2BBSA

Human deltaf508 nbd1 with three solubilizing mutations
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
283
structure length
253
Chain Sequence
b'STTEVVMENVTAFWEEGFGELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLRPDFSSKLMSFDQFSAERRNSILTETLHRFSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cystic fibrosis transmembrane conductance regulator
molecule tags Transport protein
source organism Homo sapiens
publication title Structure and dynamics of NBD1 from CFTR characterized using crystallography and hydrogen/deuterium exchange mass spectrometry.
pubmed doi rcsb
total genus 87
structure length 253
sequence length 283
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bbsA00
4TLBA 1NLZA 1XTSA 5FL7A 4YQFA 4QHSA 5J47A 1CR1A 2QTFA 4BFZA 5CM9C 1E0KA 1BS1A 1CJUC 1NSTA 3B7GA 5EE0A 4EPVA 2JLRA 5EE9A 2GRJA 2JJ2A 4L5BA 4B2IA 5E95A 1YJ5A 1Q1ZA 4TQ9A 3AF1A 4ZIRB 2UKDA 3EZ2A 4CEIB 1Y63A 3VU9A 3CRQA 2WHXA 3IO3A 2ANCA 4X8MA 3K09C 2O8BB 5JS7A 5KTYA 1XJCA 1ZBDA 3QUSA 2NO7A 2DWQA 4HB0A 4LYHA 4EPXA 4D4LA 3R8FA 1GDDA 3CPEA 2W2XA 2GJKA 1XCMA 2OAQ1 4HAYA 1DOAA 3L8ZA 2FWRA 2ASEA 1E4YA 1KGDA 3SHWA 2IYXA 2PBRA 4OKSA 5P21A 1XB2A 2WWXA 2RCNA 3CLVA 3CRMA 1XPRA 1E79A 1KK2A 1YHNA 4K8OA 3GLIE 1U94A 2JA1A 4NCKA 1ZU4A 2VIIA 1GNQA 2NPIA 3B60A 1A5TA 4Q4HA 3LO5A 4L9WA 4LBWA 2V1UA 3AVWA 5EP4A 4NPHA 4TMKA 1N6IA 3HR7A 5BN3A 4Q02A 2D62A 3QKTA 3SI7A 3FKSD 4F93B 1W5TA 5J4KA 4V0KA 4P0TA 3ZVMA 1FMJA 1ZCAA 4LHWA 3SYLA 4MUBA 4D6PA 2EYQA 4ZCMA 1AM4D 4D26A 4CT4B 5H1YA 1Z0AA 1A7JA 3U3OA 2JLUA 2A3RA 1GUAA 4EIWA 4D4KA 2ZYVX 4BFVA 2AK3A 3OEED 1Z08A 4LX0A 2QEQA 2CCJA 2ORVA 2VSOA 1ELOA 4R98A 4AK9A 4EPWA 1L8QA 3DOFA 3SQXA 1CR4A 2WMOB 1M6NA 3FMOB 3O8BA 3OFND 2W83A 1TUEA 1XXHE 2ZIAA 3H1TA 1FP7A 3NEYA 4I1VA 4LJ5A 1B0UA 1KI9A 1U0HC 2IUSA 4B76A 1GP2A 3LWNA 2FMXA 5BQ5A 2WSMA 4O25A 4TN1A 1Z0JA 2VF8A 4LBYA 3TBKA 1CR0A 4A92A 1GAJA 5EXTA 1KSHA 4K81B 4NTZA 1L4UA 1ZD8A 1T4GA 2G1KA 2VP9A 3UXMA 2X2EA 1W36C 4GBMA 4A9AA 4LSGA 3WP1B 4QM7A 1T91A 1CKEA 1E69A 2QPAA 2VP2A 3NH9A 1Z0FA 3P27A 4IDNA 1W36B 4UNPA 2ZVQX 1IHUA 5CK4A 3B1XA 5HR5A 1OXUA 1Y3AA 3NDPA 2QGZA 3HU1A 2CHGA 3C14C 3U6BA 5EE1A 4DB4A 1Q20A 5FUYA 2I1QA 1SVKA 1GL7A 1SKYE 2Q6TA 4N1AA 3B82A 4DDTA 5CYOA 2QAJA 2ATVA 1G8PA 1NN0A 4FD2A 1KI8A 4AD8A 3RS5A 2ORIA 3RS3A 1HH4A 3VMFA 5FBVB 1RJ9B 3SDZA 5E4FA 5FOSA 3FYHA 1FQJA 2IS4A 1SKYB 4PC6A 1G41A 1XTKA 2DR3A 4A8JA 2WBLC 2ZJZA 4RZUA 4HDOB 2EFGA 1I2DA 1BO6A 3C4JA 3B2EA 1S9DA 2QMUA 1Q3HA 1JI0A 2I4IA 3T1TA 4GL2A 4HLQB 3U3RA 1NMXA 2CCGA 2PZFA 5EP2A 4B35A 5K8IA 2VP0A 2BC9A 1KI7A 2QA5A 5IF9A 2GETA 1RE0A 3ZJYA 1DG1G 2OG2A 2ONJA 1RVDA 3I73A 5FPYA 1KI1A 1VYTA 3VHXA 2OCYC 3ZGXA 4URZR 1VCNA 1ZNXA 2A78A 3ND8A 1E9BA 1M34E 2C9CA 3U4QB 4XVRA 4MGZR 1GNPA 4O0MA 5EE3A 4QOSA 1CS4C 3IIJA 4B34A 4C0LA 4GZMA 4F4CA 1Z3IX 3AVPA 4HAVA 4M1WA 4WZAE 3ZS8A 4CEIA 1DARA 2AWOA 3I1FA 4CEJA 2RMKA 2OCAA 2YOHA 2IS6A 1IY1A 2E87A 3FMPB 3KJGA 2BJWA 4ARZA 2ZEJA 4JLOA 2CL6X 2ZJBA 821PA 2IEYA 3FFAA 3OIVA 1SKQA 4TYQA 1GRRA 2NQ2C 3IILA 3KDSE 4IVPA 1TTTA 5K8UA 4FMDB 1ZINA 4ZCLA 2V6IA 3F8TA 1K6MA 1ZVQA 3AVOA 3GP8A 4C3ZA 1N2CE 4A0HA 4G5QA 1DAIA 1YZGA 1TX4B 2YHSA 2QAGA 4O2LA 1Z29A 2RGCA 1VDZA 3VU9B 1NVVQ 2PH1A 3U7GA 1COWD 4DB2A 1II8A 4II7A 4PZYA 1KO4A 1KI2A 4TYYA 4XVUA 2HF8A 2X8AA 2ZJOA 5DN6A 1DO0A 3DHWC 3WNBA 3V9PA 4DLXA 1E79D 4DCTA 4BRUA 3PEVA 2QN6A 2BM0A 4HYYA 4KBGA 1M1YE 4A15A 1G17A 4GZLA 3TW8B 4A1FA 2H57A 1FFHA 1E2NA 3RC8A 3KQUA 3KKNA 3LA6A 3WXMA 2XSZD 5KHOC 1UDWA 1DTSA 1JBKA 4IEIA 4LGMA 3TK1A 1CRQA 2G1JA 4L15A 2H18A 3A37A 4TTPA 1P9RA 3WP0A 1UF9A 2WWFA 4Q47A 4B71A 3GEEA 4KSCA 1N6NA 1P9WA 2GEUA 2DBYA 2CVHA 1QDEA 2WJGA 4Q4AB 3U60B 3QG1A 1YZQA 2IYWA 1NY5A 3WRYC 1EWQA 4PHTA 2JLZA 1G7RA 3OE7A 4A6XA 1NP6A 4M9XA 2D3WA 1TL7C 4Y0AA 2F1RA 2OSBA 2YZ2A 2ODEA 2WOJA 2AD5A 4IRUB 1G3MA 2PLRA 1ZC4A 4ON9A 2NO0A 4QGHA 3VQTA 5HZKA 4BZXA 4NZYA 1FTSA 1US8B 2C03A 2RHDA 1EFRA 4PSKA 2DFKB 3M1IA 3Q9LA 5C1BA 1YR9A 4HZIA 1BMFD 1XTRA 1N6PA 2B21A 2KWIA 5GJCA 1KMHA 1RPZA 3U44A 3QKSA 3CKLA 3MFYA 2Q9BA 2OEPA 1G4UR 2IWRA 4B32A 4CZ2A 2QP3A 3LW8A 5JMTA 4TT3D 3NBZC 4JBYA 1OFHA 3QKUA 2WJJA 4N0DA 5IT5A 2FH5B 1KY2A 4DCNA 2WAXA 3AKYA 4FMDF 1GL9B 4G3XA 5KO2A 2FSHA 2NTYC 3LRPA 3EA0A 1GKIA 2ZYTX 5LBIA 2CE7A 1LY1A 3MD0A 4OQFA 3FHOA 4AURA 5IRCD 1KMQA 4Q1FA 1G9XA 3LH5A 3RS7A 3SFZA 2NOAA 1AK2A 4PSVA 2QQEA 2R6DA 3U5ZB 1G7CA 1KSJA 1GM5A 3UPUA 1VIYA 2HXYA 2WSSD 3OFNA 1VG9B 1NN5A 2R8RA 2C78A 3CH4B 1QHXA 4LBZA 4LCBA 1U9IA 3SBEA 4DZZA 4DSOA 4L8GA 4ASUA 5BN5A 8OHMA 1RW4A 1QHGA 3GEHA 3A58B 3SOPA 2ZRFA 2HT1A 3T15A 1QG4A 1PVOA 4FIDA 4RD0A 1H65A 1TQ4A 4G5RA 1G3RA 4PAOA 4ACBA 2IL1A 4OL0A 4L16A 2ERYA 4DIEA 3VHLB 2QTVB 4EAQA 1HE1C 2IYVA 4RFSB 1E0AA 2IXEA 2JAQA 3EPJA 4OK6A 5EP3A 1UBEA 1QVRA 1SVWA 2L0XA 2CLCX 2BV3A 3PENA 5FOVA 3ZZ0A 2BJVA 2IA5A 1P4SA 5G53C 2D06A 3QKRA 4HZUA 3FVQA 4PR0A 1J90A 4PPQA 4YDSA 5JSZA 5AWFC 1SHKA 4TL6A 3P20A 4PZLA 2OO7A 1NVWQ 2IYQA 3QKSB 3X1DA 5GVSA 5JSZB 1J8YF 2PT5A 1QHHB 3CZQA 4XWKA 4FCWA 4Q4HB 3DKVA 4O2RA 1HQCA 4M1YA 2N46A 3BJIC 4W5WA 4H9GA 5GJWC 4M8NE 5FR1A 1O87A 3A1SA 2QENA 3QEJA 1R7RA 5FBRB 1Z0IA 4IDPA 2KI5A 3BFKA 4HLUA 4CW7A 1H8HA 2J9RA 1Z83A 4MRVA 5DI3B 3W34A 3NBYC 2R44A 1W0KD 3TUIC 5LB4A 4W5JA 2XTZA 1RKBA 1G18A 2QE7A 2GF9A 4JT2A 4UJ5A 1CLUA 5G3YA 2P6UA 1KDOA 2HJVA 1WBDA 1KK1A 3EAQA 2WICA 4XD7A 5HTKA 4D2IA 3CNOA 2GJ9A 3B1VA 1DPFA 1F2UB 2CJWB 5FBQB 3K0CA 2J7PA 3MCAA 1AKEA 2OBMA 2XSZA 3GJ6A 5EP1A 1ZUIA 2ZM5A 4KYIB 3SE0A 4QBFA 3B85A 3MWYW 1XF9A 4EJSB 4ZDJA 5L3SA 2DYKA 1HQYE 2R62A 3CPJB 2ZANA 4TQUS 2FEOA 3Q7PA 1XDBA 2EFCB 3WRXC 2ODBA 4NCHA 1G20E 4QRHA 3JZMA 2FZ4A 2XAUA 2X19A 4GDFA 2GTPA 1MT0A 1PUJA 3KQHA 4WBSA 3PEYA 3OIUA 4TLCA 2Z6VA 1UKZA 1T3LA 2XXAB 2A5JA 1XFAA 3PFIA 3OIYA 1YVDA 2ZUCA 1JB1A 1AGRA 4ZKEA 3NC0C 4DLVA 2C8VA 3R20A 4NONA 5DI3A 4DHEA 1GL6A 3QE0A 4D82A 2ZRPA 2ZRNA 1U2RA 4LHXA 2W6IA 2WZQA 4EDHA 1U81A 1IJFA 3H0KA 1GIAA 1U9IC 4JIMA 4MRSA 1R0YA 4TQAA 3AVUA 1Z0DA 4Q03A 3JVVA 1C4OA 3K1JA 4RVCA 4LV8B 2K5UA 4WZBE 1JEEA 2XITA 5EXXA 5LDDC 3QSYA 3VNVA 3O8RA 2RGGA 2QBYA 4G5GA 3BH6A 2V7QA 1ZUHA 3KKMA 4KFSA 4B6FA 2ZYWX 4Q1BA 1YZUA 2UZIR 2F1HA 4BLQA 4W9MC 2OBLA 2HEIA 1G19A 3B8HA 1E96A 2QM7A 3MUFA 1P5ZB 1OHHD 1BYIA 1EX6A 4DSNA 5HPYB 4ZO4A 4Q9JA 2OFOA 5SZKB 4AKIA 2RH5A 3KXIA 2ZRLA 3THXB 3GEIA 2B6HA 2VHJA 1XD9A 2J0UA 3NTUA 4LJ8A 3K70D 3LX8A 4DLTA 2J87A 3GQBA 4TYNA 4TZ0A 1R4AA 3K70C 3V4RA 3DKPA 1P60A 3HWSA 4D80A 1VCIA 2AWNA 3C7KA 4PPFA 4D81A 2CL7X 3GJ0A 4F7WA 1XCGB 1V43A 4M9ZA 1Z6TA 4AC9A 4Q7MB 3B9PA 5EJEA 2PT7A 2GK6A 2CBZA 4FI3C 2F43A 1CEEA 1CJKC 1CP2A 5FUWA 4PQYA 5CJPA 2Q0HA 1X8LA 1IN7A 421PA 4HAXA 4BASA 1E98A 4DKXA 3K0SA 4IJMA 2VYFA 4KFTA 4YMWA 3GFOA 3TUZC 1NSFA 2GZDA 4S35A 3CX7A 2GVDC 1TUIA 6Q21A 4CEHB 1KJZA 4PAQA 5JCZA 4Q18A 4GMXA 2ZR7A 5CLLA 1U8ZA 3C16C 2GBLA 1XTQA 4QBGB 1XXHB 4BLSA 2XZPA 4PHGA 1JJ7A 2ZRKA 3WBJA 2O8CB 3BWDD 1O3YA 4LZZA 2VP5A 1NIPA 4JLBA 3GJ8A 4WXPA 4HB4A 4LYAA 4Q4LA 3SJBA 1TQDA 4UXHA 3CNLA 1W0JD 4TMXA 1XTJA 2P2LA 2BKEA 2JASA 2RGNC 3ICEA 1M2OB 4B75A 2J0UB 1ZNWA 3IDQA 2J45A 2QMOA 2NMVA 1E3MA 1US8A 3V4FA 5DO9A 1SXJE 1NG9A 1WDTA 2IYZA 1XNJA 3MWJA 2DPXA 3KJHA 4KITB 4BEJA 2DY1A 5KUTA 4QL3A 5KYKA 5FPKA 3WYAA 3JVUA 2AXNA 1WB9A 2I3BA 1D2NA 2XTNA 3MMPA 5CITA 1P73A 3LBHA 2QP4A 5FOWA 3CIOA 4FWTA 1NJFA 4F4JA 4RD6A 3QVVA 1D2MA 2IS2A 5TB5A 1OJLA 4NU0A 1H8HD 4BFYA 5JHHB 2DWOA 2OXCA 3PV0A 4E09A 3IKJA 2PX0A 1ZC3A 4OI0A 4D0LB 1MV5A 1NJGA 5J4YA 1XPUA 1XPOA 5AJZA 2FFHA 4OQXA 2XJ9A 3MSXA 3TSOA 3RRZA 2QPTA 3IPXA 4PPNA 5D3QA 3ZIAA 3TJZA 4PXAA 2CNWD 3EWSA 1JJVA 3GLFA 2HLDD 4AKEA 1DELA 1UEIA 3E5HA 4WXRA 4GOKA 2H8KA 2PZEA 2IF2A 3K0EA 1T8UA 1ZM2A 2EVWX 3CZPA 5C2JB 4URWR 3O8DA 2R65A 4DEXA 1YZTA 1OH6A 1UKVY 4ESHA 1JECA 3AVXA 3PUWA 3FB4A 5FBWB 4A0GA 3UK6A 3GMTA 4NCJA 2CL0X 4EQ6A 4FINA 1IY0A 2BWJA 4I1UA 1V5WA 2FX3A 2ZU6A 4IFBA 3W6NA 1R10A 1F2TB 3KXKA 4MYTA 4I1OA 2PEYA 4RKFA 4S2EA 1AA9A 3EZ9A 4ASUD 4KLNA 3ECCA 1LB1B 1F2TA 1JPNA 1IN4A 4MKIA 1J99A 4LRWA 1VTKA 1G64A 3DO6A 5FTNA 4XWAA 1UBFA 1R0ZA 1X1SA 1S4QA 2BOVA 1LFDB 1W4CA 5JI2E 4Q7JB 5E7IA 3JZAA 2NGRA 4JLMA 3A4NA 2XTMA 3K8YA 4LOAA 3SQWA 4YMVA 2IS1A 1ZNZA 2P3SA 3BGWA 3CR7A 4I4LA 4V02A 1VPLA 2G0TA 1VYUA 2CXXA 121PA 4G5SA 1P2SA 5KSYA 3KKPA 3GJXC 4G0NA 3EPKA 3ADDA 4D4MA 2JDID 4KU4A 3AKCA 2RGNA 5JWHA 4MGKR 1N0UA 1GWNA 4B6EA 3K53A 1T9HA 5FOXA 2ZJ5A 4TMTA 3PXGA 1FP6A 1MRNA 4DEYA 3ADCA 1BH2A 1FMLA 2IBMA 4JYCA 5B57C 2GF0A 2RHMA 2YYZA 3MGCA 2PCLA 2YWGA 3DVLA 1YR6A 5TXGA 1NNEA 2H5EA 2YWHA 3GJ3A 3EIQA 3U4QA 4Q21A 4F91B 5AR1A 4ZDWA 1NF3A 1WQ1R 1E0JA 1Q1QA 2H17A 3P4YA 1CTQA 4FCVA 1AN0A 1DEKA 1A4RA 2ZRBA 3CX6A 2AFHE 2BCJQ 2UZ3A 2QORA 3T61A 3TIFA 1P3JA 5DISB 1E32A 2ZR0A 1U0JA 3RHFA 5HKKA 1ZP6A 1DS6A 3TR0A 3A4MA 2J7KA 5KSOA 1NI3A 3C15C 1FQKA 1NG1A 5GADl 4BFSA 2A5YB 4C0KA 3ZD7A 1S9HA 3AB3A 3PITA 3Q5EA 3SJCA 4YLGA 3A1UA 1R5BA 1P72A 1B23P 3IBGA 3T06B 4NKRA 4FMCB 1RC8A 3EC2A 3EX7C 4JKYA 5SZIA 4BECA 1WRBA 3GFTA 5A5GA 3AF0A 1PLJA 3HYTA 1RZ3A 3I5YA 1P2VA 3NH6A 4KO8A 4LJ9A 3OEHD 3UANA 3LXXA 4M1KA 4BE7B 4NDZA 1G6HA 4IOKA 2REBA 1RRGA 5LD2B 2CMKA 5KDLA 2VPPA 1Z07A 1S3SA 1H8EA 1SZPA 5AJWA 4QGGA 4M0LA 4PX9A 3REGA 3IPYA 1Q22A 2HJGA 4AI6A 2VHQA 2ZAMA 4A82A 1AS3A 1E9CA 1KIMA 4YDHB 2FNAA 3CB4A 4GMDA 4DDWA 3DM5A 4P4SB 1W4BA 1NLYA 4Q9IA 2IUTA 1AIPA 2I1VB 5F9FA 2RGBA 5AUQA 1NMYA 4YC7A 4D0NA 4TSFD 3VKHA 4CDGA 1OKKA 1TEVA 2O5VA 2VRWA 1EFRD 1R2QA 3FMIA 3KX2A 3LV8A 3LD9A 4DLSA 3EPHA 1ZU5A 2W0SA 2V6JA 4QBHA 3HR8A 3RAPR 4CIDA 2WKQA 2ZRDA 4OK3A 1CJVC 2EFHB 2JJ1D 4JLDA 5IDVA 3HU2A 4EPYA 5BN4A 1PZNA 3GLGB 4HAZA 1T0HB 4HATA 1LF0A 5IHPA 3VX4A 2R9VA 3FGNA 4RJLA 5EZ5A 3W90A 2GXQA 5DSZA 2YWFA 1D8TA 221PA 3VFDA 4B3BA 4XTRA 2E1RA 4NYJR 3PR1A 2QP9X 1XRJA 4V0ME 4BWYA 1OH7A 2W00A 3ZH9B 2QRZA 2J0QA 2B8WA 2C9OA 1XEXA 2JLYA 2ZRIA 2ORWA 2W58A 3KXLA 1IN6A 1T3HA 2BDTA 2WWGA 5JHGB 2OT3B 2FV8A 5FI0B 1W0JA 2QNRA 5ANRB 3DMDA 1DAFA 3FHCB 3M0EA 3G82C 1OFTA 2ZRAA 3QXSA 4DSUA 3FWYA 3TRFA 5CDFA 3T12A 1BIFA 3TNFA 1S8FA 5FBLB 5HZHA 3BH7A 3W5IA 2XNSA 1R5NA 1VMAA 4OBEA 1OF1A 4GRAA 3WYGA 1OB2A 4YMUA 3BBPA 4EJSC 4HLUC 2XZLA 4QBIA 1NL3A 3LBIA 1YZNA 3BRWD 3R7WB 4DLUA 2JATA 1EGAA 1NRJB 1AKYA 1KK0A 1FUKA 2AHOA 2R6GA 2V1XA 3O8CA 2Q9AA 5KNDA 2ZYUX 2YKGA 2WMNB 4Q9KA 1Z2CA 1YZKA 2W0MA 4CEJB 3QG5A 3N2EA 4M9QA 4RZXA 3IEUA 2ZRMA 4QGAA 1SGWA 1ZM7A 3AP1A 4NYIQ 3I72A 3HP1A 5DYIA 1UEJA 3THOA 3FOZA 4BFXA 4MDEA 2EWWA 3TVTA 2O8FA 3LLMA 4MYCA 3QPVA 1XEWX 1YKSA 5L3VA 1RRCA 521PA 1OXXK 5J4VA 1UM8A 2ZJ2A 3PEWA 3IHLA 4HAWA 4GOJA 5TVKA 4OQNA 2PZGA 1KTVA 2VQSA 3GLHB 4LJ4A 5H70A 5AK0A 4X8OA 2DFLA 2OE2A 3L43A 5TY0A 2XNDD 4AG6A 4AY2A 1UKEA 4US1R 5C18A 2B7BA 4LHZA 3GLIA 3A1VA 4AYWA 2A5GA 3BC1A 3IO5A 5FI1B 5JFGA 3WMEA 2BBWA 1I4TD 5F3WB 4TYWA 1W48A 3A36A 4OHZA 5E7JA 3D7MA 1J7KA 3TVDA 3PUZA 4DLWA 4AKGA 5LD2C 1DVRA 2G88A 1QHHA 2QE7D 3SYNA 4DDVA 2IXFA 4PFSA 5FTKA 2V9PA 1Z5ZA 1COWA 2C96A 4LPKA 4DT1A 5J4HA 2FEMA 3IIKA 5A0FA 2O8DB 2FE4A 3KUDA 2QMHA 3S1AB 3REFA 3LXRA 2VP6A 4Z54A 4HEJA 5AJYA 3B1ZA 5FPHA 5B58C 2JLSA 3WYFA 2P5TB 2Z83A 2A5DA 2YV5A 5L8VA 3RVBA 2GXUA 3T1QA 1E2MA 1XXHA 1FZQA 1EFTA 3SS8A 5LPNA 1EFCA 2VHUA 1NLFA 2C77A 4V0OA 1WA5A 1N6OA 1G1MA 4FN5A 1UJ2A 2HT6A 3RWOA 1HA3A 3GLFE 3HPRA 2ATXA 3W3AA 5C4MA 3ZZUA 2ZRHA 3L0IB 3BD9A 2O8EB 2QRNA 1XMVA 1BMFA 2D2EA 1Q1EA 4KFRA 4QG7A 3R9IA 3TMKA 2O8EA 1RFLA 2F1IA 3TSWA 2YNMA 4DRZA 3DDCA 4N0EA 2ODWA 1KOFA 2ZRGA 1ZD9A 5TMPA 3ICQB 4BLPA 3U6KA 1TMKA 2D74A 4B43A 1AQUA 3BS4A 3AVVA 5DLQC 2JJ2D 3PG5A 4A0FA 2UVQA 5F9HA 1HE8B 1VKJA 4IHQA 2A30A 5HKKD 3BK7A 2E9SA 4Q5IA 2P0EA 4JMPA 2IX3A 1XJQA 1ZMXA 3SJAA 3KJEA 3P32A 1WCV1 2AR7A 1NBMA 3RYTC 4M53A 1U99A 4LV6A 1SHZA 4XVQA 3T5DA 2FFAA 4U5XA 4KBFA 5JEEA 1G7SA 3GLGA 4WIAA 1T5IA 1JXMA 3LVRE 1U98A 4A0RA 1HUQA 2Q3MA 2X1VA 4H1VA 2ZI5A 4CYMA 5B30A 2GK7A 3F5FA 1DE0A 3S1AA 3X1YA 4JT4A 2Z4SA 4MH0R 4MRPA 4XH9B 4BLOA 3KKQA 4QJ3A 2PJZA 1DAEA 3EIEA 4ZV4A 2W2VA 3A8TA 3CNNA 4CT5A 1IOZA 1EWRA 5E7MA 3ZDQA 2ZJ8A 4C0SA 3VR2A 2Q21A 4EQ6B 2ZJYA 3WMGA 4WZ6A 2C95A 2XX3A 1E9SA 1W36D 4B3DA 1J2JA 2FSFA 1E1QD 1F3OA 3PUVA 4Q1DA 1XU4A 2MSCB 4FW9A 1Z6AA 5DGXA 3Q85A 3WY9A 1EFUA 3KFVA 4QKQA 1OT3A 4OHYA 3R9XA 2REXB 2CHVA 4US0R 1NBME 2GA8A 4OYHA 4WAUA 1QZXA 1SVLA 3KB1A 3VR1A 2OHFA 4Q00A 4ZI3A 1TF7A 2R2AA 4C2UA 2V7QD 4Q9LA 5AUPB 2BM1A 3MG9A 3QXHA 4OHVA 4OK5A 1NVUQ 3AV0B 3MWKA 4RD2A 3RS2A 1IXSB 2ZR9A 1X8JA 4FWIB 2PEZA 2WM9B 4JLKA 2J41A 1W1WA 5J5CA 5BW8A 4CEHA 1E1QA 2GESA 1G6OA 2IHBA 5L3QA 1UPTA 1DBSA 5KPDA 1OXSC 3ASZA 3EZ7A 3MRSA 2BBTA 1X1RA 2GHIA 5CJ2A 3I32A 2A9KA 1Z6XA 5FOTA 3BFVA 4U00A 1LS6A 1W2GA 3Q7QA 1OLOA 2JCSA 3OHMA 3WHLA 4TZ6A 1S3GA 2YINC 1IQPA 1HV8A 3RLFA 1Z63A 2C04A 3NBXX 4KSBA 1JXOA 5JRZA 2GWHA 3KQKA 4BFWA 5JCPA 4MDFA 3QI2A 3NWJA 1KYIA 1HT2E 1JNYA 3NC1C 1KO7A 2ZE8A 5B64A 3KJIA 2CHQA 3NDBB 4US2R 2P67A 4PAMA 1KHTA 3IQWA 4R71A 2HCJB 2W2TA 3TE6A 1VHLA 4P4SA 1MOZA 4C2TA 2PLFA 1QF9A 1D2EA 3OE7D 1KKMA 4UXJA 1DAGA 3TH5A 3IIMA 1KI3A 2AK2A 3BORA 4IXMA 2HDNB 4G01B 1K8RA 2LWIA 2GKSA 1M7BA 2D4HA 2NG1A 4NCIA 2JJ8A 5EQTA 3RANA 4EUNA 1FOEB 1TF2A 2PMDA 4GI7A 1A2KC 3A1WA 4P4TA 1OV4A 5FFMA 2C2HA 4P32A 5JEDA 2YJTD 3BIFA 2AKAB 3AUYA 3N2IA 5J40A 3ZVLA 1LTQA 1NY6A 3CF2A 4KODA 5JECA 1A82A 3VX3A 3BOSA 1FX0A 1DAMA 4JJZA 1UAAA 2CK3A 3NHAA 3CRRA 3RS0A 1OYYA 2O8BA 2FPMA 4GFDA 5DHAA 1OW3B 5GVRA 4P31A 1BOFA 4YONB 1GZSA 2QGNA 5FH9A 3P26A 5L3RA 5CB6A 1FL9A 1ZW6A 3THYB 4NYMQ 2IUUA 2VSXA 4NYMR 3ADKA 3NG1A 3UATA 2CCKA 3SN6A 1S1MA 1G8GA 4ACAA 4O3MA 1MO5A 2VP4A 1RJ9A 3H4MA 2ZI4A 3BERA 3K9GA 5B2ZA 2R6AA 3CONA 2MSEB 4PSAA 3A4LA 3C5HA 3RRYA 4IDQA 3TLXA 5KU1A 3K70B 1JQLB 4Q01A 3KTAB 1Q57A 1XZPA 1KSFX 2OCBA 2FU5C 4BZPA 3CWQA 3QXCA 5HE9A 3RC3A 4AYTA 3CX8A 2NZ8A 4V0NA 4C7OA 2P5SA 2R6FA 3CW2A 4BFUA 3SYKA 1ESNA 4EFNA 4DLRA 4NH0A 3FKQA 1E2EA 1N5LA 4QHYA 1CULC 1KO8A 2DWPA 1QHIA 1G5TA 4BQSA 2WOOA 1X6VA 4QNMA 2SHKA 2IXGA 3KFXA 4I99A 5HE8A 2F6RA 2IC5A 3CBQA 4XSHA 3VR4A 3AVYA 4L9SA 3T34A 2KSQA 3QKRB 3CF6R 4LJ6A 5KDOA 2ZAOA 4WVFA 4CGZA 2ONKA 3K9HA 3Q5DA 1R0WA 4Q19A 2YOFA 2KBFA 5FPTA 3I92A 3L0PA 4UNQA 4OI1A 2HXSA 3RRNA 4A2WA 4RD3A 3KKOA 2GCPA 4JLPA 4Q1CA 4FXPA 4DDUA 2OFXA 5FR2A 4RFVA 2DHRA 2ZSDA 1IXRC 3L0SA 4I81A 1E2GA 3VNUA 4RY2A 3QF4A 4FCTA 4JVNA 1XX6A 1NN1A 3ND9A 2BCGY 2VHCA 1P75A 2QL6A 4RCZA 1I4LD 4D4JA 2N1BA 2AKYA 4B33A 4LPSA 1EFHA 1NVVR 3UWOA 3FPAA 2IWHA 3NVAA 4POAA 4OI4A 1Z0KA 4MRNA 4X8HA 1IN5A 1HT1E 3ZZTA 4BEBA 2ZE5A 1IN8A 3LY5A 4HLCA 3O47A 3BB4A 1XD8A 3K0CC 3DEFA 4LJ7A 1OXVA 3FTQA 1Q21A 2O8DA 4Q1EA 4AKHA 3QNUA 4M2LA 1F48A 1UDXA 3IHWA 4LK2A 4DIDA 3GJ7A 4BLRA 4D0GA 1GSIA 1OYWA 621PA 1TQ2A 3CWZA 1ZRHA 2ECKA 4DC9A 2LKDA 3RDPA 2ZRCA 2ZVPX 4ZDKA 1P61B 4B3CA 4C7OB 2CLDX 4LY6A 3A1TA 5LB2A 4AG5A 2FZLA 4U7DA 4R2IA 2B8TA 2OILA 3X1XA 1SQ5A 2ODNA 3MJRA 3GLHE 4MKFA 2DFTA 4TLAA 1KNXA 1NIJA 2VSFA 1E2PA 1TQ6A 2IW3A 4JYBA 2DB3A 2G6BA 1PV4A 1MH1A 3CR8A 1P6XA 4EPTA 4OQMA 4QNRA 1GITA 3K0FA 2VEDA 4PHHA 3QF7A 2JDIA 2YC4C 3UWKA 3L82B 2IK8A 2QT1A 4EJSA 2F43B 2O0KA 3LQRA 2FGJA 2GCNA 2JLQA 2IEZA 3AKEA 3EC1A 3QPUA 1OHHA 4DWJA 2GCOB 3GLGE 2JJ1A 1E9FA 1G3IA 4NHOA 4IXNA 4UJ3A 4JL8A 1MABB 1T6NA 2BKUA 3ZD6A 1KMHB 1N5JA 3U7EB 4URUR 1MABA 3I61A 3LBNA 4QGFA 3U3KA 2OZEA 1OE0A 4PC2A 2C99A 1E2IA 3RRMA 3VKGA 4IKEA 3KQNA 3CO5A 1YRAA 2RGDA 4PO8A 1JR6A 2PMKA 1W2HA 5SZHB 4D25A 2QPOA 1AS2A 3GD7A 1Z06A 4LDJA 3QPWA 3RNLA 3QBVA 1UADA 4PTLA 5G3ZA 2ZI6A 4F4IA 1JPJA 1VHTA 1HY3A 4JLJA 3IQXA 2WJHA 1QRAA 1VIAA 2VF7A 2GAOA 4Q4AA 2GDJA 3CPHA 1RIFA 4QXAA 2VTKA 4BLTA 3A6PC 2NIPA 3D8BA 2FG5A 1U0LA 5JJLA 3TW4A 4TTRA 2WKRA 3FHTA 4EKDA 1XMJA 4RFSA 3HJNA 3L2OB 1YZLA 4UXIA 2VLIA 1G3UA 2Z0MA 1IONA 1MO3A 4HI0E 1G5RA 1JR3D 3D31A 5E3HA 3LFUA 3KTAA 2H7VA 3DL0A 1Z2AA 5K8LA 1ZM3A 1Q12A 2G77B 5EXPA 1OFIA 3THWB 4PC3A 3W8RA 4XIGS 1KI6B 1VCOA 3W9YA 1T8TA 3THWA 2F9MA 4Z8XA 2QAGB 5G41A 1S96A 1F2UA 1A2BA 2N42A 2JGNA 3SFVA 3THXA 2OESA 2WSSA 5SZJA 3TR5A 1OH5A 3EASA 1LF5A 3TAHA 4AIIA 5M04A 2GEVA 1XD2A 5DI9A 3EPLA 4M1TA 3LAWA 4JSTA 4U02A 3H86A 4HDQB 1A1VA 2F3RA 2WJIA 3W6PA 3B6EA 4HB3A 2FPKA 4TLDA 3NIBA 3KZ1E 4E03A 3U44B 3D3QA 2HF9A 2GILA 4TWZA 3FFBA 5AJXA 4C0BA 1SXJD 1TPZA 1CXZA 1P9NA 2NZJA 4V0MA 3DMNA 3GLHA 4DCVA 3CH5A 1UKYA 4HUQA 1E4VA 4J0QA 1GKUB 1G8YA 3BB3A 5K8TA 3PJRA 3QF4B 2A5FA 4JL5A 2ZUBA 3EARA 3TUJC 2Q3FA 3RWMB 3P4XA 3SC3A 3IEVA 4CF7A 2W6JD 3TAUA 3EG5A 1L7VC 1IXZA 2YVUA 1G8FA 1OXTA 4PHFA 1R6BX 3E2IA 3MLEA 1D5CA 1P2UA 1L4YA 1NMZA 4KVAA 4ITRC 1VCMA 4WW0A 3QEOA 2IT1A 2ZUDA 2J3EA 3NHBA 4OI2A 2RGAA 4X8LA 5AUNB 2GNOA 1GRQA 3T35A 3UIEA 1LS1A 3QY0A 1FPMA 4RD1A 3OAAD 4LWZA 3QVUA 4BUJA 3B13B 2P6RA 2CDNA 5L3QB 4KAXA 3SEAA 3GCGA 3Q8XB 5CIWA 5FUVA 1X8KA 3IGFA 2ANBA 1GVNB 3ADBA 3SNHA 1CJMA 1XJ0A 5CB8A 3F3YA 2Z43A 2LCFA 1I4DD 2QM8A 4GT1A 4PC1A 1IAQA 4HLDA 4B48A 1AS0A 4G5OA 2GZHA 2VO1A 2J0SA 2V8OA 3LX5A 1DO2A 4KYUA 5JS8A 4JL6A 1P62B 4R9UC 3I5XA 3U7HB 3TKLA 2ZI9A 2FGKA 1XTIA 5KNCA 4ILEA 1E1RD 1DG3A 1U8YA 1R5OA 3VR5A 1OSNA 4XWOA 1FW6A 3WBKA 4DUGD 2ZSBA 3ZVRA 4IVRA 4JBXA 1D9ZA 3C41J 4KJZA 3VKWA 4TL8A 1OPXA 1KAOA 1WXQA 3ASYA 4C0QC 5DYGA 1MO6A 4KLZA 1WE2A 3L0OA 1F60A 1AGPA 3EXAA 1CJTC 1XZQA 4FMCF 4AYXA 2B7CA 3GJ4A 1XWIA 4W7SA 3K9NA 1C1YA 2ZETA 3ZQJA 4HUQB 1Z8FA 4QJ5A 5KDDA 5KOYA 2QUZA 4LBVA 5CK5A 4KV9A 1W49A 4Y0VA 3DM9B 2ZRJA 4JVMA 3QBTA 3SU8A 5FL7D 4B3GA 3IUYA 1XD2B 2F7SA 3EZ6A 4B74A 1E9EA 1KO5A 2BVNA 2C98A 2ZI7A 4HSEA 4KVGA 2AL7A 1QHSA 1ODFA 1QHNA 2X77A 4GSYA 1EG7A 1KNQA 4BGDA 3I8XA 3LLUA 5DNYB 3FE2A 3H2YA 2BMJA 4M1MA 3AKDA 4PQRA 1HEIA 2CK3D 4Q66C 2NO6A 4UNRA 2X2FA 3ZLJA 2HCBA 5DH9A 1JAIA 2GZAA 2RAPA 3OF5A 5AUOB 1ONBA 3X1ZA 2J7PD 3T1VA 2JLVA 2IYLD 2H16A 2EQBA 4JZKA 2QSZA 4XD7D 2PX3A 3U2QA 2XXAA 1GTVA 3B9QA 5F2EA 1YU9A 3T5GA 1WBBA 2EWVA 4RSGA 1TU4A 1SVMA 1WF3A 3MJHA 5H68A 1QG2A 1E9AA 3UG6A 5JWOA 2IHYA 5CM8B 2W6ID 3NXSA 4Q1AA 1N6KA 2F9LA 4B3XA 1MR3F 2G3YA 4IVQA 1AZSC 4TSFA 4CRWB 5JI3E 2ZREA 4KI0A 3V00A 1XEFA 3VAAA 1U8AA 1KSGA 4ERNA 1LNZA 2QI9C 1E2QA 1XBTA 1E99A 3ZVNA 1Z6YA 3I3SR 4RZ3A 4QFMA 5KSZA 2ZU0C 4R2HA 3PVSA 4P33A 1H8ED 4TTQA 3HDTA 4DCSA 5EUQB 2QT0A 1TADA 1F5NA 3AUXA 1AJEA 1E2JA 3N5CA 1K5DA 1IY2A 3FDIA 4OJKA 3N70A 2B92A 3KB2A 4YMTA 5DE3A 4XTCS 5CYPA 3OZXA 1GKYA 3B1YA 2FFBA 1LW7A 4Q4JB 1ZM4A 1KY3A 2ZSFA 2ZS8A 4R7ZA 1R8QA 2V54A 4DSTA 1QBKC 4ZCIA 1KDPA 5DN6D 3ZS9A 2IYSA 4Q48A 2BEKA 3DZ8A 1GOTA 4B3FX 1TF5A 5G40A 2OFWA 4EFMA 1W0KA 5GJVC 1OIWA 3FMFA 5BYKA 4NP6A 1SVSA 1OFUX 1TNDA 4A36A 4JSYA 1L2TA 4HDCA 4RCYA 2IYTA 2Y8EA 5FTLA 1QHYA 1UBCA 4UNSA 1E2KA 4YXWA 2AXPA 2G9NA 3GPLA 3OEEA 1G3QA 4ESVA 2CEAA 1U90A 2BMEA 3WHKA 2QG6A 5H8WA 2NO1A 4UKDA 4RKEA 1ANKA 2HYIC 1W5SA 2PL3A 4NMMA 3EZFA 2F3TA 1UFQA 2MSDB 1PUIA 2OBNA 3K09A 1SXJA 5FTJA 4A4DA 1RYFA 2AD1A 4LC0A 3BB1A 4UNNA 2AFIE 3RSLA 1YRBA 4E07A 1XMSA 2Z5FA 3HPQA 4PZZA 4Q4JA 3LDAA 3AGQA 2AX4A 4GPTA 5BYJA 4AWXA 3EW9A 4F92B 4N3NA 3QJYA 4KFUA 3H84A 1CBUA 5CDFE 3G5UA 4RD4A 2XEXA 2VA8A 4IOLA 1UBGA 4MRRA 2FJUA 1YR7A 2QQ0A 4JKIA 3B5JA 4MYHA 5CIQA 2O8FB 1RYHA 1KJYA 1JR3E 2O0HA 3WNCA 5EXSA 3PUXA 1VECA 1G16A 3J81k 2FA9A 2D7DA 4DCUA 2EW1A 3I62A 5J4LA 1VG8A 4Q7KA 1IM2A 1JALA 1S0UA 4MKHA 2Q3HA 4Z1MA 1JEDA 3E70C 1KKLA 4B44A 4M4SA 4V0LA 3TQFA 2D7CA 2ZJAA 1W46A 4M21A 3AP2A 4GP6A 2ZROA 4TYPA 4PPGA 2QTHA 5EZ6B 1OB5A 3TQCA 1N5KA 2MMGA 5JJIA 2WIAA 1XP8A 2YOGA 1OKKD 1KDRA 5JZVA 3OESA 2A7QA 1E9DA 3BH0A 1NVXQ 2J0VA 4DBLC 3LVQE 1N6HA 3PUYA 1J8MF 1E1RA 1KZ7B 4JLAA 1PLKA 3CUEF 4FMBB 4A2QA 3THYA 3QQ5A 2DFNA 2P65A 3GFPA 5FTMA 1PLLA 1TEXA 2EU8A 3VR3A 2FSIA 4A8JB 2F1JA 2OM2A 1W4AA 2FPLA 3EIHA 1Q1BA 3MWLA 3NEJA 2GXAA 1EX7A 5JWRA 1X86B 4OJQA 4HUTA 4DT1B 1N6RA 5KPJA 4BRWA 4BFTA 3DPUA 4C30A 1TAGA 2VL7A 3IBYA 4HB2A 2QSYA 3QXXA 2BHRA 1W47A 3DZDA 1G291 1M8PA 4TMWA 5BWMA 4K46A 2DCUA 2FSGA 1E2FA 4EPRA 2ERXA 2O8CA 1II9A 3Q72A 1VG0B 4JVSB 5IK2A 2HUPA 4A8JC 1M7HA 1W7AA 1E94E 2J1LA 2JIZD 2CLSA 4PO9A 2FDCA 1ZD1A 1T0JB 2WAYA 3T1OA 1XEWY 3R7WA 1XCPA 5F98A 2XB2A 4MQBA 2G0NA 4NL4H 2JLWA 2KBEA 3HU3A 3LNCA 4I1SA 721PA 5DHFA 2ZSEA 3L8YA 2WKPA 4YMSA 3ONWA 2QBYB 3KQLA 5IK2D 1ZM9A 4ARZB 4B73A 3M4YA 4C4PA 4EFLA 1FNNA 1IJEA 3G0HA 4DXAA 1AZTA 1E6CA 5JLJA 1RRFA 4PC7A 2GJAA 2WJVA 2W6JA 5JBQA 2WJYA 2Z4RA 3LW7A 4QM6A 2BBSA 2KB0A 1WP9A 3U3JA 2O0JA 4B47A 5HCIA 3AEZA 1EK0A 1LVGA 3CF0A 3EWAA 1FX0B 1N3BA 2EFEB 2CNWA 4QHTA 3GLFB 1KO1A 3K9LA 1FTNA 2KJQA 1QVAA 1SXJC 1F6BA 1N25A 2OAP1 1DAHA 2ZQ5A 2FOLA 4URXR 4QC2A 4LC1A 4NE2A 4NYIR 3RSOA 2RKOA 3B1WA 4Z8YA 5KNBA 3SJZA 1GFIA 5AJVB 4MUAA 1IBRA 4JBWA 1PJRA 4JLVA 4MGYR 3KL4A 2J59A 4LJAA 3ZIAD 1T5LA 2WPDD 3SHFA 5HCNA 5EE5B 1XMIA 1NBMD 2PCJA 5C46F 2P6NA 4P3YA 3AVTA 1I2MA 1VG1A 5TDHA 1YE8A 5BXQC 4HZUB 4OHXA 4KHZA 3UMSA 2XB4A 3C5CA 4URYR 5FOUA 2JIZA 4E5UA 2WVJA 4V03A 1KZGB 2YWEA 4L4UA 2WWYA 3BAFA 4KCGA 5C4GB 2WWIA 3C8UA 2YC2C 4G1UC 2XNDA 3ZYCA 4BZQA 3U3MA 3CRW1 4TMZA 4DVGA 4LUCA 1N6LA 4MKGA 2FFQA 4TLEA 5A4JA 4XOIA 5ELXA 2XGJA 1K5GA 2C5LA 2H92A 3QXJA 1MKYA 2KE5A 1G7TA 4IDHA 4JLNA 3RS4A 3F0TA 3W3ZB 1JQJC 4B2LA 3D6TB 2ZITA 1ZIOA 2RB4A 2IYUA 1Z47A 1GG2A 2OCPA 2ZS9A 2PJRA 2WWWA 1MRSA 1YR8A 1MO4A 3ZQ6A 1TU3A 2J5XA 5DIFA 5JRJA 1ZYUA 1KAGA 2OLJA 1II0A 1OH8A 2HLDA 3AH8A 1R8SA 2OV2A 3AP3A 2R6CA 5TARA 3TSZA 5CLQA 4IW3B 1II8B 4DUGA 1NN3A 2J46A 3AF2A 4LI0A 1JAHA 2QY9A 1ZIPA 5L3SB 2HYDA 3P1JA 1CU1A 3VR6A 1Q3TA 1E2HA 3U7FB 2A2ZA 2ZS7A 2OLKA 2CJWA 2AN9A 2C9YA 4Q7LA 4Q9HA 4DLYA 4RZ2A 1OIVA 4NBSA 3BFXA 2G83A 4ZKDA 4F38A 3NBFA 3QENA 1LV7A 2ZSAA 1G8HA 2TMKA 3UMRA 4M1OA 5GJBA 2VHTA 2IYRA 2V55B 3I4LA 3AGPA 4UQOA 2NO9A 3W5JA 3WNDA 4NCNA 3RABA 1EESA 1KI4A 2ZE7A 2BIFA 1R0XA 2GJ8A 2VH5R 2OXRA 3X2SA 5UKDA 3TGPA 3QOFA 2RGEA 1D9XA 1G5PA 1XEXB 1GRNA 2O52A 3R9WA 2ZTSA 2QZ4A 5D3MA 2XZOA 1RRPA 5FUXA 4M9SA 2XOKA 4MA4A 4ZPXA 2BBOA 3UKDA 4LHYA 4IEEA 1ZJ6A 2D2FA 3OIWA 1Q44A 2XOKD 3PCRB 3AF4A 4HAUA 1ZNYA 4MGIR 2BEJA 1SXJB 4LYFA 2ZI3A 3KUCA 4XJXA 4LHVA 2NPFA 1GILA 4M22A 1X3SA 4IDOA 1HTWA 5KSPA 4LJYA 3I8SA 4OQLA 4PO1A 2GJSA 3HYRA 4WA7A 1ZAKA 2REOA 4H1UA 2CE2X 5FL3A 4NYJQ 1W44A 4KXFB 1E2DA 3K0FB 1WMSA 1KJWA 1JR3A 1N0WA 2IYYA 4W5HA 3PQCA 2JEOA 1Z28A 2WPDA 2QAGC 4IOJA 2RGXA 3UG7A 4YXWD 4TL7A 2GBLC 1P7CA 4LYJA 3ETLA 1M74A 4GNKA 2IF0A 2MMCA 4JJKA 3NKVA 1DAKA 3SZRA 1N5IA 4Z51A 1FUUA 2EYUA 1CF4A 2EFDB 2WIBA 1HURA 1Z22A 4MITA 1S2MA 4TMVA 4WOPA 3AQ4A 4GP7A 1KI6A 2XJ4A 4C0AC 5D3MB 4BPBA 4ZIRA 3DOEA 4ABYA 2GAAA 4DJTA 2JLXA 2LKCA 1E9RA 2GCOA 1G21E 4C0JA 1SULA 1D6JA 1E0SA 3Q3JB 4E22A 3PIRA 3R8CA 4ZI2A 1BKDR 1VYVA 4ZDIA 3OAAA 2FN4A 1ZUNB 3X1WA 4PQFA 3SBDA 3K0AB 4A6PA 2QROA 3OEHA 1M7GA 2GXSA 1E2LA 2CVFA 2BMDA 2BMFA 3VTKA 2F55A 1YQTA 3K0AA 4TL9A 1HYQA 2VBCA 4JS0A 4PANA 3EA5A 3M6AA 4GOXA 4C0HA 2ZE6A 3BXZA 1GNRA 1N0VC 2QMEA 3U61B 1KK3A 2WWHA 4XSGA 4JVLA 4Z1MD 4M1SA 3AVQA 3CM0A 4IOMA 4DLZA 3CRVA 4OHWA 5FPSA 1C9KA 4B2PA 2HV8A 1CRPA 1NKSA 2FF7A 5EUMA 2WTUA 5TV2A 1ESMA 1J70A 2H1LA 2OUKA 2V4ZA 4IFEA 4LV5B 3WMFA 1S1CA 4A2PA 4MYUA 4URVR 1T3SA 3FKSA 2GEDA 3BE4A 1CIPA 2QU8A 3AF3A 3MAAC 3W8NA 1OIXA 1AQYA 1DADA 1KDTA 1FNMA 3GJ5A 4TT3A 3AM1A 1ZCBA 2WV9A 3B78A 1NKTA 2ZPTX 4C9BA 1CR2A 4CVNA 2Q9CA 3GLIB 1SVIA 3W6OA 1EXMA 3LQQA 1G4AE 2GVZC 3QIAA 1P2TA 1SVOA 3E1SA 3PEUA 2ZXUA 1Z6GA 5JJKA 3UMFA 1ETUA 1W4RA 4P4UA 1BYUA 4QJ4A 1Q0UA 2V3CC 3SR0A
chains in the Genus database with same CATH superfamily
3GPBA 3UB4A 4YQFA 4QHSA 5J47A 5E6UB 1CR1A 2QTFA 3RC1A 4BFZA 2B4TO 1E0KA 1NSTA 1CJUC 3TTUA 5ADHA 1Q14A 5EE0A 1IEVA 1CDEA 2JLRA 2YDXA 1YT5A 3H16A 3LKVA 9LDBA 1YK0A 3L5KA 3VSBA 5EGNA 3CURA 1FQOA 4ZT7A 2BZ0A 4ZIRB 1IBCA 2QVLA 2IX9A 3EZ2A 3EZLA 5BUZA 1OX4B 3IO3A 4LF6B 2ANCA 4NE7A 3ZJVA 2JZNA 3ANMA 5JS7A 4UCWA 1OPRA 2OD9A 1NVGA 3CLTD 5DN9A 5BURA 4LYHA 1JP7A 2R8BA 4D4LA 3R8FA 3A31A 4IYRA 4ARSA 1Q0LA 1U2GC 4YRQA 2W2XA 2QX9A 2GJKA 2BMAA 2OAQ1 3GNTA 4ZTUB 1DOAA 1Y1SA 3H4IA 3IFSA 1I24A 3JCZA 3L8ZA 2KYRA 3GLRA 3SHWA 2IYXA 2PBRA 2Q1TA 3OWOA 3V6MA 3MWFA 4DABA 3L4SO 4XFJA 2VZ8A 3FOFC 3KM0A 2W2NA 1E79A 3ZPXA 1KK2A 3NDJA 1QE5A 2QMZA 3NC4A 3V48A 5FX2A 5H9WA 3GLIE 5EJ7A 4U2EA 2OUIA 2XUGA 4L0CA 4NCKA 1ZU4A 2GLXA 1GNQA 2Q3DA 2VIIA 4I6GA 4OMCA 5ESWA 4ZVQA 4X65B 1A5TA 4B84A 2R8YA 4L9WA 4Q4HA 2V1UA 2B3TA 1H6DA 1XNGA 1LPAB 4CMEC 2NSHA 1F0PA 3T5CA 1FFXB 2QF7A 4OQZA 5MFPA 2D62A 4IQGA 3FKSD 4F93B 1AG9A 4LRXA 4V0KA 1NDHA 3ZVMA 1FMJA 3I28A 3Q8WA 4PAGA 4R7TA 3H9CA 4IIJF 4K7JA 1GDHA 1E7RA 4ZHQB 1O95C 4ZCMA 4RU1A 2PSFA 3NDRA 5H4HA 1A7JA 1SA0B 3EMKA 4C3OB 4JUIA 2HIHA 2ZYVX 4I50B 5B6IA 1J8DA 4BMNA 3OEED 1SIUA 2VSOA 3GRUA 1ELOA 3ASVA 4WEOA 2C20A 1CY6A 1M8GA 4YRLA 1U4SA 3F9CA 2CGEA 3HGQA 3JQAD 4QU5A 1YZVA 2BH2A 5EKXA 1GGKA 3NRBA 3ORHA 4X24A 4N7BA 2D1TA 3PC8A 1TUEA 3EAGA 1VYHA 2QR3A 2PKXA 3IDZA 3EDMA 2G67A 4IBOA 4DG9A 3L8EA 1B0UA 4O6VA 4B76A 1YA4A 3LWNA 5BQ5A 2XF8A 2XUJA 1H9AA 3FYUB 4O25A 2DTDA 1WY5A 4LBYA 1VL0A 1CR0A 1DKNA 1YB5A 2PKQP 5ALMA 3ZGZA 4HDSB 1U7XA 1GAJA 3A25A 1KSHA 3O38A 5EXTA 5H3CA 3FOEC 2OY0A 4NTZA 4ZJYA 3MBKA 1L4UA 5JT1A 1ZD8A 1T4GA 2P9ZA 1EAMA 2PPLA 4HN4B 2XMDA 5EIAA 1EWKA 2L18A 2EEZA 1EDDA 1NXPA 2WMDA 3D3NA 4LSGA 1XEAA 4HWPA 4PLPA 4EEZA 2O2DA 3TRIA 4M49A 1IEWA 2ERCA 2F3QA 2ZTUA 5TNXA 4E32A 4ZOLA 1W36B 2VJPA 2BTOA 1ZUWA 5CK4A 5EHNA 4C29A 4TTAA 1Y3AA 3NDPA 2QGZA 3C14C 1UODA 2G04A 5EE1A 1F2DA 3MBOA 2I1QA 5FUYA 4U63A 4KX3A 1KXZA 1DDOA 5DSTA 3ZHOA 3F1LA 1EBFA 4DDTA 1XZ8A 3M6IA 1C7FA 3JQGA 4MP3A 5IJ0B 1Q1GA 3DTVB 4O4JA 3RS5A 3WAKA 3IERA 3TM4A 3S6JA 1YO6A 4KIGA 1O9GA 1RJ9B 3MJVA 5BOSA 2IIBA 2G17A 2HK7A 3I1YA 1W75A 3W4JA 3MSCA 3IV7A 1OXMA 2HOQA 3FYHA 3T9BA 4DNQA 2QN2A 2CNDA 2WVGA 1JDZA 2WWVD 4C6SA 2DR3A 2C7QA 3PNSA 4EG3A 2WBLC 4RZUA 4ZTZB 3BMOA 3TPFA 3KDAA 5HK8A 2Z5VA 3K16A 4I6EA 1PZXA 2EG5A 4L02A 4YTEA 5LQSA 1JI0A 1JLMA 1XU7A 3COSA 4HLQB 1BKYA 3U3RA 4DHWA 2PZFA 3DULA 5JPCA 4EATA 3BGSA 2VP0A 1IUNA 2BC9A 5B1HA 4EKIA 4A8HA 2VT2A 4RM3A 5FUBA 3Q2KA 5IF9A 1I5EA 1DG1G 3NLLA 4K87A 3V4OA 1YA8A 3TTTA 1KI1A 1P0CA 3IP1A 4TRMA 2ACEA 1EE1A 3CSDA 3JWEA 1UP7A 3HP7A 3HNRA 2VTBA 1Z5UA 4JELA 2FHPA 3DE7X 4I1IA 1E9BA 2C9CA 4BJ5A 2Z04A 1ISJA 3LUPA 5EE3A 3IIJA 4C0LA 3V46A 2YX1A 2PRJA 1RYEA 1MQ8B 6REQA 1TEZA 5CFZA 4CEIA 4YK7A 3DVRX 4L6IA 4GKVA 3EZNA 1C1HA 2FP4A 2AWOA 2ZTHA 1KYYA 3AF5A 1AC5A 2VKTA 3PZBA 4Y2RA 1WVMA 2E87A 4BMPB 2O8DA 1GPKA 2XZTA 2B20A 2EKBA 2HBYA 4TYQA 2BJHA 1SKQA 3IUSA 5I6DA 1GRRA 1X7YB 2NQ2C 1TTTA 1OBFO 3AFNA 2I6QA 3FSJX 5CM2Z 4ZT6A 5BVHB 2P27A 1U28A 3A3YA 3F8TA 1WUYA 2EATA 3OCXA 1QFZA 4LGVA 2PDAA 3R7DA 3AETA 5AJTA 1UFVA 1WF6A 2W4QA 4UAJA 2WIKA 5EWMA 2P6PA 3C74A 3DT8A 4JI4B 5JXIA 1N5OX 1RADA 5FEUA 4Z9FA 3RJMA 2CXTA 4M0DA 2RGCA 1AKNA 2JHFA 2PH1A 2PSSA 2VRNA 4D44A 5HK9A 3H1FA 2VQFB 1II8A 4XB2A 2DU8A 5DK6A 4JI2B 2GHQA 5CDUA 2A94A 1OA1A 2HF8A 2X8AA 2ZJOA 3MELA 4G2TA 1GTL1 4GI2A 4LRUA 3UAWA 3WNBA 4DLXA 4DNOA 1E79D 1AZWA 5IZ4A 3REQA 4RE6A 3V4SA 4BRUA 3VR3D 2P9JA 4YPOA 1ULUA 4KBGA 1TCCA 3AHJA 5ENVA 3QHPA 5FLEX 5J58A 1G17A 4A15A 4GZLA 3OZIA 2XEDA 4BYMA 1IE3A 2H57A 1E2NA 1CUGA 1U5BA 4CR7A 5KHOC 2OHOA 1JBKA 5J2TF 4CR6A 3HGTA 1CRQA 3W2TA 4HH0A 2H18A 4II2A 3QUTA 1GCGA 2BGJA 2H1HA 2OCIA 1LXCA 1QO9A 2DFVA 4GOND 2HA2A 2KW5A 2DBYA 3LC1O 3U60B 2EX4A 4E94A 1YZQA 2IYWA 1Z0ZA 4MS1A 1EWQA 2BR3A 2BEWA 1TZKA 3ZE1B 3QEAZ 4BAZA 1FDWA 2D3WA 1K7CA 4MW9A 1JUDA 4Y8VA 5JD4A 3D7RA 5GTDA 2BUCA 4JROA 3T7CA 5C32A 4OG2A 3U7RA 2CV2A 4BZXA 2XVZA 4C03A 1RACA 1NI5A 1VXOA 3S5JA 1R0SA 2YZNA 4Z0TA 1YUBA 1U8XX 4RZSA 3OA0A 4P84A 4PSKA 5DW0A 1YR9A 4HZIA 2QK4A 3ZVKA 1CCWA 1NE2A 5C35A 1KMHA 2NACA 3TGWA 1ID8A 2EFJA 3QKSA 4HOYA 1GSHA 4P5EA 5TX7A 5AW8A 4FJ0A 2IWRA 4GSKA 2IHKA 1B6TA 3N7AA 3MQ4A 5EZSA 2XF2A 4FNMA 3S7ZA 2ZIEA 4W4TA 2NZVG 3K94A 4EVIA 3QKUA 2PN1A 3VSDA 2WJJA 4N5DA 2B5VA 5EIXA 4RHTA 1JDBC 1V8PA 3FB1A 2B99A 1YQUA 2IZ0A 3OOYA 4YGYA 3AKYA 4G3XA 1GL9B 2ODTX 3ZV7A 5IPFA 3T5AA 5KO2A 3VXKA 1W6RA 2G9UA 2IDKA 3MC1A 1RKQA 1E5LA 5JR3A 2OQRA 3GW8A 3A1CA 3ITKA 2HA0A 4TRRA 5DFAA 4MI1A 1C5KA 2H3HA 3A6GA 5IRCD 1KMQA 4BN4A 4NLLA 2J31A 2V5VA 1DINA 3RS7A 2QQEA 2O7QA 1KAQA 1UBNA 2RGYA 1M8KA 2YV1A 1ZOIA 3KP1A 4GI1A 1ISGA 1MVNA 4OD0A 3JXEA 1QQBA 2AN5A 1KSJA 4ERXA 1B2LA 4XA8A 2H7CA 3TW8A 1VIYA 2WSSD 4J75A 1JA9A 1NN5A 4LCBA 3SBEA 1ZUNA 2J5RA 4WTOA 3CYFA 4DZZA 5HIAA 3K1AB 4L8GA 3JVEA 3HCRA 3LY8A 4G85A 4GOMD 4ASUA 1NKVA 3HCCA 5BN5A 1RW4A 1QH1A 2HT1A 3A58B 4NNPA 1BCRA 2ISSD 5A6SB 5LA6F 1Q83A 3B89A 3T15A 4FIDA 3D5TA 2OAEA 5F2KA 1DBRA 3WLTA 4FONA 2X0FA 2P3QA 3RYFB 1TQ4A 2QV0A 4G5RA 4L2IB 3DDSA 4OFXA 3VC2A 4E11A 4ACBA 1EFAA 4DDKA 1Y82A 2XDAA 2IL1A 3PJDA 2ERYA 1DC4A 4DIEA 4L3WA 2QTVB 2ZIWB 4F4HA 4DIKA 4NU8X 2CD7A 4OA5A 2FFJA 2VQEB 3E1KA 3PUJA 3EPJA 4OK6A 2L0XA 2B9EA 2BV3A 1SIBE 2HPVA 2ST1A 1KH2A 4AMUA 4W5TA 4YAEA 2YVKA 3ZZ0A 1A8SA 3X43A 5IX8A 3FYUC 4HZUA 1IWPB 4FR2A 3FVQA 1UP4A 1RXVA 3W5VA 4Q16A 4Q9AA 1CHDA 5HGJA 3PS9A 3T9EA 4XYLA 2Q07A 2VNJA 1MB0A 4PZLA 1J8QA 3E35A 3QSGA 2IYQA 3QKSB 5C8YF 4ENSA 3HDQA 3EVBA 5JSZB 2XMGA 3HACA 1J8YF 5EJFA 1Z2OX 2FMUA 3CMCO 3DKVA 1I7QB 4O2RA 1HQCA 4IIUA 2N46A 3BJIC 3LLCA 4H9GA 4JQCA 4M1YA 4W5WA 1KDZA 5SYMA 4DMRA 2JGKA 2RC5A 3RIEA 1KMNA 5EJIA 1MB9A 1SWVA 2C94A 3D1LA 3BFKA 5E4YA 5AKJA 1K08A 3TIIA 4DRXB 2OGUA 1QU2A 1W4ZA 1M2VA 1TMGE 2H9AA 2I2BA 3R6GA 1W0KD 3TUIC 1PTKA 2ZWMA 4DZRA 2XTZA 1GL3A 2P5UA 1NMQA 4JT2A 4B3JA 1CLUA 1GA4A 1NXVA 2PK3A 1F3LA 3P9PA 3IIIA 1ZGZA 3PC6A 1WUHS 1MW8X 1F2UB 1WOMA 1XV5A 3MHPA 3DOIA 3Q1LA 4X6YA 5FBQB 3MCAA 2OBMA 4Y1RB 1XQYA 1BH6A 4NJOA 4ZAYA 2PO5A 2ZM5A 3AL2A 4RTNA 3O2NA 4RESA 3LI2A 3MWYW 3AUFA 5EWJB 5K09A 4B4WA 4CHGA 3CPJB 3MMZA 3VR6H 5CCBA 1XDBA 2H7XA 3W1WA 2EFCB 1M34A 2H4WA 3WRXC 5BWCA 3A0RB 1RQPA 1N57A 3IBSA 2KM1A 4MYRA 4U7GA 2XAUA 2HNKA 4MQFA 2VXOA 4EUSA 5JVDF 1PUJA 3GT0A 2NN3C 1X0VA 5ED0A 4WBSA 1CUXA 3L7LA 2QD3A 4O4LB 3LYHA 4X60A 4AT1A 1HFWA 4TLCA 2YHIB 2Z6VA 4TUYA 1ZVMA 4OSOA 4D8WA 4I0WB 1ZH8A 4BX0A 2QLBA 1PW7A 1TRHA 1XLUA 1YVDA 2EJWA 4ZEXA 4K86A 1ESCA 3CU5A 2BELA 3RUAA 1JB1A 1GPBA 3CB2A 3NC0C 1E1KA 4NBKA 2C8VA 3L4KA 2BHLA 4NONA 3MN1A 2JFPA 4DHEA 3GGSA 1B93A 1VHJA 3P9NA 2ZRPA 3C87A 4LRYA 4LHXA 1U81A 1IJFA 3H0KA 1NYRA 1GIAA 1IBSA 3D0OA 1R0YA 3BTOA 3NOXA 4NAHA 1Z0DA 3AFIA 3S8YA 4MO9A 4PZEA 4CKWB 4RVCA 4E2ZA 2P30A 1K3TA 1T3TA 1JEEA 4LV8B 1PVVA 1IPHA 1R15A 1ZK1A 3A6ZA 4X54A 1ZSVA 1PSDA 2IHUA 3DBOB 3KKMA 1ZUHA 3OF3A 4F72A 1XFDA 5JDCA 1K7EB 1NBWB 2PUGA 4IRXA 4YUXA 1W87A 2XLBA 4Y1GA 4ZEVA 1CF2O 1ODTC 2OBLA 2HEIA 4B46A 3B8HA 4NULA 1E96A 3IHTA 5DX8A 1PJBA 3MUFA 3GLFE 1EX6A 4MVXA 1KPIA 1WB5A 2ZSKA 3JSAA 4DSNA 1MXFA 2BSXA 4Q9JA 4AKIA 4COOA 1VFPA 4CQJA 1G0OA 3UAVA 3LHDA 2O3SA 4EYKA 3DWEX 4CIVA 2AXEA 1XD9A 4EA8A 3KD2A 3KJZA 3ESYA 3NETA 3MRXA 4TZ0A 1AMUA 2VWHA 2PX6A 2OK7A 2WKSA 5MN6A 1GAXA 1E3WB 4AS3A 1T1RA 1SC3A 4KN9S 3C7KA 4R2XA 4D81A 3R2JA 3GJ0A 2NX2A 1ND6A 2IFTA 3O90A 1SM4A 1Z36A 3AWIA 3HKBB 4W7HA 4IHJB 1QLHA 3H5WA 3MCVA 3VR4D 2WUVA 2F43A 4ZAGA 1CP2A 2JJMA 4YHHB 3K9FC 4F6RA 3HZHA 1ORVA 3TZ6A 1PKXA 3R0VA 1IN7A 421PA 1QIIA 4ZVKA 1E98A 5CLGA 4B79A 4IJMA 1QPBA 2BTQB 3QUAA 1ORDA 4BVAA 2O05A 3TUZC 2GN6A 3I09A 5ELLA 2HC9A 3IP6A 1QHEA 3VNBA 2AMLA 3CE9A 3L1IA 3CX7A 5DTRA 1EXDA 3CJTA 2R7MA 5EYPA 4Z49A 5BOSB 5C53B 5EAIA 5CLLA 1U8ZA 4EMTA 2ZK7A 1FUIA 3H75A 1R16A 4BX3A 4UMDA 4BLSA 3FRJA 3ZV5A 1CEYA 3NHRA 2UXDB 3Q40A 2O8CB 5K3OA 2JAUA 2NU6B 1NIPA 2VUTA 4BATA 4F71A 5M5BA 2D00A 2W8BB 3LWBA 1HI9A 3SJBA 1EUCA 1QVWA 3DE5X 3BHIA 4N5NA 4UXHA 3CNLA 1W0JD 3K2EA 4CM8B 4DQLA 3MTIA 4CXMA 4TXLA 3OP4A 3IUNA 2OV1A 3VDMA 4LFAB 1NR5A 3ICEA 2WG0A 4ZRNA 4DUZB 3EB9A 5GM1A 2QMOA 1E3MA 1UK7A 5LQDA 1BCSA 4HNVA 3DL7A 4XB6B 5DO9A 1U4OA 1WDTA 3MWJA 3RU2A 5BV8A 4R0MA 2Y4OA 3MGBA 1OMOA 4LZPA 1VE7A 3TEFA 3UXHA 4KITB 5JANA 4BEJA 2FF5A 1ZI6A 3UCXA 5ICGA 1E3IA 4BXOB 5FPKA 3O1LA 1KFBB 2AXNA 3UJBA 2XCRB 4YNBA 3COPA 1BA3A 4IJWA 2I3BA 2XTNA 3KOYA 3RSHA 5CITA 5KX5A 3O8QA 4R7GA 3PC7A 5FOWA 6PFKA 5LU8A 4H6VA 3EGDB 3EXHA 1VLZA 1D2MA 2ZWOA 3LQ2A 2IS2A 5TB5A 1I7DA 3LQ1A 4X00A 4NU0A 3RI3A 3GUVA 3BGIA 4XASA 3EQ2A 4DS3A 5JHHB 2DWOA 3HUUA 3K72B 2VUIB 3LUFA 3MXTA 3PV0A 5LP6C 5CYFA 5JV5A 2QN3A 2GERA 3SYRA 1XPUA 3JQAA 3R0XA 4IDAA 4YCDA 3U1TA 2LCIA 4J90A 5ESDA 4OQXA 2XJ9A 3TSOA 1GRVA 3RRZA 4EZBA 5CXQA 2QPTA 3P0EA 2XYRA 5IEJA 3TDMA 5DM60 5TE9A 1BEZA 3ZBPA 3OEWA 1YQEA 1CG6A 1Q2UA 1L7NA 2RJ3A 5ITZA 1RYYA 1NXTA 2QRMA 4TKVB 1I0LA 1KVRA 2CNWD 1NR7A 3ERCA 2JFGA 2DQYA 3T3IA 4F60A 1UWVA 2HDHA 4BNYA 4IVNA 1D1PA 5LKAA 2B1GA 1V3QE 3VTAA 2V7PA 2Y0DA 2DC1A 2W2KB 2H8KA 3RVNA 1T8UA 3BIWA 4IGFA 3PQFA 2DUJA 3PTLA 4WBXC 4URWR 4L74A 5K51A 3JTMA 4WA8A 5EOVA 1OH6A 3ZLUA 4MNTA 3I9NA 4AM8A 4BO1A 1XAGA 2CZQA 1WHTB 3BZBA 5KTSA 5FBWB 2C5HA 2FR8C 4UEJA 3UK6A 2O5EA 2EDCA 3NHFA 3RD5A 4EQ6A 4MARA 4FINA 1C14A 1V5WA 2HEGA 3OT5A 1ZVJA 3FZEA 4YJHB 2Q4EA 4EABA 1ULBA 2QIPA 4I1OA 3LXMA 4RKFA 4L8FA 1TFUA 5HQ3A 2N75A 3TLZA 1OAOC 1LB1B 4U39A 3HM9A 3S2EA 1JPNA 2NTVA 1IN4A 5HG0A 1J99A 1V9CA 1ULTA 2B36A 1VTKA 1G64A 2VJLA 2WJWA 1EFDN 3AV3A 4WKOA 3R7BA 4CIAA 2KHZA 3WRWA 4GKJB 1QH8B 4P82A 5ELMA 5B7PA 3V97A 4BPRA 1SD1A 2RSLA 1X14A 3OZAA 1P31A 5KTMA 3STYA 1RQ7A 4G1EB 2HMYB 2Y2UA 4GPAA 3O4GA 2G4LA 2ZBDA 4MS3B 5F2OA 3PD0A 4EG4A 1WIWA 1EVYA 2VZEA 2G0TA 1NBEA 3AF6A 1VYUA 1JXQA 1MOQA 1TD1A 5A9TA 4CCSA 1XZKA 2BEWB 4G5SA 1P2SA 4JR1A 1R6UA 2UYYA 3WDKA 2LR0A 3ADDA 2ZSUA 2JDID 3HA3A 1NI4B 3M9LA 4ONEA 5HA5A 5JWHA 4RTJA 4MGKR 4OB8A 2OHJA 1GWNA 1SBNE 5MDHA 1IM8A 2I76A 1T9HA 5CDTA 3EULA 1RLMA 2B1RA 2ZJ5A 4TMTA 4BQEA 4EA6A 4P7FA 3PXGA 1ZLXA 2XCOA 2H4ZA 5BQ3A 5C4IA 4YJFA 3ADCA 2DHQA 1BH2A 1FMLA 2GF0A 3KZXA 1GHTA 1Z7WA 3NVDA 1ACLA 3TB6A 4ALMA 1WCIA 2X9LA 5TGTA 1FBTA 3OX3A 1QAOA 1O5IA 2VRBA 1Y9EA 2PX2A 3K9CA 1KVQA 5TXGA 1K68A 1Z5WA 3WWDA 1H2AS 1C1XA 3A26A 2F3UA 3EGWA 4R1QA 3W5CA 4F5EA 4ID9A 5HMLA 5K2OA 2CBXA 2HTFA 4GF5A 1AV7A 3UUEA 1WXHA 2C0CA 2ECPA 2XMZA 3BTVA 3KZCA 4KIUA 1XAJA 4ZDWA 5FRDA 1H4QA 1JIQA 1ZOLA 3P4YA 5ALLA 3D54D 1NFQA 5A05A 1QGOA 3PDUA 2CLOB 3PNKA 5F35A 3V7FA 3CX6A 4KWTA 2XQIA 2AFHE 3IAS1 2UZ3A 4P08A 3KQOA 2QORA 3N3BC 5LXTF 2OQVA 1E8NA 4S1NA 3DOCA 3TIFA 4AS1A 1JHZA 2YWCA 4ZQBA 1M1NB 2RCYA 1J09A 5DYTA 1DS6A 3R40A 4YAOA 3KHSA 4BJ6A 3V1YA 4UAUA 2J7KA 5JZ9A 4N76A 1GFWA 3LZDA 2Y1DA 2PFGA 4JEIA 5GADl 2I1WA 2VYQA 5KYWB 1O4VA 1PR1A 1QZ3A 1TFRA 3AB3A 3ZD7A 5LQMA 2GS9A 3ER6A 3TW0A 4IMPA 3NWEA 1U63A 2Y77A 4YLGA 1DMSA 1YK1A 4Q0MA 3R0QA 1P72A 3C1TA 3IBGA 3T06B 5CEJA 2NP7A 3KSUA 1N2OA 3BULA 3GFTA 4YJ3A 4ZPJA 5EKSA 3I3OA 4WE3A 2PD6A 5C52B 1RM3A 3UANA 4U2GA 1PVDA 1Y5LA 3IAXA 3PC4A 3PFHA 4M1KA 1EP2B 4YBZA 1A98A 4FZVA 3M9WA 4B0PA 3QEKA 2FW7A 1L7EA 5KDLA 3UW3A 1Z07A 1S3SA 1Z45A 4W5RA 4HYEA 5TC4A 1SZPA 2NVWA 3BF8A 3RVLA 2Q2OA 2WD8A 4R6WA 3REGA 2Y66A 3FGZA 3CLSD 4X0EA 4QPNA 3K6JA 1P17A 2VHQA 4MVWA 4V3BA 3RFFA 4A82A 2UUCB 1AS3A 2VPWA 1PG0A 2BZ1A 2FNAA 1W4BA 3L05A 1NONA 4ND7A 4YI3A 2HRRA 5LQKA 4OAOA 4AMVA 5F9FA 3HHPA 3SIWA 3LSYA 4PCLA 4KQGA 1PDWA 3KE9A 4XCVA 4CDGA 4YRAA 2WD7B 1EFRD 1R2QA 2I65A 3FMIA 1UPCA 1P1KA 4TWJA 1ZU5A 3ZQKA 3QK7A 3RAPR 2H5LA 1N3IA 1CJVC 3B5IA 2R7LA 1LVUA 5BN4A 3N75A 1PZNA 3FUXA 5FXMA 4M0KA 4BJ3A 1CK4A 5KREA 1IRXA 2ISCA 3OX1A 221PA 2XVMA 3JQGB 2E1RA 4JUBA 3KPWA 4RSRA 1QP4A 2QP9X 2YN4A 1UXOA 4QUHA 2VOJA 2VAXA 2XT9A 3NWOA 3VZPA 3DMRA 1AB6A 3CIFA 3AKZA 3I52A 2VK1A 2F4VB 1E3QA 3AIIA 1CYEA 1IN6A 2WIDA 2BDTA 5K05A 5BV0A 2WM2A 3DHEA 3DOOA 5GM2A 3VPBA 3VGJA 3QUQA 5JHGB 3MK31 8AT1A 3NCTA 4C4OA 4NICA 1B73A 1Y8AA 4I5GA 4CHTA 4AZ3B 2QNRA 5F7JA 4G4IA 1K75A 4RS4A 3GGCA 3V4ZA 1DAFA 1DP4A 3ZX4A 3FHCB 1HE3A 1CEQA 1CUIA 1YJXA 3M0EA 2YYYA 3OFKA 1KZHA 1OFTA 2GZSA 3RHSA 4DSUA 5ADWA 3J80A 3TRFA 5CDFA 3EGCA 2A4KA 1BIFA 4G1VA 4GW3A 4KAJA 5A5FA 4ZVUA 1SCKA 2EP7A 1KVSA 1R5NA 3R3VA 2HW8A 3WYGA 3OICA 3TQOA 1UPXA 2DG2A 5C8DA 2L2QA 1TM7E 4HLUC 3H2SA 4Q9DA 1JKMA 2JHAA 4AL4A 1QTRA 4XLTA 3NALA 2CN1A 3GMDA 1E62A 5AK6A 4KR6A 4DLUA 3KUUA 4KIWA 2GVNA 1BW9A 4PZUA 4OXQA 3T3NA 4O1MA 1VXRA 2I6TA 2JA2A 2R6GA 3O8CA 9LDTA 1NJ2A 1VMEA 5KNDA 2NTJA 2VJOA 2CUTA 1DRJA 1R74A 4TT8A 4DV3B 4Q9KA 3L6BA 1EI9A 1TM2A 1W94A 1YZKA 1L7QA 1ZI9A 1DXHA 1YDHA 1FYDA 4P53A 1X0XA 1IAVA 3E5NA 1ORRA 1C3VA 4MDEA 1J8VA 1PFUA 4A73A 3TVTA 1GGEA 4MYCA 2JB9A 2E2WA 1JI3A 3M4JA 5L3VA 3KWJA 1CT9A 1KS9A 1XZEA 2WW8A 4HAWA 3HSKA 4Q3EA 5TVKA 1KTVA 4R6XA 3BRQA 2YY6A 2DFLA 1GU7A 4RVNA 5IM4F 3E8MA 4UDXX 5ECYA 2CVPA 2DF8A 4R1TA 3S1LA 3TIGA 3GLIA 3MW8A 1C0KA 3A1VA 4HQLA 3QQPA 2Q5JA 5D3ZA 1IVNA 5IKPA 5JFGA 2BBWA 1E5XA 3AEKB 1DKRA 2HSDA 4TYWA 3S8EA 5E7JA 3M6MD 1J7KA 1XPJA 1X80A 1J2YA 2EL9A 5EC8A 1DVRA 1Z12A 3F7MA 1QHHA 3HYLA 4YJKA 3PLAE 3KVNA 4DDVA 1TZCA 4BAUA 1OWPA 3WJ1A 4JP1A 3R09A 1D2HA 5I8ZA 5DB4A 2GN0A 1ISFA 3Q1KA 3IIKA 4YUVA 2GJ4A 2AQ8A 2PX5A 3LKBA 4UD2A 4M6WA 5BSEA 3ORFA 4LY3A 3GJZA 3BD6A 4YUYA 3KUDA 1BG6A 2QMHA 4LOLA 5H16A 1JLSA 3REFA 3NAGA 4Z54A 1VRCA 1V3TA 1S5PA 4YCBA 3PJGA 2C2BA 2JLSA 4RTSA 1BXGA 4QQFA 2Z83A 2A5DA 3AHGA 4QUGA 4CN9A 3J81A 3I6QA 4ARCA 4EJ0A 4TMFA 1FYVA 3HWWA 3BGVA 4ZVRA 5HJ7A 1NRXA 3OI7A 5CVCA 3GGPA 5LJIA 3X2EA 1FZQA 3A1FA 3W06A 4E4TA 2FX5A 1BA2A 5LPNA 4DV2B 4UCQA 5H5JA 2JLAA 3HEBA 5HIIA 5ECGC 1N78A 4FFOA 1FTYA 1Y9AA 4CIBA 1B8UA 1ECJA 4MS4B 4LE0A 4RZHA 5GV7A 1AQNA 2F8SA 1BKSB 4L1KA 1FTWA 3RWOA 2ZJ0A 3FH0A 3HPRA 2H4HA 1O6FA 3ZZUA 1H4TA 1ADGA 2I71A 2BFEB 3L0IB 5P8WA 3O4HA 5ALQA 2O8EB 2QRNA 3RVQA 1BMFA 2WRZA 3QP9A 3C6KA 4C88A 1XZGA 2D2EA 4KFRA 4S0XA 1YZYA 5BWOA 3TMKA 4DCJA 2O8EA 3GFSA 3OTHA 3WISA 5TMPA 2IPOA 1B1CA 4N82A 4ZODA 3ICQB 1VI2A 1CQXA 4HC4A 4XB1A 4KKXB 2HA7A 4C1BA 4B43A 3DTVD 3ILSA 1QKJA 5LA6B 1SCIA 2JJ2D 3HDHA 4J29A 4F45A 5F9HA 3BIJA 1H93A 1HE8B 3IAAA 2A30A 5HKKD 1JSRA 3NAMA 2K2QB 4QOEA 2P0EA 3JASA 4JMPA 1M6HA 4LXGA 1LKZA 1YUMA 3OZ7A 3RSFA 2A9FA 2OR3A 3HDGA 3ZC3A 3SJAA 4QX6A 3FA2A 3ZCSA 3CS3A 3KJEA 4RHUA 3RYTC 4EYOA 1U99A 3ENQA 3QYAA 4OHUA 4XVQA 5ALIA 5GWXA 1Y8ZA 2FFAA 2W48A 4U5XA 4QODA 4QSHA 4YMGA 1O54A 4BQRA 3B6ZA 2WNIA 1AKUA 3MWEA 5JEEA 5KQLA 3PEEA 1MB2A 4UHEA 1TCVA 1ZISA 4HGPA 4DREA 3K71B 1N0HA 4U7WA 4TKVA 3RIYA 1CQIA 2Q2NA 4I7EA 4H1VA 2GARA 4K28A 2ZI5A 4X6XA 4DLLA 5B30A 3PLRA 2GK7A 3F5FA 5AQEA 3RF7A 4JT4A 2Z4SA 3MPOA 5CXUA 3TRJA 1V5IA 3LY7A 4HJXA 4RETA 1ZMTA 5IYZF 1T8WA 3EIEA 2PQMA 3GDGA 3OF2A 4BNKA 3CNNA 4WXHA 4CT5A 2ZJ8A 2VLBA 3OQOA 1T29A 4WZ6A 4DA9A 2XX3A 3N1UA 2Z6UA 3SXPA 1C1DA 4I8IA 5DNDA 2FZCA 4DMHA 3DYBA 5BORA 4X91A 3FX2A 4E5PA 3M34A 4N03A 1E1QD 3UZUA 3C6BA 3I04A 3QEMB 3TTVA 4KW7A 3BHNA 1NRWA 1Z6AA 4M9UA 3DHYA 4UZSA 3KFVA 3SX4A 4PG7A 3WA6A 5IJWA 2FPGA 4OHYA 4HNAB 2D0IA 4CQMD 1NATA 3Q6IA 1F9AA 4QYIB 4OYHA 4WAUA 3OZDA 2Q2VA 1SVLA 3KB1A 4EENA 4YCMA 1BMDA 1VJCA 3N6RA 4Q00A 1GPMA 5CBPB 2R2AA 3MRVA 3T7SA 3BKWA 4C2UA 1RAHA 1XVUA 2V7QD 3VSCA 5I9NA 4RIEA 4LXTA 1RYNA 2CXPA 2BM1A 3KT3A 4YH1A 2SICE 3OZUA 5CVUA 4YMLA 4G0VA 3N8NA 4CMIA 3OKAA 1NVUQ 4I5FA 4RD2A 4PCAA 1BMTA 3E3OA 3IR5A 2BFEA 1ILWA 4JLKA 4JDUA 1W1WA 2COKA 1EGQA 1ZFNA 1D0SA 3FPKA 4M87A 3HEMA 5AKGA 1DBSA 3GFFA 4BBPA 1BD4A 4FE4A 2AQIA 3ASZA 3DBIA 1DKOA 2E18A 2J3KA 3EZ7A 5IJ9B 3L3BA 5M34A 1SQ6A 1WUJS 3MYRA 1H1DA 2O0LA 1D4AA 3I32A 5CJ2A 5JZOA 5D51S 2V7TA 1OAKA 4PAWA 3Q7QA 1A50B 2RARA 2NZXA 3OHMA 2JD0A 3WHLA 1U6JA 3RLFA 3RROA 1Y4UA 3PGA1 4LHEA 3IODA 3JR3A 3ZIUA 4JJGA 1V16B 1XR3A 1DXOA 2YRFA 3IJPA 4OAQA 3VI3B 3OTOB 3HXKA 3KQKA 3VPAA 3F96A 4UBJA 2QD5A 1M2VB 1H1TA 1SU8A 2QXTA 3I12A 3NWJA 4UU0A 3N86A 4P7GA 5BRNA 3RYCB 5D1NA 3KSRA 4PWZA 3NC1C 1H2XA 1E61A 4QT4A 2BFWA 3GELA 5ALXA 4EKYA 3U16A 2QU7A 3LT2A 2P67A 1NOKA 3FFXA 2HCJB 4UHKA 3DP9A 1F4PA 1QV9A 1MOZA 1DOZA 2AFHB 4P4SA 3W6UA 2EX0A 1RWNA 2BEVA 1GYPA 1D2EA 5M3BA 5C37A 3EFOB 3OE7D 1KKMA 4UXJA 1DAGA 4DA7A 1XRSB 3N87A 4G0YA 4Y2GA 1KI3A 3ILYA 3BQNB 1XHEA 1E3JA 1I3CA 3OSZA 3RE1A 3SE0A 2LWIA 4ZCTA 3S0JA 5EQTA 3IAFA 1KF0A 1J6UA 1U3CA 2H31A 2AV6A 4QYSA 4GI7A 1Y9DA 4L7QA 4P4TA 5FFMA 2GPAA 2DLCX 4AULA 3BIFA 1B6SA 3AUYA 3N2IA 4WD3A 2A9QA 3DXYA 3IESA 5FFFA 3IVMA 3VX3A 5AIBA 1JKJA 4JJZA 2SNIE 4NESA 3OVMA 4MVJD 2CK3A 5K3AA 3NHAA 3CRRA 1EWVA 1DTEA 4HDKB 1MD9A 1XRLA 1Z39A 4PR3A 4EMBA 5JMWA 3EA4A 2I4LA 4Z9YA 2HD4A 3EUFA 3LOQA 4HNGA 5GVRA 4I08A 1RHJA 4LVCA 1BOFA 1LRLA 4YONB 1GZSA 5L3RA 3N6VA 3K9QO 1BX0A 4NYMQ 4V3CA 2DP4E 4D9IA 1Y48E 3UATA 4XWWA 1ARZA 1FDVA 2G9ZA 1G8GA 1NOIA 1S1MA 2BAGA 1MO5A 2ZIUB 3GLSA 3ZZNA 2VP4A 4YUWA 2TMDA 2P75A 3K9GA 2ZI4A 5DTJA 1CUJA 4F5DA 4XVUA 1XZFA 4PSAA 3RRYA 3K5IA 4C2BA 3PDJA 1YFKA 3L41A 4HDMA 3QOXA 1APBA 3AZPA 2OCBA 2QVCA 4FYWA 4ZOQI 1M1ZA 4NFLA 4LF4B 1EFPA 2FKNA 2ORED 4PGFA 4QICA 4RCVA 2PGNA 4V0RA 5HE9A 4MQUA 2I4RA 1Y98A 3CUTA 4V0NA 3TS1A 5A4JA 5JNVA 4QVIA 2AI3A 5HS4A 2Z8YM 1Z0UA 1ORTA 2PUJA 2R6FA 3CW2A 5DNCA 4J1TA 4EFNA 5CA1B 2DWPA 3UA4A 3VI4B 4R1MA 4X61A 3TFQA 2JFZA 2VPXA 3K9WA 1X6VA 1N92A 1CNMA 1CVLA 2SHKA 5DJ5A 1ADYA 4EMSA 4I99A 1QQ5A 3LUJA 3CBQA 4H15A 4XSHA 1JR2A 3H2GA 4XGQA 4L9SA 3UKOA 1N1EA 2KSQA 2O4CA 4M98A 4FYKA 1THGA 3USCS 2ZAOA 1SK8A 3KYIB 3UCFA 3WB2A 1UPBA 2X8BA 2Y99A 4PTYA 1R0WA 3WLEA 4MIOA 2GSWA 1EFLA 4MVJI 4AVYA 4EITA 1T4DA 1O7JA 3I92A 4CMEA 3RRNA 1F0YA 1S2IA 1D7AA 2GCPA 2HZ7A 5FYQA 4C7KA 5J2TB 3K35A 3GZJA 2I7DA 3MTJA 1QYIA 1NW9B 2GO1A 4NQZA 1A9PA 4PRZA 3DE2X 1E1NA 4RFVA 5FR2A 4EI8A 3PNYA 4DY4A 4K2HA 5TQ2A 5K6RA 1DBIA 3CVXA 1OBCA 2O3TA 1YDMA 2P2GA 3RJTA 3GEMA 4CDNA 4AYTA 4DADA 2H2FA 2A0YA 1ZIYA 3QF4A 1I8TA 1L4GA 1NN1A 4IIXA 1KC3A 4TVSA 2UYGA 4FJ1A 2CMGA 2FG6C 3GUZA 1GUZA 3ND9A 1EGMB 2VHCA 4FQ8A 4D45A 4D4JA 2FMFA 4AP9A 3ZU6A 4ME6A 4CLHA 2JGIA 2L42A 1CQZA 1X94A 4LPSA 4AZ0B 1WQ4A 5BMVA 1NVVR