1PLLA

Crystallographic studies on p21h-ras using synchrotron laue method: improvement of crystal quality and monitoring of the gtpase reaction at different time points
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
166
structure length
154
Chain Sequence
MTEYKLVVVGAPGVGSALTIQLIQNHFVEYDPTIEDSYRKVVDGETCLLILDTAGYSAMRDQYMRTGEGFLCVFAINNTKSFEDHQYREQIKRVKDSDVPMVLVGNKCDLAARTVESRQAQDLARSYGIYIETSAKRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oncogene protein
molecule keywords C-H-RAS P21 PROTEIN
publication title Crystallographic studies on p21(H-ras) using the synchrotron Laue method: improvement of crystal quality and monitoring of the GTPase reaction at different time points.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 154
sequence length 166
ec nomenclature
pdb deposition date 1994-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1pllA00
2ZYTX 4B3DA 3NC0C 4BFTA 1G20E 1ZD1A 2FN4A 4B32A 3L8ZA 3QXSA 1Q57A 1YR8A 3G0HA 2RGEA 3I1FA 1LVGA 4GRAA 1TQ6A 4TLCA 3EC1A 4B2PA 4NONA 2FFAA 4KXFB 3CZQA 3MWJA 5EXTA 4AYXA 4LY6A 4V02A 2IF0A 2QAJA 2FGKA 1KIMA 3SEAA 4RZXA 3TQCA 2JGNA 1KO8A 1P6XA 2P3SA 4Q9LA 2ONKA 2GJ8A 4OL0A 2C98A 5TVKA 1P2SA 3QVVA 4S35A 4OQFA 3CPHA 4C0SA 4GZMA 1AKEA 2J45A 2ZUBA 4BEJA 4YXWD 1G17A 2B21A 1CJVC 3K09C 1L8QA 1OLOA 1Z2CA 2D7CA 1P7CA 4EJSC 4EFNA 3X2SA 3A4MA 2XXAB 1KSHA 4ILEA 4D4MA 1TL7C 2QAGA 1EFRD 1QHXA 3A37A 5G41A 2C5LA 4QM7A 1DEKA 2HF9A 1YVDA 5KDLA 2I4IA 4M1SA 1MABA 4TLAA 3MMPA 4XJXA 3SJBA 1Q1EA 2QE7D 2R44A 4GI7A 2F9MA 2PMKA 1VCIA 2WICA 4BFZA 4URVR 4KFUA 1W1WA 1GZSA 3DZ8A 5J4YA 1AS0A 1ZUNB 3C14C 4RD4A 3I3SR 4D4LA 1Z0IA 4DDVA 1RYFA 1ZM4A 2O8DA 4Q4AB 3TR5A 2FG5A 2QA5A 4LJ5A 1T3HA 2NO0A 1E2GA 1S96A 3QIAA 4DUGD 2AXNA 3MGCA 1Z0FA 3RAPR 2CNWD 1DAMA 3FKSA 1TEVA 2O8CB 2NIPA 3QQ5A 1ZM9A 3B1XA 2HCJB 3RWMB 3SZRA 4A6XA 1YZKA 4MRVA 4UNPA 3PEWA 1T3LA 1L2TA 2JLWA 2ZVPX 1TQDA 4DLUA 5IT5A 5AJYA 3FE2A 1YJ5A 3BORA 3WMGA 5DH9A 5H1YA 3QG1A 3GLHA 2ZSDA 2WKPA 1S4QA 4GSYA 3Q72A 4D4JA 2CXXA 2ZROA 4M8NE 3KQUA 2ZR0A 3ZH9B 3TLXA 5FOWA 3BJIC 4CW7A 1Z29A 1IN7A 2HT6A 3CRVA 3FFBA 2UZ3A 3JZMA 3B78A 2EFHB 2WTUA 2QTHA 3SFVA 4KYIB 2GK7A 2ZANA 4AURA 2Z43A 1P72A 2CHVA 2XZOA 3OHMA 4PSKA 2JIZD 3HU1A 5J4KA 3LVQE 5FPSA 1SVMA 4FCVA 1FQKA 3R9XA 1E2JA 1SVWA 1W4CA 4R71A 3IQWA 1UFQA 4LHYA 1Q20A 1N0WA 2GRJA 3QXCA 4V0OA 2F43A 1IY0A 2FE4A 1KKMA 221PA 2AX4A 1ZM7A 3I4LA 1KK2A 3KX2A 4GOKA 2PBRA 4JMPA 1P9NA 3WMFA 4OHWA 1G3QA 1A1VA 4MQBA 1NMYA 1U90A 2O8EA 1F5NA 4MRSA 4FN5A 3U3KA 5DISB 1DO2A 4F93B 4LRWA 2NPIA 4EJSB 3TRFA 4LJAA 4CT5A 1XJCA 4QRHA 2EFDB 2YC4C 3NG1A 2QROA 4LJYA 2V1XA 4PZYA 2Y8EA 2J87A 4N0DA 1ZBDA 5HTKA 5TB5A 3K8YA 2WVJA 2R62A 2HT1A 1FPMA 3CR7A 2VIIA 4L16A 3BH0A 1F3OA 4IDPA 4M1WA 3Q85A 4E22A 4JT2A 2R6GA 3CPEA 3THYA 5F3WB 3PVSA 5DGXA 4C2UA 2IEZA 1CJTC 1HQYE 2QMOA 4PPNA 2ZR7A 2IWRA 4X8MA 5FI0B 2GZHA 2RHMA 4O2RA 1R0ZA 2D62A 3S1AA 1A2BA 4C0KA 2XNDA 1OFHA 2ZU0C 2N46A 2NO9A 4EIWA 2ZI3A 1UBEA 1SXJE 3RLFA 2ZU6A 1TX4B 1H8EA 1QHGA 3K0FB 1IY2A 4BASA 4ERNA 3GLIB 3I61A 4KYUA 2Q3FA 4OK6A 5BW8A 2AWOA 1LNZA 4Q7LA 1Z0KA 2GXSA 3NBXX 1MO3A 4IKEA 1IBRA 3T1QA 1W36C 2JASA 2WIAA 5IRCD 3OAAD 4V03A 1RIFA 3E1SA 1LB1B 2WAXA 1P9RA 4G5QA 5FFMA 4UQOA 4NMMA 5LDDC 1Z0DA 1GNRA 4A0HA 3QXXA 5C4MA 1ZC3A 4NYIR 4TL9A 1YZQA 1IM2A 1ONBA 2REBA 2ZUDA 3T1TA 2J7PD 3WP1B 1NN3A 5KNBA 3LO5A 2XXAA 4HDCA 1XTJA 2X8AA 1Z07A 4W5HA 4A92A 4IVQA 1TPZA 1ZNWA 2R6AA 5DHFA 3KQKA 3B60A 2RGGA 4URUR 4BFSA 1UKEA 4M1KA 5HE9A 3Q8XB 3SN6A 3J81k 1U98A 1ZM3A 5AUNB 5KUTA 4PO9A 3RVBA 2ZJOA 4M2LA 2ZRNA 3K9LA 1VIAA 3RS7A 3K9GA 1N6PA 3SYNA 4DIEA 4F38A 5AUPB 2XTZA 3LX5A 1G1MA 5JRZA 3ZQ6A 4TYNA 2FDCA 1E2LA 1F6BA 3DMNA 1GL7A 3HPQA 4F91B 2XZLA 3EZ2A 3V4FA 4GNKA 5F9HA 1P60A 4QHYA 1Q3TA 3BBPA 3WMEA 1W2GA 1X8LA 2BEKA 4Q4AA 4CT4B 1QBKC 4OJQA 1OXVA 1M34E 3CR8A 4GOXA 4I1SA 5G40A 4LOAA 3RSOA 2OXCA 2ZYVX 5TDHA 4U5XA 1MOZA 1G5TA 4B76A 5JWOA 3F0TA 1Q0UA 3K0EA 5EZ5A 5JCZA 2O8CA 2G1JA 1NSFA 3W5JA 2QN6A 2B8TA 4Q48A 4QGHA 3L0OA 2ZE8A 4M53A 4QHSA 4IHQA 1HH4A 2QPTA 1XXHB 2ZE5A 4JBYA 3CW2A 3MWLA 4PQYA 4Q03A 1W48A 4KSBA 3TBKA 4QBGB 4NL4H 4TT3A 1OH8A 4BPBA 1N6KA 5JHGB 3QY0A 4KFSA 1MR3F 1LF5A 3LXRA 1DAGA 4ARZB 2PX3A 4OK5A 3SJZA 1XEWX 2F3TA 2DPXA 3SU8A 2BMJA 1KI4A 2H7VA 5C2JB 3FOZA 2IS6A 4UNNA 1W4BA 1YKSA 1W44A 1VECA 5FTJA 3M4YA 1AK2A 4MA4A 3IBYA 1RC8A 2JLUA 5GJWC 3WYAA 2BBOA 3KJIA 1GKIA 2GVDC 4O25A 2OXRA 2ZRDA 4WVFA 5L8VA 3C7KA 3CH4B 1A2KC 1YR6A 3LW7A 1ZVQA 1UADA 3AVVA 4CRWB 1QHIA 2GZDA 2Q3HA 4Z1MA 3KQLA 4PAMA 1SQ5A 4CEJB 2DHRA 4LHXA 3IBGA 2G0TA 1DBSA 2ONJA 3W8RA 1W36B 5H68A 3T5GA 1M7HA 1JALA 4MUBA 4MGZR 4I81A 5EZ6B 3SQXA 3AVWA 1SULA 5JS7A 4JVNA 3DZDA 1P61B 1SHKA 3ASYA 1U81A 1U94A 3GJ0A 1S9DA 4LWZA 4ABYA 1UDXA 3MWYW 3K09A 1P2VA 3CF2A 3T61A 4WAUA 2IXFA 2CVFA 3KKNA 4EJSA 2ZRGA 2ZYUX 4A2PA 1YR9A 3BH7A 1FTNA 3CIOA 4TL6A 4TLDA 3C15C 4R2IA 2EU8A 2IS4A 1D9XA 2W6JA 2ODEA 4LBZA 1SVIA 3DM9B 3FWYA 4IDNA 4BLOA 2QUZA 3KXLA 4B74A 2DFNA 4CGZA 1E9CA 1HEIA 1N3BA 4R7ZA 1T3SA 3ZIAD 4FWTA 4KODA 1CR0A 3ASZA 2JJ2D 1FUKA 2GAAA 2Q21A 4B3FX 3FDIA 2AXPA 3TSOA 1I2DA 4D26A 4BE7B 4ZDIA 1NNEA 5AJXA 3ZVMA 4WZAE 4CVNA 4MGKR 3EG5A 4O2LA 1XZQA 3BWDD 1S1CA 1CF4A 1IXSB 1DE0A 4PPQA 1TU4A 3T12A 2OM2A 2ORWA 3TAHA 3JVVA 4EKDA 5AR1A 2XZPA 1I4LD 1UBFA 1G7RA 2D3WA 2G1KA 3LBNA 3CH5A 2ZEJA 4BLRA 4YMVA 2BM1A 1J7KA 3TMKA 4HZIA 5P21A 2YC2C 4QL3A 4P4SB 4W5WA 5A5GA 3TSWA 2GJKA 3GLIA 3K0FA 5JRJA 2X1VA 4GL2A 4TMKA 4MYUA 2JDIA 2JLRA 4NCNA 1IJEA 4D82A 4AKHA 4LBYA 3MLEA 4DJTA 3A1UA 1FP7A 1QRAA 3LNCA 3NBYC 4TQ9A 3AGPA 4PR0A 2VF8A 1DADA 1VKJA 4B34A 1LV7A 2IYSA 3BGWA 3ADDA 4L5BA 2VSXA 4Q1DA 1COWA 2SHKA 3WBJA 3OEHA 4GT1A 2FFHA 3EWAA 1GDDA 4G5OA 1GFIA 2Z5FA 4MRRA 1JJ7A 4IOJA 3TR0A 1FUUA 3PCRB 3PV0A 2P6NA 2XITA 3DKVA 4C3ZA 1R0XA 4MYCA 1YE8A 1XTRA 5FBWB 2IYTA 3UKDA 1E0JA 1E2FA 2V54A 2IS2A 2O8BB 3RS3A 3AVOA 2WMNB 1AS2A 5KYKA 1QF9A 1ZD8A 4B2LA 1OXXK 2YVUA 3GLHE 4PHTA 2AD5A 1WRBA 2ZRBA 1XPRA 4TTPA 1JQJC 4YLGA 1C4OA 2X2FA 1PV4A 3LDAA 5B2ZA 5J47A 3OF5A 2O0HA 1LS1A 3U7GA 3AVUA 3CF6R 2ZRIA 4IJMA 3F3YA 1G9XA 3VR2A 2C9OA 2OE2A 4A2QA 3PG5A 1QDEA 2VRWA 1AGRA 5IHPA 1E0AA 3AVYA 4G5RA 3AKCA 3CBQA 2KSQA 2XAUA 4L15A 1R8SA 2ZE7A 5KNDA 1OB2A 2FZ4A 1OYWA 2RGXA 4PPFA 4PFSA 3RC8A 3AKEA 4LDJA 4EPRA 2JJ8A 4RD0A 5JMTA 5KOYA 1TAGA 1MO6A 2ZRJA 2AN9A 1XMIA 1Z28A 4Q66C 1RE0A 5E4FA 4ZI2A 4DDWA 5FL7A 3KUCA 6Q21A 2R9VA 4Q4HB 4IVPA 1XXHA 1Q12A 1E4YA 1CULC 2V3CC 1U8ZA 5HE8A 1NY6A 4DCNA 1X6VA 4IDHA 5FTMA 5HCIA 2K5UA 2HLDD 2FMXA 3H86A 1KJZA 5CLLA 4ARZA 1Y63A 2RGBA 1E9BA 5JSZB 1UBGA 1W5SA 5K8IA 2ERYA 4ZIRB 2REXB 1E99A 3FMFA 2WHXA 4IXNA 2W58A 3CX6A 3Q9LA 4IRUB 1LS6A 1U0JA 1KY3A 4QJ4A 2P2LA 4TQUS 3U61B 3VNUA 3ADBA 2BVNA 1GSIA 4BLPA 3AH8A 3K53A 1I2MA 1WCV1 2JJ1A 4KAXA 4QBIA 3MG9A 3N2IA 4HLQB 5FUVA 4CEJA 1DG3A 2FPLA 4XVRA 4IOLA 2E1RA 4MGIR 4C0HA 3RS0A 3QUSA 2QRZA 3JVUA 5FR2A 2FFQA 3EZ6A 2ZI9A 4M0LA 3UATA 1DELA 2O5VA 1RZ3A 3U7HB 1E0KA 1WBDA 1T0JB 3A1WA 1NJGA 2J41A 3QENA 3RC3A 1N5KA 4RZ2A 2H17A 1ESNA 1G291 2QEQA 1N0UA 4OYHA 1OFIA 3N2EA 4BRWA 1NL3A 2ZM5A 1W0KA 1ZD9A 5CYPA 521PA 3CRMA 1LTQA 3LBHA 4UJ3A 4JLPA 3B9PA 1HT2E 1KI6B 3IQXA 4FCTA 2XGJA 3TE6A 3UG7A 2G88A 3R8CA 1U8YA 2WSMA 2YOFA 3SYKA 1EFUA 4PANA 4LJ4A 5KSOA 5FL3A 3CM0A 4IEEA 4DC9A 4TYYA 1X1SA 3NDBB 2YV5A 4QOSA 2IUUA 5FUYA 1BYUA 4M1MA 1RRFA 3IEVA 2PCLA 3DEFA 1P75A 2QMUA 1G41A 4MDEA 1E9SA 3VKWA 4FXPA 3O8CA 1DVRA 1JPJA 2J9RA 2EQBA 4K81B 4CEHB 5FPTA 2DFLA 1T9HA 5HKKA 1YZGA 4MKHA 4P4SA 5G53C 4AC9A 2F1HA 4B3BA 2AKAB 1E1RD 4LC1A 4A2WA 1NN5A 2ODWA 1FNMA 1T6NA 2ZRHA 3NIBA 2YKGA 1VCNA 5JI3E 3UK6A 1UKYA 4F4JA 1YZUA 3ZGXA 2BMDA 2ZJBA 3SJCA 3ZLJA 5B30A 2P6UA 1JNYA 4TMXA 3SOPA 3T1VA 3ICEA 1VYVA 4I99A 1KK0A 4M22A 1XTSA 1XF9A 2LKDA 5H70A 3OFND 3D6TB 3ND8A 1G18A 1M2OB 2VL7A 4N1AA 2Q6TA 2ZI7A 2H16A 4JL8A 3W6NA 2BMFA 4JVSB 3VNVA 4EUNA 1R5BA 4RZUA 2JA1A 2ZYWX 1JB1A 3MAAC 5JJKA 1ZRHA 5FI1B 2RH5A 2QY9A 5J5CA 4P3YA 1VG8A 1XX6A 2IYYA 2NG1A 3UMFA 3P32A 3GJ7A 3OEEA 4FW9A 4G3XA 2VPPA 4K8OA 5DIFA 3PXGA 2MMGA 2O8BA 5LBIA 2A30A 3IO3A 4KLNA 2BBTA 1GNQA 1J8YF 3LW8A 1N6OA 3MFYA 2OO7A 2RKOA 4HZUB 5BQ5A 2BWJA 3KL4A 4PQFA 1OHHD 2CL0X 1S8FA 3BB1A 3PUXA 3H0KA 4HAVA 4QJ5A 4Y0AA 1ZINA 4Q47A 1M7GA 4AWXA 3LX8A 4RZ3A 1EG7A 2C9YA 3QNUA 1SZPA 2CHGA 4ZI3A 2GILA 4ZCIA 4FWIB 5GJVC 3NH6A 2JLVA 3M6AA 3LXXA 3BXZA 3Q5EA 2C95A 4PZZA 2WJGA 4HAWA 3N70A 2G3YA 1KZ7B 1GNPA 1ZU5A 4EPTA 4PO1A 2V7QA 4BLSA 4BZXA 3BD9A 2NOAA 3CWZA 3ZZUA 4Q4HA 5JJIA 3RS4A 1G4UR 4DLWA 5K8LA 1OV4A 5F2EA 3TAUA 4DDUA 4ITRC 1ZCBA 3QKUA 2XSZD 3GFTA 1KSGA 1G8GA 1RKBA 2V9PA 5JSZA 3L0IB 5DLQC 5AUOB 2GBLC 2O0JA 3R20A 3TNFA 5JZVA 3LFUA 4RFVA 2WWFA 3U7EB 1KAOA 1E1QA 4ZIRA 1OB5A 1T8UA 3QEJA 5FBQB 1Z47A 3LH5A 4B35A 3DO6A 1IN5A 3KKOA 1Y3AA 3WNCA 3EWSA 1T8TA 2JAQA 4KU4A 3I62A 1OE0A 1KMQA 4NHOA 1V43A 3GEHA 4EPXA 3NXSA 4HLDA 4W5JA 5DE3A 3PEUA 1G7SA 1XB2A 1G64A 2WPDD 3M0EA 4PC3A 2D06A 2GDJA 4BLTA 1ZNXA 1G7CA 2GHIA 2XOKD 1FFHA 4W9MC 4TQAA 1U0HC 4Z8YA 5TY0A 1KZGB 2YWFA 2V55B 4YDHB 4MRPA 3U3OA 2VHQA 2VP5A 3BB4A 1E9FA 4EFLA 3KKMA 4DB2A 3EPJA 4RD3A 4JYBA 2W6IA 5JI2E 4AK9A 1ZP6A 3BOSA 1PLJA 3GLIE 3OIWA 4ZDWA 1GKYA 1II8B 2VEDA 3OIVA 1XCGB 4FMCB 4UJ5A 3K1JA 3BK7A 1F2UB 4YDSA 5JWHA 3AF2A 3HU2A 1WXQA 1XD8A 4A1FA 1Z83A 4BWYA 4BFUA 4A0RA 3TGPA 1K6MA 1CRPA 1RYHA 1X3SA 2R65A 1KI6A 2AWNA 4OHVA 4NYIQ 1Z6YA 4M9QA 5G3ZA 4LSGA 2Z4SA 4L8GA 3R9IA 1VMAA 2OBNA 4JIMA 1EFHA 2ANBA 4MYTA 1GRRA 4FMDF 2Z6VA 2WKQA 4Z54A 5F98A 1RVDA 4D80A 4P4TA 4KO8A 2VP9A 2RGAA 1X8KA 4M9ZA 4NCHA 4CEHA 3IPYA 2AFHE 1B0UA 3SI7A 4LGMA 4WBSA 1AGPA 3SR0A 5EE1A 5L3VA 1XPOA 1CRQA 1GVNB 2QGNA 4LBWA 5TXGA 2QTFA 3VX3A 4WA7A 3VR4A 5C4GB 3BH6A 1UJ2A 4IDOA 2GXAA 1D9ZA 4LPKA 2FFBA 2RHDA 5J4LA 1KO4A 1JR3A 4PC2A 1QZXA 2OILA 3CONA 1UAAA 3SJAA 1PUIA 4S2EA 2VYFA 4DWJA 1MO4A 4US0R 3HJNA 4W7SA 3LLUA 5B64A 1E96A 2C03A 3GLFB 1WDTA 2AHOA 1OYYA 1YQTA 3SNHA 4XIGS 4ZKEA 4GFDA 2D2FA 4QG7A 1XXHE 1N6IA 2W2TA 3AVTA 3KJEA 4G5GA 1F48A 1DTSA 1UKVY 4TMVA 2OZEA 1OKKA 3OE7D 1H8HD 4B44A 1KOFA 1XMVA 1OXUA 2CVHA 1XCMA 4HLCA 1O3YA 4HZUA 1DAEA 1UKZA 3ETLA 1JXOA 3WNDA 3DHWC 5JEDA 3IKJA 3KTAB 3QPUA 1VG1A 1BYIA 3WRYC 4LJ6A 3DOEA 3VU9B 1CIPA 2L0XA 2F55A 2PEYA 3AF4A 4HUQB 2QSZA 3AVQA 2HXYA 1YU9A 4HB3A 2DWPA 1M1YE 1Q1ZA 1Q1QA 1XJ0A 5GVRA 2CLSA 1FMLA 3MCAA 5FUWA 4B3GA 3NHBA 3FHTA 1E6CA 2A5GA 1G6HA 1OFTA 2VP6A 4ASUD 1GRNA 2PEZA 2GETA 3L0PA 5KNCA 5EXSA 4Q00A 1KK3A 4MYHA 4D0LB 1IN4A 1CBUA 2P6RA 4HEJA 4GMDA 3RANA 3AF0A 5BXQC 3GJXC 1H65A 1DPFA 4QC2A 3HYRA 4E09A 3TIFA 3T34A 2IF2A 2A9KA 2IYXA 3WRXC 1G5PA 3KFVA 4TSFD 4B47A 2QGZA 3P20A 3B9QA 4OI1A 1I4TD 1YZNA 2H92A 1XTIA 5TMPA 4IOMA 4L9SA 3UMRA 3RABA 5TV2A 3EIEA 4ZDJA 3P27A 3I5XA 1K5GA 3UIEA 3ZVRA 5EJEA 3AP1A 3EAQA 3L0SA 4FMBB 5KDDA 1GKUB 2CDNA 5IK2A 1XEFA 4D2IA 1RRPA 4PHGA 2J46A 4F4IA 4KBGA 2HDNB 3HPRA 4LI0A 4LJ9A 2X77A 4NYJR 2JLYA 2H1LA 3T5DA 4A0FA 2IYRA 1L7VC 5LD2C 3QI2A 5SZHB 4BLQA 1PLKA 1UEIA 4KITB 2CCJA 4QNMA 3WHKA 3KJHA 1A7JA 1R5OA 1NF3A 3QKTA 4Q1CA 5FPHA 1S0UA 4L9WA 3VKGA 3ZQJA 5DNYB 1E2QA 2GEDA 2OCBA 2ZJAA 4B6FA 1NBMA 2XTNA 1SXJD 3GQBA 1DO0A 4C0QC 1ZW6A 4FD2A 4JBWA 1W0JD 4RJLA 2H5EA 1II8A 3C5CA 2BHRA 1ZNZA 3OIYA 3QKRB 2WSSA 3QXHA 1F2UA 3VR6A 1PLLA 4JL6A 3MUFA 2PLFA 1GL6A 4NCIA 1CEEA 1RRGA 4YMSA 2JLQA 3IEUA 4B33A 2OBMA 1AS3A 4UNQA 1R10A 5B57C 3VKHA 5J4HA 4ZO4A 1D2EA 1WP9A 2ODBA 1XEWY 3NKVA 1R0WA 1TU3A 1KSFX 5JEEA 2D7DA 1MV5A 1A82A 4U00A 2R6DA 5C1BA 4CDGA 5A0FA 3H1TA 1ESMA 3C5HA 2R6FA 2G0NA 4PXAA 1E79A 2MMCA 3WY9A 1SGWA 4V0LA 5DN6D 4B43A 4BFWA 5BN5A 4QGGA 2KE5A 3TUIC 2IEYA 2KBEA 4O0MA 4LYJA 4WZ6A 1HE8B 1FP6A 4Q19A 2W00A 3R7WB 2GNOA 2ATVA 1ZIPA 2J5XA 4RY2A 3EIHA 4FINA 4C0AC 3DOFA 1KAGA 1KGDA 2PH1A 4X8HA 1BMFD 4V0MA 5BYKA 4Q1EA 3NBZC 2OUKA 3CRRA 4HI0E 2XJ9A 2MSCB 2DCUA 3O8RA 1Z6AA 2J0QA 1SKYE 2B6HA 2QZ4A 1NG1A 3RNLA 2LWIA 5HR5A 3BFKA 3KXIA 2FJUA 2CJWB 2Z0MA 3Q3JB 3LD9A 3MD0A 2TMKA 4AKEA 1X8JA 2CK3A 2GBLA 4X8OA 2VQSA 4DSOA 4KV9A 1G3MA 2ZJ2A 4FIDA 5FOUA 1KO7A 1KSJA 5AJZA 3FHCB 1KNXA 4ESHA 3GLFA 3AM1A 4HAUA 3TVTA 4DIDA 1SVSA 4OK3A 3W6PA 4C0BA 2XNSA 2A3RA 2G9NA 1Q1BA 2VA8A 3PUZA 1II0A 5CJ2A 3A4LA 5SZJA 1TADA 4TZ6A 3CLVA 4LJ8A 1OH5A 1NMXA 3VR1A 5LD2B 3AGQA 1D2MA 1KDTA 1U99A 4JT4A 1QHHB 3GFPA 2GKSA 1NRJB 2B92A 1JBKA 5KPJA 3TKLA 4BFXA 4LYHA 2A5JA 2FPKA 4DRZA 4A4DA 1NLZA 3U5ZB 2AK2A 3KTAA 2EVWX 3M1IA 4PSVA 3VU9A 1RRCA 1HYQA 2VSOA 3W3AA 4HUQA 3WHLA 2PZFA 4D6PA 4UKDA 4KHZA 4YMTA 4A82A 3KJGA 1US8B 4CEIB 3T35A 5AJWA 1GIAA 1XP8A 1QG2A 2Q9CA 3UG6A 3DPUA 4Q4JB 2GXUA 4B73A 4GP6A 2VHTA 4US1R 5CK5A 5FTNA 2QBYB 1B23P 4B2IA 4M4SA 4BECA 4EDHA 1J90A 2WJHA 4I1VA 4M1YA 3X1ZA 4PZLA 3LA6A 4YXWA 1RFLA 2RGCA 3X1DA 5EP3A 3NDPA 1GITA 4XD7D 2QM8A 2GA8A 1XDBA 1SKQA 1ZUIA 1G6OA 4TYQA 1KI2A 1K5DA 5EE3A 1DG1G 5G3YA 1EFRA 3SQWA 3F5FA 1OH7A 1G8FA 3B1ZA 1KI1A 1OF1A 2DB3A 3LLMA 1T5IA 1KI9A 5EP2A 5CB8A 3AP3A 2IYVA 3FVQA 1E2MA 1MH1A 1W46A 2NGRA 2QE7A 1G3UA 1OXSC 5FOTA 2CL7X 2EFGA 4RCYA 3GJ3A 4PPGA 3JZAA 2I1QA 4U02A 4PAOA 3B2EA 2J0UB 2ZJ5A 2QMEA 3ZDQA 5IDVA 4LBVA 1NIPA 5DYIA 5EE9A 3VX4A 3CWQA 3IILA 2KB0A 4I1UA 4UNRA 5HPYB 4C4PA 2VTKA 1CR1A 4DUGA 1Q44A 1G8YA 2ZJZA 3C4JA 1ZJ6A 2CNWA 2A7QA 2A2ZA 2XB4A 3A1VA 4KCGA 2W2VA 3U4QB 4KJZA 2PZGA 3ZD6A 4R9UC 5FTLA 2YNMA 1J99A 5DI3B 4PC6A 3CB4A 1W7AA 1BOFA 2H57A 4Q21A 1HY3A 5CDFA 5LB2A 3A58B 4OJKA 2FEOA 5HZHA 1G4AE 3VR3A 3QKRA 4IDQA 3VHLB 1EK0A 1DAFA 2WWIA 3ZYCA 4DEXA 2YWHA 4DLRA 4MRNA 3EIQA 5EP4A 1JR3E 5DO9A 3EW9A 3QBTA 2ZRAA 5E3HA 2PZEA 1G3IA 2QENA 1IQPA 4O3MA 2CCGA 4UXJA 2ZIAA 2PJRA 2OLKA 3AF1A 4Q02A 3FKSD 5J40A 2C04A 4PQRA 4QBFA 4Q9HA 2XX3A 2JIZA 3L43A 4OQXA 2FSFA 5A4JA 3MJHA 4QM6A 2W0MA 1ZMXA 2MSDB 4TMZA 2R6CA 1R4AA 3A4NA 5AUQA 2AR7A 3PUWA 5CK4A 1ZM2A 1GTVA 3H84A 2OG2A 1VYTA 3R7WA 1DOAA 3LY5A 4G0NA 4JJZA 2QMHA 2GWHA 5B58C 4LYFA 1ZNYA 1Z6XA 2KI5A 2GXQA 3GJ6A 4NBSA 1S9HA 2WBLC 4WXRA 4DSUA 4NYMR 4M1OA 4HDOB 2DYKA 2DWQA 2YZ2A 3NVAA 4ESVA 3UWOA 3V4RA 1HE1C 1MRSA 2CJWA 1E2KA 3KB1A 1OH6A 1NN0A 4DVGA 2FSGA 2KWIA 5DI9A 1P2UA 4JLMA 1L4UA 4TYPA 3L8YA 1P5ZB 3EXAA 5LB4A 3UXMA 1U9IC 4HSEA 2J1LA 5FTKA 1E69A 1TF5A 2WJVA 3I72A 4MUAA 1N5JA 3LQRA 3GLGB 1Z0AA 2ZREA 2QTVB 4LJ7A 821PA 2PX0A 3O8BA 2ZI6A 1NY5A 3K70D 1WBBA 3IDQA 4F4CA 1AKYA 1QHHA 1YZLA 2PLRA 3BB3A 4G1UC 3KFXA 2C9CA 4F7WA 2WOJA 4I1OA 5CJPA 4DT1B 2XB2A 1IJFA 4C2TA 2W0SA 3C41J 4N0EA 5CM8B 1VCMA 1VIYA 3DDCA 3O47A 4US2R 2QG6A 4PC1A 4NH0A 1CR4A 4DKXA 3U60B 4AD8A 2D4HA 4OHXA 1WA5A 4Q5IA 1US8A 1CXZA 4QJ3A 1G7TA 2FV8A 4K46A 1Q22A 4E03A 4CEIA 5GJBA 3U3MA 1V5WA 1FZQA 4Q4JA 2FSIA 3IUYA 2QBYA 2VF7A 4D0GA 1AM4D 3OAAA 5KTYA 2BDTA 1JXMA 3UMSA 3K0AB 4TTQA 3H2YA 2P0EA 5E7MA 1E9EA 4WW0A 4Q1AA 2XNDD 2ZJYA 4WIAA 4H1UA 2J7PA 2GCOB 2VSFA 1NBME 3WP0A 5FOSA 2GK6A 3B1YA 3LVRE 2ZVQX 3F8TA 3QSYA 1E2PA 2QORA 1H8ED 2OFXA 3QF7A 1OIWA 2FOLA 4DLTA 3REGA 1X1RA 1AZSC 4Z8XA 3C8UA 2CL6X 4PO8A 1TQ4A 2FGJA 1M6NA 4OI2A 4QHTA 3Q7QA 2WIBA 1CJMA 1S3GA 1KJWA 4NE2A 3R8FA 1GUAA 2IW3A 2HYIC 3ND9A 1T5LA 3IIJA 3FKQA 1NG9A 3FYHA 2BMEA 1W4AA 2BM0A 2J0UA 2VO1A 3W9YA 1FX0B 2WWGA 1Q3HA 1CJKC 1DARA 5E7IA 4AKIA 4PHFA 2YWGA 3U3JA 2IXGA 5FR1A 5EUMA 2WWHA 2VP0A 2PT5A 4E07A 2HV8A 2RCNA 2EWVA 2JATA 1D5CA 2ZS9A 4NPHA 3QPWA 2F1RA 2WOOA 4JLBA 4LPSA 1UF9A 3GPLA 1LY1A 3U4QA 3GFOA 4JLOA 5DI3A 1F60A 4YC7A 5F9FA 4BRUA 4ACBA 4FCWA 4GZLA 4MKFA 2UKDA 2ZPTX 2CEAA 4Y0VA 3RSLA 1Z63A 4RVCA 4UNSA 1T4GA 2V6JA 3UPUA 3Q7PA 3I8XA 1EX7A 4V0ME 1IHUA 4Q4LA 2OBLA 3TH5A 2GAOA 3LRPA 1DAHA 2WZQA 1OIXA 3P4YA 3TK1A 3TW4A 4XH9B 1FL9A 1N6LA 2IUSA 3VAAA 4DSNA 4QFMA 2PMDA 2J7KA 1W4RA 1W47A 5JLJA 2FZLA 1W2HA 2WAYA 3SE0A 1P4SA 1NLFA 3QE0A 1R0YA 3GLFE 2GF0A 1G16A 3EASA 1SVKA 4Q7JB 1G8PA 5SZIA 1LFDB 1XTKA 3U44B 3GJ4A 5HZKA 3VFDA 3RRNA 2V4ZA 4LHZA 1XMSA 5EE0A 2GF9A 4XSGA 2EFEB 2QQEA 3T06B 4TT3D 3W8NA 1XBTA 3BFVA 1F2TB 2HF8A 1XZPA 2B7BA 2EWWA 3ZVNA 1BS1A 4OHZA 1CR2A 1E98A 1KTVA 2NQ2C 1S3SA 1GOTA 4EPVA 3IHLA 5C46F 1KMHB 5JJLA 2IS1A 3BIFA 1P9WA 1GG2A 1PJRA 3VHXA 3ZVLA 3I73A 2OAP1 2B7CA 4MKGA 3ZIAA 4ZDKA 1HT1E 1TF7A 1C1YA 1GRQA 1NN1A 1U8AA 2JJ2A 2ZRCA 4JBXA 4RD2A 1P62B 3QF4B 1FOEB 3RRZA 4AYTA 1JAIA 2OCAA 3LBIA 4Z1MD 1XPUA 2DBYA 5JHHB 2QP3A 2CBZA 3PJRA 3B5JA 4NP6A 1D6JA 4JZKA 4V0NA 2W2XA 1NLYA 3GLGA 1JQLB 2GEUA 4JYCA 2OFOA 4HDQB 4ON9A 1II9A 1CJUC 4BQSA 4DBLC 3QG5A 2C96A 4WOPA 1GP2A 4HLUA 3VQTA 2HJVA 1TTTA 4N3NA 4DT1A 2W6JD 4NKRA 1NIJA 2V8OA 1Z06A 1NP6A 4Q9IA 2O0KA 2GEVA 4NYJQ 3CNLA 3GJ5A 3WXMA 3BRWD 3ONWA 4DDTA 3PUVA 1NVVR 1CU1A 3BE4A 4M9XA 4B3XA 4P32A 4DEYA 4R2HA 2VP2A 5L3RA 1VDZA 4KFTA 4YMUA 2CCKA 4CIDA 1ZYUA 3MRSA 2BKUA 4RKEA 3B82A 2HEIA 2QSYA 1Z8FA 2ORVA 3NH9A 1IY1A 3HR8A 3B85A 1W5TA 1JPNA 3OIUA 3K0AA 2F7SA 3ZD7A 2PL3A 1KDOA 5L3SB 2BCGY 2OT3B 4R98A 3GP8A 3X1YA 1ODFA 3GCGA 1A4RA 3GD7A 2GCOA 3QJYA 5J4VA 4QXAA 1R5NA 5CDFE 2CMKA 1IN8A 2JLSA 4BFVA 3RHFA 2UZIR 2JDID 5EXPA 1XNJA 4DLYA 1AN0A 4IFBA 4II7A 2H18A 4TMWA 621PA 1P3JA 1TQ2A 5ANRB 4LHVA 2GCPA 4AG5A 5JWRA 1KK1A 1KO1A 3A8TA 5L3QB 1COWD 4OHYA 2ZI5A 3OEHD 1FX0A 2F3RA 2DY1A 3IGFA 4AIIA 4MDFA 5EUQB 5CB6A 5SZKB 3TVDA 3KQNA 1Z6TA 3AKDA 4LX0A 1QHSA 3SS8A 4DCUA 3EZ7A 4LZZA 3B7GA 3BFXA 4P31A 3AB3A 3W5IA 4LV6A 3W34A 3A1TA 2QT0A 2A5DA 2ORIA 1CS4C 3RRMA 4LV8B 1ZUHA 1G8HA 2QRNA 4CF7A 2J0SA 4TTRA 2NMVA 3NTUA 1U9IA 1KDRA 1QVRA 1MT0A 1JJVA 4Z51A 2GVZC 1NJFA 3HR7A 2IYUA 1FQJA 1GWNA 1YR7A 3B1VA 2HLDA 1TEXA 2ZSFA 1OFUX 1S2MA 3HP1A 3FFAA 5DSZA 1NI3A 2XEXA 1HV8A 4M9SA 4C0LA 1G19A 2F9LA 4H1VA 3THXB 1NVWQ 4C30A 1MRNA 3IO5A 2FWRA 1EFCA 2ECKA 3K0CC 1IOZA 2P67A 5AK0A 1N5LA 3PITA 1ZIOA 1EWQA 2Q9BA 3E70C 2WMOB 1TMKA 4Q1FA 1J70A 1Q21A 4NZYA 1N6RA 2Q3MA 5FL7D 5C18A 3U44A 2GTPA 5EXXA 3CZPA 4ZPXA 4DCVA 4KVGA 5JBQA 1E0SA 2VHUA 1EWRA 1M74A 5FPYA 1XFAA 3PQCA 3PEVA 4MKIA 4HB4A 5K8TA 2F6RA 4U7DA 2CLDX 1F2TA 3QXJA 1HA3A 4FI3C 2O8FB 3DMDA 3FB4A 2CE7A 4RCZA 2NPFA 3MJRA 1FNNA 2ZAMA 1KMHA 2FH5B 2I3BA 2NTYC 5KO2A 1EX6A 1VYUA 1OXTA 2EFCB 4TL7A 2JLZA 4TL8A 2OESA 5BWMA 2ZRMA 4C7OB 3CPJB 1XU4A 3LQQA 1RW4A 1I4DD 2IK8A 3FPAA 4P4UA 4DLSA 2RGDA 3GEEA 1U0LA 5FPKA 5KHOC 2BCJQ 1VG0B 4AY2A 1IONA 4LHWA 4DCTA 3EPKA 2JJ1D 2EYUA 3QF4A 1AZTA 3U7FB 1VG9B 3KDSE 3RWOA 1RJ9B 2G83A 5D3QA 5JFGA 1T91A 1E2NA 1FTSA 3BAFA 1W36D 3G5UA 5M04A 4JL5A 4RKFA 3I5YA 1TUEA 2AKYA 4GMXA 1U2RA 2UVQA 2IYWA 4HB2A 5KU1A 4Q01A 8OHMA 3QEOA 2FA9A 3EPHA 3PR1A 3UWKA 1KHTA 5K8UA 2RAPA 5HCNA 1JI0A 4JLJA 2E87A 2IC5A 3L82B 5CIQA 1E1RA 4HATA 4JJKA 2A5FA 2YJTD 1W0KD 2IWHA 3KZ1E 3ICQB 2ZE6A 1SVOA 1N2CE 3DL0A 3AQ4A 4J0QA 4URYR 4KI0A 4XOIA 2YOGA 1NVXQ 1QHNA 3I92A 3HWSA 2VHJA 2ZETA 4JLAA 1XD2B 3U6BA 2IX3A 3EZFA 3SBEA 2HUPA 2REOA 5KSZA 3OFNA 2BC9A 2R2AA 2GCNA 4NTZA 4GBMA 5EE5B 4QKQA 1FW6A 4TMTA 4XVUA 4B48A 1L4YA 2NO7A 3QKSB 4BFYA 5L3SA 1NMZA 1SXJC 3B13B 1P73A 3CF0A 2HYDA 5LPNA 1BH2A 2FX3A 2J59A 3UANA 1T0HB 1XCPA 5HKKD 1SVLA 1MKYA 2QP9X 3CX8A 2ZRPA 3T1OA 1KDPA 4RSGA 3AKYA 3K0SA 2OV2A 2Q9AA 1E94E 2J0VA 5FBVB 4C9BA 2PT7A 1YZTA 1JECA 3NC1C 4QNRA 3HU3A 2D2EA 4Q7MB 3WNBA 1OHHA 4A8JC 4F92B 3THOA 4M21A 1Z3IX 2OFWA 4FMDB 1GL9B 2ZS7A 3X1XA 1TNDA 2FSHA 2QPOA 4JSYA 5L3QA 4PSAA 4BZQA 4OQNA 1EESA 2GJ9A 5JS8A 3EC2A 1O87A 2OLJA 1AJEA 3AF3A 4TWZA 1IAQA 2FF7A 4Q1BA 2R8RA 4DLVA 4EAQA 3HDTA 3TUJC 3WBKA 2AK3A 2JLXA 3WYFA 4DXAA 3OEED 4ACAA 1JEEA 3E5HA 4AYWA 1A5TA 4CYMA 1IXZA 2WKRA 1Z2AA 3AUYA 2C99A 3NHAA 2OCYC 4OQMA 1OT3A 4EPWA 2QU8A 4NYMQ 3AUXA 4MH0R 3FMPB 5D3MB 2IHBA 4URXR 2WJJA 1N6NA 1XTQA 2V1UA 3IIMA 3PFIA 3B1WA 4URZR 1KKLA 2XSZA 4DHEA 2Z4RA 3NEYA 3SHFA 2IYLD 4ZKDA 2ZSBA 2A5YB 1P2TA 2ZRFA 4ZCLA 3THXA 3FMIA 4OI4A 1WB9A 1ELOA 1XWIA 3OZXA 3ZS8A 4EFMA 2N42A 4YONB 4HUTA 2FPMA 2Z83A 3REFA 2YINC 4QBHA 5KSYA 3LAWA 1Z6GA 5FOVA 2QM7A 1CTQA 1N25A 1NKTA 4LC0A 2V7QD 2WPDA 3TUZC 3GLGE 2XOKA 5CIWA 5CYOA 2ZAOA 3DKPA 2ATXA 2ZXUA 2IYZA 2IYQA 1UDWA 5TARA 3EZ9A 5E95A 1KI3A 3ADCA 3FGNA 3H4MA 2O8FA 1CLUA 2ZR9A 4JLKA 4DZZA 1SXJB 3CKLA 1N5IA 3BERA 3ECCA 1XRJA 2QI9C 2AD1A 2ZSEA 5BN3A 1E1QD 4PTLA 2YYZA 4C7OA 4KLZA 1M7BA 2BV3A 1E9RA 1Z0JA 4D25A 3W3ZB 2F1JA 4A6PA 2EYQA 3GJ8A 4BEBA 1W49A 2F1IA 4IFEA 3TJZA 1AQUA 1LW7A 3LWNA 2RGNC 4JKYA 2A78A 3RS2A 4A8JB 4BUJA 4IXMA 2ERXA 1TUIA 2CE2X 1RJ9A 1X86B 3SBDA 1Z22A 2HCBA 4PC7A 1OW3B 4XTCS 4KBFA 3ZZ0A 1QHYA 4HLUC 3CRW1 3KKQA 3VMFA 1DAIA 1ZU4A 4HYYA 5GJCA 2FEMA 1LF0A 4TLBA 3NBFA 3RRYA 3AVPA 2W6ID 4E5UA 4PX9A 4RFSB 5CLQA 2NO6A 1ETUA 3CUEF 1WQ1R 2IT1A 4EQ6B 3A6PC 1PZNA 2NZJA 2DFKB 3BS4A 3TQFA 1E2HA 3IHWA 2ZUCA 1HQCA 2GESA 4CZ2A 1GM5A 5FH9A 4YMWA 1E3MA 5ELXA 1JEDA 1OSNA 4HAXA 1JAHA 2ZQ5A 3D7MA 1FMJA 4JLDA 3KXKA 5DHAA 1XD2A 4P33A 4GPTA 1AQYA 5FUXA 2KBFA 3AVXA 4POAA 3SC3A 3LV8A 3SHWA 1BKDR 2QAGC 2P5SA 1DS6A 1EGAA 3PUYA 3AP2A 2E9SA 5GVSA 4A15A 3QKSA 5AJVB 4TZ0A 3C16C 5DYGA 3K0CA 4B3CA 1WF3A 3K9HA 4H9GA 2BOVA 2QL6A 4XWAA 3O8DA 2I1VB 4Q7KA 3PEYA 1HUQA 3OESA 3EPLA 4ZV4A 4JVMA 2WM9B 3THWB 4AKGA 2LCFA 2X19A 4TYWA 1CP2A 2VH5R 1G5RA 3AEZA 1E9AA 2RMKA 3OE7A 1H8HA 3CNNA 1E2IA 4XVQA 3W6OA 2AFIE 2QP4A 3A36A 3U2QA 1XD9A 5FOXA 3I8SA 4GP7A 3CX7A 1R7RA 1XJQA 1E2DA 2QT1A 4UXHA 4P0TA 4LYAA 1SKYB 3U6KA 2XTMA 1JR3D 2VBCA 3V9PA 4B6EA 4OI0A 2VLIA 3D31A 5EP1A 2G6BA 4IOKA 3IIKA 4KFRA 1KJYA 2B8WA 3MWKA 2C8VA 2NZ8A 1ZCAA 2ZS8A 3A1SA 1XEXB 1PUJA 1G21E 4M1TA 4RD1A 2HXSA 4ASUA 2DWOA 3FTQA 4MITA 1KI7A 1JR6A 2BJWA 4D4KA 3GMTA 1KI8A 1MO5A 3IPXA 4KVAA 4XWOA 1G3RA 1OPXA 2C78A 4DB4A 1OKKD 3ADKA 4L4UA 4URWR 3B8HA 3FHOA 1HURA 4HAYA 3VR5A 4UXIA 5D3MA 4GOJA 2JCSA 3R9WA 4TSFA 121PA 4JLVA 2RB4A 3P1JA 1NKSA 4ZCMA 1OJLA 1RPZA 1C9KA 4JLNA 3PIRA 1K8RA 5CITA 1PVOA 4PHHA 3HYTA 1D8TA 5IF9A 5GADl 4V0KA 1KNQA 1UPTA 2MSEB 1R2QA 3EA5A 3TSZA 1VCOA 1R8QA 3V00A 4B71A 2WJIA 3AV0B 3NWJA 2X2EA 4FMCF 4A0GA 1VHTA 1CKEA 1EFTA 1UBCA 2NO1A 2IXEA 3WYGA 2IHYA 2C77A 4RD6A 4TLEA 2FU5C 421PA 1AIPA 1VTKA 4Q9JA 2BJVA 3K70C 1DAKA 4LK2A 3EA0A 2VHCA 2OHFA 1VPLA 1Z08A 2ZITA 4Q9KA 4DSTA 3EARA 5UKDA 1E9DA 2BEJA 1E32A 3Q5DA 5KPDA 2BBSA 2QAGB 3B6EA 1VHLA 4A36A 4B75A 1QG4A 3PENA 1NVVQ 1MABB 1SXJA 4GDFA 1YRBA 1W0JA 4KSCA 3X1WA 5JECA 3MSXA 1TF2A 2VP4A 3CNOA 1NSTA 2YOHA 1J2JA 2DFTA 5IK2D 1GILA 2QPAA 4MGYR 4XSHA 3GEIA 2CHQA 3QPVA 4HB0A 3K9NA 2LKCA 2O8DB 1KO5A 4A8JA 3P4XA 3KB2A 2ZI4A 3BC1A 1YRAA 2KJQA 3I32A 2ZRKA 2XJ4A 2DR3A 2EW1A 2ODNA 3L2OB 721PA 2HJGA 3SFZA 2WJYA 2N1BA 5DN6A 3VTKA 3RDPA 4DCSA 1EXMA 2IBMA 2ANCA 1NBMD 4RFSA 5FBLB 4G5SA 3TW8B 4NCJA 1ZAKA 2OSBA 4JSTA 2D74A 2WWYA 2WSSD 5KSPA 2IUTA 2JEOA 2WV9A 3DM5A 4EQ6A 4X8LA 2IL1A 2OEPA 5KDOA 3GLHB 3DVLA 3E2IA 4NDZA 2BKEA 3KQHA 2O52A 2QQ0A 2YWEA 4XTRA 3CRQA 4IW3B 3W90A 3RS5A 4HAZA 4EPYA 1KY2A 1BMFA 4QGAA 4JVLA 3D3QA 4NCKA 2WWWA 4D0NA 1SHZA 2P5TB 5BYJA 3KKPA 1WMSA 5CM9C 2WWXA 3KUDA 3EX7C 2QNRA 1R6BX 2V6IA 3SYLA 4IVRA 4A9AA 4YQFA 1NVUQ 2OAQ1 1E79D 2ASEA 2OCPA 4G01B 2PJZA 1M8PA 4BZPA 1OIVA 3U3RA 2F43B 1ANKA 3QVUA 4JS0A 2AL7A 1XMJA 2GZAA 1YHNA 5FBRB 2ZJ8A 2YHSA 3G82C 4PAQA 3RYTC 1QVAA 1S1MA 4Q18A 3CO5A 2P65A 4WXPA 4BGDA 5EQTA 2O8EB 3THWA 2ZRLA 4IEIA 1AA9A 3K70B 2H8KA 4WZBE 1KYIA 2CLCX 1HTWA 1IN6A 2GJAA 4OQLA 3T15A 5BN4A 2G77B 2GJSA 1N0VC 3ZJYA 4I4LA 4QGFA 2BBWA 4JKIA 3D8BA 4NU0A 3P26A 1N6HA 2J3EA 4AI6A 3QBVA 1D2NA 1J8MF 2Q0HA 2W83A 4OBEA 1GAJA 3ZZTA 2CK3D 4D81A 2IA5A 1BO6A 4LUCA 1Z5ZA 1XEXA 2C2HA 2FNAA 4LCBA 5AWFC 4AG6A 4DLXA 1ZC4A 4LV5B 4TN1A 4OKSA 3THYB 1IXRC 2BIFA 2ZSAA 3FMOB 3N5CA 1E4VA 2ZTSA 3QOFA 3SDZA 1E2EA 3ZS9A 5JCPA 5E7JA 5H8WA 1UEJA 4DLZA 2PCJA 1WE2A 2RGNA 3NEJA 3S1AB 4C0JA 1BIFA 1UM8A 4XD7A 4XWKA
chains in the Genus database with same CATH superfamily
3B5EA 1JQ5A 2WJZB 3RVRA 4BO3A 4IJWA 4X7MA 4B32A 3LA8A 5BVGA 5EESA 5LQRA 3LTNC 3G0HA 4IHAA 1WUTA 2FPPB 3CUTA 4OLJA 3O7MA 2HK8A 2QLNA 3L4SO 4QDJA 2E4UA 4WH0A 4WK6A 4GRAA 4GE3A 1UQUA 4B2PA 5M5BA 3IMFA 4NONA 3TZHA 3VBEA 1WMFA 4KXFB 1RCUA 1RSZA 3W3AD 4AYXA 1Z4JA 4JR2A 2QB5A 4V02A 4UBOA 1MAWA 2FGKA 3HWX1 2WUGA 4RZXA 3TQCA 2Q99A 1DDGA 1P6XA 2P3SA 3NOVA 2ONKA 4ZQBA 5CCBA 1GGFA 3DSRA 4DKJA 5AHXA 3AYXB 4OL0A 4X0EA 1ADJA 1RJEA 3CNQS 3QVVA 2GUWA 3CZAA 5AOVA 3IKMB 4C0SA 2FPGA 2YN4A 1IZ8A 5I8WA 5E1MA 5F1YA 5CH5A 5BSVA 2Y99A 2ZIFA 3FNRA 3LC7O 3K09C 2O3JA 5FNZA 1L8QA 1ZCJA 2D7CA 4WPGA 2COUA 4EYOA 4I9FA 4K6FA 4YAJA 3EF3A 1AUVA 1RLIA 4DV5B 2XXAB 1JLLA 1FYFA 4JYZA 3DT6A 1ZA1A 3JQPA 1EFRD 4LXXA 4IG9A 4OEHA 2CNDA 4MINA 1WVGA 5EMKA 4QM7A 1SUBA 1U3UA 1XFDA 1Y8RB 2I6XA 1EJ0A 3EFBA 3I34X 4M1SA 4HYQA 4NOLA 1GU7A 1U28C 4TUYB 4B3MB 2I9PA 4XJXA 4RYLA 3SJBA 1Q1EA 1PEAA 3IEXA 4BZZA 1XDSA 2NN3C 4JKOA 4BFZA 4TS4A 4DRXA 5JS6A 4KFUA 3BMCA 4MMYB 4ZP1A 2L19A 3ZWBA 5JRDS 4HGPA 3C14C 4XGIA 2EF0A 2PRKA 3MBIA 4UCFA 2NU8A 4UEKA 4LSWA 2AG6A 4GLJA 1Z0IA 3D1JA 4DDVA 2O8DA 4ZRNA 3OCCA 1P7YA 4Q4AB 4X62B 3P9ZA 4DTCA 5D84A 1E2GA 1K9VF 4AXXA 3MGCA 1C1HA 1NJ2A 2BUBA 5AI4A 2XCIA 2PSHA 1I6LA 3FKSA 3KOOA 2NIPA 2O8CB 4W5TA 3TO5A 1ZM9A 3K8OE 2HCJB 5G0VA 2YNMD 5B5SA 3DXYA 5C1DA 2XVMA 4AZ3A 4HDSA 4A6XA 3QTBA 5JNUA 3GRPA 3Q4GA 3L7DA 3LT1A 5FX2A 3RUAA 1SBZA 4JXJA 4LRXA 3B9BA 4N8DA 3VYUB 2IPNA 4MO2A 3VR6H 1YJ5A 5D01A 3BORA 3ENKA 4B84A 5DK6A 3GLHA 3N9IA 1KL7A 4WXYB 3ZI4A 1PQWA 1L5SA 2AOTB 2CXXA 3GGJA 4MR7B 4BNNA 5C8DA 4N47A 2Q7DA 1ZJZA 2JH3A 1V3UA 3ZH9B 3TTSA 1LC0A 3BJIC 4CW7A 2KPOA 4S04A 2CHUA 1S01A 5EIWA 3CEHA 2QTTA 1MG5A 1ETHA 2ZTVA 1OZGA 1RHQA 3JZMA 2R7KA 4HWRA 4IIHA 2WTUA 3FHJA 5AKZA 3G5AA 4KYIB 2GK7A 4UHKA 3A1FA 2QJOA 2Z43A 3G1TA 3HA2A 4H3VA 4I5DA 3ZXUB 4CMEC 3G9TA 2XZOA 2JIZD 3HXQA 1RTTA 3HU1A 5C5IA 1P1KA 2YW9A 3LCRA 4OM8A 2BSAA 4EFKA 1W4CA 1E1NA 3F49S 1C9NA 1N75A 1UFQA 3M89A 5IW8A 1IY0A 1F38A 1RABA 3I4LA 4D4IA 4TKVB 4R83A 5AK3A 3T0IA 3VU3A 1T5OA 2JHGA 1NQAO 5A1JA 4C2BA 1B43A 1P9NA 2QTAA 3QMVA 4TKLA 2X5XA 3B1JA 1U90A 4DC1A 2R6R1 1W8IA 1WW8A 2G6TA 3U3KA 5CFNA 3EGVA 3D4OA 3OOYA 1IK4A 3DV0B 4F11A 4F93B 3H13A 3SY8A 2I4RA 3N76A 2C3PA 3FAKA 3HDQA 4KO1S 1B1CA 3V46A 4AX4A 3QELA 3W5BA 1RHJA 1JTVA 1XJCA 3WKBA 4WCFA 1VXRA 1B2LA 3AI3A 1H5NA 1YR3A 1PK9A 4LCEA 2AZXA 3NG1A 3PQ3A 4PZYA 1CQIA 1UPXA 3GDFA 1ULUA 4ND7A 1QIFA 4AKSA 4PBRA 5IKXA 1MEJA 3NV7A 1ST2A 2D5AA 1LK5A 1U2DC 1ZXXA 4UBLA 5F5LA 1QG0A 4R8VA 4KLCA 3W05A 4ATNA 1FPMA 1D8AA 2B1GA 2V7XA 2VIIA 3G1WA 3WIVA 3HDGA 4EG7A 4JP2A 3RAFC 1N2ZA 1KIAA 4JT2A 3O4IA 1UANA 4Q3CA 5CH8A 5DEIA 5F3WB 4HJRA 5DGXA 5B1SA 3F7NA 4IRXA 3QKWA 1QLJA 2XDQA 5F7OA 4PX2A 4YCAA 1ZMTA 2GZHA 4W1RA 5BW5A 1R0ZA 1KC3A 3ZCTA 2G70A 4W8HA 3AHIA 5CNIA 2JLAA 3OLVA 4EIWA 4CKCB 5JLAA 3RLFA 2EEPA 3PHLA 1GRCA 5IC4A 3RTBA 3V8VA 1AOXA 2FPPA 5DIZA 4BEWA 3K0FB 4WFQA 4CQNA 1WPXA 2VDPB 1GR0A 3HVIA 4HKTA 3I04A 3EVDA 3LIIA 4LJ7A 3WNZA 1YS4A 2VRCA 2WHRA 2CFIA 2PUEA 3I6QA 1RC1A 3WLQA 3SLKA 2WD9A 1IBRA 1Z12A 2OGZA 3HXKA 3JQ8B 1OT5A 5C37A 1LQTA 3CUWA 4FD3A 5CIYA 2AE2A 3OAAD 2IXBA 3MEQA 2VZEA 3A27A 4UQOA 4YB8A 1SUWA 1Z0DA 2B4TO 2BGNA 2O7QA 4ETIA 1GNRA 3QXXA 5C4MA 2VOJA 2W2KB 4NYIR 1NU6A 4EEXA 1XTBA 3CUSA 2REBA 3EEYA 3GFRA 1Z3CA 1R37A 2J7PD 2WTXA 2P2YA 3ILSA 4RLHA 1DWPA 3D8TA 4TKZA 3D8SA 3TTXA 5KNBA 2XXAA 4QAQA 2FPOA 3NBAA 4W5HA 4J0CA 4A92A 2EJBA 2IW1A 1JQDA 1TPZA 3QOYA 4YRSA 2ZYGA 3T52A 4OGFA 2XVXA 4XYGA 1Y8RA 5T8KC 3MAJA 3WGQA 1X94A 5KUTA 5LYJF 2V7VA 1HFWA 4PO9A 4TUYA 3FTPA 4M2LA 3K0HA 1G8SA 2LP4Y 2WP0A 2ZRNA 1W9HA 2NV0A 3K9LA 4RIFA 3VPAA 3RS7A 3DEJA 3OX3A 1PL0A 4PZDA 5I4IA 3C24A 5DBFA 1H2XA 1BXRB 5JRZA 2XZLA 3UT0A 4N49A 5CB4B 2M2IA 4F91B 3EZ2A 3V4FA 4BJ5A 3R74A 1YJCA 3ZEIA 4KDFA 5K0SA 1L5YA 2VF4X 3F7OA 4ZVVA 4YCCA 2LV8A 3GJYA 4Q4AA 1Y1TA 1QBKC 1QP0A 3FCCA 1E58A 1M34E 1J07A 1P31A 3OX4A 4GOXA 2CXHA 4ZI5A 2PX6A 2IBSA 2H7XA 3PDUA 4I55F 5TDHA 1MOZA 5JWOA 2BM9A 1T5DX 1UXKA 4G26A 5EZ5A 2O8CA 3JS5A 4GW3A 1IM5A 1VMEA 2BFOA 2G1JA 4MPDA 1Y4SA 4OP2A 1U5CA 4ZYVA 4ZVRA 5FV4A 2X7JA 3L1VA 2A0KA 4QHSA 2VHEA 2WSYB 4IHQA 3WS7A 4DA7A 2H1RA 3RIEA 1XXHB 2EDCA 3IP1A 2LDXA 3CW2A 3T6KA 3MWLA 4Q03A 1HZZC 3T9DA 2F3PA 5K3DA 1JAXA 3PSHA 1XWWA 4QBGB 1O5IA 1OH8A 1O94C 3A11A 5JHGB 1A9QA 4GEKA 4I2NA 4BKOA 3UMMA 2D5LA 4ZT5A 4MUGA 1FY2A 2PX3A 4OK5A 4MB2A 5F4BA 4MDYA 1RXEA 1YJBA 2AOTA 2G4CA 3CTPA 4MR7A 5EJ6A 1Q91A 1FJHA 4LDZA 4XOUA 4KRXA 5L7YA 4MI3A 1VECA 3OZCA 3TQQA 5HRUA 2XCLA 4O2AB 3AT1A 1RC8A 3C3EA 1RLOA 1L6RA 2OV1A 2QN1A 2R2GA 3CLHA 3ZDXB 5EZYF 3X0DA 1ECGA 3GO4A 3U9LA 3ER8A 3C7KA 3TTTA 4PLTA 3AVVA 1BEEA 1ENPA 3V7YA 4LNAA 4OHOA 1W5EA 2DHRA 2PM8A 4L76A 1MGPA 4J9UE 1DBSA 1MVOA 4FFLA 2N9UA 3WSTA 3QMWA 4L1KA 3T5GA 1M7HA 4B31A 4TKVA 3SQXA 4I81A 2XYRA 4IZIA 3JWPA 4ZAVA 4QQKA 1KE1A 4F4UA 3LT0A 1SZJG 1U94A 3GJ0A 3LUPA 1S9DA 3MJFA 3OIGA 3IC5A 3IEIA 4ZREA 1UDXA 4C7KA 1L4KA 3RC2A 2ZZKA 2FHSA 1PZGA 3DV0A 4IHJF 3T61A 1FU8A 3LZ6A 4L0QA 5DNUA 5F73A 3KQPA 2ZYUX 3W1WA 5DM70 1Z8HA 5DHRA 2IS4A 3F96A 5HMMA 5IDQA 2Q6VA 4CGYA 3VJLA 2X42A 3H6KA 4NY1A 4XYMA 2IEIA 4B74A 3VVLA 5B7GA 1CEXA 4CGZA 3N6RA 3R5TA 4U9UA 1N3BA 3BRWA 4UHBA 5A05A 3ASZA 2I22A 3KV3O 1FUKA 1SUFA 2Q21A 1L8AA 5CDYA 3TSOA 4ZDIA 1NNEA 1BVHA 4MRMB 4WZAE 4HMPA 4BMVA 1Y3DE 1XZQA 4FE7A 3SVLA 1TZBA 3QVSA 1CF4A 3I1JA 2D00A 3NWPA 4GI2A 1TU4A 1VPWA 2OM2A 1NVDA 3URKA 1QQ6A 2H4JA 2V96A 2QD5A 2XZPA 4JI6B 1V39A 3ILHA 1I4LD 1X92A 1UBFA 4CNBA 3I8OA 4NBVA 2HA4A 1W76A 1UBTS 2Z8YA 4OXYA 5D6OA 2PG3A 2QMYA 3MT9A 2ZEJA 4BLRA 1DEAA 2BM1A 2I54A 1Z4NA 4LRSB 4CKCA 4QPDA 4ARBA 2A4KA 4W5WA 4ICIA 1XTTA 1K8YB 2ZJ4A 2HCRA 4RK7A 1FS5A 2AJBA 4GECA 4PVCA 4UARA 3K0FA 3SFTA 2FEWB 3JQCA 4I9UA 2C2ZA 4NNJA 1CDEA 1G2PA 1JSRA 1V7QA 2VT7A 2YV2A 3GGGA 4NCNA 2DULA 4RY8A 1SAYA 4D99A 4EJ6A 4AKHA 2XVYA 4CXMA 4QYTA 4IIDA 5H02A 5H59A 1FP7A 3J7TA 5DSTA 5JY1A 4TQ9A 4PR0A 3VU0A 2VF8A 1WB5A 1V6AA 4J0DA 2WM3A 2XMRA 4I4IA 1C9MA 1CUHA 1KU6A 3BGWA 4K9OA 4Q3NA 1HT0A 3JQ8A 1EXDA 3RVPA 1EE2A 3QLVC 2HA5A 5JH7A 4Y18A 2FWNA 3G85A 3KCNA 2Z5FA 2OENG 3GVPA 3G6WA 1JJ7A 1UXJA 1RM3A 2W2KA 2EZTA 4GHWA 1YNOA 2V45A 3NFYA 1FUUA 3PDWA 3RTEA 1QPGA 3VZDA 5KQLA 3CVVA 2Y92A 4KNYA 1C2YA 1H2FA 1YE3A 4H3KB 1L9XA 1R0XA 1WMBA 2ZSJA 3AUFA 3VPFA 1H1DA 1XTRA 4YMGA 5IVPA 4BVBA 4KAJA 1E2FA 2I3DA 4KN6A 2Q3LA 3AVOA 2YUTA 1AS2A 4CTKA 1EJBA 1YUBA 4YAIA 3M5PA 4DR4B 3COWA 1OXXK 4B2LA 2Y27A 3DZHA 3HFJA 5M2QA 3F9CA 3P8ZA 2VUSA 4FR5A 3GGDA 3WYBA 3DZGA 1GA1A 5CFQA 5CTJA 3KZKA 4WKOA 2IEDA 3LDAA 3NFRA 3TLGB 4KO3S 1LS1A 1I32A 3IFSA 3UTCA 4D8WA 2ZRIA 4AY5A 1BXRA 2UYQA 1H0RA 5CB4A 3VI3B 2OE2A 3H19A 1QDEA 3AVYA 1PKXA 3O4RA 2XAUA 3H1BA 4LOKA 2A84A 2FZ4A 4AUKA 5HTOA 2RGXA 4FYMA 4PPFA 4PFSA 3AKEA 3ZGOA 3EMVA 4LDJA 2CFRA 4FKBA 1EFDN 1M2FA 1RCFA 1N57A 4LE2A 2LR0A 4J6FA 3SP1A 1MO6A 1V9LA 4ER0A 3CURA 4ENRA 5KYNA 3AIIA 3KYDB 3K1TA 3N2LA 5A0VA 3T5CA 2AG1A 3CRZA 3AYZB 4Q66C 5K3AA 5I7EA 1HC7A 2RHGB 5JD4A 3HE3A 3D59A 1XXHA 4MVJF 3UB3A 2WF9A 4XDHA 4BE4A 1E4YA 3GN2A 2V3CC 4KQXA 1R6UA 4I4TF 3E4CA 2XNHA 1NY6A 5HE8A 1X6VA 4OTZA 3GLVA 2EHJA 2HLDD 2K5UA 3GRKA 3R3HA 2RGBA 4JENA 2CFCA 1VLJA 4EW6A 3CEJA 3ACCA 5HIMA 2K87A 2HHAA 1F8UA 4BNXA 1W5SA 1ZL2A 2HF2A 3JVIA 4PSUA 4W8GA 5ESDA 1AG9A 4ZVLA 2WJAA 1TKCA 5DTJA 1YS6A 2FVXA 5IAKA 2O1EA 3GRCA 3IPLA 4O2AA 3V1YA 4ZIRB 5L40A 1SD1A 3Q9LA 1LS6A 1U0JA 3MWFA 2J3IA 3KOWA 3U4GA 3JXEA 1V4NA 3ZX4A 2DTEA 3OZWA 5JXGA 4A8PA 2OUIA 3K53A 1X2EA 4O4IA 3C6XA 3S2ZA 4KAXA 4D3SA 2BPOA 1TAQA 1ZWKA 3N2IA 1TE2A 2PWAA 5FUVA 2G36A 2GH1A 7ABPA 1A69A 4Z3KA 2E1RA 1Y6GA 1I6MA 1RT9A 2PXCA 2X8LA 2YXDA 3RS0A 2P8SA 2V7EA 2NSJA 3HLTA 1GYRA 3JVUA 1WSDA 4LW8A 1ZOLA 2HKIA 2NZWA 3KPJA 1SELA 1XVLA 1VSBA 1S2GA 2ZI9A 2A9FA 3N7AA 3SPXA 4RF2A 5TEWA 3UATA 3V4VB 5IJWA 4EL5A 1T0JB 4F56A 5L6LB 2J41A 4D8VA 3RC3A 2J8ZA 1A9YA 4M8SA 4NBUA 3PHHA 4Q3OA 1PWXA 1N0UA 3OZGA 3KLNA 5HDBB 4POOA 3UH1A 4D0RA 1FCJA 3ONNA 1MOQA 1YT5A 1JHXA 3GPDG 3ONFA 4OYLA 4I2VA 5F78A 4Q3LA 4GIBA 3IKLA 1NL3A 1S2IA 1V4BA 1NGSA 1W0KA 4X41A 3CRMA 3LBHA 4UJ3A 1LI5A 1H3NA 3B9PA 1TD1A 2B1JA 3DLAA 5GQSA 1HT2E 1XR3A 3ZHTA 5I51A 1QOZA 1R1DA 1ZRMA 4RPLA 4MRMA 5EVCA 1YFJA 2H29A 2WSMA 4BB5A 4D74A 2V5VA 1YI0A 1FRVA 2O6LA 4JFAA 5CW1A 4CU5A 3ZJTA 4LJ4A 3HCNA 4IS3A 3HKCB 4DC9A 1X1SA 4BO0A 2YV5A 4KH1A 4J0HA 2IUUA 1XROA 4RVGA 4XX1A 5CVEA 1F0PA 4M1MA 4PNZA 4KE7A 3UAYA 4EMSA 5A03A 1P75A 3H5LA 3VKWA 1WDLA 4FXPA 4YQZA 3H8JA 2J9RA 2EQBA 2PKWA 3HV2A 3TI9A 2ECOA 1FVXA 3SZGA 4MQLA 2DFLA 5FPTA 5HUHA 1YZGA 2GAJA 4MKHA 1HYEA 4K6CA 4AC9A 3DZKA 1MHPA 2RGWA 2AKAB 1DKOA 4JBGA 5BOVA 1E1RD 4BCBA 4LC1A 3ITNA 4WSOA 4A2WA 3K72B 2VDUE 3MPUA 2ZRHA 2VNJA 4TRJA 3OTWA 3P0FA 3KDAA 2JGKA 4DMGA 4DSAA 1WBJB 4HYEA 3SJCA 3V8QA 3WGKA 3VHQA 2QUJA 5B30A 2P6UA 3C3CA 1DKQA 1HBJA 3EAGA 3KYIB 4I99A 5A4KA 2L2QA 3G17A 1SZCA 1Y98A 2LKDA 3I2GA 5H3CA 4RK0A 3FOCA 4EELA 5JOQA 3LOPA 3TG2A 4XGNA 2VJKA 3AFMA 2B3TA 2JZOA 2OB2A 3QK7A 4JL8A 4P7FA 3V4LA 2BMFA 4JVSB 3EA4A 5KNLA 2X23A 1Z7EA 3GA7A 3FTNA 1R5BA 3DQPA 2J3LA 4R3WA 4Y1FA 4RTQA 4UDNA 2IY7A 3LT5A 1KEKA 3FZQA 4OGGA 3D0RA 1P3Y1 5CVUA 3FD8A 5FI1B 1JDZA 3WMWA 3EZXA 2OCKA 4M1EA 3OF3A 1RI3A 3FROA 4J16A 4HZGA 4PIMA 3OU6A 1AO0A 1RAAA 2IYYA 3W5CA 4G3XA 3WIOA 1AKTA 4BAUA 2VPPA 4O0LA 3HB1A 2OHVA 1U3TA 3IP6A 3IO3A 3MUEA 2BBTA 3P2KA 1J8YF 2N1MA 3DKRA 3LW8A 2AFIB 1N9ZA 2RKOA 4HZUB 2BWJA 2E5WA 3KL4A 4CQLB 2OXFA 3IJPA 3PVCA 3BXHA 4AF7A 2JL1A 3CLUD 2VJOA 3TLGA 1XJ5A 2M9MA 3Q6NA 2ZAGA 4QJ5A 4CF3A 4R8MA 3JQ9A 3CEPB 2WNSA 4Q47A 4XEUA 3LX8A 1COZA 1N2GA 2JIQA 3L9WA 1HPLA 1SZPA 2GZRA 2CHGA 4ERXA 3BMQB 4ZI3A 4CLRB 2OSVA 4ZCIA 5I9IA 5U4QA 1Q17A 3L0DA 1AURA 1G0NA 3BXPA 3LXXA 4ZOEA 4RDIA 2C95A 4EY5A 2XE4A 3KYDA 1PR6A 3N70A 5BSGA 1AQJA 1GNPA 1E3SA 1OAOA 4EPTA 3NMUF 2MR5A 2ZT5A 3GC6A 5IEBA 5JO0A 2Y2UA 2NOAA 4RWEA 2YY5A 2FN8A 3D3KA 1YAJA 3RS4A 3PFFA 1RKXA 2WU1A 2I6QA 3CZ5A 5IJ0B 5F2EA 4M98A 2GLXA 5EJ7A 1KEWA 1VSTA 3IAAA 4I50B 1EDZA 1MC4A 4Y9DA 3UICA 2P6PA 3HTXA 1NC3A 2GF2A 4PONA 3GFTA 4W7IA 3L0IB 1N2HA 5AUOB 2O0JA 3SICE 3W2EA 3WLKX 4G36A 3K71B 1DBVO 2PGLA 2WWFA 4QDTA 4RL4A 3U7EB 4W5OA 2UYHA 1EX9A 4ZIRA 4TVSA 4B35A 3QEJA 1T8YA 1Z47A 5FBQB 2NVBA 3H6GA 3VDNB 4IQFA 4WX2B 2WVHA 3CMMA 3C6QA 1V43A 3GEHA 3S5UA 4EPXA 4ENQA 1TVEA 3BXXA 4PW0A 1E6LA 2RJ3A 3L4EA 1WDMA 1ZESA 5DE3A 3J80A 3DE5X 5ALPA 1V48A 3PNMA 1ZNXA 1G7CA 1Z0SA 3OP4A 4WNYA 2WAAA 3F1LA 3RKSA 4TQAA 3ELBA 4N40A 5TY0A 1QK4A 3H5TA 2I6SA 1NUSA 13PKA 1GZ5A 3B1KA 2I2AA 3NBUA 3PLRA 1EUCB 1LTHR 3BB4A 3OFJA 4ZO9A 4EFLA 4KPEC 1SJ9A 4BVGA 1FYDA 2P8JA 3EPJA 3TSAA 2C1EA 2EFYA 2G9ZA 2AMLA 2ZBGA 1ZP6A 2I33A 2WB2A 1XMOB 4CIBA 3GLIE 3CXRA 4K1XA 4HMQA 4Z7OB 2IRWA 1MTOA 2Q6OA 2VEDA 4UJ5A 4CMAA 4NJMB 3SKVA 1NW7A 3CG0A 1WF6A 4ZQFA 1F2UB 4BJ3A 3MZ0A 2REQB 1I6WA 2RJOA 4YDSA 1A1SA 1WXQA 1VFPA 3PYXA 4RQBA 1P8AA 3WLIA 5K6TA 3P0HA 1Z83A 2W2PA 3GZNB 1ISHA 1FFEA 5C3UA 4MVJH 1C41A 4MW9A 1F9AA 1YF3A 1K6MA 2R65A 1CUIA 1XZBA 2HBZA 4NYIQ 1Z6YA 2O5EA 4M9QA 4FONA 1QGYA 4WK2B 4CG3A 5EMMA 4C4XA 2BFAA 1U8XX 3R9IA 2FPWA 3EC7A 4EGQA 4YPVA 1VMAA 3CU5A 4JIMA 3NHJA 3M4XA 1VXOA 4BNDB 3QW2A 4F2GA 1ZGAA 5D5HA 4S24A 3VZPA 1VMIA 3UQYS 2FXVA 1GRRA 2Z6VA 2P7IA 3HKCA 2C4WA 4FOOA 4MPJA 5SYNA 5F98A 3DYVA 3OZBA 4L95C 3W9BA 1RJGA 4KO8A 5ALHA 3ZE7A 3SF0A 3H5WA 1FFSA 5LXTF 3S5JA 4H15A 1FNDA 1L8OA 2OWDA 3FPEA 4LGMA 4MYSA 5EINA 4G97A 4IIJF 3NTVA 1XPOA 4RHTA 3A4TA 1DAOA 1NFFA 3OEWA 1RYMA 1VSUA 2Z2KA 4ZRMA 5TXGA 4TVOA 2QTFA 3OD5A 5GP1A 4K05A 1L5GB 3VR4A 3VX3A 1UJ2A 3DGEC 4IDOA 4OQPA 5FHQA 5KOYA 1D9ZA 3BEOA 3VAYA 4MEBA 1CP3A 2ACKA 3BX1A 2QYOA 1MQ9A 3AR7A 3K6JA 2OILA 5GOTA 3JWGA 1ACJA 3WO1A 1H4SA 1VBFA 1Y3CE 1L4GA 1BWPA 2W71A 3DPSA 2YNMC 3Q0TA 1PQUA 3CF4G 3EF1A 3R3SA 4KQ6A 5CT8A 2QN7A 3E61A 2QNIA 1E96A 2C03A 4IJQA 3DO8A 4P5DA 5A9RA 2Q7XA 2AHOA 1I7DA 1OYYA 1TFUA 4Y2GA 1XO1A 4NZZA 1K7CA 2D2FA 4IDFA 4JOSA 1ADGA 3WWZA 4ER3A 5JNLA 4X61A 2IU3A 3STUA 1V41E 2D1QA 3PU6A 2PH3A 3DXXA 3AVTA 5A1TA 4IHKA 2X8WA 2R0QC 3HCAA 4TZTA 5KAPA 1D0VA 3OE7D 3SG0A 1GUYA 1SHLA 1HZJA 3B89A 1STOA 2AFIA 3VGJA 4HLCA 1I7LA 3A05A 4HZUA 4CQLA 2W6PA 3NBKA 3IKJA 3NYRA 4NJEB 1E5LA 1AY0A 1P5JA 3S28A 1VG1A 5FNVF 4MCAA 3DOEA 5AYVA 1CIPA 2FP3A 4QPZA 2F55A 2PEYA 2QX8A 4HUQB 2H07A 2IFTA 1XRPA 1CUGA 1WIWA 2Q6LA 3IUPA 1TM7E 5LP6B 2IKSA 1L3CA 1M1YE 1GGMA 1G6KA 1H94A 1XJ0A 3R75A 4DQ0A 1FMLA 2JCYA 5LZ2A 3BMQA 3OJFA 4PYMA 4CLRA 4B3GA 3VRHA 3NHBA 2A5GA 1GPMA 4IGEA 3G2QA 1GRNA 2PEZA 1QRDA 3TS1A 1YRHA 5KNCA 2QK4A 2A9VA 3D02A 1D6MA 4JI5B 3PC7A 1BGVA 2DPHA 3BIOA 3FLAA 3T54A 5DMXA 4Y2SA 1QCYA 1J7JA 2WA1A 1JJBA 2ZB3A 1GNSA 3HYRA 1ODLA 1Z2OX 2C57A 2NZUG 3EGEA 3ITKA 5HG0A 1YR2A 2A9KA 2IYXA 3KS9A 4M1QA 4I50A 4ZU3A 3WRXC 3WB1A 4B47A 4XCVA 2Q2QA 2QGZA 3EH1A 4XQEA 1SUEA 4OI1A 1I4TD 2Q1SA 1YZNA 2C2OA 1XTIA 1XA4A 5TMPA 4NXMB 2EC5A 4C7MA 3PJFA 5F21A 1YMVA 3U9SA 2B2XA 4J43A 1KEUA 5A4MS 4PRYA 1GQ2A 2EERA 2FZEA 2WFZA 4R41A 3AP1A 5AIBA 3U5TA 1G2QA 5AVSA 1XEFA 1HSZA 2VQ6A 4MI6A 4PHGA 2ZDHA 4ESEA 3TIXB 4KBGA 4LI0A 5B7NA 2OYRA 4NYJR 2ID9A 3F5SA 4BO9A 4YCSA 1ZK4A 2IYRA 5LQDA 2P9HA 1AUXA 1LZLA 3DF7A 3K6SA 4BLQA 3FBGA 1UZAA 1ORHA 3V4PB 2W6MA 1SCDA 2DM6A 1VKZA 3C6KA 1I1NA 5I9BA 1NF3A 1EUCA 3QKTA 1SBCA 5FPHA 2IH4A 2X4DA 3VKGA 3HJUA 3ZQJA 4MRAA 1UJ6A 2RH8A 3ANSA 3HHEA 1E2QA 2BFEB 2GEDA 4MV1A 2XTNA 4D9MA 3EUAA 4BV3A 2A0XA 1KC1A 1DOZA 1P7PA 2J5RA 3LY8A 5KHAA 4D3XA 1PF7E 3W2HA 4OBXA 2PSSA 2V97A 3OIYA 4NJMA 3RTGA 2YQZA 5A5EA 2RI0A 4KLAA 4JA0A 1F2UA 3IVGA 2QTLA 1ABEA 2REQA 1PLLA 2QL5A 2VOEA 3JQFA 3MUFA 4KIWA 1J06A 2PLFA 4MYRA 3F3MA 4PWYA 2FSVC 2OZLB 4Y9SA 3SDSA 1K4YA 1RRGA 3GZNA 4QQRA 4YMSA 5FCDA 1VIMA 4B0OA 2I2WA 5B57C 2EOAA 1ULHA 5CW2A 3ZY6A 1D2EA 1WP9A 3EBLA 1PFWA 2Q5QA 3E27A 5A3RA 2NQ8A 4UOZA 4ZYLA 5C1PA 4J03A 2Z58A 4U00A 3FWHA 4BNDA 5C1BA 2YDYA 1T9ZA 2NU7B 3AW9A 3DT8A 4O3FA 1ZN7A 3OZEA 2G0NA 5A04A 1UBOS 5C1OA 1M76A 3OQ1A 1B8VA 4JH0A 1KTIA 3A6PC 4O33A 4UMVA 4HBGA 4W1SA 1VE5A 2P77A 3QFRA 2KBEA 4LYJA 1HE8B 2LD4A 2W00A 3D0OA 4FTWA 4J0FA 1GYQA 2GNOA 4QA9A 2V5UA 5DP2A 2C3MA 4DM3A 2C4TA 1ORDA 1ZIPA 2J5XA 4RY2A 4A5SA 3QYFA 3LGSA 3EH2A 1C4KA 2IX9A 1KAGA 1L7QA 1OWPA 1TECE 2PH1A 3AI2A 3WKAA 2NW6A 5BYKA 4DXHA 2RHCA 5EG5A 4K6MA 5L4LA 3CRRA 4X6LA 4HI0E 1OBVA 2X22A 3PCXA 4EW1A 2IU0A 3G9UA 2QZ4A 3RROA 2CJWB 2Z0MA 1K63A 4MQ6A 1M54A 1MORA 2TMKA 3D8NA 5JATA 2B4AA 3HJBA 4X8OA 2GLUA 3NIFB 1YB4A 3QHQA 3WADA 1VBKA 5AJZA 5EHXA 3F4LA 4HX5A 3AM1A 2YVAA 1PNVA 4MS1B 3PJEA 4WBXC 2HQRA 2WLSA 3HVHA 4OK3A 4B1FA 4B87A 5A3QA 4MAFA 2XYPA 1GQRA 1Q1BA 1AUPA 3I42A 3VDXA 4QNNA 4B9EA 4N48A 2WVAA 3E5RA 5DPMA 1Q7RA 1XUOA 1QFZA 5JD5A 5LD2B 3PQ6A 3QVWA 4JT4A 2E0IA 2O4UX 4QO7A 3LRXA 5B1IA 1NRJB 2VDNB 3W4IA 5TQ2A 3X1MA 1SXHA 5KPJA 3HO1A 3CS3A 4BFXA 4LYHA 4KV7A 2E3JA 3CVXA 2A5LA 4OXKA 3AJEA 3GRVA 4NJEA 4ZAYA 1BFUA 4X64B 1DAPA 4ZCQA 2EVWX 3M1IA 1RRCA 4M9CA 5FLKA 2O54A 4QEZA 4Q3BA 4WWHA 5EPOA 4HUQA 2YHUA 1H66A 2GBGA 1NFQA 3PL1A 4KHZA 4H0NA 1K0FA 1TUBB 5IKPA 1QG2A 3UG6A 3NR2A 4UM5A 4EVSA 2P2NA 2FCAA 2VHTA 3OSUA 4US1R 3N53A 4FNOA 4NLLA 1MX5A 4U5QA 1U2GA 4B2IA 4BECA 4EDHA 1J90A 3VPSA 1ISJA 1RWXA 3EVCA 4PZLA 4QSHA 2X0EA 1K89A 2RGCA 1CVIA 2FTKE 4H77A 5D2CA 5A4AA 1T3ZA 3AXSA 4E2YA 1XDBA 1L4HA 3SYTA 3VR5H 4DG8A 1NBWB 3COVA 4F4DA 1A27A 5CBPB 4TYQA 2XCRB 5LL6P 1KI2A 4PZUA 3V97A 2PBLA 4OX9Y 4KXYA 3OCXA 1YU6A 3GHYA 5CJJA 1KI1A 1Z26A 2D5BA 4CL8A 4WJKB 3QOXA 1T5IA 5DKFA 3N8HA 3FVQA 3BWYA 1NHWA 2G28A 3JRXA 4ZO7A 1SKUA 4U2CA 3V80A 1MH1A 2CMHA 1NTRA 2NGRA 4KQHA 3UCFA 1EGHA 4D3YA 2EFGA 1A9OA 3MVEA 5E3IA 4FB4A 3C3YA 2QZ9A 2MJLA 4I6EA 3JZAA 1Y81A 4PAOA 3UC5A 1Q1NA 3B2EA 3NTXA 5TVGA 5IDVA 1FXWF 3A0RB 4U7JA 4BB9A 2C84A 3VX4A 4AO8A 4KQ1A 2ZJ3A 4J0KA 1ML3A 1VJTA 3AR3A 2C8LA 3O95A 4W1QA 4C4PA 2QG9A 3UMVA 2BF7A 3UFBA 4J1NA 4PFQA 5K2MA 2A7QA 1TVCA 1M2WA 3ANXA 3EVFA 4KCGA 1Q1AA 2PZKA 3KR9A 2W2VA 1E3DA 3KYCB 2NXCA 3MCVA 3P5BA 2PZGA 1U1DA 5FTLA 4PC6A 2BFEA 3GT3A 5DYNA 3CB4A 5KTTA 3UF0A 1W7AA 1HY3A 4FFRA 5LB2A 1BKSB 1PW7A 2GSWA 3PNYA 4ALKA 4F3KA 2FEOA 4E5YA 1JB9A 3LUDA 3VR3A 4IDQA 3VHLB 3PJGA 5IVDA 3MCWA 2MSKA 1PCXA 5D6NA 2A67A 3TI7A 4EJ0A 2OZLA 4LCJA 3TM4A 1N8NA 4YV1A 3EIQA 1R0SA 3FSRA 1JR3E 1DDOA 4RBNA 4LY0A 3MK31 3IDOA 3JQDA 4U2BA 4BNUA 3FLMA 1NBIA 3OC0A 3T1HB 2QDXA 3GPBA 3WRYA 2R4TA 3TCKA 1DXHA 4EARA 4RGVA 1NNLA 2AG0A 4PQRA 4QBFA 1OLSB 5J40A 5EKTA 3TM5A 3L43A 4RESA 4ONEA 3WOHA 5I5EA 3PNSA 3K15A 4CKXA 5A4JA 1ZH8A 1N3YA 2BKLA 3MJHA 3WHIA 3OQVA 1ZN8A 3SXJA 1ZMXA 4AG3A 4YALA 3HB7A 1PVVA 5MN5A 5AUQA 4IY1A 3PUWA 4RUKA 1ADYA 5CDTA 1E7QA 1U2TA 5CK4A 1FSPA 3ZD8A 3DLPX 3PE4A 2WAMA 1V6SA 2XLBA 3JPWA 4XASA 2O9JA 1U7PA 1OGJA 2GFQA 2IZ5A 1BE8A 3LGAA 3M3PA 4GOOD 5CM2Z 4MW0A 2QMHA 1DIOB 2HU7A 4LYFA 2CXPA 3GLUA 3AZPA 2PU7A 1KR2A 3K4QA 2GXQA 3ORHA 4EI2A 1KYQA 3LQ4A 1CUAA 2WBLC 1IQUA 1LLDA 3D6VA 2OECA 2E4AA 2BR4A 1H0KA 2VDJA 1DBRA 4H7PA 4ESVA 5EJFA 1C9DB 3VHXB 5C8YF 1QYCA 1WCIB 5HJEA 2CJWA 2CLFB 2NSHA 4DVGA 2FSGA 5K3FB 2JGMA 1GPLA 5DI9A 1TQ8A 5HMLA 3FUXA 4DYHA 3UBTA 1TRKA 3PT9A 1JWLA 2MHCA 3S27A 3EXAA 5LB4A 4UU1A 2B0CA 3CW8X 4F71A 5JSYA 5IWAB 3DEYX 2YMPA 2AR0A 3F47A 1TF5A 2WJVA 2GLTA 2WKSA 4MS1A 1NNSA 5G0SA 4AQDA 4CR8A 1P44A 4EKGA 1TTPB 3TLJA 1P7VA 4XM2A 5HGXA 4RHEA 4ZVQA 3NKFA 4U9IS 821PA 4JODA 3HYCA 2WFMA 4FN4A 1NY5A 4C89A 3NKLA 1WBBA 3IDQA 2H06A 2VTVA 1DRJA 3ETDA 4J1TC 1H5QA 1IZYA 2ZVDA 5AVJA 2X0RA 3LCVB 4RW0A 2R7MA 3P9CA 4Q05A 5F64A 10MHA 1NUQA 3KL2A 3EVTA 5GGYA 1C7JA 1Z5NA 1X1TA 5CM8B 3DE0X 3DDCA 3O47A 4JBIA 5LLSA 1EU1A 4NH0A 4O1IA 5EKSA 3JR7A 4AD8A 2C00A 2PLNA 2Z2JA 3RVKA 2QN3A 3PD0A 3UEOA 5HWSA 5JNWA 2B5WA 2EX0A 4FKZA 4INOA 5IMSA 1CXZA 1TUBA 2PGJA 1D2HA 2DZDA 3U3MA 1FZQA 1C7FA 1VLVA 3R5HA 1L4EA 2FVYA 5IDWA 5IEJA 5CGQB 1HDGO 4XLZA 3LS2A 1L5VA 3OQOA 2VF7A 3FG9A 5KTYA 2XCOA 1JXMA 3BBLA 3SEFA 3WYNA 1ID8A 8ADHA 5JMTA 1EM6A 1OMOA 2AXQA 2GPWA 4TTQA 1NPYA 4XARA 2XRFA 5FAXA 4LF9B 2YDXA 4WW0A 2QS9A 1J21A 5CEJA 3ELUA 4J1SA 1JHAA 2P0YA 4G4JA 4X45A 1PIWA 3OECA 4QUEA 3VPXA