1RXUA

E. coli uridine phosphorylase: thymidine phosphate complex
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
250
structure length
250
Chain Sequence
SDVFHLGLTKNDLQGATLAIVPGDPDRVEKIAALMDKPVKLASHREFTTWRAELDGKPVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPLEFPAVADFECTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRHFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of escherichia coli uridine phosphorylase in two native and three complexed forms reveal basis of substrate specificity, induced conformational changes and influence of potassium
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Uridine phosphorylase
total genus 91
structure length 250
sequence length 250
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2003-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1rxuA00
3QPBA 5F7ZA 4P54A 5CXQA 1TCUA 4QASA 4KN5A 1PF7E 4WKCA 4H1TA 4PNPA 4TTIA 2AI2A 1K27A 3OOHA 1RXYA 5DK6A 2ISCA 1JDUA 3FWPA 2QDKA 1PK7A 3BL6A 1VFNA 3PHCA 1QE5A 5K1ZA 4U2KA 2IQ5A 4BMYA 1TD1A 4OF4A 5CYGA 4D98A 1T8SA 1Z33A 1A9OA 3EMVA 3OOEA 3ONVA 1PW7A 4BMXA 5CCDA 2OC4A 3T94A 3BSFA 3K8QA 5ETJA 4LNAA 4PR3A 4TTJA 5KB3A 4G41A 1Y1QA 4DARA 2ON6A 2A0YA 4M1EA 2I8AA 1JE1A 2HWUA 1U1DA 4DA8A 3UAXA 1JDZA 3IOMA 3BJEA 4TXLA 2A0WA 1I80A 5I3CA 4EARA 5F78A 5F76A 4LZWA 3LBAA 1K3FA 4F1WA 3KVVA 2HRDA 3OCCA 4DA7A 3ODGA 1U1CA 4YJKA 5F73A 1G2OA 3FB1A 1Y1SA 1A9QA 4GLJA 5IFKA 3LA8A 4UC0A 1PR1A 1RT9A 1T0UA 1JYSA 3E9ZA 4L5AA 1U1EA 1OU4A 4BN0A 5IU6A 1V41E 3KU4A 4L6IA 4L0MA 4JOSA 5CYFA 3DDOA 4D8VA 4F3KA 3DPSA 4ECEA 1PR6A 1SD1A 4DA0A 3OZBA 1PK9A 2RJ3A 3UAVA 1ODJA 2HN9A 5B7QA 4DAEA 1T8YA 3ENZA 4NSNA 4R2XA 2AI1A 5EFOA 5CXSA 1Y6RA 3O6VA 3U40A 3UAZA 4R31A 4WKOA 1M73E 1PR0A 1JE0A 4I2VA 1T8RA 1Z35A 3OZDA 4TS3A 1OVGA 4FFSA 5F7JA 4BMZA 4G8JA 4GLFA 1LV8A 1PR2A 1PR5A 1V3QE 3E0QA 3C74A 3GB9A 1YQUA 2AI3A 4LNHA 1YQQA 4QARA 1U1GA 3P0FA 3SCZA 5B7NA 1Z36A 1A9RA 1A69A 4E1VA 1Y6QA 4D8YA 1RXUA 3OZEA 3BGSA 2PGAA 3KUKA 1A9SA 4OJTA 4GKAA 3OZCA 4YNBA 4RJ2A 2QTGA 5B7PA 3O4VA 1RYZA 3FAZA 1PR4A 3NM4A 1SD2A 4D8XA 5F77A 1ZOSA 5F7OA 3UAWA 2B94A 1Z39A 3INYA 1FXUA 1WTAA 1ODIA 1Y1TA 1CB0A 1V4NA 4R2WA 4K6OA 1VHWA 4WKBA 3F8WA 3GGSA 3IEXA 1ODLA 1SJ9A 4QEZA 2OC9A 4TXMA 2I4TA 3PNPA 1ZL2A 1NW4A 5EUBA 1XE3A 2A0XA 4F2WA 2BSXA 3NM5A 1PKEA 1RCTE 1TGVA 2GUWA 3NBQA 1JP7A 1ODKA 1CG6A 2AC7A 1JPVA 4MARA 2QTTA 3P0EA 2XRFA 3FOWA 3KVRA 3LGSA 4JWTA 4QATA 4QFBA 1C3XA 3UAYA 1JDSA 5FAKA 4M3NA 4TXNA 1Z34A 4G89A 5B7GA 1OUMA 4LDNA 4DABA 1U1FA 1NC1A 4WKPA 4D9HA 3FUCA 1OV6A 3EEIA 1T8WA 1V45E 3FNQA 4YMLA 3K8OE 1YR3A 4TXJA 5EPUA 3KVYA 4F3CA 4DA6A 1K9SA 1TCVA 3PHBE 1OTYA 1ULAA 3KHSA 2QSUA 4NS1A 5CCEA 3OPVA 1Z5PA 1LVUA 1LX7A 3DJFA 1RXSA 4YO8A 4JP5A 3NM6B 2OXFA 2H8GA 1VHJA 4DAOA 1RR6A 4LKRA 1A9TA 3PNSA 4MCHA 1VMKA 4OEHA 4MCIA 1NC3A 4NY1A 5C80A 4TTAA 4DANA 2QPLA 1Z37A 5F7XA 4QAQA 4L5CA 1OTXA 1TGYA 2Q7OE 2A8YA 3EUEA 3MB8A 1RFGE 4GMHA 3E9RA 1V2HE 1B8OA 4TXHA 3D1VA 4IP0A 4WKNA 4F2PA 1RXCA 1V48A 3UT6A 4OY3A 1PWYE 4EB8A 1Q1GA 1Z38A 2P4SA 4M7WA 4TS9A 3OF3A 3EUFA 1YBFA 3DF9A 4OGKA 4TYMA 1YRYE 4L5YA 1ECPA 4OGLA 1RSZA 1N3IA 3DP9A 1JDTA 1Z5OA 1A9PA 1Y1RA 1SQ6A 1B8NA 2HSWA 1Z5NA 4X24A 1PBNA 1ULBA 5JPCA 1JDVA 3TL6A 3MMSA 2OECA
chains in the Genus database with same CATH superfamily
1U9IC 4HWPA 2IF0A 3QPBA 2O6HA 1JNXX 1YIAA 1O6FA 5TQJA 1L4FA 5FWAA 2BEKA 4RK4A 5K8TA 1ILEA 2ECKA 3CKKA 1SBYA 1VPLA 4BLQA 2XBLA 5G3ZA 2I6TA 1RRPA 2VHWA 4ZQIA 3UPTA 3AFNA 4XOIA 4TRNA 5C31A 1TVEA 2VQ3A 4PLCA 1T8PA 3PXXA 4KAAA 3ZWQA 1DAOA 4Q3OA 4Q93A 4HGRA 4REQB 2NO6A 4D8WA 3L05A 3SWWA 1Z2AA 1GN9A 3T5CA 4ND7A 1HXHA 1O95D 2GPBA 2VEDA 4MR7A 2X15A 4HLNA 5EIHA 3TTXA 4W5OA 2PS3A 2WZBA 1CYDA 3OY2A 3WYGA 3ZWNA 4TZ6A 3E8MA 4MUXA 2H51A 3L18A 3RAJA 1B14A 4EY7A 2D00A 4NZYA 5L53A 1H0SA 1U5BA 2VKTA 3BILA 1E9DA 3G82C 1CWUA 4BGIA 3NUGA 3N8DA 1GVHA 1NMZA 2FQWA 5BSEA 1AQNA 2O3QA 4JKYA 4U7DA 4LSMA 1JGTA 5CK5A 2I3BA 3RC9A 1ZESA 2RG7A 1ZUWA 2GH1A 1W2WB 4BKRA 3TRKA 3DFMA 1J9GA 3HDYA 2QNBA 1G4HA 1NWHA 1R2QA 2YS7A 4RH1A 1Y8QB 1R88A 4UAVA 4ZXPA 2KBFA 3VHLB 3AETB 1OXVA 2IS1A 3EHEA 4MV8A 5AOCA 1QX3A 4U2CA 2VHUA 3A9TA 4WVFA 3WK5A 1AA9A 4RE5A 2FZKA 2CFSA 4W5RA 3TG8A 4PAOA 1PLJA 2Y2UA 3ORQA 4ENSA 1FP7A 1DSSG 1OXUA 1Q44A 1TDJA 5CRIA 1OXKB 1WAMA 3LYAA 3NHFA 2IKSA 3I1JA 1HFEL 3C16C 2KM1A 3WLRA 2IUSA 4WCFB 5JQGF 1UOEA 3L40A 5J40A 3UBTA 1TCAA 3K1TA 4WCFC 2AK3A 3WGNA 3HA5A 1J2JA 2NZWA 3VNSA 4XDYA 1XD2B 1QQ7A 3MLAA 3OEHD 4TMWA 3CB4A 4TMXA 2LNDA 3EZ6A 4BKOA 5BW8A 1HETA 1M2WA 4B84A 3P32A 4YY3B 2IUUA 4C4RA 5FQNA 3VKVA 2ZUWA 3LUBA 5AKGA 4YO7A 1MP0A 5AHXA 2LD4A 5CPBA 1KR5A 3ZWCA 2V7VA 3EXFA 3HQ4O 3L7MA 3H04A 4FEGA 3HDTA 4PYLA 3T1NA 5CA0F 1PGJA 2PRJA 1DJLA 3EDRA 3I9LA 4O2BB 5AOVA 5AJWA 2VUSA 4LRSB 3IUSA 4LOIA 3LVQE 3DD5A 3LBAA 5BNIA 1OFHA 3IQGX 2NXJA 4DT1B 4C6TA 1RRGA 3IV6A 2QQEA 5D87A 1L5WA 2NU6B 2QX9A 1JSXA 2X0KA 1UBHS 3OQHA 4IIYA 3PJEA 4GF5A 1HLFA 2NZ8A 2PVCA 3ZNOA 2NADA 3IMKA 2BP7B 1QYCA 5CLGA 2WJPA 3HA3A 3AHHA 5H5JA 5GJBA 3UOAB 4POAA 5JCPA 3KBBA 3KL2A 3TYXA 1OV4A 3LDAA 1T4DA 1Q11A 2BDTA 4FUQA 4WXPA 3V8RA 4Q3CA 3PUVA 4FT4A 2WJAA 1OHHD 1NONA 4ES6A 1SBNE 1UK7A 1K6XA 3LY7A 4UHDA 1ONSA 1E2LA 1G5HA 5IUNC 2AMFA 2QG6A 2ZFUA 1N2CE 1Y63A 3W9YA 1JV2B 5EXPA 4B3RB 1A9QA 3TF5A 3PDIB 1D8AA 3R5HA 4YP7A 2JGKA 2PO7A 4BPBA 3BS4A 4QREA 2PNJA 4DQUA 1YRBA 4II3A 4ZVTA 4P5DA 4G2NA 2D59A 1CUFA 2HU2A 4QJ4A 1R0LA 1RPAA 3COZA 3QV1A 1USUA 1YDFA 2Q2VA 4J4HA 3FH0A 5SY9A 2RBGA 3IOEA 1UFRA 1EJBA 4EA6A 1OZHA 2P41A 1V41E 3I5UA 3KU4A 5JWRA 1RAHA 2GNAA 4H0NA 4YB8A 1BQ3A 3D5TA 1IVNA 3FYDA 3S4YA 4U0KA 2FY8A 2YW9A 4JSYA 3HKEA 3MMZA 5I7AA 5CYFA 3LGAA 3OZFA 5DM2A 5MFZA 3UMRA 2CNKA 1DZ3A 2QQGA 3VU1A 4EF5A 1HBJA 1SCIA 2NO5A 1QYIA 3WK9A 5FTLA 1UBGA 1USIA 2BMAA 2J9ZB 3FUVA 3Q0TA 4DR7B 3WNCA 4F6CA 2A94A 5ERGB 4MVXA 2GBCA 2EQ5A 3BDIA 1FBNA 5IVKA 4D96A 1F4PA 2GEFA 5GVSA 3PJRA 1CRLA 1Y37A 1YIOA 3FNIA 4KWCA 3HK2A 1BXGB 3IEIA 3MMPA 5IHXA 5KWVA 1RVDA 2DH5A 1ZL0A 4FFLA 1NUPA 5AUPB 2PX3A 2FPSA 2ZYSA 4XSHA 5E7MA 4KREA 5JS1A 5DBFA 1I2CA 3N8KA 4JROA 4MW0A 5IH7A 3RVJA 5KDDA 2WG1A 5IHPA 2PFGA 2V45A 2HZBA 3LDHA 3AEQB 4FDAA 1RNLA 1MJHA 1WB5A 4RPJA 3FWKA 3ELWA 1QH9A 4UTZA 3UATA 2H48A 3ZZ0A 3U40A 3E9NA 4BO1A 2W2KA 4B47A 3LA6A 2BIFA 4KSCA 2EATA 4PZYA 2DFNA 2I1WA 2XTZA 3RRZA 3DAYA 2GEDA 4YI3A 4FDVA 3QTTA 1BA2A 2FSVA 2OP0A 2R47A 1G59A 3VC1A 4NMMA 3SBXA 4YYEA 2Y0DA 1WCIA 2J8ZA 3Q10A 4L4RA 3GJ8A 2IP2A 1WXXA 2IYRA 5TS2A 3K09C 3E8XA 1I2BA 5K8UA 2OFOA 3QX8A 4B46A 2R6DA 4MCAA 3DLTA 4HYEA 1IL0A 5GONF 1E1CB 1SUSA 1P7YA 3C39A 5THKA 4MUGA 3NRCA 2D5CA 4GU5A 4R8MA 4CI9A 1LV8A 4TS1A 4O4IA 1YB2A 4GBMA 1T6ZA 2WKPA 4N8DA 3ZCRA 4G1CA 4NFSA 4FWTA 2WD7A 1VPVA 2A0FA 3TW8A 1QYVA 2VHYA 2VUHB 1SEVA 3NDIA 4KE7A 5E9QA 3GP8A 5CDGA 3IT0A 1MTZA 4J16A 1FQKA 3GJ6A 4X85A 5DX8A 5H7XA 5K3CA 3U3XA 5JH7A 1VHQA 1FZTA 2JFNA 3G8AA 1WEKA 4B48A 3MTBA 1P4SA 2VA9A 5HBGA 1GXSB 2J3JA 1Y9DA 3DVRX 1YD7A 3LY8A 4Y9RA 4ENWA 1NNEA 2CNNA 3EGVA 3BGSA 2PGAA 3OQ6A 4QXQA 3PKZA 5DWDA 4DC1A 5IEBA 1P60A 2C7OA 3PX3A 1AKYA 2VN8A 4AP5A 4GKAA 4BBPA 1NR5A 4EH1A 2E1RA 1XZGA 2FFJA 3K3PA 5DSZA 4KVFA 1U2DC 1Z82A 1FFAA 5KSZA 4S05A 2B8EA 4UEOA 1HDCA 4QM7A 5K0EA 3PGXA 2F00A 3LQFA 2VHVA 3GLTA 1SAYA 1WHTB 3BTOA 2GYUA 1LSSA 4AUNA 5CFLA 1GIAA 4W5JA 4G67A 1MNQA 4FFDA 3S68A 2C4UA 4I36A 1YMQA 3K2BA 1TJYA 4LF8B 1JR4A 4YV0A 4RA6A 2AD5A 1U0OC 4D4JA 2EKDA 4EFDA 2OBMA 2R2GA 4MTLA 1B3BA 4NESA 4EG4A 1BYIA 2IHBA 3G9UA 1K5GA 5JPDA 2FSUA 1W75A 1C9NA 4B6QA 3OP1A 1QLHA 2IY8A 1TUBA 2Q3FA 4QUBA 3I01A 3TGLA 3FTPA 1WCWA 1JG1A 4EYSA 5CDTA 2NV0A 4DIUA 3EPJA 4Y1EA 1E60A 1QUFA 2Z9BA 3VH1A 4BQRA 4JB0A 4P3KA 2TYSB 1IEVA 3IOCA 4LW8A 5KSWB 3BPSA 1D0IA 3C7CB 3GMSA 3UV6A 2B94A 2KJQA 3CBQA 2H4JA 3M9XA 1XZIA 5JYDA 1UMCB 4PO9A 4DMRA 4KX3A 1B76A 2YFHA 1TAUA 4LXYA 4RVUA 3KT8A 4RKRA 2ANBA 4QNNA 1Z2EA 4Q3DA 5M3BA 1EFLA 1M6EX 4J6FA 3K70C 4QL3A 4EHDA 3M6IA 1OYOA 1P1HA 5ITZA 1EWTA 4ARBA 4UVDA 4V3BA 1W30A 2IYAA 5HUJA 1BA3A 2R00A 4UVGA 5K3EA 4BMVA 2ZLBA 1FX0A 1RQ7A 2ZANA 3CFYA 3I5XA 4PCAA 1FPMA 1RKVA 3U62A 2LCFA 5JXWA 2OK7A 1N3YA 4UXIA 4MZXA 2JA1A 4QQRA 1TEZA 1KIMA 5CM2Z 5BSRA 2FEMA 2ZCJA 1QKKA 5J5VA 4M98A 2B1GA 1TEHA 1KI8A 3QEKA 3TTWA 1ZK0A 2REOA 1NW5A 2H0AA 4HVAA 4DY4A 4R9SA 1K6MA 5TX7A 1BHJA 4CNBA 1H0HA 1T3SA 1MGOA 3G0BA 3MTJA 2A1IA 3V4SA 4CIBA 2VJYA 3IAUA 1E6EA 2RHDA 4ZIRA 4HGQA 5IDWA 5JYEA 3RJTA 3ADDA 2JIRA 4XUGB 4AJOA 3CMCO 3P9IA 4E7OA 5AVVA 2VLBA 2VPXA 1B6TA 4R2JA 5K3DA 4AUKA 2O50A 1NQTA 4G1VA 5IM5A 2PS9A 2CD7A 2SICE 3GGPA 1Q12A 3N2YA 1GHTA 1RTTA 2JJ1A 2K2QB 4HWKA 3SYMA 4C3UA 5BN1A 1ZHHA 4WE3A 3TW4A 3U4IA 3E4CA 1C3XA 4RY9A 4Q39A 3TB4A 3SVLA 5FAKA 4LKOA 3WQBA 1KI1A 1O9HA 1YS4A 2Y27A 1E7YA 5DPMA 1NBWB 4LC1A 1JKXA 2Z2YA 4IZ6A 4BP9A 2PFSA 5FX2A 3P9PA 1P18A 4EY6A 1CDOA 1OUMA 2C8JA 5A3QA 4OKNA 1YE5A 1L5QA 4I4TA 2GCEA 2QAJA 3VA7A 2OGZA 4P0PB 1E96A 1P72A 3AOEC 4K6FA 1E9BA 1RTKA 1ZRMA 2B35A 4L4SA 1O5IA 4WIAA 1EZZA 2H5IA 4FDMA 4HLCA 5BWMA 3HJHA 3W8EA 3I1YA 5BV7A 3Q2IA 2FN9A 4LYGA 1DRJA 1LSJA 1VIAA 1YC5A 1F5NA 2ZCVA 4KYUA 4ZEOA 3UTCA 4KGVA 4E03A 1TMYA 4XLZA 5D85A 1EQAA 1V45E 4MKHA 1NV8A 4RXTA 4A8JC 2BHTA 3PFNA 1BCSB 1QH8A 3GRZA 2YDYA 1R8QA 4EI9A 4V0ME 1IPEA 1QGUA 2Z3ZA 5E6UA 4BNLA 4AJ4A 1WQ1R 5CJPA 3OHMA 4WUTA 5CMLA 1OKKD 3R6DA 1Z7BA 1YH3A 1Z0ZA 3P52A 4EGQA 1EVZA 4Z53A 3DBRB 3BE6A 4J4BA 4KQXA 1RXVA 3U1TA 5AK5A 1OX4B 1GZ4A 1XMPA 3VSAA 3U4QA 3GCXA 4GLBA 4TMFA 2ID9A 1TRHA 2OBFA 2UVDA 3Q7IA 4Q7LA 7ADHA 4QA9A 1YZQA 1VSVA 3PRYA 5I8PA 4CR7A 4DCSA 3H84A 1ND5A 2E4XA 1RZ3A 3D8BA 2XZPA 3I32A 3OH8A 1VHJA 2VNSA 4LV5B 4R5MA 5FBQB 5C8DA 3L7OA 2PZEA 1RR6A 2QTBA 2C4VA 3F46A 3LYHA 2OXCA 4P82A 5JE8A 2P1ZA 4HUQB 4Z4FA 3UQYS 2NM0A 1M6VA 2QTNA 4P53A 4KO4S 3BF7A 1QH1A 1ESMA 2DFVA 4RY2A 3CONA 4CM9A 4HDKA 4JJGA 4EA9A 3PNSA 5K09A 2VHZA 1JWLA 5HF8A 4N82A 2R85A 5B2EA 1ML4A 2ZSEA 3D64A 3ESZA 4D46A 2HBRA 3AWIA 5LVAA 4RDIA 2HADA 2CBGA 3DBVO 2B98A 2EP8A 4WKGA 4GNRA 2CEKA 1VG1A 4QOHA 1W5SA 4DANA 1XUOA 2RBKA 3EFOB 4RA9A 4RIGA 3F71A 3FWZA 4OYHA 2VCYA 1FVXA 4NK4A 1O1YA 4CN8A 4TLEA 1QK5A 5FPHA 1I9CA 1FTQA 2FCRA 2HHCA 5UKDA 3T12A 1L1EA 4GR4A 4JI6B 5ALKA 1BW9A 5EEGA 1R12A 1CUCA 1YIDA 1R3UA 3VAZA 1IVSA 2QD2A 3MA0A 2X5KO 4S2EA 3NH9A 3JQDA 2WR8A 3WL7A 2OEPA 5MFPA 3QWFA 2O59A 1M8GA 1S2IA 1U6IA 2ZB4A 3D6FA 3M4ZA 2E55A 1SBZA 2J6CA 3HZOA 4AY5A 3IV7A 3OAAD 1CB7A 4YALA 1UODA 4KNVA 3T0GA 1LBIA 4BB0A 4LVOA 2QM3A 1IWOA 4WACA 2V7XA 2P4SA 2LRHA 2CE2X 2VK8A 4N8SA 3V32A 3N70A 2ADFA 2I2XB 1UAGA 5A2QA 2PCJA 1ZS9A 4L9WA 1Z5VA 1OB2A 2HRQA 3OEYA 1DLJA 3R5SA 4HAIA 4CFSA 2FYTA 4P5PA 1XZPA 3V1NA 2RHCA 2RBEA 1A2QA 2RGEA 2RONA 5HYVA 3O4HA 3MWLA 3F78A 1YB4A 2QVZX 3A6EA 1JHOA 3NWBA 1W76A 4GZ6A 1U7DA 4O4HB 4P3XA 2PD4A 3BMNB 3MTEA 5KTOA 1ZI6A 5LZ9A 1U4NA 2J59A 2Q0XA 1J00A 1OBCA 4TKZA 1NJGA 2V65A 1U0RA 3KXIA 1MB9A 1T0HB 2ZT8A 2JIZA 3O8OB 2W93A 3PPIA 4GI5A 3UK7A 4EYKA 2H2DA 4B6EA 4BP3A 3HGTA 3DHEA 1XOIA 4GSLA 2XT0A 3HEAA 5AFSA 5IXJA 3R0IA 1YTUA 2XVYA 1RQRA 1OIVA 5JBIA 4LDAA 2D1FA 3HJUA 3M9WA 5EE1A 4QJ3A 1DRKA 2VUUA 4LA4A 4GMDA 2WKSA 3MMSA 1FXWA 4DYDA 1WBJB 4LCEA 4RFSA 4BQIA 1KTIA 1VE1A 2JA2A 1HL3A 5EXXA 5I7HA 1E1CA 2BUBA 3F97A 5JSKA 3GEEA 3OJCA 2WAAA 4KXQA 3JRNA 5AW5A 4A5OA 3BFXA 4NAHA 1ZKMA 2YJNA 4PLGA 3KDAA 1ZW6A 1DC7A 2NYUA 2WRZA 3CIFA 3NX4A 5ISMA 1UFQA 2ACVA 4LDQA 5C8VA 4BNYA 1UBMS 3F4BA 2FGKA 5BN5B 4PFSA 1V3UA 1KA9H 1D2CA 1TFRA 3OEHA 3NNSA 3QXXA 1ZJ5A 1M34A 2F64A 2QUHA 3ORFA 4LIPD 4WL0A 3TW0A 2WF6A 1T9HA 5TGDA 1Y1PA 4BO9A 1KI9A 5KYWB 2O8DA 2IT1A 3NG1A 4KAFA 2RHBA 4TUYF 1JA1A 1PFQA 2DAPA 4K1XA 3BL6A 1VFNA 4IWYA 1V9CA 4WFJA 1NULA 4L0QA 2I99A 9LDBA 1Y6JA 2HF9A 3BMNA 4DUGD 2W2LD 3IP8A 2W6ID 3MYRA 4LBVA 3QVSA 1JHMA 1PEKE 2R7LA 5BSWA 4UTRA 4RWEA 4MOWA 1CR2A 3HN6A 4W5HA 4WUVA 4NQZA 4HTFA 5CLLA 1IYZA 1OA0A 3F1LA 4L8LA 5KNLA 3HA7A 1XQ6A 1PVOA 1E4OA 2V0NA 4LISA 3VKGA 3O4GA 2EV9A 4RA6B 2Q3LA 5FULA 2XCRB 2GM5A 2RCNA 5BWCA 2P8SA 3DE6X 4ZJPA 4O4LF 1TUIA 5D8DA 4K6MA 2REBA 1MFPA 2ODNA 2W71A 4X90A 3USCS 5IABA 5JRZA 1JFTA 2ILVA 2XCOA 1JR3E 3C4QA 4K86A 4XVQA 5EMLA 2VATA 1X7WB 3O4RA 4P3YA 3R2JA 3NBXX 3BWVA 5ETJA 3KTFA 2VK4A 2ATEA 3KYCB 4PAWA 3W3ZB 2VZ9A 2FVXA 1GUFA 2FWMX 1GZHB 1ODCA 3CR3C 3G68A 5H70A 5BT8A 1POWA 4UPDA 2I8AA 1JE1A 1Y48E 2O2DA 3HDGA 3ILSA 1M34B 3EZ9A 1YGPA 5EJIA 1CNMA 4GC9A 3UWKA 2WAYA 4OSPA 2WIBA 3CLRC 3GLFA 3BBLA 1V6AA 4G0NA 4EECA 3HKDA 2IYEA 4JY7A 1R5JA 1S4QA 4KUGA 4U6SA 1AXRA 3H42B 3ZZUA 4BP1A 4ZCIA 2OZKA 2EFYA 2ZXUA 4LZWA 1MRZA 4M60A 4P3PA 4EW2A 1AKRA 1FFGA 1K3FA 1JXQA 1R27A 1YAJA 3AXSA 1P19A 3CX4A 1LWNA 3GJRA 3GRVA 1GDTA 3EDQA 4OP1A 3VXKA 5TQ2B 1GCUA 2KPOA 4ZJYA 3ZXUB 3MJTA 1M6VB 3IPYA 4OXKA 4CCSA 2HRDA 1MJNA 3CTPA 3B38A 2H2IA 4BLOA 3JD3A 1XQWA 1I8TA 1P5ZB 1TLFA 3JZMA 3R44A 1JAYA 4G1BA 4HLUC 2BMFA 4I4NA 4JJ7A 2WE8A 3U09A 5B4VA 3CPJB 3SK0A 4HYYA 3WI7A 4H35A 1UEJA 4FMCF 1MG0A 1E59A 2V6BA 3JYHA 4W7HA 2Y9MB 3KETA 1W5TA 1Z5GA 1DBRA 2I4MA 3G5LA 5J4KA 5CM9C 1ZD5A 4CQLB 4GVLA 4Q4HA 1D2HA 1U02A 1DS6A 1T0IA 3QXSA 4GLJA 5TEVA 1XCJA 1A8SA 1Z88A 2WOJA 3BGWA 4FFVA 2AIRA 5BUSA 1KH1A 1LJ8A 3TOXA 4F5DA 2IXTA 3T95A 3WR5A 3ZE0B 1DADA 3TLMA 1NMQA 3FHOA 1IK4A 3IIMA 2XYRA 3JQBC 4O29A 5CNIA 1CE8A 2QYSA 1D04A 3CV3A 4HB0A 3P26A 5DDIP 3VYRB 3NC1C 5KNCA 2X77A 1KL7A 4IHJB 2J08A 4CEIA 4FGJA 3RT7A 1CEQA 4W5TA 2G70A 1NT4A 4GFDA 3HB1A 2G25A 1W36D 3VSEA 4JBGA 3IXMA 1NLZA 2W83A 4BNDB 3F6CA 3NO4A 1LC0A 1MA3A 1BAPA 3G8BA 4QDOA 1PZEA 2HJWA 3R76A 3AUKA 3L4BA 1SD1A 1J33A 5TARA 4J3JA 1CZHA 2YOFA 4M7OA 4MEAA 4R7ZA 5GAJA 1VIYA 2OV8A 3DLAA 3X2FA 1SCUA 3EA5A 1MQAA 5AK3A 2VYQA 1AMUA 2Q49A 3PJGA 4N39A 3RT9A 4DAEA 4YFYA 3LC2O 2IOQA 3MCWA 4NSNA 4RNCA 5K6TA 3ISVA 3NBAA 1JKJB 2RGYA 5CEJA 3H2BA 3H1PA 2GEVA 3JAWB 4H0FA 2XWPA 4DWWA 2PBFA 4MWEA 3EXAA 3KOMA 1VJ5A 2B3TA 1K6IA 4DNQA 3SIPA 2YHUA 2GYVA 4B3HA 5B3LA 4U2BA 3W0LB 4NG4A 1VPTA 3JYNA 4MMZB 2YVQA 4QGBA 1NFQA 2SKCA 3N5CA 1JR3A 3ROQA 4W9MC 2JJ8A 3WLQA 5JT1A 3GEMA 1G3IA 2AMJA 3IJRA 3KO8A 4C4TA 4NBVA 1SOVA 3DVAB 4C0SA 2WKQA 1R0SA 1I4DD 1CD5A 1M6HA 2QM0A 3OBBA 1MUUA 3NANA 1XYVA 1EH5A 1DFIA 4DLNA 1GGMA 1OLXB 1ISJA 2DU8A 1JQKA 2EYQA 4X00A 1DBPA 4U3JA 4YRPA 4WXEA 5IWCA 1G1MA 4HQKA 4R71A 2IYVA 3U60B 3ZJTA 4YH1A 1DQSA 2CXHA 1X9HA 3EIHA 2WVJA 4BV9A 1DDOA 1Z29A 4N48A 3EIFA 1CS0B 2VPIA 3IUBA 3KJHA 3E0QA 2FKNA 3FNGA 4GAEA 4O5OA 3EXHB 3FNRA 2XMDA 4TS4A 1I6KA 1UBNA 5H4GA 1O7JA 4L74A 4D8UA 4MULA 3GA0A 4O08A 2V3VA 1KOJA 4GQBA 3K94A 4Q1VA 1F6BA 1A9RA 1JT9A 3DOEA 3GNQA 3I9MA 2P4UA 3OPYB 4IQFA 4WK4B 4XJVA 3WDMA 5C32A 1DIRA 1UOPA 3X2SA 1P5RA 5AOAA 1LPSA 1RJDA 4E33A 1XKLA 5MN4A 4R4JA 4F12A 3MINB 2XMCA 1DEHA 1DMRA 1M7BA 2W6PA 2CFOA 2Z6VA 3M5WA 3QEOA 1NWCA 3QPVA 4RM3A 4KHPB 1TE2A 4NVRA 4F3YA 2N75A 2EJCA 3PWKA 4REMA 2A9FA 4FXPA 2EBUA 1J2EA 1I4WA 2CVHA 4HJXA 4J0KA 4XYLA 4XPIB 3LDFA 5BORA 4E15A 3WWEA 1Y1LA 1KI7A 4JQOA 1RPNA 2D0DA 2GI4A 3TE6A 5B7PA 3BMCA 5EC8A 2EERA 1P62B 5ADVA 3PEYA 1LF0A 1PQWA 1YUNA 2RGNC 2WUWE 3SC3A 5K0NA 1T2CA 3KOWA 2QENA 3S5JA 4Q7KA 5DN9A 3OQOA 2DJ5A 5KUTA 2VJLA 3IP3A 4JJZA 3VYTB 1I3NA 1SA0B 4P38A 4BQEA 5JMWA 2H2WA 5IBRA 3UHAA 2JLWA 4N5NA 1MXFA 1IK6A 1TT7A 3TL2A 4ARZA 5LIPA 4JLAA 2JLXA 2GN9A 4TN1A 3GXOA 2C03A 2YWJA 2AB0A 1JSCA 2A9OA 2QGNA 5EJFA 4BWVA 5F7OA 5KREA 1FJ2A 4XQGA 4C43A 2CJPA 2BKEA 2VC2B 1WTAA 4U7JA 1K5HA 5DYTA 1X86B 2FPPA 2DPMA 4J94A 2QYTA 2FRDC 4Z4QA 2GDZA 3ZGNA 3EHDA 3O8BA 3FJYA 2B21A 5PNTA 5JYBA 4D97A 4EGAA 2J5KA 5HVNA 5KTPA 1GPWB 1E79D 3M7IA 4P81A 4NQRA 4F6LA 5C18A 2CSXA 4P4SA 3JZFA 1B6RA 3SLKA 1SJ9A 3TM4A 2PGNA 4KPFC 4C07A 2IIQA 1E3LA 3IIJA 3RVQA 4B6GA 2IGTA 4B3XA 4BKUA 2HHLA 4HDQB 2FW9A 1N3LA 3HXKA 3PZRA 4H7PA 4IOLA 4JH0A 1EK6A 2RHRA 1CT9A 2Q46A 2B2XA 2QLMA 3BCRA 3GJ7A 3ESQA 2CJWB 2X3YA 4F2WA 2E6UX 3DO6A 2DECA 1L8QA 3L8ZA 2C00A 3U26A 5JCXA 1NR7A 2WNIA 4ZALA 3IH5A 4BAUA 2Y0PA 3FF4A 4CM3A 4Y2YA 1EXMA 3M3PA 2UYGA 2Q2WA 2NXWA 2B8TA 2F48A 1NNUA 4R41A 1ZSNA 1G5FA 1HSOA 1NQOA 3D8SA 3KYJB 1BD3A 1IWPB 2IZ6A 4H2DA 2AQIA 1QMPA 2G0TA 2KE5A 1GKUB 3G5MA 4PS1A 2XLBA 2ZSUA 5LUAA 1KK2A 1BVYF 3MUNA 1WLSA 3RVMA 4PVDA 3LL7A 3G0HA 4RAOA 3MBOA 1N7JA 1V95A 3JWHA 2UUPA 2C61A 3GXBA 3LYUA 1Y98A 4UNRA 3Q2OA 1XT6A 4WESA 4A8PA 1C0IA 1YB6A 2I9PA 4DQLA 4ZAGA 3LW8A 3QI7A 2YJ3A 1JNYA 5CDHA 1V0JA 4NV3A 4OXXA 4DG8A 1WSWA 4YN3A 2R79A 3PIRA 3DHYA 4TV8A 1U1FA 4D9JA 4Z2YA 5JCJD 3GRYA 2BRUA 3GZNB 3QWBA 5COQA 4B31A 4G97A 4UOZA 4WA7A 4AMBA 2NQ2C 4DGSA 1RRCA 1FFSA 3IP9A 3RBVA 1CZNA 4AIIA 4JA0A 1HK7A 2JBAA 3IHTA 3ECAA 3AY6A 4HYQA 3OOWA 2VQFB 4ZI7F 1PK8A 3FCXA 4RBNA 4GEGA 4HQ0A 3D3WB 4UM8B 4B3MB 3IO5A 1OYWA 2XMZA 4EAQA 2FPMA 4DEYA 1EFRA 3V2IA 1XP5A 5BQOA 4I5FA 3H7AA 3STTA 2IP4A 3JVUA 5JOQA 1AK2A 1E9EA 3AVXA 3H7IA 3UTDA 1ZHOA 1GZ7A 3BVPA 2F3QA 3FJ1A 4NS1A 3VR2D 1IIRA 3GGGA 2VI5A 3KAKA 3Q3CA 5F9MA 1FSZA 4ZHQA 2ZUDA 4UU8A 5I45A 5I7SA 1EYZA 2H9AA 4BMPB 5H02A 3B13B 4JP5A 1B8VA 1VZ3A 3E05A 1JG4A 4MYHA 4X44A 2YWDA 2XKJE 2FPIB 1MR3F 4RIHA 4Y2UA 3PB3A 5IM4F 5E2IA 1T3ZA 2R6JA 1VJTA 2AN5A 4BEJA 2IYYA 1FTWA 1SC3A 3N2KA 5IAGA 1G6KA 1Y8RB 4ESEA 2ZSIA 1NYRA 2QL9A 4H7FA 3TLBA 5ADUS 4X61A 5KYTA 3I2IA 1E5QA 2AR0A 4ZQEA 2O8CB 3O21A 1VMKA 3BJIC 2X22A 5LIRA 3ZWMA 5CHEA 4XVUA 4YRRA 3CO5A 4YXWA 2V96A 2OQVA 4G84A 2IVZA 3CH6A 3GQVA 3PXGA 2HMWA 3LPAA 1SKBA 5C80A 1J42A 4OOFA 4YDSA 5CT4A 4BGVA 5B5SA 3X1KA 1R4NB 4BUJA 5JTUA 4B8YA 1G8GA 2KBEA 4G07A 3KPWA 2J0SA 3Q3HA 1NUQA 2A8YA 1KFEB 2BW0A 2GAJA 3EOZA 4HN4B 5CNMA 3ML1A 3RRYA 2PBRA 1AUQA 2PS0A 3DVLA 3CF6R 2JLZA 1C3JA 3O1LA 4OFWA 4WCFA 5D86A 5AKHA 5K0TA 2JH9A 2AZMA 1J1UA 2JFXA 1NATA 4IP0A 2QDXA 5CP8A 4Q03A 5EQFA 1TKRA 4ZVLA 3UMYA 1N8NA 3T9EA 3P19A 4CM4A 4Q4DA 1DAPA 4N5DA 5DM60 1QG2A 2BUCA 1SZJG 2D13A 2PMWB 4YJ2B 4YCJA 1RIIA 5DGHA 3WYFA 2CSUA 1U8XX 3TD2A 3IRUA 2ZJ3A 1QO7A 2W6QA 3QFHA 3G9XA 5GOZA 4KFUA 4KXXA 1UMKA 5D5QA 5DHAA 3NCTA 3NPAA 4IX9A 3SDZA 1WKBA 1WXQA 3BQ9A 4ADSG 4MW5A 4GZLA 3SYNA 4AULA 2I8LA 5DNEA 2R1TB 3GQBB 4CV3A 4MKIA 1CY8A 1H2XA 2C3YA 3T15A 4WEQA 1TTTA 2QW0X 2Y8EA 3C1UA 1RSZA 5DYWA 3SS7X 5JO0A 4HRXA 1CQPA 3U44A 3JD4A 1VLLA 1GUBA 2AK2A 3FDFA 3AHCA 2HU5A 3TIFA 1D8TA 3EEFA 2W2LA 3H86A 4IUBS 1NSFA 3O9VA 2ZJ5A 3UGTA 5DM70 1VG0B 1REQA 2XPCA 1WDWB 4LXTA 2Y0CA 2Q9CA 4MQ5A 3U56A 1XU4A 2FMKA 1DBQA 3N53A 4XFKA 4E07A 4JI3B 1HQYE 1LWOA 4HAXA 4WLFA 5AOBA 3I04M 3VI3B 4QTTB 3E58A 4L50A 4UE3S 3KHKA 3O8RA 4KDCA 3WFZA 2I6GA 1K4MA 2HSGA 1Z4JA 3KLPX 5AYVA 1RWPA 3RC2A 1JIXA 1SIBE 1V16B 4ILKA 2AJDA 1R6DA 2C07A 3CG4A 3R3UA 2DT8A 1ORRA 1N5OX 4ZKDA 4L02A 1S8OA 3VNAA 1Y4AE 1VTKA 3IUPA 3C6YA 1IHUA 3RUDA 2REQA 2RAFA 4MKZA 4QASA 2HO4A 1JQ3A 2OBLA 3AVPA 3O0TA 2YIJA 5MHTA 2C9ZA 1K97A 2NZUG 1OLOA 4H1TA 3SEZA 4AYXA 2GERA 2VWPA 2VPTA 1LPPA 2ZSJA 4IO1A 3K0FA 4AG3A 1Z4IA 4EENA 4H3VA 3T7DA 1C9YA 4RZHA 3IJPA 4DCGA 1TAQA 1SHUX 2WIDA 5ALQA 3QE9Y 2VP6A 2XQGA 3JX9A 4A1FA 2XF8A 2QRNA 3ZLBA 4I1PA 1QHEA 1G21A 3EW9A 1K66A 1ID8A 1WWKA 3QHAA 2C31A 4XDZA 3AVVA 3PWSA 3W7VA 1R9GA 1U8CB 1Z7EA 5HFJA 3I5AA 5FOSA 5TS3A 1NOIA 3COWA 4QOGA 1OOEA 1R3DA 2CFCA 4BNKA 1IOZA 2WU4A 3KQQA 1P9RA 2IE0A 3AEXA 3L7BA 1E9RA 2Z8YA 3QENA 4HWRA 4RK7A 2QD5A 5AVSA 3DEJA 1V8PA 3FYSA 3GCWA 3IDQA 3Q6IA 2WFLB 3JWGA 4NDAA 2ABWA 2J33A 1ZOIA 1B93A 1XJCA 3N9IA 1VMIA 3BHIA 3DKPA 5AVUA 2W7TA 1LSOA 4EKEA 4X1KA 3FPGA 5DNWA 2DH6A 1HYQA 1Y5MA 2HRBA 3NCHA 3O4IA 3W8FA 1X8JA 3M5PA 5KX5A 2JIPA 3FOFC 3QLTA 1GKKA 1G42A 1LB1B 1MO5A 1KTVA 4ZARA 3KJGA 2DUUA 4B73A 4Q4JB 2QTVA 5SZKB 3LSYA 3UMMA 3K0SA 1FP4A 2CEAA 2W9XA 3TVTA 4H6WA 4TV9B 4NYJQ 1W0CA 3DFKA 3FG9A 3ZU5A 1WE2A 1I0LA 5CTJA 1PFGA 3SXJA 2HDNB 1N25A 4DREA 3FYUB 5CB4F 2JIBA 5C7IO 1RAEA 2C78A 1CUHA 1HDGO 4YONB 3WWOA 3K53A 5K5EA 4OHXA 5JARA 1T25A 2W6OA 4OXIA 5BSTA 3S27A 5ALYA 4YR7A 1UC5B 4RY8A 3A32A 4EX7A 4US2R 1JALA 4CLHA 2JK1A 4KC0A 1YU6A 1CJCA 1GTL1 2HPVA 2PGOA 3HU1A 5CURA 4HT3B 4QZVA 4B80A 3VJKA 3V7UA 4DA8A 3B2QA 4QRDA 4O33A 3Q1LA 3D6UA 5IAKA 5GWXA 3X1ZA 1JDBC 3F6BX 5BSFA 2IEDA 1O87A 3OJEA 1WIWA 1XBTA 1OT5A 2HJGA 4RJKA 2H52A 3KSBC 1R6AA 1UBTS 3EEOA 1CUXA 1R1DA 2IZ0A 1PJ8A 2QRJA 2WSSD 1ORIA 5CLQA 2PSSA 3WKAA 2X7JA 4M2LA 1UPXA 2E4VA 1OAAA 1QC5A 2ZIVB 3JQAB 1PO7A 4H7IA 3NHMA 3CF4G 1EP2B 4JVMA 4BNGA 1GGJA 2VYVD 1GQQA 4F60A 2CYBA 4WFIA 1P7VA 3GRPA 3O84A 4EB6A 1DO2A 3OCCA 4XVRA 2VSYA 1YHZA 1FFXB 2XE8A 3LQ2A 3T35A 5LQDA 4YRGA 1X1QA 4IINA 1X94A 3FRIA 3KT3A 3MM4A 1A9XA 4C6SA 2LKDA 4RFVA 4X66B 1CETA 2BE7A 3HHPA 4WLVA 5BMVB 3FOZA 1QLWA 3GJZA 1WKVA 3QLVC 4RF5A 4DN6A 2R25B 4DMCA 4XWWA 1C7ZA 1G19A 3SF8B 3THWA 4B74A 5TQ0B 5HP4A 2XB2A 3EDYA 4CMIA 1MH9A 2MDTA 2CDCA 1NVMB 2J0UB 3U7EB 5HRAA 4AY4A 1XVIA 1LI5A 5JJ5A 3ZHOA 2WVAA 1RT9A 2B4QA 4MJLA 4U4AA 1I36A 3GJ3A 5CEFA 1Z3CA 1TUEA 3RYCA 1NVDA 3F7MA 4FJ2A 4GZ5A 4TPKA 5DHSA 5A6SB 3ZEIA 2V59A 1H2WA 3S70A 4BJHB 4IVNA 4F2PA 1I4EB 2D0IA 1B8PA 4LXGA 5C46F 2XLCA 3I23A 5JAIA 1DAIA 1W0KA 1M8FA 5FYQA 3GLIE 3A05A 5AVQA 5AT1A 4MQEB 3NFRA 3KOXA 4KGZA 3TNYA 5BQ3A 2IS4A 5JXIA 5FTMA 3IQDB 3UAOA 4IH4A 4PYKA 1E7MA 1BIFA 4ZICA 1NW8A 1Q95A 2V4ZA 2ZWIA 3PKIA 1KYWA 4IRMA 2MU1A 4F3KA 1Z12A 4ECEA 2BGIA 4WK2B 3V80A 4BX2A 1WRBA 4NE9A 3RVSA 2XI4A 2R8EA 3GI1A 3RKRA 4X8MA 2EDAA 2EFHB 4KVZA 4XVHA 3RSGA 2G9VA 1P1IA 4EELA 3KKOA 4AW9A 3PENA 1CIVA 2QZ4A 4IY1A 3U4QB 3ZK8A 4LJ6A 1LPMA 3SIXA 2A9JA 1UDAA 3B6ZA 2VWQA 4P2GA 1YUBA 1N6KA 3OZSA 4XCVA 3V8NA 1HNZB 3KE8A 2B20A 2ZM5A 1Z0SA 5KC8A 4GP9A 3THSA 4LSWA 4NCKA 3I28A 4YT8A 1ZMTA 4I9UA 2FFQA 4MWDA 3HLYA 3KQVA 3DPUA 5G0SA 5U4QA 3TQIA 2O8CA 4MVJI 5I9TA 1YE3A 4C2TA 1CIJA 3M6UA 3GY0A 4JYPA 1AB6A 1Q14A 1P5JA 3NVAA 1TYDE 1WABA 3GLFE 1L7BA 1BDBA 1OA1A 2HGSA 4KQKA 1KEEA 1K8XB 9MHTA 1U0TA 3LS2A 5F7JA 2J3IA 5B6IA 2Q9BA 3I1IA 3BG5A 1VLVA 3WOHA 1NRIA 4IVRA 5ALLA 4N6NA 1KP9A 3VZRA 2GF2A 1U3FA 1JJVA 2P9ZA 1PFUA 4UNIA 2L17A 4NKRA 1VIVA 4B17A 1XD8A 2FHPA 2HA0A 2XMBA 5FD8A 3BFPA 3O3NB 2VP3A 3V1UA 4FDTA 1D6MA 4L28A 1I3CA 1LLQA 1ZICA 2AI3A 2R1ZA 3IODA 5AKJA 5ALEA 1C9KA 1TJ5A 4MRAA 5A06A 2G1UA 1I1OA 3IPXA 4HDNA 2Q3JA 2NUTB 3D4BA 2C3MA 1QNLA 4QYTA 4X7PA 2QRQA 4AY3A 2WAOA 1E0SA 1RHQA 2IZ1A 3AIKA 1U11A 4J49A 3B7WA 2JJMA 3AU8A 2PGDA 4DLVA 4ZMBA 2PT5A 1ZNXA 5K51A 3WHPA 4EDFA 2OKCA 3I72A 1F6WA 2GPSA 5CXXA 5BV8A 3WLNA 4DC0A 3HUEA 2F67A 4JJ8A 4WY5A 1SUAA 2SBTA 2DQSA 1J6UA 1W4ZA 4UZSA 1DCMA 1O6BA 1IHPA 3N2LA 3RK0A 1OB5A 3F3YA 3B9RA 4GMXA 2GPJA 2NUBA 3GEPA 4AG5A 5ALOA 3LCJA 5HG0A 3WMGA 4LE0A 1XTUA 4YJ2A 4ZOLA 3VPSA 4HN2A 1QDEA 1KZ9A 2EWMA 4DM4A 1DXQA 4E94A 1HFJA 2HWWA 4ZTUB 1LK7A 1W85A 4NOMA 1PYDA 1NXPA 5A9RA 2VLIA 2EFDB 3AJEA 2OESA 2DHCA 3D3EA 2HPZA 4OXNA 5C4IA 1WZ2A 3KOZA 1HZZA 2QTMA 2CLOB 1A1SA 1KO4A 2P27A 2C2ZA 4DIFA 1I0IA 2JKVA 3QBJA 4KQ2A 4HDOB 5KAMA 3B7GA 1F2TB 1IEXA 4PQFA 4RPIA 5CH5A 4K9DA 1RXIA 4MQFA 2C98A 2FWIA 4IBOA 4GI3A 4JBYA 5IKEA 5D5PA 3OC0A 6CHYA 2EGHA 3LCRA 4RUKA 2VTKA 1NMEA 2ODEA 2MCFA 3WLJA 1V35A 3BXEA 1DIHA 3WGYA 3ED5A 4BZQA 1VB3A 5J2TB 3R5JA 2CL0X 4V02A 3TM5A 2JS7A 1KY3A 1WV1A 4BJ3A 1RIFA 3H3JA 3TMKA 3TSZA 1M3SA 2W8ZA 5IJ9A 3A2KA 2HMAA 1I01A 3C3BA 2QVCA 3A37A 4KXFB 3SR4A 2XDQA 1UPUA 1S7GA 1KEKA 2YYZA 1M1YA 3DAPA 4FLMA 1VE6A 2Z0MA 1UANA 1Y3IA 2H63A 1OFUA 3KJEA 3G1TA 4FCTA 1OWOA 1UEIA 3QLVA 3WLOA 4GX1A 4GMFA 4RCYA 4P6VF 1E77A 1CUZA 2D2XA 2JRCA 1ZL2A 3BORA 2IYOA 1XE3A 3DE0X 3KK0A 3TZ6A 1EFCA 1DAFA 1V7CA 1JMYA 4OTZA 1FB5A 3RHZA 1A2BA 4X94A 1Y9AA 5ALRA 4AN4A 4HVLA 3WA7A 4R1MA 1EUDB 3IBSA 2B83A 2PJZA 3M6XA 2FEWB 3G2HA 3NM5A 4XQEA 3WJ1A 3GA5A 4P31A 2BM0A 1ADYA 3RTDA 4MP8A 3QPCA 4EO4A 3RWMB 1WNTA 3GEGA 3JAKA 4H60A 4EZBA 4EYQA 2PJUA 5KTMA 1JWBB 4UBIA 1ZCJA 2XZDA 3CJQA 2OILA 4JXJA 4MARA 5CM8B 3VR2A 4BFTA 2JLYA 1DLIA 1EA5A 4N18A 4TT3D 5DLYA 5BO5A 4K6KA 4ZO4A 1IAVA 1ZI9A 5IKMA 5L40A 4JC8A 2Z4SA 4JWTA 2ZRBA 3WLLA 2BM8A 2NSHA 5L7TA 3SNKA 1T4MA 1POXA 4ZOQI 2NYVA 3X44A 1H8ED 4TXNA 4BZXA 3C3DA 1YVUA 4CF5A 2RGRA 1ZRNA 1XV5A 1ZCZA 1P9WA 3N3BC 4QUKA 4L7VA 2Q2OA 2QTVB 4M1WA 3B9QA 4YYZA 2OCDA 1SCQA 3PC2A 3TIVA 1MORA 5JSZA 1UK8A 4P36A 2JFZA 3DMDA 3EBLA 1UBLS 4I1YA 1ZO8A 2EXXA 1P74A 5LQUA 1M6WA 1M8JA 4WESB 4MPRA 1M0EA 2FZCA 3W2EA 3WJ7A 1HF3A 2C2WA 4ZYVA 2FOLA 3EQ7A 2JW5A 2E5WA 1FQWA 1XFAA 4LXUA 3TTTA 1RAGA 3K8OE 4TXJA 1KHTA 3FB4A 3LU1A 4GVXA 4WNCA 3ZE6A 5C1IA 3BE5A 2XGJA 2PX5A 1IIBA 1H0RA 4YDHB 2M6KA 4AXXA 4UJ5A 4MSUA 4ZC1A 1YVPA 1G2IA 3OIDA 4KTTE 2GBFA 2IYSA 3BH0A 4IDGA 3TSYA 1FDWA 5A4DA 4JP2A 2F1IA 4CM7A 5DCYA 4P7KA 1FDIA 4CR6A 5JASA 1NBME 3EZLA 1GGEA 5EQTA 1U1IA 2HRCA 4MVJM 2J0VA 4J76A 4Z8YA 5IZCC 3CR7A 3GFQA 2PXXA 2G9UA 1ZPDA 3JD2A 3QOXA 4U2DA 5FV7A 3H9EO 5NULA 1DTWA 2ODTX 3VDRA 2HHAA 4FQ7A 1PD0A 2OXFA 3QVJA 4KFSA 4EI8A 3P9SA 4F56A 5AUOB 4JUCA 1ZFNA 4C4PA 5GQSA 4D9FA 2GNPA 1P6QA 2BEVB 3IMGA 4REOA 3DWEX 3D4OA 3II6X 2P1RA 5DBIA 5COAA 5F52A 5KYYB 4UM9B 2HJSA 1H4TA 2O54A 5ER6A 3VPGA 3S8YA 3JQFA 4V39A 2FP3A 2SECE 3AUXA 2C4HA 3EG9B 3CF4A 1LK0A 3IP5A 2W70A 2GTIA 1J49A 4MUMA 1T24A 4YBRA 1OASA 1K0UA 2Z6QA 3EQ8A 3ZHBA 2EJVA 5A6SA 5EJ4A 4X63A 1I14A 3L46A 4NY1A 5GZ3A 4URXR 2JJQA 4RHYA 1C7JA 1NIPA 4NCHA 3PDIA 3SC2B 5F4BA 2BGUA 4QAQA 3N74A 4MW1A 7MDHA 2VCHA 4Z7JA 3RSQA 3BKXA 1ZN7A 2LUOA 2XTNA 3HL4A 4MWOA 4BNMA 1ULTA 1XKQA 1TQ8A 4ZT7A 5ARDA 5IKXA 1PL8A 4L0DA 5ICSA 5HDQA 4G5XA 5K9ZA 2FRXA 4OA5A 2G1PA 4KGDA 4XB6B 1TVKA 1FDOA 3HO8A 3O1HB 3S2UA 1Q0RA 4HTAA 1QUEA 2W8BB 4FM9A 1J1IA 1JQDA 2G40A 2P4QA 4WKNA 2VT3A 4MK4A 3W9SA 1I6WA 2QGZA 2CLMB 4HNAA 3R0JA 5E6RB 4L16A 5CB0A 4WZZA 5L8VA 2AX3A 1D09A 1EWYA 3INGA 2JFVA 2BH9A 3PUJA 3RFVA 5IAEA 1DINA 3H4TA 3ZV6A 2EW2A 2HT1A 4FQ8A 3EOAI 6PFKA 1EJ0A 1E6LA 2QR3A 3LQYA 5FUXA 3Q2KA 1YKSA 3DYIA 3W9BA 1K8RA 2EHJA 3H6HA 3MTDA 3L0PA 3MGKA 1G0OA 3OT1A 4ZOLB 3RW9A 4JP1A 3FCCA 4HNRA 5HPYB 1TADA 3FMOB 1OX5A 2Z04A 1YR8A 3HBLA 3LWZA 4OGLA 1N3IA 3OSZA 4FN4A 4UFNA 5CR9A 2O8BA 4OQEA 3DNFA 4INOA 2VQ6A 4PZ9A 1V5FA 5BXYA 2VZEA 3TNFA 4PC2A 2QG9A 1JKIA 1J4AA 1L5MA 1M9NA 2PTGA 3ZBQA 1LZLA 2C7PA 1C8BA 4DDVA 3EQ2A 1R4NA 2E2WA 3B3JA 3DEYX 2JPDA 3GAFA 3MSCA 4NX2A 4DY6A 5JADA 2XCSB 2WYVA 2B8JA 1FC0A 3O1IC 3UH1A 3B89A 1Z2DA 3DMNA 4L07A 2UZAA 2O48X 2J6HA 1UMBA 3QW2A 3I30X 4FYKA 2Q2QA 4ND8A 5FTKA 3DKKA 3KWLA 1QG4A 3BWMA 4Y3UA 4CQMB 4LE1A 4DGQA 5HUQA 1I9GA 1JEQA 1W35A 2Y1DA 3LQKA 3UMCA 3HCNA 3V7YA 1XMIA 3U6KA 3JALB 4EPRA 4FZ5A 3O4FA 4H27A 4D9KA 5TC4A 4HGYA 1HLDA 4DE5A 3F96A 1WPRA 2EJBA 4YV2A 5LYYA 4NCXA 2IYFA 4QAJA 2ZR9A 1PF7E 1AK9A 4WXMA 3RUAA 1K8YB 2MT9A 3CUYA 4Z3KA 2X2EA 5FBVB 4A15A 2A9VA 5CX4A 3ZY4A 3QWIA 3OOHA 3R40A 4DUZB 1BXRB 2IEIA 2J9GA 2LCIA 3WMRA 4EKIA 3OFJA 1AO0A 3ZJVA 5DNCA 2XDAA 4HSEA 3L8HA 5BVGB 3HM9A 4B8ZA 3A6PC 2ZBPA 1AS0A 4UEJA 3R7SA 5HTOA 1N77A 1L7NA 3NKVA 3D4NA 4CU5A 3P97A 2AXNA 4R40A 4OJKA 1KY5A 3A0RB 4LI3X 3HYCA 5TDHA 1KSHA 1WD7A 1PI3A 2CY0A 1W5FA 2AA3A 1QO0A 3TG2A 3VHQA 1TD1A 2VWGA 4KI7A 4F38A 3H8WA 4NZ9A 2F9FA 1U3VA 3JWIA 4Q3BA 4C4SA 2IK8A 2GPAA 3HFJA 3L8GA 1GFWA 3F8SA 3C5EA 5IK2A 4M1ZA 5TXGA 5CTAA 5AW0A 5EL0A 5A5EA 1SA0A 2UYQA 1GPYA 2CXRA 3I3OA 5DOVA 2X9NA 1II8A 3SDBA 1FYEA 4ZOAA 2IXBA 1JUDA 5I4IA 5F9HA 2HI0A 4PHTA 5C1DA 3T9DA 1F3OA 1SB9A 3KS9A 2F1JA 1GILA 2FRVA 5DCLA 1Q6YA 4DDUA 3L8YA 2VYND 4R69A 1OC2A 2YMQA 3LK7A 4QICA 5FEMA 4GC5A 3ROGA 4BMXA 2DQ4A 4EKDA 1WMDA 2BEWA 1QYRA 2J48A 4OXRA 5HRUA 3U16A 1CUVA 1IDN1 3ZX5A 2GVDC 4D4KA 4M37A 5AHRA 4TTJA 2O52A 2JI4A 3IQWA 2I2FA 2BLLA 2GB4A 2V7EA 3KAQA 1WXIA 4MAMA 3ESYA 5BPFA 3V33A 4IWXA 4OLJA 1XZLA 3DZBA 2VDUE 3BOSA 3HKBA 1QRDA 1ZEJA 1CLEA 1PLLA 3C24A 2QXUA 4IIHA 4UU1A 3DE2X 5K3AA 4LFCB 3S8EA 1KO8A 5KYVA 3A1VA 1IY2A 5BVGA 2R8BA 4ZU6X 1M54A 3I37X 4E6PA 1U1DA 3QIVA 4OQFA 1FYDA 3N58A 3FYUA 2EWWA 4N5LA 5LDHA 5MDHA 5EMMA 1Q20A 1Z74A 3V9PA 3DAGA 3R0VA 3A6JA 3CX6A 2A0WA 4IOKA 2FF5A 2RHLA 3Q15C 4Y1GA 1LW6E 2Y3IA 4LQDA 4C7OA 5E2BA 3THYA 4LWZA 1XRJA 4XM0A 1YCDA 2Q27A 4S1OA 1CR6A 2QTZA 4QHYA 1US8B 1U4SA 1QRSA 2X5XA 1DFGA 1CJMA 1M2VA 2UVPA 3H2KA 3JATB 2CLDX 3EGXA 4TGLA 5E4TA 3UT5A 1BWPA 4RFSB 4Z0HO 3DYVA 1RLUA 1SMKA 1E1LA 2KHZA 4OOEA 3UWSA 1K7YA 4X71A 4LPKA 4FC6A 3MFYA 4QXPA 4F4HA 3ZD9A 2A4KA 2ZBEA 3U1BA 4JT9A 2ZSKA 1P80A 1JILA 1RM4A 2AN3A 2Q6LA 2VHCA 4PX2A 3OF2A 1C3OB 4ZVVA 5LOVF 1X13A 3UMJA 4GI1A 2BCGY 4M83A 4D79A 4PQYA 2IYXA 2FN4A 2OQ2A 4QLAA 1U2SA 1EKXA 3A1SA 4A9AA 4ARUA 5WRFA 1G2OA 2PAFA 2HAEA 2JF0A 4XDGA 1ORHA 1QHHB 3WL3A 4EGCB 2GCIA 4A0RA 4DMMA 2HUPA 3MG9A 3ER8A 1ZZEA 2AOTB 2VR1A 4RJIA 1PJQA 5BW4A 1A8IA 3BE4A 4TLCA 1NVUQ 2C2GA 2DFTA 1T0UA 3GR6A 3DLCA 2BHSA 4UCQA 3U3JA 3VTFA 1Z6GA 4RADA 5FTNA 1F14A 2X1MA 1W96A 1TK9A 1W47A 1IHYA 2QHXA 2YWGA 3KJQA 4M99A 1FYXA 3BB3A 2OORC 4C7MA 2CF5A 4BX9A 3PDCA 4UXHA 2HKIA 3NHLA 1GNLA 2ZWPA 5HTKA 1Y4UA 1QGAA 2VPZA 3N75A 5E6RA 3QBDA 1KS2A 1WMEA 3GHYA 4PQGA 3UHFA 1WPGA 3K0KA 4QTZA 5EIAA 4TVSA 4WY8A 1EAMA 4HVTA 2JCBA 1DFHA 2P9FA 2PH1A 3EWIA 4O8ZA 2D4AA 4EKGA 2F3RA 4R2KA 1XEXB 4KH0A 2P0AA 5HZMA 4FD3A 2NTVA 3T0IA 2B69A 1FNDA 2I9KA 2OHGA 4YS6A 3I6BA 4UDOA 4GKKB 1Z2OX 1PGOA 3PFFA 4HATA 2Z57A 3ZGXA 1T8YA 4I6EA 2A78A 3RSLA 2GK7A 2BKUA 5TPZD 3PI6A 1C1XB 4UMDA 3RH0A 2IX3A 5HR5A 3L7JA 4RDHA 3HLTA 3PPYA 3KZMA 1COZA 2WTNA 5HM8A 1XZDA 3L0OA 4IXMA 4GL4A 4E12A 3RYHB 4QJ5A 1T8RA 1PNTA 3A9RA 1J07A 1W19A 1HE1C 1LVGA 2ZXEA 4AM8A 2E49A 5JFOA 3S1SA 3P0HA 5EHNA 3RGGA 1Z22A 4A27A 4Y6OA 2QZZA 3JQPA 4PWZA 4AQ7A 2ZRAA 4KLCA 4YRIA 1QH1B 1XLUA 1PGNA 4HDKB 1MOSA 3D1JA 3WRXA 4B6PA 2CDAA 1AE1A 1LDMA 1QIGA 3HCOA 2BN4A 3OCXA 3UYKA 3J81A 2R97A 3WL8A 3WWCA 2R60A 1FLDA 4WI1A 4RLFA 3Q4GA 4ND8B 4TLDA 1CFJA 1TZBA 4BO4A 3OQNA 4BCCA 1L5RA 3KU1A 4FTWA 2W00A 4JJKA 2W4IA 2J87A 4W7SA 4PRKA 2BEJA 3RF6A 3A58B 2GBLC 3KZXA 2CLKB 1QZUA 1X74A 4KIFA 3UVEA 3WLFA 4AZ3B 4CQNA 4EF6A 2NVUB 1OFUX 5BQ5A 1NBIA 3DDCA 3ETCA 4N03A 5K4GA 4GOOD 4BXOB 4D74A 3H11B 2X23A 3O94A 3NOVA 4FEAA 4G56A 1OZGA 1FSSA 1RD4A 1VCNA 1C5KA 3QYJA 4IIGA 6REQA 1DV1A 1YQQA 1G6OA 2C5EA 3E27A 5U4XA 2QJOA 4C7BA 3V1LA 1P1FA 1SCDA 3RVDA 4NU5A 4EATA 2H8KA 2Z58A 1ATZA 3NTOA 3ZQUA 4AJ2A 5CDUA 2B2CA 2JZCA 2QYOA 3DQQA 1NW6A 3ESCA 2X8WA 2J9FB 4X9XA 1JEYB 4F1JA 5LQCA 1IB6A 4Q0MA 3ICQB 1XROA 5C5DA 4LS3A 1FBTA 1H9CA 4RVGA 3ABQB 1ONBA 2E6KA 1E3WA 4JBWA 4I8IA 4JELA 4B6FA 2GAOA 2DMRA 4GYKA 2OCGA 4U5QA 3DE7X 2IIVA 4M6WA 3TZQA 1KEEB 3LF1A 3VV2A 2FMIA 3LUPA 4GYWA 2JASA 4CLOA 2UYHA 1JHPA 3GF4A 3J81k 4R2HA 4ZREA 1PT7A 2AZDA 2GD2A 3O26A 1I1NA 3RB8A 1YZTA 2EARA 3L4BC 1V1RB 4R9UC 2ZRKA 1E4YA 1BN6A 1T4CB 1SU8A 3IT3A 4CG2A 4KR3A 3DE3X 2J3HA 2X6QA 4LZOA 5KVCA 2PAAA 4OK6A 3QEAZ 2I87A 4BJ1A 3HNOA 3KNZA 3Q1KA 3OLZA 3LUHA 5JDIC 5DW0A 2C04A 3PD7A 4FI3F 2ZR7A 3FPLA 2R6FA 1BVRA 3TWOA 3RUPA 1YWGO 3A04A 2Z5LA 3GC6A 4BTEA 4BRZA 5CFNA 3A3NA 2G72A 2X8BA 3ONEA 4GXNA 1JAXA 3WY9A 2FXVA 1ZC3A 1V4NA 2VXCA 3N7TA 5FHRA 1Q7GA 3UOWA 4EJSA 1PSZA 2P9YA 1CUUA 3S7TA 1BGXT 3AUTA 2ZRHA 3GGSA 2OZVA 2WNSA 4FGSA 2MYUA 1BKYA 3NASA 4M53A 4HBZA 4DLYA 1T5OA 1PWEA 3BXPA 1EK0A 2QTFA 3MCTA 4NI5A 4RFLA 3RUFA 2O7VA 4QX6A 3KQYA 4C76A 3IYLW 3Q6NA 3C8UA 4HAVA 3WAGA 1TIBA 2B0JA 4G8BA 5IXYA 4I7EA 3V8PA 4HAWA 1I30A 4BC1A 1SKUA 3CUSA 4MEJA 5F5LA 1OW3B 3A9WA 1WCIB 3CO0S 3LJKA 4C7OB 3TDMA 2AS0A 2P2GA 3BXZA 1XZKA 1KP3A 2J67A 2ZYGA 3NYWA 3C85A 4OIFA 5G41A 1MJGA 2P79A 3K5HA 4Y1RA 4F04A 3P9YA 4QPJC 4OMCA 4PFQA 4O2AF 2BFEA 3EVTA 3OX2A 1XTTA 1AQIA 1MJ5A 2AC7A 3VRHA 3WIBA 3WK6A 4PYIA 5IJAA 2C7VA 4C03A 5C52B 2ZPTX 3IEVA 4P2BA 4RL4A 1GG9A 2BL4A 4U8GA 2IWRA 4B7UA 2G88A 3TXYA 2J0QA 3AVWA 5AI5A 4X6YA 2NIPA 3KVRA 3LGSA 5HGXA 1YRQA 1F8GA 1Y3BE 4RHCA 1QZTA 3NGXA 2LZ0A 4MV5A 3DEAA 4YP5A 3HUFA 4GXTA 1G3MA 2VSOA 3G2IA 4A82A 3RTEA 2YWEA 3AIOA 1HG0A 2H1RA 3FZEA 5JZBA 5C34B 1A7JA 3HJFA 3GJTA 5K3FB 2XQFA 4LZPA 3ETGA 4FOLA 2GXSA 1EVJA 1N1EA 1SPBS 3AGQA 3WIUA 4JCCA 1HTBA 2B78A 4RK6A 2X40A 2HEIA 3LVFO 5JQGA 5DXFA 1R8YA 2H3EA 4MGIR 2FPGA 1XPOA 4WKPA 4D9HA 4MQ4A 2CVZA 4Q7EA 1Q3TA 4Y0VA 4EG8A 2JLQA 2I2DA 1AUPA 2WYUA 3PE4A 1DX6A 2VHTA 2OYCA 3KXKA 3K30A 5E2AA 4DMFA 2AG5A 1Q77A 3MILA 4PXAA 5EHZA 1NXXA 2IFTA 2NPFA 3P2IA 1L5FA 4X6XA 2IXEA 2BOVA 2QOEA 2HIHA 2XGOA 4EHJA 2Q7DA 1Y80A 3GJ0A 2CB0A 2ZS8A 5CDSA 3EIEA 3R3YA 4L6AA 5JW6A 1W4CA 1X6VA 3E15A 4QGAA 4F3CA 5IKOA 2BFPA 1K9SA 1Z17A 2QRHA 4ZT5A 2PDAA 3B6MA 1KQ3A 2DG2A 3B53X 3HADA 3ORHA 4JBXA 4IHJF 1T3GA 1JKJA 3SBEA 3B9PA 3GFFA 4GX5A 4M88A 4KQHA 3EGWA 1GDDA 4ML3A 4BX3A 4HNQA 2IOFA 3NYIA 1Y4DE 3H0KA 4H1HA 2IU0A 1T0JB 2AJ8A 2ILTA 5AXAA 2YN4A 1DCFA 3ETJA 1J9ZA 5GM2A 2ZEJA 2H8GA 5G1PA 3VKFA 1E2QA 4FE7A 3TI9A 2HEGA 2TMGA 2IDZA 4YC7A 4E08A 4HK4A 3LXXA 3A1EA 3E48A 3SEQA 2QRVB 3G8DA 4D6XA 5FORA 3KQUA 3HB9A 2NO1A 1FMJA 3NDJA 1FZQA 4BQFA 3HSKA 3IMEA 5AKYA 1ETUA 2Y1LA 4E22A 3NAMA 4G0XA 1P2FA 5ARBA 1QF9A 4PYQA 2W6IA 3U1VA 2B5OA 3I62A 1U04A 5C3UA 1C3LA 4Z51A 1SVMA 1UEXC 3T0FA 2HV8A 3UJAA 2WB2A 1JYEA 1O96B 1R4ZA 1ZGGA 3V8BA 2ZTSA 4OH7A 5EXEA 2CFTA 4K6HA 3UKDA 4AWBA 2CXUA 4H1WA 3JAMA 2WYOA 3O8OA 2AOTA 1VM6A 5KVVA 1AKVA 3AFGA 2O8FB 2AWOA 3STXA 4IRXA 4HZUA 1KE2A 4RVHA 4NK5A 2V7PA 3C5VA 1U2EA 1V96A 4GICA 1F9EA 2X4LA 1PW5A 3GDFA 4D3SA 1CJUC 1G8HA 4DCJA 4O5AA 3H11A 4ZEXA 1NVVQ 1ZONA 4C30A 3TX6A 1TQHA 1ZD4A 3EVNA 1NVXQ 1JDNA 2BFAA 4V38A 3AU9A 1DQPA 5ALUA 2G4LA 3K9QO 3F7TA 4GH5A 1XTSA 4I19A 4S2UA 3W05A 4LHZA 4O8CA 4DJAA 1DP4A 3T3PB 4BQNA 1IE3A 4JOQA 4C4XA 1VYUA 2NX2A 1C29B 2J3LA 3Q12A 3NC0C 1KC1A 4M36A 2G9QA 1E2KA 4EBBA 2IGBA 2FZGA 1OXMA 1ODFA 4B3BA 5LR6A 3WBFA 2XE4A 5DGDA 3NIBA 1B1CA 3EEQA 1BD4A 4LF4B 4D6PA 4RTOA 4FVTA 3TRJA 4GRDA 3VU9B 3DW3X 521PA 1GKYA 4GMGA 2XMSA 2QF7A 1QOQB 1VXRA 4CM6A 4Z4CA 2FUCA 2C92A 1CXZA 3CWZA 3NAQA 2J3QA 2RAUA 1LGYA 1X8LA 4L3WA 5IW8A 3W77A 3ZDYB 1COWD 4BLUA 4ZYYA 3N2ZB 3NB0A 5EOVA 2H5JA 2O2SA 2P0YA 5D3MA 1A8UA 1CNFA 3CRMA 1DU4A 3R5XA 5JH7B 2WMOB 3KEMA 3A06A 3RS7A 3UKJA 2R4TA 3OQ1A 4R2MA 2B3DA 3URMA 4AD8A 1B8NA 8ADHA 5CLIA 2CLSA 4C87A 1JECA 2BDUA 4BPRA 3KSRA 1ZUIA 4YJHA 4FW8A 4L4UA 2VTDA 2OHVA 1EDDA 5H3CA 3DZJA 2V4MA 4X0EA 2XTJA 4FFMA 3Q3VA 4UTXA 1N6RA 3PF8A 2WTBA 4OSEA 2N3ZA 2V5AA 2FSGA 1XZMA 2QI9C 1CS0A 3SZ3A 1ETHA 1C8KA 4RAQA 4ZGWA 1OKKA 1X7ZB 4N0PA 2Y2VA 3P5BA 3VISA 3L41A 2PNFA 3W6OA 3JZDA 1GEGA 3C8HA 3Q41A 5KHOC 3QF7A 4YAGA 2FGJA 4WOBA 1ZK3A 4PSDA 3QXHA 4EX6A 3L7YA 5EMJA 1N6NA 1S0UA 1SZCA 3QKSB 5AW1A 3CH7A 3KSZO 4TVOA 5JMPA 1Q0HA 2N47A 2QMUA 2N0SA 3OG9A 3VDXA 1SXQA 2GASA 4RANA 1GWNA 4JL6A 4JB3A 2P7HA 3M49A 4EEXA 3DOOA 2MTBA 4GOXA 1Q74A 1GN8A 5BV1A 1QYXA 1DOZA 3BFVA 5LD2B 3BAFA 1XEAA 3M81A 2YFQA 4YRCA 2HM7A 3UM9A 2VRBA 1LQUA 2L0XA 3UJHA 4ZRNA 5M2QA 2ZIXB 4F4CA 1JI3A 5K1ZA 2ERYA 5D3MB 2WWIA 1TAHA 4OHPA 4NLLA 3FE2A 3Q0EA 3RUHA 4ZO7A 1AHPA 3NKFA 4FGKA 1QGED 2IF2A 4K03A 4BOYA 2G83A 5JQWA 1ZYUA 2G36A 1L5YA 2OSBA 2P68A 4ID9A 3EGDB 5H80A 4I3GA 4ZMRA 3H05A 1FRZA 3IP6A 4H3SA 3IUYA 3WGQA 10MHA 3VZQA 4NNJA 4H7KA 5BOVA 5JFTA 1XPRA 4DRXA 2JG3A 5CAEA 4Q9DA 3T7IA 4J91A 5HMLA 4MRPA 4OPMA 1JAZA 4AP9A 4YCCA 3EG5A 2XZTA 2PYDA 3D1LA 2GPNA 4HZIA 1NKSA 1L3BA 3KHTA 4EPVA 2WSMA 1WNFA 2GJ9A 4LAFA 4W8HA 1C14A 4CKCB 3ZD6A 4KYVA 2IDMA 5AM4A 5F1YA 3TPZA 1FNBA 4AKHA 3JQ9A 4KX5A 2ZB3A 3KE9A 3SF8A 2HYDA 3LM8A 4LYDA 2QRUA 5DYIA 1HFWA 1WSDA 3N2EA 5A0FA 3V8QA 4QNRA 3ZDEA 3GV0A 4AX4A 2BTOA 5K99A 1Z4KA 4E5NA 4JU8A 1EM8A 3V9AA 1HT1E 2I6QA 1WR8A 2JIOA 3COPA 3PR3A 1ZGBA 3S81A 1XZQA 4FYMA 1J2TA 2ZTUA 3TQQA 1Z0DA 2C2YA 4F5WA 2ZK7A 4RELA 1PS8A 3VU8A 5HNKA 2IYUA 3PEEA 2O0MA 4YLEA 4X95A 4O4IF 1OZ0A 1IXKA 3GL9A 1Q0PA 2MJLA 3QE3A 2GYWA 5FUBA 1KWKA 4TL8A 3I58A 4KN6A 4YJGB 2W6ZA 5P8WA 3FMPB 1H4QA 4G0YA 4NP6A 1FLNA 3ECSA 4U7WA 3HFRA 3GRFA 4ODIA 3A4VA 3OUTA 4PX5A 4D57A 1G5PA 3LFHA 1E66A 1PL0A 1ZAKA 2DEUA 5F1KA 1EXDA 4LOAA 4NS4A 4GOND 5G4KA 3ZJYA 1JHZA 4BB5A 1WHSA 4YRBA 4FPXA 3CZMA 4LXXA 4EKNB 1TOAA 4DA7A 3RE1A 1XDGA 1TMGE 1NJSA 1SC6A 3FUTA 4DXDA 3Q88A 4P08A 1AA6A 1IZ0A 2AJLI 1W0JD 3BYZA 3W4IA 3C3MA 2YCLA 1VIMA 1WUIS 4K8OA 4XWGA 3MCZA 4MNTA 3TOSA 3S3TA 1FXWF 1ID1A 4JGGA 4C7KA 3V34A 4FMPA 3EY9A 1A3CA 1F1BA 1VKNA 3BFJA 3HXTA 4KODA 4M8LA 1X9GA 2WUEA 5ALDA 3TUIC 3HACA 4BLSA 1NZDA 3GX1A 3PK0A 2IUTA 3BIWA 4UVEA 3EULA 1JYSA 2QLBA 4M0LA 2AD1A 1RVV1 2VPYA 3HYLA 3HI4A 3MLEA 3TVDA 3DTNA 3AETA 4L9AA 1RZUA 1UC8A 1FUUA 1SQSA 1W25A 2ZBFA 3FMIA 4M9QA 4YRJA 4ARSA 4L6IA 1D1SA 1PAUA 2YYSA 2IELA 4HNTA 2PUVA 4K3UA 3AM3A 2I66A 1K7CA 1H8HD 1L4EA 2AXQA 4OJNA 5E3JA 2IBTA 1P75A 3ICWA 3LHIA 5BN4B 1PYOA 3TTYA 4EHIA 4F3RA 2RGCA 4N3AA 1KI4A 2AW3A 3PGLA 1L7EA 1E3QA 1AHHA 1FU4A 2X4IA 4K5QA 2VQSA 4YAKA 1HMPA 3OZBA 3F3MA 1AMNA 1GZDA 3FCEA 3WFIA 1DOHA 1R0RE 3IT2A 1SQGA 4DLAA 2EEZA 3AKDA 1O0BA 1PJ3A 5DTEA 1ENOA 1ZSYA 1PFYA 5F98A 1PTJA 1L1RA 1YQXA 2CMFA 2YUIA 3ZYCA 1V39A 1U94A 4IKEA 2YV1A 3Q7EA 2QWXA 3KTOA 3K1ZA 5ENDA 3EQZA 2IY9A 2P77A 3JV7A 2PMKA 3VTKA 5T7BA 3UENA 4LJLA 4R31A 1P1KA 4WKOA 3ZEAA 3VYUB 1JE0A 5GJCA 1WZCA 4CIAA 2YIDA 3T52A 4KRGA 3OE5A 1XRQA 3DEIA 3LECA 2V6FA 2XEDA 3PNBA 3B3QA 4BBAA 3L77A 2BBSA 3OLWA 3KEOA 5MN5A 1WCYA 2DUMA 2H54A 4P86A 3IVMA 2F55A 3LPNA 2OT3B 3TQRA 1W8DA 2XCQA 3H87A 1YQ9A 1VL0A 5B1SA 2GZRA 3FRHA 3D8UA 3OFNA 1KMIY 4MWBA 4JA2A 3SD7A 1KI6B 2RGXA 2XYHA 5KYXA 4YMHA 1YZ3A 1ECFA 2UZ1A 4WGFA 2XUPA 5SZIA 3GB9A 4PNEA 5ED0A 1WP4A 4HQNA 1SD5A 2O1EA 3E9EA 2POQX 2B5VA 5EZYF 3GHHA 2ZVPX 1YZFA 5HEKA 3BREA 4LJ7A 4TTPA 3FLMA 3B8HA 3F5QA 3KHUA 3OIWA 2LV8A 2I4NA 1KDOA 2R6AA 3FM9A 2G06A 4Q4HB 1T9AA 4NJMA 5DV9A 1FUIA 1OLSA 1YF3A 4V1CI 3IAFA 3EGIA 1WJGA 2Y6VA 3G2PA 1HTWA 5HDBB 1AUXA 1O9BA 1QTQA 5F1PA 4IHQA 5EWMB 1BDJA 1JW9B 1PJ4A 2XMQA 3IMFA 4RTMA 1ZX1A 4LJYA 4PX9A 3VO8A 3ZGVA 3WK8A 3T1YB 2FMXA 3ROFA 3QF4B 3RVKA 2ZRDA 3GPDG 3ICCA 1RRKA 4IKPA 5K8LA 3G85A 4UHBA 5KNDD 3MWGA 3C5CA 3DLHA 1ZXLA 2A5GA 4QYXA 2WQ6A 1XR3A 4FB4A 2HW8A 2QTGA 1R18A 1F2UB 3AY3A 3D8NA 5BWBA 1JWAB 2FE4A 4GKBA 3UJBA 1PZMA 2GN0A 3GWGA 1AMOA 2CD9A 4JEIA 2Q9AA 3PGA1 4Y8VA 4XVCA 4GPD1 4YHHB 4DV4B 1NJ8A 4LV8B 3HKCA 3T3OA 4RKQA 1H6AA 3WQQA 2IS6A 1URPA 3TPFA 3OIVA 5C51B 1SQ5A 3ZQ6A 5TT0A 2XKKA 3KKMA 3L1IA 4RS3A 1EU1A 3FAZA 2CMGA 3OTWA 5T6MA 2JFGA 3OZIA 2A1UB 3AXTA 3KLBA 1SD2A 4KXMA 3E3MA 2NU9A 1KVTA 1E64A 2QXYA 1JLLA 5MGBA 4DDKA 1ZJ6A 4RGQA 1JJ7A 4LWOA 1UR5A 3OFSA 3KSAC 5ERYA 3BXHA 2H4XA 4RF3A 3IJEB 3UAWA 4I5GA 1PT8A 1X7YA 4EA8A 3INYA 1LF5A 5LYJB 1NTOA 1SCUB 1MPXA 1LSUA 1W52X 1P2GA 2VDWB 8ATCA 5ICGA 1YCFA 3AEQA 4PINA 4PN3A 2MMCA 3IBGA 2HLNA 4JJ4A 4YXWD 2WUDA 2WT8A 3GPBA 1WTCA 2I6SA 3CU5A 4YA6A 4RTQA 3HZHA 5A3SA 1M5TA 2BP7A 2WJHA 1O57A 1T2FA 5KQSA 1QK3A 5HK8A 4QEZA 1UJ4A 5BRNA 1U0NA 2OC9A 3K0FB 1S2GA 3FTCA 2FOIA 2IXGA 1OI4A 4Q48A 2I4TA 2YFYA 4F72A 4CODB 4RTSA 1ESDA 1FDVA 1I2MA 1PHRA 3H2YA 4HEA6 2J0EA 3ZLUA 1MQSA 3IEUA 3NBFA 4CU2A 2BKVA 4C88A 1ITZA 3LHSA 3Q7QA 3ZHRA 2ZUBA 4P4SB 5KYKA 4CDNA 3FOAA 3T3HA 1EIWA 1F17A 3LH5A 1EB8A 3LC1O 1XHEA 4Q47A 1KK1A 1TGVA 1KE1A 3WWPA 1OCEA 1HDOA 1IPHA 1JDBB 1Q2UA 2JZNA 4Y0AA 5DTQA 5DIZA 2NLOA 3CVOA 2OOSA 3A6GA 1CU1A 1GCOA 1XWIA 2F1RA 2WDPA 2X9GA 1VCOA 3P0EA 2GN2A 4FNAA 4PPYA 3QUQA 5J5AA 1JG3A 3F9RA 4PLTA 1L5NA 1L6RA 5EE5B 3M6FA 5E7IA 5HS4A 3AR7A 2Q1SA 2D1RA 3O74A 5CVVA 5AM2A 2ECQA 1TAGA 5FR1A 2LDBA 1HYHA 5KNBA 2W2NA 1I3KA 4N65A 2D6FA 3EDCA 2WQZA 2WV9A 3K6KA 2QEQA 3ILYA 4X1YB 3TXAA 2RKBA 4V0NA 4AJKA 1V7QA 4X54A 2QP4A 1IZYA 1L5ZA 5CAEB 4V2IA 4B2LA 2PWAA 2RGGA 3MTQA 4Q3AA 1YACA 2FN3A 4LNUB 1JFLA 1MVNA 2XYQA 2DR2A 1TRKA 4XPIA 1U7PA 5DGXA 2XH8A 2PIDA 3AY0A 1T26A 3PPWA 3QU7A 4UATA 4I50A 4UASA 1F06A 5IJWA 3I5YA 4GL2A 4WPGA 1RPZA 2Q28A 3LBIA 5KPJA 1Y81A 2A2ZA 2A5DA 4FHGA 1U0BB 3H6GA 2EZ4A 2P9BA 2KX7A 5E8JA 4HGNA 3S2FA 2X3UA 4Q4LA 1CIPA 3EVCA 1HH4A 3IX7A 4LYYA 1R5OA 3EGCA 5HCUA 4Q9KA 1BSVA 5HX7A 5KQMA 1QVZA 1RBMA 4FILA 4IDHA 4IZIA 3VZCA 3DBLB 1WP9A 2D1SA 1YFJA 4Z54A 1KJ8A 4F4UA 4UFPA 3C1AA 4J2TA 3IHWA 621PA 1QCCA 2D7DA 2RIRA 4OHCA 4NYIQ 4ZKEA 1VDZA 3VO9A 4CHGA 2BF4A 1PL7A 3LQ4A 4MR7B 5AW3A 5EUQB 4DLWA 4YLGA 3U13A 4DV5B 4I1UA 2ALJA 4HGOA 4OU5A 5ESWA 5JECA 1QQAA 3W5IA 4IIJF 1JR2A 5JIBA 2NNLD 3R75A 4JC5A 3F7NA 2X8JB 4YO8A 1ZH2A 3C7KA 3LV8A 1T6NA 4WBNA 1E1QA 3P0JA 3GFOA 2MSKA 3KKKA 1FJXA 3QXCA 4UVIA 3ZN2A 1ABEA 2BJWA 2ZRFA 2C2XA 1NNI1 3AMVA 3HV0A 4Q12A 1GQYA 2WU3A 2DX7A 3P20A 4OP3A 5HKLA 2AG8A 5HKAA 5K8CA 2ZJAA 3F74A 3NEJA 2CMHA 3SDSA 3ZWYA 4B44A 5JNUA 1V1MB 3QY0A 1JKMA 1LDGA 1FTSA 2ZRIA 3KQWA 3QFCA 3RGWS 4C7VA 5C35A 4HGZA 3Q3GE 5B3AA 8GPBA 3EQ6A 1DI0A 1JBEA 1QJ4A 4BNFA 5KQRA 1VL8A 4RESA 4WZBA 3K4QA 3AL2A 1VLHA 1KC3A 4KAXA 4P0TA 3NYQA 5TMDA 4ZOBA 1Z2CA 3FPJA 4Q1BA 4M21A 1Q1NA 3ET5A 4NU8X 1KSGA 4XSVA 2A7XA 3UKOA 2J0UA 5B30A 1GRVA 2D74A 2XDWA 4PE5B 3X1XA 4RZUA 4IXWA 2FG6C 1Y6FA 1KRWA 4M38A 1TGYA 3QRWA 2DPGA 2Q7OE 2QD1A 3KZOA 4EL0A 3DL4A 2Y4NA 1V4VA 1DHTA 2NXEA 1EVEA 4G5RA 4GMHA 4JK3A 4RO0A 5IT9A 2VKQA 5EE3A 2CWDA 1N0HA 3ANSA 1NASA 2E0IA 3QE0A 1VJ1A 2VK2A 3HCCA 5LQJA 1JG2A 1R6BX 4P32A 3WWDA 4MDYA 4OY3A 5DP1A 5FNVF 5TMEA 1GGFA 3DYBA 3QVUA 4BLPA 4KKXB 3HCFA 4CCYB 3UK0A 2CUKA 4DG5A 4DSAA 2YZKA 4TV8B 5F5XA 2LGJA 1GA4A 4JT2A 3LY5A 2ZTVA 4ER6A 3EXEB 4HNVA 1L7AA 3CVJA 4XUCA 4L57A 3CLSC 4DNXA 2I4OA 2BV3A 2GA9A 1B26A 3MFQA 3W3AH 2J7PA 2VF8A 4MKXA 5AW6A 1NTRA 3RC8A 4H3KB 1E6KA 2EX1A 2W2KB 3UW1A 4R3UC 3O2QB 1Y7HA 3SJAA 5HFNA 3DHNA 1WZNA 2XUOA 2QRKA 1P0QA 3EXG2 2ATCA 3P4YA 3EWAA 1N32B 4GKJB 4ZT4A 2DBYA 1UL1X 4HEQA 1YJCA 3SBDA 4YJFB 3OPXA 4CE6A 2KLHA 2QTLA 3LZCA 3LWNA 1NNSA 2ZIAA 3ODPA 4ITVA 5FA5A 5BT9A 8AT1A 4DV2B 2H5LA 1VYHA 4B1FA 4KW7A 1EVQA 3BIJA 4LF5B 1DIAA 3H9QA 5FBRB 4M86A 1A2KC 1P2DA 2P9HA 2XT9A 3FTQA 3TL3A 1RC8A 3GUVA 4F21A 1UM8A 5DM4A 4G5SA 3FN4A 1ZJYA 4C21A 4ZDKA 5E4YA 1ZOOA 1S4MA 1VSBA 3H2JA 4JZYA 1TJPB 4ZP1A 3BWEA 1TCUA 3IGFA 1TM4E 3V4PB 1T2AA 1OXXK 2GYYA 2XHZA 3LWDA