1AKTA

G61n oxidized flavodoxin mutant
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
147
structure length
147
Chain Sequence
PKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEGFDLVLLGCSTWNDDSIELQDDFIPLFDSLEETGAQGRKVACFGCGDSSYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FLAVODOXIN
publication title Modulation of the redox potentials of FMN in Desulfovibrio vulgaris flavodoxin: thermodynamic properties and crystal structures of glycine-61 mutants.
pubmed doi rcsb
source organism Desulfovibrio vulgaris subsp. vulgaris str. hildenborough
total genus 49
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 1997-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1aktA00
2OHIA 2HNAA 2R96A 1RTTA 2Z9DA 4QOHA 2QR2A 5F12A 2FCRA 4YQEA 4ZVKA 5EA2A 1YCHA 3B6KA 4C14A 5LMCA 2AMJA 2BN4A 3NHPA 1OFVA 3GFQA 3NHUA 4ICIA 4HEQA 1V4BA 1KBOA 1BU5A 1FTGA 1H69A 3NHYA 3NHWA 1RLJA 4LTDA 1AHNA 2OHHA 1CZKA 4C0XA 3N3AC 2QWXA 4BMOB 1YKGA 1DX9A 4DY4A 1C7EA 1I1OA 1CZNA 5LBTA 4DILA 3F6SA 2MTBA 3OJWA 3OX1A 3F6RA 3L9XA 3O73A 1DXOA 1DXQA 1WSWA 2Z9BA 4ZVMA 1CZUA 2QMZA 3NHLA 4PU0A 2F1OA 3TE7A 1E5DA 1AZLA 4GI5A 1T5BA 3HLYA 1QRDA 3GFSA 4YAUA 3FJOA 3B6IA 1D03A 3GAMA 3OJXA 1H66A 4U7HA 4N9QA 2XOEA 3OVMA 4BMPB 4C0WA 4FX2A 5JROA 1QBGA 2Q62A 1J9EA 4J8PA 2QX9A 1ZX1A 2GSWA 4NULA 2WC1A 1RCFA 3F2VA 4LTMA 2M6RA 1YDGA 1J9ZA 1KBQA 5LVAA 3HR4A 3L9WA 3OWXA 3U7IA 4U7GA 3KLBA 5FX2A 2FZ5A 2V5VA 5F51A 4D02A 1CZOA 1SQSA 3QFRA 2MWMA 1OBVA 3JSXA 3NFRA 3RPEA 2Z9CA 3W77A 4F8YA 3R6WA 4XDHA 3U7RA 2OHJA 4QOJA 3NHSA 4R81A 1QR2A 2MOKA 4DIKA 1CZHA 3D7NA 4YAWA 3UXEA 2FVXA 1FVXA 3FVWA 2ZKIA 3GFRA 1FLAA 2FZVA 4QOGA 1AKQA 4Y9UA 1F4PA 2KLBA 1XYVA 5F4BA 3HA2A 1YCFA 1FLDA 1FUEA 2Q9UA 3NHJA 3P0RA 3F90A 2BZSA 1AKTA 4C76A 4H6PA 5BUCA 1FLNA 3KAQA 1VMEA 3W79A 2BPOA 5B3LA 3TZBA 6NULA 4FGLA 4PTZA 2BF4A 2QX8A 4N65A 4GQIA 2QMYA 4N82A 1TIKA 3OX3A 3K20A 4LA4A 1CZLA 1ZWLA 3KAPA 1QHEA 2HNBA 4QOIA 2RG1A 1CZRA 5NLLA 2FDXA 1NNI1 4YALA 2QX4A 3EYWA 1YCGA 2HPVA 2V9CA 2D5IA 2FAXA 1AKVA 2B3DA 1AKRA 4CF6A 4PTYA 2Z98A 4ZVNA 2QX6A 2XODA 2MT9A 5B3KA 3FNIA 4FGKA 4GR9A 3W7AA 3ES9A 5LLDA 1J9GA 3KEGA 4Y9RA 3ESXA 4OXXA 5FA6A 4S24A 1XI2A 3N39C 2M6SA 1XYYA 1AMOA 1YRHA 1D4AA 4YAFA 4ZVLA 2X2OA 3LCMA 5LBUA 3NHRA 3ZHOA 5LJIA 1RLIA 1WSBA 1C7FA 3OWHA 2R97A 3EDOA 4CETA 4H2DA 3O2NA 1AKWA 1XT6A 1X77A 4QOEA 1FX1A 3NHFA 3NLLA 1AKUA 3K1YA 5EAIA 1OBOA 3G5MA 3FX2A 5A4KA 3ESZA 1GG5A 4LTNA 2OYSA 1FLVA 5NULA 1YOBA 1B1CA 1T0IA 3SVLA 4Y7CA 2FX2A 1JA0A 1D04A 1TLLA 4FGJA 3QFCA 3QE2A 2ARKA 1J8QA 3LT5A 2A5LA 4NLLA 3S2YA 5TGZA 3UXHA 2KQUA 2BMVA 4ESEA 2FLVA 3OX2A 4QODA 3N3BC 4HS4A 2V5UA 1ZWKA 1BVYF 1SG0A 2N1MA 2X2PA 3NHKA 5EMNA 5FUQA 3TEMA 4M0CA 5ULLA 3W78A 3B6JA 3ESYA 4XDGA 2W5UA 4U7FA 2FOXA 3FW1A 1AG9A 1JA1A 4QOFA 4YAOA 3B6MA 5LJLA 4LAFA
chains in the Genus database with same CATH superfamily
1GGFA 2JGNA 2NO1A 3FGZA 4DDUA 2HNAA 2AH5A 2Q3FA 1PFKA 1YDWA 1Y1SA 1I4TD 3PXBA 2F1JA 1FL9A 3CGWA 5T3YA 3SBXA 2XEDA 2ZT7A 3H2SA 4N8DA 4EMTA 1U0SY 1P4RA 4MQFA 4I7EA 3GRPA 4WLOA 3TLEA 4IPTA 5D3MB 1NFQA 4JOCA 4XWTA 4Y1RB 1GPH1 3DYVA 3H87A 4BOYA 2WE7A 4TMFA 2ZYDA 5JO9A 2DR2A 4BZXA 5CXUA 3AKYA 3R5KA 3IV7A 4JUFA 2WIFA 3V4PB 1KJYA 1NM5A 3GNLA 3MJVA 3PHJA 4FDTA 1VL2A 2P4EA 4IIJA 2HJSA 4OATA 2QE7D 2BUBA 4ZU1X 3UWSA 2O48X 1ZCJA 2PX5A 1WBDA 3UJAA 4YAGA 1FCJA 3NHPA 1NDQA 2PUJA 3LQ2A 1KYYA 2V96A 2XNDD 4NG5A 4PYOA 3ROZA 4MS4A 3GDHA 4RPIA 5AT1A 1GGJA 2GJAA 2VDUE 3LHFA 1U3VA 2R1UA 1SHZA 1P8JA 3QKSB 4L4ZA 3VC3A 1BJKA 4FQ7A 4M87A 4QGAA 3IR7A 1BU5A 2NACA 3I1YA 4L76A 4GPEA 4JU8A 4OB6A 5COAA 3L8CA 2PA3A 3NHYA 2VHJA 4YA6A 4B3BA 1QRAA 5SV2A 5KYXB 2OBMA 4JQCA 2NTEA 1ULHA 2DT8A 4A8JA 5JRDS 3HCOA 2ZB3A 3OKCA 5G0VA 4R05A 3ZNPA 3FTQA 2ICAA 1L4MA 1RI5A 4IJMA 3DMDA 4TMWA 4ZRMA 4S1NA 4TLLB 3A6ZA 1P60A 4PAGA 2GEKA 2D0DA 5KTRA 5TQJA 1A8IA 1UXOA 5IM4F 1F9AA 2DQYA 4I8XA 3G2OA 2EFHB 2HV9A 4IRUB 4XLTA 2HB6A 1Z08A 2C4UA 4DGQA 3UJNA 1U1DA 3Q9SA 4J07A 3PC6A 2FR8A 2FSGA 3N2ZB 1NBME 1UKAA 1XAGA 2E0IA 3SZLA 4BQFA 1LCIA 5P8WA 3FYSA 1YB4A 1RC1A 1NIJA 4WCFC 4E1BA 3D6JA 2V7QD 3EF0A 5D3QA 3F71A 3RS7A 4W5NA 5B6PA 2WSBA 3OJWA 1HEUA 1KYIA 1M67A 2XCOA 1X80B 3QI7A 3MWDA 4FUQA 4GZ5A 3Q85A 2XTNA 4GE3A 4TRNA 4ZEWA 3ZN2A 3WMXA 4Q6WA 1E5QA 2ET6A 2J0VA 3LLVA 3A4NA 4O59O 1DBSA 3R4CA 5AVWA 2DCUA 3IMEA 4YRKA 5LQNA 5HFAA 2QORA 3P9QA 4OHWA 5FBZA 1A8HA 1H5QA 4Q3AA 1P19A 2C7PA 1XEXB 3TI7A 4O25A 1JTEA 4PZPA 4RTPA 3FOZA 1ISHA 1R4MB 2A1UB 1DJNA 3WVNA 4D9MA 2BFDB 2DWQA 4KJXA 4MK4A 4YS6A 3ZJTA 2YW2A 1CB7A 4F93B 5JC1A 1GAQA 4M54A 1RWOA 2VRNA 2F67A 1FTWA 5TQ2B 3TSOA 4ND5A 2HLNA 2E5FA 2C94A 3AIMA 3EDCA 1VJTA 2EERA 3L05A 3TDKA 2DETA 4G5YA 4DW8A 4P0TA 2I3ZA 4A2CA 2V98A 4ZGWA 4A03A 5L3SB 1XTJA 3PEYA 1MQ8B 2O8EB 4OBWA 1QRDA 1Q2XA 3LUCA 3RLIA 3D4PA 4PIPA 1F60A 3K16A 4R1LA 1ML4A 4Z2YA 3TBKA 4MHTA 3DC7A 1I4OA 4PLCA 3AETA 1VA4A 3WIEA 4PN7A 1T4GA 1VLVA 3ASVA 2F4VB 4TYYA 1Z5UA 2VK4A 3M4NA 2GVDC 3FUVA 4MGHA 2GRJA 5A4MS 3X2FA 3NDBB 1N3BA 1XHFA 2PX0A 2I0FA 3IHLA 1L9KA 1JX6A 2WV7A 3SMQA 1WSDA 4FX2A 2WRZA 3QPCA 4HLUC 4H7EA 2OXRA 4KX5A 3WYGA 1DTWA 1YR3A 2VP9A 1AUVA 4QYMA 2BGMA 3AK4A 5INTA 2NPOA 1B16A 1ZW1A 1BKYA 2QX9A 3IS3A 3O3OB 2P30A 2BZ0A 3HJBA 3QYFA 4TYPA 5EWLA 4C5CA 3SLKA 1GZ6A 4PW0A 4DNXA 2BMWA 4TN5A 4G4IA 2PSJA 3BQ9A 3O21A 1L7DA 3K9GA 5I9MA 3A6PC 3CX8A 4UNQA 3UHJA 4IBOA 2HLHA 3IQWA 4KXYA 3JD3A 1A88A 3DFZA 4GLJA 5A3VA 2IV3A 5CB4F 1G5RA 3A8TA 2PH7A 2H7CA 4CMIB 2R11A 3HR4A 4MAFA 2ZYAA 2IPNA 3UJPA 1Z8HA 3ZDBA 4F45A 4GDFA 4TS3A 3X1JA 3IJ5A 4EG6A 4RPKA 1UFRA 3HWX1 3PNSA 2G0TA 2CF6A 2JAXA 2JI8A 1JBEA 2FZ5A 4C0HA 4PZZA 3FFXA 3HABA 1Z35A 3HB7A 3JX9A 3S2GA 4B6JA 5AHKA 4JZKA 4EVSA 2OV2A 4HI0E 3RSQA 1GVNB 2VPPA 1T4CB 4KE8A 4LMBA 1VZ3A 4TTJA 1B7GO 4D3YA 4LMPA 4YAIA 4K9RA 1U02A 1Y3HA 3D7LA 1GRNA 1QTIA 3OIGA 1GLGA 1S2IA 2XQJA 4MDFA 3ZR4B 2YWBA 4CM6A 5K0JA 1USIA 4IYRA 2C7RA 3IBYA 4XSGA 4YRGA 3FPHA 3UIEA 1P0QA 1R37A 2JFHA 1N2JA 1P4AA 3G9UA 5CD1A 1OAKA 1XVIA 4JUDX 3NYQA 5E95A 1YUMA 1YR2A 3CKMA 4DC1A 1DAIA 3W6OA 5CEJA 1P0CA 5YASA 5UKDA 3KL2A 3IXMA 3PFBA 4EB0A 5JOQA 1QR2A 4UNIA 1WUJS 3EIFA 3LBAA 3QUQA 5AXAA 3I2IA 4KE7A 4DCMA 1PEAA 1YT5A 5JDIA 3C0KA 2Z5LA 3EEIA 4EHKA 1KK1A 3ZHUA 1QLWA 1KH3A 4GP7A 1QNLA 5KKCA 1MB4A 2IHBA 4BFTA 3KSZO 3EK2A 5JS7A 3P2OA 5B7PA 2EQ5A 3GFRA 5EZ5A 3RB8A 4JI0B 4YVFA 4F9TA 1JHXA 2NSJA 2ZSUA 3SXJA 1GV0A 3ZCVA 3MXOA 3S29A 3GRFA 2FF7A 4R8LA 1QGAA 3K72B 4P98A 3I2GA 4QWWA 1OAOA 3RVBA 2JB9A 5I5EA 3FLBA 2W6JD 1V8BA 3QVJA 4M60A 4MS1B 4QDKA 5C9ZA 5LOVF 4E5UA 1U0EA 4PYRA 1X92A 4D82A 4BDSA 2CL7X 2BEVB 5JXGA 1Q15A 2WIGA 3BRSA 3L0CA 1CDOA 2E4YA 4JMPA 1DCTA 5I7VA 1W94A 5ELXA 3S2EA 3TTSA 2I1WA 4CODB 1PJTA 1PNVA 1NXXA 2W00A 1E79A 2DCMA 2VP0A 2GH1A 3JQBA 4AQYB 3CNLA 5C51B 3U3OA 4CV3A 5BV2P 3S1LA 5B12A 5EHZA 5JALA 5GP1A 3IVXA 4NJMA 2EU8A 4KYTA 1RSZA 3E9MA 3G7UA 4C0LA 3ZIAD 3H19A 3PCXA 3EC2A 1XPUA 1EHCA 2F8LA 3I45A 3RUEA 2W2LD 4JWKA 3HBNA 2RB5A 3CWCA 3E9YA 3KXDA 3L77A 5FPQA 3ZDEA 2CFSA 2V1XA 1H2RS 3D0KA 4K3UA 4PTZA 4OP2A 1RQXA 1MGPA 4Z4QA 4JYZA 1OV6A 1RP7A 5CLGA 3GEGA 1HDCA 4OOEA 2AUNA 3R5JA 3I6BA 1JALA 1K92A 4GRIA 2PWBA 1FVOA 3P4XA 3MMSA 1AXGA 2HT6A 4IUYA 5DIFA 3UMCA 4AY4A 1UEXC 2M98A 2PR7A 2EOAA 1JR3E 1OI3A 4TGLA 1UBUS 1UPUA 1IYZA 2NUBA 5DYNA 2PQ0A 3OIYA 1HEYA 1G8YA 4Z1MA 1W2GA 1L7VC 4MVJP 3UQZA 1G3RA 3SVTA 2FMHA 1IQRA 3CT4A 5EE1A 4ER0A 4F1WA 3COJA 3SQMA 4PQGA 4HDAA 4GAEA 1GZ3A 4PRKA 4D8VA 2QB5A 1L3CA 1GIAA 5AOVA 2DPGA 1M76A 1UMKA 2V4MA 4ND7A 2OGSA 1A9QA 4EGCB 2W6NA 4Q9KA 2X9VA 3M4JA 4BMSA 1RQGA 1ACLA 3U4QA 4O1HA 3A3OA 1SIOA 1ZC3A 1TPZA 4G23A 4HVTA 5BSKA 1A9YA 2BFFB 1E7RA 3TNDA 4C4XA 1V4NA 3IPAA 3R7FA 1BXZA 3A04A 4HGQA 5AM3A 5C32A 3WQBA 5KWIA 1RTKA 2GM5A 2KLHA 2EZ9A 2H0QA 2VUTA 3LRTA 4EG4A 1M0WA 2QSUA 1NBMD 3ZQKA 2WD9A 5A7GA 4IMRA 1WZCA 3ILSA 2P1ZA 4KZPA 3AM5A 5GZ3A 4OQ4A 4BGVA 3D4IA 1A2BA 1KERA 1CQIB 2ODWA 3WI7A 3K0SA 5IUNC 3FUUA 2NSLA 2PZLA 2ZSKA 2GFIA 3TJMA 2MYPA 2V0CA 2Y1GA 4XCXA 2D2FA 5GPBA 2YRXA 1ZESA 3NQ41 5KMGB 2N75A 4REQB 3HE3A 3J7TA 5CLLA 4LF8B 4X20A 4KFRA 3L93A 3CNOA 5E7IA 2EGHA 2Y0CA 3B5EA 1U99A 3DZJA 1GPLA 4P31A 5DGHA 3C70A 5E8RA 1MBZA 4QJBA 3PGLA 3D8BA 4LYYA 4W6QA 1G5IA 3LG2A 4GR9A 4HRVA 4K6HA 2GBFA 3WA7A 5LLDA 3ABRB 4F2GA 1ZCBA 2O3UA 3NIFB 2AJDA 2HU5A 3VBCA 1PNOA 2G4VA 4PPFA 3CC8A 4Y9RA 2ST1A 3U31A 5JJBA 4FE3A 5TMEA 2GK3A 2JFUA 3OA2A 2C2ZA 2QQ0A 2XEXA 1KGSA 3GPCA 3M49A 4MW6A 2ZVDA 4EI9A 2GX6A 2IW1A 1BZYA 3V6LA 4DWWA 4BN0A 2XCSB 3CCCA 4CNBA 2C3PA 3EUFA 4LYFA 1VKNA 2J1LA 4GT1A 2A86A 3GLRA 4Q9AA 4ZOAA 4G0WA 3F4BA 4BDTA 3DOEA 5EVCA 4Q7KA 1E9CA 1MOSA 2GWRA 2IBMA 2OCIA 4M9ZA 5D3MA 4WXMA 5EE0A 2CXOA 3T0GA 1VDZA 4HVAA 3AR3A 1A8PA 1CUJA 5FV7A 1H2XA 2EGGA 3CF4G 4I50F 3D4NA 2WINI 2W8BB 2ZUSA 3KV3O 1PQWA 1MA0A 1FX0A 2AJ8A 4ZVLA 3SBDA 1WAMA 1FB5A 2B1IA 2BM0A 5K3DA 2PL5A 4ISBA 4QTUB 4M37A 3UJ6A 2GZSA 3KWMA 2JLYA 3G9XA 3ZQJA 1QQAA 5JZMA 1OFTA 2V45A 1Y8QB 3MD9A 3UEOA 4YMGA 1AKWA 2PCLA 1B2RA 1BFUA 2FK8A 3IP3A 2JVIA 2AN9A 4J0CA 1D9ZA 1WXIA 3EAQA 1YS4A 1QIFA 1KR2A 2AMYA 4Z8YA 5DYIA 5TGDA 1TVKB 3ZHYA 4OAPA 1QS0B 2XXBA 5J4VA 2BGKA 1F2DA 3DYIA 2JGJA 1XK7A 3EVEA 3NBQA 3RUPA 2XJ4A 4HLCA 4ZAGA 2GHRA 4KQWA 3H5OA 2IJGX 2RAVA 1XQXA 2VDNB 2VDRB 5EXXA 4NFSA 1CJSA 3VR5A 3RUDA 4BZZA 1T9AA 2B6HA 1T3TA 2GOYA 3TIIA 4N5DA 2CWWA 3H04A 4GSLA 4Q34A 4FFDA 1AE1A 2DKFA 3ICWA 1EDEA 2ZI4A 1YDMA 4PF1A 5CT8A 3UKOA 4A8HA 1P0IA 3G8AA 5CH5A 4PM4A 4XJSA 3NHAA 2YN4A 1B26A 4W8HA 3EZNA 3T4UA 4BNJA 2JLQA 1IVNA 1DIOB 2HMWA 4UUAA 5GJCA 3WS7A 1QE5A 2R66A 1JMVA 4Z4GA 3CPHA 3A26A 2ATXA 2QVZX 4WESB 2GASA 1P4HA 2XVAA 4CXMA 1X80A 3PRKE 1DAOA 2UUAB 2HOQA 1ZM4A 3KKKA 4GUDA 5CITA 1MENA 1GAXA 1G18A 1N1DA 2IHYA 4QUDA 4CCSA 2JLCA 3RC9A 3EJWA 1SVLA 4BRUA 1V43A 3I5YA 2DTXA 3RS4A 4ILEA 1DKRA 4FCVA 2DRIA 5CFPA 2Q4BA 2I6GA 5LNK6 2WI8A 4XM2A 3MMPA 3K1AB 3NWBA 2VQ6A 2BMVA 3C6QA 2A1UA 1R4MA 2HF7A 3FPGA 1NUTA 3HBAA 2JHGA 2NU9B 3MWEB 4JR2A 1F17A 2BFDA 2QD1A 4HZGA 2QN6A 3SAJA 1CHNA 4BMNA 4LEIA 5BV0A 1QX3A 2JAQA 1TE2A 1A3CA 1SC4A 4FC7A 3GRCA 5TQ2A 3RU7A 1O7JA 5C7YA 3DOFA 4RL6A 3Q7EA 1ICIA 2XB9A 4HS4A 4MVJG 2V0NA 4WOCA 5CDHA 4GYWA 4IFEA 4UUNA 2NO5A 1GPJA 4AMUA 4WFKA 3FN4A 3R3YA 5L3SA 4EG1A 3JQEA 3QMMA 3O8OB 4ENSA 4OLBA 1EK2A 5J4KA 2Z8ZA 5EMNA 2O8EA 2PM8A 3RFUA 2ZUCA 3OCUA 4A23A 3C1AA 3PA6A 4C7OA 1RCUA 2Y1XA 3H2IA 4M0CA 1VL5A 3O47A 1SVOA 2WWHA 1P1CA 2W4QA 3KCQA 1B76A 4W1RA 2PRJA 4NAUA 3I04M 1AS0A 4TZ6A 4LKRA 1JMKC 3HCWA 3H05A 4LCJA 4J29A 1AJEA 1CRPA 1HYGA 1E7WA 4RV5A 2JGLA 1PT8A 2Y2VA 5IFLA 1EM8A 1JR4A 2O8DB 1TA0A 4YASA 1QIIA 3ETDA 2F17A 4G84A 4YAOA 3OZBA 3G2PA 4HZIA 4CKZA 2QVCA 3TRKA 1NR5A 3EF3A 4RACA 2VWPA 5AW7A 1M72A 5DNWA 1UIMA 4NU8X 3I62A 1KHTA 2EZUA 3C3DA 3FNGA 3HU5A 5HS6A 3FGNA 1KI8A 4LE2A 1WB4A 4U2DA 3RUHA 5JISA 1UL1X 5B37A 4AF7A 1E64A 3W5CA 3VA7A 4URXR 1GVHA 5LQUA 1U3TA 3VGJA 1KZ9A 4RGVA 4C0KA 5BOSB 4R8SA 2G40A 1JHUA 2HRZA 3LL7A 3MBIA 4BQNA 1JZQA 5EA2A 5ALVA 3DVQX 5ALHA 1JR3D 4QC2A 3MGKA 3A1TA 2YFYA 4JVMA 3WISA 1CY6A 2QTNA 3RVOA 3RUCA 3NHUA 1SBIA 1T4CA 1PJ8A 1UPAA 2CC2A 4HEQA 3VO8A 4B48A 4C7BA 2Z83A 4CMCA 5FWXA 1P7CA 4BO3A 5JZOA 3TM4A 4PGGA 5K09A 1MC1A 1X8XA 2I76A 2H48A 3EEBA 3IPXA 3NEYA 3W7VA 4DMMA 4KR6A 3RVRA 3DDWA 2HA3A 3BN3A 3VC1A 4WACA 2ZW9A 2ZRGA 5CB4B 5HFJA 2R2GA 1ISGA 1NQ5A 1Y1TA 2RJOA 5JD3A 3T3HA 3SZUA 3UF0A 1C7IA 2C04A 4MARA 2NM0A 2GETA 2XZOA 1ZPDA 3ZG6A 1NUAA 2V0GA 4KJZA 1BOOA 1CY4A 5AVQA 5JHGB 5AO9A 5F5XA 4CV0A 4C03A 3RAGA 1HDXA 2HSDA 3KCNA 3BB3A 4KXVA 1VG1A 3B12A 1T9KA 4M1WA 4UW9A 2QVBA 4MVXA 1JLKA 3IVAA 4GBJA 4W7IA 4F3YA 2I8LA 2BFWA 2VTDA 2WE8A 4MVJE 1UC8A 4MMYB 1U8TA 4OQFA 4PWYA 3VUFA 3ZV7A 4Q24A 4E5PA 3AKDA 2VT2A 3BVPA 3E1SA 1CZNA 5GWXA 1II0A 4XD7D 1QO0D 4V0MA 4B3GA 1QQ5A 1DQZA 1JQEA 4OHCA 3HYLA 4G0NA 3KHSA 3BD6A 3GJZA 4TZTA 2CY0A 4X44A 2R7KA 1OT3A 3UJBA 5L95A 3ZW7A 1AQYA 2ATVA 1SOVA 3DO8A 1SBZA 3I32A 2ZRDA 2XDAA 4S1TA 3TLMA 3E2MA 5A62A 4MB6A 2I29A 2W6OA 4MS1A 3RASA 3Q5GA 3T5CA 3FPEA 3TZCA 3DR3A 4CKCB 1A9RA 1MQAA 3K1TA 3QVVA 3OMXA 3V1KA 2CL5A 1SKQA 1YZGA 4OQZA 2BMJA 2HJ9A 1J2RA 1GNLA 4QSMA 3VYSB 3WIUA 4WFQA 5DI3B 5DHFA 3K4QA 3DQPA 1U5BB 1QZ3A 1JHOA 3C43A 2P2YA 2I8CA 4B3FX 4L0DA 5BSMA 4DJJA 2IL1A 2OB2A 3H65A 4PSAA 5CFLA 2ZI6A 5EKSA 4ON9A 1QVVA 4ZA2A 4DF3A 2ISSD 3HXKA 4HB2A 4KXNA 5HQJA 4Q37A 2PZJA 3CLSC 3QX3A 3QRWA 4RVGA 1HFWA 2OVFA 3K05A 2CLFB 4C2AA 2ZYVX 5FNVA 4II3A 1MJGM 4KIFA 5TE9A 3STHA 4DA8A 5AWFC 3AFHA 3H99A 3L4BA 1EFRD 3F8SA 1HL7A 3VSEA 4OYYA 6AT1A 1QKIA 3AC0A 3GFSA 1M2HA 4YAUA 2LD4A 3LS2A 2CXSA 3WK8A 3CN9A 1Y5IA 3OJXA 4TSRA 4X6YA 2FWJA 1WHSB 3ELDA 3NHMA 1J21A 3SC4A 1R9GA 3WQSB 3T9EA 1U6JA 1FFWA 1U1FA 1ZI6A 3N58A 3ONEA 4Q16A 4PN3A 1LJUA 1TMYA 3HZOA 4KR2A 1MORA 4AXBA 2VUSA 2IYNA 3ZU3A 1FFGA 2YRFA 5E4FA 4CMHA 2PXAA 3P96A 3NWPA 4UQLA 1TVEA 1U6IA 2CE2X 1XXHA 2IP4A 4XD2A 2FW9A 1E2IA 4EY5A 4ZEXA 4CN8A 2WYOA 3AFNA 1Y48E 3R6GA 2HU2A 4KX3A 1VCIA 4KYUA 2XCIA 1M6YA 5FV4A 1IEQA 2FG7C 1QPZA 4KREA 3VNRA 5J43A 1GDTA 2ZWVA 3TVYA 5BMVF 1CJUC 3D6FA 2O2IA 5AUQA 5TT1A 3QQ5A 4ZCRA 2EX4A 2VQFB 2L69A 3ROPA 3HCNA 4MKXA 1LZKA 1KBQA 1JDTA 1COWD 3R6LA 2JIOA 4DM3A 2XECA 4E4TA 5B4TA 4DEXA 1ADCA 4FW9A 1TJ4A 2JFXA 3GB9A 2H2GA 3DXZA 5BWOA 2BFFA 3F8WA 3W2HA 4D9NA 2W11A 3KLBA 2WKPA 1TZKA 1GRVA 4LRSB 3AVTA 1MG5A 1JEQB 4IVNA 2LKCA 5KYKA 2ZKLA 2ZTUA 4HXGA 2BTOA 1ZJWA 3H5AA 3MLAA 1U2DC 1T8RA 4GLBA 4LW8A 3IQXA 1ISIA 4YRCA 3BRWA 4E2WA 3FPCA 2G9NA 3DAOA 1ZVKA 3EOAI 5JCZA 4J0JA 3CB2A 3AVPA 2CYAA 2CV2A 3W77A 5KMGA 1E94E 3ESBA 1H8EA 1MGOA 2A9QA 4REQA 4AZ0B 1C4XA 2Q5CA 1M1ZA 4P86A 1SH7A 3PUIA 1P7VA 1YIOA 2IIVA 4XFKA 4Q1VA 3WRXC 3CPSA 4ZI2A 3KJHA 3LXUX 2D00A 1J2EA 3LBFA 4M36A 3N75A 5FAKA 2Y77A 3DOHA 5CHYA 2QXTA 3EQ7A 4OX9B 2FWRA 1GLVA 1WULS 4DIKA 5JO0A 4X65B 3ZGXA 5IKMA 1ULAA 2QUIA 2X3FA 4U2KA 3TOSA 4ZEOA 1JFVA 1U8YA 2QMHA 1JAIA 1HKHA 1LTKA 3IB3A 4QDUA 2IWHA 4H17A 3UYLA 4ABYA 2ZVPX 5ITZA 2FVXA 3P0EA 4Z0NA 3WK9A 4W9NC 4LSMA 1T1JA 4FU0A 2CL6X 3P27A 2CEKA 1TJNA 1JHPA 2ERXA 5FUMA 4I6GA 3WK4A 4CQLB 2JGDB 1M0SA 1G5TA 3ETJA 4PFQA 4Z5XA 2R8ZA 1FEZA 2BMAA 1U2EA 1E2LA 3ZCPA 3KHUA 1SKUA 1P0FA 1UBFA 2P9TA 1K7YA 2XYRA 2H06A 1YS7A 3SYMA 5KNCD 3DTVD 4G97A 5DW3A 2I03A 3AKCA 1XAIA 4ZVQA 1ZMBA 1QYWA 1REQB 2F59A 5GJVC 4R8MA 4Q9IA 4B9AA 3IE1A 3WKCA 1TAGA 2CJYA 2AL7A 1DIRA 5CX4A 3TAUA 2OV4A 2SICE 2QZ4A 1XKTA 2PS1A 3AY6A 4PZLA 5CTJA 5L3VA 4E2ZA 3WLOA 3RG2A 3IIEA 1U0OC 1O5TA 1P2BA 1Y8QA 3DHVA 1M1UA 4ZCQA 3T3GA 4HAIA 1PN3A 1IHPA 3CLTD 1APBA 3WL6A 4A27A 2Q4TA 3K9CA 3B8HA 3KAQA 4Q1FA 2GCOB 4NQRA 5FR1A 5IKOA 1TVKA 3HCEA 1MAVA 1QS0A 4HNSA 3VDQA 3OQ6A 2YUTA 3NVAA 1O94D 2VYQA 4Z0PA 1ADYA 1ZMTA 1IB0A 3BXFA 4I50B 1JFSA 1V8FA 1M33A 3LD9A 1V6SA 1SUSA 3AGPA 1JYFA 2G70A 2XNCA 1VDMA 3GJSA 3ZZ1A 5AM1A 1IB6A 4QFCA 3WGIA 1HT3A 2LVBA 2Q0XA 4EA8A 4FN4A 4BKRA 1NI4B 3OIFA 1LQTA 3MJ4A 4ZYLA 2GERA 3MFQA 2XCUA 3OCZA 4RW0A 4RPLA 4HDNB 2C9DA 3A06A 4NBKA 5ERXA 5U1PA 4EM6A 1DE0A 1RMTA 3GV0A 3B7PA 1PEDA 1LLUA 3O3MB 2DQSA 1ZKMA 1GSOA 4TTTS 1Z2PX 1E3EA 2RKOA 1TYEB 3N2KB 5BYBA 3UPUA 1GUBA 1PG2A 5AM4A 1Z4IA 4GOND 2YL2A 3P45A 3PT9A 4I5GA 4IH1A 3VISA 3NTVA 4OJNA 1O89A 3QU2A 3SEFA 3VSAA 3K5IA 1U7PA 3T4EA 2BY4A 3KAKA 1Z0AA 1BA2A 4RGBA 4WASA 5IG2A 3PGXA 4IS3A 3EDRA 2X14A 1QBKC 2J7KA 2OSVA 2GSDA 1AURA 2CBGA 3QPAA 3NXSA 2FDXA 1B00A 3TDMA 5FYQA 3W9UA 3BCHA 5AIBA 2QX4A 4MVJD 5KJ6A 1YRQA 1FYFA 3JTEA 2GHIA 3ML1A 3K1AA 4B3SB 1XRLA 4WKOA 4QPZA 4MWGA 3DDOA 2JLZA 1G63A 3JZMA 3MWEA 4XEUA 3FTCA 1VKRA 3S68A 3NYIA 4BNNA 1VG9B 4F11A 2G4CA 3R3VA 4DNFA 2XNJA 3DB2A 2PIDA 2OQIA 5EJ9A 1TEXA 2R6CA 4DVGA 3LP8A 4LV6A 2WIDA 3VYWA 5KINB 3HPRA 2VYND 2BUCA 4PICA 3VAYA 4WJKB 4YUXA 3O8OA 4OGKA 1V96A 1DLIA 3R40A 2IYTA 4PTYA 3SQNA 2BH2A 2EKDA 2ZBFA 4BNYA 4XGNA 4G0UA 4DCVA 2RE8A 2LKDA 3ETNA 2B30A 1E9SA 3D59A 3ENNA 1KNXA 5EYPB 4C4AA 3E5MA 1VP3A 4U0KA 3FI0A 1PR1A 4URWR 5EEHA 5ETJA 1BEUB 4R98A 3WGGA 4AWBA 1CEYA 3TFOA 3EZ6A 1YZHA 2GPBA 5KQGA 1WWKA 1E2MA 2P8SA 3KM0A 2ESRA 3N86A 2DXIA 4FEGA 2O8DA 1Y98A 1BDBA 1GCUA 2Z4RA 3FDZB 1PL8A 4ZVUA 3J81A 3N5CA 2Q5FA 3PXXA 4M8NE 4LIPD 1E3IA 3NAGA 2WUVA 4KQXA 4PG6A 4UMVA 2NN3C 3PFCA 4MJ3A 3GJTA 3Q6NA 1Z3CA 3LH5A 1RKBA 1DC3A 1LW6E 4ZT3A 3B38A 3DVSX 1XI2A 4J4BA 1GDDA 1T8SA 1TC2A 2FLWA 2JAPA 4OL0A 3U4CA 4KHPB 5JJCA 4KYVA 4BE4A 5A06A 3DMFA 3P9NA 4HDMA 1G9SA 2X86A 4JZYA 1N2ZA 4IICA 2CK3D 2PLRA 5HEKA 3SKVA 1K5PA 1NASA 3S1SA 1UP6A 5BOSA 4DS3A 1GYRA 4JNCA 5T64A 2JGKA 1QGUB 1V95A 1W29A 3LTEA 4RA9B 4RZ2A 1HDGO 1IG3A 5DX8A 1YJQA 4AKTA 2BEKA 1X1TA 9LDTA 2X7JA 4CM9D 4DQLA 4URHA 4EQ6B 5LJIA 2JLUA 3AM4A 4RFSB 3NP7A 4KZKA 5ISMA 4F85A 2AN5A 2JNWA 4O0LA 2I33A 3HJTA 4DIMA 1EUCB 4R7ZA 2V6MA 2L82A 2GCEA 1KEZA 1FNNA 1E3DA 2IFTA 3DZIA 1IPFA 1X77A 2PYZA 1B93A 1RADA 1IC6A 2FG6C 2O57A 2ZT5A 3MJFA 4H18A 4EDFA 1E2UA 1E5LA 5CB4A 4JOSA 3EA4A 5PGMA 3P9ZA 3MGAA 5CG2A 2EWVA 3NHFA 2GYUA 2UYCA 4BU1A 2B4YA 1I6MA 3G5MA 4KB5A 1YIDA 3WBBA 2QT0A 4NYIR 1OF1A 4R1MA 1EVQA 3WWZA 3TF5A 1WU8A 4MINA 4RQUA 3W4JA 1VCNA 3AEQB 5KDDA 2CFOA 3MUOA 2NYUA 4HH3C 1A98A 5FBHA 2EQBA 3ZJVA 4RLFA 3V8VA 2YBDA 4Y2YA 2JEOA 2OYSA 2Y71A 2AJBA 2ZIFA 4MCHA 5I7UA 3NOXA 3UJ3X 1H2YA 3UGQA 5BP7A 4AB1A 2GPNA 4WEOA 3KYCB 1U81A 4CKWB 5KTSA 3JYQA 2JIPA 1ZIYA 2A9OA 4ZTUB 1WE2A 2C20A 5FADA 3ZWDA 4AU1A 4D4GA 1RQPA 2RH9B 3KOMA 4G0QA 4UTXA 4DANA 4OQYA 1ZS9A 4KVZA 3ZY5A 5DNVA 4TT3D 1F2TB 4J16C 5LYJF 1PNQA 2DHEA 3L7CA 4AMVA 2P2CA 4PYLA 1G4AE 2GN1A 4CKCA 5EJEA 3EDYA 4TSFA 3JXEA 1V7CA 1B3BA 1SY7A 4BMYA 4BX0A 1E3WB 1LSSA 1SZDA 2Z3WA 3GN2A 3OKPA 2EX0A 5AK5A 3UGTA 4NCAA 5DI3A 3BE5A 3E61A 1DU4A 3UXHA 2P90A 3R6DA 2PMWB 4IOKA 4DABA 3DZKA 2G25A 4NABA 1M9NA 4K6FA 2RSLA 1HUQA 1ZD2P 2C5LA 4EI2A 2YJ6A 3HA7A 1GARA 4PCLA 4EHLA 1R9MA 4ZZ1A 5JWRA 1N8SA 1TEVA 1W6RA 4A3SA 3LECA 3GHYA 1DWQA 4IILA 1PD0A 3DP7A 4XCQA 3RFCA 3IHTA 2FLVA 4DCSA 4E11A 4N3GA 1KP3A 3IMFA 3MWYW 5BMOA 4RM3A 1C2YA 3NBMA 4CMEA 5LOVA 1I5RA 3VV3A 5IKXA 2N1MA 1OGYA 3TOCA 5IAJA 2BONA 1Q77A 4HG2A 1R0RE 2WWXA 3PX2A 1UADA 2JA1A 4PONA 2O07A 3W78A 4BBZA 1E8DA 1CQZA 2XT6A 1SCAA 3JQQA 4J1QA 2Q5IA 3STWA 1G8KA 3COVA 3QY0A 2C78A 2BFNA 1H4VB 2XAAA 2XW6A 1FSFA 2Y4OA 4JA2A 3TIVA 3TZQA 5DHQA 3WGTA 3ICEA 2DU8A 4O3FA 4U7FA 4KRXA 1Z2NX 3PJGA 2X6RA 4EQZA 1IHOA 4CIAA 2X40A 4RSGA 2VPTA 4P7GA 1YL5A 3LGXA 2X23A 1FJGB 4FD3A 2AZTA 3RHSA 4I4NA 4UCWA 5B1EA 4CV2A 3NDJA 4YONB 1OFGA 3WKDA 2ZYUX 1ABBA 1N2IA 3P7MA 1X9GA 4HLNA 1GQRA 4QLOA 3PPWA 3NUZA 2JI6A 2Q21A 1ARZA 4BE9A 2NUPB 4QOHA 2NTJA 3G9ZA 2W83A 6YASA 5HZMA 1L7BA 1O0CA 5F12A 3R9KA 2IELA 4LHEA 3I5UA 1CY7A 3SQDA 1M2OB 4LN1A 4BL5A 1MB3A 2EKLA 3WA6A 4URVR 3W8EA 9ATCA 1N7IA 1JAZA 2G1JA 4LDAA 5H3HA 5C1DA 1JEQA 1IJEA 1AD2A 4XJVA 1QH9A 4RD2A 3RF6A 4ROSA 2DMRA 2XD9A 5AXCA 3VC2A 1U2SA 1OHHD 2R85A 2QVGA 3LUAA 3JAMA 5LXTB 621PA 3AY7A 4N18A 3FMGA 1GGMA 1TA4A 2XQFA 1A5SB 1PWYE 2CLMB 3FGPA 4IDEA 1CF9A 5AK0A 5BMVB 1RLUA 3IBFA 1Q1EA 4CDNA 5LR6A 1T9DA 3LIPA 4UHHA 1SXPA 4AZ0A 2HREA 3ZDCA 4UTZA 4L75A 2PMFA 3KU4A 1DIGA 1A76A 2F3PA 4O2BB 1KI1A 2WJZB 3RRZA 2P6UA 4EH1A 4EL0A 5L4SA 2HSEA 4LOLA 4WK6A 5E4YA 4LTDA 2D1TA 4WECA 1YA8A 3KOXA 4WAUA 3IX7A 3M1YA 2FUG6 1O0BA 3CE9A 3TQRA 5KB3A 1EXMA 1IIBA 1BROA 2R60A 2FW6A 4N5NA 3UT5B 3BDVA 2J5XA 1HE4A 1II8B 3O8NA 3DOCA 4BMOB 3GD5A 4RH0A 2W2TA 3DUFA 3D8HA 2PAFA 2IXFA 5IBQA 3TZ6A 4EJMA 3ZOZA 3G0CA 4CF4A 4YMSA 3ISVA 5J40A 4G8DA 4IMJB 2VDWA 1C7EA 1R2QA 3RIGA 3FPBA 3C98A 2JFPA 4R51A 5JAUA 1XCMA 4MVJM 1L5GB 5JAOA 4B8YA 2M2IA 2NAFA 6Q21A 1ZRSA 3G7NA 4BN5A 1KTIA 3O93A 4DA6A 3AZOA 1MCZA 1P1HA 2LP4Y 3D2LA 2FX5A 1CUEA 1Z68A 2A88A 1W36D 1IHDA 1IG0A 4QUJA 4RKFA 2BBSA 5IJWA 2VTBB 2L18A 2PFSA 3KVRA 3U48A 3A0RB 1G8GA 1QFJA 3B78A 2AW3A 3KYIB 3NV7A 4O63O 3ZEIA 4TTIA 2YWCA 2H0RA 4JV5B 2ZQZA 3ZJ4A 4OAOA 1EM6A 1I94B 3SDZA 1FBTA 4YV0A 3NEAA 1IVYA 1CZUA 1OPRA 2QYTA 1JEDA 1BMTA 3IPRA 4RADA 3KJEA 1IMOA 4GLLA 1RYMA 3KFLA 2XUHA 3WOHA 1H8HA 5ER9A 4TRJA 2D5BA 2UU9B 2WU3A 5DK4A 5IUJC 2HF2A 4EF5A 3O38A 3EYAA 4D56A 2GCOA 1SK8A 2WD8A 4MQEB 4DCJA 2WB2A 1PJ2A 4ZPXA 3CLUC 4G5HA 3DT8A 3PGJA 5EWJA 3WLQA 4I50A 3TGPA 3I3OA 1T9GS 5GV7A 4K9OA 4A6EA 4FR2A 3IT2A 2NO7A 3GHHA 1YBAA 3TXYA 3UXMA 2JRLA 1S7GA 2Q1UA 4UTVA 1W25A 3C1OA 5FBWB 2G6BA 5DCWA 5GAJA 4BQOA 3V2GA 4JEHA 1NI4A 3PRYA 1PP4A 4YJ3F 1E69A 5KBYA 1IUOA 3AR5A 4RTOA 2H9YA 4GYJA 3SX2A 1KMIY 3GVHA 4IDHA 3S55A 4MNTA 1ZHHA 5DGXA 3OVMA 2DLDA 4KKXB 4BO0A 4QTYA 3K2EA 3DMGA 3LP6A 5EHIA 4HRYA 4EJSA 1UOPA 2GPWA 1KBZA 2CXNA 5KTKA 5LWHA 4WIAA 3BGVA 2GFQA 3RSGA 4XGQA 5LUAA 1S6YA 2NYRA 1AHHA 1ONNA 1JIVA 5K51A 3AF6A 3IJPA 2LXNA 2C95A 3DZCA 4PZAA 2IV7A 3RTDA 2W6MA 2CNWA 3CY6A 4G8JA 2RHDA 1NG1A 5CFQA 2V55B 4FGWA 2IZ0A 2R84A 4RK5A 3LXMA 3EVTA 2LDBA 3BFJA 1P9LA 5JMWA 5EPUA 5G1OA 4Q9JA 3ESRA 4C2UA 1KOLA 4UAUA 5IBRA 5C5DA 4H1WA 5JXJA 4H7JA 1RXIA 3GJRA 4LX8A 4D96A 3EFBA 5FBRB 5J47A 1RAIA 1G7SA 3E0QA 4Q4DA 2GPJA 4CKEB 3G0GA 1B8VA 3E7WA 3N8HA 4P4SA 5I9LA 3DXFA 2RHMA 3LBYA 2AEFA 4DPKA 5KNDD 5GQSA 4OMDA 5IABA 3QWBA 5J2TF 3BWBA 2QAGC 5MN6A 2CDBA 1C0KA 1NJ2A 2JBHA 2WYUA 1FDVA 1U28A 1ZM9A 1UUFA 4AZ3B 3SY8A 4AIRA 2C4WA 1WD5A 3UCEA 4XUEA 1IQPA 1MJNA 1FRFS 4LRTB 1Q17A 1UXJA 1W4BA 2DHDA 2IUUA 4CHTA 4G1FA 1N9GA 4NAVA 1JDVA 4G5RA 3R75A 2A57A 1DV2A 2P40A 1PRYA 2IHTA 4YRJA 5IZCA 1E7YA 2ZZNA 2J67A 5EYPA 4K5QA 5BUQA 4BB9A 3JYOA 4IXWA 1NLYA 5CXXA 3ADOA 1ICEA 1R6DA 1THTA 3MINA 4FKMA 1PBTA 4G07A 4LHWA 4TKVB 1OTHA 3FVVA 1DUVG 3HDHA 2H63A 3VH2A 1E6EA 3AV3A 3T3PB 3OIDA 4EX7A 4PVDA 1N5MA 3WP1B 4JP5A 4Q03A 5TQVA 2WEKA 2OGWA 3KP1A 5CH8A 4C7KA 1TTTA 2NZUG 3FDZA 2X3UA 1J0AA 3MZ0A 3VH1A 1HKUA 4DUZB 3NH9A 2BEWB 4WK2B 3LDFA 5FOQA 1PT5A 4PX9A 4ZGBA 2HX1A 3DO5A 4JT2A 1P6XA 2VCEA 3MB8A 1N2CB 4MH0R 5LD2B 3LIIA 3LGSA 2HIHA 2ORED 2CVHA 4O4JF 4B3IA 3UK6A 1U8FO 4M7OA 4C7VA 1E1NA 1KJ8A 1LSJA 4HN9A 4DCTA 4UFPA 1GYQA 2QN8A 1JKMA 2EZ4A 1U0TA 1MC4A 4RENA 4FGUA 4HADA 2I7TA 4QTXA 2HIAA 1YQQA 3HKBB 3KL4A 3E7FA 3R1IA 3AOEA 4RJLA 5FUVA 5EJ5A 4E51A 3QEOA 3OQOA 2DSNA 3EGCA 3GMDA 5C8DA 3CLVA 4ZKDA 2EEPA 5F77A 5KCMA 1I32A 1XMVA 1QGUA 2SNIE 2Z6VA 3HA3A 3LXRA 2CZGA 4R7TA 4U5QA 1KEPA 3HSYA 2AZMA 5CVCA 5HGJA 4ZYXA 2I2BA 3FR7A 3KTDA 4MYRA 4AJIA 1OH5A 5FI3A 4EQ6A 3R3SA 1TX4B 1S8OA 1PZGA 2KYRA 3CA8A 4A4DA 1VLZA 3P0RA 1X70A 2W37A 4D9JA 2VZLA 3LM8A 1KF0A 1XNGA 1MDBA 3K15A 1EUCA 4OD0A 4DNPA 2ZWMA 3ZGZA 2FEOA 1O97C 1TF7A 3TSWA 1QK3A 2YZMA 4CDGA 4JI1B 3KWJA 4WLFA 5TEWA 3EGOA 4EHNA 2V8BA 3H1GA 3JAKB 1WIWA 1A2QA 2D1FA 3W79A 3DFFA 4O02B 1KA9H 2X2EA 3IAXA 3WWCA 4F7WA 4FHZA 3KALA 1KEEA 2BM1A 3ETEA 4OKSA 5T6MA 1PTJC 4V1CI 2C9ZA 4LV8B 5EP3A 5DBEX 2I5PO 3W05A 4KXMA 3UAXA 3WL5A 2YXLA 3AEQA 5EUBA 3U3DA 4EYSA 2AKEA 5CTAA 2C2YA 1RPZA 2CCJA 3IE0A 1MABB 1ZUD1 3CH4B 4K6OA 1G5FA 4DRZA 4NCNA 4NYMR 4F56A 3UO8B 2PPLA 3ZBQA 3EXEB 1P9RA 2O0KA 1VYTA 3WAKA 4J91A 3KYCA 4YHBA 4G3XA 5DO9A 4KO1S 1XK6A 3IP9A 3DNFA 3UMRA 4ACBA 4FEEA 4CKXA 4CF7A 3IILA 5FXMA 1ORHA 3WLJA 5CJPA 1F2TA 5AMXA 2AD5A 5ALXA 2ETVA 3C41J 2YOHA 4G0MA 4GKVA 3WNBA 5LDDC 4QOIA 4C0AC 1EFTA 1MF7A 2NVUA 1CIVA 1CZRA 3ESAA 1KETA 4P7KA 3LPMA 4Q5IA 4JI5B 4CQNA 3PHCA 3UW1A 1RE1A 1A5BB 2Z4TA 3BF8A 4DGSA 4IIFA 5IT9A 3IUYA 4J6EA 2A14A 3U3XA 3ELYA 3MWKA 1YCGA 2DERA 1XJ5A 1L0BA 2BFPA 4EY7A 3KB1A 1BDJA 4LFCB 4PCAA 2CLIB 4NL4H 4ARBA 4C1BA 1GL7A 3L84A 1VKOA 3JALB 3BS4A 1JBKA 1I2MA 2QL5A 4RYLA 4WK0B 4P32A 5IXYA 3H84A 1KMMA 1JLRA 3CBGA 1SCBA 2IGBA 5BSRA 1H2HA 3PXGA 4LWOA 4E3ZA 5LYJB 2DUMA 1AKVA 1JQJC 4PAQA 4WFJA 5DJ5A 2VZ9A 3CRZA 5E1BA 1HNXB 1MO3A 4GRAA 1WMEA 2EAUA 2Z98A 1QHYA 5H9VA 4O4LB 4AN4A 1YOVB 2YH2A 5A5VA 2C92A 2A5GA 5DTIA 3OD5A 2APJA 2Z2XA 2Q46A 1ULBA 4QXAA 3FNIA 2GRAA 3E48A 3HN7A 3I0MA 4MDYA 3WL3A 1F8XA 5K0EA 2QAIA 4TS1A 3AF1A 4IOMA 2FN4A 4P33A 1L4FA 3FZEA 4BN4A 3DUWA 4XGKA 1Q0UA 1L8QA 5M29A 4PO1A 1VGQA 4C43A 1I4LD 1PJCA 4KO8A 4H35A 2SCUB 2NSYA 2P62A 5BUSA 5K3FB 3DKKA 2R6HA 2C3OA 3Q3EA 4ZO8A 3VPBA 3J7AC 1N0HA 3IMCA 1P75A 2J3MA 3VJKA 1A9SA 1V7PC 2NUPA 3RJMA 5BT8A 2ZIGA 3P71T 1FRVA 4G0YA 5KHOC 3ZVRA 2B99A 5FTMA 4EUNA 1T6BY 2BMFA 2HMSA 4HBGA 4UHBA 2GGSA 3QE9Y 1X1AA 1OIWA 2BR4A 2WIBA 4G67A 2LW7A 2DE0X 4DXAA 1TGVA 2AG8A 4Q7JB 4WX2B 3V46A 4D9BA 3KOUA 4YAFA 3BILA 2JJ2A 4HJXA 4MUYA 5KJEA 1UFKA 1A4UA 1ECPA 2ZBGA 4R84A 2Q0HA 4Z9YA 5T4BA 4YDHB 4BP1A 2BGTA 5LBUA 5IN5A 2YY6A 4IKEA 4CI9A 2AKYA 1X1EA 3L7IA 1SK9A 3LMKA 1WZEA 2A84A 4G4JA 2BCEA 1GLNA 4GC9A 4K8RB 5G0UA 4RK4A 3WTBA 3EXFA 1M6WA 3U7JA 5KVQA 2OO5C 1PUXA 3TPFA 4YRPA 3V80A 1E59A 4D99A 2H57A 5BMVA 2XUOA 5GM1A 3EHDA 2VP6A 2GUGA 3K73O 1PHRA 2CMFA 2VL7A 4G4SP 1Q0ZA 4GGMX 1CB0A 4O5AA 1PLJA 4MR7A 3VJRA 4YRFA 4JU9A 4LYJA 5CFOA 1E0JA 3DMTA 2OC9A 2FMUA 3FX2A 2ZQ5A 3E15A 4BJ1A 3I83A 5KOIA 2H1OA 2NZJA 1UP7A 1PZEA 2DJIA 3UT5A 4KQGA 1JT9A 4MP6A 2PV0A 3KSAC 1ISRA 1II8A 1SCKA 1WMBA 4FHFA 4O2AB 5TT0A 2BOVA 4DLRA 1GR0A 3OZ7A 1J00A 2RHBA 3O92A 3LXXA 4YQZA 2X6QA 4E2FA 1G3QA 2AN3A 4LTNA 4UVHA 3DYBA 3FYUA 3T7AA 3W9YA 4NOMA 2L2QA 1I51A 2WVAA 3DM9B 3UOGA 1JH9A 2XTZA 2CLSA 3DV9A 4BC1A 1FMJA 4MV8A 1UODA 1GPDG 4X3PA 3FVTA 4WBXC 1G7TA 3BTOA 1L8LA 1D04A 1L4EA 1UF9A 2E89A 2WAMA 3BXEA 5HF9A 3ROKA 1KY5A 3WK5A 4WA7A 5E9WA 2GHQA 2W6ID 3ZV4A 4JUCA 1JG2A 3HO6A 1KFBB 5A4DA 5M04A 3JZDA 3SLRA 1Y1QA 5LLSA 1U0FA 3LLSA 1LPOA 3H1FA 1E9RA 4GG1A 1Q16A 1WHTB 4ZOLF 4D0RA 2PZAA 3S2YA 4IKPA 5M7EA 2ISCA 1ZUNB 2WFAA 1PK9A 3I9FA 1EVLA 4H0CA 4HH4A 5HJ2A 3SFVA 3VNSA 1SVNA 1E6LA 4ZO4A 3ANNA 1TRHA 3WNDA 4B6QA 1UM8A 4C9BA 4PCVA 2YZGA 3TPCA 4A1OA 5C35A 3RRMA 5CBPA 1MFZA 5JRJA 1H6DA 3AEXA 2ORYA 2QRUA 1US8B 3K5PA 3OPQA 1FK8A 1HE2A 4DXHA 1SRRA 2IT1A 4MQEA 4U2CA 4RD6A 2JA2A 2CBXA 1F2UB 1SB8A 2X2PA 3EISA 1NATA 4GHWA 3RTEA 2D0PB 2OCYC 2UUBB 3PP8A 3TO5A 3WZLA 4GEKA 2DP4E 2O8CB 3JR7A 2B8WA 1NXTA 2FCAA 2BV3A 1RACA 3A3PA 3LT1A 5FUQA 3KVOA 3NTLA 3QOXA 2HNKA 4I66A 4IDQA 4FIDA 2MSEB 4KWTA 4XR9A 5JPIA 4C2BA 5HZKA 1Y7PA 3A3YA 4AJOA 1NMEA 3IBCA 5LL6P 2DR3A 3LUJA 4E5SA 4D97A 1AGNA 1R88A 1BJTA 4UUBA 1JQKA 2O14A 5HRUA 2O23A 4CDRA 1ZIOA 1WBJB 5CYPA 1F2VA 4BX8A 3VZPA 5HNKA 1RVDA 2JBAB 3B3QA 4BP8A 2H4JA 1LS6A 3UVEA 4G01B 4PSCA 5EOVA 1QMPA 3W8FA 3UGJA 2JD0A 1KC3A 4Z99A 2NO9A 2B2XA 1WNFA 3UNXA 1CS0B 4ENWA 1D2EA 1M2JA 4CT4B 4Z54A 4OI4A 2ZAOA 4YHHB 1OXXK 3CR8A 2QP9X 3INTA 3GIWA 4RIIA 4KXQA 5J4HA 1NSFA 2BC9A 7ADHA 4YRLA 3RJTA 4YJ3B 3N7AA 4ZHQB 3QLUA 2BGIA 3ZY6A 1N75A 3JQFA 4ARVA 1JHQA 3OM0A 4UD2A 5D8DA 2PNFA 4LECA 3O8QB 3TYXA 3PI6A 4CKEA 4M46A 1U2PA 3HV2A 4JODA 2ACKA 1HL3A 3C3AA 3D3NA 4PCUA 5ESXA 3V42A 1YZQA 1IRXA 2BGNA 2NGRA 4HAWA 1T4BA 1N34B 1QFSA 3MQ2A 1ZCAA 3PL5A 2CJXA 3STUA 4WDRA 1NBAA 3DT9A 5K0LA 2W70A 4AZ3A 3U60B 2QD4A 3F6EX 1XP8A 4Z1MD 3BGIA 4CMGA 5HDQA 2P4HX 2N46A 4OHZA 1U0BB 3TQQA 1A9ZA 3ER9A 3PGKA 1H3FA 4PLGA 3KV1A 5CLHA 2GNAA 1L4HA 1SZJG 5AP9A 1DKNA 4FLFA 2FMFA 2A0UA 1FTYA 3KJFA 1TU4A 1GRCA 1ZEMA 2EEZA 1P7WA 1C41A 1HY3A 4MUFA 1G55A 2QVYX 4L73A 3WHLA 2EATA 4B7CA 4BEWA 2P3SA 2NW6A 5EE9A 4TKVA 1DRUA 3OM8A 4JI4B 4XW2A 4JFRA 4M0FA 1AT1A 4RPJA 3GLGB 4L1KA 1WUYA 2YJGA 5C1IA 5DSXA 3G1UA 2D1YA 4MJXA 2WJHA 1AIPA 2PKXA 4G0OA 3QX9A 4QFMA 1T0BA 3LVQE 5LPNA 1UAYA 2C5GA 3MRXA 4IO0A 4HEJA 4E4YA 1Q1AA 4D3FA 1BDIA 1YRAA 3U4GA 1N2CA 2H4HA 1QGYA 1SM4A 3B3AA 4HQ0A 4AW9A 4BGIA 3FWPA 2OBFA 3WRYA 2FN3A 3KQLA 2E2WA 3GC6A 2J33A 4WCFB 1WEHA 2JZCA 1ZMOA 2IYXA 1JXOA 4K8OA 5IRCD 5SZHB 5EMJA 1BNCA 3CSUA 1A82A 4BO4A 1QE0A 4RWEA 3DCNA 2Q6LA 4HUQB 5E4JA 4FFVA 3S27A 4U6NA 1XNQB 2XUJA 3R5TA 3V48A 1DXOA 5KYGA 2RH8A 3M4ZA 3HP4A 2WAAA 2I3DA 1WMFA 4NEQA 4EG0A 1QRTA 4QRDA 4NENA 2EV9A 4N7BA 1YDHA 1GAJA 4NK4A 2QTLA 4WMLA 4F9EA 4I9HA 1TMOA 2IYZA 2QMZA 3DDNA 3TW4A 2PKEA 2TECE 2R4TA 4O4JB 3GLIA 2PV7A 3ZY3A 2R7AA 1W1WA 3ME5A 3MTQA 1BAPA 1MU0A 1BMFA 2PPVA 2XV1A 4FP9A 3ZE0B 3ZWOA 5FWYA 5CDGA 5JZBA 1JIJA 2QM8A 1WTAA 4RIEA 4EHIA 3SFZA 1TQ8A 5HWSA 2OMKA 1U1IA 1Y0BA 3ZGVA 1R5OA 4YCCA 2I91A 4BWVA 2PGDA 2WU1A 4J6FA 1ETUA 4XASA 3Q87B 3I8XA 2B4KA 2F1HA 3TR5A 1QHXA 4P83A 4NZ9A 2IZ6A 1JAHA 2O7RA 4HXEB 4KSYA 2WQ6A 5I9SA 3K0KA 3CNHA 2PS3A 1J0CA 3LWZA 4BNXA 3B1JA 3VU9A 2QZZA 3AEYA 1DKLA 1T0HB 2RGDA 2XMZA 3P2YA 1JJBA 2EBFX 5JCOA 5LMUB 2R44A 1GTG1 1MABA 3M6WA 4NMLA 4FOPA 3IMGA 4DBLC 3RK1A 1JG3A 2YC4C 1Q14A 4CQJA 3HM9A 4CGZA 4R2XA 3UN1A 1YBHA 3ADDA 4XAQA 3EXEA 1XN4A 5L4NA 1Y9DA 5CIQA 4B40A 4IDGA 3NYRA 3OFKA 1PX2A 3L7JA 2P1DA 3RANA 1UJMA 1N5LA 1I3NA 2WTNA 2QM3A 2D0IA 4GGOA 2GS9A 1ZX1A 2V7VA 3EBOA 4LRYA 1XXHE 1XNHA 4D0GA 4DMFA 3GLSA 3BREA 3B5JA 3V7NA 4XQEA 1UBEA 1XDZA 4LQCA 1D1PA 3GFOA 5IF3A 1N6LA 3PNKA 4FHCA 4OSEA 1CQJB 1TFUA 4LTMA 3GW8A 4NBVA 5DM70 4ZTZB 1E2BA 4F0JA 5ICMA 3ORYA 5JNSA 3QU5A 1WO8A 4TLBA 1VHDA 3DBHB 2GAJA 4W5WA 3ER6A 5TVGA 3PB3A 4LBWA 3IAEA 3LUBA 3VR5D 1NNLA 4MW4A 4HNGA 4DM7A 1YTUA 4OUDB 5JSKA 4DQDA 2X15A 4ECAA 4Z3OA 4L4SA 3VC7A 1Q19A 2A9KA 3T9CA 4F2DA 1W87A 1Q7GA 3JWIA 3W5HA 2G7ZA 2MWMA 2IQ5A 1BS2A 2HPAA 3MN1A 2VP4A 2NTYC 5F64A 4YCSA 1R0KA 2QZJA 4UDOA 2WM9B 5LYJA 2PMBA 5DM60 3U1BA 4K87A 4C3OB 1G19A 3SJAA 1W75A 4BV8A 5ICGA 4P5PA 3PQ7A 2R6ZA 1FSPA 1VMDA 1QIKA 4XJTA 4KU4A 1EX7A 5CEEA 3UB3A 4DN6A 5EN4A 1YOVA 1KY3A 4JI2B 1Q0PA 3ET4A 4MR9B 5EZQA 3JQGA 3CW2A 4R81A 5K05A 5JSQA 1TW3A 3FHCB 1DO2A 1ZGZA 1CJTC 4KH0A 1MXFA 2G5GX 1TVMA 2MOKA 1DUSA 2UYYA 2JANA 4I2VA 4DQUA 4IOLA 4U63A 5TSDA 2NU7B 4XQ9A 3N2EA 4Q21A 1HK7A 4CV1A 3ESCA 5ES4B 1PVVA 1EX9A 3C5CA 3MELA 1W5TA 2EG5A 4F3RA 2OFWA 1BHO1 2SCUA 1GUFA 3WC4A 4DV2B 4F4UA 1KU0A 1Z4JA 1YUBA 4ZCIA 5CLJA 5DTQA 1U2GA 1PVDA 4HT3B 5FJIA 3IUBA 2MJLA 4Y9UA 4KK3A 1JLSA 4KLNA 2JI7A 2QSJA 1PR5A 2AOUB 4EP1A 2PKQO 4RY0A 1VM6A 4BEJA 4KBFA 2C7QA 3HDTA 1BH2A 1ESCA 2IE8A 2C5FA 3DHEA 3PA8A 4GOOD 3WYDA 4A0QA 2ZYRA 2VAVA 1E58A 2OAP1 3DHYA 3A28A 2ZXFA 3FUTA 3EY9A 3GUVA 2HJVA 4FPXA 4GI3A 1K1EA 2C3UA 3COWA 1T25A 3KKMA 4E03A 3IR6A 2IF0A 2X5XA 2EL7A 1NBEA 3K32A 4HPWA 1QK5A 4G5QA 2AE1A 3GT0A 2C2OA 3ROEA 1UJ4A 2INGX 3HDYA 5DEOA 3UMFA 4D0LB 1PSZA 3L18A 2YHBA 2WTBA 2HMTA 2Z57A 2AMLA 4MVJH 5GOTA 3ROTA 3T3IA 4KQFA 1D2MA 3WJ7A 5DM0A 4NU5A 4BNDB 4G85A 1W9MA 3A58B 1VMEA 4P7JA 4JAVC 1HLPA 3L0YA 1R10A 3QLEA 5BW8A 2XUPA 2IZ5A 4QVGA 3ANTA 5C37A 5M34A 2JFFA 3TZBA 4UDYX 2XGMA 1XDUA 2IYEA 1T26A 2HK8A 2RK4A 4PVCA 2P2GA 3EE6A 1JDZA 1EZ1A 1KI9A 3EIWA 2IGTA 3LLMA 4WD3A 4BCBA 3DV0B 2JLSA 1A1SA 3UJHA 2XUAA 3L06A 3ESQA 5JV5A 4YRTA 4OG2A 3KG2A 1WPGA 2E5WA 1P7YA 2AEEA 1QONA 4IEIA 4M1KA 2PFKA 3EQ6A 4F97A 4RY8A 3A7DA 3C6BA 3M5PA 3MBOA 3C1TA 2G63A 3DF9A 4OYRA 1EGAA 4DBZA 1JV2B 1KTVA 3P9XA 3QENA 3MT9A 4LXIA 4AG3A 7YASA 4TXNA 2QJFA 3VI4B 1RYBA 1K5HA 3Q15C 4YR9A 5CH3A 3ESDA 1ZU4A 4LXQA 3LKVA 3BD8A 4ZD6A 4KIJA 3HBJA 2Q3HA 4L5YA 1WHTA 2GA8A 4NFYA 4BNVA 4ZYZA 4LC1A 1FQOA 1ZUNA 2ETXA 3NOVA 3U3ZA 3B1WA 5I7EA 3IEUA 4QASA 2ECFA 3BD7A 2PX3A 3KLMX 4F60A 2C00A 1CQXA 3COPA 4AUMA 5ALOA 1RXVA 1A9XB 5H81A 2ZM6B 1P2FA 3NU1A 1OGJA 1O08A 3DAYA 5AK6A 4AJ2A 1AXEA 3Q88A 4TWRA 1Z7GA 4X63A 3FB4A 1LNQA 2QLFA 3FPLA 4A6XA 4KI0A 4NECA 1LTQA 2WJWA 4B17A 5FOTA 2UXDB 3GLHB 2X6TA 1T2NA 1KDOA 2HYDA 2GM3A 1ZNYA 5HMMA 1PVOA 3IYLW 3T1NA 2AXPA 1FMTA 2WILA 3MIIA 3H4MA 4DBVO 2O8CA 1UKVY 1TU3A 2I67A 1K9SA 2HRQA 2P11A 1K7CA 2XE8A 3AKEA 1T34A 2RI0A 3CS3A 1VJCA 3L8HA 4FFBA 3H8JA 3O4IA 1NLMA 2H59A 3C7AA 3VHXB 1RXWA 2Q8PA 3NEJA 1W46A 1D0IA 3LY8A 4BFXA 4G9GA 1SCQA 3PYLA 4EAAA 1CJKC 1GXSA 1L7EA 3R7NA 4D4JA 5IJ9B 1G3MA 2FR1A 2BP7A 3NX4A 1UP4A 5AVOA 4MCIA 3C3JA 2QL9A 1O2DA 1YJAA 4JJ6A 3NIBA 1FUKA 1T4DA 4D4LA 3V4OA 3ZZTA 4QJ5A 1SKYE 3D4LA 5BWLA 5AXDA 5EZSA 3DZFA 1X7WB 1X9HA 2NV6A 3HJUA 3L04A 1CS0A 4S1WA 2PNJA 5D5QA 4YMTA 3VNUA 4CL0A 5JQGF 1U6KA 1JRLA 3HVKA 2YCBA 3S3TA 1ZVVA 4UDNA 1P72A 2QUJA 2W6QA 1OR8A 1Z6AA 1XEWX 2OE2A 4GMGA 1WTCA 4Q18A 5T4EA 1JIIA 1RFLA 4JI3B 3TSCA 2OORC 4YJ3A 5GVSA 1ZG3A 2Q6OA 1V3UA 1SZPA 1Y8RA 3E84A 2DPMA 1UOOA 1JKJB 1OU0A 2PG3A 1T2EA 2WF7A 4GUAA 3CU5A 5K8UA 1RI1A 1YI1A 3RAJA 5FPYA 1UJNA 4JS0A 1WB9A 1HT2E 2GXUA 2C2GA 1O9GA 1Q1ZA 1TT5B 3FOFC 4QZVA 4JGGA 4LJRA 2ZEJA 3T06B 5KS2A 1IAQA 4UMFA 2Z04A 2CNLA 4QYTA 3DKRA 4DSUA 1TZBA 1YZTA 3G2HA 5LZ2A 2AQHA 1C9KA 4BAGA 1ODLA 3EGDB 3W7BA 3HXQA 5CG1A 3VI3B 3B53X 3DKPA 4QQFA 3AHEA 1B0ZA 5BR4A 3ETCA 3T5BA 3GQBA 3O2SB 3CLHA 1TTHA 3Q9NA 1PJ3A 4KUHA 3V00A 5C18A 1PJRA 1UBNA 1XD2B 1KC1A 2M1ZA 1H3NA 1QAQA 1TCAA 5E3IA 4PYQA 3OEED 3S44A 1Z6PA 3BSYA 2OCLA 1TA9A 4CIDA 3NT5A 4PHTA 1C3VA 1XWFA 4M7WA 3DWEX 3FLMA 5DTEA 1ZC4A 2X1LA 3LX8A 2GMWA 4LXUA 2Q1SA 3ZV6A 3GLGA 2IEBA 3VKFA 3WK6A 1VHLA 4M1MA 4UTNA 1QB8A 1N6KA 4LC0A 1RHQA 4LSZA 2ZIXB 5J2TA 2OCGA 1BKSB 2OAGA 2FN9A 3TZHA 2A3NA 5ED4A 2P9CA 1E2HA 4M8IA 2Q0SA 3MJDA 2FU5C 4TTAA 2ONJA 3AM1A 2HIGA 1XOIA 2H4ZA 3CRW1 1AQLA 4RDHA 4GRDA 5ENVA 4BFCA 4RVSA 5T3UA 1FJXA 3SVLA 3BRWD 2XPCA 4UHKA 4WCFA 5CVJA 1Y7IA 2JFZA 4Q00A 5FL3A 3UH0A 4CEJB 3R7WB 4B8ZA 1UOEA 3MF4A 1R7RA 5J2UB 4DAEA 5M3BA 3ZDZB 1FYXA 1XZLA 1H8ED 3E8MA 4EJ2A 2F8TA 1N9KA 2O7NA 1MQ9A 4DLYA 1QYXA 2QRVB 4F6RA 1T4MA 4MDHA 3KO8A 5DW0A 5EFZA 2WD7B 1W76A 2G06A 3WG9A 1RWWA 3OA0A 1KMCA 2RDMA 1E99A 1FFYA 3E9ZA 4HN4B 1WW2A 4MEBA 2ODBA 1R4AA 3UM9A 5HVNA 3N2GB 1QYIA 3BTVA 4OEHA 5A05A 5EIEA 2ID8A 4A73A 3P2EA 4O4JA 5B36A 3ANMA 1W5BA 1SHTX 1V71A 1NVAA 3WKAA 3OHSX 4Q3NA 1L7RA 1BHQ1 1Y1KE 2ZB7A 5A3RA 1RHRA 1H6AA 2P6PA 2K4MA 5HSGA 2XNHA 3PKJA 3EXHC 3SSMA 4IOJA 1NNEA 3LJKA 4E3WA 4RKWA 2PBZA 2IUTA 1T2DA 2Y1KA 1ZWKA 3A2MA 3QXHA 4HWKA 1F8YA 4MSUA 3FROA 2NPIA 1JG4A 1D8TA 3WGJA 4E2YA 1AB6A 3LFTA 1P1BA 2OO7A 4B3TB 2G82A 4WERA 5TV2A 3O8CA 3QVKA 3OWOA 2WM8A 4PSVA 1EK5A 1JJFA 4X7MA 3QIAA 1W0KA 3MTAA 3E58A 1L1FA 5JTTA 2JI4A 3W5JA 3Q3VA 1KWKA 2Y1FA 2O0MA 3CCFA 1P1RA 4BVGA 1F06A 1DRJA 3GEHA 4Y2RA 2G1AA 3E7DA 3STXA 5F1PA 1TK3A 4ZALA 1E9VA 1ZISA 2OP1A 3PGA1 4PO3X 4B3DA 4YJGB 3B70A 4HLUA 2DYKA 4C88A 3WNCA 4NRDA 5LJLA 3GG9A 5GJWC 2N0SA 2EJTA 2HPZA 5EZYB 2WM2A 4JI6B 3CBQA 2NXWA 3BJEA 1OB5A 3ZLVA 1EFCA 2IYVA 1ZD5A 2CJFA 1I2CA 1MP0A 2PX2A 1Z4LA 3IUSA 4JB3A 4KQHA 4NDZA 4UBNA 1CP2A 2VOJA 2WUWE 3MQ4A 3ZCTA 1CQJA 2W2OA 2QR2A 3OTOB 8ABPA 4C08A 2HJGA 4IX9A 2GKOA 4OUKX 4RXUA 5CYOA 5MFPA 3VR6D 1DOAA 1R0WA 4IDDA 3DBHA 5DXAA 5LDHA 4ETIA 2FDRA 1J7KA 1OMOA 1YCHA 2OLKA 4OX9Y 1QV7A 1EQ2A 5D7BA 3K6RA 3JVEA 2BN4A 2NV2B 3B2EA 1Y3FE 3RC2A 4HWOA 2PH5A 2WIAA 2O3TA 2H29A 2GAFA 4RNCA 5DN6A 3AI3A 3HGMA 3LLUA 1UCFA 2HQRA 3AUAA 3JWJA 2IP1A 2A5JA 5D5HA 1Z7YA 3RF7A 3WFZA 1XXLA 2AUTA 4E5KA 3C4JA 1KAEA 1K75A 5ESDA 2Q4RA 3SYRA 3ZD8A 3ZCXA 1EJ0A 4FFPA 4Q1EA 5BSEA 1Y8ZA 3PJRA 4DG9A 1K8QA 1RRKA 2ZJ4A 3LVFO 3NHWA 4MR9A 4MVJI 4RHUA 4ZI5A 1RZRA 2CKMA 3GRUA 1KSGA 5K3OA 3D9QX 4M2LA 3MOGA 1CZKA 4Q39A 2EG9A 3OLYA 4C0XA 1NWCA 1WA5A 2WG0A 4M8KA 5CVDA 4D9EA 3X1XA 3DTYA 3PTLA 3R3HA 3T35A 4DA9A 2VK8A 4PG7A 3Q9LA 4IDAA 4HOYA 3WAJA 3VBEA 1X19A 4L8VA 3HYRA 4DMGA 3IVMA 1CV2A 1Z83A 4OXNA 2PXHA 2UUPA 5H3LA 4EPVA 3GDFA 3UANA 2E1PA 3SJ7A 4H1VA 1MLDA 2EHJA 4QYSA 1KI4A 2PTHA 3EOZA 2ZSHA 3IRVA 1E1LA 1PGOA 3DMYA 3EGXB 1VPTA 5AKIA 5DOVA 3VH3A 3TTUA 1JU4A 3UXYA 4TS9A 2VDOB 3G9TA 4HGYA 5BSHA 2IEZA 3FWYA 3UFXB 3QMWA 4RE6A 4BLSA 5BO5A 3ELUA 1XKXA 2A5FA 4YCLA 3AHCA 1DXQA 3NI2A 4G81A 2Q7OE 4ZMRA 1M7GA 1KVTA 3GRKA 1RRVA 3I39X 4JJEA 2JK1A 3ZE6A 4Q7QA 4C2TA 1JQDA 3JU3A 3B1YA 3BB4A 3UKDA 5JSFA 1TQ4A 1FFBA 5AVTA 2J6CA 1JEAA 2IOHA 2QPLA 3DWGA 3FFBA 4GPBA 4RABA 3N1UA 1JG7A 1ST2A 1RAGA 1UINA 5F9HA 1STOA 1MZPA 4DLUA 1NU6A 3M1IA 1MB9A 2IS2A 2QVLA 2FYTA 5AM5A 1DC5A 1LBIA 4M4SA 4DV1B 2V54A 2FFRA 1ACMA 4B87A 3FD8A 5FUBA 1N2EA 1JILA 4QE3A 1FS4A 4GOXA 4QPPA 5KNDH 4ESOA 1DDIA 2CXPA 1P33A 3UAYA 1V5IA 3UMJA 2R8OA 1RRPA 4WLNA 4YO8A 3DOJA 1EUZA 2ES4A 4WOJA 3DV0A 2P5YA 3B6IA 3Q0TA 1GFZA 3GAMA 1OZFA 1E2DA 3U1VA 2CNDA 3LDUA 3AERB 1H66A 3VX4A 4FXPA 1RWQA 2IDZA 4MIOA 5KNCH 3R8XA 3LHIA 2JIQA 2E4WA 2K7ZA 3PD7A 4OK5A 1EVYA 1XDWA 4JROA 4R2JA 2H52A 1GEEA 2D1QA 4EA7A 4YY3B 2QQGA 3B1XA 3BOSA 4BCDA 4CZ2A 5KWVA 2DFDA 3ZU4A 2GT1A 3SX4A 2D2XA 3E3NA 3W2GA 3NKVA 4R5HA 1YONA 4LZJA 2P2ZA 2BF7A 3FLEA 4DC9A 5EJ6A 1RCFA 3TK1A 3V4ZA 2PMDA 3C97A 8MHTA 1P3Y1 3FI9A 3G68A 3BERA 4F4FA 1TUBB 1OIVA 1E1RD 1YDGA 2J9FA 4J1TC 1MFPA 1JVBA 1O4WA 4ML3A 4OHKA 3U4HA 1U0NA 2OK8A 3G5AA 3BG5A 1I01A 3OE5A 3SR4A 3AF5A 1AV6A 4D80A 4XGIA 1EX6A 1FMLA 1XRQA 1B74A 1F1BA 4WZBB 3V1MA 3TJZA 1ISPA 1CR0A 2ASEA 3M2PA 3KEOA 4QJ3A 1A9XA 3UAWA 2ZRMA 5DRTA 3OZIA 1SHKA 1OVGA 3JCZA 5HIMA 4D02A 2JLVA 3IR5A 2SKEA 1JDUA 2DHRA 1ID1A 2FFAA 2ONCA 3R0JA 3VTZA 3WSTA 3OC0A 5IFKA 5IMSA 1ZJYA 2TMDA 3THXB 1Y6FA 1KAMA 4YJFB 3GLHA 2IBSA 1K7EB 3U19A 2HJWA 4RHEA 1SC9A 3BMXA 5F5NA 1O6GA 5PNTA 6REQA 3D0QA 3FYHA 3NIDB 1K66A 3B51X 4LOJA 1FSZA 4ZOLA 4YMLA 2X0EA 3IAM1 2NP7A 4FNAA 1H2WA 1L7XA 3M6FA 4TWZA 3U7FB 3PTZA 3VYVA 1KDRA 1H0KA 1NULA 3TX6A 1JGTA 3G59A 3R7SA 1QP0A 4H08A 1BYIA 4TSFD 4R2WA 4AT1A 2IRWA 4AVYA 4UUMA 4D6XA 3VHXA 3HQ4O 1OYVA 4QHSA 5I7RA 5LZ9A 1EYZA 3EA5A 3VHRA 5IJ9A 1SCNE 3PQ8A 3ZV3A 4K1XA 1WXGA 4YT4A 2GO1A 2M6LA 3QLVA 3CEMA 3C3EA 3T5PA 3ADBA 4XX0B 3HR8A 1GKUB 1CZHA 1KYZA 5F5LA 4ARUA 1KO4A 3EZ7A 3REQB 1HDZA 1XZ8A 1YACA 1ZA2A 2X9NA 4K6GA 2BZGA 2ZKIA 5KHAA 5KTPA 1CY1A 3BCSA 3OT1B 4QKQA 4V3BA 3VR3A 1TD1A 4QOGA 1WP9A 2JH9A 2YN2A 2F3RA 1DXHA 2IHKA 4XE5A 3D3EA 4OB7A 1MDFA 2G36A 4HH1A 1J99A 5AI4A 4MKZA 2OSBA 4L2IB 2J0QA 2ZPUA 5JLJA 3PCTA 3VR2A 4YI3A 1JKJA 1LRJA 2PL9A 4DZZA 5ICEA 1OD6A 1R5JA 1YJ5A 1TC1A 3T7TA 4N5HX 2XKAA 3RODA 3C8UA 1Q2UA 2HA6A 1JPUA 1TT5A 1E2JA 3EPLA 1UQRA 4IQ0A 4AP9A 3FMIA 3HBLA 3O2JA 3R5FA 1JBQA 1T36B 3TI9A 1Q0QA 1QYCA 4IJUA 3OX4A 4WGGA 5KI6A 2Q50A 1I5OA 1WW8A 3C1UA 3SDSA 4KQ1A 3KSUA 2Q9CA 5DNDA 1JECA 2PT7A 2OPHA 3QG5A 3KT8A 4IZOA 3RIYA 1EEHA 3CR7A 4FZ3A 4NH0A 4I8DA 3HBMA 5FR2A 2UYQA 1YRYE 3WLRA 4NBTA 3Q7IA 3PX7A 3VSDA 3MERA 1Z5PA 2FPOA 3DVLA 4ZZ3A 1GPYA 5KPJA 3C3BA 4NFLA 3H3FA 3PEVA 3NOOA 4HWSA 4A82A 1JUDA 2D54A 2FMTA 4EFKA 3KE9A 2FRVA 2Y1LA 2PJZA 1PCXA 1ND5A 3BWCA 3CZQA 3DM5A 3I2FA 3K94A 1ZNXA 1YZYA 2PT6A 4M7PA 5FI1B 2P5SA 5TB5A 4B43A 1K2VN 4AI6A 5JSHA 3QVXA 1XLVA 2QZSA 3T3OA 4YX9A 3AUSA 1QOZA 4N65A 1CR1A 1PLLA 1RWVA 2ZIXA 2QMYA 3P32A 1KVQA 1Z0DA 4MUBA 4AECA 3JTMA 4JP8A 3PR2B 2F00A 3JQRA 3P9PA 2ZJFA 4PZEA 5LQAA 2I4RA 2GN8A 5DULA 3E5RA 4RTNA 1L1RA 1WXXA 3DL2A 2H07A 2CGEA 2JGEA 3LC7O 3M1LA 2P8JA 2VC2B 2QP4A 4R8VA 2BISA 1A5TA 2GXQA 1KYQA 3R7WA 3H11B 5J2UA 4P34A 4HWGA 4PX3A 4UREA 1J8VA 2FEAA 2VYVA 4L8LA 4RU1A 1QX4A 2W42A 2AFHA 1Z5VA 3LQ1A 1SCJA 3MJTA 4YUVA 5I4KA 3MT7A 4HC4A 4EMBA 1DDOA 1PNTA 1Z25A 2D5LA 3ISTA 3L6EA 2WD7A 3C5WP 3DE1X 2BR5A 1AQNA 5THXA 3L6DA 3BSFA 1FNSA 1WKBA 2NO4A 2XGOA 3ONWA 1NQWA 3CLTC 4W1SA 1LH0A 1Y1RA 2XZTA 1TMGE 4M38A 4PR3A 4WKGA 2NT4A 1ZN2A 2COEA 3N2GA 4EW3A 3OLXA 1RC0A 3ASZA 5E6SB 4IFTA 1O94C 4OBXA 4ZO6A 4IW3B 5F3RA 1CR2A 2KBFA 3MTGA 1KVRA 3M82A 4ZCPA 4DJEC 4HGPA 1Z6GA 3GIDA 5EIBD 3OBBA 4XIGS 2HA2A 3TECE 2J3QA 4EI7A 4HKTA 2NXNA 1NW7A 1E7QA 3Q0IA 3P0FA 5JXWA 5K8LA 3G2JA 4WLEA 4OJTA 5K1ZA 5TLSA 2OWDA 2EFEB 3T4PA 4PNPA 2OLEA 2JHCA 3FIUA 2OPBA 1H2AS 1NSTA 3EZYA 3OMLA 3PRHA 2POQX 3K5WA 4TV8B 4ZAXA 2R68A 3HYCA 1EK6A 2IPOA 1JHZA 2A0FA 2ADFA 2MT9A 2Q2WA 3C14C 1BEZA 5JD6A 3BXGA 3REGA 3CLRC 2XYQA 1NXPA 5AW8A 4ZQIA 4Q1CA 3WGLA 4C3VA 3O3CA 3DC2A 2Y9MB 2I3AA 3MW8A 3QJGA 1MEJA 4YJGA 1JAYA 1QCYA 3M83A 1S1MA 3IUQA 3SGLA 1H8HD 4ZCSA 5H80A 1DCKA 5EZYA 4A26A 2EYQA 3DXXA 4PY2A 4X9XA 4Q1BA 4KXUA 4Z8XA 4AURA 3IL2A 2I7VA 1SXQA 4JJ7A 3W9BA 4S24A 3DCIA 1YI8A 1L5HB 1NNUA 3FMPB 3N39C 2V6IA 3ONDA 4A5OA 5K8TA 1NC3A 4BFSA 4ZMBA 5KWSA 4QL3A 4M1ZA 4FMDF 2XB6A 1WB5A 4OHOA 2OO3A 2R1TA 2RGBA 4H7KA 2NU8A 4UFOA 2JFVA 5FOXA 3RTGA 4TV9B 2IKSA 2J3DA 4IZIA 4O4IF 4CW7A 1TADA 2QD3A 4I1UA 2YX1A 5DBIA 4IQGA 4DOMA 4E30A 4F92B 2BGWA 2X2OA 3AEKB 3L3BA 5DHAA 1G8MA 3DL4A 1CUAA 1DDGA 3QSGA 1D2GA 4U7TB 5L3RA 3BDAA 3N2IA 3BH7A 1QJCA 1RHUA 4HRAA 4EEZA 3G85A 2EW1A 1YDFA 1P1FA 3THYA 1Q0HA 2Y66A 3A70A 3CWQA 2Q5HA 4CTKA 1U3GA 1YAHA 3DNPA 1PFQA 1R6AA 3MB5A 4EUSA 4D79A 3AHGA 1CC1S 4ZKEA 4GKKB 1FX1A 1LQ2A 2CNWD 3NLLA 4KWHA 4OQDA 3K1YA 2DH5A 3JQ6A 1Y33E 4U2FA 3G13A 5EAIA 5TMDA 4CM1A 1GNQA 4EENA 1PS9A 4OIMA 3W1EA 2G9ZA 5EIFA 3TIXB 3WHKA 3G0OA 1C1XA 4WH0A 2B5WA 4QFBA 4D3SA 3S99A 1RFGE 3B7GA 2XGJA 1W7AA 1ECLA 1T9HA 1MHPA 3STTA 2J41A 4AY3A 3PQDA 5GGYA 1AOXA 3V2HA 4E6EA 2H4XA 2NVWA 2YWDA 3B6ZA 3ZI7A 4U3JB 1I2DA 1Q50A 1OREA 3HZRA 4JP2A 1JSZA 1YOBA 3RAPR 3H2HA 3GUHA 5FAXA 4V24A 4NHEA 1BXRB 5FPHA 1JXAA 1PGJA 1MVNA 1ZK1A 4B46A 2AI2A 4DCPA 3UK2A 4UM5A 3JZAA 1UPBA 3WYAA 4CIYA 3EPJA 4LI0A 2UZ1B 3Q8LA 2Q49A 3JD4A 1CDZA 1DMSA 1PJ4A 2C82A 5DZSA 3BH6A 4FHDA 3UFXA 4ENVA 4ZV7A 1JWBB 5C5CA 5KTTA 2B2CA 2E4XA 3USZA 3WV4A 2PVSA 3DVRX 3IAUA 1Y5RA 3OPMA 1I7DA 2B20A 3EWAA 4I6JA 4MEJA 3QIVA 5B58C 4QECA 3KQVA 1L5QA 2F3UA 2GPSA 4TLMB 4NV1A 2B6NA 5H0IA 3Q40A 5I8PA 1E7SA 1SUPA 4MWBA 4KODA 5JPCA 4JELA 5C3UA 2LWIA 4LBZA 4Z4FA 1G6KA 4FZRA 3E8XA 5T5QA 1CUDA 2A58A 5AVKA 3U3MA 3Q10A 1HMPA 1SBHA 3MGGA 2ODAA 1UKYA 4E70A 2VNAA 4IVQA 3CZMA 4Q0MA 4NZPA 1KL7A 4PC3A 5LM3A 3PQ4A 1MOQA 4CIXA 4YYEA 3KKOA 4MTCA 3H4VA 4QODA 2BGRA 3SR0A 4CLDA 4Z1OA 4Y0NA 4ZYUA 3TXXA 4BRSA 3RVQA 1NJ5A 2GEFA 2VVTA 1UMBB 3NXKA 4I9NA 3UW3A 6CHYA 1BVYF 2ADOA 3LK7A 3R5SA 3FR8A 1W85B 4HEA1 3ZE7A 4D43A 1K0FA 1D2RA 1R5BA 2QG9A 4UOEA 2PU5A 1CJMA 3EQZA 4LISA 1IM2A 1CS4C 3P0IA 5ALWA 1VJDA 5HG0A 3KKNA 5HKAA 4KN9S 4L7QA 2YRWA 2FPWA 2R86A 4J76A 2II6A 3WLLA 3QPVA 4D0SA 1IOVA 4OQNA 4B6EA 1EGVB 5EJFA 2W5UA 2OCBA 3AT1A 5K20A 3AYZB 4MR8B 1IY0A 1EVZA 5K2MA 3S40A 3TTTA 2YMMA 4HWPA 1XMQB 3G17A 2AIRA 5FOUA 3WMWA 4D2IA 4QOFA 3K70D 3BMNB 4G56A 4GPTA 4HPXB 5GY7A 2GZDA