3DT8A

Crystal structure of bovin brain platelet activating factor acetylhydrolase covalently inhibited by sarin
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
212
structure length
211
Chain Sequence
ENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDLVQLMHQSEIWRELFSPLHALNFGIGGDSTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRRVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Brain Platelet-activating factor acetylhydrolase IB subunit
publication title Crystal structures of brain group-VIII phospholipase A2 in nonaged complexes with the organophosphorus nerve agents soman and sarin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 75
structure length 211
sequence length 212
ec nomenclature ec 3.1.1.47: 1-alkyl-2-acetylglycerophosphocholine esterase.
pdb deposition date 2008-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 3dt8A00
4K9SA 4JKOA 4I8IA 1Z8HA 4JJ6A 4HYQA 3DT8A 4HF7A 3P94A 1IVNA 2HSJA 1V2GA 1PP4A 3C1UA 5A4AA 3RJTA 2VPTA 4S1PA 1FXWF 1YZFA 3DT6A 2Q0SA 1DEOA 4K3UA 1WABA 4LHSA 2APJA 3W7VA 3U37A 1ES9A 4M8KA 4TX1A 4OAOA 4Q7QA 1VJGA 4IYJA 1BWQA 4K40A 5JD3A 3MILA 2O14A 1BWRA 3DC7A 3HP4A 4K7JA 4DEVA 3DCIA 4XVHA 3SLRA 1ZMBA 1JRLA 2Q0QA 2WAOA 5CD9A 3PT5A 4RSHA 1FXWA 1K7CA 2W9XA 4JGGA 3SKVA 1ESEA 2WAAA 5BN1A 1ESDA 1BWPA 1ESCA 5HOEA 2WABA 1J00A 3BZWA 3KVNA 4Q9AA 4RW0A 4H08A 1VYHA 4JHLA 5B5SA 1DEXA 4PPYA 3DT9A 4OAPA 4NRDA 4JJ4A 1U8UA
chains in the Genus database with same CATH superfamily
4K9SA 3Q3JB 1ML3A 2Z1DA 1J5EB 4IDFA 5JXHA 5IJ9A 4ZDWA 2BTOA 3QHAA 3I3SR 3OF5A 4DIUA 4LFBB 3GLKA 3PC7A 4GE0A 2FP4A 3X1YA 1TPZA 2CJFA 2I8CA 3DMRA 4P3NA 1OWNA 3RH0A 3DVSX 3CVJA 3QELA 4RPHA 2PMCA 2YIDA 3NNDA 5CNIA 5AQ1A 1VSBA 5FBHA 3O4IA 1J1UA 3BL8A 3RGGA 4ZGGA 4GG1A 3I1FA 4AW9A 2ZBVA 1BWSA 1XLVA 3IKJA 3SG0A 1Q50A 1USIA 1N5KA 2IOQA 3O83A 3JVDA 4MQEB 1GPAA 2YY5A 4H31A 1A77A 2O50A 4JP3A 3CLRC 1H8ED 4DV2B 3G0CA 3DAGA 2PUGA 1QYCA 2QRHA 2H1RA 2XUOA 1ZICA 1HDYA 2G67A 4UVGA 4XFJA 3L04A 3TDKA 3NEAA 3IRVA 3QEJA 4UUNA 4EI8A 1E2DA 4JOCA 4FFRA 2FN7A 1X0XA 2D2XA 2YIMA 4KFSA 3ZQ6A 4EJSC 4RHFA 3CCFA 5DISB 4I0WB 1V7QA 4HQ0A 3K6JA 4NS1A 5IRCD 2VYVD 1IEVA 2HOQA 3NAZA 4EB6A 2AVNA 3IVAA 1IHXA 5JZSA 5LMCA 3K8OE 1BQ3A 1BQ4A 2HA4A 1NAHA 2FPKA 3QY0A 3NHSA 2F6RA 2QK4A 3AR2A 3M6XA 1Q5PA 3QSGA 3ZDRA 2PA3A 2Z2YA 4IL5A 3WRWA 4ZI3A 1I5RA 3WB1A 3U26A 4O08A 1A9ZA 1MPTA 1ANKA 4G23A 3TLKA 4R2IA 4BNJA 5JV5A 2VP4A 1G8SA 5JIBA 5BN5A 1XP8A 3UT6A 3FTQA 2GHQA 3TFWA 1FXSA 2BMDA 2V58A 2P5SA 4OHKA 1G21E 4UHHA 4Y0AA 3BULA 3UH0A 5K0TA 5JHGB 3OQVA 3T99A 1JRLA 3UTCA 4MGIR 3EOZA 5F64A 5FTNA 1WUYA 1AZWA 3ETJA 4GBMA 3TZQA 4A03A 1KYIA 4EKNB 3FYUC 3AINA 1F2UB 3JRXA 4J29A 5EPOA 3BILA 5G3ZA 2JLSA 3VR5D 2QG4A 2CXXA 1V95A 4NH4A 4NAVA 4QO8A 1E9DA 2I4LA 5EKDA 5B30A 2JBAB 3QW2A 1DTWB 3FKJA 4C07A 2FZGA 3MJSA 1R2QA 1SUCA 2G5PA 3Q8XB 3EIWA 2R79A 5JS8A 4IVQA 1S96A 3SJ7A 2QTRA 3SZGA 3EQ7A 1N5JA 2QD5A 3NHBA 2NYRA 3NT4A 5EJIA 2H57A 3V33A 4BAUA 3O8RA 4ARIA 3COSA 2ZJ1A 2X9LA 4YPFA 2L19A 3I2GA 4F5WA 4S04A 2YIJA 5J4HA 3RUCA 1VGQA 3MA0A 4OJTA 3A6DA 3IJ5A 1COWD 1F3OA 4FFPA 4ZRDA 1IOWA 3S8EA 2RGNC 1X86B 1XNQB 4GI3A 2HAEA 1AUOA 1BAPA 1XOIA 3LXXA 2O0HA 4JJ4A 3ET5A 4DEYA 2VEOA 4G0PA 1Y3DE 3NYIA 4E2XA 1VE6A 2V7EA 3KL4A 3NHRA 4FOPA 4TGLA 1X1EA 4AS2A 2W6QA 1W4LA 3PB3A 1VCNA 4ETNA 3OMLA 1SVIA 3OBIA 3PNQA 4JLMA 3ZJYA 2XF2A 4PC2A 2ID8A 3QUCA 3S1AA 1ZR4A 1TVKB 2ZRNA 3L8EA 3B5IA 2OLJA 5UKDA 3V4VB 4R2MA 1R0BA 3TLGA 2WEKA 5A06A 3U09A 2RHTA 2GPWA 4BFZA 1G5QA 3PPWA 5KNBH 3L4BC 3SIXA 3M5PA 4QFBA 5CFRA 1CEXA 2XA1A 2OP0A 4XSHA 1OMOA 1PGNA 1W34A 1PFYA 3GZ4A 3INRA 1QS0B 2PKXA 2V9PA 4X00A 5HFJA 2O48X 4D57A 2JASA 1N2IA 3ZWAA 1G4UR 2QM8A 4HXFB 2UVPA 4UULA 1XXHE 2GK7A 5C7LO 5JNSA 4LI0A 2EYQA 1KJZA 4D4JA 1KEKA 2ZB2A 4JSTA 2Q1YA 3O2JA 2GEKA 1WHTA 3GFQA 4WBNF 4J0KA 4MR8B 4EG5A 4CMBA 3ROXA 1C81A 1RRVA 1S3SA 1SUIA 1TO2E 2EEPA 2NUBA 2WZDA 2D0OB 3BXZA 3IIEA 3NXSA 3VO2A 3WA6A 2AMVA 2PKEA 3Q4GA 3ZS9A 2ZI6A 1K8XB 1FMCA 5HDBB 1V8OA 2FSIA 1L1RA 4G4GA 1Y3BE 2J41A 1YZ3A 4EAAA 3R9XB 4NK5A 1VIVA 4FB5A 1PE0A 1ZL0A 5GJWC 4DR7B 3TQTA 5D87A 1W19A 4Q66C 4BCCA 5ICFA 1P7ZA 2OV1A 5L7TA 1KY2A 3P4YA 4HJXA 4YO7A 3KJQA 3OHPA 2PUVA 1YIOA 3V42A 4N76A 5EERA 3IT0A 4G1UC 3B5EA 5CLHA 4ZTBA 3SZLA 3BICA 3PNBA 1ZVMA 1M2WA 4MROA 3WLPA 1FTWA 4LJ5A 1DCTA 1OSNA 1N1DA 2AJCA 2JCVA 3PL5A 4I5IA 2HF9A 1YB4A 1C7QA 1YMQA 3C6ZA 3AOEA 2J9GA 4A8HA 3X0DA 3DLBA 1GCAA 4GUDA 1A5BB 3FPAA 5FH9A 2P3OA 3FOBA 5IMBA 2W6NA 3EVFA 1L4KA 3HSYA 3RLFA 3DWEX 4OGFA 3W1WA 3EPLA 5ECYA 3N7TA 4HAUA 3GLVA 4YMTA 2EARA 5JCJA 2VDKB 2FN8A 3E8SA 1AJEA 3V97A 1CUXA 1SKAA 5GP1A 1SC4A 3KM0A 3PX2A 4BFLA 1SZDA 5LMNB 3RYTC 1J2UA 1DPGA 2P4QA 3IC5A 3P9YA 4KMSA 1ARZA 5KKNB 2ZUTA 2QSUA 1M6NA 3T3OA 1XA4A 2YHBA 4J90A 3QIAA 4LHWA 4Y2HA 5HWSA 2UYGA 3QVJA 2O5VA 3SE0A 1T5DX 1WCXA 3JR3A 3CVOA 1MENA 4N12A 5KOJB 4XW2A 1C3OA 5CG2A 1CRWG 3SEQA 2XLCA 2CGEA 2QTFA 4OBXA 5KHOC 5LP6B 4JVMA 1Q74A 3V8BA 4XQGA 1KO4A 1IG0A 1THZA 2AZDA 2FPPB 2IYEA 2WK1A 2ZR7A 1IZ8A 3D8RA 1JAYA 5AK3A 1LSSA 3THXA 2GM5A 2O1WA 5DGTA 2QD4A 2GERA 2ZTVA 1CTQA 2W6JD 3TIGA 2I7XA 5K6TA 1ETHA 2PSHA 1B74A 3LCVB 4JJIA 4CLOA 5EJ5A 2G06A 4LDNA 1YQ9A 3IE1A 5K8JB 5F2EA 3SVTA 2KLHA 2AEJA 2P4HX 3GFRA 5LYJB 1UANA 5J3JA 3ORRA 4RWEA 4LJLA 4QGAA 4F3KA 3EGCA 3OQMA 4OI0A 2CW5A 3R4CA 4G5XA 1RJFA 1E1RD 2FJPA 5CIQA 3GY0A 1NX9A 2VSQA 4EM6A 1B7GO 2KHZA 5CDTA 4NJEB 1DT5A 2BRUC 3KLPX 3WGQA 2B0CA 4RLHA 3V8MA 4X62B 3ZCRA 3E3NA 1Z8DA 5EGSA 3LZ6A 2PYIA 3KTAB 4KLNA 3UQYS 4R1TA 2PTHA 3LBIA 1HE2A 1YR9A 2XODA 3ED5A 4YO8A 2WOOA 5T4HA 3VNRA 4QQKA 2DJ5A 4I4LA 1LBTA 1P39A 5AHWA 3PDJA 4J1SA 5EKUA 4EFLA 5BQXA 3PEUA 4IDPA 3M6MD 3V9PA 4AK9A 1HT2E 4BE9A 5JARA 4OB7A 3CUWA 1VJ0A 1FEZA 2UZ1B 2WPNA 1H1LB 4JI6B 4ETWA 3AEUA 1CJKC 2HMTA 1T9KA 2Z6UA 1MQSA 3FR7A 4ARCA 2IIVA 4I6GA 1UQRA 4BX9A 5BQFA 5JCOC 1ULSA 2J0SA 1YMVA 2B21A 3F5SA 4FHCA 4QWWA 5JXJA 2IKSA 2QJTA 1I7LA 2B0JA 3W2FA 2IV2X 1TZCA 1KI1A 4ZQBA 5DOZA 2OKGA 2RD2A 2Z04A 3JRWA 3R7DA 3VU9B 3IBYA 4EGJA 3SZOA 2ZAIA 3N0RA 1D6MA 1Z47A 3W6UA 1MAVA 1NP7A 3HHEA 2WMYA 3FX2A 5JSZB 3L02A 3O8NA 2BEVB 3I28A 1GT91 5A3VA 3V1LA 4FI3F 2CWWA 3K09A 2M1XA 3P9SA 4MZXA 4OKNA 3U16A 4I1RA 3EBLA 1HUQA 3H0EA 2X9VA 5CVDA 3WWDA 1XLUA 3L0SA 3TGPA 3WGLA 4P6VF 1IN8A 3MRSA 4US2R 3V3TA 2J5BA 4S0XA 4CIYA 1ZD4A 2CEKA 4YI5A 4N5NA 3HADA 3GFSA 2IHZA 1XAGA 5E1MA 1H6CA 1YI1A 3E84A 2HSEA 4AQ7A 3P20A 2O8FB 3CRNA 3CRQA 5L7WA 3L6UA 4HDNA 4IKEA 4C5CA 3CWQA 1ZH0A 2YXDA 4GZ6A 2QX9A 1Q20A 4HDMA 2HLPA 2IS1A 2BFAA 4UAVA 5DW3A 3MWEB 3UK6A 4DA6A 3HU2A 4ETIA 3C8DA 1M1XB 5JWRA 1UOEA 2FF5A 2QRGA 3B3JA 3KJIA 4WE3A 2V1UA 2D8MA 3COVA 1AKNA 1UDWA 3DL4A 2Q6LA 4V0NA 4YBZA 3CW9A 5KREA 1IZYA 2G36A 3EQ8A 2QRQA 1YR6A 1NM5A 2XI4A 2XPCA 2VJAA 3ANTA 3D0KA 3S3TA 1IOLA 1BRMA 3RSFA 4BFSA 3FD8A 1FDSA 4MRMB 4F04A 2DTXA 1VXOA 3GJRA 2EFCB 4B8WA 4BQEA 2QSJA 1IUOA 2WWHA 3U4GA 3THWB 2I5PO 3H1GA 3W90A 4EG8A 2W6PA 3K70C 1YB7A 4GOMD 4OQEA 1EAYA 4D9FA 3N8NA 1Z4IA 5KVVA 4L5IA 3ABQB 5HOEA 2AW5A 3VPDA 4ZCRA 3LLVA 1Q3KA 1FPMA 1L8AA 3ILXA 4U7HA 2ZK7A 2FP3A 4UTOA 3OLWA 1RPJA 1UMDA 2AT1A 2F90A 2HXYA 4JLOA 5EE1A 1SCUA 1KOFA 4U2GA 2A94A 1QZ3A 3RTCA 1Q95A 4OQXA 3F46A 1SZPA 4XRGA 3HR4A 1RCFA 3DPSA 5TSDA 2QROA 1E9SA 2G8NA 1BVYF 4EGFA 3T1OA 2ZM5A 4KPUB 3P97A 3I9KA 3CEPB 4S35A 5KJ6A 3AESA 3L8GA 1G16A 1I0IA 2AWNA 3QWBA 3QXJA 2Q8QA 4GF5A 4UNIA 5IVDA 4BVHA 4HT3B 5KJ1A 1FRZA 1MG0A 1RAIA 3LLSA 3PA8A 2P75A 3U4QA 3HA7A 4Y2XA 2RSLA 1KRXA 1KI3A 1GDHA 1CZLA 2QGNA 2AG8A 2WU4A 3BWDD 4OOFA 1ZOIA 3FE2A 4URYR 3AW8A 4O33A 4W1QA 1N4DA 4AB1A 3WL5A 3G6KA 4B47A 4XGQA 1UC8A 5CG1A 1H3EA 1LFAA 1BFDA 2B30A 4UVHA 3JD4A 3BCRA 3Q3HA 5ERXA 5DULA 5GV8A 1ADCA 3N53A 1WW2A 1QCCA 2WB4A 1GNPA 1JYSA 3FBTA 3NI2A 3AWDA 1E7SA 3RC9A 5F9HA 2QLMA 2QU8A 4PZLA 1KHHA 1XWIA 2DPXA 3S70A 2YWBA 3IHKA 4WKGA 1UC4B 4B2LA 5IULC 3NVAA 4YJ3F 2C57A 1E9AA 2XNSA 1HI9A 2P5UA 3L79A 4AZ3B 3FCEA 3B6ZA 3OUUA 1R6BX 5C5EA 4TSFD 5DM4A 3ZEIA 3UWDA 4HNRA 1YS4A 1VHJA 4RIEA 4V0KA 5F1OA 2PUBA 3N8IA 3GD5A 1SU6A 1B43A 4Q9DA 2GCOB 5HILA 4K6GA 1JLRA 4FHGA 4X66B 4ZOAA 3TD9A 3VR3A 1IYZA 4I4TF 3KQHA 4IY1A 2WYIA 2PEYA 2H1SA 2Q07A 3B6IA 1H1DA 4GC9A 5SYNA 1I1HA 1T9HA 3FHJA 1CJVC 1OXKB 3CKMA 1ZQ1A 2Q7OE 3EPRA 2VSXA 4B4VA 1DWQA 5AK5A 5AVKA 4AYTA 2D5CA 3D64A 4IJKA 1IY2A 2EFGA 1GNTA 3U0BA 2IOFA 5DTRA 5BRJA 2OLKA 3VR6H 1OF1A 1FVXA 2HPAA 3TZCA 4D81A 1HYQA 4WD3A 3LKVA 3L9XA 4OBWA 3J7AC 1ZH6A 4NMHA 1KQ3A 1N92A 4IIJB 4U5XA 5DH9A 1YVPA 1XZJA 2I6QA 3DSRA 3ZE8A 4DRYA 4HS9A 4D8YA 4R69A 4GPTA 5REQB 4DM7A 2R6DA 5ARDA 4EKDA 1ZNZA 2OGUA 1A4IA 5THXA 3TH5A 4MHSA 4BIMA 1AG9A 3K1AA 3NV7A 4WBXC 3LC2O 2ARKA 4Q5IA 3TW8A 4B6GA 3D2CA 1ZK3A 4F1JA 1USUA 3ZXXA 4BLOA 4KO1S 3QH4A 4B3XA 1Z6PA 1ETUA 2YJ3A 2CL7X 4ZT2A 1BX3A 1A8QA 3MHPA 1ZBDA 5JEEA 3QX3A 2QXUA 3ECSA 4IX9A 3UJNA 1A9PA 3ZN2A 3BWBA 2M6RA 1J0BA 3D8HA 4UDOA 3SHOA 4JA2A 3V4OA 2WVHA 4MYTA 4UAJA 2E1RA 4MCIA 3K72B 4NJMA 3HZOA 4AY5A 2PX4A 5JATA 5CA1B 5DCUA 4C4XA 1QDEA 4ZQCB 2XYGA 3EUAA 4S1OA 3CRRA 3F6SA 3SHQA 1LBEA 1DBRA 4IHJF 1PS9A 1EK0A 1PEAA 2B83A 4RY2A 5FF9A 1F51E 1U5BA 2C2BA 1RAGA 2R00C 1V16B 4I1OA 3BSWA 5TGZA 1YCFA 3TEJA 3UJ7A 2PRYA 2VJMB 4GSLA 2FZ4A 2C42A 2X1HA 3P8ZA 4UZEA 3WGGA 1PEYA 4P92A 3RS3A 3PE6A 1SD1A 3K3PA 4ZYUA 2IYUA 5C81A 1AB6A 3WI7A 2FPMA 2PJRA 1TD1A 4ZRNA 1SGWA 4YRBA 1U63A 2PZEA 1M6VB 3DR5A 2P6MA 2FPGA 1QR6A 3PFIA 3ICPA 4CVNA 3OTOB 2VUHB 3MQFA 4RL4A 1NGSA 1GG9A 5EIXA 3VPSA 4TMYA 3IKVA 2QTVA 3THSA 2QGZA 3A6EA 3TQHA 2O2IA 4IXWA 4W9NC 1ZSVA 2GX6A 2R4QA 3TO5A 4TROA 4BEBA 5I7AA 5IKXA 1PU2A 4F1KA 4L95C 3F2IA 3HY4A 3LZDA 3RHSA 3NPAA 1JAIA 1GGMA 3MTEA 4BO8A 1KZ6A 5IJZA 1YZHA 1D1PA 4E5NA 5KNDD 3X44A 4LBYA 1X70A 2P27A 3GUUA 1Z18A 4JLDA 3HVIA 4H7FA 4R8KA 5JNTA 2IX3A 1IY1A 4I9UA 4WJZA 2J8ZA 3IYLW 4DSAA 1P9LA 5EE0A 3TDNA 3H7AA 3BMNB 2Z5GA 3OG9A 1ECCA 2XIJA 5JYDA 1HETA 2O5EA 3FRJA 5BOSB 2GEJA 4MJ7A 4B3MB 1CEQA 4MI1A 4G0XA 2HNBA 4M86A 4BGEA 5E0OA 3A3PA 2RMKA 2FEWB 4Y2YA 1L5GB 3U1TA 1PG2A 4GI5A 3RS5A 4ARUA 4E03A 5A0TA 4DG9A 1U94A 2BR3A 4Y2UA 5EXDA 3F73A 1E92A 1SUBA 4GP9A 2VHVA 3SHFA 3VSAA 1KJQA 1U8FO 4XCQA 1F2DA 1ESNA 3BM5A 2QY9A 4KXMA 2QX7A 4NZYA 3DGFC 3IPAA 3HEAA 3TL3A 3F1KA 4Y9UA 3LUAA 5ELLA 2W2PA 4DCNA 1IQ0A 1P72A 2JIBA 2FEXA 2WRZA 2AH5A 4BRUA 5LLTA 4ZGWA 5M34A 2X4DA 2Y99A 2ODBA 2Y1CA 2FSFA 4RH0A 4DZTA 1U2RA 3SU8A 4L6IA 1RT9A 3EF3A 4BVEA 4D43A 1E2QA 3C6XA 2CJXA 2XXBA 4ILKA 3HGQA 2BZ0A 3NHKA 1M1YA 3ISTA 3SLGA 4ZDJA 4D9EA 2CMFA 1CJUC 4LGCA 4QREA 2FW6A 4JODA 4MJLA 1ODKA 5EHXA 3I1IA 4IF6A 1VP3A 4M0DA 1EE2A 1VG8A 4RD0A 4MGYR 2ECPA 3KXLA 3W2IA 2B35A 3AF2A 3PUKA 3C3PA 4WNCA 1ZM4A 1XC7A 5T67A 1RC1A 4L16A 4R0NA 1B8VA 1KNQA 1B41A 1SM4A 1C3JA 2CDNA 1TTQB 2QU7A 1C9NA 2D7JA 1Z07A 1AXRA 1SPBS 4ZOEA 1KJ9A 2H4YA 2ZR8A 4KBYA 2JIPA 1KU6A 2RGDA 3KCNA 1YZNA 3C4QA 4BGDA 3T1TA 2XTZA 4GMHA 2C2YA 4EHDA 3IT1A 1C7EA 1PGPA 1QTQA 1G6KA 1YZQA 1OX4A 2WABA 2HCBA 2X13A 3BRCA 4C3ZA 4GP6A 5HE9A 4MRSA 1V9SA 1C8BA 4ZK6A 2I2DA 1WXEA 1U65A 3AQIA 5E7MA 3ZIAA 2VQ6A 4AZWA 1E6CA 1GNLA 4C6TA 2XCTB 3GO4A 4TXLA 4HEHA 3DMYA 3WL3A 4U1RA 4RA6B 1VYHA 2BCJQ 4E2WA 4E2ZA 1ZJWA 3SVLA 3P9RA 2O8BA 3BE5A 3EAQA 2BGMA 3FB1A 3FLMA 3NDRA 1WW3A 5B6IA 4RTOA 1QUFA 3QVWA 1T9BA 4DA9A 5BYJA 4Z1MD 4GSYA 4UM5A 1RAEA 4XX0A 2FRDA 3C3KA 5TPZA 2ZSIA 1JKJA 2ZYTX 3JYQA 1P1BA 3VXKA 5IS2A 5GIOE 1WZ2A 3AL0C 4FE4A 2UU9B 4HQRA 4OBEA 5CBPB 3PJDA 4FK8A 3QEAZ 4YRPA 1EH5A 3AM3A 3AR5A 1S2GA 4WUVA 1QJ4A 4RKFA 5FV4A 4INJA 3Q7IA 1E9EA 3EXHB 3KQNA 4HAWA 3CNLA 1YK1A 2J7PA 2JW5A 2XCQA 1NQAO 1V3QE 1ZIXA 3PQ3A 5DBFA 2V65A 2FZWA 2QDKA 2I8LA 2ZTMA 1UP7A 1F6WA 4PHHA 2J9ZB 1D2CA 2C77A 3NOVA 4GZ3A 4LRSB 5THKA 3RR2A 3G02A 3ZDEA 1QMGA 2DWCA 1XDZA 5HJ7A 4YMGA 1F0NA 5CW2A 3ZQJA 3O4JA 3ZPXA 4UHDA 3KLMX 2XB4A 1SUSA 1YZVA 4XJVA 2IE8A 1NPDA 3ZGNA 1ONOA 2UUOA 1QMPA 5B3AA 1LH0A 1DIRA 2PWBA 4ALIA 1IXKA 2W2XA 3I5AA 4LK2A 4XGIA 3WYFA 4A36A 2G4CA 4EL5A 3HL4A 1JG7A 3JYLA 4FJ1A 1JG2A 1WD5A 3OPYI 3OU6A 4LHXA 5FPKA 2NT3A 2V1XA 1LDEA 3C97A 3F74A 3VBEA 5JH7F 2EBUA 2P35A 3U3MA 3RFCA 2F4VB 2E3JA 3LG2A 4U4AA 1AHPA 3QENA 2HREA 2JEYA 2Z5LA 3HVHA 3QGMA 1W47A 4TKMA 2OILA 1PHPA 1QH8A 3HJUA 4WACA 2YW9A 4GOLD 3TQCA 1CEYA 1ONSA 4DGSA 5JSYA 2HADA 3G7NA 1HH4A 1Z5NA 4ROTA 5ETJA 2CXSA 5KB3A 3E7DA 2VPPA 1R0KA 4FILA 4FZ5A 2ZCUA 4DUGD 2WJZB 1ZG3A 1S4MA 3JZDA 2GZRA 4MIKA 4ZCSA 1UF9A 1KVQA 2IYAA 5IT4A 4Z7QB 1I3NA 3ML1A 4IJQA 3FTDA 5LC1A 3ZJ5A 4C0LA 4YAIA 2Q0QA 1RLTA 1BXGA 3R8XA 2G1UA 2P1DA 2VSNA 3EG5A 3VDQA 1KXZA 2FWJA 2ZQZA 2XWPA 5B7PA 2IP4A 3VVBA 5C34B 3MBOA 4UE6A 4TQGA 2OD9A 3SS8A 2H8KA 1R16A 4NY1A 3LTNC 1O9HA 4J3FA 5F4BA 3RDPA 3W78A 3I73A 3WYGA 4U7FA 3LPLA 1NUSA 2V9ZA 2NSDA 2QLLA 2ZRAA 3P9IA 3VFDA 4BP9A 6REQA 2Y6VA 4L5BA 5K5EA 3OURA 3GNTA 4FGUA 1OGYA 1USVA 2JIZD 4EPWA 1D03A 3TLZA 3R1IA 1JFVA 4KQMA 4QFCA 4OMUA 4CM6A 1A8PA 1P1IA 2ZUDA 4R3UC 4ZO7A 5DI3A 1PUJA 4WFQA 3HCAA 1W4ZA 2WYVA 3JQBC 4N9WA 4QBHA 2RGYA 1OBHA 2R4UA 3HZHA 4YYZA 4ZK2A 1XD2B 4BQIA 4S1TA 4FFNA 5BR4A 1F2TB 1GQQA 1TYBE 1Y1TA 3OY2A 4NWIA 1NVKA 4HWPA 1WG8A 2V6GA 2C7VA 3G2KA 3WSTA 4LHYA 3WNZA 1HMYA 4XCXA 3WFZA 2B92A 2ZJ2A 2CNWA 4LCJA 4MLZA 1E8NA 3GRRA 3S7TA 3R7WB 1MHTA 3IP1A 5KCMA 3HRKA 1FC0A 3X1XA 1FTYA 1PK8A 3ROPA 3THYA 1ENYA 4CG0A 1UDRA 3IPRA 4EI9A 4UNNA 4V0ME 1X7ZA 1DNPA 3PC8C 1U0JA 3IDQA 4OTZA 2XUJA 3GHHA 1FVFA 4M60A 3KR2A 2J3LA 4X5OA 5KKCA 2ZVQX 2BFFA 3TXAA 2I6UA 4QODA 4EHFA 1FLVA 4HYQA 3QTLA 3HS3A 5ALFA 1XHFA 4XPIA 2ZB4A 1MO6A 2X7JA 1MABB 2IYSA 2K6GA 4YUVA 4X91A 5A6VA 4P3YA 2M6KA 3JQ9A 1JKIA 2ETXA 4ZQFA 3WQBA 4UFPA 3HNOA 3RASA 4AWBA 1F4LA 5K3FB 4IMRA 2QKYA 2AN1A 4ZJPA 1SVWA 1G55A 3HZRA 3RAPR 3SIWA 4P8RA 3IEUA 1QQ5A 4CF3A 3D1LA 4YT8A 2ZRFA 3JQPA 2GGSA 5DBEX 5SZIA 1WKVA 1BMFA 1ACJA 1P3JA 3DQZA 3W5SA 4A91A 1U1FA 4X61A 4JLJA 1X14A 1XQ6A 1Z4LA 4P53A 4CU2A 4ZU3A 4CDGA 3PPIA 4WWHA 4YXWD 4WNAB 5EESA 3SD7A 3DHWC 3N70A 3OP1A 2WVAA 3JZFA 3EULA 2G63A 4HWGA 5FOUA 3A11A 3H1TA 5CA0A 3AJ9A 1HKHA 4FMDF 2I6TA 3TE7A 2P90A 2YXBA 4X7PA 2F1RA 4BQOA 1F2VA 1PJTA 4LE2A 4A8JB 5CYFA 5GZ3A 3ZD7A 1VI5A 2CCGA 4X6LA 5HF9A 4OHZA 3RTBA 4F97A 4KX5A 4F3CA 3AILA 2WSIA 3RM3A 2A8YA 1XZNA 4BIIA 3VPFA 4UXIA 3B82A 2G72A 2EV9A 1RYHA 3EVBA 3QVGB 1EJ2A 2O14A 4RY0A 1O0CA 5IZCC 1Q83A 4CEIA 4I1YA 5JLJA 2OD2A 1HEIA 2EZ9A 5C0OE 3O2NA 4LV5B 5HKKA 1YRBA 3K1ZA 1BWRA 5ISMA 4ASUA 4CIWA 2WMDA 3CF2A 2MINA 4KRGA 2DPMA 4HZGA 3KP1A 4IGAA 3ETHA 4CE6A 5EJ4A 5KC8A 4BO4A 1LDGA 2AI1A 2QW8A 2WU8A 4ISBA 4K03A 3VZSA 9ATCA 5ICMA 2B69A 3DBIA 3VPGA 4BO5A 3O1HB 4I1PA 2AOTB 5FPTA 3I34X 2YRFA 3ND6A 4C3OB 2Y1LA 1HNZB 3GEEA 3PC6A 5HQJA 3V4RA 4OIFA 4RF5A 5K1ZA 4E4RA 5H81A 2W6OA 1TEVA 2DG2A 3ED1A 3OOJA 4X1YA 5IKOA 1ZKMA 4HGNA 2PG3A 1HLFA 1NOJA 1AH2A 3I05A 4RJ2A 2JJYA 3CSDA 5CTJA 4OHYA 4PQEA 1LB1B 2OQIA 3F4KA 1W85A 2I1WA 1QV6A 2R48A 4CM3A 5I7UA 2WINI 1Z25A 4CEHB 1EFRA 2ZBPA 1K7EB 1HRDA 1DKPA 1EGMB 1N0VC 2XDAA 4X90A 1KH1A 3N0TA 1WY5A 2M98A 4AX8A 3I83A 5C31A 1YD7A 3KYCA 1S8AA 3T15A 5C1IA 5JJ5A 4NNOA 1P2GA 4NP6A 4HQNA 4ZO6A 5AK4A 3FTFA 2VBGA 2VNJA 5HKBA 1JQ5A 1WSAA 4N3NA 4RWZA 1IBMB 4JSRA 4W8HA 3USZA 3VBCA 4BMXA 2ZFUA 3CF4G 4D25A 1FY2A 3CTMA 4OXRA 4C29A 2ZTUA 3UWOA 3CE6A 4IUYA 1ZCBA 1GIAA 1MH9A 3N2KB 1WDTA 1K6EA 3B48A 1KOJA 3LHDA 4WFJA 4KR6A 2R7LA 1HYBA 3BSSA 4MKXA 5AKEA 2WE7A 2IW3A 4IDAA 4MWTA 1FVOA 1V1JA 1YQXA 2FUG6 3G7UA 1CJCA 2X0FA 3RTDA 4PLCA 3SC3A 3TSAA 2KS6A 5EJ8A 2B4AA 4Y1RB 1Q7RA 3EAFA 3FOFC 3JQ7B 4O2AA 3ZHRA 3OSUA 2QRLA 1IEWA 4MUFA 3E9DA 3DO8A 1GKKA 3L7OA 5AVVA 1LRJA 3D1JA 2XDYA 4O5OA 2ZIUB 1XKQA 2Z6VA 3KX2A 1JDSA 4BBAA 4J6EA 2VPTA 4JX8A 1N8TA 1EUDB 3CNHA 1GGJA 2WF8A 2Q2QA 4XXHA 5D3QA 3CLRD 5FJJA 1Y7TA 4G9GA 4S2UA 3WLEA 2EC5A 3NIFB 1YRYE 2W2TA 4QD3A 4TTIA 2BHTA 1E63A 4MEJA 1D0SA 3ONWA 4C08A 4F45A 5T4BA 4HK4A 2XKKA 3W3ZB 2OAEA 2A9QA 2OCIA 4RELA 2DSNA 1GPDG 4L6AA 4J1TA 4JP2A 1H2WA 1N2GA 2BEWA 2IODA 3K1YA 5BSFA 1XL1A 2XVYA 3ZD6A 5AHOA 5JAQA 4MYSA 4DC9A 4MIOA 5IDXA 4MAAA 1PT5A 1F8GA 3VHQA 4IQ0A 2LKDA 2DUNA 3BDAA 1GL7A 3GFPA 4DR3B 1U3FA 3PF8A 5DCLA 2DQZA 3UK7A 5DYIA 1Y33E 4RHXA 1GYRA 2REBA 4QQFA 2R97A 3PGJA 3GFGA 1YU9A 1VKHA 5FWNA 2AEMA 1D1SA 1Q19A 2JGMA 1UBFA 4KAAA 2EKZA 1S8OA 4DG8A 2D4HA 4DWJA 4EHAA 3HLYA 3QKSB 1Z0FA 4XCVA 5AKIA 4BTEA 5K8LA 2AFHA 1QLJA 1FDRA 4EYKA 2IYYA 5CVTA 3QJYA 1VPDA 3KS9A 4W82A 4Y6QA 3OU2A 4EZIA 5C8ZA 5I7EA 3SYRA 4MVJI 4W7HA 2XZDA 1MC5A 3B1ZA 5AVUA 1ORRA 4FW9A 3PJGA 3FSRA 1B1AA 2VOJA 4QPPA 3BUSA 1GADO 3WKDA 4Y2VA 2FV8A 2PSFA 3ACCA 2C9OA 1BC5A 1LS1A 2B61A 3KAPA 3ZHBA 4KJZA 2BFMA 3HABA 2H2AA 1XMPA 2IZ7A 3FW1A 2B2CA 2BKXA 3PVSA 1TCAA 4C04A 5ALPA 1VZ2A 5LOVB 4KR0A 2I29A 1BXKA 1R88A 5EJEA 3P9ZA 3CM0A 3OZVA 221PA 3DBRA 5FPQA 4DV7B 3MUOA 5NLLA 5LZ8A 4C7VA 1MNAA 5DLDA 2QT0A 2LNDA 4J0IA 2VDWA 5JMTA 1QTNA 2MT9A 3EBOA 1PLJA 1NW3A 3E9MA 3AHCA 4GVLA 1DARA 3PXCX 1H0HA 5FO0A 4PQRA 2ABWA 3T9EA 4I4NA 3U5ZB 5AKLA 1X7WB 3U48A 2VNIA 5EIAA 2QAJA 3LXMA 2B37A 4I81A 1MJGA 3LUFA 1E7MA 3HN7A 4N0PA 3ZVMA 4M0MA 1ULBA 2Y0EA 4HNAA 5FBVB 3RB8A 5TT0A 1U04A 2ODAA 4HKTA 4DLLA 3DT8A 3KUUA 2HLDA 3DPUA 2FVYA 1QOZA 1OLSB 2GN4A 2WYOA 1PO7A 4RJIA 5F3RA 2BBSA 3KQUA 4FWTA 2PZAA 2QL6A 2ZWVA 1GQFA 4L9WA 1S1CA 4B9AA 4O4HA 5EIEA 1RLMA 2H2FA 2FPIB 3F97A 4LXYA 3WFIA 4YAFA 3IHLA 3AR4A 2ONYA 3TSOA 1I4OA 2V97A 5IEJA 2C03A 1U0NA 2XMSA 3H1PA 3OZRA 3DMHA 3EW7A 3GG2A 2REQA 1JKMA 4C6HA 5FXMA 4CL0A 4DTIA 1U11A 3HVRA 4N6NA 1RXEA 3A8TA 3GLHB 1ID8A 3ROMA 1DXOA 2FY8A 1A7UA 1SG6A 4HZUB 1GFSA 3B1JA 3F67A 3HWRA 3IAHA 1GN8A 3LCJA 4R41A 4DIEA 5TQVA 3WLFA 5IWCA 3PIIA 3DWGA 3QPBA 1QKJA 4G41A 3ADDA 2OMKA 4A27A 1BH6A 3ZD9A 3O3OB 2AN9A 5H83A 3IJPA 3NR2A 1EFHA 3M6AA 5FADA 5BVHB 3LWZA 1WUIS 4AKEA 1ZGZA 3RE1A 2WV9A 3BSFA 3CH5A 4FMPA 5JLAA 3R7NA 3STTA 3U9SA 3VVMA 3ZE7A 3RYIA 3KTFA 4NCHA 5TXGA 4A26A 1C7IA 2I34A 1JFLA 2JFWA 1XTKA 4JYBA 4XYEA 5E4YA 4OLJA 2RGRA 3NM4A 4LY6A 1HDXA 2X2EA 4GRIA 1TUBB 4RVHA 2ADFA 3QRWA 5LLDA 1JN0A 3QE3A 3V34A 3H16A 3VHXB 5F2KA 3NTUA 2CLOB 2CFCA 3C3AA 1NMQA 3TAUA 2GAJA 3FAKA 4HOYA 1E6MA 3PZBA 5T41A 1R0YA 3WHPA 1VSVA 3H99A 1MNQA 3UJBA 1KS9A 1ADJA 3H2ZA 1O5OA 1C0PA 4J0DA 4KXWA 3IDAA 3TQFA 3LA6A 2FSUA 4GGOA 1JHZA 5CB4B 1KA9H 3GJ7A 5I7FA 7REQB 3H5WA 3I39X 4ZMRA 1GD1O 1YXMA 3WLOA 3D3WB 1O89A 1ZNYA 3ON5A 2RI6A 4Z9FA 2QJFA 3RBXA 3RSZA 2WKPA 4TL7A 4QDKA 1BOFA 1Y8ZA 1IJEA 4D7AA 4ZVPA 5BR1A 1NYTA 1Y1PA 2CXQA 2IIPA 3GPIA 3UB2A 1Y6GA 4EW2A 1MPXA 1M1ZA 2R1ZA 1IHPA 3DTVA 2JCBA 2UZ0A 3MRVA 2WNIA 1CY6A 4PZYA 4WLVA 3LL4A 2F43A 3CUTA 1HMPA 3P0HA 4N82A 4WX2B 5HKOA 3M9LA 4MRRA 2YY7A 2QJWA 1AS3A 2LGJA 2OUKA 3N2GA 3S8YA 2NZ8A 2C1ZA 4CKWA 2Q6OA 1L5KA 5KYXA 2AZTA 5ES4B 4AP9A 4J0GA 4RD6A 1CQWA 1KXJA 2G83A 3FPSA 2G0NA 1QQAA 1TTHA 3AHDA 3BDIA 4LYJA 1D2EA 2OBNA 3GIWA 4Y98A 4ZC8A 2GPTA 4UOQA 3ELYA 4N65A 4CT0A 5HZHA 1W36B 1UBSB 3QFSA 4L7VA 3RD5A 4HNTA 2V6IA 3NRBA 3TS1A 1DELA 2PL1A 2BSAA 2GFQA 5FD8A 2G25A 4ZYTA 2YVKA 4QYXA 5ARBA 5BV7A 1P81A 3KUCA 4XLLA 2ID9A 5CDFA 3OPMA 3C5CA 3Q2IA 2F3UA 1QTIA 4P3PA 5ANRB 1X7XA 3BMOA 3BJIC 3C3EA 1HE4A 2GT1A 4UJ5A 5FO1A 3ZDYB 3LQ2A 3RLIA 4BMCA 5K6RA 1KRWA 1WBDA 2IBSA 2NZ2A 5K7SA 1E0SA 2R84A 4B73A 5IK2A 3EA4A 5IG2A 3MEQA 2VZ9A 4UC0A 3FYSA 2JGIA 4KE8A 1CT9A 1F5NA 1NW7A 4B6QA 3UY4A 5BW5A 2ZIZA 4PONA 4EQ6B 1ZSNA 2IA5A 3AUXA 1QH1B 1PJRA 2Q6VA 3UV3A 1Y8RA 4CBVA 4GYKA 2NSYA 3DZ8A 4IINA 1II8B 2XB2A 3SC2B 3RC1A 3RVPA 3ZWQA 4KUGA 1CUVA 4C7KA 4LGMA 3M2TA 4IUBS 3ZE1B 2JI9A 1U2EA 1TUIA 4OKSA 2O8EB 1HDOA 1ELOA 4W1SA 2WDPA 4CKEB 3UXHA 3ZDFA 1LWNA 3BD9A 1TA9A 2QOEA 2W6CX 3OPYA 4GX0A 5BSWA 2DM6A 4HAZA 1RAHA 5IFLA 1NIJA 3GZNA 2WTUA 1GAWA 1PJBA 2ENUA 1NU8A 1MG5A 1QHHB 2EATA 2JHFA 2N42A 4I9GA 1Q1GA 4IIEA 3D5TA 4G0VA 1ZU4A 4PSUA 2FJUA 4BQQA 4DCVA 1Z3CA 4XWYA 3L8CA 1RYZA 1K5DA 2G4LA 3IURA 4MWSA 3R5TA 1DLIA 4WIAA 1QPGA 1J1IA 3AMVA 1V1MB 1I9GA 2GNPA 2WWRA 3DKRA 3DZBA 1KVSA 1QDLB 1ZJ4A 2XDQA 5KWVA 3HP1A 1Z6XA 1AY0A 4YLEA 5D2CA 5BUCA 4EHNA 2YKGA 1CYDA 3V4ZA 4B4OA 4EY7A 4Q4AA 4L76A 3A58B 2A35A 1GARA 4UBKA 4NEHB 2ZVPX 1EUCB 2BFBB 2NGRA 3QLTA 5I7SA 4GI7A 4DLVA 1SD5A 4BQFA 2UXDB 4FMBB 5DXAA 2IPAB 1ZJJA 2VWPA 1CUDA 1DMRA 3B52X 2AUMA 3LUDA 2HJGA 1O2DA 5CNMA 1Y6QA 4JI1B 3A3NA 3W5IA 2C5AA 2EFEB 3U7IA 3INYA 4KB5A 4WSOA 4YTEA 5DHUA 3UYLA 4BFTA 4K6OA 1PJ4A 4YASA 3RRMA 5A1TA 1DRKA 4HFNA 3AF4A 3K70D 1V43A 2P9EA 1GOTA 1Z0UA 2H1LA 1U1IA 2P4UA 2ZIWB 1Y9DA 2C7GA 3BE8A 1A9OA 3EQ9A 2OKCA 4FYXA 5FPPA 5H70A 4OSOA 2K87A 2OAP1 2X8LA 4B0PA 4DCTA 4RTJA 3BJRA 3GRVA 2ZIEA 5F9FA 4HLNA 4MA0A 5KYNA 1NW4A 4H3HB 3NDIA 2AR0A 2OECA 4MO2A 1BGVA 1AHHA 1EIWA 2FEAA 2LZ0A 3E18A 4I3HA 1H5NA 3DT9A 1MJ5A 4FSHA 4CMIB 3I2YX 4ZHSA 2X5NA 4H7KA 3USCS 1D6NA 3M70A 3FYTA 3GJTA 3JATA 2P9HA 3H3FA 4AROA 2QD2A 3Q1KA 4QPCA 2OOKA 2ZU0C 4GW3A 4C03A 1AXEA 1CUZA 3KVRA 3PRJA 2GRUA 5E2AA 1QGUA 4UUAA 3GX1A 3OY7A 5E0KB 3ZG6A 4D74A 2Z6QA 2O8CB 3P0JA 1FFCA 4LXIA 3ZGVA 2DBQA 4HRVA 4NZZA 1KWKA 2DPHA 1G2OA 1ND6A 1BCRA 1U1EA 2GPBA 3JQAD 1XLWA 5J4LA 3KQVA 2BOVA 2O8NA 1MIOA 3B6KA 2I6GA 2P62A 2W98A 3CJTA 3LQRA 4NLLA 3WS7A 4BNVA 5KO2A 1N34B 2HJHA 2GD6A 3LGXA 4GR5A 3RFXA 1XU9A 1I7PA 3L49A 2BGNA 1RI3A 3AXSA 1NXSA 3QLVA 5DZSA 1RXIA 3OPVA 4C76A 1T91A 2H08A 2NZXA 1AMNA 3PXUA 4DJEC 3IAS1 5JVDA 3O8OA 1WD7A 4HN2A 3TNLA 1JEEA 2LR0A 2VPXA 1CB0A 3FUWA 3OUZA 1TF5A 3SKXA 3VNQA 2RC5A 1N9KA 3WB2A 3AYXB 1YJAA 1AKWA 4EIWA 5HM6A 5DKFA 4DKJA 3NIWA 2GHIA 4YY3B 3BKXA 1HSOA 1T4MA 1U0GA 2YOHA 1US8B 3RSCA 2BH9A 4QAQA 2ZYIA 2AEFA 2C2GA 2L69A 3PQ5A 3WDSA 4E5UA 2I7CA 3LWNA 3CY6A 1LZLA 4WDRA 3TMAA 2ZS7A 5A04A 1L5OA 1RQXA 2YTZA 5DNDA 3E7PA 4ALNA 1SUEA 4PCVA 1U9IC 2P9QA 1DBPA 2WIAA 2DUUA 3HJCA 3JQGB 4R0VA 4UUMA 5CYOA 4NXMB 1WR8A 3C7KA 3QUTA 3WLNA 4P86A 2AW3A 4Q3AA 1B93A 3GLFA 1U2DA 2GN6A 3D0OA 4WZAB 1NBWB 1UDCA 2XQIA 2Y0BA 1CUBA 1GG2A 2XQKA 2GSWA 4PZCA 1OCEA 4Q9NA 5EINA 1YC2A 4ZEVA 4ZTZB 4ZDIA 4Q4JA 3O03A 4MV1A 3T5BA 2PIAA 3T5DA 4H1VA 2F59A 3NHJA 5JQGB 1V11B 1M8FA 1OZ0A 1VE5A 1WY7A 1XVIA 1Z2EA 1RYFA 2QQFA 3EDRA 3M0EA 2QVYX 1YNOA 1FUEA 1T9GR 4JLKA 2HF2A 4PPQA 1G3IA 4WZZA 3TSCA 5HOQA 4BFYA 5A4MS 2WQ6A 1FIUA 1A98A 1BXRB 3AX6A 2HIHA 2BMWA 3HXTA 2HGZA 4HVAA 2KBEA 2FX5A 4HUQB 4WZBB 2Y77A 3K4QA 3AVWA 2AKAB 4M87A 2JLXA 2FAXA 4M4SA 2A7QA 3GXBA 5G4KA 4MPDA 4E07A 3G2QA 4NOLA 2G09A 3UT5B 4UZSA 3X2FA 1S02A 2GNAA 3K9GA 3RVNA 4A1FA 5ITZA 4R5HA 2O0MA 3PC4A 3KU1A 3SSMA 5JFOA 4AUMA 4LF4B 4C7JA 3GCGA 3ABZA 2G40A 1ZINA 4FQ8A 3WLKX 3ZC3A 4CTOA 1JHAA 2V7UA 3KB8A 4FDVA 1W9HA 2QTBA 4QVGA 5EL0A 2GXSA 3NCHA 1A8IA 3G8DA 4A16A 1B2RA 3TLAA 1R4MA 2IFTA 1KZHA 4FYJA 2QNBA 2YYZA 3D6NB 1CQPA 3KE8A 4K86A 5E3IA 8OHMA 3I53A 2GKSA 4HDSB 2R85A 3VAAA 1CIVA 4QDJA 1H9CA 4PXYA 3SJBA 4DKXA 1E2BA 1CDEA 3GLIE 4JV5B 1DG9A 4AXBA 2NU9A 3A10A 5SY9A 2HM7A 1T2AA 1Z5ZA 2J4FA 3AGQA 1IULA 3FDFA 5DGCA 2VF4X 1ICEA 4U0JA 4CQLB 2JFOA 5BW4A 1XZQA 3H97A 1P61B 3CX7A 3AJDA 3MT8A 5DBOA 4OY3A 5HKLA 5C7IO 1G6Q1 1I13A 1ZCFA 4FXOA 1JAZA 2ZYGA 3P9CA 1P2FA 2IYNA 4UCXA 4DAEA 4F5ZA 1WIWA 4REOA 1LPPA 1QH0A 2Y71A 3ELWA 2EG5A 2DWQA 5KSOA 1JLLB 3HVUA 4N0EA 3RU2A 2XDWA 4HLUA 1LRKA 4C4SA 1BE6A 3ABIA 3EIFA 3CGWA 3R9IA 2M6LA 4FOOA 4Z4CA 2E9SA 1OLXA 1NVFA 4PSDA 5FKJA 3S2ZA 4EF5A 4GPEA 3QSYA 5F2OA 1D2RA 3INGA 3K0KA 1LDYA 3BGVA 1IHDA 4JKYA 1A8SA 4MW0A 2ZM6B 4RNDB 3NHLA 1U8XX 4ZMSA 4A7PA 1X74A 4G1CA 3RS7A 1Z37A 5TS3A 5J5VA 2ZJZA 5A5GA 4P4TA 4OHCA 3GQBA 4IDDA 3UICA 5LKRA 5SY4A 2J5KA 1ZNXA 3ESBA 3K09C 4L74A 1CJBA 1XK7A 4IRMA 1CHNA 4ZZ2A 4EPTA 2PMFA 1Z0KA 1TYAE 4MKHA 4WQMA 3GT4A 5H16A 4E51A 3U56A 2Q6KA 1E2IA 4M7WA 1TECE 3LC0A 4XZ3A 4YJFA 5K03A 2A9KA 2FQYA 3RRFA 3F90A 5B1EA 2JLUA 1CY1A 3CEHA 4YAKA 1HBJA 1CZOA 1FDTA 3UJDA 4S1VA 2BM0A 1J23A 1SH7A 2BEUB 3DCNA 1EDDA 2JAQA 1L5QA 1OAOA 3GJ6A 4LE1A 4QICA 3B3QA 2V6BA 2QUAA 3RJ9A 5JADA 2XUKA 4X85A 1ZNQO 1YR8A 1OI3A 1R9JA 4R1QA 4IJMA 1MXFA 4EGCB 3VKVA 3WJ1A 1ZUD1 2BHLA 2A1IA 2D2FA 2W0SA 4ESEA 2C0CA 3ECCA 5L3ZA 3H6GA 4RLQA 3EZGA 5FEMA 3ZZMA 2WUEA 2GTIA 2WJ3A 4UCFA 3HI6A 3UJCA 3C7CB 3CW2A 5DGIA 1QXSA 3FNRA 1JVBA 3DH0A 1PI3A 3K9CA 1N5DA 1QUEA 4OXQA 4JH0A 4QYTA 3ND8A 5FHQA 4QASA 1QIHA 3T5MA 4A2WA 4TMZA 2XA2A 4MQEA 1YNSA 2HPHA 3WK7A 2O8DB 1G8KA 2CDAA 1JEJA 2XD4A 3G8CA 1AMUA 2E37A 1NYRA 4YDQA 4YCJA 2AOXA 4EPXA 2FRVA 1FFXB 1NW5A 1UJMA 1TD9A 4PQGA 5B55A 3ZE2B 2BIFA 3MM4A 2E1PA 1GZ5A 5HJEA 3JASB 3WP1B 3AF1A 2DH5A 1NRJB 1W4CA 1K97A 2BFPA 4QU9A 2NNLD 2LP4Y 3C0KA 1VI2A 4HNUA 2C4NA 4U2EA 3KWLA 3MHTA 1BVUA 4WK4B 2YVUA 3LKDA 4MVJA 4PYOA 3D6JA 3Q6MA 1G2IA 5D1NA 3G0HA 4KYVA 1OFGA 4REQB 4PYRA 3VNSA 4M0LA 3ICQB 3KVVA 3LRPA 1XMVA 3C3WA 5KWSA 2ZRKA 5LDGA 3EGDB 2RARA 3HKBB 3ODGA 5TF0A 3DD5A 4BC0A 1JIJA 2HLHA 3H5OA 1QH9A 2ZETA 1N0UA 1EUQA 3V32A 1N5MA 3OEEA 5J63A 3BZWA 3DE5X 1L0BA 4YMSA 2Q0XA 4TV8F 2YZ2A 5C5CA 1YB6A 2IYWA 3EXIA 4KFTA 4E5YA 4DR4B 4DMLA 3V00A 4ZCMA 3ROEA 2IUTA 2W6IA 3T4EA 3SSAA 1FMTA 1KH3A 3CNEA 1A9QA 1T36B 4GXQA 3HCEA 1HG1A 2VDRB 2FPUA 4QHTA 3FCAA 1MVOA 1LA2A 2DHEA 2OXCA 2JCYA 4JT2A 1F2UA 1K08A 1KPIA 4X1OA 2BONA 5IVPA 1K75A 5LR6A 5DHAA 1E3TA 3VUEA 1G66A 1BFUA 2X8JB 3QEBZ 2FZ5A 4Q3CA 1N6KA 2FTKE 5AOAA 4IG4A 4E1VA 4HGPA 2VJCA 1K1EA 1DTWA 4N5MA 3T52A 2F55A 2HCFA 5AW8A 1FYEA 5HMLA 4WKPA 3E9ZA 4RS4A 1LRLA 2GBPA 5LIPA 2PFSA 4PM4A 2AMYA 4Z9BA 2OPHA 1FFAA 1KGDA 3UB4A 3JAMA 1NXQA 3MWFA 1TKAA 1NC1A 1J0AA 2Q3EA 3SYKA 3KETA 4BMVA 1WETA 1Q7TA 1FYFA 1P29A 2FW8A 3C43A 3IHTA 4ZI7B 4E3ZA 1OXXK 4MVJM 4EDFA 5ECGC 2GQ0A 2CY0A 5E6RB 1OFUX 1L7EA 4IFEA 2F9MA 3VO1A 2VO1A 2IF2A 2WOJA 3MZ0A 1F38A 4Z49A 1NXVA 3HCWA 3M1YA 2NQTA 5AKGA 4ZAZA 3B7WA 4K46A 1UJ5A 3ZTWA 2P2YA 2P4EA 3MOGA 5JYBA 4CTNA 4G8DA 1TVKA 3F7NA 3PWKA 3JARB 4Z2YA 4URUR 3T3PB 4RVUA 4TXHA 1NNUA 1QR2A 1K6JA 1GPJA 1G7TA 2W48A 3AVQA 3AKEA 3I6IA 1E3IA 2HLNA 1HYEA 1SEVA 1TU4A 4RJJA 4A0SA 3NDBB 2RAFA 3DLPX 4K3VA 4W5TA 2GN8A 3OOEA 1EA5A 4LOLA 1B3RA 2HDWA 4LI3X 1QS0A 3GGGA 1P9RA 3WHKA 4CM1A 3PWSA 4UPEA 5JISA 2DULA 1L7MA 4RXTA 1XHEA 2ZWAA 5B2FA 1YT5A 3IQHX 1EFDN 3I37X 5EZYB 2OXTA 3W34A 3WK9A 4YRIA 1XBTA 2G17A 4OXXA 4E30A 3JD0A 4YJ2F 4NZ9A 1MUUA 1I4WA 2GA9A 1ISJA 2DP4E 3HBNA 4FEYA 4MR8A 5C8YB 2QP9X 3P71T 4GPAA 3SR0A 5GWXA 4D9HA 2ZEJA 4EHLA 2CNNA 5A4IS 2XZOA 3CT6A 3NUQA 4ZO8A 2P2LA 3NJ8A 2K2WA 4C88A 3TTYA 3DL0A 1KI2A 4TQUS 3K20A 3L0CA 3K2QA 1S2OA 3LUPA 2G07A 5EE3A 3R9XA 1BW9B 3LF2A 4YN3A 1H9BA 4ZKEA 1TF2A 2L82A 4UM8B 2JAXA 3W05A 2X1MA 4KV7A 5GY7A 4RABA 3TVYA 3K6SA 2QL7A 1WCIB 4U9HS 4CQMA 4XM0A 4A23A 2MMGA 2C54A 1Z4JA 4ZYYA 2MSWA 4J2OA 5K8CA 1DEAA 1JSCA 1UZMA 2D59A 2HMVA 2WTEA 5AJXA 4O0MA 9ABPA 4IFBA 5K99A 2B4TO 4LQDA 1BEUB 4FFDA 1M0EA 3DBOB 5FNVB 5FOVA 1VMKA 4L51A 2XBMA 2VNHA 5BYBA 1Z6TA 4IQ4A 4KDEA 3ITEA 3TZKA 2JHCA 4A2CA 1YCGA 1OT3A 4ZYVA 4HGZA 1M3SA 1WCV1 4UATA 3BWEA 3NO4A 5KQGA 1T9DA 1AS0A 1OI2A 2J6BA 2J5QA 3AV3A 3KEGA 4JBWA 5DHFA 2C59A 3L0BA 3TR0A 3VMMA 3COYA 4BZQA 2CNKA 4KR7A 2QRUA 3GP5A 4QXAA 3UJHA 5H5JA 2QQ0A 2A1UB 2YINC 1T3ZA 3CT4A 4FNAA 1N8SA 1RKVA 2IP1A 1Y9AA 1X7DA 2QLNA 3WP0A 3L7LA 5KOJA 5IUNC 4L0CA 3RV4A 1UZNA 1D1TA 2NACA 2GB4A 3A4NA 4GWKA 3T1VA 3GJSA 4H17A 4DW8A 4OH7A 5TPWB 2FPPA 3WGOA 1CUYA 4RENA 1GNVA 1RI2A 3DEYX 3HBMA 4FLFA 4ROSA 2Z4TA 1RRCA 1SN7A 1HDGO 3ZBPA 4RM2A 2ACWA 3BXOA 2QN9A 2ZYRA 5HKAA 1JR2A 4POOA 5LYJA 3K9BA 1ZH4A 4KO3S 2A33A 3KD2A 3EWAA 4ALLA 4DB4A 3T5GA 4ZHQA 1ZRSA 5C7OO 1ONPA 1L4YA 1SAYA 3QA9A 2IXDA 1NBHA 2OQ2A 1O95D 1OI7A 3GBVA 3V8VA 3ZUPA 4GI1A 4BLTA 5B7QA 5J2TA 4Q7MB 2P65A 2NP7A 3HSSA 4PC1A 5KWIA 5AKKA 4D0SA 1FS4A 2I3ZA 2TMYA 3G2HA 5JMPA 5IKMA 4Q3KA 1JF8A 1OV4A 1TJNA 3KTAA 5COAA 3HXLA 3A14A 1GPUA 4XQEA 1YFJA 3BK2A 3ZCQA 2GJKA 3AI3A 1X8KA 1XDSA 3VZBA 2C9BA 2AQKA 1WB4A 4RL6A 3LBYA 4P3XA 5JOQA 1JMVA 1JIQA 2ZJ5A 4EPVA 1K8RA 3SBOA 1GZ6A 2VP9A 3B9PA 3ICCA 4XUDA 1H1LA 1SHUX 3A1FA 3NFYA 2H4ZA 4TM7A 4C14A 5LIRA 3R74A 1EX1A 4ZAYA 3WGYA 4BFVA 1KFKB 4M1QA 1NHWA 3IVRA 2I55A 2PSSA 2XWSA 4HYYA 5ARCA 2FMUA 1S3GA 4D3YA 3NWPA 4FYPA 4PVDA 4U6SA 4CKCB 3FAZA 3KT6A 3B60A 3VU9A 4C6RA 3CNBA 1FUKA 3L0DA 1VTKA 4K9PA 4M1SA 4ZC1A 2NADA 5JSZA 3C7AA 2BEVA 3D3NA 2WMNB 4CT5A 2CHEA 1PTJA 2P79A 3OTHA 2FU5C 2VYCA 5KC9A 3PLRA 3E1SA 1GHTA 1Q2UA 1QWSA 3ADPA 1Z6YA 3EUWA 1JHPA 4IS2A 1P62B 4LRUA 4PO3X 5EAIA 3S99A 1XMOB 1SC3A 2PD6A 3LY5A 2PRZA 3S44A 2GUGA 4FEAA 3EQZA 2RKOA 3C3YA 2FRDC 3OIFA 1Y9JA 2CZQA 2HSGA 2B25A 3DUFB 4KNWA 3OM9A 4CLDA 2GO7A 1OXSC 1WUHS 2BW0A 2W8BB 3LAWA 3WBFA 2XY4A 2FZVA 5FJIA 1TMKA 1KJNA 4A8PA 2IPOA 2GBIA 1Z88A 2PX2A 3WZ2A 3MWEA 5ALQA 1UR5A 3ZV3A 2CXOA 3BXXA 4KTTE 5D84A 4Z4GA 1L4MA 4HP8A 2NZVG 4MTLA 1FK8A 4UPVA 1GGNA 4EABA 4AP5A 4MRMA 1M33A 4Q37A 3EC1A 2VK2A 4CR6A 3WJAA 3BB1A 4WXHA 3U7RA 5A2GA 3CZRA 1UMBB 3THWA 2JJQA 4WCDA 5DRTA 3AVPA 3H5NA 1GFWA 5EP2A 4UASA 3MT0A 3ZK7A 3OJFA 3NTRA 4QTXA 2UUBB 1UBHS 4FJ2A 2H54A 4M1TA 4O2RA 5DF1A 3E9YA 5J9FA 1JTVA 3P19A 2PZJA 2OTCA 1V41E 1R0CA 2P6NA 1G21B 1WPQA 2CLMB 1KTVA 2FH5B 2X8WA 3G5AA 3EIOA 3HYNA 3V7NA 2CLDX 5J23A 2HXSA 3KRTA 2BFWA 4P32A 1OBCA 3KE9A 5IDVA 3A2KA 5F33A 5IYZB 4KUEA 3LHFA 2ATXA 4Y2RA 1I0ZA 2FFRA 3PGMA 1FP6A 5F3DA 1LV7A 2A1TS 5AXBA 4KPUA 2NTJA 1NE7A 1GR0A 1R4ZA 2W0MA 3H8JA 4CNBA 2R1VB 5B3LA 3E05A 1UMKA 2QYTA 2NU7B 3QVKA 3MWYW 1ZA1A 2CBGA 3NQ41 4PZEA 4QJ5A 4JL8A 5IW8A 1FQKA 2XIQA 3Q3GE 2EF0A 1FNSA 1MMFB 1S3FA 2EJBA 4RIIA 3AXTA 2W2LA 4JQSA 2PRJA 1WKCA 4LX8A 4HDAA 1JEOA 4L4SA 2AJDA 4P4NA 3VPBA 4NV1A 4D0LB 3FM9A 2IEDA 1BN6A 2EERA 2EHDA 3EIEA 1GPNA 4IIUA 1H85A 5ADWA 2G9UA 3DMPA 2NYUA 1R74A 3UG6A 1J0CA 4DUZB 2FUKA 2V74B 3AWIA 5E4FA 2BHSA 2WKQA 1NF9A 4RH3A 3I5MA 5EHNA 4D79A 3ZV7A 2LCQA 2P9BA 3EVCA 4YRZA 4QM6A 2GNOA 3O9MA 1HYHA 3KUKA 3G82C 4AL4A 4LA4A 4MWCA 1IBRA 2OO3A 2WV7A 5CVUA 3ZVRA 1CR6A 4AZ3A 4BQRA 4XJSA 5C18A 2XRMA 3K6KA 3LPAA 4DA0A 1K98A 1BYUA 1DO0A 3QVMA 3KNZA 4IIVA 2J85A 3FLAA 3HYTA 2REXB 1GN9A 3HRIA 2OM6A 3PWZA 4ZT5A 1FP7A 2DBRA 2E21A 1GQ2A 2BMVA 2JFXA 1SULA 2LTAA 3FNFA 3LU1A 2GCOA 3G2JA 3A3YA 4TWZA 2WSSA 3SZ3A 3OCJA 2Z2KA 4RD1A 2J30A 4S3MA 2JC3A 2OV8A 3AUUA 3QWIA 4PSVA 3TZBA 3E1GA 4BUCA 2R8PA 3C1AA 3D1VA 1QG2A 4X93A 4NICA 2YOGA 3N05A 4WLOA 4XQCA 4QXQA 2CJWB 5DHPA 4NYIR 1SQSA 3TTUA 1EDZA 2XBUA 5I9SA 1KSGA 3VHLB 4NBKA 3FPKA 4ZQGA 3AUAA 1MKYA 4U5QA 3NHYA 5B37A 4CMJA 2D0IA 5ICGA 1U2GA 2ALJA 4F12A 1DDIA 4IIJA 2Q29A 2C0PA 3KJEA 1YGPA 5FAXA 3A3OA 1X1AA 1LQUA 3H2KA 4HAIA 1K5PA 1XZBA 2JVKA 4B3TB 5REQA 1M67A 5LQCA 1SKMA 4DZRA 4X6UA 1E2PA 3I6QA 1GU7A 4H08A 4EY5A 3CH7A 3PQEA 3RBAA 3T0FA 2XCUA 5BSTA 5FTWA 5FYDA 2NIPA 3AY7A 3JQ9C 4YQYA 4ERXA 5BMOA 5DW0A 4YGXB 3RHTA 3LL7A 4R1UA 2CHUA 4BTVA 3N1UA 2V6MA 3GFTA 1DOZA 5KU7A 3VJKA 2XB6A 2ZBUA 1AGYA 2HU2A 2Q1XA 3QXGA 4I5DA 4KKXB 4I1SA 3E4CA 1T4DA 2IIQA 4R9NA 2NZYA 2PZBA 1Z2AA 3IEIA 3EIXA 1Z7EA 1N5IA 4X63A 2XYHA 2ZWPA 3T9CA 1XTSA 1GUFA 1YB2A 2A67A 4GYYA 4BE4A 2RFLA 5CA1A 5FRDA 3EMDA 1TM5E 4OUDB 1Q3HA 1FJXA 5H7XA 5T64A 1OFUA 1PT9A 1ZS9A 1ONNA 1P75A 4M54A 4AICA 3Q98A 1V16A 3RHZA 3A4LA 1QIKA 1VLQA 2BAGA 3OT1B 5ALXA 4C4OA 1YUNA 3P2MA 1JILA 1VKJA 1NVXQ 2CK3D 2E4AA 2Z08A 3NVDA 5CX4A 3K1JA 3NBFA 1DJMA 4EVSA 3OWOA 1KPGA 1T2NA 1H2BA 2B4RO 2RH5A 1X39A 1E59A 4PR0A 2FG5A 2F8TA 1Z5OA 3VX3A 1M6VA 5IAJA 4DMCA 1LLFA 5CA0F 1LWOA 2D2EA 2D74A 3OT5A 1GNRA 1RBQA 2VF2A 4JUFA 1POXA 5EUMA 3DXFA 3TL2A 3GNSA 2MDTA 4YMIA 1UM9A 2F1OA 3KOMA 3N2LA 3IVCA 1CUJA 1ZPDA 3KD3A 5HX7A 2YN2A 1LPSA 1S01A 2AEEA 3VU8A 4XVRA 2QN8A 4JBXA 2RBKA 4UEOA 4IWNA 1BS9A 5DMHA 4Y2SA 2PUAA 2RGCA 3DE6X 1I2ZA 1WDKA 1T3SA 4G5OA 5IDYA 3V2IA 4DRXB 2RGWA 2CJYA 2F9LA 4JX9A 4YAJA 1WB9A 4BB5A 4Q3DA 3HFJA 3X1DA 2VDOB 2IOFK 4MRAA 2PPVA 1Q1AA 3KVYA 4NJOA 5CVJA 4HNHA 3KQYA 2JFNA 4I50B 3RRXA 3BJEA 3BMNA 3QPUA 2C31A 1IQUA 1FP1D 3ELDA 3TFOA 1HT1E 4Z0HO 5BOSA 1RRKA 1WV0A 2H1WA 2J6CA 3AG5A 4K9RA 1BS1A 1GL9B 2JGKA 2R8XA 4D4HA 3IOBA 4MWDA 1JLSA 2QTNA 3ZOZA 3EWNA 1PW7A 5D86A 2VF5X 4F9FA 3DMNA 4DC0A 3KQKA 3ER6A 1RC0A 3SKVA 3TR5A 5KJCA 1Z5PA 4AJIA 3KHTA 1P3DA 2COEA 1ZXLA 4QG3A 4MWOA 1KKLA 2QG9A 4CDRA 3AW9A 1B0AA 3KOZA 4FLEA 2ASEA 1DTSA 3ETDA 3G7SA 1KZ4A 1BX1A 1JBEA 4TV9A 4PR3A 4LBWA 2PKQO 2XITA 4J2TA 2HMAA 3O0TA 3VDNB 1LUAA 5J4KA 3TI9A 4W4TA 3F98A 3UWSA 3OQJA 2ZREA 5IBPA 3UFXB 4C21A 3B9QA 2VP2A 2V0CA 5CBKA 5HS4A 5ALZA 2QLJA 5ICSA 4QU5A 3UMYA 1A9SA 4BBPA 2CLHB 2PMKA 3RS2A 4NX2A 4OX9Y 1MD9A 3VH1A 2PBLA 3ZW7A 2E5WA 4B3RB 5LZ7A 1ODCA 1HEYA 3AT1A 3NM6B 4JXKA 4QTZA 1WCYA 3NHPA 4L28A 3DHEA 3AUYA 7MDHA 1TVCA 2PLFA 3SBXA 1AQJA 1RAFA 2QVGA 4WOJA 3F7OA 4Q9KA 1OFHA 3KTOA 4MMZB 5ESDA 1H2EA 1NRWA 2FEMA 1CUUA 2JAHA 1Y3CE 4H77A 3UYKA 4DLZA 4KR2A 2ZVJA 1P9OA 3SYTA 1ADYA 5CT9A 1YA8A 1QB8A 2V7PA 1F48A 1Y1LA 4N0MA 3L6DA 4F8JA 2QN1A 4KE6A 1DE0A 4I6JA 1JJFA 3K31A 4QOFA 4AJ2A 2QMYA 3IKMB 4Q7EA 4M3NA 4JXZA 1CDZA 4PZUA 3QE9Y 3H9UA 4NVRA 1O57A 4J6FA 4J1TC 4JB2A 3G23A 3DV0A 4E13A 1D7AA 1V35A 2OP1A 1IG3A 3KELA 3DEKA 1UIMA 4D8TA 2KE5A 4UVDA 3PXAA 2A84A 2IH2A 1L5FA 3Q8WA 4P7FA 4D0RA 3A36A 4IZIA 5DLQC 1I1QB 3QK7A 5IAKA 4U2DA 3RVKA 4BNKA 4B4UA 3I0ZA 3LVQE 3FYDA 3GNLA 2EW8A 2O2SA 3UUEA 5KOYA 3RC3A 1YR3A 4Y1FA 3GLTA 3KC2A 3M4YA 3MMPA 1QLHA 4N0DA 5ITVA 1P0QA 1Z68A 3NCTA 4IJWA 2XNDA 4EI2A 3ETNA 3ZXYA 3CNOA 4CM4B 2M2IA 3EXHA 3I62A 1GFZA 4OATA 5LP1A 1KFEB 2I2CA 3LW8A 1C3XA 2VP3A 3R5JA 4G24A 1Q0ZA 5CUQA 5EZQA 1UZAA 1RJDA 2WWFA 1AVTA 4EY6A 4CQNA 4UREA 1ZRMA 3DWFA 1LNZA 3QKRB 4HEA6 4LAFA 2FPLA 4FDUA 2JFHA 2O1SA 1O8BA 1DAFA 1RJ9B 1SBYA 2DT5A 2RGXA 2XZPA 5E1OA 4PLVA 3AETB 3ZH9B 5IC4A 2J31A 5JS6A 1QBKC 4KX3A 1NATA 3AYZB 2H7YA 3DM9B 4TLLB 2H2HA 2GF0A 2BFDB 3WISA 4O4IF 3FCOA 4DDWA 3FMVA 4BN5A 1TIPA 4BFCA 3UXYA 2BZSA 3JCZA 3P27A 2ICAA 4RIFA 4OOEA 3DONA 3HY3A 1WULS 5K0NA 1D4AA 2ZJOA 3PT9A 4L8FA 1YS9A 2DRIA 2GD1O 3WZLA 1N9ZA 2GAFA 4U2KA 1W88B 3WXBA 1JXQA 2Z0MA 1JIKA 3O3NB 1MU0A 2C2MA 4JJAA 3GA5A 3PDCA 4LJ7A 1PVVA 4MVYA 4R4JA 3H2YA 5BSRA 4C4TA 1SZCA 1E4EB 2ZU6A 3AL2A 4MO9A 4NIMA 3SIRA 4JJEA 1UBLS 2C5SA 2G08A 3KZXA 4PRYA 3RTEA 1ULHA 4B3DA 1C9YA 3CV3A 3SYLA 1AUXA 1U2TA 3Q2OA 3UW1A 2AG1A 10MHA 3D3EA 4OA8A 2BKAA 3O8QB 5TMDA 5L6LB 2PS0A 2PUDA 3AFHA 4CR8A 5LN1A 4WOBA 2GEBA 3Q87B 3LQKA 5EZ5A 4KIFA 1T0HB 1R9MA 4HWSA 1XFAA 2XNHA 1DBSA 1M1YE 6ABPA 4Z7JA 2JI6A 1EWKA 3X2EA 1JHRA 1U8UA 3OD1A 4MJXA 1M1NA 2PCJA 4AJOA 4BTLA 1F12A 3H1EA 1TMGE 5J47A 1XMQB 3KLOA 1M2FA 1ZESA 4KSCA 2BBWA 3M33A 3AK4A 1VI6A 4K5QA 4G0UA 5FOSA 4YJHA 4L4UA 1PQUA 1ZK2A 3FSGA 3HJNA 4O4HF 5TQ2A 3TRDA 4XVUA 2LKCA 3EEYA 1FVHA 3AVXA 4LOIA 5CYPA 1T2CA 2HV9A 2VAPA 4B6EA 4V0SA 4DILA 1AV7A 2PV0A 2XXAB 5CT6A 3K0CA 2AMLA 4YV0A 1UP4A 4CYMA 2WLTA 3F96A 1NUQA 1XD2A 2ZANA 3Q9NA 4HMOA 4RZQA 3T9FA 1F2TA 4QSMA 3FGZA 4LMPA 1C1HA 1I4EB 5LQMA 3ECAA 2CFIA 4OJMX 3KYJB 3KZKA 4GICA 4RYLA 2PNFA 4ZRMA 3UAVA 4C3UA 1MGOA 3QXCA 5CAEA 2QM0A 4N9QA 1XZ8A 2ECQA 4OGWA 3TINA 2IUUA 4ND5A 5CM9C 1EGAA 1WEKA 1N2CB 3OEHA 2OWEA 1G8GA 5EMJA 4TKZA 1ZAKA 2H9YA 4YJGB 1MTOA 2OCLA 4YXWA 3R7WA 5KMGB 4D80A 3MTQA 3ENKA 4L27A 5JZBA 3I5XA 2RHMA 3I2KA 3BXPA 3OJLA 3VGJA 4P58A 4Z53A 4RTPA 2C1EA 1RM5A 1LW6E 2LCFA 1P74A 3G85A 3ZDXB 3T35A 2C9YA 2H59A 3PHCA 5EMKA 4RGYA 1SQ5A 3JWHA 1DDGA 5CITA 5HRCA 5YASA 1CG6A 2DPLA 2PD3A 3LDGA 2YX1A 2MYUA 3PNVA 2DQYA 2UZ3A 1T35A 3VYVA 2DQKA 3MELA 3WL7A 4ZCQA 1SWVA 4YMHA 2GA8A 3GT7A 2OZLA 4MWEA 5DGHA 1MABA 1DS6A 2COKA 2VJDA 3NU1A 1YOVB 1E0KA 2RHJA 3CUEF 1G20A 1GAQA 3OH8A 4NYMR 5JCJD 1IATA 1RACA 3DE7X 5CJ2A 5FT9A 4NE9A 5DHQA 5K3FA 4EJSB 3CIOA 4MA5A 1IM2A 3IESA 4L6CA 4ERNA 2PE5A 1CIPA 1U3GA 3E70C 4FNGA 3B6JA 1Z75A 3OPQA 5HUQA 2CLEB 1IUKA 2L2QA 3CO0S 4K6MA 2BTQB 1VA5A 5ALKA 1H42A 3UK0A 2HMUA 1X2EA 4LEIA 1ZDMA 3VR5H 4M1EA 1I10A 2BEKA 2YNMA 3PD1A 4P80A 2FUG1 4X9XA 4WNAA 2J9RA 2Y93A 3HQ4O 4YAEA 3PKZA 4NMMA 2BMEA 4BN0A 3R23A 4JY7A 3A70A 4KLZA 3ZHCA 2PVCA 1NDUA 2HQRA 1DHRA 3BQMB 2QRPA 3MBKA 1N25A 2FMIA 4PPNA 2FFAA 2HRQA 2GHTA 3F6CA 4CIXA 4E46A 3FIUA 1PYDA 1HE1C 4J4TA 4MPJA 4A8JA 6Q21A 1UBGA 2HN9A 4HNQA 3ZTYA 4RFVA 3ZGOA 1PVDA 2I9PA 3X43A 1HNWB 3USES 1T1RA 3D6UA 5JHHB 2GDJA 1M2HA 1NLUA 2OFPA 2AN3A 3O90A 3REFA 3WMGA 1G63A 1C4XA 3NBAA 2KW5A 4CU5A 3C4JA 2IE0A 2VF8A 3E3LA 1FFBA 1YGYA 5LUAA 4DJTA 3QKWA 2ZCJA 1HFEL 5EKTA 4PV7A 3SYNA 1SVLA 3ENNA 5AW7A 1SUDA 3V2HA 2HFJA 1SOAA 2BISA 2IYXA 3QW4B 5E6UB 1U7DA 3Q7QA 3CLKA 2L42A 1NNI1 2A7XA 3PLNA 4IXNA 4F2WA 1ZI6A 2XQJA 2IGTA 2VNSA 2YHIB 3HP7A 4I99A 4LECA 4HEQA 2V7BA 5T6BA 3UMBA 3I72A 2DTDA 4G01B 2Q28A 1VG9B 4MYUA 1OT5A 4AJ4A 5BUQA 3TTSA 4LUCA 2PX8A 2IY9A 1R3DA 2WD8A 5E8JA 3CW8X 3TNDA 1ZH8A 4P36A 2WSBA 5G53C 1UJ2A 4ALJA 5JAPA 2ISQA 2QRJA 1Y5MA 1GAEO 1EX9A 1O4VA 3DWIA 3EDQA 3J81A 4B6FA 2HR1A 4EYOA 4AMGA 4IBOA 1U02A 4PXSA 4MUJA 5C8DA 1NMSA 1QYDA 2VVTA 1P7VA 4DCSA 1QIIA 3I5UA 3SFTA 3BGOS 2AE2A 1GVNB 2O3RA 3BXHA 4GI2A 3PPYA 1KWGA 1PD0A 4ENUA 1IBSA 3B2QA 3I52A 3UVEA 5G0UA 1IOVA 3O5AA 4AN0A 4F8YA 4MLPA 3PUVA 2QMZA 4D6XA 3EQ6A 1K92A 4CLEA 5LDHA 3DHNA 4M0CA 3GEDA 3ZHZA 3DFUA 1FDIA 3TRIA 4EECA 1PZMA 3EDOA 3HCRA 2HZBA 4BPBA 5I9MA 1M2KA 2P41A 5MF6A 1LDBA 3PHIA 4X7BA 1I7SB 1AC5A 3B1VA 1IU9A 3KJFA 1B6TA 1P1HA 1WVGA 1J99A 2AJBA 3N2KA 5ILOA 4LJRA 1T1JA 1QG0A 1YOBA 4I55F 5E3JA 4E11A 1YHYA 4DV5B 4FP9A 2EP5A 1S2NA 2C4MA 3A04A 1QFZA 4LJYA 4MR9B 4LZAA 3IP8A 3RVMA 4JMPA 1FF9A 1QIDA 2AFIB 4MGKR 4GE3A 2JKZA 5F21A 4YP6A 4Y1RA 4TTSA 2X86A 4AMVA 1Z6GA 3JQ7A 3NJ4A 4RKWA 4PAMA 1Z73A 2EVWX 1OH5A 2RHRA 3CCCA 4BVBA 1P18A 3IAEA 4AUKA 4BMDA 4ZGBA 2ZUEA 2PANA 1QPBA 1YQTA 3O0DA 4E5SA 1EUDA 1CE8B 3HGMA 3NIGB 4PICA 4Z4EA 1H1TA 2ODQA 1ZK1A 2QYHA 3HCDA 1EXDA 3MWKA 2UZAA 1UWVA 1SWWA 1MP0A 2OEPA 3DW3X 3GI1A 5GJVC 1EHIA 1K4YA 3IE2A 3OKPA 1C2TA 2PU7A 4JKIA 5KNLA 1KZ1A 3TBHA 2WJPA 3ELUA 1E69A 1H0RA 4QRHA 4HXYA 4TXJA 3KFXA 1Z34A 1OTYA 3OC6A 2YWHA 3CB4A 1HWYA 2QXYA 5JWOA 1GUAA 2XYVA 5GTDA 4FU0A 2J9FB 4EHJA 1FDWA 3Q0IA 1MX3A 3OHSX 4MWBA 1NNEA 1M0WA 5EWMB 1AKVA 5F51A 2VT7A 2P9JA 3OE7A 1JQKA 1E2JA 1RBMA 1UPCA 3NEPX 3PFNA 4Z0TA 4YAOA 4DEXA 3RJ5A 4P5PA 1HLDA 2V55B 3VZPA 1XIVA 4LNHA 2IZZA 2J3IA 2WTMA 4YCCA 3N86A 3KPYA 4WASA 4WKBA 1PZNA 4DR2B 2W90A 5F9MA 4BGIA 1SK9A 4YV2A 3GELA 4WN9A 1C9EA 1ORTA 1RHRA 2WKSA 1P45A 4GD3Q 1L5WA 1ADFA 2J5XA 5K3SA 1GZ3A 2XJ4A 1M7HA 1QB7A 2JGLA 1YL5A 3H4IA 3H9JA 1YRQA 2YQ4A 3JWIA 3LXRA 4XEUA 2OFFA 3QKSA 3ZJUA 3DLTA 3BWYA 1W4AA 3FIJA 1JZTA 2GN2A 4NHOA 3STYA 1XJWA 3ZQ4A 2Q50A 1J97A 1E94E 4CNQA 3ZLTA 1L1QA 3QLVC 3W8RA 4S1NA 3JU3A 3QTTA 4BKPA 4FONA 4E2YA 3NMUF 1T8PA 1ZW6A 4IGEA 4RM3A 5LQAA 1I94B 3NHFA 4BFWA 3DS8A 2OHXA 1T4CB 2R8OA 3LRXA 3LDFA 1STOA 4TTVA 3VOSA 1VE7A 3EEFA 1Q17A 1ZAYA 1AZSC 4DREA 1MO3A 1E4VA 1FFGA 4GKAA 1BS2A 4RPJA 4FW8A 3A4MA 5HEKA 3T7IA 4LF5B 3ANLA 2I8AA 1T5HX 4PY2A 3RKRA 1AF7A 3VR3D 3TX2A 4D3SA 5LOVA 1LPAB 2C84A 1LPOA 1Q1QA 4V3CA 3ZBUA 1GPBA 5KSPA 4YIHA 2WB2A 1YRAA 3FUUA 1ZX1A 2RHBA 4OXNA 2RKWA 1VYVA 5JSHA 3PLAE 1U2DC 3GMIA 2QW1A 1LPBB 2YMLA 1OD6A 1MDBA 2D1SA 5EIBC 5T4EA 4ESOA 1X1RA 2Z2JA 4L9RA 5AI9A 3GDHA 5F77A 3PVCA 5TGDA 3R9KA 4EAQA 4V02A 1G6HA 1DIGA 3BERA 1FP2A 3WRVA 1BE0A 2JIQA 2R6ZA 4LYHA 4DY4A 1RQGA 1N7IA 4R9RA 1XZAA 5T57A 1MAUA 1A2OA 2PO5A 4E32A 4F85A 1XI2A 3PZRA 3QYJA 3C16C 1SURA 2O3TA 3KQWA 4J7UA 4A1OA 1CF4A 2AN4A 3M6WA 1P2VA 5CDHA 5GADl 3CX6A 3GJ4A 2H5IA 1LK5A 5F5LA 1YJQA 3C74A 1OLSA 1RBZA 3Q2KA 5IWAB 3ZHVA 4ZYWA 3NVMB 3JPYA 4MR7B 5T8KA 1CUFA 4CMHA 2D1YA 4XYMA 3T7EA 2NNWB 3HDVA 3OJCA 4BVAA 1VBNA 2FPIA 3S4YA 1KIMA 2NTEA 2BV3A 3LT2A 4LISA 5I01A 2ZT7A 1UKEA 2JEOA 1DJQA 4NZMA 1A7KA 5I3CA 3GZTB 2JH9A 1Y4AE 4BQNA 3L6EA 3EF0A 5FPSA 1XWFA 3GLHA 4C0HA 4CEJB 2VSFA 1PBNA 4HZUA 4M8SA 3QYPA 2O0JA 1F1JA 2ZWOA 3I8OA 3TB6A 3M7IA 4YQZA 6GPBA 1RKXA 3DEFA 4HDQB 1QHYA 2EKDA 2QMHA 4HB3A 4NYJQ 1OBFO 2EKLA 5EJFA 3PNSA 2QE6A 4KK4A 4BO6A 1J49A 3ZDCA 4US1R 2TMDA 3DHYA 4Q1VA 3U31A 3DOEA 4BKUA 2HQ1A 2WJYA 2HRDA 5BVHA 4G6ZA 3QBEA 5BSUA 5I7RA 5I9TA 3D4PA 4Q18A 4WY2A 2QT9A 2GD0A 4YRLA 2C4TA 3GWZA 1E1KA 1LQTA 2HHCA 3G2NA 1C0KA 2FZLA 5H0IA 3IUNA 2PA0A 2ID4A 5CVVA 3UJ8A 3WNVA 1OWPA 1KYYA 1R8YA 3FNQA 3HNPA 2MYTA 4BQPA 1XAIA 2WNHA 2ZJ6A 3HA5A 5FTJA 3K2EA 1TUBA 2HFKA 2JRLA 3PC2A 3TOXA 5H4HA 1DADA 3WLRA 3ETCA 5EEHA 3VHXA 4D6PA 1DOHA 4BJ5A 4DBVO 1AUQA 1J8FA 4AT1A 4G09A 3M9XA 2V4ZA 3QPCA 4I7EA 4IO1A 4PLYA 4DDKA 3ENQA 4H1WA 3U3ZA 4GM4A 3D4NA 4UMEA 3UJ3X 3CONA 1HFJA 1Y9ZA 3IQZA 5CB4A 3K70B 4N48A 1NJ1A 7REQA 1UAAA 1XRNA 3ZZ0A 4M1WA 3D3WA 3OLYA 1KFJB 3DBLB 1RHUA 3P2EA 4BNXA 4BU1A 2ISCA 2OFXA 1WXWA 2H0AA 2X3UA 1CY4A 1GTVA 1O6BA 3S2YA 3ZNOA 4QYSA 3WMXA 2AFHE 3KV1A 1U7UA 2ZKLA 3WO0A 3IEXA 1SVOA 1EFCA 3DAOA 1E62A 3DFKA 3ONVA 2WHPA 4F2DA 2EL7A 3E7XA 4FE3A 3WGTA 4F4HA 5IM4A 4UBJA 1TLFA 2WR8A 5TLSA 4JUCA 4RF4A 4NAUA 3IGFA 1Z3IX 3CG4A 2D62A 3FLEA 3UA4A 3OZXA 3TM4A 1EEXB 4OEHA 4TTJA 3L1KA 5HTOA 1CUAA 4QUIA 4LJ4A 1DKQA 3OX4A 2R44A 4TZTA 5K4HA 3R0XA 4ZO4A 4DIMA 2VJOA 1Y98A 4TVBA 4YJ3B 4RE6A 1V3VA 5I5EA 4UHFA 3RRYA 4J3NA 3H13A 1CPYA 3OQOA 2CD7A 4P2GA 2QR2A 4LVCA 4PINA 3B53X 3WRXC 4MW1A 3RUFA 4E7OA 2DHQA 2XTAA 2WW8A 1ZD2P 3G0IA 5EIWA 5EWLB 1NY6A 4PSCA 1GV0A 1L2TA 3QWAA 3PX7A 1Y48E 1QGZA 1GU0A 4I4TB 4LWZA 4A10A 2H2DA 1PT6A 2EJTA 3PV0A 3BMCB 3WWPA 4LRXA 3IODA 5F5XA 1R0ZA 3NHMA 2GUWA 3DOIA 4FIDA 2WHQA 1C29B 2QXTA 3BGDA 3CLTC 4FFSA 2HSZA 4HHEA 4BDSA 3HM9A 2ZDQA 4Q4LA 3U7EB 4N8EA 2FE1A 3CPJB 4CI9A 1E58A 2PX3A 3CF0A 4J76A 3SQWA 3WWYA 1P0IA 3CBGA 3E2PA 4WNYA 3MILA 4RZIA 4EG1A 4F6LA 4BCBA 4YLYA 3VDMA 1IWOA 3LK7A 4O63O 1Y5LA 3PQFA 1XZDA 3VC7A 2YJTD 1HQKA 2CMKA 2OV3A 3AFGA 4HAVA 1PNVA 3LQQA 5I8WA 2QS9A 4IGKA 2I4TA 3F5FA 1N0HA 4Y3UA 2R8BA 5FUXA 3OC0A 3SC2A 1X0VA 1YU6A 4MVJF 3IA7A 2Q4OA 1PTKA 4W5QA 1UUFA 4FHFA 1Q22A 2GK4A 1J42A 2I62A 3HXPA 1Z0DA 2W37A 3IPLA 2E89A 3I9OA 3L93A 4ND3A 1GP2A 4RF2A 2TS1A 3W0LB 4KWIA 5EGNA 4CKEA 1KQGA 2ZB8A