2VEDA

Crystal structure of the chimerical mutant capabk55m protein
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
252
structure length
252
Chain Sequence
DKRIKDEEDVEKELGLPVLGSIQKFNMTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGMSTIAANLAVAYAQAGYKTLIVDGDMRKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIEDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPPVNTVTDAQLFSKFTGNVVYVVNSENNNKDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MEMBRANE PROTEIN CAPA1, PROTEIN TYROSINE KINASE
publication title Structural Basis for the Regulation Mechanism of the Tyrosine Kinase Capb from Staphylococcus Aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 88
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vedA00
1GIAA 1NSTA 2GXSA 5KPDA 1Q22A 3PEWA 4ZKEA 5JSZB 5DI3A 3RRMA 1FP6A 3I8XA 1G7CA 5E3HA 2BBSA 2ODNA 2KWIA 4URXR 2FX3A 1U9IA 3BOSA 4RKEA 1P9NA 1GL9B 4IXNA 3G0HA 1XD9A 1AQYA 3A4NA 3QKUA 4KO8A 4LJAA 1I4TD 2B92A 2OUKA 3B2EA 2ZAMA 1VHLA 1GRQA 4Q1DA 2RHDA 5C2JB 4F4IA 2QP4A 3R8FA 3B9QA 2P0EA 4FCTA 1XZQA 5FOWA 3ZIAA 5H8WA 4ITRC 1AM4D 4PZYA 3T15A 1E2NA 4V0OA 2WJIA 3QPVA 4I1OA 1EK0A 3PEYA 5FUXA 2QTVB 1K6MA 3FGNA 1YZUA 1OKKD 1T5IA 1ZCBA 2DCUA 3UXMA 2D7CA 4BFYA 2G1KA 2XSZA 1E0JA 4G1UC 5DH9A 1CR4A 3QF4B 1PLLA 3H0KA 3NBYC 1EESA 1MO4A 4C0JA 2IF0A 4Q1FA 4US1R 4KAXA 1J2JA 1N0VC 1TADA 3ZIAD 4PC3A 5JZVA 1FTNA 3DL0A 4GPTA 2DYKA 2QGNA 3PUZA 4JLKA 4ON9A 5EP1A 1KI1A 5FR2A 1KTVA 3CWZA 1W48A 1S3GA 3A1TA 2V7QD 3L82B 4X8LA 1CJKC 2WV9A 3GP8A 1MV5A 2Q9AA 2NMVA 3BIFA 1MRSA 1YE8A 4RFVA 1VYTA 3JVVA 5HKKA 3QBTA 4LHZA 2PZFA 4TTQA 4CW7A 4F93B 5ANRB 5H70A 4UNRA 5BQ5A 4KVGA 3Q5DA 4DDWA 3IUYA 4MGYR 1NSFA 5DGXA 2ZXUA 2EFGA 1WB9A 3VKWA 3LAWA 1E4VA 3QF7A 3X1ZA 3DMDA 4LC1A 4M4SA 3THXB 3OESA 3TKLA 3CH4B 5JWHA 1KO7A 5DSZA 1P62B 1NVUQ 3AVXA 1KNQA 1UBCA 5JLJA 4I1SA 3EIQA 1YR8A 1XZPA 1QHNA 4BLQA 4BLOA 1TQ6A 3CNNA 4PPFA 4OHZA 2O8FA 4GMXA 1KAGA 1KI3A 3GLFA 3TIFA 3AF4A 2QTHA 4LYHA 5HKKD 2W6ID 3MWKA 3QY0A 3K09C 4IOLA 2OFXA 2P5SA 3A4MA 2QBYB 2H7VA 1UDWA 3PG5A 4NZYA 3BB4A 3TNFA 4NP6A 4GP7A 4UNNA 4C0QC 1QHYA 3P20A 4IOMA 1G3MA 1BO6A 1P72A 1AZSC 3QXJA 2C2HA 3SYLA 3JVUA 3CO5A 4XOIA 3P4XA 1QRAA 1WXQA 4BE7B 5B57C 4LX0A 5EP2A 5DHAA 121PA 3I62A 3QEJA 1VMAA 1KZGB 2MSDB 1RW4A 4DZZA 3KQHA 3GLIA 1TTTA 2MSEB 4TL8A 4ZKDA 2C9CA 3SNHA 3BERA 4BPBA 3EIHA 3LO5A 4DCVA 4Q9KA 1U98A 3F0TA 4GFDA 4OI2A 3W5JA 5FPYA 3ZGXA 3VU9B 1ZYUA 4TL6A 2AR7A 4MYCA 3FTQA 2CCGA 1CKEA 3ZH9B 3Q85A 4HI0E 1CJTC 2C95A 4H1VA 3B8HA 2VHQA 1E9AA 3NHBA 4BEBA 2AWOA 3H86A 2V6IA 1KSFX 3OIVA 3WYAA 2R6GA 1G19A 1XEWY 2RMKA 2FF7A 3CF0A 3IPXA 2ERXA 4FCWA 4G5GA 1Z28A 4O0MA 2DWPA 2C04A 4I99A 1QHGA 2DY1A 3FKSD 4G3XA 4LSGA 3KKQA 4NCHA 2YC4C 4OI1A 1CR2A 3UG7A 3CPEA 4PHTA 3GLHA 5DE3A 4TMKA 1ZM4A 3IHLA 4MUAA 4A9AA 4Q19A 1S96A 4YC7A 3OEEA 1N5LA 2ZRIA 4OQNA 4JLAA 3VR5A 5J4LA 1OFIA 3LV8A 3T12A 1F2UA 3B1ZA 5EP4A 2NO9A 2QMUA 4GP6A 1XJQA 1IN8A 1ZIOA 4HAXA 4Y0AA 5C4MA 1WP9A 2GILA 3B9PA 1XXHB 2GJ8A 2UZIR 3FMFA 1EWQA 2RAPA 2J59A 4PX9A 1OLOA 3WXMA 2C9YA 1F5NA 4FI3C 1G4UR 4WXRA 1N6HA 2WOJA 4M21A 2DBYA 4Q7MB 2HXYA 2F9MA 2OCYC 4EPXA 2QY9A 4DCUA 1A2BA 3AQ4A 2DFTA 1NLYA 3B5JA 4YQFA 1JI0A 2GEDA 3MUFA 1SVIA 3BD9A 5LB4A 2DPXA 1X86B 1EGAA 1P2VA 1IQPA 1TQ2A 3TH5A 3BK7A 3K0EA 4Z8YA 1AZTA 3K9GA 4B43A 4BZQA 2ODBA 2IA5A 1LW7A 1Q3HA 1NRJB 4MQBA 4P4SA 2YC2C 1VG8A 1F2TA 2FFAA 2BM1A 2WAYA 4GOKA 3KJGA 1CS4C 1HT2E 2ZUCA 4P32A 2G1JA 3VNVA 1HA3A 4B6EA 1RIFA 2O8DB 4V0MA 5JBQA 1QF9A 2IHBA 2ZRJA 2ZRCA 2REOA 1SVKA 4HZIA 4PC2A 4CRWB 4TSFD 3AM1A 4A8JC 3GCGA 2NIPA 4A6XA 4HDOB 3K8YA 4AD8A 3Q7PA 2QP3A 2GEVA 2WHXA 5J40A 4DLWA 4QGGA 5LB2A 1NN3A 2I1VB 3KDSE 3RWOA 4IXMA 4GI7A 3K53A 4Z8XA 5FBLB 1G8FA 4DHEA 3LXXA 2CHVA 5J4HA 3NKVA 4MDEA 3MJHA 1HQYE 4FINA 4LWZA 3KQLA 3ZVLA 3QKSB 1KI6A 4BLSA 3ZS9A 3I32A 4WZBE 2JLRA 2WWXA 4EFMA 2P3SA 2OILA 4NYMR 2HF9A 3EWSA 4UNSA 2LCFA 3CKLA 1WDTA 2YV5A 4Q48A 2FFHA 5FOXA 4Q03A 2W2VA 1BYUA 3QXXA 3UK6A 4GOJA 1W5TA 4Q47A 2IUUA 1CF4A 2MMCA 2ZS7A 1UKEA 2CL0X 4B34A 5FUVA 3K09A 4NYJR 4X8MA 2QN6A 1ZC3A 3GJ8A 4B33A 1AKEA 3PV0A 4QG7A 3RRYA 3DZDA 1KSHA 1IN6A 3GFOA 2QM7A 1E94E 4EPWA 2ZE8A 4L15A 5FH9A 2IL1A 2X1VA 3O8BA 4PPNA 4DDUA 3SJCA 1E2EA 1R6BX 2GEUA 2OCBA 2BHRA 1XTQA 2B8WA 3QQ5A 1YU9A 4DBLC 2V4ZA 4P3YA 2EW1A 5HPYB 5TVKA 1N0UA 4QGHA 1OSNA 4GZLA 4GL2A 5FI1B 3CBQA 2J7KA 1IXRC 4A4DA 4BZXA 3R8CA 1ZJ6A 1JPJA 4KFRA 4AIIA 3LX5A 2ZROA 4DT1B 4E5UA 5FPSA 5DISB 4D4JA 1W2HA 2OBLA 1E99A 3ZDQA 1PUJA 1K8RA 3HU3A 3PR1A 4EPRA 5K8IA 2QP9X 4D4LA 2BJWA 2IYZA 4BZPA 3KZ1E 4UXIA 1D2EA 1R5BA 1KK2A 3QVUA 2IYYA 1P7CA 4XSHA 4RFSB 4KITB 1T3LA 2Q9CA 1E1RA 4AWXA 1SXJC 3LX8A 5AJWA 2RB4A 3CNLA 4E09A 2IYRA 1Z8FA 3QOFA 2Q21A 5FI0B 2AFIE 3BBPA 5JEDA 3TMKA 2VF7A 5JCPA 4TL7A 2WAXA 3I1FA 4XWKA 4AKIA 2P6NA 2GCOA 2VPPA 3C41J 5FPHA 1EWRA 4KODA 2YYZA 4CT4B 2BCGY 4ZIRA 3AVYA 2XZLA 1BKDR 3PQCA 2YWHA 1E0KA 3LFUA 4URYR 2NZ8A 3EG5A 5TB5A 2H1LA 4HAYA 1E2GA 3U3RA 2KSQA 2ATXA 5J47A 1U0LA 3EXAA 1NVVQ 4PPQA 2LKCA 3RYTC 5AWFC 3KXKA 1Z0FA 2CDNA 2ZQ5A 2BMEA 1OXXK 4RD1A 2XX3A 2WMOB 4Q4LA 1RRFA 1N6PA 1XBTA 3Q72A 5E95A 3CZPA 2OO7A 4J0QA 1JNYA 1Z6AA 5KYKA 4Q4JB 1TAGA 1E2DA 2JJ2D 1ANKA 1LTQA 2QRNA 4E03A 3PUWA 2HLDA 2WPDA 1JXMA 4QL3A 4AKEA 5J5CA 2I4IA 1C1YA 1N6LA 1U8YA 2WICA 4BFSA 3O8RA 4Z54A 2G0TA 3F5FA 1KNXA 5JEEA 2F1HA 3QBVA 2QZ4A 1OXUA 1XB2A 4L5BA 1OXSC 1NVWQ 2F9LA 4NTZA 5JCZA 1Q1QA 2IYLD 1ZUNB 4GT1A 4DB2A 4FMDF 1ESNA 5DHFA 2TMKA 4ZCMA 4G0NA 1GKIA 1XMIA 2C9OA 4G5QA 4OHWA 3RHFA 4BFTA 1DS6A 3I92A 2ZSEA 5KU1A 2HLDD 2WPDD 3IEUA 2GNOA 4LYAA 3GFTA 2JIZD 2H5EA 1Z0AA 2AD1A 2ZTSA 1CU1A 1E9EA 2YWEA 3WBKA 1W2GA 3LLMA 2QTFA 5TARA 3U44B 2A5FA 4B48A 1Q1ZA 3AB3A 3THOA 2OLJA 2X2EA 4GBMA 1CBUA 1L7VC 2OT3B 3C7KA 4NYIQ 4CZ2A 1XTRA 4TT3D 3EX7C 1TL7C 2WJYA 2GF0A 1XD2B 3P26A 3QKRA 5AUNB 2A5GA 1XTSA 2EQBA 4Q7LA 4Z51A 4OHYA 2HYIC 3OF5A 2GZHA 4M9XA 4PPGA 3EIEA 5EQTA 4NONA 1JR3A 5F9HA 2ZI3A 1QHHA 3VNUA 1NJGA 1JR6A 4DUGA 5FBQB 1KK1A 4C0LA 4KBGA 2ODWA 1UAAA 2V1XA 4JSYA 2IXFA 1GRNA 3E2IA 4CVNA 1OJLA 5FUYA 3I73A 3HR8A 5L3RA 4AKGA 3TVTA 1FMJA 1T91A 4WAUA 4CEHA 2ZS8A 2SHKA 4MGIR 2CCJA 5G41A 4M2LA 4XD7D 3B7GA 4ARZB 4OBEA 5AUPB 1XRJA 2H57A 4JT2A 4EKDA 4B2PA 4LBYA 5JHHB 2QT0A 4LUCA 4QHSA 2DFNA 1NBMD 5G40A 1KYIA 3C14C 1VYVA 2CBZA 2AK3A 1FX0A 2FDCA 3HR7A 3GJ0A 1R0WA 4EFLA 5L3QB 2J0UB 4BGDA 2XB4A 4Q01A 2R44A 1U9IC 3THYB 1DADA 2FZLA 3V00A 3U3MA 4BLRA 2AXNA 1CJMA 1KKMA 2H92A 4HAWA 2O0HA 4FWIB 4YDHB 4ZDWA 3AVWA 4JLOA 3RLFA 1AJEA 2LWIA 1CEEA 3MCAA 1U94A 3BB1A 5JS7A 4GSYA 2O8EA 1VIYA 1ZD8A 5EXXA 1IJEA 5FPKA 2E1RA 1FFHA 3TUJC 3LQQA 1FNNA 5C1BA 2J0QA 2HXSA 3E70C 2G6BA 2R8RA 2BBWA 3ONWA 421PA 4HLCA 2WWIA 1N6RA 4I1UA 5HR5A 5M04A 1AK2A 1UKYA 2FG5A 5FTLA 5E4FA 2ZSFA 3X1DA 1OFHA 4P4UA 1KI7A 1U8AA 2JJ1D 4PAMA 4Q7KA 3VFDA 2RGXA 4LPKA 5C4GB 4EQ6B 5LD2B 2HT1A 3W5IA 1GDDA 4AK9A 5B58C 1FOEB 2D74A 1D2MA 1T3SA 2PMKA 4WBSA 5G3YA 2C78A 4M22A 2AD5A 1XEXA 5HCNA 3ICQB 5JI2E 2ASEA 3D6TB 3VQTA 1G6HA 2ODEA 4LHWA 4MYHA 5J4KA 3VR6A 4O2LA 4LBVA 4U7DA 3I5YA 4M53A 3AV0B 3RWMB 1GITA 1E2IA 3KUCA 3ZZ0A 2ZYUX 4TQ9A 4EDHA 3OAAA 1VYUA 1RE0A 3C8UA 3RS5A 1D8TA 2ZJBA 4HB2A 1T8TA 4HLUA 2WM9B 3IIJA 1ZAKA 2J0VA 4QJ5A 1AN0A 1ZVQA 1R5OA 5EUQB 4ZDIA 1Q1EA 5B64A 2O8CA 3NIBA 5AJVB 1E4YA 2XTMA 5SZHB 1U8ZA 4DCTA 2W6JA 5CIWA 4QKQA 4FCVA 1TF5A 4EUNA 2GA8A 2JLVA 5D3QA 3T61A 3U3KA 3W90A 3TSOA 5L3SA 1DBSA 3SQXA 1R0XA 1P2TA 5HCIA 1OB5A 3S1AB 3DO6A 3MG9A 1II8A 1EFRD 1S3SA 1KMQA 3ADCA 4EJSA 2WJGA 2X19A 4Q9HA 1ELOA 3VX4A 1DG1G 3B1VA 2FEOA 3C15C 2GAAA 2Y8EA 3A58B 5FBWB 2EWVA 1XX6A 3PITA 3GLGA 2KBEA 1DG3A 1J7KA 3R9XA 5FFMA 2W6JD 3LBNA 1UF9A 2P67A 1G7SA 3TRFA 5AUOB 5B30A 2IK8A 4B35A 3LVRE 3NVAA 3SJBA 4KU4A 4D81A 3PIRA 2FA9A 3RSLA 5BN4A 1RVDA 2ZR0A 1R10A 1T5LA 1RKBA 1M1YE 3VTKA 2WSMA 2BVNA 5HTKA 3EA0A 2Z0MA 2QAGB 4LV5B 2WKPA 1ZNXA 3KTAB 3HPQA 4D4KA 3ZVNA 3SS8A 4QNMA 3BS4A 4TTRA 3ZD7A 2RGCA 1RPZA 2IWHA 3REFA 2YOHA 1E98A 4Q4HA 4CEIB 3OFNA 4LHVA 4B32A 2LKDA 2CMKA 2ZSDA 3KFXA 2J87A 5TY0A 1L4YA 1TU4A 2XTZA 3AF3A 1G21E 1NLFA 3W6NA 2ZJOA 4QBFA 2YOFA 1KO8A 4P4TA 1D2NA 1F60A 3U7EB 2BKUA 3D3QA 1G7RA 1E9DA 1UEJA 3FMPB 4X8OA 4IEIA 2QENA 3L0PA 4MGKR 3MSXA 3EZ6A 3QSYA 1E2FA 4C0SA 5IRCD 3EPHA 5JSZA 2FSIA 3OFND 2QE7A 4L9SA 4B3CA 1TQDA 3GPLA 3BXZA 1KJZA 3QUSA 3LW7A 1G5PA 3HWSA 4K46A 4A92A 1FL9A 5JRZA 4IDOA 4IEEA 5KDOA 4NH0A 1JAIA 4FN5A 5H1YA 4F4JA 1M2OB 1G3QA 2E87A 4LI0A 2J41A 3AVUA 4D25A 2CK3A 5AUQA 1Z83A 2Z4SA 1KOFA 1D6JA 3K0CA 2IXGA 3QXHA 1E9CA 3O8DA 1Z22A 2GJ9A 5FL3A 5TV2A 5KNDA 4P31A 4KV9A 5LPNA 2Z83A 1QZXA 3AKEA 3KKNA 4DSUA 2VP9A 1FP7A 4PTLA 4WW0A 1I4LD 5JWRA 5KOYA 2CEAA 3ZZUA 2CJWB 4II7A 4JLVA 1TUEA 2KB0A 2R65A 4N0DA 4C0HA 5LDDC 4MRPA 5KPJA 1Q1BA 1DO2A 3LD9A 3TUZC 1F6BA 5JI3E 5KO2A 1TPZA 4WXPA 2CK3D 4MYTA 3HYTA 2ZSAA 4BFZA 2C5LA 2IYQA 4BRUA 1E9FA 1E6CA 2KBFA 2ZSBA 3K0SA 2XSZD 4HAUA 2NO0A 4RD6A 2JLWA 2HJGA 1ZUHA 2ZYVX 3V4RA 4JMPA 3WMFA 2CCKA 3MFYA 3VMFA 4TLBA 1ETUA 4JVSB 1AS3A 1W4AA 1QHIA 3CWQA 4LK2A 4E22A 2JLZA 5GJBA 2VH5R 1KK3A 3KXIA 1YHNA 1SKQA 4W5JA 1ZC4A 1PZNA 1OH5A 3THXA 3IGFA 2ZJ2A 4JJZA 1G4AE 3P4YA 3VKHA 1X8LA 4DEYA 1DOAA 2OXRA 3ZZTA 1DELA 4GDFA 3HP1A 2IX3A 4L9WA 2F43B 3CNOA 4W9MC 2EFHB 3FMOB 3DM5A 1N6KA 3TR0A 1OXVA 1K5DA 2AHOA 2P2LA 2XAUA 3FDIA 4A2WA 4Q1AA 1JALA 4DCSA 2ZJ8A 2QBYA 3ZLJA 2BWJA 3CIOA 3WBJA 1OFTA 2RGEA 1LFDB 5CYOA 4MA4A 5BN5A 1OV4A 2EFEB 2GETA 2OBMA 3SFZA 4V0KA 4AG5A 1BOFA 4AURA 3GJ5A 2PZEA 2PCLA 2C03A 3WHLA 3GQBA 3LRPA 4M0LA 5KSYA 4QM6A 2IS2A 3AEZA 1KI9A 4B47A 1DVRA 1A82A 2GXQA 4BFVA 3KUDA 4ESHA 5DN6A 2OV2A 2IWRA 3TQFA 3I3SR 1E2LA 4JYCA 1LF0A 4PO1A 3K70C 2ANCA 3K0FB 1OIVA 2EU8A 2QU8A 4EFNA 1AA9A 2B7BA 4CEJB 4I4LA 3KXLA 3VU9A 4D0NA 2ZJZA 4IKEA 1JEDA 2ZI6A 5SZJA 1M34E 3BH6A 3T5DA 3PVSA 5DNYB 1DE0A 1KDOA 1E3MA 4OQMA 4IDQA 1S1MA 4BEJA 3FPAA 1OT3A 3W3ZB 2OESA 3M1IA 1TX4B 1ZINA 4Q02A 2XGJA 3NBFA 2ZE6A 2WMNB 4MGZR 3M4YA 4P0TA 1KDPA 1JQJC 4QJ4A 4I81A 2AKAB 5DN6D 3Q7QA 5ELXA 4JBYA 3FB4A 4ZCIA 3R20A 2WWYA 3DPUA 3NBXX 4XWOA 5BW8A 3H1TA 3T1TA 4A2PA 2A5JA 4OQLA 1HQCA 1PJRA 1SVSA 4HYYA 4US2R 3MWJA 2FPMA 4ZDJA 1W4CA 1P9WA 3KX2A 2BV3A 5GJVC 3TVDA 2XNDA 3FFAA 1M6NA 5F3WB 3RC8A 4XVRA 5JHGB 2FSGA 1G3UA 3TW8B 2O0KA 4Q9JA 4PHHA 2NTYC 4A82A 2XXAB 3AGPA 1XXHA 2KE5A 3Q3JB 3C5HA 1NG9A 1PLKA 1FQJA 2HCJB 2BMDA 2ECKA 3Q9LA 4JLJA 4R9UC 3CRQA 4Q7JB 3OEED 5DO9A 2QMHA 3KQNA 1ZM2A 1OE0A 1OHHA 1G5TA 2OM2A 1ESMA 1A2KC 4DC9A 3FE2A 4D0LB 2QORA 5EJEA 4R98A 2XNDD 2WIAA 3B78A 1T6NA 2FFBA 1FW6A 4D2IA 1LS6A 2CL6X 1O87A 2B8TA 4B3GA 1RRGA 2AKYA 2C98A 3B13B 3PUXA 2GZAA 2IS1A 1G5RA 3F3YA 3RS3A 3UIEA 3L0SA 4RCZA 3X1YA 3IO3A 4EAQA 4D80A 1G16A 3IPYA 1TEXA 5CLQA 1OHHD 2O8DA 4HSEA 4QBGB 2K5UA 2GVDC 5A5GA 2J45A 1ZM3A 4LV8B 1KAOA 4C2TA 4PC6A 1AS2A 4LC0A 4PANA 3ZS8A 2V1UA 1PVOA 2GTPA 4Q21A 1ZD1A 3EWAA 4ZCLA 2BOVA 3L2OB 3T5GA 2VIIA 1C9KA 3TSWA 2QG6A 4URUR 1SULA 2FZ4A 2G9NA 3WYGA 1ZD9A 4XWAA 4A0FA 1B0UA 4YMUA 2JLQA 1GVNB 2JDIA 3IO5A 2ONKA 2H8KA 3BE4A 3GD7A 1UBGA 4TZ6A 1ZIPA 5C18A 2QPAA 5BYJA 1Z29A 1SVOA 1W0JA 3SJZA 4Q1EA 4TZ0A 3QKSA 2VRWA 4DKXA 2NOAA 5AJXA 3SI7A 1GTVA 4OI0A 4M1YA 4LDJA 3U7FB 3BAFA 4RZUA 4TMXA 5FR1A 2GK7A 2PT7A 1TF2A 3VHLB 2BMFA 4L8GA 1KI6B 1RRCA 5JFGA 1V5WA 3DKPA 3WP0A 4DVGA 2O8BB 1FUKA 1IHUA 3HPRA 4QGAA 1IXSB 4KBFA 1H8EA 4AYXA 4BRWA 2JGNA 1OIXA 1Y63A 2CL7X 1AGRA 4TL9A 5CJ2A 3RRZA 2NG1A 3A1UA 1HE1C 3OZXA 2ZJYA 4IVQA 1J99A 3OHMA 5IK2A 1F3OA 1KY2A 3GJXC 4JZKA 3EZ2A 3WNDA 4YMTA 1US8B 1NP6A 5EZ5A 4EPVA 521PA 4DDVA 2IEYA 4UNPA 1WQ1R 4RZ3A 2PJRA 5DYGA 1TUIA 4CF7A 3CW2A 1L4UA 3UWKA 5EXTA 5CJPA 4YMSA 2ZRPA 3G82C 3KQKA 2QRZA 4NCKA 1UKVY 1G6OA 1KI4A 3T1VA 3NDPA 4JLBA 4ESVA 1H8ED 2W2TA 1JB1A 4DT1A 2G77B 4JKIA 4BFWA 4B71A 4XTCS 4IHQA 3UATA 2BBTA 1COWA 4NE2A 1J8YF 1JXOA 4NCIA 3C16C 1NLZA 2PLFA 4KFSA 1Q57A 1B23P 2GVZC 2G3YA 1E9RA 3QEOA 2CHGA 4RFSA 4IFEA 1KMHA 1YRBA 4M1WA 4D6PA 2FFQA 2IC5A 1XCGB 4QXAA 1RZ3A 2CHQA 1MO5A 1XWIA 3VR2A 4JVNA 1O3YA 1P75A 2QSZA 4HLQB 1SVWA 4XIGS 1CRQA 1VG0B 4FMCB 2CLCX 3K70D 5GJWC 2FNAA 1QDEA 4DXAA 4QBHA 5J4VA 3AP1A 2AXPA 2WJVA 1N5JA 2VP2A 1COWD 2GBLA 5CK5A 3QE0A 1DEKA 2ZRBA 3QNUA 4MKHA 4F91B 2ZI7A 1HEIA 1E1RD 2XEXA 4H9GA 4I1VA 4NMMA 2B7CA 1OH6A 2YOGA 3A6PC 4U5XA 3ND9A 4URWR 2DB3A 4E07A 2WJJA 4V03A 2DWOA 2J46A 4NU0A 3U4QA 3PENA 4Q9LA 3QXCA 4MRNA 1Q21A 2NQ2C 5FTMA 1NMZA 4TN1A 4OQXA 3AP2A 1N6NA 1HTWA 1P61B 2OCAA 2Q3HA 3B6EA 4IOJA 2FE4A 3SOPA 4A2QA 4HDQB 5GVSA 4B76A 2N1BA 3GEHA 3WRYC 1W1WA 2VHCA 4OI4A 4TLDA 4NDZA 1NKTA 1JJVA 5D3MB 4PZZA 3FVQA 1G20E 1NJFA 1WE2A 3KB1A 4B75A 2ZRAA 2FPLA 1WCV1 2XZOA 1Z07A 2UVQA 3MRSA 3BC1A 2IBMA 1MKYA 4PZLA 1FTSA 4PC1A 3HYRA 3OEHA 4PQFA 1MH1A 1RC8A 1E2PA 1E96A 2V9PA 2RKOA 3BWDD 1YR7A 4Q4JA 4BASA 3LBIA 1E2MA 1E2JA 4HLUC 3UANA 1X3SA 4M1TA 4IVRA 1HT1E 2ZYWX 2RCNA 1CRPA 1R8QA 3CB4A 1G291 2GJKA 2NPIA 4LV6A 3X1XA 4KCGA 1SQ5A 5K8LA 3MD0A 4M8NE 1E2KA 1VHTA 1GWNA 2YWGA 2YJTD 5G3ZA 4JLPA 4PR0A 3K0AB 1IY0A 2WOOA 1T8UA 1XJ0A 3B60A 2OSBA 2IUTA 3OEHD 4QC2A 2YWFA 3RS4A 1TNDA 1MABB 3U6BA 1T0HB 1RJ9B 2ZVQX 1U0HC 4EJSC 3LBHA 4LYFA 5BYKA 1EFCA 1SKYE 1IOZA 3TUIC 4A8JB 2BKEA 2REXB 4TYWA 4WIAA 4JLDA 4C0AC 4A0GA 1E9BA 2VHTA 5E7JA 3TAUA 4EPTA 4PQRA 4Q18A 1OF1A 3I61A 1I4DD 5KNCA 4DLVA 5CM8B 1JECA 4HLDA 3U44A 4LGMA 3N2IA 2W0SA 1SKYB 2P6RA 1XFAA 1U90A 4DLUA 4DEXA 1NMXA 5KNBA 4WVFA 2YHSA 1W36C 1QBKC 2PLRA 4M1SA 2ZRFA 1XJCA 1CIPA 4K8OA 3R7WB 4MKFA 1G8GA 1XD2A 4DDTA 3E5HA 2CE7A 2ORVA 4KJZA 1Z3IX 1DAHA 1NF3A 1E2HA 2ZRHA 4GNKA 2XNSA 1NBME 4JVMA 4ERNA 4LJYA 1F48A 4OK3A 2QAGC 3TJZA 2GZDA 3X1WA 2D06A 1II0A 4QM7A 1LVGA 4FMDB 4M1MA 3DVLA 5IT5A 1Z0DA 2QPTA 5EXPA 2BDTA 1GNPA 621PA 1FPMA 5FPTA 1XU4A 3SU8A 1TMKA 2VHJA 2HV8A 2UKDA 2WKQA 4HUQB 3SHWA 3CX7A 4ARZA 3K9HA 1JR3D 1RRPA 1YKSA 2NO1A 1LY1A 3LA6A 1Z08A 2CNWA 4DWJA 4UJ5A 2HCBA 2JLYA 1UM8A 3AVOA 1OYYA 3THWB 3MMPA 4DUGD 4B6FA 1NNEA 2H16A 3PJRA 2YVUA 1NN0A 5G53C 4JSTA 2OLKA 1KI2A 1P5ZB 4RZXA 2J0UA 1G64A 3GJ6A 2N46A 1DAFA 1GG2A 1SXJE 1YR6A 3NWJA 3IIMA 5EZ6B 3THYA 1H8HA 2J7PA 4RD3A 3AUXA 3A1SA 1FUUA 1HH4A 3W6OA 1LF5A 4IFBA 2A5DA 1AKYA 1G8HA 2VQSA 1EG7A 3KQUA 3A8TA 2O5VA 3CPJB 2W0MA 5A4JA 2G83A 4B3BA 2AN9A 4WZAE 4BFXA 1SXJB 3ZQJA 3RABA 4UJ3A 3GJ7A 4A0HA 2ORIA 3CONA 1KSJA 3K0CC 1GAJA 3DOFA 3HJNA 4AY2A 5JJKA 3SBDA 3MJRA 1JEEA 3RANA 4PO9A 1UADA 4JT4A 5HE9A 2ZS9A 1P3JA 2QMEA 2IXEA 2ORWA 3IKJA 4AG6A 4F38A 4TMVA 4RY2A 1H8HD 2GRJA 3AKCA 2OBNA 3SZRA 5F98A 3J81k 4BLPA 1N5KA 3SQWA 4EQ6A 1XCPA 2VO1A 3L8ZA 5AJZA 1XPOA 1KJYA 4DJTA 1WBDA 1MOZA 2DWQA 4DSTA 1LNZA 1P2SA 4ZO4A 4TMTA 2OZEA 4OKSA 3M6AA 2OCPA 4TMWA 3O47A 5LBIA 3PEUA 1N0WA 3SFVA 1SHKA 1XF9A 2GK6A 4TLCA 2QQEA 821PA 1MRNA 3DZ8A 4V0NA 2ZI5A 1NG1A 1VCOA 2XZPA 4DRZA 5JWOA 5KDDA 1TQ4A 2ZUDA 3N5CA 2Q3MA 1G7TA 3NDBB 2WZQA 2CLDX 1TF7A 3RAPR 3CUEF 4RD0A 3EC1A 3OIYA 2PMDA 2Q3FA 4U02A 1UJ2A 3ZJYA 2ZE5A 2F1JA 1OH8A 1P4SA 4G5SA 2QROA 3DEFA 3Q8XB 3OIWA 2HUPA 3DDCA 1S4QA 4HZUB 1NVVR 2PEZA 1DPFA 3IIKA 2A5YB 4TLEA 2JLUA 2O8CB 1KIMA 4LOAA 2AK2A 3OAAD 3Q5EA 2ZITA 5SZIA 3S1AA 3G5UA 1W46A 3DOEA 1M7BA 1ODFA 1YZGA 2ZRDA 2P5TB 3RDPA 2QQ0A 4UNQA 5GJCA 5H68A 2OFOA 4XVQA 1GL7A 1G18A 3CRMA 3RVBA 1R4AA 3LDAA 4MYUA 4B2LA 3LWNA 2FGJA 2QGZA 3MWLA 1NI3A 1IJFA 2GWHA 5FOSA 4Q4AB 2PEYA 1YVDA 4DIEA 4CIDA 5L3VA 4S2EA 4QHYA 2V6JA 3R9IA 1DAIA 3K9NA 4NKRA 2W58A 1A1VA 2ZI9A 3WY9A 4ZPXA 3SC3A 2ZRMA 4HUTA 4TYQA 4DLTA 1GKYA 2YNMA 1NIPA 2QAGA 2ZR9A 4QOSA 1IN5A 4PFSA 3I8SA 3KTAA 3NC1C 5CDFE 4M1KA 4UXHA 2GXAA 2FPKA 1ONBA 5HE8A 5JECA 3O8CA 3T35A 1U2RA 1KO1A 3L8YA 3KB2A 3BORA 1UFQA 3UKDA 1ZUIA 5JS8A 3R9WA 1NN1A 4MRVA 1VCMA 2PH1A 1W36D 4CEIA 2IYSA 1FMLA 1L2TA 3AVVA 1NL3A 2PBRA 2Q0HA 4O25A 2AX4A 3RRNA 2D4HA 4HAZA 2MMGA 5FOUA 2ZETA 3TW4A 2F3TA 1XPUA 1JPNA 3HDTA 1OB2A 4RZ2A 2QSYA 4C7OB 1G8PA 2VSXA 4NYIR 1UPTA 3L43A 1XTIA 3IBGA 1R0YA 4D0GA 1CULC 4TTPA 4C4PA 3ZQ6A 5BWMA 1R0ZA 3B85A 3QXSA 4RSGA 3FYHA 2JLSA 4JJKA 5SZKB 8OHMA 2D62A 5DI3B 5HZKA 5E7MA 1W4BA 4CT5A 4LHYA 1WMSA 2A2ZA 3ASYA 4N3NA 4NHOA 4XH9B 3LY5A 4MUBA 5L8VA 3LNCA 2IHYA 1XPRA 5CB8A 3ZYCA 1ZNWA 2CLSA 2H17A 3UG6A 1OKKA 5KSZA 5K8TA 3ZVRA 1W4RA 4TQAA 3T34A 4PXAA 1BIFA 1D5CA 4POAA 1MT0A 3P1JA 2JA1A 1N6OA 1XEWX 2NZJA 2VP4A 2ZU6A 3BFVA 2QE7D 2ZANA 4B3DA 3AVQA 4S35A 3NEJA 5KUTA 3KKPA 1YZKA 3AH8A 4MH0R 1BYIA 4JBWA 3QF4A 3GFPA 1E9SA 3B1YA 4HDCA 3UPUA 5FL7A 1N3BA 3GEIA 1J8MF 2RGNA 3QG1A 4IJMA 1N5IA 3AP3A 3ND8A 2DR3A 3EZ9A 1IM2A 2V7QA 1RYHA 2RH5A 2CJWA 1X6VA 2R6FA 3D8BA 2QAJA 3CLVA 2IF2A 1E79A 4NYMQ 2C77A 4NBSA 3NG1A 4DLSA 3MAAC 1NIJA 3PCRB 4BFUA 1U81A 4NPHA 2ZU0C 4JLMA 1DO0A 3I72A 4QGFA 5JJIA 3CRW1 2X2FA 2QUZA 4CGZA 4QJ3A 5FL7D 4JL6A 2HDNB 2GESA 4URVR 1BMFA 2R6AA 4BLTA 4NYJQ 2F55A 4FIDA 1IAQA 4DCNA 2VSFA 4N0EA 1Z0KA 3AKDA 4ACAA 1OXTA 1GM5A 4YXWA 2G0NA 1JAHA 2EVWX 4HAVA 2ANBA 1BS1A 1T4GA 2GCPA 2VL7A 1R5NA 1E79D 3B1XA 1XMVA 2ZREA 3ASZA 3NBZC 4IDPA 2W6IA 1DAEA 2EYQA 1X8JA 3GLFE 1LS1A 1RYFA 3A1WA 1YRAA 4CYMA 1QHSA 2JATA 3EZ7A 3VR4A 2F43A 5AK0A 5FTJA 1G3RA 2NPFA 3LQRA 3SN6A 1BMFD 1EX7A 1VIAA 3D31A 2JJ8A 2O8FB 1S8FA 1Z06A 3NC0C 1P2UA 1P6XA 1VKJA 3GLFB 3DHWC 2ERYA 1YJ5A 2IYTA 4YXWD 4EIWA 3QI2A 2WWFA 1SGWA 2FH5B 3QENA 2JASA 4XJXA 3U61B 2F1RA 3C4JA 2IT1A 4P33A 5JRJA 1PLJA 5FBRB 3GLIE 1VECA 2WIBA 5KHOC 2JEOA 2V55B 1L8QA 3RNLA 1PUIA 2C99A 2W83A 3IBYA 3FMIA 4LJ4A 2PL3A 4Z1MA 5KSOA 1AS0A 1RFLA 2KJQA 1II9A 3WYFA 3ZVMA 3GLIB 4O3MA 5DYIA 1IBRA 2FOLA 3K0FA 4LYJA 1KZ7B 4CEJA 2R9VA 2WJHA 5C46F 2RHMA 1X8KA 1ZNYA 4OK6A 1S0UA 1XD8A 2J5XA 3FKSA 5GVRA 2ZJAA 1T0JB 2B6HA 4A15A 1KK0A 3L0IB 2ZE7A 4L4UA 2DFLA 5EP3A 4WZ6A 4YMVA 2Z6VA 4RJLA 4K81B 1S2MA 3QJYA 3V4FA 3TK1A 3LH5A 3CRVA 1NY5A 1E1QA 1Z6TA 4Z1MD 3GLHE 2X8AA 1Z0IA 2BEJA 3U3OA 2GBLC 4ZI3A 4D82A 1QHXA 1NY6A 1P73A 1GILA 3CR7A 2WTUA 3HU1A 1M7HA 3TLXA 2GHIA 4O2RA 3GMTA 3GLHB 1G17A 1W44A 1T3HA 2BMJA 5J4YA 3IHWA 4U00A 1W49A 4R2HA 2ZRLA 2EFDB 3KKOA 4BUJA 1Q44A 4DSNA 1TEVA 3A37A 2XXAA 1F2UB 3SYNA 1ZP6A 1XXHE 2ZPTX 4CDGA 1Z63A 1H65A 4OJKA 4MKIA 3RS0A 1E1QD 4Q5IA 1X1RA 2D7DA 3QVVA 3N70A 2A3RA 2V54A 3CM0A 3E1SA 3RC3A 2BBOA 3KFVA 1OH7A 4JVLA 3UWOA 5KSPA 2WWHA 3K1JA 2J9RA 3H84A 1EXMA 1QG4A 1ZNZA 2VTKA 3AKYA 4PSAA 4G5RA 2PT5A 3VAAA 5EE0A 4XSGA 3RSOA 5F9FA 1KO4A 3F8TA 3CX8A 3BB3A 4KHZA 4LJ5A 1VG1A 1WBBA 2Z4RA 3W8NA 3AF1A 4BQSA 2N42A 5EE5B 2QI9C 2UZ3A 3IILA 1KDTA 5GADl 5DLQC 5CB6A 3EPKA 5EE3A 2OXCA 4TSFA 4PQYA 2VLIA 4V0ME 4W7SA 4P4SB 2IW3A 4BECA 1F2TB 3FOZA 3CR8A 2FJUA 2OG2A 1KJWA 4ABYA 4XVUA 2BM0A 1Z6GA 2FGKA 3EARA 3LVQE 3ICEA 2FV8A 5CITA 1MR3F 4JBXA 3DMNA 2G88A 4RD2A 4RD4A 2IEZA 2FWRA 4JL8A 4PSVA 1Q3TA 4US0R 1IXZA 2A7QA 1KY3A 1Z6YA 4EPYA 1CJUC 2IYXA 2XJ4A 1DAKA 1Z2AA 1D9ZA 2WSSA 3FHCB 4URZR 1UDXA 5UKDA 1UBEA 1ZBDA 1XEFA 3HU2A 4TQUS 1XTKA 1NN5A 1VG9B 2J1LA 4HATA 4KLNA 4H1UA 4UQOA 2GXUA 2A9KA 3FHTA 3A4LA 1W5SA 3QIAA 3QPWA 2B21A 2ZRNA 1LV7A 4V0LA 5B2ZA 4NCJA 5CM9C 1W7AA 2YINC 1NMYA 1E2QA 3I4LA 2IYWA 3GEEA 2ZRKA 2CE2X 3DKVA 2H18A 2VEDA 3IQWA 4B3XA 2JDID 5HZHA 3W6PA 3BGWA 1Z6XA 2XTNA 5CYPA 3ETLA 2O8BA 2QEQA 1UKZA 4C0BA 1W0JD 2WSSD 4Y0VA 1Z0JA 3T1OA 4C3ZA 2DFKB 1ZCAA 3KJIA 4DSOA 1Z47A 1KKLA 4DLXA 1GSIA 2NO6A 2XJ9A 1YR9A 4IW3B 4B74A 1BH2A 5BN3A 1DAGA 4QFMA 3H4MA 1US8A 3KJEA 2RGBA 4B44A 4LJ7A 2VP5A 1XNJA 3WHKA 3FKQA 2PJZA 2XB2A 1DARA 5K8UA 4ZDKA 4F92B 4FMCF 3K9LA 1EFTA 2YKGA 3TR5A 1CXZA 1QVAA 3L0OA 4LBWA 2HF8A 4KFUA 2FSHA 2PX3A 3TSZA 2A78A 5IK2D 2ZAOA 3EA5A 1A7JA 2GCNA 5KDLA 2A30A 3P27A 1VTKA 2WWWA 2P6UA 5CIQA 3GLGB 4FW9A 1Z5ZA 3K70B 2I3BA 2HT6A 721PA 4BWYA 2ATVA 1N25A 3NXSA 2ZI4A 1KSGA 4Q00A 1PV4A 1KHTA 3BRWD 3CPHA 4JKYA 4KI0A 4R71A 4IDNA 4F7WA 2BJVA 4M9SA 2BEKA 2R6DA 1KMHB 4OYHA 1S1CA 3OIUA 1SVMA 2D3WA 2AFHE 4C9BA 5KTYA 4MRRA 3SR0A 4FXPA 3SYKA 3IEVA 5EUMA 2WVJA 3A36A 2AWNA 2DHRA 2KI5A 1ZM7A 2GCOB 3H2YA 4IDHA 1IONA 4ZIRB 2IS4A 1FQKA 2L0XA 4JLNA 5LD2C 3EPLA 4NCNA 1WF3A 4C2UA 5FUWA 5FTNA 3JZMA 3VHXA 2IYUA 5F2EA 1IN4A 3AGQA 4MKGA 3U4QB 1GOTA 1YZNA 2ZIAA 2F3RA 2JJ2A 1Q12A 1WA5A 1Y3AA 3DM9B 3TBKA 5D3MA 3ADKA 2WBLC 2RGDA 4LJ9A 4TWZA 1E69A 3M0EA 4FWTA 3D7MA 3PXGA 3QG5A 1XDBA 3NH6A 2IYVA 5IF9A 2JLXA 4ASUA 3AVTA 2O0JA 1A4RA 2QM8A 2WKRA 3VX3A 4AYWA 3U7GA 3BH0A 4OL0A 4PHFA 1G3IA 4A6PA 1VCIA 2VSOA 2VYFA 1EX6A 1HE8B 4TYPA 2ZUBA 3TAHA 4PHGA 5A0FA 4V02A 4M9QA 1R2QA 1GKUB 2VF8A 6Q21A 3EPJA 3VR1A 2VA8A 4G01B 4MRSA 5AR1A 1EFUA 2ZEJA 3K0AA 2JIZA 3P32A 1G8YA 3GJ4A 4ASUD 4GMDA 1CR0A 5AJYA 3CF6R 1MABA 2VHUA 1RJ9A 2VP0A 3CF2A 1DAMA 4KLZA 3GJ3A 1XMJA 2CXXA 1E0AA 4A8JA 2Q9BA 4PO8A 3IQXA 2ZM5A 1CJVC 4ACBA 3SE0A 1GNRA 4TT3A 1N2CE 3JZAA 2FN4A 3UMFA 2C8VA 5TMPA 1CR1A 4ILEA 5CK4A 3ZD6A 3KJHA 1XTJA 2EYUA 1GL6A 2MSCB 4GZMA 1OW3B 3X2SA 2FEMA 1MO6A 4YONB 1HYQA 1Q20A 4C30A 2P65A 2GJSA 4KVAA 1YQTA 3AF0A 4FD2A 3W9YA 3UMSA 3N2EA 4PAOA 4AC9A 4G5OA 1OYWA 2BCJQ 2J3EA 2XOKA 3FHOA 4KSCA 2RGAA 1W0KA 3EASA 5TDHA 1JR3E 3R7WA 2Q6TA 4YMWA 1OIWA 3QKRB 1XP8A 1IY2A 4LY6A 4QNRA 3QPUA 1E32A 3QKTA 3TGPA 3EW9A 3FWYA 2CVHA 4HB0A 5DI9A 4XD7A 3W8RA 1AQUA 1QHHB 4RKFA 1CLUA 1NVXQ 3EZFA 1DTSA 2V8OA 2HYDA 3U60B 4AI6A 1NBMA 4M1OA 4W5WA 1KGDA 3LW8A 3U5ZB 4IRUB 4NL4H 3SHFA 2XOKD 4HUQA 3C5CA 1YZQA 4LRWA 1W0KD 4F4CA 1IN7A 5EE9A 2REBA 3LXRA 3EAQA 4QHTA 4CEHB 1ZU4A 3KKMA 3REGA 4DLZA 2R62A 1I2MA 2GDJA 3THWA 1HV8A 1U99A 2R2AA 4JS0A 2OAQ1 1R8SA 2JCSA 3AF2A 4OJQA 4A1FA 5L3QA 3PUYA 1MO3A 3EC2A 4D26A 4UXJA 2GF9A 4A0RA 2QT1A 2IS6A 1JJ7A 1FX0B 3CRRA 4KSBA 4WOPA 2Z5FA 4B3FX 3WP1B 1UEIA 4OK5A 2NGRA 4YDSA 1G9XA 3MWYW 4KYUA 4TYNA 1T9HA 2CNWD 3VR3A 4TMZA 2OEPA 1IY1A 2QPOA 4KFTA 1ZMXA 4LJ6A 4Q1BA 2V3CC 1S9HA 1G41A 4PC7A 1SHZA 1SVLA 3OE7A 1SXJA 1V43A 3SJAA 2ONJA 1EFHA 3T1QA 2CVFA 3KL4A 2X77A 4OQFA 2JJ1A 4XTRA 4R7ZA 2O8EB 1HUQA 1W47A 1P60A 2J7PD 4B73A 1XMSA 2EFCB 3W3AA 1AIPA 2RGNC 2HEIA 3NHAA 2GJAA 3MLEA 4TYYA 1JBKA 5EE1A 4Q66C 4LJ8A 4MITA 4HB4A 3T06B 2AL7A 2I1QA 1LB1B 3SEAA 3A1VA 4RVCA 2J0SA 1J70A 1KO5A 2OE2A 4UKDA 3AUYA 2QMOA 1GUAA 5EXSA 5TXGA 3SDZA 2WWGA 1SXJD 3OE7D 1N6IA 1QG2A 4KYIB 2D2FA 5JMTA 4PSKA 3ADBA 2EWWA 4TLAA 1GFIA 1E0SA 3U6KA 4IVPA 4OHXA 2E9SA 4R2IA 2BIFA 1XEXB 5JJLA 1SZPA 1VDZA 4AKHA 3NTUA 1GP2A 1CTQA 5FOVA 3B1WA 4HB3A 4JYBA 4LCBA 2VBCA 2YZ2A 2JAQA 3MGCA 4AYTA 2XITA 3CZQA 2OFWA 4YLGA 3BFXA 3WMGA 2C96A 2PX0A 2RGGA 1J90A 1VPLA 5IDVA 1OFUX 3LLUA 1C4OA 1UBFA 2ZJ5A 1GRRA 1U0JA 1EFRA 4W5HA 4B2IA 4DB4A 2ZRGA 4HZUA 2NO7A 3B82A 4JIMA 3WRXC 4ZV4A 5BXQC 1Q0UA 4DLYA 1QVRA 5E7IA 1M74A 1A5TA 2FU5C 1ZRHA 2W2XA 2ZYTX 3TQCA 3VKGA 2QA5A 5L3SB 3NEYA 3IDQA 4L16A 2GKSA 3BFKA 2W00A 1WRBA 1NKSA 5P21A 1VCNA 3GLGE 2F6RA 2PCJA 3BJIC 1II8B 3V9PA 3NH9A 4EJSB 2VP6A 4C0KA 2IUSA 3ECCA 3PFIA 4N1AA 2R6CA 5IHPA 2HJVA 4QRHA 1D9XA 2QL6A 3FFBA 1FZQA 4PAQA 4Q4AA 3WNCA 3WNBA 4DIDA 3BH7A 4RCYA 3CH5A 1XCMA 2F7SA 2ZVPX 4LZZA 3AVPA 2PZGA 3U3JA 2OAP1 1OPXA 1YZTA 3WMEA 1GNQA 5FTKA 4OHVA 2Z43A 3RS7A 2ZR7A 2D2EA 2F1IA 4M9ZA 2O52A 5CLLA 4IOKA 1W36B 4Q9IA 4DLRA 1GZSA 2BC9A 2OHFA 1TU3A 5FBVB 4LPSA 1K5GA 4KXFB 4JL5A 3SBEA 1ZW6A 3W34A 1G1MA 1ZM9A 2FSFA 4WA7A 1AGPA 4A36A 1FNMA 1P9RA 3I5XA 4GOXA 5DIFA 4Q4HB 5CDFA 4FMBB 1HURA 4GRAA 1Z2CA 4ZI2A 4HEJA 4Q1CA 1S9DA 3PUVA 4MDFA 4X8HA 1JQLB 1R7RA 3PEVA 3TE6A 1KDRA 2FMXA 1HY3A 4QBIA 4C7OA 1X1SA 3U2QA 3CX6A 3ADDA 3U7HB 1CP2A 1M8PA 1M7GA 1KI8A 1I2DA 4LBZA 1ZU5A 2QNRA 4LHXA 3RS2A 3UMRA 5FOTA 1YZLA 221PA 4D4MA 2GAOA
chains in the Genus database with same CATH superfamily
1CUCA 3VPXA 3VNRA 4I4TA 1GIAA 1Z8NA 1JIKA 1SKUA 2R48A 1Q22A 3KE8A 5ALIA 3PEWA 4G9BA 3WWPA 1U0RA 4FDAA 4XB2A 1FP6A 3IQDB 3P96A 2AOUB 1QKKA 3MF4A 4Q3BA 3ZGNA 1RBZA 3FCSB 4AECA 1YZYA 2OP0A 4WDQA 5ICCA 4B2YA 3W5BA 5I7RA 4URXR 4DWOA 3BOSA 3H4IA 4RKEA 2XW6A 1GL9B 4IXNA 1VLQA 3TDNA 4U2FA 1AQYA 1C0IA 3QKUA 4KO8A 1SZDA 1I4TD 2B92A 1DZ3A 1TFRA 2OUKA 2JH8A 2ZAMA 1VHLA 1GRQA 3ANTA 3B2EA 4QUHA 5BW6B 3WQRA 2QP4A 4ER6A 4F4IA 5C2JB 3LDGA 5J1SB 3MHTA 3D2LA 3FVTA 1GN8A 4QOFA 4YP6A 3MELA 5FOWA 3T6KA 3ZIAA 4MRMB 1PYGA 4PZYA 1DMSA 1O77A 4FOPA 5JU6A 4WFQA 1J6UA 2VXYA 3OQBA 4B3RB 4V0OA 1EVJA 1EK0A 3EGCA 4XDGA 4EGAA 4JQCA 1K6MA 4L28A 2HRZA 1BDMA 3E9DA 1YZUA 3OX3A 3TLZA 1JWAB 3UXMA 1ZCBA 2DCUA 1ZBQA 2D7CA 2OHJA 4RGQA 3P9YA 4XJTA 2DZDA 3HVKA 3BSYA 3BWBA 4HBGA 3STXA 3SZLA 4LOJA 4N41A 2OAGA 4F60A 5AK4A 1DCMA 2GS9A 4EVRA 2G7ZA 4DFDA 4RTJA 4ZOLF 2R68A 1EP3B 4P6VF 2IZZA 4PXYA 1PLLA 4RPIA 4DLAA 3URKA 2VF2A 4YRMA 4IV8A 1MO4A 1N2SA 3V5NA 1D03A 2IF0A 2OV4A 4Q3LA 5JD4A 5JVDF 2YV3A 4KAXA 4RNDB 1N0VC 1T2VA 1P8JA 1TADA 4RLQA 4D9MA 1EA5A 5EWMA 5JZVA 4MV0A 1FTNA 4TTIA 1VZ2A 2XPCA 3DL0A 3PUZA 2GD2A 3BDAA 5ALPA 2GRUA 4JLKA 3COPA 1LGYA 4UDNA 3GC6A 3BD7A 1M0SA 1S3GA 2EKBA 4RHFA 4XJVA 5DIZA 4A5OA 3A4TA 3HH8A 4KSYA 1MV5A 3DFZA 3NHLA 2WFMA 2ATCA 4M0MA 3G2JA 3BIJA 1MRSA 1YE8A 1DJQA 1D3AA 1K7YA 2Q49A 3QBTA 4TTQA 2PZFA 4I1YA 3TXXA 5HKKA 2R0QC 3AUKA 1BW9B 4JC5A 5BQ5A 1KH2A 4KVGA 1RD4A 2HIHA 3IUYA 2JVJA 4MMYB 3VBCA 4G8BA 4H1WA 1I3NA 1XN1A 2NVUA 3UUGA 3JR3A 3VKWA 3QF7A 2Z2ZA 4QQRA 3PGKA 4QUIA 3UK1A 5BWBA 1X0XA 3A6ZA 1PZMA 3V3TA 1NVUQ 1ZVJA 5I7EA 4GHWA 1KIAA 3O91A 4KO4S 3V55A 2CDCA 3WMXA 4BLQA 2WQ7A 2W2OA 3COJA 4W8HA 1Z73A 1RMQA 1LBEA 2BFDB 4OOFA 4BNYA 2O8FA 4GMXA 5T67A 3LF2A 4U7GA 4C2AA 3GLFA 1H1LB 2PX2A 3NRJA 4RTNA 3QNMA 2ZJFA 3NCTA 1C2TA 2W6ID 5D85A 3QV1A 5ESWA 4G6ZA 3EW7A 3K09C 1QZUA 3E8MA 5JLAA 2M6LA 1NR1A 3T7CA 2H7VA 3IEKA 1UDWA 3G2KA 1NJ2A 3EXFB 4Q4LA 5H3HA 3RYHA 4DMGA 4C4YA 2WQZA 2A4KA 1JWBB 4HDMA 1UWCA 4BNTA 1TO6A 1FDVA 1LX6A 2BFEA 3FXAA 3KVOA 3L7DA 3M3HA 4G25A 2PUAA 2Q5JA 3HFJA 3P20A 1G3MA 1BO6A 1X87A 5IASA 3QXJA 2FUEA 1F17A 4QRDA 3NNNA 1D4OA 4XPIA 5JQWA 4N7MA 3HNOA 3V4VB 4BGUA 3CLSD 1KZGB 2ZIWB 4EUKA 3KQHA 1U2QA 1MJGA 3DTTA 3EF3A 2MSEB 1L5FA 4TL8A 2YWXA 3PDWA 3HHEA 1EWYA 2C9CA 4WFKA 1V1RA 3IR6A 1UMBB 5AM1A 3ZU2A 5JAOA 5DNWA 4Q9KA 3ZWCA 3RVQA 3ZGXA 3CISA 1QK4A 1JN0A 3RIGA 3ZHCA 4EKNB 7GPBA 5I9BA 1X19A 3FPFA 2CCGA 2P3LA 4RMIA 3IQFA 1XDZA 4HI0E 4BBJA 2PT6A 2IODA 3RT9A 3FUUA 2QL9A 2C95A 1V8DA 2OGSA 5EKUA 3D3EA 3EDMA 5FNZA 4BGVA 4P82A 4RTPA 1V8PA 4EHAA 1B76A 1QR6A 3KSDO 1KSFX 1TZ2A 2R6GA 4BN0A 2E5LB 2RMKA 4HXEB 4O0MA 3QPBA 1Z28A 2DWPA 3FBWA 5MDHA 1QHGA 4LSGA 1PTJC 1CB7A 2YC4C 1RJFA 1FMTA 2DWCA 1YQEA 3IAM1 3JQBC 3KKQA 2JCVA 4X00A 4UHBA 5FD8A 3TIGA 3GVCA 4KDFA 2C4MA 3BMOB 5DE3A 4RAQA 3SSNA 1ZM4A 3IHLA 4LFCB 1XWFA 3K9WA 4P80A 2DXIA 3PNPA 4YBZA 1ORWA 1RQNA 3N0TA 3LV8A 5A71A 4NZPA 3RTAA 1VKRA 1CDZA 3S27A 3B1ZA 1P7VA 5CW1A 4N76A 1R6UA 2RHJA 5EP4A 4BQNA 4GP6A 3FYUB 3D5QA 2QS9A 3GFGA 3MWEA 3PT9A 1EWQA 4EGJA 2C5HA 1QWSA 2FMKA 5AK3A 2RAPA 4ZT7A 2I22A 3DE1X 2YJGA 5B7GA 3DZCA 4PX9A 4HNVA 2C7QA 1TK9A 1QTRA 3LQKA 4A8HA 4QQFA 2UYYA 4Q7MB 2DBYA 5TQ0B 2A5LA 3PEFA 1B15A 2F9MA 3D7RA 4GRIA 4EPXA 1A2BA 4Z3DA 3B5JA 3TMYA 1IM8A 4PFKA 2EL7A 4GLFA 3DDWA 3V8VA 4O4IB 3X44A 4LMBA 3AEXA 4RIEA 2DPXA 1X86B 1EGAA 3CTPA 4RHEA 1TEZA 3RJ9A 4BZQA 1G8SA 2ODBA 1F51E 1TO2E 3IFSA 1CR6A 3YASA 4D9GA 2FFAA 5IVIA 3A70A 3QPDA 2WAYA 5D5PA 1ZHHA 2BSXA 3ROPA 1FP2A 5EMMA 1HT2E 2E4YA 4OF4A 2G1JA 3W2HA 1HA3A 1XHFA 3B70A 2C9MA 1CG6A 1QF9A 2Q5OA 3HEBA 1BVUA 2ZRCA 1LV8A 2REOA 3PPXA 3BCUA 4YPVA 1Q0PA 1RBYA 4CRWB 5IZCC 5JYEA 4JXXA 5G0UA 4MJ3A 3VI3B 4CJXA 4QELA 4KPGA 4DV7B 1QIKA 3KVVA 3H9GA 3ONVA 5HQJA 2YJ5A 2WHXA 4L6AA 2HA3A 1GADO 5H16A 5LB2A 5B4TA 4FQ7A 2OG1A 4GI7A 4IXMA 3ORRA 5FBLB 5ICMA 4CXMA 1GZHB 2YZGA 4IDDA 2CHVA 2FB9A 5HTOA 3HJFA 2WJAA 3N7TA 3P19A 2DERA 4FINA 4KMRA 3QKSB 1KI6A 5F12A 3I32A 2JVKA 2P3SA 3A27A 4IDCA 1P6UA 4OXYA 3T4UA 3E7FA 3EWSA 2DM6A 1DKOA 3H99A 4YRPA 3T1HB 1R0LA 3CKLA 1O5OA 1WDTA 2C20A 1DTEA 2J33A 2YV5A 2BGKA 1KAMA 1L5KA 5IEJA 3LC7O 4EA8A 3QXXA 4B6SA 1M8GA 4Q47A 1V37A 1PG2A 4Q4CA 5KYNA 2ACWA 4KZPA 4WCFA 5F4ZA 4QASA 4QGSA 1C8VB 4MLZA 2MMCA 4G5FA 3GRKA 4Z4QA 1RLOA 2Y93A 4HNQA 1VOTA 3K09A 1D7OA 3DMHA 4X8MA 4B34A 5FQOA 4D6YA 2VAVA 3GJ8A 3I39X 4QG7A 4YT8A 2C7PA 3KQSA 1A9QA 2G4LA 1Y5LA 2X14A 2QM7A 2RG7A 2GBGA 3RUCA 1V7PC 1E94E 2JKZA 4YT2A 5ADWA 4WMLA 2ZE8A 2NTVA 4B09A 4DA7A 3MTEA 3ESBA 3SJCA 1B6RA 2Z8ZA 2SICE 3GH3A 3R7NA 3FPKA 3QQ5A 2ZSHA 1MV8A 1WUIS 1ND6A 3ELDA 3CFYA 4P3YA 5H80A 1N0UA 4I14A 3L7KA 3PNQA 3V4OA 3BJEA 5AYVA 2ZYAA 5FI1B 2J7KA 4TV9F 1ZY2A 3R8CA 5TF4A 1ZJ6A 1MB2A 5CB4F 3CH6A 4KFRA 3RF7A 2PGAA 2RE8A 4KH1A 1DEXA 4UM5A 2EBUA 3JQ6A 1N34B 3ECAA 4UEJA 5FPSA 4BNVA 4C4RA 16PKA 2XLCA 2YR0A 4CG1A 3S2ZA 3EEFA 1M0TA 3PHBE 1Z4QA 3GBPA 2Z9CA 1M10A 3K5HA 2PIDA 5E8RA 4EPRA 1C9MA 1I80A 2Y0CA 3ZTYA 4ARUA 5AXAA 1MDFA 2I2DA 2RSLA 2PLAA 3WLTA 2IPLA 4B84A 5LQDA 5GM1A 1KOGA 2PR2A 4K6OA 5J58A 1RLTA 3N2GB 1C3EA 2PGIA 4AWXA 1SXJC 1ML4A 2PD6A 1WB6A 2J3IA 1L5VA 3H1EA 4FI3F 4N9WA 4E6EA 3CNLA 3NYIA 3S68A 1N92A 4EW2A 4YVFA 1O5IA 1HRDA 2FVYA 3UXHA 4C0WA 3JQBA 3BBPA 3CY6A 2PGNA 1D4ZA 2VF7A 1ZWLA 4J7UA 1IMJA 5CH3A 3JWHA 2WAXA 4NVRA 2Q1UA 1JGTA 1BGWA 4K9NA 2P6NA 3U9LA 4POOA 5L4NA 1ZJZA 1BEZA 2YYZA 4N8SA 4QDZA 4EO7A 4DCPA 2XZLA 3T7AA 3O92A 3PQCA 1DP4A 4L3WA 5K3AA 4NFYA 4PFQA 3T9BA 1HFKA 4P53A 4ZVPA 3NO4A 4N3CA 1QYRA 5TB5A 3UMYA 1YT5A 5C34B 4CCSA 1EIZA 5CA0F 2WM8A 3ET5A 3HB7A 4JBIA 1QUEA 5FF9A 3B53X 1YUMA 3UMJA 2ZCVA 4D42A 1VJDA 4LNUB 4MR8B 3QVGA 3KBBA 4MW5A 4CQLB 1L5HB 3AV3A 4E5KA 2PRZA 1N8SA 2XYQA 1BKSB 1MN6A 1U65A 2ES4A 3CS3A 1L4HA 4UEKA 1JDBB 2BMEA 2D8AA 2XMCA 5EKXA 1Z2DA 2WMOB 4J7XA 5HIMA 5JT1A 1YMQA 1N6PA 2PAFA 3DPSA 5DP2A 3Q72A 5I3ZA 2YFQA 2JGRA 3CZPA 2OO7A 3KJXA 4K9LA 1VPTA 1ANKA 2GAFA 2Y1OA 3DBIA 2C5EA 1LTQA 2FPGB 7REQA 2XYRA 5ALLA 1XDGA 1JXMA 4QTZA 1JQ3A 2QW0X 4GYWA 3Q8WA 2WICA 1P8AA 3QX8A 4BFSA 1TRKA 3O8RA 3BE6A 2V5UA 2Q5IA 4A3SA 4ZEMA 3GARA 1DSSG 4COKA 5ALHA 2DGDA 1HSZA 3IJPA 5EHQA 3WIUA 1XTUA 1Y4ZA 3GWZA 3QU2A 5KMGA 2H1RA 3E84A 3GGSA 5JCZA 1Q1QA 2A1UA 1WXDA 4FMDF 5LKAA 5B58T 3I9OA 1ESNA 4RVUA 4D25A 3L0YA 3FTFA 1E5VA 3WGKA 4PRZA 2NT4A 3TQTA 2AUNA 2PYZA 5L7YA 3QX3A 4Y30A 5JSKA 3VH4A 1EFPB 2QL7A 3GUYA 2HLDD 2PJDA 1N75A 2IIPA 1ESCA 2W9XA 1M1ZA 4MOWA 4LYAA 1SOVA 2JIZD 1Z0AA 3OZ7A 1IBMB 2UZ0A 1SJ9A 3UJPA 1RCTE 4ENVA 3LLMA 4Z7OB 3PD7A 2WW8A 3U44B 4C78A 3V8BA 2X6QA 5DM0A 2X2PA 4B48A 3AB3A 3R0VA 4HNTA 3SD7A 3ZI0A 5IC4A 3H17A 4MVJG 1LEHA 1SB8A 1XTRA 4OJNA 3RPEA 1ZITA 4PX2A 1A8HA 1XD2B 3QKRA 3KZMA 2GERA 1ZOPA 1XTSA 2O6HA 1C7EA 4RQAA 1SUCA 3TYXA 1B42A 3IJEB 4WHMA 1XMXA 4NX2A 3E1KA 4B46A 2B99A 4OGGA 3GMDA 3OF5A 2GZHA 1RM0A 3BWCA 4UPDA 4K87A 4NONA 3UA4A 4DMHA 1B43A 1QHHA 3GQVA 5LA6B 1JEAA 1Z6QA 4JUDX 1K3FA 2PWYA 3MCWA 5LN1A 3TPCA 4J7CA 2WHYA 3QW2A 4FE3A 3PIDA 4N6NA 4QPCA 1L7BA 4U9IS 5K45A 1JR6A 4KGDA 2ODWA 1QE3A 3AZOA 2XE4A 4JFAA 4JSYA 4WN9A 3E2IA 4CVNA 1OJLA 2AJTA 2UVPB 4YWHA 3I73A 2F9FA 3HR8A 5L3RA 5FUMA 3MILA 2ZS8A 2SHKA 4DABA 3NRBA 3A2KA 5FFNA 3EUAA 2VHXA 2PKYX 3B7GA 4PLYA 4OBEA 4H7DA 2GN8A 1QQ6A 4AMYA 1ZA1A 3KT3A 1C29B 5K9ZA 1GQ2A 2QT0A 1YBMA 4HNAA 3C14C 3D5TA 3MCZA 1A4UA 1D07A 4LY0A 4IMIB 1JHDA 3PR3A 1V11A 2FXIA 2GBIA 3IKVA 3BRSA 4RHUA 1R0WA 4EFLA 5L3QB 1ZJWA 4Y18A 1TYDE 2CMFA 2R44A 2A9FA 2O6LA 3HADA 5JQGA 3THYB 2FZLA 5GV7A 3RU3A 3U3MA 3EHEA 4WK2B 1GNSA 4P3PA 3T38A 3TRDA 3DAYA 1KKMA 4HAWA 4YDHB 3UWSA 1T43A 3RLFA 1U04A 4Y2GA 3I09A 1NQWA 3IAXA 1CHDA 1KS2A 3EIUA 4OP1A 3BXXA 3ZGOA 1RXIA 4NNPA 2QTZA 2CEKA 1WZCA 2O8EA 1CYDA 5EXXA 5FPKA 2E1RA 5B7NA 4MVYA 1G2OA 5AVUA 4PRYA 2J0QA 1W2WB 1TD9A 3E70C 4GXNA 2EZTA 2R8RA 2A0YA 1C9JA 4AS3A 5C4IA 3OM9A 2H1HA 3LPLA 3LYUA 4QQKA 4P7FA 4RLSA 2JGJA 2FTKE 3T54A 2VDWA 3OY2A 2UUOA 4BVGA 1M54A 2I33A 1J8VA 2QIPA 5A2GA 4JY7A 4GOOD 1AK2A 1M83A 2WMDA 1PG0A 1V7ZA 3CZRA 2OHOA 4XGQA 2GN1A 2CN1A 5LL6P 3E7PA 4O4JF 3KELA 4Q7KA 1Y1PA 1OWLA 2QL5A 4KN5A 5C4GB 4EQ6B 2ODAA 4K6MA 2HT1A 4U8GA 2F48A 4HOYA 4MW1A 4ZI7B 4AK9A 1KC1A 2LE0A 1QKIA 3LCMA 3HB0A 4UUMA 4MVJM 3SHVA 4RZIA 4KPYA 4GI5A 2D74A 3P0EA 4M9UA 4PSCA 3TQOA 3ZIDA 3WRYA 1SHJA 4WBSA 1I1QB 3FMVA 4K9OA 4M22A 4DR6B 1JEQB 4LNAA 4G81A 3SDSA 3DUWA 3L79A 1XV5A 3KJQA 3AUJB 1FCJA 2YHIA 1HDYA 4II3A 4G0MA 5I4BA 3CC8A 1GA1A 1SK8A 4INOA 3VR6A 3I5YA 4U7DA 1PWEA 4TRNA 1Y1TA 3G8DA 3ZW9A 1QFMA 1VMKA 4Z4EA 4DPKA 2QOEA 2O2JA 2RHOA 3PNOA 5EWLA 2FWBA 4EKYA 3LPCA 3L6UA 1GUYA 3HYLA 3KZKA 1YB1A 2XBMA 1RE0A 2ZJBA 2WM9B 1XRPA 2J0VA 4CKBA 4DAEA 4PO3X 1ADFA 3PDHA 1RRVA 5AVZA 1J23A 4JUIA 2BRUC 4N65A 3DVRX 5AJVB 4EG5A 4EL0A 1U8ZA 3G13A 2W6JA 4DCTA 4MWEA 4F04A 2Y76A 1R8XA 3JAWB 1KAQA 1EWVA 1ORVA 4UHHA 1UWVA 4E12A 1QO0D 1E7QA 3IV6A 4P8RA 2PH7A 4KKXB 4MVWA 3I42A 5D3QA 3U0VA 5L3SA 1C2YA 4J29A 4WCDA 2QJFA 5HCIA 5JY6A 4IX1A 1IEQA 1SC6A 2B5VA 2H1CA 3DBRB 4I55F 1II8A 4BMSA 1A8UA 3C5VA 1CYEA 3VJRA 1X7ZB 3NT5A 1EUDA 1TCBA 2I62A 1DG1G 3B1VA 3O95A 2XADA 2PA3A 3BD8A 4HQOA 4B4DA 4R05A 4QTYA 1LVHA 5C3MA 4KXWA 1A9PA 3OU7A 3PITA 1XX6A 2EZ8A 1TCVA 2D1QA 2KBEA 4L6CA 4K6HA 4C6TA 1J7KA 3EOZA 5FHRA 1LPAB 5C5CA 2Q3CA 5FFMA 4I9FA 5ITZB 1SD5A 3TRFA 5H83A 1G7SA 1TCAA 5AUOB 5BSGA 1U4OA 2IK8A 3QBEA 5FTWA 5CVTA 4IZIA 5KYTA 1SD2A 2X5XA 3MT0A 2E3JA 3PIRA 4YCAA 2FA9A 4TVOA 1A69A 5HQ3A 1I3OA 1YFLA 3QE4A 1R10A 4F84A 1MEOA 1XMPA 1M1YE 2AEJA 2ROQA 4IMRA 4KG7A 1XOIA 2RHWA 5K4HA 3MB5A 1QUFA 1YWGO 2GPAA 3D3WA 1ZNXA 3QBDA 3W7VA 2OZKA 2JI6A 4DXDA 2JL1A 3NOQA 3ULKA 5FAXA 3KZCA 4MHTA 1YVPA 1UC5B 3BS4A 4FMPA 3PQ3A 5B12A 2PVPA 5CHYA 3EYAA 4QLBA 2AN4A 3KEQA 3GYGA 3A31A 5ALZA 2JFXA 2BD0A 4Q4HA 3REFA 2DVMA 2DPYA 2VPTA 1Y9JA 1YUNA 3I2HA 2HK6A 1GKLA 3O31A 3KFXA 4KKVA 5CT8A 2J87A 2QTRA 2X0NA 2DUMA 2J31A 3O8QB 3W6NA 4D9EA 1KS9A 2ZJOA 1JKXA 1ODTC 4DN6A 5BSHA 2HU2A 1XZFA 3MBOA 4NMWA 1GDTA 3HRIA 3D4IA 3RNOA 3KZVA 3TE7A 1L5NA 1CUSA 3TBHA 2R7NA 1S3IA 5DEOA 3F7NA 3N76A 4TMFA 1XAJA 2GBCA 3VJMA 4QFDA 2W2NA 4X66B 3AVUA 1UEJA 3FMPB 5ALEA 3N9IA 4IEIA 2QENA 1XDSA 4NPAA 5TMDA 3MSXA 4LXHA 3EZ6A 5IRCD 2NU9B 3EWIA 4PTYA 1MO2A 3AI2A 1SCAA 2FSIA 3LM8A 4LDQA 1TLLA 2O2GA 1H4SA 2QE7A 3G1WA 2XCLA 2PK3A 3OD5A 4K40A 4M1QA 2IBTA 4D57A 3OM0A 2C4HA 1DLIA 2WF7A 4TKVB 5EYPA 1YD7A 4N47A 3C7DB 4JP2A 1XQ9A 4K46A 4QU8A 1DLJA 3T3HA 1FL9A 2HZBA 2OZLB 2VHZA 4WCVA 5JRZA 4KMSA 1JA1A 3HUFA 4HL6A 4EG3A 4OO3A 4E5PA 4NH0A 1PNTA 4BKQA 4FN5A 1QFZA 3FF4A 5H1YA 1L3BA 2J41A 4PIMA 2Y92A 4CQMD 5KOHB 5BUZA 2Z4SA 3CNBA 1SQSA 2LW7A 1E6MA 1D6JA 1KOFA 2IXGA 1Q14A 2WSYB 3D54D 1CUXA 3D1JA 3DF7A 4QEZA 1E9CA 3O8DA 1N1DA 2MYTA 1SCDA 2VT3A 5KVCA 3VV3A 3GFBA 5K03A 3H8SA 4YQEA 1JAZA 3H9JA 5LPNA 1IK4A 2Z83A 3VV2A 4DJJA 4N03A 1U2SA 1FQOA 1QZXA 2G5CA 3KKNA 2VP9A 2WU0A 4WW0A 4WGGA 1I4LD 5JWRA 2FCAA 5KOYA 1HZJA 1Y4UA 2HPAA 4II7A 1GGJA 4D9IA 2X3FA 4CKCA 4MRPA 4XDZA 2QD2A 3FDZA 5KPJA 5JXJA 1NBWB 1F6BA 2EXXA 3SHTA 1JH8A 4WXPA 1RKXA 4J2OA 4KQ9A 5AVSA 1ABEA 3F2VA 1Y34E 4L8VA 4XIIA 5E1MA 4BNXA 2ZSAA 4HVAA 3U48A 4W5NA 3EVZA 4CR6A 2YH2A 1K3UB 2ZSBA 4L4YA 1UXJA 1JFSA 2ESRA 1SOWA 4ML3A 1UMKA 3NPAA 1K4KA 5KNDD 2JJMA 1Z5PA 1L4FA 4JMPA 1VL2A 5D00A 1PVDA 2E5FA 1QGUB 1U6KA 2PRKA 1U3GA 4IH9A 4DZRA 1AS3A 1YI8A 3CWQA 2JLZA 4CM8A 5ARCA 1EDEA 2JI4A 2O2YA 3IMEA 1KK3A 1R8YA 2WC1A 3HCFA 2D13A 1L0BA 1Y1RA 3LGSA 2VN8A 4W5JA 5EZYA 4DIFA 4EHJA 4FZ3A 1JAYA 1Y5NA 1PZNA 3H3FA 2IEBA 4LIPD 4RJKA 2Y1EA 2WWVD 4ZYWA 3L04A 1G4AE 3P4YA 4MS1A 4Q6WA 2GCEA 5FV4A 3DDZX 3D7NA 4R1QA 1CQPA 3HP1A 1RKQA 3NAZA 2BUCA 1MU0A 1V4NA 1J9EA 4M0UA 5F2NA 3M4JA 2D6FA 4MICA 4XGIA 2Z2KA 1OXVA 1K5DA 2AHOA 2P5YA 2OV1A 1X1CA 3PQDA 1Z8HA 4HWGA 5ITVA 5JSUA 2P2LA 1IJBA 2WAAA 2OC4A 1J9GA 2XAUA 3FDIA 4PR3A 4Y8VA 1WHTA 1JALA 4DLPA 4TV8B 1Q11A 3CLTC 4AROA 4J9VA 4DCSA 3CVVA 2CHEA 3JV7A 3ZLJA 1ZOLA 3HCPA 1OFTA 2HTEA 4IILA 3SF8A 1WUTA 4I50B 1LFDB 3WADA 4R2KA 5J63A 2HPHA 3T9DA 3D0QA 2EFEB 3SFZA 1WUHS 2P69A 5JDCC 1VJRA 3F6EX 1BOFA 4OG2A 3SC2B 4IDFA 3BICA 3RYHB 3GJ5A 1BEEA 4S0ZA 3FFXA 3O9ZA 2PR7A 4UVIA 4BOYA 2OXIA 3IOBA 4C4SA 2EBFX 2QRVA 2VSNA 4RANA 1ID8A 2XT9A 3GQBA 3LRPA 4M0LA 5KSYA 3HSKA 2O0LA 3K15A 4Y2XA 5KS2A 2Q2OA 1U3DA 1YU6A 1M8JA 2J6HA 3L9WA 2IWRA 3ZNOA 4ESHA 8LDHA 2WQ6A 1K2VN 3K0FB 4QO8A 2B7BA 2UUCB 1RQ7A 4EJ0A 3U7RA 1KMCA 4I4LA 4G9GA 3QK7A 4JLSA 4TKZA 2BLNA 1EFLA 1RAFA 3JPYA 1M34E 3ZC3A 3T5DA 1J9ZA 1EU1A 1R9JA 1DE0A 1V0JA 2CYBA 4BEJA 2H4YA 1EAYA 1O58A 3FPAA 4NZMA 3SZGA 3UAWA 2FP4B 1ZR2A 1YA6A 4JDPA 4OTZA 2VBGA 4Q02A 2A1TS 2BZSA 4KNVA 4KN9S 1FFWA 4RF2A 2XGJA 1SCBA 1M34B 1QFXA 2EW2A 3M4YA 3PXCX 1XUOA 3N0WA 5DHQA 4GM4A 2PUFA 3VZBA 4QJ4A 1JFFA 4M76B 5DN6D 4YIKA 3ILXA 2WWYA 1H69A 1N2GA 1EDDA 1GQRA 2XCQA 4A16A 2JFGA 3KSRA 2CXRA 4XWOA 5A5DA 1VKNA 1BXGB 1GPNA 1FA9A 4QYSA 1O08A 5AKKA 1I2AA 2AI3A 4GL4A 1GQQA 4N5NA 2P27A 2JFPA 1NASA 1P9WA 1IZZA 2BV3A 3AILA 3KX2A 4RFLA 4XEHA 2XNDA 3C3CA 1M6NA 5F3WB 4JHLA 1OBHA 2FSGA 4GDMA 3RREA 3UWPA 3N8HA 4PHHA 1WDKA 2W90A 3ZWBA 1DDOA 2XVAA 3TRHA 4I8DA 2XXBA 1DQYA 3RVMA 2B9VA 1F4PA 3Q3JB 5F1KA 2FJPA 3C5HA 3UNXA 1GUFA 4G5XA 5IDQA 3ROZA 2C2KA 2W6ZA 5DGIA 1PLKA 1ZOOA 2BMDA 3L02A 3QMPA 4R40A 3RHTA 4DOMA 5BNZA 3OOHA 2C2YA 5KNDH 3MWEB 3D4BA 4WNAA 1XTBA 3CTMA 2MCFA 3R7BA 3MM4A 2D5BA 1GFWA 3F8SA 1C1DA 2X8LA 4GBJA 1BQ4A 2GBPA 4JQZA 4WN3A 4B87A 1OHHA 5AVRA 5KTMA 4FONA 4LOIA 1A2KC 3FE2A 4BMZA 1JA0A 3WJ1A 4D0LB 5EIXA 5EJEA 1F7VA 1JFVA 1P1IA 5B3JC 1UJ5A 1ZXLA 2X7HA 2AOTB 3ME5A 3ZVKA 2AHRA 2K7ZA 3JQ9C 5KYXA 1RYMA 4AN1A 1ZEMA 3BHIA 4P84A 5AKXA 4WNCA 1FLNA 3NP7A 3ZUPA 1LS6A 4D2IA 5BPFA 4CE6A 1AZWA 1BJTA 4LSWA 1RRGA 2AFRA 3O8OA 3PHJA 4KJXA 2C98A 3B13B 4MV8A 1G5RA 2R751 1KMIY 4IIVA 4BQIA 2NPOA 4QXPA 3UUFA 1X1BA 3IO3A 3GK3A 1L1RA 1ZN2A 4D80A 3IPYA 4DQDA 4QOIA 3KXPA 3D8RA 3U4HA 4DR2B 3HBFA 2J9FA 3V8RA 4LV8B 4ZCRA 5IEBA 2IIBA 1NULA 4TQGA 4PYKA 4UUNA 3ZS8A 3KOXA 3SS7X 3EWAA 3K1AB 5LYYA 2UXCB 2ECPA 3L2OB 1R12A 3T5GA 4DLBA 1GSHA 1IATA 1I7NA 1CDDA 1SULA 2DT8A 1ZD9A 2FZ4A 2JH9A 1D6MA 2SKCA 1YCGA 3OECA 4YMUA 2Q4BA 1GVNB 3IO5A 3BE4A 3IE2A 2XDQA 5J2TF 4TZ6A 5EJFA 3Q0EA 3JQEA 4WTOA 4IBOA 3P2YA 1NMSA 5BYJA 1SVOA 4W4TA 4F72A 4FHGA 1Q16A 4Q1EA 1ZONA 2IZ1A 1WEHA 4EHIA 3AZQA 3ZJ5A 2NOAA 3D2AA 3QUCA 1Q7CA 3DULA 4P3NA 5F2OA 5KTTA 1N32B 3W7BA 3GFVA 3RIXA 1UAGA 3U7FB 2A84A 3AZPA 1JSXA 1QE0A 1D7AA 1TF2A 2BMFA 1FDTA 1KI6B 2O23A 5JFGA 5JRDS 2WU4A 3OQVA 5HNKA 2ZTLA 4HAIA 1I7QB 3QOWA 4EKEA 3BQMB 3G89A 5I9TA 3DLBA 3LZDA 4WXYB 2NXCA 1YDWA 2IZ7A 4KZKA 2C8KA 1OIXA 3JYOA 3IAS1 2NP7A 4TL9A 5CJ2A 2PZJA 1HETA 2XUJA 5JO9A 1N2JA 2B7LA 3HN7A 4L3OA 4DEVA 3CJQA 1F3OA 1KY2A 3EBOA 1PWZA 3AETB 3I23A 4P93A 3TECE 3OURA 5JMPA 4YMTA 1CIVA 1M2GA 3IVGA 2PL5A 2XR1A 2VI5A 3FUVA 2HWKA 2PT9A 3ABOB 2O54A 3JALA 4RZ3A 4CCYB 4ZCSA 4Z9XA 2FXVA 5D3KA 1L7XA 3CW2A 1L4UA 2NACA 3C3PA 5EXTA 1YK0A 3UWKA 2ZRPA 4WFIA 1WMDA 4B8YA 1JSZA 4BVHA 3KQKA 2GN0A 3T94A 1XKTA 3T9AA 4HXGA 2OTCA 3GCZA 3Q8KA 2IDZA 2BW0A 1X1DA 2TECE 4G84A 2GNAA 1PV1A 3DAHA 3G0IA 4IHQA 2BBTA 3S2YA 4BATA 1ZK4A 2BFFA 3GRPA 1KARA 1SRQA 3PQ5A 1VLMA 2XVXA 3O8NA 3ESRA 3PICA 1Z5WA 3C16C 4NCIA 4O4LB 2PLFA 1GRCA 3LK6A 1MIOA 4RTMA 3WLNA 4UFPA 1QQTA 1EDZA 2RGRA 1E9RA 2G40A 4XD2A 2HR1A 4EW6A 2CHGA 2VRBA 3WIDA 5FI5A 1X7WB 3IP8A 4R84A 4A26A 3AERB 4M1WA 5GZ3A 2I4LA 2IC5A 1XCGB 1RZ3A 4R83A 1KQFA 4JVNA 4PW0A 1SVWA 1CRQA 1R64A 1VG0B 3Q15C 4NECA 3K70D 5LMNB 2FNAA 4MLCA 4YMLA 5EEGA 2AXPA 3AX6A 1XVLA 4EA9A 1BXKA 3DHEA 4QUBA 5JC8A 3GUCA 1YL7A 2O1EA 4MKHA 4F91B 3TKYA 1UFKA 3JSAA 4W9NA 3ZJUA 3GO4A 4OH7A 1HLGA 1KVQA 1X7HA 4I1VA 4IXWA 5CGZA 4GM0A 4YPFA 2VNKA 3A6PC 4FKMA 3K1TA 2GFIA 1A7KA 3IVRA 2MTBA 2HADA 2DWOA 4HDAA 2QI9F 3RSHA 1NZDA 4MRNA 1BOOA 4XWGA 5D3ZA 4D45A 3DE3X 3G2OA 1H6AA 4YJHB 1C3LA 1Q2UA 3KLMX 1S7GA 3GLTA 4G0OA 4YRSA 1YL6A 2ZXEA 1QH8A 1ZUD1 3CRNA 2N1BA 3D1LA 2RFLA 2AVNA 5KYWB 1MG5A 4QBTA 4AJOA 2CD7A 2I8LA 4DJFC 5CPFA 1JJVA 2W22A 1E7RA 4L0MA 5SV2A 1VMIA 5DCWA 3DD5A 4P7BA 4YRQA 4BO9A 1KYXA 3QTLA 4EY7A 5EZSA 2XZOA 1C7JA 1TM3E 3CF4G 3V1TC 2VJYA 4PQFA 4OHCA 4RVHA 1E2PA 1E96A 2PSDA 3O9VA 3CHYA 1JU4A 2SKEA 3W5VA 4ALLA 2XOXA 3CMCO 2RBKA 2XQIA 2Q5QA 1E2MA 3LP8A 4YJGA 3UANA 3H4VA 3UGTA 4IVRA 3N39C 2RCNA 4R4JA 2OORC 1SUIA 4RJIA 1E7WA 4I9NA 4HWSA 3X1XA 4KCGA 1SQ5A 3FSGA 5JYBA 2OO3A 3ANSA 1E3TA 2O07A 2FZ5A 2HA5A 3ESCA 5BP7A 4DR4B 4KQCA 1JIVA 1WL8A 1V6CA 3JATA 5AW4A 5EUCA 1NNSA 4HGOA 1ZUNA 3ABRB 4QULA 4ZO6A 4D9NA 2Z56A 3OEHD 3BXGA 1LC0A 3M5WA 3M9WA 2YWFA 4QC2A 4QXQA 3TSCA 1MABB 2HBYA 4QFBA 1T0HB 1UMCB 3T9CA 1RJ9B 2E2WA 5WRFA 2J3KA 2XKJE 1TA4A 1EE2A 3DT6A 1H66A 5DSXA 4DQVA 4JI4B 3OMLA 3ZKAA 1CT9A 1IOZA 3VNAA 5M5BA 2REXB 4TYWA 2Q8PA 3OKCA 4BMXA 1UZMA 1NYQA 1LTHR 1IEWA 1WU8A 2P9YA 3HCNA 2YV4A 4N82A 4WIAA 1E9BA 4CTNA 5E7JA 4E21A 4EPTA 1LPOA 3RUEA 3WFIA 1OJ7A 2AR0A 3LC1O 1I4DD 5IKPA 4DLVA 1JECA 4HLDA 5BRNA 2W0SA 4DLUA 4F3NA 1NMXA 1BRTA 4KXYA 5FADA 1SBZA 4MS4A 4C5AA 1XJCA 3LF1A 4D46A 1UZNA 4U2BA 2BHNA 4MKFA 2EKQA 3HP4A 2HF7A 2W7TA 3CLRC 1HWYA 1Z3IX 4AJLA 1ZRSA 4GNKA 3F3MA 3RKRA 4HEHA 4Y6RA 5B7PA 3IYLW 3WWEA 3VU8A 1R9MA 1ECLA 2VWHA 4P54A 1IOWA 1L1EA 4AQYB 3OA0A 3TL6A 1UDBA 5IW8A 5IT5A 3O4JA 4JDUA 4L50A 3AIIA 5HEKA 4KL8S 621PA 1Y1KE 1FPMA 4CIAA 3SU8A 4J6FA 2HV8A 3SHWA 2Z08A 4E11A 1T9GR 1QDUA 1DC7A 1N1EA 1CE8A 3FUWA 4KV7A 3VPFA 3K9HA 1JR3D 1RRPA 3HUEA 3ZR4B 1YBHA 2OXFA 1MUUA 3ERCA 4DUGD 2VRCA 4BC1A 5H4GA 3L01A 5JROA 1QPBA 1RWPA 3X1JA 3AEQA 2B69A 4WLVA 2E4WA 5AFSA 1NN0A 3C3BA 3H2BA 5G53C 5ALSA 2OLKA 2YBDA 2IZ0A 3AUSA 2H5LA 1P5ZB 4G1EB 4JSRA 5LQAA 4JBGA 3N2KA 4U7JA 1SXJE 2V5AA 3HKEA 3RVKA 1KH1A 1JJBA 1H8HA 1QIDA 3AFNA 3AUXA 2YV1A 4JJ7A 1G0NA 3TBFA 4EFKA 4JHXA 1V11B 3KYCA 4ZCTA 3NWOA 5LMUB 4IFBA 2VTDA 5SZKB 2A5DA 4BO4A 2VQSA 2E7ZA 4FHZA 2HJWA 3DZHA 5A4JA 3BREA 3P2IA 3PJDA 2G83A 4MPTA 1EK5A 1SXJB 4AQDA 4BFXA 5FYQA 3GJ7A 1ZPDA 3K0CC 3DOFA 4NZZA 3NC4A 3BXFA 2XOEA 4CM9A 1UADA 1KJIA 1U2TA 3A3OA 2DQ4A