2VEDA

Crystal structure of the chimerical mutant capabk55m protein
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
252
structure length
252
Chain Sequence
DKRIKDEEDVEKELGLPVLGSIQKFNMTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGMSTIAANLAVAYAQAGYKTLIVDGDMRKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIEDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPPVNTVTDAQLFSKFTGNVVYVVNSENNNKDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MEMBRANE PROTEIN CAPA1, PROTEIN TYROSINE KINASE
publication title Structural Basis for the Regulation Mechanism of the Tyrosine Kinase Capb from Staphylococcus Aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 88
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vedA00
2R6FA 4LYJA 3IBGA 3VHXA 3QENA 3PCRB 1E32A 1W4CA 2V9PA 3KQHA 3FKQA 3P32A 2WJVA 1FX0B 2QSZA 4LBYA 3AKEA 2ZRMA 5FTJA 1KSGA 4RSGA 3U4QA 3KKOA 1YZKA 4HATA 5JJKA 4RD0A 3RHFA 1BMFD 4OHVA 3R7WA 3ZZUA 2J3EA 4CGZA 4XD7A 3TIFA 5KYKA 2DR3A 1P9WA 5EXSA 5E4FA 4AKIA 2JCSA 3PUXA 3HU2A 1RYHA 3L8YA 3NXSA 3U2QA 1R5NA 1Z08A 1NMYA 2Q3MA 2FA9A 4QKQA 4WAUA 1EK0A 3GFOA 2OCBA 1CRQA 4US0R 2JJ1A 1NF3A 1EX6A 2JDIA 3CRMA 4JT2A 4C0KA 4OI1A 2WBLC 3OESA 1GNPA 1OXSC 4LJ9A 2GDJA 2AD5A 2Q21A 4B76A 2GVDC 2AKYA 4DVGA 4FXPA 1MT0A 4A6PA 4ZKEA 3OFND 5G41A 1V5WA 4JSYA 1TQ2A 4BQSA 5L3QA 4Q1CA 3A58B 3MLEA 4A2WA 1FW6A 1KO5A 4B44A 3SYKA 3IPXA 1I2DA 1U0JA 5LD2B 4LJAA 3B1ZA 3K1JA 3OIYA 2XX3A 4D0LB 3Q85A 1VYUA 3AVXA 1NN3A 5BN5A 2QN6A 4NKRA 4NH0A 1NP6A 1IXZA 3NC0C 3SQXA 2WTUA 4UXJA 4DJTA 2YWFA 2RAPA 5CM8B 5D3MB 2E9SA 5AR1A 5F3WB 4WBSA 1OLOA 3FGNA 1XPOA 1XMSA 2IYUA 2OCPA 3M4YA 4LJ8A 3PEVA 1YZLA 3F5FA 4EQ6B 1ZUIA 2RGCA 2O0HA 2W58A 3RS5A 4B3GA 2XGJA 2IYZA 3EARA 2XXAB 1NVXQ 3LXRA 1PLJA 1BOFA 2IYRA 2ODEA 3BAFA 1TQ4A 1K8RA 2IWHA 3X1ZA 1XCGB 2FGKA 5HKKA 1OXVA 1WQ1R 1CEEA 1A2BA 4MH0R 5CB8A 4URXR 2IT1A 2GK7A 2P5TB 4FMCB 4EJSA 2ZYVX 4I1SA 4URVR 4TL7A 1US8A 1QHXA 4PX9A 1S96A 2IYVA 4Q01A 4PAQA 4TSFD 2O8DA 1OIXA 4L5BA 3UKDA 3KQNA 5L3RA 3M0EA 4TL9A 4EPVA 5FPHA 4M4SA 1S4QA 1MABB 1HA3A 2W6JA 4UQOA 1H8EA 2OSBA 3B1VA 3C5HA 1FOEB 1Z6GA 4PO9A 2A30A 2VHQA 1LNZA 3N2IA 3ZVRA 1WA5A 3TAHA 3AF4A 3AVTA 3AVYA 3AP1A 2WPDA 1R0ZA 1UKYA 2N46A 2QZ4A 4GFDA 1FMJA 1LV7A 4OI2A 2R62A 4Q4AA 4JLVA 4F38A 3ICEA 3CR8A 1Q1BA 2QMOA 3QKRA 4HLUC 1F2TB 3T12A 1XZQA 2IYYA 2NZJA 4JKYA 4JVLA 5AJXA 1S9DA 2P5SA 5GVSA 2VEDA 5KSZA 1RJ9A 2WJHA 2C9YA 3CX6A 4MRNA 4WXPA 4HZIA 5FOSA 2NMVA 3T06B 1KK1A 5KTYA 5JHGB 3WHLA 3N2EA 2FSGA 3CZPA 1AS0A 2P6NA 1FNNA 1KDPA 1P2VA 2ZSBA 4CIDA 4PZZA 4JLMA 2I3BA 5F2EA 4Q9JA 3EIQA 4UJ3A 3RSOA 1V43A 2GILA 4BASA 1ELOA 2BCJQ 2ZYUX 1RKBA 2EW1A 3D31A 4UNQA 2HT1A 1IY0A 1N6IA 3HPRA 2WSMA 5DI3B 1J90A 1P5ZB 1GIAA 1QG4A 3BORA 3TUJC 2A5FA 1GNRA 4RD4A 3OEED 4KCGA 3QJYA 3HR7A 4ZIRB 5B64A 5FBVB 5FTMA 4NTZA 3PR1A 2P6UA 3QNUA 1KMHB 1XXHB 2DY1A 3TVDA 3W8RA 1VIAA 1HE1C 1M8PA 4AG6A 4DLSA 3AP2A 4DIEA 2ZI6A 1QBKC 2IYQA 4BZXA 3OIUA 4AIIA 2DFNA 3AVPA 3TK1A 3KB2A 1E1QA 3KXIA 4IFBA 1Q1EA 2TMKA 1Z47A 3GJ6A 3QY0A 1XZPA 3FPAA 4JT4A 5EP1A 1DEKA 2D62A 3DM5A 5L8VA 1N0UA 1ZP6A 3KKMA 3SFZA 4TMXA 5DISB 4BWYA 3I5YA 4ASUD 4WA7A 1W2HA 2JDID 1QVAA 3SC3A 1SVOA 1T0JB 5JWOA 4Q9LA 1GRQA 1SVWA 1Z5ZA 3BH0A 3O8CA 4FCTA 4XSGA 4HUQB 1XMVA 2IX3A 3U7GA 4WIAA 2YOGA 2PX0A 4ZCLA 1UBEA 2J0VA 1FUUA 2KBFA 2IXEA 1E9BA 4LJ5A 5L3VA 1T3LA 1SVIA 1U98A 1FMLA 3SJAA 2REBA 2CXXA 4GI7A 2C04A 2H5EA 3H1TA 4BEJA 3G82C 1AZSC 1S8FA 3GLHE 3CPJB 1OHHA 2ANCA 3P26A 3MG9A 5HCIA 1Z0KA 3QF4A 2FH5B 1UDXA 4LHYA 2XOKD 2VHCA 5JJLA 1E2GA 1W0KA 3ND9A 3DL0A 1G5TA 5H68A 4ZI3A 2PCLA 4MRRA 5KDLA 1SVLA 4ZDKA 1KK3A 1VG1A 1Z06A 1SVKA 3GJXC 5KDOA 3QXCA 1Q20A 1X6VA 2ZAOA 3GLGB 4QRHA 4FINA 4AYTA 3AM1A 2RB4A 1WE2A 2CVHA 4A8JA 3CWZA 2WWHA 4GOKA 1I4LD 3QG1A 3PUZA 2GXUA 2FWRA 1X86B 3CNOA 1EFRD 1WXQA 1G8FA 3IBYA 3LRPA 5JJIA 5JLJA 1MOZA 1W0JA 2X2FA 1VECA 4M9SA 1AA9A 1OXXK 4EFLA 5HKKD 2I1VB 3AP3A 1Q44A 4Q1AA 1ZM9A 3B13B 5FUXA 2H16A 4MGKR 2H1LA 2XB4A 6Q21A 2MSCB 3A4NA 3GLIA 2XSZA 4GP7A 1UDWA 2QPTA 5J5CA 3S1AB 4ARZB 5K8TA 5CYPA 1SKYB 5DO9A 1DO0A 1UFQA 2QAGA 2J1LA 3IIJA 3SJBA 4Q1FA 1VCNA 4EPXA 2BM0A 3CH5A 5FUYA 1ZM3A 4G01B 3F8TA 1TU4A 3T1OA 4CYMA 2W6JD 2OG2A 1JJ7A 3NBFA 4LYHA 3VAAA 4E22A 5HE9A 5B2ZA 1QF9A 1S3SA 2GVZC 4TMVA 4RZUA 1ZINA 1NG1A 5GJVC 4D25A 4DCVA 1G7RA 2HJVA 2R9VA 1PUJA 5FPKA 2ZJYA 4FMBB 1U2RA 1HY3A 4N0DA 3MWKA 3SOPA 2G6BA 2W0MA 3CO5A 3UG6A 4LCBA 4B3DA 3K09C 3U44A 1HT1E 1IN8A 1AGPA 1EWRA 1NY6A 1E2LA 3AV0B 4NYIQ 621PA 3EZ2A 4FMDB 4EPYA 1BH2A 2JLUA 1DARA 3PJRA 1ZUNB 2KBEA 3FHOA 3BB3A 2PT5A 4FMDF 4IEEA 3BJIC 3DPUA 4GP6A 1WRBA 3LBHA 1L2TA 2QROA 1WBBA 1P9NA 4MRPA 3W9YA 5JSZA 3CNLA 3ONWA 4NYJR 2GCOB 4QBHA 5GJCA 1W1WA 1W5TA 1ZAKA 4L9SA 2BHRA 4PHGA 1G21E 1GDDA 1G4AE 1W46A 2YNMA 1GNQA 2ZU6A 4A0RA 2HDNB 4QGHA 2AWOA 2V6JA 2O8CA 4ZCMA 4RKEA 4TLCA 4IVQA 4KHZA 3WXMA 1DAFA 2AFIE 1Z0DA 4HAZA 4POAA 1AJEA 1EX7A 4Y0AA 4JL5A 4HYYA 4B3BA 2D2EA 1DG3A 2F1JA 1N0WA 2CK3D 2QT1A 4W5JA 1XJ0A 5K8UA 5A4JA 4C0QC 1W5SA 5CDFA 4ZDIA 3I92A 4OJQA 2VH5R 3SU8A 2VF7A 3WYGA 3O47A 5FL7A 1U9IA 5IT5A 1E1QD 3I8XA 4OI0A 3I4LA 3B1WA 5IK2D 2D74A 2QGZA 3LWNA 3THXA 1W4AA 2O52A 4ITRC 4M1MA 2D7DA 3RC8A 2D7CA 1XTKA 4TQAA 4K8OA 2CNWA 2JEOA 1KI8A 1J2JA 2OLKA 2V1XA 2B92A 2J7KA 2DB3A 3BOSA 4BGDA 4LHWA 4TN1A 1CJUC 3KJHA 1QZXA 2EYUA 4QHSA 1VHLA 2PT7A 1AKEA 1IOZA 2F9LA 4P3YA 3CH4B 3DKVA 1G4UR 2ZRPA 3LVRE 4CF7A 5FI0B 2KJQA 2PZGA 2FNAA 2WKQA 3K0AB 1G3RA 2XEXA 4HI0E 3D8BA 3CR7A 1GOTA 4TWZA 5KNBA 1I2MA 4HAYA 3AKYA 2W2VA 3A8TA 5DHFA 5J40A 1CS4C 4AWXA 1E9RA 2GCNA 3I32A 5ANRB 3REGA 2YINC 1JEEA 4LC0A 1ETUA 2ZQ5A 4M1OA 4M9XA 3T15A 2PCJA 4AG5A 3DHWC 1AKYA 2ZYWX 4HB2A 5KSPA 2NO9A 1W0KD 1G5RA 3P20A 1OB2A 2NO7A 2ZRHA 3T5GA 4YMSA 3DOEA 5J47A 1D5CA 4A36A 1U0LA 2JLYA 1KKLA 5E3HA 2A9KA 1WB9A 4B6FA 2OLJA 3N70A 5D3QA 4NONA 3X1WA 2QY9A 4CDGA 2ERYA 1KZGB 4KODA 3EWAA 4MYUA 1RZ3A 2IYWA 1MO6A 1D2NA 2BKEA 2HJGA 2C9CA 3THWA 3THYA 3NC1C 5SZJA 3EASA 4LDJA 4EIWA 1SKQA 2ZPTX 1II0A 3L82B 4CZ2A 5KHOC 3QKUA 5AJWA 1W0JD 2NPIA 4JLBA 3FHTA 2CHQA 5GJWC 2YVUA 1ZM7A 1Z6XA 4TTPA 2GJ8A 1ZYUA 1GVNB 1ZIOA 3C8UA 1U0HC 2G77B 4JKIA 4NYMR 4TT3A 2OBMA 1OPXA 1KSJA 1EXMA 3NKVA 5F9HA 4IEIA 1F2UA 2ODWA 2G9NA 1N5IA 5JEDA 1E99A 3ND8A 2YV5A 1U8ZA 3HYRA 1OH8A 1JI0A 4Q4JA 3RRMA 3V9PA 1E0KA 5DYIA 5BN4A 1M2OB 2EFDB 2MMGA 2DCUA 4HZUA 3ICQB 4L15A 3LX5A 1GL9B 2LKDA 4L9WA 4B2IA 2GWHA 3IQWA 3UG7A 1DAEA 1VTKA 1E2HA 2WSSD 4QNMA 4NCHA 3UMRA 1ODFA 2JAQA 2REOA 4P33A 2GZDA 1G3MA 2ZSFA 3OIVA 5G53C 1JPJA 4RCZA 3RRYA 4YMWA 4MDFA 2RGEA 4LYFA 2F1HA 5CLQA 4JL8A 1MKYA 3LA6A 2ONJA 3ZQ6A 2QSYA 4D80A 1P60A 4B6EA 2EWVA 4PAMA 1Z6YA 2AFHE 1COWA 1KI6B 2GTPA 3K70C 2V8OA 3H84A 1QHGA 4B32A 2J45A 4P32A 2GHIA 4Q19A 3I73A 1G7TA 2NTYC 4NCKA 2BCGY 2CLSA 4GPTA 4ABYA 4DLVA 1VG0B 2IEZA 3BIFA 4Z8YA 3U3KA 2GEUA 3PUYA 3J81k 3VR4A 3TGPA 2ZVQX 4HSEA 1WDTA 4HDOB 2F1IA 2C8VA 1YZTA 2JLRA 3EW9A 5SZHB 4M53A 2LKCA 1YZUA 4I1OA 4C30A 1TPZA 3P4YA 5FL7D 3MWYW 5FOXA 2CLDX 3H2YA 3R8CA 1Q12A 1VPLA 1XBTA 3GJ5A 2PMDA 1O3YA 4UNSA 4ZV4A 4PPFA 5JBQA 1PUIA 3AF3A 1JALA 2VIIA 4PFSA 4S2EA 5L3SA 4GZLA 1QHHA 4XTCS 3KTAA 2H7VA 4C0AC 3SFVA 4HAXA 4G5SA 3W6PA 4G5OA 3NTUA 3DEFA 4HAVA 1CBUA 4MGYR 4NZYA 1CR4A 4B34A 1P9RA 2Z4SA 1XD2B 4IKEA 2ATXA 3QOFA 5J4YA 1H8HA 4BFYA 2VA8A 3C14C 1KI9A 1U8YA 3GD7A 2JGNA 4LOAA 3HPQA 4GSYA 4AK9A 3BGWA 1YRBA 1XCPA 1XTSA 2J9RA 3AKDA 4D6PA 3TSZA 4JS0A 2JLVA 3KQKA 1GAJA 2XITA 4PAOA 1XPUA 2ZI9A 3IO5A 2OHFA 1OFHA 5EZ6B 1RVDA 1GILA 1B0UA 3LD9A 4M1SA 4FWIB 4DLWA 4GMXA 121PA 1UAAA 2HLDA 4LUCA 1SXJD 3NBZC 2HCBA 1JB1A 2O0JA 3EZ6A 2NIPA 1G19A 2N42A 4FCVA 2ZYTX 4DT1A 5CK5A 1E2EA 1XB2A 2F1RA 1OW3B 3GEHA 1BYIA 3IEUA 4TMKA 2GBLC 2OBNA 4HB0A 2KE5A 4HLQB 2GZHA 5JI2E 5KOYA 2ZROA 3NBXX 1KMQA 2OO7A 3MSXA 4JVNA 4AC9A 4C0BA 5JS7A 3EA5A 3VKGA 3O8BA 1ZUHA 1XRJA 3ADCA 2CE2X 4MQBA 2J46A 2J0UA 3G0HA 1DAHA 1UADA 1NRJB 1XMIA 3H4MA 1P2TA 4MRVA 3VMFA 4UNRA 3VU9B 1CRPA 2AK3A 5EE1A 1MO5A 1XF9A 3A4MA 1CJKC 1GP2A 1YZNA 2A3RA 2XNDA 4XIGS 1P2UA 2DPXA 4OBEA 2ZE8A 5FPTA 3X1XA 3K0CC 3EIHA 3L0IB 3IHLA 4EKDA 3Q8XB 3OAAD 2FE4A 2ANBA 3U6BA 4A15A 3EPJA 4TLAA 5AUQA 1GL6A 1G41A 1NIPA 2FSIA 3AVVA 4LI0A 4MGZR 4DB4A 3CRRA 3NHAA 1PJRA 4X8MA 1P72A 3QXHA 2ZRNA 3TSWA 1ZC4A 2IUSA 4PSAA 3LV8A 3ZS8A 1L8QA 1XEWX 2QP3A 1YR9A 4DEYA 1CJMA 1HEIA 4IXNA 1E9EA 1I4TD 4GZMA 4O2LA 4E09A 2VLIA 5JWHA 1OJLA 2IS1A 1ZNXA 2ZSEA 4JMPA 4BLQA 1E1RA 4OL0A 3MGCA 2KI5A 4S35A 3ADKA 3CRQA 4B47A 2HYIC 1OFIA 2JLZA 1G3UA 2W6IA 3KX2A 3PUVA 1SXJE 1ANKA 3FKSA 4ESVA 1COWD 4L8GA 2MSEB 1OKKD 1NKSA 4XWAA 1I4DD 2Z5FA 1GRRA 4KYUA 2REXB 2VO1A 2BKUA 2VYFA 4QBFA 3LAWA 4M0LA 2QL6A 4CEIA 1AS3A 2P65A 1ZIPA 4V0MA 2P2LA 2YZ2A 3WMEA 1TF7A 1XWIA 2QAJA 4LY6A 4RZ2A 1R5OA 3I5XA 2CLCX 3BFXA 4Q7LA 3U3RA 2BVNA 2OAP1 3SZRA 3SHWA 1LVGA 1A82A 2QG6A 3QXXA 4WVFA 1Z6AA 1A4RA 1Z22A 3DZ8A 3AVWA 2A7QA 3VNVA 3RLFA 4JLOA 1YU9A 5IHPA 2ZXUA 1E2PA 4LWZA 2F3TA 1XEWY 2O5VA 3KUCA 4YXWA 1VCIA 2G0TA 3LFUA 3PQCA 4BFZA 1GG2A 1FFHA 2QP4A 2R8RA 3HDTA 4I1UA 1DO2A 2IYSA 3LQRA 2XJ9A 5G3YA 1W36D 3QPWA 2FV8A 1VIYA 1YJ5A 2ASEA 1MO3A 4L16A 2QEQA 3RWMB 3AUXA 4N1AA 5E7IA 4OQXA 5KU1A 4NU0A 4PQRA 4BEBA 2PEYA 1OV4A 2EFEB 2FFAA 3OHMA 3LVQE 1QHYA 4Q21A 2I4IA 2CCKA 2AXNA 2WMOB 3NDBB 1Z63A 2JATA 3WNDA 1NN1A 4AKEA 3K9LA 2JIZA 2CL0X 2VSXA 3CWQA 2X8AA 5KPDA 4A0HA 4P31A 4GBMA 2GRJA 2QPOA 3EWSA 1QHNA 1NJFA 1GM5A 3B82A 5DIFA 1II8B 2EFHB 4TQ9A 3T35A 4Q02A 1KJZA 4YMVA 1N3BA 1AQUA 4LGMA 4DDTA 2PJZA 2FU5C 3GLHB 4HLUA 4F7WA 4TYYA 3TQFA 2BV3A 4MDEA 2J7PA 4BFWA 4K81B 3OE7D 2J59A 1Q57A 1ZJ6A 4ZDJA 2R6DA 2OFOA 4FMCF 4KYIB 3VHLB 4TL8A 1KSHA 3AVOA 4I81A 1UBGA 4EUNA 2D3WA 1ZNYA 2YWGA 2ZAMA 3Q7QA 4NE2A 4LJ4A 3U3MA 2ZE6A 2OFXA 3IILA 1ZBDA 3UWKA 1S3GA 4QFMA 1Z8FA 2XNDD 2YC4C 1CKEA 4GRAA 4K46A 4OQLA 5EP3A 3RRNA 4ILEA 2ZSAA 3K0FB 1NVVQ 3CONA 4Q5IA 4ESHA 1FQKA 2FPLA 1BIFA 4QJ5A 2JLWA 2ZUCA 1JR3A 4QGFA 5DH9A 3ADBA 3A1VA 3L43A 2QI9C 2G83A 2VF8A 2PLRA 1P73A 3R7WB 1E2KA 2IXGA 2VSOA 5B57C 4G1UC 3D6TB 4JBWA 4OHZA 2BEJA 4URZR 4RJLA 2Q3HA 4CEHA 3B9QA 2QBYA 5CJPA 4Q4LA 4PO8A 3QBVA 4DEXA 1P6XA 3GPLA 4R7ZA 1Z0FA 1WP9A 4MKFA 1RIFA 2QQEA 3MRSA 4LHVA 5AK0A 4JVSB 4BLOA 3FOZA 4URUR 1LB1B 1T4GA 3K53A 3ZVLA 4OQNA 3GLFA 1E1RD 2DBYA 2WJGA 2IUUA 4Q4HA 2ZRIA 5LB4A 1RYFA 1XFAA 2L0XA 3MMPA 4F4IA 1YVDA 5K8IA 4V02A 4ARZA 4AY2A 2AX4A 3FKSD 3QG5A 4B2PA 2NO6A 4IDQA 4P4SA 2ZREA 5EE9A 4X8OA 4M22A 3AEZA 5EE3A 5C46F 5L3QB 2E87A 3E5HA 1P7CA 4XD7D 2YOHA 3O8DA 3AGPA 4LSGA 4D4LA 1F6BA 2ODBA 2O8BA 1XEXB 5CK4A 4Q66C 2G1JA 1S1MA 4XOIA 2VP6A 3ECCA 4KAXA 3U7FB 2ZJBA 4FI3C 3D3QA 4AYXA 1JQJC 3ASZA 2JJ1D 1G3QA 5HZKA 2X19A 1JPNA 4DDVA 4P0TA 2CJWB 3BRWD 1E9DA 2AL7A 4YC7A 1E2QA 2PLFA 3CUEF 4TMWA 4EFMA 2QM8A 1E9CA 2VRWA 2FZ4A 2ZI5A 3QKTA 4DBLC 3FWYA 3MAAC 1E2JA 3TQCA 1JXOA 1KJWA 521PA 1WBDA 3RS7A 2BEKA 4V0LA 3IO3A 5KDDA 4NYIR 1E9SA 3DVLA 2RGNA 4EJSB 1Z29A 2IUTA 3PFIA 2IA5A 2GKSA 1US8B 5JWRA 3C5CA 3ZGXA 1R0XA 3VR5A 4YONB 4ERNA 3A1SA 4LBZA 2O8DB 3PXGA 1E96A 5DN6A 2RGBA 1MV5A 2HXYA 2IF0A 5GJBA 2EVWX 2GEVA 2ZJ8A 2Q9AA 4G5GA 5EXPA 2NQ2C 3ZJYA 3Q7PA 2EWWA 1NL3A 5FBLB 2ZJZA 2OE2A 3KJGA 3QEOA 5TDHA 4DLZA 1FQJA 1AS2A 1LF5A 2C98A 2FZLA 4Q4AB 3SHFA 2V54A 2ZANA 1SHZA 3AF1A 3Q3JB 4MYCA 3QKRB 2FG5A 3ZZTA 3KL4A 5HZHA 1T0HB 4DDUA 4KLNA 1TUIA 4QC2A 2ORIA 1RJ9B 1ZC3A 1MH1A 2BWJA 2C9OA 1YR6A 4NL4H 2O8FA 1OFTA 1G6HA 4Q7JB 4B3CA 4V0ME 5GVRA 4DCTA 2DWPA 3V00A 4ZI2A 2JASA 2WWYA 2OCAA 2AN9A 1JR6A 5AWFC 2OFWA 3K0AA 4G5QA 4O2RA 4Q00A 4KBGA 421PA 3DDCA 1T5IA 3VX3A 3I61A 2OEPA 1HH4A 4URYR 4Q7KA 1D9XA 4IDHA 1E69A 1G8HA 1H8ED 4O25A 1FTNA 3I1FA 2QE7A 2ZS9A 2Z6VA 4Z54A 3TE6A 3B5JA 4C0LA 2GJ9A 3CBQA 3PENA 4C7OA 1CXZA 1ZNZA 1TQ6A 1U81A 2WPDD 4EFNA 4IDPA 4DHEA 2R65A 2XAUA 1C1YA 5JI3E 1TL7C 2XZPA 4AYWA 4DRZA 2XNSA 1JR3D 3QBTA 1NN5A 3WP0A 2ZE5A 4QL3A 1CR0A 1NBMA 2OUKA 2Q3FA 4ZPXA 1A7JA 2FN4A 4TYPA 1GTVA 1NIJA 2ZRJA 3M6AA 2CEAA 3AH8A 2F43A 3Q72A 2CL7X 5DSZA 4B35A 4D4MA 4D26A 3B7GA 1TUEA 2A78A 3UATA 5TV2A 4BE7B 1OT3A 1T8UA 4B73A 3B78A 1Z2CA 4B33A 5CYOA 3KKPA 1NLZA 1M7HA 2WWGA 5AUPB 4IXMA 1RPZA 5CIQA 3I3SR 1KKMA 4KO8A 2LWIA 2A5GA 2X2EA 1NN0A 1ESMA 1KOFA 4G3XA 4JYCA 3Q5DA 3SEAA 4KFUA 3SBEA 4HDCA 3CF2A 2P0EA 3BH6A 3BS4A 4TMZA 4PPGA 2V3CC 3JZAA 3LY5A 1F48A 2IW3A 4IOLA 2OXCA 3A6PC 4JJKA 5BXQC 4PZLA 2SHKA 1S1CA 1Q1ZA 4P4TA 1NY5A 3RS2A 2IS4A 1MRNA 1JEDA 2HT6A 2IK8A 2IBMA 2V6IA 2ZTSA 3LH5A 3UMSA 3AVUA 3GFPA 4YDSA 2C78A 1ZW6A 2B7BA 2GK6A 4NCIA 2HV8A 1YRAA 3QF4B 4PHFA 4TZ0A 2ZM5A 3U5ZB 3QUSA 1P61B 2YC2C 3QIAA 2W00A 3MJRA 1KI7A 5CLLA 2QQ0A 2WVJA 4NCNA 3RWOA 3KQLA 5CM9C 5G40A 1R4AA 1VKJA 2RKOA 3DKPA 3NHBA 4DIDA 1YR7A 4LC1A 3U7HB 1G16A 1QHSA 4C9BA 1G8GA 4LV5B 4QM7A 3WNCA 3WMGA 4M1KA 1W4RA 3LBIA 4A8JB 1HURA 4M9ZA 1DAKA 2KSQA 1AZTA 4M2LA 2PL3A 1VCOA 1X1RA 3QQ5A 4KXFB 2YOFA 1IXSB 1LS6A 2D2FA 1KI6A 2GEDA 1JR3E 1PZNA 2V7QA 4DSOA 4AKHA 2O8EB 5C4GB 2GJSA 2ZS7A 4TYWA 3TSOA 2YKGA 3GJ0A 4Z8XA 2WAXA 1YHNA 5JFGA 3X1YA 1T9HA 1OHHD 3GLIB 1KTVA 3PUWA 4W7SA 3THOA 2N1BA 4BPBA 8OHMA 3DMDA 3M1IA 4RFSB 3QPVA 4FW9A 1DELA 1AK2A 2QAGB 4JVMA 1NG9A 2C77A 1A2KC 1DG1G 1ZNWA 2G1KA 1KY3A 3WHKA 3B6EA 3IIMA 2UZIR 1DAMA 4PQFA 3VR6A 3ZD7A 1UEJA 3GLFE 3EPLA 5FL3A 1PLKA 2D06A 4PC1A 5EE5B 3T61A 2IXFA 2GXAA 2NO0A 3IGFA 2BBOA 1UJ2A 1FPMA 1Z83A 2EU8A 4HB4A 4WXRA 4JSTA 2FJUA 3RDPA 4WZBE 1EWQA 3T34A 3B9PA 3CPEA 1KAOA 2ZU0C 3P27A 3ZVMA 4G0NA 4PC2A 4QXAA 4R2HA 1T5LA 3CZQA 2XSZD 1XD2A 1Z6TA 5DGXA 4IHQA 4Z1MA 1Z28A 2F9MA 2WJYA 3IIKA 4PTLA 3MD0A 4QOSA 5E7MA 5JSZB 3VX4A 4LBWA 1RE0A 2LCFA 1HV8A 2ZJOA 4LV8B 1T3SA 2BJWA 4M8NE 3W6NA 5FOTA 4CT5A 1PVOA 5F9FA 3C41J 3R9IA 1E2IA 3I62A 1AM4D 2O8CB 2IC5A 4M1WA 4JLDA 1SXJC 4I99A 1KDOA 1LY1A 5FPYA 3TR5A 4BLPA 1E9AA 2UZ3A 1QG2A 4QM6A 1NLYA 2QM7A 4HEJA 3BWDD 5EZ5A 1K6MA 1JJVA 5EP4A 1E2MA 2P67A 2WV9A 1T8TA 5EQTA 2VP0A 4DXAA 2FFBA 4QG7A 4V0OA 4MYTA 2DYKA 5LBIA 1NBMD 3VR3A 2CVFA 4D4KA 5IDVA 3W90A 3PIRA 3C7KA 3RVBA 1ZU5A 2W83A 4Q1EA 4LBVA 4KU4A 5BYJA 4QJ3A 4XVRA 4DLRA 2JJ2A 4YLGA 2CCGA 3THXB 5DNYB 1KO4A 3Q5EA 4L4UA 4UNNA 4YQFA 2JLXA 2EFGA 1GL7A 4MKGA 1Y3AA 3ZDQA 4B71A 1D2EA 1YKSA 1UKZA 2VP9A 1T91A 4CEJA 2RGXA 5AUNB 1XDBA 4B75A 1QVRA 2WZQA 3VU9A 1U99A 2Z83A 3W8NA 5AJVB 3ADDA 4US1R 1NMXA 1QRAA 1L4UA 2WJJA 4NMMA 1HT2E 3NH9A 4EPRA 4M21A 1GWNA 3TUIC 5HR5A 1EGAA 4R98A 3EAQA 5IRCD 2DHRA 3LNCA 4C3ZA 4C0HA 3RRZA 4B43A 3GLIE 1NMZA 2BJVA 4RVCA 4G5RA 4H1VA 3BC1A 1DAGA 1SXJB 3CF0A 1FL9A 3K0EA 3KJIA 1DADA 3GEIA 1DAIA 4M9QA 2CNWD 2C5LA 4RFVA 2GAAA 3V4RA 3AB3A 4ZDWA 4BZPA 1E6CA 2O0KA 4RZXA 1M1YE 1XTRA 4A82A 3OZXA 4D4JA 5JEEA 3UPUA 3KFVA 3VTKA 1S9HA 1KZ7B 1N6KA 2QNRA 3EIEA 1GZSA 4R9UC 2RHDA 1EFUA 2O8EA 3K9GA 1JAIA 3AF2A 3BB1A 2OM2A 3G5UA 1HE8B 1Q1QA 1F5NA 3SE0A 1E79A 1RW4A 2VPPA 3L0PA 1ZD9A 3THWB 3QKSB 3THYB 1FX0A 1BYUA 3SS8A 1CR1A 1KI2A 1E98A 2CHGA 3SYLA 2GZAA 1NBME 2RCNA 1ZMXA 1IY1A 2Q6TA 4JLKA 3MJHA 1N5KA 4FN5A 1GKIA 2OAQ1 1NLFA 5EUMA 2VQSA 2C03A 1KY2A 1Z3IX 2EFCB 1R0WA 4H1UA 1XCMA 1HTWA 2RHMA 2VHUA 4HAUA 4DLYA 4ACAA 1WCV1 3B60A 2JA1A 4CRWB 1F2UB 4U02A 4XJXA 5SZKB 2B8WA 4NBSA 4JIMA 2C2HA 5DI9A 2VP4A 3NWJA 3R20A 2OILA 1CP2A 4GMDA 4OI4A 4Q4JB 3R9XA 3HYTA 3NDPA 2HF8A 4HZUB 3REFA 1G8PA 1SHKA 2F7SA 1VMAA 2YJTD 4XVUA 5KSYA 1XTJA 4PQYA 3VKHA 5EE0A 5LPNA 4E5UA 2G0NA 1W36C 1RFLA 4QHTA 3GP8A 2CHVA 5CDFE 5B58C 3ASYA 2GA8A 4FD2A 5TB5A 1ZD1A 2JLQA 4A2PA 3U6KA 3RS0A 1FZQA 4DKXA 3UANA 2NOAA 2QPAA 4TT3D 4Z1MD 2ZJAA 4F91B 5M04A 3MWLA 4BFTA 2FDCA 2NG1A 3PEYA 5FH9A 3EC2A 5B30A 1O87A 3X2SA 2F3RA 1IXRC 1TTTA 1MR3F 4C2UA 1W48A 4TSFA 2BMDA 4LJ7A 3WRYC 2NO1A 1N6RA 2WWWA 3L0SA 5D3MA 5C4MA 3QVUA 5BN3A 3IHWA 4F4CA 1N6PA 3C16C 3NIBA 3QEJA 1XX6A 1A1VA 2ECKA 1FTSA 5FOVA 1PLLA 3VR1A 1XJQA 1Z0AA 1OXTA 3W3ZB 4EQ6A 1NSFA 2ZRAA 2WWFA 1N5JA 3MFYA 1A5TA 4XWKA 1VYTA 1XD9A 2XXAA 2Q9BA 1KHTA 5GADl 4MYHA 1EESA 3T1QA 2WWXA 3NBYC 2PH1A 3UIEA 1IBRA 1IN5A 1NVUQ 3OF5A 4IVPA 5C1BA 2FPKA 3AF0A 1ZM2A 2QP9X 3A1WA 4C4PA 3FE2A 4KSBA 1TNDA 2BBSA 4LK2A 3L8ZA 2QORA 5L3SB 1QHHB 4OJKA 4XH9B 3KTAB 2I1QA 3L2OB 4TQUS 1M74A 3BBPA 4I4LA 1AIPA 3UK6A 2JJ8A 2BBTA 2X1VA 3ZZ0A 2IYTA 4O0MA 4OYHA 1W36B 1H65A 1MABA 4BLRA 1R8SA 1Q0UA 1ZD8A 1RRCA 2IS2A 1OB5A 1KIMA 2A5YB 1F60A 4JL6A 3SBDA 1R5BA 2OV2A 3DOFA 3CNNA 2ZJ2A 4PPQA 1KK0A 2DFLA 3K0FA 4YMUA 1J8MF 3KB1A 821PA 1IY2A 4XSHA 1TQDA 5FBWB 2GETA 4UXIA 4BLSA 1F2TA 4RD3A 4LJYA 2DWOA 2RH5A 1OF1A 3GQBA 3NH6A 1E0AA 4BFVA 4GDFA 4PC3A 4Q1DA 1G9XA 2B21A 1LTQA 5TVKA 2RGGA 3R9WA 4X8HA 3DMNA 2PBRA 1XU4A 1JNYA 3AKCA 3L0OA 1YQTA 1ESNA 1FP7A 4ACBA 2R2AA 3CLVA 4A6XA 5KNDA 1GKYA 3EC1A 2QENA 3BXZA 3NVAA 4DT1B 4LPKA 2GNOA 1NVVR 3HJNA 2HF9A 3VFDA 2EQBA 4XVQA 5DI3A 4V0NA 5BQ5A 4ASUA 2ZJ5A 4OQMA 3F3YA 5KUTA 1H8HD 1P4SA 1KDTA 5A0FA 4ZIRA 2P6RA 3QVVA 5KO2A 4D82A 1C9KA 3B1XA 1BO6A 4EPTA 2XB2A 1CJVC 2FFHA 4MITA 1E79D 1KMHA 2HEIA 1XXHA 3WBJA 5K8LA 4KBFA 5BW8A 1NVWQ 1OSNA 2ODNA 4KITB 1PV4A 2J0UB 4IW3B 5FTNA 1VG9B 4JJZA 2GCPA 2AHOA 4II7A 4PHHA 2HLDD 1M34E 4B3FX 1OFUX 3PVSA 4YMTA 3A1UA 4DCNA 2IHBA 4C0JA 3PV0A 1XEXA 3D7MA 2WOOA 4OHWA 2XOKA 2GF9A 3E1SA 3EA0A 3PEUA 2W2TA 5KPJA 3Q9LA 1KSFX 3QXJA 2WICA 4MKHA 1D2MA 1D6JA 3W5JA 1QDEA 4DCSA 2D4HA 4RZ3A 2OBLA 1LW7A 2J0QA 3EPKA 5C18A 3NEYA 1XNJA 2CJWA 2FF7A 2XTMA 4HAWA 4HUQA 3HU3A 4B48A 4WZAE 4JLNA 3MCAA 2IYXA 3RS3A 2YHSA 1L4YA 4EAQA 1EFRA 1T3HA 2BMFA 4HUTA 2ZRDA 4HLCA 5ELXA 5JS8A 1MO4A 3LLMA 2GJAA 2WAYA 5FBRB 2G3YA 2QMEA 3KKQA 2YWHA 2QRZA 3QXSA 4ZCIA 2V55B 4R71A 2OCYC 1Z0IA 3U4QB 3CF6R 1G8YA 3A1TA 3IKJA 1DE0A 1RRFA 1E4YA 2ATVA 4PR0A 3VKWA 3GLGA 4CEIB 1IHUA 4QGGA 1KAGA 3B8HA 4N3NA 3VR2A 5EXTA 4DSTA 1KNXA 3AGQA 1G5PA 5TY0A 4D0GA 1E3MA 3QPUA 1ZCBA 4DDWA 4XWOA 3H0KA 1JAHA 4NDZA 1VCMA 2BOVA 1K5GA 3LQQA 3BFVA 2BMJA 3MUFA 4EJSC 1VDZA 5FR1A 5JRJA 3HP1A 2CE7A 3KUDA 1ONBA 2K5UA 3KJEA 5HCNA 4MRSA 5J4KA 1VHTA 4NP6A 3ZD6A 4N0EA 3W3AA 2W6ID 3S1AA 3RNLA 3PG5A 1W2GA 1E2NA 4F92B 1W44A 3KQUA 2XZLA 3LBNA 5LDDC 1TMKA 5FOUA 4WZ6A 3ZQJA 4D2IA 4BFUA 5JHHB 5CJ2A 3WYAA 2B7CA 3E70C 1E2FA 1XTIA 4UXHA 3A37A 4RD1A 2ONKA 5TMPA 1CF4A 2YWEA 3AUYA 4W5HA 5FOWA 1W4BA 3CIOA 5EP2A 3SDZA 3WY9A 3QSYA 3EZFA 3RABA 2CK3A 5J4VA 1J7KA 4Q1BA 3WBKA 2WKRA 3DO6A 1GFIA 1JXMA 1XJCA 4OK5A 1RC8A 3O8RA 1G291 4IOMA 4F93B 4IDOA 5P21A 1E0JA 1ZCAA 3PEWA 1II9A 2YYZA 4HDQB 4LV6A 3TR0A 4I1VA 4PO1A 1N6OA 1M6NA 2FGJA 3EZ9A 4JLPA 4YXWD 3KXLA 3OIWA 1OIWA 3WNBA 4TL6A 1KGDA 5EXXA 2AR7A 5IK2A 2OZEA 2G88A 3FYHA 5TXGA 3SNHA 3R8FA 4NCJA 2FX3A 2GCOA 2BDTA 3TUZC 4JYBA 3ZLJA 1XD8A 3SJCA 1UBCA 5HPYB 2ZI4A 1UPTA 5BYKA 1X8LA 1KI3A 2ZRCA 4Q9IA 1BKDR 3TNFA 1WF3A 1HQCA 1HYQA 4Q9HA 2Z4RA 4GT1A 1Y63A 2ZRBA 4A4DA 1J99A 5H1YA 4LZZA 2R44A 2ZR0A 4TTRA 4A2QA 5JMTA 3V4FA 1T6NA 2JIZD 5FTLA 5JZVA 2WOJA 4U7DA 2GF0A 2PEZA 2H18A 2HYDA 3JVUA 2VHJA 4KJZA 1IJFA 1R8QA 5FBQB 3TRFA 3CX7A 2ZE7A 3GEEA 3T1VA 1AN0A 2J41A 3TAUA 2AK2A 4LX0A 2VBCA 1YZQA 3IUYA 4U00A 4A0FA 2FEOA 1JBKA 1DPFA 4US2R 4TTQA 2ZVPX 4GOJA 3K09A 3A4LA 3SJZA 2WIAA 2J7PD 3AQ4A 4PXAA 4FWTA 4PHTA 4URWR 1W47A 2EYQA 2CL6X 3HWSA 2QBYB 4CEHB 4TLDA 2DWQA 3I8SA 1R2QA 4WW0A 3WRXC 2A5DA 5JECA 1XTQA 2ZITA 4LHZA 5FI1B 3UXMA 1OH7A 4RY2A 2AD1A 2NGRA 2RGNC 1KO7A 4DZZA 5JCPA 3GLFB 5FUWA 3PITA 2Q9CA 2OT3B 1CLUA 4Q4HB 1ZRHA 2CMKA 3LX8A 1JQLB 2PMKA 1JECA 2IEYA 4UKDA 1YZGA 4RFSA 3TW8B 2RGDA 3QF7A 1R7RA 1ZU4A 3H86A 3JVVA 4Q18A 4P4SB 3TW4A 2FPMA 3K8YA 3GJ3A 2WJIA 1OYYA 3C15C 4A8JC 2J0SA 3EPHA 1XMJA 2CDNA 1M7BA 1P2SA 2QTFA 4GOXA 4KVGA 1X8JA 4HLDA 5SZIA 4B3XA 1ZM4A 1G17A 2O8BB 1OH6A 3HU1A 1HQYE 2A2ZA 3GJ7A 3EG5A 2C96A 1XXHE 1HUQA 3EX7C 4PSKA 2WSSA 4IDNA 4A1FA 3DM9B 4KVAA 4TMTA 3CM0A 5KSOA 4OHYA 3X1DA 1KI1A 3LW8A 4FCWA 2PJRA 1SGWA 1Q3HA 1SQ5A 1NSTA 1G18A 2GAOA 4OK3A 5HE8A 5FR2A 2QAGC 1E94E 2H8KA 5EJEA 5J4LA 4C2TA 4BZQA 2FOLA 3VNUA 4KI0A 1P62B 1VG8A 2IYLD 1N6LA 2WWIA 1EFTA 2ORVA 3IDQA 1UM8A 3TMKA 2QRNA 5C2JB 1KJYA 1U94A 2ZIAA 1P75A 1C4OA 3SI7A 3TVTA 4JZKA 1SVSA 5AUOB 4H9GA 1NNEA 3RYTC 1FNMA 3IEVA 3K9NA 3A36A 1RRPA 2QU8A 3ZIAA 1W7AA 2F6RA 1R0YA 3TBKA 4BLTA 4DLTA 4M1YA 1G20E 2ZI3A 4DUGA 2XZOA 1S0UA 1Z0JA 1DOAA 1MRSA 3U3OA 1EFCA 2FSFA 4TZ6A 4IRUB 3FFAA 3FDIA 3N5CA 3LDAA 5LB2A 2PZFA 3U61B 3FMOB 4LPSA 4DSNA 1RRGA 3LO5A 1OIVA 2AKAB 2QA5A 3OEHA 4W9MC 4WOPA 2HUPA 2ORWA 4O3MA 1YR8A 2MSDB 3RS4A 1W49A 2RMKA 1N5LA 2WMNB 4IJMA 1CR2A 2RGAA 3CX8A 2CBZA 1P3JA 2FEMA 2KWIA 3IQXA 2O8FB 1GKUB 1TU3A 2R6AA 1FP6A 2ZSDA 3GLGE 2X77A 3GFTA 5AJZA 5TARA 2A5JA 1G7SA 1UEIA 1Z07A 3VQTA 4AKGA 5DN6D 3ETLA 5FUVA 3CRVA 1F3OA 3FB4A 4DLUA 4TYNA 2GJKA 1TADA 4KV9A 3KXKA 4QBIA 1J70A 1U9IC 3FHCB 5F98A 2BBWA 5H70A 1U90A 3MWJA 2ZR9A 3FTQA 3FMFA 1XP8A 2DFKB 2IWRA 1NKTA 3ZYCA 1X1SA 4F4JA 4C7OB 3LXXA 3UWOA 1N2CE 1ZVQA 4NYJQ 2WIBA 2VTKA 1N6HA 1OXUA 1G6OA 4RD6A 3RANA 1SULA 1SKYE 4JLAA 1SXJA 5FPSA 5BWMA 4B2LA 3U44B 2P3SA 4MKIA 1IQPA 1CJTC 2J5XA 2UVQA 5E7JA 3HR8A 2JLSA 1CU1A 3KFXA 1M7GA 2ZETA 1TX4B 4YDHB 1BS1A 1UBFA 4KSCA 3CKLA 4CW7A 2QMUA 2F43B 5HTKA 4C0SA 2QMHA 5DE3A 2GXQA 4NHOA 2Y8EA 4GNKA 1LS1A 3QKSA 4BFSA 4E07A 4LRWA 721PA 2XJ4A 2H57A 4KFTA 1G64A 2QE7D 2VL7A 3CB4A 1UKEA 3KKNA 5JCZA 4AI6A 3FFBA 3CRW1 3SYNA 1KO1A 4RD2A 4PPNA 1R10A 3CPHA 1K5DA 2IL1A 4PC7A 1DS6A 2GXSA 4ZO4A 3WYFA 1G3IA 4QHYA 3LLUA 3OAAA 4Q47A 3RSLA 2ZEJA 4OHXA 3AVQA 1GUAA 1E4VA 1TF2A 1DTSA 5FTKA 2Z43A 3ZH9B 4DB2A 4OQFA 4PANA 4UNPA 1Q22A 1QHIA 1TEVA 4IFEA 3TKLA 1UF9A 2BMEA 2W2XA 3FMIA 1AGRA 2XTZA 1NI3A 4LJ6A 1IN7A 3WMFA 2ZS8A 1XPRA 1IN6A 2MMCA 3GMTA 3CW2A 5EUQB 4UJ5A 2ZRKA 1TAGA 4JBYA 1N6NA 5CB6A 2HXSA 4DLXA 1UKVY 4Q48A 1YE8A 1SVMA 3BB4A 4OK6A 2J87A 4ON9A 4JLJA 2IHYA 5CITA 2ZR7A 2F55A 1OKKA 3F0TA 3KDSE 221PA 2XTNA 4RKFA 5CIWA 3K0SA 4MUAA 1D8TA 2H17A 1N25A 4ZKDA 1BMFA 3WP1B 1G7CA 5DHAA 3ZIAD 2QTVB 4X8LA 5IF9A 2ZRGA 2ZI7A 3GCGA 4Z51A 3U60B 1U8AA 4MA4A 4LYAA 4DUGD 4RCYA 2E1RA 3DZDA 3T1TA 4XTRA 3SR0A 4Q03A 3RAPR 1CULC 4M1TA 4NYMQ 2C99A 4PC6A 5KNCA 3IPYA 3FMPB 1GSIA 4EDHA 1TF5A 2QT0A 1DBSA 4JBXA 2B8TA 5G3ZA 3RC3A 3OEHD 2GBLA 1LFDB 1XEFA 2Z0MA 1IONA 1SZPA 2QGNA 4HB3A 4Q7MB 5UKDA 2H92A 2QUZA 4B74A 1KNQA 2V7QD 3GJ4A 3QE0A 3B1YA 2BM1A 1X3SA 2KB0A 2VSFA 3OFNA 3TJZA 1X8KA 2ZUBA 2FMXA 1E9FA 3BH7A 4V03A 4BUJA 2W0SA 3E2IA 4TLEA 4IVRA 2R6CA 3UMFA 2FFQA 1N0VC 4V0KA 1NJGA 2B6HA 4QBGB 4A92A 1Q21A 1Q3TA 3C4JA 3ZVNA 4LHXA 4D0NA 4OKSA 2IF2A 3U7EB 3I72A 3QI2A 3BD9A 4U5XA 4TYQA 1B23P 4KLZA 4DCUA 1Z2AA 1OE0A 1GRNA 3SN6A 3K0CA 3P1JA 5A5GA 3K70B 4AD8A 2NZ8A 4NPHA 1IN4A 2GESA 1LF0A 4AURA 4KFRA 2FSHA 2WM9B 2CCJA 4A0GA 1S2MA 1KYIA 4QGAA 3T5DA 2UKDA 3BFKA 4BECA 1E2DA 1IAQA 2AXPA 2OESA 2PZEA 3FVQA 4DSUA 1CTQA 4QJ4A 2BIFA 1KDRA 4QNRA 1KK2A 4GL2A 2ERXA 2NPFA 4Q9KA 3JZMA 3TLXA 2DFTA 3SQWA 3NG1A 1EG7A 4EPWA 5DLQC 1IM2A 3EZ7A 4CT4B 1FUKA 4TLBA 3OE7A 1VYVA 1AQYA 2ZUDA 3P4XA 5E95A 5J4HA 2Q0HA 2WHXA 4CVNA 4CEJB 3K70D 1D9ZA 3NEJA 4BFXA 5H8WA 1WMSA 2ZRLA 4MGIR 4BRWA 4A9AA 3B85A 4PSVA 1L7VC 4DC9A 5AJYA 2VHTA 1OYWA 1J8YF 1KO8A 3B2EA 5FFMA 1II8A 2VP5A 4DWJA 2BC9A 2QTHA 4W5WA 2VP2A 4IOJA 1GITA 3K9HA 1R6BX 3KZ1E 4FIDA 3TH5A 4J0QA 2V4ZA 1TEXA 4Y0VA 4E03A 3GJ8A 3GLHA 2JJ2D 1E0SA 4D81A 4IOKA 3W5IA 3EXAA 3U3JA 3BK7A 4PZYA 2OXRA 3W34A 3BERA 1G1MA 4BRUA 4P4UA 3BE4A 3W6OA 2R6GA 5DYGA 2PX3A 1KI4A 2V1UA 2IS6A 3LW7A 1CIPA 1IJEA 2WKPA 5LD2C 4MUBA 4R2IA 3ZS9A 2ZRFA 1DVRA 4KFSA 2AWNA 2HCJB 1OH5A 5JRZA 3OEEA 2C95A 1EFHA
chains in the Genus database with same CATH superfamily
3OX2A 3EAFA 4LYJA 4MAFA 4MS4B 1KQNA 1B1AA 1YK1A 2XYQA 2BFEA 1H22A 2D54A 2JFQA 2NVWA 3U31A 4DQXA 4UBMA 3ZQ4A 1FX0B 4Y6PA 2ZXFA 4DNXA 3IJ5A 2I6GA 1ZL2A 4GPBA 2FWIA 3D6VA 2K7FA 3RJMA 3PNPA 2XCOA 4QPJC 4TTIA 5CFRA 1BZYA 3CINA 2PH7A 3AY3A 4RD0A 4Z9YA 3R7WA 3RHFA 1FSFA 2J3EA 2JIMA 1CJCA 2LXNA 3DV0B 4MWBA 4NABA 1KMNA 3TIFA 5KYKA 3PUXA 3HU2A 4NG4A 1KYYA 4WT7A 1ITZA 4FHGA 4R2MA 3OM8A 5KYXA 4JC0A 3CRZA 1XNRB 2Q3MA 1UDAA 2OM6A 3KU4A 1L7MA 1EK0A 1V96A 3AONB 4ARIA 1CRQA 4AJLA 4XKJA 4FKMA 1P0FA 1AHNA 2P2DA 1A9SA 1QGUB 4HVTA 4QXOA 1PGPA 4JT2A 2EZ9A 3FCSB 4IUCS 1GTRA 1GNPA 2YCLA 5I4BA 5FHRA 2GDJA 1D07A 4MW1A 5EIEA 2QGFA 1Z5NA 3ABSB 3OTHA 3BIXA 3ZNQA 4YRKA 3FNQA 1TLLA 1CP3A 3KP1A 5DNVA 2Y9MB 1K08A 1V5WA 1Z13A 3N86A 4OFXA 1QPGA 1ZIYA 4DGQA 4RTPA 5EPEA 5L3QA 1VHQA 1YL6A 4Q1CA 4EZBA 3K1AA 3MLEA 1AKVA 1FNCA 2JCYA 4DREA 1FW6A 4KSYA 1XUOA 4BNHA 1FU8A 4IX9A 4Y2XA 3N28A 4UE6A 1KDYA 1U0JA 4TWJA 3D64A 5LD2B 4LJAA 2NYRA 4WNCA 3OG9A 4JZYA 2W2MA 3B1ZA 3OIYA 4GI2A 1NF8A 1VYUA 1FS4A 1NN3A 1QO0D 2VJNA 1RLIA 5LZ5A 4NKRA 2DPYA 1U8UA 1HO3A 2RE8A 1RHJA 3QXGA 2PVPA 2YWFA 1AZWA 3G8AA 4G0YA 4MI6A 4X63A 4XI9A 4DJTA 5BN3B 2YN2A 3CISA 5A4AA 4X62B 2ERCA 1OLOA 4I8IA 2IZ7A 3CY6A 3HKCA 3GRRA 2PUWA 3FGNA 3HVUA 3JY6A 4MWOA 2OGSA 2GN4A 4XXHA 5ULLA 3ILHA 4UOEA 1TUBA 3GD5A 1X3LA 1U0TA 2ZWAA 4IR7A 4LJ8A 3D6HA 3PEVA 1ES9A 1RPJA 2P1RA 3UMJA 3ZGLA 3RS9A 2E55A 2W58A 3UYLA 3EUFA 3RS5A 2ENUA 2YHAA 2ZIGA 1AJEA 3HTXA 1NVXQ 3F6RA 2TECE 1RAIA 2IYRA 2ODEA 3FVVA 4GP9A 3V7UA 1K8RA 4F97A 5JC1A 3BCRA 1ZIXA 2Q28A 2ZT8A 4MCJA 3OJOA 4F2HA 5KYGA 4XFKA 3CG0A 3KLBA 2EBWA 4URXR 1VPEA 2GK7A 4KK3A 2ZYVX 2MWMA 2PXXA 3VR6H 1QHXA 1AN9A 3LYHA 4J3JA 7REQA 1S96A 3KUXA 4RJTA 4IS3A 3ITDA 3TRIA 2O8DA 4OBBA 4W6ZA 5EMMA 3OP1A 1XZKA 4R1SA 4M8IA 1PE0A 4C22A 3KVOA 4UQOA 5DTQA 5TF0A 4F3CA 3UCEA 1MUUA 1YI0A 1X7GA 1FOEB 1Z6GA 3PXAA 2MSKA 2NU6A 1RXWA 1JILA 2VSNA 5E4TA 5AVZA 1UC9A 1WEKA 1BOOA 2QZ4A 4HN9A 4MKRA 1OWPA 4N8EA 1BEEA 2OZKA 2R62A 1C29B 2CKDA 3DDZX 4DLKA 2BGJA 5DASA 1E20A 4F38A 3I42A 1I7QB 1P4HA 4HDMB 4HLUC 4Z7JA 4Y30A 3WLQA 4KWTA 3TZEA 3T12A 1A8PA 2XLCA 4HTFA 5AJXA 1S9DA 2P5SA 1XO1A 5JDIC 2HTEA 2VEDA 1GNLA 3BCUA 2DBQA 3C3EA 3NTQA 2PTHA 2EF1A 2C3YA 3VO1A 2ZLBA 2NMVA 1K6JA 2XB6A 3L0YA 1CJBA 3I0MA 3UY4A 5K0JA 4X84A 3ZYZA 1P2VA 1QYIA 1VL0A 3GN1A 4H35A 4QPCA 5DM4A 4EYEA 2Y1GA 3DOIA 3LPCA 5B30A 1V43A 4JYAB 3D31A 2V6FA 4WKBA 4ENVA 2HT1A 1IY0A 1KU0A 5EYPA 3HPRA 2X9QA 2YVLA 3PXUA 2HBRA 2VT3A 3H2HA 1QAQA 4GUDA 4GYYA 5K3DA 3BF7A 2BFOA 3TUJC 1AKUA 1WW8A 5DLDA 3VC3A 5AHKA 4GF5A 3HR7A 4ZIRB 1T9AA 5AIAA 3UVEA 4UTVA 5KS2A 1JYFA 1PR2A 1K6XA 1M1NA 5K0BA 5LXTB 3QNUA 3SICE 3JWGA 4GZ5A 2GMWA 8OHMA 1UMDA 4LDPA 4N8DA 2VT2A 3GZJA 3W8RA 1VIAA 1LU9A 4ZVOA 1O0CA 1HE1C 1N34B 16PKA 2ZBUA 3OCZA 1P3DA 1CUVA 3N74A 2J3IA 5D1NA 1J22A 4WZBA 4DIEA 5JXIA 5JY1A 4X1YB 1EXVA 2A0XA 2ZI6A 3WWOA 3DWIA 4AP9A 4HP8A 3P9IA 4NQZA 1I4WA 4X1OA 3UAVA 2FUCA 3A25A 3D8SA 4HVCA 4G0PA 3AR8A 4DRYA 3JALB 3GJ6A 3SS7X 1XZPA 4F7DA 3R5FA 5KNDD 2X0IA 1KH1A 1VLZA 4C4SA 3JQ6A 2PT9A 5DNWA 5BRJA 3VU8A 1ZP6A 1KA9H 3KKMA 3LOUA 5A1TA 5D6OA 3Q8MA 3HB4X 1PD1A 3ZDXB 3UJ3X 1QGOA 1RD4A 1NVGA 3HP7A 3SC3A 4J1NA 1SVOA 2QT9A 3ZHRA 4CV0A 5BR1A 4YBRA 1L1EA 5T5QA 2V6BA 1U8EA 3QSGA 5F12A 4FP9A 1U1CA 3ES9A 2C59A 2IX3A 3NHJA 3LDHA 1G20B 2R1ZA 3JRNA 3P9QA 1V3UA 1OI2A 2X22A 1ZS9A 4G6ZA 4LJ5A 1DQSA 3BSWA 3KZOA 1JFFB 1IZYA 5LR6A 3DDSA 1SOWA 1W5AA 1A72A 1VJ1A 2XUGA 4GI7A 1A8HA 4M6WA 3UMCA 4DE5A 2O59A 2HU7A 2H5EA 2IXAA 3L7IA 4HMQA 4BEJA 1XJWA 1TAHA 3G82C 1GN8A 1AZSC 2ANCA 1HNWB 3RBVA 3MG9A 3F74A 5F2OA 3QF4A 5BSEA 1UDXA 3D9QX 3GEBA 4G4SP 4LHYA 4BQOA 4YPOA 4KQIA 3OQHA 5H68A 4YP9A 1SVLA 1VGQA 2Z1NA 4QYSA 4ZDKA 1GD1O 5LKAA 2PZAA 3N8GA 4XAQA 5E3JA 2Z6AA 1DX9A 1OC4A 4CIXA 2PRIA 1Q20A 1B00A 1Y4AE 1TKBA 1PFUA 2FN7A 3UAWA 3BL6A 2R66A 4IHJF 4AYTA 1XAIA 1WE2A 2VKTA 4NATA 3CWZA 3LM8A 4ENTA 4P3NA 1QIHA 2X6TA 3GBPA 3KBBA 2UYOA 3EGCA 2GXUA 3GA7A 1HLPA 4H1TA 4F3KA 1EFRD 1AMNA 3HYLA 1QGAA 3STUA 1YH3A 5A04A 2H9AA 3FIUA 3LRPA 4C4AA 3IA7A 5JJIA 1U3GA 4MJXA 5GGYA 5F3RA 3DTTA 3B52X 3T7IA 1DXQA 5HKKD 1SZCA 4Q1AA 1WU8A 5FUXA 4EUFA 3LVBA 6Q21A 1F0NA 3A4NA 4N3GA 4NBVA 5CG2A 1R8JA 3A6EA 4MRMA 1JLHA 2Q8NA 4M89A 2I9KA 1SKYB 1U28C 1U8FO 2G9UA 2QAGA 2XIJA 3PU6A 2R0QC 4DR4B 5KYVA 4GLBA 4WXYB 1FYWA 3WTCA 1VLLA 4EPXA 5CPBA 2BM0A 2DT8A 2PFSA 5FUYA 3DGEC 5JD5A 4CUJA 2XCLA 5FBHA 2P4EA 5LBUA 4UDYX 3GDWA 1L9XA 4JC4A 1JJ7A 4LTMA 3RTGA 1UK8A 4O4LA 5B2ZA 2ZAYA 1S3SA 1XL0A 5L7YA 3A7EA 4RZUA 3FOWA 1NG1A 5LYJB 1G7RA 1I01A 1EWTA 2HJVA 4R5HA 5DPMA 3I83A 1U2RA 3HFGA 7ABPA 1HY3A 3MNFA 3WSVA 3TLCA 3PFWO 4QUAA 3SOPA 4FQ8A 2G6BA 2W0MA 1A69A 3VOTA 4LCBA 3QEMB 4B3DA 1AUPA 3FN4A 3K09C 1E9VA 1HT1E 1SMKA 5K1ZA 1BH2A 3C7DB 1B3RA 1H66A 2WF8A 3CX4A 4ZAYA 1AV7A 2KBEA 3W04A 1KVQA 3B7WA 3W3AD 3VU3A 1Z7EA 1R4MA 4GUAA 1DHTA 1X7HA 1NQWA 3Q3HA 1WRBA 3LBHA 2UYYA 3RH0A 3SQDA 1U2GC 2IXDA 3HVHA 4JCOA 3COYA 3CSDA 5K0NA 2Q0XA 4MRPA 3W9YA 1C7JA 1TVKB 3CNLA 3QVOA 4NYJR 4BV9A 3FFTA 5DM2A 4L9SA 1BVRA 2BHRA 2WINI 3R3VA 3WGMA 4LMBA 1X1AA 5TIIA 3HC7A 4QGHA 2WP8J 1Y3FE 2V6JA 1NVTA 4EGSA 1FLNA 2AF3C 4WBNB 2BAGA 4QYXA 4YJFA 2P69A 5SYMA 1W93A 1KFCB 3CE9A 3MD9A 1IRIA 1DAFA 1QKJA 1SQGA 4HAZA 2OORA 2PYIA 5IJ9A 4CTMA 4I19A 2NQ8A 2X13A 2Q8PA 2F3PA 2ZB4A 1XJ0A 1I2CA 2GN2A 2HA2A 5K8UA 4C0QC 3GYBA 3K8QA 3UHPA 2C31A 3RYCA 2DHQA 1OAKA 3F6BX 5IT9A 1QS0A 5E8RA 3DZIA 2IZ6A 3ZCTA 3SJUA 1EHCA 1ZOLA 3UAYA 1PT8A 3OUUA 3HSKA 1E1QD 4RABA 2NW6A 3BXFA 3I8XA 3I4LA 4MHSA 4OSPA 5I4CA 4I5FA 1SXQA 5CDFE 1AV6A 3GVXA 3JRXA 2ZDHA 3THXA 3CJRA 4PN3A 4J2OA 2D7DA 4OMDA 1C5KA 1VYHA 1W85A 1XTKA 4RSHA 4K8OA 1E5VA 2CNWA 1MDFA 2OLKA 4GG1A 2RGWA 2DB3A 3A6FA 3BOSA 4BGDA 4HK4A 1C0EA 3G0BA 2YQ5A 4BN0A 5K6RA 5LQNA 4R2JA 2VAXA 1VHLA 1GO2A 4YJGA 3C7AA 3QUQA 2PKYX 1IOZA 1NOIA 2F9LA 4P3YA 4B3TB 4W9RA 4W1SA 1Z56C 4MO2A 6PFKA 3E22B 3LVRE 2XXBA 5SYAA 1FSZA 1NJ5A 2KJQA 4MV0A 1S8AA 4X85A 3HJRA 1YIOA 3MLAA 2XEXA 3WGQA 3D8BA 1KZ4A 1GOTA 2P9HA 1O96A 3ENKA 4UBIA 4X7BA 1ZN2A 5H83A 4J0JA 4K3VA 1I2MA 4HAYA 4RK0A 5LUBA 3VZRA 5KJCA 2JHCA 1M2VB 5F1PA 4K7JA 2VA9A 1KDZA 2GCNA 1P0CA 3I32A 4ZYYA 2FX5A 1XQVA 1GGEA 2YINC 4M1OA 2ZXEA 3P2EA 4GI3A 2JZNA 2PCJA 3N0XA 5CNKA 4AG5A 1PEYA 1A97A 4HB2A 3LOPA 4E4TA 1JQ3A 4UM7A 4ZOLB 3W8EA 1G5RA 3P20A 3K8ZA 1JSZA 1GQSA 2YXBA 3Q40A 3RI3A 4HNUA 5BVGB 2ZRHA 4HNAB 5F23A 4KQEA 4YMSA 1WDLA 5KKCA 4JI8B 1GUZA 4DLBA 4FC6A 1QLWA 3P19A 1D5CA 4IKOA 3UEOA 5F3DA 5AM1A 3C8HA 2WD8A 1KP3A 2XQVA 2GHRA 4A36A 1KKLA 4WNAB 1FRZA 2CHUA 5IBQA 5HKOA 3PCTA 2OHGA 2C2OA 4QEZA 3KSMA 5D3QA 2QL7A 5EPUA 4B6FA 4Q4CA 4NONA 3X1WA 5JY6A 2X8WA 3OCJA 4CKEB 3I6QA 1SAYA 1O8BA 1BGWA 1U9YA 1XQ1A 1ZIDA 2HK7A 3BGIA 3VU1A 4CDGA 3NUGA 1JU3A 5JQGA 4UHDA 5F5NA 5AW2A 1DBIA 4IMRA 1C9NA 2C9CA 2WNIA 3S81A 4EIWA 1I3OA 1GLGA 4O4HB 3L82B 4CZ2A 4LWQA 2KMLA 2I71A 5AJWA 5KHOC 3HM9A 4X5OA 1FCJA 2VS1A 4J03A 4IQ4A 2AOTA 3QE3A 1ZM7A 3E3LA 5AOBA 1MEOA 4YB8A 4P08A 5AYVA 5BMOA 1LTKA 1ZYUA 1RACA 3M89A 5BW6B 2QN7A 5K03A 1U0HC 1TJYA 2VEOA 1JXAA 3INRA 2HGZA 5CB0A 2J07A 4LGYA 2OBMA 3R41A 4QU8A 4NBRA 4RVNA 5B3AA 4EX7A 1EXMA 3NKVA 4RTQA 5F9HA 2QLBA 4XB2A 5TR9A 3TIIA 1YK0A 2FP4A 2PPVA 3LY8A 1TUGA 2G9NA 1EKXA 2WE7A 3VPAA 1SCJA 5EHXA 2GKOA 1L1FA 4W5QA 2JGFA 1E99A 1C3XA 3C6BA 4EGCB 2HSGA 3Q2KA 4ZEMA 4JKOA 4OQDA 5BN4A 1NHWA 1ZJ5A 2EFDB 3ICQB 4B2IA 1TCBA 4N0MA 4W82A 1TZJA 3HP4A 4I50A 3IQWA 1XAHA 4ZJPA 3WWEA 1VTKA 4QTUB 2QTRA 1PL0A 1Q15A 1X7XA 2HFJA 4I8XA 4NCHA 1ODFA 2JAQA 2GZDA 4BWVA 2Q7OE 3TQOA 3RRYA 1JPJA 1YE5A 3UT6A 4G07A 1PI3A 2XCUA 4JQOA 3QI7A 1RJDA 4LYFA 1MB9A 4DQ0A 2F1HA 2LRHA 3LUKA 3MTBA 5CLQA 1M34A 2ONJA 4TXNA 2MSNA 2DKOA 2QSYA 1W8IA 1P60A 2G36A 3O8OB 4HWOA 1ADYA 1IWBB 4YHBA 4B6EA 2FPUA 3L04A 3F47A 5JVDB 3A6KA 1COWA 3RK0A 5BV0A 3KB8A 2Z9CA 4RF4A 2IH2A 3QX3A 1D4AA 2HNKA 2J6IA 3VH1A 2Y1KA 1LZLA 2YNMD 1SHUX 2GHIA 4J76A 3WK7A 5KWSA 4OX9B 3JQ8A 3I73A 1MAHA 1G7TA 1N2EA 3A6LA 3GR6A 4NAUA 2UUCB 3DMHA 1HF3A 2FKNA 2K2QB 2BCGY 3ANMA 1VG0B 3T9CA 1CDEA 1PT6A 1YFZA 3FRHA 2IDZA 2FSUA 2IDKA 3TGPA 2O4CA 4J1TA 2XMBA 2ZVQX 3HL0A 5EWLA 4HSEA 3E15A 2E37A 4HDOB 4QAJA 1CUUA 2JLRA 3EW9A 3RVKA 3G2MA 2V97A 3G0CA 1TO2E 3AY0A 3KOWA 2YH2A 1L5HA 4D8YA 2D1TA 2E82A 2EXXA 2Q2WA 1E5LA 5FL7D 3WYDA 5FV4A 1V2GA 3EE6A 1WTAA 5ER9A 1XBTA 3NIGB 2P2SA 2E6UX 1U9JA 2PMDA 2RJNA 4MUKA 3S8EA 4I9NA 4K1XA 2LDXA 4ZEXA 1PUIA 5REQB 1Z7GA 1JALA 2ACEA 3E7PA 3KV3O 4RA6A 4S2EA 4GZLA 1QHHA 2DC1A 1EVZA 3O94A 4YYZA 1QOPB 5C51B 4F60A 1LZKA 1MXHA 3OUTA 3L1VA 4FDMA 5IFKA 2OQ2A 1XF1A 2A84A 2QU7A 4G0XA 4ZALA 3AIMA 3DEFA 2W7TA 1SCKA 3UUFA 2NSDA 3OPQA 1P9RA 4B34A 1QP8A 3AOEA 4DVJA 2X1LA 5DXFA 1Q2UA 2BP7A 5CBPB 3H2SA 2XI4A 1YE3A 3KYIB 2WU3A 4JUDX 3ANNA 1W8DA 3OTGA 1SEVA 1H1DA 4DCPA 3BGWA 2V7BA 4J0IA 5NLLA 1JLLA 2JCBA 2J9RA 3CZ4A 1OLXA 3QA3E 3NRBA 4V1CI 3U3ZA 1KEWA 3RQSA 2ZZNA 4QFDA 4W8OA 1GAJA 4XJTA 2XITA 1O95C 3LPNA 2HMVA 4IUDS 2OHFA 1K6IA 5EZ6B 1RVDA 1DQRA 2XVZA 2VCEA 1C1XA 1EFKA 1AF7A 1Z3CA 2C4UA 2W2QA 3IS3A 4NJEA 4PX2A 3WRYA 2EP8A 2PKQO 4GMXA 1RAFA 2P2GA 2WEKA 2AEJA 1AKTA 2W9XA 3IEXA 3KR0A 3NT4A 4I5IA 3WK5A 1DIGA 5I8PA 1QH8A 2V7VA 1JG6A 3NBZC 2HCBA 2O0JA 3B38A 3S6JA 2NIPA 1PJBA 1G19A 1SELA 2N42A 1NXVA 1FXUA 3II6X 1IHDA 3L0DA 4QUBA 3A10A 4CG3A 3BHNA 3SXUA 3EG9A 4AJEA 4JOBA 2O5EA 3VZPA 4MVJF 1P1KA 3PDCA 4M7WA 2KE5A 1ZX1A 2EBHX 4KPUA 4QPZA 1YHZA 3D0OA 3PQ5A 3BIJA 4HLQB 4HL6A 4IH9A 5JI2E 5KOYA 2CFTA 3NBXX 1DZIA 4YRTA 1U04A 1TZKA 4ZAGA 5A02A 1XHEA 1NE7A 3U56A 1VL6A 1SWVA 3VKGA 1DQZA 4Y9DA 3RFCA 4X9XA 4L6AA 2I65A 2JFHA 2EZTA 2CE2X 3ADCA 1DB3A 4BKMA 1MORA 5FWDA 3CKYA 5B2FA 4MTCA 3I8OA 1QK5A 1NRJB 1J8FA 3GYGA 1P2TA 5DWDA 2J5BA 2Y3IA 4S1PA 4UNRA 3IMEA 4JR0A 1CRPA 2YXNA 3HCEA 5GONF 1HT0A 5HQ3B 1X7DA 3NHUA 1RR6A 4Q7QA 1PJQA 3HZHA 2A3RA 1WO8A 1YZNA 1O57A 1YB1A 2CB0A 1T9GS 1QRDA 3IP1A 1RWPA 1DI0A 3CTPA 1J8QA 4B09A 1GV0A 4AY6A 1N1DA 1M8GA 2Y9PB 5IYZF 1QP4A 3FI0A 3O31A 1QH1B 3OAAD 5AUQA 5BN1A 3DL7A 3DW3X 4PRLA 4EWLA 3AVVA 4NK4A 2ZK7A 3VC1A 4HXEB 4MV8A 1HDYA 3WTBA 4RVOA 5A7HA 4PAGA 4NBTA 4RU1A 2C4HA 4II3A 1QNLA 4MW0A 1SG6A 2HIGA 3R09A 1P72A 1ZD4A 3AETA 2I3AA 4E88A 4JLWA 4X3PA 4PSAA 4H0FA 1L8QA 4UMDA 5G02A 3RKUA 1CNFA 3C8MA 5CTAA 4YRNA 2QP3A 4DEYA 2PKXA 1VIVA 1EVJA 2V98A 5TSDA 4GZMA 4O2LA 4EHJA 2EF0A 4E09A 4K2AA 3ZDCA 2BGUA 1NDHA 1Q16A 2VRBA 5ENDA 4TKZA 1GTG1 2KI5A 1FP4B 2V7GA 1EM8A 3ADKA 2WIJA 3I2JA 3ILXA 4EY7A 1W5FA 1TKRA 2GLXA 2H4JA 2C5BA 2VPIA 4GX2A 1RDFA 3A1FA 1OAAA 5I5GA 2W2LD 4PLCA 3WMRA 4AZTA 2VAPA 1I4DD 3RVRA 2VFAA 3JAKA 1UBSB 3K5WA 3ORHA 1TE2A 1NJ2A 4G65A 4KMMA 2YY5A 1UOEA 2REXB 2BKUA 3GT7A 1IPHA 2VYFA 3HJTA 4EF5A 2YV1A 4ETMA 5CAEA 4BYMA 1TCVA 3OFJA 3GMDA 3A05A 3GRFA 4OIMA 2QL6A 1AS3A 1NDQA 4K6MA 4PLVA 4UCQA 3VSDA 3L7JA 4V0MA 2P2LA 2YZ2A 1TF7A 2Q4DA 3EMBA 3LZDA 3P9XA 4XPIA 1XWIA 4LY6A 4WK6A 5GZ1A 4EG5A 3I5XA 5C53B 3L6BA 1IPEA 3M6VA 1N1EA 3G9ZA 3CLTD 1QPZA 3O0TA 2P6PA 3COJA 4ZHQB 3U7QA 4H3SA 3M9XA 1HMPA 2HH9A 3PC6A 1E3WA 3DVQX 4LOIA 1Z22A 3DXYA 1NBOA 3AVWA 1X7YB 3IB6A 3VNVA 4YDQA 5IHPA 1YU9A 4LWZA 4WOCA 1LSJA 7REQB 2DE0X 4J7XA 2FUG6 3LFUA 3TSCA 4HAOA 2GUWA 1FFHA 4PR3A 2ECFA 1Y3HA 3RB8A 5G3YA 5B3KA 1W6UA 2OGTA 1RSZA 5KB3A 3ISJA 1GVHA 3QPWA 1DKMA 2ID8A 2GNPA 1JAXA 2XDQB 1VIYA 1BG6A 1YJ5A 3EA4A 1MO3A 3W7BA 1YA6A 3W1EA 1CT9A 2GCGA 5E7IA 5CEJA 2QZZA 3DXXA 2XH8A 1TYBE 4FGUA 4IMJB 4PQRA 1Y6RA 2EFEB 4XYGA 5LXTA 1PJAA 3LVQE 4WEOA 4YUWA 1KY4A 2OQIA 3JARA 1I4OA 2XA9A 5AJHA 1MDBA 2G06A 5JO9A 5AI6A 4I9UA 4Q21A 5BQ3A 3CR3C 1V71A 4FX2A 2YIDA 3GFFA 1QG6A 2JVIA 3A26A 4Q6WA 3VA7A 1JKJA 4IQ8A 2ZIVB 2H8GA 4OAOA 1XZCA 3K9LA 3WNDA 3HJHA 1RZUA 4TRRA 1SK8A 2XWBF 4XIYA 3DEKA 3QOYA 1KKUA 1HQKA 2E4VA 3HGQA 3M4ZA 3MOIA 1C9JA 1UPXA 1RHUA 1C8VB 4KFCA 3EWSA 2AOXA 1GM5A 4MJ3A 5DWVA 2UYHA 3VZBA 2VNJA 3MSCA 3PL5A 4OQYA 2EFHB 3LUDA 3G7SA 3SEQA 4WJKB 3T35A 1KJZA 1NFFA 2BUBA 3IT2A 5B37A 1JDZA 1N3BA 2AB0A 4DDTA 1IOLA 2C20A 3N6RA 5LMNB 3O3NB 2PJZA 3GLHB 1N3LA 1PQ4A 4HLUA 4O2AA 3QFRA 3HXLA 4IQFA 5BRNA 3TQFA 5DX1A 5ITVA 2SCUB 2ZWVA 3MJEA 3VOAA 2J7PA 4MI3A 4X3OA 2Y1EA 2VHWA 3GJYA 4NNPA 4D9GA 1WMAA 3F97A 2XE4A 4FGWA 4I3FA 3SLRA 2OFOA 4IL5A 1V11A 4YAWA 5LQUA 2J30A 4FYMA 4KH1A 4BN5A 4TL8A 3RW9A 3IAM6 3PZRA 3DBRA 3GP5A 3P9SA 1PN3A 2WVGA 1RI4A 3T0GA 3EFOB 5DT2A 1ZNYA 2WLSA 2ZAMA 4XR9A 4DILA 2WU4A 3L92A 2ZE6A 4L8VA 3ZWPA 1LPPA 3VUFA 1E6LA 3B53X 4G41A 1S3GA 4U7PB 2YWJA 2L19A 3FOCA 4K46A 4BKOA 4MUGA 1EIWA 3OX1A 2CLKB 4ILEA 3K0FB 1FNDA 1NVVQ 3AFIA 3CONA 1FQKA 3PI7A 1BIFA 4D3ZA 4EMTA 5JW6A 1ABEA 2ZUTA 1A71A 1H4SA 2WD9A 2ZUCA 1IIRA 3ADBA 4A10A 4YUZA 5JH7B 1JVNA 2G83A 3LP5A 1OGIA 2VF8A 1U7ZA 3LZ6A 3Q9SA 2PLRA 3BN3A 1P73A 2NAFA 5AI9A 2AMLA 5LQMA 1F5SA 4AMVA 3IV6A 2HJRA 1SM4A 2I3ZA 2F4VB 1T0UA 1V37A 1X38A 3GO4A 1X0VA 4AY5A 2Q3HA 2YZMA 4NESA 3W2GA 3B9QA 4B6QA 3D3WA 5CJPA 2JBAA 1E3DA 2HU2A 3LLSA 2YICA 2DUNA 2WUDA 2BL4A 1P6XA 4D8TA 1NBHA 1SOUA 4XOUA 4R7ZA 4M0MA 3U0VA 3V8RA 2X14A 5F51A 3MRSA 3C39A 3U39A 5AK0A 4JVSB 3U4IA 3ROQA 1NV8A 3FOZA 4MPTA 1LB1B 1H1TA 3K53A 1I36A 3F4KA 5AVUA 1XNGA 4OQNA 2ABWA 5DULA 3PL1A 5I7EA 4MVJH 1EP2B 2DBYA 1C1HA 2ZRIA 4BLVA 5LB4A 1RYFA 2L0XA 2PXHA 4FFDA 4PGFA 3ZKWB 1UPAA 3WLHA 4ARZA 1BHSA 4Y2SA 2AX4A 1HSOA 1SCNE 3FKSD 4BL5A 4AY2A 3HCFA 1DEOA 2NUPA 3FOBA 3PHHA 4FHDA 4QVIA 3FLMA 1MZPA 2ZTLA 4X8OA 2QZ9A 2ICAA 3AEZA 3MBOA 4IO0A 5EE9A 2E87A 3L1HA 5C46F 2DHEA 4NEGA 2VTEA 1IC6A 5I7WA 2W6PA 1E3IA 2QG9A 5BNWA 4YJHB 3NAQA 4C4ZA 4D4LA 1TVEA 1F6BA 1Z7WA 2BKXA 2Q46A 4IIDA 4OOEA 3VM6A 4EMSA 2O8BA 3PF9A 2IPXA 3JQAB 1Y4DE 2IIVA 4KAXA 4LZPA 2ZJBA 3DQPA 3IV7A 3F6YA 3G3EA 4ND2A 4RF3A 3WQHA 2JI9A 1GPMA 5J9FA 3D5QA 1G21B 3BHIA 1G3QA 4M1ZA 1XA3A 4RESA 2B98A 1JPNA 1ZONA 4NIMA 4TWBA 4X7PA 4P0TA 1CIJA 1ZUNA 4XEUA 2I78A 2IHUA 4DXDA 5IC4A 3M5CA 2E49A 3NBKA 1P0MA 2AFIB 3R7DA 1Y7LA 2GM5A 5IASA 2XTJA 1E2QA 2VPTA 1P7PA 1VA4A 3H11A 3CUEF 4TS9A 4D56A 2DECA 1QQTA 1XZBA 2QM8A 2VUIB 3EFHA 3BD7A 3PICA 2VRWA 4EF6A 1YQGA 4BNTA 2O3QA 3GC6A 1JXOA 1KJWA 1T5SA 3L5OA 1M3SA 5EIWA 2C00A 3N6XA 4ICIA 3RS7A 2BEKA 2IPLA 4CQMA 3DBLB 1SHLA 4YT4A 5FDFA 4DCCA 2V3WA 3BTSA 3NM4A 2RGNA 3NV7A 5EL0A 3TG8A 2IA5A 4TLLB 1US8B 5IW8A 2GHTA 2JVKA 1R0XA 3PSHA 4X95A 3VR5A 3K2IA 1NAHA 2CYCA 3A1SA 3AJ9A 1T5OA 1FFBA 4LBZA 3DVSX 3QVKA 3ZLUA 1MV5A 1PSWA 2IF0A 2JFPA 4JB8A 3RGGA 2EVWX 2GEVA 4FPXA 1EXWA 4CMCA 4IGAA 3VSEA 1XRMA 3OA0A 2CGEA 2HTFA 4PLTA 3O26A 3PFCA 2Q9AA 2QJOA 1UEXC 2D2VA 1Z0UA 2JIQA 3DOJA 4MQEA 2M1ZA 5LYYA 3ZJYA 4WUTA 1LKZA 1CUFA 3VYVA 4ZHSA 2ZJZA 3E0XA 3NQ41 3QEOA 1B1CA 1YC2A 3V7FA 4URVR 4PSCA 4KIJA 1AS2A 1LF5A 1YB6A 2VAMA 1YS9A 1IBMB 2YMMA 1YDEA 4HJRA 1U1GA 3DONA 5TJ9A 1UFVA 4P58A 1PL8A 3KQTA 1PYDA 3Q3JB 4K05A 2ALJA 4Q3AA 4CIAA 5KQMA 3NMUF 2WHPB 3FGOA 3KL4A 3NETA 4FFNA 3QWAA 3PGXA 1Q0LA 3TDMA 3W1VA 1TKCA 2CZCA 1TUIA 1ZK3A 4XLLA 1ZC3A 4DIFA 1P77A 3OQPA 1O97C 1GQ2A 3A7DA 3O91A 1V95A 1EBUA 1KF0A 1OFTA 1SUAA 3P9PA 3QLVC 4MKZA 1BHJA 5FI3A 4EY6A 1N8NA 5U4QA 4V0ME 4DCTA 2DWPA 1K4KA 1FLVA 2FSPA 5CURA 3V00A 4CIVA 3QLTA 5CT4A 3K0AA 4BWFB 4CLXA 3G2IA 5IJXA 1HH4A 4ZT3A 2Q1XA 1M1YA 4MUHA 4Q7KA 1TMGE 4IDHA 4RCVA 2P1ZA 4L0CA 4R8SA 4OSOA 4RFLA 3I1FA 1VSQA 1V1MB 1JIVA 1ZJYA 2QE7A 3IQEA 3KOYA 2VWQA 4XX0B 2Z6QA 3U4MA 4C0LA 4HC4A 2GJ9A 5LIRA 3A2MA 3O3OB 1U81A 4YCJA 5BMVB 4DV0B 1ZICA 2D5CA 4WOJA 3S8MA 5FWAA 3GG2A 3GCDA 4IJ5A 3WGNA 2QV0A 3KS9A 4U7HA 2XNSA 1GCUA 5CCXA 3WP0A 5A0VA 3C6YA 3RG8A 2G1UA 1SKAA 2FWJA 2Q3FA 2ZIEA 4JB0A 2J9XB 4M0CA 3W4KA 4C76A 3MZ0A 2FN4A 4TYPA 1E6EA 1GGKA 4CNQA 1ZITA 3AO0B 3GT3A 5CG1A 4N03A 3M6AA 2F43A 2ZDGA 1O03A 3WLTA 2PM8A 3B7GA 1GTL1 3QLUC 1JWLA 2GOYA 1TUEA 2A78A 3DYIA 3PT5A 3TTYA 4BE7B 3OPMA 2F3UA 4MX8A 1N7GA 1Z2CA 1JQKA 3B78A 3SZ3A 2QG4A 2XRMA 4B33A 1YKFA 2OBBA 1GA1A 3AJ8A 3KKPA 2Q2NA 3U19A 1M7HA 3D8RA 2Q9UA 2C2MA 2VRCA 1HFWA 2XQFA 3MJFA 4IXMA 1AB6A 1I4EB 4EO7A 5AUPB 1UKAA 3ICPA 1DWPA 2MINB 2LWIA 2X2EA 4G3XA 4JYCA 1RYZA 3BQMB 3PXBA 5FLYA 3OX4A 4WBNF 4L02A 4AKTA 1QTQA 3EIUA 4A2CA 4PPGA 3EXHC 3LY5A 4MQFA 2IW3A 3F1KA 1MC1A 2PG3A 3PQDA 1Y1RA 4IDBA 4KQFA 4A91A 1JSCA 5HKLA 1S1CA 3I2FA 2JD1A 3BMNB 3DE5X 3NRJA 1GA4A 1MRNA 4C78A 2HT6A 3DMTC 1U6JA 1B0ZA 1V2HE 4DDHA 3GWGA 5TEVA 3R75A 4XQEA 1Y1TA 4K9PA 3RK1A 4FFPA 1AZLA 1KH3A 4WK4B 5DMHA 1BA3A 5I7HA 9MHTA 3U5ZB 1XZDA 2RHOA 3IDFA 1AO3A 2W00A 2WPNA 4M38A 2IDMA 2I2WA 5EKDA 5TQ2B 4NCNA 1EE1A 3KQLA 4GVXA 4KKXB 5HRUA 1N32B 4DMCA 4DQLA 4G63A 3WWZA 4O1IA 4R0VA 1IYZA 1YR7A 1FYVA 3KJFA 4LC1A 4ZGGA 1QHSA 2Y0DA 3FZNA 4C9BA 4MW5A 1EUCA 3UTDA 4C01A 3WNCA 4CIBA 3VPFA 4M1KA 1W4RA 4BP8A 5E9JA 3JQPA 4M9ZA 5JUWA 2IYFA 1AZTA 2ISQA 2ZTUA 4OL9A 1Y8ZA 3ER8A 2EKDA 3FDFA 4JXKA 1L7BA 3KHKA 1G5FA 3Q8WA 4TXLA 1LS6A 2GEDA 2V7QA 1C4KA 3R0IA 4DSOA 1S2OA 1LBHA 4AKHA 2DR0A 3LQ1A 2GJSA 5F2KA 3RVQA 2ZS7A 1IOVA 3HACA 5E1OA 2NXJA 1OA0A 1P7ZA 3P2JA 2WAXA 3R77A 4P82A 2Y6VA 1KTVA 2PUHA 2PGIA 1S5PA 3S68A 2QTVA 3I1IA 3OJFA 4BQQA 3THOA 4BPBA 4YCMA 1QE5A 4UNIA 4FW9A 3ILYA 4ZGWA 4HQLA 3EVAA 4K6HA 3DHVA 3Q12A 4IIYA 1ZNWA 5LZ9A 1NG9A 1Q7CA 1ST3A 4PYRA 1GT6A 2OCIA 2YWDA 3FZYA 3GRYA 2GPBA 3B6EA 3ONNA 4OYLA 1DAMA 2XQJA 3OE1A 4ALIA 4FILA 2JGAA 2HLPA 3C6XA 3SYTA 4LNUA 3E27A 5FPQA 3E3AA 2PS0A 4I4CA 3VI4B 1B73A 2IXFA 4IDFA 2PLNA 3G89A 3WQSB 1CVIA 5HTOA 1AT1A 3D81A 4LF8B 4E5YA 3KC2A 3OCYA 2W5UA 5C5EA 4J0CA 1BE0A 4WD3A 1B4DA 2PQMA 4WXRA 2FJUA 3ANYB 3WGTA 4BX8A 2WQ7A 1UR5A 3CPEA 1KAOA 2ZU0C 3CLSD 2JGJA 3MCZA 1XHLA 1ZWLA 4G0NA 4KB5A 1T5LA 5ALLA 1YB2A 1XD2A 3I9V1 3MWEA 5DGXA 3AEQA 4IHQA 1USKA 4GLLA 1QF7A 3MVEA 5E6RA 5C7IO 3MD0A 3KZVA 5LNK1 4BWGA 5JSZB 1QTNA 2BSXA 3R3WA 4KWEA 4D44A 1GNTA 1UT5A 3VX4A 4RENA 3WKCA 2OG1A 1RE0A 2LCFA 1DUVG 4LBWA 4O3FA 5BT9A 4PNZA 1T3SA 2BJWA 2OWDA 3IMGA 1DINA 3IVMA 4U3JB 3HE3A 5FOTA 5HF9A 2FXIA 4UHCA 2IOHA 1LBSA 3I9OA 4JLDA 1Z8HA 4I99A 4MUYA 2IY8A 4W1PA 2VZEA 4BLPA 2IVFA 2UZ3A 4WV3A 3KEOA 4QM6A 4KLRA 1NLYA 3FFWA 3H9GA 4GPIB 1V41E 5EZ5A 4JXZA 3WDSA 2JGDA 1WD7A 3AL0C 4OPMA 1E3LA 2K6GA 3GGGA 3HCBA 4MUIA 5EGNA