2BBSA

Human deltaf508 nbd1 with three solubilizing mutations
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
283
structure length
253
Chain Sequence
STTEVVMENVTAFWEEGFGELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLRPDFSSKLMSFDQFSAERRNSILTETLHRFSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Structure and dynamics of NBD1 from CFTR characterized using crystallography and hydrogen/deuterium exchange mass spectrometry.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 87
structure length 253
sequence length 283
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bbsA00
1QG2A 4NZYA 4Q7LA 1EFRA 2F43B 2EU8A 2ODBA 2ZYWX 4Z1MD 4D0NA 2G83A 3U7GA 1FUUA 1A82A 1M8PA 3U44B 1E2GA 2ZXUA 1XRJA 4HEJA 2NTYC 3L0OA 1QHXA 4LZZA 3T1VA 2BEJA 1XTSA 1BKDR 2BJVA 1KY3A 3H1TA 4GI7A 2OBLA 3R9WA 5DNYB 1RKBA 3J81k 2FEMA 4AY2A 2AXNA 2VL7A 2P2LA 4QKQA 4HLDA 1ETUA 1E0JA 1G1MA 2E1RA 2BKEA 2O8CB 1LY1A 4M9QA 2GNOA 4MQBA 2FFHA 1KI2A 5FUYA 2FEOA 2WJHA 1JEDA 3LVRE 3HR8A 1CBUA 4B6EA 1ZM9A 1VG9B 1IJEA 1WA5A 5CDFE 4FMCB 1NVVQ 2WICA 3L8YA 1SHZA 2VSOA 2MSEB 2R65A 3QEOA 3SHWA 4Z54A 2GEDA 3ZVLA 3K70D 3A37A 1AM4D 3B9QA 3AP3A 3KL4A 2YC2C 4JT2A 2C2HA 2IX3A 1KK1A 2ZE7A 3MRSA 5E95A 4US2R 1II9A 2D62A 3K09C 4IVPA 1RYHA 4RY2A 4AK9A 1QG4A 2HYDA 3K0SA 2ZUBA 1TEVA 3EWAA 2Z6VA 2JIZD 4FMDB 3EAQA 3ZVRA 3EC2A 4ACAA 4TYWA 3VKWA 4BFWA 3TIFA 2V9PA 1G41A 621PA 1DAFA 2N46A 2OXCA 2ZRIA 1DPFA 4AC9A 2V7QD 2ZTSA 3KFVA 1W4RA 1XZQA 5L3QB 1XD2A 1P7CA 3LW7A 1N6IA 3CKLA 3PUZA 5FOTA 4W7SA 3OEEA 2IYVA 2DWQA 3NBZC 1W47A 2PJZA 1ZMXA 3X2SA 4KJZA 2ZRNA 4PZZA 1CEEA 1R0XA 2ZRMA 1KK2A 5EP3A 5BN5A 1SXJE 2VIIA 1G6OA 3GEEA 3ZLJA 3NDPA 5FPTA 4ASUD 1E1RD 3PITA 3K8YA 3T34A 4BEBA 1DVRA 2VBCA 4KCGA 3KXLA 2IL1A 5E7IA 4GL2A 4L8GA 1GP2A 1VCIA 3NKVA 4TMZA 1X6VA 4I1OA 2VYFA 1YKSA 3BE4A 1GSIA 2ZI9A 3BB4A 5EXPA 4LX0A 1G4UR 3L43A 5GADl 3GLIA 3LX8A 4FMCF 4Q66C 1JQLB 1OF1A 4JSYA 4PPNA 4ZI2A 3U6BA 1KO8A 1MT0A 2A9KA 4FMBB 1FP7A 2GEVA 5CIQA 3SU8A 1NIJA 5GVSA 4PC7A 1VCNA 3G82C 5GVRA 2XJ4A 5JWHA 3N5CA 1I2MA 1TAGA 5EUQB 1J70A 2KSQA 2QI9C 1HE8B 4D4LA 2IYUA 4DSNA 2WVJA 3NBYC 2D3WA 3U4QA 4B3FX 4UXJA 1E9RA 4RD2A 4DXAA 3RRYA 2P6UA 3RC3A 4RKFA 2QPOA 1ESNA 3RYTC 1XCPA 2XTZA 3G5UA 3KFXA 1X1SA 2QG6A 3PENA 4HDQB 2FA9A 1N5KA 4TWZA 4DLSA 1RW4A 1SVWA 2BOVA 2ZRLA 3IGFA 1KDOA 4DCSA 3ZGXA 4HAWA 4QGAA 4TTPA 2BMDA 4X8MA 3MWLA 2NQ2C 2B7CA 2WSMA 1N2CE 3GQBA 3NH6A 4QHSA 1OV4A 3RSOA 1KJWA 1PLKA 2JDIA 1G7RA 2ZRGA 4Q1AA 3RS0A 2GK6A 2GEUA 1XMVA 1T0HB 5FL7D 4Z8YA 3LNCA 2XZOA 5KYKA 4ZDIA 1NBME 2JLYA 2ONJA 4OBEA 3OFND 1JALA 5EXSA 1CIPA 3QKUA 3QKTA 5CITA 3TJZA 1G8FA 3I62A 4GBMA 4URZR 4X8OA 1MOZA 4IVRA 3PEWA 1U8ZA 2GKSA 3V4RA 3UMSA 2BBOA 3GJXC 1W48A 3TKLA 1GKYA 2DWOA 2A3RA 2ODEA 4NONA 1UM8A 1DBSA 1P73A 3ZZUA 5FR1A 1E69A 1KDTA 2GZHA 2H7VA 2RGNA 1FOEB 1GUAA 3WP0A 5A5GA 5BN3A 3CH4B 4M21A 1VG8A 3QXCA 4BWYA 3EWSA 1J2JA 3UK6A 2P65A 2DBYA 2J0SA 2R2AA 3MWJA 3GPLA 1YR8A 4Q01A 1IQPA 4Q4AA 4FINA 5EJEA 2OFXA 3PFIA 1FQKA 2A5DA 4CT4B 4R7ZA 2HDNB 3RDPA 3RS4A 1R8SA 3W3AA 4QGHA 2OZEA 3WYAA 2NZJA 4OJKA 3RRMA 4DC9A 2H92A 4C2TA 5FBWB 2YHSA 3DZDA 4TYNA 4MGKR 4RFSB 1DAKA 1I4DD 2WKQA 1R10A 1SXJA 3PUYA 4TQAA 1Z0IA 4B73A 3SJBA 4QHTA 4XWKA 1SVLA 3B1VA 2ZEJA 4QM6A 4QM7A 3D7MA 1QDEA 4DLWA 1UBEA 3Q8XB 1ZINA 4LJ5A 4OJQA 1ZIOA 1NSTA 3FOZA 4PC3A 1IN7A 4BASA 2V6JA 1CXZA 2WJYA 2YOHA 2VH5R 4MYTA 4RSGA 1JJVA 4M4SA 5LD2C 3AP2A 4ZDKA 4Y0VA 2PCLA 4PHHA 3IIKA 4GOKA 5LD2B 1E99A 3QNUA 2WIAA 3QSYA 3W34A 2MSCB 2NZ8A 4FI3C 2OO7A 1R5BA 2ZSEA 4BLOA 5JRZA 1HH4A 2WWIA 3EIEA 3VTKA 1IY2A 4ESHA 4Q9LA 4L9WA 4OKSA 1IJFA 2QMOA 1U94A 5JRJA 1ELOA 1JB1A 2V54A 1QF9A 3FHTA 1OXTA 3GMTA 4OK3A 2QNRA 2FN4A 5AUPB 3B9PA 2IWHA 4G5SA 4DCUA 3SZRA 2CJWB 3VKGA 4TYPA 2VP2A 1CF4A 2ZREA 4BECA 4F4CA 1W36D 2ZAOA 3NWJA 1JQJC 3LA6A 3UANA 4ARZB 4L9SA 2WPDD 4DLRA 1J90A 2ZE5A 5ELXA 5HE9A 2YVUA 2XSZD 2QTFA 4MGIR 1Q20A 1NBMA 3E70C 4JLKA 3EZ9A 4KBGA 1JR3E 3RWMB 3NC0C 2LWIA 1YJ5A 3OEHD 1R2QA 1YR6A 2VEDA 3Q7QA 2ZSAA 2DHRA 4KLNA 1HE1C 2QQEA 4ERNA 2J1LA 5JWOA 4DKXA 1KJYA 1U81A 2UZ3A 4PPQA 2F3RA 3I72A 4PC6A 4TL6A 1GOTA 1WCV1 1KNXA 3UXMA 4LC0A 3CLVA 4GZLA 4BFXA 4EFLA 5JSZA 5LB2A 5FOWA 2ONKA 3K1JA 5E7JA 3LAWA 5FUWA 1E79A 2G88A 2C99A 3OE7D 4FCTA 4YMWA 3FKSA 3SQXA 3T5DA 3FYHA 4HB2A 1XPUA 1ZW6A 1R0ZA 5EP2A 2PLFA 4G5OA 4JBWA 3RRZA 4NYJR 3GLHE 3WY9A 5BYKA 3RABA 4NDZA 2F9MA 1N25A 3F3YA 5BWMA 1GWNA 1ZNYA 4II7A 2N1BA 3CX6A 1Z07A 4D0LB 4Z51A 2OEPA 4XTRA 1W4AA 3RNLA 1XXHE 1KYIA 1SVSA 5CIWA 1G3MA 1FNMA 1Z6TA 2QSZA 2H17A 2DYKA 2ZVQX 3P20A 3G0HA 3AF0A 3H84A 1S96A 3N70A 1UFQA 1ZVQA 1OPXA 2EW1A 2AD5A 4LBZA 3REFA 1TL7C 3GLGB 2JLVA 1TF7A 1TQ4A 2GZAA 2VQSA 4YQFA 1LW7A 4GSYA 4HLQB 4Q9KA 5IDVA 5JS8A 4JLDA 2ZJOA 4JIMA 4B3XA 4DZZA 3EPLA 4U5XA 1E2LA 1NIPA 5JI2E 2QU8A 1N5IA 4QOSA 4TMXA 4XVRA 2BM1A 1R7RA 2QZ4A 2GHIA 4JLOA 3CNNA 4OI0A 4NE2A 8OHMA 2H8KA 5FTKA 3ZH9B 2WM9B 1DG3A 1KHTA 5CB6A 1SULA 1EGAA 3NIBA 3A58B 4MRRA 1KSFX 1XEXB 2IK8A 2VF8A 3I92A 2DFLA 1KDPA 2FJUA 2VTKA 4MYHA 1U0HC 2D7DA 1TQDA 1W2GA 2DFKB 5EE5B 4DJTA 5FPKA 3PEVA 2GF0A 4BEJA 2IS4A 4AYXA 2GTPA 5IK2A 1DTSA 5KDOA 3SBEA 3TR0A 2W0MA 3VX3A 1UF9A 2GJKA 5FBRB 4DWJA 2C9CA 2WKPA 2X77A 3AUYA 5FTNA 2RGAA 4I1VA 2W2XA 3ZJYA 4JZKA 4RZXA 1WQ1R 2BBWA 5E7MA 1BOFA 2ZS7A 1XB2A 4TLCA 3VMFA 4AKIA 3WRXC 1P9RA 3I3SR 4RD6A 1YRAA 3R20A 2PT7A 3TBKA 1KZGB 2C98A 2WWXA 2ZRCA 2J0UA 3Q5DA 1CRQA 3QE0A 3DDCA 3QPWA 3TQFA 2P6NA 4Q4JB 3FGNA 1JPJA 4J0QA 4US1R 3V00A 4MRVA 4DSTA 5JWRA 4DSUA 4D4JA 1NL3A 3DVLA 1W0KD 3THYB 2J41A 1FPMA 2PZFA 2QAGC 3VR6A 2J7KA 3ASYA 2ZS8A 1T9HA 3AKCA 2ANCA 3VNVA 1OHHD 4HB0A 3UKDA 1XU4A 3HDTA 2W6ID 1T3LA 2H5EA 2QAGB 2ZRHA 3KQKA 1B0UA 2YC4C 2QMUA 1GRRA 3LQQA 1KO7A 1Z06A 4ON9A 4WZBE 1KY2A 4HZUB 2G0NA 1VKJA 4HATA 3EX7C 3B78A 3BH6A 2W6JA 4Q48A 5AJYA 3CB4A 2B8TA 1X8KA 3SN6A 4FCWA 2I3BA 3GLHA 5H1YA 5KNDA 2VP4A 4UJ3A 4D80A 1KSJA 3KJIA 4UXHA 4AWXA 3DOEA 3NHBA 3MAAC 3VR3A 3WNDA 4EJSA 4DRZA 5KSOA 3AVTA 3EIHA 3LXXA 2O5VA 1H8ED 2QM8A 4D2IA 1G5TA 1MR3F 4O2RA 3SFZA 1N6NA 2V55B 1Z28A 2QAJA 3FMFA 4IDOA 3WBJA 1XNJA 3SI7A 4CF7A 2W58A 4QC2A 4BRWA 1GG2A 1SZPA 4JMPA 2WTUA 1AS3A 1QHNA 3JZMA 4Q7KA 2HLDD 3OESA 1GVNB 4M1SA 1FX0A 1G6HA 1UDXA 1J8YF 1KAOA 2OBMA 3FKQA 1XTIA 2EFCB 2HJVA 4BLQA 5FBVB 4M1OA 2FPMA 4NL4H 2YYZA 5CM9C 3ZZ0A 4LK2A 1R0YA 2ZRJA 2RMKA 3IILA 2ZROA 3R9IA 1P4SA 3SJCA 5KTYA 4PPGA 1Z0JA 4URYR 3OZXA 4AKGA 2AR7A 4P3YA 3NEJA 5EE9A 2FFAA 2Z4SA 5L3SA 5K8UA 2P5TB 4EDHA 4B74A 3CIOA 2IYLD 3HR7A 5TB5A 4MYUA 1CRPA 3LV8A 2WV9A 1J8MF 2YWFA 1XD2B 3Q5EA 3F5FA 4GRAA 3GCGA 5GJBA 2VP9A 2KBEA 1IBRA 1DAIA 3TLXA 3C4JA 3WRYC 2O8BA 4E09A 4D82A 1G3RA 1Q1ZA 4UNQA 4ZIRA 1W46A 2V1UA 2WIBA 1VIAA 2GCNA 2IYWA 4V02A 4LYJA 4P0TA 3T06B 4KFUA 1HA3A 2J45A 5J40A 2NO6A 2QPAA 1MRSA 2V7QA 4DCNA 3TUZC 1KAGA 3U3MA 1N6LA 3TK1A 1EXMA 1S3SA 2BCGY 3K0FB 4MUAA 1QHGA 4QBFA 3SBDA 4DLTA 4C9BA 3IQWA 4M1TA 2SHKA 1RIFA 1ZNZA 2ZR9A 1Q21A 4JSTA 3GLIB 1NMYA 3M0EA 4LOAA 2HF8A 1E1RA 2AL7A 1A2KC 1J99A 5JFGA 3ZQJA 2IF0A 1DAGA 2RB4A 2R6AA 2HXYA 3Q85A 3IQXA 3SR0A 1Z2AA 4HUTA 1P61B 1FTNA 2W2VA 2EWVA 1RVDA 4O2LA 1P72A 2FSHA 1F5NA 3PCRB 3U4QB 4JL5A 2ZJBA 5SZHB 1N3BA 5KU1A 1UPTA 2A2ZA 1VHLA 3DMNA 4Q4HA 2WWWA 1OXUA 3NG1A 3OIYA 2HT6A 2D7CA 4EPRA 4DDVA 5JHHB 1HV8A 4GP7A 1NF3A 2AKAB 4BLTA 1G3UA 1F2TA 1Z2CA 3MCAA 4OHVA 2CNWA 3KTAA 1COWD 3BORA 4U7DA 2QEQA 5G3ZA 2PZGA 1WBDA 1YZKA 3B5JA 1O87A 3A1TA 1GL7A 1KJZA 1T5LA 2Q3FA 5EE3A 2OFWA 2G3YA 4DEYA 1RFLA 3AGQA 2D2EA 4JYBA 4MKGA 2RHDA 5D3QA 4CEHA 1KMHA 4XSHA 3IEUA 5TV2A 4OHWA 5P21A 2WHXA 4ZKDA 4XVUA 2FU5C 1YZQA 3W5JA 4LJ7A 2R6GA 4C2UA 1YHNA 3QENA 4B6FA 3AQ4A 3L8ZA 4OQLA 1H65A 3CONA 1MV5A 2OUKA 2RGNC 3IBYA 4XD7D 4L16A 5FL7A 5GJCA 1ZAKA 2X2EA 4B32A 1D5CA 3AP1A 3U6KA 3X1XA 1XCMA 3QXXA 1EFCA 2FNAA 3CRW1 3IO3A 3MFYA 3OFNA 1XZPA 1XMJA 4TN1A 1X8LA 2QMEA 4B34A 4DB2A 4XIGS 1BMFA 2FGKA 1Z47A 5DYGA 3WMGA 3T1QA 3IPYA 1M6NA 1TU3A 3QF7A 4PFSA 1MO5A 1S1MA 1G3QA 4IEEA 1T3SA 3BH0A 1NLYA 5AJXA 2X8AA 4LJ8A 4N0EA 4FCVA 2O8DA 3MMPA 4YC7A 4JLPA 1HT1E 4KVAA 1KMQA 2JLXA 4OHYA 1SXJC 1WMSA 3BIFA 3H86A 3L0PA 4Q03A 4QNRA 4G1UC 4BZQA 1MKYA 4OQMA 4BZPA 3CF2A 3O8CA 4DBLC 2KB0A 1SXJB 4NCIA 1E2IA 4MKHA 5LDDC 4Q9HA 1V43A 2NO0A 2CK3D 1IN6A 4X8LA 2ZJAA 4RZUA 3KB1A 1E2HA 1BYIA 2NPIA 5CJ2A 2YWEA 2D06A 4V0KA 5A0FA 4B76A 1WDTA 2W83A 3FB4A 1ZIPA 2AK3A 5DGXA 4TL9A 3TNFA 2VPPA 4A4DA 1IN8A 2QE7D 2QRNA 2EYQA 4XWAA 4IFBA 4PQFA 2ZRPA 1R4AA 2J0QA 4PSVA 3OF5A 3BERA 1VYTA 1SVMA 1VYUA 2QMHA 221PA 3ZDQA 2AN9A 1KZ7B 1GKUB 3QXHA 3E5HA 5JCZA 1HY3A 2H57A 2FZLA 3GJ8A 4F92B 2ZRAA 1ZUIA 3TGPA 3QBVA 4EIWA 1J7KA 1KIMA 2NO9A 4TZ6A 3L0IB 3CWZA 3LXRA 4LYAA 3SYNA 1OXVA 4FIDA 4Q7JB 1KI4A 3Q9LA 4BGDA 1G7SA 2XNSA 1NN3A 1TMKA 1UKYA 2J87A 2ATXA 2OM2A 2WOJA 4GT1A 3X1WA 2WJJA 5H70A 1T8TA 2EFHB 4CDGA 1DOAA 3TMKA 4PZYA 4F93B 4TSFD 821PA 5DN6D 5JJIA 5JLJA 1KI6A 1E94E 4NCKA 2Z83A 2XNDD 1E6CA 3QOFA 1R5NA 5K8IA 2HJGA 3FMPB 5G40A 3ZD6A 4P32A 3M4YA 3LO5A 1AK2A 1SVIA 3P26A 1OFIA 3W8RA 5FTMA 5KDLA 1OKKD 4ZCIA 1MO3A 1Q12A 1NSFA 5EQTA 2IHBA 5EZ6B 4D4KA 3NEYA 4CZ2A 4JLAA 1FFHA 2WPDA 3BK7A 1HTWA 3W9YA 2XSZA 4JLVA 4M2LA 5JSZB 2B6HA 1JXOA 2RH5A 4GFDA 1S2MA 4P4TA 2XTNA 3OEHA 4IDNA 1P60A 1TNDA 2L0XA 2I4IA 2WJVA 1GFIA 1IY0A 1VCMA 2GZDA 2BHRA 2CLSA 2OLKA 3TSZA 4C0AC 2H18A 2OHFA 3RS3A 1RC8A 3VHLB 5TMPA 2FSGA 2XJ9A 3KJGA 4TLDA 4ABYA 4IOKA 3WBKA 5F9FA 1K5GA 4HAUA 1VPLA 1CR1A 2EFGA 4DB4A 4NH0A 4OL0A 3JVUA 3SDZA 2J7PA 3BXZA 1NJGA 2ZAMA 3FE2A 4M1KA 4KSCA 4YXWA 3QG1A 4WBSA 4WOPA 4G5QA 1E2DA 3AVVA 2RGEA 1ONBA 1X3SA 3MJHA 4UXIA 3MGCA 5CK5A 1ZD1A 1E2JA 2WMOB 4XTCS 1SHKA 4CGZA 3LFUA 3HPRA 3VNUA 3QKSA 1QVRA 4Q1DA 3BRWD 4DCVA 2ZM5A 4NCNA 4E5UA 1MO6A 3R7WA 4N0DA 1CJUC 4JLJA 2IEZA 1N6KA 2B92A 4FMDF 3QVVA 1U99A 3RHFA 4C0KA 2VHTA 1EFTA 2GWHA 3P32A 2XOKD 1EFHA 3QG5A 2FG5A 1IXRC 4NBSA 4ZI3A 4BFYA 1HUQA 1YQTA 5G53C 1DE0A 3CNLA 2OFOA 2Z4RA 5HE8A 1OH5A 4LV6A 4MGYR 4L15A 4MRPA 2WWYA 2ZRDA 5SZIA 1SVOA 1PLLA 5DI3B 2UKDA 5CDFA 4KAXA 2JLQA 2OXRA 3AV0B 1F3OA 5CLQA 3QXSA 3DOFA 1CJMA 3B13B 3M6AA 4KV9A 1W0JD 1G20E 4URVR 1U0LA 3AVPA 4QGGA 2F1RA 1JAIA 1AJEA 4C7OA 2MMCA 5FI1B 3VR2A 1QHYA 4M1YA 4PXAA 2J0UB 2I1QA 4QHYA 3GJ5A 5EP1A 3O47A 2WSSA 2XEXA 2H16A 4DSOA 3Q72A 4PAQA 4PC1A 2JJ1A 4MDFA 1YU9A 3AVQA 3I1FA 3AF2A 2ZVPX 5DI9A 4DLVA 1IAQA 4R2IA 1G7TA 1E1QD 3B1XA 4K46A 1S3GA 1W5SA 1Z22A 2R44A 5A4JA 2YWGA 2E87A 3MLEA 1G5RA 4UNPA 3WYGA 4C0BA 1YZNA 4IOJA 4URWR 2XTMA 2OCYC 4CYMA 2QGZA 4QBIA 2HCJB 3W6OA 1C1YA 1NVXQ 2HF9A 3NTUA 5HZHA 2BWJA 3GJ7A 3TVTA 2X2FA 4LJAA 3R9XA 1YVDA 4Q1BA 2QTHA 4RD4A 1W0KA 5BXQC 1H8HD 1L4UA 5C46F 2H1LA 1Z3IX 2OESA 4DT1A 5L3RA 4IHQA 3WNBA 4EPXA 3GLHB 4EJSC 1NRJB 2EFEB 2VHUA 4Q9IA 2RKOA 4NYIQ 1OHHA 3L82B 2W6IA 4M9XA 1ZC4A 3RANA 2JGNA 4EJSB 1HURA 4OYHA 1EX7A 2OV2A 5IT5A 5FUVA 4Q7MB 1C4OA 2ZJ5A 1E9EA 4Q5IA 5KNCA 3BGWA 5JZVA 1U9IA 3FWYA 1Z0FA 2ERYA 4QL3A 4YLGA 1L8QA 3C14C 1I4LD 3A1VA 4A8JA 5AUOB 4OQFA 4ITRC 1KO4A 4DLUA 4JL8A 3AEZA 4P4UA 5ANRB 2F1HA 1CR4A 4HB4A 4A6XA 1X8JA 2O52A 1ZP6A 2FMXA 4HZUA 1RJ9A 5EXTA 1ZYUA 5AUNB 1H8EA 4GNKA 2AK2A 1FX0B 3VHXA 2ZS9A 3WMFA 2A5GA 1V5WA 1D2NA 2QGNA 2F1IA 4GMDA 5EZ5A 1MH1A 4C0QC 4IDHA 4W5WA 1U90A 2OAQ1 3N2EA 4PO1A 2ZSBA 1XX6A 4O0MA 1M34E 3LD9A 4UJ5A 3ECCA 1TUEA 3PUWA 3QI2A 1XJ0A 5L3SB 3QF4A 1KK3A 1UKZA 2HLDA 2FE4A 3AUXA 4IJMA 3K9GA 1NLFA 3HU1A 2C04A 2ERXA 2G1KA 2J3EA 1NN1A 2O8BB 3ND8A 1W49A 1KTVA 4ZO4A 4ZIRB 3DM9B 1OW3B 3LH5A 1HEIA 1X1RA 2QBYA 1N0WA 2PEZA 1FL9A 4EQ6A 4G3XA 4GZMA 1NVVR 2C95A 2GJAA 4OI4A 4AKEA 4BQSA 4E03A 2BCJQ 1SGWA 1VTKA 5CLLA 3CRVA 1UKVY 2XGJA 1SQ5A 5HPYB 3X1ZA 4TT3D 4B33A 1G8YA 3GFTA 3U3RA 3KKQA 1CULC 4RVCA 4YMUA 4MGZR 1ESMA 2G9NA 3EA0A 4Q18A 3EZ7A 1AZSC 4LDJA 2PX3A 4WXPA 4A2PA 3THXB 3FDIA 5JS7A 5KUTA 1DEKA 4C0HA 1UKEA 4WZ6A 3A1SA 3TAHA 4JVSB 2XZPA 1N5LA 4AKHA 3LX5A 3R8FA 2XAUA 2QT0A 5JHGB 2IC5A 5FBQB 1JJ7A 5F98A 5AR1A 4CEIB 2TMKA 2CCGA 2ECKA 2QENA 1XEFA 4G5GA 1XEWY 2ZJ2A 5F2EA 2GBLA 5C4MA 5JJKA 4U00A 2OCPA 1ZM4A 1EWRA 3EA5A 3IEVA 4CIDA 1ZD8A 4AG5A 4ZKEA 121PA 2PEYA 2XZLA 1E9BA 3CF0A 1XDBA 3T61A 4W9MC 4Q4HB 4P31A 4R9UC 3BWDD 1RRFA 2A7QA 2FSFA 4M8NE 4RZ3A 1KI3A 4OI2A 2ZQ5A 1F2TB 3CPEA 3HP1A 5FOSA 5L8VA 1N6OA 3KTAB 1W2HA 3IUYA 1E0SA 5KSYA 3UMFA 2IUSA 3C16C 2C9YA 5LB4A 1XTJA 5AJZA 1A1VA 4V03A 1PV4A 2YINC 2WAXA 4ZDJA 2J9RA 2WZQA 2XXAA 4DVGA 1OXXK 1XTKA 2QTVB 3CX7A 1D8TA 2IYTA 3W3ZB 1A2BA 3X1YA 4CEHB 4A92A 5GJWC 1KMHB 1OIVA 2VSFA 1COWA 1NKSA 4HLUA 3PEYA 3K0AA 1Q3HA 1UBCA 1TTTA 4LJ9A 4PPFA 5CM8B 5EXXA 3SHFA 4URXR 2ZRFA 3AM1A 3W8NA 2JDID 1DADA 4A36A 3VKHA 1KI9A 3KKPA 2QQ0A 2WOOA 2BKUA 3AF1A 2CCJA 3AKDA 2PL3A 1Z83A 3QPUA 5TDHA 3VR4A 4M53A 2NO7A 4QGFA 5CYOA 4HAXA 3QBTA 4LYFA 2ANBA 1FNNA 3S1AA 3UG7A 2RCNA 4NCHA 3FMIA 4LRWA 1L2TA 4KU4A 1XF9A 3CPHA 1W5TA 5HR5A 2P6RA 3A6PC 4TZ0A 3V4FA 3BC1A 4F4IA 2EQBA 1CTQA 2O8DB 4OK6A 1G291 1XMIA 5K8TA 4EKDA 3K9LA 5B64A 3BFKA 1JR3A 4LHVA 1CS4C 2YKGA 2P3SA 1GITA 1P62B 1II8B 4NYMQ 3NVAA 2KBFA 1TPZA 1Z63A 4PC2A 2LKDA 3MUFA 2VA8A 4LJ4A 1YE8A 3ZVNA 1T0JB 4TMKA 1XPRA 1RRCA 2GXAA 1TX4B 1FZQA 5DE3A 2VHCA 4A1FA 1ANKA 1NY6A 4JYCA 2PX0A 1KI7A 2CE2X 3D3QA 3TRFA 2J5XA 2OAP1 3FMOB 2FFBA 4Q1EA 4WW0A 5FOUA 4LPSA 3ZIAD 3THWA 4A2WA 2ZE8A 2QM7A 2J46A 2CK3A 1TU4A 3AF3A 4IRUB 5B57C 3QXJA 1OXSC 3A1UA 1HYQA 2CXXA 2IUTA 5KPJA 1XXHA 3EZFA 3PG5A 4TTRA 4Z1MA 5L3VA 3U3JA 2ZYVX 5CJPA 3VR1A 1IOZA 1D2EA 2WJGA 3IBGA 3BJIC 3WYFA 1Q57A 1E2KA 2YOFA 4RCYA 1A7JA 2QE7A 2ZJZA 1TEXA 3IKJA 4KFTA 4AURA 3GLGE 2V1XA 1RRPA 1ZUHA 5E4FA 1EX6A 3TQCA 4XJXA 3GJ6A 3C7KA 5AUQA 3NHAA 4JBXA 4DUGD 4A6PA 4Q1CA 4Q47A 2HUPA 3CUEF 2DCUA 4RD0A 5J4VA 3GJ4A 4QNMA 1A4RA 1E2FA 2BJWA 2C96A 3ICEA 3A4LA 2EYUA 1Y63A 3EPHA 4JL6A 2QROA 1KI6B 3QPVA 4TL7A 1LF5A 4B3DA 2WBLC 1BO6A 2CBZA 3OAAD 4DHEA 2X19A 5DHAA 4PTLA 2W00A 3IHLA 4LYHA 4H1UA 1N6RA 1XD9A 2A78A 1GM5A 2FOLA 5FL3A 1OFHA 3W90A 3TVDA 3GEIA 4TL8A 1FMJA 4TSFA 5FH9A 1MABA 2OE2A 4MA4A 3L0SA 3HU2A 2XNDA 2JIZA 5FFMA 1U8AA 2RGBA 3U3OA 4DLZA 4JVMA 4BFSA 1KSHA 3GFOA 4TYQA 3DM5A 3RVBA 3SEAA 2IF2A 4I1UA 2WKRA 1LB1B 1ODFA 4V0OA 4DEXA 4P4SA 1FP6A 1ZD9A 2R62A 4A82A 4ARZA 2REOA 3U7HB 2Q9CA 3QKRA 1SKYE 3QJYA 1E96A 4C0SA 1NN5A 2FV8A 1WF3A 2BV3A 2CEAA 1GKIA 3GEHA 3NBXX 3RC8A 1T5IA 2IYZA 1XEWX 2GK7A 1NKTA 2IYXA 2ZETA 2Y8EA 4ASUA 1Z0KA 4YMTA 4GOJA 2GAOA 3TH5A 5CYPA 1ZU4A 1L7VC 4NCJA 3TUIC 3KB2A 3CBQA 3ADCA 3TR5A 1M74A 4E07A 2ZPTX 1P2TA 4RZ2A 1G64A 2EFDB 2ZR0A 1B23P 3QKSB 2DB3A 1N0UA 3CWQA 3CR8A 3R7WB 1Z6GA 3AVOA 4B2PA 2HV8A 2FH5B 4RD3A 3M1IA 1S1CA 2DFNA 3QEJA 4R98A 3MWYW 1OYWA 4W5HA 4D0GA 3MD0A 3C5CA 4IDQA 4V0LA 5LPNA 1U8YA 4JT4A 2G77B 3LBIA 2O8FA 5J4YA 5H8WA 2FDCA 521PA 2C8VA 3LW8A 3PIRA 5C1BA 1CJTC 2YNMA 4KODA 1NMXA 1GNPA 4UNNA 4M9SA 4DCTA 2PCJA 4RKEA 1NMZA 4O25A 2O0HA 721PA 3O8RA 2ZJ8A 2DPXA 1ZM3A 5J4LA 4AIIA 4O3MA 2VRWA 2XOKA 1NG9A 3GLGA 3K9HA 1EG7A 3H4MA 2IXFA 3RLFA 3IDQA 1OH8A 1U98A 2BC9A 4NMMA 3KX2A 4IDPA 1FTSA 3I4LA 4URUR 4C7OB 3KKOA 4LSGA 4PX9A 4HLCA 1O3YA 3EARA 4EFMA 3BS4A 1AA9A 3IO5A 4BRUA 3U7EB 4YMVA 5KDDA 1WRBA 4G0NA 4TTQA 2IYQA 1CR0A 1E0KA 3JVVA 4C4PA 4A15A 3RSLA 1C9KA 2QP3A 3CPJB 2K5UA 4YDHB 3SYKA 2B7BA 4AYWA 2GILA 4Q4AB 1P5ZB 3AVXA 5J4KA 4LY6A 2NOAA 3DPUA 1UJ2A 4LGMA 4W5JA 3EPKA 4GMXA 2CMKA 4WZAE 1FMLA 3BB3A 1KO5A 3PUXA 3E2IA 1IXSB 1E1QA 5B2ZA 4JJZA 3BAFA 2JLWA 2ZSDA 4KHZA 4V0ME 1OJLA 2JJ2D 3GP8A 4DT1B 4X8HA 2RGDA 2CE7A 1QHHA 1LF0A 3F8TA 2OBNA 1E0AA 1AKEA 1ZRHA 5DSZA 4KLZA 1XWIA 3UMRA 3P27A 1D9ZA 2QUZA 2WWHA 1U9IC 1Z0AA 5JEDA 1ZNWA 4KO8A 3HJNA 4A8JC 3FHOA 3GLIE 2W6JD 5B30A 3KQNA 1H8HA 3NDBB 2GJSA 2JASA 3KQLA 4A8JB 1M2OB 1T91A 2ASEA 4GDFA 3EZ2A 4PSAA 4FW9A 4D26A 4TLAA 5AWFC 2WWFA 2IYRA 3FFAA 4MYCA 4ACBA 1ZM7A 1E3MA 4AI6A 1UADA 4F7WA 5F9HA 2BBTA 1AGRA 3KUCA 1RJ9B 1PUIA 3EG5A 1DO0A 1R8QA 2W2TA 3EZ6A 4FXPA 4D6PA 1GILA 5DIFA 2PJRA 3CM0A 1GNQA 1KI1A 4KVGA 1E4VA 1GAJA 4B3GA 3HYTA 3CZPA 2FF7A 4BLPA 3KXKA 3BH7A 3KZ1E 5M04A 1S9DA 4ESVA 3P1JA 1NN0A 3VFDA 2LKCA 6Q21A 2YWHA 1GNRA 2QP4A 5AJWA 4KI0A 4A9AA 2ORVA 5BYJA 3LBNA 3QF4B 3BOSA 1VIYA 2FGJA 3ASZA 3BFVA 4QXAA 1I4TD 4TYYA 4CVNA 4LI0A 1P9WA 2R8RA 3CRQA 4Y0AA 3ZD7A 3ADDA 2W0SA 2GCPA 2QBYB 2G1JA 3F0TA 4DIDA 2IW3A 4V0NA 1KKMA 3CR7A 4EQ6B 1LS1A 4M22A 1IM2A 3QUSA 2ZANA 2B8WA 2ZYUX 3I8XA 1Z5ZA 1XTRA 3TUJC 2HXSA 2FFQA 1KI8A 2ZR7A 3RS5A 4B3CA 3ZS8A 5FPYA 4Q21A 5AJVB 3VAAA 4YONB 4NYJQ 4PHFA 1E4YA 4PO9A 5DLQC 4JJKA 3GLFE 4TLBA 1E9CA 1F2UA 5TY0A 2C9OA 2GBLC 1E9SA 4TT3A 3MWKA 2OG2A 3ADKA 5C2JB 3A1WA 1LV7A 2QRZA 2R6DA 5FPSA 4MDEA 2LCFA 2HT1A 4KYUA 2VSXA 1GTVA 3OE7A 3W5IA 1Z8FA 2IT1A 2CHGA 2GESA 3IHWA 1YR7A 3SNHA 4F91B 2AWNA 1S4QA 3FTQA 2IA5A 3OIUA 3T5GA 3UWKA 4V0MA 3BFXA 1T6NA 1P3JA 1D2MA 1Q1BA 2XITA 4PQRA 3WMEA 4JKYA 4BLRA 2R9VA 3K0FA 2JLZA 4KFSA 1W1WA 4LBWA 1VHTA 2KJQA 3CRMA 4MRNA 1Q44A 3RS2A 4M9ZA 2C03A 2ZYTX 3P4YA 4FWTA 2UZIR 4HLUC 1ZCBA 1JI0A 2XXAB 2VO1A 5EE0A 1N6PA 2GA8A 4H1VA 5DISB 2XB2A 2CNWD 2OCBA 1IHUA 1G21E 4S2EA 4DDWA 3U2QA 3K0AB 1G3IA 4IOMA 4B43A 1WXQA 2JA1A 1G18A 1RE0A 4GP6A 1L4YA 5KSPA 1JBKA 3N2IA 3CZQA 1LFDB 5EE1A 3VQTA 4Q00A 4BE7B 1WP9A 3EPJA 2WWGA 3VR5A 1PZNA 3S1AB 1E32A 4MRSA 3KQHA 3DL0A 3W6NA 2ZUDA 4PSKA 1WB9A 5KNBA 2Z43A 4KSBA 4UQOA 3VU9A 4QG7A 4KITB 3H2YA 3UWOA 5JEEA 3AVYA 2C78A 2GCOA 1TQ2A 2Q0HA 1YZGA 1E9DA 3KQUA 4NP6A 4MKIA 2G6BA 1GL6A 4JLNA 1BMFD 2CLDX 1PUJA 2JJ8A 5FTLA 4CEJA 4UKDA 1TF2A 3DEFA 1F6BA 4B2IA 2ORIA 2QT1A 3PJRA 2AX4A 1PVOA 1GDDA 3NBFA 1AS0A 4QJ3A 1R5OA 2XB4A 1OFTA 1YZLA 1ZJ6A 3K0CA 3E1SA 1US8A 4NTZA 2D2FA 4LBYA 1G8PA 4HUQA 5D3MA 2NO1A 1MRNA 5KSZA 3GLFA 2Q3HA 3THWB 3U7FB 1AS2A 4WXRA 4BPBA 4EAQA 3HYRA 4BFTA 2GXSA 2RGCA 5HKKD 2EVWX 2IYSA 1NG1A 3NXSA 3A4NA 5FOXA 4KBFA 3PV0A 2D74A 1EFRD 1XXHB 3I73A 2O0JA 4LHYA 2HCBA 4R2HA 5IRCD 2ZI5A 5TVKA 1M7BA 4OK5A 5EP4A 4Q02A 2Z0MA 4JLMA 2ZRBA 1NP6A 2CL7X 2DWPA 1OT3A 3ZIAA 1OIXA 1CJVC 3B82A 3ZZTA 3UG6A 2MSDB 1G19A 3DZ8A 4P33A 1T4GA 3ADBA 2YV5A 4IVQA 2VF7A 5BW8A 1P2VA 3KJEA 4B71A 421PA 4PHGA 1YRBA 2F43A 2A5FA 2VHJA 1OYYA 1KOFA 3U44A 1NVWQ 3KXIA 3SJZA 5JCPA 1XBTA 3LLMA 2IS1A 2OILA 1NI3A 4Q19A 3EC1A 4GOXA 1U0JA 2WJIA 4NHOA 3K70C 3ZVMA 4AG6A 4N1AA 3JZAA 4DLYA 4DDTA 1BS1A 2QPTA 3D6TB 1E98A 4IXMA 1VECA 2WMNB 1FW6A 2PMDA 2ODNA 2ZUCA 3K70B 1IN4A 1KGDA 1YZTA 2QY9A 3AH8A 4DUGA 4FN5A 2O8CA 2CCKA 1DAMA 4BLSA 5LBIA 2BMFA 5CK4A 2ZI3A 3ONWA 3KUDA 1MABB 1IXZA 1P2SA 2NIPA 2DR3A 2ZI7A 3Q3JB 1MO4A 1XTQA 4PQYA 2Q9AA 1S0UA 2YOGA 2ZJYA 3OAAA 1E9AA 2PLRA 1AN0A 4RJLA 4AD8A 4XWOA 1QZXA 1XMSA 1NLZA 1Z29A 4TLEA 4WAUA 4D81A 1OB2A 3EIQA 4HAYA 2QORA 4OQXA 3GJ3A 4EPYA 4G5RA 1AGPA 4P4SB 4PAMA 2VP0A 4XSGA 4C30A 3B2EA 3OEED 1UEJA 3I32A 3H0KA 3QKRB 4QBHA 3VX4A 2G0TA 2A30A 3K09A 5DH9A 2BDTA 2ZI6A 4JVLA 4K8OA 1DAHA 5J47A 3LWNA 1R6BX 4PO8A 1XP8A 2F6RA 1EESA 2ATVA 4POAA 3CW2A 4LHXA 5IF9A 5J4HA 5L3QA 3EXAA 4LJYA 2QSYA 4US0R 1OH7A 3U5ZB 1G16A 1N5JA 2O8EB 4IW3B 1GRNA 1CU1A 2GRJA 4IFEA 3T1OA 2PBRA 5JJLA 2CL0X 2J7PD 4G01B 4YXWD 4TMTA 2NMVA 4QFMA 1Q1EA 3AF4A 3B1WA 1LNZA 1JAHA 1AKYA 1P2UA 1OLOA 2BMJA 1GZSA 4WA7A 1SKQA 2KE5A 2FZ4A 3LQRA 1EWQA 2AKYA 3CH5A 1Z6YA 4HI0E 2BM0A 2VP5A 2CL6X 5HZKA 3T35A 2NPFA 3FPAA 2QA5A 1RYFA 3PR1A 4BZXA 2ZI4A 2O8FB 1W4CA 5DYIA 1IONA 5F3WB 4OQNA 1N0VC 3B7GA 1I2DA 2BIFA 5SZJA 3NC1C 2REXB 1ZC3A 1Z6XA 1XPOA 3MSXA 1UBGA 4D4MA 1TUIA 5FBLB 2IS6A 1E2EA 1K5DA 5G41A 2VLIA 3WNCA 3SS8A 3FVQA 3NH9A 5FR2A 3C41J 5GJVC 1D6JA 4ZDWA 1R0WA 2IS2A 1S8FA 2F1JA 4Q9JA 5FUXA 3ZS9A 3PQCA 4H9GA 3B85A 2YZ2A 4UNRA 4JVNA 2R6FA 3EASA 2CVFA 3U3KA 2F3TA 4HDCA 2IBMA 4B47A 4I1SA 4TMWA 5DO9A 4K81B 3I5YA 3B6EA 1S9HA 2JEOA 1PJRA 4LUCA 3D8BA 4DLXA 1TQ6A 1E2QA 1N6HA 2KI5A 3ND9A 1OFUX 4D25A 5HCNA 3DKPA 2IWRA 1WBBA 4LHWA 1E9FA 3IIJA 4PANA 2PT5A 4LV8B 4DDUA 1XCGB 1K8RA 1XJQA 4XH9B 2IUUA 2GVZC 4ZCMA 5AK0A 1P6XA 3A36A 3L2OB 1F48A 5DHFA 3FFBA 3O8BA 3U60B 4AYTA 4M1MA 5C18A 1G9XA 3I61A 2D4HA 4EPWA 2HYIC 5DI3A 2PMKA 4XD7A 1PLJA 1ZUNB 3AB3A 2IXGA 2WSSD 4TMVA 3DHWC 2JJ1D 4TQ9A 4RCZA 4HDOB 1Y3AA 4LWZA 3SYLA 3B60A 1HQYE 2NGRA 1VDZA 1YZUA 4IOLA 2JLUA 1DG1G 2OCAA 4TQUS 4IEIA 4YDSA 4KXFB 1P9NA 2AXPA 4HZIA 5EUMA 3QIAA 1IN5A 5E3HA 5G3YA 1HQCA 1OB5A 4Q4LA 1RZ3A 1BIFA 3B1ZA 4F38A 4HYYA 1CR2A 1VYVA 1NNEA 5FOVA 1G4AE 1QHHB 4QJ5A 5K8LA 3IIMA 2AFHE 1SKYB 3WHLA 3WP1B 1W44A 2A5YB 2C5LA 5C4GB 2CDNA 5FPHA 1VG1A 5H68A 4ZV4A 1QBKC 2B21A 3K9NA 1SXJD 4MITA 4WVFA 3AGPA 1M7HA 5FI0B 5KHOC 4MKFA 2AD1A 2JJ2A 4FWIB 2BVNA 4F4JA 4R71A 4NPHA 2F9LA 4PR0A 2CVHA 3PXGA 3RS7A 3T15A 4B48A 1YR9A 3KJHA 3C5HA 1KDRA 5KPDA 4RFSA 3RRNA 2V3CC 4CRWB 1NY5A 3MG9A 2Q21A 3I8SA 4QBGB 2P0EA 4I99A 1AQUA 1BH2A 3AVUA 1ZBDA 1XJCA 1JXMA 2AHOA 2GXQA 2ZU6A 4ZCLA 4MUBA 1CP2A 5UKDA 4HSEA 1ZM2A 1Z08A 3T1TA 1JECA 4QJ4A 4B35A 4B2LA 1TADA 3UATA 1KO1A 1K6MA 3K0EA 3LY5A 4HAVA 2P67A 2QL6A 4PZLA 4NYIR 3GJ0A 1EK0A 3KKMA 2OSBA 1UAAA 2ZIAA 3REGA 3MJRA 1D9XA 3U61B 2A5JA 2KWIA 1UDWA 4FD2A 1W36C 1NVUQ 2Q6TA 4UNSA 3AKYA 3SOPA 1W36B 3LVQE 1JEEA 3B1YA 1OIWA 3V9PA 1G8GA 2QN6A 2VHQA 3LDAA 4LPKA 4MH0R 5DN6A 3DO6A 1KKLA 3R8CA 3THOA 4EPVA 4LCBA 1U2RA 1AZTA 1KSGA 3WHKA 4ILEA 1WE2A 1E2MA 1NBMD 2CJWA 1W7AA 1OH6A 3RWOA 3BD9A 5SZKB 4Q1FA 3UPUA 2J0VA 3ZQ6A 4KYIB 4OHZA 1OKKA 3IPXA 3B8HA 2R6CA 2GDJA 3D31A 4EUNA 1NJFA 1IY1A 2FPKA 2YJTD 2ZITA 4L4UA 4JKIA 2XX3A 1F2UB 3C8UA 3PUVA 2VP6A 1G5PA 2EWWA 4XVQA 2C77A 3SC3A 5HCIA 1GL9B 2ZSFA 4EFNA 4C0LA 3BB1A 4L5BA 3QY0A 5J5CA 3GD7A 1QRAA 4BFUA 3GFPA 2N42A 4BUJA 2DY1A 4A0RA 1E79D 1VCOA 3TSWA 2JCSA 3FKSD 2V8OA 1DO2A 2GJ9A 3UIEA 1LTQA 1HT2E 4C3ZA 4S35A 2FSIA 3P4XA 4EPTA 2NG1A 1FQJA 1AIPA 2O8EA 2ZE6A 3HU3A 2BBSA 4A2QA 3RAPR 3SJAA 4U02A 2V6IA 3TE6A 4RFVA 4DIEA 4A0FA 5KO2A 2O0KA 3C15C 1DS6A 4LHZA 2X1VA 1OE0A 5TARA 1JNYA 3THXA 3OIWA 3QVUA 4C0JA 2Q3MA 2IHYA 3PEUA 2AWOA 4QRHA 2ZU0C 1ZNXA 4XOIA 4BFVA 1KNQA 1Q1QA 2ORWA 5IHPA 3SE0A 1JR6A 3CF6R 1Q3TA 3SQWA 2Q9BA 1G17A 2I1VB 4KFRA 3AKEA 3CX8A 1FUKA 2BEKA 1DARA 4CEIA 4I4LA 3TAUA 2BMEA 2GAAA 2ODWA 3ICQB 2GVDC 1KK0A 2E9SA 3T12A 2GJ8A 3LLUA 3TW8B 1E2PA 4B75A 2RGXA 3W6PA 5JMTA 1VMAA 5JBQA 2FWRA 1QVAA 3CO5A 1E2NA 2UVQA 4NKRA 4LC1A 1EFUA 1M1YE 4OI1A 1X86B 5HTKA 4N3NA 2CHVA 1Q22A 3ZYCA 5BN4A 3BBPA 2F7SA 1XFAA 3K53A 4HB3A 5FTJA 4CT5A 5B58C 4ZPXA 3QQ5A 3A4MA 5KOYA 1P75A 4I81A 3OIVA 3Q7PA 4JLBA 2CLCX 2IYYA 1ZU5A 1LVGA 2AFIE 1UEIA 4PHTA 3VU9B 4E22A 5IK2D 2WAYA 2P5SA 2GCOB 2QP9X 4A0GA 3ETLA 4PAOA 1XEXA 4M1WA 5TXGA 3FHCB 3A8TA 3X1DA 1W0JA 2OT3B 3O8DA 4OHXA 2MMGA 2REBA 2FX3A 2OLJA 2GF9A 1A5TA 1Q0UA 2F55A 2RHMA 3LBHA 2PZEA 3TW4A 1GIAA 4CEJB 1DELA 1QHSA 3OHMA 3I5XA 4NU0A 1QHIA 4LV5B 1Z0DA 3CRRA 4B3BA 4BFZA 4WIAA 5JI3E 1ZCAA 2ZRKA 5CB8A 2RGGA 3K0CC 3HPQA 2IXEA 2J59A 1CKEA 1JR3D 3AVWA 2V4ZA 2FPLA 1TF5A 3CNOA 3WXMA 1M7GA 2HEIA 1US8B 4LBVA 3TSOA 5JECA 4HUQB 4IKEA 4RD1A 1II0A 2JAQA 1JPNA 3HWSA 5D3MB 1CLUA 3GLFB 2GETA 2JATA 4CW7A 1SVKA 1W4BA 3LRPA 2RAPA 4Q4JA 2JLRA 1CJKC 1RRGA 2PH1A 3DMDA 4LJ6A 1LS6A 1T8UA 1UBFA 1GRQA 5BQ5A 1BYUA 1T3HA 2IEYA 3EW9A 1DAEA 3PVSA 1F60A 1VG0B 1G8HA 1AQYA 2CHQA 2GXUA 3SFVA 1XD8A 3KKNA 3DKVA 3THYA 1II8A 4M0LA 2Z5FA 1G7CA 4JS0A 1RPZA 4YMSA 4A0HA 4GPTA 4B44A 1Z6AA 4JBYA 4HAZA 5HKKA 4NYMR 2QAGA 1OSNA 4Z8XA 4IXNA 3KDSE 2DFTA 2JLSA
chains in the Genus database with same CATH superfamily
1QG2A 4BMNA 4NZYA 4HNAB 2ODBA 2Q6KA 2VUSA 4Z1MD 3U7GA 3OZWA 4NOKA 1FUUA 1A82A 1I5EA 2EDCA 5HGJA 1E2GA 5F23A 2ZXUA 1QAOA 3IODA 4MUYA 5BVGA 2Y99A 4MR9A 3H1TA 3ZYZA 3R9WA 3REQB 5KMGA 3S3TA 2FEMA 4ILKA 3SSNA 3IUMA 2AXNA 4YALA 2PUWA 2Q8NA 4Y2UA 1RZVA 3GLTA 4CU2A 1KC3A 4OG2A 3UJ3X 3SLKA 1D5WA 2YS7A 1NOIA 4I08A 1K92A 2DQYA 3VH2A 1G1MA 1RPJA 1ITZA 4M9QA 2FFHA 4YCDA 3GPCA 5FUYA 1YR1A 4KZPA 2R00A 1JEDA 3GN1A 1M8KA 2XWQA 3FJOA 5L45A 3OMXA 2JRCA 5CDFE 3L9WA 1AKTA 3SFTA 3G6WA 4DIOA 4ALKA 2WICA 4FE4A 1MO2A 2GUGA 2MSEB 4Z54A 3SHWA 4AJKA 1ML4A 1XRSB 1QV6A 2VPXA 4RABA 3V2HA 3K70D 1RBMA 5CDUA 2GA9A 4KI7A 1NI4B 1YI1A 2IDMA 3AP3A 3H87A 4XCQA 4JT2A 2IX3A 1QFMA 3R6DA 5JD6A 1CY7A 1CRZA 3CY6A 2RC6A 1CW2B 3ND7A 4L1KA 1RYHA 1DG9A 4H1TA 2NVUB 1DTWB 4HWRA 3KPWA 3GF4A 4NXMB 2D1FA 1PHRA 3EIWA 3GBSA 3IAM1 4K9NA 4Q4DA 1YQ9A 4Z9FA 3EC2A 4EB6B 3TJRA 4DNOA 4D4HA 4Y2PA 1XNRB 1ZSVA 3OTOB 3CISA 2PGLA 5BY2A 3G0OA 1DPFA 2ZTSA 4I5EA 1XZQA 1LPMA 1T6BY 2XUGA 4JYZA 1P7CA 3AJ8A 3CKLA 3PUZA 3FW1A 3R0IA 4HTFB 4C7XA 5CDHA 2BFNA 4UPEA 3WYNA 4TMYA 2GN8A 3AZPA 3CURA 4BO7A 1OLXB 5BRNA 4P34A 3IQEA 4F8EA 5L7WA 3WRYA 2ZRNA 3ILXA 3DO8A 3DVQX 3KVYA 3ZHSA 2R1UA 2EF0A 3B9BA 2ZRMA 3WK6A 1KH2A 5EP3A 1SQFA 1UMCB 2VIIA 4J0CA 3DT8A 2ZFUA 1K86A 1XCLA 1Z15A 4PWYA 1E1RD 4D5GA 1FFCA 3AU8A 2J32A 5AKGA 1ZL2A 4KGVA 3VDRA 5CB4A 2VBCA 5E7IA 5B3LA 3LP5A 5AOBA 4D6YA 3OHPA 5JH7F 2ZB4A 3EXFB 1G5HA 1DCFA 4YCBA 3UOWA 1YKSA 1EWTA 3BE4A 4RA9B 1F17A 2NTVA 1XNGA 4ECAA 3O1HB 4DN6A 3L43A 1E3MA 4DWOA 3CZMA 1OI3A 3LUGA 3P2JA 4FMCF 3EF3A 1J39A 1JQLB 1OF1A 3U6BA 3IB3A 1MT0A 5IZCC 4FMBB 3A6ZA 4K6KA 2Y1DA 4KIUA 5GVSA 4KREA 4PC7A 1VCNA 2B8NA 4OP3A 4ND8A 1HZZA 2XJ4A 3FBWA 3SD7A 3NALA 3IP9A 3TEMA 3VSDA 3N5CA 5HVNA 5AW1A 4P3NA 1Z4JA 2P4HX 1J70A 2KSQA 2I3GA 3EQ8A 1LQTA 4D9CA 2IYUA 2SICE 3PQ4A 4DSNA 4YDQA 2GD2A 4YROA 1E1CA 1MX1A 1ORWA 4PYIA 3OI7A 4B3FX 5C37A 4FDVA 4RD2A 2Q1UA 3HG7A 4BQIA 2A35A 2AR0A 4Y2YA 5AOAA 4MB6A 3VPDA 2X0FA 4CQMD 3RYTC 1EVYA 3PS9A 1HDYA 5B4TA 2C4TA 1TO6A 4XIFA 1GKKA 1BNCA 2FA9A 5DV9A 3ULKA 3L4BA 4TWZA 1Q6ZA 4B09A 5BR1A 4E15A 1JSCA 1KPGA 4ZT4A 3ZGXA 3PZBA 2D8MA 2GEFA 3EZYA 2NQ2C 3IV6A 2WSMA 3NH6A 5AT1A 4L8FA 4IWYA 4RJTA 2BEUB 1S2DA 3P8ZA 4RLHA 4D92A 4DQLA 3FUWA 5EJMA 2VSNA 1G7RA 3G23A 2ZRGA 5FLEX 3VGJA 5FL7D 2Y3IA 4Z8YA 3QYAA 4DIUA 2VSYA 4ZDIA 5JNVA 4RK6A 2ZJ4A 4JLWA 4S1TA 4LAFA 4CDMA 5JXJA 1REQA 1JALA 1NNI1 4O4LB 1CIPA 1C81A 2NM0A 1HZJA 1R6XA 2X9GA 4ZCQA 5D00A 1NUHA 3LY7A 1TOAA 4YCLA 5BMVA 4ZYUA 1MV8A 3GFVA 2VQ6A 2VWPA 1SBZA 1ACJA 1GKYA 5D3KA 3TKLA 2DWOA 2A3RA 3V1LA 1IDOA 1MW8X 5EKUA 4GXQA 2WTMA 5F12A 1NVGA 4FX5A 4ZOLA 4DQ0A 1T9ZA 2AN5A 1KDTA 3H1FA 2R96A 3P9PA 4FHDA 4ZRDA 4DGSA 3HVRA 1N2SA 1FOEB 1M66A 1R6TA 1EE2A 3SQLA 3GAZA 2OKCA 2IOYA 2I2XB 3JSXA 4M21A 1VG8A 1MB3A 2BUCA 2E3JA 3GIWA 3HC7A 3QXCA 4C4AA 3SWWA 2DBYA 5AI0A 3MWJA 4PS1A 4EEXA 1BU8A 1YR8A 4W7HA 1IQPA 5DPMA 4Q4AA 4DMCA 4UUQA 2OFXA 2FMIA 4XPIB 3LMKA 2Q5JA 2AZDA 3O75A 1R8SA 4QGHA 1BX3A 3SZLA 4C2TA 2J85A 3DBLB 4YCMA 2YHSA 3GGPA 3UWDA 2ZBUA 1ZH0A 4MGKR 2YQ4A 3RG8A 4BNMA 4NZOA 4TQAA 1I4DD 1ZH8A 1YZVA 2X58A 4QHTA 1K6IA 5LDGA 4DG8A 1M1NA 1SCIA 3AOEA 4LXGA 5IBQA 3N2LA 4QM6A 2C2XA 3TYXA 4QM7A 2AJLI 1QDEA 1VPTA 2C3MA 2WTNA 1X77A 3G02A 1IIRA 1ZINA 1H0HA 5CURA 3TOCA 3N8GA 1P4GA 3EBLA 1LSUA 1JQKA 1ZIOA 3KEQA 4GBED 5CHEA 3I37X 1SKMA 3JAKA 3K6RA 3E18A 4GNRA 1GA1A 1NP3A 3WX0A 5CH5A 2VH5R 2NYAA 1D0IA 1TJ4A 1JJVA 4GM4A 1BKYA 1HOTA 3QX7A 2CLMB 4I4CA 3DOUA 4Y0VA 1QRRA 4PHHA 1BE0A 2R1TA 1RLMA 4C4SA 1GPWB 1E99A 3R7SA 4XOUA 3OZSA 1V5GA 1BFUA 5BP7A 2MSCB 3VYRB 5K0EA 4RV9A 5JO9A 4QDKA 2ZSEA 3SP1A 2XGOA 4FDLA 5JRZA 3OA2A 4JIGA 3B8EA 2WWIA 4O08A 3EFHA 4N5DA 2B2NA 1NATA 3Q4GA 4P7GA 3IAUA 1EVJA 1IJFA 1MX3A 5IX8A 4BOYA 1ELOA 4OHRA 3QBDA 1JB1A 1ZL0A 1JHVA 1Z7BA 2Q4RA 1OXTA 2V54A 4MO2A 1RJEA 3AI7A 1ZHOA 1DTEA 2JD0A 3IXQA 2FN4A 1QIMA 2ZUUA 3DC2A 5AUPB 3SG0A 2G5CA 2G5TA 2YRFA 4BNYA 4DMRA 4IFTA 1VMIA 4U4AA 1T4BA 3HACA 1CF4A 1R15A 2ZREA 4P4NA 3VDNB 5CPBA 4BMXA 3AEKB 2WU4A 1SUPA 4ZEOA 3VM6A 1T9KA 4ZAFA 1V9CA 2ZAOA 1STOA 3WLLA 1YZHA 4IF4A 5GZ3A 1WXHA 4JLUA 1V3VA 2QRMA 1OZHA 1LK7A 4ARZB 4D9MA 4S1OA 4JFRA 4CUKA 4DLRA 5CBPB 2QGFA 4RQBA 3ANXA 1KH1A 4Y6QA 4ZICA 4FHZA 1YAJA 2QTFA 4MGIR 2FHSA 2Q2WA 3R0JA 5HRUA 1SQ6A 3TLBA 5LZ4A 1YQDA 2OZVA 1T15A 3EZ9A 3E81A 3IAHA 3T7DA 1TQ8A 3D81A 3NRCA 3VSEA 3OEHD 3QFFA 2YDYA 5TPWA 1TJNA 1YDMA 1ENZA 2QQEA 2QK4A 1GCUA 1K7SN 2UZ3A 4BP3A 1W88B 3D4LA 3LP6A 5FXMA 3ZWOA 1EVLA 1KNXA 3UXMA 4LC0A 3CLVA 3VUFA 3ENVA 4TPKA 2NU6B 2DSNA 1ZD3A 4UASA 4WECA 4DJDC 2W6QA 2ONKA 3QUTA 5E7JA 1Y7PA 4UEJA 3CLTD 5FWYA 2C99A 1W6RA 2DM6A 2Z8YM 1PVDA 3OE7D 1P45A 4ODIA 1RZRD 1ZK4A 3FYHA 7GPBA 4WJZA 2WK1A 1X3LA 4BTLA 4HWPA 1WDMA 2BEWB 4JBWA 1R88A 1AMUA 2IQIA 1IBSA 5CFZA 1THZA 3GLHE 3A6FA 1KJIA 2YYSA 3MTJA 2WM3A 2OPHA 3RABA 3WY9A 3AIOA 4CBVA 4NDZA 1NWCA 1JEYA 4GKJB 5FHQA 3NWEA 4BO6A 1A7AA 3CX6A 4Z51A 1P2GA 3RNLA 2ZDQA 1NM5C 1XXHE 3DYVA 5FX2A 2GPNA 1WNTA 1RKQA 5CIWA 1Z6TA 3A28A 3GAAA 3PNLA 4MKXA 4F3RA 3MC1A 1EM6A 4BPRA 1JE0A 2CLFB 4S12A 3VJLA 5B12A 4LBZA 1TL7C 2IU6A 2JVJA 5LYYA 2GZAA 2VQSA 5LP6F 2C88A 2XMQA 4GSYA 3I58A 4HLQB 1K27A 2AOTB 5AI8A 1IZ7A 3WFJA 4DBZA 1H4VB 4UUBA 4HVLA 2PBFA 1P1FA 1UL1X 2ZJOA 4ER7A 3IR6A 4RZQA 3ESCA 3EPLA 2ZSJA 5JI2E 4MJ7A 4XVRA 4FGUA 2BM1A 2JFOA 1MGOA 3CNNA 3FWHA 2CUTA 2H8KA 2HLHA 5FTKA 1V3TA 5IBCA 1YONA 2P9GA 2WM9B 4S05A 2QSJA 4U6QA 3A7EA 2B4AA 4RACA 3AY7A 2VF8A 3I92A 4WL0A 2QRKA 2ZW9A 1RQNA 2VTKA 1U0HC 2FFRA 1TQDA 4REOA 2DFKB 5F52A 3UNXA 5EE5B 3EGWA 5FV7A 1UDBA 4DJTA 4KO4S 3OCZA 1FYXA 1Z88A 1NQVA 2GN6A 3LECA 4RVOA 3M9WA 1R0BA 1P7YA 5G1NA 3AETA 1C0EA 1SC4A 5KDOA 2DPYA 3T99A 4ZVKA 1WCIB 2VJYA 4FQ7A 4OLJA 5FBRB 4J29A 3ZI7A 2C9CA 5LSAA 3AUYA 4HN9A 4PO3X 1CZLA 3AX6A 4YP7A 3RUCA 4LXYA 3A3KA 5COQA 1WVMA 2W2XA 2UZ0A 3ZJYA 4ZTUB 5AVTA 2BZSA 5EHQA 2QJRA 3UAZA 3VMFA 4AKIA 2R6ZA 1P9RA 2VT2A 2G9ZA 4RD6A 1PTJA 1FYEA 4WOKA 2X4DA 3H05A 4I9NA 3R20A 5FNZA 3CXUA 3TCXB 5G1OA 3A6LA 1KZGB 4QYSA 3R3ZA 2FJ0A 2EX0A 1CRQA 1FB5A 3H75A 1T13A 1UM9A 3KEFA 4MQUA 1FDOA 5IJ0A 3TQFA 1D04A 4COKA 5EHZA 1NVMB 1IG0A 3NEAA 4J0QA 4HK4A 4MWBA 4XIIA 5ER9A 4ZARA 1BEUB 4DSTA 3UGQA 1EG2A 5IYZB 4D4JA 1IULA 5FYDA 3I09A 3NGMA 1A4XA 3IKVA 2QUKA 3DKKA 3DVLA 4JLSA 1Y9AA 2J3QA 2RKBA 2PIDA 2CLOB 4WADA 3RSGA 2J41A 1WS6A 2PZFA 3HCFA 2QAGC 1JFVA 1T9HA 4WEQA 1RI5A 1FFSA 3GP3A 4CLHA 2H4ZA 4DFDA 4HG2A 3IC5A 4HB0A 3X44A 2QAGB 2C2KA 3ZZ1A 3DNFA 3SC4A 1WSDA 1UAGA 2QMUA 2QTRA 1I1QB 1UDAA 3RTGA 1KO7A 5EC8A 2ZULA 4ON9A 1JH9A 2PMBA 5BSEA 2G0NA 1JHXA 1VKJA 4HATA 1QKJA 3S29A 4AWAA 3RFUA 2W6JA 2YTZA 3BA6A 3CUSA 3X2EA 5B1HA 4CDNA 5AJYA 5BVGB 3KSRA 1N4DA 1YB2A 4LE1A 4Q12A 4NPCA 4LYDA 3SN6A 3URMA 4X60A 2I3BA 1RAIA 1ZJ5A 2P40A 2O6HA 1M3SA 4XJTA 1RM4A 5J9FA 3TKYA 5CFMA 4D80A 2BT4A 4LS3A 3QKIA 4DGQA 2Z58A 4AWXA 1I4OA 3EGIA 3AF6A 3DOEA 1BMDA 1RIIA 5FULA 3WNDA 2R00C 2FDRA 4UMVA 4W6QA 2YJ6A 3EIHA 1LLDA 9GPBA 3K05A 2H1WA 3TSYA 3DCJA 2OC9A 5TR9A 1WBJB 3HXTA 1SUDA 1CRWG 2FOIA 2NXCA 4WASA 3MERA 2EGHA 1RI1A 3SFZA 2F62A 3F5MA 2QAJA 2Y1EA 4C78A 2QRGA 2PZLA 5DLDA 5EHGA 3WBJA 3WFZA 1I24A 4DQXA 1QF7A 5CM2Z 2B8EA 5A04A 4RC9A 1RC1A 2EX4A 4NZMA 1T34A 4AULA 4BRWA 3JASA 4JZYA 3TLYA 3V8VA 4JMPA 4ALMA 1KEEA 4JXXA 2XT0A 5TF4A 3E15A 3CLRD 4W99A 1FK8A 1NMQA 2HLDD 3VJMA 2UYYA 1FBTA 3TXAA 2CLEB 3NVKI 2OBMA 3IAS6 2PL9A 4BDTA 5FBVB 3R3SA 2FPMA 3GRZA 3KZNA 3D7NA 4P7BA 1VOTA 2WUVA 1I32A 2Z1MA 5DBHX 3CRZA 4EJ6A 2ZRJA 3IILA 3S8EA 1F7UA 3SJCA 4N7RA 2ALJA 4BKPA 1WMAA 3NEJA 2Z4SA 1ZITA 1VM6A 4IQ4A 3IP3A 1DT3A 1CRPA 3LV8A 2WV9A 5JNWA 2PMWB 3H1PA 4GRAA 5GJBA 5C1PA 3C4JA 3OT4A 4R2KA 4UU0A 3WRYC 1C1HA 2PR7A 1XU7A 1QGZA 2O8BA 1P8AA 2NZ2A 2FI1A 2QLLA 1ESDA 1WW3A 3USZA 4CIYA 1JIIA 1J7JA 4ZIRA 2V96A 2PX8A 3QTBA 2GCNA 2IYWA 4I4TA 1XT6A 5CUQA 1Y8RA 5B1IA 2C2ZA 3DEKA 4V02A 3T06B 3ODPA 1KQ3A 1HA3A 2RBKA 4QRIA 4BL5A 5E4TA 2NO6A 2QPAA 4KO2S 4QYXA 2PAFA 5J40A 4CLEA 4W5OA 1R9JA 4DCNA 5EIHA 3LI2A 1MJGA 1KAGA 3G2KA 1H1LA 5FI3A 5CB4B 4O4IF 4LRQA 1VLJA 1YK0A 4JKOA 4QBKA 3LTNC 1NBIA 1EXMA 3E7PA 1F0NA 4JGGA 1QHGA 2VYQA 3OEYA 1N2HA 3DXZA 2SHKA 4ZO6A 2OO5C 2ZR9A 4PHCA 2AEMA 1NMYA 3VC3A 1HZZC 4MP3A 1Y9DA 4BQPA 3DEHA 1QH9A 4PLCA 1E1RA 1QRUA 4ZU6X 4JJGA 3N7TA 1J99A 5K3BA 1IFXA 3C6KA 2IF0A 2RB4A 2XOXA 4ND8B 4UUOA 4LZWA 2R6AA 1XXLA 1I2CA 2HXYA 2ILTA 3I23A 3KTDA 3Q85A 5HFNA 1P61B 3FZYA 5JSYA 3PEFA 2EWVA 4ED9A 1RVDA 3VAYA 5T57A 2AS0A 1CNFA 1E1CB 3DCIA 4JL5A 2ZJBA 1GT6A 1Y5RA 2Q3EA 3L4BC 2A2ZA 1KAMA 1X1TA 4HHEA 4UE2A 2HT6A 4DDVA 3OZUA 1HV8A 1QGYA 2HU7A 1NF3A 1TLLA 4GXTA 4K5QA 2V7BA 3ETNA 2B1JA 3MCAA 4IJQA 4ECEA 5EIAA 1FW8A 5KCZA 4QXOA 5ICEA 1KE2A 2AI2A 4AMYA 4KNVA 1SMKA 2PZGA 3C39A 4FGZA 4P35A 4Y1GA 3GJYA 5BW4A 1ZIXA 1T5LA 1A7UA 4ND3A 1I1NA 4I5IA 3NFYA 1TW3A 2NTNA 2DHCA 2G3YA 1FFGA 1PT8A 3IQHX 3OD1A 4KWEA 4YREA 4AF7A 1JYSA 4EP1A 3VR4D 2RHDA 4AP6A 3GPBA 1TYCA 1JW9B 4QUHA 4UZFA 4BJ3A 2O5CA 1KQPA 4RGYA 1P7PA 4PYQA 1E3WA 3RVMA 1REQB 1XQ1A 2XUQA 3DE5X 3MPOA 4XR4A 4RHTA 4DA8A 3W5JA 3IYLW 2R6GA 3WAGA 1YHNA 2VAMA 2W2NA 4C2UA 3QENA 5JPDA 3AQ4A 5BMVB 2HM7A 2HJRA 2RB5A 3CTPA 3VPGA 2OHIA 2VT7A 1D07A 5FL7A 3SX0A 5GJCA 2WU1A 5LZ2A 4Q93A 1ZAKA 4RA6A 4ZOLB 4DA0A 5C1OA 1T2EA 1YUMA 1NQUA 1Y37A 3DOIA 3CUUA 4ZC8A 1CFZA 3IO3A 4IHKA 4HAIA 1XMJA 4TN1A 1X8LA 5DX1A 5H9VA 3V6LA 4ZYZA 5L6MB 5CLGA 4N65A 4OQZA 5JO0A 4BLVA 4G63A 1Z47A 4N7JA 2DE0X 3T1QA 4PFSA 1C14A 1UQUA 3AF5A 4GR4A 1F8YA 3QV1A 1S1MA 5AKEA 1G3QA 4IEEA 1T3SA 2QX8A 5AJXA 2B9EA 1VGRA 5HGXA 1VBFA 4R8LA 3D8HA 2WU8A 4OHYA 3PYMA 4Q03A 3L0PA 4WBNA 4JJEA 3IA2A 5ENDA 2GB4A 4DE5A 3AOEC 4BZPA 1ZGJA 4HLNA 4Q3NA 4O4JA 4X61A 4WE3A 2E5FA 2KX7A 1U7WA 3H0EA 2RBGA 1ZN7A 4RVHA 3QFTA 1NV9A 3OQJA 1M1NB 4YJ2F 1J22A 5LDDC 5IAAA 1DDOA 5F5NA 1DJOA 1GARA 5HF6A 1OYVA 1IPEA 1T3ZA 2R6JA 2WFMA 2E4UA 2JGIA 2VDWA 1VE5A 3GZ4A 4CWAA 2IEGA 4DXDA 5CJ2A 5CFNA 2VQDA 4A16A 1J4AA 2ESRA 3JAKB 3VNQA 8LDHA 4WK4B 4Z86A 2QVBA 1VIMA 1ZS9A 2W83A 1ZIPA 3FB4A 4JP8A 2XUDA 3RBZA 4W5RA 3JQ6A 4KWCA 4YCAA 3HBMA 2OHGA 1E6EA 1PK8A 3H7AA 1D8AA 4XWAA 2HA2A 4IFBA 4PQFA 4B4VA 5C5DA 1RPTA 2ZRPA 7MDHA 3KETA 1LDMA 2R1TB 3OF5A 2FMKA 1M1UA 1MJNA 1KZ9A 3LUKA 3ZE6A 2Z1DA 3ZDQA 4MW1A 2O3JA 3ZBQA 1ADYA 1KZ7B 1XYYA 3GEBA 1GKUB 3QXHA 3E5HA 3ZD9A 2C7RA 3OZFA 4I4IA 2EIHA 2J6HA 1W93A 2C3PA 3TGPA 3QBVA 4MW2A 4PZCA 4D8YA 3IL2A 2AEJA 4D57A 3I05A 3QH4A 1YGYA 3CWZA 2EKDA 1B14A 2GNPA 1OXVA 1J0XO 4LYAA 3KV1A 1EUQA 3HBNA 3N0XA 4BGDA 2XNSA 3JQFA 2RI0A 1WXDA 4R1MA 4Y2SA 2O1SA 5IULC 2VH1A 2HI0A 2W93A 3TM5A 1ORIA 2OM2A 2WOJA 4QWMA 5AJUA 2PUGA 1WR8A 4GT1A 1SBHA 3B52X 2ZAYA 3OJLA 1G8AA 1O8BA 5H70A 1RLUA 1ILEA 2E48A 2IZZA 8ADHA 3D2CA 3IAS1 4NR0A 4ZJPA 3DLCA 3RJ9A 3TINA 2GN2A 2E4VA 3R23A 4HVAA 4KMRA 5IJWA 5BUSA 3O8QA 5CH8A 1Y3HA 1T9DA 4KAAA 3TM4A 3W3ZB 2VJBA 3FMPB 3QMPA 4B83A 4B3TB 4RPIA 5BUCA 2IBTA 3M4YA 1MJFA 1OFIA 4RLFA 1XAHA 3GLQA 3W8RA 3ZY5A 4MHTA 2QN2A 3I52A 4RSMA 2O14A 5FWXA 5TPWB 4HH4A 1VMKA 4RZIA 4CZ2A 4DL9A 4JLAA 1WTCA 4IUDS 1FFHA 2QZJA 3SIRA 3LCMA 3RD5A 1LBEA 5KYWA 1HSOA 1HTWA 1Y9JA 4OA8A 3N28A 2W22A 4GPEA 4M2LA 5JSZB 3ZJVA 1IHPA 2B6HA 4QU9A 4PBTA 5FWYB 2QR3A 4RNCA 1ZONA 2F8TA 16PKA 1S2MA 2CSUA 4P4TA 2PRSA 3OEHA 5C80A 3C43A 1NDQA 2WJVA 3B70A 2XKKA 3ET5A 3V4ZA 1GFIA 1VCMA 2CLSA 5IVPA 3TSZA 4C0AC 1RC8A 2QJFA 1YB6A 5FUQA 1OXMA 3FM9A 3GCDA 3ON5A 2A9PA 3CLUC 3HZZA 1JEYB 1OZFA 2FSGA 4TLDA 2OR3A 4YRCA 4IOKA 5F9FA 3L1VA 4HAUA 2CDAA 1D2HA 4R0VA 1VPLA 1XA0A 4IINA 3SM9A 3NKFA 4XYEA 4JYMA 4NH0A 5I8ZA 3SDZA 4YXWA 4KSCA 4UUAA 5E6RA 5DM2A 4WBSA 1I14A 2FSVA 4LYGA 2A33A 1L8OA 5LXTA 4PBRA 4KOEC 4D02A 4G5QA 3GFQA 2RGYA 2WAOA 2J3MA 2L42A 4B8ZA 1ZW1A 4JB3A 3OX2A 4CEHB 4OLBA 2A4KA 1NVDA 2F8MA 4Y2VA 3G2HA 2VC2B 4HC4A 3OZTA 4BN4A 4XB2A 3P7MA 3PCXA 4U63A 5DLYA 2IE8A 2YNMD 4Q1DA 3BRWD 2D1SA 1V26A 1MO6A 2JAHA 3ZDYB 4PW0A 1ZOIA 2JGMA 2FPGB 1CJUC 2IEZA 1H4QA 2B92A 4N01A 4R01A 2QLTA 5A5VA 3DQQA 3PKJA 4FGJA 5L7TA 1U6IA 2PX4A 3ROKA 2X1HA 3VA7A 1JZSA 3AR2A 4RIEA 2HOQA 2M1XA 3CE6A 3HVHA 2P9JA 3KQVA 2PAAA 4FFMA 4OTZA 3BICA 1IWOA 4TX1A 3R5KA 1SEVA 4N6OA 2UUBB 3FVVA 3B6KA 3H1GA 4Y2GA 2DKOA 1SB9A 4G1BA 4TV8A 4G0OA 4L15A 4CTJA 3D54D 1WSBA 2ZRDA 3S8YA 2FZ5A 3O4JA 2FEAA 5CDFA 4MWTA 1GPBA 3AESA 4KAXA 4NF2A 5G0VA 3HS3A 2JLQA 4U6SA 1M67A 3AV0B 1J9GA 4LRYA 2I1WA 2G9QA 4UD6A 3SHVA 2ODTX 3DOFA 1ZSYA 4TTSA 3L01A 3M6AA 5BO5A 1PTJC 2FP4A 2Y6VA 4KV9A 5JS2A 3UWMA 3VVBA 1N2XA 4GD3Q 1G20E 4OUDA 4BWGA 5EKXA 2L69A 2PSFA 1XDUA 4WLNA 3AVPA 3FDFA 2FX5A 4CV0A 2F1RA 3TFWA 2QTTA 4NEHB 3S1SA 1CX9B 1S7CA 1V6CA 3GEGA 4LRSB 2RH4A 4WSOA 2ZT7A 2QYSA 2GYWA 4PG7A 4PXAA 3PXDA 4XX1A 4NS4A 4P08A 1UM9B 1QM5A 5CDYA 4QHYA 5IJ0B 1RYEA 2X9NA 4MEAA 4MLZA 3WZ2A 5JXWA 1XVVA 1YU9A 3I1FA 4J49A 4Y2TA 2XKAA 4RH1A 1VHQA 1DBQA 4GLBA 5DHSA 5LR6A 4R2IA 3NT4A 4BMCA 4K46A 1ULSA 4JP2A 4BVJA 1JEOA 5GV8A 3TRHA 1DQZA 1SU8A 3HFSA 3MLEA 3O83A 4OFWA 5CFOA 1AK1A 1YZNA 4X64B 4XB6B 1AKUA 1X1AA 5EWJA 4FDMA 3RIHA 4A26A 4CYMA 3MZ0A 2ZWIA 3CT6A 1NW5A 3O1IC 3EBOA 1NVXQ 4W1QA 4L78A 2BWJA 3GJ7A 1GPDG 2JANA 2X2FA 1FU4A 1LPOA 3P9IA 4RE5A 1SO8A 4E3WA 4ZODA 3DHEA 1C4WA 4RHXA 3IT1A 2PS0A 2QTHA 1KQFA 2CVPA 5DT2A 5BXQC 4PGMA 2GN9A 3V5NA 1E61A 4OXRA 4ZOBA 4DT1A 5IJ9A 3WNBA 4EPXA 5BNWA 3HV0A 4V0QA 4Q9IA 2VTBA 4C2BA 1OROA 2Y4NA 3PJDA 4CIXA 1L5RA 1NF8A 1WD7A 3P2YA 2PUEA 5BWBA 1HURA 5HDQA 1GQFA 2JVKA 4EY6A 1U2EA 4Q7MB 1C4OA 4JMLA 5AOCA 3HWRA 4XUCA 1O8CA 2VDLB 3E3LA 3BGWA 3U62A 5IT0A 5JZVA 4BB0A 5FV4A 4Q24A 4EKNB 1E6MA 4UVEA 2ERYA 3OOYA 4DZTA 1VRWA 4HGOA 4ZEMA 4URHA 1YNSA 2ZBGA 3HUEA 3OY7A 5AUOB 5I7OA 4PIMA 3L7LA 4O4LF 5DM60 2XCSB 4PX3A 4P4UA 5ANRB 4EHJA 2TMYA 4JP3A 4L57A 3JASB 2GRAA 3BFPA 1YKGA 1GAEO 1KEEB 4E5YA 4IUCS 4HZUA 5ER6A 3RVJA 1WPXA 2IFTA 5JANA 1ZYUA 5I7HA 4B84A 5KC8A 3KT0A 2YWXA 5AXDA 3LDGA 1ZLXA 1G2IA 2P2YA 5ALWA 2A5GA 2COKA 5LNK6 5JYEA 3JQEA 2F1IA 1XC7A 3KR2A 3TZKA 1FXSA 1E8NA 4DIFA 1ZH6A 4IDHA 3L6DA 4E6EA 5KAMA 3KWFA 5F2NA 3IVGA 1XX6A 1G9TA 1Z4PX 3P52A 5EKDA 4O0MA 3DQPA 4TRJA 1M34E 3ZXUB 1SNYA 1X92A 2YFKA 3BF7A 3FNIA 4M0PA 4FZJA 1X39A 1QPBA 2PMFA 3UWPA 4C07A 1UKZA 2HLDA 1A9PA 2HSWA 2C04A 2C7BA 2ERXA 3E27A 4FFBA 3V8BA 2G1KA 1ISJA 2G9VA 3G2NA 2O8BB 1ZRMA 3ND8A 3UYKA 4PLPA 4FM9A 2YN4A 3ESZA 1KTVA 4ZIRB 3DM9B 3SKXA 2HIHA 2XYRA 1N0WA 4I4TB 1Y8RB 1QIKA 4DCGA 4KH0A 4UHCA 3JQAA 4RENA 1DX6A 4AKEA 4BQSA 6ABPA 4COOA 5CLLA 2XGJA 1UXIA 1V16A 2VXOA 3C87A 5CT4A 1H1LB 4BC1A 3JWGA 3IT3A 1JPUA 1YT5A 2QW1A 4FYPA 3GFTA 3KKQA 4EMBA 2Y9PB 1ESMA 3RK1A 4A6EA 4EB8A 4XR9A 2RAUA 2YUIA 3KQWA 4LDJA 2Y1GA 2B5WA 3LVBA 1DPGA 1CUIA 4QPPA 2HK6A 3A25A 3RM3A 1WU8A 3TAHA 4MW4A 5BORA 4LOJA 1UK8A 4WK6A 4MV6A 3QEAZ 3A05A 3H6GA 4KB5A 3IXMA 3HJAA 1KOGA 1LDEA 5ULLA 3V8RA 1U11A 4DLAA 1JJ7A 2PPLA 4RMIA 1XCJA 3IEKA 5AR1A 5B55A 1GPJA 4AS1A 1C3JA 3OQNA 4KL8S 3CINA 2BELA 2H00A 2XVZA 2GBLA 4EUSA 3QLUA 4U00A 2OCPA 4FGLA 5KTPA 3WIEA 2QLNA 3LCJA 5E7QA 4EB0A 5ADHA 3IEVA 5K8JB 3LPMA 2VR1A 1RPNA 2PEYA 2XZLA 1YS4A 2WZCA 2X5XA 1UWVA 1RRFA 1U0RA 5K3OA 2PIAA 4FW8A 4Z6KA 1FNSA 4OI2A 1OBHA 2ZQ5A 1RTKA 1JTVA 2WWTA 2XEDA 3BCHA 3BQNB 2A1TS 3FDXA 3G89A 3PXCX 4H4CA 4HQ6A 2JG3A 3UMFA 2G4CA 2OENG 2QDKA 1T8SA 5LB4A 2PWBA 3HB1A 5AJZA 3D4BA 4CM9D 2W7TA 2FR8C 3L46A 3MJSA 1FQWA 2Z6UA 1SG6A 2BGTA 4FE3A 5HILA 3KPUA 3ZOZA 3GUHA 5KVSA 1Z18A 1ZLYA 2XXAA 2C1ZA 3EZGA 4HXGA 4DYHA 1XTKA 1Y4ZA 3LQ1A 3DS8A 3OP4A 3MQ4A 1A2BA 1F3LA 4HOYA 3LSTA 4XI9A 1OIVA 4UBNA 2IKQA 4P22A 3BZUA 1GAWA 4EVRA 2FDXA 2P4SA 1E3WB 1LVHA 2GI4A 1WJGA 2ID9A 4CHGA 3D7LA 4G6ZA 4QPJC 4BVKA 2HV9A 3PFWO 3P45A 4X7BA 3ETJA 1L4FA 4DQDA 2HX1A 1KI9A 4F7DA 3NWPA 3AF1A 1Z5PA 3VR4A 3T7TA 4Z4FA 4M53A 2F3QA 1V8FA 2FW9A 4RA6B 4J2OA 1PGQA 1UAYA 2NO7A 3HVUA 4BFCA 3P94A 3EEBA 3QBTA 4P84A 1W25A 1DFIA 2C9BA 3RROA 3E4DA 4OLFA 2Q4BA 1JVNA 3DTTA 1GUBA 2VFAA 1XF9A 3CPHA 1W5TA 5TF0A 4UUMA 3A6PC 3F6YA 1PQUA 2PDAA 3UGKA 3FVWA 3V4FA 4F4IA 2EQBA 2PSEA 1CTQA 3R40A 4OK6A 1G291 3RC7A 2QS9A 4NZPA 5ILGA 3W9UA 5HM8A 1PNRA 3COSA 4GZ3A 1MOQA 1JGTA 1MENA 4WBNB 1VKNA 2P8JA 3LC2O 1VJRA 1GAXA 4IY1A 1DZIA 3FTNA 2ZUVA 4F12A 4O4JB 1YAHA 4PRZA 1Q92A 4NYMQ 1UBOS 2KBFA 3PC6A 1ND5A 2MYUA 3NGLA 4W82A 1Z63A 1JIQA 3BRQA 1QWOA 1W75A 2LKDA 4DJAA 1TEZA 4G4SO 1YE8A 3ZVNA 2VDWB 2Z5GA 4TMKA 5ITZA 1XPRA 3MNFA 4ZALA 1TX4B 1Z5NA 3F6BX 5B6PA 1WNFA 1GAQA 3MWGA 3TQTA 1LA2A 1NY6A 2YL2A 4BE9A 1NFRA 1T9GS 2RONA 1YQEA 3S70A 2BGKA 2X7HA 3FMOB 4OJYA 1UFRA 4RK4A 1SUEA 4WW0A 5AKYA 1P9LA 2RK6A 2WF5A 4LPSA 3W2GA 1K6XA 5EYPA 3LF2A 3RKRA 2OK8A 3DDNA 5KWVA 4A2WA 3RIGA 1HT3A 2CNOA 4MQMA 4P7JA 1B16A 4C14A 1IEQA 2PRKA 4IRUB 1JRLA 1M2HA 2HHAA 3A1UA 1NJ6A 1ZOLA 4CI0B 4WBXC 3JQ8A 1UK6A 1FJ2A 3BWBA 3RO7A 2VDJA 2COEA 1XXHA 3EZFA 2CYAA 4DLPA 3HN2A 3M2TA 2WJGA 4AG3A 2QTGA 1E2KA 2VNKA 1DKUA 2YOFA 1CEXA 1GPH1 1A7JA 1HL7A 4HN2A 4MIOA 2W6MA 3VZRA 3CX3A 3G0CA 3JQFC 1TK9A 1E92A 4B0PA 3IKJA 1NP7A 4N3AA 3H9JA 4ZVUA 4PG5A 4AURA 3ZHUA 3GLGE 5E4FA 5KS2A 4B6SA 2HJWA 4BX8A 4M6WA 5GP1A 2A67A 5AUQA 3L8GA 3VO2A 3T7KA 3MRTA 4PIPA 3RUDA 2HUPA 3DZIA 4X95A 2C4NA 2FUCA 2DCUA 1EJ2A 2GYVA 1EMDA 2JFHA 2ZQYA 5AHWA 3GJ4A 3Q88A 3S44A 1A4RA 3BQMB 1OWPA 3U3DA 3EPHA 3P2EA 3O8QB 4M49A 4TL7A 3H3JA 5ALIA 2X9QA 1UK9A 5IYZF 3L1JA 1BO6A 2H48A 2BDEA 2X41A 3S2SA 2VJQA 2NADA 1DC3A 3H3XA 2X19A 4W8HA 5DU2A 4KLRA 2IDKA 2ZCVA 3WLIA 4H1UA 5AW7A 2A78A 1XD9A 2ZDHA 3P2IA 3GPDG 1IN1A 2FOLA 2FW6A 3F9IA 1IDN1 4PLHA 5FWXB 3TVDA 4LZPA 4A0SA 2LTAA 3GEIA 4TL8A 1FMJA 1WIWA 3UJBA 1FTGA 1YL7A 3DTVD 1FF9A 2AX3A 4OVKA 3W6UA 4DUPA 1NUTA 1BGWA 5KYWB 5U9CA 2W37A 4XQGA 5EG5A 3TSCA 4EQZA 2ZJFA 4FJ2A 1X9IA 2EP7A 2QUBA 3EXG1 3DLAA 1JAZA 2YCLA 3GPIA 1RWPA 3ZCPA 4BFSA 2X5NA 4GMGA 6LDHA 3UENA 4C7VA 1MCZA 1LWOA 1P1BA 3AIMA 1ECGA 3OTHA 4DS3A 1OQAA 2VLBA 3SHTA 1QIDA 1ODFA 1SKAA 4JC4A 4NNPA 2PHZA 4ENRA 1SUCA 3O91A 3GZNA 1N75A 1YACA 2REOA 4RKWA 3QKRA 4N12A 3CLTC 2VDRB 1PVVA 1FXUA 2ID4A 1KVUA 3T3EA 5BV1A 3ODGA 1LGYA 3QW2A 4HPWA 3UJ8A 1WF3A 1MEJA 2ACKA 2FSVC 2QSUA 1W2WB 4OB7A 4EVIA 3AOGA 4OHFA 2C5SA 4B3MB 2FN8A 1T5IA 5E6RB 1JJFA 4DNXA 5KKNB 1XEWX 2HMYB 5LQAA 4RDXA 5MFZA 3DAHA