3DT8A

Crystal structure of bovin brain platelet activating factor acetylhydrolase covalently inhibited by sarin
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
212
structure length
211
Chain Sequence
ENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDLVQLMHQSEIWRELFSPLHALNFGIGGDSTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRRVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Brain Platelet-activating factor acetylhydrolase IB subunit
publication title Crystal structures of brain group-VIII phospholipase A2 in nonaged complexes with the organophosphorus nerve agents soman and sarin.
pubmed doi rcsb
source organism Bos taurus
total genus 75
structure length 211
sequence length 212
ec nomenclature ec 3.1.1.47: 1-alkyl-2-acetylglycerophosphocholine esterase.
pdb deposition date 2008-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 3dt8A00
4JHLA 1WABA 3MILA 4DEVA 3DC7A 3PT5A 4PPYA 3BZWA 1VYHA 1BWRA 1FXWF 1ES9A 4OAOA 4RSHA 4JKOA 4I8IA 4K7JA 1ESDA 4OAPA 3U37A 4TX1A 1BWQA 3W7VA 4RW0A 3C1UA 3HP4A 3KVNA 1DEXA 1J00A 3DT8A 2O14A 1DEOA 5B5SA 1BWPA 4M8KA 1FXWA 4Q9AA 1YZFA 4S1PA 2WABA 1ESCA 4JJ6A 3SLRA 3P94A 3DCIA 5BN1A 4K3UA 4JJ4A 4LHSA 1JRLA 2WAOA 4HYQA 1PP4A 4NRDA 5JD3A 3DT9A 2Q0QA 1ZMBA 5CD9A 4IYJA 2APJA 3DT6A 4HF7A 2W9XA 1VJGA 4K9SA 1ESEA 5HOEA 1IVNA 1K7CA 2VPTA 3SKVA 1Z8HA 4H08A 2WAAA 4JGGA 2HSJA 4XVHA 1U8UA 4Q7QA 3RJTA 5A4AA 2Q0SA 4K40A 1V2GA
chains in the Genus database with same CATH superfamily
3MWFA 5BUCA 1NDUA 4QWWA 4LHVA 2DT5A 2QVCA 5LR6A 2DBZA 3EXIA 3PUJA 1XYYA 4YP1A 4W9NA 4YMVA 3V2UA 5BSGA 3UA3A 5T41A 3D3WB 2RKOA 3GIWA 4ZOAA 1H22A 5CLLA 1KPGA 2HV8A 3DMFA 2FN8A 4M37A 4YQFA 1VL8A 2Y0PA 4Q37A 5DIFA 5DX8A 3DTTA 4CMHA 5HUJA 2VP2A 4IS3A 4ZALA 3SIWA 3T4XA 3NHAA 3FYTA 5EZYA 2ZTLA 4LGVA 1SXJD 4E7OA 4DV6B 1QK3A 1KK3A 1RLJA 1LK7A 1YNOA 3EJ6A 3WNCA 3ZVKA 1NJ1A 5GIOE 2H4FA 3D8RA 3GA5A 4HNAB 1UT6A 3MK31 1XEXA 5B7QA 4LQDA 2AX4A 2C5GA 3A25A 1MT0A 1EBUA 1Y8RA 2VEDA 4L5YA 4UAGA 2QDXA 5ALYA 1Y4ZA 3EG9B 3FGZA 3FNEA 3FMPB 3LT0A 4M7OA 4ZI7B 4IUBS 4QIHA 5DE3A 4LHEA 3SYMA 3ZQ6A 2RHRA 3QY0A 4JKIA 4LBYA 1LBEA 2EAUA 2C3UA 1L4KA 4FW8A 3U7QB 2JGFA 1UDRA 4ZOBA 2YMQA 1ADYA 3CC8A 3DWIA 2I6UA 5D5HA 3TMYA 3JW8A 3WK4A 4BP1A 4BZPA 5KINB 1E92A 3FTDA 4Q34A 4D6YA 1V48A 2BHRA 4F6RA 1C1YA 1GD1O 1YO6A 4WBXC 2C5BA 1QFSA 2WVAA 3ZE0B 2B3TA 1A71A 4F3KA 2CXOA 2NSDA 5NULA 2HRZA 1A7JA 3PP8A 4H3SA 5T4HA 1RBZA 3R6WA 4OKNA 4HTAA 4IOJA 4CF5A 3N6XA 4HX2A 2VT2A 5CYOA 4ER3A 4KYVA 5FEUA 2WKPA 1WZEA 3K0EA 3SQXA 3UTCA 1YS9A 3GO4A 1QQBA 3TIXB 5LQCA 2O54A 1UBGA 4UZSA 1N5LA 3SXUA 1CJCA 1NQUA 3BDIA 3QE2A 4NEHB 4JUFA 2VHXA 3DHWC 3N74A 2PD4A 2Q9BA 4LK2A 3PEUA 2YYYA 3A6KA 5IEJA 3I76A 4OA8A 4GSYA 1U8TA 3CFYA 3JVVA 4KTVE 2VHWA 2WE7A 3L7NA 2QLNA 1VG0B 2D2EA 1Q0HA 4HADA 5A4DA 1D04A 5CLIA 3I04A 1ACJA 4YACA 1N8NA 5ALMA 3ZI0A 3H13A 3GLHB 5AW8A 4QRIA 1WULS 4XFDA 3ZE2B 2QI9C 4RFVA 1SUDA 4F21A 4PSUA 1K7SN 1Q0LA 2H3HA 5EXTA 3F6EX 3RJ5A 2XQFA 1T3ZA 1E3LA 1NLMA 1S9HA 3OPVA 3KTOA 2Q21A 4PM4A 4UJ5A 4Y2YA 4PYOA 4ZO7A 1TA9A 5ETJA 1NNLA 1R8SA 4QTUB 2XGJA 2IH2A 1UUFA 2GPJA 2GAFA 3MJVA 1U28A 4GX5A 2AN4A 2F4NA 2IDKA 3LQKA 4HB2A 5GPBA 3ZHTA 3OZ7A 3TSOA 3T7IA 3AJ8A 4QAJA 2RGEA 3SC2A 4D4GA 2BZSA 1V6AA 1I3NA 1V7PC 1ZK0A 2W5UA 4H16A 5JZVA 5KHOC 3BEDA 4H7IA 5C5CA 3WKDA 3RHTA 2R6ZA 5ALDA 3TSWA 1LLDA 4HEA1 3UB2A 3U44A 4MR8A 2G1PA 4QXRA 5EQDA 2F4VB 5E2AA 4AT1A 2FJUA 1ORIA 1E5VA 4CG1A 4D0NA 1NVEA 3B1YA 5LDGA 4A1FA 2W6OA 2QORA 1JHOA 4PPQA 3H4IA 4UNIA 3AESA 3AR8A 1V4BA 2ZXFA 4CT5A 3WHKA 4NR0A 1RU3A 3RD5A 4F84A 3ANNA 3WL6A 4N76A 4LYFA 2C84A 2GZDA 5FNVA 1ODCA 4HYTA 3ETNA 2B30A 1KYXA 5TMBA 4ZZ0A 1NJGA 2CXNA 3AUFA 4HAXA 3FNFA 3OWOA 4ECEA 4E30A 1EUDA 1Z47A 2RJOA 4M22A 1DOAA 2XX3A 3SGLA 5BQ3A 1A50B 7MDHA 3HA7A 3JQAA 2HA3A 3IAFA 4OP3A 5JT1A 2OVBA 1A97A 4FWBA 2LW7A 4IMIB 5ENDA 5L40A 3PXAA 4TN5A 1BMFA 2N3ZA 3ISVA 1C5KA 3GC6A 4XLZA 2PR2A 4GD3Q 4HVCA 2VDOB 1AMUA 1IWOA 3EQ9A 3NYWA 4P82A 4RF5A 5C53B 2SKEA 4D4LA 1PJCA 4HSEA 4MUJA 1ZNXA 4YC7A 1LJUA 1PG2A 1LQUA 1SK8A 2E4VA 4EY3A 4MV3A 3UJBA 3HO8A 4GZLA 1E99A 1Y1QA 2OYSA 4JROA 4TN1A 2QJWA 5M3BA 5KJ1A 4JLMA 3TWOA 3X1WA 3CXRA 3O8LA 5ALQA 1GZHB 1G5HA 4W9RA 1VLZA 3O90A 3KK0A 3HZHA 4AYWA 5B2FA 2VYFA 4GPD1 1FP7A 2A57A 2DH6A 3DTVB 3KYDA 4IIXA 3JQBC 4B85A 1QNLA 3E81A 5J5VA 1NBIA 4O2AB 5JE8A 3UATA 3GLGE 4FCWA 1NUAA 3I5YA 4QARA 3C39A 1Q2UA 1ZW6A 3KZ1E 1VC2A 2MMCA 4RDIA 1KC3A 5KQSA 3HY4A 3DG9A 3ESRA 1B3RA 3BM5A 2JLZA 3U81A 2FDRA 4QTZA 2H4XA 3TQOA 4MHTA 1HNZB 3S68A 4II2A 1E1MA 5HIKA 1QCDA 4HDRB 2FW0A 4N12A 4XUDA 1WUIS 1ZM7A 3P9CA 3ZLBA 4LNUB 4N5MA 4KXWA 2ATIA 4XWKA 1C9YA 4GLJA 2Q7OE 3A6PC 3K6JA 2PGOA 4RF4A 5K2MA 3K5PA 2B4YA 1G64A 4C0HA 2H8KA 5IBCA 3Q0IA 3RLFA 1GAEO 3GNQA 4HNSA 4ZGGA 3VI4B 3ZGXA 2GZMA 5GTDA 3VZRA 4Y2VA 3O4JA 2FPKA 1M3SA 2IOQA 5I7VA 1SZCA 1TVCA 4AWXA 3D81A 3FNHA 2HW8A 1X6VA 2UVPB 1SZDA 2CWDA 3DEFA 1GTSA 4P7JA 3OCVA 1WW3A 1Z9BA 4FSXA 2I7XA 3VFDA 2ZSBA 4N6OA 1KYVA 4AN0A 3UK7A 2PFGA 2EX1A 1RYEA 3L8YA 1JHVA 2HU5A 5BWCA 2JIMA 4HRVA 4ZT5A 4QU5A 2ZANA 5EFOA 1DKNA 4N7MA 5BOSB 2X9NA 1J9EA 1KARA 1IUOA 1ZH0A 1EZZA 1EFHA 2HLHA 2RGYA 4TZKA 4CF6A 4BNJA 4M1MA 4RKEA 1JDVA 1I10A 4QGBA 4BLOA 1LVGA 4GRAA 2XPCA 4L4SA 2DMRA 4ZCTA 1Z29A 3TQCA 3NOQA 3JATB 4YJGA 4LXIA 3W3ZB 2CXRA 2WV9A 5KB3A 3IHWA 1JDTA 2D00A 4KUEA 4JI7B 4KGZA 5EESA 3WBFA 4MYUA 3WB0A 4JJEA 3THSA 3G59A 3EVNA 3ESBA 3B8EA 4NV3A 5BY2A 4LRWA 1UKYA 4ITRC 4BZWA 2XJ9A 4U7WA 1XP5A 1UMBB 2NTNA 1FNMA 1VG8A 2DAPA 3QSGA 3UKJA 3RU2A 3R0VA 4EF6A 5IC4A 2DKFA 1DAKA 4HDSA 1A8HA 3I45A 5K05A 5HW0A 1XTSA 1FUYB 2QTCA 4G0PA 5FT9A 4NU8X 5JMTA 2FUG6 2GUWA 1IRIA 2O06A 2NP6A 1J25A 4JASB 2NQ2C 3MTQA 1MB9A 1GA1A 3MQ4A 1BFKA 2R4QA 3OOSA 1XYVA 4Q4HB 3PHIA 1BEUB 2OECA 3WGVA 5HVNA 1E4YA 3DLPX 3OCUA 1GIAA 5K8CA 1N36B 1T3GA 4ZOLB 2HCBA 1SKQA 1EAMA 3DO6A 5D3MA 1ZIOA 2YQZA 3OCWA 1IBRA 1T3SA 5JS1A 4ESVA 4WLFA 5P21A 4GF5A 2V3VA 1IZ0A 2J0UA 2A5GA 4B48A 4E3ZA 4BJ6A 4WFQA 1WMBA 1D8AA 2QD5A 1EX6A 1YJQA 2OM6A 4RVHA 4Y2QA 5DTEA 1Q1GA 3CLVA 3H9BA 1RJGA 3PRHA 4V24A 1DKPA 5EJGA 3JQGB 1KY5A 4I0WB 5J43A 3NP7A 1U65A 4GPEA 2WV7A 4INZA 2A9PA 5IM5A 3ODPA 2PRZA 3WTBA 4E2XA 5K0FA 4JOCA 3SZ3A 1JEDA 3MMSA 4R7GA 3FHLA 2GH1A 2W11A 4OQQA 1G3QA 1OAOA 2B35A 4IGKA 1UODA 1R8QA 4NAUA 3L6BA 5TY0A 3RVKA 3EARA 2GF2A 1NXPA 2VPXA 2CV2A 5A4JA 1BVYF 5CA1A 1V45E 2WG1A 1QO7A 3BTSA 1Q1EA 3NO4A 4LTDA 4LZJA 3CVWA 2HLDD 3DKPA 3VOAA 4PLZA 1GILA 1PCXA 3GF4A 4KWCA 3H8VA 1F9AA 3CVYA 2W8ZA 4JUIA 4AROA 4CGYA 4MEAA 5CYPA 1QWOA 2QM3A 4BCBA 4E32A 1VJGA 5FTKA 3R5XA 4O4HB 4DIEA 3D6JA 1XQ6A 3MJRA 3NBXX 4BXOB 3B9RA 5HOEA 1GAQA 1M6YA 1GUZA 2J41A 1MOQA 5DW0A 4Q9IA 3NEAA 5FTWA 1IY1A 5LQUA 2JCGA 4II3A 1COZA 2QXYA 1X1BA 4P4LA 3RO7A 3HACA 4L74A 4MK4A 3L43A 3ZCVA 3ZU5A 5H9WA 2ZM6B 4Z1MA 5IKMA 2B7BA 2ZBRA 2Q4EA 2R44A 2CJXA 2VZ8A 3LP8A 1E20A 3KQQA 4LE1A 4MAMA 5DGHA 5DN9A 4GM0A 3TMAA 4FI3C 5L7YA 1UBEA 2CVQA 4FCTA 1WPRA 1NX6A 2JKVA 5DTJA 2C42A 1ZC3A 1ZEMA 2JAQA 4BFYA 4D8YA 4NNOA 3J81A 4ANFA 4FPXA 1EJ6A 3DE2X 2EFDB 2EJUA 2HSZA 3ND8A 4JOBA 5EUBA 3RS3A 1E2GA 2HFJA 3VI3B 4AMYA 2DJIA 2AFHE 2HLDA 3W78A 1F3OA 1U2ZA 5CA0B 1FSGA 1SAYA 1AO3A 4MVCA 3ZR4B 3L8DA 1N5RA 1GEEA 3NM6B 1CFZA 2QQ0A 4JHLA 4JJKA 3VZCA 5AVRA 2IEYA 4IDAA 4I9FA 3RIXA 2REOA 4RK7A 1A9OA 1OZGA 2H54A 2O20A 3QVGB 4B4VA 1XO1A 4HGQA 2AXNA 4LMBA 5CX4A 5BYBA 5C32A 4Z4EA 1G4UR 2FW6A 3FM9A 4DRXB 1N7GA 3D0RA 2C9MA 4RFSB 4B3TB 4DVJA 3FHTA 3EULA 3VYTB 3UA4A 5C8DA 3M33A 1B43A 1J0XO 2ZIFA 2QD4A 1I1HA 2QX4A 4L73A 4L7QA 3T95A 1F5NA 1ZUD1 1PFGA 3AONB 4DV0B 4RK6A 4QTXA 3ESYA 3VH4A 3DXZA 1WKVA 4BNUA 2ZQYA 3A9UA 1Y3BE 3K73O 4CIXA 1KZYC 2Z57A 3LY9A 4CM3A 4H0FA 2R8ZA 1ODTC 2V4UA 2BP7A 5IAAA 1JR3D 2VAPA 1VHWA 2DWCA 3MSCA 1C7QA 2FW1A 1DVRA 1AMNA 2ATXA 3QHPA 3EBOA 3LHIA 2Y1CA 1CUHA 4O2LA 5EMLA 1TL7C 3TEMA 4ND2A 3B51X 5H82A 3K71B 1Z07A 2R7MA 4XSHA 1VBMA 2O3TA 5HA5A 2Q8NA 3VISA 4RZQA 4B80A 4D9FA 4WXPA 2JIZD 4MAAA 4NJEB 3L6RA 4N8DA 4J4BA 4QEZA 4BMVA 3WE7A 5KTRA 2P8SA 4XM2A 1JFSA 5MN4A 2Q4TA 2RGNC 2ODBA 3HJBA 4Q3BA 3M3HA 1MB3A 2Z5GA 4LNHA 1B15A 4XYMA 4EFLA 1C81A 3I37X 3COWA 1DKOA 2VYND 2XYQA 3OURA 2IY7A 3R3HA 4OGFA 1ZP6A 4QOEA 4RD3A 3IB6A 5EY5B 1JVSA 5TB5A 4EYGA 5HGJA 1KVUA 2FFAA 2REQA 3HJAA 1IXZA 1KKUA 2LPMA 1H9CA 2Q50A 2WAYA 4EKIA 4EJSB 3R9XA 3JZFA 1G5PA 4X1KB 4MQ6A 5B1DA 2R0QC 1BTOA 2WAOA 3BKXA 3OM9A 1GNQA 1O9GA 1YACA 3KKLA 3X2EA 4BO0A 2GVDC 5F12A 4Z4CA 1DJMA 1M1YE 3WZLA 3U2QA 4RIHA 2Y1EA 3ZXYA 4X8HA 2B20A 1RKQA 3O8OA 3NHFA 3REGA 1O4VA 4QYTA 1IOWA 1DCMA 1QMPA 1P1HA 3ZW8A 5A0VA 3BGVA 4BL5A 1Y48E 2BFFB 1ENPA 3RUDA 4J1TA 4B83A 3GZJA 3PQ5A 1CEYA 2JIZA 4KO2S 2NT3A 3OPQA 4ARZB 3K0CC 2FEMA 5ES3A 4EGJA 1NW8A 3UVEA 5LQAA 3ETJA 1G8HA 1WSAA 3THXB 4F12A 4GFDA 1AMOA 5FR1A 3SFTA 2VYNA 3TOSA 5AIAA 5LQKA 4H08A 4EG3A 1HYEA 3K1AB 3GJ3A 3WJ1A 3ZCUA 4CFYA 3JAMA 1NJSA 2WC1A 2DULA 4HTFA 1S89A 5F78A 3I01A 3ZDZB 1HQCA 1ZH4A 3KX2A 2QLBA 1YVUA 4L0QA 3ETEA 2YXBA 2H1RA 2QLLA 5LMUB 2Q2NA 3GRZA 4CFSA 4RZXA 4L72A 4MJ3A 3BIWA 1I51A 3S0JA 3GT3A 1UKVY 1Y63A 4FONA 4NVRA 5BQOA 5MF6A 2GRUA 3CZCA 2F8MA 2PANA 3CBQA 2GBIA 1I8TA 3LCCA 4FN5A 1A0OA 1UBHS 1ZM3A 1XTJA 2JJ2D 1YZLA 1NZDA 1XVAA 3HVIA 5B1SA 4TTSA 3U9TA 2PVSA 3B3FA 4QPDA 3U4DA 1T9AA 5ELXA 4KCGA 1Q0SA 4HCJA 3A2NA 5FH9A 4HSGA 1JG1A 5JZBA 2VR1A 1U0BB 2WY2D 4CCYB 2QVZX 3JSAA 1DPGA 3PQEA 4HZUA 2NUPB 2ZSKA 3FFAA 2GKOA 4LJYA 2C3OA 5AW4A 2SCUA 4G1FA 2HNBA 4CIDA 2H4JA 1R6TA 2V5AA 1SWVA 4RYDA 5FADA 2AFVA 1TZCA 2HBZA 3F0TA 4U7HA 4KXLA 4ZQCB 4NULA 2FUEA 4MJLA 2WM2A 4G9BA 3KOZA 3GH1A 5KTKA 3RFFA 4XR9A 2Z98A 1PTJA 1PNQA 3TW6A 4RESA 3CLHA 1LH0A 3KQOA 1N4AA 2HA2A 1HE4A 3HFJA 5JCJD 3ADDA 2ZCUA 4D45A 5IUNC 2QNBA 4AUNA 3PGLA 5I7FA 5IZCA 5DNVA 3HHPA 1SBNE 1EWTA 3PNOA 3FOBA 5EMKA 2OV1A 1O58A 3RC7A 3G8DA 2ZU0C 3CVJA 2R6R1 1XXHE 4GI5A 1W36B 5B5SA 1SXQA 4CQJA 2D06A 2NU9A 3TSYA 2DQKA 3KZMA 4JEUA 1U8AA 2DRIA 2G9RA 3WKAA 2HT6A 4YMUA 2HDOA 1KO4A 4IHQA 2WJJA 1PNRA 1WMEA 3ZJ5A 2R7AA 3Q2OA 3RFTA 3ON5A 5CAEB 3HXMA 2XB6A 1P1IA 3EE6A 4B82A 1LRJA 1I2DA 1VIVA 3Q2IA 1BXGA 1XELA 3F71A 1T5TA 4RPCA 2JL1A 3RWBA 4J76A 3P9RA 4CDRA 1EBFA 1SG6A 5KNCH 1IPEA 2IFTA 1W35A 4HEHA 1MTZA 3IBCA 4I55B 3FOZA 4G85A 4OGLA 1CUFA 5CDFA 4IFEA 2WE8A 1W4ZA 3UJHA 4J0CA 3AF0A 2GM9A 1YIAA 1X7YB 2H07A 1PYOA 1N8TA 1UK8A 3B13B 2ZAIA 4INOA 1CHNA 4W82A 4CFZA 5JPCA 4XDZA 2WVHA 1FCJA 4N5LA 4MEJA 1JPUA 1L4NA 4CL2A 1MDBA 3KHUA 4WY5A 3RYHA 4DA7A 1U2QA 3PHJA 3ZLJA 5DBFA 3M4XA 4WZBE 4MVJA 1CQIB 1H2WA 1FBTA 3AF5A 3A6GA 5T5QA 4IWYA 2I1VB 1A3CA 1SA0B 4P53A 2Q6VA 3AR3A 1HFKA 5HZKA 3IEVA 3U3ZA 3MN1A 4HC4A 2NVBA 1KS2A 1M2OA 3OCYA 4XW2A 1N0VC 2I4OA 4B2YA 5FPTA 1WEHA 1FTGA 1NP6A 4U63A 1W9MA 1KEUA 4IJVA 4XA8A 1UPBA 2OC4A 4FGWA 2BFCA 1SZJG 2XUOA 4FOLA 1N2IA 4FEAA 4PONA 3W5JA 1Y5RA 3EVEA 4I9HA 4IG4A 3RTDA 2IEZA 2DERA 4ZVOA 2HDNB 3CKYA 5B37A 5KTOA 1SBTA 2F9MA 3R3SA 5AKYA 5IBPA 3VR0A 5L3QB 3I9V1 4DIUA 1DV1A 1VE9A 2RBGA 5JC8A 3H2BA 1RPZA 4IOLA 3YASA 1DRWA 4ZOQI 4BE4A 3GFQA 2RC6A 4MKGA 4RM3A 1MC4A 3ZOKA 1F60A 1F48A 4XOIA 5YASA 2Y0DA 1IUNA 2C8VA 2ZK7A 2O8CA 4PRZA 5I8PA 1RZUA 2QP3A 5AK6A 3WIBA 3Q72A 1MQAA 2B37A 4KR9A 5BSTA 1SUPA 4OI1A 5AVSA 1NW5A 4FFBB 2G28A 2YUIA 1I14A 4Q4CA 5B4VA 3CLKA 2C29D 3U4QB 2VFAA 3GJTA 3ROQA 5JFGA 5JJLA 1NLUA 4Z4QA 1TUGA 1U2SA 2H92A 1QC5A 1RCTE 3ED1A 3OEHD 4G0XA 7ADHA 4JB2A 4TV8B 3RYFB 1OJ7A 1D2MA 1O08A 4M9UA 1Z26A 2WIKA 1GPH1 4ZHQA 4NJMB 4XI9A 2JIRA 1CQPA 2J6IA 4K6MA 4HH3C 3GGCA 5EHZA 3TLYA 4IDEA 1XU9A 1VIAA 1JF8A 3FUVA 3LA8A 2NU7B 2B7CA 4MGIR 1UFOA 3RQSA 4WW0A 2QP9X 4RV9A 5MN6A 1C4OA 1F9EA 2A33A 1DWUA 4G23A 4IIJF 3AETA 2HO4A 3G8YA 2QUIA 3NHWA 4UOEA 1GGJA 4WOJA 3VU1A 1I6WA 3JV7A 3KVNA 3PNQA 1BHO1 2K87A 5I47A 3MYYA 1EHYA 1K9VF 3TYXA 3QLVA 2QI9F 1ULZA 3JQ8B 4A8JB 2ORYA 3LCMA 2IUTA 2YL2A 1GL6A 1Y7TA 2UU9B 1V3TA 1ZWLA 4J9UE 2VSOA 3PHBE 5CDGA 3RVLA 2EFEB 3OEHA 1QGYA 2Q3FA 3EPPA 3C7TA 4JY7A 2VDNB 4OG2A 1N5MA 4X71A 4RVUA 4K9KA 4KQWA 1QH0A 1XD2A 4CU5A 2HWXA 1AJEA 5CFOA 5F4BA 1JHMA 1E18A 1G8MA 2AYZA 2E3JA 3H9EO 3GMIA 3L7KA 4RZ3A 3ZH2A 1IAQA 2XQJA 5IAJA 2LP4Y 1SD5A 5DP2A 4NBSA 4PZEA 4ZAFA 2YHIB 5FPHA 4IXDA 2OO5C 1NT2A 2BMDA 3AVQA 3D0KA 2ZSHA 3L6CA 3FRIA 1E6EA 1RWBA 5DV9A 3VGJA 4GOOD 4UVIA 4C7BA 5ESDA 4PX9A 4BATA 2DXIA 4PCLA 5AJVB 5BW6B 5KQLA 2EDCA 3ZVRA 4CIWA 2WWGA 3QX3A 2J7PD 2Q6KA 3P1JA 4QTTB 4WLNA 4R8RA 2W7TA 2PKCA 1MOSA 3KTFA 4LJ6A 1G8SA 2N1BA 3D3KA 3DMTC 1KJZA 3CF4G 4Y7DA 1GPWB 5C0OE 3L84A 2GPNA 1PKEA 2ZRHA 4BUCA 1PWYE 1SR8A 3RANA 2ZRPA 2CFCA 4RGQA 4XJXA 2OOSA 2PD6A 2B1GA 5REQB 2C9YA 3RODA 1V5IA 1XU4A 1LF5A 2JHFA 4KLRA 3R40A 1EFKA 2FSFA 2W6CX 3KDAA 2IXBA 4DL9A 1WLSA 2OCLA 3IV7A 2CWWA 4LDZA 4GGOA 3UCEA 4TYMA 4BLTA 4UDYX 3NOVA 1G55A 4O4JB 4XJVA 4YWHA 3NHSA 4A0FA 3F3MA 3IEMA 2GBLC 3ZWNA 5EJ6A 3QMVA 5CVDA 1FVOA 1WUJS 2BISA 1OHHD 2GBGA 2OM2A 2UZ1B 5JSFA 5JQGA 4U8GA 2H1HA 4N8EA 4TRNA 4AMVA 4EJ2A 1BDIA 1V4VA 1P4SA 4FMCB 1D0IA 1TQ6A 3LQYA 4RPKA 5HMLA 5BYJA 3RJTA 4DMRA 4PYLA 1OFIA 3UJ6A 2HCRA 4BCCA 3Q15C 2OA0A 4TWBA 1YB5A 1A8QA 1PKXA 2EZ9A 2RGBA 2RHDA 3SF8B 4ZDJA 2AOTA 2V7QD 5ECDA 3TL2A 1RFLA 3I6ZA 4G36A 1HK7A 1JLMA 5CR9A 1I1OA 2JFZA 5AVTA 2ZS8A 2C88A 1TQHA 3DDCA 3Q12A 4K86A 4R2KA 1L4LA 4UBKA 3U0VA 1Q1NA 2Z09A 4GP6A 3G17A 1AQJA 3FCSB 1BE1A 3JR7A 2VQFB 1QE3A 3M7IA 1UQUA 2WYIA 2H0AA 3I39X 1V5FA 3RC2A 1TF7A 2DGDA 2HRQA 2FMKA 3O3NB 3VHXA 3JASA 4CI9A 4C2AA 1XRRA 1U7HA 3HBMA 1W76A 4V0SA 4YGYA 2P9CA 3MGGA 5AJYA 1UFRA 2A35A 2EKLA 4RH1A 1S7GA 4E31A 5EXXA 2NTVA 1BNCA 5K3BA 3D5QA 4ZCMA 3HU2A 2DJ5A 2H4HA 2REXB 3P7MA 5K4HA 1WVIA 1XB2A 3JWHA 1XHLA 4BRWA 2V7QA 1NF8A 2VZ9A 1RRMA 1G66A 2BR3A 2QTVA 4PINA 4WDRA 1PJ3A 1PZNA 3MTDA 5JO9A 2PNJA 5BNIA 1PJ8A 2E6UX 1GVHA 5TLSA 5BN3A 3HEMA 2ZBDA 4UCWA 3PFNA 1XZMA 1EHIA 2C7GA 2CL5A 2CXUA 4KQGA 2E9SA 1GGMA 4RQAA 2WABA 3HFRA 4JLNA 2QE7D 4YCBA 1QYXA 2VBGA 3IAM6 1XZEA 1EX1A 3UMCA 1BJRE 2O2EA 4OHUA 1GTRA 1RQLA 2M32A 4WFIA 1AGRA 3R0XA 3N5KA 5BYAA 1YBAA 2CUKA 1HDEA 1Y37A 4HNUA 3KCQA 1R9NA 1EVQA 2IODA 4BNHA 5EWMB 3KC2A 2OYRA 3RKSA 2NU8A 3RVRA 3DE6X 3P9XA 5K3OA 3DR5A 1CBUA 1PT6A 3KD3A 5CFPA 1J2RA 1PJAA 4CKEA 3ZD6A 4C2UA 3KP1A 1P5RA 1QIGA 3O8QA 5K0JA 3U56A 1TYDE 3NEYA 1SUFA 2FR0A 2OCPA 4QE3A 2A0YA 2UVDA 5HQTA 1H4TA 2J08A 3KJEA 2NX2A 2V9PA 4W8OA 2IPLA 5CM8B 1UPFA 1L7PA 3LT1A 2O07A 3ORSA 1C1DA 4JSTA 4X20B 1DO8A 4B3HA 2QE7A 2R2AA 2C96A 2OBFA 2PIDA 3OQVA 4L08A 4UBLA 4WCFA 1KFBB 1YQTA 2XWPA 4XYGA 5SZKB 1GZUA 1QE0A 2WJGA 3GYBA 4QPCA 2PYDA 1B2LA 1T5LA 4AQYB 2FI1A 4L3VA 1S2LA 4OHFA 4UOQA 5DW3A 4EO4A 2X2EA 4KI0A 1AURA 1KAQA 1E3JA 3IMCA 2DPGA 2JRLA 4XIGS 1U3GA 2HKIA 1UJ2A 3CVOA 3D6HA 1KY4A 4QUIA 5FKJA 1SCDA 3FBGA 4KJXA 1F2UA 1MAHA 1LVUA 1S3IA 2GARA 5DIZA 2Z4RA 4YASA 3WWZA 4ARSA 1GTJ1 2H1VA 2V03A 2ZB4A 4D9JA 4PFJA 4DWVA 3IE0A 6AT1A 3T54A 3WAJA 3A1NA 2W4QA 4K9RA 1T9HA 3K53A 4G5OA 4KE9A 4M0FA 3HJRA 3QXGA 1CRPA 4M1SA 3UGKA 4DLNA 3E48A 5KMGB 1XZBA 2YMLA 3K1ZA 4XYEA 3GFPA 3DVSX 2W70A 4MVJP 4Z8YA 1QCCA 2I4LA 3N9IA 5DBEX 5JZOA 4EB0A 3MILA 5JNWA 2FWJA 4FP9A 2FOLA 3MM4A 5JEDA 3MAGA 1O6BA 2YXEA 5DLYA 5AT1A 3W04A 4AJHA 2QAIA 1L8QA 4Z6KA 5CB4F 5ITWA 3KB8A 4H6WA 2OHIA 1PJRA 4HQNA 3RU3A 3MCUA 2YV2A 3AF6A 1V16A 4AK9A 3KKZA 4YREA 1ABFA 3H99A 2ON6A 3W1EA 4F86A 3OY7A 1F2DA 1PUIA 3T3IA 2J9ZB 2J07A 3FYDA 1QG6A 2FPWA 2GPWA 2JVKA 2PXCA 1W1IA 3PGMA 3V4OA 2PZGA 2DY0A 2VT3A 1V95A 4P0PB 1TAUA 4A7PA 2ID7A 2HQRA 3QUBA 3EPKA 1CY1A 3MEQA 3VC1A 3A9SA 4KBGA 1N7HA 1ONPA 1F1BA 3AERB 3WYDA 3OI7A 3BXPA 4WLUA 5CT4A 2MSEB 1ZI6A 1P3DA 4ZAVA 3TZLA 2Q4DA 2YKGA 1H65A 1FYEA 5IMBA 4I4LA 4Q0MA 3Q11A 1R6XA 5J4KA 4KMMA 3SY8A 1C3LA 2F8SA 4KPGA 8ABPA 2C4TA 5IG2A 2EJWA 3NJRA 1AVTA 3QEOA 4BS9A 3U3KA 1GQ2A 2QT0A 3LUGA 2LCFA 2R1VB 4IH9A 3TTXA 4Z5XA 2R8BA 4BLSA 3V4PB 3H9GA 2Z5FA 3NRBA 4YRIA 3ZW7A 1S6YA 1JVBA 3MGAA 4TT8A 1YZYA 2PMCA 1XDSA 5HIJA 4ENTA 4DUYB 3MZ0A 3L7OA 3JD1A 1YFJA 3F7MA 5K3AA 4AL4A 5IT4A 2XMBA 3INRA 4EQ6B 3K05A 3GEPA 1E58A 1DIRA 4H17A 2DF8A 4UEJA 1DXOA 1OILA 2WF5A 2VRWA 2IK8A 3O73A 2Q45A 3WO0A 1KP2A 2BFMA 3DL7A 3ZUGA 4KWTA 1KSFX 1L5QA 2LCQA 2W42A 5AW5A 1GKYA 3L06A 1IAVA 1NI4A 2AUTA 2OXRA 3EW9A 4MWTA 4EB8A 2FHSA 1IEWA 1JIKA 3OFJA 9LDTA 1U3DA 5CD9A 1N5IA 4GR5A 1SELA 3T41A 2YOHA 1U90A 4Z86A 2IUSA 3UPDA 3QF4A 4YA6A 3E9EA 2NAPA 3DL0A 4RAOA 3TINA 4YMIA 1DRKA 3RREA 4KNVA 4BNKA 4NEQA 1ZGAA 4HPWA 4BLQA 1BX1A 3QENA 3LSYA 9GPBA 4I4IA 2PV0A 2V4ZA 4OUDA 1K7CA 5B1HA 2G25A 5KCMA 2Q1WA 2ZRDA 1WWKA 3S7ZA 1WCIA 2FWRA 4RMNA 3RRJA 3ER9A 3U3OA 4LYHA 2G9NA 1HO3A 1PSWA 3BJIC 4CKCA 1A98A 1UJ6A 3VC2A 2G1AA 5TVGA 3RJZA 3EQ7A 3R5KA 2FEXA 2W48A 3HCPA 4XIJA 4TUYF 1XTVA 1UK6A 3K9QO 2BTQB 4H7JA 4JL8A 4K8RB 4MUIA 3TK1A 4LIPD 1ECJA 1VSVA 1ND5A 1OX4B 4R83A 5EXEA 2WPDA 1DE0A 2GYVA 4QHYA 4QBIA 1K75A 2VJBA 4WBSA 4ZC1A 3LPCA 4EJMA 2WF8A 1YE3A 4ZPJA 3DAYA 3PQCA 1ODSA 2W6ID 3RS0A 4M21A 1AUOA 4OCZA 2FPOA 4KBYA 3A9CA 1S3SA 3PCXA 4PAQA 4PC3A 1G6KA 4A91A 3TIFA 1TCUA 3AVPA 3AWIA 3MVEA 1ZNWA 3A1WA 5CGQB 3PT5A 4BUZA 3T34A 1DELA 1LBTA 3SFZA 4CLRA 2AOUA 4RK4A 3JQBA 1FU8A 5TNXA 1G98A 1GZVA 4I4TB 2MINB 3IUSA 2YNMC 3UO8B 3R7NA 3OESA 3FYUC 1K7FB 3LSTA 7ABPA 5I7SA 1M6WA 4PX2A 1OWLA 2CVOA 2LTAA 4L5CA 4ARIA 3D7RA 3STXA 2O05A 3NVAA 5IABA 4INAA 1RRGA 3PDIA 1USGA 3T7SA 3NJ4A 5TF0A 1H23A 3CXUA 2EJBA 2CHGA 4O2RA 1QPGA 1GGHA 1JQ5A 4WHMA 4A9AA 4BWVA 3OJ0A 4DT1B 2IS4A 3R41A 4E88A 1AKWA 1NM5C 1Z6XA 2PH5A 2QRVA 2XD4A 4QOJA 1RZ3A 3N1UA 4MI3A 1ARZA 3RVBA 2C7RA 3FROA 2GCNA 2MJLA 2B9VA 3W0LB 3EVAA 3PA8A 2VS1A 3OQIA 3QOFA 4KB5A 4P8RA 5FI5A 4D0GA 2ZUUA 1MV8A 2ZYHA 4UAJA 3X1JA 2V3WA 4KVGA 4M1QA 4DBZA 2WWFA 3PZBA 4FE3A 2OXFA 1HQKA 1VMEA 3GHYA 3ZYCA 1Y98A 5JSZB 4J90A 3EIQA 4JJ6A 4KYTA 3MC1A 4FXOA 3THOA 3EPRA 4CKYA 5ICSA 3ZCXA 1NFFA 2Z0MA 2FPIB 4B79A 5K0TA 5E0KB 1EB8A 1H2EA 1ZH8A 2FRDA 4FN4A 4N9QA 4R2JA 4L78A 4B74A 2AZXA 2D2IA 5AVWA 1EUCA 4DKJA 4RJLA 3EWSA 1DCKA 4UXIA 1V9LA 1DKLA 1SUEA 1VI6A 2P1DA 1KI4A 5B57C 1C9EA 2PSHA 1E6CA 3QX7A 4Y6LA 1JIVA 2X2OA 2GMWA 3K3PA 4H6XA 5A3QA 3DBLA 3WMRA 2YMPA 4GM4A 3E0XA 1SUSA 4QULA 4KXXA 3ANTA 4TXHA 2WIFA 4QDKA 2JBHA 1RAEA 2LIVA 2P27A 4LZPA 4W5WA 2PLNA 4EITA 1GZ4A 3PXGA 2GWRA 1JECA 3G5MA 5L6LB 1E1LA 1YBFA 5FUMA 4M99A 5IULC 3TG8A 1IRXA 1JDBB 1VPEA 3JYPA 4E33A 2C2GA 5CFMA 3LL7A 3NUGA 4BC0A 2DLCX 3BC1A 4E3WA 1C3OB 4I9NA 3EC2A 1TPYA 2CEKA 2ZBQA 3TEJA 3AI1A 1SWWA 1KAEA 3UQZA 4C4RA 3WWCA 2WB2A 2MTBA 5G2OA 2AI1A 1Y89A 1L3CA 4JUDX 4H4EA 3SYKA 1BA2A 4E5DA 1OXTA 3X2SA 4RTRA 2RK4A 2NMVA 1R8XA 1P39A 3KB1A 1PO7A 4FFRA 5AK5A 1E2MA 1TK9A 4FILA 1MJHA 5HF9A 4F5ZA 2WSSD 3OJFA 1UOOA 4FBLA 1NASA 2YZGA 3LBAA 3QTBA 2FPMA 3HNPA 3IV6A 4MS4A 1ZGCA 3EEQA 4LPKA 3QKSB 1M34E 1NY6A 3STTA 4PGAA 4D9EA 4DMLA 1IM2A 4RTLA 4R9UC 3VC7A 4YAGA 1FBNA 2XIQA 1YIDA 3ABZA 2V4MA 2Z3VA 4M1WA 3VJLA 1YL6A 4IJWA 2Y9PB 3SZUA 1ZH6A 3WWEA 1XL1A 3DNMA 1K0FA 1U2GC 3T94A 2EFHB 3D43A 1ZY2A 1QHEA 2TSYB 2W2KB 1ZJJA 1IH8A 2B4AA 1RM5A 2R79A 2X3YA 1YKFA 2ZUVA 4P3PA 3O8RA 1TYCA 3K1YA 4MV5A 3FY4A 4RZUA 2WQ7A 3UJ9A 2PT7A 5DGIA 2JAWA 2VBCA 1GRRA 4JVSB 2BFBA 2WSSA 4OD0A 2JH9A 5BQXA 1TMKA 1I5EA 1YC2A 2IVFA 3ECAA 3TUIC 1CK4A 2FVYA 8ADHA 3OLQA 3RK0A 3C3YA 4C3ZA 4NZNA 5CDUA 4NP6A 3JD4A 3TPFA 1X9GA 1XZAA 1KO8A 3RDPA 1NP7A 3ZV5A 1NVWQ 5G02A 3SC6A 3NEJA 4IFIA 1DX4A 4OYRA 3B6MA 5C3MA 4W63A 3KLOA 2ZJZA 3BHJA 2LRHA 3OJWA 1Y3AA 3T1NA 3ZGVA 4COKA 3HYCA 2EWVA 3O8BA 2R8RA 2QGZA 3VR1A 1ESCA 2Z6AA 2NN3C 1L5LA 4CM7A 1S2IA 3V7NA 3KCNA 2VNIA 1QS0B 1W87A 1XTQA 5AJHA 3RRMA 3AR6A 3NH9A 1L7EA 4E1BA 1DIGA 1KFJB 3TZBA 1MPTA 4EHBA 3HSSA 3P2KA 3BB4A 2DWQA 2ETXA 2OL4A 4RJJA 1GKIA 1X2EA 3DPIA 1ODIA 3QU4A 4UC0A 2AMVA 1BEZA 3C7KA 3IMFA 1JBQA 2EZTA 3RRNA 3C8UA 4B4OA 4S0ZA 5C52B 2CNWD 1IZ8A 1IQRA 4FFDA 2VSXA 4BPBA 1YBHA 3DS8A 2G5GX 5EP1A 1K88A 1W49A 1TJYA 4FJ2A 2W2MA 2NUAB 3SXPA 5FBVB 4EVQA 4LQ4A 5CJPA 2G80A 2PGJA 1Z6PA 4JXZA 1ESNA 3GT4A 4WZAE 1F2TA 2VA8A 3PG5A 4F4DA 4LV5B 1R6BX 3P71T 3NFRA 4V1CA 3S8EA 4KG7A 5CHYA 4NBLA 2LVBA 1U02A 1YUNA 5HFNA 3IP6A 5THQA 1VFNA 4J0KA 4Q21A 5K0NA 3ZGYA 2L2QA 4BVGA 4AYTA 2FDCA 3E7PA 3AF3A 4JOQA 3E53A 3LLUA 1TAGA 1XRNA 4K6GA 1R00A 3C5VA 3OZBA 4IO1A 2IP1A 5LA6A 3ZGNA 5JXIA 4WERA 4FYWA 1C0EA 4PY2A 1E7SA 4ILEA 3KD2A 3PUVA 1QQAA 1YWGO 1EFVB 4K9PA 1F4PA 3I1FA 4L0MA 1N5JA 2YWGA 3CLSC 2BMVA 3FHOA 3LHFA 4IVQA 5KYUA 4WVLA 3LC2O 5SY9A 3BGOS 3DE5X 3ZWDA 2IEBA 4ZMBA 1E60A 5ALVA 3EEYA 3IT3A 2EGUA 2H7YA 4QUEA 7AT1A 4DARA 2XBMA 4QATA 4Q9KA 1JXMA 5FPPA 1D4AA 4KQCA 3N2GB 4I4NA 4TTRA 4CM9D 4UM9B 3ISTA 3TAXA 4DLTA 2I9KA 4KAFA 5L3SB 2QRZA 4JHXA 1PRYA 3ACCA 3M6FA 3F46A 4FGUA 4F1KA 4L5AA 1YR8A 1BQEA 2BGTA 2PH1A 3O38A 4RSMA 4ND8A 1WP9A 3E5RA 4B3XA 5EXSA 2FUCA 2PYZA 3I83A 4LF7B 2NNLD 4JUAA 2HB6A 3AL2A 3KZCA 4N0DA 5LBTA 2XUZA 5K3DA 2COUA 4AQDA 1DBRA 1C1HA 1Z0IA 2MYNA 1E4OA 2B2XA 4D2IA 4A1OA 4AF6A 1QP4A 2YWHA 4M88A 5H59A 1Y4DE 1E2LA 2CVHA 2FYTA 3I9NA 3C8MA 3VSBA 4ENPA 2I2XB 3LQ2A 3QLEA 5J5AA 3TDMA 2AK3A 3OU7A 4P6VF 2WMNB 3N28A 5JU6A 1U0NA 4PV7A 4B3DA 4OMDA 3LL4A 4PRKA 4BB5A 3NNNA 3NXSA 5T8KC 4YUZA 3ZHOA 3Q2KA 4RUKA 3WYAA 4EELA 4MR7B 5CT9A 1STOA 1E3MA 3MJEA 1Z25A 4LE0A 4XX0B 1Z63A 4BJ5A 3HKEB 5ALOA 1ZJ6A 4ZK2A 1OH8A 4RHEA 2G3YA 1KH2A 2X13A 3NBMA 2R47A 5CLQA 3VPHA 2V65A 1U1DA 1YS1X 2NIPA 3DEIA 3TLJA 4W5TA 4Q1BA 2Q29A 4I1YA 1CHDA 4MKXA 4G6ZA 2ZWPA 3RC1A 1RLTA 3WRWA 1K7XB 2WM3A 2PPLA 4G67A 1BXRB 1UF9A 1ZKMA 2QV0A 2H1SA 2ZJBA 5CM9C 2C8JA 3RVPA 5LYJB 4DQDA 3PSAA 4JX9A 5CTJA 2JFWA 2FUKA 4B43A 1EH5A 1JZSA 1RVDA 1Y7LA 3LLCA 4L9RA 4BMSA 3GJ7A 3ZU2A 3EXG1 4C07A 1UPTA 2IUEA 4JGIA 2G04A 2CHVA 2XYVA 4G4SP 4KDRA 4NCXA 1Q7GA 3M6AA 1OFUA 3N05A 2IYTA 1BDMA 4V1CI 4B40A 4U3JB 2HCTA 3D8BA 3EGCA 4KITB 5KX5F 2VZEA 3M1IA 5G0WA 4B35A 1WJGA 2C31A 3C2QA 3JQQA 3L7IA 3Q0TA 5FUXA 5KZMB 2C5HA 1CZUA 1VGVA 1CNFA 2N9UA 4B3IA 1PLJA 4FR2A 3OEEA 1VOTA 2GPSA 2HQOA 1NJ8A 1ZPDA 3NBKA 1UBJS 2BC9A 3LQQA 4LJSA 4NMHA 4AY2A 1UDCA 3BXHA 3FUWA 4B7UA 4S1OA 3ONWA 4JLOA 3FDZA 3E84A 1OYWA 4B6RA 2BCJQ 4G37A 4G97A 1VLJA 1V9CA 1NQ5A 5ARDA 4NCJA 1Y6FA 2CFSA 1YJAA 4DDMA 3K32A 1N34B 1B6RA 3DBHA 1CXZA 3SQMA 1LDBA 2QE6A 5KREA 2Y99A 2ZIAA 1DHTA 1E2BA 1M75A 5I7HA 3ELUA 3ESAA 2FZCA 3OPXA 3MJHA 2YWDA 3A9TA 5EE1A 4CM8B 2BMEA 1EFRA 2XMQA 4C4SA 1BC5A 3OOEA 3GGDA 5AJZA 3VTZA 2AJLI 3ONNA 3HBNA 4ZTZB 2JBAA 1JIUA 2WT9A 3PRYA 4LBWA 5KKNB 3TFOA 4TWZA 5ENVA 2Q5FA 1DV2A 1VJRA 3BQNB 1HNNA 4B81A 3EXIB 3WQQA 3VX4A 1UK7A 1THGA 4XWAA 3HY6A 4GRDA 5E4YA 3WKCA 1HY3A 4C2BA 4J2OA 2YC4C 2Y1KA 1J1UA 5B12A 3D6TB 5JD5A 1FJGB 2FSVC 3L8FA 1UPCA 2ZRLA 3MFYA 4U2DA 2XUHA 1OA0A 2BPOA 2YV4A 3E7XA 5CG1A 2B8JA 2IUUA 1XAJA 2GEVA 3TXAA 3OBBA 3EJWA 1J0CA 2E4AA 3FDXA 2W8BA 5EZYB 1SCNE 5F7OA 5SYNA 3ITKA 5THKA 3VPAA 5IANA 2CD7A 1FUKA 1J0AA 5IP5A 3EOBI 3D6NB 3AVWA 4ZO9A 1QH8B 2WA2A 3W3AD 1ZGHA 1VYHA 1XEXB 4UHFA 1BSVA 2CB0A 4DCMA 2WU3A 2FX2A 3H6GA 1U2EA 2A9OA 3T5AA 3KM0A 4IP0A 5L7WA 2ZYWX 3HCDA 1TM7E 2EF0A 3ETGA 3N7AA 3LXUX 3R5JA 1G1MA 4N49A 3RSFA 2NUTA 4A5SA 2WP0A 3WNQA 1EFDN 2ZU6A 3BCHA 2XYPA 3OG9A 4LQLA 4OATA 3TR0A 4AMBA 4H60A 1Z0UA 4LJ4A 2QUZA 4FXPA 1ID1A 3UHFA 2Z2ZA 4QBKA 4MMZB 3A06A 1E4EA 4F6RB 1A9RA 1ENYA 2OVFA 2R1TB 3IO5A 2H7VA 3S44A 5LXTB 4HNRA 4YCNA 1VCHA 4R05A 5ERYA 2PLAA 1M7HA 2OBXA 1MAWA 3SHQA 1DAPA 5AI5A 4ZOCA 3U6KA 2L17A 2HUPA 1U3TA 4QU9A 4W1RA 1TKCA 4BMNA 2E85A 2JGIA 2EGHA 3QNMA 4TSFD 1P7WA 3SBXA 1CUVA 4XVQA 2MHCA 3VSAA 2UXBB 5ADHA 4ZV7A 4LDAA 3H9QA 2GXAA 3DB1A 3I2HA 1G5QA 1LUAA 2OGUA 3LW7A 4GPAA 1V35A 3B3AA 3W3AA 4QYIA 3L92A 3SXUB 5L4SA 4OLAA 3DPUA 1Q1BA 2I6XA 5DKFA 1E9VA 3FKSD 4DCJA 1OPRA 4ZICA 1RQRA 1UDWA 2IYQA 2AJDA 5A9SA 5JYDA 3QXJA 2IHVA 3HN7A 3RPEA 4BMOB 1P0QA 3WKEA 4D4IA 3AEQA 2PZ8A 1Q17A 1XFDA 2WA1A 3V34A 3ZK9A 1XQ1A 3C4QA 3WTCA 4D8WA 3QPBA 4DHWA 4WACA 5ULLA 3K0FA 3KKKA 3QPCA 1EVLA 1ZS9A 3HM9A 1K3UB 1XRLA 3GLFE 3DLHA 2FP4A 3R0JA 1TXGA 1DZ3A 2G8LA 2AOVA 3BXFA 4QD3A 4C20A 5AW3A 3C5HA 4OXQA 2NM0A 2BFEB 1PP4A 4HYYA 4YRKA 5KWVA 3PEWA 1CUCA 1OXUA 1X1CA 4AP9A 4MYTA 3MCZA 3KQWA 3PUKA 1JHAA 3CA8A 2QPAA 2O0LA 3DWEX 4JBWA 3DMYA 2NYVA 5KSZA 4IIDA 1W96A 3IUQA 4IJQA 4JITA 3KQNA 3E7DA 1IXYA 2PO5A 5FI0B 2WSLA 3E15A 1TA4A 2WFZA 2PFKA 1KJJA 4YJHA 1M8GA 3UAGA 1JDUA 2LE0A 3SC2B 4AJLA 4TMZA 1OR8A 3ZE1B 5A0FA 2IH4A 2ZB2A 3E1SA 3W8DA 1HBJA 4OF4A 2IA5A 1YCGA 2XMCA 3U44B 2ASVA 4PR0A 3K9LA 1N25A 4NU6A 4Q3LA 3QMMA 1YQUA 3EHEA 2JIPA 3L4EA 4URXR 4N48A 2MT9A 2DFKB 1QGZA 4YCDA 5EGNA 1T0JB 4OM8A 4E2WA 3E7WA 1SCBA 2WJ6A 3TRKA 1FX0A 3F78A 3GCGA 4KMRA 2P6MA 1RE0A 1WKBA 3C8HA 3AESB 1YZUA 3OHPA 4TS4A 4YQEA 4XGRA 3AU8A 1RRKA 1JH9A 4JU9A 3GQBA 5IT5A 3R6TA 1K5DA 3QXSA 1TGYA 2O3JA 1IWBB 3PF8A 5FNVB 4G5FA 1NE2A 3WXBA 1VG9B 5FIUA 2VXBA 3SX0A 4DR1B 4FHFA 5FWYA 5JTUA 4K2HA 4NBWA 1XX6A 4XPIA 1X1QA 1H2XA 4MKRA 2PMEA 2PX4A 3WNVA 4NS4A 1X8XA 4YJ2F 1GGFA 3RC8A 3VSDA 2YTZA 5JMOA 1CCWA 3JQAB 1J8FA 3W1WA 1VE6A 1WXQA 2GCGA 3ZNQA 3ZV7A 4EGFA 5LU9A 1Z62A 3OJXA 5CEJA 3IT1A 4K6FA 4KXQA 4L8VA 1YR7A 1W0JA 3KT0A 1XAHA 2PM8A 4NYJQ 4RDXA 4LGCA 3GH3A 5CT6A 5TRTA 2ZUDA 5AUPB 5JW6A 3GLQA 2PHZA 2NZJA 2Z5LA 3GJ5A 3KJIA 1NKVA 1UBOS 2F9LA 4K6KA 5ALIA 4O2BF 1JPJA 3CLRC 1Y1LA 2I78A 2GCPA 1R0SA 1SQ0A 2HN9A 3N75A 3AB3A 2IL1A 3C1UA 3DMTA 4UUQA 1EI9A 1X7WA 4JXKA 4ETMA 4BB9A 5EMHA 3K9GA 3WLKX 3A04A 4TRRA 1WZ2A 1QSGA 3D6UA 5EE9A 2WFMA 5B3LA 5LMNB 4BU1A 1DLIA 1S1MA 3LPDA 3P9SA 4PYNA 5FPSA 4EGQA 4UATA 1FXWA 2OGZA 3SSOA 4GUAA 5KSYA 5D00A 4PHHA 4B2PA 1QV9A 1NFRA 3CNNA 1JEYA 4YUVA 2WWXA 2V96A 4NABA 3W2GA 5CB0A 1V11A 2FAXA 5EEGA 4DLZA 3EQZA 1DINA 5F5NA 4DV3B 2E4YA 4Y6GB 4AQ7A 3WGGA 1WNTA 2G1KA 1DWQA 4RABA 4WA8A 3NBQA 1KVRA 3F8SA 2H48A 4EF5A 2B99A 4AS1A 2PSEA 3WL3A 2P7IA 2BSXA 1MZVA 3KJHA 5DBGA 3D4OA 1ZRNA 1E1CB 3LP5A 4OKSA 3O94A 1YQEA 4NNJA 1B6GA 2HA5A 4EAQA 2R2GA 3HTXA 1FQWA 5IVHA 1A2QA 5AHXA 1POWA 5C2JB 1J0DA 2JLCA 4NV0A 3EZ9A 5DNDA 1GUFA 1MENA 4UULA 2K6GA 2JLAA 3FZYA 1TW2A 3EXFA 2NSYA 4ZQFA 1QXSA 1I5OA 4GBJA 4D81A 4AU1A 2PJRA 2QMHA 2VWQA 3NP9A 4WTOA 1GG8A 2PZFA 1DQPA 3FNGA 1VPWA 3JWEA 2JGAA 3N6VA 1U2PA 2BH9A 2HA7A 3O95A 4JBXA 4G9EA 2VPZA 3ND5A 4JLAA 3GFRA 2QYTA 1TIPA 2OHVA 1PWEA 2RHLA 3C3MA 5G41A 1THZA 3BH6A 2PXAA 2DUWA 1DAEA 2H4YA 1A7AA 4X44A 3CEMA 5LOVF 5U1PA 1YR9A 3PE6A 3C7CB 4KKXB 3ORQA 5K8TA 5JDCC 4JXJA 4GOJA 3DDZX 3UMRA 5EQTA 1NR7A 2W0MA 4URUR 1CNEA 5JXJA 2R84A 3DUFB 2QTFA 4HQ6A 4R8SA 2XCRB 4YJGB 5KNBD 5AR1A 1P6XA 2FPSA 4ZYLA 4L95C 3VVBA 1YUMA 4ZVMA 4EJSC 4DQVA 5BMOA 1FFCA 1PW7A 1NBMD 3C97A 1N77A 4O4LF 1ZICA 2D5BA 3MRXA 4KOAA 2Q49A 1CZRA 3BGWA 4MRRA 1XZDA 3KLPX 4QOGA 4XFKA 2JARA 3QEMA 4J3NA 3H11A 1LS6A 3OZWA 1XGKA 3B70A 1NBOA 1WXGA 4HDSB 4CV1A 5LBUA 3BSYA 1BW9A 3LUAA 2RHMA 3EHDA 3IKJA 3I2GA 4G5GA 2QN6A 3T5DA 4ESHA 4X95A 2WJVA 3LOUA 3OQNA 3P52A 3IT0A 5F33A 4UFPA 5THXA 3G2LA 4URFA 2R87A 1PR0A 2WFAA 1XMOB 4E21A 1R0RE 1XDBA 2CFIA 4MP3A 5JVDA 2FETA 1ZC4A 1DARA 4LC9A 1ESMA 1J7KA 4FFNA 4U5XA 5FJJA 3W2IA 3I6QA 2P5YA 4HNQA 3GZTB 4M6WB 1G8JA 1P29A 1QCYA 3MD9A 1X0XA 3P9KA 3V4VB 2QMUA 1A1SA 1NC3A 3RV3A 3SHFA 5LVAA 5F1OA 3TTTA 2DM6A 4LSWA 4L8LA 2IXGA 3JQ7A 3TCKA 1YQWA 2J0UB 4Z0TA 1R5NA 1EPUA 1RBQA 4IDCA 1OC4A 3IDAA 5H3LA 3BDVA 3AZPA 4FKBA 2HNKA 1IZ9A 5F9MA 3RT7A 2GZ3A 3BFXA 5F3DA 2D1SA 5E6SA 1DJNA 5IBRA 3IA2A 3OUUA 5LLSA 5K0CA 1ZMXA 4KC0A 2IXFA 4DRYA 1B16A 3KUCA 2RH8A 2CNOA 4TPKA 4YRBA 1I80A 3G9TA 1SU6A 4Q05A 3F3SA 4BU0A 4ND3A 4GL4A 1UMCA 1NVBA 2AWNA 1UADA 1CUDA 2RH4A 1Y3CE 2HMVA 2NZ2A 5K6AC 4GZMA 1XUOA 1PWZA 3KKEA 3AINA 4R0VA 3V8NA 4ZXPA 4TKUA 1PS8A 1ZVVA 3QOXA 1GL3A 2PXHA 3TLZA 3I72A 5DXFA 4IZIA 3GUUA 1I4TD 3L07A 1H6AA 3REQB 2P9BA 3TW0A 3G9UA 2FG5A 3LDUA 2EKDA 3CX4A 4KV9A 4RA9A 2OXIA 4B45A 4RIEA 1TJ3A 4CQNA 1PJLA 4MW6A 4RXTA 1AK1A 1E2QA 2CLIB 5H7XA 1QIHA 5BRJA 2RE8A 1ZR4A 2JG3A 5U9CA 2ZEJA 1ZX1A 1GR1A 3IX7A 4HV4A 4MKHA 2VWPA 2AG8A 1H69A 4JA2A 2RB5A 3IIIA 5IJZA 2WRZA 1W36C 4OEHA 1Y4SA 2QTBA 3AUXA 5E9JA 2P4QA 3PHGA 3ZWVA 4CJXA 1M73E 3G1UA 3I5UA 3A0UA 2F3RA 1U94A 1Y6RA 2J67A 2QTLA 5TEWA 5BVGA 3P45A 5C8YF 4NZ9A 3D1VA 5CGZA 4LXQA 2PGAA 2IWHA 4Z7NB 4MS3A 4OGGA 4DSZA 5TQ0A 1QRAA 3ZEIA 1U7OA 1XBTA 3FPGA 2C58A 5D01A 1SBYA 1T4GA 2BD0A 3G2KA 1FW8A 1Z2CA 2YFHA 5LSAA 2XYHA 4NKRA 1XV5A 5KOIA 4MIKA 1Z75A 3UJDA 5A5DA 4N65A 1USWA 1FMJA 2A30A 1MO5A 4BQOA 1ODJA 3JQPA 4D4HA 1ADJA 3S2FA 1DMRA 1N2CE 5E6UA 4LOJA 2ROQA 4RXUA 1O7JA 3A10A 2V74B 3PDWA 1LDMA 4RHFA 2QSZA 2O2DA 1VGQA 2KLHA 3ANXA 3EGIA 3QX9A 4OHPA 5EIFA 2Q3CA 2NQTA 2DC1A 2EFJA 5HJEA 3U5ZB 1DAOA 2XQVA 2ONCA 3RARA 4LXTA 1GHTA 1HYBA 4DG8A 4F3TA 3B36A 1XFAA 2H16A 4TKLA 1UIMA 2G72A 3KL2A 4JENA 1JG3A 2ZJ7A 4Q16A 2ID9A 2A9QA 2FVXA 2G0AA 3K5HA 4PZLA 1IY0A 4PR3A 5FO1A 3Q7QA 3COSA 1F4VA 1NJ2A 1ZM4A 3FFBA 1I4LD 3HABA 4UTZA 5AUOB 2F3UA 1YHZA 1G4AE 3QE3A 4GZ6A 2F3QA 4B7CA 1CT9A 4F8JA 2YRWA 3AFHA 2H9AA 4CETA 3OLVA 2HF2A 4C4PA 1HNWB 1Z2EA 2P6OA 2R00A 1G16A 5JQWA 1PR1A 3DYIA 3LJKA 4B7XA 3RVSA 1E8NA 3OZSA 5IAGA 1B26A 1Q12A 3W8FA 3IE1A 3Q3GE 2TYSB 2WYOA 2JFFA 4KPYA 2A86A 4R31A 3QKRB 4C7XA 4AJ1A 1I9CA 2J5KA 2F1IA 2E7ZA 2H85A 1FTQA 3UK0A 3V7YA 3SD7A 4B84A 4M8KA 3QSYA 2REQB 4QJ5A 3AIKA 1PDWA 4JJAA 5IKOA 3ER8A 1EWYA 2YNMD 2D0DA 3H5LA 3R76A 4LX0A 4PNHA 5KKAA 5L95A 4YPVA 3MF4A 4MQLA 4P4TA 3VH2A 4DLLA 2IYSA 1KAOA 2ZR7A 1FDVA 2QGNA 1VL0A 4XCVA 1G2PA 2QQFA 3OF3A 4IH1A 4KXVA 1YMUA 5DOVA 4EVRA 2IHYA 4GOKA 4YUXA 4KNYA 1GYQA 4DUZB 1SEPA 3O8OB 5EJ9A 2WOOA 2H18A 2C2MA 5LCXA 4Y9TA 4UVGA 4YRGA 5HOQA 4KO3S 1XE3A 3S99A 4R5MA 2F43B 1QF7A 2WB4A 4HGOA 2AHOA 4L5BA 1A4RA 1C30B 1NX9A 1A8IA 1K4YA 2X9GA 2VHUA 3SS9X 4J43A 1G3UA 4BFTA 3NDBB 2NWQA 3QVKA 1K2VN 1RWMA 1TO6A 2ACKA 4O1MA 2ZRMA 1ICIA 4Y0AA 1U4OA 1J9GA 1A4UA 1VCNA 4A8JC 2ZQZA 1SN7A 1ONOA 1RZVA 2GHRA 3OX1A 3O4RA 4EHIA 3L1IA 3MTBA 3ZQ4A 2P65A 1GNLA 3A28A 1DTWA 2CFRA 3G49A 3G7SA 3TNJA 2PUDA 5LUAA 2UUCB 1GPLA 5KNDH 1NMSA 4TLCA 5E7MA 2PWAA 2GKGA 3WGZA 1N1GA 3B1JA 4I66A 3LZ6A 4TS9A 4UE3S 3UKDA 5I4CA 3LVRE 1J8VA 1EQUA 3DLAA 3DLIA 3OECA 4G9GA 4P38A 2X5XA 3TFQA 1JDPA 4U2GA 3ZWPA 2DY1A 3C41J 3WQHA 3MCAA 1L5ZA 2YZMA 3N70A 1HV8A 1HF3A 4HEJA 3P19A 1ISIA 1TVKB 2GEUA 2J59A 1DAGA 2GJKA 3LVQE 4TMWA 3D7NA 1XD8A 3QWIA 1LK0A 1YRHA 5BXQC 3AHHA 1IMOA 1L8AA 2HU7A 4HATA 2OO3A 5PNTA 5LP1A 2WJYA 1SXHA 1EWQA 2PEZA 5J2UF 1IATA 2FLKA 1E69A 5ALRA 1GU1A 4JC5A 1R15A 2IOFK 4R68A 3HYSA 3G1TA 4JP2A 3W90A 1BE8A 5CXSA 3TVDA 2BWJA 4RF3A 1BH6A 2ZVPX 4RHTA 1AIPA 4KN8A 121PA 1A9PA 1N7JA 1VKZA 2QL5A 3MWKA 2DUUA 2WZDA 1E96A 4NENA 2WWYA 1ZR2A 3PX7A 3TQFA 3K16A 1B6SA 2A8YA 4FE4A 4IF4A 4QUAA 4BX9A 3WQSB 1DIAA 1XHFA 2UZ0A 5GZ3A 3NR2A 2PX5A 5INTA 1F0PA 1WD5A 7GPBA 2II6A 1TZMA 2ZVQX 3G7UA 4D9NA 4N41A 1RDFA 3JWJA 5A05A 1GGVA 5DHSA 4DDVA 2BTOA 5CBKA 3VHQA 2WJPA 5LMZA 4U9IS 4ZT2A 4RWZA 1SC1A 2Q3JA 3CYFA 5E7JA 4GMGA 3OZTA 5DMHA 1OLUA 1HXHA 1QLHA 3SHOA 3VHRA 2YDXA 5ADVA 4L4XA 2Z43A 4AKHA 2C00A 3BGSA 2ZXUA 2ICAA 4WQMA 1XZNA 1YZNA 4ME6A 4ZREA 2O8DA 4YI3A 3GBSA 3F7OA 2A2ZA 5I7OA 5AJUA 1GPMA 2HCFA 3OHMA 1G17A 2D8MA 3HJTA 3JVEA 3L8MA 1ORWA 1YB1A 3NAZA 3PC8C 1L9XA 3RTGA 1RYMA 1RBMA 4W5JA 1KZ9A 4EZEA 1O1YA 2GASA 4G3XA 1S4MA 1H85A 2YS7A 5KCZA 1R5OA 2GCOA 1Z0SA 3MAAC 1PNOA 5T6MA 4AC9A 1EFPA 4BGVA 1VDZA 3NWPA 3ZDDA 5AM5A 3ZGLA 3LC7O 4DJFC 1R0BA 4M9SA 3OMXA 2JFBA 1NQTA 2D5LA 3A2LA 3RS8A 1RZRA 3WIEA 2C2KA 2GDJA 3MIIA 1E9BA 2WDZA 3GUYA 4KK4A 5LP6B 5LLDA 3RYHB 1WCWA 4F1JA 2RHTA 4RKWA 1K8YB 2PL3A 3LAWA 1PGQA 4DR6B 1IZZA 2WVJA 4GWKA 5JDIC 1XCBA 3WWPA 5LZ7A 3GROA 2F62A 2AFIE 1T9BA 2C78A 4L9AA 1W88A 1NNSA 3PCRB 5FEMA 3EC7A 2CY0A 4YRDA 4KRXA 2SHKA 1AS3A 1C9MA 2QS9A 3F5DA 1ZINA 1DUSA 1S8OA 1JA9A 1UR5A 3MTJA 4W1QA 4GECA 2BFCB 5JFOA 2PWYA 3FRJA 2V54A 1DOZA 3UGTA 1NU8A 3KAQA 4IEIA 4CG0A 3W5HA 3RUIA 3EW7A 1ILWA 5JNLA 3S1LA 5C51B 3L4JA 1LF0A 3VAZA 4C3VA 3LGXA 1MA0A 3I8OA 4IYJA 2YH2A 1B73A 5LDDC 1LJLA 3H9CA 3WI7A 4PHCA 5FDFA 2CB9A 3G5UA 3X1KA 221PA 2B5VA 3FCUB 3PHHA 3ICEA 1Q6ZA 4PPGA 1Q83A 4FFSA 4Q1CA 3ZY6A 4OOFA 1FS4A 3MERA 4OPMA 1E6KA 2VTKA 1T34A 4RNDB 2I62A 4ZODA 3EYWA 2ECPA 3QKWA 3E2IA 2FPGA 4G0YA 3GEDA 2QM0A 2C04A 2XKAA 3DDOA 4M87A 1ZXXA 2ZRJA 4OHWA 2FN9A 4Q15A 4RD2A 5FLEX 3HKDA 3VUFA 4EKNB 2VYVD 3AQIA 4PZUA 4IQFA 4ZZ3A 3SK0A 3B3QA 1FXSA 1PQYA 3DQPA 3N2GA 1R6AA 1SHLA 1RIIA 3ZNPA 1QC5B 3Q9LA 5AOCA 4AO6A 1OF1A 2DCUA 2P9YA 2Q28A 3DKIA 2BE7A 5HKAA 2QSUA 2FEAA 2V98A 3R75A 1NWCA 3IUJA 1DFIA 1K7EB 2HXGA 3MWYW 3H1GA 4TWJA 4EARA 1W581 3PV0A 2X9LA 1E7WA 4MS1A 4AI6A 1GPAA 4MVJI 2L18A 1U2DC 3DF7A 3DQQA 2DFDA 2FPUA 4I19A 3VV2A 1SB9A 2J9XB 2I6TA 2W37A 3NIDB 2GN1A 4IFTA 3UTDA 5CDHA 3BS4A 5ALTA 4F3NA 3N07A 1D9XA 2IX9A 2DSNA 2FX5A 2I76A 1MB0A 2FR8A 1FTNA 3G88A 4IGIA 1R5BA 3A4YA 3AETB 3STUA 2QWXA 3CLSD 2ETVA 3NALA 3PPVA 4BQPA 5BXYA 4C0WA 4EHKA 4CCAA 2YXLA 3IEIA 4HNAA 3TLEA 1VB3A 2ZI6A 4PGGA 4CHGA 4O33A 1W4LA 2PFSA 1SIUA 2X5JO 3EDMA 2BI4A 2JZOA 1R37A 3U5TA 3O6VA 3EG9A 4ICIA 4DIBA 2QQGA 3OFND 2P4UA 3PGKA 3VR4H 4Q18A 2HRDA 3AUAA 4TMVA 1UBKS 5LFAA 4HT3B 1XRPA 4KRGA 2NXNA 3ILHA 4S12A 4US2R 3WLHA 3CKLA 4DV2B 3LYHA 3D6MA 1GQOA 1X38A 3URKA 3GRCA 3NUZA 3ABSB 2G09A 2BELA 3L8CA 4HFRA 4AB1A 1YDEA 1Q0UA 2KW5A 5EIXA 1NA5A 4XE5A 4FYMA 4EHJA 3EDOA 4WK0B 4QICA 4DS3A 1W75A 3TZ6A 1GCOA 2WFLB 5SV2A 3UCXA 1NMEA 2XODA 3DD5A 3LHDA 5H4HA 3RAGA 2P41A 4C6HA 4PZ0A 4D9MA 3M4ZA 3F4KA 4ZA2A 4KO4S 1I7DA 1TU3A 2I8AA 1U0JA 2VUSA 3I58A 4LYDA 3WK8A 1ZXBA 2VH2A 3DFFA 1INLA 4B4DA 1NW7A 4WY2A 3CINA 1L1RA 5K4AA 4BJ3A 4F5YA 4D56A 1DRVA 3KETA 3DKRA 1JG2A 1K86A 3HLYA 3I6MA 3JVIA 5I9BA 5HXAA 4M36A 4UNNA 5E1OA 1AA6A 3IBGA 1KDOA 2XVAA 4WKCA 1CWUA 1Z4KA 2WIGA 7REQB 1RWVA 4B3CA 1EK0A 1N5KA 1FRVA 2Y8EA 3LX4A 4NH4A 4TT3A 5AXAA 3T1VA 1E9DA 3KEFA 1HPLA 3FPKA 1A9YA 1E1NA 4MV6A 3N3AC 3I4CA 3JRNA 3IH5A 1LV8A 3GLTA 1AUPA 4EY7A 2AOWA 3LA6A 5JS8A 2EEPA 5JECA 3KUDA 3MNFA 3Q7RA 3TOCA 1XZQA 2J3QA 2OQIA 4IXWA 4PZCA 1W4RA 4FYYA 4R1NA 2Q5JA 1L1FA 5KO2A 5JBIA 3A1VA 4YT5A 4QM6A 3CPJB 5DLPA 4JEIA 2WDPA 4IZ6A 3WGNA 1EDBA 4WBNF 3TRIA 2NGRA 3HA3A 3QUTA 3FF1A 4QT4A 2QF7A 4H7DA 1JAHA 4YAKA 3HRIA 4JLJA 1URPA 3QKIA 4BPRA 4FUQA 4M8NE 1D6NA 1A4XA 3NHBA 1Z17A 4AJOA 3MBIA 3B5IA 2HNAA 1H3FA 1JKMA 1OLSB 3CUSA 1G59A 3LQ4A 3OKPA 1NMYA 1R66A 2GLUA 5IF3A 4ZD6A 3QFCA 4JP8A 1G9XA 5TF4A 3LG2A 4EA9A 3FH0A 3QWHA 4R1UA 4DM7A 4Y6PA 3NETA 1OGYA 2DUMA 1S2DA 2FLVA 4LZLA 4WOKA 4BLUA 2W6QA 3U09A 4C7OB 5E4FA 3U9SA 3EIOA 1GO2A 2HV9A 3ONDA 3GUHA 3OPNA 5EUQB 1XTZA 3K0HA 4RCVA 4AG3A 1NYLA 3O8CA 1X9HA 1CDEA 1JKXA 3JASB 1C3VA 3X1XA 2SNIE 2VK1A 2X5KO 1ULHA 2WUGA 4L22A 2GRJA 3L5OA 2IEDA 1RQGA 4QGFA 5F4ZA 1N2OA 3R9WA 1ZD4A 3DTVD 1Q84A 1MVOA 5KQGA 1OB2A 1MPXA 2VJAA 3H4VA 1NUTA 1G8AA 3TNLA 1ES9A 4B9EA 4DLYA 1PWXA 1FDOA 2FDXA 4A27A 4RHYA 4F4CA 1I24A 2Y66A 2P78A 3DBRA 2HY7A 3WYNA 2W6MA 3S70A 5BN3B 2ZDGA 4LY9A 1MG0A 4YQZA 2QTAA 3R5TA 4MDYA 5IFKA 2VP6A 4MOWA 3PTZA 4R8KA 4ZJPA 1NGSA 3F4LA 4RW0A 4W5NA 5AKEA 4DNPA 1TJ4A 1V8BA 3WKBA 2RI0A 5CXQA 5K5EA 3LY7A 4JU8A 4CN9A 1WDMA 5DHAA 4D5EA 2JLVA 1E1YA 3A1FA 4TZTA 1XMIA 3OQ1A 5KUTA 5CK5A 4Q6BA 4FGZA 4GRIA 4EMSA 4TLMB 3HI4A 4MRNA 3EF1A 3EGDA 5TGTA 2FSHA 5HK8A 4AG6A 1IJBA 1IJFA 2N42A 4J94A 1U3VA 3LQRA 4MV9A 4GLLA 3DTVA 1T9DA 4ABYA 4DN6A 4F1WA 2Q07A 4K9LA 2VH1A 2PG3A 4HDOB 1AB6A 1FFXA 2P11A 1NVFA 1SKAA 1Q0QA 4KL8S 4KRYA 4KP7A 4ZTBA 1KSGA 4CKEB 1SVWA 3O8QB 5JATA 2FXIA 4PX5A 4HH4A 5FL7A 4F9TA 3V3KA 1TKAA 4P7KA 1GUAA 4KQJA 3GEMA 5LDHA 4X62B 2IYPA 2ES4A 4F4IA 4JZYA 1C1DB 1GQSA 1PZMA 4PRYA 3BXXA 4WCFB 4G81A 3C6ZA 4LNUA 2LXNA 5CRIA 3R7SA 1D1PA 2WYWA 4XVRA 1L7NA 3AKYA 2BGRA 3VTKA 3BE4A 1S96A 3C0KA 1EU1A 4ZEOA 1ZOPA 1PS9A 3K8OE 4JC0A 3EPLA 4EG5A 1RLMA 4I81A 4QQ8A 4R71A 4Q6WA 3VR5D 4DR3B 2JGJA 1ECCA 1TLTA 1WY7A 2VXCA 2GA9A 1KYQA 1FY2A 4WD3A 5SY6A 4CMBA 2X0DA 3GLRA 2XCTB 1GTZA 3P2EA 4WA7A 1L5FA 2EC5A 2V7WA 3SZRA 3WMGA 4MB2A 5LWQA 3G2QA 1I3KA 1X39A 2K2WA 2W9XA 3BE5A 4R8VA 4XQ9A 1YXMA 1ZN7A 4ZQGA 5TMEA 3ZLTA 4DCGA 2C95A 1QK5A 2AF3C 1HE1C 2MYPA 3X2FA 2BRUA 4F8EA 1QUEA 3L1UA 3ZDAA 5C7LO 3O82A 5HQ3A 4ZVVA 4CU2A 3ZHVA 5KHLB 5E9WA 1M2KA 4NMLA 5BOSA 2OMEA 2A3NA 3L0YA 4OSEA 2YIVX 4H9GA 2RGGA 1CRLA 3BZBA 3ECSA 5K0LA 1J5XA 3HJHA 5E4TA 1FTSA 5D1HA 4G56A 3BL5A 4O25A 2CGEA 3DULA 1C2TA 3DBIA 4RH0A 1FC0A 4B6QA 2I71A 1WHTA 5TS2A 4NG4A 5JH7F 3NI2A 2HA6A 2JLBA 1ITZA 5F51A 4O5AA 2MYTA 1U0OC 2QL6A 3LP6A 1Z12A 2ZRQA 1NQWA 2H31A 4UVEA 1KJYA 1NIPA 4Y6OA 4YPFA 4MUGA 2J9FA 1N32B 1T4MA 2Q2VA 3LZCA 2N0SA 1XXHA 3OX2A 1JDBC 1T2FA 1G7TA 1LXCA 3V6LA 1XN1A 4D8XA 3GU3A 1R16A 4ZARA 4BTEA 5D3ZA 1UC5B 4I6JA 4EEZA 4U2KA 1FP4B 5E7QA 2P5TB 3DMPA 1T36A 1X9IA 3SOPA 2IYZA 4XIIA 1TGVA 5KYNA 1OXVA 4AKEA 3K09C 3OP1A 3QMWA 4HXEB 1GV0A 2PH3A 3D8NA 3DVQX 1NHGA 1P4GA 3AM5A 3VPGA 1LKZA 4QTYA 1MRZA 4Q66C 1Z5GA 4E2FA 1FPMA 3HPRA 3N0XA 2YY7A 3R4VA 1XLTC 4WN3A 2BT4A 3BUSA 2UKDA 5DLDA 2NYUA 3S8MA 2JI8A 3UH1A 5JPDA 1UAAA 1QU3A 2IIQA 1MR3F 2Y0CA 2XQGA 4QL3A 1HMPA 1L4MA 2GF9A 3HP7A 4I08A 4J0IA 4WZBA 4B09A 3HCEA 4FTWA 3OD1A 3FTCA 2J4DA 3PVCA 2P7HA 4Z8XA 5DWQA 2DX7A 2WMDA 3VPCA 1DJLA 3RSSA 2JI9A 1EP3B 3NC4A 3PIIA 4OYHA 4UNRA 2Y6VA 2NO9A 2EGGA 2R68A 4OHRA 5JJKA 1H2YA 1JR4A 3E8MA 4FEGA 4POAA 4U4AA 5TJHA 2WBLC 1NI4B 1HEIA 5A02A 1N8SA 1G291 2ZB8A 2ZGVA 2XOKD 3CLRD 4BBAA 4DLKA 1QRUA 2X9VA 3HEBA 5HM8A 3QF4B 4F2WA 1H2ZA 4HQFA 4DCCA 3VYSB 5LQNA 3TJRA 1Z6GA 2WYUA 1YONA 1FLAA 1X19A 1Y5NA 2Y3IA 3KXDA 1JWAB 3P0IA 3PI6A 3QY9A 4DBLE 2K7ZA 3P9QA 2ZZMA 3AVYA 4XQ0A 1I7SB 3QWFA 1AQLA 3MT9A 1DDIA 4GZ3A 1FRZA 4HS9A 4DMCA 1P61B 3V1KA 4UXJA 2IUYA 1ZD5A 1KAGA 3MAJA 2AGVA 1WCIB 3PXDA 1ECBA 2JZNA 4RKYA 1K97A 3D3EA 4O4HA 1QRRA 1RJFA 4BO5A 1BGWA 4LXGA 2XDQB 1JPNA 2XVMA 2GWHA 2WM9B 3HXLA 5AM2A 2VDUE 2CLHB 2QJTA 2VEOA 3FPEA 3I23A 1PK7A 1I1QB 5F7JA 4YMTA 5H4GA 1CW2B 2JD2A 3C3WA 5GJWC 2GK3A 5HZHA 2C2OA 1U8YA 3FVQA 4FFMA 3SX4A 4DG5A 3I04M 3JZMA 3HB0A 2G88A 4FOPA 3W34A 4X6UA 2UYCA 3GNSA 3EZ7A 2XOKA 5HILA 1RI2A 3FRHA 1AHIA 4N0MA 1N92A 1WNFA 5F2NA 1IOVA 1D6JA 2ZROA 2H0QA 3FJ1A 2GGSA 2GQ0A 1A77A 4NBTA 4WPGA 3GW8A 3TVYA 3AIIA 4AXBA 5CEFA 2ZBEA 1XHEA 3OZEA 3IUEA 1KSHA 721PA 4P5EA 1FFYA 3MMZA 3NTUA 4CLRB 2P2YA 1P7CA 3TNFA 1OX5A 2AOUB 4TQUS 2HEIA 5CA0A 1UBMS 4C04A 4P0QB 1WXDA 1QHGA 2BBSA 2XT6A 1K4MA 3K9CA 4X6YA 4EMBA 3AGQA 1CDZA 3DE3X 2J6BA 4FR0A 3I5AA 3K2EA 5A9RA 1XTRA 3QVGA 1A9TA 1QIKA 2PKQO 4WNCA 3TZCA 4XLTA 4C06A 5AXCA 4RBNA 5IKXA 4L2IA 3PDIB 4RFSA 2AV6A 2QRUA 2FN3A 3GAFA 3GZ4A 1ISRA 3O9MA 3LDFA 4R9RA 4UTRA 2Q27A 3HKCA 4R3UC 1HMYA 1BD3A 4FLEA 5J2TF 4FGLA 2EFYA 3ZDRA 2XNDA 2XQKA 4EKEA 3KZXA 4TWAA 1P44A 4GPZA 4QXQA 5DN6A 2IDJA 4GPIB 1FXUA 2QENA 2ILVA 1AB5A 3TI9A 1D4FA 1P74A 1ECFA 1DTSA 1ZYUA 3PC4A 3OQIB 4NATA 3WGJA 4DLSA 5I4IA 2IPXA 4U7PB 2CBGA 1Y6ZA 4KR0A 5BR8B 3VPDA 2C4MA 3HK2A 4Y9DA 2O3SA 2NSLA 3R7WB 4MUEA 3A36A 4N8SA 4R2IA 6CHYA 3OM8A 4UNSA 6LDHA 5E6RA 6YASA 2P9GA 1DPFA 4OUKX 4EUNA 2KQUA 3I2IA 4M0CA 4B3SB 1BFDA 1J21A 1OZAA 2QU8A 4AJNA 1P80A 1IZ7A 1OBOA 3I2JA 1R50A 1CUJA 1S8FA 3GVPA 3CIFA 3FWKA 2HF7A 3PUIA 3VOBA 3UICA 2VWHA 2QSYA 1RPAA 2JGLA 3N5CA 4ENVA 5ALFA 4NJEA 4YB8A 1TC1A 3LBNA 3F8WA 3M5WA 1BWPA 4TMTA 4BNMA 1CYEA 1OPXA 3QTTA 4YRCA 4C0SA 2NVOA 2UUPA 3L5KA 1C0KA 2W71A 1XJQA 1QX4A 2QRKA 4DR4B 2QW1A 3DBLB 1QYDA 5HCIA 4LN1A 5IHXA 3LI2A 4YUAA 4B5LA 3JQCA 1SVLA 1KMMA 1UDAA 2E5FA 2PL1A 3HB1A 4YUYA 1A04A 5EWLB 2O2ZA 1EQAA 1WW8A 5J3JA 3ZXSA 2CLEB 2HCJB 3V7FA 4QZVA 2VDLB 4X1KA 2WJIA 4ZQEA 5AK0A 2G7ZA 3IOEA 4WCVA 1B8OA 1J97A 2O2XA 5LKRA 1NIJA 1A7UA 5DGDA 4V2UA 3LK6A 2FF5A 2MSNA 4MCAA 3EEBA 3UAXA 3M3DA 4B8WA 5B6PA 4C78A 4QC2A 3ZZNA 4PZ9A 4U2EA 1PHRA 2O52A 3MINB 2CMHA 4PICA 2JFOA 2BFFA 2UV8A 4WVFA 4AYXA 5F76A 1MJGA 4RA6B 3VU9B 3HYTA 3BFVA 2JCBA 4ARZA 4F0JA 3CMMA 3Q1LA 3WIVA 3JQEA 4RL4A 3L46A 4L8WB 2IEIA 4ONEA 3RTAA 4A2QA 3THXA 2P0EA 4RACA 2X41A 3DZDA 3IRVA 1RABA 5H8WA 3K1AA 2Z4SA 3NORA 2FCRA 1OKKD 1E3WB 2XF8A 3TQRA 1AS0A 4O0MA 3K20A 4PW0A 4BMYA 4I1UA 1H0KA 4YDRA 5A06A 3I9JA 3C3XA 4PNZA 3DMNA 1Y4UA 1R0CA 3T7JA 4NCAA 3GLIE 4GIBA 3AI3A 3TGPA 2QVBA 4TV9F 3GFTA 2XD9A 3JQFA 3ZKWA 5JRDS 1G8GA 4CG2A 3RHZA 2WJ4A 4RE6A 3I5MA 3QMPA 2FZ4A 4XWTA 4G01B 1XTUA 3WLOA 5J1TB 2R97A 3PPYA 2ORIA 1W36D 3RHSA 1DBSA 1HKUA 4ER0A 3FPHA 2POCA 4ZQIA 1Z0FA 1JHZA 1NXQA 2A4MA 3LYLA 3QU5A 2CD9A 4N6NA 5K6AA 3N59A 3THYB 2YN2A 2WG2A 2HWWA 1VXOA 2BFBB 3TCXB 2FFRA 1T4CB 2NPIA 4G5YA 2HMAA 1AQ6A 4M0PA 4DQKA 2DSTA 3EC1A 3T7EA 2F2TA 1GEGA 1LC0A 3CF0A 4K26A 4WEQA 4KSYA 5C3UA 3H86A 1GRCA 2O2IA 3QFTA 1SHZA 3LRXA 2PMBA 2PPVA 1NDQA 1TIBA 4KQIA 3AVOA 4MUAA 2RGCA 5IJAA 1SU8A 2VWGA 3ED5A 1Y1TA 3IQHX 4U8HA 5AO9A 1E77A 1QHNA 1P7YA 1UJNA 1XCOA 3T9EA 1SKMA 3BF7A 2ZZKA 2YZKA 2P4EA 1RMYA 1N57A 2ZIZA 4W9NC 4ZCRA 3MLAA 3QVVA 3QBDA 1Z08A 2OXEA 1CZOA 3ND7A 3LS2A 5DNWA 3I32A 1BVUA 1MB2A 1QKJA 2JDIA 3WP1B 4ZCSA 1TNDA 5CW2A 3LQFA 4BNLA 1KGDA 1U6IA 2O14A 2WYVA 3BB1A 1KK2A 1YOVB 3MSXA 1PN3A 4D42A 3PEEA 5EP2A 2O4CA 1VSUA 4TGLA 5FTNA 5FJIA 5KTNA 4K5QA 5ARCA 2GAAA 1C7FA 2LZ0A 3SJCA 3K94A 1ZM2A 1FJXA 1M2NA 1OXKB 1TTQB 4I55A 2WI8A 2XV1A 4LWOA 3OE7D 4MLCA 4RKRA 4Y0VA 4Z9FA 3QVSA 5L8VA 2UUAB 1NRJB 2V55B 4A15A 2X1VA 3SLKA 3N2LA 4XR4A 5EIBC 1IG3A 4L3WA 2IOYA 1F2TB 4N5DA 4TXMA 3T1QA 3KYIB 3C48A 4R1SA 2QRJA 2GAOA 3BWEA 1PV1A 3CO5A 1G18A 4HH1A 4MYDA 4F5EA 4W5OA 2JCXA 4QO8A 1EFUA 1CQIA 1WR8A 3QEKA 4UM7A 4WXYB 1NRIA 1MO2A 1V7QA 3DGFC 4W5QA 2FJPA 1SA0A 5LA6B 5BR4A 3CT6A 2DPYA 3HYLA 2JEZA 4YYEA 3QJYA 5AQEA 3BK1A 1U1EA 1NNI1 2CKMA 3OEYA 2BDEA 3KSMA 1MD9A 2WWWA 1MU0A 3A05A 3LBIA 2XMRA 5EXPA 1C9NA 4I3HA 3D31A 5KYUB 4ZKEA 4PXAA 3T1OA 4P4GA 3OICA 4NBNA 5FUYA 4N39A 1NVVR 5A04A 3GJYA 4KFCA 2NZVG 3A1TA 4JL6A 5JXGA 4GG1A 4JIGA 2Z83A 4HMQA 3T15A 4RGYA 4F97A 4DTCA 3OE7A 4WE3A 5L3QA 3SKYA