2BBSA

Human deltaf508 nbd1 with three solubilizing mutations
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
283
structure length
253
Chain Sequence
STTEVVMENVTAFWEEGFGELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLRPDFSSKLMSFDQFSAERRNSILTETLHRFSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Structure and dynamics of NBD1 from CFTR characterized using crystallography and hydrogen/deuterium exchange mass spectrometry.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 87
structure length 253
sequence length 283
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bbsA00
4DUGD 3LD9A 3BS4A 1E2QA 1T9HA 3C8UA 5J4HA 2Q9CA 1MRNA 2Z43A 5DH9A 3SEAA 2ZE6A 4AKEA 4HZIA 1EK0A 3CH5A 1DAFA 3KXLA 4L5BA 2CLDX 2GBLA 1GAJA 2ODNA 4NYJQ 2OILA 1E9BA 4EJSC 5UKDA 2JLZA 2ZU0C 3VR1A 1D9XA 1SXJE 4CEHB 4KJZA 3R7WA 4FWTA 4GI7A 2NPFA 1N25A 3TAHA 4D25A 2O8FB 1R8QA 3PUXA 3IO5A 4UXIA 1CLUA 2FOLA 3FFAA 1ZYUA 2C2HA 1T3SA 3DM9B 5C4MA 2AFHE 3GFPA 3P4YA 1YR7A 3CRW1 4D0NA 4OQMA 3R20A 2VHQA 3IBYA 4GBMA 2G9NA 1GG2A 1GOTA 1IHUA 4C0BA 1YZTA 2ECKA 1GKIA 2LWIA 3CONA 4XVQA 3AP2A 4M9ZA 2HLDA 5C46F 2WVJA 2XX3A 1W44A 1FTNA 3HU3A 5CJ2A 1D2NA 3BC1A 2QMUA 1KO5A 2YVUA 5E7IA 2IXFA 2VIIA 5L3RA 3ADDA 1GUAA 2V6JA 3NBZC 2NGRA 5H68A 3FMOB 1AGPA 2FSIA 3MRSA 4QHTA 1JECA 4Z8XA 3TUJC 2GCPA 1UKEA 1OIXA 1G6HA 3OE7A 1J2JA 3SC3A 1XCGB 3AVVA 2F43B 1COWD 1GVNB 3DHWC 4FINA 3AUYA 1KSHA 1Q3HA 2QAGB 4TT3D 1N6KA 4XTCS 4D26A 4IDPA 2GWHA 5K8TA 5KSOA 2ZJ8A 3WBJA 2FA9A 1T0HB 2OG2A 2ODEA 3QXHA 4B47A 3ND9A 3R8FA 1P2TA 2VHCA 3X1DA 3VU9A 3VHXA 1UDWA 5CK4A 4BRWA 1X8JA 2ZS7A 4XD7D 1LY1A 1Z0JA 5HKKD 2ODBA 4XWOA 1A1VA 4Q9IA 1AKYA 2GXUA 2PLFA 2IYTA 3NG1A 3PVSA 2W00A 3I62A 2BDTA 3WYGA 2IA5A 5TXGA 1G21E 4Z1MA 2YYZA 4DLWA 1GNQA 4ILEA 4A8JA 2CL0X 4TYNA 4GZLA 2RGGA 3SFVA 2WAYA 2J0SA 3G5UA 2O0JA 2DWPA 5FTMA 3QKTA 2C99A 1AN0A 4FMCF 4DUGA 4CGZA 4F93B 2ZM5A 5HE9A 3SYNA 1SHKA 2FPKA 2V6IA 5HE8A 1NF3A 2GTPA 5EXPA 1P60A 4BLQA 4DCVA 3OF5A 4HAYA 2YOGA 2IBMA 4D0LB 1D2EA 2GVDC 4K8OA 2NZJA 2H17A 4II7A 4JZKA 4DIDA 1IJEA 1CR4A 4M2LA 1KO7A 1DPFA 1T5LA 1Z2AA 3CPEA 4PFSA 5EP2A 4B3BA 1G16A 4QNMA 1F2TA 1J70A 4XVUA 4D4LA 4TMTA 5AUQA 4JLNA 2QTVB 2CL6X 2X2EA 1N6RA 1UDXA 1VHTA 2F1JA 721PA 1KSGA 4LRWA 4XSGA 4QKQA 1UF9A 2QPAA 1XMIA 3M0EA 2ZXUA 4IKEA 2W6IA 4H1UA 4OK6A 3AVWA 5KDOA 3THXB 4WIAA 5AR1A 4LJ5A 1W5SA 4OQLA 1MKYA 1XJ0A 4LBYA 3ZZ0A 2X77A 4YXWD 1FNNA 5SZKB 5CLQA 1O87A 2ZRJA 4JLOA 1Q21A 2J7KA 4EPYA 3RVBA 1KJYA 4QRHA 1WMSA 1MABA 4A0HA 3BH6A 2GXQA 4HUQA 2XAUA 4NCIA 1OXSC 4Q4HB 1GL9B 2RGBA 1SVSA 4ASUD 3RANA 4G5QA 3BOSA 2O8DA 2ANCA 4KXFB 1Z63A 1NJGA 2XXAB 2C98A 4JT2A 3DDCA 3CWZA 4RFVA 3RS2A 2BMJA 4OHXA 3PG5A 5G41A 4OQXA 4S35A 2IHBA 4HLCA 2HEIA 1L4YA 4AY2A 2YOHA 4WBSA 2V8OA 2CVFA 4RKEA 3U44B 4XOIA 3BFKA 2J45A 1ZIPA 3N70A 4Z8YA 4YONB 4M9XA 2V1XA 2GNOA 1YZKA 3EA5A 1PLJA 2NZ8A 1IY0A 1NNEA 2HDNB 2D3WA 2XSZD 3FKSD 3IO3A 4NYIQ 3CR7A 2BKEA 4CEIB 1N5JA 4AC9A 3CRQA 2OEPA 4IDQA 2QN6A 2NOAA 1FPMA 1KYIA 2FX3A 2ZR9A 3G0HA 2YNMA 4NL4H 1TQ2A 3GLGB 4MA4A 4RD0A 2AWNA 4OK5A 1ZBDA 5AUOB 2JJ8A 1OH5A 2IS6A 2GCOA 3A37A 3MG9A 3KQUA 2JDIA 4JKIA 2JIZA 3IUYA 3K70D 1I4LD 1SULA 4Q9JA 2Q3MA 2ZYWX 2O8BA 1E2PA 4ZPXA 2ERYA 2ODWA 2YZ2A 4WA7A 4A2QA 2DFLA 3AF2A 4IEIA 5AUNB 1OF1A 1TMKA 1KI7A 3UWKA 4R9UC 4OHWA 2QRNA 1T8TA 4G0NA 2GZHA 1S0UA 3DMDA 1RRFA 3HR7A 4BGDA 3KUCA 3TGPA 2WWWA 4RD1A 3V4RA 1K8RA 3AKCA 4CZ2A 2WBLC 4CDGA 4LBWA 5CDFA 3AEZA 4IOKA 2VEDA 1VYVA 4NTZA 4OHVA 1XMVA 4XWKA 1OFHA 2REOA 2IYWA 1BOFA 4HAWA 4PXAA 1GRRA 4LHVA 1VYUA 4Q4AB 3D31A 3BFXA 1E0KA 1CF4A 2P67A 1JR3E 1MO6A 2PCLA 1ZIOA 3NIBA 4YXWA 2AD1A 5CITA 2ZI3A 3KXIA 2JEOA 4EPWA 3GJXC 1DE0A 2ZE7A 3VX3A 3EIQA 4QGGA 3CBQA 3FHOA 3VKGA 4KFTA 3A8TA 3GLIB 1V43A 4NP6A 4XWAA 1S9DA 2C04A 3K0CA 5B30A 2QE7D 4QBFA 1UEJA 4JVSB 5FUYA 1BYUA 2IWRA 2G0NA 2WV9A 2G3YA 4TZ0A 4DBLC 5KNCA 4EJSB 5FFMA 1VDZA 2ZSAA 4KBGA 3QBVA 4QFMA 2PCJA 2MMGA 3CB4A 5FOSA 1OV4A 2QPTA 5G3ZA 2CCGA 2QENA 2IYYA 2RMKA 4P33A 3U3MA 3RC3A 4QJ3A 5B64A 4AKHA 1UADA 4Q1CA 4B44A 1E0JA 3WY9A 2HF8A 4JMPA 2CHGA 3RNLA 4DT1A 3FFBA 1E32A 4KO8A 3K0FA 5FUWA 3FHTA 4ZIRA 1Y63A 4HDCA 5JS8A 2FWRA 2BEJA 1MH1A 2BMFA 2XSZA 5LBIA 1KO4A 1T0JB 3VAAA 3LVRE 3KQKA 3UPUA 1MO3A 2RGEA 3ADKA 3ETLA 1AZSC 1G4AE 4D2IA 4JVMA 2JJ2A 3LXXA 3KUDA 3VNVA 4R98A 3T1QA 4DLSA 2R6DA 2XB2A 1T4GA 2XTNA 1KMHB 4PQRA 3W5JA 4MRPA 1FTSA 4UNQA 2WJJA 4TLDA 4P4SB 5FOWA 3RWOA 4YMVA 1XU4A 3AP1A 3KKMA 1DAIA 3SHWA 2Z4RA 3J81k 4MH0R 4QJ4A 1FP6A 3ZIAA 4I99A 1KSFX 3C16C 3U2QA 2QU8A 3FKQA 3P1JA 4JLKA 3GFOA 2JCSA 5AJVB 1T8UA 1G3RA 3CR8A 2I1VB 2VQSA 3QIAA 5FTNA 3U7FB 2GILA 5ELXA 2BOVA 4OKSA 1IXZA 3CLVA 1ZRHA 1ETUA 3EWSA 3L0PA 4GNKA 3I4LA 3RS3A 4DXAA 1C4OA 2DYKA 3QXSA 2OFXA 4IDNA 5DHAA 3E2IA 1DAEA 1BS1A 2N46A 1L4UA 2PEZA 1QHHB 3T5DA 2EW1A 1F60A 5JRZA 4A6XA 1EWQA 1KI2A 4HLUC 1N0WA 1W4CA 2RGXA 6Q21A 1U8YA 2JLVA 4CT5A 3I5XA 4HATA 1XEFA 1ZNXA 3N5CA 3K9LA 4LHXA 5BN5A 4FCTA 1JR6A 1AS0A 1EFUA 1EFCA 2P6UA 1QHSA 3LY5A 2KBFA 1HH4A 1RRGA 3LBNA 3JZMA 1MR3F 4N1AA 1G3UA 1CBUA 4JJKA 2VF8A 4R2IA 5FI1B 1Z6XA 4MDEA 2IYUA 2E9SA 4URYR 2FEOA 5JEDA 3ZQ6A 2QMOA 1ZVQA 4OBEA 4DCTA 2YOFA 5KYKA 3BIFA 3ND8A 4RD6A 4TMWA 1DG1G 2NO7A 1ZNZA 4C0HA 1IN6A 4DVGA 2O0HA 3AVYA 4AKIA 3TW4A 5K8UA 1W1WA 2ZI6A 4BLSA 1EFHA 1W2GA 3FWYA 4FI3C 4DCSA 5JS7A 4EPRA 4HAZA 1W36C 1HEIA 4GOKA 2PEYA 5G3YA 3BD9A 4NPHA 4S2EA 3REGA 2REBA 2C8VA 3MWJA 1XD8A 1G41A 3BAFA 2XOKD 5DHFA 4LC1A 3TQFA 4YMTA 3K9GA 2WWHA 4PPQA 1XTJA 1RVDA 2XGJA 5FTKA 2QAGA 3H86A 1YR6A 2GJ8A 3FMFA 1M7BA 3W6OA 3B13B 2XJ4A 2QGZA 2EVWX 3EAQA 3ZD6A 2WIBA 2FJUA 4JLJA 3ZLJA 2WPDD 3KJGA 4R71A 2PZEA 3T61A 2FH5B 5GJVC 1NKSA 2CLCX 2W6JD 3KX2A 4M22A 3C41J 1ZCBA 1VKJA 1GM5A 3FMPB 5HR5A 4Q9KA 3KQNA 3LNCA 3L0IB 5FPTA 4FD2A 2GXAA 1X86B 2ZYTX 4D80A 1EFRA 3CO5A 4LHWA 3OAAD 4C0AC 3LX8A 1O3YA 2B8TA 3B60A 3RS5A 4EFLA 1CRPA 1QF9A 1ZJ6A 2PL3A 3NTUA 2FV8A 2OZEA 4BE7B 4NH0A 1NSTA 2DWOA 1HA3A 2QP3A 3K09A 5KO2A 2WZQA 3H4MA 5GJCA 4X8LA 1GL6A 4DEYA 2E1RA 1E2GA 1UFQA 2VHJA 2VSOA 2DBYA 1W0JD 3S1AB 3ZZUA 1NVUQ 2VP5A 1BMFA 2G6BA 3FOZA 2IW3A 4V0KA 4BWYA 1Z29A 3X1YA 2ZJOA 3U60B 4TZ6A 2HJVA 3TVDA 3AVTA 4Q03A 5LD2C 1KI3A 4LBVA 3EZ9A 3LRPA 2DCUA 2FSFA 3A4LA 5FBRB 3HYRA 3SBDA 1OSNA 2W2VA 1JPJA 4PO1A 3UATA 4YMWA 3MJHA 5JBQA 4MKGA 3AH8A 3AVOA 1E1QD 4JLAA 2ZVQX 3T35A 1WA5A 3U6KA 2LCFA 1ONBA 4C2TA 3QY0A 3EPHA 4EPXA 1E9RA 3T1TA 2IUTA 1SKYE 2BV3A 1R0XA 3CNLA 3THXA 4UXJA 5JWHA 3E5HA 4G5RA 1X6VA 2A5YB 4QGAA 1CJVC 2BMEA 3CX6A 2P3SA 2ATVA 4K81B 1GRQA 1P9NA 2ZITA 1QHNA 1SGWA 4NYMR 3IKJA 4XJXA 1LW7A 4FW9A 3HDTA 1E2JA 2VP9A 4WZ6A 4L8GA 1ZU5A 3EASA 2AR7A 3TKLA 4A0FA 1NMXA 4C7OB 4PHTA 2PX0A 4Q4HA 3HPQA 3GPLA 1UBFA 1GITA 2B8WA 3LBIA 4RD2A 1Q44A 1TU3A 2G1JA 1NBME 3MD0A 2XOKA 5JRJA 1TEXA 2A5GA 2OXRA 2FG5A 2GF9A 2ORWA 3NDPA 3I1FA 2A2ZA 3RSOA 2RGNC 1QHIA 5KNDA 3V00A 4M1YA 4QGHA 1KOFA 2GK7A 1PV4A 5EE5B 4ABYA 1GDDA 1KNQA 2NO6A 3QEJA 4EDHA 1JALA 1VTKA 3KFXA 3NC1C 3RLFA 2W6JA 3AKYA 4W7SA 5CJPA 3L8ZA 3UWOA 1TTTA 1QRAA 3UIEA 1LFDB 2ZRAA 2ZSEA 2WWYA 3THYA 4WZAE 1FMJA 1TF2A 3OHMA 2C78A 3C4JA 2OHFA 2GZDA 4QG7A 4NKRA 1UKYA 3OIVA 2LKDA 4DLTA 3ICEA 2LKCA 3BBPA 2FFQA 4E03A 2FZ4A 4ZKDA 2DWQA 2DHRA 5FBVB 5G40A 5AK0A 5FOXA 1N5IA 4G01B 5B58C 4LY6A 4R7ZA 4CRWB 1WRBA 1D2MA 1W0JA 4B74A 3R9XA 3A1SA 4B73A 2EFCB 4BFXA 2OCAA 3EW9A 3BXZA 3GLHB 2DB3A 2ZS8A 1ODFA 2PZFA 1QZXA 1E9CA 3NBYC 4ESVA 1JNYA 3JVUA 3WP1B 1OE0A 1R0ZA 2FGKA 1W0KA 1MO4A 2ZS9A 5H70A 1LB1B 4US2R 1Z08A 1XX6A 1ZNWA 2FFHA 2GK6A 2BBTA 3OIWA 1E1QA 4F91B 1XD9A 4HEJA 4E5UA 1SQ5A 4OK3A 1GFIA 1ZM7A 1P5ZB 1U9IC 4O25A 4YDHB 5E95A 2JAQA 4JSYA 4OI1A 4DWJA 1KI1A 1KTVA 4Q1AA 2A5DA 4A36A 2I3BA 1YVDA 1SXJC 2KI5A 2H16A 2ZJZA 4TWZA 4TQUS 3IEVA 2C95A 4Z51A 1E2FA 1F5NA 4A6PA 3M6AA 4GMDA 2GZAA 4PAMA 5IK2A 1E6CA 4FMCB 5KHOC 1AIPA 4US0R 2FFAA 1XFAA 5KU1A 1AGRA 1S2MA 4JLPA 5A5GA 4Q18A 2XNDD 5EZ5A 2CE2X 1WBDA 1DAGA 4E09A 4ZKEA 2YWHA 4ZCLA 2J7PD 4V0NA 1U8AA 5TMPA 2AKYA 4ZDKA 1RKBA 2Q0HA 1XTIA 2XZPA 3HJNA 3PCRB 3QOFA 4URZR 2K5UA 4CIDA 1R2QA 2FE4A 4B71A 1KK3A 1W2HA 1CXZA 5E3HA 1G8PA 2D06A 2FPLA 3EZFA 3NHAA 5FTLA 1P7CA 3IHWA 2SHKA 3K53A 4B32A 3BB3A 1AK2A 1G5RA 2OFOA 1AZTA 2AL7A 2CE7A 2HUPA 3GD7A 2ZRHA 2DFKB 4U7DA 1II0A 2VSFA 4MRVA 3Q5DA 3W8NA 1IN5A 5J4YA 2R2AA 1ZMXA 4DLVA 3NBFA 2FZLA 2JJ1D 4JT4A 4JL6A 4KVAA 3AKEA 1OYWA 1Q1EA 3IILA 1Z0IA 3OEHA 4IOLA 1P4SA 4PAQA 1KMHA 3GCGA 1UM8A 2NIPA 2OV2A 4KLZA 4P4SA 1DARA 3L82B 1SVMA 2WWGA 4M8NE 1XPRA 3GLFE 2GBLC 1XXHB 4KLNA 1OHHD 1W36B 4TYPA 1G7TA 3Q3JB 3KTAA 5DI3B 1KI6B 1OH7A 3BWDD 1OT3A 4LDJA 1G1MA 4H9GA 4BQSA 1E9EA 2ZI7A 3IPYA 4ZI3A 1RZ3A 3EC2A 1CIPA 4IFEA 1US8A 2WKQA 4F4JA 3I8XA 2AK2A 3VX4A 1FW6A 1G8GA 2EWVA 3SJBA 3WNDA 2D74A 3U4QB 1KO1A 3SYLA 1CR0A 3IQXA 1W4RA 4V0MA 2BM1A 3WNCA 1NVVR 1WP9A 2IYSA 2GCNA 3Q7QA 3I61A 3ZD7A 2EU8A 4Q7LA 5ANRB 2Q3FA 4UNSA 3T1VA 2QY9A 2VL7A 3B1YA 1IQPA 4PC3A 2GKSA 621PA 2ZUCA 4QJ5A 1ZC4A 4UQOA 1T3LA 4M9SA 3B1WA 2VP0A 4LPKA 3QUSA 1Z83A 5C4GB 3U5ZB 4Q02A 2HXYA 4RZ3A 2N1BA 1VG1A 4HAUA 1KZ7B 3EA0A 4TN1A 2I1QA 4ZDIA 5EJEA 4ARZA 2UVQA 4BPBA 1RJ9A 2ZPTX 3V4FA 3CW2A 1TADA 2J7PA 3A1TA 3AKDA 3B2EA 4HB2A 4LZZA 1DAHA 1HV8A 4G5OA 3K0SA 1Z2CA 1JBKA 1RRPA 5K8IA 5LD2B 1ZD8A 1VCMA 2KSQA 4YMUA 1I4TD 2V54A 3KB2A 3A4NA 4P3YA 1E9SA 2X19A 2HT1A 5BWMA 3QKSB 1K6MA 4MGKR 1XEWX 2VHTA 3PV0A 3WRXC 4ACBA 2YC4C 1U0HC 4DHEA 3LFUA 4IDHA 5E7MA 2F55A 3RRYA 1R5OA 3GFTA 2F9LA 4PC2A 3DKVA 4PHFA 4V0OA 2NO1A 2PJRA 1DBSA 5IHPA 1ELOA 4JBWA 4RFSA 4FMBB 2R6GA 1JJ7A 3THWB 4WW0A 3A4MA 2EYUA 5HCIA 1ZUIA 3QKRA 1S96A 2ZETA 3FTQA 1XD2B 4TSFD 4BFWA 2JA1A 2XTZA 2V1UA 2H8KA 4JSTA 3TLXA 2ZUDA 5JEEA 3AV0B 3K0AA 1KK0A 3MWKA 4LBZA 4LJ9A 5JJIA 2GAAA 3DO6A 4EAQA 3LLUA 1CJMA 1NI3A 4FIDA 3SI7A 1U98A 1UBEA 3DEFA 5JHGB 2V4ZA 2A5FA 4V0ME 3WXMA 4YMSA 3EPJA 1H8HD 1UBCA 2ZJYA 2ZI4A 1XTRA 2ZSFA 2GAOA 3LQQA 5DLQC 3FVQA 3LDAA 5CYOA 1HTWA 3X1XA 5D3MB 3EIEA 4AYWA 1K5GA 3MMPA 3U61B 4OI4A 3ASYA 3DOFA 3TR5A 1CRQA 3SBEA 4EFNA 2ZRPA 1M7GA 1OB2A 1Z22A 1CR2A 1COWA 2BBWA 5KTYA 4TT3A 5L3SB 3U3OA 3QXJA 1P9RA 3DKPA 4UKDA 5EE0A 4C0LA 1SVKA 4DLUA 3SU8A 4TYWA 2J0UB 1C9KA 4OQFA 2NMVA 3IPXA 3L43A 4OHYA 1OFUX 1OFTA 2GEVA 1GKUB 4XD7A 5HKKA 4M1SA 5DI9A 4B2PA 4F4CA 1S8FA 3U6BA 1XCMA 1TQ6A 2JLQA 3DPUA 1KAGA 1U81A 2WKPA 5AJZA 2CLSA 2VP4A 2IYLD 1ZD1A 4NZYA 1P72A 3R8CA 4BZQA 4MYHA 4DLRA 4UNPA 5J40A 1OXUA 4C30A 1E0SA 1I4DD 2VLIA 1YHNA 3ZS9A 1SZPA 2CCKA 2FSHA 3BORA 5JWOA 1JI0A 2VA8A 3IHLA 5JZVA 2JLYA 3A1UA 1VIAA 1G5PA 4HB0A 3ZJYA 1G19A 2IK8A 4M1WA 4NHOA 4C7OA 3CRVA 4ZDJA 3Q85A 1U0LA 2A3RA 1Q1QA 1E2NA 4M53A 4Q21A 5EQTA 3OIUA 4DKXA 4U5XA 1M2OB 4MRRA 3D7MA 4Q66C 2R44A 4LJ4A 2H7VA 3D3QA 3CF6R 3QEOA 4URUR 3SJCA 2C9CA 4WVFA 1FX0B 4LOAA 2RGDA 4D4KA 2IS2A 3LW7A 3GJ4A 4PSKA 1R8SA 1XWIA 2CL7X 2GF0A 4Q19A 5FL7D 2HCJB 3TSWA 3VTKA 1SXJB 1QBKC 4F92B 3I5YA 3PEYA 1NN1A 4M1OA 2ZU6A 4BLTA 1WB9A 5F9HA 3NDBB 3CNNA 4YLGA 1G6OA 1BIFA 3KKQA 4G5GA 1R4AA 5DNYB 1KSJA 4PZZA 2R62A 1DG3A 4I81A 4U02A 2R8RA 5CIQA 4NU0A 4ON9A 2BKUA 4B3CA 1ZINA 4AKGA 2ZRKA 4KCGA 1H8HA 3RRNA 3HWSA 3I72A 3D8BA 2DR3A 4N3NA 3SJAA 1E3MA 2IYQA 1W36D 3PR1A 2B6HA 4ASUA 1GWNA 5DIFA 2BIFA 4MGZR 1NY5A 2O8CA 3GLHA 1AS3A 2BHRA 1G3IA 4GZMA 3P26A 2UKDA 5BXQC 1KI9A 1X8LA 5JSZB 1AQYA 4F38A 4A0RA 4O3MA 2D62A 5KOYA 3LQRA 3KFVA 3SHFA 2IYZA 5AUPB 2CJWA 5BYJA 3B85A 4ACAA 5L3QA 2HF9A 2BMDA 4FCVA 4JL8A 4Q4JA 3HP1A 3RABA 1DELA 1QHXA 2WSSD 4B48A 1P9WA 2F1RA 3IIMA 421PA 3FKSA 2ZANA 1D6JA 4GP7A 4XTRA 1TPZA 1X1RA 2IL1A 2ZVPX 1RW4A 2XJ9A 3GMTA 3I3SR 3C15C 5FH9A 1E2EA 2ZE8A 1NN3A 2OSBA 2D2FA 2EWWA 4PPFA 4BZPA 3K1JA 2Q9BA 2ZRDA 2QSYA 3LO5A 1E9FA 3Q5EA 5JECA 4URVR 2O8EA 1CR1A 2AKAB 1YZUA 2ANBA 2OBNA 3WP0A 5CDFE 3RYTC 1N6NA 5CM8B 5DYGA 1N2CE 1X3SA 1JB1A 2IEYA 4AURA 5AJWA 3KQHA 4EPVA 1DOAA 2VBCA 2GA8A 3BGWA 2IWHA 2GJAA 2JASA 2Q6TA 3CPJB 1N0UA 1E69A 1OKKD 2OO7A 1VG9B 2VYFA 5LB4A 2ZE5A 2WHXA 2BM0A 3SE0A 1UEIA 1UKVY 1C1YA 1LF0A 3KJEA 4WOPA 3EZ2A 4IHQA 2PT7A 2BVNA 3QPWA 4L16A 2Q3HA 1ZNYA 4HLUA 1D5CA 1NBMD 2AXNA 3B1ZA 4IVPA 4PHHA 4Q00A 5CIWA 1BO6A 2H1LA 3TJZA 3O8RA 3EZ6A 2KE5A 4CEHA 3FMIA 4EKDA 3KJHA 1G8YA 4C0JA 3CNOA 2O8FA 3BH7A 4BRUA 3GEEA 1N5LA 1W47A 5DO9A 4MUBA 4QM6A 3ADCA 3EC1A 2ZSDA 3RRZA 2J1LA 1Z0AA 2AWOA 2PJZA 2IYVA 4BFTA 3VR3A 1FZQA 4HLDA 5F9FA 1SVWA 2CEAA 3W3AA 2FFBA 1VG8A 4LJAA 3NC0C 4PO8A 4G5SA 3PFIA 1H8ED 2XZOA 4PC6A 3Q8XB 2CK3D 2B92A 1MO5A 3T5GA 3LLMA 2OAP1 2QE7A 1XDBA 2YWFA 3A58B 4NBSA 3QF4B 5DGXA 3A6PC 1HE1C 3WRYC 1IN8A 4EIWA 3OFND 2IS4A 1KIMA 1OJLA 1S9HA 3H1TA 2CBZA 4BLOA 1Z3IX 3QG5A 1N0VC 1JXOA 3LVQE 4KFUA 2PZGA 5EXSA 4L15A 3H84A 1M6NA 3MGCA 5D3QA 4GPTA 1NRJB 1II8B 4DB2A 2RKOA 4RCYA 3PEWA 1E4VA 2ZI9A 3QF7A 2F43A 2ONJA 2G88A 2WTUA 1CTQA 3UKDA 2WSSA 3QXCA 3U4QA 2AFIE 4Q7KA 2QUZA 4GOJA 3MWYW 5FTJA 4H1VA 1BH2A 3B8HA 1CKEA 2P2LA 1KK2A 2V9PA 3CX7A 3HU1A 3QE0A 4X8OA 1ZCAA 2WSMA 4IRUB 3CUEF 1VG0B 3WMEA 1DEKA 4RZ2A 4OJQA 3VR5A 1U99A 4GDFA 5F98A 2BCGY 2IS1A 1AA9A 2YWEA 5JJLA 2ZI5A 3AGQA 1YQTA 3H2YA 5JCZA 1F2TB 2IHYA 2CHQA 2YINC 2QPOA 1XP8A 1XJQA 4TMVA 3ADBA 3W9YA 1LV7A 4KV9A 2VPPA 2WMNB 2G77B 4GP6A 4HDQB 2ERXA 1N6LA 2QM8A 1LTQA 4M1MA 2P5SA 3M1IA 4Z54A 1BKDR 4MYCA 4Q1EA 2OCBA 3DL0A 5E7JA 3KZ1E 4PR0A 3SOPA 3WHKA 3I73A 2EYQA 4DSUA 2B21A 4YC7A 1NKTA 4GT1A 4Q7JB 3W34A 5FUVA 3GJ5A 2OXCA 4PHGA 1TAGA 4WZBE 3OEED 1LVGA 1N3BA 4M1TA 1MABB 3BERA 1JQLB 1AKEA 4V0LA 3AM1A 3T06B 4TQAA 4NYMQ 3DZ8A 4HUQB 2OAQ1 1SXJD 4CF7A 2ZAOA 1NJFA 3T34A 4D4JA 4ESHA 4QBGB 1XB2A 3JVVA 2MMCA 2Z4SA 3K09C 3CH4B 4K46A 4B2LA 4AYXA 4LC0A 1Z28A 2O8DB 1XTKA 2IXEA 3B6EA 4PZYA 3RHFA 3ZS8A 2C9YA 4BFYA 1DAKA 2ASEA 5FOVA 4DDVA 4Q9LA 3P20A 3P27A 2RCNA 1G20E 4KODA 1G9XA 3UXMA 3PUWA 5EP3A 5C2JB 1WQ1R 5F3WB 2IF2A 1Z0DA 4JBXA 4MRSA 4LYFA 3TW8B 4RZXA 1G7RA 4DLYA 3U3RA 2CNWD 2IUUA 4BLRA 2OUKA 1YZGA 3PITA 1W5TA 5FI0B 3OFNA 1RPZA 3Q7PA 1F6BA 1G4UR 4HLQB 4M4SA 4LYAA 4TMXA 5EUQB 1QG4A 2D7DA 1AQUA 2FF7A 2RGNA 5FL3A 2OE2A 1W4AA 1P3JA 1U90A 2XXAA 4GL2A 2VTKA 4V03A 2WJVA 1FP7A 3CF2A 1KI4A 2BBOA 5L3SA 3TK1A 2BBSA 4UNNA 1PLLA 2GCOB 4OI2A 4R2HA 3U44A 1I2DA 3CRMA 2OM2A 2WPDA 1VCOA 1KZGB 3NXSA 4Q4LA 2V55B 2J0UA 4RY2A 4FXPA 4PSVA 3W6PA 4C2UA 5CB8A 2A78A 1Z6AA 1LS1A 4GSYA 2QBYB 2O8BB 5SZJA 2F3RA 4CEIA 2ZRIA 4LHYA 4EPTA 1N5KA 4D4MA 3A1VA 4AG6A 4YQFA 2HJGA 1ZM9A 2PT5A 1NLFA 1EWRA 1YRBA 2R6CA 3OAAA 4A92A 1GKYA 4KFSA 5J47A 1OH8A 1I2MA 1GSIA 2W0MA 3GLGA 4FWIB 3W90A 1KDRA 1S3SA 4FCWA 4IOJA 1G18A 2W83A 3OESA 3VHLB 4X8MA 3L0OA 4DDTA 1RYHA 3TR0A 2G0TA 1TX4B 4RZUA 4B3FX 5L3VA 2EFHB 1KY3A 3SN6A 3SYKA 4DLXA 4CEJB 3HYTA 1NL3A 1KY2A 4FN5A 3AP3A 1W4BA 3TBKA 1VPLA 1II9A 5CYPA 4OJKA 4EQ6B 4AIIA 4TQ9A 2GESA 1EX6A 4JYBA 1E2MA 1QHYA 1NY6A 4BFZA 1Q3TA 5GADl 3DVLA 3MAAC 1UAAA 2ZJBA 4TTQA 3LH5A 1Q22A 1PUIA 4AD8A 1FNMA 2OCPA 3QNUA 4ERNA 3C7KA 4TMKA 4TL9A 1X8KA 4TL8A 2JLRA 8OHMA 2WOJA 1NN0A 4LCBA 3UMFA 4P0TA 1A4RA 3B5JA 1G291 5JJKA 1S4QA 3L0SA 1IN4A 3BK7A 2ZJAA 4Q4AA 1HY3A 2HT6A 1FMLA 3KKPA 3BH0A 2PLRA 2KJQA 3IBGA 3OE7D 1OXTA 4CW7A 1KNXA 3TMKA 4C0SA 4DT1B 5HCNA 1W48A 2CNWA 3K0FB 4OYHA 2GHIA 3RWMB 3VR2A 4PPGA 4ZIRB 3UK6A 2KWIA 3GLIA 3KDSE 3K0EA 4G1UC 5FBQB 3X2SA 5LPNA 4UNRA 1ZP6A 5KSZA 2FN4A 2MSDB 4A2WA 2CHVA 4IOMA 2IF0A 4HB3A 5K8LA 3ZVNA 4EJSA 1DS6A 5A4JA 1M8PA 2L0XA 1WXQA 2ZREA 1HQYE 5JSZA 1NN5A 1S1CA 3PUVA 3GLGE 2WJIA 2RHDA 1E2HA 3LV8A 2G1KA 3AGPA 4AYTA 4G3XA 5JHHB 1IBRA 2ORVA 2ATXA 3BJIC 4RKFA 3BB4A 3GJ0A 4RSGA 1JJVA 4RCZA 4XVRA 4Z1MD 5B2ZA 1Q20A 2IYXA 1BYIA 2PX3A 1G8HA 2QM7A 3FGNA 3OZXA 2QTFA 1A5TA 4GRAA 4BFUA 1HQCA 4DDUA 2EFGA 4BLPA 2JLWA 1W46A 2IC5A 1Y3AA 3K8YA 3QG1A 3QVVA 3AF3A 4ZCMA 5KUTA 4L4UA 3SQXA 1GP2A 1P6XA 1HYQA 1A2KC 4JKYA 2X1VA 2QT1A 1B0UA 2H5EA 2OCYC 1RFLA 4NONA 4P31A 2BWJA 4URWR 5J4VA 3CKLA 1OIWA 2W58A 1TUEA 3L2OB 4XSHA 5BQ5A 1OXVA 2FNAA 3U7EB 2NO0A 1M34E 3SQWA 2ORIA 1CEEA 4MRNA 4LUCA 3K9NA 1R0WA 2NTYC 1NVVQ 1FOEB 2Q21A 4JS0A 3RSLA 3TQCA 1GTVA 4I1VA 5A0FA 1JAHA 3EIHA 2WIAA 3LWNA 2PMDA 4PC7A 4NCNA 4TYQA 5FPKA 2OT3B 4NYJR 2W6ID 4C9BA 2OLJA 1NVXQ 1Z5ZA 3MUFA 2RH5A 4JL5A 4O2RA 4B3DA 1IOZA 1E2DA 2Z0MA 2Z5FA 3DMNA 3GLIE 2GXSA 4MGIR 1VECA 1JXMA 3R9WA 1KDTA 3LW8A 1QHHA 1F2UB 1WDTA 2VHUA 4XH9B 3EPKA 3R9IA 1J8MF 1RC8A 2FDCA 3B9PA 1G64A 1RRCA 3PQCA 1TF7A 1KAOA 2VH5R 4LX0A 4A4DA 2QT0A 5DISB 1PLKA 5TV2A 4IXMA 2GETA 1V5WA 2QROA 1XF9A 1D8TA 2IEZA 3C14C 4FMDF 4Q47A 4TL6A 5HPYB 4DDWA 2UZIR 1SKYB 3FYHA 2EQBA 3VKWA 4JIMA 4QOSA 3T12A 5GVRA 1G7CA 4UJ3A 3REFA 4CVNA 3GP8A 2HYIC 3AVUA 2EFEB 3QXXA 3FE2A 4Q1FA 1JR3D 4PO9A 2DY1A 3NBXX 4QGFA 1T91A 1YU9A 1ESNA 5EP1A 3WYFA 2ZRGA 1L8QA 4CYMA 4QXAA 2FU5C 1KK1A 2XNDA 3P32A 3MJRA 4HB4A 3QF4A 5KNBA 3DM5A 1XEXB 2ONKA 4Q01A 1FUUA 4KI0A 1ZC3A 1ZUNB 2V7QD 1EG7A 1G3MA 3EXAA 1E2IA 1OB5A 3O8CA 2IYRA 4M21A 3ZVLA 1Z6GA 1YZNA 1KI8A 1E96A 4A82A 4BUJA 2P6NA 3TAUA 4WXPA 1II8A 2HXSA 2QEQA 3ASZA 3O8DA 4POAA 5FPYA 3SS8A 2X2FA 1YR8A 1Q0UA 3ECCA 2WJYA 1QHGA 4B76A 3NH9A 4JLDA 5FBLB 2JDID 2QA5A 4BFSA 4LSGA 3AVXA 2JIZD 2NO9A 3LAWA 3QKUA 3QVUA 2JJ1A 1CP2A 1TUIA 5AWFC 4Q1DA 2D2EA 1QVAA 3QQ5A 1XBTA 4DZZA 821PA 1Z0KA 4A8JC 4KSBA 1FL9A 2R9VA 1Z6TA 3IIKA 1WCV1 5FR1A 4D6PA 2A9KA 1KHTA 3MCAA 3SR0A 2VF7A 1NVWQ 1DAMA 4KBFA 4LWZA 1TEVA 1YJ5A 3RS0A 2FSGA 3NEYA 3ZDQA 4DIEA 3I92A 1OHHA 1IJFA 2C77A 2QG6A 2Z83A 4PQFA 3GJ3A 4LV5B 4B6FA 3IEUA 3QPUA 1R7RA 2IT1A 4JJZA 2IXGA 3F5FA 3EZ7A 4IEEA 1NMZA 5FOTA 2WWFA 5CK5A 4MUAA 3S1AA 2J9RA 4TTRA 3W6NA 5JWRA 2WWIA 3K9HA 1VMAA 5E4FA 2OESA 2ZEJA 1RIFA 4GFDA 2WMOB 1OPXA 3GJ6A 4ZCIA 3CF0A 2FEMA 3TSOA 2QZ4A 3ZH9B 4HDOB 1EFTA 2JATA 3AF0A 4M1KA 4E22A 5EE1A 2FGJA 5EP4A 1ZU4A 2RHMA 2QP4A 1KJZA 3MFYA 3UANA 2JLXA 4V02A 3F8TA 2IX3A 4QC2A 2RB4A 1N6OA 4PC1A 1E79D 1AM4D 5DSZA 4BFVA 4TLCA 5G53C 5EUMA 1TNDA 2HCBA 4HSEA 4Q48A 3EG5A 2GRJA 4HZUB 1YZLA 1JR3A 5DN6D 5JI2E 4EUNA 2BJWA 4KSCA 4F7WA 5LDDC 4E07A 1RE0A 2VSXA 4MKHA 2J46A 2O52A 4URXR 2QORA 2WWXA 2V7QA 4US1R 3JZAA 4IVRA 1F3OA 2TMKA 1E0AA 3VFDA 3Q9LA 2FPMA 1XJCA 4PZLA 1VIYA 4EFMA 2XB4A 3X1WA 2JJ2D 3THYB 2ZROA 4DCUA 1P2VA 2A30A 2D4HA 2ZYUX 4PAOA 1Q1ZA 1S1MA 2GJ9A 3NKVA 4M9QA 5KSPA 1CJKC 3TSZA 1SVIA 1KDPA 3AF4A 3CX8A 4D81A 2UZ3A 1DO0A 4IDOA 1NLZA 2A7QA 3GJ7A 4DRZA 3TRFA 1JQJC 4NYIR 2VRWA 1ZM2A 2AN9A 2RAPA 1TQDA 2QMHA 3BE4A 3Q72A 3TE6A 3ZIAD 2QBYA 2J87A 3PEUA 5GVSA 4TSFA 2ZRFA 1N6PA 1YRAA 4A9AA 4BEBA 5BN4A 5KSYA 4Q9HA 5BYKA 3TH5A 4W5JA 3WHLA 1U0JA 4NE2A 4U00A 3G82C 4KVGA 2ZYVX 3MSXA 5KPJA 1W49A 3ZZTA 3VKHA 1CJUC 3VQTA 1U94A 5F2EA 1E9DA 4Y0AA 4PX9A 2NPIA 4I1SA 5KPDA 3THOA 1U2RA 2AD5A 1HURA 1P62B 4AG5A 1IN7A 4BECA 1AS2A 1OLOA 2J0QA 1G5TA 1ZW6A 2J41A 4TLAA 3GLFB 1MOZA 4C4PA 3B1VA 2OLKA 2F6RA 4CEJA 3WNBA 4Q5IA 2J0VA 1D9ZA 3I8SA 2C5LA 4EQ6A 3VR4A 4LJYA 1R0YA 3RC8A 2YKGA 3RRMA 2H18A 5AJYA 3KKNA 4LK2A 4A1FA 2QNRA 4OI0A 2YWGA 1IXRC 3PXGA 2QL6A 3N2EA 1OXXK 3VR6A 3W5IA 3FHCB 4PPNA 3T1OA 1HUQA 1WF3A 1AJEA 2ZTSA 1SVOA 2EFDB 4JLMA 3KXKA 1FQKA 3WYAA 1T3HA 5KDLA 2W2TA 3EWAA 1KMQA 2V3CC 3WBKA 1JEDA 5HZHA 5SZIA 2ZRMA 5C1BA 2WM9B 1XPOA 1QG2A 1TF5A 1NG9A 2N42A 1E79A 2H57A 4B75A 1HT1E 1SKQA 4CT4B 1GNRA 3AUXA 5FPSA 1KDOA 1XNJA 3RAPR 1J90A 3K0CC 3C5CA 2ZJ5A 2GEUA 4HAXA 4QHYA 4ITRC 4LYHA 1IONA 5DN6A 2AXPA 5B57C 3NVAA 1N6IA 2Z6VA 1KO8A 2PH1A 1IY2A 3SDZA 4C0KA 5GJWC 4UJ5A 3TUIC 3WMGA 1XCPA 1P61B 2CMKA 3R7WB 4AWXA 3CPHA 4JVNA 4N0DA 4Q7MB 3UMSA 5C18A 1NSFA 5BW8A 4Q1BA 5EE3A 4KHZA 2J59A 3U3JA 3DOEA 3L8YA 3UG7A 1MV5A 2P0EA 3X1ZA 3KJIA 3VMFA 4DSTA 1EFRD 1DTSA 1OIVA 2X8AA 3RDPA 2Y8EA 3D6TB 4LV6A 1TQ4A 4ZI2A 2R6AA 5FL7A 5JI3E 1NLYA 1L2TA 3PJRA 4LJ6A 2NG1A 2BCJQ 3EARA 2QI9C 2AK3A 3KTAB 2H92A 2ZRBA 2ZAMA 3AF1A 3QBTA 3LXRA 4TLEA 2NQ2C 2WJHA 3UG6A 2J5XA 4TL7A 4WAUA 5KDDA 3GLHE 2XNSA 1ZM4A 3GJ8A 3CM0A 1DVRA 2F9MA 3K70C 3IDQA 1NMYA 5J4LA 5CM9C 2IUSA 1BMFD 1L7VC 1US8B 1R5NA 4BZXA 1M74A 1EXMA 1FUKA 2CCJA 2C96A 1G17A 4IXNA 5L8VA 4D82A 3EX7C 2GJSA 1P2SA 2F3TA 1XXHA 2W2XA 1S3GA 121PA 5FPHA 3HU2A 5DI3A 3NEJA 4DSOA 1E99A 1KI6A 1Q12A 2CDNA 2JGNA 2J3EA 3MWLA 2GDJA 5IRCD 3LBHA 1PJRA 1ZUHA 3VU9B 1P73A 3KB1A 4IFBA 1RYFA 3GEHA 3U7GA 5JLJA 4QNRA 4I4LA 5TVKA 4OL0A 2DPXA 1GL7A 1ESMA 3IGFA 2XZLA 3O47A 3F3YA 5FBWB 1NIJA 3GQBA 4JLBA 2WOOA 1TL7C 2JLSA 2WJGA 5DYIA 5JFGA 2QSZA 4ARZB 2ZIAA 3PEVA 4IJMA 1XZPA 4D0GA 1J7KA 1RJ9B 3IIJA 1E9AA 1F2UA 3BFVA 5AJXA 4A8JB 2ZJ2A 4DSNA 2OBMA 4LGMA 4WXRA 1VCNA 2P5TB 4IW3B 5SZHB 4QL3A 4F4IA 2GVZC 4MYTA 5JMTA 4AI6A 4L9SA 4TLBA 5LB2A 2YV5A 1KKMA 4GOXA 4JLVA 1SHZA 4DJTA 1Q57A 1R10A 2PMKA 2QAJA 2ZR7A 4NCHA 3SFZA 2Q9AA 4QHSA 1CU1A 2HYDA 2G83A 4KAXA 4AK9A 3W3ZB 3AVPA 3H0KA 4RFSB 1UBGA 3W8RA 4IVQA 3E70C 1A82A 4XIGS 1WBBA 2CVHA 1XTSA 4YDSA 3CZPA 1OKKA 1T6NA 3QKRB 1XEXA 5HZKA 3KQLA 5BN3A 1OW3B 1X1SA 2QAGC 3CWQA 4JBYA 1OH6A 4W5WA 3A36A 3CZQA 4MQBA 4BASA 2XITA 5J4KA 2YC2C 2F7SA 1GZSA 2PBRA 3MLEA 5TDHA 5IF9A 2OFWA 1T5IA 3K0AB 3ZQJA 1LF5A 1N6HA 3QKSA 5CLLA 4ZV4A 1P2UA 1NBMA 3SNHA 1WE2A 3ZVRA 1XXHE 4HAVA 1F48A 2F1HA 3HPRA 1XTQA 1Z47A 1UPTA 5EZ6B 4DEXA 3QPVA 1PZNA 4LHZA 2YJTD 2JLUA 1EESA 2GJKA 2CXXA 3FDIA 3RS7A 3I32A 3THWA 1Z0FA 3NHBA 1CS4C 2A5JA 1A2BA 1OYYA 4PQYA 3TNFA 1IXSB 1YZQA 1XD2A 1R5BA 2ZR0A 2QGNA 4I1UA 4BEJA 2P65A 5FOUA 4I1OA 5H8WA 1JAIA 1TU4A 1IAQA 2O5VA 4MITA 4N0EA 1H65A 4A2PA 1ZAKA 3KL4A 2BC9A 1GNPA 4UXHA 1OFIA 4ZO4A 2ZUBA 1H8EA 1W0KD 3PUYA 4B3GA 1G8FA 3RS4A 4B35A 221PA 2CK3A 4RJLA 1PVOA 2R65A 1VYTA 3GEIA 4HYYA 2FMXA 4B6EA 3VNUA 1M1YE 2RGCA 1QDEA 4KYUA 2XTMA 3SZRA 1E98A 4LI0A 1JEEA 3F0TA 4LJ7A 4TTPA 4W9MC 4DCNA 3LX5A 3HR8A 5HTKA 1VCIA 4MYUA 3QI2A 5D3MA 2E87A 3NH6A 3ZGXA 5TARA 3U3KA 5M04A 2HV8A 4MGYR 4QBIA 1XMSA 1ZD9A 2R6FA 4O2LA 1M7HA 1A7JA 3QSYA 4KYIB 3V9PA 1FFHA 1GRNA 3QENA 4LPSA 2KB0A 4L9WA 1E2KA 4JYCA 2C9OA 5IK2D 1E1RD 1KGDA 1QVRA 1VHLA 4TMZA 4P4UA 4LV8B 3BRWD 4GMXA 2AHOA 1NIPA 2YHSA 3PIRA 4NCKA 5EXTA 521PA 1GIAA 1GILA 4PANA 1Z07A 3A1WA 2QQEA 4NMMA 3TVTA 1Q1BA 2ZSBA 2XEXA 2ZRLA 4X8HA 5EXXA 1YE8A 3B82A 3SJZA 4A15A 1DO2A 3N2IA 2QTHA 1XMJA 1E4YA 4HZUA 1XRJA 5H1YA 1E94E 3ICQB 1ZM3A 3AQ4A 2GEDA 4O0MA 1KJWA 2WKRA 3TUZC 2I4IA 4RD3A 4W5HA 2QMEA 1J8YF 1PUJA 2ZRCA 1UJ2A 2W0SA 4P32A 1E2LA 4C3ZA 3O8BA 3OIYA 2VP2A 3PUZA 1EGAA 3CIOA 2B7CA 1K5DA 3WMFA 5FR2A 5TB5A 1MT0A 3FPAA 3ZVMA 3T15A 2QQ0A 3NWJA 4HI0E 4TYYA 3OEHD 2O0KA 4P4TA 2D7CA 2KBEA 4A0GA 1FX0A 1G7SA 1R6BX 4B2IA 5CB6A 4B34A 1U8ZA 1DADA 1EX7A 3OEEA 1G3QA 1U9IA 2BEKA 2ZQ5A 4MKFA 4OQNA 4M0LA 4DLZA 2RGAA 5IT5A 2HLDD 5JCPA 4PSAA 4LJ8A 1SXJA 4DB4A 2MSEB 4FMDB 2F1IA 4QM7A 1Z06A 3FB4A 1YKSA 1SVLA 3IQWA 4B3XA 2O8CB 3TIFA 2AX4A 3LA6A 2C03A 3UMRA 2P6RA 2ZRNA 4OHZA 1KKLA 3AB3A 4B33A 3CRRA 3PENA 2QP9X 3KKOA 4RD4A 1IY1A 3P4XA 2CJWB 2WAXA 1NP6A 5L3QB 1YR9A 2QRZA 4MDFA 3B78A 2BJVA 5DE3A 5FUXA 5TY0A 4KITB 3ZYCA 4Q4JB 1NG1A 1LS6A 5IDVA 5J5CA 1J99A 2OBLA 5EE9A 1B23P 4JVLA 4LYJA 3GLFA 3B7GA 4B43A 1HT2E 2REXB 5P21A 1JPNA 3M4YA 4J0QA 2VO1A 4KU4A 3B1XA 3B9QA 3ONWA 4RVCA 1UKZA 1XEWY 2B7BA 1ANKA 4HUTA 4MKIA 3BB1A 4Y0VA 4C0QC 3E1SA 1XZQA 4PTLA 4NCJA 4KFRA 1LNZA 3DZDA 1E1RA 3C5HA 2VP6A 2O8EB 2DFTA 1W7AA 4ZDWA 1XPUA 5GJBA 1HE8B 1P75A 1IM2A 2MSCB 1MRSA 4DC9A 3U7HB 3K70B 1CJTC 3EPLA 1FQJA 1CULC 1Z8FA 4QBHA 2WICA 4NDZA 2DFNA 1Z6YA 3AVQA 3QJYA
chains in the Genus database with same CATH superfamily
4DUGD 1ODTC 1H3FA 3BS4A 2HHHB 2Q9CA 4IIJF 3AKZA 2Z43A 4FFDA 1XQ6A 5IDWA 2G40A 2OOSA 3SEAA 3HFSA 4HZIA 4QJIA 4H31A 4AQDA 1NVEA 3NGMA 4MI9A 1TE2A 1Y8RB 1ZITA 1CUEA 2C97A 2Q3BA 3ELWA 4L28A 4MKZA 3WAKA 1E9BA 2PO5A 4N9QA 2JLZA 2ZU0C 4X3PA 4HNHA 1X2EA 4FGSA 2W9XA 4X1KB 4LWQA 4CMCA 4X94A 4Q0MA 4UAVA 3QX9A 4L75A 4KK3A 3RF7A 4CKEB 3NBAA 3TAHA 3P52A 4NCAA 2W2PA 1IOVA 2V59A 1H1DA 2VUIB 3BGSA 2IZ0A 1M8KA 3JQRA 1V7ZA 5E9WA 4EUKA 2IPAB 4K0KB 1ZA2A 3R24A 2H1WA 4CQMB 2ZBUA 3KV3O 3N2NA 3E0QA 4FHDA 4LYDA 4PCLA 1F7UA 1U5BB 2VRBA 1PZFA 1SXGA 3GFPA 4FNGA 3I53A 3P2KA 4D98A 5JATA 2JH8A 5LQJA 1IRIA 2FZWA 3EBOA 4XX1A 3ZJ4A 3T7TA 3OZCA 2V4UA 3DXYA 2CYCA 2ONZA 3R20A 4OQMA 4DWWA 4OATA 4KR0A 3DFUA 1IHUA 1YZTA 2VDKB 1O6GA 3LF2A 3PDHA 4CMAA 4BN5A 3I01M 4UREA 3SC2B 1RLJA 1V6SA 2IZZA 1HLPA 2IBTA 3GRAA 1W44A 4WZBB 1KFCB 2IOFK 4RADA 3BC1A 2ERCA 1TAQA 2VWPA 5K0CA 4HHEA 3CUKA 4QIHA 1B93A 3ADDA 5L3RA 1KQOA 3R8XA 3WLRA 4QUDA 4HXFB 1QS0A 3G2QA 3NBZC 4RQBA 3BRCA 4ZT3A 1AGPA 1V1MA 4Z8XA 1N1DA 3EWIA 3A1NA 1FSPA 2FMHA 1UKEA 3NJRA 1ZMTA 2QZZA 4H3SA 2Y1WA 3HCEA 2X22A 3OE7A 4XUGB 1WS6A 3SC3A 1XLTC 5CVDA 5JXGA 3FNEA 4UASA 2F43B 1Z16A 3NJ4A 3AUYA 1Q3HA 1QMPA 1Y4AE 1RPAA 2QAGB 2RHOA 2Y77A 4XTCS 5B6PA 4HRXA 4IDPA 2GWHA 4XUEA 2D2IA 3DVRX 5ADVA 5K8TA 2WWRA 2HX1A 4DW8A 5F7XA 5KSOA 1NHWA 5JCJD 2AJ8A 3T9DA 1JDZA 2OG2A 1FVXA 3DWEX 2C3OA 1XKTA 2I22A 3BL8A 3Q41A 4P7GA 4PYIA 1E2BA 1G6KA 1Y1KE 2AEMA 2Z5GA 1W85A 2VHCA 2HQRA 3X1DA 1UDWA 1NGSA 4DMLA 1LGYA 3HNPA 4BYGA 1TMOA 2XLCA 2OXEA 2VK1A 1W9HA 1Z0JA 2J85A 3OJ0A 4IIBA 3V46A 2W90A 3FDZA 4AB1A 2PZKA 4CL2A 1JJFA 1ILEA 2FJ0A 1MJHA 4DTCA 1ATIA 3PVSA 5EFOA 4B46A 1JYEA 1XVUA 2W00A 3B6ZA 4N3CA 1FSZA 3TJMA 1JQDA 3WYGA 5JJ5A 2IA5A 5TXGA 1FXWA 5LZ4A 4PZDA 3S55A 4X6XA 5AVRA 3FYSA 4Z1MA 1GGMA 3GNLA 2YYZA 5K3BA 3T9FA 4RHYA 2FPGA 6PFKA 2CL0X 1Z38A 2D7JA 1L5NA 3USES 3ELUA 3SFVA 3O1HB 3WG9A 4EB8A 2O0JA 2JGDB 1KQFA 2C99A 3DF9A 4DUGA 1BS2A 3L6BA 5IAAA 4JROA 3LPMA 3ELBA 5K3FB 1FDOA 1RBMA 3LBFA 3QV2A 5HE9A 3SYNA 2ZM5A 2VQEB 3BSYA 4DAEA 2RAVA 5TS2A 4RL6A 5HE8A 1NF3A 4F2HA 2EAUA 5GM2A 1RYYA 3LUPA 2YOGA 2PGNA 2J48A 3GPIA 4ER0A 2VLBA 4NECA 5FNVA 4AO6A 3N3BC 4KMRA 3QU5A 4ZEOA 4C7KA 4M2LA 2R60A 4TWBA 4B3BA 1DPFA 1O7JA 3CPEA 1DIAA 1ZONA 1QIGA 3Q4GA 2R6JA 4YMHA 2JGFA 3GZTB 1UBJS 4BKMA 4FWBA 1J70A 2OV1A 1YDEA 2IHNA 1E4EA 2DSTA 1SRRA 2QTVB 4MUHA 2Z2IA 1ZVKA 4NPAA 2OGSA 5C31A 1N6RA 4I3GA 1UMCB 2QR5A 3OCCA 4R16A 1UDXA 2Q1XA 2F1JA 4UPVA 4HX5A 4FOSA 4ZQFA 721PA 4RWZA 1IL0A 3QOWA 4QKQA 4X62B 2C1ZA 2NTVA 3C6MA 3HCCA 3JARB 3M0EA 4IV0A 1YRWA 3EHDA 5GZ3A 2R8ZA 1Z7BA 2QTTA 4H1UA 1P7VA 4OK6A 3AVWA 1OLXA 3IUPA 2PH3A 4S1WA 1D2CA 2QTLA 2Y1XA 3AR2A 1I30A 3CNBA 5F21A 3UENA 4J3JA 1YA8A 1ESCA 1HDYA 4OYLA 3ZCTA 1XZLA 1O87A 2ZRJA 3O84A 5CLQA 2J7KA 4YP9A 2ZJ3A 1SXIA 3IVGA 3VNAA 2V5UA 5K99A 3S70A 1WMSA 3OKFA 1Q84A 1W8IA 1T9BA 3A7DA 4P7FA 2O8NA 2ZIXB 3ZX5A 4WOJA 3PD1A 3SDSA 1C50A 5KYNA 3ZCRA 3IVCA 5EMHA 1KS2A 2HIMA 1FIUA 4KXFB 1L5LA 2HU7A 3VJLA 1XA3A 5DWDA 1JKJB 2B35A 1EWTA 2JLBA 4AZSA 1H3NA 4RFVA 4YHBA 3U4IA 1Z88A 3PG5A 1O77A 4M98A 1XA0A 1O6FA 2PXHA 4S35A 3NPAA 2FPPA 1U6IA 2IHBA 2HEIA 1L4YA 2YOHA 3LHKA 2CVFA 1UBLS 1DLJA 3V4VB 1DT5A 4MVJI 1GNLA 5ENVA 5I9SA 5T7BA 2JRCA 4GX1A 1V37A 2F8MA 4DLAA 1A72A 1P1CA 1PZMA 1R3DA 1IK6A 3HP7A 3KM0A 1B2RA 2VZ8A 4HFNA 4PHCA 3OMXA 2HDNB 2XSZD 3FKSD 4NYIQ 3IO3A 4YO8A 2DT8A 3X2EA 3CR7A 1U7WA 3EXFB 2PPVA 1N5JA 5I5GA 4CEIB 1USWA 3K96A 4LRYA 4PGAA 3STWA 2OEPA 3DS8A 3QLEA 4TM7A 2A1TS 3WV4A 4J7UA 1DHTA 1PD0A 3OPNA 2HRZA 2XCUA 3TM4A 9MHTA 3W5DA 1QV7A 2QQ5A 2O5EA 1KYIA 2OG1A 3F67A 3HGMA 3ODGA 1TI7A 2NADA 3Q2IA 3ZNQA 4F04A 2JF0A 1ZIYA 2RBEA 2CUZA 4XQEA 3G0HA 1UFVA 3ZU5A 3BXGA 4EOGA 1XZNA 5A04A 1CZLA 2BFAA 1NXXA 3CNEA 3D9QX 5HFAA 4EY4A 3MG9A 4GRIA 3LOPA 2H2HA 4RWEA 2HOQA 1CY0A 3E8SA 4GOOD 4JKIA 4TPKA 4RY8A 1XZMA 5C37A 3AJ9A 1DG9A 1KXJA 2Q3MA 4Q9JA 3TLGB 3OT4A 3LLCA 1TFUA 2O8BA 1E2PA 4NESA 5AXDA 3RARA 2ERYA 1T2DA 4QT4A 1MN6A 4MV8A 4DNFA 1Q11A 1KI7A 1P5HA 1HYHA 4OO3A 4CI9A 3W5BA 4WQMA 4X90A 1QCZA 3OQPA 2QRNA 1T8TA 1LDGA 3FBTA 1QANA 1SIOA 2PGIA 3WDLA 4BX9A 3DMDA 1RRFA 2PX5A 5A9TA 5CVEA 1VJDA 4RD1A 3D7LA 3ZLTA 4OQZA 3ZTWA 1ZS9A 1JT2A 1AN9A 1BXGA 3OF2A 4PGHA 4XM0A 5GOTA 4OHVA 4CDGA 2VEDA 4IICA 1XMVA 4XWKA 1OFHA 4KREA 2JGMA 3BUSA 3COZA 1XNQB 3PGXA 3S2YA 4CM4B 2BYTA 3CTMA 2IPXA 5MF6A 1PR5A 3IDZA 3ZCQA 1SXPA 5ALDA 1SUAA 4YI3A 4BB5A 2G63A 3BFXA 2YXNA 1CQJA 1E0KA 1FFXA 1WUIS 1CF4A 4ND3A 3RK0A 2PCLA 3NIBA 3O2JA 4CMKA 2ZI3A 3KXIA 3ED1A 4K40A 4DHEA 4DIMA 4KZKA 1X3LA 2V74B 3CLTD 2XXJA 2ZE7A 5JU6A 1HMPA 3EIQA 3IXMA 3K2BA 3KYDB 4NV0A 3VKGA 2I03A 3PDCA 5SICE 4XWAA 3V8BA 1JFVA 1F5SA 2C04A 2PR7A 1H9BA 4KQHA 1C1HA 1M6VB 1QQ7A 1UEJA 1BYUA 4JVSB 4TRJA 4WY2A 3RIYA 2C4HA 1JIIA 2J67A 4HGPA 2XLBA 3J80A 4I08A 4YCLA 4QPPA 2VDPB 3NMUF 4KGZA 4H6VA 2KHZA 5J5VA 1S01A 2PCJA 2Z08A 5HKAA 3AOGA 5IZCC 5BUZA 5CU7A 1H1TA 4TZTA 2QENA 4ETIA 5IX8A 4JQOA 3PC6A 3C3XA 3RC3A 1Z0ZA 2PQ0A 3EGIA 3R3HA 4W99A 1E1MA 4PZ9A 5ALJA 1E0JA 4W9NA 4NF2A 3WY9A 4EVSA 4JMPA 3LDUA 2CHGA 4LZWA 4DT1A 4G84A 4RGYA 4PLCA 2I80A 1Y63A 1LK7A 2MT9A 2EZ4A 4B81A 2XSZA 3BDIA 5FCDA 4MLPA 2FWMX 5FA5A 3U37A 3QLUA 3GVCA 1GTZA 5FIUA 3JYNA 5TVGA 3OEYA 2RGEA 3ETLA 3QV1A 1EK5A 3R3YA 3UUEA 2HWYA 1Q16A 4BJ6A 5KTNA 1IZ7A 4QYMA 2VNHA 5MGBA 3OZIA 3T1QA 2NAPA 2HO5A 2D5CA 2O1WA 1Z15A 2NSYA 3ZXYA 2XTNA 4V1CA 4JR2A 2YZKA 3CSDA 4KW7A 3PPIA 3T7CA 4UNQA 2WJJA 3RWOA 1RJEA 2JZOA 4P4SB 3VXKA 1XU4A 2E4AA 4JQSA 1R15A 3QBEA 4I55B 4UOEA 1DAIA 1QQAA 3ZDCA 5I47A 5ITWA 2XYHA 3QUAA 3DHVA 2DAPA 3M8KA 3SDBA 5BV1A 5CFPA 1T4DA 2NPOA 4I99A 3OECA 3QU7A 2JGKA 3DEKA 3C3MA 1KRXA 5EIXA 3OCXA 2Z1DA 4MQ4A 3L1JA 3L4EA 1T8UA 3O2SB 3UT6A 1YZFA 3JCZA 3QIAA 3JASB 4I6JA 1ZOOA 1ZGZA 2X4DA 2XB9A 3AR5A 4F3KA 2GCIA 2OD7A 1PQUA 1JDVA 2IFTA 2P2SA 1N7GA 4FT2A 4BNYA 1ETUA 1GLVA 4BMXA 4RLHA 2AOUB 1F06A 3HVHA 3HI6A 4IDNA 5SYMA 1BS1A 2Q4RA 2WKWA 2QG4A 2ZZMA 2H1SA 2EW1A 4A6XA 1PR6A 3L18A 3QPAA 1AMUA 2HK9A 3IL2A 4H7KA 4CT5A 3I5XA 3BQ9A 1KH3A 4R2WA 5JS1A 5HMLA 4R05A 4XJSA 3RYCB 2I7VA 5BN5A 1JR6A 5DB4A 2JIRA 5B1HA 1J9GA 1QHSA 3M3PA 1HH4A 3DV0B 3BX1A 2VOEA 1MR3F 4QAQA 1C4XA 1CBUA 1T43A 1PEAA 1Z6XA 2R8EA 3D3NA 2IYUA 4L72A 4RPCA 4G9BA 1FA9A 2EZ9A 5JEDA 3E0XA 2X0DA 3PK0A 4DSZA 3ZNOA 3AETA 3BHIA 4HRYA 1ZZEA 4EHKA 1V0JA 2ZATA 5DYTA 5KYKA 4GOMD 2PSHA 5KJ6A 1Y4ZA 1CQPA 4DVGA 3TGLA 3DLCA 3UK7A 1FFSA 5K8UA 4BLSA 3L9WA 3KT0A 4EHIA 4YX9A 1W2GA 3SYMA 3DBRB 4HAZA 3GLQA 4JGIA 4UCXA 5G3YA 4TSKA 2HBYA 3UN1A 4S2EA 4HWKA 3VISA 1QTQA 3MWJA 1R5JA 3R5FA 1TU0A 2AN5A 5DHFA 3TQFA 3NTXA 3G79A 3K9GA 2WWHA 3LSTA 5HRAA 1XTJA 2FPOA 1DRJA 2GK4A 3P8ZA 3QBDA 4MXDA 5F5LA 4UHJA 5FTKA 1DKUA 1E7MA 1EP2B 3PNMA 1KOLA 4JYAB 1MX1A 3DZIA 4IZOA 4JLJA 1KEEA 2WPDD 2F59A 2PPLA 4QGSA 4TV9F 2WF6A 4AQYB 1ULAA 4D9KA 2CLCX 3GAFA 3GMSA 3KX2A 4M22A 2ZT8A 2Y1OA 3SC4A 1ZCBA 3H5IA 3WLTA 5JBNA 2A67A 5JH7B 3COSA 1GZHB 2A1TR 1YGPA 2ISSD 5F2KA 4RM3A 5FLXA 2LV8A 2JL1A 1ZIXA 3BRSA 3WB1A 4G56A 1X86B 1EFRA 4LHWA 1H66A 5A9RA 2P8SA 3LX8A 1N75A 3LQ4A 4MGHA 1NNI1 2O4CA 4EFLA 5JPDA 4DJFC 4P4NA 2OZEA 4Y2TA 4II2A 4A23A 1MU0A 4NH0A 1NSTA 4MZDA 2HH9A 4M7PA 4DB2A 1MX5A 3K09A 1WHSA 5KO2A 1L7QA 5F77A 1FP4B 1KR2A 5ALOA 5B1SA 3UK1A 4X8LA 4DWOA 1VI2A 2PUHA 3HXTA 4WN9B 2RAUA 1IM5A 2NUTA 1YL7A 4E30A 2I0FA 4M49A 5BRNA 2ZJFA 2GS9A 2J9XB 1DPGA 1MDBA 4IIXA 4MAFA 4L5JA 3ZZUA 2VP5A 1BMFA 5TIIA 1B14A 4V0KA 1CF2O 1Y8QA 2CLMB 5EKTA 3WLLA 3PFNA 2COEA 4E2ZA 3T5BA 2NVWA 3L7IA 1J2RA 1KDZA 3TR6A 3AVTA 2QW8A 2NZWA 4PX3A 5A5DA 3OPYB 2NVUB 3EZ9A 3LRPA 3A4LA 1I33A 4PICA 3H6HA 3W7AA 4KQWA 4G0YA 1JPJA 1S2OA 2ABWA 4YMWA 3RSSA 1HG1A 3QNWA 1JA0A 3AF5A 2I2BA 2EW8A 3AVOA 2H7XA 1B1AA 2Q2WA 4FZ5A 4NC9A 5FBKA 2QRHA 3HGTA 1K6IA 4ENPA 3U6KA 1C3LA 3ROFA 2VT2A 4YFYA 4YDRA 3I76A 1BE6A 2W22A 3M1AA 2IUTA 5D5QA 1SKYE 4DPLA 3V1LA 5B6IA 1G98A 4M38A 5AYVA 1X7ZA 2XD9A 1YU6A 1TZMA 3Q1KA 3MT7A 3GZ4A 4ZT2A 5HF6A 1X6VA 5HUHA 3PHJA 3Q9UA 1DFGA 4K6CA 1CY4A 5L6LB 3H4TA 2VNSA 3WMXA 3CX6A 1X7WB 3OU7A 1J5EB 2ATVA 5DHTA 4HK4A 2HQBA 4NYMR 1G6Q1 2LCIA 1AKWA 3HN7A 4M0MA 4K6GA 1LW7A 3L1VA 3HDTA 2VP9A 5AHWA 4ZTBA 4Z7NB 4F4HA 4IRXA 4WSOA 5DTRA 3I5UA 2XGOA 2YL2A 1NMXA 3TKLA 1XL1A 3GPLA 2VWGA 4C06A 2ZTHA 3SEZA 1XZJA 2B8WA 4IJWA 1IQRA 3EOZA 3LBIA 4ALJA 2FAXA 2Q8NA 1EA5A 3OQMA 1NBME 5JRJA 4LGYA 3RIEA 1Z36A 4MO9A 1E59A 3L07A 2Y0PA 3ZIDA 5BRAA 5DHRA 3FFWA 4H4EA 2DKFA 2JI7A 3KAKA 2W2KB 2A2ZA 3UT0A 3K7EA 2WUFA 3OY7A 4L7VA 2BHSA 1VPTA 4OBWA 1GDDA 1KNQA 4Q6BA 3NV9A 4S24A 2UZ4A 4EDHA 1R37A 2R1TA 1VTKA 3T94A 3T4EA 5EJGA 4J2HA 3AKYA 3CEAA 1P4HA 2FWJA 5EFZA 3UWOA 3D1VA 5JD3A 1OBVA 4CLRA 3JW8A 2JLAA 4EB6A 5I48A 1TTTA 3UIEA 1LFDB 1U0OC 4OLAA 2E4VA 2NNLD 3BSFA 5K3CA 4AJ9A 4FHZA 4FJ0A 4MJLA 1FLDA 2Q6OA 4CETA 1YQQA 2C78A 2OHFA 1XWFA 3H65A 4D8TA 5JQGB 4G5XA 1X7YB 1UKYA 1RHRA 2LKDA 4DLTA 1XAGA 4UHDA 3ICEA 3BBPA 2NTJA 4MS4A 2EZTA 1VJGA 2FFQA 1K4MA 2H1CA 3EODA 3U31A 3ZUGA 1GZ4A 2FZ4A 5I7AA 5EHNA 4ZKDA 2PUDA 3SBOA 5CBPB 5AK0A 1N5IA 2P0AA 2R96A 4LY6A 3SLGA 1YRLA 4PYLA 4R7ZA 3OICA 4CRWB 2AVNA 2OWEA 2P9CA 4B74A 4B73A 3WYBA 5C8VA 2Y68A 4Y6OA 5J58A 3GVHA 3GLHB 4JUCA 4V0QA 5T3YA 1BJTA 3DD5A 3MLBA 1TCCA 5HBRA 4UC0A 4ZOAA 1E3EA 3F9RA 4MPTA 3KQTA 1O94C 3JVUA 3ZNNA 2X5KO 1OE0A 2I6UA 4GNRA 4Q3KA 4MP8A 1RS0A 4R81A 1W0KA 3I0MA 2ZS9A 5H70A 1AQJA 4US2R 3ZVKA 4FJ1A 1Y6GA 2XCLA 3DMHA 4ITUA 3RVJA 3ZIUA 3TRHA 1XX6A 3O1JC 3QVGA 4FQ7A 5LZ7A 4DCJA 3OIWA 4F1KA 2FWIA 4WBNA 2UZ1B 4INPA 4UDYX 3TKAA 4CMJA 2QSUA 5KS2A 1GFIA 1ZM7A 1VFNA 3R7FA 1U9IC 2BEUB 4GM4A 4YDHB 1KFEB 5DGDA 1Y98A 5JJLA 2B82A 2X14A 3KYCA 1K08A 2JVJA 2RK3A 3TX6A 1W88B 4KQ1A 1DEHA 2KI5A 3ECSA 4KVFA 3KEQA 1AKRA 1AUPA 4RV5A 5IYZF 3RCBA 3WDSA 4EHJA 4CIWA 5IJ0B 1Z33A 3WIOA 4HGZA 5CH8A 1E2FA 2MYNA 3E1GA 3D5QA 4GMDA 1A50B 5CNIA 3ZHOA 4PAMA 2B3DA 3K30A 3R3XA 1VL6A 4CM5A 2XHZA 4MINA 5AK4A 2ZT7A 4LY0A 4BZZA 1P4JA 2FFAA 2ZZNA 4JVOA 2J31A 2HHAA 3SIPA 3I05A 3OSZA 1WZEA 4PNEA 4FILA 5C7IO 1GGKA 1AGRA 4BBZA 3REOA 1D1SA 3NKFA 4JLPA 4Q18A 2CNDA 1UK8A 4P3PA 4Q3CA 4Q12A 2Q8QA 2ZG6A 2J7PD 3VPXA 2R8XA 2FJPA 1U8AA 5DNDA 1QWOA 5IJAA 1GV0A 4CWAA 2XIQA 3B9RA 4D9FA 2ZWPA 3G2MA 2OORC 1F8YA 1XTIA 1RBQA 2REQB 3PX3A 4RGBA 2I3DA 4IHJA 5E3HA 3BRQA 3EZFA 4N5LA 1I0LA 1V6CA 2DCMA 1H69A 1RM4A 1E1CB 3IHWA 2A58A 3H5TA 1T4CB 3C7TA 3K53A 4YJGA 2M9MA 4BDSA 5JC8A 1G5RA 2OFOA 2CE7A 2HUPA 3AM4A 2ZRHA 3MWEA 1QQ5A 4Z7QB 1A5SB 1NNUA 2I2FA 4I4TA 1PSWA 3PL5A 4GE0A 3Q5DA 5JE8A 3GPDG 1IN5A 5BWOA 2OXFA 4O4IB 4DLVA 5IVIA 2HMYB 3OLVA 3NBFA 4D3FA 1XRLA 4PR3A 3UA3A 4ARIA 4ZC8A 1GU7A 3ODPA 1MENA 3AKEA 3OEHA 4GMFA 4H35A 4BVJA 4AT1A 4PAQA 4L50A 4QUJA 6AT1A 4D9NA 4YRZA 3AHIA 3FVRA 4KLZA 1ONSA 1TD1A 3ZHTA 1L1FA 3TZBA 2IX9A 1VE6A 2MU1A 4EMUA 5LA6F 4YJ3A 3WB2A 3IV9A 1NUAA 2YWJA 1PK8A 3GLFE 2GBLC 1XXHB 4KLNA 1C3EA 5KYYA 4PGGA 1KI6B 1OH7A 3PQ6A 3BWDD 1X74A 2O2IA 2FP4B 2C2GA 3AINA 1XLUA 1ZVVA 1NU8A 1OT3A 1M2WA 2PSJA 2X8BA 4LDJA 3K5IA 1NAIA 1JMYA 2ZI7A 1EINA 2PRKA 4BOYA 5E6UA 3EC2A 1CIPA 1U3UA 2FCRA 2QYTA 3T7IA 2A0UA 4IFEA 4AW9A 5DCLA 4OA8A 1US8A 4JUDX 4ENVA 1WPXA 4XDYA 2WKSA 3BCRA 3S44A 3ZNPA 3ZCUA 2A5LA 4BNDB 2IPOA 4E5MA 5KJ1A 1CHDA 5CMLA 2JNWA 3ITEA 3ZDXB 4D8UA 2PUWA 1XHFA 1REQB 5NLLA 3T3MB 1O8CA 4DLNA 4BV2A 4C07A 2FUNB 1L6IA 1XRPA 2C3MA 1M1ZA 1YC2A 3D0RA 3IQXA 2WJ4A 1ZSYA 3C1TA 3WNCA 2JA2A 4N7BA 1WP9A 2PRIA 3LNTA 4FE4A 2GCNA 5FQNA 4E51A 4LF5B 3ZD7A 5HIKA 3WRVA 5AM3A 4Q7LA 3ER6A 1SCAA 1HOXA 2Q3FA 3T1VA 1XMPA 3VR6H 1W35A 1HORA 4MQ5A 3CE6A 1YI8A 1K66A 3OSUA 1JL3A 4LTDA 621PA 1XMQB 4RM2A 3GCWA 3F3MA 5K09A 2I4TA 3I09A 4M9SA 3AF6A 1SIBE 2YHIB 2VP0A 3KRTA 4LPKA 1RWNA 1P8JA 2KM1A 1JHUA 2Q4DA 2Z1NA 1K92A 1T5DX 3A4YA 3T7SA 4EY3A 5ARBA 3FPFA 4WNCA 1BFKA 1E3LA 1VG1A 3DCNA 4N49A 2H5IA 2I1QA 4E2WA 1RQNA 5B36A 4ARZA 1FY2A 1BKSB 1FMTA 2XCSB 4BPBA 4LN1A 1XNRB 3V4FA 3A3YA 4ZQCB 5A0TA 4UUNA 5L7TA 2J7PA 3ER9A 2AJDA 1FYFA 2P9GA 1JG2A 1LXCA 1ZOPA 1WXEA 2GCGA 1Z8DA 2Y0DA 2Q46A 4WKGA 3CN7A 3DOJA 3WISA 3GJZA 3LVFO 4BN4A 4YMUA 5K8IA 5EIFA 1I4TD 3DFIA 3WGNA 1GGJA 3EOAI 1O89A 5M29A 4KHPB 1E9SA 2HT1A 1MOQA 3RVKA 3WA6A 3ZE2B 1CW2B 1OAOA 5EZSA 5INTA 2WYUA 3LFUA 4FR0A 2W42A 2H0RA 4UAUA 3KT3A 4M0CA 3RRYA 2PRZA 1N4AA 1Q77A 3DKVA 4PHFA 3B8EA 5I9BA 5B1IA 2NO1A 5C8YF 1OMOA 4JBWA 2C8LA 5FO1A 4Y2VA 1JJ7A 4LDQA 3THWB 4PG6A 1MJGA 4IZIA 3VU3A 3DVSX 2C5GA 1M72A 1P7WA 2JFHA 3H5WA 3RKUA 4YAUA 3DKIA 3W2EA 2PO7A 2E4YA 2YHAA 4INOA 5JROA 1DRVA 3E2PA 2V1UA 2XTZA 1NQUA 2ZUDA 3AV0B 2XI4A 3LGAA 1JHPA 4HRAA 4QU8A 3MWKA 4LBZA 4LJ9A 3E3LA 3PNOA 4N41A 4PNHA 1CJMA 1NI3A 4MVYA 2X58A 1M9NA 4R3NA 1XHEA 1UBEA 5IT0A 3CVVA 1HF3A 2CEKA 2A5FA 3KEOA 3BIXA 3EPJA 4GS5A 1ZD4A 1H8HD 2FQWA 4UFPA 2B20A 3QFFA 2ZJYA 2IDMA 2ZQZA 2OZPA 3LQQA 2JARA 1KU0A 1NFRA 4FGLA 4FR5A 1ACMA 3KBOA 2OP1A 4XIFA 2I3ZA 1I8TA 1N2JA 2GYVA 3ASYA 1QLJA 3L7DA 4YUAA 1XT6A 3A1FA 1U9ZA 4L57A 2WF9A 1OWMA 4YCMA 2SICE 4OM8A 5BNZA 1GG9A 2ZRPA 3EEBA 4LOJA 1A8HA 1I9GA 2FW8A 5H82A 3P9XA 1CDOA 1CR2A 3DFZA 3RAGA 2BBWA 1GU0A 3MWFA 4K6MA 4CMGA 4MWOA 2LCQA 3H99A 4HMQA 1CQIB 4N6NA 5HVNA 4C0LA 5ITSA 1SVKA 2R3SA 2QTCA 2ZYHA 1DC7A 1FFAA 4RGVA 1DHRA 3DV9A 3OM0A 1K06A 3NUZA 1YOVB 1ZI9A 4OQFA 1G2QA 3GLRA 1ECFA 4DG5A 2NMVA 3IPXA 3L43A 3MELA 5DU2A 3LM8A 4R9RA 6LDHA 4RELA 5KTMA 2I6SA 3FCXA 4XD7A 3ICOA 3WGGA 5HKKA 4M1SA 3GGCA 1Q1NA 1XCMA 1TQ6A 4JMLA 4LYGA 3DPUA 3LPAA 4U7FA 1KAGA 1U81A 3H18A 5HDQA 2J9ZB 2EARA 4TXJA 2CLSA 1RYMA 2IYLD 5AJZA 5FF9A 4C29A 5HRCA 1ZD1A 3R0JA 1ZMOA 2XCRB 4A3SA 2NZXA 4BC1A 4R8RA 4UNPA 4RH3A 2GZRA 1I4DD 4P3KA 3AZPA 3U81A 5BSFA 2CCKA 3RJ9A 3RK4A 1Y1SA 3V1UA 4LDAA 2CLKB 5KAMA 5C52B 1P81A 1OXKB 1K86A 1DKLA 3A1UA 4PBTA 4HB0A 3M3DA 1DJLA 1F20A 3T8YA 3KLPX 4M1WA 3L7MA 4CM8A 1TO2E 4BQEA 5LVAA 2IYOA 4D9IA 2LVBA 5BSTA 4NMWA 3CE9A 4J4BA 3PQ2A 3OPVA 1TUGA 4AFNA 3D7MA 2R44A 3W79A 2RI6A 4LJ4A 4FFBA 1E6MA 1TYBE 1V9CA 2X9LA 3IOCA 3D3QA 4WNAB 3SJCA 3U7RA 4AZ3A 2C9CA 4ETWA 1FX0B 4LOAA 2RGDA 1M1UA 4PIMA 2YJNA 2DWCA 5LU9A 3DAPA 1B0PA 2W8BA 3B6IA 5LMCA 1M2EA 1R8SA 1XWIA 1E92A 3VSCA 2GF0A 1FTQA 5FL7D 3UH0A 2HCJB 3MOSA 4TOIA 5DTEA 3ZCXA 2YNMC 1SXJB 2VATA 3P9SA 4CLEA 2FN7A 4FR2A 4PZEA 1ADGA 5CP8A 4EI7A 3DZHA 3RBVA 1BJKA 1EIWA 3FIJA 4BVEA 3PSHA 1UM9A 3AUKA 2HGZA 2W6PA 2IXAA 3OH8A 3U4GA 2IW1A 3MJTA 3OPYI 1CS0B 2A0XA 3M2PA 4YLGA 1OCEA 1D8AA 3WJAA 1R4AA 5DNYB 1KS9A 8LDHA 3C4VA 1Z4PX 2D8MA 1WSAA 1F12A 1EI9A 2MTBA 4LVUA 1UJBA 3QY9A 3CKYA 3CUTA 4HDNB 5AT1A 1GNSA 2BKUA 3FGOA 4ZXFA 4B3CA 4WEQA 1NYQA 1H8HA 2WYVA 3RRNA 3TMYA 1QO0D 4XR4A 4X1IB 4AJNA 3PGA1 3D8BA 4N3NA 3USZA 2OHIA 3RASA 3DNPA 4NZ9A 4OM7A 3A25A 1E9VA 2FSUA 4KR9A 3EA4A 2P3QA 1ZOLA 4LZNA 2P69A 5ALVA 3M2TA 2WZDA 4X64B 1F9EA 2BIFA 4CLOA 1XVAA 4KG7A 4E3WA 4GI2A 1XL0A 2BHRA 4TKUA 1G3IA 2A4MA 3P26A 1JTVA 3UAVA 5BXQC 1X8LA 1AQYA 1Y81A 2WVGA 4NCXA 2DBZA 4F38A 5TQJA 1C7EA 3SHFA 2DLNA 2XE4A 5L3QA 3UWMA 3RAEC 4FCVA 3SQMA 1L5VA 1CY6A 4ENUA 5CFZA 3HP1A 4RHUA 1JEQB 3T6KA 1Z4JA 3ZE1B 1QHXA 3GH3A 2WSSD 5LQRA 1P9WA 3PC4A 2VN8A 421PA 1VYHA 2GLUA 2PBFA 4GP7A 1D6JA 1TPZA 2F8LA 4EABA 2IL1A 4JXJA 1NYRA 1R50A 3G02A 3LU1A 4OUDB 4XA8A 1E2EA 3AY0A 3IJPA 2IODA 2NACA 1RQGA 2FPRA 3NOOA 4PPFA 3QW4B 4FVTA 1A95A 4JR1A 2XMBA 3K3PA 5HFNA 2Q6IA 4X63A 3DA8A 1YXMA 1FQWA 2A7XA 2EX4A 2KQUA 3TOZA 5LOVB 1KZ1A 1NR1A 1A5AB 2VR1A 4URVR 4HDAA 4U6NA 5H7XA 2JHPA 3A4IA 3WP0A 6ABPA 3D7RA 1I5RA 3L4JA 1IPFA 1HWYA 1EK6A 1LQ2A 2PJUA 3QFRA 4NABA 4ZVTA 4CV2A 1GSAA 4IDFA 1G21B 3ZQ4A 2R7NA 1MH9A 4Q24A 2IWHA 5LP6C 3HCNA 3JQ9C 5CNMA 2Q6TA 3W8EA 4HFJA 1N0UA 1E69A 1TJ5A 2PX6A 1VG9B 2VYFA 5JFGA 4JYPA 3ME5A 2ZE5A 4ZEMA 4NJMB 2D2XA 3W9UA 3UJNA 5JS2A 1GPMA 1UKVY 2FN3A 4RDXA 3CURA 1EHCA 4KQGA 1C1YA 3PDUA 2DM6A 3TEFA 5K0GA 2VS1A 3IODA 1XDDA 5DVZA 1W8DA 5TR9A 4K9OA 3VYSB 1N3YA 3GEDA 3RQSA 3IAAA 4OXQA 4JBNA 3PLNA 4Q00A 3SM9A 1R6TA 1YR2A 4OB6A 1RWOA 5GZ6A 5CA1A 1IMOA 2VPXA 5J2UF 2KE5A 1Y80A 1CERA 2GM4A 4CEHA 1ZVJA 1UXKA 1N4DA 2H06A 3KJHA 4C0JA 3PVZA 1SCNE 3WLQA 1GRCA 1A9TA 3CLKA 3KEGA 4FOOA 3GEEA 3R0ZA 1IG3A 4BRZA 4FHFA 1N5LA 4MI6A 1V11A 1FTWA 1SQFA 2GZ2A 4MUBA 3RH0A 1QS0B 3V8PA 4O1MA 3VM6A 5TLSA 1V1MB 2J1LA 3I6IA 1JGTA 4BFTA 4OAQA 5AOVA 5CH3A 5LQMA 1QC5B 1FZQA 2A86A 5F9FA 1SVWA 1QHFA 5CDHA 3ANYB 3W3AA 3G8CA 1QCYA 3WVNA 3D4PA 3ROQA 2J09A 1WXFA 2GEJA 3G2HA 2PZAA 3MMXA 4L4YA 3K6SA 4A91A 2FMFA 2IRWA 3VDQA 4ENSA 3FGZA 5EZQA 4TXHA 3Q8XB 1GT91 1X19A 3G85A 1VDMA 4EITA 4EY7A 4G5FA 3U7HB 3IEKA 4WCFA 3GGDA 2YWFA 2I65A 3KWLA 4JJEA 4KSYA 3ZHUA 2W6MA 2PM8A 3A6PC 1GQYA 3OFND 4HWTA 1SA0B 4W5TA 4Z99A 1KIMA 1VP3A 2JB9A 3UWPA 2NSJA 5CXUA 3QG5A 2XDQA 4Y2GA 1N0VC 1JXOA 2HDHA 3LVQE 2AI3A 1I1QB 2BZSA 1T1SA 4HEA6 4LSMA 1CY8A 2QDKA 1VE5A 3HADA 1NVBA 2Z8YA 2P62A 2PZLA 3MGCA 1ODKA 1P33A 1Z13A 1W96A 4YRFA 5D3QA 3WB0A 1QV9A 3DULA 4EJ0A 1J9ZA 2RKOA 1XV5A 1UC5B 2HLHA 3LI2A 2VUSA 3QF7A 3ZDRA 3PEWA 1G20A 1S5PA 1XZEA 4CQLA 1OASA 4J1SA 3FDJA 1EFVA 5EESA 2FWPA 2WSSA 1Z45A 3QXCA 2FPGB 4K05A 4YS6A 5IKOA 3PUJA 3OOHA 1LRJA 3I9OA 4IXTA 1O8BA 1ADYA 1LSOA 3SS9X 1MJ5A 4H1VA 2C58A 3C85A 4U6SA 2P2LA 3FNBA 2V9PA 2GZ3A 1D5WA 3DDSA 2WP8J 4OVKA 2FKAA 3ONDA 1ZCAA 2EGHA 4WK2B 2D5IA 1QPBA 1T1EA 3CUEF 4BGUA 1FBNA 4BJHB 4EY6A 1ZBQA 3WMEA 1DEKA 1T1JA 3A3KA 1U99A 4O2AF 4OJQA 5AVJA 2Z3ZA 4ZP1A 4YVFA 5I7RA 1U3WA 3TECE 1PUXA 2QMQA 2X9QA 2RH8A 1JB9A 3P7MA 2YWEA 3QU9A 2UV8A 4FLFA 1UJMA 1R6XA 3OOYA 5FJIA 3AGQA 4DLPA 5CDUA 5HFJA 1CVIA 3VPDA 4B87A 1PWYE 1ZD3A 4W82A 2D1FA 4F86A 2JAXA 3H2YA 3Q6MA 2ET6A 5EPEA 5JO0A 3F7MA 3F4BA 5AW1A 1JFTA 5EWJB 3LCVB 2B8EA 4GPIB 1FB5A 1LV7A 3W9YA 3Q3GE 2XKBA 3U4MA 2X9NA 1JKXA 3RS8A 1N6LA 2XWSA 1LTQA 5IP5A 3NWPA 4HMPA 4R2JA 3MJ4A 4OGFA 2P5SA 3M1IA 1BKDR 4MYCA 3ZWBA 1FUYB 2C8JA 2RGWA 3DL0A 3UJHA 3S3TA 2VUTA 3QHQA 2DH5A 2V7PA 3C3PA 3HUTA 4OCZA 1O08A 1KU6A 2EYQA 4BQPA 2LR0A 2VDJA 4J3NA 3F7TA 4B80A 1S2NA 4Q7JB 1PFGA 1R0KA 2G4LA 1PL8A 3FNRA 4PHGA 1TAGA 3BZBA 5HZGA 2X6RA 3OEED 3RFVA 4BX2A 4M55A 4O33A 3ZWPA 2VHXA 1AKEA 4Q3EA 4X1OA 5AVZA 3T06B 2XKAA 4NYMQ 3DZ8A 1YE5A 1UIMA 4D4JA 2G5TA 3JQFC 3MTGA 3KZVA 5JR3A 2YHBA 4OLBA 2CC2A 2MMCA 1RLMA