2QTGA

Crystal structure of arabidopsis thaliana 5'-methylthioadenosine nucleosidase in complex with 5'-methylthiotubercidin
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
246
structure length
246
Chain Sequence
ILRPISSVVFVIAMQAEALPLVNKFGLSETTDSPLGKGLPWVLYHGVHKDLRINVVCPGRDAALGIDSVGTVPASLITFASIQALKPDIIINAGTCGGFKVKGANIGDVFLVSDVVFHDRRIPIPMFDLYGVGLRQAFSTPNLLKELNLKIGRLSTGDSLDMSTQDETLIIANDATLKDMEGAAVAYVADLLKIPVVFLKAVTDLVDGDKPTAEEFLQNLTVVTAALEGTATKVINFINGRNLSDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular determinants of substrate specificity in plant 5'-methylthioadenosine nucleosidases.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
molecule keywords 5'-methylthioadenosine nucleosidase
total genus 79
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 3.2.2.9: Adenosylhomocysteine nucleosidase.
pdb deposition date 2007-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qtgA00
1V2HE 4M3NA 2QDKA 1U1EA 4PR3A 3F8WA 1A9RA 1PR1A 3EUFA 1SQ6A 2QTTA 3LGSA 4UC0A 1SJ9A 3UAXA 1PR0A 1PW7A 3PNPA 4TS3A 3UT6A 2A8YA 1SD1A 4MCHA 5EUBA 1PF7E 4U2KA 3BL6A 4QAQA 2IQ5A 2I4TA 5B7GA 1PK9A 3SCZA 1N3IA 4ECEA 5FAKA 1JPVA 5F77A 3FWPA 5CCEA 1Q1GA 5EFOA 3KVVA 4BMZA 1Y1SA 4TXJA 4WKCA 5B7PA 1FXUA 3NM4A 1RXUA 4MARA 3E0QA 3FB1A 4TTIA 5F7XA 4L5YA 1V45E 1V3QE 4GKAA 2HSWA 4TS9A 2A0XA 1Z35A 3FNQA 3P0FA 4M7WA 1YQUA 2AI2A 3UAZA 3GB9A 1OV6A 3OPVA 4PNPA 4G8JA 4D9HA 4L0MA 1NC3A 4FFSA 2OC9A 1B8OA 1CG6A 2ISCA 1Y6QA 3UAVA 1OVGA 4TYMA 4I2VA 1U1FA 1ODJA 1Y1RA 3UAWA 5F7OA 4YMLA 3U40A 3O4VA 4R31A 2QPLA 3ENZA 1QE5A 4D8VA 1VHWA 1U1DA 1RCTE 1VMKA 1WTAA 1JDUA 1NC1A 1RR6A 5F7ZA 5B7QA 1RSZA 2PGAA 1JP7A 4NY1A 4WKNA 2HWUA 1YBFA 3LBAA 1ODLA 3OZCA 2QTGA 4OF4A 3DDOA 1A9QA 3QPBA 1PR5A 3EUEA 4LZWA 3BSFA 1A69A 1Z38A 3KVYA 2H8GA 4QATA 1NW4A 1A9OA 5F76A 4OY3A 3FAZA 1JYSA 3OOEA 1PK7A 2A0YA 4GLJA 5CXQA 3TL6A 4EB8A 4QARA 1PR6A 4X24A 3NM6B 1OU4A 1TCVA 4L5CA 4F2WA 5KB3A 4L5AA 1ECPA 4DA8A 5B7NA 4YO8A 4F3CA 4BMXA 5C80A 1C3XA 3KHSA 1I80A 1LV8A 4D8XA 1Z33A 1K3FA 3FUCA 1SD2A 5CXSA 2BSXA 5IFKA 3KU4A 1YRYE 3KUKA 3OZDA 2Q7OE 3O6VA 1Z36A 4TXNA 4QASA 2AI1A 3K8OE 5F78A 1U1GA 4QFBA 1CB0A 4QEZA 2HN9A 3C74A 4JOSA 3DF9A 1JDSA 3PNSA 1Z5PA 4D8YA 5CYFA 1OTXA 3K8QA 2P4SA 4DA6A 4OGLA 5DK6A 4D98A 1Y1TA 1YR3A 4IP0A 3OZEA 2GUWA 1Y6RA 4M1EA 3BGSA 2B94A 4K6OA 5F7JA 5EPUA 5CCDA 3DPSA 1PBNA 1RXYA 4DAEA 1T8SA 3OOHA 4F3KA 4OJTA 3E9ZA 1V4NA 4P54A 5F73A 5ETJA 1TGVA 4KN5A 1JDTA 1ULAA 4DAOA 1JDVA 2OECA 4E1VA 1B8NA 1RFGE 1T8WA 1T0UA 3IOMA 1Z37A 1RT9A 1ODIA 1K9SA 4TXLA 3EEIA 1JE0A 5JPCA 4OGKA 4MCIA 3OZBA 4NS1A 2OXFA 4LDNA 1TCUA 4GLFA 2OC4A 1JDZA 3PHCA 4BMYA 3P0EA 3E9RA 1OUMA 4WKPA 3MB8A 4WKOA 1Z5OA 1M73E 4NSNA 4TTAA 3T94A 4DARA 1PR4A 1Z5NA 4JWTA 3KVRA 4LKRA 2ON6A 1Y1QA 1PR2A 4TXHA 2RJ3A 1PWYE 1ODKA 3EMVA 3IEXA 4LNHA 1JE1A 1RYZA 1LVUA 5I3CA 3D1VA 4RJ2A 2AC7A 1PKEA 3INYA 1VHJA 4G89A 3NBQA 1K27A 4L6IA 3DJFA 4TTJA 3DP9A 5IU6A 4GMHA 4EARA 1RXSA 1ULBA 3FOWA 1ZOSA 3LA8A 3OF3A 1V41E 3PHBE 1TD1A 3ODGA 4LNAA 2A0WA 1T8YA 5K1ZA 4DA7A 3NM5A 3UAYA 2I8AA 1RXCA 4R2XA 1VFNA 4DABA 2XRFA 4DA0A 1U1CA 1A9SA 3MMSA 4F2PA 1Z39A 4JP5A 4DANA 3OCCA 4TXMA 4F1WA 1A9TA 1ZL2A 2HRDA 1XE3A 1V48A 1YQQA 4H1TA 4OEHA 2QSUA 5CYGA 4R2WA 1TGYA 1LX7A 1Z34A 3ONVA 1G2OA 4YNBA 3GGSA 3BJEA 1A9PA 1OTYA 4BN0A 4YJKA 1T8RA 4G41A 2AI3A 4WKBA
chains in the Genus database with same CATH superfamily
4TZKA 4Z1MA 3ZHSA 1L7VC 1YHNA 4ZGGA 2A9PA 4IS2A 5C1OA 1EYZA 5DSXA 1Z29A 4LG1A 3QOWA 5DLQC 3PFNA 3F8WA 5BYBA 4XOUA 1QG4A 1GAJA 1EE9A 3ZGYA 2WW8A 4GZ5A 3M8KA 2QMUA 4I55B 2JFNA 2LUOA 3OM0A 2EW2A 4KX5A 4TWAA 1GU0A 1KE1A 2XZLA 1R64A 3OEHD 2YHUA 4GPD1 4M98A 4MR7A 3HJGA 4G0OA 1C7IA 3TB4A 3UMRA 5C7YA 1LJ8A 2Q4BA 3W5DA 1KORA 2EJBA 3I8SA 4YACA 1A4IA 2FFQA 4GZ3A 3ZG6A 2FAXA 4AO6A 2EKBA 4IDGA 2IODA 5LP6A 4I5GA 4DMUB 3WTCA 5HCNA 4NMXB 2W2VA 4YQFA 4Q34A 1BROA 1FFCA 3KFLA 4X5OA 3B9BA 2OM6A 4MS1A 1DC6A 3QWBA 4LPKA 4RVFA 4TWZA 5CU7A 3RYHB 4INPA 2ES4A 3AFGA 4XZ3A 1TW3A 3DBHA 1WXWA 2WICA 2XTJA 4JT8A 3KVNA 5TPZA 4CKBB 2P4HX 3N2GA 1PK9A 4RXUA 4IIVA 5FR2A 5IJWA 1Y63A 1P6UA 1KJNA 3KB2A 2XYHA 1SN7A 3E1KA 3PDIB 3PPXA 3QXJA 3IILA 4Q01A 4LFCB 4CKXA 5K8JB 4QTTB 3P2MA 4FYXA 4QU9A 5CJ2A 3REFA 4A8JC 3LVBA 1GSAA 4O2RA 3UAGA 3MJ4A 3KKZA 2UYGA 4R71A 1UQTA 4YDQA 2QD2A 4XXHA 2PWYA 2H4FA 3W34A 1WG8A 1FZTA 2J9FB 3KZMA 4DUGD 2ZWMA 3BXGA 1P9OA 2O2GA 2OCPA 3MNFA 3I30X 1Q22A 3KVVA 4BMZA 4J07A 5K0EA 5A0FA 1JEOA 1TYDE 2C0PA 3W77A 5CA1A 3GVPA 2GHIA 1UQUA 4KCGA 5ILQA 1V4VA 4O29A 5B7PA 4W1SA 2GSWA 1QHGA 2LPMA 4HBZA 1QBKC 1DHTA 1Y3CE 3O0DA 1VA5A 1XAGA 2XMPA 1P19A 1K8YB 4ZQEA 1W7AA 3DVLA 4FXPA 1PLJA 3H11B 3CBGA 3I4CA 4GKAA 4RD4A 2H2WA 1KAHA 3P9XA 4R81A 4U2FA 3SU8A 1SCBA 2G1KA 2EJCA 5DYYA 1RJWA 3A11A 1TKBA 4D02A 5J3JA 1IH8A 1SBHA 4MV9A 4WNCA 3I5UA 2V45A 3TTVA 1WPRA 4FMCF 4M7WA 4WFIA 4Q82A 2R6JA 2VNJA 5TS3A 3NBZC 3LI2A 2WJWA 1JU4A 2FB9A 4B3TB 3AY7A 3IUYA 2PNJA 1VHQA 3PYXA 1ZGHA 1GEGA 3O3MB 3IR7A 4NZMA 4G8JA 3V55A 3AUXA 3H5OA 1K7SN 5E9WA 2VCHA 5A4MS 3VR0A 1S3FA 4K86A 2J3LA 3TXAA 4H15A 4ZVLA 4GI3A 3UPDA 3K6RA 4S1WA 2ZTMA 5IKMA 1B1CA 4CDNA 2FWBA 2MSEB 4EW3A 1I32A 1KDTA 2CBZA 3BHNA 5A4KA 5A6VA 2QJFA 2G72A 4W8HA 1VKRA 1OMOA 2IYWA 3LUHA 5K6AC 4BXOB 3HJBA 1VP9A 4GXRA 5BMVB 1QIDA 3PE4A 4I8IA 2ZYSA 3AU9A 4D80A 1TJ5A 2E87A 1JLSA 1BD4A 1FNCA 1G5TA 2QPTA 3DZDA 1VB3A 4DQVA 4DQUA 4U6QA 3VC3A 4I2VA 5JHHB 2HD4A 1JT2A 1U1FA 2XOXA 1PL7A 4XE5A 5ALFA 5KVSA 5LQDA 1ZCJA 2H2DA 3BHJA 3OIYA 4FZRA 1COWD 1I5EA 1NAHA 1NQVA 4HHEA 3TMYA 1N5DA 4LJ5A 1T24A 1QYCA 1Y1RA 2R96A 4I1UA 4AYWA 2W2OA 4C2TA 3BWEA 5B2FA 2ZBFA 3C3KA 1F4PA 4ICIA 4G97A 1N5MA 3TIXB 3GUZA 1JW9B 2XR1A 3B8HA 3SF8A 1VXOA 2AQIA 3CNLA 3GPBA 3RK1A 4L51A 5BN3B 2QPLA 4PZZA 5D5PA 2BFWA 5E6UA 2G17A 2PKQO 3MEQA 3PCTA 4LHVA 1FP7A 5G0TA 5BR4A 1ISPA 1SWVA 4BHTA 3H6GA 3DZHA 2QX8A 4AAYA 5KTNA 4U3JB 3I9MA 4GWGA 1C4WA 1WB5A 3LXMA 3UYLA 1OH5A 3H86A 1IMOA 1KI2A 4EG5A 2OORA 3S7ZA 1N6LA 2AZ4A 2PWBA 2C84A 4OH1A 3WXBA 5KX5A 1K08A 4P86A 3KJGA 2V8OA 1VRVA 2QRHA 1FQJA 1QNFA 4M2LA 3GUCA 2PJUA 3AYZB 4DXDA 4GWLA 5GVRA 1EWVA 4IQGA 1TQ8A 2N47A 1FFGA 1TO2E 1ZH2A 4KK3A 3IBTA 1I3NA 4PLYA 5DEIA 5BUCA 2WWGA 3NHBA 4IV5A 4NFLA 3H1TA 3JQRA 4ZT6A 2J32A 4TS1A 5AM4A 5JCOC 2R8ZA 3ZE1B 5HPYB 1GPAA 3ENQA 2O2JA 4FFWA 4UTOA 3KSZO 1A9QA 3HCAA 3QPBA 4XTRA 5JC1A 3TO5A 1N9GA 1TA4A 1V9LA 2FUKA 2V7XA 2XX3A 4GOLD 1QBGA 5GJCA 3KZCA 1DO0A 4AY3A 2C4MA 1UJBA 1MPTA 4R8RA 3HFGA 2YHSA 3V7UA 4MPJA 3S28A 2BEKA 4KWEA 1VTKA 4LZNA 3U31A 5F76A 2BV3A 3ZHXA 4MYCA 4EP1A 1J24A 1NXPA 2OCGA 4IG4A 4KN8A 4P22A 2B4QA 1NW3A 2ZJ4A 2GAOA 4FR5A 4MQEB 3OOWA 4K9SA 4Y0VA 3D5EA 4QXOA 2ZJ0A 3O38A 3PENA 5ICCA 1C8VB 4HDKA 3RSQA 1WL8A 2ZSUA 3ESDA 1SMKA 1RM0A 1V3TA 2UVQA 1H2RS 1ZHOA 1M8PA 2QRQA 1GGNA 1ISGA 1VMEA 1RABA 1YUMA 1ECPA 1ZNWA 1V26A 2ZSAA 3CFYA 3QRWA 4HQOA 3ROEA 3PB3A 3ZIAD 4BJ1A 4ZZ3A 3QLVC 3FD8A 2JVKA 4NBTA 4YO8A 1XRSB 4H7EA 4RPCA 2JS7A 3KAQA 4M86A 2NYAA 2X8BA 2ZBEA 1SXGA 1YQGA 4WBXC 5C80A 5IKXA 3F5DA 2AOTB 2HQOA 4HEA1 3FFAA 3M4XA 4Y2XA 5CD1A 3CSSA 4BY9E 2JH8A 1KY4A 3D6UA 4J7AA 4Z0HO 3RGWS 3RVSA 1TU0A 1W5TA 3EARA 1SH7A 5CFPA 2F7SA 5ADVA 2B1RA 1SCDA 1PLKA 4RAOA 4RMNA 3GZNB 1N5RA 5CXSA 3NAZA 5HZKA 1HMPA 1CJBA 3HLKA 5DBGA 3SJAA 1YNSA 1E9EA 1NJFA 1HDZA 3N2KA 4MULA 1QOPB 3G2QA 1AUVA 3CG4A 3O7WA 4REQA 3KT8A 4ZO8A 5ALOA 4FYYA 4AS3A 4DCJA 3HA5A 2WM9B 2BDTA 2X8WA 4AMUA 5KJ6A 5DLEA 2VOJA 1FU8A 1U8UA 3D2LA 2AKYA 2Q4OA 2CXPA 4HWGA 3K09A 3A1FA 1NV8A 2Y1OA 3RYHA 4EYSA 2BKEA 1Q0QA 1L5HB 3I58A 2PANA 5DASA 4KC0A 2Z5VA 4IFBA 4UEOA 1E2QA 3GT3A 4Y30A 3OM1A 2Y2UA 4X7MA 4ZO7A 4UUMA 5LMZA 1MJFA 1BYUA 1FVFA 3GAFA 2AG1A 1W87A 2QVXX 2NO9A 2ZOSA 5JBIA 1P1CA 2PX5A 1CBUA 2IU0A 1P7CA 2HN9A 3D3KA 4W6QA 1NR1A 4KQXA 4DDVA 1IIBA 3N86A 4W5WA 1GQSA 2ZYIA 1SXJA 3T12A 2WOOA 2IKSA 3D8SA 3MXTA 1JQEA 4YI5A 3G59A 3VDRA 3ZQUA 5KVAA 1JFVA 5D6OA 5FI5A 3OAAD 1OBHA 2WIFA 2Q2OA 3FPAA 2ZLBA 4YDHB 4EA6A 4YJGB 1YVEI 4NG5A 5LNK6 3NHKA 3UBTA 4DV0B 3CLRC 2VHZA 3AV3A 1ZIOA 2R9VA 3N28A 5IAKA 1O96B 5JS2A 3UWKA 4UHHA 4RL4A 4LPSA 4BE9A 2ZIXA 5EXXA 4OREX 1QP7A 2GUWA 3PNBA 4LRSB 1B00A 1YV9A 4BLSA 2BZSA 4RDHA 3K4QA 3AQ4A 2NZVG 4B76A 3D3QA 3T06B 3JV7A 1JL3A 4QPDA 4MR9B 2VWQA 1CR6A 2HIGA 2BMFA 1EFPB 5EPUA 4LN1A 4EQZA 2XTZA 3T7IA 4KO3S 4GYKA 1L7PA 2D6FA 1A8HA 4YX9A 4LQLA 2GEDA 2BLNA 4XEUA 4F3KA 4Z4CA 2A78A 2P75A 3OZXA 4NABA 5IARA 3WKCA 5BSEA 4B87A 4I50A 4I1OA 3EA0A 4QJ4A 4QU5A 3Q8MA 2W6MA 2DMRA 2Y1KA 5EP2A 3L93A 1H2XA 2R8PA 2GCPA 4TLDA 2JBHA 4W7HA 1C8LA 4ZEXA 5HZGA 3IS3A 1T0JB 3Q3JB 3HDYA 4DJ5X 5I8WA 3CUKA 1DV1A 1HY3A 2BFDB 1E18A 2ZRHA 3AVXA 1PEKE 1ZMTA 4Z54A 3KXDA 2B7LA 1Z0SA 2N1MA 3AJAA 3TLGA 4B2LA 3VSCA 5HS6A 2AJ8A 3UMFA 4KQMA 3GMDA 2Q29A 2VJAA 1KTIA 3GMTA 8ATCA 1P77A 1GARA 1TVKA 3C6MA 2O23A 4G5YA 1ZFNA 4YRTA 1F20A 1ZBQA 4IGFA 1GFZA 1UAYA 3PZBA 2DYKA 4OGKA 5ECDA 2X0EA 4B3CA 1TOAA 4YLYA 4ZYXA 2P0YA 3CRNA 3GFPA 3GEIA 4EO7A 2F9MA 4GW3A 3EVCA 2H48A 2PX8A 5LXTF 3TZLA 2GPJA 3ZHYA 5KJCA 1EX1A 2QAGC 5G0WA 4G9EA 1TECE 2DQZA 4GMDA 3PHCA 1KHTA 3SYRA 1ADCA 2X0DA 3LD9A 2O8BA 1ZH6A 3KSMA 2YYYA 3HCRA 4X3PA 1MRNA 3VNRA 1MQ9A 3OZAA 5J59A 3VU8A 2HBQA 4BB5A 3MB8A 1PWEA 1V8PA 1JBKA 1X42A 1KH1A 2D2FA 2GA8A 3IA7A 5H5JA 4UAUA 1KS9A 1WUHS 4YJFA 2XA2A 3DE0X 4YRDA 1BHSA 4Y2RA 5BNWA 3E4CA 3OO0A 3PGVA 1LBEA 2NAFA 1D3AA 2Q9BA 2UUOA 4MJLA 4Q9KA 5AVJA 1V25A 3K16A 4G09A 4FKMA 2O4CA 3P4UA 1PR2A 4ZHQB 3WKDA 4N3BA 1I8TA 2B7CA 4XJXA 4DEVA 2B2NA 2H7VA 4ZTBA 5E8JA 3RUIA 3MPOA 2IIQA 4BKRA 4DN6A 1APBA 1N3LA 3N87A 3CO5A 3NBMA 3R5XA 4G4SP 5LOVF 1A27A 3PC8C 1BU8A 1NPDA 3ND9A 4PLFA 4C07A 2C8LA 1G66A 3PL5A 4M9ZA 1PV2A 2EDCA 4E0BA 2JJ2A 5AVUA 1ONOA 2CD9A 3FYCA 4OV6B 3SD7A 3CT4A 3GLVA 1KYYA 1CUZA 3IOCA 3T1TA 2OCLA 2JFQA 1CT9A 2YXNA 3D6HA 4HLUC 5IDXA 4QE3A 2BH9A 3A1WA 3ZGVA 4OHRA 4RE6A 3ZJ4A 4RA6B 3Q8KA 1E5LA 5AJUA 1I6MA 5CA0F 1U7XA 4Z2YA 4MEAA 3JVIA 3P71T 1FSPA 2I34A 3EEFA 4ZO6A 5BVGA 2NT3A 1RPZA 1F2TA 1A76A 1D0SA 4LZPA 2I9PA 1CF9A 1UKYA 2TRSB 1WU8A 2WR8A 3ITDA 1T3LA 2CXTA 4X85A 1MB2A 1XD2A 1BW9B 2G0NA 4FQ7A 4MAMA 1J1IA 5G4LA 4B7ZA 4EFNA 5J4VA 4FK8A 5A5EA 1QKIA 2FDXA 1Q7GA 1RZ3A 4MX8A 3M6IA 5TQ0A 5HHTA 1KOFA 1MENA 4HFRA 1L3BA 5JDIC 4ZT3A 3L1KA 2II6A 3PD1A 4R3WA 3TLCA 4J9UE 2J5KA 3P19A 4KN6A 4YP5A 5JEDA 3DNMA 4F4FA 1H2FA 2XRYA 3H0EA 3FPKA 4KGVA 5FLEX 2JHFA 1NOIA 5D51S 1JAZA 4Y1FA 2QUZA 2JLBA 4NE2A 1X92A 3H5AA 3UUFA 4KXLA 2ZI3A 1QFJA 1M72A 2UYYA 3CF4G 3CEHA 1I5OA 1U1CA 4WACA 1XLUA 2XNHA 5LJIA 2ZYUX 3V48A 1ZUNA 1GTMA 1X1RA 1M10A 3A1DA 4Z9YA 3H05A 3DO5A 3BMOA 2GH1A 4DCSA 2QIOA 5EQDA 1WIWA 4G0PA 2QRVB 4CZ2A 4QLBA 4K40A 3DF7A 1Z8FA 4DV4B 3F5FA 2HRDA 1GRQA 2I8LA 1SHLA 2J1LA 1YQQA 4JB0A 4R2LA 3T5GA 4DGQA 2R6R1 1X77A 1QS0B 4IDCA 5L3SB 3KSDO 1J1ZA 1RI3A 3FPFA 1UIMA 1UINA 5DHTA 1V5GA 4AZTA 2ZCVA 3HKEA 1I4EB 4YRBA 2DXIA 3HP4A 3J81k 2VPWA 1V6AA 4I1IA 3L0YA 2YWFA 3ED5A 4B7XA 3AOEA 4HQLA 4BMSA 4C20A 5C18A 4BO9A 4AO8A 1UBHS 2XB4A 2DKOA 1MO3A 3AIOA 1XR3A 2VAVA 1H5QA 3L0ZA 4MVXA 1FU4A 5FIUA 2NLOA 4RHFA 4Z4HA 4Q1DA 4UE6A 2O50A 3KDPA 3X0DA 5CX1B 3O7MA 1TK2A 1I0LA 1UWVA 1NUAA 2CSUA 4IX9A 4EKDA 1C14A 1QNLA 3V4ZA 3K1AA 5GM1A 2D2EA 3QVGA 2Q1XA 5AVVA 1OGIA 3NGLA 4O0LA 4LGYA 3AV0B 3IAFA 2V6BA 3IEUA 4PZDA 1SIOA 3ZV7A 5IAEA 2CNWA 2OV1A 5F12A 7ADHA 2PJRA 5DHQA 3KTAB 5AKLA 4UU1A 3KEQA 3N0XA 4Q7QA 3IPRA 1S3IA 2FFHA 4CM7A 2E85A 3AP3A 4MLPA 2CYCA 2CFIA 4G01B 4G4SO 4JBHA 4TMWA 1F0NA 2BPOA 2BFFB 1T2CA 2OHGA 3QV1A 1Q7TA 4D4GA 4FCWA 4YIHA 2BH2A 5C8ZA 3WYCA 2DUUA 3AWIA 2YNMA 3ESQA 5C0OE 4MV7A 4E2FA 1SM4A 1AK1A 5KWJA 2QUHA 5AUNB 3BGOS 3KPWA 4QDJA 1JLLB 2QN1A 3RCBA 1DKQA 4E14A 2H5IA 1YAHA 1CUDA 3HNPA 3RDPA 1GNPA 3JAMA 4GT1A 2IL1A 3COPA 3F7TA 1VMDA 2OAEA 1GD1O 1TAHA 4J49A 4EVRA 3AHIA 4FKZA 4YMVA 1XNHA 3VKFA 5KHOC 1F7VA 1D2EA 3COYA 5JEEA 5JS8A 3HKDA 2AFHA 2AD1A 1BVYF 2PD6A 3N07A 1EWYA 4CMAA 2VIIA 2YQ5A 3CYFA 3ONFA 4MW7A 1WZUA 1T2NA 5FO0A 2WB4A 3UO8B 2RD2A 3BL6A 2FGJA 3PJFA 2NPOA 1IPHA 3F5QA 3SZLA 3D5TA 3T7JA 1FDVA 9ATCA 2I4TA 2V0CA 2IUFA 2F3RA 2NGRA 5TJHA 1LPSA 1UP7A 3V34A 3SCZA 1N3IA 2BF4A 5D1NA 3W2IA 3HRHA 4CLDA 1F6DA 2PS0A 4IOKA 3RS0A 3ED1A 2I6TA 2NVWA 3SZMA 4PQRA 1ZVJA 2W6IA 3U81A 4YC7A 1LF0A 3ZZ1A 5DDIP 4E5NA 2WPNA 2JANA 4E5PA 4M37A 3SXPA 5JSUA 2FQXA 1GFWA 2FUG1 3P97A 1QWOA 3L04A 4PEVA 1ICIA 1YR8A 4OHUA 3PC8A 2ZYAA 3AP1A 2AJTA 2X40A 2EV9A 3CONA 5G0UA 3WGTA 2GPAA 4DV6B 1FP6A 4RF4A 2UYQA 1V11B 2IEYA 3SHQA 5KYUA 4RSRA 5KWSA 4YI3A 1M2WA 4ENUA 5JJIA 1G0NA 1LQUA 4ZIRB 1DG3A 2ADMA 4JQCA 5IJ0B 3VKWA 2CLKB 2PQ0A 4DRZA 3HP7A 3HJCA 3LCJA 4RM3A 4KG7A 2QROA 1X7ZA 2DJIA 2B98A 1QRUA 5SYNA 2QRVA 4IXNA 4WZZA 4PANA 4LY9A 1XFAA 3EXG1 2F1HA 4IF6A 4FFNA 5DXJA 4D92A 1M1NA 1P45A 2Y67A 3BWMA 3MRTA 3VVLA 3C6QA 5NLLA 3BSWA 1XO1A 2IOYA 1I7LA 1QIJA 2RARA 1MC1A 4FWIB 2JJYA 5HGJA 2BC9A 4YUYA 3VDMA 2WT8A 3ANTA 3HB9A 1UOEA 5AICA 2J31A 1ISMA 2DTEA 4KTTE 3GJ6A 4NJEB 4PNPA 5KQPA 2HAEA 3K0KA 1MAUA 3ENVA 5U9CA 1RKBA 2HJWA 5A06A 1V1RA 4JC4A 1COZA 3U2QA 5U1PA 2PA0A 4QPPA 3IDQA 1JG3A 3MIZA 1JLKA 1HYEA 5HP4A 5HKOA 4O59O 1RKUA 3CUEF 5A4IS 4AURA 1PNQA 2ATIA 2W98A 4L16A 2CCGA 3ER9A 2CKDA 3I12A 5SZHB 3RS9A 1JFRA 1SKUA 3PDWA 2IKQA 4WXHA 1M6YA 4C3OB 4EHNA 1CJVC 1V8OA 3JVUA 4LZZA 4FOTA 3ZYZA 1S3GA 4F4DA 1LQ2A 3KLMX 4EMTA 1YU9A 1EWQA 1TE2A 2G77B 1QCDA 2ZS9A 2G83A 4DMCA 5J2TB 5TSDA 1F8YA 3CRVA 3LRTA 1U0RA 2ZPUA 4LOLA 1C30A 1Z2PX 1FFAA 3SQMA 4R05A 4G0WA 3IAS6 2KWIA 2F3SA 1T3SA 2W6OA 1QG2A 1B4DA 2L17A 3AW8A 2KSQA 4QG3A 2VF7A 1XZIA 4X62B 2FJPA 3TIGA 1TW2A 3K5HA 1JTEA 4Y9DA 5F7OA 4RGQA 4GF5A 3W2EA 3RK4A 4TRJA 4BEVA 1E3EA 1DWUA 1L9XA 1PZGA 2WSSA 1Q57A 2PH1A 1AV7A 4YJDA 1E1DA 4HXYA 3GGOA 3QU7A 3IEMA 3R09A 4IXDA 3W05A 3M5DA 4F45A 2FP3A 2EATA 1NT4A 4EHIA 3O47A 5FNVF 4W4TA 1B43A 1X39A 1KKMA 2FNAA 1HOTA 1TK9A 3N76A 5TLSA 4L8LA 3TIIA 1WDTA 3DTVB 1NX9A 2BHTA 2ZT8A 3GNLA 3IEKA 3L0DA 3G1WA 1GTVA 2CXOA 3LT1A 4FCCA 3R7LA 1JHDA 5IK2A 4DRXB 2HWUA 4HYQA 1T6BY 4JT9A 4PO3X 5DWQA 4ZT2A 1N0IA 1ESEA 3I3SR 5B1HA 4MGKR 3F1KA 4PX3A 3Q6MA 2ARKA 2IPXA 4O5OA 4D3FA 2Z95A 3VU9A 1VJ0A 4RHEA 4Z4FA 1IN1A 5KTSA 4GMGA 2VYQA 2GJSA 4PRKA 3VR6A 4I66A 4OA8A 3HXPA 4M9SA 4ZDWA 5E7IA 4XD7A 5CVEA 2DTXA 3C8UA 3EW9A 4M6WB 3Q0TA 1WOYA 4F46A 4Z1OA 1BJRE 1SKQA 2XE8A 4MQLA 2R6GA 4KE9A 4KVGA 1EP1B 2QVYX 4PPYA 5I5EA 1QXSA 5KNCA 3CUVA 1U0EA 3PPYA 1VHDA 3DDZX 4G36A 5G0VA 3NHZA 5K03A 3LIPA 1DP4A 4LJ9A 2X2EA 2ZBRA 1T91A 3PF9A 5F2NA 4OQNA 5B1SA 1ESMA 2XQKA 3TVDA 3G2OA 3OOEA 4MAAA 2ZM6B 1SVMA 2XSZD 3O1IC 4X7RA 3ZBTA 4YCCA 2CXHA 3AIKA 1L2TA 4N1AA 4BPBA 1NUUA 1XMIA 3ORHA 3DZFA 2AZMA 4FLMA 3EGOA 3OX1A 4MV0A 4QARA 5ALKA 5B1DA 1XWWA 1FFYA 1MTZA 1RP7A 3RFVA 3RS3A 3WJ1A 4L5CA 5DX0A 1YZGA 2P0AA 1FUUA 2IZ5A 2OHXA 4Q3KA 1QU2A 5FKJA 1MOPA 4GPTA 4BNTA 1NKSA 2ZAIA 4PX2A 3TR6A 2NYRA 4I5DA 4XJVA 4UPEA 4DDWA 4WEQA 1N6RA 2B8EA 4MIKA 5EPOA 1HDYA 2EL9A 2QTVA 1M2NA 4O1IA 5AK6A 3VH2A 2H4YA 4EHDA 4MYUA 1BMFA 3EUAA 1AKRA 5CR9A 3WL5A 1ZH8A 5KOHA 3L8CA 2NG1A 5ERYA 1O8BA 4BO7A 4RU1A 2HO4A 2K7ZA 2ZITA 4ZJUA 3OFKA 2ZP1A 4MUXA 1FC0A 2IE0A 3U62A 4I6GA 3JAKA 3JY6A 3OT5A 1GY8A 4WNYA 1AF4A 3B1YA 4UCWA 2WM3A 3EHEA 3D31A 3KQQA 2PFGA 1J8YF 1II0A 3WO1A 3B6IA 5DCLA 1JJVA 4GPBA 2IXFA 3NC0C 5A4JA 1DTEA 2W43A 3GY0A 4DCTA 4DM3A 3R9XA 3RC3A 3L5KA 1OHHA 2Z1MA 3P2OA 4TXNA 3T3HA 5C1BA 2LDXA 1BMQA 1EWKA 2ZR8A 1XKLA 5C51B 4B33A 2AI1A 4V24A 5GQSA 3JQAA 5LJLA 1RTTA 4NH4A 2ZCJA 1U3CA 2GXUA 4ZI2A 2WVJA 3CNHA 5HMLA 4ZGWA 2OAQ1 3I2YX 5JJLA 1EM8B 4RPHA 5EJGA 3HDQA 2QX9A 4ED9A 4KBFA 3VNVA 5GONA 3MWLA 3NEPX 1GPYA 1GGJA 5KNCD 3A6HA 3E7XA 5KU7A 1PDWA 2PVCA 4R69A 1T8PA 1UDBA 4LI3X 1QQTA 2PWZA 1CP2A 1JR3A 3M81A 4HDMA 4HWPA 3RS7A 4P0PB 3O3CA 3CINA 4KDRA 4GOJA 4ZREA 4AWXA 1L5HA 1P3JA 2O1SA 4B3IA 4MVJH 1GA1A 1X1SA 2YW9A 5C1DA 2JF0A 4RDCA 1HYQA 3FLAA 4ZOLF 5DGIA 1GITA 4HZUA 2WZBA 1Y8CA 3R3SA 4M55A 3S5JA 4EI2A 1X1EA 3X1ZA 2D1TA 1XNGA 1JIJA 4V1CA 3AYXB 3ZDDA 1QU3A 4HSGA 3GMSA 1TQ2A 2RGBA 4CKCB 4K6OA 2ZYTX 3PC6A 4LQCA 4PZYA 3RWOA 4Q4AA 4F3YA 3K9FC 2DJ5A 1EP2B 1OXUA 1IUNA 1ZONA 2A5FA 2G9ZA 1J70A 4DYDA 2QVBA 1Z83A 2BTQA 3D8BA 2ONYA 2WWXA 3E9ZA 4IH4A 4XW2A 1XL1A 2VHQA 4IJUA 5DGDA 2QLLA 3QHPA 4IM7A 1L7BA 1DZIA 2RJOA 3W4KA 3DE6X 5CFOA 1TM2A 1LDMA 1H4TA 2V54A 3GFBA 4NEGA 2WE7A 2PD3A 3QXSA 2EVWX 4M49A 1NVDA 3E4DA 1BD3A 1EFTA 2A9VA 2HXSA 2QS9A 2Q0HA 3HN2A 3PUWA 3PCXA 4YPOA 5AIBA 1QG0A 3MJCA 4P34A 3TW4A 4ALLA 1LS1A 1L4LA 2R65A 3HRIA 5L45A 1L5FA 1RCUA 2DUWA 3SSNA 4EZEA 5CB4F 3IOMA 4YWJA 3C97A 5FDFA 2ZAYA 1KWKA 1H5UA 1P2UA 2H07A 3PFHA 3V8PA 4PAWA 2VYFA 1HNXB 5BURA 1SRQA 3C5VA 2QPOA 3EGCA 5FX2A 2P68A 2O5RA 3C5WP 3KZOA 3WNCA 1D8AA 4CMGA 4DIBA 4ARAA 1CR1A 5AM5A 2WTAA 4JHXA 3KR2A 1U63A 3B7WA 1U3FA 2QORA 1YRAA 2XF8A 5FD8A 4DXHA 1I2BA 1GU1A 1IHYA 3BL8A 3QNUA 4YGXB 2KMLA 4ID3A 1JS1X 1XQ1A 3CX4A 3U7HB 1UBRS 1TRKA 2GGSA 1XX6A 3LBHA 3EZXA 4PPGA 5ALTA 2UVPB 3MIIA 4BEBA 4EGJA 1U0HC 3ETDA 3OY2A 3I04A 4WKOA 1QIFA 1Z5OA 3TSYA 2ZT6A 3OAAA 5FPPA 1P9RA 2F62A 1I0ZA 3HE3A 3N9IA 3LC0A 4LA4A 4PSAA 3CC8A 3QTLA 4RZSA 4FGLA 3TNLA 4Q7KA 3D5QA 1Z5NA 4JWTA 1NJSA 2O06A 1WVMA 2CFSA 5AP9A 3AEXA 4NFSA 1ZN9A 3MOIA 4UZEA 1S4QA 4Y18A 1JHUA 3IBYA 2AG5A 2HJRA 4HGQA 4C4ZA 4IIYA 4TM7A 1Q50A 1X7WB 2Q8PA 3HNRA 1AGYA 3DPIA 4NBLA 5DI9A 2COKA 2RK6A 5EA2A 4ZYUA 1S1MA 5CB6A 1TC1A 3PC7A 1MFPA 3TI9A 1IATA 4ZK6A 3THWA 1RYZA 4DPKA 5NULA 3I3OA 4MQFA 1MO2A 4BP8A 4H60A 2A35A 3WB2A 1NONA 5BN3A 1L4HA 2J7PA 3B7GA 3IIMA 1PWHA 1JV2B 3PK0A 2XNDA 2PMDA 2AG0A 3TRHA 1O0BA 1N2JA 3L01A 1I36A 1QDLB 4HLUA 3WRWA 2C5BA 1LB1B 3HKBB 4YAWA 4G89A 2N3ZA 1H94A 3ZHOA 4GXQA 2F3TA 3KG2A 4Q37A 3RPEA 3N0TA 3QI2A 2C2MA 3Q7SA 4FE3A 2QG9A 4ZI3A 4II7A 1Y34E 1VKHA 3CRMA 3K96A 3D6JA 3R0XA 4BIIA 1C80A 2XUZA 2PUTA 3DGEC 5CAEA 1Z0UA 2BSAA 4UREA 2IW1A 4JI7B 3OTIA 3OCYA 3V7FA 3SSOA 3IIEA 3JQ8B 2ZZMA 1KO4A 4LYAA 3NZEA 3WRYA 1K1EA 4EX7A 4FBLA 4FDMA 1CHDA 3PHBE 2HPVA 1NRIA 2PX4A 3D3NA 5CM8B 5CEJA 2WYWA 4RK6A 1EJBA 3MMNA 2F55A 1K8QA 1T8YA 2RK3A 3JQAD 3F3YA 2NU7A 3AUTA 3PXAA 3G9TA 3WRXA 1K4MA 2CLDX 3F7MA 3IUMA 3JQBC 4C03A 4DT1A 1MO5A 1KEEA 3A4TA 3PVSA 4UTPA 3NO4A 1IJFA 4QUBA 2I8AA 2AZXA 5DIFA 2J9ZB 1W1UA 3TOVA 1BN6A 3OZFA 4CEHB 4JS0A 3QEAZ 2E37A 5E2AA 1FOEB 4GNKA 2QZ4A 1KRWA 3AOGA 1B15A 4LY6A 3ZE0B 2Q5EA 1W85B 3S2GA 5C7IO 1VKOA 3ZH2A 5H8WA 4M0DA 4URUR 2NZXA 3VOSA 1L4GA 5JJBA 2EFYA 2XQVA 1WV1A 5FV4A 5UKDA 1VPEA 2C4NA 2C9BA 4EJSB 2GLXA 2IPNA 1O3YA 4GAEA 1A9TA 2QRUA 1ZBDA 2V7PA 1RLTA 3BQMB 4RPLA 2PMCA 2WWTA 4I5EA 1C3JA 4FJ1A 4GOOD 2ORWA 2XIJA 3C1OA 3S1AB 5KYXA 2WWYA 1FXWA 3QA3E 3B9QA 4I8DA 5CGQB 1NVXQ 2GHTA 2LZ0A 3HCOA 2GN6A 3I39X 3HI4A 4AKEA 4Q3OA 2EQ5A 1TF7A 4OLBA 4JENA 3PUJA 3RKUA 2BIFA 3K8ZA 4BBZA 3E5MA 3B85A 3QWIA 3K72B 3UCEA 4EQ6A 1PGPA 2ROQA 3GFGA 2PTGA 1GN8A 1MZPA 4JT4A 1IMJA 2WHPA 4R3UC 4TLBA 1DMRA 4RVSA 3DMTA 3WG9A 3RTDA 3ORSA 1JEYA 2F4VB 1JXQA 1CKEA 1A9PA 4W5HA 5LA6A 2PQMA 1DL5A 4XM2A 2GXSA 3NBAA 1BQ3A 4NDNE 4Q19A 3ZWPA 4Z4QA 1ZQ9A 1ONPA 4DQDA 3OECA 3H1EA 3E9QA 5T6BA 2O20A 3FVRA 2NTEA 4GUAA 3N2GB 5KTYA 1F14A 2OCDA 2C9OA 2XD9A 2IPOA 2XB9A 3L7MA 5AKHA 4HNUA 3GPIA 2X5OA 4CLRB 2P9TA 3RBZA 1UKEA 2DBYA 1V3VA 5HSGA 3HEMA 1YZLA 1DU4A 2VK8A 3FBWA 4PC1A 4KREA 5E1OA 4WZBE 5CYOA 4J29A 1VKZA 1ODFA 2WHEA 3JPYA 2AHRA 5JVDB 5JJCA 1QPZA 1DFHA 1E9BA 3UATA 1WMSA 2G40A 2OLJA 3BZWA 1FEZA 4B4WA 4OX9B 2Y0PA 2PJZA 2FXVA 4YA6A 3S2UA 4YYEA 4IHJB 4KIUA 2AJCA 2Y0EA 4L7QA 4LXXA 1Z13A 3T3IA 2APJA 1G8MA 2Q46A 5KYUB 5LVAA 5FPHA 1Z22A 5ICFA 4DCOA 3WLSA 1Q17A 1V9CA 4BVGA 1QDEA 3A05A 1JQAA 1U3DA 3ETJA 3TNYA 4FBGA 2BFBA 1R4MB 3NUZA 1YZQA 1Y82A 4A5OA 5E4FA 2O2ZA 3TRFA 3ZPXA 1P81A 2Q1SA 3EAFA 2PYDA 3L0SA 2JW5A 5DNVA 4R16A 4Q00A 4WESA 3UV3A 4UMDA 1IY0A 1Z4QA 4CKEB 3MT7A 5H4HA 1OR8A 1W9HA 3QLEA 4HO1X 2FSVA 1KIMA 1N75A 3LC7O 3EA4A 2XGOA 5IM4F 3H2HA 2JGKA 3VNBA 3ZZ0A 1OYOA 3D0OA 1MQSA 4H4EA 3LH5A 1UWKA 4MW1A 3UWPA 4ALKA 3AR7A 3U7FB 1JXAA 4HUJA 1VCMA 3DXYA 2VBGA 4WX2B 3SEZA 3TZQA 1H9BA 4GI2A 1L7NA 4AMBA 4BX8A 4Z51A 5EE0A 5EP1A 3AR9A 4I2NA 1FJGB 3WDLA 1DIGA 1TZBA 2PYIA 2VXCA 1JALA 3R7SA 5AK0A 5EOVA 2AS0A 5FT9A 4LAFA 1NVVQ 3FUVA 4A6XA 3VH3A 3O03A 4NHEA 4MI3A 4Q15A 2V0NA 2O8DA 1JA0A 1NLZA 3CG0A 4OMCA 2G4VA 1L6RA 4U8GA 4XEHA 4NESA 1M2FA 3IHWA 3OQIA 5EZQA 4Q3EA 3BULA 2BFEA 3FKJA 1E89A 2Q6VA 4J3FA 4DSTA 4MRMB 4CLOB 3TZEA 2XVXA 5AQEA 2XUAA 2CJXA 2CWWA 4JJ8A 3COWA 2FEPA 4RA9A 3TAXA 3KHTA 1I2ZA 3IVRA 4ME6A 5AVKA 4M8IA 4MS4A 1VL5A 2WVHA 2ZGVA 3W2HA 4ZZ2A 3FNQA 1AVTA 2HWWA 3BDIA 2ZIEA 1CS0A 2HJ9A 3QVXA 1MH1A 4BOYA 1DOAA 3VU3A 2A7XA 2ID7A 1SBIA 1ZYUA 2OB2A 4P98A 3L40A 1OV6A 1QAMA 3ZC3A 4OTZA 3USCS 5B57C 1MNAA 2DU8A 3OPVA 3VHLB 2PGXA 4ZVSA 5REQB 3TLAA 2R7MA 1BC5A 1MEEA 2ZROA 4G0MA 3HXQA 4O4JF 4QBKA 5IJ9A 1OU0A 4OFWA 4TSFD 3H2JA 3P7MA 4CIXA 4RF2A 1OHHD 2NO5A 1P7YA 1Z08A 4GOXA 5KQLA 1UBMS 2H1HA 4Z9FA 2UKDA 3EBLA 4F3RA 3DB1A 4FYMA 4JCCA 4R0NA 2G9VA 2WG1A 4V02A 3W6ZA 3ISTA 3ZDZB 2O14A 1O57A 5F64A 4JWKA 5IVIA 4RELA 1H2HA 1C41A 2Y1DA 3AXTA 4MAFA 3VQTA 2ACEA 4WXPA 4F8EA 2P3SA 3X1XA 5KYNA 1YZUA 1V1MA 3N7AA 5J4KA 2D5AA 1TEZA 2HT6A 1R2QA 2EP5A 3MM4A 1OXSC 1YHZA 3QIVA 16PKA 4X7BA 4K9LA 2YYAA 4EPYA 1THTA 2Y27A 1T9KA 4QBHA 3DMTC 1VBKA 1QMGA 3ND8A 4IKPA 3K0FB 1ARZA 3LT5A 2JLYA 4C0KA 4DC1A 3QXHA 4I4NA 4NNJA 4K9DA 1RQPA 4HQNA 2FPIB 3HWSA 4G25A 1SKAA 2GMWA 4HDRB 2OZPA 3QWAA 2EXXA 1Z8HA 1Q91A 5DBEX 1EVZA 1R3UA 2O7RA 4YMLA 3QVSA 1ECGA 3RC1A 1N1MA 2C1EA 1VI6A 2F90A 3R20A 2P2CA 3GJTA 4IIFA 1GTG1 3HUUA 4JIGA 5LP1A 4JBXA 1QORA 1ORVA 5JTUA 2V5AA 2QN6A 1P8AA 3GEGA 5JSYA 1J23A 5LB2A 1RR6A 2HNAA 3AUKA 5FADA 2PR7A 1IL0A 4DQLA 3CX7A 2PGAA 4V0OA 3VHXA 5C35A 1NXQA 1P2FA 3FPEA 3BMNB 2WTMA 3LUKA 3O82A 4RVOA 1PJ4A 1DZ3A 2HB6A 4WGFA 2JIDA 1VIYA 5JCJA 1UKZA 5JDCC 3UUGA 4CKWB 4RHYA 1PKXA 3AI3A 1UK6A 4XGNA 1J7JA 2HA0A 3VR6D 3V3KA 5B36A 3B89A 5BV2P 1KU0A 5FWNA 4OF4A 4CKWA 2AWOA 5L6MB 5FWDA 2QNBA 3KXPA 3ADCA 2KW5A 4A3SA 4F60A 3IIJA 1FSZA 3K1JA 3PNOA 1F12A 1ORWA 1O6BA 4ZANA 4RMHA 5D3MB 1CJMA 1TU4A 3BJZA 2P2NA 1E2MA 3OE4A 4PS1A 1IN8A 1GAWA 1R8QA 2VG8A 3KCNA 4PLPA 1PVOA 4P53A 1Y1LA 4NENA 3H42B 4XYLA 5KOJA 5KMGA 3HPRA 2GBGA 4ZYZA 1EUCA 2H8GA 4DJDC 1OPRA 1RC0A 2W4MA 3FPCA 4LXIA 1F0YA 1K06A 1V71A 2HO5A 2W11A 3AHEA 3FYDA 4HJXA 4OU5A 1EUDB 2CUTA 4HDRA 4RTQA 3O8QB 2B8TA 3Q7TA 4N39A 3CX8A 3TUIC 3O8LA 3X2FA 4L5JA 4EYQA 5J4HA 1H69A 4HDCA 1U7PA 1EZ4A 1QPGA 2GBPA 1FRQA 1KR2A 4PN7A 2D74A 1TUEA 1PJ2A 2WC1A 3G7NA 4H18A 2ZG6A 3PVCA 2EKLA 4MUHA 4P32A 3A2LA 2OM2A 3MLBA 2GQ0A 2IYPA 4R40A 2R44A 3B8EA 4AP5A 2H06A 5JZSA 3WAGA 3UGJA 2XXBA 3D54D 2AR0A 2H6EA 4D79A 4PG5A 2G7MC 4GMFA 3WOVA 4UNRA 4YAFA 1J9GA 1BCSA 1ZUD1 4DZZA 1Z07A 5EJ2A 4IHJF 4C7KA 2ZXUA 4UMFA 5HCIA 4DIMA 2CVFA 3V1NA 2H0QA 1NUTA 1BVRA 4WLVA 4IZOA 3GJZA 5E6RA 3C6YA 3M7IA 5FOVA 4BNVA 1SHUX 2R6FA 2A0UA 3VTKA 1NNUA 2FSSA 4WN9A 2YXDA 1ZM4A 2NXNA 4IKEA 1NVEA 2QMEA 3B53X 2CV0A 3B6KA 2G76A 3FCEA 4FUTA 4D3YA 2OGUA 4GQAA 2WK1A 3DZGA 1UPXA 1PQWA 5J5CA 3KU4A 2YQ4A 4C0BA 4CCAA 4G6ZA 5CDHA 1EB8A 3DZIA 4OHOA 1YMUA 2VJYA 4KO2S 2B34A 3QVJA 4XD7D 2C42A 2ZUSA 4L50A 3L6OO 4K46A 2ZJBA 4DDKA 5HX7A 4BKPA 5CB4B 4RA9B 1OV4A 1X7YB 1OLUB 3QYAA 3TD6A 1DEHA 4EGQA 5AVYA 2DBVO 3L4EA 5FH9A 3CVXA 4G37A 1AT1A 5HW0A 3ET4A 4RPKA 2Z9BA 4US1R 3BMCB 4J3NA 3K8OE 3S2SA 3NIFB 4H7KA 4H35A 5AOBA 4BZQA 1TZ2A 2I8CA 4GQIA 2YNMD 3GARA 1UR5A 1MABA 3ZE7A 3U49A 2FK8A 1ISSA 1PT5A 2DFKB 4QYTA 3KRTA 3TSCA 1ZOLA 5JALA 2A57A 2E18A 3ZX4A 2R25B 2QXYA 3S0JA 3IV7A 1WJGA 1XEWX 3RGGA 1PZXA 1QF9A 5E0KB 3P9IA 3SN6A 5JAHA 1CEYA 2XKAA 5JDCA 1YKFA 3SFTA 1WCV1 4L76A 5FLXA 5B3LA 3FTFA 4BNWA 2EKPA 2FKAA 2I4MA 2W6PA 3IKLA 4P3YA 5HTKA 2Q7DA 1QJCA 2PGDA 3JQGA 4OB8A 3ZN2A 4A8JB 4GO1A 4KFCA 1GPNA 3LX5A 2NTNA 1AKEA 3R5SA 3ETCA 4WOCA 5CLGA 3SJ7A 3V1LA 2AMVA 2CL6X 4D9EA 1CRWG 4LK3A 2CLLB 2PZBA 5MFPA 2YVUA 4DOMA 2WFLB 4H17A 4Q6WA 2GBLC 4YJGA 3EDYA 2GARA 5L7YA 1KFJB 4B31A 3ROFA 4LGMA 1UWCA 3LZCA 2YC4C 5U4QA 2CN1A 3A2MA 5JAUA 2PKCA 2WVGA 3ZVNA 4KVFA 3EDRA 4G8BA 1T1EA 4KAJA 5DTMA 3D6NB 1MZVA 1T36A 4P54A 4KN5A 1JDTA 2YZNA 4N8SA 5BWMA 5GINE 5AJWA 1P72A 3CNNA 6REQB 9MHTA 1L7QA 3N2NA 5AM3A 2Z1NA 1EVJA 2IDJA 1RVV1 2X4IA 2VDOB 3H8JA 3BBLA 2IV3A 1HNWB 4Z1MD 1SZJG 1VLZA 2CB0A 2H29A 3W6NA 1ZINA 3DV0A 1T0UA 3JWPA 3A9RA 1Q84A 5GWXA 3WICA 2J3DA 3G79A 3FRIA 3K94A 4PYMA 4HC4A 3FNEA 5F21A 4IZ6A 4K9QA 5AW8A 1KMMA 1CY0A 3TS1A 3V7WA 3MUEA 1XWFA 2BFPA 1ZVKA 2AWNA 2BGNA 4C4TA 3W7VA 1J99A 3FI0A 5JAOA 1XK7A 4M89A 4K8OA 2L0XA 3FMFA 4KXYA 4QREA 5DF1A 5EYPA 5LYJA 2I2AA 3E9CA 4IIDA 4Z86A 1NDQA 3E3MA 3OZBA 3SQLA 2P62A 1AK9A 1ZD2P 1L5NA 1UWLA 3U4HA 1TIBA 3D2CA 3K5IA 5CT4A 2OESA 1IQ0A 3V1KA 3VSBA 5A5VA 4RJJA 4Y6QA 1LPOA 3RRNA 5T8KC 3QXXA 3ZE6A 3L1UA 3E9RA 3UG6A 4EJ0A 4PHHA 4DG8A 4GDMA 4ZOLA 4WKPA 1JEYB 1GSIA 3ZXUB 1ZICA 3T5DA 5D85A 1YC2A 1YNOA 2X6TA 2GEFA 1OKKA 4DHEA 1U3GA 4UU7A 5AI5A 3A6GA 2GYYA 4HPWA 4P3PA 3W5BA 4A36A 1W4LA 4ZMBA 1P5ZB 3LY5A 3ZQ6A 5LD2C 4B84A 4OD0A 1T9DA 1TTPB 4OGGA 1FMFA 4FS8A 1N6OA 4JVOA 2QX7A 5A2QA 4PO1A 1NLFA 1XZPA 2GM3A 3I64A 2H0AA 4UUOA 1GO2A 1OQAA 3SJUA 1JPUA 3TEMA 1HQYE 2AH5A 4O2BB 1MA3A 1H1LB 1XVIA 4CMKA 3DMHA 3KWJA 3CCFA 1R6UA 3LPLA 4GX1A 4K6KA 2H7XA 3I09A 1B8PA 1YOVA 4ARBA 3KYDA 4YDSA 2OBYA 3N70A 1T9CA 2PK3A 3DEFA 4ND8A 3L4BA 3NIGB 3WLKX 3UJNA 1QANA 1FYXA 1W581 2XUIA 3I2JA 3ISJA 1HQDA 4J0KA 3VH4A 3WIVA 3OTOB 2WYVA 3JPWA 1YSCA 5JU6A 1U0SY 2GVDC 3OU6A 3BC1A 3DLIA 1SUBA 1EP3B 2E4YA 1OXVA 2PUWA 3G8DA 4DT1B 4CGYA 4ER6A 3FDXA 4CT0A 2J6CA 2RKWA 4GMHA 1PDVA 2C2HA 4KQ6A 2RC6A 3ZLBA 3VKGA 1PL6A 1ZP6A 1DMSA 3DV0B 4PFKA 5CVTA 3RE1A 5AJTA 1TUGA 3VR4A 4BB9A 1MUUA 3WIBA 2XCTB 4YRLA 2JHCA 4EUEA 2HR1A 5TMDA 3TDMA 4MI1A 3WKBA 3H8WA 4N7JA 1F51E 1YBHA 1RLJA 4BLVA 2NNWB 3ZU3A 4CMBA 3MQ2A 5DULA 5HUJA 2JJ1A 5ALDA 3X1YA 4Y9SA 1NU8A 4MUKA 5FOXA 2GTIA 4O4IA 3FLBA 4AROA 5K2OA 3H17A 4C0JA 4EW1A 2O7SA 2I78A 4N03A 1T25A 2VLIA 2XOEA 3E1GA 2PAAA 3UK6A 3GLFB 1OYVA 1HUQA 3RUPA 1H2WA 2C99A 1S2IA 4F2PA 1E1CB 3FJOA 4E2YA 3JQGB 2BF7A 2GPWA 2SKEA 4L8YA 4TXMA 4K0RA 4RMJA 2GO7A 4IHQA 3QWHA 1Z2DA 2GT1A 4WY5A 2P9YA 3RT9A 3LKDA 2W0MA 5JNWA 3UXMA 4YIKA 4OSEA 4EHAA 1WCIB 4MR8A 1FSFA 2IU4A 3DCYA 5JWOA 3MWKA 1K3TA 1B6SA 5ALWA 3AT1A 3SC2A 1GRCA 4LDJA 2ZRLA 3EUWA 2E3JA 9LDBA 5T7BA 1YCGA 3ACBA 1DO8A 3VC2A 5INTA 4ZOEA 1I4LD 1FYWA 3IAM6 3QFCA 4BXOA 3A37A 4G1FA 1KYWA 2WTNA 2YXEA 1COWA 5K3FB 4BWVA 4YRSA 1M8FA 3AJEA 1EBBA 2JIOA 2IH5A 3WAJA 4OQDA 3WMFA 5BV1A 9GPBA 2AOVA 1E7QA 3QFFA 3ZU6A 2A33A 1EXVA 2XVMA 3AU8A 3B78A 1VPDA 5AVWA 3EXHC 3KOZA 3ZOZA 2PJDA 2DC1A 3KOWA 5FI3A 3RFTA 3VR4H 3I9LA 2O5EA 4QYXA 3RAJA 2ETVA 4ECAA 2O19A 1QHYA 1SQ5A 2I67A 2IYYA 3GVXA 4ABYA 2QD5A 4G0YA 2XDWA 3NDJA 4PINA 2H3HA 1W0JA 2GZSA 4XQ9A 5F52A 2AE1A 3ZHUA 3ZE8A 4B0OA 5ADHA 1XRMA 4NAUA 1IOZA 2ZPAA 3L8ZA 3L7CA 4K28A 5IYZA 4PCUA 1JQDA 5COAA 1F4VA 4D6PA 5JH7B 1ZLYA 4L0CA 5CVVA 2W48A 2WAXA 1DKMA 1U0NA 3UMCA 4YAEA 1T4BA 4KXQA 4F5ZA 2WWFA 4RTNA 4IF4A 1FNNA 5I7SA 1PS9A 3ZVRA 5KINB 1XTPA 1J0EA 2DQSA 2GCIA 2I80A 4OI1A 5P21A 3PFFA 4KYTA 1JQKA 3ODPA 1X1CA 2FP4B 1C3OB 4FEAA 5ERGB 3PHIA 3KZVA 3LSTA 4GG1A 1TFUA 4NH0A 2H63A 4OXNA 4Q47A 3FDZA 1H9AA 3WBFA 2JDID 1GN9A 1JSZA 1AJEA 1C29B 1DIAA 1FPQA 2C3OA 1SD1A 2W83A 3OFSA 3Q5EA 5G02A 3A3YA 3RSSA 1O6ZA 3K0CA 2XVZA 5C7LO 2OXIA 2ST1A 3NHAA 1C9NA 4ZZ1A 3S8MA 2QUIA 1E6MA 4KUHA 3ABIA 1M6VB 2UXDB 3H9BA 1SVSA 1BHJA 5DM2A 3IXMA 3SF0A 1NJ1A 1ZNZA 3MCZA 4NMHA 3RUAA 2PZGA 4B2PA 3LRPA 3PQDA 5ARBA 1SB9A 1QIHA 3CH6A 1F9AA 4Y2VA 5ECWA 1C3LA 2B8NA 2VDWA 2VSFA 4KQEA 4W7IA 3ZWDA 1IUPA 2WQ6A 4MUAA 3KE8A 3ZTYA 3NV7A 1ZLXA 4HZUB 1YE8A 2NU6A 4XB1A 3HQ4O 2ORVA 1XTKA 4FM9A 2OCKA 3ZWYA 3K6KA 4MEBA 1RNLA 4R3NA 1JHQA 2GFIA 3Q3CA 1S96A 4RLQA 4XVQA 2Z6UA 2OD7A 2JAXA 1W29A 1C50A 2I22A 4Y9TA 4WLEA 1LFAA 4WLOA 5CLHA 1SIWA 2OSBA 3LGAA 3UXHA 4JC0A 4L8GA 3VR5H 3KQVA 2GI4A 4RSHA 3SOPA 3VR5A 4NTZA 1OFIA 1Z74A 4J8PA 4Y7DA 1OGYA 4X66B 5AJVB 1QB7A 2YZ7A 3BGWA 3W1VA 4AXBA 1T35A 2EARA 2WIDA 3OJXA 4Q4LA 2GEUA 5JCPA 4LVUA 1FDSA 1MHPA 5K20A 4LDZA 4XWAA 1SC1A 3AUSA 3VC1A 3VTZA 4F7WA 1H3EA 3RU7A 1Y7IA 4LNUB 1QH1B 4MB6A 5H3HA 4EGAA 3EDQA 5JAPA 2JGAA 1J56A 3MGBA 3PTAA 2HDHA 3KSUA 1N7JA 4PQEA 1KH3A 2NU6B 1DC7A 4HQKA 2FSPA 3T99A 2FHSA 3QVLA 1JDPA 2IA5A 5B3JA 2P2GA 1PT7A 3FGZA 1Y4DE 2Q1WA 4LJRA 2FEXA 3QEMA 4PHGA 4MVJM 1G5IA 1XCLA 4KNVA 5AJYA 3C1UA 4C5CA 2FXIA 5K8CA 3A6PC 4P80A 1KZ1A 1YBVA 2AFHE 1PFYA 4LX0A 5CFLA 4QNMA 3M49A 4EL0A 1B73A 5F98A 4MWCA 4C88A 5BWCA 3DG9A 3OCVA 4ARUA 1R9NA 4Z49A 2FPIA 2QAJA 2V98A 4YCNA 1JXOA 5KOHB 1NI4B 1TMGE 3Q1KA 4ZYVA 2WLTA 5EERA 3WIEA 2HGZA 1DINA 5E7QA 1N6KA 1OFVA 4K2HA 5GMOA 4L1KA 1EKXA 4JFAA 5D5QA 5J5AA 4AZ3A 3VM6A 1WF6A 3C7AA 3X43A 3DE5X 3HR4A 4PZ9A 5EWMA 2Q7XA 2QRGA 4L75A 2PUBA 3L79A 1W2GA 3DOEA 5DGCA 3RG8A 3LJKA 5LLDA 4HYYA 1X19A 2HEGA 3NB0A 3PRYA 1QYWA 5FF9A 3T9DA 3TZCA 4AN0A 3PT5A 1ELOA 1V7QA 3KC2A 2HMUA 4N5DA 5GZ3A 3C8DA 3EVGA 3WL4A 4OBEA 5IYZB 1SAYA 4R9UC 2YHBA 4Z53A 4DYHA 1FB5A 5REQA 4DR3B 1GPWB 2BEUA 3BWVA 4L5BA 3TI7A 5GZ1A 1QFZA 3AG5A 2Y9MB 3Q98A 5K8IA 3OLXA 3PYMA 1HE4A 1OBFO 4ZO4A 4B7AA 2FMTA 1KSHA 3BEOA 3MXOA 3ENZA 3UTCA 1ZHHA 3OF5A 3ZY2A 1UMCB 3VZQA 4BP1A 3LHSA 1T34A 3QUAA 3RNOA 2Z1DA 3OFJA 3HGQA 5B1EA 3G8CA 2OZVA 1EEHA 4EL5A 4P9NA 1I3LA 1PLLA 5FBWB 4REMA 4ZYTA 4YDRA 3ICEA 4ZJPA 4L85A 1FTSA 1MAWA 1P0MA 3ETHA 2WFZA 2ZVQX 1X15A 1XTUA 3MAAC 3O73A 3F97A 5FFFA 1RI5A 1GEEA 5HBRA 3E3AA 3QBTA 4NR0A 2V3VA 3WGIA 4R41A 5ALJA 1S2GA 2ZVJA 1OZAA 3I01A 3UMSA 5FJJA 4O1MA 4CM4A 5JC8A 1T4MA 3RYFA 4IL5A 3PWKA 1NVBA 2P9JA 3DEKA 5D2CA 4DC0A 4F86A 1LW6E 2A9KA 4WASA 1IWOA 2A59A 5DISB 5A5DA 2NPIA 5I48A 3GBVA 3BSFA 2JL1A 1IZZA 5JXIA 5L3VA 4N12A 2J09A 4I1VA 221PA 3HCNA 3T7RA 2WIKA 3IP5A 3PIDA 1QP8A 4K9KA 3ICWA 4W5RA 1W35A 4J94A 2CMFA 4LBWA 1QAQA 4J0GA 1NOJA 4QDZA 2R1UA 4XSHA 4CKEA 4O4IB 4KPEC 1G38A 4ZK2A 2RG1A 2HMAA 4Q3AA 2NXCA 3C6XA 5DTRA 4ENQA 5JMOA 2AC2A 4YQYA 5FUWA 2RGXA 4ZC8A 4KI7A 1XQWA 3H9QA 5SY6A 3DL2A 3GRFA 4UVEA 5ITWA 4QPZA 2HRZA 2O7QA 3RSCA 4P8RA 1CF4A 5JWHA 2LE0A 5C5EA 2NW6A 1PE0A 3EIOA 4OUDA 4R2KA 2GBLA 3QX7A 4U7DA 1E96A 2BRUC 2DM6A 2XZOA 3MZ0A 4B48A 2FUG6 3NTLA 2C4HA 5JO0A 1E2BA 1RBZA 2D2VA 1TDJA 4J0JA 4DPLA 1OFUA 1ZGZA 2VHUA 3EIFA 1KQOA 3N2LA 3PWSA 2ONZA 2XQGA 4TYYA 1DLIA 3DTTA 4BO3A 3I4FA 4G1VA 5T41A 2J87A 1N0WA 4F0JA 1VPLA 2CGEA 3WP0A 3ANXA 4O2BF 3KOOA 3T52A 2FW1A 3IE0A 3RREA 1WD5A 3AZQA 2IEIA 3V4SA 2CEKA 1WZ2A 3KQKA 3BFXA 3CURA 2G1AA 3I45A 3DE4X 2QGNA 3MWFA 3X44A 4E32A 5KQMA 1JSXA 4K6GA 1CUGA 3G9XA 3QEKA 1J33A 4FFVA 1JLRA 4NS4A 4TL6A 4CI9A 1H1LA 3LRXA 3DLPX 5JCJD 3AGPA 2QPAA 2XUOA 3C5EA 3MCTA 1Y3IA 1KFBB 1YUNA 4A92A 1UBFA 2MDTA 3V1TC 1IVYA 2Q3MA 4G4IA 1Z36A 2B3DA 1JNXX 4FD2A 1JF8A 2VDQB 3VJRA 4F7DA 3MK31 4PGGA 3FB4A 1VCOA 4GI1A 4M1ZA 1VSQA 1WM1A 4KEAA 1QHHA 4WY2A 3HM2A 3ZVLA 5IWCA 4QU8A 4NU5A 3VISA 1XHLA 3KJQA 4LUCA 4NOKA 2BGKA 5JR3A 4NCNA 1VRCA 3C3BA 3V46A 2BCJQ 3C8ZA 4BNLA 2OOKA 1H4QA 3CE9A 3M3PA 3G2JA 4O02B 2YWHA 2Y0CA 4OXRA 3VTFA 1U90A 1DQPA 2GN2A 3SFVA 2DHCA 1AKMA 2NUBA 1J0CA 2XKJE 3BXHA 1GP2A 4LV5B 3C3JA 5TEWA 4XQGA 4P7GA 5K4GA 4LF6B 1L8QA 3KPYA 2R751 4PN3A 2HQRA 3PIRA 1E6UA 3MGCA 2Q9UA 3M3DA 4EUHA 2C2GA 1RHRA 1EFAA 2O2CA 4JJEA 1GDTA 4EJSA 1D4FA 1NUHA 1MJ5A 2LCQA 1E7SA 2HL6A 2YJGA 1XZKA 3K4PA 2CNNA 3DFZA 2Z83A 4FMDB 2QM3A 2C7QA 1S4MA 3QIAA 3UA4A 4L3WA 1WMDA 4OK5A 5AUQA 2DY0A 1F7UA 1ENOA 2B94A 4B3SB 3CKLA 3T7EA 4LTDA 1Z0DA 1E2PA 1E1YA 2DFVA 3NHLA 4BJ5A 4BTLA 1R4AA 3C8HA 4JEHA 4JYPA 4QUEA 5T57A 2HF9A 1PUJA 5DBHX 4BO1A 5JJ5A 3OUUA 1PBNA 2FETA 1X7XA 2O8VA 3ET5A 2HI0A 1S89A 3LHFA 4FCTA 2B7BA 2DF8A 2P1RA 3VPHA 1LSOA 4NE9A 1FJ2A 3IXLA 5TC4A 5E9JA 3SBEA 3VX3A 5JH7F 5I51A 1Y81A 1RWMA 2J3EA 2P9EA 2PQ2A 2VK1A 4JOBA 1L5GB 5J9FA 4JQZA 5KPDA 1ULAA 2OBMA 1UK7A 4TLAA 3BX1A 4RY0A 4PSUA 1A1SA 2P5SA 3A06A 3MFQA 2HK9A 4KQIA 4RV5A 2J7PD 1S02A 2B1GA 4N7RA 2ZRQA 3IIKA 5BSUA 2P3OA 5CB8A 4C0LA 1G2PA 2X1LA 1K8ZB 4QUKA 3KEMA 1SVWA 4IVPA 1N78A 1E59A 2YN0A 3HSSA 1N2HA 1AMNA 1SXJC 4S2EA 1YT5A 1SCAA 2IY7A 1SUPA 2H1LA 4PNHA 4HFJA 3DCIA 5DWVA 1HG0A 2XCLA 3ZCVA 1ABBA 4U0JA 3VSAA 2OMEA 1WP9A 3DAGA 2JFOA 5J4LA 4MITA 1J5PA 2WI8A 2YVKA 2XLCA 4S05A 2BBTA 5LM3A 1J42A 4HXEB 4YV0A 1VMIA 1AK2A 3SZRA 4IUCS 3H1BA 3Q87B 3QVGB 4RY2A 4C0HA 1KQGA 1W36C 3DUWA 4BS9A 2EZ9A 2I7XA 3KV1A 5L7WA 4C1NA 4J6EA 1T2UA 1ZD3A 3K09C 3OCJA 3C1AA 4FINA 5ICMA 5JARA 3THWB 4OHBA 5I5GA 1WHSA 1JECA 5KCMA 5CDFE 4IGEA 4IG9A 2JFHA 2PKEA 3IB6A 2LDBA 2ZSIA 3K73O 4GLBA 4LOHA 1KI8A 4HH1A 2V4UA 2H2GA 4WWHA 3HGTA 3DBRA 3PNKA 4MW5A 4BDSA 5BQ3A 4NARA 1GPMA 3DXZA 4YAIA 2VCEA 2WA1A 1IHUA 1Q44A 3K0SA 1YK0A 1ULTA 1GUAA 1RRPA 3OIDA 5EUMA 3L49A 2BGTA 4AKSA 4ZCQA 2ANBA 3STYA 4P7BA 3H9EO 3QVKA 2NZJA 2V6MA 4QYIA 2C4VA 1OLUA 5CNKA 1K97A 2A0KA 2P9HA 4IDPA 2ZKIA 5DKFA 2E1RA 5LUBA 4UFPA 2ZCUA 3UJAA 1PJ8A 1TYBE 3ANSA 3R6WA 4CHGA 1JE1A 2LKDA 2R86A 2R7KA 1DUVG 5LQUA 3S2YA 1L5VA 2BRUA 3W5AA 4BIMA 2HDOA 2LRHA 3QKRB 4D5EA 5HG0A 1JLHA 3HPQA 4O6VA 5TY0A 1O77A 3UY4A 5TMPA 1W9MA 3DE2X 3HJAA 2X0KA 3EC2A 2ZE7A 1GUDA 1YJAA 1O9BA 3AR3A 4AJ2A 3S68A 3RRBA 2RCNA 1YR7A 4FU0A 3SHFA 4A4DA 4ZAWA 3B5JA 5AVZA 2PRZA 2BD0A 3NDRA 3NBQA 2GYWA 3RVMA 4ZDKA 3GGDA 3HTXA 3UOGA 2G6TA 2H85A 4PXAA 4BZWA 3QM1A 4OJYA 3DYVA 2LV8A 3GGJA 5FQNA 1ODTC 4UCFA 1K4YA 1NNEA 2IHTA 3KSRA 3F1LA 3TRKA 5IEJA 1ULBA 3EZ7A 3GPDG 5EI5A 3EJWA 2FW6A 1NNLA 2WINI 4X20B 5F2OA 2YC2C 4TQ9A 1JJFA 4TWBA 2OAGA 5DRTA 1LPMA 1KFKB 4HF7A 3K71B 1F2TB 4H3VA 2PZLA 4QOIA 1TD1A 1HSZA 4YB8A 5TS2A 1QGZA 3ODGA 4EKGA 3A10A 2NZ8A 4XOIA 4QYWA 2B4KA 2P6OA 3LPDA 5A2GA 1G1MA 1P2SA 1Y3AA 2JGDA 3A3OA 1VL2A 1Z6XA 2O5CA 1P6QA 3I8XA 3CGWA 1M83A 1CUFA 3SG0A 3UAYA 5KWVA 2WMYA 3OSUA 4YHBA 3HLTA 3U0BA 1OKKD 3EEBA 4KSCA 4QDXA 5C3MA 3WYEA 3O8QA 1T5OA 4OHZA 3AKZA 1EUDA 3E8XA 1S1CA 4BNJA 2QJWA 4C7JA 2W0SA 2PSJA 5AJZA 3JRNA 1PS0A 3T4EA 1J00A 1JA9A 1M1YE 4JQSA 1QFYA 5K3BA 3U48A 1CUBA 1Z39A 5B5SA 1NJGA 1I7PA 4RSMA 1L4EA 5EMLA 1TVEA 5K0CA 3EVNA 2Z5LA 1A5TA 1L8XA 3RJTA 2O2SA 4Q3NA 2QJRA 4BJ3A 4DB2A 3RRZA 3BMQB 1ZIXA 4MS3B 4LSZA 3GH3A 2HMTA 3GLQA 4Q6BA 3ZWAA 2H1RA 5JFGA 2DFTA 3QXCA 1KP3A 2FMUA 3R8FA 1GQOA 1E6WA 1GQFA 5A9SB 1VLHA 1NBWB 5ES3A 5EKXA 3O4HA 3E5HA 3GFQA 4CR6A 1Z4OA 4R2WA 3T0FA 5FUQA 4Y3UA 2JLQA 5EHZA 1MCZA 4Y1RA 4UATA 2FRVA 3HVKA 3G13A 5K0TA 3BRSA 1SUAA 5HCUA 4GM0A 3RSFA 2NN3C 4JJ6A 2GTHA 1GZUA 1NLYA 3NS7A 5DTEA 4D57A 3DDSA 4D9GA 1VL0A 3FNRA 1ZHFA 2VEOA 1POWA 1QHXA 1NOKA 3B70A 2CLOB 1QR6A 3E2PA 3OLVA 4N0PA 1V8ZA 3LCUA 1FW8A 5CT9A 1KJ9A 3N0WA 5G53C 2DWUA 2H2IA 5CA1F 3TMAA 2F4NA 1W4AA 1VC2A 1FFXB 1WF3A 3ETGA 5BUSA 2H0RA 1JJBA 1P1JA 2FX5A 5K0JA 2AFVA 4AO7A 1K7XB 4PFQA 1DC8A 3B38A 2HRCA 5LNK1 1KZ9A 2JJMA 2ID9A 5GGYA 3MJTA 2M1XA 4TRMA 4IKOA 2I2WA 3TD9A 2AUTA 3TNDA 1YB1A 3Q11A 4U9HS 1HI9A 1RQNA 1XZBA 1RRKA 1XAIA 3OJOA 4GHWA 1O54A 1GTZA 2CUKA 3GAMA 5AKZA 5GGXA 3OJFA 1FSGA 2ENUA 1W1WA 2FRDC 2FZKA 5IABA 2IH2A 1O95D 4YR7A 4DR4B 1TKRA 4WRRA 2QZSA 4HUTA 1O4WA 2AXQA 2DT8A 2Q6LA 2ZB3A 5K0GA 4FIZA 3ROXA 4A1OA 1F38A 4CMCA 2XT6A 3DBOB 4GKVA 4RM2A 3NT4A 5KNBD 3L6DA 2JD0A 2WQZA 6PFKA 4FZJA 1T3TA 4ND4A 4K3VA 3RIHA 1U2PA 3IP1A 1YB6A 2YXBA 4ML3A 3PF8A 1CUSA 1SHTX 4ZRMA 4DUPA 3SHTA 4KPGA 2C5EA 2OXRA 4NV1A 5BOVA 3ZJ5A 1W4CA 3IMKA 5EUBA 2EJTA 4C76A 1FVOA 3L6CA 4XX0A 4B6RA 1N0VC 1RM4A 4U2KA 4RLSA 2XGMA 4XFKA 3BRWA 4GBJA 3TBKA 4BCCA 2ZIXB 1BMFD 5CIQA 3EC7A 3FVWA 4ZI5A 4K81B 2Z2YA 1NBIA 1P75A 3QTTA 2GK4A 3R0VA 4DR1B 4PPQA 4X65B 2QW8A 2DBZA 2IHJA 4LV8B 3M6FA 1IQPA 1S8OA 1MDBA 4R2IA 3BZUA 5F1OA 5A4FS 4AG3A 3IL2A 2RGDA 3BK7A 2DPMA 3PEUA 3GLIA 4EPRA 4C3UA 1XKXA 4K87A 3KTOA 4XWWA 1GXSB 2OY0A 4CMIB 4K9PA 1FXUA 2QQEA 3NM4A 3WGZA 4JAVC 5BYKA 4KLRA 4JLSA 2BE9A 3P9YA 1D2NA 5EUCA 1NJ6A 3K6SB 4D5GA 3GH1A 4DFDA 4MUJA 1E60A 1S2LA 3NRCA 4K9NA 3WNQA 1LTKA 3MGGA 4P4SA 4BFWA 3C3EA 1XA0A 1C2YA 3IQHX 2Z8YA 5AM1A 4L27A 4BWFB 5KUTA 2XQJA 2HSWA 5AKKA 2X5XA 4U2BA 2V96A 4EB6A 5JTTA 2AOXA 3D81A 3D8UA 1DUIA 3BK1A 2JH9A 2PUGA 1OI4A 2YN4A 3A9SA 4WERA 4Y9UA 3FOAA 3H8VA 5H81A 1G20B 3ACDA 2X2PA 1DHRA 1ECCA 1J90A 1JR2A 1YQUA 2R3SA 2YVLA 1QCYA 2OG1A 2O52A 3H4TA 3NORA 3OT4A 4ND8B 5AVQA 2DFNA 1WR8A 1C8BA 4UM5A 2ZRIA 3WLFA 2FG5A 1EIZA 4PC7A 4X1KB 1VLLA 2CNOA 4KQ9A 2R5NA 3A7EA 3M3HA 1G64A 3NBFA 1C9MA 4RKEA 1NHWA 2E82A 2IITA 2QRPA 2IV7A 3RK0A 3W1EA 1TO1E 3H75A 4EZIA 1D1SA 1FY2A 4N9QA 5CFQA 5JRDS 4H4DA 3MD0A 2DQYA 4M83A 2J46A 3DEYX 3DVSX 4FMPA 2Y0BA 1H2AS 4CEJB 1PQPA 4D0SA 4KL8S 5F1PA 4ZI7A 3VNUA 2C9ZA 2ATEA 2RHTA 4PYNA 2C0CA 4GBMA 2HIHA 4QBIA 4D9CA 4H1HA 4BQEA 1GHTA 4IFEA 2WHYA 3OJEA 5T3YA 3TZ6A 4ZI7F 2OV6A 3PEEA 5JVDA 1G21B 1JFTA 4JKIA 1G3QA 2ICAA 4L4RA 2WKWA 5EJ8A 2CVQA 3JASB 1AQJA 3F3SA 4PZLA 1JI3A 4MQEA 2EQBA 3RARA 5KJFA 1HYBA 1KY2A 1PR3A 4NIMA 5IANA 3OPQA 2IU3A 1MFZA 1SZPA 3TDNA 5ITZB 4DCUA 3C87A 5BN1A 4OFXA 3U40A 1ZN7A 1E1MA 2NADA 3FCYA 4BBPA 1X3LA 3BFVA 4DLLA 5LN1A 3ENKA 3TCKA 1ZGJA 2QW0X 4JITA 4OB6A 1QOQB 1RQLA 2ZIUB 1U4NA 3VUEA 4KGXA 4XUEA 1VL6A 4RENA 3FXAA 3EPKA 2V9CA 1RQGA 2PG3A 2WHPB 3OZUA 4TLLB 1Y3BE 1Q12A 4BTVA 4UDXX 2BM8A 3CVJA 2ZSEA 3MQFA 1XCPA 3MWGA 2QM7A 4TUYF 1W88B 4N82A 3RTCA 4RZ2A 2RHCA 4RNCA 2HQ1A 1OH8A 4BZPA 1P4JA 2FOLA 1J21A 5LMUB 1JWBB 5CB0A 5IK2D 1R9JA 2G5TA 4M8KA 3T9EA 2BP7A 3JQCA 4CMEC 2JPDA 4N47A 1T9BA 1OTHA 1Z12A 2B6NA 1MG5A 5JBQA 4XIGS 3ND6A 2AYXA 1C1XB 3K1ZA 5IUNC 3EQ9A 2FDCA 2ZAGA 1P2TA 3M9WA 3IJ5A 5ICEA 5L4SA 5LDHA 3S40A 2Y4OA 1T5DX 3CJRA 1PW5A 4Y6LA 5LPNA 3HDJA 2HRBA 3EIQA 4OP1A 4JYZA 3OU7A 4KLCA 4LDPA 3UICA 2IOHA 5MGNA 1LK7A 1ZMOA 5F5LA 3W2FA 5FPKA 5IHPA 4YMTA 4BGVA 2WU3A 1VBFA 1VE1A 5BYAA 4AG5A 1T3GA 2AX3A 3LLVA 1SVUA 1UMDB 3A04A 1K8RA 3GCWA 4UCXA 4AQYB 1LTHR 3UH0A 4AMGA 4B3RB 2P4EA 4QYSA 2YBEA 4BECA 4QGSA 1E2JA 3DCJA 2J3KA 2JGNA 4CTMA 1NASA 1PR6A 1D09A 4CM5A 3E2IA 3NM6B 1B23P 1XMPA 4XUDA 4KITB 4MVJF 1OZHA 3FF4A 1IXYA 4BMNA 1X2EA 3QOXA 3DDHA 3I9JA 4WH0A 5IDYA 3UC5A 1EIWA 2BKVA 2ZIWB 4FSDA 5J40A 1N2OA 2Q8QA 1DC5A 1GUYA 1P7ZA 2C4UA 1A71A 2JI6A 2ONCA 1MABB 3HWRA 3EF1A 5EG5A 1YGPA 3IVCA 4Q9NA 4LCBA 1Z15A 4Y2GA 1GG8A 3PWZA 1QX4A 1XN4A 4G5FA 4WI1A 4YJHB 4EF4A 3BZBA 4QOHA 5J1TB 2IZ1A 2X9NA 2F8TA 1WUTA 3WGNA 3HM9A 3BA1A 2ZYRA 1XYGA 2I0FA 3HKBA 3RM3A 3ZVKA 2Q6OA 2UYCA 2HK8A 1L8LA 2OGZA 1I9GA 5I9TA 3LM8A 2HU8A 3R8CA 2XRZA 5B6JA 2FYTA 4LRTB 1SU6A 2WUWE 3WKEA 3VXKA 2QHXA 4PLGA 1UMBB 2OQVA 3TN7A 4BNYA 2QN2A 1B42A 4Z7NB 2N46A 5LIPA 4GPIB 2X4DA 3W1WA 3KUCA 4QC2A 2CNLA 2P1DA 1EVYA 5I9NA 2D59A 2PLFA 2REQB 3G2IA 4X45A 2OPBA 2Q4RA 3Q9SA 4MLDA 1ZITA 3DT9A 3HVHA 1GNTA 1O9HA 1M2EA 2PUHA 4WN9B 1U2TA 4P08A 3AVOA 5H9VA 3FMGA 4D3DA 1OB5A 2B4TO 1FP1D 2DR3A 2X4LA 2Z30A 5TQJA 4YUWA 1E3LA 1SXJD 4DDTA 4G56A 4X8HA 3WZMA 1BWPA 4JXJA 4OHPA 4TMXA 2JI4A 1DB3A 1DAFA 2DBRA 2HREA 3R6TA 4CCSA 4ISCA 1XZHA 3D7LA 3K4HA 1Q1BA 2W8ZA 3U1BA 2QNIA 1P1RA 1Z5PA 5LQCA 4EJ6A 4WY8A 4EOGA 2CB9A 2AKEA 5DO9A 1NATA 4YJ3A 2HPAA 3RANA 2CLMB 2AL7A 2F17A 2X6QA 4CF7A 4YAOA 2H4HA 5DK6A 3IPCA 2IU6A 4YH1A 3HCCA 2WFMA 4B44A 4XVUA 3DHYA 3PGA1 4OGWA 2GAAA 1M8GA 1Z5GA 4JVSB 3A26A 4DLSA 3N8GA 3PCRB 5KYWA 4WTOA 1Y6ZA 2H18A 1ZKMA 3HC7A 3O9VA 1BE1A 3WK9A 4E70A 4RHCA 3CW9A 4F92B 3P0IA 2C8VA 1FDTA 2H2FA 2R8OA 2VI5A 3D8HA 3QY9A 3DBIA 2XYVA 4HWOA 2JI7A 3HWX1 5F7JA 3WK7A 3I6ZA 4BV8A 4F3NA 4ZCIA 3FHTA 1SQSA 1MX5A 3VJLA 2GXQA 1GLNA 2X41A 1C4XA 1SB8A 2YWEA 1H3NA 3GRRA 3LVRE 3DPSA 4MS1B 4YGYA 5FNVA 4IXTA 5BVHB 2B4YA 4R0MA 3CZRA 2FPMA 3VPCA 4K6FA 3STTA 3T1YB 1DAMA 1L0BA 5EZ5A 1BFDA 3AB3A 1V4NA 4H0NA 3E8SA 3IHTA 5CG2A 2IQIA 1US8B 2J3HA 2J4DA 2IUEA 1JKFA 2E49A 2ACWA 3RYTC 4Y1RB 3PDHA 3FPLA 1G17A 1CU1A 1XD2B 1ZWLA 4PZPA 5HJEA 2IGBA 2ZEJA 1SIBE 2NVUB 1L4NA 1NSYA 1VG1A 1PG0A 3QUBA 4LDAA 5CK5A 3VDXA 3ZNNA 4AU1A 4X00A 1CZLA 1KK1A 3L06A 1GZ6A 4YCBA 1LC0A 3HEBA 5G0SA 4ILKA 4B17A 4E15A 4BFYA 2XNCA 1FUKA 1TJYA 5K6AA 4RMGA 3OWXA 4WK6A 5GPBA 4B5LA 3G5AA 2RH8A 1TMKA 4G24A 3I8OA 3LK7A 4Q9HA 1YVDA 3PNYA 4JI3B 2BSQA 1QLWA 5AKXA 3ZKAA 2TECE 2PY6A 5A5GA 2ASEA 2B99A 1PK8A 4HR7A 5CH5A 4Y2JA 3B36A 3E84A 4IWYA 2O3UA 1Y8QA 1BWSA 2YV4A 3UW1A 4CMEA 4G67A 1ADYA 2C97A 3KKKA 5D3ZA 3LT2A 2YV5A 2J07A 5FTNA 1UXOA 2HUPA 3ZDRA 1AKUA 1HMYA 1IHXA 1QV6A 2ZTSA 4QOFA 2BVNA 3QU2A 2B1QA 3ABQB 4YCJA 5M3BA 3UKJA 1DVRA 1EFUA 2Q1UA 3K2BA 3CSDA 3EZLA 3LQYA 1B0PA 4JODA 4OBXA 4ZC1A 3GD7A 3V1YA 4YCSA 4LQ4A 5JZOA 1PR4A 4DV1B 4FX2A 5ADWA 3R4VA 5BXQC 3LUCA 1AF7A 4X20A 5DLPA 1VKNA 3LDHA 2AW5A 1XU9A 1WAMA 2Z58A 1PQYA 4GI7A 4KV9A 5TNXA 5EWJA 3ZVMA 1B93A 2I4OA 3PQ2A 4RF5A 1STOA 4FFBA 1IAQA 4TXHA 5BSMA 4BC0A 1EE2A 5ALUA 3QE2A 2Y93A 3U3DA 2FX2A 1INLA 2UZ1B 4Q39A 3IEXA 1GVHA 1PSZA 2GOYA 1KSFX 1DKUA 3DVQX 3OE1A 4ZVVA 3R7AA 4LISA 2ID8A 2P9CA 5K0ZA 2P69A 3U80A 2ERCA 1PO7A 3UC9A 3QYJA 4Q1AA 4IDBA 2QL6A 1JIVA 1Y7TA 4CHTA 3MJVA 4B1FA 1GKIA 2CVZA 2TMYA 2X6RA 3FZYA 4FGUA 5T4EA 4IW3B 3M6XA 3RC2A 3LOQA 4QGAA 5IJAA 2QZJA 1G5RA 4LC9A 4RZXA 1V16A 1NR5A 4Q12A 3CF6R 2VHTA 3DJFA 3GCDA 3T6KA 1USIA 4CE6A 1GTRA 1EUZA 4WE3A 1SURA 2OD2A 4KUGA 2J0SA 4M7OA 1VXRA 2A9RA 3EASA 3O5AA 4ON9A 521PA 5IG2A 4UFOA 4JLKA 3JVDA 4NYIQ 4KNYA 3TX2A 4MKXA 1AZTA 3BWYA 4KHPB 4QPJC 2Y3IA 5J58A 1TUIA 3LA8A 5AW0A 1N34B 3QZUA 1TC2A 2PGNA 4O4LF 4ZOAA 4DLVA 4DSUA 4J2HA 1ZUIA 4YWHA 3C16C 4CR8A 1Y8ZA 1OH6A 3SC2B 4P58A 1A5ZA 3QMPA 4INAA 4D4KA 4C7XA 2O48X 3TGWA 3AEKB 2E89A 4DLAA 4YLEA 4NG4A 4Q66C 1HFKA 3GI1A 4RH1A 3P20A 3QYPA 4LXUA 4RCZA 4EG1A 1J4AA 1U28C 1GM5A 1P2VA 4W1RA 3VTAA 2SKDA 5AVTA 3DKKA 3TECE 1MVOA 3CBQA 1ZSNA 3H5VA 4DR6B 4YALA 1U2EA 4JBWA 3UT5A 5GIPE 4E6PA 2VHVA 1KO1A 1U4SA 3MMSA 3Q3EA 3MUOA 4M0FA 1D4ZA 1QGED 4TYPA 4EY4A 1KRXA 4XLZA 1DRJA 1UFOA 2HRRA 2X15A 3OCCA 4IUYA 2MSWA