1PLLA

Crystallographic studies on p21h-ras using synchrotron laue method: improvement of crystal quality and monitoring of the gtpase reaction at different time points
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
166
structure length
154
Chain Sequence
MTEYKLVVVGAPGVGSALTIQLIQNHFVEYDPTIEDSYRKVVDGETCLLILDTAGYSAMRDQYMRTGEGFLCVFAINNTKSFEDHQYREQIKRVKDSDVPMVLVGNKCDLAARTVESRQAQDLARSYGIYIETSAKRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-H-RAS P21 PROTEIN
publication title Crystallographic studies on p21(H-ras) using the synchrotron Laue method: improvement of crystal quality and monitoring of the GTPase reaction at different time points.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncogene protein
total genus 31
structure length 154
sequence length 166
ec nomenclature
pdb deposition date 1994-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1pllA00
5HKKD 4DUGA 4ZO4A 4B76A 3KKQA 1ESNA 5FFMA 2QTHA 3BIFA 4D81A 4XWAA 3CB4A 2ZI9A 3KXLA 2W2XA 3KB1A 3U3MA 4DIDA 1JR6A 4AKGA 2JAQA 1KMQA 1ZUHA 2V4ZA 3MGCA 4PPQA 1Z0AA 2QM8A 4JLMA 4UNPA 4A4DA 3BRWD 5KPDA 3GLIA 4FWIB 1BO6A 2H57A 1A5TA 3VHLB 1PZNA 2AWOA 1W36D 2CLSA 3KFVA 1W48A 3CNNA 5C4MA 2UVQA 2CHGA 2FEMA 1OFUX 4DHEA 5K8UA 1AGRA 1ZCBA 3A1SA 2O8EA 4DLSA 1BKDR 3BH6A 5CB8A 4XTCS 1TPZA 2KJQA 5KNBA 1CLUA 2H1LA 2A5GA 2A30A 1JI0A 1H8EA 2PL3A 4L4UA 3KJEA 4QL3A 4URYR 5H8WA 1OH8A 3BGWA 1PUIA 1EGAA 4FIDA 3CWQA 4HAZA 1W2GA 2B21A 1GKUB 3BBPA 4LI0A 1OJLA 1R7RA 3NEYA 5EP4A 5C18A 1XEWY 1IY0A 3L43A 1Z8FA 1RYHA 2X8AA 1E1QD 1DADA 4DT1A 4ZIRB 4EPWA 1G4UR 4M1SA 2QE7D 2R44A 1RE0A 3PEWA 4DCTA 3OHMA 5SZJA 1SQ5A 2NO0A 3VR6A 2B7CA 3C5HA 1P9NA 2AD1A 1Z0DA 3B85A 1T3SA 1RKBA 2FG5A 4C2TA 1GUAA 1KO5A 2OZEA 2Q9AA 2WICA 2WZQA 1E2GA 4NCJA 3VX3A 3U6BA 1Q0UA 2R9VA 2ZTSA 1XEFA 2GCOB 4D0GA 3CRW1 3TMKA 4Q9JA 2HF9A 1YR7A 1G3UA 2SHKA 3LQRA 1K5GA 2MMCA 1IN4A 1ZM2A 1G1MA 1KI1A 4GZMA 1GWNA 3Q5EA 5BQ5A 5GJWC 4N1AA 4B3DA 4F38A 4KLZA 4PQYA 3NIBA 2FZLA 3O8BA 4XVRA 1Y3AA 2NIPA 3L2OB 2GEVA 4PC2A 3NBZC 4B2LA 2P6NA 5JWOA 3F0TA 4OQNA 1NMZA 1MV5A 2GXUA 1I2DA 3QXSA 5EE0A 2VYFA 1XJCA 4TSFD 2DWOA 4YMTA 1WCV1 2IS6A 3FKQA 2RMKA 1Z0FA 1WP9A 2CE2X 4IDHA 5CYPA 4W9MC 4TLEA 3FKSA 4OI2A 3CF2A 2C03A 4U5XA 1E2FA 3ZZTA 4W5JA 4BZXA 1KYIA 5FTMA 1ZIOA 4B43A 1AZTA 3PUVA 2FE4A 3AVQA 1ZC4A 2VBCA 1HY3A 2IHYA 1TF2A 1NBMD 3KUCA 4F4CA 2J87A 1Q1EA 1YQTA 3WY9A 4OK5A 2DR3A 1NJGA 5AJZA 5DO9A 4EDHA 5JMTA 3BJIC 3RSLA 3GJ6A 4ABYA 2ZE5A 4W7SA 5FUWA 4NCIA 3RRZA 3RDPA 4CIDA 3QG5A 3U6KA 2GILA 2QAGB 1QZXA 1TU3A 4DSOA 3OIUA 2IEZA 2W6JD 1OLOA 4ZIRA 3EWSA 3WRXC 1XWIA 2O8FB 4Q1CA 2A5DA 1RYFA 3SDZA 2OV2A 3CX6A 1W0KD 5FUYA 3B82A 4S35A 2D2EA 4HDOB 1IM2A 4PO8A 4DUGD 5CK5A 3B1WA 4AY2A 3B78A 4UNQA 1QDEA 4TMKA 4ESHA 1QHNA 2GCOA 1TUIA 2IWHA 3AVYA 3PEUA 2B8TA 2O5VA 4TTQA 5UKDA 3HU3A 3U3RA 1NLYA 4PAOA 1E2QA 2ZI5A 1OSNA 2ZJAA 3UKDA 2IXFA 2X2EA 1PUJA 3AP3A 4XTRA 4OHZA 1IN6A 2KWIA 2ODEA 3RS4A 3CRMA 4YMSA 3U4QB 2C9CA 4F92B 3O8DA 1J7KA 1Q1QA 1MOZA 4M1YA 1G3MA 3LX5A 3EG5A 2RGGA 1XPRA 1E9DA 4FMDF 5GJBA 2VHJA 2CCKA 4I1UA 1G8HA 1EWRA 1VECA 3BB4A 6Q21A 1NLFA 4JVMA 3QXJA 2VHQA 3TK1A 4UXJA 1H8ED 1AKEA 4P4SB 2RH5A 4I1OA 1QHHB 4WXRA 3KFXA 3CX8A 5FOVA 1FQJA 4RY2A 5EP2A 1MKYA 1U81A 2XAUA 4HEJA 2D7CA 1X3SA 1ZCAA 2HCJB 1E9AA 1G4AE 4MRNA 5FR2A 1SVWA 4XSGA 5J40A 1J99A 4KITB 1TMKA 2OBMA 4PC1A 5HCIA 1RFLA 4JLBA 4M0LA 1CKEA 1TQ4A 1GL9B 4URZR 2PX0A 3R9XA 3QI2A 4TT3A 1C4OA 1F2UB 2NTYC 4IW3B 4PHFA 4JT2A 4TMVA 2OG2A 2R65A 4Q4HB 3RS3A 1G7TA 3L0PA 4HLCA 4BFVA 4IOLA 5BN3A 4FN5A 1OIWA 5G40A 2BVNA 3FGNA 1E2PA 3X1DA 3KKMA 3GJ4A 4Q21A 1VG9B 1EXMA 4G01B 4I81A 5L3RA 2QAGA 2O0HA 2IYSA 2VP2A 3SQWA 5B58C 3P20A 2IHBA 1E2NA 1YZGA 2V3CC 4CVNA 2O8FA 5C2JB 2Q21A 4ZI3A 3CONA 1JEEA 1HURA 2ZROA 3SJBA 4GL2A 4HAUA 3DDCA 2FF7A 4Q47A 3GLGB 2WWHA 1U99A 3L0IB 4XOIA 5LB4A 4Q18A 4F4IA 3GLGE 1OB2A 1TADA 3EARA 4F4JA 1II9A 1G291 2BMEA 4B34A 2X2FA 1CR0A 1N0WA 2NQ2C 2Q3HA 2W0SA 2FPKA 5JZVA 4JBYA 2PCJA 2V54A 3DZDA 4BASA 1WMSA 4KV9A 3KJHA 5EXXA 2HJGA 4IDPA 3K70C 1FNNA 1ZD9A 5JRZA 1BOFA 2VLIA 3U4QA 4QBIA 2QBYB 3LO5A 3BWDD 4FMCF 4JKYA 2FJUA 2BCGY 1Q12A 3FKSD 1HE8B 1Z0KA 3QBVA 4BZQA 2ATVA 3NC0C 4QJ4A 3TAUA 1WXQA 4XH9B 1NG9A 1ZJ6A 5G41A 3F8TA 4JJZA 2CL6X 4CGZA 3KXIA 2I1QA 4JL6A 2ZRFA 1UBCA 4P4SA 2ZJ2A 1QHHA 1EFRA 1UKZA 2RGXA 2YVUA 4TWZA 3WYFA 5IHPA 1Z2AA 2OFOA 2GTPA 3KB2A 3P27A 2P3SA 2ANBA 4JLPA 1XMJA 3IQWA 3QVUA 4URXR 1JECA 1NG1A 1XMIA 4C7OB 4PPGA 3SZRA 1NVVR 3QIAA 4OJQA 2NZJA 5J4KA 3D3QA 2CVFA 1XTKA 2DHRA 1MR3F 2CCGA 1E2HA 2DFLA 5FPKA 1Z06A 2IYZA 4Z8XA 1F2UA 2FH5B 1XMVA 4Q4HA 1CRPA 2VP6A 5IDVA 5KNCA 4NL4H 3GLHB 4KFTA 1XCMA 2GDJA 1UDXA 3GLHE 2H92A 4YLGA 4MKIA 4OI4A 3AF2A 3QSYA 4MYTA 4IOJA 1QHIA 4TLAA 3DO6A 4JL5A 3VR2A 1LF5A 1GKIA 2R8RA 2J0VA 3CH5A 4LDJA 2IXGA 5H70A 2AFHE 4DCNA 1A4RA 1NSFA 2G0TA 4HAWA 3GLGA 4QBGB 3MWYW 2WWIA 3VQTA 1DO2A 1XZPA 1GDDA 4BFSA 1V43A 3TBKA 2WJHA 2FFHA 2HT1A 4MRVA 2P0EA 4UNNA 1GG2A 1VIYA 1FL9A 5E7MA 2D74A 2QT1A 2Z6VA 2OFXA 5CM9C 2PJRA 421PA 5JSZB 2WAXA 3K0CC 3QY0A 4LHYA 4AKHA 1ZU4A 3QBTA 1M2OB 3OZXA 3U3KA 1KDRA 3ASZA 3Q7QA 4RD1A 3PR1A 3OEHA 4KLNA 1E1RA 2ERXA 2Q0HA 5DISB 1N5JA 5KHOC 2QBYA 4Q1DA 2I3BA 2QQ0A 4AD8A 1OPXA 1S0UA 1RRGA 3HU2A 3P26A 5JHGB 1AKYA 1NN1A 2C2HA 5LD2C 3MRSA 1NVVQ 4NYMQ 1VCIA 2VH5R 1DVRA 3NTUA 2OILA 2WKPA 5G3ZA 2YWFA 3AUXA 3EA5A 4A2WA 2DY1A 2VP4A 1KI9A 3DM5A 2IC5A 1AN0A 2PT7A 3IILA 4TT3D 1W7AA 2VO1A 5EUMA 3TR5A 4B3FX 4EPVA 3AVOA 3GLFE 2GRJA 1YE8A 1XJQA 3CH4B 721PA 3TNFA 5FOTA 1G7RA 3CUEF 4C7OA 3H2YA 1KTVA 4OI1A 3PITA 4HSEA 1W4AA 4LHVA 4WOPA 3K9HA 4M1KA 2HT6A 4A15A 4NCHA 3RS0A 2C8VA 2UKDA 4LHZA 2AXNA 1UM8A 1HUQA 3WBJA 2ODNA 3CRRA 3LFUA 3QXCA 2QQEA 2CEAA 1BIFA 3NG1A 4D4LA 2YNMA 5FUXA 2JJ8A 4V0KA 3TH5A 3SQXA 3GLHA 3ZJYA 1Z6TA 5KO2A 4Q9LA 4KU4A 1WBBA 1I4LD 4LBYA 4QGGA 4FCVA 2A7QA 3I5XA 2BKEA 5FPSA 2JGNA 4Z51A 1E6CA 2PZFA 1NJFA 1NSTA 4R98A 4PHHA 3U5ZB 3K0SA 2JDIA 2QMHA 4BLOA 1OFTA 1G17A 3OEEA 1LVGA 4HLDA 1NIPA 2CK3A 4GOKA 2ATXA 2IL1A 5DH9A 3MJHA 5D3MB 4QFMA 4AYTA 2XTMA 4WZAE 3UANA 1E0KA 1L4UA 4NE2A 3LY5A 4DCVA 4AWXA 4JIMA 2DFKB 2VF8A 3BE4A 4WVFA 4LV8B 5JSZA 4JZKA 4EKDA 1ZUNB 1XTRA 1V5WA 3IHLA 1T8TA 1CXZA 1KO1A 1XXHE 3LW8A 3IBYA 1E9FA 2ZRNA 4HYYA 1FMLA 2OCAA 1UPTA 2VEDA 3ICQB 3KJIA 3N70A 2HXYA 3CW2A 3AP1A 2CVHA 3KZ1E 4XIGS 5K8LA 2I4IA 3QJYA 1VCOA 5ANRB 2ZYUX 1JR3E 1L2TA 3QKUA 3UWKA 4XVUA 4NTZA 4BLSA 4IRUB 2JCSA 5HZKA 2ZVQX 5F9HA 3KKPA 1A7JA 2G1KA 3BB1A 3U7FB 2NO9A 4IVRA 4AKIA 2QPTA 5FTKA 4L16A 3CPHA 3NWJA 4JBXA 4XVQA 4D6PA 1N5KA 4TZ0A 4US1R 4LZZA 4C4PA 3X1XA 1Z3IX 3LW7A 3SJCA 3AKDA 3X2SA 1FP7A 2ZRCA 4Q4JB 5EE3A 1CJKC 2B8WA 1G41A 2EW1A 2WM9B 1OV4A 4A92A 2Z4SA 3I8XA 4UXIA 3ADBA 2R62A 2CHVA 3RABA 2ZRPA 3B1YA 4Q5IA 1N2CE 1EFHA 5JECA 2Q9CA 1KSGA 4JLVA 3VAAA 1E9RA 4BFTA 4DBLC 4CF7A 2CXXA 3CNOA 3WP0A 4PHTA 1S3SA 3WYAA 4NZYA 1W4BA 3JVVA 4GBMA 3E1SA 1YRAA 4KSCA 4X8MA 5AR1A 3D6TB 4Y0AA 2J7PA 2P65A 3QE0A 3A37A 1DELA 3KKOA 3IIMA 1E69A 4GP6A 4U7DA 4Z54A 5BXQC 1VKJA 1KDPA 3RHFA 3ZVRA 4GSYA 1M7BA 4LCBA 1P61B 3OEHD 5D3MA 2EYQA 5J4HA 4GDFA 3LDAA 1E1RD 2BMJA 3LD9A 1ZM3A 2WOJA 1YRBA 1PLJA 4YMWA 4AG6A 4AURA 1WQ1R 4DB2A 1YU9A 2F1HA 3O8CA 3UPUA 2VSXA 1YZNA 1B0UA 3QUSA 3SC3A 3Q5DA 2GVZC 1KJWA 1R5NA 4KAXA 2F7SA 4DVGA 4DLVA 2ZI6A 3K9LA 3UMSA 4D4JA 4C2UA 1YR9A 2F1IA 1ZM4A 1W4CA 2E1RA 4B33A 4KYUA 4BLQA 4NMMA 3W3ZB 1G18A 5G3YA 1FTNA 1JQLB 1T4GA 1U8YA 1X6VA 2G83A 4M21A 5EP3A 1ETUA 2DCUA 2YJTD 2NMVA 1P75A 3SU8A 1IXRC 1OE0A 4G5GA 5EE5B 1JR3A 3CRVA 1QG2A 2D3WA 1E2IA 4TL7A 1LTQA 4Z8YA 2G6BA 3C15C 3HPQA 3MUFA 1W5TA 4X8LA 2IS2A 1N0VC 3ZH9B 4DZZA 3GJ0A 3QXXA 5GADl 4DCSA 4E03A 1VG1A 4KFRA 3RWMB 2CHQA 2GZAA 1U8AA 5DN6A 3MLEA 3PG5A 3P4XA 1OXUA 1ESMA 3EAQA 3QKRB 2FEOA 3UIEA 3VTKA 2J45A 3W6NA 2QMOA 4LPSA 4DIEA 3RLFA 3Q85A 3AH8A 3I1FA 1ZD1A 2C9OA 5EQTA 2O8CB 4Q4JA 2FX3A 5L8VA 3OAAA 5HTKA 2FV8A 3RAPR 2V6JA 4L9WA 2JDID 5B64A 1FPMA 3LQQA 2CCJA 2JATA 3LWNA 3OEED 2FN4A 2LWIA 1G8PA 5TDHA 2RHDA 3CKLA 3NXSA 2CK3D 4D0LB 5EZ6B 2ZRAA 1J2JA 4NP6A 3CLVA 4MRPA 3JZAA 1FMJA 2CJWB 3AF4A 2IBMA 4HLUC 2XB2A 3REFA 2ZREA 1CRQA 1D9ZA 1S96A 4B71A 4YDHB 2PCLA 3TLXA 1AGPA 1G64A 2ORWA 1N3BA 3LLMA 4XJXA 3UXMA 2OM2A 3FHOA 1NVUQ 3MD0A 2XZOA 3L0SA 1UF9A 2AL7A 2BCJQ 2IXEA 3QPWA 1KI8A 4B44A 1LNZA 1X1SA 2J46A 1E2EA 4AYWA 1YR8A 5LD2B 3CWZA 1AA9A 4PSVA 4URVR 4EPTA 2X77A 2OBLA 1N6HA 3BOSA 2C77A 4CT5A 4OI0A 3FMIA 1KNQA 1X86B 2WKQA 5JLJA 4M2LA 1E79A 3TW8B 2KSQA 2ORVA 3DKVA 4I99A 2BBSA 3H84A 4JMPA 2G88A 3TW4A 2QGNA 1NF3A 1S1MA 3AKEA 5DLQC 2Q3MA 2YWEA 2OXRA 1WA5A 2WBLC 3TR0A 4FWTA 2EFCB 4D2IA 2GJ8A 4V0OA 1RC8A 1WF3A 1KI3A 1W49A 1ZVQA 1TX4B 1T6NA 2ZE8A 1NY5A 121PA 2WJVA 2OXCA 5AUNB 1U2RA 4W5HA 4TQAA 4QNMA 5G53C 3BK7A 2FFAA 1ZD8A 4CEHB 3QKRA 1T9HA 1P9WA 4GP7A 1KSJA 1D9XA 1Z22A 5JEDA 1ZIPA 2F55A 2C04A 2IYQA 3QQ5A 4LRWA 2O8CA 3NC1C 4O3MA 2XZPA 1MT0A 1MO3A 4C0SA 4LSGA 1II0A 1NNEA 1MABB 4QOSA 1M74A 1E4YA 1H65A 1OKKD 2J7PD 3K8YA 2VSFA 5FI0B 3EZ9A 4NKRA 3HYTA 1DARA 2C9YA 5CM8B 2MSDB 1DAKA 4Q4AB 5LPNA 1TL7C 2GK6A 4JLAA 3UG7A 3HPRA 5JRJA 2ZR9A 1UDWA 2CJWA 4TTPA 2ZXUA 3AKCA 1AZSC 2X1VA 2ZRBA 4RKFA 2DFNA 4KHZA 5TY0A 1T8UA 5KSYA 1LFDB 5F2EA 4ZDWA 4AC9A 5KDOA 4OQLA 4DKXA 4A8JC 2FGJA 3GD7A 1E2JA 4HI0E 4QGFA 4WZ6A 3B60A 1ZNWA 1SGWA 1OYYA 3D31A 1UBGA 3RWOA 3LV8A 5F3WB 2ZS8A 3EIEA 1RRFA 2V8OA 4DDWA 4ZDKA 2OUKA 4US2R 3C16C 1C9KA 4RZ3A 1JR3D 4MGYR 2XTZA 4B32A 3LBNA 4NHOA 1QF9A 3VU9B 1JB1A 4LJYA 4B3CA 2ZJZA 5JFGA 1XCPA 4IEEA 3PQCA 4LHXA 3DOFA 1PVOA 3SI7A 3IIKA 1DE0A 2QM7A 4MQBA 2R6FA 1L4YA 4G5OA 5DN6D 3C14C 1HT2E 1RZ3A 3B5JA 1N6KA 4JLOA 1IQPA 4DLWA 4ACBA 3SYKA 4C9BA 3PEVA 5FBLB 1N6PA 4P3YA 4HZIA 1Z29A 2ZR0A 3O47A 4KVGA 1OIVA 3G82C 3Q9LA 1NY6A 2XTNA 3GEIA 3OAAD 1UKYA 1XNJA 1NN5A 4H9GA 1G5TA 3PUXA 3TJZA 1LV7A 4B6EA 4QG7A 2HDNB 2ODWA 4MKFA 4A6PA 4K8OA 5BN4A 4CEHA 2D4HA 2ZJBA 2QORA 2WWWA 4D26A 2A2ZA 2ZRGA 2ZQ5A 4QJ5A 4TMZA 2P2LA 3MJRA 3IBGA 4LYHA 5DHAA 3WNCA 4FCWA 2WOOA 2Q6TA 1KJYA 2MSEB 3DOEA 3HR7A 3PEYA 2FDCA 2GXAA 2GJAA 2REXB 2EFGA 3H0KA 1FW6A 3PIRA 4JYCA 2GHIA 1SXJC 1GAJA 2ZUBA 5AUOB 5TB5A 4C30A 4DSTA 4BFZA 1Q1ZA 2ONJA 1JALA 4MGIR 1UEJA 2ZRKA 4JSYA 2ZU6A 2JJ1A 4DCUA 3AUYA 4XWKA 1CF4A 1G7SA 1G5RA 1ZUIA 4BLTA 4MYHA 5H1YA 5BYJA 1KK0A 1U94A 2Y8EA 1ONBA 3GQBA 2QZ4A 1IN7A 2RGEA 4G5QA 3CF0A 1Z6YA 2JJ2A 4DXAA 1Q57A 2R6AA 1QG4A 1E79D 2W0MA 2ZYTX 3X1ZA 2PJZA 3CF6R 4MITA 3CPJB 1T3HA 5C4GB 3U3JA 3ZS9A 4H1VA 4A6XA 4A0RA 5GJCA 4PFSA 4NYIR 2ZM5A 4LYAA 2BWJA 2AWNA 1VYVA 3VU9A 2FA9A 1EFUA 4HATA 3AVUA 5FOXA 3PUWA 1TTTA 3GEEA 5BWMA 3IEVA 4HDCA 4RKEA 4C0JA 5A4JA 2GF9A 1P73A 2EFHB 1CBUA 4JS0A 3KQUA 4LJ8A 2G77B 1IHUA 3OIYA 1T0JB 1M7GA 3A6PC 1DOAA 3KDSE 1P6XA 4MYUA 2CNWA 2EFEB 5E3HA 1KIMA 5AUPB 4ZCIA 1GIAA 1UJ2A 2BBTA 1BYUA 4EQ6B 2BEKA 2H18A 1DTSA 4ARZB 4DDTA 2FU5C 4GFDA 3EZ7A 2WVJA 4M9SA 2YC2C 4TLCA 3BC1A 1OHHA 1MO6A 3PCRB 4GOXA 5IK2A 4Q1BA 3EZ2A 1UBEA 4PXAA 3LA6A 4BFWA 2AXPA 3AVPA 1XU4A 1GILA 2J3EA 2ZE6A 4CEIB 2RGNA 1II8B 2GZDA 3A8TA 4M9XA 2WAYA 3O8RA 3NVAA 2PMDA 3EIHA 2VRWA 2WIAA 5FPTA 1HTWA 3ND9A 2DPXA 3TIFA 4TMTA 1OH7A 3ZIAA 4IVPA 3R9IA 1GL7A 1XB2A 1EWQA 3AGPA 1SHKA 4KBGA 4O25A 1Q3TA 1XEWX 4LX0A 1PLKA 2UZ3A 3H4MA 3ZDQA 4F93B 1XD8A 4RSGA 1E0SA 1O3YA 2C98A 1R4AA 3T1QA 4AIIA 3RS2A 1RJ9B 4IVQA 4POAA 2D06A 2QG6A 3TVTA 3ADDA 1KMHB 1NN3A 1VYUA 2Z83A 3NBYC 4MH0R 5A0FA 3GPLA 3T1TA 4LBWA 1XTQA 3DPUA 4ITRC 4D4MA 4M53A 3PJRA 4OKSA 1HQYE 1E32A 3Q8XB 3R20A 3AB3A 4B2PA 5FUVA 2PZGA 2BV3A 4JLJA 4N3NA 5EP1A 3THXB 3OE7A 1YZQA 2O8DB 2QT0A 4PZZA 1P5ZB 1ZNYA 3FDIA 5DI9A 1Q3HA 1BS1A 4TLBA 4IDQA 2YWGA 1P2VA 2F9MA 3D7MA 1KY3A 4FD2A 5FBWB 2YOHA 1ZYUA 2H17A 3AVWA 5TVKA 5EZ5A 4R2IA 1Z5ZA 5AUQA 5CLLA 1SHZA 1IY2A 4UKDA 4EJSC 1Z08A 1NVXQ 2GNOA 1JQJC 4X8HA 4LK2A 4QGAA 4OQMA 1P9RA 1XJ0A 2QRNA 3GJ7A 4G5RA 3G5UA 2ZITA 4ZDIA 2A5FA 3B9PA 2WSSA 1IONA 5L3QB 1DO0A 4H1UA 3VR4A 1KO7A 4EQ6A 4ARZA 3K09C 1XX6A 5FL7A 5JCPA 3DEFA 1YHNA 2F3RA 4HLUA 1R10A 2QRZA 1IN8A 4OL0A 2BKUA 3ADKA 2J41A 2B92A 2JJ1D 2NG1A 2QSYA 2ZSAA 3GJ8A 3LVRE 4ZCLA 3ZZUA 4UNRA 2WSMA 4ZKDA 2YHSA 4CEIA 1XF9A 2VPPA 1II8A 3TSWA 4A8JB 3JVUA 1EESA 5HR5A 4IDOA 3WNDA 3I3SR 3KTAB 3RVBA 3CR8A 1RRPA 2JJ2D 2HEIA 1G8YA 4DLZA 5FTLA 4D0NA 1E96A 2REBA 3FE2A 4OQFA 1SVMA 2ZI4A 1HV8A 1HYQA 4Q7JB 2A9KA 2R2AA 3CX7A 3DZ8A 3M0EA 2WPDA 3N2EA 4Q03A 1WRBA 3BS4A 1SVSA 3RS5A 1RJ9A 1A2BA 1BYIA 1KI7A 3FVQA 4M1TA 3GP8A 1SKQA 2NO7A 2ODBA 5EXTA 2IX3A 2NO6A 2WWYA 1HA3A 5IT5A 3A1TA 3FYHA 1Q20A 1NRJB 2OCYC 2FPMA 2JLWA 2IF2A 4JJKA 2EU8A 3JZMA 3IO5A 1C1YA 4NCNA 1R0WA 5SZKB 3THXA 1KKMA 5LBIA 3VR3A 2O8DA 3QVVA 4F91B 3Q7PA 2GVDC 2ORIA 4GT1A 4DEXA 1VIAA 2JLUA 221PA 3QF4B 1EG7A 4TL8A 4V0ME 4CDGA 3OIWA 3NDBB 4URWR 2DFTA 2CNWD 2ZRLA 5E7IA 4DC9A 3A1UA 3RS7A 4FI3C 4GMXA 4WIAA 1SVLA 1DAFA 4LY6A 5FPYA 2F9LA 5J4YA 2ZJ5A 4TQUS 4S2EA 2KBEA 5SZIA 2ZI7A 5DYGA 4LJ7A 1GSIA 4AKEA 1S4QA 2QMEA 4DWJA 1OHHD 4HZUB 5IK2D 3M6AA 1U0LA 2EFDB 3ND8A 4LYJA 4XD7A 1SXJB 4OHXA 3I62A 3IKJA 4DLUA 2XITA 4V0NA 1SXJE 3T1VA 5L3QA 4M4SA 2BBOA 2IT1A 2QENA 4P32A 3A4MA 1J70A 4NBSA 1MH1A 2R6GA 4JVNA 1RVDA 4LWZA 4KYIB 4ZDJA 3I73A 2VSOA 3KJGA 4LJ9A 3ZIAD 3NBXX 2IS1A 4LJAA 5DI3B 5FR1A 1G6HA 5CJPA 2HJVA 2WIBA 2I1VB 3U44B 1DAIA 5L3VA 5JEEA 3BD9A 2IYTA 4A8JA 3TRFA 3I32A 1VTKA 1WE2A 1M8PA 2PT5A 2QPAA 3TE6A 4QM7A 3I4LA 5DIFA 3NDPA 3AGQA 3DKPA 2ZVPX 4JL8A 3WRYC 3KTAA 1KI6B 3C4JA 4WXPA 4GRAA 2HXSA 1GNQA 3VKWA 4Q7LA 1KSFX 1VG0B 2IWRA 2V9PA 4DSNA 2J9RA 5FBRB 5A5GA 4P0TA 4PC7A 4EPXA 4RD2A 2OEPA 2ZANA 2BJVA 2ONKA 5JS7A 2CLDX 2JLXA 1LS1A 1E2LA 1E2KA 3OE7D 2H5EA 3AKYA 1ZC3A 1H8HA 4Q9KA 3L8ZA 4FCTA 3FOZA 1KHTA 5LB2A 3U2QA 4QC2A 1XTJA 3P1JA 4OK6A 2GKSA 2OLJA 3I92A 5CITA 4NH0A 4A2QA 3EC1A 1IBRA 4ESVA 2OT3B 3CBQA 4V03A 3VKGA 4C0KA 3MG9A 3TQFA 1YZLA 4V0MA 1T3LA 2QNRA 4Z1MA 1EFRD 3VKHA 4E07A 2CE7A 3QF4A 5LDDC 4KFUA 2J59A 2ZAMA 4NCKA 2P6RA 2EWWA 2WSSD 1FUKA 2AX4A 3CM0A 4M1WA 5TARA 2GEUA 3B1ZA 1K5DA 1Q21A 4QM6A 4G0NA 3RYTC 2LKDA 2XNSA 4ZCMA 2D62A 2VL7A 3N5CA 5DSZA 3TAHA 5FL7D 1W46A 5CYOA 3NEJA 1E3MA 3TUZC 4PZYA 3A1VA 4HZUA 3ICEA 3ZQJA 2AN9A 4A0FA 2JLQA 2ZI3A 3OF5A 1SXJA 2P5TB 4QJ3A 4MKHA 4A9AA 4GMDA 5TMPA 3K0AB 5AJYA 1MRSA 1P2TA 2FWRA 2A3RA 1MO4A 3PVSA 2HF8A 2WHXA 3T15A 4TYWA 3LNCA 3QENA 4PQRA 1ELOA 4DJTA 1YVDA 1UADA 2XB4A 2BEJA 3WMEA 1LY1A 3FFAA 3BXZA 5DI3A 2G9NA 2NOAA 1CULC 3A1WA 2BOVA 4DLYA 5C1BA 3AVXA 5IF9A 2KI5A 3U44A 1X8KA 4MKGA 5JWRA 1D6JA 1XD9A 3MWKA 4Q9IA 1NKTA 3W34A 2GJ9A 2WPDD 4A0HA 1KK2A 3EIQA 1W47A 3MSXA 2YOGA 5C46F 1VHLA 3FHCB 4N0DA 4NDZA 1KI6A 3CNLA 4URUR 4XWOA 2HCBA 5GJVC 4TYYA 3V00A 3K70B 2ZRJA 1JJ7A 4E22A 1S3GA 2WJJA 2YYZA 3IPXA 3L0OA 4TMXA 2CDNA 3NBFA 3PENA 3GJXC 4PAMA 3T61A 1G5PA 4Q01A 1N25A 2XJ4A 3H86A 3EPJA 3IQXA 3QEOA 2BJWA 4LJ5A 4KFSA 3UMRA 1DAMA 2DWPA 2YWHA 5EUQB 4U00A 4QHYA 4CEJB 1G21E 3W8RA 1HT1E 3SHWA 1Z0JA 1RW4A 5F9FA 1I4TD 4G5SA 4EPYA 2WTUA 3SN6A 1HH4A 2QGZA 4KSBA 5CIWA 3GJ5A 4QHSA 2HLDA 4OYHA 2QTFA 4DEYA 4GNKA 3SBDA 2GF0A 4TYPA 1JJVA 4XD7D 5AWFC 1BH2A 1VPLA 4CT4B 1KO4A 4RD0A 5B57C 1NLZA 2QP9X 1QVAA 2ANCA 2HUPA 3ETLA 3KQLA 3LX8A 5FTNA 1XBTA 2H8KA 2WJGA 3B7GA 4LUCA 3I5YA 1D2EA 4MDFA 4DDUA 1D2NA 4P31A 3BH7A 2KBFA 1IN5A 1DS6A 3K0AA 1GVNB 1TUEA 3HWSA 1G9XA 3LXRA 1CS4C 1S9HA 3W6OA 4LV6A 4M9QA 4OHWA 1YKSA 2PX3A 1N5IA 4FW9A 3AVVA 5H68A 4FINA 3QNUA 3B8HA 4WW0A 2V55B 1Z2CA 1DAEA 1ZM7A 3AEZA 4Q1FA 2YC4C 3E5HA 3MAAC 3ONWA 2BIFA 3H1TA 1SVOA 2ASEA 1E98A 1M7HA 3WHLA 4PHGA 5KPJA 5KUTA 3TGPA 4Q1EA 4V02A 2P5SA 5DNYB 2QP3A 2QP4A 5KU1A 1P2SA 3KQHA 5M04A 2LKCA 1CR1A 2MMGA 3B2EA 3GEHA 1H8HD 3B6EA 1XPOA 1KKLA 3WMGA 4D82A 3A58B 4QRHA 1NMXA 2IYXA 1EFTA 2VHUA 3ADCA 2D7DA 4DB4A 4A36A 3U3OA 5BW8A 2J0QA 1NP6A 1ZU5A 2RGDA 4BFYA 4BUJA 4CRWB 3THYB 1U8ZA 2IW3A 2WJIA 4PO9A 4RFVA 3VNVA 2OESA 4Z1MD 3IHWA 1JAHA 1NBMA 1OYWA 2ERYA 4JKIA 1CIPA 2AFIE 4CEJA 4B75A 4Q4LA 2EWVA 4RVCA 3NH9A 4DLTA 2JASA 1VHTA 1W5SA 2GZHA 3Q3JB 3Q72A 4LBVA 3SFZA 1OH6A 3B1VA 2ZYVX 3AVTA 2DYKA 3RNLA 1JXOA 4RD3A 2J0UB 4PO1A 1K6MA 4ZI2A 4GPTA 1FTSA 2BDTA 2VA8A 2W00A 3KL4A 3HP1A 3T34A 1XPUA 2XEXA 1SXJD 1AK2A 3K09A 4JYBA 3WP1B 5JCZA 1NN0A 2JLRA 1IY1A 1L7VC 1KNXA 3CIOA 3WXMA 4JBWA 3FTQA 3IUYA 4B6FA 2YV5A 3ZGXA 2FZ4A 3BFXA 4I1SA 1X8JA 4II7A 2C96A 4OBEA 1VG8A 3IGFA 4Q1AA 2N42A 4TQ9A 1OFIA 4AYXA 4KI0A 2WWXA 1TQ2A 5FTJA 1R8SA 5GVSA 4TLDA 4W5WA 4BWYA 3THWB 4QXAA 1LF0A 5BYKA 5L3SA 1DBSA 1M6NA 2EQBA 5DGXA 5JWHA 4BRWA 1FP6A 2EVWX 2YKGA 1JPNA 3K1JA 1E9BA 1JXMA 2J5XA 2QTVB 1UFQA 3B9QA 1J8MF 1N6LA 2VQSA 1N6NA 3QOFA 1QBKC 2R6CA 4MYCA 3WNBA 2X19A 3K9NA 5FPHA 2AHOA 1GM5A 3K0CA 2QN6A 1R0ZA 1E2MA 3DM9B 2CMKA 1J90A 1G3QA 1U98A 1ZBDA 2BM1A 4M1MA 3W5IA 1QHXA 3IPYA 3A36A 1GFIA 3EPHA 2JIZA 1DAGA 1LW7A 3B13B 1CJTC 3M4YA 3QPUA 4JVLA 1TQDA 1CR4A 3FPAA 2IYYA 1G8GA 2FSFA 2HLDD 3THYA 1T0HB 3V4RA 5SZHB 1KJZA 4IHQA 1S9DA 2A5JA 2AKYA 2DB3A 2QL6A 3FMPB 4Y0VA 3K0EA 1GNPA 1XP8A 2NO1A 1KO8A 2XNDA 4BQSA 3W9YA 2GESA 3A4LA 4GI7A 3S1AB 2G0NA 4HB4A 1F3OA 2PBRA 1L8QA 3T06B 2PEZA 2ZRIA 2J0UA 3BAFA 3F5FA 2AK2A 4V0LA 4BGDA 1FQKA 3SJZA 2V7QA 1OB5A 1KAGA 1EFCA 3MWLA 2GWHA 4TZ6A 4IFBA 2C78A 1U0HC 4RZ2A 2ZSBA 4D25A 3K9GA 3AF0A 1P7CA 1CJVC 4TYNA 3TQCA 1Z6XA 1Z28A 3LBHA 1ZP6A 1SULA 4HB2A 5JJIA 3ZVLA 3G0HA 1IJEA 1NL3A 821PA 1JNYA 2BMDA 4I4LA 3SYNA 4NYJR 4BEBA 4MUBA 1A82A 3NKVA 4KBFA 1BMFA 2RGCA 3U61B 5CK4A 4LC0A 1OXXK 3OESA 4M9ZA 1OXTA 2FNAA 4IDNA 1US8B 4YONB 3MWJA 4US0R 4TTRA 2O8BB 1N6OA 3TSOA 2OHFA 2V6IA 5J4VA 1OIXA 4TN1A 3U60B 4JLDA 3EASA 3THWA 4IXMA 3SS8A 1XEXB 2WMOB 4IFEA 1SZPA 2ZE7A 5HZHA 4DRZA 2RAPA 1FUUA 3K70D 1MO5A 1MABA 1W1WA 3ZQ6A 4DLRA 3TUJC 3C5CA 3E2IA 5KSOA 1Y63A 2GJKA 1G6OA 4F7WA 1Z0IA 3I8SA 2ZJYA 2V1XA 4Q4AA 1KZ7B 2F1RA 3UG6A 4A2PA 2ZSFA 4LC1A 4PSAA 4C0AC 1E0JA 1TAGA 2PEYA 4P4TA 4LOAA 5J5CA 1AS0A 1R8QA 3BFVA 2IK8A 1NIJA 3KX2A 1NVWQ 2AKAB 4MUAA 3UK6A 1RRCA 1W36C 1Z63A 2W6IA 4BLRA 2HYDA 5JI2E 3SYLA 5FBVB 3W6PA 4ASUA 4XSHA 5KDDA 3FMFA 3P32A 1LB1B 3J81k 2ZETA 2JLZA 1B23P 2IYVA 3R8CA 3S1AA 3V9PA 4IEIA 2C99A 4UNSA 1VDZA 1GOTA 4NYJQ 3KQKA 1WBDA 5JHHB 3NHBA 1NKSA 1I2MA 4FMDB 1GRNA 2E9SA 3K0FB 4YDSA 1GL6A 4KCGA 4TYQA 4M8NE 3L82B 4X8OA 4DLXA 4D4KA 3WMFA 1PV4A 1OW3B 5FI1B 1ZMXA 2C5LA 1W44A 2PH1A 3TUIC 1KAOA 4PPFA 5B2ZA 3CRQA 2L0XA 3L8YA 4NPHA 1XMSA 1U90A 3FB4A 1US8A 2O8BA 3KXKA 3PUYA 4DSUA 2FSGA 4C0HA 1Q44A 2FOLA 1HQCA 1WDTA 4B2IA 2IYWA 1JEDA 1XEXA 3BORA 4MA4A 2QAJA 1E9EA 2ZSDA 3QKSB 1Z47A 3AF3A 1AS2A 3PV0A 4LYFA 5E7JA 2BC9A 2QY9A 2W58A 3P4YA 3U7HB 3QKTA 2JIZD 3VHXA 5AJXA 3SFVA 4A1FA 2GJSA 1O87A 2F3TA 3CO5A 4B74A 2MSCB 2PZEA 4EFLA 1TU4A 2VP5A 3SJAA 1IXZA 5AJVB 3SEAA 4OHVA 4B3XA 4BEJA 5AJWA 2QPOA 1KSHA 4UJ3A 3WHKA 3BB3A 1QHYA 1T91A 4KXFB 5KDLA 4CYMA 4PC6A 3ZD6A 2XXAB 1TEVA 1VCMA 3EPKA 3EX7C 3K53A 3RC8A 2RCNA 2ZJ8A 2BHRA 2XNDD 4NYIQ 5P21A 5HPYB 3F3YA 1XDBA 1NI3A 1ZAKA 2RHMA 4MRRA 1RIFA 4LHWA 3SBEA 3LBIA 3HR8A 3AM1A 5JI3E 3I72A 1ODFA 3ZS8A 1KK3A 1P60A 4LBZA 5FOWA 2GAOA 2V7QD 4MGZR 4RFSB 1R6BX 2DWQA 3T1OA 1FX0B 2G1JA 2PMKA 2QEQA 3OFNA 1HEIA 2XOKA 1OH5A 2ZEJA 1U9IC 2VHTA 1EX6A 4FMCB 4TL9A 1COWA 4C0LA 4TMWA 5HCNA 1PLLA 4OK3A 2WWGA 1AIPA 4PR0A 3FHTA 3EZ6A 1AQYA 1BMFD 1IJFA 2VP9A 4HAVA 2GBLC 4EFNA 1KZGB 3K0FA 2QUZA 4HB3A 2IF0A 1E2DA 2CL7X 3WBKA 1P62B 2ZSEA 4E5UA 1N6RA 2OAQ1 2KB0A 3D8BA 4ILEA 4MRSA 1XD2B 1GP2A 3EA0A 5EE1A 2YOFA 2OCBA 1YZTA 5EJEA 2ZU0C 3VMFA 5KTYA 4JT4A 1QVRA 2WV9A 5FH9A 3ZVNA 2N1BA 1KI4A 2QI9C 3CR7A 4G3XA 2JLYA 5FBQB 4BZPA 4R71A 2VP0A 1S2MA 1KI2A 1OT3A 2YINC 1S8FA 2CL0X 2ZS9A 2J7KA 3W5JA 3VX4A 3UMFA 1XFAA 2P67A 3UATA 1SKYB 1FNMA 2N46A 1F2TB 1SKYE 3QKSA 4HAXA 4ACAA 3AV0B 1PJRA 4MDEA 1DAHA 4B35A 1G19A 1E99A 4PX9A 4B3GA 1G3IA 4PAQA 4YXWA 5D3QA 3R7WB 3A4NA 4LJ6A 3LVQE 4NYMR 4UQOA 3QPVA 1Z6GA 4Q19A 2W6ID 4RCZA 4HDQB 2PLRA 2GXSA 3THOA 4E09A 2WWFA 2AD5A 4NU0A 1CU1A 2JLVA 4ASUD 2XXAA 3R8FA 4C0BA 3AF1A 3B1XA 2IA5A 3HDTA 1N5LA 3DL0A 1ZM9A 2ZJOA 4PSKA 4RJLA 5CDFE 1KMHA 4QHTA 4N0EA 2HV8A 1GTVA 2XSZA 4PANA 4LJ4A 4MGKR 1OXSC 5K8IA 3VR5A 3CZPA 1F5NA 1OF1A 1TQ6A 2P6UA 3KQNA 4RFSA 1YZUA 1ZNZA 2Z0MA 4HUQB 4A82A 1FX0A 2NGRA 4YQFA 1A1VA 3RRYA 4Q9HA 5B30A 1QHSA 2Q3FA 4C3ZA 3DMNA 2QSZA 4RCYA 4M22A 3FWYA 4IJMA 1N6IA 1G3RA 1ZW6A 1CJUC 4IOKA 5HE8A 3C7KA 4AI6A 2IUTA 2A78A 4BPBA 2RKOA 4RZXA 3FFBA 2WJYA 4YC7A 2ZUDA 4B47A 2V1UA 1HE1C 1VMAA 5IRCD 2ZRHA 4ZPXA 5AK0A 1XD2A 4KVAA 1KDTA 4KJZA 4ZKEA 1N0UA 1P3JA 2WKRA 2FPLA 3LLUA 5CJ2A 1W0JA 3V4FA 4P4UA 5KOYA 4RD6A 4BFXA 1G8FA 521PA 2REOA 1U0JA 4BE7B 5JBQA 5F98A 2CBZA 1T5IA 4WBSA 3T35A 1GITA 3IIJA 4G1UC 4UJ5A 2W2VA 3QF7A 3GCGA 4PTLA 4O2RA 3ASYA 1F2TA 5E4FA 5HE9A 1GRRA 1E9CA 4BECA 3SHFA 3U7GA 2FSIA 2OAP1 2OFWA 2VTKA 3GLFB 2J1LA 1AQUA 1R0XA 1W36B 4QBFA 2QU8A 2ZRMA 3R7WA 3EW9A 3GFOA 4QNRA 4KODA 1NMYA 4C0QC 3BFKA 1IXSB 1KY2A 5L3SB 3N2IA 1W2HA 4M1OA 1KOFA 2ECKA 5CDFA 1X8LA 3OFND 2XOKD 4HLQB 4R9UC 1G20E 1W4RA 2A5YB 4K81B 3QG1A 5EXPA 1COWD 2NZ8A 4TL6A 4LV5B 1QHGA 1WB9A 4CW7A 4BFUA 1AM4D 1P2UA 1GNRA 1UAAA 4EPRA 4HUQA 3HYRA 3GFTA 2ZS7A 1J8YF 4JLNA 1CJMA 4WAUA 3EXAA 1OFHA 2WMNB 1E94E 2FGKA 4AG5A 1Z07A 4B48A 1X1RA 2IYUA 2QROA 2XX3A 3MFYA 2F43B 5KSPA 4RZUA 3BH0A 4HB0A 4WA7A 5JS8A 2R6DA 2GCNA 3VFDA 4OJKA 2BBWA 1XXHB 3MMPA 1DEKA 2AR7A 2RGAA 1G7CA 3EWAA 3IO3A 2IUUA 1TF5A 1MRNA 4DDVA 1CP2A 2Z5FA 1YR6A 5J47A 4YXWD 3ZLJA 2FMXA 3TSZA 5HKKA 4WZBE 2IEYA 2JEOA 4D80A 1UBFA 3U7EB 3T5DA 1YJ5A 3QEJA 4L15A 4U02A 2B6HA 2JLSA 4LPKA 3DVLA 4EUNA 3PFIA 1Q1BA 2FSHA 8OHMA 2ZRDA 1D2MA 1E0AA 2ZAOA 4IKEA 5EE9A 4EAQA 1CTQA 3SE0A 3T5GA 1TEXA 3GLFA 2NPFA 4ZV4A 2ZYWX 3W90A 1FOEB 2ZIAA 1R5BA 3R9WA 4YMUA 5CB6A 4O2LA 4BRUA 3VNUA 1GKYA 2XSZD 4O0MA 1F60A 1Q22A 3C41J 2H16A 4OQXA 3RANA 2AK3A 3IDQA 3LAWA 3WYGA 2W2TA 1UKEA 3M1IA 2E87A 2Z43A 2ZPTX 3CZQA 3GFPA 3GJ3A 3KUDA 4PC3A 4L9SA 3SR0A 3ZZ0A 1P4SA 1VCNA 2O52A 4FXPA 5BN5A 1SVIA 5J4LA 5DHFA 2KE5A 3ZD7A 4R2HA 4YMVA 4GZLA 2GEDA 2XZLA 1KK1A 3E70C 3LRPA 1ZINA 2C95A 3X1WA 1NBME 4EJSB 4PQFA 3GMTA 4JLKA 2O0KA 2DBYA 2HYIC 3TKLA 4JVSB 1JBKA 1E4VA 2GAAA 1VYTA 1OKKA 2D2FA 2ZR7A 2GETA 3I61A 3NHAA 3AP2A 1GZSA 2BMFA 5K8TA 2RGNC 3C8UA 3SOPA 1CR2A 1E1QA 2CLCX 4OHYA 4ON9A 2G3YA 3AQ4A 2IYLD 5FOSA 2FFQA 2OCPA 2QE7A 1YZKA 4L8GA 4QBHA 1W0JD 2QAGC 3VR1A 3LXXA 3NH6A 5JJLA 1LS6A 1KGDA 3OIVA 1DG3A 1EX7A 3RSOA 1A2KC 2F43A 3ZYCA 2GXQA 4QKQA 3BERA 1K8RA 1TF7A 2VF7A 2TMKA 3KKNA 1ANKA 4J0QA 4B3BA 1XXHA 1UEIA 1M34E 1ZNXA 2BM0A 3X1YA 1XZQA 1F48A 3IEUA 4PPNA 2Z4RA 2Q9BA 2OBNA 1T5LA 4KO8A 5KNDA 2QA5A 5E95A 3PUZA 3HJNA 5GVRA 3GLIB 5ELXA 1UKVY 4EFMA 3TVDA 3GLIE 2PLFA 2VHCA 2OLKA 2JA1A 1ZRHA 1KDOA 2IUSA 5DYIA 1OXVA 5CIQA 4AK9A 1GRQA 1XRJA 2RGBA 1M1YE 4FMBB 2XGJA 1IAQA 1I4DD 2K5UA 2O8EB 3W8NA 2EYUA 4Q66C 1Z6AA 1SVKA 2XJ9A 3CPEA 4R7ZA 3PXGA 3T12A 4ERNA 3DHWC 2RB4A 1XCGB 5JJKA 2O0JA 1EK0A 3DMDA 4A0GA 2IS4A 1CEEA 1DPFA 3RC3A 3RRNA 4TSFA 4Q7MB 3REGA 1TNDA 1D5CA 5KYKA 2OO7A 2B7BA 1IOZA 4QGHA 1R5OA 2H7VA 2GK7A 1U9IA 1D8TA 4P33A 1G16A 2NPIA 3EZFA 5FL3A 621PA 4Q02A 1R2QA 5CLQA 4Q00A 5FOUA 4IOMA 1QRAA 3QXHA 2UZIR 4HUTA 3SNHA 4Q7KA 4JSTA 4DT1B 1DG1G 2GBLA 2QMUA 1JAIA 2OSBA 4PZLA 4EJSA 1Z83A 4IXNA 1XTSA 3RRMA 4L5BA 3UWOA 1AS3A 1P72A 4LGMA 2J0SA 1E9SA 4RD4A 3HU1A 1RPZA 3MCAA 3FMOB 5KSZA 3W3AA 1FZQA 2LCFA 4I1VA 2W6JA 5DE3A 5EXSA 2OE2A 2F6RA 4GOJA 4HAYA 3EPLA 5TXGA 3ZVMA 3ECCA 4Q48A 4EIWA 2GA8A 2FFBA 4UXHA 4BLPA 1F6BA 1S1CA 3LH5A 4K46A 4NONA 1XTIA 2IYRA 4B73A 1R0YA 2F1JA 1AJEA 2ZUCA 1JPJA 2VIIA 2W83A 1FFHA 1W0KA 3EC2A 2GCPA 2YZ2A 5TV2A 4CZ2A
chains in the Genus database with same CATH superfamily
3BXPA 2P6PA 1KQOA 3GRRA 3OP1A 4B76A 4PGGA 3I2HA 2DWCA 5J2UA 1ZH2A 2WT4A 5J2TF 4TV9B 1QYXA 1JDSA 3U3MA 4DIDA 2W2XA 3M81A 4GX5A 2BFCB 1T9GR 2V4ZA 3TBFA 5F7ZA 3E35A 4MVJF 4WH0A 3BRWD 2E5WA 4A4DA 3AKZA 1O4VA 4E2YA 1E6UA 1LGYA 1PZNA 2CLSA 3C3PA 2FR8C 4RHYA 4WK2B 2UVQA 2Z09A 4QASA 1QHFA 2FEMA 2YFKA 4KQXA 1R15A 1ZCBA 3G2PA 1JZQA 3FUTA 2DP4E 2A8YA 2V7VA 4XIIA 1SRRA 3WB0A 2KHZA 4PAWA 2RGRA 1L3IA 1T24A 1UANA 3PB3A 1FX1A 2GPTA 1W2WB 3DTYA 3H7AA 1TYBE 3Q3GE 1IOLA 4LI3X 1JI0A 2BL4A 4L4UA 4URYR 3KJEA 5H8WA 4UE6A 4WUTA 1MAHA 3BGWA 4BPRA 1QCCA 4D4HA 2Z56A 4J90A 4X1YB 4HAZA 1OAAA 4YRBA 2B21A 2O1WA 1GHTA 4J0DA 4LI0A 1T4CA 2LW7A 3WRVA 1E2UA 3AHEA 2ZYAA 3HYLA 4XGRA 5D86A 3EUAA 1R4ZA 4DC0A 3DNMA 1B8VA 1XV5A 3V4PB 1Z8HA 1Z6QA 1X9IA 2DQSA 3AEUA 3DWFA 1YL6A 3I2JA 3I9V6 3L43A 5EJ5A 2BMAA 3IELA 2H8GA 2X8AA 3RYFA 4DT1A 4MOWA 4ZIRB 4ZV7A 1VIDA 1QGZA 1MQSA 2QE7D 1RE0A 1RWXA 3H7IA 1PZEA 2QQ5A 4UZSA 3OHMA 4F9EA 2NO0A 4H08A 2B7CA 3SLGA 3VR6A 1KEPA 5DX1A 3UJDA 2AD1A 1JIIA 3B85A 1LPBB 3D4OA 4L7QA 4XRRA 4PN7A 3ELDA 4MXDA 1EFVB 5F5NA 4C2TA 1KO5A 1VL1A 2OZEA 3R2JA 2CNNA 2GRUA 4NCJA 3NW9A 4MQ5A 5AQ1A 4RYLA 1CEXA 2R96A 4IBOA 1Q0UA 2GBGA 2GCOB 3ESRA 3TMKA 2UUPA 4JMLA 4D0GA 4Q9JA 2Q5IA 1PK8A 2V03A 4A27A 3E0XA 1P1HA 3BYZA 5IFLA 4CV3A 2X8JB 3TTUA 1JHYA 3OFKA 3PPVA 3SD7A 1O9GA 5TPWA 3Q5EA 1RQGA 2ETXA 1PQ4A 2GZSA 5GJWC 4W4TA 4MI1A 5NULA 4EYEA 1ILEA 2PKQP 4KLZA 4FZVA 4HFNA 2GCEA 5CH3A 4EEKA 9MHTA 1T10A 3T3IA 2AQHA 3OLCX 4WTOA 3ANLA 3BJZA 4DKJA 1LDBA 4D8WA 2NIPA 4EG6A 4W6ZA 1M6HA 1YTLA 4LEIA 1RMTA 4PR3A 3G9QA 3WRYA 4CTMA 3R44A 1YQGA 2P6NA 4NBTA 2FUCA 3M5PA 1Y5NA 3F8WA 5CLJA 1KRWA 3ZD9A 1MV5A 1T0BA 4RO0A 1I2DA 5EE0A 2G07A 1OI7A 5BWNA 1QV9A 1GAQA 2DWOA 4XM0A 1QZTA 1WCV1 2ZYIA 3FKQA 3JPWA 5HF5A 4W9MC 1CJBA 4IDHA 1U5AA 1IQRA 1H4VB 4IMRA 5F21A 4BVJA 3EEBA 4F5ZA 1EDOA 1P31A 1XLUA 2SKEA 4U5XA 1E2FA 2BE7A 2C0PA 2K2WA 2Z2KA 3S44A 1MPTA 4FQ8A 4MPRA 5BVHB 4TKLA 5JALA 2WD7B 4MUEA 4OQQA 1KYIA 1SUCA 4XASA 3TNJA 3DBRB 3K2IA 4LRUA 3PUVA 2FE4A 3V46A 2EERA 2PSEA 2AFVA 3U13A 2VBCA 2ZQYA 3NCHA 4F4CA 1DOHA 2J87A 4BVBA 5TJHA 4F6CA 1YQTA 3IXMA 2DR3A 2VRBA 1BFUA 1JP7A 4NK5A 2OENG 3VMMA 1SOWA 4AJNA 3BJIC 4EW3A 5BN3B 4CR7A 3L5KA 4NCIA 3QG5A 2R79A 4V24A 4ZOCA 3ZDZB 4CUZA 1JDPA 3OIUA 3OPMA 3W3AD 4DY4A 4V0SA 1R4MA 4L5CA 3EWSA 4FKMA 3G8CA 3MN1A 1KL7A 2A5DA 1OX6A 4DQDA 1VLMA 1E6WA 3H87A 1GGKA 2DWUA 3CLRC 3SDZA 3ZHVA 1CHNA 5DMXA 2H2AA 3DE7X 1C2YA 2OV2A 4PN3A 1XNGA 2HCRA 2Q3JA 3GFRA 5FUYA 4S35A 3JQBA 3FDJA 3WGKA 4K28A 1A88A 3B78A 2F3UA 4OGLA 1J97A 3NT4A 4NBKA 5EMNA 4Y6SA 1RRMA 1PJBA 3PEUA 1PYOA 4HFJA 3H8SA 2O5VA 1L5RA 4G84A 4TTQA 1VI2A 3FTFA 5A1TA 2XUKA 4XRGA 4S24A 4DUPA 4NU5A 1D09A 1EQAA 2ZJAA 3A9SA 2X2EA 1WHSA 2QX9A 3FCYA 3O2NA 4G5XA 5KNLA 2PZAA 3DUFA 4RCVA 5BNWA 4YMSA 2C59A 3AZOA 3O8DA 2BI4A 3LVFO 3WLNA 5LXTF 5HGJA 2J09A 3P2EA 5KQGA 3PEEA 1N1MA 3O90A 3ECAA 1RP7A 3IODA 5KNBD 5ITWA 1EWRA 1VECA 2CJXA 2GTHA 1QU3A 1YVRA 3X0DA 1BN7A 3A04A 3RHTA 4NFSA 3FDXA 1U9ZA 1H8ED 4P4SB 2Y1KA 2RH5A 5BV2P 3FI9A 1QHHB 1X39A 3CJTA 3KFXA 4WXRA 2JCXA 2PV0A 4DJAA 1ZH8A 3G49A 4CR8A 3AL2A 3VPXA 3GGPA 4BZWA 1IOWA 1U7UA 5ALNA 2HCJB 1EE2A 1G4AE 1L8OA 3PT9A 3VSCA 3G85A 3SHOA 3CZMA 3KO8A 1F1BA 4IIHA 2BT4A 4PBRA 1RFLA 2XB6A 1TQ4A 4MV6A 1T6YA 2VQFB 2BCEA 2FLWA 2XVYA 3NVKI 4WOBA 3EH2A 2NTYC 3THRA 1QRUA 3S3TA 2O3TA 4JT2A 4K5QA 2JFGA 4JI7B 1U0SY 3EGEA 2RC5A 1NXTA 1G7TA 3AR7A 4HLCA 5D85A 1DNPA 4R8VA 4LDQA 3ZBTA 5EQJB 1ZD3A 1AKVA 5IDYA 1E2PA 4MS1B 3ASUA 3KKMA 5FQNA 2OPHA 1E5QA 3R5TA 3X1DA 4RTKA 3FWKA 3A70A 3I30X 4O59O 2HV9A 4EY6A 3OZEA 1OXMA 4GEGA 3MWFA 2AYXA 4NBLA 1JSLA 1U3FA 3LO8A 3PIDA 4GO1A 3PBKA 1YR3A 2VAXA 5F73A 5C8YB 1EB9A 2CZCA 5ECGC 2OO5A 1JEEA 3B36A 3SDSA 1N4DA 4DR2B 1JQ5A 2QRPA 3DDCA 4HAUA 3GFGA 3OCVA 1MIOB 4Q47A 4FE3A 3WZLA 3GLGB 3OQBA 3RYCB 1LPOA 2ARKA 3HBNA 3O93A 5ADHA 1OB2A 1P2GA 5ITSA 1II9A 4OOFA 4UVEA 1AMNA 1M2NA 4M0EA 2Q3HA 2NQ2C 2QV7A 3WGGA 1TAQA 1KPHA 1O9HA 4JBYA 2OHXA 2V54A 5AVKA 4IO1A 3KV3O 4JP1A 2R1VA 3IPAA 4BHTA 1E8MA 1QC5B 2OYSA 3CUKA 3D8RA 1ONOA 3KJHA 3P5BA 4KV9A 4X1KA 5EXXA 4N5IX 3L7IA 3SSNA 3HJFA 1FNNA 4D0RA 3LK7A 4DXHA 1XOIA 2WDZA 3NP9A 3T0IA 3GLSA 2VLIA 1EEXB 3V6MA 2PQ0A 4DDHA 2WUWE 1AF4A 4S1TA 4BJ5A 4JKYA 2H65A 3A3YA 1C8KA 3AEQB 1NFFA 4XPIB 1LLCA 5FBHA 3QBVA 2PGAA 4BZQA 1DCMA 3EULA 2V98A 3LBYA 4I36A 1WXQA 2PZJA 1ZJ6A 5G41A 4AT1A 4ZI7B 3C5WP 4JJZA 2WF6A 4CGZA 1M2GA 2I1QA 2H4JA 1UBCA 3SICE 5DBEX 1FSGA 5IDXA 2C2GA 2YVUA 3LL7A 1UJMA 1ZKMA 2WA2A 1W34A 2H6EA 3CU5A 3G9XA 4IY1A 4TWZA 1Z2AA 3UJNA 2GTPA 3CVYA 1H0SA 2C1EA 4IXDA 2ANBA 2PL5A 1XIVA 3F67A 3MJ4A 4UMEA 3UN1A 4BQRA 2G1PA 2YL2A 4C7OB 1JECA 2ZAGA 3BIJA 1C1DA 1ZCJA 1OBFO 3KBOA 1EWTA 4PPGA 3QIAA 3ENKA 2FF5A 2CBGA 1EFAA 1OBCA 3PX7A 1L5VA 4YVFA 4ZYZA 2BY4A 1XP5A 2IDZA 4KFCA 5LLSA 3SIXA 2LV8A 1KY5A 3DV9A 4U2FA 2LUOA 2A9RA 2JIDA 4Z9XA 5LWQA 4MVXA 4WZZA 4YA6A 3HEBA 4MWOA 1XMVA 5EJ8A 4Q4HA 3NKLA 1SAYA 4AKTA 1CRPA 4NL4H 3IUPA 3QW2A 3GLHE 1M2VA 2H92A 3ZDYB 1DTWA 4DR4B 2JIBA 4OGKA 4AL4A 4FYYA 4W63A 3OVMA 4G4SO 1QHIA 5D6OA 4LJRA 3K0HA 3UWDA 1KHHA 3VR2A 4RVFA 2O8NA 2NU6A 5EMLA 2J0VA 1QOPB 3BULA 3W5UA 5EIXA 2AFHB 1UMKA 1A4RA 4PG5A 3T38A 1RYBA 4UHFA 3LC2O 3DVAB 4LYEA 2J9FA 5KKNB 3A9RA 2WWIA 5BSFA 1O94A 4MQ6A 2GBPA 1GDDA 1XL1A 3N0VA 1POWA 2WJHA 1GG2A 3F97A 1TQ8A 2OBXA 4WX2B 1FL9A 2IPXA 2D74A 2Z6VA 4QDXA 2HREA 4FFMA 1V2GA 5CM9C 2V5AA 1HQKA 5IW8A 2W2LA 2NU9B 3TRKA 1FB5A 4DLKA 5IXYA 2WAXA 4ADSG 4AJIA 2HW8A 1ZU4A 4C03A 2Q6LA 7REQB 3KLBA 2JAWA 3O6VA 3DWEX 2MWMA 4KR0A 2QRVA 3CG0A 3PR1A 1HZJA 1E1RA 1ESDA 4L78A 3D8TA 5DISB 4EZEA 3O3OB 3NOXA 3PPIA 2NSJA 5KHOC 3AUJB 3IE1A 3KD3A 2QBYA 5EYPA 3TOZA 4OLBA 4AD8A 4KWCA 1OPXA 3PKIA 3WLTA 1WUYA 2E49A 1EPUA 1AKYA 4JI8B 1FP4B 4IZ6A 2C88A 1NVVQ 2XHEA 1VCIA 4N7JA 3H42B 3RYHA 2VH5R 3ZGOA 2OILA 3K05A 5DGCA 3OM9A 2HNBA 2JGFA 2DY1A 3EA5A 4W8GA 5DTJA 4A2WA 3V5NA 4WNCA 2IC5A 4K9KA 1KH1A 4ND8B 1AN0A 1U0FA 1VKRA 2PXCA 3D1LA 3HVJA 3QHAA 5JMWA 3B3FA 1W7AA 1YB2A 4YI3A 3TR5A 1V1MA 1HPLA 1BU5A 3LOQA 2QIPA 1U1CA 3CH4B 3CKYA 5IVIA 3IP8A 721PA 3CUEF 3C6YA 3NORA 4OI1A 3PITA 4UE2A 1O0CA 4WOPA 4L2IB 4M1KA 1E58A 1R4NB 3B53X 3OE5A 4FNOA 3W7BA 3RS0A 5DBHX 2UKDA 2B4YA 2P3OA 2VPWA 1HUQA 3WBJA 2ODNA 1V16A 3QXCA 4JXKA 2V6BA 3QGMA 3LT1A 1QK5A 3ZJ5A 2YY6A 4YN3A 4ISCA 5JZSA 3VXKA 5JNVA 4Q9LA 4KU4A 1RXYA 4PYRA 1CYEA 1O5IA 3C45A 4QGGA 1AT1A 2EAUA 3LDHA 4JXZA 1CUWA 3OM8A 4Z51A 1WDKA 3Q87B 4ID9A 1E6CA 2HK9A 4LXHA 1NJFA 5LYJA 4R98A 1CUXA 1ODLA 2QMHA 1Z12A 3JD0A 3NUZA 3FWHA 1TRHA 1V3UA 3ABRB 3ILXA 1QIMA 4HLDA 4E1VA 3QY9A 1NIPA 3F1KA 2CK3A 4R9VA 5ARDA 4I2VA 4MMYB 4L1KA 3K6RA 1QGOA 2XB8A 3IT1A 4QFMA 4TVKA 4FBLA 5D3MB 5DH9A 1H66A 1D1QA 2IYEA 2QRGA 4NE2A 3WI7A 3BHMA 3T5TA 2PT6A 1Z5NA 1QFZA 1I7NA 3M4JA 1U2GA 5MN4A 3JTEA 3BE4A 3DFKA 4EUHA 3OLQA 1P5HA 4BMYA 5JSZA 3MTGA 4JZKA 4M60A 2ZIXB 3IKTA 4DREA 1ZUNB 5JH7A 4KAFA 1T0IA 3IHLA 4BNTA 1XKQA 1U5BA 2C5HA 1XXHE 1LK7A 5AVOA 3CLSD 3SZOA 1FMLA 2OCAA 1W0CA 5KTSA 2E4UA 4E5PA 2NTEA 2HXYA 4PLGA 2H1VA 5CW2A 3AP1A 4L51A 4QO8A 3ZHYA 1K9SA 1Z37A 2IZZA 3V7FA 1YB4A 3KZ1E 3IAHA 2RHTA 4X65B 3WLJA 3QJYA 4B0OA 1A98A 2H29A 4BGEA 4EG5A 1D4OA 1EGMB 2C9BA 4IRUB 2RKWA 2L2QA 2OV1A 4RKRA 1HE2A 1PVVA 3LOUA 1V2HE 4MV7A 5HZKA 3C70A 1A7JA 4N5HX 3PGXA 4NX2A 4IVRA 2Z4TA 4PLCA 4JJEA 1NP7A 4L16A 1A8IA 4I4TB 3QX3A 3R0IA 3UTCA 4Q3NA 3CPHA 5JU6A 1N5KA 1P4HA 4LZZA 2VBFA 1UFVA 3OZDA 1VZ2A 3R3SA 2HC9A 4X91A 3WRXA 1HE3A 1Z3IX 3SJCA 3JYLA 3N5KA 1RXVA 3SC6A 4O4HA 3NTXA 4E4YA 2ZRCA 3QTTA 2XCRB 3U62A 2B8WA 3RRBA 4PG4A 3CT6A 2EW1A 2O2JA 4HWPA 4A92A 2Y1LA 2IHZA 5CG1A 3LPDA 3D7SA 1AV6A 2XRZA 3LQ1A 3G8AA 4Z3DA 4S04A 1CQPA 1EFHA 5K5EA 2Q9CA 3DV0A 3D3NA 3P52A 1KSGA 4JLVA 3DE4X 3WP0A 4A1OA 2J3QA 4YV2A 1LJLA 1E4OA 3RCBA 1U3DA 1SCAA 2H2WA 3TECE 1SELA 4GR4A 2GN6A 5CP8A 4LXTA 4QAQA 4XGQA 1QR6A 1V41E 4YFYA 3B20A 1L5YA 1IHOA 4X8MA 4EB3A 1Q6ZA 2P65A 5SYAA 1DELA 4YCJA 5C7IO 3IUMA 4GP6A 3S27A 2UV8A 4MAAA 1VKJA 4B84A 4UARA 3RHFA 4DXDA 5BXQC 5HOQA 1HBJA 4DF3A 1FU8A 1ZESA 1M7BA 1AUPA 3OEWA 3IOMA 3OEHD 2H0QA 4WZAA 5I7FA 3ELYA 4AXBA 5J4HA 3BEDA 3I39X 2BMJA 2Y1WA 5H16A 1CQIA 3O1LA 3QA9A 4BO9A 1NW6A 3BX1A 1ZM3A 3EC7A 4DB2A 1WQ1R 4FB4A 4CL0A 1YU9A 2F1HA 4P80A 1E3IA 2XQVA 3EMVA 2QUKA 2DETA 1E3WA 3I8OA 1I30A 3QUSA 1GQ2A 4ZQGA 2JH3A 5KB3A 3N86A 1K88A 4RGVA 3DP9A 2IY7A 3K9LA 2OB1A 4JVOA 4JFRA 4QUJA 2UYGA 2R7MA 3R3YA 2YW2A 4C05A 2HN9A 3DLPX 3I23A 4B33A 1H5UA 1D5WA 5EJGA 2CUTA 1WULS 1JQLB 2VDVE 4M21A 1LCIA 2YUIA 3GEMA 2JFUA 1P75A 5EPOA 1K8XB 2BEWA 4E3WA 1JR3A 2XCTB 3UWSA 4KR7A 1IMJA 1WVGA 2DUUA 4GLLA 4NNOA 1G5HA 3GJ0A 3QXXA 5CDYA 4N8SA 4BATA 2O1EA 5EWLB 4F46A 1JG6A 1G98A 4L6AA 2HA6A 5A05A 4CLRB 3R41A 1ZH0A 3A32A 5D5HA 2GZAA 4GSKA 1U8AA 3UHOA 5DN6A 1NQOA 3MLEA 3TCKA 3EAQA 1OJ7A 4F7DA 2M98A 2CVOA 4HYEA 4DIEA 4A2CA 2C7OA 2PQ2A 1BXZA 9LDTA 3Q85A 4EW6A 1YZ3A 3PQ2A 5TS2A 2C9OA 4HYQA 3AUTA 5EQTA 2FEXA 3CF4A 2FX3A 1FU7A 4L4SA 1HO3A 1XNHA 5L8VA 1EAYA 2JFXA 3OAAA 4FGJA 5HTKA 2FV8A 3OQMA 2ZBGA 1TJYA 1OGIA 2OBBA 3D7RA 1O0SA 1PL0A 2XA2A 2JDID 2YJGA 5T4FA 2XBMA 2NT4A 5AI5A 2LWIA 3NAGA 3NUQA 4NZNA 4U3JA 2LE0A 3D4IA 3MS7A 1CVRA 2RBGA 5FOQA 1MX3A 3LK6A 2HCFA 4N6OA 4JZYA 2DKOA 4X3CA 4HRXA 1ML3A 1HWYA 2X8WA 4H18A 5D3ZA 1J49A 1UJ4A 4HLUC 5CR9A 2ZVDA 3VPSA 1SJ9A 4QXOA 2JFYA 4YDHB 1N75A 1G64A 1JJBA 4XJXA 3UXMA 3FHOA 1NVUQ 3MD0A 4CLEA 2XZOA 1QS0B 3TCXB 1OV6A 2BCJQ 3D6MA 4L85A 3ANMA 1E2EA 4ND7A 3ESZA 1ZBQA 1G8MA 3BIWA 4GGPA 2LDBA 1TMOA 2FN8A 4AYWA 4EO7A 2X9VA 3CLUC 4PSVA 5JJ5A 1NUTA 1QVWA 4IUBS 1GG9A 1W5AA 3K92A 5CURA 5DXAA 4F4IA 3AOEC 4QVIA 1AUXA 1OGJA 2PIAA 4XCVA 2B4TO 1FDSA 4C4RA 3WK6A 3QE4A 1XZAA 1VL5A 1L7RA 1PFVA 1PI3A 2NZUG 1A76A 3D3WA 3OQ1A 4G5FA 3JQCA 4Q12A 4UOEA 2KSQA 1B76A 1PU2A 2BBSA 4QTYA 3MT8A 4JMPA 1RRVA 4GOLD 1M0SA 1WWKA 1ZMOA 2VA9A 3UV3A 1AQNA 3OCCA 2QGNA 3KVOA 5KTRA 1X7XA 2Q3MA 5LA6F 5CB4B 4I19A 4LXQA 3OIGA 2O05A 1Y80A 2O57A 1H0HA 3I4FA 1SIUA 1H6DA 2YICA 4V0OA 5GONA 1ZVQA 2PFSA 1NC1A 3Q9UA 4DMKA 3OTOB 1RKUA 1USUA 2V45A 5HKOA 5E2AA 1T6NA 1DHRA 1RCTE 1WKVA 2XTAA 2LNDA 2ZE8A 3CLRD 3DTTA 3IJEB 3K1AB 3GB9A 3PWSA 5GOTA 5HBGA 4F45A 4LGCA 1P4RA 3EZGA 2NO4A 3OY2A 3C6BA 4V39A 5MDHA 1KJ8A 1ZD8A 1JHRA 2F67A 1VL0A 3JYQA 4QODA 4MW7A 3GQVA 3E7DA 1P9WA 4F3CA 2J4FA 1CW2B 3NTLA 3AR4A 2AV6A 1W5BA 2EW2A 3MCZA 5AKHA 4P58A 1D0VA 4L4ZA 2F55A 2FPIA 3EXG1 3REOA 1YDHA 3DAGA 2IYQA 3O1HB 3DO8A 4YAIA 4O3MA 3GZJA 3FNBA 5AXAA 1II0A 4BQPA 1NNLA 2MCFA 5IEJA 1AXRA 1H65A 2J7PD 3K8YA 2HRZA 1O03A 4EHIA 4HNQA 3GDOA 4NKRA 2YCBA 1DARA 4FDLA 3D9QX 1FS5A 1DAKA 4YX9A 5LPNA 1CEYA 2AGVA 2ILTA 2BLNA 5DLPA 5JRJA 2ZR9A 1RADA 3MGKA 3ACDA 5EQFA 4EVRA 5JV5A 3AKCA 3ZOKA 1YFLA 2R8PA 2ZRBA 4GE3A 4MVJP 4RKFA 3RSHA 5FEUA 3BCHA 4LTNA 1BSVA 1HSZA 1YKFA 3ZW9A 1Z5WA 2XZTA 2WJWA 1LFDB 3OTWA 5F2EA 4ZDWA 4ZAFA 3W5SA 2X1HA 4AC9A 5KDOA 2BFDB 4A8JC 4JASB 1E2JA 2PN1A 4MGEA 3SM3A 1FDWA 4ZRNA 1WHTB 1OYYA 4AY6A 4PBTA 2GUGA 1FPQA 1WB4A 2BFBB 3D31A 1AK1A 1U80A 4RMIA 4B3JA 1Y89A 3AHDA 1GT91 1SURA 2GEKA 3KYCB 3HUEA 3E18A 2FEWB 2ZS8A 1RRFA 2QRLA 2B1RA 2C07A 3R4VA 4GKVA 4QOHA 1RXUA 2P30A 3KALA 3C16C 3UEOA 1C9KA 4RZ3A 4BYMA 3VPFA 4CG2A 4MGYR 4YRLA 4HNAB 4P7BA 4K26A 3ZI0A 5T3YA 5BUCA 1UODA 2GHRA 5J2TA 1FFYA 3VU9B 4LJYA 4B3CA 5TQ2B 3DF7A 1R37A 1LQ2A 3ID6C 2VI5A 3HWRA 3NO4A 2XQGA 5THXA 4UUOA 4L72A 3AUUA 3SI7A 4P86A 2QM7A 3R3UA 1DCFA 1E6LA 5FI1B 3FY4A 1HT2E 2O3SA 4Y6QA 1IQPA 1PFGA 4DLWA 1E0DA 3NVMB 1A9PA 3PEVA 2I65A 3AI1A 2PBFA 1Z29A 3O4RA 3ZWKA 1PJZA 4ZVSA 2GAIA 5FYQA 3NIGB 4B4UA 2XTNA 3GEIA 3UMCA 1T26A 1Z2DA 2FP4A 2FN3A 2JLAA 4H9GA 4LXXA 1SUEA 2DPLA 4FE4A 4A6PA 3BWEA 1Y1KE 2D4HA 5JO0A 1PGQA 2QORA 1UXOA 3G2JA 2WWWA 3KOMA 3MCTA 3NPMA 3D81A 4JR0A 1LSJA 1WXIA 4KPUA 4KX5A 3FUCA 4XZ3A 4GXRA 4FCWA 2WOOA 1MC5A 1KJYA 3DOEA 3HY3A 5KI6A 3OBIA 1QAQA 1ZN7A 2VJMA 2YRFA 3EG9A 4HT3B 4CXMA 2GXAA 4UU7A 2ZRQA 3L8DA 4C76A 1EZ4A 2GRAA 3H0KA 4BNDA 1FW6A 4JYCA 2GHIA 2ZUBA 1GAJA 3ANXA 4WERA 4JEIA 1UT6A 3KBBA 1VHQA 3PX2A 4C30A 3TB6A 3WB1A 1FFWA 1U2EA 5FDFA 4BFZA 1U7WA 4J1SA 1JALA 4MGIR 5JAQA 4HX5A 2ONJA 1EJ2A 5C1BA 4X20A 2ZRKA 1H2WA 2E21A 1S3IA 1UZLA 3O3CA 2JJ1A 1TVMA 3KVVA 1HR0B 2WA1A 4IWXA 5HIIA 4C6RA 1RHQA 4E5VA 4B7XA 1CF4A 4IH9A 2AI3A 1HC7A 4R2LA 1OX4B 2MSLA 2VDWA 4BO1A 4MYHA 2ZBPA 4CDMA 2OP0A 2JGEA 3COPA 3KJNA 3WQRA 2RGEA 4G5QA 5JBIA 3OLXA 5ALIA 1GZ6A 2JJ2A 1SC9A 1QYIA 1GRVA 2WUFA 5DTEA 5TT0A 5KOJB 2Y1XA 1BFDA 3RTCA 3KLPX 1E79D 2ZYTX 1GGJA 2YV3A 1BE0A 1T3HA 4YJ3F 3AHGA 4ZQEA 1VXRA 3SJ7A 4A0RA 3WLHA 4PFSA 5K03A 1Y5RA 4LYAA 1KZ9A 1LWOA 2BWJA 3CC8A 4HQFA 2F8TA 2YMPA 3E9DA 3IAEA 1P74A 2FA9A 3TRHA 5KIAA 1Q1AA 2VNIA 4BJHB 4QXQA 4BKPA 3RUPA 4OPMA 1G5FA 1JU4A 5FOXA 3VNSA 3GF4A 1B8NA 3CWCA 4CU5A 1TTTA 4DR6B 4AN1A 5KYXA 2AN1A 1UK7A 4RKEA 5BOVA 1BWQA 1NVMB 2O23A 1CG6A 1P73A 3V4LA 4TTAA 4I9UA 3R7FA 3CN9A 4AZWA 1JLMA 2OV4A 3C3AA 3NETA 3OMLA 4BO0A 2WHRA 1R6XA 1IHUA 1L8XA 3JW8A 3Q88A 4E21A 4F8EA 2H1RA 3AEKB 4JR1A 5DLYA 1Y7IA 4KN5A 1YHZA 4B6PA 1KIMA 2VYNA 5E3HA 4CKWB 4CMGA 4ZCIA 5AUPB 1TYDE 3RIGA 1MJFA 3VVMA 1BYUA 1J33A 4NNJA 4AS1A 1PL6A 3HUUA 1YTUA 3DBRA 1G8SA 1FRNA 2APJA 3DOOA 3TDMA 3ZXUB 4LS3A 2AMVA 1WEKA 2BDUA 3PCRB 1ZVMA 2FJPA 3KQPA 4LNUB 4LGYA 4BFWA 2PIDA 1AX9A 1G2IA 3YASA 3WWEA 3AVPA 1BHO1 1L1RA 4HNSA 4Y1RB 3RT7A 2OUIA 5KNDH 1WDLA 5LZ9A 2WAYA 3C85A 3H1FA 3O8RA 1DMRA 2ZSKA 5FPTA 5LLTA 3JATA 1HTWA 5FLKA 4JJ6A 2O6HA 2BGMA 2JFQA 4FM9A 2M1XA 1OH7A 2NU7B 3ZIAA 2B20A 5IFKA 1P4JA 1GL7A 1PDWA 3H17A 5E6UA 1XB2A 3VZRA 2LCQA 2OYCA 3H19A 4NATA 4KBGA 3K30A 3V7WA 2CXOA 3OCJA 4LX0A 2GNPA 2ZJ7A 4S1PA 1YVPA 3AJAA 4O2AB 5TEVA 3FLBA 2H52A 3Q0IA 5FLEX 5A9SB 2C98A 5CB0A 4S05A 4TPKA 1X9HA 3DMTC 3LFHA 5J63A 1RJ9B 4M55A 1DIGA 2R85A 3V4VB 1TAUA 3L05A 3ZE9A 1VYUA 4G0XA 3ODGA 2V3WA 3T52A 2B5WA 3SMQA 3GPLA 2Z2XA 4LBWA 5KCZA 2N3ZA 3DEKA 1RWQA 5LDHA 2IH4A 3Q8XB 3OG9A 1TJ3A 3DBOB 3MMZA 3A06A 3NWOA 2H2GA 1WG8A 2PH7A 3AB3A 2BV3A 3BWXA 3SHVA 2P6MA 1ECJA 4ITVA 1MJGA 2YH2A 4LHSA 2CXNA 3KTDA 5DI9A 1BS1A 1SC4A 3PQ4A 2CYCA 2F9MA 3D7MA 5T6BA 4QDTA 3G3EA 4EATA 3IJRA 1KY3A 4FD2A 5FBWB 3H5AA 2WG0A 3ZYZA 1FVFA 3FGZA 4FK8A 1Z0SA 3KQTA 1SHZA 5LQSA 1KQ3A 3E8XA 3U26A 4KB5A 3QFRA 4G9GA 4UKDA 2PMEA 3TD9A 1Z08A 3ZY5A 4CG0A 4EJSC 3L07A 4N9QA 3KLOA 3NHKA 2OZLB 3OX1A 4XEHA 4OQMA 1YC5A 3WYCA 2QRNA 3GJ7A 1UH5A 2NADA 3TNLA 3KV1A 2CF5A 4FDVA 1UJ6A 4CKEB 4ZDIA 4BS9A 1VLHA 4EKNB 3OUZA 4IJVA 2BGIA 7ADHA 1DO0A 4EQ6A 3BD8A 1RPJA 3W1WA 4AZ3B 4CMHA 1A69A 3KDAA 1M0EA 2XYHA 4O1MA 3G7UA 5JSFA 5ITVA 5J5AA 1C0PA 5KVAA 3VH3A 4JQCA 1YHNA 1DBQA 4XWGA 3EODA 3I6ZA 3D1JA 3RAGA 1R10A 2QRZA 3UICA 1QFMA 3IKLA 3D6VA 2BKUA 1KPIA 2B92A 3JAKA 1J6UA 1WF6A 4QFDA 3DWGA 1HYBA 2Q1YA 5EGSA 4WY8A 1DHTA 2XUFA 1GXSB 5ELLA 5IAGA 3CSUA 1TQHA 1II8A 2BYTA 5BQPA 1X92A 3EDCA 3HUDA 4IJQA 4DYHA 4BP3A 5H4GA 3K20A 4DCJA 4IDOA 1QO0A 5HR5A 3ZXYA 3IIEA 4QOGA 1HG1A 5FV4A 3C3WA 3I3SR 1LV8A 3RVBA 1YL7A 3C3XA 3CR8A 4B8YA 1RRPA 3FWPA 2HEIA 4BOYA 2ZBQA 1OBHA 1VJTA 1PL7A 4F4UA 5EEGA 4F6LA 3AG6A 3OQJA 1E96A 4D0NA 3SQLA 5FXMA 5A9TA 1SVMA 2BFAA 3RSSA 3DC2A 5FWDA 2NUAB 4Q7JB 4G81A 4R31A 1XG5A 2R2AA 4G4GA 4M9UA 5DK4A 4EG3A 3M0EA 1X7YB 3RS5A 3BS4A 2VAPA 4Q9NA 1BYIA 2PRIA 5DULA 1FDUA 2HQBA 3GP8A 1SKQA 3PGJA 2FPGA 3DBHA 2WIJA 4IRMA 3SGLA 3BA1A 3I9MA 1POXA 2XXBA 5BT8A 4B7UA 2IX3A 4AY3A 1RLOA 4FLFA 3WZ2A 3A1TA 1XA4A 3D8SA 4H6XA 1Y33E 4L0MA 4RH3A 4PYJA 3GN2A 4JJKA 4Z4QA 1Q1GA 3JZMA 3EVBA 3WQHA 1Y6ZA 1C1YA 3VGPA 1O6CA 4INJA 4NCNA 1J5XA 1OZHA 4I55A 3GT4A 4OB6A 3VR3A 1NDUA 2ZBEA 1L4EA 5DGTA 3PGVA 4F97A 3Q7PA 2QN3A 2WAAA 2WFZA 2ORIA 2BM8A 3F4LA 2WR8A 3HFSA 1VIAA 3PGA1 3ND7A 221PA 2X0DA 3MERA 1CS0B 4XWWA 3DZFA 3LF1A 4D3YA 2DFTA 3NT5A 2ZRLA 4HDNB 4OTZA 5GV7A 1HKUA 3N2LA 3PFCA 3A1UA 3P0JA 2IV7A 4GMXA 1SKBA 1XLTC 1NE7A 4LTDA 2SKCA 2ZIUB 2ZJ5A 3SE7A 5KMGB 5IXSA 3VUFA 4LJ7A 4MQLA 4UUPA 4HXYA 4K6MA 2DLDA 1K8QA 3DBIA 2QMEA 4DWJA 4LDRA 4HZUB 1N2XA 3C5EA 4GECA 1AKWA 4XD7A 1KRXA 4OHXA 3H5VA 3ZNOA 2L18A 3IKJA 2GPSA 7GPBA 1ZK2A 2PYIA 3BK2A 5L3QA 3GXOA 1NF8A 1SCQA 4OHMA 2BBOA 2IT1A 2Q5EA 3D3EA 5KOHA 2DVMA 4V2UA 2HTEA 3CQ9A 1IWPB 2R6GA 2YMQA 2ZKLA 3A9TA 4LWZA 3A3PA 1ZUD1 3FBTA 4LJ9A 2VSOA 3BREA 4GPEA 1M8GA 2PKQO 2WIGA 4DG9A 4MS3A 3LE8A 1CUIA 3DNPA 1PNTA 4ETIA 1Y9DA 2Z8YM 3MTAA 4G8JA 1DU4A 3BD9A 2IYTA 3TRFA 2ZYRA 3I32A 1R9JA 1YT5A 2A9JA 4OQDA 1NNUA 3TE6A 3DQPA 1PTJA 3I4LA 4QM7A 1FEZA 1LJUA 3NDPA 4OUKX 3S70A 3THSA 4J16C 1AHHA 2JH8A 4ND4A 3C4JA 4CM4B 1XJ5A 2DGDA 4WXPA 4YLEA 3T3NA 2ZUUA 1CY6A 5EKDA 2JHAA 5GAJA 2N0SA 2AJ8A 4IHJF 5HQ3B 4DSNA 5FBRB 4PC7A 2XCQA 3L0DA 2QN7A 3L79A 4TKVB 3AXTA 5CT6A 3U3XA 2OEPA 4EPXA 1SXPA 1GPMA 1N2IA 4FEYA 1HXHA 3W78A 1U0OC 1ND6A 2QIOA 2E4AA 2FZWA 4TKZA 3NOVA 3RJZA 3N3BC 2ETVA 3U49A 5I7UA 3AKYA 1P2DA 3P9YA 2O2IA 4K86A 5IKEA 4BY9E 5A6SA 2AJLI 1BXKA 1P7ZA 3GL9A 2JF0A 4XSVA 3TX6A 1T6ZA 3TLGB 3PC8A 1KVUA 1TZMA 2PG3A 2ZG6A 4KXLA 2WWVD 3U2QA 4ARVA 2XYPA 4QC2A 1XTJA 5LLDA 3ZCVA 4GVPA 3FSGA 3UK1A 4FILA 5I5EA 4YR7A 3EC1A 4DVJA 5JSUA 1GY8A 1VJ5A 2VWHA 3GIWA 3E48A 4D5EA 1V25A 2OT3B 4ESVA 1IBMB 2E18A 3VKGA 3LDUA 3PHJA 3AT1A 4JJAA 1HDEA 3NAQA 3VKHA 3QOWA 4E07A 2H31A 2OHJA 5KKAA 2J59A 2UXDB 1AC5A 1UMDA 2P6RA 4PFKA 3WZMA 4RHFA 2JANA 1NI4B 3CM0A 3WLMA 2JIRA 4DPKA 1PTKA 1K5DA 5J43A 1VJDA 4MWEA 2LKDA 3RYTC 3H9CA 1HFKA 4CHGA 4UUBA 4Y2JA 3N5CA 2EJTA 4N7RA 4HEA6 1E3MA 4LF4B 5I9LA 2FP3A 2C82A 3IQIX 3HADA 2JFOA 1WX1A 1IVYA 2PUVA 2PX8A 3HCCA 2CD9A 2AN9A 1O95C 3EIFA 3OF5A 1SXJA 2P5TB 7YASA 3ZE2B 4BNKA 3QTBA 1NOJA 3MTIA 1TM2A 5AJYA 5DB4A 1P2TA 4Z4FA 2FWRA 2A3RA 4RDCA 1PV1A 2HF8A 2ZKIA 3T15A 3SSOA 3VYTB 4L2IA 2D8MA 4R8MA 5KTYA 4U1RA 4YJKA 4INOA 4LNAA 1WB5A 2XB4A 3WMEA 5M2QA 3HKEB 3CLUD 3VA7A 3IV9A 2NOAA 3DEJA 1JRLA 3T7EA 4CKBA 4EHLA 3U44A 3AVXA 3H2ZA 1D6JA 1DJOA 2Q5LA 3W34A 1NKTA 1DX9A 1SXHA 1T6BY 3E82A 4UREA 2WPNA 1EEHA 3M5DA 1KK2A 4A0HA 3EIQA 1KFEB 4YAKA 3MSXA 3IV7A 3NHZA 1E1DA 1K3TA 3A3KA 3FUUA 3QK7A 4UHEA 3N0WA 2O4UX 5FB3A 5EWJB 3X43A 5IAKA 4F3TA 4XWOA 4URUR 3NM6B 4KDRA