2BBSA

Human deltaf508 nbd1 with three solubilizing mutations
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
283
structure length
253
Chain Sequence
STTEVVMENVTAFWEEGFGELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLRPDFSSKLMSFDQFSAERRNSILTETLHRFSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and dynamics of NBD1 from CFTR characterized using crystallography and hydrogen/deuterium exchange mass spectrometry.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Cystic fibrosis transmembrane conductance regulator
total genus 87
structure length 253
sequence length 283
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bbsA00
3CKLA 2QTFA 4TTRA 2RGNA 1G8GA 2VPPA 1H8HD 2OEPA 4PC7A 1KI8A 1C1YA 1KAOA 3EPJA 5K8TA 3UG7A 3LAWA 3OAAA 1P60A 4M9QA 3Q85A 2C8VA 1KO1A 2GF0A 3SYNA 4V02A 4PZLA 4JBYA 1B0UA 1DPFA 2IEYA 4JKYA 1TU4A 2G1KA 4GMXA 5HZKA 1G16A 3I1FA 4A1FA 2F6RA 2FNAA 4NKRA 3IKJA 1GFIA 1EG7A 1AKEA 1U81A 1VDZA 4HI0E 2IW3A 3FHCB 4NYJQ 3ZS9A 1JQJC 3IGFA 1QDEA 4AG5A 1WE2A 1IY2A 4LJ9A 3U5ZB 1NMYA 4D82A 4B3CA 1KJYA 2FFHA 4C0HA 2VH5R 4PC1A 1DEKA 4GDFA 4QGGA 1DAGA 3GEIA 3CRMA 4MDEA 4DDUA 3U3RA 3Q72A 2IS2A 2IEZA 3M0EA 4QKQA 1DS6A 3P26A 3P27A 1G8YA 1J7KA 1R0WA 4JSTA 3I4LA 2LWIA 3KJIA 3NKVA 3K53A 4PSVA 2WWWA 3PJRA 5F98A 3I92A 3IIMA 3MWJA 4Q7LA 2UZIR 1Z6AA 4NBSA 4A8JB 2W6JD 2BBOA 4G0NA 3QVVA 3CX7A 4HZIA 1II9A 2RGDA 4U02A 1KI1A 1TNDA 5SZJA 4PAOA 1MT0A 4ACBA 1RYFA 2LKCA 1P7CA 4DLSA 2ZRHA 5CJPA 2J7KA 2RHDA 3QEJA 5KNBA 2OZEA 5CLQA 1V5WA 1Z0FA 3U3MA 3EPKA 2QM7A 1N6NA 3AVTA 1Q1EA 4M53A 1L2TA 2EW1A 2QNRA 3EXAA 1FNMA 4D4JA 5HKKA 4GFDA 1IN7A 1AZSC 2HJVA 3L43A 5J47A 4B43A 3A8TA 5DH9A 1ZUIA 2D2FA 3T1OA 3CONA 1LF0A 1HT1E 1HH4A 1YR8A 1PUJA 2V55B 3P4YA 4FXPA 2C9YA 2JASA 2JJ8A 2WKPA 1S3GA 3QKRA 1NY5A 3GLIA 3EWSA 1EFRA 3NVAA 3QF7A 3W34A 4ERNA 3B1YA 2OCYC 4LBYA 3O8BA 4FWTA 2HLDD 3P1JA 3QKTA 5KHOC 1EESA 1G21E 3FVQA 1F48A 4Q7JB 2CJWA 2WJIA 3IO3A 2XB2A 4CEHA 5IT5A 2C99A 1W4AA 2ZANA 2FFBA 1E0KA 3WY9A 3FOZA 4IOMA 1G291 1FTNA 5HZHA 1A2BA 1XEXB 3IPXA 3G5UA 4M2LA 4BLRA 5L3VA 1CRQA 2CL6X 1NVVR 1TAGA 2CVFA 3TW4A 5L8VA 4YDSA 4IFBA 1OXSC 5FPYA 2O8EB 1OF1A 5JHGB 2G88A 4PQRA 2WTUA 3LH5A 1OKKA 3PEVA 3RC3A 2OCBA 1S2MA 4KJZA 5L3RA 1ZUHA 4L8GA 1E2KA 1ZCBA 1UF9A 4B6FA 2QGNA 4TYPA 2R8RA 2Q3MA 3M4YA 4LOAA 4W5HA 2FN4A 2ZI6A 1ZP6A 1M7BA 3HYTA 4KFTA 5AJVB 4AKIA 2AXPA 1EWRA 2HF8A 4URZR 1KMHB 1Z22A 2O8FA 5B2ZA 3T5DA 3WNCA 4B3BA 2H7VA 1IJEA 4PPFA 1TQ2A 1E9CA 3OEHD 2R6CA 4B44A 3B9PA 2KB0A 5EXSA 1CIPA 5AUNB 5FTJA 1KSGA 3SE0A 4O0MA 3O8RA 3NDBB 1DO0A 3GLHA 1MH1A 1M34E 1P2TA 1G8PA 4PAMA 4X8MA 2ONJA 3B1WA 5F9HA 3BXZA 2SHKA 2AR7A 1KOFA 1H8EA 1GL9B 2P5TB 2XSZD 3C7KA 3K8YA 3UKDA 5E3HA 1Z47A 2DWOA 2YV5A 4RD1A 4KHZA 3DKPA 4V03A 5JWHA 4FIDA 4HZUB 2V7QA 2CXXA 4Q9HA 1OB2A 1PVOA 1CP2A 2XTMA 2R6DA 1RPZA 3NWJA 3EARA 3GJ6A 1CTQA 1FPMA 3QI2A 2NPFA 5UKDA 3GD7A 5J4HA 4LV6A 2EFEB 4DLWA 1E9BA 1Z07A 2FSGA 2GNOA 4LBWA 3W8RA 1TPZA 3THXB 1VCOA 1OW3B 3SQWA 2JLQA 3LBIA 4KO8A 5FOWA 3VR5A 1FUUA 4Q7MB 2GWHA 4N0EA 2I1QA 1SXJB 2ZS8A 3SI7A 5D3QA 4CGZA 4CT4B 4GBMA 4BLTA 4PHHA 1GUAA 5JFGA 121PA 3CRVA 4MRNA 4ZO4A 2V1UA 1NLYA 2VP4A 2ORVA 4NDZA 1XMVA 2AXNA 2R6GA 3VR4A 4NYMR 4Q9LA 4LC1A 4B2PA 1TTTA 2AN9A 2RB4A 2JDIA 5H68A 2C78A 4W5WA 1OKKD 4HB2A 2B7BA 3C16C 3NBZC 1KI4A 4MRRA 1UDWA 1E6CA 5LD2B 3AKDA 4MGIR 1GZSA 3SBDA 1Z0IA 3PQCA 4Z51A 2UVQA 2OESA 1W5TA 4ZKDA 4RD4A 1GIAA 1P2UA 1P61B 3AKEA 2A9KA 2AL7A 5DGXA 5G40A 1JI0A 2NTYC 2CHQA 3PVSA 4DKXA 5KOYA 1R10A 4DC9A 2ZJZA 2C77A 3P20A 3PUVA 4GP6A 3ZLJA 2QPAA 3K70D 2ZROA 1VMAA 2JLZA 4JS0A 1NL3A 4EIWA 5FUWA 3A37A 4BFUA 3X1DA 3H84A 1ESNA 3RAPR 4KFSA 1QHHB 4KITB 2WSMA 3LA6A 2W0MA 4A15A 1UFQA 3DM9B 2OM2A 1IJFA 2RGBA 1BO6A 5B64A 4V0OA 3BFXA 1G4AE 2AD1A 2CDNA 2XSZA 2BCJQ 2O0HA 3U7EB 3CNOA 2CLDX 4JLDA 3BD9A 1OFUX 3MWLA 2DYKA 4R71A 1KSFX 3VR1A 5L3QA 1FNNA 4J0QA 1UAAA 4V0ME 1ZM3A 4N0DA 3RS3A 1AN0A 1ZBDA 1HE8B 2CLCX 3I32A 4KBGA 4RSGA 2BC9A 1J99A 1XEFA 4G5OA 4EJSC 2OO7A 2W00A 4B35A 1WBDA 3GJ8A 5FTKA 4II7A 2ZRGA 5A5GA 1VTKA 4POAA 2Q3FA 3L0IB 1FOEB 4OQNA 1G6OA 3K0SA 1ZD9A 4KVGA 4PO8A 3UANA 1E2EA 3GJXC 3DMNA 5LB2A 4OYHA 3PXGA 3TR5A 1Z0DA 3TAHA 1OFHA 1G5PA 4FMDF 2WOOA 1G7SA 1N6PA 1DAFA 2QMHA 2BMDA 2RAPA 1F2UB 4QC2A 4WAUA 3A6PC 4GL2A 1Q1BA 3BRWD 1EWQA 1IXSB 3KXLA 3SHFA 3QVUA 5KU1A 2BMJA 4UNQA 4TLCA 1RYHA 3K9NA 2R44A 2ZQ5A 1NG9A 3JVVA 3ZS8A 1WMSA 2ZRCA 4TL6A 1ZM2A 2WSSA 1E2QA 2XNDD 4C4PA 3ZVNA 2REBA 4HZUA 1E2NA 4CRWB 3B78A 1NN3A 3HU2A 1ETUA 2VP2A 2IWRA 3LD9A 3AUYA 4RZ3A 2I3BA 2G83A 3QENA 4NYMQ 4OI1A 1EFRD 2IYWA 1T8TA 2OFXA 2G0NA 1GKIA 2G77B 1KZGB 3RHFA 4F4IA 1DBSA 4MKFA 4FMCF 5JS8A 3HPRA 4D4LA 2TMKA 4IKEA 3TMKA 3I5XA 3IEVA 1QHHA 1ZJ6A 2GETA 3IUYA 4DVGA 4BRWA 4L16A 4A9AA 4Q4HA 3BB4A 5DI3A 4XWOA 1SGWA 3B60A 3U7HB 5L3SB 1BOFA 1TEXA 3U4QA 4MITA 3Q7QA 4IRUB 1I4LD 2Q21A 5A0FA 1KI2A 2PMDA 3LX8A 1NMZA 3TLXA 3GLGE 1N6KA 2FSHA 3CPEA 1F2UA 1W7AA 3IHLA 1T5LA 2A5FA 3DEFA 4LK2A 1Q0UA 3G0HA 3FB4A 3NHBA 2ZSEA 1RFLA 5DLQC 2C04A 5BN4A 4XSGA 4Q03A 5FOXA 4NHOA 3SR0A 1W36D 1J70A 1UBEA 1YVDA 2HYIC 2QE7A 4QGHA 2CLSA 4E03A 1G3QA 1A1VA 1XB2A 2HXSA 4KLZA 4D80A 4JVMA 2YWGA 3TVTA 4QJ5A 4CYMA 3FMIA 3MFYA 3NBYC 1GL6A 3HDTA 2XZLA 3B8HA 5FR2A 3GLIE 3AKYA 2F3RA 1BH2A 4TMKA 3KZ1E 3EC1A 2DFNA 2ZTSA 4HLDA 3R9IA 3UWOA 1T8UA 3QF4B 2W83A 1W0JD 1OYWA 1ZIOA 3C41J 3OEHA 4C9BA 3C5HA 3K0FA 1F2TB 1ZYUA 3IO5A 1SVWA 5FL7D 1T0JB 4BE7B 1SVSA 2HT1A 3BBPA 3RVBA 4LHVA 5EZ6B 4EDHA 2ZJOA 4Z8YA 3AEZA 4M1OA 2RGAA 2PZGA 4DEYA 3PUZA 4H1UA 2QT1A 2D7DA 4Q5IA 4CDGA 5A4JA 1NNEA 3NEYA 4P33A 5M04A 5DE3A 1DAHA 3KQKA 1YQTA 2P2LA 3O47A 4Y0VA 4WZAE 2ONKA 3KB1A 1QG2A 4A0GA 5JWRA 2C9OA 2YHSA 2XX3A 4C0AC 3EZ9A 4EQ6B 2N46A 2D7CA 2ZR9A 5AWFC 4KVAA 4P0TA 3VX3A 1ZU5A 1ZAKA 4DDWA 3X1WA 4JLNA 3SDZA 1XMSA 2C2HA 1N5IA 1NN5A 1L7VC 4OHVA 4DUGA 3R8CA 3RNLA 4PC2A 4FMDB 4CIDA 1T5IA 4XIGS 2AX4A 1YZLA 3TSWA 1XF9A 3AF0A 3UIEA 2ZREA 4TTPA 3DZDA 5L3SA 5JI3E 2WJHA 5CIWA 2OT3B 1WBBA 3T15A 1VCIA 4OI4A 4EFLA 3MWYW 4Q1FA 3SFZA 2IS1A 4FN5A 3Q3JB 1W4BA 5FBVB 1QG4A 3X1XA 1D2MA 4NH0A 2YINC 3U3KA 1CR2A 4NL4H 2ZE5A 4AIIA 3EZ7A 4EAQA 1FZQA 4QNMA 1VHLA 2R9VA 3NG1A 3PR1A 4DCNA 4KI0A 3GLGA 2KJQA 2YOFA 4N3NA 2F7SA 2FJUA 2WJYA 2IYZA 2DR3A 1G8FA 4LJ7A 3K0AB 2QQEA 2REOA 1X8KA 3BFKA 1YZNA 2J9RA 1VYVA 3UPUA 2ZSBA 1U0HC 1R0ZA 1KO7A 4FCVA 4RD3A 5KDLA 2ANCA 4EPRA 4G01B 2RGNC 4MGYR 5BWMA 1KJWA 3IQWA 3BOSA 4AI6A 1ANKA 4QRHA 3QKUA 1P75A 3KQHA 1T3SA 1SKYB 2E9SA 2QAGC 3KJGA 3KKPA 3QKSA 4D0GA 3UMRA 1EGAA 1OV4A 2AD5A 3D3QA 3HR7A 3ZVLA 5EJEA 1R5NA 2ZSFA 4MGZR 4WIAA 2FSFA 2O8DA 3VQTA 1UEJA 4FWIB 3LV8A 1RVDA 3LVQE 1TQDA 2RH5A 3U7GA 3LXRA 2P5SA 1Q1ZA 4LZZA 3OIUA 4TYWA 4TSFD 2RGXA 1N6RA 2OBMA 5SZKB 2CCGA 1Z08A 1N6OA 4ZV4A 3R20A 3W5IA 3QG1A 3GLFB 1FMLA 4KAXA 1WA5A 3BIFA 4D6PA 4YXWD 2CL7X 2ZE6A 1HV8A 4YONB 3KQNA 1YZKA 1Q3TA 2YJTD 1MABB 1VCMA 1R8QA 3EIEA 2F9MA 3DOEA 1OT3A 2J0SA 5IK2A 2VP6A 3KFXA 3OE7A 3PEYA 4F4JA 4CEIA 1RKBA 1X3SA 2QU8A 2DHRA 4R2HA 4ZCMA 3TRFA 4EPTA 2IS4A 4DCVA 1WCV1 4Q9JA 2IUSA 3FKQA 1JJ7A 4NCKA 2OFOA 3U7FB 1G4UR 2Q9BA 2IXFA 4E22A 1KI6B 1MOZA 1D9ZA 4MH0R 1BMFD 1XTKA 3NIBA 3CM0A 2GEDA 2JGNA 1PZNA 4TQ9A 3K70C 3HP1A 1N5LA 1WQ1R 3ZIAD 2J0QA 4YMTA 4LY6A 2GA8A 4B2LA 1YRAA 1M7HA 4X8LA 2VEDA 3NBXX 4PX9A 1LV7A 2IF0A 4XD7D 2ZVPX 2VHJA 4B32A 2WWYA 3PUXA 3BAFA 1SULA 2GAAA 2FMXA 2J41A 2QTVB 1QF9A 1ZNYA 4MRPA 1Z0JA 2JJ2A 3RRMA 2NO1A 4QG7A 1G5RA 4DB2A 2VP0A 2FF7A 3JZAA 2OV2A 4KFUA 5TB5A 3VHLB 3BERA 4DCUA 1KI3A 2W2TA 3QKRB 2VIIA 2GXUA 2L0XA 4E07A 4FI3C 4FMCB 3ADCA 2PBRA 2IYSA 1Q12A 2PLRA 1K8RA 1OXUA 2GZHA 2IF2A 4WBSA 2RKOA 4BLOA 1XJ0A 3VKGA 4KODA 3AVYA 4ILEA 3I61A 3B85A 1SHKA 5F9FA 1ZD1A 1U0LA 4RCYA 4PHFA 4Q4LA 5AUPB 2CCKA 4A6XA 1OE0A 1H65A 5K8UA 2IYYA 3K09A 4RZXA 4DLYA 2OCPA 4Q01A 2EWVA 1SHZA 4HAVA 2A5GA 2KWIA 5EZ5A 4EJSA 2W58A 3J81k 3RSOA 1Z6GA 2QG6A 4V0LA 2FGKA 1Q22A 4ASUA 4PFSA 2ZIAA 2O8CA 5JS7A 5DN6D 2A78A 3SU8A 2QM8A 1KI7A 3IHWA 2QA5A 1E99A 3WYAA 3EZFA 4O2RA 4DLXA 1IXZA 3ECCA 3LWNA 4QHYA 1HA3A 1XTQA 2O52A 2CNWA 4DSNA 1AIPA 2BBSA 4NU0A 4OQXA 3VKWA 2OAP1 1CJKC 2HCJB 1JALA 4PZYA 1HQYE 1I4DD 2CE7A 2GCOB 2JA1A 4K81B 5JEEA 1R5BA 3R9WA 1M7GA 1AA9A 4KYIB 1RJ9B 2ZE7A 1LS6A 2NGRA 4M8NE 4OL0A 3FKSD 3AP1A 4Q1DA 3RSLA 3AVUA 1E1RA 2ZI9A 1EFCA 3THYB 2AFHE 3X1ZA 4KXFB 1XTRA 4P31A 1W44A 3T06B 1KMQA 5E7JA 3BC1A 4LPSA 1D5CA 2VRWA 3N70A 4C0SA 5JSZB 4A92A 4KFRA 4RKFA 3RANA 3GJ4A 4DT1A 1R7RA 2J7PD 1J8MF 4YMVA 4JLPA 4A82A 1P5ZB 1E0SA 1QHIA 2MMCA 1W49A 2X77A 4L9SA 3T61A 1SXJD 3BB3A 3LO5A 1GWNA 4D0LB 4RD0A 1SVLA 1Z6YA 2G0TA 2BKEA 1F60A 2J59A 4KSCA 5AJZA 4DSOA 3BJIC 3GFPA 1CR1A 1KK3A 1CRPA 3CWZA 3EIHA 5DN6A 1ZNWA 2WJGA 5EXXA 3ETLA 2H57A 4HAYA 4HUQB 4QBFA 5EXPA 3NXSA 5K8LA 3FE2A 4YMWA 5G53C 3AV0B 1CLUA 4LJ8A 5DHAA 5DHFA 4I4LA 4URWR 3KKMA 3TSZA 1NLFA 2QQ0A 2EU8A 4AKGA 3E70C 2BM1A 1WB9A 1EFUA 2ZETA 1OH6A 4EFMA 1R0YA 3W9YA 2F1HA 2BIFA 2QY9A 2ZRBA 4LV5B 3R9XA 4JVSB 1HT2E 3ASYA 3WNDA 3A36A 1U9IA 4GRAA 2BMEA 2W6JA 3K0CC 4F91B 2FV8A 4NP6A 4Q1EA 5EP3A 3SYKA 2B92A 2VL7A 3CH4B 1E4VA 3K9GA 3REFA 3MLEA 4Q00A 721PA 1G41A 5CJ2A 4B75A 4Z1MA 1VECA 2QMUA 1W2GA 1ZVQA 3QF4A 2IYXA 5G3ZA 1I2DA 2EYQA 1FQKA 4B6EA 3EWAA 2OXRA 1OLOA 3W8NA 1E9RA 1OYYA 4OHWA 2ORIA 1AKYA 1Z6XA 3QSYA 1KI9A 1NSFA 4TWZA 1E94E 2R6FA 2GESA 3S1AB 2ERYA 4Q7KA 1JXMA 2GJSA 5F3WB 3BH7A 1GKUB 4JLJA 4QXAA 2OFWA 8OHMA 1IQPA 5KUTA 1RW4A 4RJLA 3FMOB 3EPLA 1UBCA 2OE2A 4ACAA 4BQSA 4OQLA 3DOFA 4DEXA 2QMEA 4QBIA 5BQ5A 5CDFA 3EZ2A 5FUVA 4G3XA 1KK1A 3NH6A 4M22A 5HTKA 2YZ2A 1GKYA 2VBCA 2XTNA 1KY3A 1DAKA 3QIAA 3ICQB 1KO4A 2X8AA 1YR7A 2HJGA 1S9DA 1X8JA 4A0HA 1P4SA 3FMPB 3JVUA 4B47A 4HAXA 2ZRNA 2FEOA 1XX6A 2V7QD 1E2HA 2CNWD 2Z0MA 1DG1G 2OXCA 3KUCA 4LBZA 3PUWA 1GRNA 4WA7A 2WOJA 2XEXA 4MDFA 2NQ2C 4IVRA 1XTIA 3VTKA 3Q5DA 2BWJA 1PLJA 2V1XA 5FFMA 1GG2A 1E9EA 5C2JB 2VTKA 3GJ7A 4B74A 1W1WA 3TR0A 2D06A 5BXQC 4G5SA 4ZI3A 3L8YA 1AM4D 3PG5A 2QP4A 1NKTA 5FTNA 2ZU0C 2GJ9A 2GCOA 1E98A 4US2R 4AG6A 2YWFA 4A6PA 2ZJ8A 1E0AA 1JXOA 3Q7PA 1KO8A 5FPHA 1G9XA 2XNDA 2HT6A 5LBIA 2Z4RA 3RRYA 3RWOA 2ZRFA 3ND9A 4I1OA 3D7MA 4DLTA 3KXKA 2WKRA 5FBRB 2QROA 1OHHD 2BMFA 1E9SA 2YVUA 2WVJA 2G9NA 5KDOA 2O8EA 5AJXA 4WVFA 2DPXA 2AKYA 2HF9A 4QFMA 5FTMA 2O8BB 2E87A 2FFAA 4JSYA 2WM9B 2WWGA 1CJUC 4HDOB 3GLHB 5KPDA 4DLRA 4JL6A 3LDAA 4F38A 3S1AA 5HR5A 1II8B 4LJYA 1WP9A 2PT7A 4IHQA 3L8ZA 2FA9A 2O0KA 4XOIA 1P6XA 2FEMA 1OB5A 2ZYTX 2DWQA 4M21A 3E2IA 4MKIA 4W7SA 2IYQA 2IT1A 4P4SB 4F7WA 1P73A 3LVRE 3W90A 3EAQA 3HU1A 4P4UA 5J4KA 4ZIRA 1WDTA 1GM5A 4O2LA 3AF4A 5E95A 4TL8A 4HAUA 1R0XA 2H92A 3DM5A 2GJ8A 1JAHA 4YQFA 5B57C 3THXA 4Q4JA 4BASA 3ICEA 2IS6A 2CBZA 2IYUA 3CO5A 3H2YA 3AGPA 1KDRA 1ZRHA 1FW6A 2ZJ2A 2GDJA 2PX3A 1C9KA 4A0RA 1RIFA 4Z1MD 1SVMA 2ZAMA 1W4CA 2VYFA 1NIJA 4B73A 2ZAOA 5FBQB 1XEXA 5IF9A 5JEDA 2FDCA 4AKHA 3SC3A 1W5SA 4PAQA 2XB4A 5FOTA 3W6PA 2IYLD 5EE1A 3TW8B 2O0JA 3AB3A 5GADl 3NH9A 1SKQA 1YR9A 3ZZTA 4B3GA 4JT4A 4IDNA 1GTVA 1XXHA 2OAQ1 621PA 4TYYA 5CB6A 2RCNA 1WRBA 2WZQA 3AVOA 1LB1B 2QSYA 4M1TA 1M2OB 5TVKA 4US1R 3TK1A 5JCPA 1Q1QA 4BFYA 1IONA 4RZ2A 4KYUA 3OIVA 4IJMA 1F6BA 4JLVA 2OILA 4UKDA 1COWD 1G3IA 3I62A 1G17A 3BWDD 1JR3E 1Z28A 2EVWX 3B2EA 3AUXA 3K09C 2OG2A 3TVDA 3FHOA 1MR3F 5LD2C 5FOSA 5EUMA 2GKSA 5JSZA 3QXSA 2W6IA 3MSXA 1VCNA 2RHMA 2ZRJA 4WZ6A 1R2QA 4UJ3A 4DSUA 4JBWA 3DO6A 2Q6TA 2X2EA 2W2VA 4JIMA 2VA8A 3FMFA 2C96A 1KJZA 3IDQA 4KSBA 4RFSA 2ZR7A 4UXHA 2ZYWX 3W3ZB 4C0JA 3T1QA 4CW7A 4BFTA 4PQYA 2VP9A 4I99A 5JRZA 2QBYB 1CBUA 2ZRAA 4DDVA 1NG1A 3QG5A 2GRJA 3MRSA 821PA 5BN3A 2FU5C 3KQLA 4D4KA 1J2JA 3BK7A 2FFQA 3CF2A 3EW9A 5FI1B 1NIPA 3KTAA 4TTQA 5EE3A 1Z8FA 1PJRA 5D3MA 2WV9A 3P4XA 4Q4JB 1QHSA 4NCNA 4XWKA 4AY2A 3F3YA 2FPLA 4EJSB 2JLYA 2F43A 4TMWA 2XJ4A 3D6TB 3GEHA 4R98A 1BMFA 1XBTA 4B3XA 1IN8A 2ASEA 4FD2A 1EK0A 1U98A 3UMSA 1OH8A 3HPQA 5KSOA 2ZM5A 1XTJA 1FX0B 4C2TA 2YC2C 5HKKD 1KNXA 5IK2D 3MG9A 3BE4A 1S8FA 2J45A 2A30A 3HJNA 4UJ5A 4B33A 5EP1A 1OHHA 3ASZA 2IYTA 3GQBA 4RD2A 1SZPA 1EFHA 4PPGA 1IY1A 3U3OA 1R5OA 3WBJA 1QRAA 3HU3A 3GJ0A 3ONWA 4Q1BA 3SJAA 1AS0A 1FUKA 4Q02A 1L8QA 4TT3A 3SOPA 1TL7C 2FZ4A 3FPAA 4JT2A 4GP7A 3CB4A 3HR8A 4U7DA 2JDID 2ZYUX 2D3WA 4B48A 1V43A 4BLPA 1XJQA 1BIFA 2IX3A 3AF1A 1BS1A 4LX0A 2EFHB 4GOXA 2RGEA 1U2RA 3FFBA 2FX3A 4PPQA 4Q18A 2J1LA 3WRYC 3CWQA 3CF0A 2CJWB 4PHGA 1E2JA 1E9DA 3CRQA 1KYIA 3PITA 3GJ5A 3DMDA 2V3CC 1BKDR 3FTQA 4YMUA 3GFOA 1JPNA 2ZUBA 4HATA 4Z54A 5JRJA 1N6HA 5DO9A 2QT0A 4OHXA 1D6JA 2QGZA 4Q1CA 2JCSA 2OBNA 3NEJA 3B6EA 4BFVA 2BHRA 4BLSA 1Q20A 1FX0A 3TH5A 1TADA 2J5XA 5C18A 4DCSA 4AK9A 1RRPA 3OZXA 4IDPA 2IXEA 1G7RA 4LBVA 1QBKC 3TQFA 4PC3A 3RYTC 4GZLA 3HWSA 3O8DA 4JYBA 4K8OA 3LLUA 2VSFA 1UJ2A 1KMHA 4Q1AA 1RZ3A 2V6IA 5E4FA 5J4VA 3PENA 1ZU4A 4WW0A 3MCAA 4MUBA 4OK3A 2HCBA 3CPJB 4ZDKA 1A7JA 1X8LA 4GOJA 1SVKA 3TQCA 4ABYA 1QZXA 2F43B 1E3MA 5JJIA 2QZ4A 1S1MA 5E7IA 3VFDA 3TIFA 3T1TA 1QHGA 4LYAA 1KGDA 4C7OA 2J0UA 4GSYA 4I81A 1Z63A 2QI9C 2Z83A 3ZGXA 2P65A 5D3MB 1X6VA 1E2PA 3C14C 4M0LA 5SZIA 4QBGB 4LJ5A 3O8CA 1CF4A 2NPIA 1XNJA 4NTZA 4FCWA 4ASUD 2NO6A 4A0FA 5JBQA 1KK0A 3RS7A 4B71A 4TYNA 4JYCA 2RGGA 1EX6A 3K0CA 2CHGA 4IDOA 2ZRDA 2JAQA 1Z2AA 1T4GA 4PO9A 1Z3IX 1K5GA 3WRXC 4CZ2A 2RGCA 4N1AA 2ZRMA 3AKCA 1E2IA 4RFSB 2IHBA 2QL6A 1T0HB 2NO0A 3QE0A 5H8WA 2EFCB 4TLAA 5C4MA 3WMFA 2WPDD 3RRZA 4LJ4A 4MYUA 3SJZA 3W6NA 2F1IA 3RS5A 5C1BA 4MRVA 2GXSA 4OQFA 2F3TA 2WBLC 3EA5A 521PA 2GXQA 4GOKA 2BJVA 1F2TA 2BM0A 2H18A 2ODWA 4B34A 4A8JC 1DARA 3X2SA 3F0TA 1LVGA 4NCIA 5FH9A 1KKLA 2PEYA 1J90A 1XCPA 3ZZ0A 3RABA 4QJ3A 3W3AA 4Q4AA 2QUZA 1Q21A 3TUIC 2N42A 1FP6A 5BW8A 3THWB 3LQRA 3RDPA 2HLDA 1W0KA 3KKQA 5FL7A 1E2GA 4PHTA 3UMFA 3T35A 1JJVA 5GVRA 1UEIA 4DJTA 4HAZA 4M9XA 2QE7D 2V54A 2C5LA 3BFVA 1KTVA 2YOGA 3MD0A 4PSKA 2ANBA 5E7MA 1E32A 1ZM4A 4FINA 1ZM7A 1T3LA 2ZUDA 3Q9LA 3ZVRA 3A58B 3E1SA 5EUQB 2GVDC 2A5DA 4JLBA 5FI0B 5KNDA 1PLLA 5J4LA 2VF8A 4WOPA 1IN6A 3LXXA 5KYKA 1GRQA 3AGQA 1GOTA 4IVPA 3UXMA 5FPKA 1XD9A 3A1SA 3CF6R 3KKNA 1OIVA 3V4FA 1E2LA 1CU1A 2PX0A 4RD6A 4HLUC 3A1WA 1I4TD 1KHTA 1JPJA 2FSIA 2KE5A 4EPVA 2J7PA 4P32A 1U94A 5ANRB 1LTQA 3EC2A 5EXTA 1NBMD 2YWEA 2NZJA 5DSZA 1K5DA 1Z06A 4DZZA 4HUTA 1NN0A 1WF3A 5JI2E 4DIDA 1IN4A 3TUZC 3VU9B 3W5JA 2GJAA 3VNUA 1IOZA 4YMSA 3SZRA 1OSNA 5L3QB 4LHZA 2O8DB 4NYIQ 1IAQA 2IYRA 1I2MA 5TXGA 2J87A 1AGRA 2KI5A 4BFSA 1DOAA 4D0NA 1U8ZA 3NC0C 4D4MA 2MSCB 3D8BA 3IILA 1PLKA 1FP7A 3PIRA 2GK6A 4TQAA 1W0JA 3FWYA 3EZ6A 2JJ1D 4HUQA 3DZ8A 1AS2A 4LDJA 1U9IC 4BWYA 2WPDA 1N5JA 1YR6A 4HB4A 2B7CA 3THWA 5C46F 4QOSA 5AUQA 3OESA 1W46A 2WMOB 4ZCLA 5DNYB 4URYR 1E1QA 4G5RA 4Q4HB 3CRW1 1NKSA 1GAJA 3RS2A 1ZNZA 4WZBE 1GVNB 1LFDB 3CH5A 4CEIB 4AC9A 4A4DA 2AWNA 2Q3HA 1XPOA 1LY1A 4B76A 5JLJA 5K8IA 5TDHA 2BDTA 4KV9A 1S1CA 4EKDA 2N1BA 3R7WA 2OLKA 1Z29A 1B23P 3PCRB 2Q0HA 1FQJA 1X86B 2QAGA 3SQXA 4BPBA 1O3YA 1N5KA 1M6NA 5EP4A 4HDCA 2ZVQX 2AKAB 3C8UA 1VIYA 3IBYA 4D2IA 3NC1C 4QHTA 4JLMA 3NBFA 3TBKA 3GLIB 1JEDA 4AYXA 1R4AA 1CXZA 1ZC4A 2K5UA 3VNVA 1L4YA 2EFDB 2I1VB 4LHYA 4MYHA 1NLZA 1HUQA 3VR6A 1VYUA 2VHCA 3TE6A 4D25A 5CYOA 3TNFA 4URVR 2ZI5A 3OAAD 1CR0A 3WYGA 3KTAB 4URUR 1LW7A 2OBLA 2DY1A 4Q9KA 4A36A 1GNRA 4LCBA 1MO4A 2X19A 2ZI7A 2GCNA 2A5JA 3A1TA 2XXAA 4BZPA 4Q48A 4HSEA 1BYUA 4UNRA 1OIWA 2YNMA 2IBMA 4C30A 2ZI3A 1XDBA 2IXGA 4L15A 3KXIA 2DFTA 3PEUA 1XD8A 4JZKA 4MRSA 2JIZA 4OQMA 5J5CA 4YDHB 1G7CA 3GFTA 2CK3D 3LFUA 1N0UA 2YYZA 2QBYA 5TARA 2ORWA 4BEJA 3ZYCA 3SS8A 2Q9CA 2D62A 3SBEA 3OF5A 2A3RA 4IOJA 4D81A 1N0VC 1G7TA 1HQCA 4TN1A 4EPWA 2GBLC 5KSYA 3I3SR 3KUDA 5HCNA 4X8OA 2NIPA 2J0UB 2BVNA 5AR1A 5GJBA 3K0FB 1AQUA 1VG9B 3MUFA 1NVXQ 2P6NA 1G3RA 3KJEA 2WHXA 4DDTA 2WMNB 1CJMA 1DAMA 2AFIE 2JLRA 3I73A 5EE9A 2VSXA 4PTLA 3EA0A 2IWHA 5KPJA 4M1MA 3LBHA 3H0KA 5JMTA 1ZD8A 4OHZA 3PEWA 4TQUS 1Z2CA 2WIBA 1YZGA 2ZU6A 3KJHA 4YXWA 1UM8A 4XTCS 2JJ1A 5FL3A 5G3YA 4B2IA 5B30A 1G3MA 1H8HA 1G19A 2ZRLA 3B13B 4TLEA 1IBRA 1N3BA 1W2HA 3BORA 2OLJA 4EFNA 2WWFA 1UBGA 3BS4A 4PR0A 4UNNA 2P6UA 3U61B 3QXHA 2HUPA 4IOLA 4OI2A 3RRNA 5LPNA 3GCGA 2CK3A 2O5VA 2DBYA 2ZXUA 2Z4SA 3QXJA 1COWA 2FH5B 2HEIA 3NHAA 1XMJA 4CT5A 1VG8A 1XEWX 2ODBA 2A7QA 4UQOA 2WIAA 5EQTA 4LHXA 3UG6A 1NMXA 4BUJA 1T9HA 1SKYE 3DDCA 3A4NA 2FWRA 4L4UA 1S3SA 4V0MA 5C4GB 3SEAA 4F4CA 1UDXA 5FPSA 3A4MA 4OK5A 3L2OB 5KNCA 2CE2X 4NMMA 1SXJE 5DIFA 1DELA 2FG5A 2ZJAA 3QBTA 4ITRC 4I1UA 2ATXA 5CLLA 1U8YA 2ZRIA 3AF3A 5AUOB 2R65A 1GL7A 1ZC3A 5BN5A 4D26A 5HE8A 3R7WB 4DLUA 2W2XA 1OXTA 4KCGA 4X8HA 3CIOA 4XVQA 1E96A 2ZS9A 5CB8A 1JQLB 2YKGA 1X1RA 4TL9A 4DSTA 4M9SA 1TMKA 4AKEA 1T6NA 3CRRA 3LY5A 1CR4A 4PSAA 4GT1A 2IUUA 1P9NA 1TUEA 1UPTA 4BECA 2XNSA 2GCPA 4UXJA 5CDFE 1EX7A 2FZLA 3BB1A 1XPUA 4R7ZA 3QQ5A 2C03A 3FDIA 3CX6A 4BZXA 4ZDIA 3K0AA 4LJAA 2Z5FA 1Y63A 4ZI2A 2ZPTX 5DI3B 3RWMB 4CEHB 4WXPA 5J40A 4JLAA 2NOAA 3GLHE 3DHWC 1XXHE 4EPXA 1ODFA 1KAGA 4AYTA 3P32A 3FHTA 1DO2A 4ARZB 2R6AA 5AJYA 4FW9A 2KSQA 3H4MA 2VSOA 4MYTA 4Q19A 1R8SA 4DUGD 1P9RA 2OCAA 3THYA 1DTSA 3L0SA 1Z5ZA 2EFGA 5FBWB 3CZQA 3IBGA 2ZSAA 1U0JA 1GP2A 2IHYA 2GVZC 4H9GA 5LB4A 5KDDA 4DB4A 5ELXA 1W47A 2B6HA 2NZ8A 3IIKA 3QEOA 4OBEA 2PH1A 1E79A 4G5GA 1HURA 3ZJYA 5GVSA 4Q4AB 2GTPA 3KX2A 4I1VA 3H1TA 5CK5A 1W48A 2QORA 5JHHB 1DAIA 3QPVA 1CJVC 4ON9A 4OKSA 1HTWA 2J0VA 3QKSB 4BRUA 4DIEA 1XCGB 3PV0A 2MSEB 2XGJA 2JLWA 1RRGA 1P2SA 1VPLA 1YKSA 1G5TA 2H8KA 3OIWA 1M8PA 2QENA 3DVLA 1YJ5A 2H16A 4R9UC 2G3YA 2YC4C 1FL9A 3WYFA 2VLIA 2HXYA 1P62B 3VAAA 4OI0A 1XEWY 2C98A 1ZW6A 4C2UA 4CEJA 3F8TA 4TZ6A 2H5EA 4QGFA 3T34A 1W36C 2PCJA 3GLFA 3LBNA 2QP3A 4G5QA 2WJVA 1S0UA 1W0KD 2P6RA 1MABA 1S4QA 5B58C 5HCIA 3L0OA 5CITA 2BKUA 4MYCA 5J4YA 5FPTA 5BYKA 1NI3A 4MGKR 4Q66C 4M1SA 4JKIA 2JJ2D 2PL3A 2H1LA 4M4SA 3U44B 2Z6VA 2Z43A 3LW8A 3V4RA 4TSFA 3MJHA 3SFVA 1U99A 2JLUA 1JR3D 1S9HA 2BEKA 1TEVA 3QJYA 3QPUA 3U3JA 5FOVA 4P4SA 2BBWA 4MKHA 2VHQA 3NTUA 4ZDWA 3ADBA 2FE4A 4EPYA 1IY0A 1F3OA 1VYTA 5DI9A 3B1ZA 4ARZA 2ERXA 1E4YA 3QPWA 3AH8A 4V0KA 1QHXA 4DCTA 6Q21A 2PZFA 2Y8EA 1JECA 4LYFA 1P9WA 1E2FA 4U00A 3WNBA 1YZTA 1GRRA 2YOHA 1UKVY 2CMKA 1E2MA 3FYHA 3U6BA 4Q21A 1VHTA 4LI0A 1XZPA 4DRZA 1VG1A 2HDNB 3T5GA 2LCFA 5BYJA 1HE1C 3A4LA 4PQFA 4RKEA 4S2EA 3SYLA 4A8JA 1G6HA 4ESVA 2CEAA 4LC0A 4LV8B 4M9ZA 4JJZA 4P3YA 3E5HA 1E0JA 4US0R 5SZHB 4DLZA 1N0WA 4UNSA 4ZIRB 1MO3A 1RJ9A 3ADDA 2HYDA 1OJLA 3D31A 2QAGB 2ZRKA 1TUIA 3AVVA 2QEQA 3B5JA 1Z6TA 1II0A 1ZMXA 3KB2A 1AZTA 1JR3A 3K9HA 2XXAB 3FKSA 4YC7A 4IEIA 1Z0AA 1QVRA 2V9PA 3VHXA 2P3SA 1E1QD 4BEBA 2NO9A 5CYPA 1H8ED 1NVWQ 2GAOA 2ZJYA 1KSJA 2JLXA 3K9LA 4AYWA 1LS1A 4OJQA 4QM6A 2BCGY 3BH6A 4FMBB 1MO5A 4RZUA 2FPKA 4RFVA 1XMIA 3B1XA 4MQBA 2PEZA 1DE0A 3B1VA 3CNLA 2BV3A 2D74A 4GPTA 4F92B 1XFAA 4Q9IA 4IEEA 4HB3A 1XJCA 2W6ID 4TMVA 3SJCA 3ZIAA 4DXAA 2GF9A 4NCHA 2XITA 2F1JA 4E5UA 3U4QB 3ZQJA 3H86A 2AK3A 5FOUA 4CF7A 2GEVA 3GMTA 5AJWA 2ZJ5A 3I8SA 2R62A 3SNHA 3UWKA 4DWJA 3N5CA 1G64A 1NRJB 2JATA 5H1YA 2VQSA 4BZQA 1OH5A 3A1UA 5F2EA 2XTZA 1NJFA 4UNPA 1JAIA 4AWXA 4CVNA 3CR8A 1JB1A 3ZD7A 3TGPA 3IPYA 3QNUA 1N2CE 1XTSA 2Q9AA 5DYIA 3QXXA 1A82A 2UKDA 1OFIA 3DPUA 1E9AA 1GSIA 4Z8XA 2XOKA 1W4RA 3IQXA 2OHFA 5EE5B 1MO6A 4TLBA 4TLDA 3ZZUA 1CS4C 1DADA 5IHPA 2GXAA 5JCZA 3KQUA 1NY6A 3GEEA 4MKGA 4NCJA 3B9QA 2J46A 3PFIA 4JJKA 1A4RA 4NYIR 1LF5A 1RC8A 3AM1A 1PV4A 1KI6A 4NONA 3RLFA 3AVPA 3U6KA 4OJKA 2PCLA 5FUXA 2WKQA 4JL8A 4BGDA 3MJRA 1D8TA 3QUSA 2J3EA 3AF2A 2OSBA 3CUEF 3SJBA 4M1KA 5IRCD 4E09A 4ZCIA 2FGJA 3C5CA 5FBLB 1US8B 5JECA 3I5YA 3QBVA 4EQ6A 4UXIA 2PZEA 4IDHA 1GDDA 1G20E 2AK2A 2JLSA 5CM9C 3VR3A 1KDOA 5DYGA 2B8WA 4RY2A 5TMPA 2G6BA 2B8TA 4HAWA 1VKJA 1YE8A 5JJKA 1TF5A 5FR1A 4R2IA 1RRFA 3KL4A 1QVAA 3R8FA 4W9MC 1KY2A 1N6LA 4DHEA 5AK0A 4XTRA 3GLFE 1XU4A 2XZPA 421PA 1ZIPA 3EASA 2PT5A 1QHNA 2P67A 1E79D 4IFEA 4RCZA 3RS0A 3ZDQA 1HYQA 4BFWA 1KO5A 3UATA 2QTHA 4OHYA 1CEEA 4PPNA 2ZJBA 4QNRA 2G1JA 4C0QC 3X1YA 2WICA 3K70B 2ZUCA 4EUNA 1KDTA 3TKLA 1NVVQ 1FFHA 3HYRA 3ZH9B 1SXJC 1GITA 2PJZA 3IEUA 4TT3D 1GILA 2QMOA 3RS4A 4LYJA 2V8OA 2JIZD 1OIXA 1G3UA 3ZVMA 2KBFA 4KU4A 2F55A 2GILA 2NG1A 2IA5A 1E69A 3U60B 3LNCA 1T3HA 1LNZA 4IW3B 5JWOA 4GNKA 1O87A 2VP5A 1M74A 4DT1B 2DCUA 2DB3A 4LWZA 1AJEA 3AP2A 4LYHA 4PZZA 5CIQA 4G1UC 5EE0A 3QOFA 4GMDA 4A2QA 1K6MA 4ZPXA 1IN5A 1E2DA 1KIMA 1XZQA 1Z0KA 2B21A 2V4ZA 1UKEA 2GK7A 2XJ9A 5FUYA 3U2QA 1XCMA 3U44A 2WAXA 1Q44A 5IDVA 4B3FX 1NVUQ 2MSDB 3Q8XB 5CM8B 2QPOA 3CPHA 3DL0A 4HLQB 1NN1A 4NPHA 5TY0A 2WJJA 2PMKA 3MMPA 4MUAA 2EYUA 1FMJA 1TX4B 2QN6A 3CLVA 3OEED 2EWWA 4LPKA 4KLNA 5GJVC 3UK6A 2ZEJA 5P21A 1II8A 4H1VA 2VF7A 4B3DA 1NSTA 1R6BX 2ODEA 1AK2A 4HB0A 4XVRA 3C15C 4HEJA 4XWAA 2XAUA 1YRBA 3WP1B 2HV8A 3GP8A 4C0LA 4TL7A 1RRCA 2PJRA 3OHMA 4LHWA 1D2NA 4O25A 1KNQA 2CL0X 1WXQA 2MMGA 4P4TA 4WXRA 1IM2A 3MWKA 1G1MA 1TQ6A 1A2KC 3KDSE 4CEJB 1NF3A 2DWPA 1CKEA 1HY3A 4I1SA 4QM7A 2BOVA 4L9WA 2A5YB 4F93B 1YU9A 3L82B 5KTYA 1KDPA 3T12A 3F5FA 4Q47A 3GLGB 4W5JA 3FFAA 1AQYA 1HEIA 1GNQA 2DFLA 4C7OB 1YZUA 4JMPA 4RVCA 1NBME 5G41A 2ZR0A 3N2EA 2KBEA 2QPTA 3ND8A 3AVQA 1NJGA 2REXB 1P3JA 2UZ3A 3QY0A 4QJ4A 2EQBA 2QP9X 3BGWA 1S96A 3B82A 4HLUA 1KZ7B 3VMFA 3EX7C 4MA4A 3CR7A 3KKOA 3WHKA 4URXR 3TUJC 4NE2A 3IIJA 2DFKB 3CBQA 1OH7A 4DLVA 2C95A 4AD8A 2IYVA 1TU3A 2D4HA 1F5NA 1TF7A 2H17A 1ESMA 2YWHA 2WAYA 3BH0A 3OIYA 4NZYA 4BFXA 2RMKA 3K0EA 3ZD6A 2ZRPA 4C3ZA 4OK6A 2ZI4A 3NDPA 1SVOA 1XPRA 2BJWA 1G8HA 3V00A 1UADA 5JJLA 1CJTC 5DISB 3SN6A 1DG3A 2CCJA 3WMEA 1VG0B 4BFZA 5GJCA 4ZKEA 3AVXA 3N2IA 3I8XA 1EXMA 1XD2A 1TQ4A 1RE0A 3CW2A 4PO1A 3TSOA 1KKMA 3M6AA 4XH9B 1E9FA 4TMTA 4JBXA 4LGMA 3G82C 4O3MA 1MKYA 3AQ4A 1OXVA 2PLFA 3AP3A 2NO7A 2IC5A 1JEEA 5KO2A 4V0NA 2GZAA 4TZ0A 3GJ3A 1Z83A 3TAUA 4M1WA 1CULC 4QHSA 1N25A 1ZNXA 3LRPA 3WMGA 4HLCA 221PA 4C0BA 4XD7A 3VX4A 1D2EA 1AGPA 3ADKA 2AHOA 1UBFA 1UKYA 1M1YE 3FGNA 2ZE8A 3OE7D 4L5BA 3VU9A 3CZPA 2ECKA 4GI7A 4YLGA 1MRNA 4XSHA 1E1RD 1VIAA 3OFND 4XVUA 1ZM9A 2XOKD 2FOLA 3PUYA 4PXAA 2WWXA 1IXRC 1IHUA 1D9XA 2CHVA 3CNNA 3MGCA 3DKVA 4JL5A 4TYQA 4XJXA 2AWOA 3LX5A 2QRNA 2IUTA 1L4UA 4A2PA 4LRWA 4PANA 2WSSD 4PC6A 1U90A 4DBLC 4LSGA 2E1RA 3C4JA 1AS3A 1W36B 3T1VA 1XRJA 1QHYA 1GNPA 4BLQA 2BEJA 1U8AA 1FTSA 1MV5A 4IDQA 1SQ5A 4IOKA 2A2ZA 2IL1A 1SVIA 1SXJA 3AVWA 2GZDA 4JVLA 1J8YF 5GJWC 1KK2A 2ATVA 1XWIA 1NBMA 2GHIA 4M1YA 1G18A 3WXMA 2O8BA 4QBHA 2O8FB 4IXMA 1A5TA 4JLKA 2XZOA 1P72A 1EFTA 5FTLA 2W0SA 1DAEA 2BBTA 2ZITA 3B7GA 1BYIA 1MRSA 3CX8A 3LQQA 1DVRA 3OEEA 2QAJA 2R2AA 4LJ6A 3TJZA 2ZS7A 5HPYB 2VHTA 4A2WA 4HDQB 4IVQA 1Q57A 2ODNA 3EPHA 1N6IA 4K46A 4U5XA 5EP2A 2CVHA 2GJKA 3KFVA 2OUKA 3RC8A 1YHNA 1UKZA 2GBLA 2LKDA 3A1VA 4TMZA 5HE9A 1JNYA 1NP6A 5KSPA 1XD2B 2V6JA 1JBKA 3K1JA 5KSZA 5CK4A 1OPXA 3I72A 3Q5EA 5H70A 2GEUA 3SHWA 4IXNA 2JLVA 2C9CA 2QRZA 1T91A 3LLMA 2VO1A 2JEOA 2FPMA 2D2EA 2ZSDA 3W6OA 4HYYA 3THOA 4S35A 2WWIA 2X2FA 4LUCA 5TV2A 4NYJR 4JVNA 1ZCAA 1X1SA 5JZVA 3VR2A 2I4IA 1ZUNB 4FCTA 2F9LA 1OXXK 4GZMA 4Y0AA 5LDDC 1ZINA 2X1VA 1US8A 3ZQ6A 1ELOA 3LW7A 1KSHA 1XP8A 1Y3AA 3EIQA 3M1IA 3MAAC 2P0EA 4ZDJA 3GPLA 2O8CB 1P2VA 4C0KA 1ONBA 4QGAA 1PUIA 3OFNA 2NMVA 3L0PA 4QL3A 3REGA 1JR6A 1OFTA 4ESHA 1YZQA 2VHUA 3WBKA 2IK8A 4KBFA 3QXCA 2QSZA 2WWHA 3V9PA 3WHLA 2F1RA 3WP0A 4AURA 3EG5A 3JZMA 1XXHB 1C4OA 2ZYVX 4TMXA 1Q3HA 3VKHA 1TF2A 4JLOA
chains in the Genus database with same CATH superfamily
5IH3A 4ARUA 3JYLA 4X85A 4DIOA 2QT9A 3T3NA 2ZWPA 3A6GA 3W8DA 1RWWA 3QE4A 1GUYA 3H18A 3MJDA 1NNSA 5J1SB 2ZIZA 2P3QA 3QX3A 1RYYA 3L4BC 4TWAA 1F14A 3AJRA 2VLBA 4DA6A 2C8VA 1YJ8A 4M54A 1U8EA 4LDQA 5ISMA 1B6GA 4PZLA 4V02A 3PLRA 1RQPA 2IEYA 4GGOA 3AR2A 1XLWA 1JTFA 2JGDA 1QYRA 3T52A 2R5WA 5JAOA 2P1ZA 2I54A 1QYDA 3WLNA 2A9JA 3PI7A 2ZUVA 4FFLA 4L6IA 3E15A 3QK7A 1EG7A 1U81A 3OJOA 1KJJA 4HI0E 2ZUEA 3N05A 1SY7A 1XU9A 2G4CA 2QOEA 1JQJC 4AG5A 1WE2A 5E0KB 5KIAA 4LJ9A 1DHTA 2Y05A 4D82A 5JXWA 4QDTA 5L6LB 3QSGA 2XXJA 3AF6A 2FFHA 1X13A 4PC1A 5AI5A 4GDFA 3N39C 2JS7A 2OD7A 3CRMA 3RODA 1EFAA 4F2HA 3ESRA 4MRMA 4TT8A 3AJ9A 3M0EA 4HQ0A 4KQ1A 4G07A 1E1NA 2I8CA 4NMXB 1NW7A 5T8KC 3T4EA 3UJAA 1RRMA 2OVFA 1GKKA 4BKPA 1G6Q1 2LWIA 1DQZA 3KJIA 4HHEA 4K6HA 2VQEB 2P9QA 1RM3A 2WWWA 1V45E 4KAFA 5K45A 3IIMA 1GR0A 3NIFB 2GZSA 4OL9A 4YJ3F 1U0GA 2W6JD 1RLJA 3KSBC 2YHIA 3AU8A 5IKMA 3CX7A 3O2SB 4B7ZA 4GVPA 3QFFA 4PR3A 4DGSA 4KACA 2XVZA 1OBFO 2XYRA 2V5AA 1MT0A 4ZO6A 3X43A 2CNBA 4CU5A 2LKCA 1ORRA 2B1JA 2H7CA 3AOEC 3IUQA 1SEVA 1N5OX 3A25A 4QFDA 5KJEA 5DBGA 5TMDA 3VPHA 1B0PA 2ST1A 1Q1EA 1PYDA 2YWDA 3MMZA 1QYCA 4N7MA 1R18A 4QJIA 2ZWVA 3HXLA 1FNMA 4D4JA 3VAZA 1REQB 2H11A 2HK7A 3DZGA 3RSQA 3L43A 1K8ZB 5LP6C 1PFYA 1S5PA 3DOJA 4ZJYA 1MA3A 1V2GA 1XZAA 2QTZA 2D2FA 5GZ3A 4DV6B 1HI9A 2D0IA 1HT1E 2C42A 4FZ3A 4S0XA 5BPHA 5CFPA 4CM1A 4XW2A 4N4AA 1X2EA 1ZOSA 1SU6A 2C9YA 4D4GA 2WKPA 3JQAA 4WESB 1UMBB 3TEMA 2AKEA 1NY5A 2DOKA 2QRVA 5AO9A 3V4VB 3GLIA 4F3TA 2XDAA 4L0CA 3B1YA 3O8BA 3Q7EA 3KOYA 4PTYA 4L72A 3EFHA 3R3HA 1USIA 1Y8RB 4W99A 3V1NA 4H59A 1QANA 1F7VA 1F48A 1LSJA 1JA1A 1A9RA 1YKGA 2CJWA 3ZJTA 4EEKA 3N2GB 2FZWA 1JQ3A 4FDUA 4YGXB 5JTUA 3N0VA 2CLFB 1O6BA 1QYVA 3I6ZA 1RYDA 4X54A 5C8VA 2ZIWB 1ADYA 1L8AA 3IPXA 3NLLA 1PP4A 3H3JA 4M2LA 1K2VN 4MK4A 1IWPB 4UUQA 3TLAA 4BLRA 4AY6A 3SCZA 1C80A 3PXUA 3TW4A 2Z8YA 4RENA 2V98A 1MPTA 3BTOA 4JB8A 3DGFC 2EBWA 3TTSA 1L1EA 3W05A 3EODA 4MR8A 4GPD1 1OKKA 2ARKA 1J2TA 2RHCA 2COUA 2YMPA 5CA0A 1P33A 1LBIA 4P5DA 1VLZA 1LTHR 2FQQA 2PHZA 4TYPA 2WMDA 3UAOA 3M4YA 4GIBA 1NW3A 4LOAA 3NT5A 1ICEA 3EJ6A 4W5HA 1KP9A 5JT1A 2FN4A 4CM8B 4YAKA 6CHYA 1MOQA 3RV4A 4GM4A 4QRIA 5AJVB 2Q5JA 3DCIA 3VNBA 1D4OA 4URZR 3HBFA 1WV0A 5CLHA 2O8FA 5EMNA 1RMQA 1V25A 5B2ZA 1DXOA 4MVJG 3GCDA 1KJIA 1SCIA 4X1KA 4YP1A 2VTBA 3EMVA 2VRCD 5AW4A 2GBPA 2ZJ0A 4B6RA 4BNMA 3RI3A 2RGWA 4CF5A 2C4MA 5JXJA 2R6CA 4MV4A 4WJKB 4YCDA 5ALXA 4R1NA 3TGWA 5JCOA 2BR5A 1A0OA 5AUNB 1LLCA 4MZXA 4O0MA 3O8RA 1N2JA 2A9QA 3VNSA 4JI5B 3RVMA 5D5PA 1MH1A 1KETA 2XT0A 3BMNB 1FRZA 2AMFA 3CINA 3D2BA 3IEXA 3UF0A 5C7LO 3B1WA 3RAEC 3EPRA 1DCTA 2QD1A 2CXUA 2VXYA 4HGOA 3RROA 3UKDA 1H8EA 2QL9A 3CYFA 4AJKA 1X7WB 4MHSA 5E3HA 1UMKA 4WBNB 1Z47A 2DWOA 4ZGBA 4PNHA 4WA8A 5GZ1A 5J2UF 4DLYA 4DJAA 3KVYA 2PXCA 3ZKAA 4NCAA 4KHZA 2ZUTA 3A05A 5JWHA 5BVHA 3C2QA 2XTMA 2R6DA 1RPZA 4BO7A 1ZS9A 4QNNA 2OHGA 2Q5FA 3LZCA 2GHQA 1I0LA 2G9RA 1HFEL 4AVYA 5J4HA 3QI2A 2B82A 5LC1A 2GEJA 2EFEB 1ZN7A 1B8OA 1FFXB 1CZKA 2FSGA 2VP3A 4ZZ3A 4HN2A 3W8RA 3VPGA 4G4SO 1PRYA 1JHUA 1LC3A 1TPZA 2IXTA 4LHSA 2AOVA 2I80A 4D0SA 1VCOA 1OW3B 1XCLA 2BP7A 2JLQA 3KQYA 4MR7B 5IC4A 1FUUA 4KWTA 3M8KA 3SI7A 2FZKA 4CGZA 5D3QA 5IT0A 3G8CA 4GBMA 4CT4B 2UZ1B 4EY5A 4R0VA 2I1WA 2EJBA 3AY7A 1GPDG 5FF9A 3D54D 3KDPA 3W1VA 4PLGA 4LOHA 1IZ0A 2AXNA 5F64A 4IHJF 3VR4A 1IIRA 3LOQA 1OC4A 1Y9DA 4UUPA 4RO0A 3SKYA 1AMOA 3TPCA 5B53A 1TTTA 1F38A 5CXQA 2MU1A 1QGDA 3QMMA 4MEAA 5CW2A 3O26A 4JBIA 2Q27A 1DFHA 1U1CA 4H4DA 1E62A 3LE8A 2VJKA 1U4SA 3ZG6A 1JHAA 1GEEA 1GGJA 2ZXFA 3JQFC 4PLCA 4NBNA 1FDTA 1DDOA 1PT5A 2QS9A 3V5NA 4DJDC 4EJ6A 4OX9B 1MQ8B 4EVSA 1QF6A 1EM8A 4LNHA 1Z0IA 4DA9A 1EFPA 1WDMA 1AE1A 4ND3A 3EXFA 3A9WA 1GPLA 2HJHA 2OESA 1Z4OA 3BXXA 5KC8A 1KPGA 1W5TA 5HIJA 4ZKDA 4I5IA 2AF4C 4RD4A 4MWTA 2ZR8A 2EJTA 2AL7A 5DGXA 2RAFA 1ICIA 2HDHA 1YJXA 2Y0CA 2CHQA 3PVSA 2EIXA 1LK5A 1ND5A 4DC9A 1UWLA 2ZJZA 2H0QA 3BMOA 3CC8A 2HCRA 3I6QA 5EZYA 4ZMBA 2HNBA 1RLIA 2C77A 3MXOA 2HO4A 4GP6A 2I8AA 4E30A 2JFYA 4H6VA 1J2YA 5AM3A 3BK2A 2OFPA 2ORYA 1DEXA 1CZUA 1VMAA 1B74A 1NL3A 4R2KA 4C03A 2BGNA 4EIWA 4OLAA 1RTTA 2FW9A 1G6KA 3LHFA 3SBXA 5ICFA 3ZZNA 3H84A 3KETA 1WEHA 1ZN8A 3CMCO 1FVXA 4JGGA 3FPJA 4RVHA 4J16C 1F7UA 1T1RA 2OM2A 1IJFA 4MQUA 3B5EA 1ZIDA 4DCCA 1BO6A 1NV9A 4EYSA 4NEHB 2YXPX 3SFTA 3S99A 3DONA 4BB6A 2W2MA 2XSZA 1PR2A 2WW8A 2O0HA 3K2BA 3PHBE 4G86A 2XDQA 1OFUX 3MWLA 1KRXA 2Q2NA 1XMPA 2XYHA 3O3NB 5ALUA 5K5EA 1FNNA 5L3QA 1SBZA 2AS0A 3GFRA 3E53A 3Q8KA 1GJRA 3TINA 4K6KA 4IJ6A 4N0DA 2P69A 1ZBDA 2PKRA 4GL4A 4ZI5A 3UK1A 2CLIB 2VPZA 3QMVA 4RSGA 1Q84A 1J99A 5ER9A 4RLSA 4YRLA 4F86A 2W00A 3QFCA 1CF9A 3PC8C 1W87A 1BDHA 5DM1A 4II7A 4YJ2F 5A5GA 2O9JA 2KX7A 5IZCA 4RM2A 4POAA 1GZUA 2BFOA 2QD5A 1FOEB 5IW8A 1B2LA 4CV3A 3H9BA 1WOMA 2Y0EA 1ZD9A 6AT1A 3E9MA 1ISRA 3UANA 1DPGA 2O19A 2GS9A 5T41A 4MMXB 4OOFA 4R1QA 1PD0A 3HYSA 3ZHRA 3O95A 5HMLA 2ECFA 1DQYA 4G65A 4WAUA 1DAFA 3N2NA 3A6PC 2ZBVA 3ZHVA 3HV2A 1Q1BA 1EZ4A 2FRDA 1KFCB 3BRWD 1IXSB 3T3IA 3T5AA 5IUNC 2J9FA 1BGXT 4C4RA 3E18A 2B9VA 1R16A 2FR1A 2PNJA 3EMBA 5KNDH 5BVGA 3JVVA 5HWSA 1WMSA 1HOTA 2ZRCA 3AWDA 3RJ5A 1E2QA 3TD6A 1EXVA 2R7MA 2REBA 3A3OA 1E2NA 2D8MA 4HZUA 4GEKA 2WLSA 4MXDA 1G60A 2WF6A 1SUFA 1DEOA 3S29A 4CMAA 2E4VA 3AUYA 1FRVA 2O2GA 1QE0A 3E9QA 4RZ3A 2PA0A 1EVYA 2WU1A 3DGEC 3Q11A 4G6ZA 4HPXB 3QENA 3ETNA 4JH0A 4L6AA 4MV1A 1UAYA 3JAWB 3BRQA 2UYOA 2IYWA 1E66A 5IG2A 1T8TA 2G77B 3ZGLA 1D6SA 4X7MA 3D3KA 4FR2A 2DPGA 3ZZMA 4D4LA 4IKEA 3TMKA 4BY9E 2QTVA 3PQ7A 2X4GA 2NU9A 1SPXA 1ZJ6A 2AI3A 3IUYA 3KB6A 4WGFA 2PRJA 2BH9A 3URMA 1QGUA 4DVGA 5AKIA 5A04A 3BDVA 3QELB 2DKFA 2BF7A 1AKQA 3G8YA 2PS9A 3Q1KA 5F4BA 3B60A 3C3AA 5JOQA 4ZYLA 1Q74A 2VJBA 1XVIA 1BOFA 3KYCA 1BVYF 3Q7QA 4IRUB 1C9NA 3S70A 3NWEA 3P9IA 3A6DA 2PMDA 4G1EB 4RHFA 3EEBA 2FSHA 3PICA 1W85A 3A3NA 1CEYA 2PRZA 3VYSB 1QOPB 3P0FA 4F1KA 2A5FA 1KP3A 2AMLA 4LK2A 3DXYA 4NHEA 1KS2A 2ZSEA 1EK6A 2OZVA 1FFGA 2W2LA 4J1TA 1Z13A 4FYKA 1CDOA 1PR3A 2BGIA 2QW8A 4NHOA 3SR0A 4OM8A 1J70A 1UBEA 4D9FA 1LSUA 4I9NA 2Q9UA 2JHPA 3GI1A 4IL5A 3PIDA 4QGHA 3CLRD 4G4IA 4FKBA 4ZODA 4A0QA 4E03A 5DHQA 1WXXA 2HMSA 3GIWA 1A1VA 2CHEA 4KLZA 4D80A 3EUEA 2JGMA 1J0EA 4CYMA 2EKBA 3FMIA 1NNUA 3HJTA 4WESA 2IU0A 3C43A 3PEEA 4J7CA 5GQSA 1GL6A 4PZEA 4BMXA 2Z9DA 3CF4G 4GWKA 3DD5A 3GLIE 5BXYA 1DTWA 5CVEA 3ZTWA 1BH2A 4TMKA 1BE8A 4XGNA 3F9RA 2D6FA 2EX0A 4CLEA 3QF4B 3A31A 1OYWA 1PTJC 3OEHA 2HK6A 3DBRB 1UZNA 4LVOA 1R5JA 3EEQA 3K0FA 3QLTA 4WEQA 2I6TA 5FBHA 1SVWA 1POWA 2OHIA 1LW6E 5BPFA 5DX1A 1ZZEA 3KQKA 3AEUB 1R8XA 1JGTA 1W52X 2N47A 3I6BA 4GWLA 4MROA 4MGHA 2WF8A 4Z8YA 3DDWA 1EB8A 3CURA 4EDHA 4DR3B 1TZBA 1V5GA 3R4VA 1LPBB 3EBOA 4ZQIA 3OF2A 3PUZA 3QU4A 5AHWA 4CMCA 4CMKA 4MJXA 4DEYA 3E03A 4Q5IA 1V16B 3B6KA 4CDGA 4Y8VA 3NEYA 4M0CA 3ZWBA 7ADHA 3ZI7A 4PXYA 1ODTC 4UATA 5DE3A 1OQAA 1L4FA 2HB6A 2P2LA 2XVXA 3HA7A 2XUOA 1JSRA 3UK7A 2VVTA 2DPMA 3K4PA 4NSNA 3W7BA 2C9OA 5CA0B 5JWRA 1UPXA 1I8TA 2YHSA 3GBVA 4JA0A 3ZCXA 2MSWA 3ZY3A 5CEFA 2N46A 2C7VA 1JAXA 4NY1A 4LOJA 4BQRA 3FZNA 4NNOA 2BDEA 1OWPA 4TXHA 1ZAKA 4XQEA 3X1WA 4FDMA 3VV2A 4AROA 4BJ1A 5HUHA 2LV8A 1T0PA 1N5IA 1GT6A 3R6DA 2NPOA 4FQ8A 4II2A 1THTA 4OHVA 2CEKA 5JNTA 1YU6A 4CG3A 1ARZA 1QNFA 2W2NA 3SHVA 9LDBA 3IELA 1JYSA 1XF9A 4FHZA 4G26A 4HBZA 3AF0A 1C9YA 3ONFA 2PZKA 2HPHA 2OECA 4N0MA 4L78A 4BMCA 4ES6A 4RTQA 3LU1A 1E3DA 1QZZA 1EIWA 2EV9A 4BAUA 4OFXA 3OPYB 1Z5WA 3D6UA 4Q1FA 1HZJA 3RSSA 4YXFA 4NX2A 2P2ZA 1X1CA 4HBGA 2RIRA 3I04A 3LUAA 2HHCA 3H9JA 4JA2A 1QG4A 4O29A 4P3KA 5BSGA 4IJUA 2NZ2A 1DQNA 1F8XA 1J23A 2JI7A 1TCAA 3IQFA 4I4TF 4E4RA 1FZQA 4QNMA 1ZGHA 2O57A 4OM7A 1Q91A 5T6MA 4W6ZA 2W90A 3CTPA 1VP9A 2P78A 4MGEA 1MC8A 3JD0A 3O4FA 4N3NA 1R27A 2HDWA 2NNLD 1Y7TA 4P2GA 1M6VA 4HNAA 4BNVA 2A4KA 2HSEA 3GZNA 3K7EA 2QQEA 4FSXA 1GSAA 1X8KA 3ZDRA 3BFKA 5HOQA 2YWJA 3D4NA 4IH4A 1Y4ZA 2ZSBA 1OAAA 1O0CA 4JQYA 5KDLA 3OZVA 3P2KA 4YRQA 2RGNC 4MGYR 1BCRB 3GUYA 1KJWA 1Z2EA 4OYRA 3RW9A 1KORA 2CUNA 2PANA 5T64A 4OP3A 1ANKA 3QKUA 4QUHA 1LGYA 3ZUPA 2BGKA 2JLAA 1SKYB 1EVQA 3KEFA 2A8YA 1DU4A 3KKPA 3QKSA 2WJ6A 3UMRA 3HI6A 2AD5A 2EDCA 1A72A 3R7NA 1AURA 3GRPA 1EUCB 4DOMA 5K05A 4YH1A 2FSFA 3JWPA 5AI9A 2QQ5A 2QR5A 4EG4A 1N92A 2AOXA 5M29A 4PN7A 1AX9A 1BXGA 3LXRA 2P5SA 4MICA 2Y4NA 4LZZA 5EKDA 4HUJA 2H1CA 3TLGA 2A1IA 3DFIA 4DMHA 4REMA 3LLVA 3PWZA 4YAUA 4J6EA 2IU3A 1FMLA 2I7VA 2JGAA 1WA5A 3BIFA 5BWNA 5ICCA 3GEBA 3TFWA 2QX9A 4K9PA 3PRJA 3KQNA 3V7YA 2X86A 1Q3TA 1DFIA 4YJHA 2OYCA 1VCMA 2AGVA 2P27A 2GA9A 2WM3A 3U5TA 3W4KA 2V03A 1KAHA 4ZV9A 2QL7A 1W59A 2QYTA 2VP6A 3OE7A 1RAHA 1ISSA 4K9QA 4M38A 5JNWA 4C88A 3L79A 3GGJA 4GRIA 2ENUA 4FYJA 5FNZA 5IPFA 7YASA 2VAPA 4NECA 4NNPA 4R1UA 3QJGA 3G2PA 1QFXA 4OQQA 1U2QA 4YA6A 3IR5A 2PUAA 1VB5A 3PPYA 4LY9A 5FQNA 1MIOA 4E22A 1LVHA 3IDZA 5FO1A 1F9AA 1TIKA 3JD3A 1T0UA 1ZJJA 3N74A 1BMFD 1XTKA 3NIBA 4YQZA 2LIVA 2JCBA 2GEDA 2JGNA 2XNKA 4TQ9A 1UBRS 1T1JA 2YVAA 1P1CA 2J0QA 1NYTA 4YMTA 2DR2A 1YRAA 2AMYA 3SP1A 4Z7NB 4Y6SA 3NBXX 4RHCA 4PX9A 1YB6A 3OTHA 4NOKA 2GPJA 4ZEMA 4CM3A 3J80A 3ODGA 2P2NA 2XF8A 3IAM1 2GAAA 1U65A 2FMXA 1A9TA 2J41A 4E2ZA 3RYCB 1AK9A 1D4FA 3R6TA 1QF9A 4QUJA 3K4QA 2Z2IA 4UTOA 5TT0A 2JJ2A 3L7NA 3RRMA 3VUFA 4BAZA 4JEIA 3BDAA 3PRYA 3T3GA 1G5RA 2QB5A 2C1ZA 2FF7A 2OV2A 4KFUA 5TB5A 1XZBA 5B6JA 2IHTA 1CUSA 2R84A 3IP7A 3LUHA 2CMHA 1H22A 1WD5A 2W2TA 2AEEA 3BF8A 4M8KA 4E07A 3FN4A 2PBRA 2IYSA 1Q12A 2GZHA 1OXUA 4KRGA 3LBYA 3ODPA 4UZSA 4CIBA 3A6FA 5AW6A 4BLOA 1H9AA 1XJ0A 1YUNA 3VKGA 2BFFB 3G0DA 3I5UA 5CGZA 4K9NA 1C3XA 4ILEA 4DDKA 5CM2Z 2NYUA 1YHZA 1TGYA 2A14A 3OA2A 3U80A 1LDMA 5AM1A 2P9HA 3O1HB 2Y92A 3UNXA 1FNDA 2P0AA 5AKEA 1M8FA 5FHRA 4CF4A 1A9QA 2EP8A 2PS0A 4DWVA 1AKUA 1KS9A 4A6XA 1OE0A 4RTOA 1GCAA 1MEOA 5K8UA 1CUDA 2A86A 1ID1A 3CPSA 3D6JA 3K09A 1SHTX 1VLHA 4RZXA 4U0JA 4Q01A 3SF8A 4AJ1A 3IPCA 3WLAA 1SHZA 4ZGGA 1TB4A 3TZQA 4LXYA 4LCJA 3PVZA 4FSHA 2ETXA 3TL3A 5JAPA 9LDTA 1I3MA 2W58A 2Z6AA 4ASUA 1Q22A 4PFSA 2ZIAA 3L1HA 3WZ2A 2WNSA 1KJNA 2N0SA 3BK1A 2M9MA 2Y27A 2QA5A 1G8JA 3G9XA 1U2GA 2QUKA 2V9CA 5E2IA 3BCUA 3GW8A 5K0NA 4BVGA 4DLXA 4FFBA 1P2BA 4K0RA 3ECCA 4QHYA 1R0LA 3WA6A 1XTQA 1QK4A 1WB5A 1YBMA 5D85A 1AIPA 3EGIA 3BSFA 4OQXA 3NYRA 4EYOA 1CJKC 4UTRA 4KGXA 2EARA 3N2KB 4AY4A 3PC2A 1JLKA 1WR8A 1GUFA 1EFVA 3BGSA 1XRRA 4AAYA 1R5BA 1MW9X 1GNSA 1UPFA 1RJ9B 4X7RA 4OL0A 2VOJA 4M8NE 2Z8YM 5FBZA 3DLCA 3FKSD 3PL1A 2W6CX 4MKZA 4OXQA 4Q1DA 4TV9F 3SR4A 2QHXA 1E1RA 5F73A 1AKRA 1CQPA 3OPNA 3X1ZA 1M0EA 1KMCA 5CHYA 4OUDA 4KXFB 3VNRA 5G4KB 4K9KA 2WK1A 5D86A 2QTTA 1D03A 1KMQA 5E7JA 4ZU6X 3M49A 1SG6A 3BC1A 4INAA 1EPUA 3N70A 3O73A 5JSZB 1TT5A 1N1DA 2CFIA 3MQ2A 4HYTA 5CMLA 4H15A 1R7RA 2EJVA 4QGSA 4R3NA 4JLPA 5M7EA 4XX0B 3RTBA 1W49A 4MUEA 3WS7A 2YCLA 3ZGZA 1XZFA 1S7CA 1G5HA 2B30A 3OJWA 5ALGA 1A97A 3T61A 1FUIA 3BJEA 4D0LB 2VYCA 1Z2PX 1GU0A 1Z6YA 2BKEA 1C1XA 1F60A 2EHJA 2D4AA 2J59A 2ZKIA 3HLTA 3BJIC 4X94A 1ETHA 4MS3A 1JFRA 1EU1A 1ZOPA 1B8VA 3N87A 4YIKA 2DSTA 3CWZA 2XE4A 4OYLA 5AIBA 1ZNWA 4AKSA 5EXXA 3ELWA 1NVMB 3ETLA 4BQIA 1XZIA 4HAYA 2WFLA 5SYAA 4GD3Q 2B8EA 2X1HA 4HN4B 5G53C 2B8JA 3SDSA 3TG8A 4LJ8A 2PBFA 4URWR 4WFIA 2YL2A 3FBGA 3KKMA 1Z4QA 2V74B 3IQGX 1R37A 1JQ5A 2XYVA 1CNMA 4AKGA 1JDTA 3WIOA 4KQ6A 1YR1A 4K2HA 4DNFA 1YBVA 2VJNA 4J2OA 2ODPA 2ZRBA 1D1QA 2BIFA 3DF9A 1FU8A 1UMCB 3L4KA 3WNDA 1F8GA 2GBGA 1UJ5A 5FP0A 2BMEA 3C3WA 3K0CC 4KMRA 3I2JA 3HS3A 4Z4EA 3HEBA 3HSKA 4Q1EA 5EP3A 3PGLA 2VF2A 2ZSKA 3OF3A 1MNAA 4WXYB 2HSZA 2JARA 4RL4A 3PEFA 3REFA 4JI2B 2XCQA 4OX9Y 1G41A 4BO0A 5CJ2A 1CY2A 1TW3A 1VECA 1W2GA 1ZVQA 1XL0A 4CFSA 3L46A 3ZQUA 2XMZA 4UUAA 2WUWE 4C4ZA 4Y6GB 4BE4A 2H4HA 1E3WA 3BKWA 1AKYA 4W8HA 1UBUS 3RQSA 5DW0A 3QSYA 3ENZA 3HYCA 3RC7A 5IKEA 1NSFA 1GFWA 3DW3X 4HGQA 1WDLA 4AG3A 3O1LA 4TWZA 4WKPA 4NARA 1UP7A 3WGIA 4OLHA 3W2TA 3DKKA 4QU8A 2A94A 4OXRA 1LVUA 4ZP1A 3MIZA 4REOA 1JXMA 2GJSA 4ZVKA 5F3WB 1BH6A 1JIQA 2HWWA 3UFXB 4RJLA 3AR5A 4UFOA 1UBCA 3STYA 4BQSA 2KMLA 1I1OA 1ZCZA 1T10A 4H7DA 2QMEA 3PIIA 4QBIA 4FFVA 4ZVRA 2Q2VA 5BQ5A 3ZDFA 3CVOA 4NOMA 4R5MA 4B17A 1QWOA 4KSYA 4OHOA 1FJ2A 5E1BA 3IJRA 2QTCA 2ZBFA 4HS4A 4WK2B 2ZYAA 3AR9A 3A7DA 2OBBA 4A0HA 2W9XA 1EXWA 2JRLA 3FMPB 2HIGA 3D5QA 4QEKA 5JV5A 4MP6A 3D0KA 3JVUA 4NE7A 4HQLA 3IJEB 3O4GA 4U63A 4B47A 4E7PA 4MJLA 4EVRA 2V7QD 4EGJA 5LU8A 2CNWD 3NVDA 3PUWA 1YZ3A 1GRNA 3B7WA 3Q3IA 3SOZA 3JWGA 5JAMA 2UUCB 3HXOA 2QVXX 3BD8A 4JUDX 4INPA 4QIHA 3VTKA 2Y2VA 1X42A 4JU8A 4ZRNA 2AV6A 2V1XA 1V4VA 2X42A 1GG2A 3NDRA 3OCCA 4HWTA 4X20B 2YFQA 1Z73A 5DNDA 4ZHQA 3TR0A 3S6JA 1ULUA 2H8GA 1OFUA 1ZQ9A 2A0YA 2H6EA 3MBOA 4FOLA 3ROMA 2ET6A 3QJ5A 3PG5A 2MIIA 3V4ZA 1NKTA 1B2RA 1XF1A 4PBTA 4K1LA 2BGUA 4US2R 4FOOA 3KYDA 1C3OA 2WFLB 1QP7A 2XGOA 5L53A 1V5FA 1KO8A 1G9XA 2XNDA 3W7VA 2VSQA 2ZRFA 3ND9A 3D7MA 4KIFA 5A2GA 3V8NA 1TAUA 5FBRB 1CUVA 1MW8X 1NVFA 2RONA 2ZWOA 4FHGA 5HKBA 2CVOA 4FW8A 2YVUA 3LLSA 2B61A 1MAHA 4XQ0A 5DZSA 5AJXA 3TZLA 4EA9A 4UM7A 5KDOA 4FGUA 2UVDA 2XMDA 1PJSA 2DPXA 2AKYA 4BNJA 2GHTA 2HF9A 3KALA 3KVRA 1PR1A 2E87A 4XEUA 3LKVA 2H51A 1OXKB 1Y8CA 1K7FB 2WM9B 3WK7A 4YJ3A 4HGRA 6GPBA 5HM8A 5JBNA 3E84A 4QU5A 1BWSA 3MUEA 5EQDA 3INGA 5DLDA 2V5VA 3HL4A 2E0IA 3LDAA 3PRHA 4JL6A 1SFRA 1UR5A 4BYMA 5IZ4A 3WA7A 4CLRA 3MINB 4UVHA 2IVFA 4TXNA 3WWPA 3DMFA 1PQUA 1X1AA 5E4JA 2ZYTX 3E2IA 1GZDA 2NAFA 3CW9A 1IRIA 5DU2A 3W5SA 3HYLA 1ZKMA 4WH0A 2IT1A 4F7WA 4C43A 4MW5A 4G36A 3ZWKA 1R0BA 2NYAA 3DAPA 2B36A 3HU1A 4P4UA 1JLHA 3JWJA 4G5HA 1IJKA 1GM5A 1UWKA 1XJ5A 3U1BA 1K7YA 4DV0B 1RXUA 4D6YA 3AF4A 3DBIA 3F6SA 3FROA 1WY7A 5K03A 2H92A 2GJ8A 1GZ5A 5FO0A 4B4KA 4MLPA 3CW8X 4C3OB 2JJQA 3H2YA 3AGPA 3KOZA 3FRHA 3NIWA 1WW2A 3ADPA 1YH3A 4Z1MD 4TVOA 3SM3A 4INJA 1SVMA 3S28A 3CVUA 2ZAOA 3GBPA 2FUNB 5DLPA 5B3JA 4AKHA 4JI3B 1W5SA 4XAQA 1FXSA 1FLNA 4MQMA 1UWVA 4PAQA 3I83A 4RIGA 3PQFA 5IUKC 3W6PA 5EOVA 5EE1A 2J07A 2R97A 4W1RA 2O2EA 5F5XA 5KJCA 1YR9A 3ZZTA 4MR8B 1PJ3A 2OAQ1 5H80A 1T4DA 5AVOA 621PA 2F8MA 3KHSA 3DUFA 5F3RA 2RCNA 3V32A 4D56A 5BORA 3AVOA 2QSYA 4M1TA 3VV3A 1JVBA 1Q1QA 2DAPA 4BFYA 5IDXA 2BCEA 2YXDA 4N9WA 3ND5A 2DETA 4RZ2A 3V4LA 3G6KA 3YASA 5G4LA 2EF1A 1RI5A 5A06A 2DUMA 3VUEA 3C6MA 5KTKA 1VSBA 1G17A 3HM2A 3KVNA 5JARA 3B2EA 1EDZA 1ADFA 2OG2A 4TKUA 2JG3A 4COOA 2O1WA 5AVKA 5KTRA 2O0MA 2XCLA 2YJ6A 4ESOA 2ZJ7A 5LD2C 3N5KA 5EUMA 1NUPA 2GKSA 4AXBA 1TK3A 1ZHFA 4CCYA 2ZBPA 1ZEMA 3L3BA 4JROA 3AJ8A 2C8LA 1VE3A 2HREA 3L7DA 3MSXA 5TS3A 1DCKA 1T4MA 4RY0A 1ZNQO 2VPXA 4DCPA 2Q6OA 2WJ4A 2XDWA 2CL5A 2C2XA 3RE1A 2Q41A 4GXQA 5DFAA 3F6YA 1OCEA 3MLBA 3UUWA 3DO6A 3VZBA 3TXAA 2RK6A 1F8UA 3HLKA 2FPSA 4YJ3B 4JIMA 5KYVA 2VRBA 2O4CA 4ANFA 3LO8A 1TXGA 2H2DA 4FFRA 1XTPA 1V9CA 2ZGVA 5ES4B 1OFVA 1E6MA 1CQXA 2POQX 4KSBA 5ALFA 2PMWB 2VCYA 3A3PA 2OCIA 2W4IA 4KTVE 3LT4A 1JLLA 4M1MA 3AHHA 1CY4A 5K3EA 3IQIX 3T1QA 3ZV5A 4ALNA 3S2FA 4PQYA 2VP9A 2HF7A 4I99A 3WADA 5I4CA 5JRZA 1T6XA 1XHLA 3FLAA 3N0WA 4OU5A 3HO6A 1TO2E 1VI6A 5CYGA 2JGJA 4KGDA 4OGKA 3U7QB 2I3DA 4D4KA 3DE5X 3EW9A 4UEOA 5TQ0A 1NIPA 1T9ZA 3D8HA 4RA9B 4TTQA 2VWGA 4EGFA 4ZK6A 1A88A 3I53A 1KFJB 4NFYA 3LPCA 3WTCA 2HN9A 3WI7A 1UDAA 3L0ZA 2F48A 2NLOA 3QUCA 4AY2A 2C7RA 4AN4A 4OUDB 4ZOEA 5G4KA 5EIBD 2OMKA 4N12A 2PMEA 9ABPA 2WE8A 3GEHA 3IMFA 4M7OA 4R98A 4FQ7A 4LK3A 4FOTA 3E9RA 1U8TA 1JUDA 3C0KA 4MHTA 2CHUA 4CM6A 2LCQA 1VKZA 3TQRA 2ZM5A 5M2QA 2VXCA 1Q7RA 1OH8A 4HAOA 4PAGA 2YC2C 5HKKD 3QPDA 2WSBA 1KFKB 1U5CA 1WHTA 1O95C 3MRXA 1CHNA 1DQSA 3PZRA 4MWSA 3MD9A 3MCTA 5JQWA 2OQIA 3LCVB 3V6MA 4UD2A 4EW2A 2IYTA 2AHRA 2G5PA 3GQBA 4RD2A 3S27A 1BHSA 3MN1A 1R5OA 1W8IA 3BZBA 4QQKA 3ZWWA 5FLXA 1NT4A 2X14A 1KAEA 4Q1BA 5H5JA 4RX1A 3QFHA 3H2SA 4NBTA 4DXHA 1R9JA 3LOUA 4RIHA 4ER5A 3TX6A 3EVGA 1SUWA 2AZ4A 3Q98A 4TRNA 2PYZA 1HG0A 3FW1A 3NHZA 3P94A 2P68A 1EP9A 2VK8A 1QVWA 4IIYA 3SQOA 4OY3A 4QEDA 1Y4AE 2IX3A 4QJBA 3AF1A 3BA6A 4GOXA 5JVDF 1U2RA 5IM5A 2FX3A 4K0KB 1VHJA 2I33A 4Q7QA 4S2UA 4CKZA 1H6CA 3O8OB 2BGRA 4QYMA 4HWSA 5DASA 4KZKA 1WV1A 4LF9B 5CFQA 2YX1A 1BKDR 3BGVA 1DWQA 1NA5A 3FTQA 3DR5A 3GFOA 4JR1A 1DX4A 1DQRA 4HATA 1N6HA 3I4FA 4OHXA 2GRAA 3R7AA 3BICA 4K6MA 4ZCSA 3Q2OA 5IVKA 3B6EA 4I0WB 4ZVQA 2DJ5A 4WDRA 3T0IA 3DVAA 3MILA 2J5XA 4QDXA 4FEAA 5AQ1A 1ZSNA 2EJUA 2XDQB 5L95A 1QBKC 2AG8A 3HN7A 1CNEA 2COEA 2O7SA 3RYTC 5CBPA 1DKRA 3DZIA 1WW8A 2XBUA 4I6EA 1YFKA 3DLPX 1NGSA 1SD2A 4Q1AA 5A4AA 3K6SB 3UAWA 2PSFA 5DDIP 5E4FA 4H7HA 1L9KA 2NZVG 4XLLA 3T1YB 1ZU4A 3L92A 1SUIA 4OK3A 3E1KA 3TDKA 1X8LA 3EUFA 3UFBA 1NUSA 1L4EA 1TOAA 2OHOA 3I34X 2F43B 3B3AA 3MWEA 4WN3A 1KQNA 3WDLA 5E7IA 1K5PA 1RYMA 1SC4A 2GT1A 4Q3LA 1MB0A 3TIFA 1KGDA 5AVJA 5HJ7A 4I81A 1E61A 1K5HA 3P2MA 1WOYA 2Z83A 3ZGXA 1KQOA 2GPAA 2O14A 1VA5A 1X6VA 1QH1B 4UHEA 5LZ7A 3HDVA 4AZVA 4PINA 1XZ8A 4L4RA 2FX2A 3H2JA 4FCWA 3UN1A 1T2DA 2YN2A 5I9BA 4ASUD 4BRZA 1Y8AA 1KWKA 1R88A 1KK0A 3DA8A 3RNOA 1A1SA 4DQDA 3EULA 1W9MA 2ZRDA 3D6HA 1T8YA 2GWRA 4RJ2A 2RGCA 4ODIA 1BKSB 2IIVA 2ZRMA 3AKCA 4RFSB 2X0EA 1N0IA 2ESRA 1WLYA 4OXIA 2QL6A 4HVCA 1N2OA 2EF0A 4LYDA 5EZYF 3TD2A 5HS4A 3LT1A 1BMDA 4IF4A 4MA0A 4TLAA 5C4MA 5MGBA 1M8KA 4GX1A 1VRWA 5KQLA 3QYFA 5DGIA 2C1XA 2WHRA 2HAEA 1ADJA 4MRVA 4JJ6A 3OFJA 521PA 1ISPA 4GOKA 1PSWA 1MGPA 2ODWA 5HFAA 3RJZA 1SN7A 1P7PA 4GM0A 4NCIA 1KZYC 2WUDA 2XBMA 4JQZA 1J90A 3T9CA 1HC7A 4Q4AA 2I4NA 2VC2B 4RK0A 3T7EA 4Q16A 3TTVA 1WXFA 3BIOA 4BFLA 3DKIA 5TS2A 4I46A 5JC1A 3ORRA 4IDDA 4OHFA 3U19A 3L6UA 4JENA 2D00A 4N3GA 3R7BA 2W93A 3UMFA 3PYLA 3T35A 1JJVA 3V80A 1VE6A 3ZCRA 3C1AA 3EXEB 3PDJA 4PM4A 4DJTA 1NF2A 3UGTA 2R1VB 4HAZA 1RTKA 4M9XA 1Z0SA 2C5LA 4Q3BA 2PSEA 2HGZA 4FINA 2QJFA 1ZM7A 2ZUDA 4JGBA 5JZ9A 1D4AA 1WUJS 2OD9A 3JPYA 3RR2A 7MDHA 1U8UA 2NUTB 2CNNA 3E1SA 2REQA 5F12A 3S5UA 4CKBA 4X60A 2A5DA 2VT7A 2CZQA 2XD4A 3DULA 3ENNA 5FI0B 5CBPB 2LE0A 4HMOA 4RA6A 4BYGA 1PLLA 5J4LA 2E3JA 2ZIGA 3OM1A 2FDXA 3KQPA 4WOPA 3LXXA 3OZDA 2NUBA 3WBFA 1J9GA 3NQ41 4Y2SA 3IT3A 3TPZA 2YY5A 2ZSUA 2Y76A 4WOCA 1GUDA 1XD9A 1Q11A 1QS0B 1U0OC 1YUMA 3O0TA 1FTYA 2Q4BA 1UFKA 1JPJA 4YRDA 1I13A 4UHJA 4EPVA 4IICA 5FHQA 4TTSA 5ANRB 3GT3A 1LTQA 3EC2A 3KIPA 1GARA 3N8IA 5BN1A 2YWEA 1JHOA 2ID8A 2NZJA 4EI8A 2NAPA 3LCMA