1PLLA

Crystallographic studies on p21h-ras using synchrotron laue method: improvement of crystal quality and monitoring of the gtpase reaction at different time points
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
166
structure length
154
Chain Sequence
MTEYKLVVVGAPGVGSALTIQLIQNHFVEYDPTIEDSYRKVVDGETCLLILDTAGYSAMRDQYMRTGEGFLCVFAINNTKSFEDHQYREQIKRVKDSDVPMVLVGNKCDLAARTVESRQAQDLARSYGIYIETSAKRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies on p21(H-ras) using the synchrotron Laue method: improvement of crystal quality and monitoring of the GTPase reaction at different time points.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncogene protein
molecule keywords C-H-RAS P21 PROTEIN
total genus 31
structure length 154
sequence length 166
ec nomenclature
pdb deposition date 1994-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1pllA00
1VYTA 2YC2C 4I1SA 1ANKA 3VR3A 1FMJA 4FINA 2R6GA 5F2EA 4HAYA 1II0A 3HU1A 3PEWA 2XTNA 3SYLA 3SN6A 4TL7A 4NMMA 1Z28A 1TEVA 2XSZD 2QUZA 5ELXA 1A2BA 3SDZA 2QT0A 1WBDA 3CWQA 2CJWA 3AQ4A 3I8XA 2XJ4A 2KE5A 1UDWA 1XD8A 2NIPA 3U61B 4TQ9A 1CS4C 3Q72A 1IN7A 2P3SA 1ZP6A 4HLCA 2XXAA 1Z07A 1LW7A 1W44A 5CIQA 4E09A 4N3NA 2ANBA 2NPIA 4BE7B 1RYHA 1YZKA 2D62A 3KQKA 1FOEB 1Z63A 3Q7PA 2FNAA 2JASA 1SQ5A 2RGDA 4FMBB 4EKDA 1R0YA 1VMAA 1RZ3A 1S96A 1DS6A 3DPUA 4ITRC 1ZW6A 4HZIA 5DE3A 5AJXA 4TYQA 1FW6A 4LI0A 5LB2A 3KJGA 2ZI7A 2J0SA 5K8TA 4X8HA 1E2GA 1MO6A 3BGWA 1WXQA 1P2SA 2ZE8A 2ZU6A 3KXIA 3RRMA 1XPUA 1EXMA 1SHZA 2DCUA 4CRWB 5M04A 1N6RA 2QTHA 3LX8A 2GCNA 4LJYA 1GL6A 3NWJA 1QG2A 3OIUA 4V0KA 3OFNA 3TVDA 1OXXK 1XFAA 2Q3HA 4OL0A 4A0GA 4TZ6A 2FWRA 1H8HA 3W5JA 2HYDA 2ZI9A 4R2HA 2WV9A 5FBRB 1J8MF 1N0UA 3LFUA 3V9PA 2D06A 2ZS9A 4CGZA 1JAHA 2YJTD 1P62B 1CKEA 2A78A 4I1UA 4IRUB 3V4RA 2GJ9A 1TU3A 1HA3A 4B3FX 2VA8A 3LW8A 1XB2A 4DSTA 3L8YA 2RGBA 4ZIRA 1AQYA 4V0LA 2AKYA 1Z0KA 4UNQA 3WRXC 2R6CA 3AKEA 4FCWA 4AKGA 2ZSAA 1F48A 2VO1A 4CEHB 2HXYA 4LWZA 2I1VB 1VECA 4HYYA 1II9A 1K8RA 3JVUA 4XOIA 2CVFA 2FSFA 3K0AA 1L2TA 3WXMA 5JSZA 1DO2A 4ESVA 2O8EB 3BK7A 3BORA 2BOVA 4GNKA 3RHFA 2C2HA 1RW4A 2JJ8A 5E4FA 4E5UA 4EQ6B 4FMDF 2IS6A 4LHZA 3CX6A 3ZYCA 5JJLA 1T3HA 1VHLA 2G1KA 4IOLA 1G19A 4MQBA 1ZM7A 4P31A 1G6OA 3ZZTA 2FJUA 2ZJYA 3NKVA 2WOOA 1NLZA 1UKZA 2ZEJA 2OZEA 1C9KA 2QSYA 4P33A 1XPOA 2F7SA 3CBQA 2C03A 2QP9X 3C4JA 2PX0A 4ACAA 5TV2A 4M0LA 3L43A 2OEPA 2ZE6A 2ZJ8A 3CPHA 1U9IA 3QKUA 3ADCA 1GM5A 2XB2A 1CEEA 2O5VA 3CR7A 4BLPA 1KKLA 1N0VC 2W2XA 3K0CC 2IXFA 4DSNA 2HCJB 3NDPA 1Z2CA 2ZI3A 1RJ9B 4Q21A 4QGAA 3ZVNA 4G1UC 5JEDA 1TPZA 1X86B 5EXXA 3TSZA 4IW3B 1TUIA 3QG1A 4EFNA 5CITA 1GVNB 3QXXA 4LJ8A 4TSFD 4P0TA 2PT5A 4E22A 4EJSC 1Q0UA 2F1HA 2KJQA 4ZDKA 3B82A 3KFVA 4B6FA 5C18A 5DISB 5FTLA 3WP0A 3BB1A 4KFUA 1XMSA 2WJHA 5FOSA 1YR7A 5D3MB 4JBYA 1OKKD 5AUNB 3O8RA 1GNPA 4P4UA 4MKHA 2QP3A 3BFVA 3RS7A 3RWOA 2IYRA 3Q85A 4DLSA 1CJKC 2KWIA 5LPNA 1GDDA 1OB2A 1XTKA 4B35A 1SXJE 2QM8A 3TRFA 3T1TA 1KI4A 3QUSA 3A1TA 1XU4A 1U90A 5L3RA 3TGPA 2IBMA 3W6PA 2GF0A 1BKDR 4JVMA 1G7RA 4LJ5A 5TXGA 3SJBA 4AG5A 4UXJA 2O8BB 2BCGY 3PEVA 4I99A 4PXAA 5CK4A 4DLYA 1LTQA 3SE0A 2WWXA 2VH5R 5L3VA 4OK3A 2FPKA 3WNBA 1VPLA 3S1AB 3QOFA 1E1RD 1KNQA 1M7BA 3U6KA 2FFAA 2Z6VA 2DWQA 4WZAE 3TAHA 3EW9A 3MFYA 1G8HA 1Z6AA 3LX5A 4PZZA 3C5HA 4YONB 5JZVA 1SVWA 3SHFA 3UKDA 5AJZA 3UG6A 2AXPA 3TH5A 2NQ2C 3UMSA 2HEIA 4PANA 5JI2E 1MO3A 2QGNA 2FSGA 1NY6A 1D2EA 1E69A 1H8EA 2OFOA 1NMXA 3QPWA 1CIPA 3QVVA 3GJ4A 4B71A 5EP2A 3I1FA 2VP5A 3OF5A 5CDFA 1ZNYA 4NCHA 5SZJA 2QENA 3EG5A 4NCJA 4IDOA 5FBLB 1Q20A 3WYAA 4TMXA 1Z0FA 3BERA 3NHBA 1NNEA 5FL7D 4D0GA 4A15A 1I2MA 3VX4A 5GVRA 2Q21A 2VL7A 2W2TA 1W46A 2V7QA 1VG8A 4WVFA 3RRNA 3EZ9A 2GZDA 3PQCA 4YC7A 4LBWA 5DIFA 2XSZA 2GBLA 2IYQA 2LCFA 4B3DA 4G0NA 3U6BA 4OHVA 4RJLA 4CF7A 4KYUA 5CK5A 1GKUB 1KSGA 1GZSA 1OYWA 4ZDIA 4GDFA 3H86A 1FZQA 4D2IA 2BM0A 1P72A 1S3SA 2XAUA 3KX2A 2IWRA 2J5XA 1ZMXA 2Y8EA 1T9HA 4QL3A 4Q7JB 3GD7A 4Q9JA 4PHTA 2RAPA 3WYFA 3VU9B 2OCYC 2V6JA 4BQSA 721PA 5JEEA 2ZR9A 3QXSA 1BO6A 4PR0A 4TLAA 1P2VA 4UNPA 1COWA 4FIDA 3N70A 1QHGA 1RE0A 4DLRA 3K9HA 3ASYA 2UZ3A 2BKEA 1FP7A 5DYIA 3IHWA 2P6RA 2FF7A 4LDJA 4IHQA 2EFCB 2H5EA 4QBGB 3LLMA 4NYMQ 1CLUA 4HB0A 2P65A 4R7ZA 1XRJA 1S2MA 4L8GA 4A36A 3QKRA 3SQWA 2GZAA 1N5LA 3GLIB 2OLKA 1M8PA 2WWYA 4KBGA 1Q21A 1VCOA 4GP6A 4Q1EA 4RZUA 5KYKA 3X1WA 2WKRA 3REGA 2H8KA 3QNUA 1IN8A 2RHDA 5HKKD 3KJEA 5CM8B 1E6CA 4ZCMA 4HLDA 4BFZA 2GRJA 3K8YA 3TQCA 3DKPA 3E70C 3L0PA 3CIOA 3GLFB 3SBDA 2IC5A 2R6FA 1JALA 3QG5A 1W36D 3KZ1E 2QPOA 2OCBA 1I2DA 1G3MA 1KY2A 1IXRC 2BVNA 5EXTA 1CJVC 3B13B 1NMYA 2MMCA 3LXXA 4DEXA 1EX6A 3W9YA 3QKRB 3TE6A 2ZPTX 1QF9A 2ZJBA 3ZH9B 5LB4A 1KYIA 1SXJB 3HYRA 2ZJ5A 2VIIA 3ICQB 5EXSA 5E7MA 2C78A 3NXSA 4QBFA 1LY1A 3GJ8A 2CLCX 2QT1A 2ZI4A 2W0MA 1W48A 2ZR7A 3CRQA 3AGQA 5H1YA 3GFPA 4TMKA 4D25A 1Q3TA 4ZV4A 1XZQA 3T06B 2XNDD 1Q44A 4Q01A 5JWOA 5DNYB 3CONA 5L8VA 2BBWA 3MGCA 2DYKA 2F1RA 5G53C 1D2NA 4PPQA 1QHNA 3TUZC 3TQFA 3WYGA 2FFQA 2IEYA 2WSMA 2ZUDA 3NBYC 4QOSA 4F91B 1W7AA 1M2OB 4NP6A 2OAQ1 3LNCA 4HAXA 1OW3B 2UZIR 4FW9A 3RRYA 1DG1G 3NH6A 621PA 1MRNA 1KSFX 3QI2A 1WCV1 4PC7A 4PO1A 5FOWA 3RABA 4TLCA 3TW8B 3AVXA 1S9DA 1QHHB 2K5UA 3K70C 3CPEA 3B1VA 2KI5A 1TQ4A 2H17A 4P3YA 3F5FA 2J59A 4PSVA 3SJCA 1XJQA 1ZBDA 2X19A 2IXGA 4Q4AB 4OJKA 2NO7A 3M6AA 1Z5ZA 1G7CA 1AZTA 2LWIA 4DEYA 1VHTA 3EX7C 2FMXA 1O3YA 2IYLD 4KBFA 3MG9A 4URZR 3KB1A 1ZRHA 2G88A 3T1VA 2HDNB 3BH6A 2BIFA 2BMFA 4FXPA 3KFXA 3VNVA 2D7DA 2P5SA 1SVMA 2RGAA 2BCJQ 2IWHA 2HF9A 4DRZA 4DDTA 3K0SA 2J7PA 1FQJA 2PCLA 5CYPA 4P4SB 5FUYA 3AKDA 3P4XA 1EFRD 4B76A 3I4LA 4H1VA 2ODBA 2G83A 5BYKA 2WMOB 1E9DA 1P73A 4AYTA 4QJ3A 5KSYA 2WIBA 1SKYB 2ZSBA 3EIQA 3UWOA 1EWQA 2XEXA 1N6NA 3GLHB 2CE7A 3NBXX 3K09C 4KVAA 5L3QA 4DSUA 1YR9A 4M9QA 3RS3A 2P6NA 5BN3A 4XWOA 4BLRA 2GJ8A 3I72A 821PA 2XX3A 4B33A 1SVIA 3OEHA 2QGZA 3GJ6A 4B32A 3L8ZA 3AP2A 1ZVQA 1FUKA 4M1SA 1F60A 1WMSA 4US0R 1LS6A 1E79A 3SBEA 2YWGA 3K9GA 3TW4A 4BFTA 2HV8A 2GJAA 2VYFA 4JLVA 3VR5A 4V0NA 1ZM4A 2JATA 1IY2A 2Z5FA 3KTAB 2GCOA 4MDFA 3D3QA 2W0SA 3U4QA 4NL4H 1DAEA 3U7FB 4JYBA 1NBMA 4ABYA 4MRRA 2JDIA 4BLTA 3CWZA 2WICA 1E0SA 3B1YA 2JJ2D 3PUVA 3IEVA 2W6JD 1VG1A 2N42A 1BMFD 4C0BA 1AS0A 1UBFA 2J7PD 4Z51A 3Q5EA 4S2EA 1PUJA 1HUQA 2ZROA 4FD2A 3L2OB 3OZXA 3NEYA 3RS0A 3MUFA 4XSGA 1W2GA 4O2RA 4CYMA 4JMPA 2P6UA 4O25A 4OHYA 1LVGA 3A1UA 3VAAA 2WJJA 4XVUA 4M1WA 4QBHA 1XJCA 4IXMA 4EJSA 2QM7A 3HYTA 3OFND 4RSGA 5FL3A 3UANA 4AKHA 1R8SA 4IDHA 4MGIR 3BB3A 2BEKA 3MWJA 3IEUA 3NHAA 3I5XA 3OEEA 3LLUA 4G5QA 3DKVA 3QF4B 3QPUA 4B75A 3THYA 3PITA 2OILA 3SYKA 4YQFA 4HLQB 4CIDA 4WZ6A 2IYXA 2HXSA 5J5CA 1DO0A 4R98A 3SJZA 2D3WA 4M22A 4C7OB 4NZYA 2AN9A 1G16A 1NSTA 1Q57A 4NYJR 1SHKA 1RRGA 5TDHA 2Z83A 2FX3A 4KFTA 4PPGA 2R9VA 2GBLC 1KO1A 3QE0A 1NJGA 3NVAA 2LKCA 1OE0A 4C2UA 3LVRE 5KSOA 3THWA 1I4DD 1KZGB 2RH5A 4IFBA 4CW7A 2CMKA 2JJ1A 2ZU0C 1Y3AA 2IUSA 4X8MA 4BEJA 1CBUA 4JL6A 4Q1DA 5DI3A 1S1MA 4EIWA 4BFYA 4KJZA 1L4YA 1NI3A 3CX7A 4B3CA 1UBCA 4XIGS 1MABB 2IA5A 2OE2A 2WWGA 3A1VA 2E87A 1E9SA 4YMVA 3RS4A 1N6OA 4JJKA 2IYZA 1G8PA 3QKSA 1NSFA 3GEEA 1C1YA 1E9FA 4GT1A 1SZPA 1CJUC 4GOJA 4PZLA 2ONJA 3LH5A 3EIEA 2IUUA 1ZD1A 521PA 3DM9B 4QNMA 2H92A 2WWHA 4PO9A 4FI3C 2A30A 2H57A 4N0DA 4OQXA 2B6HA 3GEHA 4ZDWA 4YDHB 1G64A 2J0UB 1OF1A 4YXWA 1GOTA 2ORVA 4Q18A 4HB4A 3ZS8A 3PEYA 1R8QA 1Z6GA 3REFA 5JWHA 3F0TA 3W8NA 2FE4A 3CNNA 3MWYW 1YE8A 1XD9A 3QXJA 2O52A 1JECA 2O8CB 2ZRCA 1JR3E 5J40A 2IEZA 2QBYA 1YZUA 2I3BA 3I32A 4AK9A 3IHLA 3HJNA 1WBBA 2ZUBA 2R6DA 4JZKA 2OXCA 2OLJA 3PJRA 1OXSC 2ZRDA 1WDTA 3HR7A 3CNLA 2GCPA 3CF6R 1GNQA 3OAAD 4B44A 5EP3A 3NH9A 4RD0A 4TQAA 2FOLA 2ZYUX 4QM6A 1GP2A 1X8LA 2QROA 3B1WA 3I62A 4B43A 3B1ZA 2GHIA 5FTNA 1NN3A 1R5BA 3R8CA 3CPJB 4D4KA 4UJ5A 4GI7A 1X6VA 1NP6A 1U8YA 2Z43A 4Q1AA 1AKYA 5FPYA 4OQMA 1G5RA 3P26A 2F1IA 4B34A 1R0WA 1TNDA 2C04A 1IN4A 3O47A 1S8FA 2QRZA 1T0HB 3VX3A 2HJVA 2ZYTX 1PVOA 5BWMA 2YWEA 3BFXA 2GEUA 2YNMA 1QHXA 2NOAA 3DDCA 4H9GA 3G82C 1W4BA 4RD3A 1IQPA 4A0HA 1CU1A 2RGEA 2ZETA 2DFTA 2Z4SA 4GOXA 1HTWA 3WRYC 2CL0X 2OUKA 2WAXA 3K0EA 3ZIAA 4B48A 5KDOA 4DB2A 1RVDA 1WE2A 1E2PA 4KSCA 2ZJ2A 3EC2A 5FUWA 4DB4A 2E9SA 1MKYA 3EWSA 2V7QD 1E0JA 1E9CA 2F3TA 3IKJA 2OHFA 4RFSB 2RKOA 2XITA 4EPTA 5C46F 4NU0A 1D9XA 1CRQA 3DEFA 2WKPA 4DCUA 1VKJA 2QBYB 1Q3HA 3LQQA 4NYIQ 4A1FA 1H8HD 2A5DA 4AURA 4DWJA 2C8VA 2WJIA 5KU1A 1ETUA 3GQBA 3R7WA 3I61A 1KMHB 4WXPA 4JYCA 2B92A 3DVLA 1MR3F 3PUYA 2ZIAA 4A0RA 3FMIA 4LV8B 5J4YA 3GLHA 4II7A 4EPRA 2YZ2A 2QSZA 1OFIA 2NG1A 2MSEB 1IJEA 4S35A 1LS1A 4M1OA 5UKDA 4O0MA 3SZRA 1T6NA 5CB8A 3V4FA 1TQ2A 3SI7A 2OBLA 3Q5DA 1MV5A 1KDRA 2IXEA 4LV5B 4QGGA 2XTMA 4FMDB 4OQLA 4JJZA 3QF7A 2WPDD 2AKAB 3EPHA 1EFUA 1MABA 3AV0B 5IT5A 3TR5A 4QFMA 2QE7A 5LBIA 1Q1QA 4MYHA 4HB2A 2I4IA 3PIRA 3H0KA 4I4LA 4R9UC 1F2UB 5EP4A 2IS2A 2PJZA 1YHNA 2BBSA 2DFNA 4C2TA 4LC1A 1XCGB 2WPDA 2DBYA 5FOXA 3TR0A 5HR5A 1CULC 2FPMA 4NKRA 3TUJC 1Z47A 2FA9A 2JDID 1N6PA 4Q48A 1NN1A 1JNYA 2QZ4A 4JLPA 5EE5B 1U0HC 3JZAA 4W5JA 3T35A 1SKQA 4LYAA 1VCNA 1ONBA 3U7EB 1U0JA 1XCPA 5HZHA 1KZ7B 4TT3A 2OO7A 3H2YA 1CR4A 2PMDA 3I92A 1F2TA 2J9RA 3AP3A 4TSFA 5FR2A 1WF3A 3AUXA 2QMOA 2BHRA 2G6BA 3CH4B 4DZZA 4ASUD 3M1IA 2RCNA 4JL5A 1UM8A 1AS2A 4M1YA 2ZSEA 5HCIA 1CR1A 1N6IA 3FFBA 4GFDA 1KOFA 2EWWA 2MSCB 2L0XA 3FDIA 2XNSA 1US8B 4IFEA 1Q1ZA 4XH9B 1G5PA 2AD1A 1WRBA 3P27A 1ZC3A 3EIHA 3VR1A 2BKUA 5KPDA 4URWR 3SYNA 3X1XA 1W5SA 1XEWX 5L3SB 2C9CA 4GZMA 3A8TA 2R44A 1NIPA 3GLGE 2OXRA 5EZ5A 1JXMA 4LUCA 4TZ0A 1E2HA 2ECKA 2QNRA 3QENA 4QNRA 1VG0B 4LYHA 3BB4A 1TADA 3EA0A 4QBIA 1YU9A 5EUQB 1KTVA 3LBNA 1E2KA 1FNNA 4DCSA 1XF9A 1GNRA 1Y63A 3H1TA 5GJBA 1LFDB 1VCMA 1W4CA 1DE0A 2V4ZA 5CLLA 4Q66C 3WBJA 2FSIA 1AK2A 1S3GA 3SNHA 3R8FA 2QRNA 4DCTA 1GRNA 5FPTA 5LD2B 5L3QB 3OE7A 1DAKA 3ADDA 3U2QA 4XSHA 1OLOA 1T5IA 4HAUA 1K5GA 1BS1A 4HZUB 2BDTA 2EQBA 2XZOA 3B9QA 4JLBA 4KCGA 4URYR 3LW7A 5KDLA 4JBWA 2C99A 2RGGA 4XTRA 221PA 4P4SA 4HUTA 3MAAC 2GAOA 4D26A 2GDJA 1NMZA 1G3IA 1XD2A 1W36C 2JLWA 3ZVMA 3VR6A 3LAWA 1ZINA 3X2SA 4D0NA 1P9NA 3IPYA 5CJ2A 4DDUA 4OI0A 1JEEA 1SULA 2VHCA 4V02A 3NEJA 4MKGA 4DLUA 3W6OA 5ANRB 5H8WA 2OFXA 3BWDD 3ZJYA 2XTZA 1G8YA 1U99A 1E2EA 2V8OA 1P60A 1IOZA 4Q4AA 5B58C 1HH4A 1KNXA 3BXZA 5SZIA 4UXIA 3ZS9A 1G3RA 1G291 1KDPA 4Q1CA 4AD8A 4F4IA 3I3SR 1G9XA 3K0CA 4DUGA 8OHMA 3FKSA 3KXKA 3MWKA 3PXGA 3U5ZB 1OH5A 3IIMA 4D0LB 4JL8A 1QHHA 1CRPA 1PLLA 1N5JA 4D80A 5HE8A 3N2EA 1A4RA 2XB4A 4FCTA 1YZGA 2XOKA 3PEUA 4MA4A 5IK2D 3GFOA 1RYFA 3W34A 5HZKA 1P2UA 1M7HA 3FMOB 3PUXA 2BEJA 1TF5A 4AC9A 4XVRA 3KQNA 1NN5A 2KBFA 2OESA 3SR0A 4TL6A 1TMKA 1YZTA 3PENA 2SHKA 3QBTA 4Q00A 1VG9B 4JSYA 2BM1A 2ZJOA 2ZYVX 3MSXA 2WWWA 1UFQA 4TN1A 4AG6A 4CEIA 4P32A 1KK3A 2PJRA 5AWFC 1J2JA 3GPLA 4JVNA 2W2VA 5EE1A 2CLSA 3LQRA 3CZPA 5DGXA 4UJ3A 2ZI5A 4LSGA 1TF2A 1NRJB 2XJ9A 3B78A 1GSIA 1YRAA 1ODFA 4HLUA 4UNSA 4KVGA 3T34A 2DPXA 2F9LA 3FHOA 1CP2A 3TLXA 1R0ZA 5F9HA 5HPYB 2WWFA 1E9RA 2A3RA 2IYVA 4HSEA 1G3QA 3KDSE 4OKSA 1CJMA 3UMFA 3KXLA 3S1AA 1NBMD 5KO2A 2ORWA 4M1KA 1FP6A 5E3HA 1V43A 2IHBA 4ZI2A 3DMNA 3MMPA 4Q19A 3O8BA 2FZ4A 2CNWD 1Z08A 2EWVA 3K53A 4U02A 5DI9A 3GLFA 1S4QA 3K1JA 1NVXQ 4EJSB 1HQYE 1QG4A 2BMEA 4HDQB 1TU4A 1A7JA 4XD7D 1JEDA 1XZPA 4EPXA 1XTQA 2BC9A 1X8KA 3O8DA 4L4UA 4QJ4A 2KSQA 1FNMA 1XNJA 2CK3A 1BOFA 3DMDA 4G5RA 5JS7A 3A4NA 3BFKA 5CYOA 2CNWA 1TEXA 4JLAA 1PLJA 1TL7C 3W5IA 5TY0A 3FPAA 2WMNB 2JIZA 4OYHA 2A2ZA 3IQXA 3QIAA 2ZE7A 1T4GA 3NC1C 4KLNA 2OV2A 2QL6A 4C30A 3VMFA 2FZLA 2F6RA 1W0JA 3ICEA 3QEJA 4AY2A 5GADl 2PL3A 2IF2A 2GXQA 4GL2A 1FL9A 4BRWA 3NG1A 2GK7A 4PSKA 4QGHA 4F93B 2CEAA 5TB5A 1ZCBA 3EA5A 4LHWA 5BQ5A 4BFWA 1TAGA 4KFRA 1NG9A 1NVWQ 3AVWA 4GMDA 2GWHA 4PHHA 3SFVA 1IONA 3U7GA 4FMCB 4Q9LA 4A8JB 3VKHA 1G7SA 1ESMA 2WAYA 4G3XA 4NCKA 2QI9C 4QKQA 5FPHA 1IM2A 1XTRA 2IYYA 1D5CA 2Q9BA 3KB2A 5KDDA 1KK1A 4Q47A 2GVZC 2ZTSA 4EAQA 4JLDA 4QXAA 4Z8YA 2P5TB 2F43A 1XXHA 2ODWA 4DT1B 3ETLA 3L82B 3SOPA 3B60A 1BMFA 3TAUA 1OSNA 4NPHA 3OHMA 4Q4LA 1PLKA 4EQ6A 2FU5C 2GEDA 2OM2A 2W6JA 2W00A 2ERYA 4N0EA 3OIYA 3AP1A 3L0SA 1S0UA 1Z22A 3EXAA 1OIWA 3P32A 2BMJA 1ZM3A 3B1XA 1WP9A 1Z06A 2RGNC 4DCVA 1DADA 4IVRA 1N25A 2DWOA 4IVQA 1ESNA 4L16A 2DY1A 1GWNA 2RMKA 4LPKA 3ND8A 1OB5A 3U3MA 1YZLA 4DIEA 4JLNA 3RC3A 3CKLA 2QE7D 2WIAA 2FEOA 4I81A 4N1AA 4ZO4A 4PFSA 3AH8A 1FQKA 2NO9A 2QU8A 1OFTA 1E9BA 3N2IA 1QHYA 3DL0A 1DARA 2ZRBA 3AKYA 4C0JA 2ZRIA 1JR6A 1CTQA 5KOYA 4NE2A 1E94E 2PT7A 4M1TA 4RKFA 2ZUCA 1AKEA 3AVVA 2ODNA 4B2IA 2WSSA 1I4LD 3B9PA 3PCRB 3THYB 3K70B 4DLTA 4AKEA 4ARZB 2LKDA 1OXTA 1OXUA 1QDEA 3ZQ6A 4BZQA 2OCAA 4W9MC 4IEEA 4M9SA 2GJSA 2R65A 4HAVA 5JCPA 3ZVLA 3IDQA 5C1BA 1E2QA 1SGWA 1Z0AA 1G8GA 1RRFA 2AXNA 4LJ4A 2ZRAA 3CRW1 4AIIA 121PA 2VP2A 4RCYA 3THOA 2GEVA 2ZITA 3BBPA 1IY1A 4DLZA 3P1JA 1TTTA 1EFHA 1X1SA 3A4MA 4TL9A 1P9RA 3WY9A 4BZPA 2GETA 2EVWX 3VFDA 3U3RA 4K46A 2PBRA 4KXFB 1SXJA 1VIAA 2JAQA 5C4GB 4KV9A 1ZAKA 4X8LA 3QXCA 3LV8A 2YHSA 1KSJA 2QN6A 4AI6A 2IHYA 1PUIA 4M9XA 5D3MA 4BGDA 3U44A 3ZIAD 2JIZD 1AS3A 1QBKC 2PH1A 2TMKA 2I1QA 2QQ0A 4MKFA 1A2KC 4TTPA 4YXWD 1DAMA 2PMKA 2FN4A 2VP4A 4TWZA 3KKQA 4OK6A 4Q4JA 3IO3A 2D7CA 4LJ7A 2CLDX 4RD6A 1L7VC 5E95A 1K6MA 2OAP1 5TVKA 4EFMA 3CX8A 3EZ2A 4ZI3A 2NO1A 4URXR 1Z0IA 2J45A 2CXXA 2CCKA 5JLJA 4JVSB 4KLZA 4RD2A 4XVQA 1W5TA 1ZNWA 2PEYA 3AVYA 4M21A 3AF0A 1E2MA 4M8NE 3AVTA 1E1RA 2ZRHA 1IXSB 3DHWC 3GLIA 3B5JA 1ZM9A 4Q03A 4PX9A 1T5LA 2V6IA 2FSHA 1Z0DA 3HWSA 1KIMA 1IHUA 1C4OA 1RC8A 4GP7A 1GL9B 5BN4A 2AHOA 2VSOA 2EYQA 1RRPA 3QSYA 1YJ5A 2PZGA 1LNZA 1E0KA 4YMTA 4HLUC 1E9EA 3DO6A 4W5WA 3MLEA 3OE7D 3SQXA 3CW2A 2IW3A 2IF0A 2CE2X 1X3SA 1AZSC 5SZKB 4QG7A 2ZQ5A 2AFIE 1W49A 1EFRA 5J4KA 2W6ID 3OEED 2ZRFA 3VU9A 4QM7A 3SEAA 1P6XA 4BLSA 4A2WA 1AA9A 1N6KA 3IBGA 3TIFA 1XMIA 2WJYA 2DWPA 3FWYA 4LV6A 2P67A 5G3ZA 2IX3A 4H1UA 3E1SA 4IOKA 4NYJQ 4PAQA 4TMWA 2AL7A 1MO4A 5E7JA 4TQUS 2ZE5A 3UWKA 5A4JA 1QVAA 2GESA 5G41A 3W3AA 4NCIA 3ZZUA 2DFKB 3NDBB 4UXHA 2A7QA 3R20A 4WA7A 4UNRA 1YR8A 2WJGA 1XEXA 3OAAA 1H65A 1R0XA 4B3GA 5B2ZA 5JRZA 1OT3A 2VSXA 2QMUA 3CO5A 2CDNA 4KU4A 4XD7A 1G7TA 2H1LA 2IL1A 5FTKA 2EYUA 4LCBA 4CZ2A 5JFGA 1Z6XA 3D6TB 1XEXB 3EZFA 1N3BA 3FKQA 4US2R 5AJYA 1KJWA 3BC1A 5KTYA 1PJRA 3NC0C 1V5WA 1M74A 2JLUA 1T0JB 1XMVA 3BAFA 1OH6A 3DOFA 4PPFA 1NKSA 1EFCA 2G1JA 1KI9A 3RSOA 1OXVA 4BASA 3TJZA 2UVQA 4ZCIA 1XD2B 2J7KA 1UKEA 2Q3FA 1D2MA 4DSOA 3ZDQA 5DN6A 4G5SA 4LYJA 5BW8A 4XWKA 1F3OA 3VHXA 3D31A 3MWLA 3C14C 4LY6A 2Z0MA 3GJ0A 4V0MA 1R2QA 1YQTA 2VF8A 1E32A 2Q6TA 1HQCA 3GJ7A 5FOUA 1JJ7A 4TYYA 2JLYA 4D6PA 1IY0A 2HLDD 2ODEA 4Y0AA 2D2FA 5K8UA 2VRWA 4FCVA 4IDPA 1T3SA 1KI3A 1UKYA 3PR1A 5F3WB 3B7GA 4D4LA 4XJXA 4KAXA 2YOGA 5H70A 3AF1A 3SS8A 3LDAA 1QHSA 1R10A 1W4AA 4Q02A 2RGCA 3AKCA 3TSWA 2VF7A 4OQNA 5EJEA 4W7SA 5CB6A 2YINC 4PC3A 5BYJA 3THXA 1N5IA 2B8TA 4D4MA 5JS8A 3OESA 4AWXA 2FG5A 2JLSA 3O8CA 1E2NA 3IO5A 1CF4A 1JBKA 2Z4RA 3FE2A 1X8JA 4P4TA 1OHHA 5FR1A 3U44B 4ZPXA 3FB4A 5L3SA 1UAAA 1KMQA 3WHKA 2VHQA 2H16A 1JQLB 2IUTA 5EE9A 2BJVA 4UQOA 2JLZA 1E2DA 1AJEA 4MYCA 1MO5A 2X1VA 2ZR0A 3TUIC 1FX0B 1E3MA 4A6PA 3FHTA 4JT2A 2OSBA 1G18A 1NL3A 2YV5A 1KJZA 4DHEA 1COWD 1KO5A 4U5XA 4C0AC 4LPSA 1ZD9A 3LRPA 1KK2A 3C41J 3UATA 1GIAA 4OQFA 4JLKA 1EX7A 4A2QA 1EK0A 3NTUA 2QAJA 4WXRA 5JJKA 4Z8XA 1NLFA 3VR4A 3K9NA 3LD9A 4LJ6A 4F4CA 2G0NA 2BV3A 4L15A 4RFVA 1YRBA 4LX0A 2F9MA 4MYUA 4YDSA 4LC0A 1AGPA 4KFSA 3Q3JB 4QHTA 5GJWC 1WA5A 2P2LA 3UK6A 4DLWA 4R2IA 4D82A 1U8AA 3M4YA 5B30A 4LYFA 5DLQC 4C3ZA 3WP1B 4DLVA 3AM1A 2G0TA 1R5OA 3FMFA 1J8YF 2FPLA 3IGFA 3Q8XB 3R9XA 2J0VA 4Q9IA 2GNOA 1GL7A 2V55B 5IRCD 2PZFA 3CLVA 4TLEA 1NIJA 4JKIA 2QMHA 2ZAOA 3RRZA 4CEJB 3ZD6A 5HTKA 1T8TA 2ZREA 4A6XA 2GA8A 4BFXA 1G20E 2QPAA 2ZJZA 4EDHA 1DG3A 4D81A 3FOZA 2GILA 3WBKA 4WW0A 4CEHA 1XEWY 3KKOA 2D2EA 3PVSA 4DT1A 1XXHB 4JSTA 4PSAA 3BH0A 3BH7A 2ZYWX 2B21A 2NPFA 4GSYA 3T1OA 2PCJA 3GLHE 1XCMA 1GKIA 5JHHB 3TSOA 3C7KA 2CHQA 3TNFA 1AM4D 1J70A 1Z83A 4GMXA 2RB4A 1A5TA 2F43B 1AQUA 3AB3A 4KODA 3NBFA 2Q9AA 2VHJA 4A8JA 4EPWA 4IVPA 3PUZA 4Q1BA 3SHWA 4NBSA 2PZEA 3DZ8A 3ZQJA 1XXHE 4NCNA 5A5GA 4MRNA 2C98A 1DTSA 2HF8A 4FWTA 2ZS7A 3ZLJA 1JPJA 2ZRJA 3GLGA 4HAWA 3PFIA 2BBTA 2JJ1D 5P21A 3A1WA 4JS0A 3WMEA 4LOAA 2IYTA 4POAA 2F55A 2WWIA 2IYSA 4RVCA 2ORIA 2VHUA 3WNCA 2EFEB 3BJIC 2DHRA 1M1YE 1ZM2A 2E1RA 3Q9LA 4TTRA 1GRQA 1D6JA 5DN6D 4BECA 2W58A 5KPJA 5CLQA 2XZPA 3X1YA 4KYIB 2B7CA 1M7GA 3DZDA 4BFSA 3CUEF 4OHWA 2VQSA 1E1QD 1E0AA 4Q9HA 4YMWA 1TQ6A 4RZ3A 5CIWA 4MUBA 1SVSA 3LO5A 4DJTA 4ZKDA 5FUXA 2XOKD 4IKEA 3WNDA 5A0FA 1DAHA 1ELOA 4Q7KA 2MMGA 5SZHB 1YVDA 2IT1A 5C4MA 4HB3A 4JLOA 5K8IA 2O8FA 5EE0A 5FUVA 2ERXA 3HU2A 3RVBA 3NBZC 4NH0A 1EESA 2AK2A 5HCNA 1WQ1R 2V54A 3L0IB 1YZNA 2XXAB 3KKMA 5AK0A 1RJ9A 3AVQA 1U98A 5FL7A 2GVDC 2CJWB 4DC9A 4HATA 1U9IC 3SFZA 1YKSA 3THXB 1MOZA 3AVPA 3N5CA 1RPZA 1YZQA 4DDVA 4QRHA 1GRRA 4LBZA 4DUGD 3KQLA 2X8AA 3LWNA 1W36B 2IS1A 4PTLA 4ERNA 1KI1A 3IPXA 2PX3A 3CRVA 4QJ5A 3AF3A 5IF9A 2DR3A 4EUNA 2C96A 4A82A 5CM9C 1KDTA 5FBWB 5AR1A 4TMZA 5B57C 1P75A 2C9OA 1E4VA 2O8CA 4BUJA 3FHCB 1HY3A 1U94A 1F6BA 3EAQA 4M1MA 4CEIB 3WMFA 3BIFA 1XMJA 2V3CC 1KK0A 5IHPA 4WOPA 2CVHA 4LGMA 1P5ZB 1VYVA 1ZIPA 1KI6A 1IAQA 2REXB 4IDQA 2CCJA 2FGKA 2ZVQX 2O8EA 5EE3A 4A0FA 5JSZB 1R5NA 3K0AB 3RS2A 4V0OA 2FEMA 2GXSA 2JJ2A 3CB4A 5J4LA 1E99A 1JAIA 1KI8A 5JRJA 4L9WA 4JLJA 3FKSD 4CT4B 4KO8A 5JWRA 1OKKA 3U3OA 1JR3D 5FH9A 2WTUA 2ZVPX 2KBEA 5LD2C 3KL4A 1W1WA 2WZQA 2OBMA 1JI0A 2VBCA 1KI2A 4ZIRB 6Q21A 2WHXA 2EFDB 5FPKA 1E2JA 1E79D 4B3BA 4Z1MA 1ZUNB 4MRPA 2WM9B 4A4DA 2FFBA 1DPFA 2J1LA 4IDNA 5H68A 3IUYA 2JLQA 1G41A 5KUTA 2WBLC 3AVUA 2JA1A 2FDCA 1U8ZA 1KSHA 1NLYA 2ZRMA 3U3JA 1D9ZA 3J81k 1TF7A 3PG5A 5J4VA 5BN5A 1OHHD 1EG7A 1LV7A 1UBEA 2C77A 2D74A 5K8LA 3CZQA 4PQRA 3T1QA 2NZ8A 3ONWA 2R6AA 1MH1A 3ZD7A 3PUWA 1G1MA 1E4YA 2VP0A 1IJFA 5JI3E 1LB1B 2A5JA 3RLFA 4ILEA 1W0KA 1LF0A 5EZ6B 4LRWA 2WOJA 5FOTA 4F4JA 5JBQA 2CHGA 5KNCA 1GKYA 3F3YA 1Q1BA 1BIFA 2KB0A 3H4MA 4YMSA 4LJ9A 1PV4A 2YWHA 3AUYA 1JXOA 2A9KA 4Q5IA 4M2LA 5GJVC 1G5TA 1DBSA 4KHZA 5FPSA 2RGNA 2ZSDA 5DO9A 3CH5A 2UKDA 2AK3A 1R7RA 1T3LA 1X1RA 2QY9A 4MH0R 3T12A 3BD9A 3RYTC 5IDVA 4E03A 5HE9A 4HZUA 3HR8A 1KGDA 1OPXA 4TMTA 3W90A 3ZVRA 2VEDA 3QJYA 4YMUA 3VTKA 1KY3A 1PZNA 4LHXA 4B47A 1CJTC 5TARA 4O2LA 3VQTA 3ADBA 1BYUA 2ASEA 2VLIA 4LJAA 4F38A 3C5CA 5KSZA 1GG2A 1JPNA 4AKIA 3KUCA 1OFUX 1KO7A 1ZU4A 4RY2A 5EQTA 2EW1A 5FTJA 1DAGA 2QAGA 2GF9A 3B8HA 4NTZA 4LZZA 1TQDA 4PC6A 1JJVA 2IYWA 3U4QB 2V1XA 4Q4JB 4E07A 1EGAA 2FGJA 3KKPA 4HI0E 2QAGC 4DXAA 1NY5A 1OV4A 3CF0A 4JBXA 1N2CE 3EWAA 3LA6A 2F3RA 5DYGA 4CT5A 1W47A 3JVVA 3FMPB 3U7HB 1NKTA 1TUEA 2O0KA 4OI4A 1NF3A 4YLGA 1UDXA 1A82A 3KQUA 5CJPA 1Z6YA 5DSZA 4ZCLA 1HT2E 4TMVA 3EARA 4A8JC 2ANCA 3L0OA 2DFLA 2GKSA 2VTKA 4Q4HA 5G40A 1FTSA 1MRSA 2NMVA 3AEZA 3VHLB 3K0FB 2C5LA 4C0HA 4B3XA 3B2EA 4A9AA 5AJWA 1FTNA 1UKVY 4NYIR 2ZJAA 4Q9KA 1CXZA 3D8BA 1XTSA 2J87A 1DOAA 1N6HA 5CDFE 2CL7X 2QP4A 3KUDA 5FI0B 4KITB 3B6EA 2GK6A 4Q1FA 3RC8A 1P61B 3AF4A 1F2TB 1CR0A 3CNOA 4BFVA 1P3JA 1ZJ6A 3K09A 3EASA 4ARZA 1NBME 4MKIA 4BLQA 2WSSD 1XJ0A 2AFHE 2GAAA 4AYWA 2GJKA 3EZ6A 1OIVA 3QPVA 2BBOA 4DBLC 1DAFA 2ZM5A 1P2TA 4PPNA 3KKNA 1KHTA 2G3YA 2OG2A 4UNNA 1OFHA 1HYQA 2JLRA 1VYUA 4L5BA 1U0LA 2HT6A 3GJXC 4MRSA 4DDWA 4PAOA 3TBKA 4ZDJA 3EZ7A 4C0SA 1JQJC 4DCNA 1AN0A 3RS5A 2N46A 1E1QA 1XTIA 2R2AA 2ATVA 2QPTA 1VTKA 2ZXUA 1G21E 4RZ2A 4BEBA 3MD0A 4US1R 4ZKEA 2JLXA 2PLRA 4OI1A 1KAGA 3PV0A 3TMKA 4GBMA 1N5KA 4R71A 3GP8A 2C9YA 4TT3D 4BPBA 3JZMA 1OJLA 4EPYA 4HDOB 1A1VA 4C0QC 1LF5A 4GZLA 4I1OA 1E2LA 3EPLA 1DAIA 1KMHA 2O0HA 4ASUA 4PQFA 3UXMA 1UEJA 3W8RA 2YKGA 1E2IA 4WBSA 4IOMA 1SXJD 1KAOA 1L8QA 4M53A 5JECA 3T5GA 1GAJA 4LK2A 3WHLA 4TYWA 4LHYA 1W0JD 3R7WB 1XBTA 5D3QA 3CF2A 2ATXA 3HPQA 3QBVA 4PHFA 3GLIE 3EPKA 2QA5A 1FUUA 1XPRA 3UPUA 1ZC4A 2GZHA 4PQYA 1GILA 1WB9A 3MRSA 4JLMA 2OCPA 3MJRA 3VKGA 2RGXA 3A1SA 3UMRA 2A5FA 1IN5A 1FMLA 4WZBE 1SVLA 1UEIA 1DELA 2QORA 4FMCF 2V1UA 2YOFA 2G9NA 3FVQA 4KSBA 3SC3A 2YOHA 2JEOA 3TK1A 4J0QA 4BFUA 4MGYR 3CRRA 2ZRNA 4QHSA 2GTPA 3VR2A 1P7CA 2AWNA 2VSFA 1ZIOA 2NO6A 3HDTA 1HEIA 1XTJA 2O0JA 3UIEA 1SVOA 4HAZA 5E7IA 5AUOB 2ZRKA 2REBA 2XGJA 1II8A 3LBHA 4MRVA 4PHGA 3OIVA 2QTFA 4G5GA 4I1VA 1BH2A 1E2FA 1II8B 3I73A 1P9WA 1GITA 4DVGA 2YWFA 2O8FB 1GFIA 1G8FA 2JGNA 1JR3A 1MT0A 2ZRLA 2BJWA 2QMEA 2O8DA 3HU3A 5F9FA 1G17A 1Q22A 4ON9A 3AF2A 2HJGA 5KNBA 1DEKA 2CK3D 3KQHA 3OIWA 3VNUA 1M34E 1QRAA 3HP1A 4B73A 4Q7LA 1Z6TA 2QEQA 2CBZA 4JVLA 4RKEA 2HLDA 421PA 3T15A 1KKMA 2R8RA 4HUQA 1N0WA 1Z29A 3A4LA 1ZUIA 4M9ZA 1G4UR 4BZXA 3RNLA 3FGNA 4MITA 4MYTA 5LDDC 2J46A 2JLVA 3AVOA 2BMDA 3R9WA 2AX4A 3GMTA 2F1JA 2B8WA 1W0KD 3IILA 3QY0A 4V03A 1FPMA 2Q3MA 3QQ5A 4TYPA 3GLGB 4KI0A 5DH9A 1ZNXA 2MSDB 1Z2AA 2EU8A 5FTMA 4A2PA 4X8OA 4GOKA 4GRAA 4O3MA 2VP9A 4LBYA 3P4YA 1NVVR 1Z8FA 4V0ME 5J47A 1UF9A 4W5HA 3X1DA 2J0UA 2VP6A 4MUAA 2CHVA 4PZYA 3RDPA 2A5YB 3GJ5A 3RAPR 1O87A 5DHAA 3SJAA 4RZXA 2D4HA 4JKYA 3ZGXA 3EPJA 3Q7QA 5IK2A 1AIPA 2EFGA 3RWMB 4IJMA 4B74A 3KJIA 5AJVB 4TLBA 5JHGB 1E9AA 2J3EA 5FBVB 3ECCA 5DI3B 4IXNA 3VKWA 2GXUA 3ASZA 3RSLA 2YYZA 3D7MA 1EFTA 2YVUA 3LBIA 3QKSB 2OFWA 2WVJA 4Y0VA 1VCIA 3FYHA 4URUR 3ZZ0A 2H18A 4TYNA 4CEJA 1NN0A 3G5UA 1SKYE 4URVR 3T5DA 4WIAA 1Z3IX 3TKLA 1R6BX 2PEZA 4MGZR 4OI2A 3BS4A 3THWB 3W6NA 4Z1MD 2N1BA 5KSPA 4PO8A 1XX6A 3FTQA 3OEHD 2C95A 3CM0A 5KHOC 1KI7A 2ZRGA 1KJYA 2NGRA 4K81B 5G3YA 4BRUA 2VHTA 1UPTA 2CL6X 3GLFE 3BE4A 5EP1A 5C2JB 1IN6A 3A6PC 1N6LA 5BXQC 4HUQB 4PAMA 1OH7A 1EWRA 2A5GA 2PLFA 1ZCAA 3DM5A 2V9PA 3B85A 3V00A 4MDEA 3K9LA 3TVTA 4C7OA 1VDZA 4MGKR 2O8BA 1D8TA 2REOA 1HURA 3A37A 4LBVA 3IIKA 1R4AA 1UJ2A 1T91A 1AGRA 3QF4A 5GJCA 3R9IA 2O8DB 1IBRA 1E98A 4QC2A 3IIJA 1W4RA 2NO0A 3GEIA 2ONKA 3QEOA 3K0FA 4CVNA 2HUPA 4OK5A 1T8UA 4B2PA 4QHYA 1OYYA 1NVVQ 2G77B 1UADA 4Q4HB 1SXJC 3E2IA 1S9HA 1G6HA 4U00A 1W2HA 2QG6A 5AUQA 3AGPA 1KO4A 3MCAA 4ESHA 2GXAA 5TMPA 4XWAA 2WKQA 2VPPA 5B64A 3KTAA 1ZD8A 4BWYA 1DVRA 3QKTA 3FFAA 3P20A 3E5HA 4Q7MB 4U7DA 4CDGA 2Q0HA 2QAGB 2HCBA 3QXHA 4NHOA 2CCGA 2R62A 4EFLA 5HKKA 4RD1A 3K70D 2GCOB 3KJHA 3QVUA 1G4AE 3LVQE 3CR8A 4JT4A 5FOVA 1QVRA 4D4JA 3C16C 1M6NA 2AD5A 3BRWD 4C0KA 1QZXA 1Z0JA 2B7BA 2XZLA 1HE8B 1OIXA 1US8A 2X2FA 4OHXA 2ZANA 3C8UA 1Q12A 4PC1A 3GCGA 4LHVA 4ACBA 1F5NA 2OT3B 4IEIA 1XP8A 2NTYC 3A58B 2RHMA 3EC1A 4RD4A 4Z54A 1B23P 1Q1EA 4BLOA 1G3UA 1J7KA 2QQEA 3ND9A 4XTCS 3H84A 4IOJA 1HE1C 1RKBA 2NZJA 1RIFA 2AWOA 4OHZA 5FFMA 2WJVA 2FFHA 1QHIA 1KDOA 4PC2A 4TTQA 4HDCA 3F8TA 1U81A 2XNDA 3CRMA 3M0EA 3IBYA 3U60B 2ZAMA 4C9BA 4HEJA 5KNDA 3NIBA 2HT1A 3GFTA 2IS4A 1YR6A 4UKDA 4G5OA 1JB1A 1HV8A 4C4PA 2DB3A 5EUMA 1XDBA 1UBGA 2QTVB 1ZU5A 1E96A 1P4SA 3A36A 3LXRA 2P0EA 1ZNZA 2ZS8A 5EXPA 1F2UA 2BWJA 3LY5A 1ZYUA 4L9SA 3DOEA 4A92A 1U2RA 1TX4B 1IXZA 2H7VA 4B6EA 4NYMR 2IK8A 4F7WA 2X2EA 4OBEA 4TL8A 5JCZA 5AUPB 4K8OA 5FI1B 3IQWA 4G01B 2FH5B 4M4SA 4NONA 4TLDA 1ZUHA 2YC4C 5JMTA 2EFHB 2FV8A 3C15C 1BYIA 4FN5A 2W83A 5J4HA 1RRCA 3UG7A 3G0HA 1B0UA 2J0QA 1OH8A 2Q9CA 2ZRPA 1KO8A 2AR7A 4JIMA 3HPRA 1NG1A 4FWIB 3ADKA 5F98A 3BOSA 1H8ED 5JJIA 2ZI6A 2J41A 1J90A 1J99A 2JCSA 2W6IA 1KI6B 4NDZA 3I5YA 3MJHA 5DHFA 3W3ZB 2ZSFA 4EPVA 4AYXA 1I4TD 1K5DA 1NVUQ 1FFHA 5FBQB 1XEFA 2IYUA 1GUAA 1L4UA 4B2LA 4GPTA 4OJQA 1S1CA 4DIDA 1SVKA 2X77A 1HT1E 1FX0A 3X1ZA 1XWIA 3I8SA 2HYIC 4RCZA 3SU8A 2OBNA 4QGFA 3U3KA 4RFSA 1GTVA 4F92B 3T61A 3WMGA 4DLXA 1NJFA 4DKXA 1CR2A 5GVSA 4WAUA 4C0LA 1VIYA 1RFLA 3RANA 3GJ3A
chains in the Genus database with same CATH superfamily
1L0BA 1VYTA 1ANKA 2YXNA 4FINA 1U5BB 3G2NA 2DQKA 1II0A 3PWSA 3SYLA 2C5FA 5EEGA 4H31A 1TEVA 1QR6A 2BDEA 2WF6A 2XSZD 5JPCA 5ELXA 3G5TA 4ID3A 3E18A 1C3VA 1PAUA 1YZHA 1Z8NA 2Q8QA 2QT0A 5E1BA 3LT5A 1F4PA 2VAXA 3ZCRA 1XD8A 4TQ9A 3Q72A 3HN6A 1P9OA 1VL8A 4MKRA 2XXAA 1GEEA 3W2FA 2CVQA 3ILHA 1V1MB 3DEIA 2QX4A 2ANBA 4C29A 2ZQZA 4BE7B 1RYHA 3KQKA 3LZ6A 2FNAA 3MSCA 4KE8A 2JASA 3HVKA 5AKGA 1AMUA 1SQ5A 4FMBB 3FGZA 1I3NA 2H2IA 1VMAA 3JD0A 2HJRA 1RZ3A 3ORYA 3MWEB 2VT3A 4NOMA 1VJGA 2VUIB 1DBQA 4ITRC 3LDGA 2BUCA 5AI5A 4HZIA 3RVDA 1VJCA 1TYAE 4TYQA 3H5TA 1YJCA 4LI0A 2FKNA 1FW6A 4JCCA 1KJIA 2ZI7A 4RMHA 2Y1WA 3MHPA 1WXQA 5DSTA 1VHWA 3ZDBA 1OROA 1XPUA 1M5TA 2PO7A 3A11A 5HJ7A 1EXMA 1KAEA 4U2KA 5DWVA 4F1WA 3S44A 2JFYA 1C9NA 1MJHA 3IMEA 3OO1A 2C2GA 2Q8PA 4RSMA 1N6RA 2PGJA 2QTHA 3LX8A 2GCNA 5LOVB 3AF6A 4I55F 1TUBB 2H2AA 5BNIA 1DKLA 2JAWA 2HDOA 1EI9A 1VFNA 2G4VA 4OGFA 3M4JA 4TZ6A 3GVHA 3Q8LA 4EHJA 3A4YA 4R2HA 4DCMA 2Y93A 4JLWA 1ZLXA 1TK3A 1BJTA 2BFEA 2Z5LA 3UJ7A 3VVCA 1TKBA 3P8ZA 4P22A 1JH9A 2FSPA 3V9PA 3VNAA 1JKIA 1QDUA 3KV1A 4BDSA 4KQIA 5JAQA 4CGZA 5DYTA 3ETGA 2RJNA 3IUEA 3QFTA 4CU2A 4DM4A 2CJYA 1GUDA 3U1VA 1FRZA 3SSOA 4XQ0A 2JRLA 1KA9H 2OM6A 1XEAA 4OUDA 1XB2A 3JQBA 1EK1A 3PHBE 2RGBA 4ZIRA 2P4SA 1L8AA 5KU7A 1I1HA 1V25A 2R6CA 4OHKA 5CTAA 2MINA 4E5NA 4C87A 1APBA 1K98A 2LIPA 1HDOA 5ALIA 3O74A 4XUGB 4IIHA 2IEDA 1XK6A 5DW3A 3NT5A 2X6QA 2H11A 2W6CX 4ZGWA 3KVNA 1K8RA 2P7IA 4A15A 4Z3OA 4HSGA 1L2TA 2CYAA 1NUAA 1LI7A 1ULSA 4M86A 5HUHA 4L5JA 1R5JA 2YHUA 2OORA 3HKBA 4NJOA 3Q2KA 3CZRA 1ZQ9A 2BOVA 2IPMA 3GT0A 3GPBA 3MJ4A 4E5UA 1V7CA 2JJ8A 3AB7A 2OCKA 3ADPA 3K15A 4L9RA 3ONNA 3RG2A 3H13A 4FMDF 5L7WA 2LCQA 2WPNA 2FCRA 1Y7TA 3CX6A 4KPEC 3SY8A 2G1KA 1G19A 2CC2A 4H7EA 4IDDA 4MQBA 1ZM7A 4KQ6A 4P31A 1LK5A 3O6VA 4G1CA 1YJAA 3VJKA 4BBPA 2R8YA 4RF4A 1YU6A 3A2LA 3NKVA 2OL4A 3T7RA 2WOOA 1NLZA 3KT0A 1UKZA 3JQPA 4N65A 3PKIA 2ECQA 4E2YA 4P33A 1GPNA 3FAZA 3K71B 3CBQA 4CFYA 2COEA 3DHVA 5D8DA 2I87A 2H9AA 2DULA 3KZVA 5IKOA 4ZZ2A 1GM5A 2OEPA 2XB2A 2ZJ8A 2R68A 4FLFA 1CZRA 4AUMA 4EABA 1N0VC 3K0CC 2D2XA 3DXYA 4DSNA 3OHPA 1M2NA 1DJQA 3P45A 2YWBA 2Y66A 4UVDA 3NDPA 3V3KA 1TYBE 4FQ7A 2WK1A 1Y8AA 3QE2A 1LSJA 3I2IA 4G1UC 1GPWB 1X86B 3DCYA 4QGAA 4ZZ1A 3W4JA 5CITA 1B0PA 1C7FA 1GVNB 3ZHBA 2FVXA 5K0ZA 3ZBTA 4NABA 2IZOA 4K87A 3QLEA 2IYOA 3B82A 3E5RA 3GVXA 1XZKA 2G82A 3O2SB 3BB1A 3HYNA 3R3SA 2VDWA 2V4MA 2WIKA 3GRPA 5GAJA 2HMAA 3VGPA 5IT4A 2I65A 3P0JA 4MWCA 5LDHA 3CUUA 1Y3BE 3S7ZA 1OKKD 1WUYA 3SJ7A 2VN8A 1GNPA 4NE7A 1SWVA 1G8JA 1CY1A 1IRIA 4D9FA 1I4OA 1SRRA 3NNDA 3Q7EA 2VEOA 1CJKC 4XE5A 1GDDA 4NK5A 2C07A 4IYRA 3T1TA 3TRFA 2NTVA 2G67A 2ZKIA 1KI4A 4CG2A 4P54A 4O8ZA 4D9EA 4J16C 1AD2A 1CYDA 4OOFA 5F33A 5FBHA 2GF0A 3T4PA 1CE8B 3SJBA 1NV8A 5T67A 2IVFA 3JU3A 3PEVA 4I99A 4LSZA 4E21A 3G0IA 2HCFA 2AS0A 3TXXA 1QZUA 1QR2A 1JEOA 3SEQA 3QE9Y 2W6PA 1S2IA 2FPKA 1YQEA 3G88A 1I7LA 2QTZA 1KJ9A 4P6VF 1E1RD 4LDQA 2GI4A 3G2JA 4HMOA 5AKEA 2DWQA 3QMMA 4HBGA 4HWGA 4KSYA 2IP1A 3GLQA 3KQVA 1C2YA 4Q3KA 4DABA 5KNLA 3OOEA 3JD2A 5B3JC 4YONB 2XRZA 3KCNA 5JZVA 3DOUA 1SR8A 2AGVA 3N2GA 5AJZA 3UKDA 3UG6A 4L3WA 3KYIB 3UMSA 5HGXA 3PGA1 5KKNB 2PSJA 5EWMA 4S1OA 1MO3A 2QGNA 4BTVA 5JI2E 3JAMA 4NU5A 1NY6A 4O2AB 2QRJA 1E69A 1Z73A 2NPOA 4DRYA 2BGKA 1Z25A 2G0AA 2OHVA 4F2GA 3EUFA 4LZPA 5EP2A 1YQ9A 2H4FA 3I1FA 3SR4A 5K3SA 4L7VA 3ZJ4A 5ESRA 4RMNA 4ISBA 1E61A 5SZJA 3T3DA 3KPVA 3UWPA 4E3ZA 1BXGA 2UYHA 1I6LA 4X84A 1NLUA 1Q20A 3L1VA 1Z0FA 3I2JA 2X5XA 3LCVB 1V37A 4K9OA 3Q12A 3IHTA 3DL2A 4F86A 1UPCA 2H9IA 1DJPA 1I2MA 4H2DA 1PFGA 1JKJA 4M0PA 3ETHA 1AUVA 2HA4A 3E05A 4MK4A 5B53A 2W2TA 5PNTA 1W46A 2ZB3A 4D9MA 1UXIA 1XSEA 3NHWA 4QXMA 3RFUA 1JT9A 1S02A 3IJEB 3RRNA 5CCXA 3I58A 2GZDA 3PQCA 4NE9A 2X8JA 5B6PA 2GWRA 1SVUA 2G63A 3OIDA 4B3DA 5HBRA 2JK1A 4LMRA 3GXOA 4R3NA 5JG7A 3U19A 5CH5A 3AM3A 1KSGA 3IOEA 1T15A 3AZPA 1C0KA 4ZT2A 1L3BA 2OYRA 1NF2A 3TTXA 4DCGA 5ALVA 4QGBA 2PRIA 3H86A 4RGYA 3PWZA 1JRLA 7ABPA 3TE7A 4RVGA 3A31A 1Y9DA 1NUQA 1WD5A 4BGIA 1ZY2A 2J67A 3PUIA 4ZJZA 1P72A 1S3SA 5A5DA 1BN7A 4BMSA 2D0DA 1CUUA 2IWRA 1I3CA 4WV3A 1YZYA 3GRRA 3W2EA 2BGMA 4Q7JB 4Q9JA 1CEYA 3Q7TA 1VP3A 4NENB 3TM5A 3WYFA 3OOHA 1LV8A 2V6JA 4WE3A 4F6RB 1SU7A 3EWIA 3H16A 5CVTA 1Y8ZA 5JEEA 1XRNA 3LCCA 1ABFA 2IIQA 1P2VA 4OXQA 4ZTBA 4UNPA 1COWA 3AJEA 3GWGA 2PXCA 1RE0A 3KO8A 4OXRA 5A9SA 4RMIA 2EDCA 4B82A 2Z3WA 2ZUUA 1ZUWA 2E89A 4ZJPA 4LVOA 1GCAA 1Y9JA 1P0PA 2C4VA 2E4UA 2HWKA 3LUPA 5DYIA 2PMCA 4AECA 4CTKA 2IYNA 3IHWA 1ISSA 1Z5PA 2W6MA 2FF7A 3CLKA 4LDJA 4INAA 3OTWA 2GARA 1CY7A 1GQQA 2H5EA 4HVAA 4BU1A 2NUTA 1ITZA 1CLUA 3AFHA 4HB0A 1I9GA 3B5IA 4NYMQ 4R7ZA 4C14A 1WY5A 1XRJA 2Y1EA 3GA5A 4XGNA 4TUYB 4CL3A 4OAPA 3ZHRA 3NRCA 1N5LA 2OLKA 3HBLA 2V9ZA 3FPSA 4B17A 1LNQA 3PYLA 1I51A 3HMKA 4LQCA 4FDMA 3ROKA 1SWWA 4Q1EA 4CKBA 4MWTA 5M2QA 1K86A 1GA4A 4OO3A 5BMVB 3PLNA 3DG9A 4TPKA 1J2UA 3DEYX 5AW8A 4HLDA 3IE0A 3N6VA 3GDHA 1F51E 3DKPA 3E70C 4AP9A 1A9PA 1F1JA 2E21A 3KLPX 4QQKA 3M7IA 4NJMB 3FD8A 5AJHA 4PNEA 4KXNA 4MUHA 5ALPA 1TM5E 3LZDA 1W36D 3KOOA 5K3AA 4DY6A 1WXHA 1TVEA 2HWWA 4ESOA 1KY2A 1R12A 2P9FA 5BO5A 3JQGA 3JQRA 3AOEA 4QDTA 1AKUA 4DUZB 1QWOA 2VJKA 4JFRA 1U5BA 3UVEA 1MVOA 4ZARA 5JARA 1DNPA 4DG8A 4DSAA 1OA1A 1X0VA 2JFGA 4PVCA 3GLUA 4J91A 1NPDA 1FNSA 2ZPTX 3TE6A 3FYSA 3FRJA 4AZ0B 1PX0A 2IEAA 3D1LA 3G8BA 4A8HA 5LB4A 5I47A 1KYIA 3DW1X 4ZC8A 2ZJ5A 3CLRC 4OBBA 5B7GA 4MP3A 4U7WA 3ICQB 2C78A 3U62A 4QBFA 1LY1A 1IPHA 3FZQA 2ZTHA 4XPZA 2HJHA 2ISQA 1FRQA 1YBVA 3LK6A 5ECGC 3AGQA 4KO4S 3GFPA 2J48A 1CUSA 2VRNA 3FPGA 2GT1A 4BQQA 4D25A 4I46A 1Y8RA 1FS5A 1KKUA 4S12A 5I7AA 3CONA 2DPHA 2BBWA 3I2GA 4ZVMA 1H2XA 1PSZA 1ULTA 1MT3A 2QLTA 4EELA 1PT6A 1N2CA 4PPQA 4NV1A 2BR3A 1T26A 2H85A 1BROA 3FNIA 2BN4A 3UAVA 4AJKA 4BVKA 1YFJA 2OAQ1 4R2LA 4HAXA 1N2SA 1GYQA 2Z2YA 1O8BA 2X0NA 2WJ4A 3MIZA 5LQDA 4JJ4A 3VZDA 3BCHA 1NFRA 1VIMA 5TT1A 3K70C 2A0WA 5BW6B 3B1VA 5D3KA 3WVNA 1LK0A 2FOIA 2H17A 4P3YA 4Y9RA 5E8JA 1QVZA 4PSVA 1E3IA 2Y1DA 3ZJTA 2IXGA 2OB2A 2R8OA 4G37A 4D0SA 4FR2A 4FFRA 3EXEA 3WYNA 5J2TB 3M6AA 2ACWA 3M89A 1Z5ZA 5KJ6A 3UAXA 4UCQA 2LWIA 1L4FA 2HNBA 1VHTA 3LKVA 3WIVA 1JQKA 1LI4A 2WU4A 2FMXA 5TR9A 3EX7C 1O3YA 5FQNA 1JV2B 1GZ6A 2FOXA 2P9ZA 1NUPA 2PK3A 3ABIA 3MG9A 4LQDA 1VFPA 3SCZA 3IEIA 3SXJA 1Z39A 3RUFA 1OZHA 2HDNB 2R7KA 2RARA 3EZGA 3FLEA 4RA6A 2BIFA 2BMFA 2CKDA 2PX2A 3JQ8A 3NX4A 3O4HA 3QI7A 4BYMA 4QUHA 2IWHA 2HF9A 5EHXA 2AE2A 2CY0A 2J7PA 1UDBA 2NO5A 1NW3A 2A94A 1KL7A 2X4IA 2XCLA 4UZFA 3DBOB 2YV2A 3SSMA 1GVHA 1CQPA 5CYPA 1YTLA 3TTYA 2XADA 2C4TA 3LY8A 4P4SB 5FUYA 3AKDA 1GLVA 4LECA 4UHJA 2OQ2A 1Y7IA 3VSCA 2A3NA 4ND1A 4GKVA 3W7AA 2KLBA 1NMSA 2UUPA 4HOYA 4LDAA 3WGIA 3IHKA 2WMOB 2V7PA 3NHRA 1N9ZA 5KSYA 2OXIA 3HCRA 2P27A 5CHEA 3UWOA 1EWQA 1AHNA 3GLHB 4KVAA 1AO0A 4QOFA 1RPAA 1JDSA 4EW3A 1KJJA 2GLUA 1IULA 5DTRA 2VNKA 4TM7A 3IMGA 4J16A 4K28A 4X00A 1LLDA 2GJ8A 4X54A 4BLRA 2A0YA 4YAOA 1J9ZA 3OEHA 4YAUA 3GJ6A 1LPPA 1P39A 1OLXB 2F2TA 2VJLA 2X6TA 3DDUA 3B3JA 3DOHA 3ZLBA 3AP2A 3Q3GE 1DIGA 4J76A 3TXYA 3UJCA 4JQOA 4F3NA 4U6SA 2L42A 1WMSA 1P17A 3NT4A 5CXSA 4EUKA 1LS6A 1E79A 1VBFA 2KS6A 4JJ7A 3SJUA 3RU2A 3WFZA 3K9GA 4BUCA 2WRZA 3A6JA 4HN9A 2XBUA 1V26A 4KAAA 4BFTA 2HV8A 4CQLB 2EX1A 1U2GA 3VR5A 4R1SA 4RPJA 2JATA 3N0WA 4O4LF 3MOIA 4Y0NA 1JZSA 1SA0B 4LYGA 1T0BA 4ZP1A 4KOAA 1QTNA 2VQDA 3I6IA 3JASB 3U0BA 2GAFA 4WECA 1PJ3A 4JYBA 3TLGB 4ABYA 1PEKE 4BKUA 5CFNA 5EHZA 1CRZA 3O0TA 5T4BA 2GUWA 4RE6A 3AJ8A 1NXXA 2JJ2D 3I5MA 1ZPDA 1KBZA 4IWYA 4WOKA 3WLHA 3UAOA 3VZCA 4C0BA 1UKAA 2K7FA 3HB1A 4HXYA 3BE5A 3RRBA 3EIFA 4WDRA 3ROGA 4BHTA 5DCLA 2PAAA 1I10A 4CV1A 1EUZA 4Z7OB 2WYIA 4XSGA 2H00A 1GUFA 4CYMA 1QQ7A 2P6UA 4G36A 5DMHA 2A8YA 4JHXA 1OC2A 3A1UA 3RFXA 3GLSA 1WCXA 1XJCA 3FTPA 3BHIA 1UPBA 2AA3A 4YP9A 4RSGA 2PPVA 4KB5A 5F5NA 2XMGA 3PDIB 2FZEA 3H4IA 3DZKA 1TXGA 1R8SA 4IDHA 1V5FA 2O54A 1XL1A 1OTYA 5F23A 1WW8A 3OTIA 4RPHA 1JHDA 3P94A 4KR3A 4BS9A 1U3VA 3THYA 3ZOKA 3PITA 4ZYLA 3A1FA 4CIDA 4WZ6A 2IYXA 4RPGA 3QNMA 3SJZA 1AUOA 4Z0PA 1UUFA 2HU7A 1VE6A 3GT3A 3NTVA 3DEKA 2J5BA 4Y1FA 3NM5A 5J9FA 4Z5XA 4OATA 2WI8A 3IP7A 4E31A 3QOYA 2REQB 2G06A 4JQCA 5JSHA 3SZLA 1DB3A 2NV2B 3TBHA 3I1IA 4S05A 4NOKA 4F5ZA 3VZPA 3LVRE 2WIFA 1MO2A 1QMPA 1MF7A 5IT0A 2HH9A 2RH5A 1D03A 4IFBA 4XCQA 4INZA 3WLOA 1VIDA 2ZU0C 1Y3AA 1WOYA 2IUSA 4Q3LA 3TSYA 2DLDA 3H9EO 1O6ZA 3F2VA 4JL6A 3R7BA 4GRIA 2CXPA 3O91A 3WHIA 1JL3A 3TNLA 1V48A 4FHFA 1UBCA 3VOBA 1ORTA 3W5BA 1MAHA 2WWGA 2JFPA 3A1VA 1NWHA 2E87A 3IXQA 2Q50A 4YMVA 3RS4A 3QE4A 3CJRA 1NSFA 3ZDCA 1MGOA 1XLVA 1E9FA 1I0ZA 4M0DA 4GT1A 4H16A 3QVOA 5GONA 1QYIA 3QVXA 4GOJA 4PZLA 1QYRA 3S0JA 1LI5A 2C7BA 3O5AA 3R5FA 4OBXA 1QO0A 4RVUA 1WCYA 1ZD1A 2J6HA 5KKAA 3DM9B 4J03A 2IUUA 2XKJE 2Y0CA 1LPOA 4PO9A 4RK7A 1H2EA 1WLYA 3MTEA 3FZGA 3GEHA 1B73A 4J2OA 4PZ9A 3ROPA 3FMGA 1OF1A 2ZZNA 1MW8X 2X9VA 3KWLA 3ORQA 4OOEA 1GOTA 2GZSA 5EHNA 5ENZA 4Q18A 3GEPA 1QCZA 2G9RA 3CT4A 1QF6A 4Y2TA 1HFKA 3IQZA 3F0TA 4IDEA 5JWHA 2FFJA 3KLNA 3L1UA 3RUIA 1ZJ4A 3VR4H 5G4KA 3EDRA 3MWYW 1FFCA 1JECA 5ALOA 3UB3A 4Q3BA 4AVYA 2BFBB 3QTBA 4NICA 2PX8A 2I3BA 4KDFA 1BU5A 3MC1A 1VBMA 3DMPA 2R6DA 4JZKA 2OXCA 3T6KA 2K2WA 1Y4AE 1YUBA 3VYVA 2ENWA 1V6CA 4RO0A 1EIWA 4BNJA 1WDTA 3HR7A 4E6EA 2Q0XA 4OL9A 4N18A 1X19A 1C8LA 2GCPA 3ZWMA 2F8MA 1DHRA 3OAAD 5GWXA 3C6MA 4B44A 2PBZA 5C4IA 5KVSA 4RD0A 3FW1A 1LX6A 3DZIA 2I7DA 2QROA 3DP7A 4WCVA 3MUNA 4B43A 4E5VA 5C5CA 1QP0A 3HH8A 3RUDA 4QOHA 3R8CA 2YXBA 3QFCA 4D4KA 3QX3A 1KERA 1P1KA 3EGDA 1W96A 4NG5A 1R8YA 3R7DA 3TEFA 2X22A 3NHFA 4YRMA 3I9V6 2Z43A 4M0KA 3ND5A 1U9YA 2RH4A 4N49A 5CCDA 3VGJA 2G08A 4W9NC 1GLGA 3ZQ4A 5BVGB 2QRZA 1T0HB 1PVOA 2ZYTX 1VE7A 4FZ3A 2C88A 3BFXA 3PX3A 2YNMA 6ADHA 1QHXA 1EXWA 1U28C 1W4BA 3BWMA 3QWBA 3ISVA 4KMOA 5ALXA 5PGMA 3T3EA 4A0HA 3HJAA 4PHCA 5IJ0A 1F06A 2XECA 2ZETA 1X7WB 2I99A 4H1HA 5FV4A 3ZXUB 4GOXA 1HTWA 2OUKA 5KDOA 1L3CA 2Q9UA 2DQYA 3W3AH 1WE2A 1E2PA 1XMXA 4O33A 4RHUA 3PLAE 1MKYA 3C1TA 1MCZA 3LIPA 2V7QD 5K51A 4XIJA 3LF1A 4DXHA 5K6RA 1UJ6A 1ZRNA 1KF0A 2XITA 3GJSA 5C46F 4INPA 3FWNA 2Z1NA 2A9RA 1WB6A 2R2GA 3C1OA 4XQ9A 3TN7A 3UGQA 1EAMA 2IHUA 4TKUA 2ZIFA 2XAAA 5CT8A 2G70A 1SOMA 3IXLA 2A5DA 3C85A 4DWJA 5JTTA 2FEAA 5IAAA 1GSAA 2JLXA 3VR5H 1ETUA 4ZZ3A 3GQBA 5TQ2B 1KR2A 1GZHB 3WWOA 4JYCA 2B92A 3DVLA 4A0RA 2ZIAA 1EP1B 1FPQA 4MR9A 2YZ2A 1U2SA 5JD5A 2NG1A 2MSEB 4BN5A 4EUEA 5J23A 5H7XA 2P77A 3U4AA 1LDBA 1LS1A 1XQ6A 1PKXA 1ZSNA 3NDIA 3O4VA 4M1OA 4MI1A 1K63A 1Z4NA 1T1RA 2XCIA 3V4FA 5B1HA 1NVMB 2C3OA 3Q5DA 5HP4A 4ZCSA 1T24A 4QGGA 2P62A 4IHJA 5TVGA 3BUSA 5I7OA 2ZSHA 1EYZA 4KO3S 5AJTA 4JJZA 1ILEA 3C4QA 1DFHA 1BOOA 1N2BA 3GUCA 2OO5A 2AKAB 3HWX1 4B31A 4KXXA 4YAKA 4AO7A 3FCXA 1IMJA 3A04A 2XGSA 1R4NA 2OD9A 4OLHA 3CXRA 2QE7A 3C70A 1J0DA 3DCIA 1Q1QA 4MQLA 1QTRA 1QZTA 1M33A 3LDHA 4EHDA 3H0KA 2CWWA 1SIUA 1DKOA 3NIWA 4X6XA 1RLTA 1EFVA 5BOVA 4U9UA 5K1ZA 4C2AA 2UV8A 1YHNA 2DFNA 1GZUA 3A1EA 4TTSA 2WPDA 1IXKA 3L6EA 5E6SA 3G0GA 3SEZA 3TB6A 4B09A 4HNUA 2P69A 1D2GA 1QQTA 4PYMA 2IOYA 2GLTA 3KVRA 3R0JA 3ZQKA 5IU6A 1VJRA 1DC6A 1Z47A 2Y2VA 1DX9A 2HK7A 2JDID 2QLNA 3I04M 3L84A 4BAZA 2PA3A 5EE5B 1U0HC 1TCBA 1GU1A 2UUCB 3VMMA 1XYVA 4ER6A 1RRMA 1VDMA 2NV0A 2VYVD 2JFQA 3C3JA 3O8QA 4IHJB 4L4YA 5JOQA 5JMOA 2BJHA 1FDIA 3ZTWA 4EW1A 4N5IX 3QUAA 4NX2A 3L07A 4D3FA 2HIAA 1ZAYA 3MMSA 4FNAA 5AM3A 2ZAIA 4ITUA 4MB6A 2OGZA 3R8XA 4GEGA 1SCJA 1F2TA 2VSYA 3AP3A 1SQ0A 1Y8QA 2IEGA 3NM4A 5FR2A 2CHUA 5DNUA 4RGVA 4RPIA 3ENNA 4RGQA 1E1CB 5DLEA 2UAGA 4KIWA 1A69A 2VYND 4ASUD 1I4EB 1R50A 1I2BA 1UM8A 1AUXA 1QH0A 2AYXA 2G17A 4OXXA 4RXTA 5HCIA 1KPHA 4ODIA 3T9DA 4BRSA 1O58A 5ECWA 2L0XA 3IR5A 5F5LA 3LC1O 2YWDA 2RI0A 2XA9A 1I1NA 3KWMA 2G25A 5EPOA 3P27A 1PZGA 3I2YX 5IC6A 2QTTA 2DVMA 3VR1A 1K0FA 5B4VA 1OMOA 1SUCA 4G5FA 1N32B 2FKAA 2G5PA 3EYAA 4JU8A 3PQEA 1P33A 4EG5A 4YR9A 3CZ4A 3STWA 1M1YB 3LT0A 4DCCA 4YRBA 5HS4A 2C9CA 3ESDA 5JH7A 1WW2A 1KEEB 2R44A 5U4XA 3OP4A 3P0IA 1JXMA 1PFQA 3QWFA 4TZ0A 1E2HA 2JJQA 3M5WA 3D2BA 2QNRA 3QENA 3WLTA 4QNRA 3L3BA 1VG0B 2PXAA 1SUIA 4V1CA 2P1RA 2AE1A 2NVBA 2PGDA 3H2BA 2WDPA 1NAIA 5EUQB 3LBNA 3S2UA 4RXMA 1HETA 5EVCA 5FNVA 3VPBA 3BFJA 1P1FA 3KVYA 3RVSA 2O5EA 4U8GA 1TCUA 3ZWCA 4PLWA 4MYDA 4FGLA 4HFRA 3R6WA 4XRRA 3CINA 4Y6RA 3SOZA 1PWYE 4J0IA 3ABZA 5CLLA 5K3CA 1XU7A 3C3MA 4R2KA 2NVUB 3R8FA 3M5DA 2QRNA 4DG9A 2OGTA 4KXQA 1ZL0A 2OYCA 5C3UA 1L1RA 5D3ZA 3KP1A 1H69A 5FPTA 3BBLA 2FW7A 4HKTA 3TLKA 4CI0B 3ZU6A 3PTAA 2WLTA 3WRXA 1XYGA 3ZWPA 3B1KA 4HDNB 1T5IA 5CMLA 4HAUA 2PIAA 4LQ4A 2EQBA 2BDTA 2LD4A 1Y3DE 3M70A 1AC5A 1YOBA 4JLBA 4ZXPA 3W2TA 5KOJA 1BEUB 2YDYA 4OAQA 3OU7A 5KDLA 2JFVA 1NQXA 2GFIA 3JALA 2FF5A 3QOWA 4XDGA 5AK3A 3CLHA 2OXEA 3PKJA 2MU1A 3DBHA 4YT4A 2H4XA 2GAOA 4GI1A 4D26A 2SNIE 2FWIA 2WM2A 1ISMA 5AICA 1Z6PA 2V6FA 2WFLA 5EKXA 5LMCA 3VR6A 1I9CA 1ZINA 5TSDA 2DBVO 1K75A 1W35A 3PC2A 3R5SA 3RNOA 5FLXA 4PYKA 2BFBA 3VC2A 4BVAA 1C0IA 4Y9TA 1SPXA 1T1EA 5TGTA 4JCOA 4DLUA 3A6KA 3F71A 3W6OA 3M9LA 3AEQB 2GASA 1IY9A 1SBYA 5F4ZA 3WDSA 2OFXA 4R1NA 3TI9A 5A3JA 4N7RA 1ZDMA 3RKSA 2YCLA 1G8YA 1T9BA 1U99A 2GN6A 4D3DA 1KQFA 3NU1A 3NEPX 1KNXA 3BXZA 5IAKA 4UXIA 3MOSA 5AVZA 1W0CA 1NW7A 1G3RA 4OFXA 4RKYA 2FLKA 3SYMA 4B7CA 4WK0B 3K0CA 4YRDA 1S7GA 1K7EB 1OA0A 3IIMA 3O3OB 1MAAA 4JL8A 3QHQA 3T3OA 4FGZA 4D80A 2OQVA 3G79A 1V7ZA 3R3HA 3E9RA 2HRZA 2XB4A 4FCTA 1RLIA 1T36A 2AOUB 2BZ0A 2ONCA 4N4AA 3PEUA 1TZJA 4YJHB 2VDJA 3GFOA 4IRXA 1PNTA 2DUWA 5TMDA 3BX1A 1YV9A 1RYFA 4L4ZA 4R2XA 4YQYA 5C35A 1M7HA 3LCRA 4ES6A 1K8ZB 1PR3A 1OBVA 1PNOA 4XVRA 2OXTA 1NN5A 1Z4JA 3I1YA 4Z9AA 4N47A 5H3CA 5TT0A 3SR0A 8ABPA 1TMKA 1FJXA 3E9NA 3VU0A 2SHKA 1A77A 3QBTA 2J3JA 1VG9B 2V3VA 1E8DA 4MVJH 4WUVA 4ZQIA 3RV4A 3NKFA 5IJZA 2V5VA 1YIDA 3TIXB 4TN1A 3Q7IA 5I7WA 4P32A 2XB9A 1J2JA 1DT3A 3GPLA 4JVNA 2W2VA 4GICA 2XCQA 4FYPA 4O0LA 3WOHA 3BWCA 5DGXA 4EZIA 4QELA 3OLWA 4G4GA 3PCTA 4OPMA 4QTTB 2YS6A 1JLSA 1IZ0A 1GSIA 3O90A 3DBVO 4HLUA 1SG0A 1Z6ZA 2P8JA 1H0RA 4BNVA 2DPXA 2F9LA 4O4LA 4JB3A 4PX3A 1PZHA 3WRWA 3OURA 5F9HA 1DXOA 1UT6A 4MO2A 3W6ZA 5ICGA 5DCYA 1R6DA 1PTJC 4QICA 4E5DA 1CJMA 1XDUA 1NBMD 1QV6A 1JVSA 3OWXA 5E3HA 2IHBA 4ZI2A 3TTVA 1KYTA 1WMAA 1ZNQO 3DMNA 3T7KA 3MMPA 4A6DA 6REQB 1QH1A 4K6OA 2EWVA 3GEMA 2OXFA 3GHHA 4U02A 5DI9A 3G9UA 3ZV7A 1L9KA 3T7CA 1FSZA 3B53X 2H2HA 4KX3A 1UWVA 4OHUA 1L7DA 1DZ3A 1A7JA 1Z2NX 3M1AA 4FOSA 5SV2A 1A5ZA 2W4MA 1XZPA 2Y9MB 9ABPA 2A92A 4RLQA 1Q0PA 2HLPA 3DO8A 5B7NA 2KSQA 3T1HB 1F2VA 1XNJA 3ICWA 3DMDA 3T41A 1O6FA 3WISA 5D5HA 3K16A 5JS7A 2HOQA 4G0MA 2YMPA 1H4TA 4K8RB 3UJ8A 3FOCA 1PBNA 1KC3A 4TLMB 1IVSA 1TEXA 3ODGA 2OZVA 5TY0A 2BZ1A 3F90A 4DQVA 1RMTA 1YKFA 2YN4A 2I6FA 1OFGA 3R0ZA 2P2GA 1BFKA 4ANFA 5HIJA 5J5VA 1E9VA 4Y2JA 1SA0A 1L6IA 4RQTA 1GA6A 5ALTA 4KLNA 1T9DA 2QL6A 2FVYA 3HS3A 4MV8A 1IOVA 2F6RA 1OLUB 4CQNA 1DEAA 4ZU6X 1Q50A 2Y9PB 3PHLA 1Q17A 4O4IA 3ERCA 3ICEA 5EJFA 4N01A 4AY2A 2X3FA 4FW8A 4EMSA 4DA6A 2DUUA 3HKDA 5AXCA 4P35A 2DH6A 4F93B 4PBSA 3HDYA 1LBSA 3N6RA 4TV8B 3EEOA 1CUGA 1X7HA 4GMDA 1I7SB 1O0CA 1IONA 4H7FA 4Q9LA 3FYUA 4G84A 1Y4SA 5LBTA 3RU9A 3WGZA 1I3LA 1FUIA 4G3XA 2O2HA 2Z1DA 2IH5A 1U3WA 2YV1A 2QRVB 3DLAA 5FPHA 4R1MA 2ZSKA 2Q9BA 2AG8A 5KDDA 1I2AA 1HTBA 2GVZC 2Q1UA 4Q47A 4W7IA 4QXAA 4YO7A 3WIDA 1O9BA 4DIDA 2F43A 3ZK8A 4WLOA 4DT1B 2PNFA 2IP2A 3A9TA 3C8DA 1BMFA 4ZOCA 5E8RA 4GLOA 2FU5C 1QOPB 3WLQA 3IURA 3Q41A 1NVDA 2F62A 3OIYA 1WPQA 1C81A 3ED5A 1Z56C 2UUBB 1Z22A 1JFTA 1RI3A 1X7DA 1OIWA 5LMNB 1DP4A 3B1XA 5LU9A 5JNLA 2B4YA 2FQXA 2R751 1TMYA 4HGZA 1BDIA 3R5XA 1DADA 2QUBA 5EIOA 2DWOA 4IVQA 4RYLA 1HGXA 1V5IA 4ZHQB 2DY1A 1GWNA 2RMKA 3FBWA 3ND8A 2Q45A 1CIVA 1M66A 5CP8A 3U3MA 1OREA 2E48A 1YZLA 1FFGA 2ZCVA 3DAGA 4I8XA 5DMXA 5HDQA 5TRTA 1CS0B 3EIUA 3EVTA 4JLNA 3CKLA 3DMHA 3CO0S 3RC3A 3PXCX 3WKDA 2WIAA 5C8ZA 3KSMA 4ALIA 1JHYA 2FEOA 3IRUA 4I81A 4BX8A 1H93A 1E7SA 3BF8A 1PJAA 3F5DA 3FNFA 5A5EA 2OP1A 3HK2A 3RGWS 1UM9A 3AKYA 4KXUA 5LOVF 1PV1A 5ALHA 3VR6H 1TLFA 4M1TA 5KQSA 1D4OA 4RKFA 4DDMA 1UK8A 2BDUA 3T54A 4BKQA 3ADOA 1AKEA 4M9CA 4AF7A 3D0KA 5LNK6 3A6EA 2PZJA 2NZUG 3M2PA 1I4LD 1MENA 1SY7A 1IZ9A 1CQJB 2HU8A 1OVGA 3B9PA 4OM7A 4AKEA 4ARZB 5JC8A 2NXWA 2ZUSA 5JCXA 1USVA 1OXTA 1LZKA 3DDWA 4IBOA 5DXFA 5EIHA 4BZQA 5B12A 1MIHA 2OCGA 4RHEA 4UU7A 2GJSA 3NJ4A 1L7XA 1U2DC 3A28A 4M1QA 4K9RA 4OQEA 3SMVA 4D79A 2NQ8A 2R7NA 3HCAA 3OM8A 3FN4A 5F52A 5MN4A 1E2QA 1QK5A 1Z0AA 1RRFA 2HA7A 2ZRAA 3GJRA 4NS4A 1DWPA 4RCYA 3WMWA 4AIIA 3PQ5A 2ZITA 1PFKA 5IS2A 5A6SB 1QGAA 3P1JA 3VOTA 5BNFA 4BZPA 5I9BA 2MYUA 4K46A 5A0VA 5AKLA 3DBIA 2JGDA 3AQIA 4B4VA 4B6PA 1EPUA 4JZYA 4R1PA 2V0CA 5C4GB 3NUGA 2QX6A 2CNKA 3F6PA 3TSCA 4NBNA 1BVHA 1JZQA 4RDIA 3S27A 3LDUA 2AFVA 2CMFA 2IHYA 1PUIA 4C6TA 4BGDA 3U44A 1X7ZA 5BQOA 1PUXA 1QBKC 3EHDA 1BKSB 4HNAB 2QQ0A 1GU7A 1A2KC 1G5FA 2FX2A 1P29A 1Z0SA 2VP4A 2XTJA 1RCFA 3OKPA 1PT7A 2QRMA 3ZKWA 1IATA 3ZBPA 4ZRMA 3AONB 1L5HA 4X65B 2HF2A 4O8CA 2CLDX 2ATEA 4RD6A 5BSFA 4OX9Y 4W1RA 5TVKA 3AFOA 3IBTA 1YQDA 3K96A 1BCSA 3N9IA 1QS0B 4URXR 3V7NA 3HUEA 4L74A 1P0MA 4LJLA 1R66A 4JVSB 4KLZA 4RD2A 4XVQA 4M8NE 5DHPA 1E2MA 4FQ5A 5GM2A 2ZRHA 1IXSB 5JSYA 4CLOB 1ZM9A 4Q03A 1T5LA 2V6IA 3QTLA 1Z0DA 2Q3BA 2RGWA 2VVTA 1GL9B 1WIWA 3SDSA 2UDPA 2VSOA 3VYTB 4JEHA 3D3NA 4PYIA 1U2GC 4HTFA 1YJ5A 4X1YA 5REQB 3UF0A 2WSLA 2AZDA 2B5WA 3RASA 1PG2A 3TKYA 3COJA 4RTSA 2BYTA 5T3YA 4RV4A 4X63A 4ZVVA 4W5WA 3MLEA 3VNRA 3ZBUA 1XI2A 1UOPA 4IHJF 2AG6A 3IAHA 2ADMA 4LFAB 3JWGA 3FIJA 3FPCA 2OQIA 2RDMA 4OYLA 3HV2A 5SZKB 2ZQ5A 4WD3A 1YSCA 2R84A 1EFRA 4AMBA 2QLMA 2NYAA 1KIAA 1ZI8A 4NENA 2EJUA 4QM7A 4BLSA 2HBRA 5BSKA 4A2WA 1AA9A 1N34B 2PPLA 3E2PA 3WLLA 4R6WA 2WJYA 2DWPA 1J56A 4LV6A 2P67A 1XA3A 1U0SY 2X76A 4IOKA 4KWTA 3K7EA 1JYSA 2AL7A 1ZWLA 3HZRA 4NEHB 5FF9A 3UWKA 4EEXA 5A4JA 4LGVA 1ZOIA 3VVLA 1PT5A 4QU9A 1AN9A 2A0KA 1A4IA 4BQPA 4PF1A 1GYPA 1NUTA 2A7QA 1XTTA 3R20A 1HZZC 4WA7A 3W2HA 4UNRA 4YV7A 1XEXA 3V8BA 5KHLB 2IOHA 2OV8A 1H65A 1R0XA 4Q9DA 5AK4A 5B2ZA 5JRZA 3HCBA 3FCAA 2VSXA 1ZGAA 1VPVA 1ZUNA 4FE3A 3T5CA 3RJTA 3JTEA 1YDMA 2XDQA 2B94A 1G7TA 5FTKA 1U5C<