2BBSA

Human deltaf508 nbd1 with three solubilizing mutations
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
283
structure length
253
Chain Sequence
STTEVVMENVTAFWEEGFGELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLRPDFSSKLMSFDQFSAERRNSILTETLHRFSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and dynamics of NBD1 from CFTR characterized using crystallography and hydrogen/deuterium exchange mass spectrometry.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Cystic fibrosis transmembrane conductance regulator
total genus 87
structure length 253
sequence length 283
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bbsA00
4JLDA 2OV2A 4TL9A 5B57C 4PSVA 2GILA 1YQTA 3WNBA 1XD8A 4OQNA 4URXR 2QMOA 5M04A 4FCWA 1NVUQ 4EPRA 4YLGA 3WHLA 3OFND 3PEYA 3VNUA 2V7QA 4TSFA 1FMLA 3Q8XB 1EGAA 2IYYA 2OESA 3MWJA 1QHSA 3T61A 5GVSA 5FTMA 5JSZA 3R8FA 3R9XA 5HZKA 3E2IA 4OQLA 1UFQA 3CF2A 3AVWA 1OH7A 1R0YA 3U3KA 1Z6GA 1KI8A 3L0IB 3QXXA 4B3XA 4D2IA 4ZV4A 3ADKA 2X2EA 3IQXA 1NJFA 1AS2A 1XEWY 3EIEA 3DZDA 1NL3A 4GNKA 1FX0A 3VAAA 1CRPA 3FOZA 2FGKA 1EX7A 1KMQA 3T1VA 4IOJA 3OIVA 2A5DA 2X19A 1KTVA 5J5CA 2KJQA 4G5OA 1MR3F 1N5IA 3W9YA 1RRPA 4DC9A 4Q7JB 2IWRA 1IN5A 2O5VA 3I92A 5FBRB 5JECA 1R0ZA 1WXQA 1XMIA 3AVVA 1ZUHA 3LD9A 4IDHA 1SVLA 4LGMA 3RYTC 3DOEA 2A9KA 1JR3D 1AJEA 2JJ1D 1I2DA 1XXHE 1MV5A 3K0CC 5JWHA 1G5PA 2NIPA 4MRNA 1P6XA 3H1TA 3W3ZB 3NEYA 3SN6A 2R6DA 3LQQA 4C30A 3A8TA 4JLKA 4FMCF 2O8CA 3TKLA 2QL6A 1XEWX 4RZ2A 1EFRD 2WWHA 1NN1A 5TB5A 4JVNA 3SZRA 4Q4LA 2YVUA 4WXPA 4BFVA 3AVTA 3SR0A 2ASEA 4TMWA 3QXSA 2G83A 2C98A 1QRAA 3PUYA 1Z0AA 4KFSA 5LPNA 3TQFA 4DB2A 3K09A 1W48A 1G1MA 2PZGA 3TVDA 4AYWA 1E79A 2P6RA 1NNEA 2ZI3A 3V4FA 2ZRPA 2QT1A 4V0KA 3DM9B 1ZRHA 1XTSA 1RPZA 2VP9A 2NZJA 3VNVA 1Z29A 2QU8A 4K46A 2ZS8A 1Q57A 2PX0A 2EFCB 1IXRC 1FUUA 1Q0UA 5H8WA 4HEJA 5KSZA 3T15A 5KNBA 3CKLA 2GXQA 1EWQA 1KZ7B 2GCPA 2JASA 2JGNA 2UZIR 3VR2A 3S1AB 3F3YA 3ADBA 3QKSA 3BERA 1D8TA 2JEOA 2ZS7A 1G7SA 2QN6A 2RHDA 2ZI7A 4CEIA 2ZRMA 3C4JA 4ACBA 1W5TA 3OAAA 2QMEA 2KBEA 3CB4A 1W0JA 1OLOA 1UKZA 2ECKA 1KZGB 1P2SA 5JWOA 3I62A 2IUTA 4JZKA 1ZJ6A 3B82A 3QBTA 4BLSA 5AJZA 1WDTA 5CIWA 4TYPA 3R7WB 1E2IA 1X3SA 1DOAA 4XJXA 1KAGA 4HB4A 4PPQA 4TYNA 2IC5A 3QNUA 4PFSA 1OIXA 5FOXA 4URVR 1TEVA 5KNDA 2ZVPX 2Z0MA 5BW8A 3KQLA 1Q44A 1XEFA 1QHIA 2E1RA 2JA1A 2OO7A 2D2EA 5CYOA 5DH9A 3W8RA 4BLOA 3HJNA 3QOFA 2CCKA 3LAWA 3W5IA 1M8PA 1OFUX 4RKFA 3RS0A 1WE2A 3MLEA 4CGZA 1ODFA 2J1LA 3ZD6A 1GL9B 1A82A 2IEYA 5ANRB 1NN3A 2BM1A 2F1HA 3PV0A 2O8FB 3IBYA 3LVQE 1UEJA 1OJLA 4PQRA 1R5OA 5LD2B 3WP1B 2CE7A 1IN6A 4BLRA 4D0LB 2HXYA 5LB2A 5FOSA 1YE8A 2H92A 2CVHA 3PENA 1R10A 4LZZA 5DYGA 4A1FA 5IRCD 2IYSA 1ZCBA 1RIFA 1Z8FA 3LDAA 3KUCA 4D80A 5DN6A 2WSSD 1EX6A 4IXNA 1KI9A 2CDNA 2EW1A 1OH6A 1W2HA 1GITA 1NIPA 1DS6A 1OW3B 2YC4C 1L8QA 4YXWD 1QHXA 4DDUA 3CPEA 2YINC 3OIUA 5CJPA 5DGXA 2C03A 1RJ9A 4HDQB 3WRXC 4OI1A 3RDPA 3AQ4A 4M1OA 3VR6A 3CZPA 1HE1C 5CB6A 4JSYA 1GSIA 1JXMA 2EFHB 2GK7A 4A2PA 4B3CA 3KQHA 1OH5A 1YVDA 4QM6A 1KK3A 2FH5B 2LKDA 5J4YA 1G21E 4F7WA 2YZ2A 4DLSA 1D5CA 2ERYA 3AF1A 2IS1A 1ZM9A 3HP1A 4MKFA 1DBSA 5FTLA 4UJ3A 4Z54A 4Q1CA 2QI9C 4OK3A 2ZAOA 3K70C 4BASA 2JIZA 4H9GA 4QJ3A 2ZRLA 4HZIA 5EXSA 2AK3A 3LWNA 4GT1A 1S0UA 2A5JA 4DSOA 5AUOB 3BRWD 2H16A 2CNWD 1KAOA 4TMKA 1G8GA 4R98A 3ZZTA 3BWDD 2A78A 1TF7A 2FDCA 2VP2A 4OYHA 2ZJZA 4HATA 3FMFA 3EX7C 4LPKA 4HAVA 4J0QA 4I99A 1AS0A 4WOPA 3IPXA 3MMPA 3BFXA 3V9PA 4A15A 4MRRA 4TTPA 1G19A 2ZRKA 2O8CB 2AFHE 3UPUA 5EE1A 3CW2A 2UVQA 1CR1A 4LHVA 5DI3A 5EZ5A 4EQ6A 3Q9LA 3DEFA 3RABA 4Q9KA 1PLKA 4PC6A 2REBA 3GPLA 5L8VA 3GD7A 1OXXK 4TMTA 4ZIRA 1L4UA 3UXMA 1FP7A 4CF7A 3RRNA 2ZRBA 1ESNA 1MO5A 3TLXA 4MYUA 2ZQ5A 1NN0A 1Q1ZA 4LYFA 1N6NA 1JB1A 4L16A 4GPTA 4RFSB 4E22A 1NG9A 3ZVRA 1XPRA 4ZIRB 2B7CA 4XOIA 4DT1A 4JJZA 2ZM5A 4R2IA 2DY1A 2C78A 3ZYCA 1Q3HA 2QMUA 2D3WA 2IS6A 4B73A 3RWMB 1RRFA 1YR6A 3SI7A 3H86A 3QJYA 4Q48A 1WBBA 2VP0A 1KSGA 3MWKA 4U00A 3QVUA 2OCYC 4PAMA 1VCIA 1GNRA 3B1WA 2JDIA 5K8LA 3SDZA 4X8OA 1UBCA 1GM5A 1QF9A 2BIFA 4I1VA 3LA6A 3K0CA 5JFGA 2ATXA 4WZ6A 1V5WA 2Q9BA 4B2LA 5DNYB 5DHFA 1ZCAA 5D3QA 3U4QA 4UKDA 2OCBA 1ZMXA 3WYFA 2C04A 3UG6A 2ZRNA 2DFNA 4CT5A 4G3XA 4LJ7A 3N2EA 2KI5A 4DIEA 4B71A 1W36D 3K70B 521PA 1W1WA 1QVAA 4ZDJA 2V54A 3THWA 3WNDA 1MH1A 1QHHB 2YWEA 1KK1A 1D6JA 3R9IA 4ZDWA 2WKPA 4CVNA 3SQWA 1YZNA 1VG1A 1XNJA 1KNXA 2FSGA 4PAOA 2LWIA 4IDPA 4NCKA 3UANA 2DPXA 3GEHA 421PA 2QNRA 3RS7A 3EIQA 4B2IA 2ONKA 2J0QA 1HE8B 1ZUIA 3BJIC 4DJTA 3AKDA 1Y3AA 3GJXC 4IJMA 2GXUA 1GRQA 1ZYUA 1U9IA 5KO2A 4M1WA 4C7OA 1A7JA 1A2BA 1X8KA 4BWYA 5FPTA 5FOVA 4CDGA 4Y0VA 2WJIA 3DPUA 1U8ZA 2OILA 2OLJA 4ESVA 1DAHA 2GJKA 5BQ5A 1L2TA 4MGKR 4AD8A 2OBMA 1ZINA 2HXSA 3B60A 5B30A 1BMFD 2O0KA 2R62A 2QGNA 2ODEA 3GLHE 1Y63A 3BBPA 2REOA 3AF3A 4ZCMA 4DHEA 4JYBA 1G8FA 4HLDA 1XB2A 4MGYR 4MUBA 4RFSA 4RCZA 4BFUA 3FKQA 2HV8A 1P4SA 3VQTA 4QXAA 1KI3A 1KSHA 2G9NA 1G7TA 3T5GA 1LY1A 5E3HA 4EIWA 4Z8YA 3DVLA 1EFHA 3CR8A 1W46A 3H4MA 4TLBA 4XSHA 1PLJA 4C0JA 5K8IA 2YKGA 2W00A 4EKDA 1D2NA 1N0VC 3TRFA 2KWIA 1IM2A 2ODNA 4RY2A 1LTQA 3HWSA 3W90A 2WWXA 1M2OB 4NCIA 4BFYA 4EJSA 3NBZC 4LHXA 1DARA 3UKDA 1SVSA 4POAA 1E2JA 4L5BA 3OEED 3DKPA 2ERXA 2F1IA 3TMKA 3IUYA 2X2FA 2JIZD 3EC1A 5DI9A 3W8NA 1NKTA 3RVBA 2J7PD 5EE0A 1AZSC 3AUYA 1NI3A 1J8MF 1U8AA 2WWGA 2DBYA 3BGWA 4K8OA 5A0FA 3Q85A 4YMTA 3BC1A 1CKEA 1XRJA 1KKMA 3KKNA 5D3MA 3IIKA 1OH8A 4AWXA 3IDQA 3V4RA 3LLUA 2XX3A 3GLIB 4UJ5A 1OFHA 4E09A 4TYQA 1N5JA 1E3MA 1N6RA 3KTAA 2ATVA 2ZE8A 4OHWA 3K53A 4TLCA 3K0FB 1XPUA 3HU1A 4IDNA 5HTKA 3TVTA 2WJHA 3SHWA 1U2RA 3S1AA 5FL7D 2IYZA 1HEIA 4A36A 3F8TA 3CF0A 4RD4A 4YMUA 3ZVLA 1OKKD 2J3EA 3P20A 1WMSA 2FSFA 4GOJA 4DRZA 5KUTA 4JIMA 3VU9A 2XJ4A 2H18A 1DO2A 3W5JA 3IILA 4UXIA 1Q1EA 3SU8A 4GZLA 1GRRA 1CTQA 1RE0A 2RGGA 1S4QA 2QUZA 3K9HA 1EXMA 1T91A 4BRWA 5FTKA 4K81B 4B6FA 2JLZA 4AY2A 1X1RA 3TQCA 3CPJB 2H17A 3OFNA 1SVWA 2V55B 2YHSA 5SZHB 2F1RA 2RMKA 2CCJA 4EAQA 1Z47A 2G6BA 1AK2A 4TMVA 4ILEA 4D0GA 1T9HA 2QG6A 2R44A 1S1MA 3QBVA 5FPYA 5KYKA 5J47A 1TQ4A 3RC8A 1FTSA 1E2LA 3GJ0A 4HLUC 3LO5A 2AR7A 4BFZA 4YQFA 3AKCA 4OKSA 2O8FA 2A7QA 2OAQ1 1XJQA 2I4IA 4ZCIA 4CEHB 4JBYA 2CL0X 4JLBA 5BN3A 5C2JB 1PUJA 1W4BA 2W0SA 2ZAMA 3B1YA 5EXTA 4CIDA 2IYTA 2ODWA 5EP2A 4RZ3A 5J4LA 4NU0A 4DCTA 2D74A 2GEUA 3MAAC 4KXFB 5DSZA 3ICEA 1HA3A 3THXA 4CRWB 4S35A 3I61A 3QPVA 1OYWA 1E2DA 2IT1A 4LRWA 3RNLA 1CJKC 2KSQA 4C3ZA 1DADA 3D6TB 1T3HA 2RGBA 3U3OA 5KOYA 1A2KC 3HR7A 3Q72A 3QXJA 4V0OA 4PPGA 2VEDA 1W2GA 5EE9A 3DDCA 1HQCA 2AXPA 2ZPTX 4XTCS 1VG8A 5JEEA 2DR3A 2JLUA 5KSYA 4BEBA 3SJBA 2CLSA 4Q47A 5A5GA 2QE7D 1W4CA 4PSKA 4Q1BA 4C2UA 2QPAA 3KXKA 3MWLA 3FMPB 2ZVQX 2W2XA 4HUQA 4X8LA 5JI2E 4ZI2A 3GLFB 3EAQA 1NSFA 3K0AB 4A6PA 5DIFA 2QP3A 4JSTA 4HZUB 4V0NA 4D81A 1Z06A 4KCGA 4Q00A 4DLWA 2BVNA 3C8UA 2ZUBA 4RD6A 3DL0A 5H70A 4OBEA 1E96A 4BQSA 4BZQA 4P31A 1N6IA 1SKYB 3NHAA 2VP6A 2WZQA 3MUFA 3B78A 5IF9A 2CL7X 2XEXA 3A37A 2XTZA 4FMDF 2A5YB 2EVWX 2ZRIA 4RD1A 4A8JA 3U3MA 2PH1A 4F38A 5F2EA 2FX3A 2GESA 5CK4A 3A1VA 3NH9A 4A4DA 5FPHA 3ETLA 3UWOA 2EFEB 4NCHA 2ZSBA 1N6HA 2FZ4A 1E2FA 2RGXA 4TTQA 2GF9A 3UK6A 3LQRA 1U8YA 3KJIA 3QQ5A 5FUYA 1KMHA 4KYIB 5DLQC 1N2CE 4QNMA 3WMGA 2W6ID 1TL7C 5KTYA 5CK5A 4Q4HA 2ODBA 4PXAA 2BBSA 1KO7A 3A1WA 4RKEA 2A30A 3W6PA 1TTTA 2EWVA 3QF4B 1G291 2WVJA 2GA8A 1XD2B 1F2UB 1T3SA 4B48A 4HB0A 1T8UA 3FHOA 1S9HA 2PEZA 2ZU0C 4OJQA 2RGAA 1Z63A 3I73A 1CU1A 3TR5A 3HR8A 4FINA 2VLIA 2CVFA 2ZIAA 1LVGA 1ZD8A 2ZRDA 2H1LA 5IHPA 4Q5IA 1XDBA 2IA5A 4PHTA 3CZQA 3TUJC 1VCOA 4DBLC 1N0WA 4IOLA 1U98A 4TL8A 5FR1A 2YOGA 4IW3B 4OQXA 2GJ9A 1XBTA 1II8B 1NSTA 1AQYA 1S96A 2WWIA 2QSZA 3TW8B 1CR0A 1IBRA 2ZJ2A 3AF2A 2UKDA 4UNQA 4CW7A 1XZPA 1N6LA 1QHGA 1F48A 5J4HA 5BYJA 2PEYA 3TBKA 3LVRE 221PA 3KZ1E 4Q4AB 1KK0A 4PZZA 3KQNA 5L3SB 2NO6A 3ZZUA 5GJBA 5SZIA 2ZTSA 3CM0A 3ADDA 3NC1C 3A1UA 5AUNB 3LBHA 1G3QA 3E70C 1QHHA 5FPSA 1VDZA 4TT3A 4EUNA 5GADl 2QTHA 5G53C 4TLAA 4HB2A 4M1SA 1JBKA 1Z2CA 2B6HA 4KSCA 2P6UA 5BN5A 4DLUA 2GXSA 2XNDA 1CEEA 4JVMA 4MUAA 4MA4A 1YJ5A 5FUVA 3VMFA 1ANKA 1P9WA 2QBYA 1FNMA 4Q4JB 5CM9C 3K0SA 2H57A 3EARA 1TQDA 2REXB 3IHLA 2A5FA 3CRVA 3OF5A 4JT4A 4V02A 5KPJA 3QE0A 1ZC3A 1R6BX 1YR9A 3CWZA 2W6IA 3UATA 4FWTA 4DXAA 5HPYB 2EU8A 3CNNA 1G7RA 3B2EA 2O0JA 3OESA 4BZXA 2XB4A 2VHJA 2EFDB 4IEIA 4D0NA 1XD9A 2WMOB 4QFMA 2VF8A 4Q01A 1NN5A 5G41A 4NYIQ 1AA9A 3CBQA 4E03A 1FTNA 2RGNC 1M7HA 5L3RA 3FTQA 5JHGB 4XD7D 2XAUA 1IJEA 5KNCA 3TSOA 3U6BA 2P3SA 1CJMA 2YNMA 4DLZA 1G5RA 1KNQA 4OL0A 5EXPA 4HSEA 3CX8A 1KI4A 1Q20A 2WOOA 4KLZA 1NLFA 2XJ9A 4FI3C 3BFKA 821PA 1XP8A 1DEKA 2OG2A 3NHBA 3VX3A 1KJYA 2YC2C 4OK6A 4UQOA 4XVUA 3FB4A 1G8YA 4HDOB 1KO1A 3IQWA 1II8A 1VG9B 3P1JA 1PZNA 2D2FA 1VHTA 3AKYA 1KYIA 4LC1A 1G6HA 1ONBA 3FWYA 4WVFA 3TE6A 1M7BA 2ZSDA 2UZ3A 1ETUA 3N5CA 1FQJA 4AI6A 4Z51A 4MRPA 1OPXA 2OM2A 1P62B 4HLUA 1XCMA 3JVVA 3RRZA 4H1UA 3O8CA 3TJZA 4A0GA 3AB3A 1FMJA 1DAEA 2O0HA 4KHZA 3UG7A 3LH5A 1JR6A 1P75A 4LV5B 2WICA 4Q4HB 3GEIA 3UMFA 1T3LA 3TR0A 1RVDA 4AKIA 3SEAA 3AGPA 3K70D 1XTJA 1Q12A 3QF4A 4WAUA 4LY6A 4C4PA 2JATA 3MJHA 1NBMA 5ELXA 4B34A 2OSBA 2IUSA 1RZ3A 1E9SA 2J0UB 3PQCA 2GHIA 2FN4A 4IOMA 1GKUB 1SXJA 4LJ9A 4QC2A 3ZDQA 5FH9A 1AKEA 1S2MA 2IBMA 3EZ6A 4HAXA 3WRYC 2OHFA 1E2KA 1DELA 1HT1E 2A3RA 1O87A 2PLFA 1OXSC 3K0FA 4TTRA 4FXPA 1YZQA 1II0A 4Q9LA 2IK8A 4TSFD 2WJJA 1BOFA 2MSEB 3CWQA 2HJVA 5EP3A 3U4QB 3CH5A 1UKEA 4TWZA 1OV4A 3A36A 4B3DA 1X1SA 5FUXA 1KI2A 1KO5A 2WM9B 4QGFA 3KDSE 1JECA 1NLZA 5AWFC 5TXGA 3AVPA 3U7GA 1OKKA 2ZJAA 2PZFA 5GVRA 3BB3A 2J0UA 3WNCA 5JHHB 4TYWA 2NO1A 1ZM3A 4RD2A 3THXB 4QBGB 5E7MA 3RHFA 4Q02A 3A1SA 2GEVA 2PBRA 2VBCA 1TEXA 3OIWA 2VP5A 4DZZA 1JNYA 1GZSA 4BFSA 2C77A 3GLIA 2FMXA 2OXCA 3QXCA 2C5LA 3CONA 2VYFA 1YZUA 4QNRA 4LDJA 1SXJD 1KIMA 2WHXA 2Z43A 4NYIR 1YHNA 1Z83A 2J46A 3EZFA 5E7IA 2VF7A 3UMRA 1YU9A 4YDHB 2WTUA 4QG7A 1TU3A 2DWPA 4HLQB 1XMVA 3KJGA 4JL6A 1TAGA 5DE3A 1YKSA 2GBLA 1PVOA 1IXSB 4M9SA 4EJSB 3CX6A 4R9UC 1Z0IA 121PA 4JKYA 3PEWA 4DT1B 1ZW6A 1NY6A 1NMXA 3QEOA 2VHUA 3T1QA 3P4XA 3H0KA 2NG1A 4XWAA 3R20A 621PA 2QY9A 1R5BA 3EPJA 1G4UR 2OFWA 1G16A 5SZJA 4LHWA 1G8HA 4JYCA 2PMDA 3TSWA 4O3MA 1EFTA 4LYHA 2N46A 2NQ2C 4ACAA 1JAHA 4Z1MA 2JAQA 1PJRA 3P26A 3UIEA 1SHKA 2XXAA 2OAP1 5G3ZA 3TSZA 4MKGA 1N5KA 3EIHA 3LRPA 2ZYTX 2BM0A 4B43A 3SFZA 1JAIA 4QGAA 1U94A 5DI3B 4X8HA 3GQBA 4W5HA 3DMNA 2DYKA 3FVQA 2FSHA 1XEXB 4NH0A 5KDDA 2YWGA 2CMKA 4HB3A 1KMHB 3QKRB 4RCYA 4DLVA 5JCPA 1SULA 2F43B 4TYYA 2BMDA 4DDVA 4GZMA 3IKJA 3QPWA 3TK1A 3CF6R 4JMPA 5AJWA 1G3RA 3PUVA 3VKWA 4AG5A 2QAGB 1W0KD 1E1RD 3B85A 1X8LA 1US8A 2RH5A 2WJGA 4P4SB 4B35A 5JJLA 1CR4A 1S9DA 3U7EB 3I4LA 3RS3A 1U81A 3FMOB 4ARZA 1LFDB 2AK2A 1SKYE 2WPDD 4QBHA 2O8BA 1Q1QA 3VKGA 4GMXA 4BPBA 3DHWC 3I8SA 4FWIB 1KI6B 3L0OA 1J70A 1XZQA 3LBIA 1RFLA 2IYXA 4LJ6A 5C18A 3GLIE 2FWRA 2ZROA 4C0HA 3QF7A 4JBXA 4FMDB 2O8BB 1OFTA 3K9LA 2IXFA 4FN5A 2DFTA 3A4LA 4DIDA 2Q9AA 2PLRA 1Z5ZA 3EG5A 4PHGA 2Z4RA 3Q5EA 3ADCA 2XGJA 1JQLB 2FOLA 2Q3FA 2NO0A 2QAGA 3CH4B 2BCGY 4LPSA 2QAJA 1VIYA 4AYXA 5JRJA 1KKLA 1PUIA 3LXRA 3NBFA 4Q4AA 3KKPA 4EFLA 5CITA 4N3NA 3X1ZA 1AN0A 2ZS9A 4BEJA 2PT7A 1K6MA 4W7SA 2C96A 2IUUA 3L82B 3X1YA 2R2AA 2CJWB 2JJ2D 1N6KA 3AVOA 4PSAA 5IK2D 4B3BA 2VTKA 3ZH9B 2QPTA 4EFMA 3T5DA 1YZLA 1BYIA 2DFLA 1H8HA 2B7BA 4EPXA 2OZEA 4B76A 1F5NA 1KY2A 4IFEA 3BE4A 1NRJB 3M0EA 4DEYA 3KFVA 4LBVA 4GI7A 3W34A 4NMMA 1ZM2A 2BCJQ 2J5XA 3NVAA 2QT0A 2ZJ5A 1QHNA 3MWYW 4EPWA 2A2ZA 1GVNB 2MSCB 4EPTA 4NYJR 4JT2A 4M1YA 2ZRCA 1AS3A 3GLHB 5LBIA 4DLTA 4P3YA 4Q03A 1E1RA 2VL7A 1C1YA 4D4KA 1FNNA 5FR2A 2JLVA 2W2VA 3QUSA 3EA0A 1NY5A 4MQBA 2FU5C 1AQUA 1VKJA 3U7FB 1TF2A 5FUWA 2B8TA 2RCNA 2J7KA 4FCTA 1GL6A 2ZR7A 1E2QA 5E7JA 5L3QB 1KDOA 1Z0JA 3RAPR 3U3RA 4A8JC 3EPKA 2FE4A 1D9ZA 3TUIC 2XSZA 4FMBB 1G3IA 3OE7A 1HQYE 3O8BA 1VCNA 3GLGE 2FPLA 1VECA 2GTPA 2NZ8A 2QENA 4JLJA 3Q7QA 2Q6TA 2WBLC 3EC2A 3GFOA 1Z0DA 4DCNA 2HUPA 2OBNA 1UAAA 3SNHA 2QP4A 1S3GA 2BKEA 2PX3A 3A4NA 4DLRA 3SJCA 3TUZC 1P72A 1GTVA 1NVVQ 2IXEA 2MMCA 2F9MA 4KJZA 3OEHD 5IDVA 1P61B 2F55A 4XWOA 1ZAKA 3QIAA 4OQMA 4JLOA 1WP9A 2AD5A 2PMKA 2F43A 1MABA 1VTKA 3THWB 2FJUA 1W47A 5L3SA 4IVPA 3QG1A 4B3FX 2J41A 3GFTA 1W5SA 4TZ6A 1BH2A 2QTFA 2ORVA 5KDOA 2NTYC 2G3YA 1Z2AA 3PG5A 3RWOA 5KHOC 3FHTA 3OE7D 4LUCA 4WIAA 2I1QA 3MFYA 3CIOA 2F3TA 4KU4A 4LYJA 4M53A 2R6CA 2D62A 4NTZA 2GZHA 3ZQ6A 1VIAA 2ZREA 1F3OA 2CLCX 3I8XA 4IVQA 4TQUS 3X1XA 5FOWA 1NMYA 3ZS9A 1BMFA 3QXHA 4XWKA 4OHYA 5KDLA 2IEZA 4C9BA 4GMDA 1HTWA 4IDOA 3BOSA 2F9LA 2OFOA 1JR3E 1E2HA 1NIJA 4HYYA 2XB2A 3EWSA 3QKUA 5EZ6B 4BLTA 3FHCB 2ZE6A 1CULC 4CZ2A 5DN6D 2OBLA 2Z6VA 1CJTC 3GMTA 4LHYA 2Q0HA 1OIWA 1R8QA 4PTLA 2PL3A 3GJ6A 4PC3A 4RSGA 5A4JA 3ZD7A 4NE2A 2GF0A 2GEDA 4CEHA 4UXHA 3BB1A 3BXZA 3PUZA 4E07A 1Z07A 1KHTA 4B33A 3C14C 4XVQA 4IXMA 2P2LA 4UNSA 1ZNWA 1DAKA 4PZLA 5FI0B 2C99A 1SGWA 1F2TB 1OT3A 2ZE7A 4OI0A 2FFAA 1P9NA 3IGFA 1W36B 4N0EA 3T12A 2V6JA 4LYAA 3BIFA 1G17A 1ZU5A 2C2HA 4GOXA 3QSYA 3HYTA 2B92A 1KI6A 4US2R 4KITB 3AM1A 2FFBA 3L43A 4B75A 4HUTA 3VU9B 3GEEA 3EXAA 4C2TA 1ZU4A 1R5NA 2JLRA 1ZM4A 4G5GA 5DHAA 1Z22A 2QM8A 1U90A 2ZR0A 4Q9IA 1EK0A 3I5YA 2OLKA 2ZI6A 2OCAA 1FFHA 2VHTA 4G0NA 4GBMA 4Q66C 3AF0A 5TY0A 4C0SA 4AIIA 2ZRHA 1IN8A 4OJKA 1UBFA 1ZBDA 2A5GA 5BYKA 2BBWA 2E9SA 4JKIA 3WBKA 3CRW1 2ZRJA 3I5XA 4PHHA 3CR7A 3CRQA 3LXXA 3U60B 2ONJA 2WMNB 4LC0A 5SZKB 1GDDA 2HCBA 3PJRA 3MJRA 4U7DA 5HKKD 5CIQA 2Q9CA 4JLMA 5HCIA 1DAIA 1XXHA 1WBDA 1KI1A 1VG0B 4KFTA 1I2MA 2EYUA 2QSYA 3I32A 1M74A 3MG9A 4RFVA 1Z6YA 1V43A 1ZIPA 2QTVB 4XD7A 3SBEA 1E79D 1XCPA 5EQTA 3FMIA 2ZSEA 5HE9A 1DAMA 3PIRA 2H7VA 2HLDD 3GP8A 1KJZA 4M22A 1JEEA 3R7WA 3T1OA 4UXJA 1JR3A 4PC7A 4WZAE 2X1VA 2GWHA 1SVMA 5G40A 2BDTA 2VHCA 3NC0C 2D7DA 2OCPA 2GKSA 2XOKD 4LJAA 3IEVA 4ESHA 4QOSA 5JS8A 1AGPA 4A6XA 4BRUA 1XTQA 2Q3MA 5B58C 1P60A 3FFBA 2V8OA 2ZSAA 1XMSA 3AF4A 3KKQA 1IN4A 3REFA 4ZDKA 1UM8A 1Z0FA 2JCSA 4DLXA 4PPFA 1OB5A 5C1BA 3I1FA 4GSYA 4M8NE 1E9AA 1BKDR 3AVQA 4B47A 3WYAA 5C4GB 2C9OA 4MKIA 2YWHA 3IO3A 3PUWA 2FEMA 3K9NA 4B3GA 3ZZ0A 1JPNA 1E98A 1P2UA 2ZUCA 3U7HB 1UADA 1GKIA 5CYPA 4HAYA 4V0MA 4EPYA 3KKMA 1I4TD 4M2LA 3TW4A 1DTSA 1E2GA 5FOUA 3WP0A 4LHZA 2FF7A 3G0HA 2ZE5A 3NXSA 1MKYA 2N42A 1WF3A 2ZRFA 5L3QA 2PCLA 5F3WB 2FSIA 3CPHA 3Q3JB 2RHMA 3AVXA 1ESMA 1NG1A 2V7QD 3LNCA 1SZPA 4WBSA 5FBQB 1VHLA 5FL3A 4DWJA 1A1VA 4C0KA 2QQEA 5JJIA 4PO9A 1S8FA 1CLUA 1FOEB 5J40A 3U3JA 3OZXA 4LK2A 4L4UA 5IK2A 3PEUA 3VR5A 4HAUA 3GJ5A 2AKAB 2ORWA 4P33A 1F2TA 1TX4B 4WZBE 4CYMA 3U5ZB 2V1UA 1E9EA 2HF9A 4L9SA 2IW3A 4GP6A 4G5QA 4DKXA 3T06B 4TL7A 1NP6A 3PUXA 1T5IA 3RRYA 2P5SA 1D2MA 5H1YA 1LW7A 1Z3IX 4M9XA 2GRJA 4ZCLA 2HT6A 3B9PA 3IHWA 4JL5A 2AHOA 3R8CA 4MITA 4QGHA 2E87A 1M1YE 3CNOA 3IBGA 4ZPXA 3M1IA 4YDSA 4KO8A 1VYTA 4P32A 2D06A 2ZJYA 5AUQA 5JRZA 1WB9A 1OB2A 1W0JD 4BUJA 1K8RA 1XX6A 1OXTA 5CLQA 4OHZA 1OHHA 4O25A 3SFVA 4DCVA 2BC9A 4G5RA 1Z08A 1BO6A 3HYRA 4IKEA 5EE5B 4NCJA 4F92B 4NP6A 4WW0A 3U61B 1G3MA 4JLVA 1AZTA 2BBOA 1UBGA 1KY3A 4URYR 1SXJE 3A58B 4NYMQ 1LS1A 3NTUA 3Q5DA 1NVXQ 4RZUA 4US0R 1L7VC 2R8RA 4AKEA 1W7AA 3OAAD 3BH6A 1NVWQ 3LBNA 3WMFA 4HLCA 2F3RA 1F60A 3NG1A 4NKRA 3GLHA 1MABB 2BJWA 1IY2A 2BBTA 3PXGA 1FX0B 1VYVA 3A6PC 4HAWA 1KSFX 1J7KA 5BN4A 3J81k 1X8JA 4C7OB 1EWRA 5AJXA 3NKVA 1DE0A 1N0UA 2XZPA 4NL4H 1RYFA 4EDHA 4IDQA 4DCSA 2VSFA 2GCNA 4KBGA 1B23P 4PC1A 3I3SR 3SYLA 4KFRA 4KV9A 2N1BA 1GWNA 3KB1A 2VP4A 4PPNA 5JSZB 4DDWA 1D2EA 3U6KA 3VHXA 5UKDA 4LBYA 2WJYA 4QHSA 1OF1A 2GAAA 4PR0A 5CDFA 2Z83A 3BK7A 2X8AA 1OFIA 4MRVA 4ITRC 3H84A 3TH5A 4D26A 1ELOA 2JJ8A 5FPKA 1T8TA 1DO0A 3B9QA 4QRHA 4US1R 8OHMA 4JS0A 1GOTA 4BECA 4F91B 5JZVA 1C4OA 3K0EA 1FL9A 4TLEA 1E0KA 4AURA 4BLPA 1E2NA 1KOFA 3KB2A 4TQ9A 1CRQA 4M9QA 4QKQA 4JVSB 4CEJB 2FV8A 2DB3A 3X1WA 3THYB 3SS8A 1KDRA 2LKCA 5LB4A 1MRNA 2BJVA 1OXVA 4DSUA 4M4SA 1RRGA 5L3VA 2GK6A 5TDHA 4D6PA 2GETA 3AV0B 1E69A 4IOKA 2GXAA 3WY9A 2BMFA 2ZJOA 1E0AA 1E2EA 4I1SA 4A0HA 3GJ4A 4LI0A 5E95A 4A2WA 5TMPA 3HPQA 2WAXA 1Z6AA 3MSXA 2WV9A 1JQJC 1QZXA 1Q1BA 1U0HC 1J8YF 3ZIAD 1E0SA 3W6OA 4JLNA 1P2TA 1UDWA 3F0TA 4MGIR 4NCNA 4KBFA 5B64A 5IT5A 1DG1G 1AIPA 2WIAA 1TPZA 2QZ4A 1SVIA 3FPAA 2GBLC 2Y8EA 4L15A 4Q7MB 4F4JA 2PJZA 2JLSA 4PQFA 3L0SA 1TF5A 1ZD9A 4TLDA 4ASUD 4XVRA 3TAHA 1NMZA 3G82C 3GLGA 5FBWB 4W5WA 1G41A 3KJEA 3P4YA 3ZIAA 1GP2A 4JJKA 4KI0A 4V03A 3BORA 3PFIA 3QPUA 2WWYA 3DO6A 3IIJA 2ZYUX 2GJSA 2YOFA 1RW4A 1E94E 1AKYA 4Q7KA 2CK3A 3NDBB 1F6BA 2GVDC 4B32A 4W9MC 2IYUA 4TL6A 1SVKA 4M1KA 4FMCB 4ZKEA 4D4JA 3QVVA 3OHMA 4ZDIA 1ZNXA 2CHGA 4PAQA 3C41J 1G3UA 2W6JD 1VPLA 2CLDX 2IYLD 2OXRA 3DKVA 3RSOA 4ZI3A 3C15C 3BH7A 4D82A 1F2UA 1COWA 1FPMA 3O8RA 3UWKA 1XCGB 2Q3HA 1KK2A 1Z6XA 2IHYA 2O8DA 2C9YA 4HDCA 3QG5A 1MO4A 2IF2A 4GRAA 4I1OA 2FA9A 2PT5A 1KDTA 5JS7A 3IEUA 1MRSA 1IHUA 2GCOA 2VH5R 1DVRA 1CS4C 4Q21A 4O2LA 1U0JA 3VR1A 2IHBA 1JI0A 3QKTA 3EZ9A 3SQXA 2XXAB 4CT4B 5C4MA 1C9KA 4A92A 1G6OA 2RAPA 5EP1A 1EESA 2G1JA 1HH4A 4Q7LA 1W36C 3EPHA 1QVRA 3ZQJA 2WWWA 4C0AC 1GIAA 5TARA 3B7GA 2FNAA 1G5TA 4UNPA 1NLYA 1UEIA 1BYUA 3KXIA 2BWJA 1LB1B 1RJ9B 2F6RA 3B13B 4FW9A 1DPFA 1SHZA 1E2PA 2QA5A 4Q1EA 4NYMR 3RC3A 4MDFA 3KXLA 3NDPA 1JPJA 3PR1A 4YMWA 2BMJA 2WAYA 4KYUA 2XNSA 1Q22A 1T4GA 4L8GA 3L8ZA 1AM4D 1VCMA 4NONA 3WMEA 2JJ1A 1CXZA 4BFWA 1Z0KA 4GDFA 1GNQA 4JBWA 4QGGA 1X86B 2VHQA 6Q21A 4Q19A 3BFVA 1AGRA 4EPVA 3LX8A 2CJWA 4URUR 1QBKC 5EE3A 1TNDA 3SJAA 1IAQA 3AP3A 3QY0A 4V0LA 4MRSA 1T6NA 4UNNA 2VQSA 3K8YA 3U2QA 2W83A 4EQ6B 2GJAA 1WQ1R 1FW6A 3ASZA 2IWHA 3P27A 1E9CA 3ASYA 3BAFA 3W6NA 2LCFA 3KL4A 3E5HA 1LF0A 1G8PA 4KAXA 1T0HB 2I1VB 2DWQA 1S3SA 4B6EA 1XU4A 2QMHA 3NEJA 1NJGA 2ZI9A 3FDIA 3SYNA 1K5GA 4AKHA 3IO5A 3MD0A 2FFQA 4LOAA 1H8EA 2YOHA 5LDDC 2BHRA 2CHQA 1SVOA 4LX0A 2GDJA 4ABYA 1T0JB 4KFUA 4YMVA 1XMJA 1CBUA 2ZI4A 4NYJQ 3AKEA 3A4MA 3TGPA 1R7RA 2NMVA 4ERNA 2NPFA 5B2ZA 4B2PA 4LV6A 4RD0A 3AVYA 2CL6X 1I4DD 2ZITA 4JLAA 3RRMA 1Q21A 1I4LD 3NH6A 2TMKA 2NPIA 1VYUA 2KBFA 2DFKB 3NBXX 2FGJA 1R2QA 4QJ5A 3LLMA 1TUIA 2XITA 3FKSD 4PC2A 4V0ME 2IYWA 2WKQA 4M1MA 4B74A 5FTJA 5AUPB 4QM7A 2JDID 3KKOA 1JEDA 4CEIB 3C5HA 4TMZA 2NOAA 4NZYA 2WJVA 3RS5A 3HPRA 1CP2A 1HT2E 3TIFA 2RGCA 4EFNA 2H8KA 3ZVNA 4HUQB 1G18A 1R4AA 3REGA 1JALA 1BS1A 2IF0A 4N0DA 5JWRA 3RS2A 5CB8A 1G7CA 2ZXUA 4NBSA 1NVVR 2OFXA 2ZJBA 4I1UA 2P6NA 4P0TA 3LW7A 1Z6TA 5HE8A 3FYHA 4URZR 5K8TA 1LS6A 3OIYA 1OSNA 4KODA 1HUQA 1H8ED 2W58A 5JEDA 4MDEA 3KQKA 1LF5A 4XIGS 1IJFA 2BOVA 1CIPA 4PX9A 1RC8A 2P5TB 3D7MA 5FL7A 5HR5A 4R71A 1ZNYA 2G0NA 4Q4JA 1TQ6A 3QI2A 3W3AA 2ANBA 2RGNA 4Q1FA 1K5DA 1HYQA 2QEQA 4OHVA 1YZGA 3AH8A 1IONA 1GL7A 1JJVA 3F5FA 4MYCA 4IRUB 1TU4A 1J2JA 4HAZA 3SHFA 1NKSA 1RRCA 1P3JA 4BZPA 1OIVA 3VTKA 4M21A 3OEHA 1XTRA 1EG7A 2R6GA 5AK0A 3DZ8A 2VSOA 2XOKA 1KO4A 1XFAA 2DWOA 2L0XA 3FFAA 3BB4A 1LV7A 2FPMA 2J7PA 4I81A 4DDTA 1N25A 4JLPA 2AX4A 4TMXA 3X1DA 5BXQC 4D25A 3T35A 2C95A 2ZETA 2EFGA 3C16C 2GAOA 3OEEA 1J90A 2HYDA 3CRRA 3EWAA 3P32A 2BV3A 2G1KA 3D31A 3VX4A 2R6FA 2SHKA 3LFUA 3KUDA 2R9VA 3THYA 4JVLA 1R0XA 1PV4A 4ZKDA 1P2VA 3T34A 3B6EA 4QHYA 2CNWA 1NBME 2QROA 3DM5A 3Q7PA 2YJTD 4Z1MD 1TMKA 2D4HA 5EUQB 5HKKA 5JMTA 4Q1DA 3H2YA 4FIDA 5H68A 2CEAA 3U44B 5KU1A 4P4SA 2ANCA 4G5SA 5GJCA 2PCJA 2O52A 3B8HA 4YXWA 1O3YA 2IX3A 3HU2A 5FI1B 3PITA 5HCNA 2QQ0A 4MYHA 4RVCA 2AD1A 2EYQA 2HYIC 4C0QC 3A1TA 1M6NA 2QM7A 2JLQA 1E1QD 3QKRA 1E9BA 4QHTA 3KX2A 2RGDA 4YONB 2FG5A 3GJ7A 1N6OA 2QAGC 1TQ2A 4M9ZA 1XF9A 3VKHA 3GJ8A 5GJVC 1XPOA 1G20E 4GP7A 2VPPA 2B8WA 1U9IC 2GCOB 3K1JA 4H1VA 2JLYA 2J9RA 3L0PA 3SYKA 2OE2A 4Q18A 1MT0A 4AYTA 4DUGD 1G4AE 4LSGA 2JJ2A 4DVGA 2BKUA 2NO9A 2B21A 1WA5A 1KGDA 2QBYB 1WCV1 2EWWA 4PO1A 4R7ZA 3ZGXA 3TAUA 3KQUA 1ZM7A 1DG3A 4LBWA 1E4VA 2J87A 3DOFA 1KDPA 3D8BA 3ZJYA 2AL7A 3GLFE 2G0TA 2AN9A 4LJ4A 2V9PA 4N1AA 3V00A 4XH9B 3FE2A 1ZIOA 2IYVA 3MRSA 2GZAA 1J99A 2IS2A 1ZD1A 3IPYA 3WXMA 2ZU6A 3K0AA 3SBDA 3FKSA 4OK5A 4P4UA 4WA7A 5DISB 3WYGA 721PA 1HURA 1YRAA 4ZO4A 4A0FA 1CR2A 4LJYA 2R65A 4DUGA 2ZI5A 3EW9A 3CX7A 2EQBA 3EA5A 2XTNA 1IY0A 2HJGA 3LV8A 1IQPA 1ZVQA 1W44A 4R2HA 1KSJA 2HDNB 3K9GA 4MH0R 1DAFA 4EJSC 4II7A 3VR3A 4HI0E 4O0MA 2ZYVX 4Q1AA 1UJ2A 2H5EA 2ORIA 4DSNA 4M0LA 1E1QA 2ZYWX 1P9RA 2C9CA 1NF3A 3RANA 3B5JA 3D3QA 2W2TA 1G64A 2ZANA 5CLLA 1XWIA 1NBMD 3PCRB 5CM8B 3B1ZA 2Z4SA 3BD9A 3BH0A 4LBZA 3CLVA 1LNZA 3DMDA 1GFIA 5P21A 2WPDA 4XSGA 5J4KA 2JLXA 4QBFA 1N5LA 1IOZA 1E2MA 4U5XA 2D7CA 1GG2A 4C0BA 1DAGA 1GNPA 1ZNZA 4LV8B 4TZ0A 4HZUA 4G01B 1VMAA 3QKSB 5DYIA 1KO8A 4PZYA 2XTMA 1OE0A 1YZTA 1ZUNB 2BEJA 1EFRA 1EFCA 1N6PA 2CXXA 3I72A 2P65A 3N2IA 4OI4A 4MGZR 1S1CA 1US8B 1IXZA 2GZDA 2RB4A 2GNOA 3THOA 5D3MB 4ARZB 5AJVB 4KVAA 1UBEA 1ZC4A 2KE5A 3O8DA 2ZEJA 3SC3A 4F4IA 4GL2A 3MGCA 1QHYA 4WXRA 2OEPA 1HY3A 1MO3A 2QP9X 4JL8A 2FPKA 2HCJB 2NGRA 5J4VA 2QRNA 3B1VA 1EFUA 2YYZA 5CDFE 2CCGA 1YZKA 1JJ7A 1X6VA 4BE7B 4D4LA 2O8EB 2IYRA 1R0WA 5FOTA 3WBJA 2OT3B 4URWR 4DB4A 1A4RA 5C46F 1M7GA 1P73A 4DEXA 2BEKA 4E5UA 5FBVB 2ZRAA 1HV8A 1UKVY 1XJ0A 4U02A 2DCUA 4AK9A 1UKYA 2AWNA 3GLFA 1GAJA 3RSLA 3MCAA 3AUXA 1GILA 1ZP6A 2OUKA 1G9XA 2QORA 3ONWA 2NO7A 3M6AA 4S2EA 2QGZA 4A2QA 1E0JA 4AKGA 3AP1A 3VHLB 2XSZD 2AWOA 2ZUDA 3CRMA 4PANA 3ND8A 3WHKA 4RD3A 1JXOA 2Q21A 4NPHA 2JLWA 2V1XA 3LW8A 1KJWA 3NWJA 2YWFA 4DCUA 4TN1A 3EASA 3B1XA 1TADA 2GJ8A 2W0MA 5AJYA 2PJRA 4IFBA 1FUKA 1TUEA 2AFIE 4TQAA 1P7CA 4ON9A 1IY1A 4XTRA 4LJ8A 4A9AA 2YV5A 4Q9HA 2HEIA 2PZEA 4A0RA 5JLJA 1XD2A 1YR8A 2W6JA 2CBZA 5JBQA 3PVSA 3G5UA 5FBLB 3ICQB 2WSSA 1CF4A 3L8YA 4B44A 2I3BA 3GFPA 2MSDB 3NIBA 4IHQA 3AGQA 2P0EA 4A82A 4LWZA 5FFMA 2G88A 2IL1A 2AXNA 1XXHB 1Z28A 3NBYC 1BIFA 1E4YA 2WSMA 5KPDA 4KLNA 2IS4A 4FCVA 4Z8XA 4RJLA 2F1JA 4QJ4A 3M4YA 3HU3A 4W5JA 4PO8A 4OI2A 3CNLA 5FTNA 1GRNA 1H8HD 4IEEA 4ASUA 4PQYA 3ZLJA 1GUAA 4A8JB 4GFDA 1YR7A 1XTIA 2IYQA 1RYHA 2F7SA 2WIBA 4F4CA 5K8UA 4LCBA 3CUEF 1E32A 2FZLA 2Z5FA 2O8EA 3ZS8A 1D9XA 2V3CC 1QG4A 5KSOA 1E9DA 2X77A 1SXJC 4C0LA 1GKYA 5CJ2A 5F9HA 2IXGA 2CHVA 2ZSFA 1Q3TA 3O47A 2ZJ8A 3GJ3A 3L2OB 1R8SA 3TNFA 1XTKA 4NHOA 4KVGA 3AP2A 5DO9A 1XEXA 2HT1A 3ZVMA 1W4RA 3ECCA 3SJZA 2RGEA 1MO6A 5F9FA 2O8DB 3PEVA 4BFTA 1UPTA 2R6AA 1M34E 1QG2A 4QL3A 3ND9A 3RLFA 2V4ZA 3E1SA 1PLLA 3HDTA 4L9WA 4GOKA 2AKYA 4RZXA 3GLGB 4OQFA 1L4YA 2GVZC 5EUMA 3VR4A 4UNRA 3QENA 2MMGA 2ZRGA 1FQKA 3IIMA 3SOPA 4YC7A 3N70A 3KTAB 1W4AA 1U99A 5HZHA 4D4MA 3KFXA 4IVRA 1T5LA 5JJKA 1SXJB 3T1TA 3R9WA 1E9RA 1CJVC 5EJEA 4I4LA 2WOJA 4NDZA 1W0KA 3AEZA 4MKHA 5LD2C 2P67A 2J0SA 1FZQA 4PHFA 3CO5A 1RKBA 4YMSA 5TV2A 3EPLA 1OYYA 3AVUA 2VRWA 3LX5A 4M1TA 2FEOA 4F93B 2HLDA 1OXUA 3UMSA 1UF9A 2QPOA 5F98A 4FD2A 2J0VA 2RKOA 1E99A 2J59A 4DSTA 1MOZA 4BLQA 5KSPA 1II9A 5BWMA 1H65A 2VIIA 2QRZA 2QE7A 2WWFA 1CJUC 1KI7A 2C8VA 5TVKA 5JCZA 3JVUA 2DHRA 2VA8A 1P5ZB 4CEJA 4O2RA 1B0UA 5EP4A 4X8MA 4KSBA 2VO1A 4DLYA 2FFHA 4LJ5A 4P4TA 1N3BA 3JZAA 1WRBA 5G3YA 2G77B 1E6CA 2XNDD 4MYTA 1QDEA 2WKRA 2HF8A 2V6IA 2ZR9A 1XJCA 3KJHA 3X2SA 4G1UC 2XZLA 4Q9JA 3JZMA 3K09C 4BGDA 4Y0AA 3FGNA 4AC9A 4TT3D 1U0LA 1W49A 3GCGA 2CE2X 1UDXA 5GJWC 3BS4A 4AG6A 4QBIA 2K5UA 3C7KA 2CK3D 5E4FA 3U44A 2XZOA 2KB0A 1E9FA 3EZ2A 1COWD 1FP6A 1IN7A 1OHHD 3C5CA 3RS4A 5JI3E 3VFDA 4BFXA 2BMEA 3EZ7A 3LY5A 1YRBA 2J45A 3SE0A 1A5TA 4OHXA 1SQ5A 3QEJA 5AR1A 2VSXA 5EXXA 1SKQA
chains in the Genus database with same CATH superfamily
1F51E 2OV2A 3NT4A 4JLDA 4TL9A 1CVIA 2GNAA 1K8YB 3E61A 5G4KA 4ALMA 5HRCA 1DKUA 3RROA 3L8FA 3M4XA 2ZIXB 5M04A 1QG0A 4C4TA 2WTNA 3AY3A 2CYAA 2NSJA 5C8XA 1F6WA 3LM8A 1Z2NX 1K6JA 1ZMBA 4PINA 3OFND 3PEYA 1GPUA 1PR5A 2ISSD 3UJ9A 4DQ0A 1FMLA 1XCBA 3QUQA 4JUAA 1EGAA 3FCCA 1JNXX 4C7MA 5HZKA 2EZTA 3GN1A 1A98A 3EGEA 16PKA 1SQSA 3Q1LA 4AZTA 4XM2A 3PYXA 3WJ1A 2C07A 4DMCA 1W52X 2D7DA 1T2AA 3WKDA 5HJEA 1EIZA 4NBRA 1QH9A 1CE8B 3E9ZA 1YSCA 3T0IA 1O89A 4ZV4A 2X2EA 1SG9A 2QLTA 3DCYA 4BBJA 4DR1B 5HQJA 3T3PB 4AB1A 1ECFA 4HCJA 1NL3A 4DIBA 3P4UA 1FX0A 3VAAA 3VZPA 1CRPA 1IULA 3M89A 4L9AA 3R3JA 2LPMA 1O9BA 4IOJA 1IPHA 4TZTA 1M6VA 3H9GA 1PFUA 2QL7A 3EVTA 2XD4A 5J5CA 3UKOA 3OA0A 2IX9A 3G2LA 1MR3F 4G5OA 4ERNA 1I7NA 3PDJA 2FRXA 3W9YA 1J5EB 4DC9A 8LDHA 4UPVA 1PFQA 4Q7JB 3SZ3A 1OVMA 2OV4A 2C5GA 4EZIA 4W5RA 4LJRA 1RBZA 1MJGM 1CJSA 1VL5A 2YYYA 2H9AA 4IDHA 4MIOA 1SKBA 5JY1A 3EEFA 1MHTA 3VRHA 4RLQA 1LBTA 3RYTC 1LJ8A 2A1UB 4KPGA 4MV9A 4REQA 1TK3A 1Y5RA 1T4DA 2DGDA 1PFYA 2FPPA 2VPQA 1MV5A 1Q2UA 2Q28A 2NIPA 3K0CC 4ZAZA 1GAEO 2F48A 1AF4A 2QD1A 3NEYA 1E4EB 3PI6A 3A8TA 4C4YA 3RT1A 1BNCA 4JR1A 3H0EA 4I55B 4RZ2A 1WHSB 2DBRA 1NN1A 2EF0A 4MULA 2LW7A 1DB3A 4JVNA 3LA8A 1XXLA 1A9PA 1KPGA 4BFVA 3EISA 4ONEA 1PFKA 2Q2OA 2RHCA 4HH1A 2PR7A 1R8YA 2ASEA 2A86A 4ALLA 4QEKA 3N5KA 1OOEA 3DBIA 3HMKA 5HIJA 2C98A 5LIRA 5DNAA 1VI6A 5BQXA 4X7PA 2FP3A 4U6SA 3VHQA 3Q4GA 4AQDA 1C8LA 4WMLA 4IJWA 4OHKA 1SC9A 1W48A 4Z7QB 2OGWA 2P9ZA 1B8OA 2PZMA 4ND8B 5CNMA 4EITA 2J9YB 1XPRA 1NNEA 4HTFB 2P6RA 1UP6A 4YAEA 4NJEA 1I33A 3L7IA 1JSZA 3D6VA 4PRYA 1WUHS 4K46A 3RVJA 1Q57A 3PNYA 2PX0A 1IXRC 1FUUA 1ID1A 1JEOA 1T2CA 4HEJA 4QTTB 3ZX4A 4UUMA 5KSZA 3EY9A 1E8DA 4GP9A 2GCPA 3H9QA 3O92A 3KVRA 3VR2A 1R8JA 3F3YA 5DBGA 3ADBA 2H4FA 4OA8A 4RS3A 4MCJA 5I5GA 2HHCA 1THMA 2ZS7A 3FJ1A 4B84A 1NW4A 2QN6A 3VZSA 3RV4A 4CEIA 4RVHA 1ZK4A 4ACBA 2KBEA 2GN0A 1NHGA 1UKZA 2Z9BA 4ILKA 3UUWA 3NNNA 3WTCA 4JZKA 3ADPA 3B5EA 4ZO7A 1WPQA 4WKGA 2NQTA 3QBTA 4M8LA 3LMKA 3LWDA 4MS3A 3RAGA 1GPDG 3R7WB 1N2OA 5FI5A 1DOAA 1JHXA 3HRKA 4R0VA 8ATCA 1QLHA 4E1AA 2GD1O 2IC5A 3RAFC 4PFSA 1IDN1 4OB7A 4Y9RA 1OIXA 4BS9A 2FWMX 5FOXA 5KNDA 2Z0MA 3OT1B 3C5WP 5BW8A 1A9YA 2CF5A 3ECAA 3KYJB 5IC6A 2OO7A 4DLNA 4F2HA 4BLOA 3D1LA 2C59A 1N2HA 2CCKA 3D2CA 5LQUA 3LAWA 4MPTA 1OFUX 3RS0A 4REOA 1QQ5A 5FEMA 1PHPA 2G1AA 3EF3A 3WLQA 4X65B 4F5YA 3DG9A 3RUPA 3O84A 5ALFA 3REOA 3TRJA 2GUGA 4JGBA 2XVYA 4XPIB 1OTXA 4C4SA 3AV3A 2XXJA 3MWGA 1M2KA 3EXFA 1UDBA 2BGMA 3MNFA 3AEQA 1W4ZA 3IBYA 3PZRA 1RPNA 2NUTA 3BIXA 1UEJA 2Q49A 2H4ZA 4BNNA 2PMFA 2FSVA 1ZJZA 2CVZA 1YB7A 2CMDA 5LD2B 5EIFA 4BLRA 4AUEA 3TG2A 1WXIA 4D0LB 4KR6A 3IB6A 5LB2A 3IP1A 2H92A 4FJ2A 4F2DA 4LZZA 1R10A 4J0JA 4PZAA 4A1FA 2VYND 3SLKA 5CDHA 1FCJA 4Y9DA 4XGRA 3ROEA 4WUTA 1ZCBA 4X97A 1QRTA 2QRJA 3LDAA 3S6JA 3A9RA 4YJFA 1GLNA 1LKZA 1NRWA 4D80A 1KXJA 5DX1A 2F59A 4A0QA 1EINA 1PT7A 2VRCD 3IP6A 2CDNA 4MW1A 3K15A 5LIPA 5CLFA 1H93A 1PT6A 1X1DA 1OH6A 1NIPA 2H52A 4NZMA 2YC4C 2QTTA 4OP3A 3UK7A 3PICA 1ZUWA 1RI1A 1QHXA 2QZZA 4DDUA 5KNCH 4HGYA 2V9CA 5CJPA 3SYTA 4L8LA 2AA3A 1IEVA 4IH1A 3WIVA 4LMAA 3WRXC 1T1RA 3RDPA 2WHPA 1YIOA 3L8GA 4QPCA 2HAEA 3KWLA 4A2PA 4B3CA 2C88A 1RM4A 2EWMA 3K1YA 2R00A 1JQEA 4HGQA 4NV1A 2QTCA 2HNKA 2LKDA 5CNIA 5BSRA 4QM6A 2A1TS 3D7SA 4JBLA 5A9TA 4DLSA 1G0NA 3AF1A 4GPEA 2IS1A 4ZZ3A 3UH1A 1ORDA 5LQJA 3C39A 3IJEB 4DJEC 4Z54A 1CE8A 4BQIA 3HBLA 3ESRA 3JWGA 4OK3A 4EDFA 3K70C 2JIZA 4H9GA 4MW7A 4B4WA 3I9JA 2C58A 4PYLA 1PT9A 4FGLA 1A8QA 1IZ8A 4EJ0A 3C3MA 3V7NA 3RADC 5BN1A 1SK9A 1TM1E 2O2YA 3F6PA 3I1JA 4HMOA 1DT5A 4QODA 1I0ZA 1Z6PA 5C8YB 4FYPA 3GRAA 1MC5A 1K7EB 1Y9EA 4S0ZA 1QPBA 3DAFA 5FDFA 3THRA 1R8XA 3EX7C 3W5BA 5C5EA 5IW8A 3DEYX 4ND8A 1JX6A 4LK3A 4BL5A 4WY5A 4WOPA 4A15A 2A9VA 5JAQA 2HCRA 2VDWA 4KRYA 1X92A 2QVGA 4HDAA 1K9SA 2AFHE 2C57A 4QOGA 4N6GA 4X6XA 3F9IA 5EE1A 1OLUA 3ZZMA 4BXOA 2UVQA 4N6OA 4FYHA 4HNAA 4LHVA 4KXVA 4LRYA 3X44A 3HXLA 3R3VA 1DRUA 3U0VA 3WGUA 4DEVA 3AY0A 3RABA 1JG6A 1K3FA 2Y6UA 1PL7A 1KYVA 4TMTA 2DEUA 4N48A 3RTCA 1TYDE 2GFIA 3MINA 2F17A 5DDIP 2Y1LA 1KBQA 4D96A 2O3UA 3QNMA 1ESNA 1J2TA 1MO5A 3COZA 5JNRA 4MWBA 4IIJB 5BOSB 3DLPX 3KLMX 3EQ6A 5EJ2A 1V16A 1PDWA 5A1TA 1JB1A 4JU9A 4RFSB 4NZOA 4E22A 2C5SA 4DT1A 3G17A 3QEKA 3NGLA 2AQHA 3BGSA 4Z9BA 5IDWA 2QMUA 3NJ8A 2D3WA 3MELA 4LJSA 1D0IA 3TKYA 1DWQA 2PUBA 1WUKS 4KI7A 4DR3B 3VBEA 2W2KB 1L7BA 3FSJX 1HEYA 2B0JA 2NYRA 2Q07A 3FIJA 4ZC1A 3URKA 3WK4A 4F6CA 2B7LA 3B2QA 5H3CA 3DC7A 4ZJYA 2WUVA 1IB0A 2QX7A 3SHOA 1W5BA 5DHQA 5AI6A 3B1WA 3FVVA 3AESB 2XWQA 7ABPA 3WMRA 2E49A 4DGSA 5D6NA 3HJTA 4HX5A 4I1VA 1BEEA 4WXMA 3K0CA 4M88A 3UB4A 4CKEA 1XZMA 2EGHA 2RBKA 5BSWA 3M49A 2Q9BA 3JTEA 3QFTA 3OU6A 5DNYB 3FNQA 3F8SA 5DHFA 5J3JA 4KIGA 2C0PA 2IDKA 2ZBPA 5D3QA 2DH5A 3VNRA 3A05A 2B4TO 3M4NA 5TEVA 1JKXA 5LNK1 2PO7A 1VI5A 1M0EA 1ZMXA 3WYFA 2C04A 4Q3OA 3SVTA 4MV0A 2ZRNA 3QVLA 4P7BA 4G4GA 2PZAA 2IU3A 4LJ7A 3UMYA 4DIEA 1L7OA 3L6RA 3L06A 3C3BA 4IDAA 4JJGA 1D07A 3SM3A 4FQ5A 4FS8A 2G8NA 4MGHA 4X54A 5AK6A 3WNDA 1QHHB 1DCMA 4P2BA 2NU9B 3ZZNA 3THWA 1KK1A 2XTJA 1W6UA 2H54A 2Q2NA 4QIHA 2EHJA 2ZDHA 3CHYA 3R9IA 4ZN6A 4ZQFA 1CZHA 4BO5A 4MUHA 2GFQA 3NYRA 2I03A 3HZZA 3V7WA 4UUBA 5ALUA 5J9FA 4J03A 3UANA 3ZHXA 421PA 2A9OA 2G80A 3FAZA 5FB3A 1NXXA 1WTCA 2QNRA 3EBPA 3UFXB 1E58A 4B2IA 1CNEA 2K6GA 2XDYA 5LOVB 1AQNA 4B40A 3HKCA 5DNEA 4C5BA 3BJIC 1PGOA 4DJTA 3GJXC 4EKYA 3P5BA 3M4ZA 5H82A 4F11A 1XZKA 3HEBA 1BN6A 3LK6A 4QOFA 1A2BA 1X8KA 2EZ9A 2QG9A 5HRAA 1ETHA 1ZQ1A 4EH1A 1OYVA 3RUCA 4D5EA 1NOIA 5FPTA 5FOVA 3G0BA 4Y0VA 5J23A 3DPUA 3HP4A 1EFKA 2GN9A 3MJTA 1TCUA 3WNQA 1EWTA 3DHEA 3H1AA 1L2TA 4WN9A 4MGKR 3WE7A 5I9TA 2OBXA 2V59A 1JLLA 2OBMA 3B60A 5FYDA 5B30A 4I4CA 1X9GA 3IOBA 4IQ8A 3AI1A 3BUSA 5IYZB 3BBPA 2C3PA 3K72B 3OFKA 4Y3UA 4MVYA 3AF3A 4DHEA 2ZT5A 1POWA 1U3TA 1XB2A 4MGYR 4MUBA 4N01A 4Q39A 1ZXXA 4FLFA 3FKQA 5KYUB 1P4SA 1U2GA 3Q3CA 5I9BA 5C7LO 4HDKA 3T7KA 3IUQA 4N8SA 5IYZA 2XGSA 3T5GA 1LY1A 2KHZA 4Z8YA 3I6BA 2HIGA 3CR8A 2JLBA 5BUZA 5TPZD 1ZAYA 1GGJA 4LOKA 4CM8A 3GVCA 1R16A 5KKAA 4C0JA 1GGMA 2IPAB 1ORVA 1X7YB 1ODSA 2VSNA 3GYGA 3JAWB 3N6VA 2A67A 4NESA 1MB3A 1B14A 5ILOA 3T5AA 4CM7A 1I3MA 3JQFA 4TMYA 2PMEA 5TGTA 5JDIC 1M2OB 4CLOB 4EZBA 5LKRA 1YOVA 5KNCD 2WQ6A 1DARA 5TR9A 3UKDA 1W85A 1E5TA 2PLAA 5GV7A 1HDXA 1L4BA 4AG3A 4UNIA 2X40A 4X1IA 4KNWA 2HPHA 2ERXA 2OUIA 3E7WA 1VKRA 3B9BA 4G09A 4JP5A 1K8QA 1VL0A 2V3WA 3AUYA 1NI3A 2WWGA 3IA7A 4GMFA 3BGWA 4K8OA 1Q5PA 5B6JA 3ANSA 3EEIA 1I0IA 2IPLA 3VAYA 3BWMA 3GT0A 4BEVA 3ECSA 5AKGA 3KKNA 1JG1A 5CAEB 2ZTHA 3IIKA 5KS2A 4FFPA 1FP2A 1N33B 4XFKA 2WMYA 2XX3A 4QASA 3GLIB 2IYOA 4HGZA 4E09A 4KN8A 1ISSA 1HE2A 1P0PA 1N5JA 1GVHA 2Q6VA 3QBDA 4V1CI 1LW6E 1RIIA 2X9GA 2Y67A 5GM2A 1RWQA 1Y7TA 2ZE8A 3R75A 4TLCA 2P9HA 2RKWA 2C9ZA 2JLAA 3HU1A 3JASB 2YDXA 1IK4A 4FYVA 1SKAA 2QW0X 2DPGA 4IDNA 4NEGA 2BZGA 4YT4A 1CVRA 3LCRA 4A6DA 2IYZA 3T9DA 3EVFA 2X1HA 4ALIA 3F8TA 1C3OB 2WZBA 2A58A 3QA9A 4E32A 3ZVLA 4G63A 4YMUA 1XP5A 4H59A 1BCSB 1P4AA 1PJCA 3GWGA 4BU1A 2EKBA 1EAMA 3T7AA 4DMHA 4WEOA 1HE4A 4J7UA 4MW4A 1L6RA 4IHJA 3H4VA 3H9BA 1AXEA 4JIMA 4YJ2F 2XJ4A 3VU9A 2H18A 4FNAA 1B15A 3KYDA 5E1DA 2EEZA 4UXIA 3W5JA 4YBZA 4EKEA 5KEIA 1GRRA 3TNDA 3TXAA 5B6PA 4KWCA 2RGGA 4WCDA 2C83A 2A0FA 1S4QA 2VYCA 3GCDA 3PNBA 5C7IO 4RLSA 4ZT2A 4RY0A 3L7JA 4HDKB 1RQLA 2CW5A 4YI3A 3MEQA 4K81B 4B6FA 2JLZA 2N0SA 3LKZA 4AY2A 3O8QA 1X1RA 3TQCA 2IFTA 3CPJB 1M2JA 2PJDA 3LQ2A 1TO2E 1CQWA 2H17A 3IUEA 3OFNA 2QD3A 3WHPA 1SVWA 3AFHA 3F7OA 3GUYA 4MI9A 1JEYB 2RMKA 4K0RA 4R9NA 3K0KA 5BWMA 2DUUA 1H1DA 2C4TA 1KVTA 1T2DA 1Q7RA 4C2AA 1ADYA 2CLMB 5ALIA 5DWQA 3O4IA 5KYKA 2CVPA 1FYWA 1TQ4A 1NJ1A 2FLVA 2VXYA 4LSZA 1VP3A 4HLUC 3LO5A 4YQFA 3AKCA 3NP9A 2A7QA 2OAQ1 2VPXA 2LDBA 5AJHA 1A9SA 2I4IA 4ZCIA 4CEHB 4JBYA 2AB0A 2CL0X 4KPFC 4ED9A 2WF5A 3RK0A 4UHJA 2CF6A 4D79A 3FYTA 1W4BA 2V65A 1KOJA 4CG2A 1GA6A 1NOJA 2G63A 4FDAA 4MLZA 4O6VA 3MWEA 4WLOA 5EZYA 2I2FA 4F5EA 4MKXA 1AVTA 2J3DA 4UE6A 4KXFB 3QTLA 5I4KA 3I09A 1QM5A 1V4BA 3ICEA 3HEMA 1CD5A 3VJMA 2FMKA 2I76A 5JVDB 3VO9A 3AXSA 2JNWA 4S35A 2GZ3A 3I61A 1E2DA 3CZ9A 4C3ZA 1YT5A 1IATA 1DADA 4NENB 1RZRA 3O4JA 3WLIA 4KTVE 3FPSA 2CXRA 1A8IA 1IVSA 1RWXA 2D00A 1VA5A 1WIWA 3N6RA 2NU9A 3QXJA 1W2GA 1H2BA 3MWFA 4I7EA 4PPGA 5IMBA 4INOA 2WWTA 3CLSD 1YFZA 2ZPTX 4MWCA 3OCUA 3RD5A 4HRXA 4D8WA 4E51A 3WRYA 2R4TA 5MN6A 1HR0B 4BMYA 2PSDA 1QAOA 2PU5A 3RVNA 3DTVD 2FLKA 4PSKA 1SD1A 3KXKA 4OHFA 4EB6A 4EHAA 5AW8A 3O31A 2W2XA 1CUAA 3LI2A 1REQB 4B4VA 1L0BA 1NSFA 4P22A 2QP3A 2WHPB 4V0NA 1Z06A 5AI4A 2OGUA 1K7SN 2ZUBA 4RD6A 4R9VA 3WYBA 5H70A 4OBEA 4BAGA 5LJLA 4MR9A 1ARZA 1M34A 4GX1A 1N3IA 5TGDA 2JAWA 2WZQA 3MQ2A 3B78A 5CXUA 2XEXA 1RJEA 3A37A 3C87A 1DL5A 5BWBA 4RD1A 5DZSA 1CS0A 3R5SA 3DZKA 2HJSA 2PH1A 4I5IA 4CTKA 3JY6A 3B89A 1CSEE 2GESA 2N9UA 3EHDA 5FBKA 2NO4A 1L5SA 3OC6A 3RE1A 1FW8A 1G0OA 1K97A 1UWKA 1ZMRA 3WK6A 4FTWA 1WW2A 4RQTA 1XZDA 2ACWA 2RGXA 4CUZA 3LP8A 2MINB 3KJIA 4K3VA 1WW3A 2J5QA 1UH5A 2EJCA 3AFNA 5DLQC 3WMGA 2W6ID 1QBGA 2ZYDA 3PNKA 4DIFA 5U9CA 4R1MA 2UZ1B 4Q4HA 2WAOA 3STYA 3AEQB 3IE0A 5IJ0A 5JDCA 2YHAA 3DYIA 4KQHA 3PGLA 1XDUA 5D5QA 3A1WA 3T1YB 4MV4A 1H85A 4RKEA 4QWWA 4S2UA 1HFKA 3ELUA 3DW3X 3W6PA 5BYBA 3LFHA 5FOQA 3LQ4A 3QF4B 2WVJA 1DSSG 4N49A 3UHPA 4HPWA 3IS3A 2FW7A 1GUBA 2HNBA 4HB0A 4L73A 1VJ1A 1YRWA 3D4IA 1L5ZA 2WFZA 1WSDA 1HF3A 2PEZA 4NK5A 4YPOA 4OJQA 2RHWA 1Y6RA 3I73A 1QX3A 2NX2A 3AZQA 4JR0A 4G9BA 4OLAA 2PM8A 2R84A 1LVGA 5REQA 3DWGA 1L4EA 3N0RA 2XOXA 4W1QA 3AR4A 4F0JA 3D1VA 2RHOA 3JYHA 3FOBA 2JFVA 4PHTA 3A9WA 1Q2XA 4DBLC 4NZNA 4NECA 2DOKA 5FR1A 1EFVB 1D4FA 2W4QA 2O07A 5K4GA 1EXNA 2YOGA 1GPH1 3RGGA 1VJCA 3SKXA 5KOJA 4AQ7A 1GRVA 2PKRA 3CZCA 1NSTA 3GZ4A 3ZEAA 1S96A 2AI2A 3CS3A 3WGJA 2GFHA 5F5LA 4EG0A 3JZFA 2DMRA 3KAKA 1XZPA 4G26A 5BYJA 4C0XA 1W9HA 2VI5A 1JZTA 3KZ1E 4FR2A 4GF5A 1Y82A 1AC5A 1N5MA 4TLLB 4TWRA 4OM8A 5C80A 3UAVA 4WDRA 2Q9UA 2W22A 1RI5A 1T2EA 4W1RA 5CVVA 4QAJA 3OO0A 1C7FA 1L8AA 3H13A 2ECOA 5TE9A 1VI2A 3ADDA 3NC1C 3A1UA 5AUNB 3LBHA 1NR7A 3THSA 2QLFA 3E70C 1KIAA 4MB0A 4DSAA 1LC0A 1VDZA 3IVGA 1ZH0A 3V2UA 2EFJA 2KM1A 1JBKA 4ARUA 3EF0A 2P6UA 4I19A 3A6JA 1IWOA 2GXSA 2XNDA 3SE7A 1YQDA 4MUAA 4A7PA 4GLBA 1UBKS 2P3QA 1P9WA 3H3FA 1FNMA 1UJMA 1X1BA 3ENNA 5FUQA 3K0SA 2WLTA 3TZHA 2H57A 5DASA 2GCIA 2ETXA 1JQAA 3A28A 5FXMA 3IHLA 2A5FA 3MMXA 2V7XA 2OBFA 3OF5A 4JT4A 4LDRA 5I4IA 1R6BX 3CWZA 4YK7A 1C3JA 3UATA 1BCRA 1Q83A 1KP2A 2IXAA 4B9EA 3PQ3A 1T9ZA 2O0JA 1OV6A 5IX8A 4AVYA 4E03A 5LP6F 1TIBA 2JK0A 1AA9A 2D1FA 1L5HB 3IAM1 4NNOA 3GEBA 1LA2A 3ITEA 2OV1A 5JFTA 4LOJA 1RPAA 1UBHS 5A7HA 5KNCA 3WWEA 5F33A 3TSOA 2P3SA 3U6BA 1J0XO 4Z0PA 3VYWA 3T3DA 4QREA 4RDHA 3AFGA 5JDIA 5EXPA 1N9GA 1B7GO 4HSEA 4YRFA 4AO7A 1NLFA 3BFKA 2CDRA 1DUSA 2X9LA 3NYIA 4YJFB 4CR7A 821PA 1DEKA 1ECLA 5CCXA 3AJ8A 3UW1A 4UQOA 2YC2C 4OK6A 3G0CA 2NUBA 4BUCA 3D4NA 1XYYA 1JFRA 3FB4A 5IBRA 1KZ9A 1KO1A 1VG9B 4FUQA 1ICIA 3U19A 4P38A 4H3KB 4WJZA 3QITA 3PDHA 3LKVA 4LC1A 3FWYA 2OQ2A 5JBNA 2VTBA 4CYMA 2BT4A 5K0FA 4AI6A 1Y37A 2D8MA 3QOXA 3I5MA 1XROA 4XX1A 1RCTE 1XCMA 3G9ZA 4R7TA 3O8CA 3GJQA 4L50A 3AB3A 3L7CA 1JR6A 4OQDA 5DTJA 3DL4A 3K9WA 2WICA 3CLSC 3B6JA 4OX9Y 3E8SA 1YS7A 2NSHA 2VDNB 4I4NA 3EGIA 3HFRA 3C5VA 3UICA 3A10A 3UMFA 5LNK6 3TFOA 2JIDA 1R6AA 4FPXA 5BUSA 2BL4A 3AGPA 3K70D 3QZUA 2P9BA 3QF4A 4JX9A 2JS7A 4AMBA 5LQKA 1J1UA 1NBMA 3HEAA 2DFDA 3EIXA 1V95A 3NPMA 4B34A 1P3DA 2A9FA 1RZ3A 1WF6A 2IU6A 1OZ0A 2HPZA 3BILA 4H4DA 4I2VA 4MWZA 2BGGA 1UP4A 2H4WA 4IOMA 1HT3A 1SCNE 1UQUA 1Y8AA 2CJFA 3DDWA 1Y5NA 3NO4A 4QC2A 1AGYA 4X71A 1XLTA 1S2MA 5IVKA 1VMDA 5A5VA 1WG8A 3VYTB 3G13A 1BX0A 1JIIA 1E2KA 4L02A 2RI6A 4FC6A 5TQ0B 2P9YA 2XAAA 4UHHA 4I50A 2VDOB 1OXSC 1TW3A 3E9EA 3K0FA 4JEUA 4FXPA 3U80A 4LDQA 4WGGA 2TYSB 3VI4B 2G09A 4EY4A 4DG9A 1YJBA 2BTOA 1UP7A 2O3SA 2NPOA 3EXEA 4GRDA 4KR2A 2QVZX 3R0IA 4TSFD 3K1AB 2MSEB 4MIEA 3WBFA 2VKQA 3U4QB 4LMPA 1N0HA 3CH5A 3U4IA 2PGLA 1R6TA 4XB2A 3BQ9A 4QD3A 2RAVA 4TWZA 4UC0A 3F3MA 2H1FA 1ORRA 3HQ4O 1X1SA 4HYEA 5FWYB 5IJ9B 3KD3A 1KI2A 3PIIA 3HB7A 1J22A 1XZCA 3R3HA 1TMGE 5TXGA 1CUHA 4CLDA 4BX8A 5K3AA 4EG8A 4CIVA 4WKOA 3WB9A 3J7AC 5JHHB 2QGFA 1ZCFA 3K35A 1C4XA 5HILA 4AJLA 3R3SA 2XNCA 1ZM3A 4TYWA 3WL6A 1JS1X 4YALA 4BN0A 1GTL1 4BFLA 1WUYA 2YW2A 3HCCA 5EKUA 1P2DA 4YAGA 3OHSX 4BV2A 2VYFA 3HABA 4B82A 4QNRA 3VUEA 2E4VA 4LDJA 3V33A 4YCAA 1SXJD 3WK5A 1SU6A 3RNOA 4GYYA 3P2JA 4CI9A 1ENOA 1MX5A 1YK0A 1YHNA 3RIMA 4C03A 3EZFA 4C01A 2H1OA 1YU9A 3HFSA 4ZYUA 1E6UA 1K3UB 4EI7A 4H18A 3IOMA 3P19A 3Q40A 3A4YA 2A1IA 3GA5A 4JDUA 1TAGA 4MPDA 5DLDA 3K16A 2IHNA 2AYYA 5F7JA 1NQTA 3FZGA 1K89A 1LUAA 3V7UA 1Z5NA 2QLMA 3WL5A 4RTJA 2FSUA 5J4LA 1YNOA 1WPRA 2J32A 2R5WA 1BS2A 4E5DA 2NVUB 4EEKA 1UAGA 1CY6A 3DT6A 4GKAA 3BWEA 3NRBA 2A1UA 2C2YA 1LI7A 4UU7A 2O3RA 1DAPA 5IJAA 4BX3A 1ZW6A 5C1PA 2OTCA 3WB0A 5D3ZA 2VHUA 1IXKA 3T1QA 4IHAA 3T7IA 3H0KA 2NG1A 1QCZA 1CFZA 3R20A 1CUGA 3QLUC 2MYPA 2QY9A 4HMPA 4JC8A 3EB9A 2QRUA 3FLMA 2PS3A 4KGZA 4WOCA 3KQYA 3Q7EA 1BDBA 1EXVA 1Q16A 1G16A 3OX3A 3I9MA 3DV2A 1G8HA 1RQNA 3F6CA 2PLWA 3PT5A 2I4TA 3KQTA 5EWJA 3G2KA 3WGQA 4E5MA 1JAHA 3A6EA 1A76A 3IBCA 1RXIA 2Y1CA 1SHKA 2XXAA 1NYTA 3U9LA 2PJUA 4AICA 2JKYA 4YP7A 1Q95A 4DDHA 3EIHA 3LRPA 3VA7A 1YA6A 4H15A 2ZJ3A 5MFPA 4KX3A 1WSBA 2AEJA 3BJZA 3VZQA 4ZT4A 3O4RA 3DMNA 2G5GX 2YV3A 3D5QA 1GZHB 3RIHA 3TSAA 4D42A 5C51B 3C3AA 3D4BA 5JO0A 1XEXB 2VWHA 1KMHB 4RCYA 3N7UA 4DLVA 5CBPA 1GT91 4TYYA 2BMDA 3QPWA 4J0CA 4G0XA 5AKJA 1ULAA 4HWPA 3CEMA 3CF6R 4GECA 2L18A 2YXLA 1NBEA 2CMFA 3PUVA 3F4KA 3VKWA 1POXA 5JQWA 2AJBA 2JD1A 3V1TC 3OKPA 3KYCA 2H8GA 4RK4A 4B35A 4ZHQA 4D3YA 2PE5A 1YQWA 5EINA 1S9DA 1P19A 1RC0A 2JFYA 2ZCJA 1E89A 4ANFA 4ER5A 2AFHB 1GNSA 1OJ7A 2X5XA 1O94C 2HA6A 4KO1S 4CLRB 1FA9A 1K0UA 4FGWA 3TBFA 3OHPA 4KAFA 4TXLA 1VJ5A 3JW8A 4GMXA 4BPBA 1M0TA 1FDVA 1GQQA 1BXGB 1WMEA 2SKCA 2R8BA 2WUEA 4LJ6A 4PQGA 4DWWA 4C0HA 3QF7A 4CM6A 1WCXA 3WQHA 3OU7A 1OI7A 4CF6A 2NU7A 1V25A 2X8WA 2O3TA 4PWYA 4GYJA 2XNHA 4MWEA 3M5DA 4QOIA 3EG5A 3ET4A 1Z5ZA 4WKPA 3ZWPA 1QCDA 2PZBA 4RPCA 2XGJA 3BWYA 3HR4A 4KFCA 2Q6OA 2QAGA 4HYQA 3LQKA 3IV7A 4LPSA 5KJEA 4FFVA 1VIYA 5JC8A 2HA7A 5DK4A 2GEKA 2A9PA 2QNBA 3LXRA 4Q4AA 3ZD8A 5JRDS 4RHXA 1BWSA 1PD0A 1WY7A 1KC1A 1X7ZB 1KJQA 1LD3A 1Y4DE 3JALB 2ZT7A 5JCJD 2PT7A 5G1OA 1K6MA 3KSZO 4YYEA 2LIVA 2VXBA 4KWIA 5BRJA 4RAOA 2R2AA 1RWWA 3SK0A 2JJ2D 3SX0A 2UYQA 3ZY4A 5A1JA 4RJIA 4B3BA 2YXEA 2YV4A 3T5DA 3P0JA 4RTKA 4LXIA 4X90A 2CKDA 4OLFA 1F5NA 2OC9A 4IFEA 4II2A 4CODB 1AV6A 5JD3A 1Z73A 4AJ4A 2C2BA 3UAWA 2D0OB 2GJ4A 2NXNA 4ZVLA 1L5OA 2BCJQ 3KCNA 3V4VB 4MUFA 5CEEA 1QHNA 4QZVA 2VJOA 2A2ZA 1QZUA 3JR3A 3AX6A 3KP1A 4EMBA 5JTUA 2DXIA 1FSPA 2XYVA 2X0JA 2IYEA 2Q4EA 1G2IA 4RFLA 1VRVA 1V8BA 5EL0A 2WA2A 4X5OA 4KPEC 1VE6A 4LX8A 4P4NA 3VGJA 3MTIA 3SY8A 4P3YA 3TLEA 2A94A 3VZRA 1E1RA 1I4EB 3U13A 4IJQA 2VL7A 3DWFA 1FNNA 2YICA 2ZULA 1I94B 4MVCA 4MQMA 1YDEA 3OU2A 1L4NA 2I67A 4W4TA 3OFSA 4FNOA 3V7FA 3AXTA 1T5SA 2CYBA 1G60A 4AM8A 3AIKA 1OY1A 13PKA 1AQUA 4ETMA 4H7IA 3TL6A 2ZB8A 2Z30A 1XALA 2NTNA 4UVIA 3ZNQA 3U7FB 4QYIB 3O5AA 5FUWA 3L1HA 2RCNA 4FCTA 4RVGA 1GL6A 5E7JA 4A03A 3RTAA 4RXUA 1SZCA 1KDOA 3BRSA 4C3UA 3TFQA 1O0CA 4P7KA 4A8JC 1QNLA 3TF5A 3JVEA 3EPKA 2FE4A 1D9ZA 4A0SA 3ZY5A 3FCOA 1G3IA 3GV0A 2FPLA 5D84A 1U8CB 3A3YA 3DP7A 4K6MA 4RLHA 5E6RA 3GNQA 1FMCA 2NWQA 3BF8A 1Z0DA 1UAAA 2OBNA 3ZWAA 3R6LA 3PF9A 3SNHA 3FNBA 4L51A 4RMGA 4R68A 1G2QA 1B6TA 1E1MA 3SJCA 3V32A 1PR1A 1EYZA 2D7JA 1P72A 3DJYA 4CLXA 2ZTLA 5KIAA 3R6WA 4BO4A 3LXUX 2MMCA 3RC2A 1C0IA 1GKLA 4KJZA 3OQBA 2PLNA 1YONA 3WZ2A 3OEHD 4QUAA 3ST7A 3WYDA 1P61B 1RXCA 4YJ2B 2QTWB 3Q98A 1QGED 4IXTA 4LDNA 4XWOA 1U7OA 2AD5A 4NDNE 2PMKA 3PTAA 3JTMA 4ML3A 1E1YA 3STTA 6NULA 4M8IA 4HV4A 5JD4A 4K6HA 1ENPA 2H2AA 4J3NA 2QAIA 1W47A 3F97A 3COPA 4L6AA 1W5SA 4HWGA 4Y98A 5EYPB 5JNSA 4TZ6A 2ORVA 2B2XA 4UAGA 2HIHA 2NTYC 1XR3A 3A4TA 2BI4A 1Z2AA 3H8VA 3PG5A 2X14A 2OB2A 1LPOA 3PDIA 4G89A 3DMTA 3P9ZA 1U5CA 4G8JA 4W9NA 1JV2B 4LUCA 1ATIA 1IYZA 4WIAA 4BKUA 4JI4B 1HLGA 4IKOA 3TRHA 2GEBA 4NTZA 4YRZA 3LG2A 1TJPB 4I3HA 2CLCX 3X1XA 4GI5A 1NFFA 3QEBZ 2NACA 3HXTA 2YYAA 2VYNA 3SC2B 4OHYA 3Q88A 4LC9A 2C8JA 2HDHA 3OP1A 4GMDA 3WYNA 6REQB 1DI0A 2ETVA 3B6ZA 1CC1S 1K5PA 3N39C 2I2DA 4CFYA 3W78A 1NIJA 3FSEA 1QH8A 1IE3A 2NN3C 4OGKA 3G7SA 1SA0B 3JR7A 4BLTA 4IIJA 5BOSA 1J33A 3FHCB 1CULC 5I48A 1YVEI 3GFRA 4NNJA 3O4VA 4XM0A 5DN6D 2H2GA 4Y67A 5KSWB 4HD8A 2Q0HA 5IBQA 3BICA 5HJ7A 1SCBA 5A4JA 2J09A 1N7HA 1DFGA 3QPCA 3EPPA 1LWNA 1XKQA 4UXHA 4CEHA 1KOGA 4R1NA 3PUZA 2I3ZA 5ES3A 3EDOA 5GWXA 1SCKA 2BLLA 5SV2A 1UXKA 2OBYA 4BYMA 4D3FA 5JH7F 2H1SA 1Q7EA 4IXMA 2Y77A 2P9CA 5FI0B 2IYNA 4DCCA 1P7ZA 2C99A 1KP3A 2A9QA 1F2TB 1OT3A 2ZE7A 3BFPA 3B1JA 4IGIA 4PZEA 1GUDA 3CN7A 3TZBA 3D6MA 3L01A 1IH8A 1T6XA 1GQFA 4N0EA 5H80A 4CLRA 1KYWA 1Z5UA 3CUVA 3U7QB 4G67A 4GOXA 4QXQA 3WC4A 2OK8A 1HLPA 3QSYA 1KI6A 4US2R 5IS2A 4I9HA 3AM1A 2FFBA 2ZVJA 3QKWA 4B75A 3P2OA 3LF2A 4BIMA 4ETNA 3H0CA 4IUDS 3R7NA 3U4DA 3B2NA 3U4MA 2P79A 6CHYA 1CP3A 2ZR0A 3GRPA 2OAGA 2DJ5A 2O2GA 3ROMA 2XA1A 2W4MA 3RSCA 1LSOA 3AR9A 2GZSA 4XLZA 4ZEWA 5EIBD 3ODGA 5F1YA 2JH9A 1KDZA 5KNBD 2FXVA 1W25A 2ODAA 1IN8A 1TRKA 2ZRHA 3RFUA 4FFMA 4I50F 3Q41A 2WKSA 4KGVA 2BBWA 4CQMD 2E9SA 2H7YA 4JKIA 3WBKA 5K0EA 1I7QB 2ZRJA 5IEBA 3IVAA 3AESA 3CR7A 3CRQA 3LXXA 5EG5A 3TTSA 1AK1A 3N0VA 3WFZA 1U63A 1HK7A 1ZKDA 3ADOA 3CIFA 3GQBB 3F98A 5EQDA 4BBAA 5K01A 4RACA 3IKVA 5K8VA 4CXMA 1RAFA 3DEZA 3ICPA 4LXGA 1KQFA 3S2EA 4Z4IA 2CUNA 2H1IA 2XUAA 3CCCA 5HKKD 1NUQA 1T9BA 2C3MA 2Q9CA 1E6EA 1UWVA 1SHTX 1ZA2A 5M5BA 3UPTA 4IKPA 3Q10A 3QMMA 3WGMA 2FY8A 3ZHTA 1O96B 4LQDA 1U2TA 3FSGD 5E2BA 2PH3A 4KFTA 3VR3A 2QSYA 1HYHA 2WKWA 2RHJA 1M74A 1PJBA 4CMKA 5HJ5A 3GY0A 2QTVB 3VH4A 1PJ8A 3SBEA 1HMYA 1E79D 1XCPA 1IBCA 4PCUA 4BTLA 3MTAA 3O1IC 3EVEA 4YRRA 2NVUA 1V9SA 5HK8A 5DNCA 1Y1SA 2YUIA 4ODIA 2XT6A 4O59O 4RSMA 2H7VA 1VSBA 3CE6A 5TPZA 1JEEA 1P39A 2BI8A 4UXJA 3CG4A 2IHUA 2UVDA 2GWHA 1SVMA 2PZLA 3G8DA 4GO1A 5G40A 4ZZIA 3RG8A 4RIIA 2GKSA 3G89A 4J0HA 4ESHA 1FRQA 1C7QA 4KH0A 3QOYA 4UDNA