8A 4MPDA 5JAZA 2CVPA 2P9CA 3I9V1 3OO0A 2VJYA 3OZRA 4EAAA 2P30A 3FWNA 5E38A 2QPOA 3U7QB 2PN1A 1DXYA 1WXIA 4OF4A 4RIFA 5LA6A 1BHJA 3HB7A 1NWCA 2C0CA 4ENWA 4A3SA 2HZ7A 1NP6A 2E3JA 2WICA 5HGXA 2C3MA 1IUOA 5IXSA 1UH5A 4MMZB 3ZUPA 3FPHA 1VPLA 4ZYTA 3KTDA 1XLUA 4GYKA 1G5HA 1U3DA 5LIPA 2EFDB 4AJ4A 3ANLA 3JRWA 1L8LA 4GI5A 2CSXA 5I8ZA 2Q2OA 4WBNA 4GDMA 1G63A 4P3NA 1IBMB 2UV8A 3OFVA 3OC6A 1YB5A 2JEYA 4RFLA 3TIVA 1KO8A 2YV2A 2O3TA 2P9BA 3M1YA 4HTFA 4ZXFA 4EO7A 3KUCA 3AJEA 4MA5A 4J1SA 3H5LA 5IBQA 2PMDA 2GCIA 1BE6A 3FGNA 3NRJA 2XHZA 3R6LA 4G2TA 3QEBZ 1U4OA 2VBIA 3IDFA 3NM6B 3CEJA 2XNCA 1P4JA 2R1TB 3NV7A 3EOAI 4RDIA 2F1JA 4WKPA 1NMZA 1PWEA 2ECQA 3LX6A 2AN9A 1VXRA 1XTUA 1YQGA 3CKLA 4G5QA 2KBFA 4QXPA 5LMZA 4MZXA 1DI0A 1Z5UA 3OPMA 1CYDA 3AH8A 3CE9A 1J0DA 4OJMX 2R1UA 5C1DA 1CS0B 1AU9A 1FUYB 1O5TA 2A7XA 3R3JA 4XCVA 4XYEA 4ENRA 3WNBA 1VL8A 3KR9A 3UBTA 5L7WA 2QN9A 1SKBA 4FN5A 4G89A 1X19A 4J4BA 2LDBA 1AZLA 3B5JA 2YFQA 5LVAA 4RABA 2NNWB 3HLKA 1RAFA 1U9YA 1QORA 3IL2A 4KAFA 4YLYA 4DSTA 3PD1A 1UQTA 1P44A 2ODWA 3GEIA 5B12A 2JIMA 5HRCA 3VBEA 2ZPAA 3DJYA 3HO6A 3DXZA 1Z5NA 2V98A 4RY8A 1DRVA 4Q4AA 3MFQA 2XVZA 4HLDA 4RVNA 3N2YA 4GXTA 4IRMA 3TDNA 4BKOA 4E6EA 7YASA 3BWEA 5K99A 4J4HA 1IPHA 4TOIA 1QCZA 3G49A 1JU3A 4MS3A 3O8NA 1GGNA 3VU9B 1HLGA 5F7ZA 5K9ZA 3L82B 2H65A 5TVGA 4RYLA 1GNPA 3RSFA 3VPDA 2AD1A 2D2XA 4HB3A 2IK8A 3T34A 3BTOA 5LYJF 5HVNA 1TM4E 3SKVA 2B2XA 1DU4A 1LS6A 2CLFB 4XI9A 1PGPA 3EXEB 4Y7DA 5K2OA 1KTIA 4DCJA 4LGMA 3CFYA 3PJEA 2CD9A 2BGUA 4RHTA 3K71B 1K5GA 1FYXA 1R2QA 3LFTA 2QZZA 4JENA 4CIXA 5F9HA 3OT1B 2FSUA 3FTQA 2H1IA 4P4NA 3NOXA 3LC1O 4QNNA 2YWJA 3DEFA 3VZRA 1QUEA 1LK5A 4U5QA 3V9AA 1U9JA 2R1VA 3DFKA 1CUCA 1S5PA 2V03A 4WXHA 4JB2A 3K72B 1N3BA 1PBNA 1YUNA 3OE4A 3ESYA 1Z82A 3D2BA 3L8CA 4D9JA 4EG5A 1TEXA 5KJFA 5MF6A 1RHRA 1JZQA 1C4XA 3ANXA 3M89A 1NI3A 2QUAA 1DAGA 2Q21A 3EQ9A 2XDYA 4J1TA 4Q4HA 4TS3A 1XU4A 1OQAA 3QVSA 1JKJB 1WOMA 3EXG2 1Z63A 3ZDBA 1W2HA 2Q8NA 3AOEC 1XB2A 1PLLA 4YP1A 3KOOA 3WLQA 3L4JA 4M4SA 4WAUA 2B37A 3HN2A 3FF4A 3FSJX 3BDAA 3WLAA 4ASUD 2YVQA 5JBIA 1YHNA 1XJ5A 2AN1A 4UNNA 3D0RA 3C98A 4S12A 5KQSA 4AJ2A 2LD4A 3SF8A 3I37X 1YE8A 3TNFA 1ABEA 3TB4A 3FZEA 5EP4A 4S3MA 1KKUA 1CY7A 1V8OA 4KXLA 2V5AA 5LNK1 4LYEA 4R8MA 1XOIA 1BJKA 3L4SO 4B34A 3DAHA 3EVTA 1VLVA 2DHRA 4DGQA 1QIFA 3CW2A 4O02B 2NYAA 1QGZA 2A35A 2NZVG 4PRZA 4BNNA 1OAOA 4LFAB 1EBUA 1JH9A 2CLKB 2VO1A 3ILHA 1TW2A 4MQLA 3DZGA 1QFZA 2OHFA 2OQIA 1QGDA 1SU7A 3K20A 4U7JA 3BB3A 3KYCB 4JJ4A 2GSWA 2W0SA 3F98A 3IPRA 1N6IA 4GBMA 5DU2A 1LQ2A 3O90A 2VNKA 3ZQ4A 2H6EA 5KTTA 2Q62A 3BRWA 3AKZA 4H7KA 1ZISA 2OVBA 1DMSA 3I6ZA 4RW0A 4JI1B 2NADA 1R6DA 2WNIA 5K6TA 1FNDA 2WHPA 3HKBA 2QX9A 1X2EA 3EFBA 4MYHA 2ZUDA 2F3QA 2FDXA 4N8EA 2Q3EA 4RSGA 3VHXB 1I6MA 2CMGA 4JQZA 4MV6A 3DE0X 4ALJA 2J5BA 2OL4A 4HMQA 1NBEA 1E4EA 1EFAA 4MIOA 3ZHOA 5BMOA 1M67A 2P3OA 4F5EA 1FUUA 4J0IA 4WOCA 4I08A 3SM3A 4BHTA 3H9BA 4B3HA 2N75A 1JHYA 4YUXA 1KWKA 1VE9A 2PD3A 1P0FA 4AB1A 2IUUA 5GP1A 4YJKA 2J8ZA 1XJ0A 1E2HA 1LUAA 2IF2A 2LXNA 3JRNA 4QOHA 5B1HA 4EFMA 5C5DA 1IYZA 1GQQA 4N5HX 3QX7A 3A0UA 5HG0A 1YR6A 3KBBA 3DCIA 3EE6A 4GG1A 5DASA 1TK9A 3A9RA 1NF9A 4Q1VA 5DJ5A 5FI1B 1A27A 4H35A 4KV7A 4N7RA 3JYOA 3HWSA 1XMJA 521PA 4R83A 5KVAA 4Q7QA 1OXVA 2BJVA 4FLMA 3HBJA 5EA2A 5SZIA 1YZKA 3WHIA 2BMEA 3HQ4O 3QPBA 3C8ZA 1Z4QA 1OZGA 3H8VA 3L8ZA 2RCYA 3LQRA 3WKEA 4AVYA 1GNQA 4O4HB 4HVCA 2EV9A 1B93A 1RRGA 2RH8A 4OU4A 5TQ2A 4AX4A 1QX4A 1NVFA 5M2QA 1M83A 1EP9A 2HK6A 2ZSUA 3BPSA 3HSSA 2Y1FA 3LXMA 4I5GA 2ZULA 5IVKA 3MJCA 1QGUA 3X1MA 1XZNA 5A4MS 5LP6F 2VATA 2W42A 5KTRA 5HKAA 3H84A 2HUNA 1G5RA 1JSZA 3R0XA 3VPAA 5IARA 3AV3A 1TK3A 4X7BA 3W2EA 3AHFA 3OIFA 3DMFA 1EAMA 1FFAA 2XMCA 3ZH9B 4RIEA 1U4SA 1VZ2A 5BORA 2BGTA 2XQGA 2VOEA 4OKSA 5IZCA 1ZN8A 4HRYA 2G07A 1P7PA 5CIWA 4EDFA 4DC1A 2XADA 1AZSC 2JZOA 3MYRA 3ESBA 3OCUA 4Q1CA 1GXSA 2YV3A 3V46A 3WWDA 1I80A 5LOVB 3TFWA 4IP0A 1KJ8A 1OYWA 1TYCA 4OXQA 4B6RA 1DDGA 2HQ1A 2NQ8A 3Q10A 2UXBB 2CJYA 3AKDA 2Y76A 4OMUA 4FYMA 4A27A 3BIJA 5FCDA 5K6AC 2C5GA 2X6RA 5AW4A 3G0HA 1O57A 1G3UA 3D0QA 2CXTA 4W9RA 3OLQA 3QP9A 5DGIA 3EVNA 3VGJA 4BNIA 4EW2A 4O4IB 4QG3A 4YDQA 4YUVA 5EUBA 2M1XA 3CUVA 1HLPA 3IB6A 3PLRA 5WRFA 3AJ9A 1PJ3A 1NHGA 2XDAA 3BK2A 4KO1S 1T0BA 1PNTA 1VM6A 2H48A 2ZJYA 3CKKA 1OKKD 1NAIA 3FI9A 3THWA 1XYVA 1WWKA 2GDJA 7ADHA 1M33A 3QPWA 3G85A 4FFSA 3K1ZA 4ML3A 3K5HA 2B9EA 2K7ZA 3MAGA 3AUJB 3THYB 1ENPA 1F4LA 1TCAA 1UDRA 1Z6TA 2CJWA 2CUNA 2JA1A 1JR3E 2LCIA 3GEGA 1N2XA 3H04A 5I9SA 3JR7A 1ZRNA 4B7ZA 4B76A 1WABA 1ZFNA 4YJGA 1ULAA 1PDOA 1FY2A 4WZAA 1Q1AA 3CEAA 3JD1A 4ZHQB 2OHOA 3DS8A 4AMYA 4Z9BA 4C6TB 3VR5D 5JSUA 1E3TA 3IAFA 3EIEA 3B3JA 3GAFA 3M6IA 3VZBA 2PHZA 2CY0A 1F12A 2HGZA 3G5AA 1JA0A 4OHXA 1IK4A 2CC2A 2JKVA 2Y92A 1G5TA 1L4GA 3AB7A 4WI1A 5JH7B 4HP8A 3AERA 4TYQA 2G1AA 2YWDA 1EJ2A 2VHYA 4O2BB 1OZHA 1MENA 2CNKA 3UAVA 2H1LA 2VH5R 4AMVA 1SRQA 4RWEA 3ZTWA 4HNVA 2JJ1A 1V3QE 2ZRJA 4C0BA 4JELA 4YAKA 4KHPB 2JGRA 4ZT3A 5DIZA 1HZZC 4L0MA 1C9MA 2PRKA 2B9VA 1LW6E 1XP8A 1DCMA 2B1QA 3OEHD 1QGOA 1G4UR 3OD5A 4JBXA 2VPPA 1QTQA 1J49A 1FVFA 1WCWA 2JI8A 4IGEA 4IXNA 4X41A 1H3NA 1JE1A 4M8IA 2GBPA 3RUIA 4B31A 4EEZA 2Z5FA 3OX2A 2PSDA 2AX3A 4LZJA 2R25B 4KPUB 3CUUA 5JNUA 1JXAA 1AQNA 4P8RA 5IULC 3OZSA 2BI8A 5JXHA 4D9NA 1U3GA 4UU1A 1UKZA 1M10A 4KYTA 4ZV9A 1DC4A 2VTEA 1GVNB 4Y1RB 1AN0A 4GRDA 1Y33E 2JAQA 2J41A 2X23A 2YHSA 4ZAXA 2IP4A 5JJCA 1SM4A 2X8WA 4NNPA 4YBRA 4LMPA 5CM8B 4PRYA 4E5UA 3W6OA 2WYUA 1WB5A 2WYWA 3VDQA 2DTXA 3ZHBA 5EJ5A 5IDWA 2JZCA 4ARZB 1M2WA 4AC9A 3RUCA 5H16A 3N75A 1OOEA 3WLFA 1HUQA 5GJWC 1KIAA 1YJAA 5FPTA 3DLBA 1B23P 1ZC3A 1T2EA 3RD5A 2F9MA 4MW5A 4AS2A 3HJFA 1A97A 3HRKA 3ZJTA 4OHMA 3KOUA 4BNZA 4GOKA 1QHFA 2NVBA 2PSSA 4CV3A 4OGFA 5JZSA 3W2IA 1MU0A 2ZI6A 1ZN9A 2HA3A 2Q5JA 4JODA 4RFSB 4K87A 1R12A 4IDOA 1NQTA 1RSZA 3ITDA 3O9ZA 4I5EA 2D1YA 2X5NA 4UHEA 3LY8A 3PKJA 1AKUA 4PIMA 3HB0A 4HX9A 1AXRA 3QVJA 3E18A 3M3PA 4JBNA 1JIIA 1JEQA 3UKJA 3DC7A 4CBVA 3ZOKA 2GXQA 2C04A 2DBVO 3H87A 1LPPA 2R2AA 4R2XA 5H1YA 3ZVNA 1U80A 4LZPA 1TCBA 2P35A 3C6YA 3DQZA 3P4XA 3G8DA 4JB0A 5FTKA 1J22A 1I3NA 1N5LA 2IUTA 3GJSA 4OPMA 3F7MA 4QQKA 2VPTA 3ZDAA 4RCVA 1G21B 3T1TA 1TF5A 2PIDA 4MYUA 3U4HA 4Z9FA 2HLHA 3B3QA 1UBKS 1O77A 2WPDD 4V38A 4GR9A 1M2EA 3NBYC 1GGEA 3BGVA 1T8WA 4P35A 4HRVA 5CCEA 5EMJA 3D6HA 1S3GA 2FQ1A 3K15A 4N18A 4OGWA 3SMVA 4C7JA 4XIYA 4D9GA 1CZNA 3U4GA 1SA0A 5DYTA 2QX6A 4EVQA 4GXQA 5KMGA 4AO8A 1XXLA 2YXEA 4FFNA 1CNMA 2P7IA 1JFFA 3RAJA 4M7PA 3KZ1E 2VTBB 4C0KA 2PGDA 2VTDA 4RVGA 1NBMA 3UHOA 4YRGA 4MVYA 5C46F 2V54A 1XWFA 4Q47A 4RF2A 3PGXA 2ZVJA 4I66A 1C14A 1G66A 2ZR8A 2HX1A 3ROMA 2ENWA 3SBXA 2UAGA 1OF1A 1UXJA 2UYHA 1IUNA 1XQ6A 3E5MA 1U90A 2IS4A 1Z6XA 1XLVA 1DHRA 4D9CA 4E14A 2O4CA 4ISBA 1S89A 4NR0A 5JMTA 5C5EA 3TLKA 5EWLA 3LXRA 3ZDZB 1Y9JA 4AMBA 2YZKA 5JYDA 2FZLA 2ZUCA 4FYWA 3NHWA 5IYZF 4JN6B 1V1JA 1SNYA 1T5OA 2XB6A 1GGFA 1SCDA 3HUDA 3R7WB 5E7JA 5JXWA 3EVCA 4LF6B 1EGAA 3EAQA 1OFVA 2C42A 1NSTA 5CURA 1R0SA 4ZAWA 5KVVA 4EVIA 3AR8A 1M6YA 1RYEA 4NG5A 2QHXA 1TTHA 1CIVA 2JGNA 2VZEA 5CJ2A 1PSZA 2AYYA 4OB6A 3R75A 1KU6A 2QX8A 5CCXA 1G59A 4HS4A 4A0RA 3E1KA 5CNMA 3V32A 2VXYA 1F8XA 2JEOA 3CVWA 4XWYA 4AZ3B 4I9UA 3K70B 5TB5A 2Y1OA 3DOOA 3NDIA 4IJ5A 1W1WA 2FJ0A 2XMDA 2OBLA 3E3NA 4RHCA 4BO0A 5TRTA 4EKGA 4F4FA 1JI0A 2WZDA 5DNYB 3A3KA 3GXBA 3UMGA 1T0JB 1CERA 1U7WA 2P78A 1N2ZA 1Z8FA 3PPXA 1R6XA 1AKNA 4TV8F 2XT9A 4ALKA 3ZYZA 4U7GA 2HU8A 1CR1A 3P5SA 3M9LA 4OL0A 1YVPA 4G8JA 2ZSIA 1KK1A 3MQ2A 3RAEC 1Z4KA 2O8BA 1UXHA 3GGOA 3A4TA 3AESA 3JQDA 3M49A 2W83A 4R9NA 3IKVA 1H65A