1RXUA

E. coli uridine phosphorylase: thymidine phosphate complex
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
250
structure length
250
Chain Sequence
SDVFHLGLTKNDLQGATLAIVPGDPDRVEKIAALMDKPVKLASHREFTTWRAELDGKPVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPLEFPAVADFECTTALVEAAKSIGATTHVGVTASSDTFYPGQERYDTYSGRVVRHFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Uridine phosphorylase
publication title Crystal structures of escherichia coli uridine phosphorylase in two native and three complexed forms reveal basis of substrate specificity, induced conformational changes and influence of potassium
pubmed doi rcsb
source organism Escherichia coli
total genus 91
structure length 250
sequence length 250
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2003-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1rxuA00
4BMZA 4TS3A 4U2KA 4K6OA 1G2OA 5F76A 5CXQA 1XE3A 1U1EA 3UAWA 4WKOA 2AI1A 1T8YA 4F3CA 1VFNA 4R31A 3DDOA 1TGVA 3KUKA 1Z5PA 1V45E 3KVVA 4F1WA 5F7JA 4DAOA 3BL6A 3DF9A 5B7GA 3KVYA 1PR0A 1ODLA 2OXFA 3F8WA 4MARA 5CCEA 1TGYA 1A9RA 5CXSA 1Y1TA 3LBAA 1JYSA 3O4VA 1I80A 3KU4A 2Q7OE 1OTYA 4OJTA 4YMLA 4DA0A 4DABA 1U1FA 5IFKA 4OF4A 4E1VA 4L5CA 4M3NA 4LZWA 4QATA 1A69A 2AI2A 3EMVA 1A9PA 1NW4A 4L5YA 2HWUA 5CYFA 4WKNA 4EARA 4WKBA 4TXMA 1SD2A 4MCHA 1CG6A 4KN5A 4TS9A 4DA7A 3FNQA 4F2WA 1JP7A 1M73E 3BSFA 2H8GA 4NY1A 3NBQA 3E9ZA 4OEHA 4JWTA 1VHWA 1U1GA 3UAVA 2QPLA 1JDTA 4TXNA 5B7QA 3P0EA 4L5AA 4R2WA 4BMXA 1ODKA 3OPVA 1OU4A 1A9OA 3UAZA 1U1CA 3GB9A 3E0QA 4LNHA 1V3QE 3O6VA 4YO8A 1OUMA 3P0FA 4F3KA 3K8QA 1JE1A 3LGSA 1YRYE 4G41A 4L6IA 3FOWA 4JOSA 1RSZA 3OCCA 1TCUA 1JDVA 5CCDA 1Z5NA 1Z36A 3OOHA 1T8WA 4G89A 3LA8A 4D9HA 2QTGA 1V41E 1SJ9A 1FXUA 5I3CA 3MMSA 1SD1A 3U40A 1ULBA 1RXYA 1CB0A 4DARA 1PW7A 4PNPA 4DA6A 1JE0A 3ODGA 4M7WA 4TTAA 5EPUA 4D98A 4WKPA 2BSXA 4QAQA 3SCZA 2RJ3A 3UAXA 1RXSA 1PK7A 1N3IA 1QE5A 1Z39A 3OZCA 4DAEA 4QEZA 3DP9A 5DK6A 1YQUA 1Z34A 1Y1QA 1K3FA 4WKCA 3DPSA 5KB3A 4TYMA 1A9QA 2A0WA 2PGAA 1T8RA 4YJKA 3C74A 5B7PA 1ODIA 5C80A 1PKEA 1LX7A 1ULAA 1V2HE 4JP5A 3EUFA 3UAYA 5F78A 1ZOSA 4RJ2A 2XRFA 1Y1SA 4IP0A 2HSWA 2P4SA 1LVUA 4TXHA 1NC1A 3BGSA 3ENZA 3OF3A 1PBNA 1T8SA 5F7XA 3FAZA 4LNAA 2ISCA 2HN9A 3OZEA 4P54A 4QFBA 5EFOA 3IOMA 3BJEA 1SQ6A 1ODJA 1TCVA 4D8VA 2I8AA 2GUWA 1JDUA 2OC4A 1WTAA 3EEIA 3ONVA 3FUCA 1Z37A 1Y6RA 1RT9A 2A0YA 3PNPA 4I2VA 1A9TA 1JPVA 5IU6A 1Z33A 3GGSA 2ON6A 2HRDA 4TXLA 3K8OE 4FFSA 2B94A 4YNBA 1PR4A 3T94A 4OY3A 5B7NA 1VMKA 4L0MA 1RXUA 3FB1A 1ZL2A 4M1EA 4BN0A 2QDKA 1PK9A 1PR1A 1Y6QA 2A0XA 5EUBA 4EB8A 4NSNA 1PR2A 3FWPA 4D8YA 1JDZA 1PWYE 4F2PA 1RXCA 4X24A 4LKRA 1C3XA 1RCTE 1K27A 3KHSA 3NM5A 1OVGA 1RR6A 3PHBE 1YBFA 2A8YA 5CYGA 1Z38A 1TD1A 3PNSA 4R2XA 5JPCA 4QASA 5ETJA 2IQ5A 2I4TA 4PR3A 4OGLA 4TTIA 1T0UA 5F7OA 1V48A 3OOEA 1Z35A 2AI3A 4QARA 3D1VA 1VHJA 1YQQA 1U1DA 3MB8A 4H1TA 5FAKA 4MCIA 4UC0A 4BMYA 1Z5OA 3IEXA 4TTJA 1A9SA 1RYZA 1B8NA 1OV6A 4TXJA 1Q1GA 3NM6B 4GMHA 4OGKA 1PR6A 1JDSA 4DANA 5K1ZA 3NM4A 2QSUA 1K9SA 4ECEA 1PR5A 2QTTA 5F73A 1OTXA 1PF7E 3OZBA 1ECPA 3E9RA 3QPBA 1RFGE 1YR3A 5F7ZA 3DJFA 4GKAA 3EUEA 1LV8A 3KVRA 1B8OA 2OECA 3INYA 2OC9A 4LDNA 3OZDA 5F77A 3UT6A 4G8JA 1Y1RA 4GLFA 4D8XA 3PHCA 1NC3A 3TL6A 4GLJA 4DA8A 2AC7A 4NS1A 1V4NA
chains in the Genus database with same CATH superfamily
4YUWA 4BMZA 3UENA 1BKYA 3PNYA 5H9WA 2ZOSA 4PPNA 4PFJA 4RGVA 4E88A 5KZMB 1PK8A 4R1PA 4EHLA 1T9KA 4K6OA 4LXUA 4NXMB 1MAWA 1MF7A 3CVWA 1G20E 3FGZA 4ZI7B 3ZNPA 2AKEA 4J16A 1UM9A 1YDWA 2FSVC 4GOLD 4TSRA 2XVMA 1T5IA 1KO8A 2B37A 2XVYA 3NOVA 2DPHA 3I37X 2PFSA 2HU5A 4XYBA 1P7WA 5JWHA 1J2EA 2HGSA 1PLLA 4WZAA 1JFFB 4QQRA 1R66A 1DV2A 4V0QA 5CLGA 3WIOA 2X15A 3UMVA 2IJGX 1NP7A 2P9CA 3EF0A 3EUAA 3F6SA 3M81A 2CCJA 3Q3CA 4JUDX 2IW1A 3G88A 3ND8A 4E4YA 2PL5A 3H1AA 1YZHA 4PYRA 4DQXA 5AI9A 1JAIA 3L79A 3R5JA 5SY6A 1G5RA 3OBBA 1RQLA 2Y0EA 3UPTA 2W90A 1ORIA 3AHFA 3W5AA 2ZIXB 2R7NA 4K1LA 4MW1A 4TWIA 1GXSB 1Z88A 4F1WA 2YICA 2D1TA 4BGVA 1WHSB 2AH5A 4A8JC 1XEAA 4ZCIA 4FXOA 3CJRA 1WU7A 2R00A 5I51A 1EVYA 1NXTA 2PQMA 3TZCA 4IDEA 4KR6A 1W5SA 4MPPA 4WLVA 5H83A 4RKWA 5H59A 2C83A 1SPXA 3DT9A 1XHEA 2WB2A 4I3GA 1U2TA 3EZGA 5EYPA 3TRDA 4S05A 5LJIA 4BWFB 3ETLA 1SXPA 2HK6A 4NBRA 3DB1A 4PAGA 1RC8A 2J7KA 3KXKA 4KWEA 1SCKA 3ABSB 4ZTZB 2FQ1A 2YIDA 4IJWA 3KUDA 3GLVA 4MVXA 3VR5A 3FVWA 3DZIA 5H0IA 3T9CA 2FI1A 3A0UA 4WZAB 2O8FA 1O2DA 4BTVA 2QJOA 2RGXA 5AK3A 2OVBA 1Z8HA 5AK5A 1XMQB 1L4KA 4YDHB 3DDSA 4D81A 1GOTA 1TUGA 1XRSB 2FZ4A 1RWWA 4WBNF 4A03A 1O9BA 4TYYA 5AOCA 1XG5A 3ZCPA 4OXRA 1UKEA 3W1VA 1XZBA 3B9BA 1AG9A 2ZB4A 3HP7A 5DX0A 1MRNA 3VSCA 5D6NA 3AIKA 3PNOA 3QJYA 4DIKA 2J87A 3K4PA 1W30A 1F1BA 3FYTA 3ANMA 2PH7A 1M10A 3C43A 3QKSB 3MLEA 2FZWA 5CT8A 5ERXA 1BXKA 3ZOZA 4DPKA 4U00A 1E9DA 2AKYA 1UJMA 4UNNA 1LI4A 4XDYA 4ZCPA 4I4CA 4KKXB 1DRUA 3V6MA 2C04A 2FR1A 3CX6A 3H99A 1L7QA 4LRXA 4OGFA 3CVYA 5EUCA 1TEZA 1O95A 2OY0A 3C97A 3GJ8A 4ALJA 4H0CA 1H1LA 1W0JD 1C9DB 1KK2A 1QS0B 3R6TA 4H6PA 1W75A 4Y9UA 4GMKA 2HRRA 2Y05A 4JXXA 1O8BA 2OCKA 4AP9A 3Q8MA 2YZGA 4MAAA 4P9NA 1G64A 2FOLA 4Q4JA 2Y1CA 3A58B 2PPLA 1GGHA 1H66A 1JT2A 1PVDA 4GWGA 1HUQA 4B3FX 4RDHA 3D8HA 1T4CA 2OD9A 4WKNA 3BH7A 2AK3A 2QT0A 3LUKA 3ESRA 4D9FA 1SHUX 1TAUA 3JQCA 2JAUA 2O8FB 2VVTA 2FMKA 1XTVA 3T1NA 2JK0A 1PGJA 4ZCLA 3VR4A 5FNVA 3RDPA 4AY3A 5C3UA 5J43A 1N9GB 5JNLA 5C52B 3ZJUA 1OXKB 4TS9A 3URMA 3GVCA 5BNFA 3HCCA 2WKSA 1USUA 1NSYA 2CN1A 4OBEA 4FZ3A 1NYTA 4RIEA 1P6XA 4Q21A 2EZUA 1H2EA 1SBZA 2J5BA 5C4GB 2HSEA 3I6YA 4IFEA 3VYRB 5EJ5A 4MPJA 1CS0B 4IJKA 2WJ3A 4K9RA 2RH5A 3BE4A 4BVAA 1Q0QA 1LWOA 5JMWA 1EEXB 1A4UA 3JVDA 3BICA 4V0NA 1FX0A 2OR3A 3DOJA 2QV0A 4K6GA 2B2XA 5F1PA 4PRLA 3IP8A 3C4VA 2EDCA 4G86A 3HFJA 5JCJA 3A6KA 1ODSA 2Q50A 4OQNA 3MM4A 5HJ7A 1NUPA 3IT2A 4Q0MA 3WAJA 4YJHA 5JNSA 2I2WA 4BCBA 4EKDA 1PJ2A 4Y1RB 1TK2A 3G1UA 1A9OA 1NNSA 1TDJA 2X1VA 5DGDA 1DWQA 4XWYA 5TXGA 4DLZA 4I1IA 2R8BA 4ZYXA 2ZRFA 1WUTA 5ERYA 5JMPA 5IM4F 1O9GA 3E9YA 5AKGA 5TT0A 1V6AA 2V4MA 2CNDA 2WBLC 4LVOA 1O94A 4G9BA 1ZC3A 4YRLA 5J2TF 1PNQA 1NUHA 2O1EA 3OECA 1FRQA 3ZH9B 4D3YA 4ESOA 1O08A 5D01A 5JD6A 1U9YA 1DOAA 3L6BA 1TYCA 4DLBA 3ADOA 3GEHA 4OK6A 4L4RA 3JYPA 3IMFA 1MIHA 2WJHA 4ZJPA 4UW9A 3R5HA 2UYHA 3PNQA 1G1MA 3HR8A 1DDIA 4Z3OA 3WIUA 2XWPA 1JAHA 3QOWA 4Y3UA 4QGHA 2BKLA 7MDHA 5JARA 2EWMA 1TJPB 1GCOA 1J0EA 3OOWA 2BEWB 1FU7A 3Q3IA 4YDRA 3RIMA 1NV8A 3C6XA 3A3OA 4IF6A 3MWDA 3QF7A 2AC4A 2IX9A 3HSKA 1V1MB 3CCBA 3NHYA 4UCXA 4G0VA 4QODA 1KJQA 3V1MA 1QIFA 3I9MA 4EK9A 1YJQA 5A3QA 3FFWA 3R0XA 1EVIA 1T0BA 1Q77A 4NDAA 3OZSA 1Y3AA 5EWMB 3WBBA 4M8SA 4F3NA 4GDFA 4JVSB 4LF4B 3EIEA 4EHHA 5IVKA 4CTNA 1WX1A 3AZPA 5TMPA 3S8YA 1QP7A 5J1TB 6CHYA 3EEFA 1N75A 3L07A 4Z6KA 4TQAA 3KJEA 1XRRA 1Q7GA 2QZ9A 5TQ0A 4Y8VA 3UUGA 3ZGVA 2X4DA 1RIIA 1OQAA 3A1TA 3Q40A 2R2GA 3ZD6A 3WHPA 4FVTA 4MUIA 2YHAA 4N9WA 2OB1A 2HIGA 5ICCA 5CFMA 2XR1A 1OH5A 1G20A 1P0MA 3NHRA 2I9PA 3LOPA 2AS0A 1BFDA 1FFSA 3SZ3A 2DBRA 2GQ0A 3EVFA 2VBGA 3R4VA 2N42A 2V0NA 3R20A 1I2AA 1HXHA 2AN4A 4IHKA 5AVXA 4MS1B 4HWGA 4BJHB 5DWDA 1Z0ZA 4P4TA 3X1DA 3H3FA 1C1DA 1KZ9A 4HXEB 3SF8B 2X5XA 3E53A 3ICPA 5CG2A 1NQTA 4BO5A 1E2UA 3GA0A 2DPXA 4LSWA 1GPYA 5C2JB 1MG0A 5EXEA 1GPBA 2EQ5A 1E9BA 2IT1A 2Q46A 5FOWA 4N47A 2WWWA 2QUKA 4X84A 3W5HA 2HHCA 2RK6A 4JYCA 1I5EA 2ID4A 2CDAA 3W9BA 1PK7A 3P1JA 4JKIA 4MIKA 4IJ6A 2VAMA 3FUVA 1Z4JA 5FBKA 4EHJA 3HJBA 3UB3A 1CUXA 1IN6A 1NONA 5TQ0B 5TDHA 1PUJA 1G55A 2VP0A 2YW9A 4MRPA 1XYVA 2IYTA 3N2NA 4FNMA 3OIDA 5ALNA 4N48A 4Y2UA 1I4EB 1N5OX 2YHBA 3ZHTA 1PX2A 1E0SA 1P2DA 2Z2IA 1P2FA 5HKKD 3KYDA 1NU6A 2XNKA 3B1KA 1FFYA 1ISRA 4R1NA 3RKSA 3FKSD 1JILA 2IE0A 2O5EA 5ANRB 4PS1A 5JJLA 4ITRC 4TLDA 1RRFA 1S2OA 5FHRA 2W2KA 5I5GA 4EHAA 2B99A 2YV1A 2TMGA 3ZZTA 5JHGB 5C8DA 2HZ7A 1ZXBA 3K5HA 4UUOA 1YFJA 1H94A 1N25A 1OYVA 3MS4A 3A1UA 3PVZA 5FLYA 3OWXA 4RV5A 1QWSA 4LDPA 5DDIP 5ADWA 1ZMTA 4L7QA 3BGDA 3OX4A 2CNOA 2A57A 1O0BA 2XRFA 3OWHA 1HBJA 3M1YA 1Y3IA 2GILA 3R3ZA 3C7TA 4ENUA 1IOZA 1YJ8A 4MUGA 3HCOA 2VHCA 4ZN6A 2QRMA 4FGSA 3TKAA 1E5XA 2YRXA 5CLQA 4BO3A 4D6XA 1SR8A 1UFRA 1LVUA 2XYQA 1MCZA 2YWXA 2OZLA 1YZVA 1VKHA 2DLNA 4KDCA 2PWAA 4RJTA 1T9AA 1RCFA 4FFBB 4TXHA 2ORVA 3ENZA 2ZBDA 1NQAO 3MTGA 4JR0A 2NZWA 2G08A 1VRWA 2V6FA 2RCYA 4ZRDA 1SQSA 1NBAA 1QK5A 3CSSA 4E2ZA 1EGMB 2YVQA 4LHWA 2JGFA 1UXJA 1VSVA 1X7XA 5K0CA 1IOLA 2ZDQA 4XH9B 3K9WA 3HEMA 3VU1A 2QBYA 1UBTS 4QREA 1UMBB 1AS2A 3PQFA 1H4SA 1UF9A 2QYOA 2JGKA 2RDMA 1JHXA 1XCJA 1I9CA 3ACCA 1OJ7A 1EUDA 1T6NA 5B2FA 2WD8A 4J1TA 4EPVA 2BKEA 2EX4A 3TSWA 3U7RA 3OZFA 1GL6A 1ZK0A 3LUDA 4XCXA 3NT5A 1JFVA 2GZMA 4ZK2A 4CTJA 3EEIA 4Z1OA 4H60A 3UKJA 4O2BA 4JZYA 3RHZA 3FLEA 5BV8A 2I03A 3VJMA 4Z9XA 2PS1A 4B6QA 1VLZA 5B1IA 1T4DA 4DTIA 4YYEA 1JPVA 2UZ3A 3DAYA 4R2LA 5IU6A 3E6AA 1RU3A 2H9AA 2PX4A 5LA6B 4GP9A 5J9FA 1JQLB 3MTDA 5DASA 5JADA 2YV2A 4NFYA 4ZC8A 4WN9B 1SUAA 4F91B 1EIWA 3EIFA 4K28A 1EFAA 3SEZA 5EIBD 3S2FA 4US1R 3U2QA 2HMUA 1CFZA 3AFGA 1KAEA 3K1ZA 5M34A 1H4QA 4GUAA 4COKA 2O0JA 3PCRB 4PFSA 1E3WA 2E4WA 2Q3DA 2R6AA 3T52A 4B4UA 4BLSA 3UJPA 2N3ZA 4YAJA 1R12A 1JHYA 1GA1A 1X7WA 4D3DA 2A0XA 2C98A 3NDJA 2IBTA 4CG3A 1E59A 1XZEA 2W71A 3BCSA 1Z2OX 4OU5A 2E87A 2VZLA 4L8YA 1XLTA 3D8BA 2PLAA 3OE4A 2BJHA 4EJ2A 1FTYA 5JDIC 5CGQB 2A7QA 3GRPA 3FPAA 2ZM6B 1Y1KE 2BFPA 1ODFA 2BHTA 2QZZA 1K27A 3HZHA 4PHGA 2NZVG 3KHSA 2R65A 5SYAA 4NFLA 4OP2A 3RV4A 5ES3A 4MPRA 4ZMSA 1JH8A 3ZDAA 1J0AA 1P45A 3UMRA 2ZYVX 4KX3A 2JPDA 2DQYA 3GP5A 5EJ8A 4LCJA 1QTIA 4RFLA 1MH1A 1OBFO 1N9KA 3EWNA 3IIMA 4FIZA 4KPUA 3FETA 5HIAA 5AMXA 2J5RA 2I4TA 1F2UA 1JLMA 3H5VA 2Y71A 1E2FA 3NDIA 4GI5A 4YPVA 1KIFA 4NX2A 5BQ5A 1CQJA 3OKFA 4UNSA 1BX1A 4XWAA 5JSQA 4HATA 1Q20A 3B7WA 1W1UA 4DCOA 1IY0A 1BROA 3KX2A 1YA6A 1E3WB 1KVTA 1DRJA 2BMFA 3NUQA 1CHNA 4AM8A 4G26A 4C4OA 5D3KA 4GOOD 4YXWA 1NVDA 3V80A 1TRKA 2AL7A 2W6ZA 2HCRA 1O87A 4JUFA 3NAZA 3Q12A 2VK1A 3AZOA 4R41A 5GZ3A 4ND5A 4BZQA 5LQMA 4Q1EA 2BHNA 1FU8A 2J7PD 3EPPA 4EHDA 4GQIA 4GZMA 2R1VA 3AXSA 5KJCA 3GVXA 4NNPA 4JNCA 1UFKA 3COVA 1WA5A 3BXEA 4NXNB 5CX1A 1B8NA 1WR8A 2RFLA 4HZUA 5CB4F 3K09C 4XDZA 1NVTA 5FTLA 4G5YA 3IDFA 4CMAA 3OCJA 3A3PA 1E94E 4JYBA 3A7EA 1R6VA 3DOHA 2NTYC 2O8DA 2EGHA 1CWUA 3VPBA 5FJIA 4DEVA 1JDSA 3UWKA 1OZ0A 2FN9A 1FDRA 4X97A 3U7QA 4KPUB 1HYQA 4AN4A 1UP7A 1N6OA 4NCXA 4AZ0A 1AS0A 4AZVA 4DANA 3T5TA 4FOLA 1QYRA 5JAOA 2XCIA 3O74A 1ONOA 3OZUA 4BVKA 3EG5A 1S4MA 2H1SA 1CV2A 5THXA 3C8UA 3VR5H 2HA5A 2WHYA 5C5EA 1LDGA 4RK5A 5AD1A 1THZA 3ESDA 5I7AA 5A4AA 4BV8A 1T3ZA 1TQ6A 2ODTX 2WTXA 4OM8A 4PGGA 1D9ZA 1OTXA 2OD7A 3LKZA 5AHXA 4CKYA 4DYHA 1P9RA 4N6NA 1ZNWA 3ES9A 3OZBA 4OHWA 3A4NA 4BQEA 3G7UA 4B46A 2OLKA 1PG2A 4H4DA 4X6UA 1CUSA 1Z74A 3T9EA 3W34A 4WBNA 1ZR2A 1KFKB 3STXA 4C43A 1PZGA 4QC2A 5KBYA 1G9XA 1E9CA 3F90A 2UKDA 4A6XA 1B8OA 4FPXA 4HUJA 5LC1A 5B4UA 4N3AA 5KU1A 3DWFA 3JWGA 1ZD8A 4F5YA 3N3BC 2OC9A 4G1BA 1XHFA 4R2MA 5BW5A 2R9VA 1Y7LA 1GAXA 1QNFA 1M2JA 1YRHA 2BL4A 4M21A 5BXQC 4GOXA 2O8DB 3KUUA 3PEYA 3AVVA 3NHFA 3O8QB 4BJ1A 1JIXA 3KPJA 3OPMA 4EPRA 4ZI5A 4COOA 1PJLA 5BR8B 4Y2HA 3TUZC 2G8LA 4P3NA 4FJ1A 5LFAA 3TL6A 3DL7A 3ZGXA 3WVNA 1BQEA 3IKTA 1K5DA 2RIRA 1H9BA 2P1DA 4R9NA 2WZDA 2R96A 4Z3DA 5JATA 1KI7A 2JJ1A 1V4NA 1Z6XA 5CUQA 5JIBA 4TUYF 1TVMA 3CUTA 3KKMA 1H93A 4HFRA 4RD2A 3A31A 3WGQA 4WRRA 1MOPA 3GCZA 1CUUA 1MJFA 3BWBA 4XGRA 5D86A 2Q29A 1YKFA 5DYTA 5HG0A 9LDTA 1YGPA 5EXTA 4B3XA 1W93A 4MQFA 3KLPX 1H85A 4MDFA 4FN5A 1NVVR 3SVLA 1V6SA 3I61A 1AMNA 2EAUA 1P18A 1E2NA 4WBXC 3TZBA 2WVHA 1POWA 3ZWQA 1BYIA 3PDJA 1C0LA 4MK4A 1BX0A 3AVYA 3O92A 3PC2A 3OSUA 5EIOA 1Q1AA 4OSEA 3IPCA 3WWCA 1YQTA 3LRXA 3R0QA 5CHYA 1W8DA 1R8XA 2YQ4A 1ZD4A 2DWOA 4UQPA 4R3NA 3RGWS 1LVGA 1SQ5A 3U0VA 1W7AA 3ZCRA 3BILA 2UV8A 4RDIA 3GMIA 1QIMA 2WPDA 3UIEA 1A77A 4U7WA 1NRIA 1XYYA 3PKIA 4W8GA 1TIPA 2NOAA 3DZHA 3FOBA 4ANFA 4LZZA 1UIMA 3I04M 3UEOA 3MUNA 2I1WA 3ZXYA 3KVYA 3GI1A 3VAYA 4KFUA 2W2LD 4EUSA 3TE7A 4B5LA 3FLMA 1EFRA 3HB5X 5AJZA 3AEQA 2GKGA 1VKRA 3ZUGA 5JBNA 4RETA 1JZSA 4WX2B 3ZK7A 3E70C 3QWIA 4ARSA 4QG3A 4O4JA 4MQFB 2HLPA 1UJ4A 3WLKX 1XDDA 1ONSA 2WAAA 3C3WA 4LOHA 1ZH8A 4RSMA 5DB4A 2XMQA 1QFJA 4C30A 2IE8A 1TLFA 1H8EA 4NBVA 3MILA 4ZDWA 1W36D 3WK4A 2J9RA 1RPZA 2ZWMA 1HZZA 5K3DA 3LPDA 3LPCA 1H0SA 1OX4A 3O4VA 2IV3A 3K9CA 3VTKA 3CRVA 1YZ3A 3BJZA 3JARB 5I9BA 2G67A 3ND5A 4K03A 1MX1A 2WT4A 1GZ7A 1ZG3A 2YDYA 4S1WA 4X9XA 4Y6GB 1A98A 3C8HA 1DQRA 4BB9A 5BVGA 3JX9A 3MBOA 2BGGA 4BE4A 3UGJA 1G5HA 4L8LA 3GDOA 4LHXA 1U2ZA 4UM9B 3FGOA 4DYDA 3ON5A 5LL6P 1PFQA 2JH8A 1OA1A 2CZGA 4BX9A 4YV1A 4CL2A 4KVZA 3PS9A 4L5CA 1XEXA 4U5QA 2AW5A 1I36A 1V37A 2MSNA 4G0ZA 2B61A 5DRYA 4A15A 2IDKA 3TW6A 3BGIA 4O4HF 3H2BA 3TO5A 1TU4A 2JG3A 3UFXA 1UBJS 1YE5A 2GJAA 3UOAB 2Y27A 3PC8A 5E1DA 3U3KA 4EYEA 3DHNA 4O4JB 1V5IA 5E7JA 2YZ2A 1OXSC 1D6SA 1U98A 2PWYA 2PQ6A 1XZFA 4XX1A 1DIBA 4CF7A 2X9LA 2B5OA 2VOEA 2FW6A 3QVUA 5CYFA 3ONDA 1XIVA 4ARVA 2FWIA 2OYSA 4RFVA 1OX4B 2R79A 4HB3A 4CHTA 1V4VA 1IOWA 821PA 3OT1A 3EW7A 1CF2O 3PSHA 1OWLA 3U4GA 4C2AA 3DUFA 2OVFA 3A6PC 2AN5A 3HLKA 4QJIA 3FNRA 4C9BA 1KH2A 1LBTA 4INAA 3WQSB 1J9GA 1KQ3A 4DA7A 5U9CA 1E3MA 1E3JA 1L7PA 5G2OA 4KMSA 3I76A 4G56A 4FEEA 3UO8B 1KNQA 2HMYB 2WPNA 3ND9A 3BKWA 1FNSA 4FT2A 4MRRA 4C3ZA 1C1XA 2M9MA 1XEXB 1VLVA 2CJXA 2YIMA 3R24A 3RFCA 1SOMA 3CVUA 3NBQA 2OILA 3OM1A 3WLPA 1KEVA 4FYKA 4EITA 5ABPA 2Z2YA 5IJZA 3KCNA 4UOQA 1ELOA 1JDTA 3TFQA 4ZAGA 1Z8FA 1MNAA 3GW8A 3V1KA 4A10A 2NO4A 4RYDA 5K51A 3N2GA 5IKOA 2WC1A 3W6UA 3JQ7B 4MP6A 1SC6A 2PXHA 2WFMA 2ZJ5A 3ED1A 5L7WA 4QTUB 1ZVJA 4EVSA 1KFEB 1X42A 3D3WB 2AB0A 4L6CA 1Q7BA 4JLVA 2AE2A 2REQA 1DGQA 3GNQA 2Q0SA 4B3TB 2XOKD 4C2UA 4TSFA 1B73A 2XCRB 3TJRA 4RY0A 3MS2A 2C8KA 3D4NA 2QXTA 3DZFA 3OT1B 5BQXA 4E3WA 1T5LA 3EXEB 4K8OA 5ITZB 1YF3A 4ETNA 5L3ZA 2G07A 1QHYA 2J45A 4CNQA 3EWIA 2CMFA 4IW3B 4QUEA 2FQYA 2PZJA 5PGMA 1I7SB 3IXLA 3K8QA 2RBEA 3RIXA 2CXOA 3R5XA 2VUUA 1D0SA 2BHRA 2CFTA 3VV3A 4MKHA 2IV2X 1SVSA 1RBQA 2IBMA 3UW3A 1RM3A 4U2EA 1XJQA 2GHTA 1UXGA 2C4UA 1W2WB 3DNPA 4L8GA 1O77A 3ZGYA 4S1TA 2ILVA 2X0FA 4PWZA 1A4RA 2F17A 2HHLA 2FRVA 3OCCA 4OJMX 5ALFA 3O83A 1T5DX 2A9KA 2H2GA 3WA7A 4GL2A 3RPEA 2GEFA 5A2GA 3QG1A 5G02A 1VP3A 3JU3A 3BMNB 3PKZA 4OFXA 4YJFB 2GBFA 3BEDA 1LWNA 3RUPA 1FYWA 1Z36A 4R40A 3VPSA 2JDID 1GN8A 1YUNA 3N8IA 2QD2A 3GRAA 2YYSA 2VDUE 4JMPA 3IT0A 4TKUB 4EL5A 4HK4A 5AXDA 4QBFA 4C21A 2OZEA 3SS9X 2REQB 4R7ZA 5F2NA 3V4LA 2AFHA 3DMDA 2WUEA 2O48X 2RHDA 2R1TA 4RWZA 1JFLA 1ZWLA 3QYPA 4S35A 1T5OA 3CH5A 1YRQA 2B8NA 5THKA 1WBJB 2VP4A 1JHDA 2GNPA 2QRPA 3DBRA 4HRXA 4KEAA 4B4DA 4EB6A 3CRQA 3RT1A 2XB4A 1K7SN 4RPJA 4CV0A 4JI4B 5EMNA 2WSSA 4MV0A 2XGOA 1JVSA 1W4RA 4GVLA 4PNPA 4Q3OA 3K5PA 5DW0A 3DVAB 1UBMS 2CZCA 3L7BA 5TMBA 3PDCA 4L95C 2P30A 4RM2A 4FI3F 3AKZA 2G80A 5LP6F 3T3PB 4UHDA 4BU1A 3QHQA 4RZQA 4CCYB 1A2KC 3ZWXA 2E1RA 2R00C 4RH0A 2E5WA 1GNTA 2ODWA 1WEHA 2AVNA 4FZ5A 1OT3A 3L8HA 3A6ZA 4IGFA 5EJ4A 2E48A 2GUGA 1O4VA 3F7MA 1T6XA 3NGMA 1OI2A 4JBIA 3Q7RA 4H6WA 4ERXA 3OE5A 4G1EB 4OSOA 4P4SA 3P96A 5EKUA 4XIGS 3SU8A 1PFVA 4KSYA 2I91A 4IILA 2BKAA 2L42A 4ZJUA 2B8EA 3RW9A 4XWWA 1FDSA 2WF7A 3HB7A 3T3HA 4G2NA 1FW8A 3OZCA 4I8XA 1RI4A 4B3GA 5CA1B 3EZ7A 2PH1A 4AZ3A 2Y1EA 3JQ8B 4MYSA 2GF0A 4BO8A 1VKOA 4HNAA 3DBRB 2P9EA 1H6AA 2P78A 1CBUA 1UP6A 4G1VA 1K3FA 2IVZA 3KKPA 4RKYA 5DMXA 2OLEA 2YXNA 3VH1A 2QMOA 3A4TA 3FTNA 1KYWA 4KN8A 5ICMA 1DKMA 1KERA 1J4AA 4UMEA 3U3RA 5FAXA 3HQ4O 3V00A 2XSZD 1RXIA 1DJOA 2C9BA 5LIRA 1U3WA 2P5YA 3BQNB 1PKEA 5CK4A 1GSAA 4MI1A 1EEHA 1SCJA 1F9EA 5K3FB 4KQ1A 2ZQYA 1OXVA 4JP5A 1O95C 3ANXA 4TOIA 5FFMA 4R3WA 4URVR 1FTNA 2ADFA 3FWHA 3QMPA 1NVMB 2B8WA 1ZOSA 3O73A 1HQKA 1SA0B 2ZIFA 4W8HA 2H4WA 1Y1SA 3ETDA 1R5NA 1YH3A 3LUFA 2QUHA 3L0BA 4QLOA 4MUEA 5LN1A 1V0JA 3DBIA 3QITA 2OCLA 2XF8A 4KSBA 4L4SA 4HN9A 2YH2A 4BC1A 4M37A 2H0RA 3FJ1A 2MYPA 1NXOA 1M2NA 3RUEA 1E1QA 2JIOA 4JQOA 1Z18A 2Z1NA 3D5TA 4REMA 1NBEA 1I1NA 3NC1C 4EPYA 4EEZA 2P2LA 2V0GA 4JIMA 4KIWA 3WFJA 1Q7TA 2WQZA 2Y0BA 2B4YA 2VDPB 3N6XA 3BMQA 4O0LA 1PGOA 4CTKA 3GEEA 1QR2A 3ONFA 4ZAWA 1PZMA 1I2ZA 2P9FA 3OU7A 5DEOA 3PYLA 4U0JA 1XCLA 3F67A 4FBMA 1N6PA 2X3YA 3AJRA 1P77A 1UMDA 4LRSB 1XF1A 2WJ4A 4NK4A 1TUBA 3GXOA 1XRMA 3NNNA 1P39A 3O4GA 3G79A 2EGGA 3TSCA 1QSGA 1M0EA 3PFBA 3N8HA 5B12A 2ONYA 1ZA2A 2WG1A 4MRMA 5JV5A 2MR6A 2A0YA 2VDLB 2W42A 4GX5A 4OQPA 3UGKA 3C0KA 2ZGVA 2QYSA 1VI5A 5AW5A 3D6VA 2K87A 3NVKI 4K9NA 2IEDA 1FLDA 1F7UA 3DOOA 3NP9A 3TDNA 2BCJQ 1E69A 4HVAA 4J2OA 1ZM9A 5IX8A 5IDQA 2FPPA 5FWYB 1IXYA 1O94C 2J5XA 1TC2A 2ZAGA 2R68A 1HNXB 3HZOA 4TRMA 5NLLA 3RC3A 5KCMA 4YPOA 3E5MA 1WW2A 4LPKA 2V45A 2RAFA 3OVMA 4WIAA 4B1FA 2LNDA 4EGCB 5BSFA 5IXJA 3T9BA 1QHHB 4JB3A 4CM7A 2J3HA 3LG2A 2V7XA 1J0CA 1FQJA 1M54A 3AHIA 3GCWA 4OU4A 2Q2QA 1FMJA 1Y6QA 1YFZA 4UM7A 5BPHA 2P11A 3EJ6A 3LUPA 3MAJA 3P4YA 4LRWA 4PIMA 2HQ1A 4GPZA 3EK2A 4D2IA 5DLYA 4B80A 4IGIA 1OX6A 2G4CA 2OV6A 3L6UA 4LJRA 4DZTA 1JPJA 1XAGA 2AMFA 2JS7A 4KCGA 3T9AA 3COPA 3H5LA 3NPAA 5LKAA 3R3YA 4LKRA 4X90A 4ARBA 1RXWA 5DT9A 1E64A 1JQ5A 1DEXA 1MIOA 2ACVA 1X7DA 2JGAA 2Z6VA 3NM5A 2FZ5A 3AK4A 3HBLA 4TUYA 2X9NA 1P2BA 5CYGA 1JAZA 1XRNA 3S2EA 4MICA 1IZ8A 1YIOA 4ND2A 1QPGA 4MUXA 4QWWA 5HWSA 4MYHA 3N39C 4FFMA 5IZCC 1BMFA 1NJ5A 2CVPA 3S81A 1JYEA 2JARA 4JDPA 3GA7A 2X2OA 4EIWA 1AZLA 1G6OA 1V5GA 4YI3A 3TVTA 2H1VA 1HLGA 4IGEA 4U3JA 2HR1A 1QF7A 2AYYA 4DQ0A 2NNWB 3LVQE 3N8NA 4MYRA 1H2ZA 4RK6A 4RLSA 2B2CA 2JLRA 5CFPA 2JJMA 4EYOA 4IDAA 2O8EB 3FG9A 1Y81A 3LC2O 4Z86A 4DJJA 4LE1A 5AKIA 1E2BA 2VPYA 4LQCA 4Q4AB 5H5JA 4HLUA 4RQTA 2QSYA 3IAM1 4TV9B 4IH4A 3W5VA 1XRLA 2B7LA 1XNJA 4Q24A 4Q9KA 4MH0R 3U3ZA 2IA5A 1P4GA 3BXHA 3QKRB 3TKYA 2OPBA 4I5FA 3VSEA 2YRWA 5FAKA 2JDIA 1NR1A 1S1MA 5AW9A 3ROQA 3PF9A 1U3VA 1PNRA 2M6LA 3T61A 3GLSA 2CBXA 4MHTA 3VKVA 1CUJA 2HCTA 5F3DA 2WD9A 4WBSA 5DF1A 4B8YA 5ALWA 2BDTA 3QUCA 1JSCA 3PQCA 4IZHA 4PCLA 4R1QA 1Y4AE 1YVRA 3RVSA 4QUGA 4DLKA 4RMIA 2IF0A 3JQPA 2WJ6A 4GMHA 4AUNA 3N2KB 2BF4A 3BD9A 1C9KA 4R0MA 4PPQA 1XVTA 2ZBVA 3VSDA 4B0OA 1FXSA 2NO1A 3KQLA 4EA9A 1E1NA 3PJEA 3SQNA 4OHYA 2IF2A 3H84A 1TF7A 1SC4A 1U3FA 1U3GA 3JATB 4ATNA 1LFAA 3RI3A 1SOWA 4BYMA 4F86A 1SVUA 1KI1A 2J1LA 4BMDA 2BE9A 2WSBA 1NIPA 1ZJYA 4WA8A 5HUHA 3KZOA 4M83A 5IDXA 4FM9A 1IBMB 1IMJA 4TL8A 4BFYA 1ILEA 1J8FA 4IQFA 3RK0A 3TJZA 2DX7A 2UZ4A 3G82C 1C8BA 4Q7JB 5DHTA 3USCS 3UTDA 1VLJA 1K3UB 1S8AA 1PSDA 2C0PA 2HBRA 4PC1A 3S2YA 4C88A 4LBWA 1KO7A 3RCBA 3GNTA 1DKPA 1JEAA 1QUEA 2XDQA 2RAVA 3AI1A 3COSA 3GGPA 4O4LF 4H59A 4YRMA 2WE7A 2JLYA 3QYAA 2GX6A 4DCCA 3D2AA 4YQEA 1H6DA 3OOSA 1Z82A 2A5GA 4I55B 1YZLA 1EUZA 4BKRA 4K46A 1RC0A 4JLPA 3QUQA 4OM7A 3CLKA 4HDQB 3VVLA 1GILA 1IBCA 4IOMA 4O4HA 2VT3A 4XQ0A 4JL6A 2DY1A 4G85A 4KH0A 4EI2A 1OASA 3A6DA 4G8JA 4H4CA 3TLGB 3ROEA 5HYVA 1OZAA 5IAOA 3OF5A 5J4LA 5FQNA 2PUTA 4OB6A 1ISJA 1WQ1R 4DXDA 1H5QA 1CP3A 2P1ZA 1C14A 1I3LA 2WM8A 5AESA 5M5BA 2OK8A 4A36A 4E1AA 5EWJA 3U37A 2BFEA 5B1YA 2HT1A 521PA 1RRKA 2P5TB 3TLBA 5DHRA 2F3TA 4JJEA 1M5UA 2PFGA 4R1TA 2BUCA 1WULS 1NXSA 3AC0A 1ZH0A 4POAA 1U11A 4B6RA 4HLCA 2ZT8A 2ZEJA 1RQ2A 1SMKA 2PNFA 6NULA 2XDQB 5J4KA 5DBEX 2FP4B 2H1WA 3HL4A 1UDWA 1KJYA 1VE5A 2AMLA 3IAFA 4GF5A 4J1TC 1ZDMA 2ZBEA 3FI0A 4MWCA 2J5QA 1YI0A 3OJFA 1Y7TA 1QDUA 1NRXA 5CW1A 4Z7OB 1T8YA 1WVIA 4IUYA 5EIAA 3ZNOA 4ZHQB 3FMGA 1GTMA 3AJ8A 3QE3A 4JC0A 4CFZA 2QVYX 5KTPA 1VFNA 3MEQA 2BF7A 4GGPA 3I3OA 3NORA 1S2GA 1E5LA 4L51A 2ZDHA 5JJBA 1DFHA 4D9NA 4AS2A 1NN3A 4B84A 5E7QA 1RCUA 5AXBA 3I1YA 3N05A 1V39A 4EF6A 2Q0QA 1XJWA 1AKTA 1DBRA 3LHDA 1JHMA 4R5MA 5CITA 2IPOA 2W5UA 3DF9A 1S3SA 1LQTA 1LW6E 1XC7A 2GTPA 4LBVA 4TRJA 3SC2A 2WEKA 5FV4A 3EEOA 4J4TA 4M2LA 4XVQA 1F12A 2QJWA 4Y6QA 3UKDA 5JO9A 1G21B 1OFVA 2EFCB 1F6BA 2N9UA 4X20B 5I9MA 1KJ9A 2OA0A 3VA7A 1IDOA 4BFSA 5KTYA 1YS4A 3VXKA 2K2WA 2Z4SA 3THYA 2WM3A 5DHAA 3JAWA 1FDWA 4MARA 4NMWA 5K99A 1Z26A 2RK3A 1XLTC 1NJSA 2W6OA 1IZ0A 5HDQA 3BAZA 4HWOA 2VZ0A 1NT2A 4X93A 2ARKA 5EZYB 2FZKA 4HEJA 2JZNA 4WAUA 4B7ZA 3EVZA 2BHSA 3DOUA 4B85A 4HDOB 1MAUA 1O03A 2O3JA 1VE9A 2NVBA 2OV4A 2Q7OE 1IEVA 1MLDA 1FDOA 5JCZA 2QN3A 3F3MA 1V2GA 4ZIRA 1U1FA 2VRNA 3O7MA 1VCIA 4OD0A 2EKLA 2A30A 3P2MA 4GICA 4ODIA 5BR1A 1XDBA 3PJDA 5IKXA 2PUCA 1YFLA 3LCJA 3NYRA 2QLFA 1CUFA 4FEYA 2IDZA 3RS8A 4ZCRA 1OC2A 1YL7A 1X8KA 1WXQA 4NYMR 1WHTB 4ZEXA 1MX9A 3SFVA 3WGOA 3HA5A 3QI2A 4EELA 1XKTA 1N7HA 2DWPA 3PI7A 3SC2B 4RENA 5HRAA 3EBOA 1Y8RA 3MSXA 5D85A 4CKWB 3LIPA 3U61B 3L2OB 1Z15A 2ZYHA 3CXUA 1Y4SA 3L0PA 3VO1A 3M2TA 4W5TA 5JAZA 5GJBA 2QTAA 1E0AA 4RW0A 1DX4A 5LYJF 2I2BA 1Z2AA 4O1MA 1U2GA 1A7KA 5WRFA 3PEWA 5EJAA 2XZTA 1F5SA 1W4ZA 2JCBA 4RHFA 1AOXA 2AE1A 5A7HA 4DEXA 1SCBA 5LP6A 2B4QA 3L8EA 5ALHA 3FDFA 2IYLD 1QP0A 1JTVA 3HUDA 2OHFA 4UTZA 4UTXA 4E5PA 3L7JA 1FNDA 2ZS9A 3AOEA 4E5MA 2ZUTA 2B1GA 4PPYA 3ZHOA 5I5EA 1NNEA 4QU5A 1IHDA 1SN7A 2CCKA 1BXGB 1EVZA 3NTUA 4LNUA 3SJBA 2D0IA 1HEYA 4ND3A 4O63O 4MVCA 3UXMA 2P9GA 3RH0A 1IDN1 4WLFA 4K9QA 3TMAA 2VZ9A 3BL5A 4CE6A 2JAOA 2NVUA 4NYIR 1DARA 3GFPA 4D4KA 4NQZA 5I4CA 3JCZA 4DQLA 2QJRA 1VHWA 3QPWA 4Q6BA 3NIWA 4N0MA 3DLAA 5H02A 5AW8A 3FSEA 4WNIA 3GHYA 1Y8RB 4KTVE 4OLAA 1B0AA 3R3JA 4R68A 1YMUA 3L0OA 1VL5A 3WKDA 5JD3A 1LCIA 2IHJA 3BK2A 4HKTA 4E7OA 2W93A 3I73A 5TQ2A 4E5KA 2PN1A 2WWRA 3CKLA 4URYR 3LD9A 1B16A 2VXBA 3OC0A 1JKXA 1Y63A 2OK7A 2P9QA 2Q99A 5ITSA 1MV8A 1OFGA 1E8NA 3HGMA 4GC9A 1LEHA 1QG6A 3WYBA 4ZCQA 3N0WA 1N77A 3TRIA 2VF8A 1Q0TA 2HW8A 2O2DA 2GF2A 3NAGA 2VTBA 5IXYA 3COYA 3H8WA 3AJAA 4J7CA 1VCOA 3IJPA 2PX2A 4Z0NA 3QW2A 3I5YA 1FFCA 2P9JA 2R6CA 3I30X 2K2QB 2CW5A 3A6LA 3DTNA 3E0XA 4GZLA 5E9JA 3UC9A 1Z83A 1W0KD 4YACA 4LJAA 1JE1A 2J3DA 2PSJA 3VU9B 5FOQA 4KU4A 3Q0IA 1Z7EA 3NT2A 3DOIA 1UEIA 4KQKA 4X7MA 4RZXA 2PUDA 4XX0B 2NVUB 1AB5A 2P4QA 4J8PA 1JG4A 4LSMA 1BRTA 4RK4A 1OC4A 1GO2A 1N1EA 1SHZA 3LF2A 1KYYA 2J41A 4KSCA 2XD9A 3H2GA 1X1EA 1VIMA 4G1UC 3AOGA 3E9MA 5U1PA 3AEUA 3TTTA 1RAHA 4N8DA 1IQPA 4N7JA 5CCDA 1G9TA 4GNKA 1O5OA 3ZBQA 5CPBA 4BFTA 1M1YE 1UH5A 2NU7A 1N32B 3I28A 4X3CA 1Q74A 1GZHB 3SIXA 3HH8A 3WBJA 3WWYA 4GSYA 4U5XA 3H9BA 3SOZA 4KPYA 1AZTA 1O6BA 1QR6A 3QNMA 1DXYA 1AGRA 3PRJA 3GFOA 5LMUB 1AJEA 5FOVA 1EX7A 2ZSUA 4M36A 4Q1VA 4QVGA 4URWR 2ZJFA 4UU7A 4ND8B 4IR7A 4XB2A 2O8VA 4D92A 3HZRA 4TVBA 3ZHYA 4DJEC 1P19A 3R7DA 4JEMA 4Q01A 1XDUA 2XUGA 3P32A 1C4OA 3MA0A 3GLFE 1IWBB 3BORA 1CIVA 1DJLA 2VRCD 3FE2A 5LIPA 4NZNA 4W5WA 1ABFA 4D0RA 3I72A 1BH2A 1DKQA 3NDPA 1GSHA 4BV2A 4MI6A 2B35A 1UOQA 2BGLA 3K0CC 1W25A 4RQUA 2ZR0A 3GN2A 3O4HA 1KP9A 2V7QA 1DKNA 4U6SA 5LDDC 2O5CA 1TKRA 1ZK2A 3GFVA 1PQPA 4LXIA 4WEQA 4WKPA 4AUMA 1DE0A 4TQUS 2C84A 3L77A 1EVJA 3KUCA 3QMMA 4B3DA 4OI2A 2Q3JA 2XXJA 1AY0A 4XIJA 4F21A 1KEEB 1KNXA 4IJMA 4A0FA 1EUCA 2NU7B 3IJ5A 2X6TA 4ETIA 5CBPA 2XNSA 4V2IA 5IH7A 1FFBA 2FF5A 3V5NA 5HCNA 1UBHS 3IIIA 4F60A 3HWWA 2FU5C 3CPEA 4Q1FA 4X8HA 5F5NA 2WZCA 1RLTA 3UH0A 3TLAA 1H2YA 3AUTA 1OMOA 1CUEA 4DCUA 5C37A 1JX6A 2ZSDA 2CK3D 4R81A 3GLRA 5BORA 5BRAA 4LZOA 1GRCA 3IVCA 1T4BA 4TMYA 4AWAA 5JPIA 4XAQA 1TPZA 3HB1A 4QUIA 1GSIA 4QTZA 5T41A 1ISHA 4WKCA 1DEOA 4N9QA 1QCDA 1EG7A 4LV6A 1V26A 4TPKA 5CT6A 2NU8B 2HX1A 4NAVA 1A9QA 4RNCA 5CA0A 3R3UA 1N36B 4YHBA 4ZQBA 2FW9A 3RQSA 3Q8LA 1YRWA 1JALA 3FMFA 3RRYA 3TSZA 3C3MA 5GJWC 2WINI 3DKVA 4RMJA 1RAIA 4FLMA 2D74A 1LTHR 2ZYTX 4TVOA 3ZV5A 5I7UA 3A26A 3C1TA 4MA0A 1KAQA 2Y0PA 4G5GA 4AMGA 5LBTA 1EFHA 4MDYA 2YYZA 1NY5A 4GZ3A 1K4MA 2CMGA 2BCGY 3X2FA 3EXHA 3EUFA 2NYUA 3N5CA 2J3EA 4PQGA 5GV7A 3UAYA 3PC8C 3UJCA 4J3JA 4I3HA 1EUCB 1NURA 2HSWA 6YASA 3NDBB 1TB4A 4IMRA 3U3OA 2P4SA 1KARA 3IAUA 3D4PA 5E4FA 3EF3A 3TNJA 1ETHA 3VUFA 5E3HA 2DKOA 2BM9A 4HMQA 1KMHA 3TOVA 2PZEA 4MW5A 4R69A 1QIDA 5HS6A 1T6YA 2YVUA 2OHVA 5F7XA 3KSRA 1SU7A 3ZY4A 3L01A 1G98A 2W48A 1QF6A 3EB9A 2VTDA 3D8UA 3Q7PA 3Q7QA 3TVDA 1U5BB 2CF5A 3INGA 4O0MA 4U63A 1NR7A 4BN4A 5CA0B 1UXOA 2LZ0A 3CQ9A 1T1IA 1JJBA 4OHMA 1K8ZB 4YBZA 1Y7IA 2YY6A 5EIXA 3HKDA 1H4VB 3CXRA 3IUYA 4H08A 5EIHA 5FUXA 4HB0A 1PZXA 4HP8A 2R97A 4FR0A 1KI8A 2UZIR 1MMFB 2G6TA 2ZI9A 4UE3S 4JVNA 4M46A 3NMUF 1XN4A 5AOVA 2IU0A 1EDZA 1NAHA 4EG1A 1R00A 4NZZA 2GEKA 1UPBA 3ONVA 1YOVB 4IXMA 1G4HA 3ONWA 2WIKA 3TOXA 3BWDD 3QVXA 4D9GA 4G5XA 4IVRA 3MK31 2RH9B 1CRZA 2XB2A 1WCXA 2ZI5A 1J49A 1CULC 4IZIA 1E1MA 2SKCA 4L2IB 4U2CA 1SUBA 2YWJA 4DUZB 3R9XB 4TV8B 1KMHB 1CXZA 1V43A 3HA2A 3O8CA 1PI3A 4WTOA 1EJ0A 3K8OE 1FRVA 2E85A 3DAOA 4FFSA 5TJHA 3E48A 2Y9PB 1EDEA 4O4LA 1ZZEA 3IUMA 3ZYCA 3FMOB 2BFDB 2VRBA 4J1SA 2A59A 1T3TA 2G5TA 3HCBA 3NTQA 4PAWA 4XM2A 3EGXA 1HSOA 1ST2A 1GTJ1 3RLFA 2B4RO 4DV6B 5BWOA 3RRZA 2R6HA 3MT9A 4WE3A 5D6OA 3TAXA 5IAJA 1KQFA 3FPHA 1N9ZA 1SVLA 3ZDEA 3F9IA 1NJGA 4IIUA 5TPWB 3HYTA 3WLLA 4EEXA 3HBAA 1RWQA 3FBTA 3PKJA 1F6DA 1JIJA 2HK9A 4ZARA 3QVWA 4YAFA 3CF0A 3RWMB 2DUWA 1S01A 1PR2A 1Z0UA 4IY1A 1SPBS 4AECA 1E1RA 3UMYA 4PY2A 1T2NA 1WZUA 4NR0A 3H2ZA 3PR1A 3H17A 4XIIA 4X24A 3WGUA 4P31A 1X9HA 3URKA 4D44A 2QMHA 1B0UA 5GADl 2C9YA 1YBFA 1ZL0A 2Z5LA 4MMXB 5JC8A 2OZKA 1Q17A 2CDBA 2VHZA 2UYCA 1KORA 3AM5A 4EX6A 3M1IA 1NDHA 3D02A 3L7IA 3GJ4A 3H3XA 1Z5ZA 5EMJA 2AR9A 1W0KA 2DWUA 1N6LA 3VI3B 4F5ZA 4G0OA 1XWWA 2WNIA 2R6DA 3C98A 4H7EA 3VHRA 4HJRA 4BO0A 1QYDA 2VDJA 2QWXA 5ES4B 1DC3A 4DKJA 1DG9A 1GU7A 1AURA 1M1YA 1MZPA 3T8YA 4JJ6A 4JELA 2A35A 1JEYB 5HIKA 1Q91A 1V8BA 3Q3GE 4HTFB 4NMLA 4IIJF 3VJRA 2P2ZA 2QL9A 2ZRAA 1CZUA 3BFVA 1P61B 3E35A 3A10A 4TVSA 1GTL1 3DQQA 2PM8A 4DILA 5C18A 3VYWA 2PGIA 2JFVA 4MKGA 1N0WA 1QZZA 2X4GA 1T3HA 3A1NA 3AETA 5CVUA 3IT3A 5AK6A 4KRYA 1BXRA 4TTJA 2E37A 1UPCA 1WKVA 1X3SA 5TQJA 4B3JA 3GLFA 1S9HA 1IOVA 1KYVA 2GETA 4JLUA 1TVEA 5L7YA 1IIBA 3VPGA 2IIQA 1UQUA 1ZRSA 2CNLA 4U2BA 4RTPA 2TECE 3GD7A 1CUAA 5BWMA 2D5AA 1JU4A 3BDVA 4HRVA 2ZSIA 4RF4A 3Q2KA 2K4MA 3PQDA 2VP3A 5BRNA 1KAMA 1WW8A 5K2MA 4F12A 4U2FA 3OTOB 2GD1O 1U2QA 3NEAA 1P2SA 2PKWA 5DHFA 4DR7B 4HGZA 2DEUA 3BWEA 3WMEA 1UM8A 2NSDA 4QPNA 5IXSA 1J0DA 3FGPA 5F73A 2CLOB 3IHWA 1JBKA 2VTEA 5TS2A 2BRUA 2J59A 4MWTA 2AOUB 3K0BA 3LBFA 2NZ2A 3UUEA 3UXYA 5DKFA 2Q8NA 3DDHA 1ZCFA 4DEYA 3QXSA 4LXYA 1M0TA 5D7BA 3DJFA 4R9SA 1KU6A 3AX6A 1E9RA 1V8FA 3BFJA 3OEWA 3RROA 1ZLYA 3O4IA 1GYQA 1QH1B 4AXBA 2LE0A 1AUPA 2EU8A 1ECFA 3G02A 2MMCA 3O75A 1SVKA 4FS8A 3R7NA 3AQ4A 4DMUB 4LDNA 2P6MA 4ER6A 1QIKA 3KPUA 1T91A 3QFTA 3ZK9A 3PEUA 1SKQA 3GLIB 1E7MA 1LDEA 2ZT7A 5GVSA 2HHAA 2CV1A 5I7HA 1U8TA 4Q12A 2CK3A 4AJ4A 5JEEA 4WACA 2JFFA 4F8EA 2QTZA 3EZFA 2AFIB 1GPH1 2CFIA 3O8OB 2WHQA 1DQNA 3EPLA 1TJ3A 2JIBA 3BGVA 3VTAA 2H9IA 1OD6A 2OHJA 3NEJA 4YCMA 1JDPA 2H4HA 3FNBA 5LYJA 3CX4A 4PYKA 3TOSA 1UDRA 2H1FA 2VQDA 4FDLA 3WYNA 4HNRA 1R0ZA 3KWMA 4JBNA 2H2IA 3RG2A 1N6NA 5DMHA 1NBME 2F3UA 4OFZA 2BD0A 1Y82A 4RZIA 4XJXA 5E0KB 3TD6A 4BX3A 4W1PA 1FFHA 1L7MA 3T7TA 3VH2A 3IVAA 1WCWA 4BJ5A 1PFWA 1PG0A 2A6PA 2G9UA 1MFZA 2VH5R 3CUYA 3N0TA 5CW2A 2DTXA 1JLRA 1RIFA 1ADGA 1EFTA 1D4OA 3FMPB 4N39A 4WY5A 1QTNA 2D62A 4DR4B 2QQ5A 1NMYA 1A5BB 3AF3A 3TTWA 5BSWA 4UATA 4POOA 4CV2A 1J21A 3IDZA 4I4LA 4NRDA 5LWHA 1IAVA 3DE3X 4OB8A 4A0RA 5C7YA 1QG2A 1A1SA 2HJGA 3O3CA 4JLAA 5I8PA 1FNBA 1XSEA 3PQ8A 1HE8B 3UQYS 2OO5C 1C81A 1G8GA 1KOLA 1MB9A 3GARA 1XELA 3JQAA 2F48A 1WMDA 2Q9BA 2QRLA 4R31A 4RPLA 1U5AA 3U3XA 4BX8A 1DDGA 1VLQA 4HBGA 3RVPA 1AQUA 1DWUA 2O4CA 4IM7A 2AOTA 5IK2A 3RS7A 1GTZA 4JITA 2CLIB 3PITA 1FIUA 1RXEA 2Q5QA 5F7JA 5I3ZA 4LF7B 4B82A 1G2PA 5KOJA 2I4LA 3I2KA 1JG1A 5TMEA 3KDSE 3LYUA 4EOGA 1C3LA 3EMKA 2UZAA 4YB8A 3WK9A 5CFOA 2OXEA 2ZRKA 3SJZA 2FMTA 3B3QA 2HREA 2FMIA 2J32A 3NAMA 4R51A 4HFMA 3R74A 4NE2A 1XP8A 4UUAA 5IUJC 4Q1AA 1ZD3A 1I7LA 4BZXA 2P5SA 3OQIA 1B26A 5EEHA 5EP2A 2XT0A 4GRDA 4MA5A 2OKGA 5DRTA 5H82A 4BV3A 2XOXA 1E2IA 1H69A 2B1IA 3W9UA 1EFPA 3O31A 1WMFA 1M2GA 2P3QA 3F8WA 4YT5A 1XEFA 3I2FA 4TMFA 2VF5X 5DBIA 4BOYA 5CCEA 3PFWO 3G2QA 2O7RA 2WK1A 2FETA 1J9EA 1Z13A 2D2XA 2IZ1A 2R66A 3CNQS 3KJQA 2UYGA 4JA2A 1ZD9A 1RRGA 3LW8A 3FFBA 2WJGA 3ZZ1A 3TECE 1C80A 1G4UR 2PRZA 4UXJA 5E4JA 2NTJA 5KWSA 1CNFA 4PYQA 2A4KA 4CMBA 5HA5A 4ENQA 1BMQA 2ERXA 2JGDA 3RK1A 3P19A 5HRCA 2I4MA 3WGVA 1NPYA 1IU9A 3FNFA 2PYZA 3OKCA 4B6GA 4EBFA 4E1VA 1CY6A 3HDTA 3W7AA 3ICCA 2PKXA 4Q15A 5SYMA 3LP5A 1B1CA 4I8IA 1NBIA 1TF2A 1KJJA 5H81A 1FJGB 1R3UA 3H6GA 4JBGA 4TYPA 3ZE0B 1ZVKA 2RHHA 2MHCA 1TM7E 2CVZA 2G5GX 2GAJA 3LQFA 4G1CA 4ZU1X 3SJAA 1AVTA 1NQXA 2Z3ZA 1N2SA 3IAEA 3VQTA 2I6GA 1Y9EA 3ORSA 4L78A 3OQIB 4DCNA 1AKEA 2BDUA 4CDGA 4C7XA 3HB0A 3LNCA 4PQYA 4PX5A 4HLUC 2ZI6A 2WM9B 4CFSA 3K6RA 4C78A 2ZBGA 2O8NA 2ATIA 4A92A 2PGOA 5JNVA 4L8WB 5EERA 1RHMA 2FK7A 1RLMA 1TCBA 2G1KA 1GNVA 1XL1A 4GMXA 5BYJA 2QTLA 3U6KA 1PE0A 3FFXA 5AR1A 4QPJC 4EARA 2QW0X 1M0WA 4PS0A 2JFNA 2IOYA 3HGQA 4ZA2A 2UU9B 3NJ4A 1KY4A 3WLMA 5KYYA 5JJIA 4FCWA 2QY9A 3TI7A 3KJXA 2JGDB 3LQ1A 3GLTA 1YUBA 3U5TA 2G0TA 4LQDA 2HA4A 4DIMA 3ZN2A 4LRQA 3EAGA 4IKOA 4YCLA 3OEHA 1RABA 1R8SA 4CCWA 3V2GA 4DRXA 3SIPA 5AXCA 5C4IA 4RF3A 5I7EA 1NG9A 2PZBA 3RBXA 2PUFA 3LDAA 4JLMA 3RTGA 2A5LA 2EV9A 2O1SA 4US2R 1XPJA 3GBSA 2JAHA 4ZZ0A 5B4TA 2SKDA 1OIVA 1WDMA 4IRXA 1DBVO 3EFOA 4BQNA 3TM5A 3AXTA 1CUVA 1QRSA 3P9SA 4JH0A 5L3SB 3VAAA 3QE2A 1LLQA 2RI0A 1WLSA 2YFQA 2O6HA 3P0EA 4KQWA 1QK4A 3KD2A 3RYIA 1YWGO 2D4AA 2H0QA 2LDBA 4GDMA 3JQ9A 3OPVA 3M6MD 1NYLA 4NHEA 3FCAA 1Z4IA 3R3WA 4DG9A 3CLUD 2HOQA 1O6ZA 2IVFA 3FUWA 3FVVA 3S68A 1NTOA 5ER6A 3PC6A 4NPCA 2MJLA 3ZDRA 1U2RA 1DAOA 1GZ3A 1V35A 4DJ5X 721PA 2QD3A 1M1NB 4LJKA 5A4JA 1HDGO 4NH0A 2D5BA 4FDVA 1CQIB 3BGWA 5LXTF 2PGXA 2DR3A 3HYSA 1HE1C 4OHRA 3C5EA 5DGIA 4ALIA 2YUTA 3V4FA 5C9ZA 1G3UA 2C7OA 1JSZA 5IT5A 1A50B 2FFAA 3P0FA 4D26A 2YRFA 1UT6A 2DKNA 2Q3FA 4BNKA 1M2VB 1XVLA 1E5QA 1DS6A 3AGQA 2NO7A 1DT5A 1YMQA 3DEHA 2A1IA 3LGSA 5FTJA 4NJEA 1E1CA 3T3GA 1SY7A 1JHVA 3BH6A 3UZUA 3BC1A 4M53A 3KOZA 1GGFA 2V7BA 4ENSA 1Y37A 2ODBA 2P2DA 2IPAB 2DGDA 2H4XA 1U7HA 2XTMA 3LCCA 3OOYA 4J2TA 4QIHA 4RORA 4F84A 3MCZA 1MAHA 1XU9A 4K87A 4KO8A 2BEUB 3SSAA 4F7WA 2QSJA 1JDVA 3RYIB 1CSEE 1EP2B 3NBUA 3SXUB 1OXTA 2RH4A 5BOSA 2IDMA 4P6VF 2ENUA 1NOJA 3C70A 2PNJA 3CRMA 2JNWA 1UC4B 1TKCA 3S3TA 2JAXA 1SUEA 3BTUA 3NBYC 1ZN2A 3RFFA 2G1PA 2VK8A 1ECCA 2R7KA 1XLVA 2FWMX 2IHYA 2FXIA 3JD3A 5E6RB 1KA9H 2Q5FA 4Y2YA 1XK6A 3D81A 2BFFB 3LK7A 1BQ3A 2FV8A 3A36A 1NBMA 3ADBA 5J23A 1B43A 2Z2XA 4N8EA 3MMSA 4MS3B 3TQQA 2Q4RA 4J4HA 3BRWD 1I3CA 3DO5A 2C29D 4XD7A 4G1FA 3KYIB 2EW2A 2VATA 2EG5A 2XYVA 1DAEA 4NCNA 5KQPA 3NV9A 1HNZB 3UMCA 3EULA 4JI1B 1E1CB 3H5IA 4QOFA 4KX5A 3RVOA 3JSXA 3K6KA 5HFNA 1A9ZA 3ZBTA 4ABYA 4NV1A 2TMYA 4F4CA 5DNDA 4ZZIA 1OAAA 3EQ9A 2JATA 1QHEA 2QRQA 2XMZA 3D3JA 3SFTA 1Q2XA 3V7UA 1ZSYA 3EVAA 1A8QA 1UJBA 3F8SA 1V5WA 4FN4A 3G23A 5IHPA 3TKLA 3K35A 4GW3A 3TN7A 4CQLA 4RM3A 3T7RA 4MQMA 1T13A 1E3SA 1XVVA 4KN6A 3SR0A 4QAQA 3H75A 1OYYA 4XVUA 2JKYA 2RJ3A 4EAQA 4FZVA 4QELA 3K1YA 5DNUA 3RAPR 2Q8QA 1AUOA 1U4SA 1SUWA 1Q7CA 2M1ZA 2K6GA 3K9GA 2BFMA 2QR5A 2GYVA 3H18A 3NBFA 1X9IA 3FDZA 4CLXA 4EJMA 5KMGA 4YREA 2AZDA 3F47A 1E7RA 4QG7A 1T0HB 3VBEA 3SR4A 4UPEA 3CLRD 1FMTA 4AG5A 4BQPA 4LDJA 1TK9A 2ZWIA 5IUKC 2F1JA 1SEPA 2R8ZA 1YJBA 3QQPA 3RJ5A 4EEKA 2IQIA 2V0CA 4E11A 3GUYA 4FMDF 4DMMA 4YR9A 4JKOA 5IWCA 5FL3A 1T2FA 2P69A 1J2UA 4HQKA 1A2OA 3JWHA 3H9UA 2EZ8A 2I2XB 2HWXA 4ME6A 3WGGA 4TYMA 3G7SA 4BCDA 5KO2A 1OXUA 1Z28A 2ST1A 4E51A 3C74A 3DPIA 3K9NA 1T1EA 1MABA 3NOQA 1JVBA 3V32A 2E49A 3PGJA 4RA6A 5DCUA 5AM4A 4R9RA 3KXDA 3I62A 5I01A 4UULA 2H65A 1GNLA 2WVGA 2CT8A 3WP0A 2CDNA 3H65A 3R5SA 1EBUA 3PENA 3Q3JB 3CTMA 4LWPA 4KKVA 1BMDA 4PV7A 2OWDA 3CNLA 3PDHA 1K7CA 2OHIA 4IP0A 4OBXA 4C6SA 2O57A 2F9LA 2O23A 3LT1A 3FDZB 2CE2X 5KMGB 4N54A 3M6LA 3R6DA 3V1UA 1AXGA 1ISFA 1UWKA 2NAFA 2OORA 3LT5A 1SUFA 2FHPA 3HJHA 3IX7A 4GBGA 4K0RA 4AF6A 4CRWB 2QM0A 2Z8YM 2JJYA 1F48A 3GIDA 1J6UA 1NC1A 5LP6C 4HNVA 6REQA 1POXA 1VL1A 3GT3A 3N86A 3HFRA 3C8DA 3U17A 1ZGAA 4FMCF 2C3YA 1ATIA 2H59A 3KUXA 4Z9BA 5C1PA 3AOEC 4MW0A 3SN6A 3R77A 5FWDA 2WB4A 4ESHA 3GV0A 2VEOA 3GZNB 2C1XA 4OQFA 3R5TA 1QFZA 3VGJA 2HN9A 4AJHA 2FQXA 4LHZA 1XBTA 4BE7B 5KVCA 3HZZA 4M86A 4MWBA 3S99A 3VPCA 2YWBA 4MKIA 4FD2A 2AJDA 3RC8A 3DT8A 1R88A 1L4YA 4WUTA 5K2OA 3JPYA 3PBKA 1BE8A 4Y9DA 4URZR 1MP0A 1VZ3A 5EQTA 3U44B 1Z37A 4GOJA 5KVVA 1WB5A 2XQVA 1GQRA 3BMCB 3RIEA 1CNMA 3KLBA 5ALRA 3G8AA 3E27A 5A9SA 1R6BX 1QDLB 2ZSFA 2P2NA 4HZGA 2XNJA 5AT1A 5JCOA 4C03A 3OM8A 4YX9A 5CFRA 4X71A 4XUEA 3PPYA 2E4XA 3HNOA 4I9HA 5EHIA 2WIJA 4QULA 2PZKA 4W9RA 6REQB 2GB4A 2NV0A 2PU7A 3C6ZA 3GFSA 3RBAA 3KDPA 1Y5RA 3R3SA 3H86A 1WLYA 5DWVA 5H3LA 3PWTA 2DFLA 2TYSB 1XAJA 4CN9A 3ZCTA 2QTVB 3WNDA 4ND7A 4EJSB 5AJYA 1JQEA 4BMNA 3QXGA 3H5RA 2NPFA 1IZ9A 5GJVC 1OHHA 3CKYA 3G6KA 4IDOA 1MD9A 4EG0A 4NOLA 5ISMA 2QAJA 3ACDA 4KLRA 4KE7A 1K98A 4ZV4A 3VNUA 2ZZMA 1IXRC 4ZT2A 4A0QA 6GPBA 1KC3A 2C0CA 4BNJA 1H42A 2FG6C 2PGNA 1JIVA 2JGEA 3K71B 1B41A 1QAQA 5DT2A 3LS2A 1KEUA 2H4ZA 3VDMA 1W34A 2BC9A 5TS3A 1FYXA 3VM6A 1RJWA 3CFYA 3O90A 3MTBA 3OETA 3T9FA 1GTVA 2O0MA 3GOQA 4KBYA 3PYMA 5JVDB 5SY9A 1W73A 1SXGA 1V16A 1K6IA 3K2EA 1WG8A 3QFCA 4L72A 3A1WA 3H9JA 2UZ1A 5FA5A 4YUZA 4JJGA 4UHJA 1H5UA 1LV7A 2PKRA 1TECE 2XD4A 2WYIA 5B37A 3T7IA 4BPRA 3USZA 1YFKA 2AMVA 2CYAA 2IZ5A 2J6IA 3COZA 1QV6A 4QOSA 5F7OA 1K97A 1ZU4A 2I76A 4D74A 2P9HA 2DC1A 3JQDA 2ET6A 4KV7A 4KXWA 4BU0A 3UMJA 3SSOA 4YUYA 3FZNA 4AMUA 2AT1A 2FJPA 5ELMA 1X14A 2C3PA 3HVUA 3MCWA 2QZPA 4UUNA 1ZS9A 5BSRA 5CFLA 1EWQA 3UJ8A 1ZRNA 1ML3A 1XTSA 2VNIA 3E18A 1W49A 1Z5OA 4HNQA 2QGFA 4UEKA 4EW1A 2E7ZA 3D7NA 3TNLA 5REQA 5TY0A 1M0SA 5JDCA 4Q03A 1DCTA 1E3EA 2DCUA 2PA0A 4NEQA 4FFOA 3SKVA 1W87A 1OV6A 2Q2VA 2KQUA 1H6CA 2F55A 1KZHA 1VGQA 5GONF 4I99A 3AI2A 4L9WA 3EQ6A 5L6LB 3KZNA 3Q7EA 4Q1BA 3ZXIA 3FWKA 3IQHX 3LIIA 1BVYF 2CNKA 1DCKA 4GX2A 3KPVA 3JD4A 5CNMA 3WC4A 1N6HA 4MV7A 1VSUA 2QIOA 3O82A 2F7SA 2BFBB 3FVRA 3HVIA 2GLTA 2HIAA 2C2HA 3W8NA 3BT7A 3ER8A 4YMHA 4I5EA 1KC1A 5ARDA 2IU3A 1Z4QA 3U7JA 2XZPA 4I1OA 4YUAA 3OP4A 3L7YA 2WFLA 4PLGA 1VFPA 1ONNA 3ESQA 1MOQA 3A70A 2W8BA 1JZQA 4LRTB 2D7JA 2ZW9A 3B1ZA 1EMDA 3EQ8A 5JI3E 3QVJA 3E8SA 4TS4A 4NPHA 1WV1A 3S4YA 1YBVA 3FPJA 5B58T 2IU4A 1Y6JA 1IPEA 3I39X 4US0R 3V7FA 1T2VA 3U3DA 4UFOA 3E3MA 3OESA 4RH3A 1ORRA 2GK7A 4OVKA 3KJZA 1KKLA 4JDUA 1M8JA 4BXOB 3NHLA 1T25A 4G0QA 1XP5A 1C0PA 5KYUA 1SOVA 1FDVA 3L40A 4KUGA 2YHIB 5KHAA 2FUCA 4HGYA 2IC5A 5KYKA 1XMSA 3ZR4B 4C0QC 2FF7A 1SUIA 1W2GA 2CXTA 3F5QA 2Q3CA 4MVJF 2PMDA 3T3NA 3DH0A 3A4MA 1R6XA 3C7KA 4OA5A 1QKKA 3MJFA 4LN1A 3L1KA 5CBKA 3I32A 2AC7A 2E6UX 3DB2A 2PS0A 5G3ZA 1JSXA 1A04A 1WSAA 2JHCA 3UF0A 4HV4A 1BEUB 2ZM5A 4E08A 3P9ZA 1VYUA 1UIRA 4BFWA 2CXNA 1QH8A 4RV9A 3KV1A 4CKEB 1SC9A 2WFLB 4ZJYA 1Q12A 1GLVA 3PHIA 5ALSA 5CXQA 1XYGA 5CD1A 1P0IA 4AWBA 4B35A 2P4UA 4N5HX 3DLIA 2AWOA 3DZJA 4PSDA 1RMYA 1YB2A 3HADA 3HN2A 3RB8A 3RVRA 4P53A 2HFJA 1VJDA 1CQXA 2PD4A 2VF4X 3KQMA 2G9QA 2I0FA 3RM3A 4YEDA 4BMVA 1RZRA 4BQOA 5FFNA 1U9IC 3TG8A 1F8XA 2ZVDA 2BDEA 3AVOA 3GFQA 3K1AA 4LMPA 1EESA 1HF3A 4OG2A 4Y2RA 2CUNA 2X5JO 4QSMA 2J4CA 5IAKA 5KYVA 2YHSA 1WVGA 2I7VA 3KK0A 2BM8A 4ZANA 3PXAA 2IPMA 1Y8CA 2J4FA 1EXNA 1C8LA 3NC4A 3PWSA 3KV3O 4RIFA 5I4BA 4LQLA 5AVUA 5B3LA 4C7MA 4R4JA 4C7OB 4Q00A 4QD3A 1MJNA 1LPPA 4OB7A 1AH2A 2GVDC 1W76A 3WRXA 3ZVLA 4X3OA 1CUZA 4FDTA 2NTVA 4IVQA 1DTWA 4XDHA 5LXTA 1AK9A 3ZWBA 4I1PA 1ODLA 2DULA 4EGQA 4G65A 1II8A 4B8ZA 3AR2A 2BFOA 2WR8A 5AW7A 1GAJA 4NU0A 4EENA 2RMKA 2TMDA 4FFWA 4FIDA 4KFSA 1L4HA 4K7JA 5EIWA 1DMSA 1XA3A 4H15A 2VQ6A 3R40A 2D6FA 1KE1A 1U6JA 2N46A 4GBED 1B0ZA 2PIDA 1LPAB 2H3HA 4Q4HA 1ZICA 3FKJA 3Q9LA 5KYWA 1MV5A 2H5IA 1JR4A 2X2PA 4IDBA 2YJGA 1W1WA 4J49A 3K9LA 4CG0A 2XWBF 3M89A 1AHIA 1G16A 1Z2PX 5IBRA 4EL0A 1JMKC 1O5TA 3FYUB 4I08A 1XWIA 2DTDA 4PO1A 1BO6A 4QEDA 2JGIA 2JL1A 4KP7A 3OZTA 4YA6A 2XVZA 4S1VA 3U39A 3NV7A 4R2KA 4QTYA 2IX3A 1JHZA 1XZLA 4I5GA 4L22A 3PWKA 1ONBA 2R60A 3CZCA 2H06A 1TYEB 3T35A 1NV9A 3R3XA 4J29A 2P9YA 1L5HB 4N82A 4WDRA 4D9BA 5IPFA 1JSLA 1LC3A 4X7BA 3AWDA 4BNDA 1WQ4A 2C5BA 3AUAA 2WFZA 4YRZA 3EC7A 5EI5A 1Q14A 2BISA 4XUGB 2H51A 1AB6A 3LPAA 1N7GA 4NZOA 3PDIA 3AUYA 4C0HA 4PCUA 1Q0ZA 1ZCAA 2I1VB 3ETNA 3SXJA 4XZ3A 3RV3A 3TL2A 3EZ2A 4M1OA 3L0ZA 1II8B 3AESA 3IKJA 5EJ2A 4X1IA 3VNRA 5BSVA 3S1AA 4RDXA 3K6SB 3LQ2A 5DFAA 2HMSA 1FP2A 2WSLA 1MC5A 1PV2A 2Z4RA 3Q8WA 1GL3A 1VJ0A 4BPBA 4YCSA 1ZJJA 5IHXA 1W59A 2H16A 5KYWB 4YH1A 2A9JA 5FHQA 1YBAA 1NX6A 4BMPB 4DNFA 1BCSB 1FK8A 1UKYA 3EBPA 4FEGA 4IIDA 1TRHA 3VR3D 5JALA 5IEJA 2AOXA 5MFPA 3PXGA 2DAPA 3G2MA 1LD3A 5E38A 4PG7A 1UK8A 2B78A 3ZZNA 4IGAA 2D5LA 2GRUA 1ZESA 2I1QA 5LZ4A 1WUIS 2EVWX 2VDOB 2XMPA 1I6LA 3AEZA 1PJTA 1IM5A 5CDGA 3A7DA 1X1QA 3HDJA 1GQOA 3TRHA 1PU2A 1T36B 5BN5B 5B57C 3LUAA 3GGJA 1OXXK 1SUPA 2W98A 2RGWA 1IJFA 1ZK3A 2Z3VA 2OLJA 2BRUC 2Z5VA 3H2KA 2R6JA 3BS4A 5EGSA 5JTUA 3OIYA 3EVBA 4LHSA 3WLHA 2HF9A 1V7CA 4LIPD 4G5FA 1YRAA 5T57A 5TEWA 4MVJD 1RJDA 3EOZA 2VQEB 1YVPA 1VB5A 3DXYA 4R01A 2CD9A 4X1IB 3S2GA 5LWQA 2Q3MA 5JY6A 4OHXA 4JV5B 1NULA 1R6UA 2JAWA 2JBAA 2ZTSA 2IHBA 4UDNA 5DM1A 3ESBA 1RI3A 2DJIA 1HQYE 3HJGA 3LTEA 4LOJA 4LNHA 4UTVA 5K8TA 1PGPA 4LI3X 3PUIA 1ZN8A 3SC3A 4FC6A 1QPBA 3PFNA 2IHZA 3T4XA 4O33A 2G1UA 4LYEA 4CUZA 1OUMA 1UBRS 4XEUA 4O6VA 5FXMA 1BSVA 4HDMA 2Z58A 3K4HA 3V33A 5K6TA 3UJNA 2JHGA 4N0PA 2WVJA 3TRFA 2CNWA 3ZE2B 2RSLA 3BBLA 5TRTA 1C7FA 5K0ZA 1D0IA 3DL4A 4I9FA 4WZBA 3HPQA 4IS2A 3RYFB 5ENDA 2J6HA 2I6TA 1C7EA 1HEIA 4U8GA 4KE8A 2WI8A 4Q9NA 1KU0A 3S0JA 2VSYA 4H31A 5K3BA 3C6YA 3C14C 2H00A 4G67A 4F92B 2WWFA 1A8HA 4M8LA 3N59A 1LS1A 3P0JA 4D5GA 4DL9A 1X1SA 3M5CA 3OOHA 1R27A 4WXHA 4AZSA 4DUGD 5B5SA 4CL0A 1IN5A 1PNOA 2WUDA 5HHTA 1UC5B 3H6HA 4I9UA 4MO2A 4RHXA 3WQHA 3TTUA 2WA2A 4EX7A 4PFQA 2V8BA 3PE4A 3ZWOA 4JJAA 3K5WA 1LX6A 3PFIA 1SC3A 4RFSB 3CZAA 2WF8A 1SD1A 1UDBA 1Z8DA 3DCJA 3DJYA 1ENYA 1RRCA 3EMBA 4JOBA 3KJIA 3LMKA 1NUSA 2QTNA 3CE6A 2F2TA 1F3OA 2O3RA 3DBOB 2FN3A 4UEQA 3RK4A 3KEMA 3MYYA 2PS9A 1XDZA 1GFWA 1PUXA 1S9DA 2GPYA 3M34A 1ZSVA 3K0AA 2OQVA 4RHCA 1NN1A 4F38A 1RM4A 2VAVA 1CTQA 4IKPA 4JLOA 4PNHA 5FUWA 5L3RA 2UUBB 2IGBA 3W2FA 2I66A 1VJTA 1RQPA 4Y2PA 1SQGA 4WV3A 1JDBB 3WMGA 3HI6A 3GJ6A 1BKDR 3RVQA 1KAOA 3SC6A 4WMLA 3NKLA 4U6QA 2OAQ1 1QRDA 4B45A 3HSYA 4Z4IA 2B0JA 1ZK4A 4MS4A 3CF2A 4PGAA 4Y2VA 4YRCA 1PL8A 1BFKA 1TA0A 4J7UA 1R7RA 1G7SA 3LX8A 3G5AA 1NVAA 3W8DA 2HK7A 3UWMA 2E4AA 2XV1A 1GLNA 2CXXA 3LP6A 2C61A 3RVBA 3KCQA 1X92A 1O6FA 2YC2C 1YQUA 2RGNC 3DFKA 1Z34A 3TPCA 2Z5GA 4QLAA 3HJRA 3CA8A 1NF9A 3WA6A 2CB0A 4AO6A 5KC9A 2BMDA 3GJ3A 4ARCA 4HDRB 3MF4A 4RL4A 3KTOA 4N7RA 2QI9C 1U8AA 1FW6A 5CG1A 3DV9A 4LX8A 4ITUA 4EA8A 2ZKIA 5JG7A 2C1EA 3A05A 3Q3VA 3ZIAD 2IOFA 1M5RA 4KGXA 2EBFX 2AD5A 5FPQA 1UKBA 3OX2A 5HBGA 3KJHA 1KI3A 3W6NA 2ATEA 5FPKA 3TZ6A 5FEUA 1ZYUA 1YRBA 3R7AA 2X1LA 5FPYA 4ZXFA 3VYTB 3MG9A 3QPUA 5JO0A 4GT1A 1DX6A 2RGDA 4DV5B 1WUYA 2CHEA 3UAGA 1KIAA 5JR3A 3DVRX 3EFHA 1JXOA 3EDQA 4LE2A 4F4JA 5K0SA 1C5KA 4MUFA 3KQUA 1BS1A 3HYNA 1J00A 4LBYA 1OOEA 3VGPA 2ZBPA 3KSDO 2JFUA 4DNPA 1C1HA 2UVPA 4DA9A 3B48A 5LOVF 3Q4GA 1P4SA 4JI2B 1AKNA 3AILA 4LSGA 3HRKA 4YRSA 3O95A 3SS8A 3AINA 1RYYA 3MCUA 3P9CA 1ZRMA 3GLHE 4UU8A 4XQGA 3G68A 2VF7A 3T0FA 4F1JA 4DDHA 1E98A 1U1IA 3OC6A 3T4EA 4UHFA 5A4IS 3ISTA 5JMOA 2ONKA 1SD5A 1LSOA 1MEJA 3ETGA 4WINA 4D4HA 3G2IA 3QVOA 4Y67A 4XCQA 3V4RA 3T7EA 4TLMB 3HKEB 2KX7A 4RJKA 1XTTA 1ABEA 4Q6WA 3UWPA 4EVIA 1C3EA 4Y18A 3NWBA 5D00A 3UV6A 4P58A 2PSSA 1R64A 1IQRA 1SQ6A 5GONA 3KJNA 3RT9A 4XQEA 3LKVA 2XHEA 5EL0A 3ZVKA 3EYAA 4M9CA 2IZZA 2OCDA 2D8MA 1GZSA 3VHXA 1A9YA 3VC1A 4ZYYA 3LTNC 1U0TA 3A0RB 4CI9A 1JA1A 5HEKA 4LFCB 7YASA 4KN9S 2HYDA 3PUJA 2ONJA 3JVEA 5TNXA 1GVHA 3HE3A 3HG7A 1VHQA 4GU5A 3JQ9C 1TEVA 2VN8A 3AHCA 5HRUA 1X77A 1BHJA 5DM2A 3P2EA 4IOLA 3RUIA 4D8UA 2ZBFA 2B6NA 2VTKA 3DBHB 4RHTA 1SXJE 4I4TA 4IUBS 2ZIVB 1H0HA 2VJYA 2V7WA 2OM6A 2TSYB 3CMCO 3K9HA 1Z0IA 3T5DA 3ZLTA 1E32A 1FFAA 2M2IA 4HH3C 4JC8A 3ZX4A 5KX5B 5LNK1 3IJRA 1QBGA 3OAAD 5EQDA 1M74A 3MWEB 1ZNXA 1SM4A 1S89A 1JKFA 1ZCJA 4DC0A 4UTNA 5COBA 1SXHA 2AGVA 2I6SA 1UT5A 3FB1A 5C5IA 1ZL2A 3EDCA 3F96A 1A9XA 1XOIA 2WWVD 4E12A 1F51E 1X94A 3C48A 2IWHA 4KDRA 3QG5A 1I2MA 2JD2A 2R85A 1GG8A 2HIMA 1ZUNA 5E3IA 1IEWA 4MVJA 2COEA 1G3QA 2QXUA 4P2BA 3SP1A 3X1JA 2AEMA 1U80A 4BZWA 3T1TA 1YHZA 1HORA 4GE0A 1EB8A 4CF5A 1SCUB 1W52X 1BNCA 4GRIA 5IZ4A 4ENTA 5HK8A 3UK6A 1W4BA 3ACBA 1BJKA 2VIIA 2A0FA 5CAEB 2SCUB 5DCLA 1Y3BE 1WMAA 1RKUA 4PVCA 2BGMA 4I4TB 3W9YA 5C8YB 1TUIA 1ZI9A 2M32A 1NAIA 3H83A 4MEAA 2D2EA 2QX4A 3RFTA 3SIWA 2C8JA 5F98A 1C8VB 2G09A 1JU3A 2GVNA 4M22A 4UU0A 3WLOA 3P9KA 4A9AA 1G8HA 4NIMA 1T0UA 2FSUA 3HVHA 3UTCA 1E9SA 1OF1A 2CJWA 3LNTA 4EGAA 4QNRA 3OFJA 4TSKA 3SKYA 1NXXA 3RSLA 3CURA 4F93B 1AF4A 2ZRQA 1EUYA 2CMHA 1PZEA 1GFIA 1QKJA 3GJ0A 4RAOA 5TPZD 4J1QA 2ZIUB 2FUKA 3EA5A 3IQGX 4M76B 1T4GA 4ZO4A 5EEGA 1KETA 1PKXA 2H8KA 3OPYI 5KSOA 3HXPA 3BWCA 1V4BA 3K6JA 4G09A 4MI9A 1ZH2A 1ZUNB 4UHBA 4XA8A 4Y6SA 5LZ7A 3S2IA 1YCGA 2VJDA 5F2OA 5HKLA 1C3JA 4UCWA 3TE6A 4CKEA 1R15A 3WKAA 2R8PA 2XQGA 1YGYA 4EA6A 1Z5VA 1A9SA 1ESMA 1RYZA 1Q95A 3N2EA 5DHSA 1SG6A 2PAFA 2NUTA 3TI9A 3QFRA 2HSJA 3PQ4A 4CT0A 2W4MA 5C8VA 1XO1A 2PKEA 4PG5A 3H4VA 4BBJA 2GR9A 1OFUX 5A5VA 4ZCMA 1GKUB 1YZYA 5DLEA 4DDMA 4ML3A 4XLZA 4XVCA 2OGZA 2C9OA 2JFZA 4HC4A 4PYIA 1Q1QA 2G72A 3RUAA 3RS2A 4CM9A 4I7EA 4EKGA 4EY3A 2IYRA 4EW2A 2KLBA 5LMNB 3NEPX 3X1WA 4ZYUA 2P3OA 5TF0A 2ZRBA 3D6NB 1JMVA 2AN9A 4AJEA 1SVIA 4W82A 3O47A 3REGA 4FHDA 4CR8A 4ASUA 1QGYA 1PF7E 3HKBB 3OWOA 3RSSA 1KH1A 1JA9A 3AVUA 4BEJA 1XEWY 5KVQA 5GY7A 5LB4A 3ANYB 1PV1A 5A6SA 5H80A 5A1JA 1YK1A 3GG9A 2ZBRA 3QPBA 1E6WA 3FZQA 1U0EA 2YBDA 5DN9A 3I92A 1CR6A 2V6BA 3M4YA 4GKAA 1R37A 3AO0B 3LO5A 1G3MA 4HRAA 4O02B 1WCIB 5ARCA 4AMYA 3OLCX 3T06B 1JA0A 4F85A 1Y34E 1Y8QA 2PT6A