2BBSA

Human deltaf508 nbd1 with three solubilizing mutations
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
283
structure length
253
Chain Sequence
STTEVVMENVTAFWEEGFGELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLRPDFSSKLMSFDQFSAERRNSILTETLHRFSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Structure and dynamics of NBD1 from CFTR characterized using crystallography and hydrogen/deuterium exchange mass spectrometry.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 253
sequence length 283
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bbsA00
1HTWA 6Q21A 2FFBA 1KDTA 1VPLA 2B8WA 2IYSA 3W34A 2QE7A 4ZI3A 2R6FA 1Z6TA 3BE4A 3SJAA 4B74A 3BS4A 3T34A 1FP7A 2FEOA 4G5RA 2SHKA 2ZS9A 3LW8A 3S1AA 1WXQA 3KJIA 1WBBA 3RS4A 5BN3A 1KI6B 3THXB 4OHYA 3CONA 3AKDA 4AKHA 2VL7A 2IYYA 4D25A 1AKYA 1KDRA 4TL7A 1JXOA 3A1UA 4MKHA 4J0QA 5EUQB 2W6JD 4DCVA 3T1OA 1KNXA 4QFMA 1NBMD 3TMKA 1XP8A 3M4YA 1DAFA 3THYB 2QBYB 3CF6R 3MG9A 2YJTD 3TR0A 3UANA 1FP6A 3LBNA 1YE8A 2QPTA 4TQ9A 4YONB 3X1WA 2PEZA 3NVAA 4K8OA 2X1VA 4KBGA 1JEDA 4LBYA 4QJ3A 4C7OB 4TMVA 2EFHB 1ZIPA 1GRRA 1KJZA 3GLFE 5AUPB 4ASUA 1OXUA 4URUR 3HPRA 3L8ZA 2FH5B 5TXGA 2ZJBA 3RDPA 2GAOA 1NN3A 4F38A 1TTTA 1OW3B 1N25A 4R7ZA 4TYPA 3ZD7A 5B58C 3N2IA 2VRWA 3KL4A 4PC1A 2JAQA 4MKGA 4DSTA 2QRZA 2DFTA 1E1RA 2NO0A 3P20A 1OHHA 2Q21A 4HATA 1F6BA 2PT5A 2QA5A 2C8VA 3AGPA 4WVFA 1R5OA 2HF9A 3AF2A 1IJFA 3K70B 5G53C 1I4TD 4TL8A 2DCUA 3V00A 5JLJA 2ONJA 4A82A 4KO8A 4RZUA 4JS0A 721PA 4EFMA 1Z8FA 2QQEA 2QZ4A 5IK2D 1UKVY 2ZRPA 1RW4A 2C2HA 2ZRKA 5EXTA 1W4RA 5SZIA 1TQ4A 1E4YA 3K0SA 3AV0B 2V1UA 1NBMA 4URXR 121PA 1T0HB 1VTKA 4HDQB 5FPYA 4DLYA 5DYGA 4EJSC 3TUIC 5K8IA 1DEKA 1DG3A 1VDZA 5CDFA 1G8YA 3KKPA 2W58A 4AD8A 3I8SA 4GT1A 4MYUA 5KSOA 3BFVA 3FPAA 3VHLB 4HAYA 3NHAA 4TN1A 3N5CA 4ZKDA 1DTSA 4GSYA 2ZS7A 3IO3A 2CK3A 1PLLA 4W5JA 1DADA 4GOXA 1HURA 4CIDA 5JCPA 2Q3MA 4C2TA 1KAOA 5JI3E 1A2BA 3R9IA 2QL6A 4FIDA 4NYMQ 1JXMA 1N0VC 2AFHE 2IYWA 5SZHB 2FFHA 4BLSA 3JVVA 1ZW6A 1U2RA 2FSIA 1E2IA 2CNWA 4GMXA 3CWQA 4DCNA 1QZXA 2IUTA 2FX3A 4DC9A 2QT1A 3B2EA 2REXB 3UMFA 2GDJA 5EE9A 4KFSA 4DB4A 4BLOA 1J70A 4MRNA 1W47A 1UBCA 3QG1A 3RABA 1B23P 5DN6D 1IY2A 4Q1BA 1QF9A 1E1QA 1T3HA 1Y3AA 3SS8A 4P31A 3WP0A 3KXLA 4B3FX 1JBKA 1ZD1A 2GXUA 1DVRA 1JQJC 3X1DA 1BMFA 1Z6AA 2VYFA 3LD9A 4WAUA 4OK6A 4E03A 2IYQA 1U0HC 521PA 3K0CC 3MWYW 1SZPA 4MA4A 4R2HA 3U7FB 2FMXA 3EIEA 5AUNB 2YC4C 3ZJYA 3O8RA 3ADCA 5ANRB 4NYJQ 3TK1A 3X2SA 5JSZA 2VPPA 4XJXA 5JBQA 1LB1B 2B21A 3QXSA 1VCNA 1IOZA 2BKUA 1I2DA 5A5GA 1MABA 4Q5IA 3O8DA 3NHBA 4UNQA 1NMYA 2LWIA 4OI2A 2ZRLA 2ZR0A 2RKOA 2QNRA 4HAZA 3IPYA 3U4QA 3VNUA 2D7DA 3D3QA 3CKLA 3LWNA 3GLHE 3GJ8A 2AKAB 5DO9A 1RC8A 3L43A 4TLDA 2WSSA 3K0AA 5IHPA 5CK4A 4RY2A 1N6HA 1KK2A 2VP9A 1MOZA 3IBGA 1OFHA 5FR1A 3LA6A 4MH0R 1NJFA 4QHTA 1ZRHA 1W36C 3K70D 4FN5A 3GLFB 4URZR 3I32A 1PJRA 3KUCA 1KI6A 1Z63A 3THXA 3ICQB 3VQTA 1GNQA 3K09A 2V7QA 4WIAA 3ASZA 3QF4A 1YR6A 5KNBA 3AP3A 2BEJA 4PPFA 1TPZA 2A78A 1KMHB 4RZ2A 4GDFA 2QG6A 3WNBA 4ZIRA 4E07A 4FXPA 2GVDC 2BV3A 3ZVRA 3FFAA 4JYCA 4R71A 2OUKA 3THYA 2QBYA 4BGDA 4EFLA 2XB4A 1A5TA 1UDXA 1ZYUA 2OLKA 4XTRA 2XJ9A 4P3YA 4JLOA 4PAOA 5F98A 1E3MA 2RGEA 2WJIA 4D81A 1SULA 2NO9A 4TSFD 1X3SA 4B35A 2FFAA 3DPUA 4FCVA 1KSGA 3QE0A 4C7OA 4LJ8A 3K53A 3NEJA 1XMJA 5AK0A 4KVAA 4BQSA 2RCNA 5FUXA 2IS4A 4AC9A 4QM7A 2V4ZA 3VR6A 5KDLA 1OIXA 4QBHA 4JLNA 2G77B 4Z1MA 4D6PA 4JVMA 2GESA 3OIYA 1VECA 2WMNB 3DVLA 3AB3A 5HE9A 2N42A 1G18A 1DARA 2J3EA 3H1TA 4I4LA 1W0JD 3MWJA 3T1QA 2H17A 1E2EA 2GXQA 1ZVQA 2QTVB 4D4JA 1A2KC 2PCLA 1GZSA 1R10A 5L3SB 3N2EA 1SHZA 4OJQA 5EP4A 1YU9A 1E99A 5C2JB 3FTQA 3EARA 1XD8A 1CR1A 1JNYA 2P3SA 3C41J 4UXJA 4XD7D 5LDDC 3F3YA 1Q1ZA 2D2EA 4LJ6A 4H9GA 1U90A 2JJ1A 2BEKA 3OAAA 4Q66C 3A4NA 1ZCBA 1LW7A 1Z29A 4PO1A 1TU3A 2YWEA 2XZLA 4HLQB 3VX4A 3FE2A 4V0OA 4TLBA 2ONKA 3NBFA 4TSFA 3CB4A 3EA5A 4AURA 1WF3A 4IEEA 4LV8B 3PUVA 4LJ5A 4RD4A 1WDTA 4W7SA 3CH4B 3PVSA 4A9AA 3R9XA 2JLWA 4NYIR 5JI2E 2OXCA 2B7BA 2C95A 5AJZA 2ZJ8A 3OE7D 4AYTA 1B0UA 1AQUA 3HJNA 3PFIA 4A6XA 2WV9A 3R8FA 2ZE5A 2XAUA 2XX3A 4K81B 4TT3A 3NBYC 1D8TA 1KO4A 3AM1A 5EE3A 1W0JA 4C0HA 2Q6TA 4MUBA 1ZNWA 4QG7A 3QUSA 3A37A 2IK8A 4URWR 3WXMA 1W46A 2R62A 4KXFB 1DELA 1JR3E 2GCPA 4EDHA 1SVWA 4YMWA 3EXAA 5D3QA 1U94A 5CLLA 3MFYA 1VYUA 1E4VA 1GILA 2F6RA 2FU5C 1KY3A 1N2CE 4ERNA 1FNNA 2FA9A 4DLRA 4QBGB 3U7EB 1P7CA 5L3RA 4IRUB 5EXSA 5C1BA 5JS7A 1Q3HA 1QHHB 3H86A 1GKUB 3TIFA 2HEIA 1BS1A 5A0FA 1WE2A 1E9BA 1Y63A 3SOPA 2O8BB 5FL7D 4EJSB 4PHFA 2QU8A 2AD5A 3QNUA 3WBKA 2GTPA 3LO5A 1GRNA 2IXGA 1HT2E 2IYZA 1HUQA 2IEZA 2GNOA 3KJGA 2JDID 1XMSA 1R2QA 2JEOA 1DBSA 1KGDA 3CX8A 2B6HA 2JJ8A 3SQXA 2VHJA 3NKVA 4XOIA 5FH9A 4JYBA 2IS2A 5KYKA 3VTKA 1E0AA 4B2LA 2F43B 4M4SA 3ADKA 4HB3A 2BM1A 4L5BA 4BFTA 2YWHA 4CT4B 1II8A 2F55A 4OI1A 2OLJA 3RRZA 2JLVA 4JSTA 3GLFA 2AK3A 1N6KA 1R5NA 4NH0A 4XH9B 3HR8A 1P5ZB 4WZBE 4URVR 4B3GA 2C5LA 4TZ6A 3DZ8A 3LNCA 4B71A 1CJMA 2DFNA 3E1SA 5FBWB 4BLPA 1KMHA 4WZAE 3HR7A 3CX6A 2QAGC 3P27A 1Z5ZA 3LAWA 2J0UB 5KSYA 3QXJA 3B1XA 4ZI2A 4LBZA 3UKDA 1L7VC 1XB2A 1W0KD 2D3WA 2A9KA 1NLZA 1NBME 2XTZA 3GMTA 2WVJA 4DSNA 3W8RA 2VHCA 1RZ3A 2QP4A 4A0GA 4UKDA 5EP2A 5FPHA 4RD0A 3VKHA 5FL7A 4CEIB 4LJAA 5EXXA 5C4MA 2C03A 2R44A 2OESA 2QM8A 4RSGA 4DLWA 1S3SA 4B75A 3LVQE 2PJZA 1QHYA 1E2MA 3VAAA 3VHXA 5JWRA 1X1SA 2RGXA 4ON9A 1RE0A 4YMVA 5FR2A 5HZKA 3K9HA 2BMJA 3NDPA 3Q7PA 2J7PD 3OFND 4NDZA 5JRZA 1P9RA 4POAA 3M6AA 1UDWA 5FUWA 1OXXK 3QIAA 5AR1A 2AFIE 1CJVC 4OYHA 3RHFA 3IGFA 3B7GA 1FX0B 1MO5A 3MLEA 3RAPR 1XTRA 3MUFA 1XEFA 2OCBA 4JJZA 2ZJAA 5AJXA 4G5OA 5SZKB 1UKZA 3PITA 4W5WA 1UEIA 2DFKB 2BMFA 5BN5A 1W49A 2QRNA 3BB1A 3F8TA 2A3RA 4AG6A 5IT5A 1W36B 3D31A 3LBIA 1GFIA 2JIZA 4XSHA 3VU9B 1NVVR 1VCOA 4M8NE 3ZZ0A 2C9OA 3KDSE 2WPDA 5DE3A 1DO2A 1SVOA 1L4YA 2FJUA 1W0KA 2VF7A 4U7DA 2ZUDA 3TUJC 4AK9A 1FW6A 2C9CA 1QVRA 4GMDA 1OH7A 3WMEA 4PHGA 4JVLA 1KO1A 3KXIA 3A1VA 1UF9A 3DO6A 4I1SA 2ZRGA 4BFVA 1G3MA 4V0KA 4CEHB 4AWXA 2V3CC 2CLSA 1TQ6A 1VCMA 4LJYA 3CBQA 3T1VA 2VSXA 2YV5A 1XPOA 2PH1A 4GNKA 4ZKEA 2BHRA 1BH2A 4PAMA 3EWAA 3RS5A 2ZRIA 4TYYA 2YNMA 4PO9A 1NG1A 1HT1E 1QHNA 4Q7JB 1G17A 4GI7A 2PLFA 3TQCA 1ESNA 4NZYA 1II0A 4M1SA 2GETA 3W5JA 5E3HA 3CM0A 3QOFA 4MQBA 4KYUA 2EYQA 2X2FA 2GA8A 2JLUA 5FI0B 1FPMA 2W0MA 3L0PA 3GLHA 4HYYA 5E95A 3EG5A 5EP3A 3E70C 5KNCA 4FMBB 5D3MB 2EYUA 1CKEA 1U9IA 5JMTA 1EGAA 1R7RA 1ELOA 5FOWA 4C0LA 4NBSA 3U6KA 4II7A 4TTQA 4HUQB 1Q1QA 1XMVA 4YDSA 5EE1A 3VNVA 1NN1A 3AUYA 3TW8B 1QHSA 2QGZA 4A8JC 3GJ6A 1TX4B 2PMDA 3F5FA 1TADA 2ZYVX 4Q02A 2GZAA 1XF9A 1DOAA 1G3IA 1QHHA 2QMHA 1XD2B 3G5UA 4IDNA 1N0WA 2ZI3A 2ZRDA 1FQKA 4Q7LA 5L8VA 4KU4A 1Z22A 4Q01A 4Q4HB 2O8BA 3PQCA 1E9RA 2ZYWX 3EZ9A 4EJSA 4TYNA 1TNDA 2X19A 3FGNA 3LW7A 4OHWA 2DYKA 1L8QA 3QKSA 2WKQA 2W2TA 4Q1CA 2HJVA 1E96A 3TBKA 3OF5A 5J40A 2IYVA 3RWOA 3LX5A 1QHIA 3G82C 3AUXA 4A1FA 2RGBA 3TVTA 1ZUHA 3T5GA 1XTIA 3PEWA 4PC6A 2YHSA 3K0EA 1DS6A 4ZPXA 4RFVA 3K9NA 4Q7KA 2BCGY 2JLQA 3CLVA 2F43A 2IS1A 2C96A 3KFXA 3A6PC 3MWLA 3LV8A 5CB6A 4LK2A 1AK2A 4C0JA 1KMQA 1PZNA 1VG9B 3QBVA 1NNEA 4DLVA 3CZQA 1SVSA 2QROA 3IO5A 4H1VA 4LI0A 4DCTA 2QMOA 1W36D 4XVUA 4US0R 1N5LA 4HI0E 3GJ3A 4AKEA 1OFUX 2EWVA 2RAPA 3CRMA 2IX3A 4FCTA 2G1JA 5EUMA 1SGWA 2WWHA 1E9CA 3KTAB 4C9BA 1MH1A 3UPUA 1P2VA 2GHIA 2P6UA 4YXWD 3CWZA 1EWQA 3IEVA 3MJHA 3ONWA 1KI2A 1KKMA 2XITA 2R6GA 1YKSA 4MDEA 1T91A 1NP6A 1DAMA 1G5RA 1G41A 1XD9A 2H92A 3K0CA 1DAHA 2CE2X 2ZS8A 1CBUA 3LY5A 3ZZUA 3P1JA 4AYWA 4QL3A 2JLSA 2DY1A 1DPFA 4BLQA 4CEIA 5GJCA 2EW1A 5H70A 2EU8A 5CJ2A 1YZNA 4MGIR 5DISB 4C0BA 3SEAA 2FFQA 3BBPA 1CEEA 1TMKA 1GM5A 1IY0A 1G64A 1PUJA 2FEMA 2KI5A 2X2EA 4PQRA 4PSKA 3WYGA 1F5NA 3UMSA 4C2UA 4JT2A 3BRWD 3B13B 4IVRA 4LY6A 1D6JA 1GVNB 5TDHA 1K6MA 1FX0A 3EIQA 2KE5A 4MGKR 2WZQA 2ZE6A 3SC3A 4CRWB 1E2QA 4HSEA 4Q9KA 2Y8EA 4V0ME 1Z0IA 4MRSA 5JHGB 2FGKA 4RD1A 5L3QB 1GWNA 4TZ0A 2N46A 4O2RA 1AIPA 1U8YA 3UG7A 3SZRA 3QKRB 3AVQA 1NY6A 3CNOA 3KX2A 3VU9A 4GOKA 4Q03A 1XXHB 3ICEA 1QG2A 3SFZA 2ERYA 1YZKA 1RRPA 4TLEA 3KQUA 3DMDA 3WYFA 4NYIQ 4IDOA 5C46F 1U99A 4OQMA 3ND8A 4MKIA 2GCNA 2QAGB 3U60B 4BLTA 1TUIA 221PA 3ZYCA 1R0XA 3W6OA 4FCWA 1BOFA 1JR3A 1Q3TA 2XXAB 4E09A 5KDOA 2QY9A 4CEHA 2XB2A 1J7KA 2V55B 2GXSA 1Q57A 4JJKA 3R8CA 3Q8XB 2FV8A 3SNHA 1MRSA 1EK0A 2A7QA 1NLFA 5HTKA 3W3ZB 4EFNA 2FN4A 5FBLB 4PC2A 1S1CA 4I99A 4MYTA 4JZKA 1KSJA 4HLDA 4IVQA 3GLGB 1XEXB 2IA5A 4NTZA 1P9NA 4US1R 2PCJA 4LYFA 4ACBA 2O8EB 2R65A 5JS8A 3L2OB 2GCOA 2OAP1 1NRJB 3B9QA 4JLBA 1E2DA 3VKWA 4MKFA 3QVVA 3CW2A 5D3MA 3QF7A 2WWIA 4LYAA 4BUJA 2XTNA 3BORA 1QHGA 1HY3A 2OBMA 4Q4AA 1G19A 1X1RA 2ZSEA 3AKYA 4QJ5A 2I4IA 1ZCAA 3VKGA 3GJ7A 3BAFA 4DLSA 2FPLA 4M1KA 4NL4H 4P4SA 3QPWA 3KUDA 3R20A 4LUCA 4A4DA 1OIWA 3ZVLA 1XD2A 5G41A 2G88A 3RS2A 4JBWA 4OQLA 1HE1C 4Q4HA 1XFAA 3WMGA 4DCSA 4F92B 3AVYA 4FINA 4LBVA 1OIVA 2H1LA 1ZM4A 2WWWA 3MCAA 4JLAA 5F2EA 5CIQA 2F1JA 5FFMA 4B6EA 2W6JA 4Q19A 1CIPA 421PA 2ZI4A 2VO1A 3KB1A 3P32A 2I1VB 2ZRMA 5ELXA 4JLPA 4CEJB 1XMIA 1UBEA 1NIPA 2HCJB 4KAXA 5G3ZA 1DAIA 1EFUA 1SVIA 2J41A 3HWSA 1UM8A 2QGNA 1W4BA 2AKYA 1LTQA 3WHLA 2AWNA 4A36A 1RYHA 3RS0A 3D6TB 1A82A 1W7AA 4PC7A 3AVWA 3C4JA 4JMPA 4TMZA 4PSAA 2BMEA 4IKEA 4D4MA 2KB0A 1P2UA 1ESMA 2P6NA 1D2MA 3OEHD 5J4VA 3V4RA 1IXZA 2DWPA 4P32A 4Q18A 4PFSA 4V03A 3THWA 1R0WA 3CRQA 3I73A 2V9PA 3LVRE 2Z83A 2GJ9A 5LPNA 2ZR9A 4PC3A 4U00A 1G7SA 3KTAA 3CR8A 5H68A 4C0QC 1OJLA 1JB1A 3ZS9A 1Q0UA 5J4KA 3EPKA 5CM9C 4L15A 5KU1A 5DI3B 2ZSDA 2RGNC 4MITA 3SYNA 4DVGA 1CR4A 1D2NA 3V4FA 2F7SA 2IYUA 3AH8A 4A8JB 3ZIAD 3Q85A 5FPSA 5FUVA 4ZCLA 4BLRA 3TNFA 1N0UA 5FOUA 2DBYA 3FVQA 5IK2A 3RRNA 1I4LD 1AGPA 2J46A 4GZLA 5AWFC 2ODWA 1KK1A 2ZJ2A 5FTKA 4BFUA 3T15A 3RLFA 3AVVA 5JJKA 1NVVQ 3CNLA 1K5GA 2ZAOA 2IYRA 1XEWX 4M2LA 1JAIA 4Z8YA 2UKDA 5B30A 5AJVB 1BO6A 4NPHA 1N6IA 4PR0A 1D9XA 2MSCB 1BYIA 4BFYA 5L3QA 2G0TA 4W5HA 1FMLA 2DWQA 3WYAA 2YKGA 1GKIA 3X1XA 1H8HD 3UMRA 4PQFA 1UAAA 1RKBA 3QKRA 2J87A 3C7KA 3UATA 3KJEA 4E22A 4B34A 1PLJA 4KHZA 1E9FA 1D9ZA 1DE0A 3QQ5A 3NTUA 1Z47A 3Q5EA 3T06B 3GJXC 2ORVA 4C4PA 4UXHA 2CJWB 2XOKD 2FE4A 3CPEA 4LPKA 4BECA 3H84A 1M6NA 5EQTA 2QAGA 4ABYA 1OYWA 1EESA 4G0NA 2HXYA 1TQDA 1NJGA 3CNNA 3EPJA 1KK3A 1HV8A 4D26A 2BKEA 2J9RA 2JLRA 2LKDA 3Q7QA 4LHYA 5DN6A 2ZVPX 2XXAA 3U61B 3NC1C 3IQXA 2C04A 3U7GA 4FMCB 2C99A 5P21A 1E9AA 4TYQA 3SU8A 2J0VA 1Z0KA 4KFTA 4IVPA 4PPGA 1AQYA 1TQ2A 4UNPA 5E4FA 3X1ZA 1U8AA 1TF7A 3OIUA 4RCYA 1OF1A 2IC5A 1XEXA 2GZDA 3AQ4A 1NG9A 1CRQA 3RRMA 1OLOA 2V1XA 3QJYA 2O8EA 4DDWA 1CJTC 1ZC3A 3NXSA 3CRRA 4DBLC 4ZV4A 1AM4D 1KJWA 3BD9A 2ANBA 3MMPA 1H8HA 2AN9A 1UBFA 2VEDA 3OIWA 2CHVA 3VR3A 4JVSB 3KFVA 4O3MA 2ORWA 2CXXA 2ODEA 3PEYA 3FMPB 1GL6A 3PIRA 5J47A 1GIAA 1H65A 4JLVA 3U3RA 3ADDA 4R98A 4EIWA 1GUAA 1CP2A 2Q0HA 2QI9C 3GPLA 4BRWA 2O0JA 1TU4A 3ZVMA 1M7HA 1QRAA 2XZOA 3LX8A 3B1ZA 5FTJA 3MGCA 1JQLB 3CIOA 4C0SA 3FHOA 2FNAA 3CPJB 3OESA 4NCJA 3MRSA 4FMDF 2YINC 4LZZA 3I5YA 4CGZA 3NH6A 3C14C 3C15C 2O0KA 1G8FA 2ZAMA 2PZFA 2GEUA 4YMSA 3ZH9B 2IUSA 2XZPA 3HDTA 2BVNA 3M1IA 2RHDA 1KI3A 5TVKA 4ZDKA 4UNSA 5JECA 4XWKA 1GTVA 4DHEA 5BQ5A 1XRJA 1ZJ6A 1Q1EA 2ZI6A 2ZITA 2D62A 4P0TA 4P33A 1KO8A 1IY1A 3L0OA 4JLJA 3WY9A 2MSEB 3KQKA 5KO2A 3AGQA 1C9KA 4F4CA 3KB2A 1LVGA 3CPHA 1WRBA 2RB4A 2WAXA 2K5UA 2CL0X 2VLIA 1DAEA 3IHLA 1AZSC 2IWHA 2JLZA 5EXPA 2H5EA 1XCMA 3EZFA 1XTQA 4QGAA 2ATVA 4A0HA 4IXNA 1FUUA 4S2EA 1G5TA 4CZ2A 4RKEA 5DH9A 5LB4A 1GDDA 4P4TA 4RJLA 3NG1A 3X1YA 5KTYA 1ZP6A 4PAQA 3NH9A 1KOFA 4EPYA 5JRJA 3CO5A 1KZ7B 4IOJA 4V0MA 1EFTA 2WSMA 3AKCA 2Z4RA 3L0SA 4TTRA 3CUEF 5IDVA 1S0UA 3Q72A 2OXRA 4M1OA 5B57C 4TYWA 3IILA 1EWRA 4X8OA 4QRHA 1O3YA 5DI3A 5DIFA 4KCGA 2FWRA 4L4UA 2WWYA 4A8JA 3K1JA 1ZU5A 2FZLA 2DPXA 2IF0A 5FTLA 2ASEA 4BFWA 2KSQA 4DKXA 1GG2A 1KDPA 2E87A 4F4IA 1IXSB 1UJ2A 1ZUIA 2Z43A 2J1LA 4LPSA 4BWYA 4LHXA 4HLCA 2NPFA 4DLZA 2V54A 2GEVA 4KLZA 2GAAA 2QMEA 3UK6A 3UWKA 4XD7A 1J99A 1VIYA 2JLYA 4GP6A 2WJJA 4XVRA 1EFRD 1MO3A 4NE2A 1IHUA 2NO1A 3K0FB 3RSLA 2IW3A 2E1RA 2IXFA 2HJGA 4G5GA 1JALA 1I2MA 1SVLA 3VMFA 2O8DB 1COWD 5FL3A 1DAGA 1UFQA 2J5XA 4DUGD 1D2EA 4C0AC 1J8YF 1EX7A 1QG4A 5FBRB 4BEBA 2DB3A 3FHCB 1SXJC 5A4JA 4C0KA 4C3ZA 2PJRA 4BZPA 1Z6YA 2WJGA 1XCGB 4ZDJA 3OE7A 3CRVA 4LYJA 4PPQA 1ZNXA 4RVCA 2CJWA 3U5ZB 1GITA 5F9FA 4V0LA 2P5SA 1LF0A 3LXRA 3OEED 1G3UA 3I61A 4OL0A 3A1TA 2FSGA 1L4UA 2BC9A 2IEYA 3I8XA 5EZ5A 4M9QA 3B1WA 1NVWQ 2PT7A 1A1VA 2HXSA 4Q21A 2Q9BA 2A2ZA 3NDBB 4YMTA 2RGDA 4BFXA 3M0EA 621PA 1RJ9B 2CDNA 5TARA 4E5UA 1AA9A 1N6PA 2AXNA 4B2PA 4BZQA 2PX3A 2WTUA 3DZDA 1ZAKA 3WP1B 1OXTA 1KI1A 5HE8A 2QORA 3TGPA 5E7JA 1G8HA 2C78A 2DFLA 2DWOA 1NL3A 2QQ0A 1AJEA 5AUOB 2AXPA 3DKVA 4RZ3A 3IPXA 4Q9IA 1FZQA 4Q1DA 2WM9B 4L9SA 2NZJA 4BEJA 1XBTA 4PQYA 4DUGA 4ITRC 5FOTA 4EPRA 1OH8A 2AHOA 3SBEA 1Z0FA 2CHQA 3QKTA 1RIFA 3PCRB 3RVBA 4A92A 2JDIA 1OE0A 1US8B 2ZEJA 3A1SA 3KJHA 1Z2AA 1Q22A 2D2FA 3TR5A 1E2NA 5CYOA 4HAWA 1CF4A 1LV7A 1TUEA 2AL7A 2ZVQX 4F4JA 1E9DA 5HCNA 2D4HA 3WNCA 4MYCA 2ZANA 4X8MA 1E0KA 2ZJOA 1SKYE 4IDQA 3TE6A 1H8ED 3O8BA 1HA3A 4NP6A 4OHXA 4EKDA 3TW4A 1MKYA 5FTNA 2H8KA 2WKPA 2CVHA 5L3SA 4WW0A 1RFLA 2OT3B 3BFKA 5HKKD 1WP9A 4A0RA 4XIGS 5C4GB 2HYDA 2QN6A 4PTLA 3GEIA 4Y0VA 3CX7A 4OHZA 2N1BA 2OBLA 2Q9CA 2WHXA 4MYHA 1GSIA 3TH5A 1FNMA 4JL8A 1OKKD 4ESHA 2ZSFA 3JZAA 3FMFA 4LV6A 1G5PA 2LCFA 1P72A 3B9PA 3C16C 4LV5B 1FFHA 4R9UC 4CT5A 2ZM5A 2ZIAA 2F3RA 3B1YA 4YMUA 1KNQA 2RGAA 5H1YA 4EUNA 4LRWA 2L0XA 2YOHA 3EC2A 3IUYA 3K9LA 4OBEA 5BN4A 1M7GA 2ZRAA 3A4LA 1MO6A 4DXAA 2QTHA 1R4AA 3TSWA 2J7PA 3OFNA 2VP0A 4EPVA 4XWOA 1KK0A 5DNYB 4WOPA 2OCAA 1JJ7A 3P26A 1KAGA 4ACAA 3SQWA 1P4SA 2GJ8A 1JECA 4WZ6A 3T1TA 1XXHE 5H8WA 1X8LA 3W9YA 2YWGA 1SHKA 3UIEA 5KHOC 4B6FA 1JEEA 3DDCA 3W6NA 4C30A 821PA 1PV4A 4ZDIA 1M74A 2HLDD 2CL6X 4YLGA 4RKFA 1XWIA 3ZQ6A 1AS3A 4PPNA 1U8ZA 4R2IA 3REGA 5BWMA 2MSDB 1CXZA 2OFXA 2JJ2D 5HZHA 4LOAA 1Z3IX 2OCPA 4LC1A 4JT4A 2GJKA 4NONA 4GZMA 2XSZD 2QAJA 1DO0A 1M34E 2CHGA 3QVUA 1G8PA 4DIDA 4IOKA 2PMKA 2BBOA 3DKPA 3TQFA 4URYR 5EJEA 4MDFA 2IBMA 1IJEA 4N0DA 5SZJA 1OKKA 1YR7A 3K0FA 2C77A 3WHKA 4UNRA 1Z83A 3GLGE 4Q48A 1J90A 4PZYA 2PBRA 1ZM2A 2O8DA 2OM2A 1O87A 3RC3A 2AK2A 2BIFA 3DOFA 5FPKA 2B7CA 4MUAA 4S35A 3U3JA 1R8SA 4PHTA 1Q44A 3SE0A 4D0NA 1GAJA 2Z4SA 2BCJQ 2F1IA 1BYUA 2H57A 2QPAA 2RHMA 3K8YA 5AUQA 1T9HA 5HR5A 1R0YA 1E79D 4TL6A 1BIFA 2REOA 2P2LA 3FKQA 4X8LA 4IFEA 5EE5B 2ATXA 3JVUA 2VH5R 4F91B 1Z07A 3U3KA 2VF8A 2XJ4A 3CRW1 1VCIA 3AVTA 1JJVA 1GNPA 2NIPA 2RGNA 1N6OA 2HF8A 3UG6A 3VR2A 2O52A 1AN0A 2V6JA 3DM9B 2ANCA 4A2QA 1T6NA 5EE0A 2J0UA 2I3BA 1XTKA 3BGWA 3SBDA 1RJ9A 3NBZC 4NKRA 4HLUC 2KJQA 3L0IB 4A0FA 1UKYA 1W4CA 4JLDA 2H18A 1CR0A 1VG0B 1SKYB 3ND9A 2ZI7A 4X8HA 1G291 2OEPA 2WICA 2YZ2A 3MJRA 2IUUA 3FOZA 3F0TA 3QXCA 4US2R 2CE7A 1Z2CA 2QT0A 2VA8A 3TVDA 2Q9AA 1E0JA 1G20E 1W5SA 3BK7A 4HDCA 5FI1B 5G40A 2G0NA 4Z54A 4OI0A 4QGHA 3BH7A 4LHZA 2WIAA 1F48A 2C98A 3U44B 1W2HA 2CMKA 4MGYR 2GVZC 3J81k 3ECCA 1E9SA 1FUKA 3KQLA 1MR3F 4IOMA 2BWJA 3GJ0A 3Q5DA 1M7BA 1X6VA 4NCNA 1US8A 4JKYA 3ZD6A 2NO6A 1NN5A 3A4MA 3IBYA 2A30A 2OFWA 1WB9A 4B44A 1SXJB 2EQBA 2NTYC 4DLTA 4MRRA 2FSHA 4L9WA 4A2PA 4L16A 1W1WA 2OHFA 1VIAA 2OG2A 4QNMA 3RWMB 5DGXA 1XDBA 5KSPA 4G5QA 4JLKA 3FYHA 1Z0DA 2NZ8A 2QM7A 1P2TA 2VP5A 3BJIC 3OIVA 2PZGA 4AIIA 3U3MA 1V43A 2D74A 3QEOA 4RD3A 5KOYA 5DLQC 1RRCA 5JSZB 1P3JA 4N1AA 4YXWA 3LRPA 4DDUA 1ZMXA 2FPKA 1Z0AA 1MABB 1ZINA 3B60A 4B3BA 3E2IA 1JR6A 2GILA 2RH5A 2IYXA 4B2IA 3EA0A 4WXRA 2ZSBA 4IW3B 2AX4A 2WMOB 4ASUD 1ZM9A 4M1MA 1EFHA 1E2LA 3TAHA 3BXZA 3KKMA 1I4DD 1D5CA 1S96A 1VYTA 2CBZA 2ZRBA 1IONA 4K46A 2ZQ5A 4F7WA 3K0AB 1F2UB 1M2OB 1T5IA 2GF9A 2GK6A 3FFBA 5FBQB 1KY2A 1Z06A 2PZEA 4JVNA 4M22A 5LD2C 4OI4A 4GL2A 2ZUCA 4V0NA 1E1RD 1OHHD 1ONBA 1FOEB 4B48A 1XPUA 1ZNZA 5GJVC 1VHTA 4O25A 4ZCIA 2IHBA 1XX6A 2QP9X 2IWRA 3GJ4A 1KIMA 3PG5A 1RRFA 3IIMA 1R5BA 1CJUC 2ZTSA 3C5HA 2VSFA 1PLKA 2FF7A 3QF4B 3WBJA 3KKQA 3AVUA 1JI0A 3BC1A 1YR9A 3SI7A 1IN5A 5K8TA 1G9XA 3HYRA 2RGCA 1VHLA 2WWXA 2ZI9A 4ZIRB 1ZIOA 4PSVA 3REFA 2IF2A 5LB2A 1CLUA 3IEUA 4KYIB 4D4LA 2WIBA 3FMIA 4DLXA 4MRVA 1G4AE 1V5WA 2W6ID 1KTVA 2WBLC 4HUQA 1OFIA 2ZRCA 4UJ3A 4WBSA 4LX0A 3SYLA 4B43A 1LS6A 3QENA 5JZVA 2F9MA 3MSXA 1TF2A 1U0JA 5E7MA 4NCKA 1PVOA 3EPLA 1T3LA 4DEXA 3W3AA 2ZRHA 2UZ3A 4Q1FA 2ZJYA 3THOA 1WQ1R 2CK3D 1C1YA 2ECKA 1YZQA 3RANA 3SDZA 3PENA 2IL1A 5FTMA 1VKJA 2AWOA 4TMXA 2OBNA 3H0KA 4LHVA 3U7HB 3IQWA 4V02A 4CVNA 1YRAA 1MV5A 2UVQA 5JWHA 3CH5A 2O8CB 2CNWD 4PZLA 2QP3A 4GPTA 4JBYA 4BRUA 1U9IC 3W5IA 1EG7A 2MMGA 3R7WB 1XZQA 3GCGA 2V6IA 3VR1A 4B32A 2G6BA 2J0QA 1KI8A 1SXJD 2QTFA 1RVDA 2YC2C 4OJKA 1E1QD 2VP4A 1T8UA 1KDOA 2D06A 2IXEA 3E5HA 1R6BX 3HP1A 2P65A 1DAKA 1KSHA 3AF1A 3CF2A 5AJYA 1BMFD 4A6PA 4NMMA 5CB8A 5BXQC 2REBA 1OFTA 1X86B 4YC7A 2ZJZA 3WMFA 1G4UR 2R6DA 4DEYA 2FDCA 3HU2A 2R6CA 4IDHA 4HAUA 1DG1G 1P60A 3AF0A 4JL5A 3RS7A 2W6IA 1P6XA 1HQYE 2QPOA 3RS3A 3QSYA 2G3YA 3DHWC 3HPQA 1N6RA 3RC8A 4ILEA 2PLRA 3DMNA 4TTPA 4B73A 4U02A 5AJWA 1FL9A 2CLCX 4I1OA 2CL7X 3ASYA 2GRJA 4QNRA 4Z8XA 4TWZA 2IS6A 3EASA 1IAQA 3PXGA 3ZDQA 3LH5A 5JEEA 2ZETA 2ZROA 1E94E 3AVPA 2F3TA 2QSZA 4U5XA 2GXAA 3GFPA 4OQNA 1E2KA 2YYZA 5CIWA 2MMCA 4M9SA 1XNJA 4HB4A 4QHSA 4ARZB 2WSSD 5FOSA 1LF5A 3MAAC 1AZTA 1YJ5A 1OXVA 4IJMA 3U44A 3QXXA 4BE7B 4MGZR 1OB2A 1BKDR 4HB2A 1W48A 1IBRA 3A36A 4Z51A 2VHUA 4HAVA 2P6RA 1G3RA 3AP1A 2OFOA 3A1WA 4KBFA 1EX6A 2OCYC 4Q47A 1P2SA 1SXJA 4HZUB 4B3XA 1XPRA 1F3OA 1Z6XA 2V7QD 5TV2A 1N6LA 2WJYA 4PXAA 4G1UC 2Q3FA 3Q9LA 2ZE8A 2NG1A 3OEHA 3D7MA 2ZU6A 1RYFA 1W4AA 2HDNB 2Z0MA 2H16A 5KSZA 3O8CA 1YQTA 2QEQA 2GBLC 3K9GA 2VSOA 3LBHA 4QGGA 1XXHA 2ZE7A 4JLMA 4KFRA 4DIEA 1OPXA 3B6EA 4BPBA 4DSUA 3BWDD 3GLIE 4DT1B 3FKSD 5DSZA 4N0EA 4BASA 1IN8A 1YHNA 3KKNA 2WAYA 3I92A 4UNNA 4ZCMA 4JL6A 4PHHA 3TKLA 5JFGA 1GL9B 2ODNA 4QXAA 4DDVA 3ZIAA 1Q1BA 2ORIA 2QUZA 1ODFA 2ODBA 3HYTA 4KJZA 2GKSA 4LHWA 5KUTA 2OV2A 4Z1MD 1P73A 3W90A 1F2UA 1ZUNB 2OO7A 1S3GA 4D4KA 1S8FA 2YVUA 3EZ6A 4TLCA 2JA1A 3LFUA 1KZGB 2A5DA 4Q9LA 1II8B 4AG5A 2JCSA 3QEJA 2WKRA 2B92A 4KFUA 4LBWA 3TLXA 1E2GA 3RSOA 3LDAA 1JPNA 5DHAA 2CCKA 3GLGA 2EFCB 4M1TA 3U2QA 2AD1A 3C5CA 4LJ7A 2I1QA 5B2ZA 2A5JA 1ZU4A 2VBCA 4FWIB 1HQCA 3BH6A 2VQSA 3HU3A 3TJZA 1IN6A 1MT0A 1S9HA 3WRXC 2OE2A 3ZS8A 1GRQA 1TEVA 5CITA 3SYKA 3SHWA 1XU4A 4NU0A 2G83A 4LC0A 1XJ0A 1N6NA 4RFSB 4HB0A 5TB5A 1OT3A 2JJ1D 3OAAD 2VP2A 2GJAA 2XOKA 4QOSA 3FKSA 4AY2A 1XEWY 3BOSA 3ZGXA 4AKIA 1OYYA 1Q12A 4D0GA 5KDDA 4JKIA 3TUZC 1G8GA 2IHYA 4KI0A 1E2PA 4UQOA 1G7TA 2VTKA 3C8UA 1WCV1 3NIBA 1CJKC 2PL3A 1S1MA 4FWTA 3GFTA 2ZU0C 3T5DA 4L8GA 3KQHA 3ZLJA 5CM8B 1W5TA 1MRNA 4Q00A 2O8CA 2OZEA 4IDPA 5J4HA 4YDHB 1QVAA 3D8BA 1GL7A 2NPIA 5FPTA 1N5IA 1U98A 4CEJA 4DDTA 4TT3D 3R7WA 1QDEA 4O2LA 2J59A 2JGNA 2EFEB 4QM6A 2XNDD 5LD2B 4AKGA 4OQXA 1AS0A 1YZTA 4QBIA 1F2TB 1E98A 4HAXA 4RCZA 4M21A 2GWHA 5IRCD 1G6OA 2D7CA 3DOEA 5K8UA 1QHXA 2YWFA 1XJQA 3RRYA 4KSCA 2OSBA 1G16A 4M53A 3B78A 5BYJA 4OQFA 2BOVA 3DL0A 5UKDA 4CDGA 5CYPA 1HE8B 1R0ZA 1LFDB 3TAUA 2ERXA 4WXPA 4AI6A 2Z6VA 4DWJA 3QKUA 2PX0A 1CR2A 4Q1EA 3EC1A 1G6HA 2ZUBA 1A7JA 3RYTC 1A4RA 4JSYA 3QI2A 3L82B 2ZRJA 5KNDA 3EIHA 3QG5A 1EXMA 3SJCA 4IXMA 4HEJA 2A5YB 1N5KA 1Z0JA 4ARZA 3GLIB 3SN6A 1JAHA 5JJIA 1F60A 2GEDA 3OZXA 5EZ6B 2NOAA 3Q3JB 3WRYC 1FTNA 1W2GA 4G5SA 3W6PA 3GP8A 5L3VA 1OH6A 5LBIA 2TMKA 2NMVA 4DJTA 3GLHB 3PJRA 3PUWA 4D2IA 3B1VA 2ZRNA 2XNDA 4HZUA 4Q9HA 4DZZA 2FZ4A 4W9MC 2JATA 4NCHA 2QENA 3B82A 3GFOA 3KKOA 4OKSA 3TSZA 5F3WB 1G7CA 1KI9A 2A5FA 1LS1A 1CS4C 1KHTA 1NSTA 5F9HA 1UADA 3ZZTA 1E0SA 3EX7C 3GD7A 1R8QA 3N70A 2W0SA 5KPJA 1ZD8A 1CU1A 1OH5A 2YOGA 4OK3A 2YOFA 3BB4A 1ZM3A 5M04A 3IKJA 2HV8A 3VR4A 3VFDA 2QMUA 1WA5A 3V9PA 4HDOB 3U3OA 4Q4JB 1S2MA 4DT1A 1Z28A 1S9DA 3DM5A 1YR8A 4KITB 5E7IA 1VMAA 1J8MF 3QKSB 3QXHA 3BB3A 4HLUA 4PANA 1UKEA 1NI3A 1P75A 4KVGA 1UEJA 2RGGA 4G01B 3GQBA 2G1KA 3TRFA 3B8HA 2X77A 2DHRA 2PEYA 3EPHA 2WWGA 2O8FB 3MD0A 3SJZA 3I72A 1E32A 4LWZA 3VR5A 1E2JA 1E9EA 3PEVA 5GJBA 4Q7MB 4KLNA 1TF5A 2CEAA 3U6BA 4OK5A 1EFRA 3EAQA 3KZ1E 1P62B 1AS2A 4Q9JA 1MO4A 5TMPA 1ETUA 1KKLA 4D80A 5KPDA 4RD6A 2BDTA 4MRPA 2DR3A 1IXRC 2JIZD 1IQPA 2F1RA 4H1UA 1NY5A 2WOOA 3OHMA 2ZJ5A 4DSOA 4GFDA 1COWA 2WPDD 1KO5A 2VIIA 1OB5A 1E6CA 1K8RA 2NGRA 3L8YA 4I81A 1GNRA 5DHFA 3TSOA 4DB2A 4TL9A 3PR1A 1UBGA 4M0LA 3K09C 1P61B 4RFSA 2FOLA 4UJ5A 1OXSC 1NVUQ 1SVKA 2EVWX 4D82A 1CRPA 4CYMA 1IN4A 2V8OA 2ZRFA 2XGJA 4NCIA 4XWAA 5CDFE 1OSNA 1E2HA 5JHHB 1YZLA 3I3SR 3OEEA 3SJBA 4NYMR 2R2AA 3I62A 2B8TA 3T61A 3MWKA 3UWOA 4EQ6B 2ZSAA 5FBVB 2Z5FA 4M1YA 3SR0A 1GP2A 1II9A 4LCBA 2VHQA 1XTJA 4QC2A 2GF0A 1NKTA 1SQ5A 1G21E 3FMOB 2BM0A 2WOJA 4PO8A 1Z6GA 3GJ5A 4DLUA 4TMKA 3IIKA 4O0MA 3BFXA 1LY1A 1AGRA 3ZQJA 1T3SA 4DRZA 2KBEA 2NO7A 3A58B 5DI9A 3LQRA 4FMCF 1K5DA 5DYIA 1YZGA 2G9NA 2R6AA 1E2FA 2KBFA 1SXJE 2P67A 1F2TA 2FSFA 3AF4A 1GOTA 1NKSA 1NMXA 1TEXA 4D0LB 4NYJR 3W8NA 3K70C 4KODA 3WNDA 1NN0A 1ZM7A 4BFZA 2F1HA 5JCZA 4M9ZA 4N3NA 3EZ7A 3ADBA 1YRBA 2HUPA 3S1AB 4BFSA 4JBXA 3RNLA 1ZD9A 1EFCA 4LYHA 2ZYUX 4I1VA 4QHYA 4HUTA 5HCIA 3T12A 2UZIR 1CULC 1FTSA 3SHFA 1VYVA 2JLXA 1KYIA 5K8LA 5J4LA 2BBTA 3PEUA 4FI3C 2EFGA 5EP1A 2J7KA 4LSGA 4OHVA 3AEZA 2ZI5A 5JJLA 3DEFA 2EWWA 2A5GA 1ANKA 1H8EA 1JPJA 2X8AA 2J0SA 2R9VA 2WJHA 2XEXA 3NEYA 4LJ9A 1HH4A 2J45A 5J4YA 2R8RA 4A2WA 4BZXA 3GLIA 1G7RA 1T5LA 3FDIA 3NWJA 4DCUA 2FPMA 5HKKA 4RZXA 1NF3A 4LDJA 4GOJA 1J2JA 1VG8A 2BBWA 4LJ4A 1YZUA 2LKCA 3IDQA 5TY0A 2P5TB 2W00A 1RPZA 2BJVA 1N3BA 1Q21A 1XTSA 2ZPTX 2GCOB 2IYLD 3GEHA 4ZO4A 1IN7A 3I4LA 1FMJA 1HYQA 4KSBA 4B47A 1PUIA 1QBKC 1KSFX 1NLYA 4TLAA 2OILA 1KI7A 3BERA 5G3YA 4Q4AB 2Q3HA 4XSGA 3NC0C 3VX3A 1VG1A 5JWOA 1C4OA 1TAGA 2CCGA 3LLMA 5JEDA 4TMWA 4WA7A 1G1MA 4P4SB 3QPVA 4LGMA 2HT1A 1SKQA 3IHWA 4GBMA 4M1WA 5GVRA 3R9WA 1ZC4A 4PZZA 4Q4JA 2BMDA 3EZ2A 1KJYA 4B33A 4IFBA 4YQFA 4EPWA 2W2VA 4PX9A 3QBTA 1T0JB 3CZPA 5C18A 1ZBDA 1UPTA 3GEEA 2C9YA 4QJ4A 3UXMA 2XNSA 2VHTA 1G3QA 3KXKA 5FUYA 1TL7C 5CJPA 5FOVA 2HLDA 4EPXA 3BIFA 2BJWA 2RMKA 3FB4A 5BYKA 3PUZA 3CR7A 2AR7A 2GK7A 2HCBA 4IOLA 2FG5A 5B64A 4NHOA 4I1UA 4ESVA 1SVMA 3H2YA 3P4XA 1Z08A 3PV0A 4QKQA 1FQJA 2P0EA 1WBDA 2JJ2A 3CF0A 4M9XA 1LNZA 2O8FA 3NBXX 3FWYA 3I1FA 4GP7A 1KO7A 1L2TA 1U0LA 3IIJA 4CW7A 2VP6A 1CTQA 1NVXQ 2XSZA 5CK5A 3H4MA 2EFDB 3ZVNA 2W2XA 4EAQA 1XZPA 4QGFA 3AP2A 2CVFA 2KWIA 4RD2A 4Y0AA 2FGJA 1IM2A 3KQNA 2JASA 1P9WA 5GADl 1T4GA 3THWB 1XCPA 2NQ2C 3QPUA 3I5XA 1X8JA 4A15A 2CCJA 5GVSA 1AKEA 3JZMA 1NMZA 2QE7D 1W44A 1M1YE 3AKEA 1YVDA 3HU1A 3AF3A 1WMSA 4FW9A 4G3XA 3EW9A 3LLUA 1E69A 4FD2A 5J5CA 1KI4A 4EPTA 4IEIA 2WJVA 1GKYA 1T8TA 1HEIA 1X8KA 1JR3D 1E79A 2HT6A 2GJSA 3AVOA 1S4QA 2GBLA 4XVQA 4Q1AA 2ZR7A 3A8TA 3PUXA 2WWFA 2QSYA 2F9LA 2ZYTX 2ZXUA 3ETLA 1RRGA 1XJCA 3PUYA 2H7VA 3B85A 3AVXA 4TQAA 3EWSA 4EQ6A 4GRAA 3O47A 1NSFA 3B5JA 3LQQA 4JIMA 3G0HA 4B76A 3BH0A 5BW8A 4CF7A 8OHMA 2BBSA 3FHTA 4IHQA 2CLDX 4HZIA 1Q20A 3SFVA 4AYXA 2E9SA 3P4YA 4B3CA 2HYIC 5CLQA 4F93B 4ZDWA 1NIJA 4B3DA 4P4UA 4QBFA 4XTCS 2GZHA 4Q4LA 4TMTA 4TQUS 2O0HA 5FOXA 4KV9A 3T35A 2IT1A 5IF9A 4UXIA 3U4QB 1U81A 5GJWC 4FMDB 2XTMA 2W83A 1M8PA 2ZREA 3LXXA 2O5VA 2IYTA 5HPYB 2OAQ1 1OV4A 1ZNYA 3QY0A 1N5JA
chains in the Genus database with same CATH superfamily
1HTWA 3PF8A 6Q21A 3D1JA 1VPLA 3AR9A 3RI3A 4B74A 4ZI7F 1ACMA 1FP7A 4PLHA 1GPAA 4G5RA 1SR8A 3LW8A 5E6RB 1WXQA 2PU5A 4R05A 5FUMA 5FJIA 1OLXB 1KI6B 4G0VA 3THXB 3CONA 4DMFA 3LYAA 4EABA 4OFWA 3AKDA 1E7SA 2HEGA 3DBRA 5TEVA 4DBVO 3OQVA 4LTMA 1JXOA 1O57A 2XUHA 4J0QA 3GFRA 3OJFA 5CH5A 5EUQB 4C5CA 2W6JD 4YO8A 3T1OA 4DCVA 3QK7A 2DQKA 3VV3A 3CC8A 2C42A 4QFMA 4YTEA 1I5EA 1J6UA 1KYTA 1DAFA 3RAJA 8ATCA 5L95A 1CWUA 3CF6R 4F8YA 2YJTD 3VPAA 2M2IA 4KQXA 3TR0A 2ZYRA 3RYIA 5BYAA 5A4FS 4NK5A 2WTNA 1A9QA 1OXMA 5BSTA 3UH0A 3GO4A 4Q39A 5J2TF 2HBQA 3LCMA 4C4XA 2EEPA 3IA7A 5MN5A 4ARSA 1SIBE 2BGKA 3KQVA 1J97A 1EAYA 5H83A 2R751 1EGMB 2AQHA 2C2OA 1P2DA 2UYYA 1IPEA 4IH1A 4UVIA 2FW9A 2Q7DA 5AVXA 1Y81A 1SKUA 2PEZA 1QSGA 4YIKA 3HL0A 4NAHA 4C7OB 4KBGA 1JEDA 1U2QA 1BX0A 5EIWA 5HJ7A 3ZZMA 4NZNA 3HCEA 2OZVA 4ASUA 3ND5A 4Y3UA 3L8ZA 2DVMA 2FH5B 5TXGA 4HNUA 5KB3A 2NZVG 3RD5A 3KETA 1JHMA 3DONA 2WDZA 8GPBA 3ND7A 1UIRA 3KL4A 5LNK6 3C3MA 2JAQA 4RC9A 2Q3EA 5DW3A 4BDSA 3AF5A 3CH6A 1C7ZA 2PGNA 1KEZA 2QRZA 2DFTA 2NO0A 2FE1A 3H1GA 2Q21A 3KR2A 3JR7A 1LDNA 2QA5A 3H9BA 5K0ZA 3AF2A 5DK4A 4TL8A 2G1AA 1JDUA 2DCUA 3BMQA 5JLJA 3M89A 2ONJA 4B6GA 3WGLA 5ARDA 1THMA 4OX9B 1N2BA 3DC2A 4RBNA 1Y48E 1JH8A 2DQYA 4MS3A 1UKVY 1YDFA 3IAEA 4E3WA 3RB8A 3DF9A 2WA2A 4CQMB 5G1OA 2GBCA 2E37A 5I9TA 2HOQA 1NBMA 3JAKA 3SE7A 3ZNPA 4W6ZA 3ZLVA 4B9EA 4BN4A 4URXR 5IXJA 1I13A 5LBTA 4DV1B 4GXQA 4GUAA 5BQ3A 5AJUA 3ANYB 2VDKB 4DLYA 3GW8A 3MCTA 2CNLA 1Q77A 5LLSA 1DG3A 1ISMA 1EU1A 2CVPA 4DJDC 1COZA 4DQLA 4EARA 1HL7A 4YV1A 4JLWA 4UFPA 4TKZA 4A23A 2P4EA 3LGSA 3BFVA 1G5HA 1V11B 3RODA 1F14A 1N8KA 1F0PA 4U7FA 4AZSA 4L4XA 1M72A 3DBIA 3S0JA 2WU1A 1YI8A 1U7XA 2CK3A 3PHHA 1J0BA 1W0CA 1DADA 3BWMA 4QSMA 2HSGA 2EF1A 5ADHA 2KLHA 4HPWA 2Q3MA 4M60A 2YWXA 1A2BA 4XGIA 3KHUA 2QL6A 3CT6A 4FIDA 2XLBA 3HJAA 1N0VC 2AFHE 1M6VA 2IYWA 3U4CA 1U6JA 2FFHA 1O95D 1DQNA 2V4MA 3GT4A 3JVVA 3N28A 3O9VA 2CNWA 4H0NA 5EERA 1ULSA 2PKCA 2IUTA 2WP0A 2ZDGA 2FUCA 2J33A 5HMMA 3TZBA 1NONA 3UMFA 2GDJA 3D2CA 1ABEA 4XCQA 3G9QA 4LN1A 1P4RA 1ISRA 2PH5A 4LI3X 1UBCA 4K5QA 3RABA 4B3JA 1B23P 2PIAA 5C1IA 3GBVA 1QF9A 1E1QA 1B93A 1AZWA 1P1JA 1EDDA 3IQGX 1Z12A 3KXLA 4P31A 1BJRE 3SS8A 4F9GA 4V1CB 1NC1A 2PJDA 1VGQA 4WE3A 1U63A 2V7TA 1OYOA 4WAUA 1BG6A 3WZMA 5C1OA 2C0QA 4J3JA 4XM0A 3K0CC 4J75A 2HNAA 2WILA 1W4LA 2YC4C 1K9VF 5DBGA 1CD5A 2XOEA 5GIOE 3TMYA 1RXSA 4FGKA 4NYJQ 4V0QA 4TKUB 5JSZA 2VPPA 4Q3OA 1X13A 3I2JA 4V0RA 2B6NA 1LB1B 4AZ3A 1Z39A 5KYXA 1VCNA 5L53A 5A5GA 1Z7EA 4CLOB 4G86A 1MABA 3O8DA 3C3AA 3MUNA 2FN7A 2LWIA 4HTAA 3DS8A 3RSGA 1IPFA 4HAZA 1DCKA 3L6EA 4JQSA 3IPYA 4E2FA 2M1XA 5E9AA 2DQZA 2DBVO 4S3MA 5ALKA 3B52X 2YW9A 3GLHE 3VR3D 1P5RA 4DANA 2YVKA 3K92A 2VOJA 4H7EA 5BV8A 2VZEA 5IWAB 5DO9A 4EMSA 1V26A 1UR5A 1RC8A 4MWTA 5DN9A 3RRBA 5LXTF 1NOKA 1RHRA 5BVGB 1K1EA 5IHPA 1CRZA 4YMHA 5EC8A 2H4FA 2Q2QA 2YHUA 3QFCA 5CK4A 2R85A 4BBJA 1LW6E 1EUYA 4V24A 4P5EA 3QUAA 3AQIA 4DRXB 3VH1A 2X0EA 3ISTA 3H9CA 4RNCA 4URZR 5LA6B 3F1KA 2VYNA 4MV6A 3LUDA 1KY5A 1KH2A 3VQTA 4Z4EA 2QX4A 3KB8A 2ADMA 3NHLA 4EW6A 4B46A 2V7QA 4WNIA 1CF2O 1DC6A 1JIVA 3IP8A 5KNBA 3G2PA 4YUZA 3V48A 2A78A 4MQUA 4RZ2A 1PJAA 2O4CA 1YZVA 4DADA 1FW8A 2QG6A 4ZIRA 5K0GA 1UP6A 5G4KA 3T5TA 3CZ9A 2GVDC 2BV3A 1FDOA 2LTAA 3VH4A 3FFAA 4YDQA 2OUKA 2RD2A 1PZMA 4YMIA 4BAZA 5ARBA 4BGDA 1A5TA 1UDXA 4F56A 2GHTA 3CNEA 4Q9DA 4XTRA 2VJPA 1ZCZA 4BMNA 5HDBB 4NF2A 4PAOA 5F98A 1E3MA 4D81A 2NO9A 2QMQA 2VF5X 4K6HA 4OF4A 3CXRA 5IVKA 1V4NA 1X3SA 1KERA 3TIXB 2E5WA 1CF9A 5GPBA 1OX6A 4EITA 1OXBB 3O91A 4QTZA 1KSGA 1NGSA 1QH9A 1DKUA 1LJUA 2XUKA 3JAWB 3QE0A 1XMJA 3WV4A 3TTVA 4CG0A 5CG1A 2VT6A 4TKLA 1U7UA 3SX0A 3ZY5A 2I2DA 4P3XA 5A4IS 4ZVVA 2JJQA 2IS4A 1SXHA 1VZ2A 4AC9A 2Q5HA 4ARCA 3OOHA 5A06A 5KDLA 4JLNA 5KJEA 1WUTA 2G77B 2HMYB 4EYOA 3C3JA 4KLAA 4J91A 3OIYA 1OZGA 1QPZA 1FA9A 1WY7A 1ZESA 3AB3A 1FMFA 1DKOA 3JY6A 1DARA 1Z13A 2NXJA 5AW8A 3WZLA 1JDPA 4YRTA 2P75A 2PKQP 2OAGA 3ZV6A 2IPXA 3H1TA 2WNIA 3GGOA 2IODA 2TRSB 3RUIA 3WC4A 3ECAA 3PNOA 2FJ0A 3HUUA 1TZMA 4BAUA 3TXAA 5I4KA 3GFSA 3RAGA 2H17A 1B16A 1E2EA 1WMFA 2QTVB 4MQEA 4MW5A 4D4JA 5H80A 4LFBB 2B4AA 1VC2A 1L7BA 1L7RA 2O2GA 2PCLA 5G1PA 4D4IA 2SCUA 5LU9A 2O2CA 2JI4A 3G3EA 3NHPA 3AOEA 1SHZA 1MBZA 4FE4A 4OJQA 1GGEA 4RMIA 5EP4A 2MIIA 2V6FA 2B83A 3FTQA 5BQOA 4ETWA 7ABPA 2NSDA 1VPVA 2OHVA 1BKYA 4QDUA 1P0IA 5F3DA 4R9SA 5JCJA 2OQ2A 4H9GA 1XHLA 3KD3A 1YB5A 2BEKA 3K8OE 1TJNA 4Q66C 2H0AA 1JDBC 1ZDMA 2IUEA 5AXCA 3RHTA 1Z29A 2XZLA 4I4TB 5TMBA 4TSFA 3QW4B 4KV7A 2J9GA 3CB4A 3OFSA 2AC7A 2WR8A 1Q2UA 1H3EA 3SYMA 3MTGA 4YI5A 4DCMA 3LS2A 4MTCA 3LP8A 1N2GA 1W52X 1WDTA 1C7JA 3FNGA 4N0QA 4NESA 3RKSA 1HDYA 3PVSA 1RTTA 2JFGA 4UTPA 5K03A 4NYIR 5E0KB 1R4NA 3GXBA 2QLJA 5CFZA 3AILA 2AX3A 1GFZA 2PZJA 4GYWA 4LWOA 1R15A 1QYXA 2D2XA 1TI7A 2RDMA 4R9VA 4X7BA 4RAQA 5FYQA 4JX9A 4KSYA 5TNXA 1JBEA 3HJNA 3ZHCA 3GRPA 3RYCB 2VDWB 2L69A 2WV9A 1TOAA 4BS9A 2ZE5A 2ZUWA 4FEEA 2YZGA 3AFNA 5M5BA 1W5FA 4PYQA 5IMBA 4EA8A 4CR6A 3LQFA 4ZICA 1T5BA 1KO4A 4WXHA 1E64A 5ALDA 1SRRA 2I33A 4QYSA 1MA3A 3PUKA 1KMNA 3QUSA 4R3NA 2IK8A 4URWR 3UBMA 3WFIA 1J49A 1WU8A 1JR3E 1NC3A 2GCPA 5BSHA 4EDHA 1KEKA 4PGFA 1NP3A 2RBGA 4JBLA 5CLLA 2XUGA 3KQSA 3FSRA 1E4VA 1GILA 3MFYA 5CDGA 4YS6A 1FNNA 4OLAA 5ECWA 4DLRA 1ZK3A 1IH8A 3R6TA 2IP4A 4ALLA 5JS7A 4BGUA 5EXSA 3OQIB 5JW6A 3QXGA 1GKUB 3PC7A 3TIFA 1ZD3A 3LC2O 1BU5A 2WYVA 5J5AA 1SG9A 3C24A 1E9BA 4MDHA 3WYNA 3R7LA 2O8BB 3Q40A 4EJSB 3UJBA 4DHWA 2GO7A 3KWMA 3Q2IA 4EG8A 5K0JA 2I91A 4UHEA 4OU5A 4UOEA 1D6MA 2FX5A 2UUAB 2WB2A 5IXYA 2JEYA 3SQDA 2IXGA 4DQKA 3MJTA 1UH5A 4U3JA 3SWWA 4C06A 5CFOA 1HUQA 4HRVA 4DLNA 1XMSA 4GI3A 4UUMA 2JEOA 3EZLA 3QFSA 5F2KA 3IULA 2XUFA 3LGXA 3NKVA 4WKNA 5FH9A 1EVLA 2PRZA 2IS2A 3VTKA 1Y6RA 2P0YA 4CT4B 1UXOA 5A6SB 2OP1A 2I6XA 2F55A 2FPIB 2OLJA 4O1IA 4RDCA 2JLVA 1CUHA 3G85A 2ODTX 3KR0A 1NJ6A 4XWTA 5DBIA 4QOFA 5KCMA 4B7ZA 4UEQA 4FDMA 3WICA 2BHLA 1P5ZB 2IPNA 2COUA 4F6RA 3JSXA 4B3GA 1O95C 4OXKA 3COJA 3SAJA 3GEMA 2AUMA 1PX0A 2DFNA 3FOFC 1KMHA 2FLVA 2O23A 1H2AS 2OR3A 4NBUA 4WZAE 3CX6A 3ZCQA 2QAGC 1MHPA 2FEXA 3PQEA 4NZMA 5A02A 1DL5A 4ZODA 4MS4A 4AUKA 4BV3A 3THYB 5EWMA 1L7VC 1W0KD 4TYMA 2DHCA 4HQOA 2BI7A 3QM1A 1NBME 3NBUA 3OE4A 2F8SA 2FKAA 3W8RA 1W4ZA 5IVIA 1CW2B 4U4AA 3SEQA 3U17A 4DREA 2VVTA 4MAFA 2PR7A 2QP4A 2P5UA 4KIWA 2XOXA 4P84A 3RHSA 4HEA6 2YYSA 3R09A 3VKHA 2X41A 1EUCB 3GRUA 1X7GA 4E5KA 4A10A 3IAM1 5C4MA 2R44A 4PCVA 3DGFC 2A3NA 1PD0A 2QVCA 3W2IA 2A35A 2B69A 4W1QA 1FUYB 4QQ8A 4Z54A 1X1SA 5JWRA 4RQUA 1GGFA 1PFVA 3DA8A 1RE0A 3CWCA 5FR2A 4CMEC 4CL3A 4YMVA 3WQSB 2QRGA 3Q7PA 1DQRA 2VT7A 3THRA 4POAA 3V2IA 5IHXA 1UDWA 2Q7XA 1IYZA 1MOSA 1CJVC 3NO4A 4OQZA 1ZSVA 1MO5A 5DHPA 3IQHX 4EBFA 3PKJA 4AZTA 1ULTA 4ECAA 2XVXA 3EJ6A 1TC1A 1XTRA 1YCFA 1H0KA 1X3LA 2VDQB 2RC5A 4K9SA 4MULA 1UKZA 1UEIA 2FWAA 4I9GA 1HMYA 3SKYA 3F3MA 3R75A 1OASA 2H2HA 4G65A 4PM4A 1QGDA 4JNKA 3DBOB 5IDXA 3F8TA 2A3RA 3DWFA 3RUAA 3L1UA 3HXMA 3RSFA 3LBIA 3W1EA 4GKAA 2XBUA 1VCOA 1SBQA 5FNZA 4Z7JA 3Q9NA 4QUJA 3CVYA 3PC6A 4NZOA 2F3QA 3ZJTA 2B37A 2ACVA 1L4YA 3ICCA 3O7MA 1GTG1 4XQGA 3RUFA 1UXHA 3UCFA 1J25A 1L9XA 2VF7A 4RLFA 5CCDA 4U7DA 4IS2A 4EHJA 2ZWAA 3GUYA 3IMFA 2J8ZA 3OZUA 4GMDA 3KQWA 3COZA 5M2QA 1VLMA 2JVJA 3NRBA 2NNWB 5PGMA 1KO1A 2WNHA 3DO6A 4I1SA 3DV9A 1G3MA 4IRMA 4G1MB 4RV9A 4EY8A 4YRJA 2PE5A 5KAMA 2V3CC 1N4DA 1MX1A 4JI8B 4ZTZB 4LJYA 1Z15A 4RK6A 1U5BA 2NLOA 2HU2A 4YREA 3NQ41 3H5NA 5BW5A 1JT9A 4W5QA 2ZIUB 5JC1A 4JAVC 4CM6A 2XVZA 2Z8YM 4PO9A 4Q7JB 1GTL1 1G17A 2WUWE 4GI7A 1JFTA 1N4AA 3WL4A 2I3ZA 1WW2A 1GAEO 3AEYA 4XARA 1Y4SA 3S2FA 1X7DA 1WLSA 2NU6B 4ENWA 2DWCA 3ESXA 3G9XA 1L7EA 2YZMA 2Z9CA 1W8DA 3D6MA 2H54A 3EDOA 3IAAA 4DG5A 4KYUA 4LWPA 2DF8A 3PA6A 4JB0A 1CV2A 1VLQA 3NNDA 1HOTA 1FPMA 2HWYA 2W0MA 3H9JA 3L0PA 1ZIXA 2N1MA 4G0ZA 4HYYA 1U1CA 4MIKA 5EP3A 1K0UA 3M4JA 3M8KA 4FMBB 5D3MB 3DMYA 3RIXA 5I9LA 3RTGA 2EYUA 1LJLA 4X45A 5FOWA 1B8OA 1RJWA 4NJMA 4NBSA 1NXTA 1PDOA 2WYIA 3DZJA 5EMLA 4MUEA 3DGEC 4H18A 4BEVA 1Q1QA 2UYHA 3JD0A 1WBJB 3QYFA 4LZWA 4P3NA 2C59A 4YCNA 1NN1A 5EJ5A 2GPSA 1P19A 4RTPA 1QB8A 2ZT5A 3W0LB 3KOZA 3TW8B 4FX5A 5TIIA 3JU3A 4A8JC 3GJ6A 1TX4B 3F5FA 4BMXA 5LQKA 1TADA 2ZYVX 4N0MA 4OMCA 1EJ0A 1Y33E 4OSOA 4JSRA 5CLJA 2GFQA 1DOAA 1WB6A 3FUXA 4JC8A 2AQIA 2QMHA 4D5GA 4R68A 3UMGA 3ZY6A 4JQOA 5JASA 5L8VA 1Z22A 2P9BA 3L7NA 4YBRA 2YJ4A 3S81A 2WMYA 3PT9A 1KAQA 1TNDA 1C3JA 1SOMA 1M8FA 4QYMA 2DYKA 1L8QA 5AQEA 5MFPA 1GFWA 2Z8ZA 1L4BA 3GUCA 1FFYA 2W2TA 5K0BA 4FSHA 3TBKA 2G9VA 3OF5A 5J40A 3ROPA 3RWOA 5A04A 1B8PA 4DJEC 3AUXA 2ZIFA 1F0KA 2ENWA 1PR9A 1S3FA 2NT4A 5F1PA 4DARA 2IZZA 5HUHA 1DGQA 1RVV1 2YV1A 5ALNA 2E0IA 1XOIA 3PZBA 1A5AB 4QT0A 4G56A 1RWWA 4PRLA 1O8BA 4BP1A 2BCGY 2JLQA 3FA2A 2F43A 4HGQA 4V1CI 1NQ5A 3LYUA 4IHJB 3VDMA 3FH0A 2ATIA 4QXQA 4BKOA 4OFBA 1VOTA 1KMQA 1PZNA 2O0MA 3NR2A 3QBVA 5A03A 2NQTA 3TLBA 1O4WA 1SVSA 3DWGA 4C7JA 4DCTA 1C0LA 4LGYA 4US0R 2PLNA 3PVZA 3RBXA 4QNNA 4RPIA 1OFUX 3A3YA 1L8OA 1M8GA 2WD7A 4A27A 4GKKB 5EUMA 5TEWA 1C8VB 1H6CA 3ZXIA 2IXBA 4C2AA 1NBAA 2BZ1A 4Z2AA 1FRZA 3UPUA 3V1MA 2GHIA 1ZJ5A 3CXUA 4YXWD 3CWZA 3L93A 3VSEA 1KI2A 1MHTA 2BPOA 2R6GA 2RK3A 2B94A 4PS0A 4MDEA 1JJIA 1QIHA 1V8DA 1XD9A 1XVAA 3K0CA 1V6SA 4K6OA 3STVA 1B00A 1QPGA 5FLEX 3X2FA 4D44A 1DAHA 2CE2X 5G0SA 1CBUA 5F7JA 4AYWA 4LXXA 3HKEA 2RC6A 1NXWA 3A3PA 3GHHA 3O4FA 2DY1A 2NP7A 2WIKA 4HQNA 4CEIA 1QOQB 1Z6QA 3EFOB 2AZXA 1PL8A 1QYWA 2EU8A 4ENVA 3K71B 1D2GA 1CNMA 2HQSA 3LZCA 1GM5A 4GLJA 1WPQA 5D2CA 2KI5A 4L2IA 4PQRA 2X2EA 3FVRA 3ZWVA 2C58A 4P7FA 4C2UA 1JWBB 3OWHA 3QPBA 3HP4A 4N40A 2FW1A 2ZT7A 3U9SA 1LSJA 3JARA 5TDHA 3HHPA 5JXIA 2G4CA 3KOOA 2KE5A 3ZWKA 4HVCA 2HJWA 2ZE6A 4CRWB 3B9RA 4RVFA 1C3OB 1E2QA 1NQVA 1RYBA 3Q41A 2FGKA 4FE3A 2KMLA 2KS6A 4K87A 3NTQA 2GVNA 4EKYA 2Z6AA 4TZ0A 3GUVA 4TMFA 4O2RA 1AIPA 1LV8A 1U8YA 2VYVD 3GBPA 4HJRA 2H85A 3OQMA 4BFCA 4Y6GB 1ODJA 1IZZA 2DE0X 3CNOA 3SDSA 1XMOB 1ORRA 4GOKA 2EEZA 3LHIA 2AXEA 1XXHB 4I4CA 4JP3A 4O4JA 3ICEA 1TYAE 1T1JA 5T4BA 1YZKA 1RRPA 4I50A 3PZRA 3WYFA 3N59A 4NYIQ 1SURA 3IDSA 4L5YA 4OQMA 4L73A 1PTJC 4BLTA 4WVLA 3DAPA 2VHXA 3EGWA 2X0KA 1A9RA 1ESCA 4Y2HA 1VSQA 3UQYS 3NNNA 3W6OA 4HNGA 1GSOA 1IWPB 2A84A 3H17A 2R87A 4ZYVA 2XXAB 5I4CA 4YK7A 5DTRA 4CLRA 3PTAA 4E09A 1NW6A 4HWSA 3ZCXA 3OUUA 2J67A 2NNLD 3DHVA 3R8CA 4FR0A 3OZ7A 1AUOA 2FV8A 3CISA 2G4LA 5AK6A 4JI0B 4B3SB 5BXYA 2GZSA 4GSLA 5AVQA 3CCFA 3LDUA 3A6LA 1X9GA 4KUGA 4E94A 3CVXA 3MB5A 1DBIA 1S1CA 3EVGA 3ZD8A 4P81A 2DECA 4EF5A 5JC8A 3OPXA 4HQRA 1N9ZA 4OJMX 4YCDA 2GM4A 1YS4A 3E0QA 1R74A 3RQSA 5TQJA 4RDXA 5IN4A 5COQA 3JVDA 3WLNA 3CMCO 2Y0BA 2IDMA 2C54A 2CMDA 4EGJA 3IAM6 1JKIA 2R3SA 3FWZA 2HPAA 1Y9EA 3IV6A 5EFZA 3VKWA 3TTXA 3WLIA 4Y1RB 3V9AA 4DZRA 3T3NA 2CF6A 2XVAA 4IQFA 1ACJA 4BUJA 2XTNA 3BORA 1YACA 3EXIA 4HGRA 4ZYUA 3KSZO 2GYUA 1PS0A 4RGVA 2RHCA 2YVQA 4EKNB 1RXEA 1HNWB 1LX6A 4COKA 1T6XA 1G19A 1RYNA 3GVHA 2I4IA 2LDXA 1TXGA 3O8OA 5ALQA 3PNQA 1C3EA 3C1AA 4MVJH 5KHAA 3AR7A 4NL4H 3IXLA 3AOGA 1CQIA 3HA3A 5IARA 5SICE 3KUDA 3HJRA 3IUEA 4UBOA 3VBEA 1OIWA 3CE6A 3LKDA 2H5LA 1XD2A 4LXHA 1PK8A 2NU8B 4RVGA 3R7AA 3TOVA 3ZVLA 3UXEA 5F23A 4OQLA 4Q4HA 2ILVA 3NRJA 3AVYA 1OIVA 1ZM4A 1CE8B 3AW9A 4Q24A 4Y0NA 4O4JF 2VNKA 4M38A 3KOYA 5F2EA 2Y1WA 1F9EA 2W6JA 3V32A 421PA 4I50F 4N6OA 3ITKA 4EW1A 2LIPA 5TE9A 2PHZA 2I1VB 1XAIA 1RI5A 4J7XA 4J03A 4MUGA 1X1CA 2ZRMA 4A9AA 1DKRA 1LVHA 2O2SA 2R11A 4JLPA 1A88A 1XMIA 4CEJB 1XDSA 1NIPA 1VLVA 2HCJB 2J6BA 1EFUA 3D2BA 3KHSA 1XQXA 5D01A 4ZFNA 3PCTA 3G8AA 3QPDA 2Q1WA 3ZN2A 4RTRA 1H22A 1KIFA 1VJ1A 4MWCA 4KXVA 2PZMA 3RS0A 4B3TB 1H1DA 3LL7A 3AI2A 5LZ7A 3QVOA 1L5NA 2ODPA 2JAHA 1W7AA 4LF4B 3AVWA 4JMPA 4TMZA 4GMFA 2BMEA 2QTCA 3ULKA 4D4MA 4R3UC 2KB0A 2Y6VA 4QTUB 1D2MA 1JAZA 5J4VA 2C7GA 4P32A 2DWPA 4PO3X 2BR5A 5B6PA 2CLFB 4NJEB 1A8UA 2AFIA 3ENWA 1V2GA 3EDCA 3F9RA 3U13A 3WGVA 3P0EA 5I47A 1BXZA 2V9PA 4ALIA 1A7UA 2GJ9A 1NMSA 2PGDA 4XEUA 4ETNA 5D1NA 5ERXA 5LPNA 2OWDA 2DETA 1G7SA 3GHYA 3KTAA 3CR8A 5H68A 4FKZA 1OJLA 1JMYA 5IC5A 3SQNA 3T9BA 2ALJA 2CL5A 3V55A 4WN3A 3ZS9A 1U8XX 2DLDA 2JGIA 4UHJA 4W8GA 5CNMA 4H08A 4CF4A 5J4KA 5JXHA 3EPKA 2B4TO 2E5FA 2ZSDA 2RGNC 4CF3A 2W8ZA 4FSXA 1TW3A 1W29A 3GK3A 4H27A 2NM0A 2OORC 3UWDA 4J6EA 2VDLB 2CMFA 2Y2UA 3H9EO 1M3SA 1U1DA 1SK8A 3DMHA 5FUVA 4BLRA 5JMWA 3TNFA 4XQCA 2DBYA 3RRNA 1TAUA 1WKCA 4TKVA 5KOJB 1LQ2A 3CLRD 2BSAA 5AOCA 4W4TA 1OBCA 5FTKA 1I7DA 3HYCA 5HJ5A 3U4AA 2P3LA 3MM4A 4MR7B 2ZAOA 3OSZA 2FCRA 2IYRA 4YP6A 2C07A 4N39A 5F51A 5SYNA 1DTWB 3GPDG 1UDRA 4JXKA 2ARKA 4ZP1A 1G8KA 3RSCA 3W4JA 2VA9A 3FDZA 3HA2A 3F2IA 1PR1A 4NPHA 1N6IA 4BO0A 3EAFA 4RFLA 1D9XA 1B1CA 2MSCB 3A2MA 3CG4A 3QJ5A 4TSKA 4Q7QA 1BYIA 1HC7A 5LP6C 3G7NA 4BFYA 2G0TA 4BO5A 5L3QA 2PUCA 4RY9A 2YKGA 1GKIA 3JQAD 3P9CA 4GS5A 4UCFA 5CTJA 4PQFA 3UMRA 3S8MA 1UAAA 4HNTA 3R9KA 1RKBA 3QMPA 3UATA 3IODA 3W77A 5THQA 1GNTA 1B42A 2IE0A 1QP7A 3P9XA 2PGAA 3DTYA 3KC2A 4IH9A 4KHZA 1E9FA 1D9ZA 3GZNA 3NANA 3QQ5A 3QIVA 3QFFA 5EY5B 4TTJA 2WQZA 1OMOA 5LZ9A 1O95A 3LC0A 3OE5A 3AT1A 3T5AA 2F17A 3TG8A 1TMOA 4DJ5X 2DR0A 3I12A 3JATA 2HA6A 3FJ1A 2ZKIA 2QAGA 5E6RA 1XZIA 4BNZA 2OO3A 4G0NA 4E2WA 1TQDA 5I7AA 1V8PA 1CIVA 2JPDA 4QOGA 3MQ2A 4DCOA 2OGUA 1NJ8A 3M6MD 1ZVKA 3U61B 3IR6A 4MUMA 2C04A 3GD5A 1D09A 2O5RA 3OPYB 4Y8VA 2HB6A 4CIBA 4G0MA 1E9AA 4NOKA 4TYQA 5DW0A 5G0WA 3ZXXA 3FHJA 3OSUA 2VZLA 1UINA 1Z0KA 2I29A 3AK4A 3E9DA 2JZNA 2HZBA 3LXMA 4IVPA 3FCEA 1MFZA 3ZHQA 1AQYA 2WP8J 1QVVA 3KUXA 1NTOA 4MUYA 4V3BA 1AHPA 1NE2A 3RWBA 3ZGOA 1AUXA 1U1EA 3F96A 3A6KA 1T2AA 1Z16A 2IC5A 4INJA 4O4HA 3WMRA 4CMEA 1Y1TA 1XEXA 4JQZA 4IG9A 3TEMA 3AQ4A 3DQQA 2EKDA 2N3ZA 5I7OA 3QJYA 2NUPB 2BGNA 1CJTC 3M2PA 4JU8A 5DYWA 1YZ3A 4C07A 1KE2A 1QP0A 1ABFA 2AH5A 2A0UA 3AI7A 3GCWA 5K0FA 3V5NA 4Y9DA 1H8HA 5JRDS 4JYAB 2VWQA 3AERB 3ZDFA 3VR3A 3P8ZA 1RQ7A 4DILA 4PONA 2CXXA 1RYDA 2ODEA 3PGLA 8AT1A 4QVIA 3UCEA 5J47A 3PEYA 1K08A 4YO7A 4EG4A 1QG6A 3U80A 1YCHA 4R98A 5JG7A 4EIWA 1CP2A 2QI9C 1K88A 4ROSA 3GPLA 1H4QA 3U3DA 5DJ5A 3ZVMA 2FN8A 1ADFA 3CUKA 1QE5A 3LX8A 6NULA 1KEWA 1GPBA 3KVVA 3V8EA 4C0SA 2P9EA 1YGPA 2ECFA 3CPJB 1S2GA 3TI7A 1WTCA 4NCJA 3MRSA 2QOEA 1D4ZA 4WZZA 3KWJA 4FMDF 3I5YA 4CGZA 1G9SA 2J9XB 2YHIA 2X7JA 3NH6A 5JO9A 2ZAMA 4INAA 1XNQB 3ZH9B 1TC2A 2QHXA 4G4SP 1PJTA 3M1IA 3NKFA 3KCQA 4RWEA 1YTLA 3SOZA 1XL1A 3HWX1 5EJFA 4ZDKA 4CR8A 1OLSB 1K7EB 4G97A 4JEIA 1Y7IA 3QHQA 4FKMA 2NVOA 3VJKA 4BQFA 2AT1A 3HEBA 5C3MA 3O94A 2ZUSA 3KU1A 4HNSA 4P33A 1IY1A 3L0OA 4JLJA 4JROA 4YP0A 1PWEA 4IYJA 4U9UA 3AGQA 1C9KA 1VE7A 2A0YA 5C37A 1LVGA 3KQTA 2HK7A 2RB4A 2WAXA 4FW8A 4P3KA 1LLUA 5SYMA 2VLIA 2PD4A 3UAGA 4ZALA 3NP7A 2EJVA 2UDPA 4GI5A 5D7BA 4LIPD 1FYXA 2W2NA 3OX2A 4MO2A 4WECA 2JLZA 1XCMA 2XVYA 4PZAA 4JV5B 1UIMA 1YQUA 2XCQA 1B0ZA 4A0HA 3DEJA 4IXNA 2PR2A 1SBCA 3OZSA 5HHTA 1FDIA 5I4IA 3CNBA 4F3RA 1U3GA 3OBIA 3NG1A 4EPYA 1KOFA 1THTA 3GNQA 5FBHA 4O4HF 4BNJA 5LQAA 4QSHA 3CUWA 4JB3A 1EFTA 2VJKA 3CUEF 1FFAA 3PI7A 1S0UA 4HC4A 2OXRA 1C9YA 3EJWA 3M4XA 2MSNA 3WWPA 4AJOA 2JCBA 5C1PA 5MHTA 5EJIA 1O3YA 4O5AA 1XRRA 1YCDA 3P19A 3JQ9C 1GQQA 1IIRA 4ITVA 4PR3A 4NJOA 2FWRA 1Z5GA 4A8JA 1GPJA 1ZU5A 3VTZA 4ZV9A 3E3LA 1ZMRA 3AV3A 3MJVA 3QE3A 2CD7A 3H75A 4Y1GA 5E8RA 4R6XA 3ZU2A 4PTZA 1Y8ZA 7ADHA 1SWVA 5BNWA 2PS9A 4FEGA 4G4GA 3R6WA 4KMSA 4OHPA 3RLIA 1U3FA 1IXSB 1K75A 4KXWA 2Z43A 3A3KA 1WZUA 4LF7B 2ZSIA 4EW2A 2VAVA 3EWNA 5CA0A 3ANTA 4RX1A 1E7QA 1XJ5A 4EUHA 4CTNA 1ISFA 1IDOA 4KE8A 2AKEA 1L5ZA 2HC9A 1P80A 2VI5A 1FSGA 2HIGA 3PDUA 4XVRA 4IV0A 5BR7A 1IHUA 3S2SA 5CCBA 2NO1A 3TX2A 3RSLA 3VJLA 3DYIA 4IDEA 4ND4A 4IQ4A 3OF3A 4YRAA 5FUQA 5KINB 2PU7A 3L92A 1JTFA 2SKEA 1P1RA 1A04A 3VMFA 4KRGA 4M7OA 4O2AA 1HSZA 2I6QA 2B4RO 1DAGA 4PSCA 1PL7A 1Y8CA 2XB8A 3BGSA 1J8YF 1EX7A 3K96A 1GKKA 4BEBA 3GT0A 3HV2A 2DB3A 3KOUA 3FHCB 4QELA 5ETJA 3QVWA 2HN9A 4C0KA 4OQ4A 1XZMA 3GUUA 4P3OA 4UAGA 4EG7A 1I32A 1Z6YA 2CLLB 2WJGA 5G1NA 1U7DA 4YMLA 1EFDN 2PJRA 2WM3A 5K20A 3ZH2A 2CUKA 3JYOA 3M6VA 1NU8A 1EVJA 5DHRA 5F9FA 5BR1A 2EW8A 1T9GS 1OY1A 2P5SA 2B35A 4DRXA 4PFKA 2WTBA 1QZ3A 3LCJA 1DOHA 2UYQA 2ZCVA 3QNWA 4P7GA 3WWOA 4XB6B 1N77A 3A1TA 1AU9A 4AY4A 4QLBA 4M9QA 3UAXA 2PT7A 5EZQA 2P35A 1W59A 2HXSA 3KZMA 3EMKA 1KMIY 5FLKA 2XQIA 5IKOA 1GQ2A 2RGDA 4X3PA 3H65A 2C7VA 4BFXA 2BTQA 5CXXA 1P18A 621PA 2CDNA 6ABPA 1AA9A 2QMYA 2VPTA 2EERA 2W7TA 1TZBA 4S1PA 2W9XA 3DDUA 3KTOA 3R3UA 4B2PA 1SXQA 1MTZA 1NKVA 3CO0S 1ZAKA 3WP1B 3H2BA 1LLDA 2HF2A 4KRXA 3TGPA 1FQWA 2DWOA 2GPAA 2QQ0A 1MG0A 1WCXA 2J3JA 3FZGA 3GCXA 1U8TA 3CLRC 2AXPA 3BSSA 4W9NC 4B09A 3QX8A 1M6WA 1DQZA 2TECE 5FFNA 5INTA 4PX3A 5JTUA 4L6IA 3QOXA 3GEGA 4X7PA 1FFBA 4Q1DA 4KR2A 4MAMA 2WIDA 4OQPA 1IQ0A 2WM9B 1L4MA 3OZBA 4PNHA 1JFRA 2NZJA 2R8OA 1XBTA 3DZBA 4O33A 5FOTA 2JS7A 4DNQA 3VJRA 2AHOA 3NB0A 2AR9A 1P2BA 1Q0QA 4FVTA 1RIFA 1GU7A 1XK7A 3GX1A 3DR3A 4LTDA 3M70A 3R3YA 1SUWA 4GRDA 3RVBA 2VF4X 4MVXA 1US8B 5JJBA 1XZNA 3A1SA 1UKBA 5E38A 4LE2A 1A5BB 1Z2AA 5EMMA 2HJSA 3PHLA 4IV8A 3IOBA 2FOIA 5CBPA 4JR0A 1CF4A 1LV7A 5ENVA 2FZ5A 1YL5A 4ERXA 4F4JA 3C3CA 4NC9A 4PCUA 4AY6A 4FYMA 4O2AF 5HCNA 2HMSA 2CV1A 4XQ0A 2ZANA 3C7TA 4F3KA 1T4CB 3VOAA 4D3SA 5K01A 2XCIA 2YV2A 1PTJA 1S3IA 1QF7A 4NP6A 5KNDH 2C3OA 3FI9A 3A9TA 4FYXA 2H8KA 3GU3A 2B34A 1EE1A 3L6BA 1MIOB 4Q3DA 4QBTA 3UJ6A 4CTJA 4YY3B 1MMFB 1ACLA 1RFLA 2OT3B 5HKKD 3FBWA 3ME5A 4OEHA 5EQFA 4IV5A 2ZG6A 1Z33A 1BXRB 2QN6A 3EFHA 2CKDA 3R0XA 4Y0VA 1C30A 1IB0A 1OA1A 2I2XB 1Q50A 2G06A 3CX7A 2OBLA 3K8QA 3VO8A 1CDDA 1LPPA 1HE2A 3BSFA 4WK6A 3TH5A 1D0VA 1U7TA 1JMKC 1NNUA 1OKKD 1R9MA 2F3PA 2Y9PB 4JL8A 4MJLA 2Y66A 2Q4DA 3IUNA 3OWOA 3B9PA 4U7WA 4BNMA 4GKJB 4NEGA 4Y2SA 1GEEA 3E8XA 3CKMA 2XKBA 1UBRS 3R3HA 1VMDA 4DN6A 1OAOC 2BY4A 2ORED 4EUNA 2L0XA 3EC2A 3Q10A 4K26A 1M7GA 1XLVA 2ZRAA 1MZVA 3A4LA 3JWJA 3JRXA 1MO6A 1DT3A 2RKWA 1CUZA 3TSWA 3O4IA 2X0NA 3M5DA 1OU4A 5DNYB 4XWOA 1RPJA 1RBZA 1E58A 4UU7A 4WOPA 2HMAA 2OCAA 1LBEA 3P26A 1CERA 4YT4A 1B8UA 3BD8A 4PCAA 4CE6A 5C5DA 3N2ZB 5H8WA 4FNGA 3LSTA 1AB5A 1PYOA 2YRWA 2B99A 5WRFA 4CKBB 4RZSA 2IYNA 3GY0A 1QCCA 1W93A 3DDCA 5BV2P 4C30A 5JZOA 2V7EA 1IRIA 4PLYA 4F1KA 4ZDIA 2BUBA 2J6CA