3DGEC

Structure of a histidine kinase-response regulator complex reveals insights into two-component signaling and a novel cis-autophosphorylation mechanism
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
122
structure length
122
Chain Sequence
b'MSKKVLLVDDSAVLRKIVSFNLKKEGYEVIEAENGQIALEKLSEFTPDLIVLDIMMPVMDGFTVLKKLQEKEEWKRIPVIVLTAKGGEEDESLALSLGARKVMRKPFSPSQFIEEVKHLLNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein
molecule tags Transferase/signaling protein
source organism Thermotoga maritima
publication title Structural Insight into Partner Specificity and Phosphoryl Transfer in Two-Component Signal Transduction.
pubmed doi rcsb
total genus 33
structure length 122
sequence length 122
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3dgeC00
3N0XA 2L2QA 2FEWB 4KV7A 4Z4GA 3KKEA 1NXVA 2QR3A 4GPAA 4NICA 6ABPA 3OQOA 1GCAA 1GLGA 3OLWA 8ABPA 2FN8A 1W25A 5JNRA 2FKAA 3OLYA 1P6QA 3SG0A 1KGSA 2PUEA 1FSPA 3GA5A 2X7XA 3O2JA 4TN5A 5KC9A 4Z9AA 3F73A 4QICA 3H5TA 4S04A 4RY0A 1BVHA 1U04A 2R4QA 3IDOA 2H0AA 5B3JC 3EDCA 2L17A 3BREA 2PKXA 1J56A 4DADA 1BDHA 4YGXB 5KQGA 2IPAB 3HS3A 2VUHB 3JVDA 1TVMA 3RVNA 4EY3A 1USIA 3MYYA 4MR8A 4XXHA 4Z4CA 4OLBA 5DLEA 1Z12A 4HYEA 2PAFA 5F64A 3TD9A 3HJFA 3A3KA 4GNRA 1QO0A 4WT7A 3H5VA 4PICA 3HUTA 3A0RB 1L5YA 2QVGA 1Y1LA 4WUTA 2LP4Y 3NHMA 3OLXA 5PNTA 2PUGA 2QV0A 2OENG 3KLOA 2NZVG 3W9SA 3LUHA 1CYEA 3QEMB 4MQFA 2H3HA 4QYWA 3Q15C 4FE7A 4MQFB 1P8AA 3UKJA 4F8JA 1ZESA 5JNUA 3R0JA 1PHRA 4FE4A 2M1ZA 3SNKA 1JDNA 3HSYA 3LUAA 5JNTA 3HVRA 1JF8A 5E3JA 1D1PA 1DCMA 3Q7TA 4YO7A 4XFKA 3DGEC 1QP0A 1VPWA 4MLDA 3MF4A 3OMXA 1F4VA 4YS6A 1FFWA 5IUJC 4IGAA 4Z0NA 4F12A 5KQPA 1QP7A 5FBKA 2B4AA 3H5LA 3NBMA 1TLFA 1Z15A 4MR8B 3T8YA 3MMNA 3H5WA 4Y9TA 3KHTA 1Z2EA 1ABEA 2FEKA 1E6LA 2QSJA 3N75A 1D1QA 2MYNA 3QX9A 4JOQA 1QNLA 3EJWA 3EQ2A 3LOPA 3EULA 2LIVA 5IC5A 4D6YA 5EWLA 1APBA 1JFSA 1JH9A 3MQ4A 2PUBA 1A0OA 2YHAA 3IP7A 4MR9A 3NNSA 4W5QA 4W5TA 1PNRA 2V0NA 2MYPA 1DC7A 3LFTA 3N0WA 4KVFA 2ID9A 3F6CA 4MR9B 3IP9A 4KQ9A 2NUBA 2IDMA 6CHYA 3OQMA 5BR1A 1L5ZA 5TQ0B 4Z4EA 2FMFA 3DZDA 4O1IA 1JLKA 4G0MA 1LBIA 3N53A 4MR7B 5DCLA 3T6KA 3H5IA 2L19A 3QK7A 4RZSA 1P6UA 1DBWA 5FBHA 3LKVA 5TQJA 5C5CA 3G85A 3N8IA 2JBAA 2OQRA 4G86A 5DGCA 1T34A 3RVQA 2ZWMA 2FSPA 1LBHA 3Q7RA 3DLBA 1USKA 3SAJA 2E4XA 1FFGA 1IIBA 2P4UA 4JP1A 4L4UA 1DG9A 4RU1A 2VUIB 5KI6A 3QEKA 3QEMA 2A9RA 5FWXA 2YHBA 1RXEA 1ZY2A 4N76A 2LUOA 5TQ2A 2FQYA 4LE1A 4YLEA 3A10A 3HO1A 3P9YA 4YV7A 5ABPA 3Q9SA 4PYRA 3KYJB 5I4CA 3SY8A 4EYKA 4RDCA 3O21A 1JBEA 1RZRA 4RXMA 4ZYLA 2PUCA 1XHEA 4RK5A 2FVYA 3QELB 3C97A 1WETA 3JS5A 1K66A 2JVKA 3EAFA 2GBPA 3GBVA 1ZH4A 4OG2A 4MPTA 3Q41A 3LUKA 1JYFA 3FGZA 4JASB 4DN6A 1KMIY 4JAVC 3C3WA 1USGA 3K9CA 1NTRA 4N03A 5BRJA 5TE9A 1QKKA 4ML3A 2WWVD 2RDMA 3N0RA 1JL3A 3JTEA 3IPCA 3L49A 1MVOA 2FQXA 4EVSA 2QXYA 3H5OA 1KRWA 2NZUG 4HNQA 1PNTA 4WWHA 3E61A 3NNDA 3JY6A 4Z4IA 1DP4A 4G0PA 4MS3B 4NCBA 1Z16A 1BDJA 2R48A 3IPAA 4FB4A 1ZDMA 3I45A 1DJMA 1EAYA 3O75A 4MR7A 3TO5A 5IULC 1YVUA 4IMIB 3NNNA 1M5UA 3ILYA 5IEJA 1ZVVA 3QLTA 2CWDA 1MB3A 3L6UA 1TM2A 3O2QB 5KQMA 2WY2D 1A2OA 3CS3A 4EYGA 1RPJA 5T3YA 4N0QA 3HXMA 4YRZA 2FMKA 5HQJA 2WB4A 1JHZA 5CNIA 4Q6BA 4WZZA 3OLVA 1NXXA 1ISRA 4LDZA 3EODA 4KFCA 4ZPJA 2FMIA 3LTEA 1GUBA 1GCGA 1ZGZA 4D6XA 4MS1B 1TMYA 3T95A 3A0UA 2JBAB 4IMJB 2QW1A 1JX6A 4TLLB 1UDRA 4MRMB 3TB6A 1SXHA 2IKSA 1SXIA 1YTUA 3ILHA 2MYTA 5BRAA 3H6GA 4KZKA 3LUFA 3HUUA 5HKOA 1F51E 2PL1A 4LDAA 1YMVA 1B00A 4DQDA 7ABPA 1VLZA 1DRKA 5TPZD 2RJNA 5KC8A 2GX6A 3HDVA 1E6MA 3BRQA 3H1EA 5GOTA 4RKRA 1SRRA 2FW0A 4B09A 4G97A 1I3CA 2HPHA 3RVKA 1DZ3A 3LUCA 3RVPA 2WRZA 3BRSA 2JVJA 1DRJA 1YK0A 4N41A 4RK6A 3FFXA 4Z9BA 3S99A 3FMVA 1XHFA 4UHKA 1D5WA 4WXEA 1AB5A 3BILA 4PEVA 1E2BA 4ETIA 4ZJPA 1QQBA 4O5AA 1ZH2A 1U2QA 2PL9A 3QLVA 3I09A 3RVMA 1NXTA 4G0QA 4ZMSA 3KYIB 4RXTA 5FWXB 1CEYA 3C3MA 3JPWA 4PE5B 2F8TA 3D8UA 3B2NA 1PUXA 4LE0A 5DTEA 5CNKA 2PE5A 4OATA 2E4WA 3CTPA 1A04A 1ZHHA 3RVRA 2FMHA 3CNBA 3FFWA 5IUKC 5TQ0A 3CFYA 4NCAA 2MSLA 5FWYA 4KK4A 4RK4A 1Z26A 2E4ZA 3KLNA 4TLMB 2CHEA 2JRLA 3OM0A 4M88A 4IILA 3RH0A 3EGCA 3CU5A 1W9HA 4H3HB 3D02A 4N0PA 3LUJA 3GRCA 4Z4FA 1QPZA 1ABFA 3BBLA 1LJLA 1NXSA 1M5TA 2RJOA 3MM4A 1NATA 4G0ZA 4JB2A 4JA2A 3M9XA 5CNJA 2NT3A 4HNRA 3E3MA 2PUDA 5TPWA 3O1IC 4MRMA 4L85A 3GBPA 5EWMB 2GI4A 3FDFA 3CZCA 1EFAA 4MS1A 5GQSA 1NY5A 1U0SY 3JPYA 3O1HB 3UK0A 4S05A 1BAPA 1QMPA 1EWTA 5TQ2B 1H9CA 2HSGA 3I5AA 3SQNA 2GKGA 3IP6A 1KRXA 1RZRD 4LZLA 2JB9A 1C4WA 1DCKA 3HK2A 3RVSA 1EWVA 2WMYA 4MAAA 3HDGA 2HJ9A 3QELA 4MS3A 4W5RA 5EWJA 2W42A 1RNLA 5IEBA 4EYOA 1OXKB 2KYRA 4H60A 2PLNA 4F06A 4Z99A 3CZ5A 1P2FA 1E6KA 4RK7A 1YIOA 4KMRA 4XAQA 2E4YA 4YCSA 1S8NA 4RY8A 2IPMA 3URMA 3CRNA 1Z13A 3HEBA 4G0OA 4MGEA 3K4HA 4YWHA 2LPMA 2AYXA 3OO0A 4MQEB 1Z25A 1C0EA 5TPZA 1Z17A 1CHNA 2GWRA 2R47A 3QLUA 4OTZA 4Q7EA 5CHYA 2E4UA 3CKMA 3ROFA 3I42A 1DBQA 3RVJA 1JFVA 1SXGA 2FLWA 2XDYA 4ZMRA 3O1JC 2E4VA 5T7BA 3EQZA 1EWKA 3F6PA 5KWSA 4G0XA 1DCFA 4OBBA 2MSWA 3H1GA 2IOYA 4O1HA 2L18A 1EHCA 1VKRA 3KSMA 4F3TA 4XARA 3DGFC 5D2CA 5JS2A 4IF4A 4XLTA 5C5EA 3DLHA 1YS6A 1MAVA 2RGYA 5EWLB 4RK0A 1PEYA 5HM6A 2LBPA 3CG4A 3N6VA 3O74A 1AB6A 4KRFA 2MYUA 4RS3A 1DC8A 4E7PA 1ZGGA 1U2PA 1ZITA 2M98A 2PMCA 3Q7SA 3GT7A 2ZAYA 3DBIA 3RVLA 4XASA 2I6FA 1D4ZA 1U8TA 4LRQA 4P1ZA 3RQIA 3NHZA 1SD5A 2HQRA 4Q6WA 2A9PA 2HQOA 2VK2A 2DRIA 2FN9A 4NQRA 3QX8A 1QP4A 3C3KA 2WJAA 4QYMA 3OMWA 3VNAA 1QO0D 2QZJA 1TJYA 3O2SB 4LX8A 1LJUA 4N47A 3KG2A 2PUAA 3KTOA 4RWEA 2BGGA 2AYZA 4KQCA 4UHJA 5FWYB 2QVCA 4RSMA 3M9WA 3GL9A 1JYEA 1DBPA 5JNSA 1JFTA 5B3JA 4W5OA 5EWJB 3OM1A 1D2AA 4RXUA 4TMYA 1LK0A 1YK1A 3C6QA 3KCNA 3TX6A 3IP5A 1BA2A 4YP9A 1MIHA 1ZN2A 4LE2A 4H3KB 3UUGA 5HSGA 4OLAA 1XWWA 2QU7A 3MA0A 3RVOA 1Z2DA 3HCWA 4RY9A 4EGSA 3CLKA 3MIZA 1YS7A 4ETMA 3H75A 2IYNA 1FQWA 2Q5CA 3VNBA 3F7NA 3HZHA 5JNWA 1BDIA 3LMKA 2TMYA 2VYCA 2MSKA 5CNMA 4EVQA 3KS9A 1URPA 5BQ3A 5JNVA 3LUDA 3QLUC 1Z18A 3H1FA 1NXPA 4Z4HA 1PEAA 1MB0A 2HQBA 3H6HA 4RK1A 2JK1A 1OXBB 2FQWA 3M6MD 2IPNA 2O20A 3FFTA 5DKFA 4G0YA 4W5NA 3OO1A 3QLVC 5EWMA 1YMUA 4D74A 4WXMA 3OQNA 2ID7A 2FTKE 5IBQA 2WJWA 4MLCA 4F11A 5JS1A 2N9UA 3ROTA 2F8SA 1FFSA 4NV3A 3GV0A 1K68A 1RXIA 2JCGA 3LUGA 1HEYA 4RKQA 5IX8A 2PJUA 2NT4A 4YR7A 1VRVA 2A9OA 4MYRA 3GYBA 5KQLA 3KJXA 4CBVA 2IPLA 4MQEA 4RV5A 2FXIA 2P9HA 4KK3A 2PUFA 4QPJC 1GUDA 1M2EA 1M2FA 4PZ0A 1ZAYA 5IUNC 4KREA 4JB0A 4HNSA 4MS4A 4KNYA 3JVIA 4IRXA 3HM9A 2A9QA 4ETNA 3HV2A 4EUKA 2CHFA 2R25B 3CHYA 1R8JA 4MS4B 3T38A 9ABPA 1JWLA 1QQAA 2CD7A 3LKBA 3SM9A 3TMYA 2FLKA 4EVRA 2JVIA 3OLZA 3G1WA 4EYQA 1NXOA 1NXWA 4P98A 3CG0A 1ISSA 4E7OA 3GWGA 4KPYA 1JDPA 2J48A 2FEPA 5ED4A 5TPWB 2B1JA
chains in the Genus database with same CATH superfamily
1BEZA 3BK7A 1NX6A 4QXRA 3FUVA 2J5KA 1U0BB 1I6WA 3ZVNA 3JQEA 3V8BA 2E55A 3NANA 3B6ZA 4OL0A 1Z2PX 2XDQA 1I36A 4HEA6 4XOUA 3K4QA 4JU8A 4WKPA 1RADA 2Q3JA 3HKBA 4DMRA 3FJOA 1YAJA 2ERCA 3Q5DA 3O1LA 4CV0A 4K6MA 1ZI6A 3K8OE 1QRUA 3D6AA 3W2IA 5FQNA 3EQ7A 3KELA 4HN4B 3TE7A 5B4VA 5SY4A 3MT9A 1ZD5A 2CDBA 2QRVA 1AGNA 4NFYA 3ZIUA 4ZAZA 2CVQA 2XMCA 3U44B 1CUYA 1VFPA 4Z9AA 4MUGA 4KITB 1KTIA 1NY6A 3QY9A 1F48A 1QFZA 3A3YA 4WEQA 5DMHA 4UOZA 4E2WA 1QU2A 3WB2A 3ELDA 4G1UC 2AYYA 2HA7A 3KT6A 3MYYA 2JC3A 4RJLA 2B7LA 2KBEA 4XXHA 5AJTA 3VU9B 4C14A 4MQLA 1JHQA 2AMFA 2R84A 5F64A 1OAOA 3AJDA 3OQIA 2Z5GA 2ZIVB 3KXIA 2RGNC 3QKSA 1YCHA 4IF6A 4HL6A 1AKQA 2IIQA 4GNRA 4I19A 4JJ6A 4A1FA 1GNPA 1XUOA 3A4IA 1S2IA 3MCWA 3O4JA 3SPXA 3GJ0A 2Q7OE 3G23A 3TLGB 1I2DA 1A5ZA 1EM6A 2XRMA 2YFKA 1B8VA 4O59O 4HNTA 5IARA 2JI6A 3TAXA 1TUGA 3JQBA 4LHZA 1SC6A 3SF8A 3U3XA 3WLEA 3FKSA 5JFTA 4UEWA 4L5JA 1RZUA 2QTBA 1T5OA 1S96A 1EEHA 4QYWA 2ACWA 4MVJA 5DI9A 3DDNA 5HG0A 3TQSA 1QS0B 1RJFA 3A1NA 1FJGB 2BRUC 2C5FA 4BQOA 1CY4A 4EATA 3NU1A 1Y5NA 3KJHA 3HA3A 4Q1DA 1OYVA 2GUWA 1XZQA 3SNKA 3MJVA 4XRGA 3KXPA 2HR1A 1LS1A 4ME6A 2PGNA 4DLZA 3LT2A 1MA0A 3DAOA 3IAS6 3NAMA 4BAGA 2IS4A 1S01A 1MAUA 1XZPA 2IJGX 4PVCA 4M89A 5A1TA 1LC3A 5LDGA 4Z4QA 3H84A 4FMPA 4G5RA 3VYTB 2O19A 5T8KC 1KE2A 3FLBA 1SEVA 3OX2A 1IB6A 2VTEA 3RRXA 3MTGA 2Y1CA 1U31A 3TJMA 5KQPA 1T29A 4A5OA 3B9PA 1VDZA 4P36A 1J2YA 3FZEA 2LVBA 2HQSA 1NA5A 4JQZA 2PYDA 3ZE1B 2WV7A 3ETLA 1Y8AA 2ZTMA 1BRMA 1GARA 1K89A 3AHGA 3HM2A 4YAOA 4ZANA 4BMYA 4CU5A 1I32A 4R2WA 1UJBA 2O7QA 3EC7A 4J6EA 4NNPA 4FR0A 3VPGA 4KPUA 2PZMA 1V7PC 2ONZA 3GGGA 721PA 1MNAA 4MI1A 4D98A 3CH4B 3N75A 4RKRA 2JHPA 3BWEA 3UH0A 3ITEA 5JXHA 5IC5A 1JH9A 1AHHA 2N3ZA 3D1JA 4N9QA 5LMUB 2MYPA 2RK3A 1WQ3A 1H5NA 4IYJA 3JWIA 1PK9A 1Y8QA 3CLSD 2XQFA 3UC9A 3RM3A 3THRA 3SIWA 1L5ZA 4F5WA 1KGDA 3F1LA 5E38A 5FUVA 5M3BA 1BGXT 4NVRA 4B2PA 4MDHA 1MZPA 1WXXA 2D06A 5DSTA 4EG3A 3N53A 4BGVA 5JC8A 2L19A 1WG8A 1IULA 2QZ9A 1FP4A 2QUAA 3E1SA 4K6FA 2QLJA 4NOMA 3TIXB 3V9PA 1YR7A 1PGQA 1GZVA 4YI3A 2IP4A 2FOLA 1E5DA 3DDWA 3RVQA 1JQJC 1L5RA 1P74A 1KIMA 2BFCB 1ZG3A 2X0EA 1USKA 2F3SA 4TQGA 2BUAA 3AVOA 4LXGA 4M1KA 2RHHA 4FBMA 3HJBA 3BHJA 1A95A 2BEKA 2DLDA 2WU8A 2FR8C 1RTTA 1O2DA 4RU1A 5EIWA 2O8CA 1LPMA 1KQGA 2ZIXB 3QWFA 3OUZA 2BZ0A 3BTSA 4BNLA 2VSXA 5K6AC 2H8KA 1U7ZA 1IBMB 3EZ2A 3MJCA 4N76A 2YUTA 2JI4A 1OV6A 1WE2A 2NO1A 4LE1A 4PCUA 5FPTA 5TQ2A 1Q1AA 4BFLA 2R6AA 1TU3A 4J2HA 3I4LA 4IQ8A 2HU7A 3AEKB 1Q14A 3VZCA 4FP9A 5JH7B 3TIIA 4GO1A 3S40A 1E58A 5A1JA 1KJZA 4QG7A 1QGED 1T9HA 1XJ5A 1JBEA 4DDWA 1KK3A 3SHOA 2C1ZA 4D0RA 2DMRA 2C9ZA 3G2MA 1YQWA 1MO3A 2GLXA 3WHIA 1FFHA 3WQSB 5AOAA 2DG2A 3CKLA 3VTKA 3DZFA 1U5AA 3C97A 1RHQA 1Z0KA 4D5GA 1QG6A 1SBHA 1B4DA 5JXGA 1H0HA 2GAIA 3GJYA 3GR6A 4TV9B 3VU1A 5BN5A 4WCFC 3WI7A 2YS6A 2ZSJA 3OHPA 1Z82A 2DQ4A 2QRKA 3C3JA 1T9DA 3BCSA 2F2TA 2HNBA 3CBGA 3VDNB 3K6RA 4UVHA 4E30A 5I45A 3U9SA 5GONF 3PC3A 1E60A 1J20A 1RI4A 4G4SO 3FFBA 3VMFA 2PKCA 5ALUA 4BN0A 4JAVC 3Q0TA 1CVLA 1R8SA 2P69A 1TGVA 1CF9A 3O3MB 4OB7A 4PW0A 3HU3A 1VB3A 3GAFA 4Q01A 1NU8A 3C5CA 4WZAA 4XJTA 3RBXA 3W5HA 1LQUA 1XAHA 1J5XA 2NAFA 3N0RA 1U2ZA 4FMCF 3IAM6 3L49A 3R3UA 2VHTA 1RLUA 4ZO9A 3GGDA 3GRFA 1PFKA 2EBWA 3NTQA 1QYXA 5ALIA 1P2GA 2W5UA 2WJIA 1AK9A 3UZUA 3IQHX 3T7TA 1E3SA 3GFTA 2PWZA 3PX2A 4LF8B 3LXRA 3AO0B 1XMIA 4TYQA 4R5MA 4MWEA 4P84A 2EHJA 1KYYA 3PSHA 1JIJA 2JFHA 1Q3KA 2R79A 4F9FA 3AY7A 4GI7A 4MR7A 3AKYA 4PHGA 1HE3A 3PFNA 4WOCA 10MHA 3M6UA 1VXRA 1SCAA 4BV9A 5JAPA 4HNAA 1KI3A 3ZCRA 4JYBA 4IWXA 3RRZA 2BIFA 4GZLA 1UMCA 2I2DA 4KTTE 2FWRA 1A5SB 2W2LA 4H35A 3P97A 4HZIA 1H94A 4DF3A 1N0UA 1DTSA 2GZHA 5CNIA 3UAZA 2G82A 2DWCA 2D54A 1SU4A 1AN9A 1LI5A 3AX6A 4RM2A 4LDJA 1P1HA 2GEVA 4MW0A 1VG1A 1GCGA 1W87A 3EVDA 2HH9A 1UDWA 2FPKA 2ONJA 1F3OA 5JS7A 1GPH1 2GARA 2RD2A 1YTUA 4B6GA 2PGIA 5J2TF 1MG0A 5IFKA 3QLJA 5KSZA 3WSTA 4P4TA 1I30A 5AIBA 3LPAA 4LDPA 5DTMA 5T3UA 1MQ8B 1DX6A 2ZI4A 1B00A 4NJOA 1B0UA 1E4OA 3BA6A 4PHTA 4QYIA 4GI1A 4BO5A 2JK0A 4R1PA 4MAMA 1XZKA 4CM8A 4L08A 4D4MA 4DEXA 4QGSA 1E89A 3VR3A 1I4LD 4JKIA 2ID8A 4A0GA 1KJNA 1Q11A 4B3XA 4BCCA 4OMFG 4GPBA 1XDSA 1Z0SA 1QHHB 2JEOA 3ECAA 2HO5A 2GA8A 2NU6B 2VXOA 2XUGA 3P96A 4TMTA 3RSQA 3S2YA 1Z7BA 4HQOA 2WINI 1EE1A 1XHFA 1E2BA 1J0XO 3N2GA 5KX5F 3DT6A 2AX4A 1KNQA 3NHFA 4I9NA 4H0NA 3UJCA 4U0JA 2ONKA 1J8MF 1U2QA 2P2NA 1N5DA 2X9LA 4TZTA 4GLFA 1NP6A 4O1MA 2Q5LA 3AI7A 5SZJA 1R8XA 4R9NA 4FFBA 4G0QA 1DIAA 4UHBA 3WWPA 2QLTA 1PJLA 3ER6A 4PC1A 4BKMA 3K0AA 2BZSA 4DLPA 3L6CA 3U3DA 4N6GA 1R15A 3OWXA 1AUXA 1E7WA 2C9DA 2DULA 2WFAA 3DNFA 1ILWA 4HB0A 4P38A 4AAYA 1V35A 1XTRA 2YHSA 4S0XA 1PBTA 3CZRA 4QBIA 3ECSA 2WUWE 1DVRA 1TRHA 3LXMA 3WRXC 4NDZA 3OOWA 4AZ0B 2MSLA 5C5DA 3UPTA 4A36A 1WEKA 4MOWA 5CA1B 1KEWA 5K6TA 4TLMB 1P77A 1X77A 5AUOB 4LV6A 4DLTA 2QD1A 1L7VC 1W9HA 2CB9A 4HS9A 4Z4FA 3Q1KA 5K3FB 3OX4A 2CJFA 1WMEA 1M5TA 1J8FA 1L4EA 4O2AB 4DSNA 4JI4B 1E3EA 5IKOA 1DQZA 5BR7A 2VPYA 1JI3A 2WIKA 3BDIA 4TUYA 5KMGB 4JI5B 1UEJA 3IOBA 3IV6A 4NLLA 5CBPB 2Y0DA 3DH0A 3ZEIA 1IB0A 2QTVA 1HKUA 3B1JA 2EW8A 1JR6A 2P77A 4B0PA 1UBNA 4DLAA 3K0CC 5D3ZA 1Z56C 1GPJA 3AEKA 3LQQA 4K81B 4YONB 2OLKA 2XDQB 2PDAA 3HLTA 1KYTA 4EYSA 2YV1A 3T5DA 2FETA 2CZGA 3K1JA 4JOCA 3HY4A 4YJHA 5FFFA 4K6OA 3UV6A 4DT1B 2GYYA 3PU6A 4JP5A 4LYDA 1S4QA 3OC6A 3TNJA 1JSRA 3B53X 1G6Q1 3I8SA 5HHTA 1F4LA 2ZPAA 4PYLA 3RWBA 5IVPA 1VL8A 3GVCA 1R6BX 1RNLA 2OQIA 2PQ6A 3MJDA 3NGMA 5JD3A 4EYOA 3KYBA 3OWHA 2GLUA 1KY4A 3D7RA 1E79A 1NVKA 3EVBA 2IU3A 3B6EA 3MJRA 2WMNB 1D1SA 4JUBA 1JTFA 4BE7B 3RJ5A 1DEXA 3V4SA 1PT7A 1X1EA 2HRCA 3FM9A 3LX8A 4LG1A 2YWDA 4C6TB 2Z08A 5JQWA 1CVRA 2IUFA 3DA8A 4XVQA 2CUZA 1HT1E 1G20E 4ZK2A 3V80A 3E03A 1J4AA 4IHJF 1AMNA 5AW7A 3UV7A 3OO0A 5HRUA 1YZTA 2Q6OA 3C14C 1YZLA 2DJ5A 3DKKA 3NVAA 1X13A 3WGNA 3LYHA 1GQRA 5JEEA 1DLIA 5CVEA 2D8AA 2ZJOA 4Q9HA 5LZ5A 4UTVA 1B0ZA 1RJEA 4TZ6A 1X2EA 3PPVA 1G3UA 4FM9A 4BX3A 1T2NA 2NNWB 4O63O 1F1BA 2B20A 4EG8A 4QJ3A 4H6PA 3CZPA 4XYBA 4US1R 2PZGA 2P2ZA 1NUQA 2XF2A 3VO1A 1EFVB 3BIXA 3H1GA 3U4QB 4G5SA 3GNQA 3KC2A 1PQ4A 2ZCVA 3D2BA 5U9CA 3MAGA 4IF4A 4NG5A 2GGSA 1O3YA 3BCUA 3LYAA 2VHCA 4XLTA 3LECA 3UWOA 1T4BA 4RF5A 1IY8A 1FTGA 3RV4A 2ZZMA 4IG9A 1SCKA 3NJ8A 3IFSA 1KFEB 3SR3A 1N92A 1ZGGA 3VJKA 3N6XA 4DR5B 3C6BA 3LUPA 3A1CA 4HQKA 1YJCA 1Q7EA 2W2LD 3LCMA 2JLWA 2PJRA 1WLYA 5I9MA 4N3BA 2W6OA 3W5IA 4I7EA 1M2VA 2XE4A 2BFPA 3WQHA 2QZJA 2VO1A 2PLRA 3O2SB 4N6NA 4IH9A 1BKSB 2IX3A 3OPYI 4P4GA 3KYDB 2PUAA 3B82A 1HL3A 4C7MA 2BGGA 1GEGA 1GXSA 1U4SA 2AYZA 2HWKA 2VATA 2RHOA 4E32A 2JJQA 1MC4A 2H0QA 2W90A 1CZUA 2B4RO 2GF2A 2TMKA 3F4BA 5F7OA 5IVIA 2FPUA 3IQWA 2BFDB 3P71T 3AQ4A 1BQEA 5DTQA 5H4HA 3KZCA 2GO7A 2NACA 5H7XA 3V3KA 2Z9BA 1P8JA 4EI7A 1QCYA 2R8OA 1UFRA 3TX6A 3IP5A 3P0EA 2V5VA 3ROXA 1CS0B 3QUBA 1BX1A 1T5DX 4JNCA 1BXKA 4PAMA 5CA0A 1Y3AA 2EQAA 4HWSA 4QRHA 3E9QA 1KZHA 3CVUA 4DVGA 1HNXB 1AGYA 5JCPA 5ALYA 2P4HX 3SWWA 5EEGA 5A6VA 1OLSA 5LMZA 1TEHA 3CLKA 5EG5A 2YR0A 4J7CA 3DTYA 4DSAA 3ZXYA 4NK5A 3IJPA 2W48A 1YL5A 2GVZC 2HBQA 2IYNA 1JG4A 3H0KA 3VNBA 1USUA 3QKIA 3ZIAA 1XKQA 3A1DA 5LB4A 3E7XA 1A4RA 2YUIA 4S1PA 3UATA 1C81A 2XB2A 2FPSA 5GOZA 2VAWA 5BQ3A 5GV8A 1U5BA 4U4AA 2J9YB 1DJQA 2IV3A 5KWIA 3VYRB 1ZC4A 3FNFA 1NN3A 4D0LB 4ALNA 3QLVC 1PR2A 3K5HA 4J1NA 4WXMA 2BUBA 1HEIA 2WHQA 3AUUA 3B6KA 4ZD6A 2FTKE 2EQBA 1RHJA 2C9MA 1TTPB 5KREA 3IXMA 2ZI5A 1W0KA 4NNJA 4FIDA 1P7ZA 1Q6YA 3OJOA 5D86A 2CLIB 5FTLA 4F9GA 2PLFA 3QLEA 4RPGA 2ZI3A 4YR7A 2BKXA 4MYRA 2BSAA 4ED9A 3DDCA 1WBBA 1G1MA 5BNIA 2JAWA 4IMRA 4EENA 3Q72A 2J0EA 4ISCA 1XXHB 1WUYA 2HA5A 1T5LA 3EBLA 4TUYF 5CH8A 3USZA 2YWJA 3W2GA 4ZAGA 1E3QA 4IEFB 1T1IA 2RONA 3TZEA 3U0BA 1NYQA 2ZSAA 2DEUA 4MS4A 2G1PA 1Y63A 2M1XA 3B1WA 4ZAWA 1DEAA 1L5WA 2JFFA 1D9XA 1XEWY 1BDIA 3FHTA 2AFHB 3PE6A 4ZHSA 4BX2A 2PUHA 3HVJA 3KX2A 1SC3A 2OV1A 1J0AA 2Q2QA 3CCBA 4IJKA 3S1AA 3TW4A 3WBFA 5LQRA 2Q8NA 2PGDA 3FUUA 1WJGA 4O3FA 4V1CB 5CCXA 1ZIXA 5DTRA 2QD2A 3N87A 3S4YA 3PB3A 4KACA 1N3YA 2FEPA 2ZTUA 1W9MA 3I9V1 3ZTWA 1NT4A 1YB7A 1CUIA 1OWMA 3BX1A 2QBYB 1W76A 2QL6A 1WU8A 1VPEA 3OESA 3ZKWA 1I4TD 3QITA 3TMKA 2B5OA 1JRLA 2ZG6A 3C48A 4I8IA 5BN3B 3DKRA 2I6QA 3B3FA 4NWIA 4RZHA 4KTVE 1GCAA 4K9PA 2EIHA 3SYMA 8ABPA 1W25A 1HRDA 3OSZA 3JQ6A 3IR5A 1KZGB 1PE0A 5KAMA 5KX5A 2WOJA 4YROA 2DHRA 2PTHA 2W2QA 1RQ2A 3EA5A 2Y9PB 3O2JA 2X5XA 4FMDF 1NU6A 2YTZA 1P2UA 3OZGA 3M3PA 1JHYA 7REQB 3BXHA 2PSSA 3U4AA 5I8PA 2CJWA 4PANA 4AYWA 2VR1A 4C0XA 1WTCA 2EJUA 5AVRA 1U8FO 1NOIA 1Y6ZA 2H08A 4J0EA 4YJ2F 3ZY5A 4E4TA 5F12A 5IDWA 1BDHA 4LFAB 4BJ3A 4NYJQ 2NTNA 2PWAA 3IHKA 3KJZA 3KHKA 2QROA 1SZCA 3D8HA 2P6RA 3PC4A 2Q3FA 4QQ8A 1ETHA 2P6MA 1KMNA 4LJKA 1DEOA 4ND5A 1N78A 3OEED 1Q83A 5AYVA 1BFKA 3EA4A 1JWBB 2YH2A 3R3VA 1S2NA 2QV0A 4FFNA 4PYMA 3M34A 2YYZA 2RJ3A 3H04A 1YGPA 3N0TA 1SB9A 1A9XA 1F5SA 2DFLA 4EJFA 1J8YF 4FUTA 3WNZA 1W36C 2OV4A 2JCYA 5DBEX 1YB5A 4MW1A 2P2LA 4J0JA 2XOKA 4HAXA 2G9NA 4XWWA 2O8EA 3FPJA 1DRVA 3HI4A 2M1ZA 2W2VA 4PO3X 1VHDA 2VAVA 3HSYA 4M7WA 3WRYC 2AQIA 4YRNA 4KNWA 3JRNA 1G8PA 1JB9A 2EFJA 2HMUA 4G1MB 4Y7DA 4ALIA 3O91A 5IJ0B 4QJBA 3MF4A 3NC0C 4NS1A 5FL7D 1TJ5A 2Z2KA 3RO7A 3IVRA 5DLQC 3L6DA 1HTWA 4BC1A 2VXBA 2R2AA 4LF5B 1LF5A 3PZRA 1TEZA 2FHSA 1G3QA 2DLCX 3QJGA 4GLLA 3SICE 3NBMA 4MR8B 4BNVA 5C1OA 3RBZA 2BELA 5AVWA 1PDVA 1AE1A 4DG8A 3EXG1 5T4BA 3DVLA 1K6JA 4RHXA 5CA0F 2Q0SA 1TYBE 3EA0A 2W7TA 2EYUA 1BRTA 3E9RA 2XE6A 1MRNA 5GGYA 2V7QA 4BPBA 5DYNA 5HIKA 4I1PA 4AZ0A 1U0NA 2IYLD 1VLHA 4GQIA 5EWLA 1UFVA 3LS2A 3MFYA 1JE1A 3SKXA 4QUBA 1WDTA 3LFTA 3K6JA 3DV2A 1YXMA 4I9HA 1DKNA 1DV2A 3DM9B 4MX8A 3TLCA 4CHGA 4HMQA 4GLOA 5ALJA 5SZIA 3MJTA 3ZV6A 4Z4EA 3PQ4A 4LHVA 5JSKA 1IBCA 1VP9A 1WO8A 2D1TA 3EQ6A 4MUBA 2PZFA 5ICMA 2JLXA 1C1XB 4LY0A 4OQDA 1ZD2P 2EATA 1ZS9A 1NMQA 3T6KA 3QK7A 3IR7A 4JVNA 2WWWA 3ZHXA 4EA6A 4CIYA 2XVXA 3EQ9A 5TQJA 4P58A 2QD5A 2JBAA 3N8IA 2PX4A 1ST3A 4J0QA 2BSQA 3L04A 1C8VB 3WK7A 4HATA 1BE8A 1IONA 3LSYA 3NYWA 1CY1A 1QLHA 1XOIA 5LQKA 2XE8A 3RAGA 1VPTA 3GLHA 3SAJA 2E4XA 2H4JA 2LD4A 3G88A 3MWYW 3STHA 1RXYA 2XXBA 3IKVA 4G01B 2DFTA 4N5MA 2FZWA 3JAMA 2IYRA 3D5TA 3WXBA 3VR6D 3S8EA 3BF8A 4K05A 4FX5A 4B8WA 4D9HA 1I7LA 1UOPA 2DVMA 1U1GA 2F59A 3GFGA 2G09A 3AJ8A 3RAFC 2Z83A 2ZIGA 3A10A 4OBWA 4ZJUA 2BI8A 1ZKDA 3IXLA 1ZNZA 2EBFX 4RLHA 4W1SA 4PYRA 1FTNA 3LQ4A 2EZ9A 1KI8A 4EHFA 1HE2A 3TRJA 2P65A 1WW3A 3TGPA 3JAWA 4GR9A 1ZGCA 2XXJA 3IA2A 4UNPA 4JQSA 1G7CA 4BLTA 3UBMA 2GJ9A 1KMCA 2F3UA 1XHEA 2I54A 1YCGA 4V0NA 5J5AA 4B6OA 1UFOA 3FTCA 2BN4A 3K1YA 5I8ZA 1UP6A 3VPBA 1FSGA 4YPOA 4WD3A 1E9SA 4Z7OB 3BMOB 4RL6A 4FFLA 4X8LA 1SZJG 3DEZA 2OQVA 5C7YA 4HB3A 2GBPA 1V8PA 3HN7A 3HXLA 1ZH4A 3CLRD 1A77A 2GTPA 4MEAA 1YKGA 3TJRA 3Q41A 1BKYA 3LUKA 1GCOA 5LA6B 1F2DA 4XB6B 2PL5A 3LX4A 2BSXA 3FUXA 4ZVVA 3AUKA 1G5RA 4A92A 2P5SA 4W99A 3D8TA 4X1KA 4RJIA 3PVCA 3U4QA 5I9SA 1V11A 3NYQA 4IH1A 3JTEA 5YASA 2G4VA 5DSXA 1MVOA 4NSNA 2ATIA 3V5NA 3QPBA 3WFJA 1SXJB 5IYZA 4K6KA 1YMQA 1SUAA 4MWZA 2YFYA 5IK2A 5CDGA 3HMKA 4FB5A 1O0BA 1HO3A 2F6RA 4ECAA 2V7PA 1IQUA 2I1VB 3FKQA 3NDRA 4NCBA 1WBJB 4ARCA 1IZ0A 1G18A 5LD2C 1ELOA 1W5EA 5CB6A 4CIWA 1JEYB 3G9ZA 1E1CB 2PX2A 1DQYA 3JQAB 4BFUA 1XLWA 1WPRA 5E1MA 3KJFA 1EZZA 1YVUA 2XADA 3GCGA 1DPGA 2F3TA 1WL8A 2I3BA 2ZM5A 1KS9A 5F2NA 1E2KA 4O4LA 3K35A 5IAEA 4XW2A 3QTTA 1IUOA 3CUVA 3SSMA 2ZUWA 2J3HA 2P40A 1JEEA 3L77A 2VBCA 3OAAD 4OGKA 3UFBA 3ZEAA 4YRZA 5DH9A 4A2QA 4JD5A 1IHOA 1XB2A 1Z2OX 3EXEA 4CKWA 3MT0A 5TT1A 3THXB 1ZJWA 1YS1X 4JSTA 5EYPA 3KBBA 5F1PA 5LP6A 1ACJA 1AKMA 1I5OA 1SQ0A 1QP8A 1KO7A 1C7RA 2ZAIA 1FDUA 3C6ZA 3COVA 3L8HA 3KPWA 2H48A 3WSWA 4BWGA 1DKOA 3MG9A 1KJ9A 4RTRA 4PSAA 4K2HA 1IZ7A 1YQQA 1YTLA 4N8SA 5AHRA 3RUHA 1TEXA 1YA8A 3RSHA 2PXCA 3PFFA 3P20A 2JJ2A 2V58A 3G13A 4G0VA 4NX2A 3GPCA 1IBRA 4MGZR 4DPMA 3VSBA 4RPJA 3SHQA 1ODIA 3BRWD 2ZQ5A 1BXRB 4GF5A 4M22A 3SZUA 3BRQA 1J70A 2WZDA 4KR6A 4RADA 1UINA 4EQZA 5K3BA 2BKUA 3I37X 5EE3A 3B89A 1L5GB 2WRZA 3NM4A 1U4NA 3ZJTA 4X62B 1CJCA 5FUXA 5DTJA 4DLWA 3Q7IA 2RKWA 3GFSA 3SEAA 3ZCUA 1DTWB 2HB6A 3LDHA 3H1TA 2WJ3A 4EY5A 1YRBA 2ID4A 1GTG1 3AOGA 1W8DA 1P5JA 2ZBVA 5FPQA 4BLWA 2BMFA 4OHWA 3U40A 1NRJB 3FPKA 4XVHA 1UIRA 4FGKA 4L0QA 1X1AA 4M53A 4TXHA 1BW9B 4J3NA 3RUAA 3ZHUA 2Q1XA 2F4NA 1J8QA 5NLLA 3UV3A 3TQFA 4QDOA 5FI5A 5ELXA 3VR2D 2IHZA 2F8TA 2V7EA 1ZOLA 1YZHA 3FPAA 4WK6A 3H83A 4OH7A 4Q4JA 3FZNA 4F4FA 2IW3A 4CKZA 3NP9A 3VQTA 2QGZA 5I3ZA 5FT9A 1IN7A 2VHWA 1QTNA 3UWPA 3TF5A 2EKPA 2HCFA 4D3XA 2CE2X 3GDOA 3L79A 3DONA 3ZWPA 3EB9A 4OYLA 1G2IA 4F2GA 1VTKA 3O6VA 4DNPA 3GLGA 1JPUA 1KIAA 3LUJA 3RRMA 3IUSA 2JARA 2HIMA 4HJRA 1FDRA 1V9SA 1JMYA 3Q87B 2W4QA 2X4GA 1SUCA 4IY1A 4II7A 3VZQA 2FW7A 2KLBA 4IVRA 3RT9A 5H3LA 4EGJA 1ZK2A 2C95A 5EOVA 2ZRIA 4ZVUA 1P60A 3O1IC 2OHGA 2XGSA 4MRMA 3GLIB 5KNBD 3KVNA 1PWHA 5JYBA 1MV5A 3AR6A 1JPJA 3EFBA 1FZTA 1PRYA 3UK0A 4H7IA 4Q66C 4YIHA 1N8KA 3GNTA 2VP6A 3FWKA 3M5WA 2GKGA 2OR3A 3F46A 4LZLA 5K8JB 4C6HA 3H65A 3VR2A 3OJEA 2VNIA 3TM4A 5IVDA 2NLOA 2HSZA 3VAAA 1JPVA 4D9CA 1A3CA 1HNWB 1EX1A 1X3LA 1OXKB 3D7MA 2FRDA 1ICEA 5CM2Z 1IM8A 4OSPA 4H0FA 2WE7A 2ZDHA 1NRXA 3FYCA 1HYEA 1E6KA 4L4RA 4RK7A 1YIOA 1KBOA 1DCTA 2E48A 2Y67A 4NE9A 4KKVA 2G88A 4CKEA 4NPHA 1ZGJA 3QWHA 1EUCA 4NIMA 1YA6A 1YZYA 4FYHA 1CR2A 2I3ZA 1QF7A 3QFSA 3NTVA 4Z9FA 2EGUA 3PCXA 1INLA 2C3YA 2G70A 4DYVA 2G0TA 1H2FA 5LOVF 2C7OA 2PA3A 2IT1A 2JL1A 5EGSA 3KZOA 2Q1SA 3OJ0A 4URWR 3C16C 3GCZA 4DV4B 4BNXA 5CIWA 3HNPA 4Q9DA 2IXFA 1SM4A 4BJHB 3IUQA 3QX7A 3HWX1 1IDOA 4PM4A 4RMJA 2GEFA 5EIXA 1Q7BA 1ZIPA 5BV1A 3PR2B 4BAUA 5TRTA 4TLCA 1GZ5A 2H7XA 2DQZA 2JGDA 3HJUA 3KT8A 1T26A 3CRMA 4LOJA 5E4YA 3LY8A 4WZBE 5MGNA 3T0GA 2GCNA 1DEHA 1ACLA 5K3AA 3WWYA 1XMVA 3AOEA 4HLDA 4MUEA 4EKNB 4QD3A 4B76A 1TK9A 2OO5A 1P61B 4CKXA 4OBXA 4WDRA 3RLFA 1ZLXA 5SZKB 4NRDA 2J6IA 3AESA 3KO8A 3GLQA 3QVTA 1N0IA 2PKRA 4ZARA 3ERCA 3WL3A 5D5QA 3B6JA 2OCKA 1T0UA 4PS0A 4OUKX 4PXYA 4E5SA 2Q3CA 1SCQA 1EXNA 5FQOA 3LE8A 2F1IA 1KQOA 4R84A 5DCUA 4LSMA 4PRZA 2BM0A 3QXGA 4MP3A 3X44A 2G76A 1A97A 1I1HA 4DIMA 4IIJF 4ZYWA 2QM8A 4NH0A 3NDIA 1QC5A 1E7YA 5EIEA 1TD9A 3EWIA 5F2EA 1TUBB 4X6YA 1E1YA 3NEAA 1HDRA 1LJUA 1YS9A 4MEBA 4FYKA 2F3PA 1L7EA 1UXIA 2A7QA 4JIMA 1I2AA 3TLBA 2O3TA 1WZCA 3W78A 1NRWA 2Q50A 4G5QA 4ZKEA 3U3ZA 1CP3A 4OBEA 2J5RA 2ZJYA 4GOND 1RQ7A 1PSZA 4LRSB 1FMCA 1JU4A 1GV0A 4AM8A 4EMTA 5B7GA 4ZT4A 3QEOA 4FR5A 4EY6A 2WSLA 1X8XA 5EWJB 1P4SA 2VI5A 4UDNA 5GJVC 3HUEA 1OH7A 1XD8A 2P9JA 3S44A 5ICSA 2GD0A 1GNVA 3E1KA 2CXUA 3DAPA 3ICWA 5DE3A 4EDHA 2ZXEA 2V4MA 1FJ2A 1T8TA 2QU7A 5ERYA 4O4JB 2VOJA 1XD9A 5IH3A 2M6KA 3A37A 3OCXA 1YCFA 5IJAA 3TOXA 1YZUA 1PZNA 2ATVA 3HCWA 3VVCA 2QAGB 1A50B 4ZVTA 2BLNA 4REQB 1IPFA 1HC7A 4QWWA 2OMEA 1LV8A 1S5PA 1I4DD 1W59A 2WZCA 3ET4A 4XR4A 3L06A 3CY6A 1YRYE 1PZGA 4CQLB 1AA6A 4F97A 3ACCA 1THZA 1ORWA 3KS9A 5CPFA 3LUDA 2F43B 2ALJA 2K6GA 1Z5OA 2DH6A 4IOMA 4TYWA 4A8PA 4MPJA 3TSCA 3I39X 1NIJA 3ECCA 1YRQA 1ZP6A 3LH5A 3QKTA 4W5NA 1KQ3A 3P32A 4TQUS 3FLMA 3BQNB 5TVGA 1BU8A 4MLCA 3PI7A 3BT7A 1Q0HA 5KNCH 4GBED 2Q3MA 1MUUA 2QEQA 3E05A 1Y1SA 3WDKA 5KTYA 3EHEA 4RKQA 2J3MA 2JZNA 3VR6A 1VFNA 5FIUA 2C4TA 3K1ZA 1X80A 3KR9A 3STXA 4WZBA 4FYXA 1GG9A 1Q6ZA 5A4MS 1XZEA 4HDKA 3IEVA 1EQUA 3RSSA 3ZH9B 1BVYF 2IPLA 4JBYA 4E1AA 2ZB8A 1GDHA 1V1MA 3EW9A 3I3SR 4RKEA 4AWBA 4R8MA 3ZHRA 1O4VA 2EQ5A 3FSEA 3H3FA 4UVEA 5KKAA 4DS3A 1PYOA 5AWFC 2CXTA 3I2KA 3T3EA 1DRUA 4OMCA 5F2KA 3ICPA 2A9JA 3L7BA 2ZJ1A 1Q2UA 1P9OA 2A9QA 2QW0X 2OORA 1LA2A 3ZJ5A 4ARUA 3MTJA 3KWJA 3ZXIA 4XTRA 3AI3A 4DILA 1LLUA 2GOYA 4QELA 1NR1A 1TYAE 3FMPB 3UCEA 3U26A 3ONFA 1OXSC 2BMVA 2X76A 4FOPA 2XTAA 1G60A 1S02A 1QFYA 5EIBD 2YW9A 1FOEB 1M6WA 1Z6ZA 3OMLA 4Y30A 1DU4A 3IERA 3WDSA 4PBSA 1AO0A 2QRQA 3KQWA 4CTMA 1PS0A 2QR3A 2LV8A 4GPAA 2VT6A 3IQFA 4BMOB 1IHUA 1S6YA 2OZKA 3B3QA 1Z22A 2XCTB 4LF9B 4MUMA 1E6EA 5GM1A 1FQKA 4EJ6A 3LBNA 1U3GA 2WHEA 4IJQA 1V4BA 2FKAA 3OLYA 2GFHA 1LZKA 3PWKA 2FUKA 2Y93A 5LBTA 3FLAA 2BFOA 4A2CA 2GN1A 2X7XA 4TYNA 1SEPA 1EH5A 2V8OA 4G1EB 5DT9A 4BAZA 3F73A 2X19A 1TCAA 2RB4A 4J0KA 5C9ZA 3HFRA 1YC5A 3NOXA 3AUXA 5H3CA 4DNOA 4PY2A 5B3JC 2J33A 4UHCA 3PUHA 1J56A 2P9BA 3LJKA 1VL2A 3PI6A 2AS0A 1XZLA 4Q34A 4Z3DA 3STYA 3RVNA 2J3DA 4E70A 4OX9B 1QXSA 1CLUA 2ZSIA 1UPUA 1PT8A 1OZAA 2WP0A 3AP3A 3FI9A 5CXQA 1CERA 4A73A 3GDHA 2XWJI 2ZYTX 3MK31 3H3XA 5AW3A 2HV9A 2PK3A 3EEFA 4JLDA 1IXKA 1SUWA 3H5VA 1RRGA 2WTUA 3RREA 1JHPA 3S27A 4HRAA 2IHBA 3H5RA 3PFKA 5ICFA 4DANA 2WYWA 4YUZA 3AP1A 4K9KA 4B4VA 3W9SA 1C9KA 4KR0A 5BMOA 1O5IA 1LFAA 3F3YA 3ZLBA 1N6OA 3G5UA 4E4RA 1H85A 1MU0A 9MHTA 1M1XB 1GTSA 1AK1A 1DMSA 3HO8A 3E0QA 3ESAA 1TM1E 2ZJ4A 3FSRA 1ZESA 2H4FA 3KKOA 3LZCA 3IUMA 3R0JA 1XZHA 1YJQA 1FDIA 5CT6A 4ZHQF 2TMGA 2QVXX 2YV2A 1JU3A 3G8YA 1U0HC 3OHMA 1G9XA 3OURA 1V5WA 4QDXA 4W1QA 3OC0A 3P4UA 4COOA 1J06A 4D3ZA 3GAMA 3LP5A 1OZHA 2OGTA 5FYQA 4QG3A 5LSAA 3PV0A 4IW3B 2HPZA 2WJHA 3LCUA 4WKCA 4AP9A 2AHOA 4EF4A 4U0KA 2IELA 2D5BA 3O8NA 1A88A 1BMQA 1KU6A 1CFJA 2BDTA 5I5EA 3WLSA 3Q2KA 1TT5B 2CKDA 1P1KA 3JATA 2QQ0A 3KWLA 4HMPA 4C0JA 5HZMA 4DDVA 2IH5A 1A8UA 3MMNA 5H16A 3PFIA 1GKIA 1H2EA 2AN3A 4Y9TA 4I3HA 3ESBA 3KHUA 4X95A 3M82A 3VPHA 1Z2EA 2CL7X 4BX8A 4QNNA 5FUMA 4YQFA 3COSA 4NOKA 4XDHA 4F46A 1SKAA 1APBA 3HJCA 3IUNA 4IXMA 1UM8A 5JT1A 1PKEA 1SVUA 2O0LA 4EQ6A 1QG4A 2UZ1A 1U2GC 3F6CA 1ZJZA 3GI1A 2PL3A 1H2ZA 3C87A 5LYJB 3LL7A 2FFJA 4UFOA 5TQ0B 4CMCA 1GRNA 1IATA 3OTHA 4EEXA 4MR7B 3ZW7A 4TTIA 5JZOA 1WABA 3UXHA 3TI7A 1ZRSA 1FZQA 2OB2A 1FFDA 2AFIB 1OLUB 2ROQA 1P44A 5CTJA 1LBHA 2H1HA 1SCBA 3HCCA 3M6AA 1F2UA 1E96A 1YUNA 1C80A 3D0OA 2QB5A 1P91A 3HWWA 5K8IA 4UUOA 5GMOA 3T9FA 1W5TA 3U7IA 4CV2A 1NFRA 3L6EA 5JASA 2MOKA 2V6BA 4OQQA 4TT8A 4UUMA 2A1IA 1LVGA 4Q9JA 4BL5A 1A7AA 3FMGA 4MTCA 3SR4A 1K4MA 3K09C 1U0OC 1PW5A 2Z56A 3G59A 3RFXA 3VU8A 1LDBA 2YFQA 3DHYA 1AD2A 1U99A 2GQ0A 2ZOSA 4MWSA 4HT3B 1D2GA 3AFNA 4KBFA 4U00A 4L3VA 2GBLC 2AD5A 1GPWB 7MHTA 5EIHA 3VC3A 5I4IA 1W93A 5KTMA 1XYYA 4IIJB 3SY8A 1EJ6A 2HJHA 5ALVA 1JJVA 2YRXA 3W77A 2VDWB 2FNAA 4WFQA 2RAUA 3AF0A 4IJ5A 3VO2A 3NASA 2VUTA 2W43A 3CX4A 4BMNA 1YT5A 3FHOA 1PYGA 3ESQA 2PRZA 1I24A 3QELB 2CK3D 1GYQA 1P3JA 3CPJB 3KJNA 1CQXA 1VL1A 4JSRA 3TK1A 1K8RA 3ZIAD 4EGFA 1E5XA 1HYGA 3D8BA 2QN7A 1U94A 821PA 1U81A 1VIAA 2G36A 4WNIA 2GSDA 2X2PA 3PJEA 2NSYA 4GZMA 1K0UA 4WKBA 3VC7A 4B3JA 3ADCA 4HZUB 2R65A 3A58B 1J42A 4B45A 2BLLA 4O0LA 2NO0A 3K9CA 1MEOA 2WP8J 3EGOA 4DY6A 3FHLA 3Q6NA 5CFNA 3EISA 4I9FA 3IPCA 1SUIA 4I1VA 4R1UA 1GLNA 3K0AB 4RULA 1DX4A 3L01A 1U7TA 1WD7A 3IL2A 1ZD8A 2VDVE 2ZUVA 3L7AA 4YBZA 1Q7CA 2ZJ2A 3E61A 1ZIYA 3RBVA 4DXAA 4RANA 2IW1A 4C7VA 1CIPA 2BFMA 3OOEA 2H59A 3E7WA 4WNCA 2DBQA 2WJ4A 5AW4A 1TTTA 4IHKA 5C51B 4YP7A 5A0VA 1XZNA 3F4KA 5KOJA 4OREX 5FHRA 4QZVA 2Q27A 1QC5B 3G0GA 3LPNA 4DMUB 4DTIA 3FGOA 5AUPB 3BD9A 4ALMA 2K2WA 3VISA 1OHHA 3ZHBA 4HGPA 5K0FA 5IDYA 2IYYA 4KOEC 3W6UA 3X0DA 1PUIA 2QVYX 1LDGA 1LSSA 3OF2A 3GLSA 3E3AA 2PPLA 4Y1RB 3GLUA 4A9AA 1H5QA 2DQYA 1EIWA 4LDZA 5AM2A 4N7BA 2WAAA 3T3PB 4CM4A 1LPSA 1WPQA 2KLHA 2M32A 3NT2A 5EIBC 3KLMX 5BN5B 3BRWA 4QYTA 4Y2JA 1P5ZB 3BMXA 1H3FA 4IIHA 3V32A 4BOYA 1UL1X 5AKHA 2HU5A 1YRAA 4WJZA 1KDTA 3JQCA 4RD2A 4XDYA 2QXTA 4YRJA 5BR4A 1KEZA 2AOWA 4BB6A 4OUDB 4CM6A 1N5LA 4AMUA 1Q1GA 1QTIA 2LIPA 2QR2A 3LUFA 2IQIA 3HUUA 1DINA 4IDPA 4YUVA 1JZTA 4YC7A 2P79A 1BMFD 1OXMA 2QAGA 3PUIA 4E51A 1EX9A 2NYAA 3VJLA 1FW6A 3DV0B 3TXXA 5HFJA 2HA6A 5JZSA 2O2IA 3JATB 1D0VA 4C3OB 3ON5A 4Q9IA 2Q5IA 4B9EA 5A4DA 5EJGA 5JZBA 2P2CA 4KBGA 5EJ5A 4QBKA 3UT5B 4I4TA 4YFYA 4YDQA 1O6CA 2EP7A 3MHPA 3VR5H 4I4NA 1V8FA 1XO1A 4HQRA 1NR5A 3L0BA 3UF0A 1AV6A 3FY4A 3MWDA 1ZICA 4KODA 5AM1A 5HMLA 3VC2A 1QQBA 4O5AA 2Q41A 3UOWA 1IBSA 3AG6A 1Y7PA 4QOEA 4PZEA 3WYNA 5BW6B 2OKGA 1H2XA 3CWQA 4C22A 4DJFC 1E2HA 1OU0A 1YS4A 3S1LA 2DHQA 1SD2A 1UFQA 5JIBA 1JIKA 2YMPA 4C4YA 3SQWA 1C9DB 2OT3B 3DR3A 3T4XA 4B35A 5CNKA 1QYRA 1U0EA 1H9BA 2IYOA 3IAM1 3LQYA 1X7WA 1Y1RA 4GBGA 3O8LA 4I5EA 2LCQA 2ZSEA 4TTRA 4H4DA 3FFWA 3M89A 2G5CA 1UADA 2QTWB 3BPSA 3MWGA 1P72A 4IQ0A 1NG1A 2OAEA 1PG5A 3RFTA 2E4ZA 3TLGA 4EI2A 2EW1A 5KNBA 4IGFA 2IHVA 4NV0A 1G8MA 3CRRA 3CU5A 3KZXA 3M1YA 4OQNA 4N0PA 3HEMA 4Z6KA 1E2NA 4OM7A 1VL6A 4RD6A 3ABOB 1REQA 2CLOB 1K06A 3C7DB 1VJ1A 4HNRA 3RROA 4D82A 4E08A 5LP6F 3E3MA 2PUDA 4D4GA 4Q3NA 2BY4A 4QYIB 2H5JA 1P19A 3DEYX 1BYIA 4ROSA 1W1IA 1M2VB 4AJJA 4BLQA 4GSYA 4ER5A 2YRFA 2ZSKA 2ICAA 3DVSX 4EA9A 1FUKA 2AK2A 4AZWA 4EPYA 2P5TB 2Y1OA 1UKEA 2ZT8A 4FR2A 4G65A 4QOJA 1GV1A 3IDSA 4R05A 1Y42X 1EXWA 3G02A 3FUTA 3ZJYA 1DCKA 1KK0A 1P75A 2OXCA 3DBLB 4QEZA 1CX9B 3CVJA 4TS9A 4X20A 3RK4A 3FPCA 4WXHA 3THYA 3QELA 1FUYB 3IEXA 5EIFA 1I14A 1Y8ZA 5EP4A 4G5FA 4PQEA 3ADDA 4GKJB 4HB2A 4J03A 4M9CA 1Z5GA 1XKXA 4BQEA 2GAAA 2E4YA 4BTVA 1KZ1A 4OD0A 4YCSA 2PS1A 4D92A 3LF1A 3AU8A 3ZNOA 5HRAA 3VKHA 3VHXA 1YDFA 3AF5A 4LIPD 4MYDA 1UBMS 1ZW6A 2Z6VA 2ZVDA 3T4PA 2WUFA 1QOZA 5HKAA 3GARA 1GTL1 3DBHA 4DWWA 2NXCA 4DQXA 3FTFA 3IOYA 3ZJ4A 4W9NC 3EN0A 2EBUA 4RVGA 3L7CA 4X0EA 5FOWA 5JI3E 1A7JA 1Y7TA 1RLIA 4LFBB 1D6NA 1FE8A 4V0KA 4LSGA 1X39A 1W0JA 2HXGA 4HRVA 5BV2P 1XG5A 2FLWA 4J4BA 4ROTA 4UNSA 3GPBA 4ZAYA 1MO4A 4YQZA 4BMCA 5JC1A 1DV1A 2Z2JA 4QU8A 3BGDA 5IKXA 2OZLB 4PFSA 5KTKA 3GOHA 5F1KA 1M8GA 4G07A 3GPLA 4EKIA 4CEJA 1EVQA 2PD6A 2L18A 3BMCA 2PT5A 3I6ZA 4KO3S 4HPJB 1VKRA 4AMVA 3EXHC 1Q0QA 4E21A 1ZI8A 1DO0A 2P6UA 3CC8A 3S8MA 5KWVA 2FG5A 4ZOEA 5LMNB 2WT4A 4ANFA 5C4MA 3O4IA 3GXBA 2V9CA 1IOVA 1CJSA 1YQDA 2VA9A 2X3UA 4NABA 2GKOA 2PH1A 2BJWA 2CLKB 3HKDB 3I30X 5CMLA 4XUDA 3USES 4CIXA 4D43A 2BYTA 2WNIA 4BGIA 3GDWA 1X1TA 1KRHA 3C3BA 4Y2PA 2NGRA 3LRPA 3PR1A 5REQB 3SN6A 1DC6A 4YRAA 1K1EA 1ES9A 2CV0A 4JT4A 1QR6A 3F3KA 4BE4A 2VZ9A 2H4ZA 3TQHA 3GJRA 2FN9A 2WHPA 5J59A 3VAYA 4FUQA 3ZYZA 3GAAA 2V6IA 1QO0D 5FJJA 3F5SA 1FMFA 1X6VA 5HQTA 4ZZ1A 2XE7A 4I1YA 2C4HA 3T41A 3ZGXA 4UHJA 4BEVA 2I4RA 1T24A 5LKAA 2Z2IA 3A05A 3IMGA 2C3OA 5SYMA 5JBNA 2FWJA 2UYYA 5ALPA 3U44A 3I0NA 4PYJA 2VHUA 4YRBA 3D8RA 3OM1A 2JLBA 3FNHA 3N58A 1ZMRA 3G2OA 4V0ME 4G5YA 1YK1A 3M4ZA 4JUFA 3KDPA 1GQSA 1ETUA 2ZBFA 5DHUA 3MCTA 1DIGA 2JD1A 3QUTA 4FMCB 1T9AA 2C1EA 2P9YA 2WMDA 2Q4OA 3ILSA 4JLMA 3BWDD 1Z2DA 3L18A 1EFVA 2XWBF 5CD9A 2W71A 4Z0PA 5K8LA 2Q5CA 2F8MA 3F7NA 5JS6A 1IL0A 2VSYA 2P1RA 2OPBA 1VQ1A 3SZ3A 3W9YA 5CNMA 3A6EA 2HQ1A 3G3EA 5IU6A 1VG8A 3FZQA 3QLUC 3AY6A 5G1PA 5HS4A 3ZGLA 1NSTA 2VNKA 5JPCA 4E2FA 3DLTA 2GYVA 1BU5A 4R8SA 4ZCRA 1RSZA 2O20A 3SYNA 1R4NB 3VVBA 1JLSA 2FW6A 2OCXA 4KFSA 4D74A 4X90A 3OQNA 1L8QA 1N8SA 1RI5A 2JKVA 5HIIA 4X64B 1CQZA 1O6GA 3BSWA 3DZKA 1SC4A 3L7LA 5K6AA 4YACA 1QKJA 3V8MA 3HHPA 3FOFC 3ANSA 4M49A 4CG1A 1ZCAA 4IRMA 3JQBC 4G41A 3WKCA 4BP1A 3C3PA 5ESDA 2DUUA 2NT4A 5IX8A 2WD7B 1I3LA 4RGYA 1F20A 1WHSA 3PIRA 3G6KA 4PG5A 1DJLA 4RV5A 4TLDA 5FAXA 4UEOA 1VKNA 3RW9A 1SULA 3RHSA 4CUJA 4CWAA 4C7JA 4IFTA 1YIDA 3CPSA 1ZU5A 4TTPA 1L0BA 3BD6A 1NJGA 4R01A 1W88B 3T7KA 1T9BA 3AT1A 2FOIA 2BGRA 3GB9A 4KXXA 5FBQB 3CHYA 3RG8A 1ADJA 1MB9A 4RMHA 4TYYA 3F5QA 4JJ8A 2BFAA 1NJ1A 3SX4A 4F9EA 1E98A 1P4HA 3AIMA 3H1BA 3X3HA 2V7UA 3RJZA 5EJ8A 1FXSA 3OLZA 2VL7A 4IZ6A 5AXDA 3TJZA 4D9FA 1ADCA 4CGZA 1XU4A 1XV5A 3C2QA 4GXNA 3UHOA 2I4OA 4NARA 4UM9D 5B2EA 1BFDA 1QKIA 1JLHA 3BFJA 3CSDA 4TSKA 1P6XA 4YB8A 1THTA 3NETA 2ZANA 1T2EA 3RFUA 5KYWA 1RYEA 2NU6A 2MINA 3W5AA 3U19A 4M7RA 3ABQB 2QMEA 5JEDA 4G5HA 4LJAA 4M1QA 3G2QA 1CQPA 1DQRA 3PJGA 1KJJA 3INTA 3NCTA 1SKYE 3ILVA 5H0IA 3TM5A 4KR2A 1QQ6A 4JLVA 4B5LA 2FPRA 3DMYA 3IESA 3PTLA 3WISA 2I29A 1I01A 5AVKA 2CK3A 1Z4MA 5ALNA 2ONYA 4R1QA 5KC9A 5ISMA 2O4CA 4X9XA 4X66B 3QW4B 1I13A 1QU3A 3N0VA 3IQXA 4DCMA 4S04A 2CL5A 2C4VA 3JQQA 3HB0A 4WBNB 3U56A 4HCJA 5AHXA 1Z07A 3DD5A 4XI9A 1GRRA 4X1YA 2QSZA 2WSSD 5HFAA 4X41A 1G8YA 1ECFA 2FMXA 2QNIA 4Q00A 5C8YA 2GZ2A 1CJMA 1V96A 2R7MA 4K87A 1R9MA 1TM5E 3DE3X 3NBYC 4XUGB 3JAKA 4YAKA 1XJ0A 1Q95A 2Q1WA 1NVTA 4TSFD 4KWEA 4EF5A 2PKEA 4IDEA 2POQX 1BCRA 4LSZA 2XZOA 1L4NA 4UU8A 4EH1A 4FZRA 2VQEB 2H52A 4MCHA 2XYPA 5JHHB 1W4AA 2CFSA 2VRBA 3WIDA 3AIOA 2ZTHA 1PNQA 3WLMA 1OLXA 1JKMA 1U9CA 1ZEJA 2A67A 1AQUA 2N42A 2VYQA 5TVKA 2C5SA 2WKPA 3WL6A 1MRZA 4MQFB 4OHCA 3L6OO 2YMMA 4OJNA 2OQ2A 4EJSB 4HYYA 2AEJA 2I8AA 4LJ5A 4PZ9A 4PAOA 2O4UX 1F6BA 3GGOA 4JT9A 5DHFA 4AMZA 3RUFA 2F1RA 4UVGA 3BRCA 4XZ3A 1Z3IX 5L6LB 2VF7A 3CM0A 4IIEA 4HX9A 1E94E 3DGEC 4CGYA 3HDTA 3CZ4A 3W5SA 1OWOA 4URVR 5BSGA 1PT5A 2VHQA 4HWTA 2H2WA 2UYOA 2Q1TA 2JNWA 2PSEA 1R1DA 2GB4A 1K7XB 3E1GA 4I1RA 1J9EA 2RG1A 4J94A 4G36A 4BXOA 1M0EA 2QN1A 5E9JA 3PWSA 3ETDA 1GDDA 5AESA 1EIZA 1EZ1A 1G2PA 3M6LA 2XKKA 2O50A 2GHTA 3O92A 4BLPA 3K0CA 4CQMB 4HX5A 4KQXA 2Q5EA 1PGOA 2AMVA 1ZRNA 2MYNA 4M9UA 3RYTC 4MI9A 3ZUGA 1PYDA 1G98A 1CRQA 2JIBA 4UD6A 5KOIA 3SYRA 1IBLB 2PUBA 1M73E 4QQFA 4CLOA 4LYAA 1O6ZA 3USCS 2EF0A 4ND2A 1ENPA 1FU8A 4MIOA 1DNPA 2R9VA 4RLQA 2ACEA 2ISSD 2HK8A 4R7ZA 1GILA 2BJVA 4YRQA 4H1VA 1IVNA 4DRXA 2QLNA 1UQTA 1X94A 2GTIA 3L84A 3WIBA 4CL3A 2OZEA 5LN1A 3A2KA 1R27A 1X15A 4CKYA 1Y6QA 1YB6A 3C7KA 3H5IA 4KQFA 4PZCA 5C8DA 4RE6A 1PP4A 5AQ1A 1DBWA 4C5BA 2CNDA 1PJTA 3OOYA 2AMLA 2ANBA 4KPEC 3AY3A 4F85A 1Y80A 4LJ4A 5JO0A 2V7XA 4DMKA 3DLBA 3CRQA 5CH5A 3RTDA 5IRCD 1AQLA 2NYUA 4TKVA 2P4UA 1P7CA 4HSGA 4E5MA 3FR7A 5EJ9A 2OCGA 1Q12A 1FP2A 1XELA 3H1AA 1IQ0A 3UQYS 1L5FA 1JA1A 5KI6A 1IY2A 2WSSA 3D2LA 5F1YA 2G0AA 1WY7A 5JS8A 1Q2XA 3UJ6A 3SP1A 3MZ0A 4WZAE 4XD7D 5FWXA 5BSEA 5F73A 5K0EA 4L0DA 3AI2A 1Z4NA 3QMPA 3SC2A 1CQIA 4N8EA 4C0SA 1I3KA 4DJTA 3W5DA 5JUWA 1M1NB 3EPJA 1EFPA 3T15A 4L3WA 3HEAA 4YAUA 2O07A 3HB7A 3QVXA 3H8JA 4GE0A 2AW3A 2VDUE 4PG8A 1QJ4A 1VHJA 1B1AA 2XX3A 1ADBA 1PTJC 1MJGM 3E23A 5LUBA 1G0OA 4PO9A 1MJGA 5HCUA 4ECEA 1HM5A 3JZIA 1CY2A 1Y1PA 3L7DA 2CEKA 1V8DA 3R40A 4UM5A 4LOKA 4JLJA 1M6VA 2FP4A 3JS5A 4B3MB 3KK0A 2YDYA 3A6ZA 2R7NA 1Z75A 2CMDA 4OQMA 2JI7A 2JLRA 1PVVA 4HUQB 4ZVOA 3WL8A 4UTNA 3HV0A 3NFYA 1DO8A 3WJAA 1TTQB 1KJIA 2HF8A 4MPTA 5JAMA 2R6ZA 5KTOA 1KU0A 1D2MA 3S2SA 1RVV1 1JEQA 3IDAA 4KX5A 1JQAA 5CVUA 4B48A 2V7WA 4DZRA 1ZKMA 1Z6GA 1R0RE 3ZG6A 3BMCB 3ZZNA 3P4XA 4P35A 2QGFA 2ORVA 2CJYA 2J08A 5AI5A 4UTRA 2Q6KA 3QGMA 3IMEA 3RODA 1LZLA 4JBLA 2QZPA 3H5OA 5IKPA 5KU7A 1DE0A 2AWOA 3O4FA 4FW8A 3TOCA 4WWHA 5KYTA 3ZH2A 2O2YA 2JCVA 3ROGA 4D8YA 3JY6A 4X1YB 4DR7B 1X9HA 1QMGA 1SOVA 1NLFA 2R48A 3R8CA 3TI9A 2RHWA 3R7DA 1ZDMA 3WOHA 1A8SA 1EAYA 3GT4A 1NNSA 3KT0A 1HZZA 3T7SA 2NTJA 2HDNB 2WYHA 3BFKA 3BWBA 4IMIB 5THKA 4HMOA 1K86A 2CL0X 1ULSA 3G6WA 1ONOA 4YMLA 3HN6A 1AGXA 2RBGA 4FONA 5JH7F 3TTUA 3NHUA 4IX9A 4V2IA 2IYEA 5HQJA 2EJTA 1AKTA 4PIPA 4BEWA 4ZI7A 2A94A 2RGUA 1DC5A 3U4DA 3E8XA 1BH6A 4BO8A 4M36A 3NEYA 2FMIA 1ZGZA 2RHTA 4JHXA 4WY2A 1JEDA 1JNXX 3MYRA 3A0UA 4P7GA 4R3NA 1CUUA 2QW1A 2HBZA 2Q4TA 3PKIA 3RWMB 4CLXA 3HWRA 3D5QA 1ISPA 1CJKC 3A1VA 3SDSA 3T0FA 3MWEA 3WBJA 3ER8A 3LPLA 2X0NA 5JQGF 4QKQA 2BGWA 5JJ5A 1SBNE 3VKVA 3WWCA 4AXXA 4RBNA 5JLJA 1OPXA 1KFCB 4BN4A 3GEEA 3BB3A 4I5IA 2PL1A 5CDYA 4OHYA 4MLPA 4IXNA 4R71A 1OW3B 2QTRA 4ETNA 1C0PA 1KO1A 4Y2YA 5KC8A 2O5EA 2HJSA 5G0VA 2Y1EA 3O82A 3VNRA 3T5BA 1QK3A 1UZNA 5EP1A 3EGEA 4JJFA 2O8CB 1EP2B 3B51X 3DOJA 1K3FA 3CW9A 2PM8A 4BVBA 1C7QA 3PUWA 3UA4A 4D26A 1R4NA 1X7ZB 2A2ZA 1JI0A 3ADOA 5DW3A 3X1XA 3DL2A 4QT4A 4YT8A 1Z8HA 3BTUA 1ZUNA 3QFFA 2O7RA 2QRHA 3K6KA 4FFMA 4JWTA 4WXPA 1P7YA 1I7QB 3WNDA 4GU5A 1RC0A 1BS9A 4X7PA 1HXHA 3SKVA 1WPGA 3MUFA 3NATA 1DAGA 2IXAA 3INGA 4JI3B 2FEXA 2X9VA 3KR0A 4AQ7A 1GO2A 2HD4A 4ZI2A 2LE0A 2DPHA 3FTNA 4RQBA 4DLXA 1RLOA 3D8UA 4BZXA 3E3OA 5DGXA 3D6JA 3SBXA 1LPAB 3I1JA 4OP3A 3NO4A 4ZA2A 2GZAA 3LHFA 2X1LA 3FCAA 4ZT2A 2Y0CA 3AC0A 1J22A 1JJIA 3QF7A 3GMDA 4TPKA 3AL0C 2Y4OA 3IAEA 3C4VA 2OC9A 3LGSA 1VJ0A 3QBJA 1WUIS 3MJHA 4JK3A 4LPKA 4Y9UA 1IN4A 1W0KD 2JAHA 4IMPA 3FMOB 4NCNA 4YALA 1ITZA 2CHEA 1OJLA 2RHBA 3KYDA 1A5BB 2O8FA 2PU7A 3BEDA 3BXPA 4IV8A 4RSRA 1MAHA 4Y2HA 1EK5A 1KR2A 2WVAA 4KX3A 3W3AD 2W2KB 3AKCA 5EXPA 4ER0A 2AJDA 3BCHA 3U60B 3RTAA 1TDJA 2FW1A 2D4AA 5IKEA 1ZL0A 3EGDB 4ZQGA 4MVYA 1A1SA 3UJ9A 5H4GA 1AM4D 3EVZA 3D54D 3TXYA 3AM5A 4JYMA 3L8ZA 4UUPA 1JP7A 3K53A 4I66A 1JUDA 2QUBA 3MSCA 1B16A 2PT9A 4P4NA 4C9BA 1PJ3A 2WIJA 2ZUTA 1M9NA 2WK1A 2VRWA 4R1MA 4YQYA 4LF6B 1OFIA 4QWMA 1L8OA 3VPSA 3FPBA 2QWXA 3J81A 3BXZA 2XTJA 1EMDA 2DPYA 3HE3A 5C7OO 4AJHA 1W36D 4BLUA 4MS3A 5TJHA 4GAEA 2JJMA 3DE5X 5EWJA 5CGZA 3TGWA 1RHRA 1V6SA 2Y76A 3LQFA 4CVNA 2B69A 2V96A 2UDPA 1G16A 2FFHA 2SKEA 3ELWA 3LP6A 3OE4A 4MQ4A 3H8SA 1T8RA 3DMNA 5ECDA 3PXBA 1FTWA 3TRHA 1EWQA 1NBOA 1GTVA 3LT0A 4QXQA 1S8NA 3I61A 3IXQA 1AU9A 1CR0A 1E6UA 3GIWA 3KIPA 4KAJA 4CLRB 3NHSA 2ZYVX 4A0QA 2VN8A 4WLEA 4MGIR 1J9ZA 4LC9A 1OX4B 4MJ7A 1TZKA 2Q9AA 3QWBA 5THQA 3X1JA 4R51A 7YASA 3T1TA 1Z25A 4P22A 1XD2B 1TK2A 2WM9B 3A4MA 1HSZA 4LX0A 4QYXA 4P54A 4PBTA 5CHYA 1FCJA 5E3HA 4L16A 3N6RA 3PJRA 5GINE 4NAVA 1JFVA 2PMKA 2QUKA 3I83A 1P1BA 3C4QA 1B74A 1NPTO 2W98A 1XXHA 1Q7RA 1XVAA 4G8DA 3HY3A 4EG1A 4H31A 1EESA 1RP1A 5BOSA 2IODA 4YJGB 2GAFA 1OAOC 1NI4B 3HRIA 2IHKA 4U6QA 1GL9B 3WMXA 5KNDD 2VJMA 4GM1A 1XAGA 1NDUA 4K9NA 3V4OA 3DNMA 4FXPA 4RABA 1G66A 4DRYA 2R8XA 1KP9A 2QLBA 3EXIA 2VAXA 4ALJA 2WJGA 3V4LA 4RHEA 4K9QA 2WTAA 2P6PA 2PGXA 1RVDA 2Q46A 1T36A 1H42A 1UKYA 3OBIA 4CTJA 3TWOA 4MI6A 3V3TA 3CZQA 4CEHA 3F78A 5DF1A 1MQAA 1EVEA 4XQ0A 1A69A 1E5LA 1OV4A 3PRHA 3UHPA 2OWDA 3B1FA 4ALKA 3TSYA 4XUEA 1VMAA 3E4CA 3OAAA 4NG4A 2OAQ1 1HEUA 2HQRA 2JHCA 4QODA 1JR3D 2HSWA 2OE2A 3KE8A 5HMMA 3V33A 4MKHA 1LLDA 1FDOA 2QVLA 2ZAMA 3NONA 4NU0A 3VDRA 1MV8A 2DPLA 3UA3A 4U1RA 3MAJA 4DC0A 4CKEB 2G67A 2XF8A 2ATXA 4RSHA 5EZQA 5F5XA 2BBOA 2OBBA 2QVCA 2BM1A 3I72A 4BWYA 3OIUA 3C98A 1B8NA 4OA8A 3FCXA 1Z62A 4KN8A 1SGWA 1L5HB 3HXQA 1YRHA 2QENA 3OPXA 1F8UA 3T7IA 3U80A 5CB4B 5C7LO 3OY2A 3HH8A 2P2GA 4LXYA 3CF6R 5IKMA 5F9FA 1W0CA 1CBUA 1RMQA 2NQTA 2NVOA 2GXUA 2CUNA 5AHOA 1QGOA 2VUUA 1R6VA 1P39A 1Y5MA 4X84A 5TY0A 4CM3A 4DRXB 4E2XA 3CMMA 1SIWA 1ND5A 4L1KA 1QQ5A 1DKPA 3LQ2A 4MCAA 3UJBA 1ZUNB 4R2XA 2XHZA 3OU7A 4KNVA 3L1JA 3LLSA 3KFVA 2YJGA 4L50A 5K3DA 2I87A 4QLBA 3H75A 1FQWA 1A7KA 4CTNA 3D3WA 2W6JD 2X0FA 5B4TA 4DEVA 4EVQA 4M76B 4ESOA 2O2EA 2IYQA 1KXZA 3GC6A 1PV4A 1S3FA 2HQBA 3H6HA 4JFAA 2GFQA 1E3TA 1E1CA 1J8VA 1N2HA 2Y0EA 4G1FA 2Z6AA 3QU9A 3F6BX 4PV7A 1HQCA 1HDZA 4IKEA 2QYTA 5FTKA 5DRYA 2AC2A 5DOVA 5LZ7A 3U3MA 4AN1A 2JJ8A 3IODA 3LX6A 4KQ2A 3KHSA 4R2IA 1IZZA 1CQIB 2WJWA 5KJEA 1XZFA 1N6RA 2OG1A 2UYGA 3GLGE 4KP7A 4WBSA 4KQIA 1NLYA 2QQGA 4CFZA 4P7BA 4LN1A 4GRAA 3B1VA 2HX1A 2M6RA 3DLCA 1Y5LA 8MHTA 3NXKA 5FO0A 4J7XA 3VH2A 1JMVA 2GDJA 2ODPA 3R3HA 1LNQA 2ZBPA 1E5QA 2YQ4A 2QVBA 1SHLA 3H05A 2GSWA 3KKPA 1YZQA 4UPEA 2EDCA 2O2DA 5DHTA 3PQ5A 5I7UA 2R8ZA 3H16A 4FCTA 5EGNA 4TWAA 2A0WA 3LKBA 2PAAA 2C2GA 4N5LA 3TMYA 2YWRA 3UYKA 2EX4A 1U0GA 5SV2A 4ARZB 1CF2O 3LW8A 1NXWA 3QUCA 3Q4GA 4P86A 4FZ5A 1YNOA 3CONA 3LX5A 4P3YA 2DH5A 1Q74A 2NUTB 3BEOA 1UJNA 3FB1A 4M60A 1T1SA 3N0XA 4YMGA 3IVAA 2XSZD 2H8GA 1HG1A 3R0ZA 4JCOA 4N0EA 4C0LA 5JMTA 2XOEA 2Y1GA 1YHNA 3OZVA 4EPTA 3PCRB 4LXUA 4B3IA 1FFEA 3RRNA 5C5IA 1AKWA 1WAMA 4A1OA 2FWIA 5T64A 4LHYA 1CE8B 4RA9A 5B7QA 1T6NA 3N8HA 1P6QA 4F86A 1KGSA 3DFMA 3CF0A 1TMOA 2C97A 2WF7A 3C8DA 3E0XA 5I9IA 3GPIA 3P9NA 1JAZA 4ZYXA 3AVVA 1BJRE 4H1UA 5B6JA 3CF4G 4PNZA 1NQ5A 1BDMA 5DYTA 4F6LA 1J5EB 5JW6A 2R5NA 4QICA 1LSJA 2VWHA 1QG2A 3CZMA 4JBWA 4KMSA 2GK6A 1QGDA 2A5GA 3JZAA 3KAPA 5A3JA 4GE3A 4MVCA 1D6MA 3TVDA 2DBYA 3AB7A 3N2YA 5FCDA 1LI4A 3NG1A 4IIVA 4WZ6A 3T54A 2C04A 4LEIA 4ZODA 2DTDA 3IKLA 1B3BA 4HTFB 4KRGA 1USIA 3QKSB 3U49A 4XUCA 2RARA 1EFRA 1Y6JA 3JR7A 5L4SA 2QNBA 1OFTA 2PAFA 4HSEA 5CT9A 4WN9B 1GUZA 3TD9A 4N4AA 3HJFA 1XCOA 3NW9A 5I7SA 4YCNA 1H2WA 4QSMA 4UMVA 3EXAA 5EMJA 4D0GA 3WGHA 3HUTA 1WU7A 3D64A 4HXFB 2PUGA 2QMOA 2VHXA 4TV8B 3SF8B 1T0IA 1T2FA 2ZT5A 3R7FA 2YXPX 3TNYA 4DDUA 1E20A 5D01A 1U1DA 2Z2ZA 3OZRA 3OUTA 4J9VA 5EEHA 1FK8A 1WB5A 5C4GB 1QS0A 4LC1A 2J9FB 2AZTA 1G42A 2PHZA 3AYZB 5F77A 3Q15C 2PNJA 3R0QA 3K9WA 1L4UA 3DBVO 2KX7A 3G2LA 3N3AC 5CM9C 4RLSA 3W6NA 4ZICA 5I7HA 5JJLA 3ZLTA 2CGEA 1EVJA 1ZD1A 4UHEA 3GJ5A 3N2KB 1X42A 5D87A 3R7NA 4XIYA 3GRPA 2VHZA 4PHFA 5DNUA 2CYCA 2IH4A 2GYUA 3BFXA 5E3JA 1QWOA 4ZV7A 1XMXA 3JSXA 4W8OA 1KHHA 3NI2A 4GDMA 5FBVB 2BWJA 4J0FA 3DO8A 4CDNA 1KXJA 4LKRA 4M1YA 1LPPA 1YOBA 3HCFA 3VSDA 2A0XA 3H2HA 2P27A 1DBVO 3B13B 3BE6A 3LHIA 4F12A 5IT4A 1OILA 4U2FA 3GZ4A 3QE2A 1E0KA 4XOIA 4FYVA 3DEFA 1B7GO 1GGMA 2VNAA 4RJKA 1TVKB 4NC9A 2E1PA 3A70A 4G5OA 4I2NA 5CFOA 1Q1BA 2X22A 3SQLA 1TF2A 4B1FA 3MRXA 1UJ5A 1T3LA 2OGZA 3FCSB 1WKVA 4UDYX 4GXTA 3W4KA 1T4MA 2YYYA 3I2IA 4TLEA 3ZC3A 1E2DA 1GCUA 5L3RA 1JFSA 2JIPA 2XXAA 3G0CA 1HLDA 3QOFA 3S0JA 5FBRB 1U7UA 5JDIA 4ENQA 1TA0A 3QKRA 1XVVA 1DC7A 4MKIA 3SYTA 3LNCA 4AF6A 3IP9A 3DKIA 2BEWB 4Q1EA 3ZWAA 4CR8A 4ZWNA 2D3TA 2WTXA 2ZYIA 3AR9A 3U3OA 3GFFA 4PSDA 4CR6A 3K70B 2NPOA 2V03A 5IZCC 4R6XA 4DZZA 3L07A 1PZXA 4NDAA 4IICA 2H57A 4CTOA 4J16A 3H9CA 3FH0A 2BP7A 6REQA 4Q1VA 1AK2A 3HGTA 4R0VA 1SVLA 4O4IB 1GZ4A 5BV0A 2QQFA 5JI2E 1PEKE 1P4AA 1T34A 4QULA 5AKJA 5A05A 3M5DA 4FDAA 2L0XA 4B32A 1NHGA 3P0FA 2G40A 3ESZA 2NU7A 2A57A 3KUUA 5J2UB 5CX1B 3RK1A 3PUJA 4M7OA 4HGZA 3CUWA 4J4TA 3WOVA 3DOFA 3U31A 1RZVA 2VUIB 2ZVPX 3F3SA 2PCJA 4RMGA 3QEKA 4R1OA 2VQSA 3DR5A 3MC1A 1TVEA 4F4CA 2YZMA 5ETJA 3X1KA 3NBAA 2ZSHA 3AHEA 1ZJYA 2A92A 3RNLA 3P9YA 5JD6A 1NUAA 3PNYA 4B46A 5EE1A 3SVLA 1N2XA 2ZUUA 4JI2B 4MQ5A 1FSFA 2Z04A 2I7XA 4EKGA 1KSGA 2D6FA 1QSGA 1T4CA 1PWEA 8ADHA 1LEHA 1WKCA 4ICIA 1T0HB 2WNSA 2CLLB 5D5PA 4RUKA 4E14A 5HK9A 2GEBA 4AB1A 1ZUD1 1ORVA 3QIVA 3BMNA 4X6XA 3RB8A 1J1UA 2DWQA 4AZVA 3MOIA 2P8SA 4EJ2A 4UEQA 4I50B 2EAUA 2CXNA 2G25A 3KV3O 2QT0A 3SIRA 3GUYA 3ZHSA 2AOUA 5LQDA 3TUIC 3VU9A 5C1PA 4O4JF 4JASB 1G20A 1OFHA 3KAKA 2LTAA 2BBSA 3PIIA 4Y9RA 1YHYA 3SEQA 4YN3A 1K0FA 3QE4A 1YF3A 4FBGA 3I9JA 4QUIA 3UUFA 2O8BA 5TE9A 5AHWA 2W9XA 2P9TA 4ML3A 3ZQJA 4TL9A 4BBAA 3THSA 2CJPA 4IDBA 3PSAA 3I5XA 4ASUA 3HCPA 3UHJA 1ZK0A 1W4BA 2QXYA 5DNVA 1PQUA 3GH3A 1CEXA 3PD1A 5K2OA 2X8LA 2QG9A 3H87A 1I2MA 1EA7A 2XZDA 4DXHA 5L7WA 3AHDA 2R96A 4DMMA 1E7RA 2WAOA 1JGTA 2XD4A 2GCGA 1UXGA 2H5IA 4OLFA 1YIAA 2XMDA 2XCLA 4RCZA 4WASA 1IZ8A 2FF7A 1M74A 2FPLA 3RD5A 3UEOA 4EF6A 2ZBDA 1VKZA 2W6QA 2OCIA 4KRYA 4MW6A 1XJCA 1G8FA 1FUIA 4WADA 3CS3A 4MJ3A 2DGDA 3P0IA 4IDFA 4N0QA 4EABA 4LVCA 4FINA 4IDCA 5DHSA 3BG5A 1B76A 1I4EB 1XZIA 2AFRA 1UDCA 3ICVA 4DFDA 5HQ3A 1RAFA 5AFSA 3PFHA 1QAMA 4XIJA 1QYIA 2AUTA 4CIBA 1F8YA 3OTWA 3A28A 1GFZA 4KFCA 2XAUA 3LTEA 5IVHA 2KPOA 4DAOA 5I9NA 1TMYA 2IXTA 5EE5B 2GXQA 5KVCA 2I22A 2JH3A 1XFAA 2DBRA 1EM8B 4ZZ3A 1ZISA 4BNDA 1YUMA 1BGVA 2UV8A 4M2LA 4ESEA 2IKSA 1SXIA 1VKHA 1P9NA 1XCJA 3EVCA 5C3MA 1JBQA 1QFJA 4I6EA 4IFIA 1QGZA 2ZT7A 4WKGA 5TEVA 1KMHB 5CB4F 1RKQA 2HKIA 1QIHA 4QUJA 1O97D 2GMWA 4MUKA 5DNDA 3DE4X 1E1QA 5CW2A