2QTGA

Crystal structure of arabidopsis thaliana 5'-methylthioadenosine nucleosidase in complex with 5'-methylthiotubercidin
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
246
structure length
246
Chain Sequence
b'ILRPISSVVFVIAMQAEALPLVNKFGLSETTDSPLGKGLPWVLYHGVHKDLRINVVCPGRDAALGIDSVGTVPASLITFASIQALKPDIIINAGTCGGFKVKGANIGDVFLVSDVVFHDRRIPIPMFDLYGVGLRQAFSTPNLLKELNLKIGRLSTGDSLDMSTQDETLIIANDATLKDMEGAAVAYVADLLKIPVVFLKAVTDLVDGDKPTAEEFLQNLTVVTAALEGTATKVINFINGRNLSDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-methylthioadenosine nucleosidase
publication title Molecular determinants of substrate specificity in plant 5'-methylthioadenosine nucleosidases.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 79
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 3.2.2.9: Adenosylhomocysteine nucleosidase.
pdb deposition date 2007-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qtgA00
3PNSA 2AI2A 4QASA 1VFNA 1JYSA 3OZDA 1N3IA 1XE3A 4OEHA 3P0FA 1ULBA 3UAYA 4QATA 1T8SA 4WKPA 1RXCA 2QTGA 1V48A 3OZCA 1LVUA 4M1EA 2Q7OE 2I4TA 3O6VA 2AC7A 1YQQA 1A9PA 1JDSA 1PK7A 2I8AA 3OZBA 2A0XA 5EPUA 1PW7A 1Y6RA 1PR0A 4GLFA 5KB3A 3OPVA 3GB9A 1PR4A 4GKAA 4OF4A 4WKNA 4I2VA 4DABA 4H1TA 1A9SA 1TGVA 1YQUA 2BSXA 1T8RA 4L6IA 4WKBA 4D8XA 1LV8A 1PK9A 3LA8A 2OC4A 1T8WA 5F78A 1VHJA 4KN5A 1RCTE 3OF3A 1PF7E 1YRYE 1FXUA 3MB8A 2RJ3A 1JE1A 4TS9A 5EFOA 5IFKA 3UAZA 3INYA 4DAEA 4G8JA 4JWTA 2QSUA 3O4VA 1V45E 1A9TA 2OC9A 4L5CA 1PKEA 4L5AA 3K8QA 1Y6QA 4X24A 4TTIA 1U1EA 3PNPA 3OZEA 3NM4A 3UAWA 1B8OA 4F2PA 1Z36A 4YNBA 2OXFA 1Z39A 3KVVA 5JPCA 1SQ6A 3E0QA 1YBFA 3KUKA 1SD1A 3GGSA 4E1VA 5DK6A 1ODKA 4R2XA 4RJ2A 1V41E 2ISCA 4G41A 4YJKA 4JP5A 4IP0A 1JP7A 3C74A 1I80A 3OOHA 2IQ5A 4D8VA 1RXYA 3LBAA 4LNHA 4QFBA 1PR5A 3ENZA 4R31A 3D1VA 4PR3A 4OGLA 4TXLA 4DA0A 1T0UA 1B8NA 4OY3A 5IU6A 1TCVA 1JDVA 1U1GA 3FNQA 4DA7A 1JDTA 5B7NA 5ETJA 1RR6A 5CCEA 1A9OA 5C80A 3DDOA 1OUMA 5EUBA 4L5YA 3BL6A 1U1DA 2XRFA 1C3XA 4BMZA 1PWYE 5F77A 5FAKA 1YR3A 3T94A 2ON6A 1Z5PA 3BGSA 1Y1TA 2QDKA 3KU4A 5F7OA 2AI3A 1U1FA 5F7XA 3FB1A 4LKRA 1ODJA 1JPVA 1V3QE 5B7GA 1SD2A 5F76A 1WTAA 4BN0A 1Z33A 5F7JA 4ECEA 1A9RA 1RT9A 3K8OE 4TXJA 4QARA 3E9RA 4GLJA 1U1CA 4F2WA 2PGAA 4LZWA 4JOSA 3DJFA 1ODLA 4WKCA 1A69A 1ZL2A 3KHSA 2AI1A 3MMSA 4TTJA 3KVYA 3FWPA 4OGKA 5K1ZA 3DF9A 4U2KA 4BMYA 4YMLA 1NC1A 1RFGE 1PBNA 3ONVA 1VHWA 3BSFA 1ULAA 4M3NA 2HRDA 1Z38A 5CXQA 1LX7A 3UAVA 4TYMA 1OV6A 4GMHA 2H8GA 1PR6A 1PR2A 2A8YA 4D8YA 4DARA 1RSZA 4NY1A 4K6OA 1Z35A 2HN9A 4PNPA 3PHBE 5CXSA 3LGSA 1JDUA 4F3KA 1Q1GA 2HSWA 1Y1RA 1G2OA 4D9HA 3OCCA 5B7PA 4WKOA 1JDZA 2HWUA 3UT6A 3F8WA 5F73A 3EUEA 2QTTA 1OU4A 4TXHA 4DA6A 4TS3A 4FFSA 3EMVA 4TXNA 1ZOSA 3U40A 4F1WA 2A0WA 4F3CA 3P0EA 4TXMA 3FUCA 1Z37A 3IOMA 4EB8A 3DPSA 3DP9A 4G89A 1OTXA 1PR1A 4BMXA 4L0MA 1SJ9A 3PHCA 1Z5NA 4MCHA 5F7ZA 1ECPA 1Y1SA 3FOWA 4UC0A 5CCDA 4TTAA 4QAQA 1NC3A 1JE0A 4NS1A 5I3CA 4OJTA 3NBQA 4YO8A 4DANA 1K9SA 4P54A 1ODIA 4D98A 1V4NA 4QEZA 2A0YA 3TL6A 1A9QA 1K3FA 3E9ZA 1K27A 1M73E 4MCIA 4MARA 5B7QA 5CYGA 3NM5A 1NW4A 1OTYA 3IEXA 3SCZA 3KVRA 1OVGA 1TGYA 4LNAA 2P4SA 3BJEA 4NSNA 1TCUA 1T8YA 3NM6B 1CB0A 1Y1QA 4EARA 4DA8A 2GUWA 3EUFA 4DAOA 2OECA 4R2WA 1V2HE 4LDNA 3OOEA 3ODGA 3EEIA 3UAXA 4M7WA 1RXUA 1Z5OA 1QE5A 1RXSA 1TD1A 1RYZA 3QPBA 1Z34A 2QPLA 5CYFA 1CG6A 3FAZA 1VMKA 2B94A
chains in the Genus database with same CATH superfamily
4C21A 1HMPA 2YFHA 1U0BB 1T6ZA 4L9AA 4AXXA 4LYDA 4XLZA 4U7PB 2PAAA 2VF7A 5E3HA 4TS4A 1J2RA 3O3MB 3MF4A 3OEHA 4JB0A 3WE7A 2G7ZA 1E1KA 3CJTA 5EJ5A 4LJ6A 3OY7A 3UC5A 1M9NA 4OXYA 4U9HS 2B21A 3QHAA 3QKIA 4OMFG 2H29A 5K2OA 4D3DA 1KYWA 4WECA 2Z2KA 4HDSB 5DYNA 1RXCA 1PEAA 2PKEA 4ETNA 1LSJA 2PX5A 4R2MA 5A2GA 2IEBA 2FX3A 3WG9A 1LVUA 2APJA 1E0KA 5DGCA 3K0EA 4MWSA 3CRMA 2FUKA 1OPRA 2JI8A 3O6VA 3TIGA 4DXDA 2Z43A 2ZXUA 4K2HA 2JHFA 1WB6A 1IULA 1N4DA 1J56A 1OX4B 3MQ4A 1KQGA 1WEKA 3HXLA 1W4ZA 4HP8A 3UMRA 4BFYA 2HUNA 3F5QA 2RGYA 2I1LA 4V0NA 1GDDA 2I9PA 2CD7A 4B2YA 3VKGA 1NG9A 4L78A 2DR2A 1EX6A 4OBBA 3WIVA 2Q0XA 1JR4A 4KMRA 2ZQ5A 5G0UA 3ZKWB 4DXHA 4MUJA 1JG1A 3CZ9A 4BIIA 4ZKEA 4B73A 3HRIA 3JASA 4QRDA 4X85A 2DWOA 3F4BA 4Y6RA 3RSCA 3OTQA 5DU2A 3UTDA 4D9FA 4N3NA 1NZFA 3ND8A 4IYJA 1KZGB 2QEQA 3SEQA 1L2TA 3AWDA 1GSOA 2KBEA 1UJCA 2VZ9A 4FGLA 5G0VA 4AO8A 4HEJA 1ZVJA 1M2OB 3Q0EA 1KO5A 4NI5A 2O5EA 2Q4EA 2RHDA 3IKJA 2EBUA 3E3LA 1AKRA 3OA2A 4UD6A 1Y89A 3SS7X 4BVFA 1PJZA 4E5UA 5JBQA 2DUJA 4K9OA 4YBRA 2O2GA 2QXUA 2BKXA 2DCUA 2P9HA 2VOEA 1WA5A 5AK4A 5F2KA 1ZPDA 2AF4C 4C07A 3ETDA 3LC2O 5LZ2A 3O92A 4L74A 2Q2VA 3R41A 1DJNA 1KOJA 4WOJA 4BQEA 4B7AA 2JFOA 4DZRA 1XD9A 3AJRA 4HAYA 1F5NA 1EZ4A 2CNKA 5I47A 3NIBA 1T8WA 4QREA 5JYBA 3BJMA 5JCJD 5HF8A 3GH3A 2OHIA 3Q7PA 4DLAA 1P6XA 5JVDA 4PZDA 3VDMA 1JBQA 2TYSB 4ZO9A 4TLAA 3NZEA 4X84A 4WGFA 3U3RA 3WIBA 3VZQA 2VWHA 4BL5A 1S8FA 2B4QA 4TMTA 4IGIA 3B5EA 4PSDA 3O1HB 5KTOA 1E3LA 3D7NA 1RCTE 5GOTA 4A92A 3BHNA 4C20A 4YDQA 2XUHA 3VPSA 3BICA 1TM5E 3KOWA 5JEDA 3GPBA 5K51A 3BJRA 1RPAA 1MO3A 1RFLA 3CLSC 5T4EA 1GNPA 2H2HA 3UENA 3U44A 1N5OX 1SZJG 2DM6A 4R69A 4WDRA 4RQTA 3GRYA 4KE7A 4FLEA 4HJRA 5CM9C 1U98A 2UXCB 2Y6VA 1I6MA 4DAEA 2XBMA 3GT0A 3EHDA 1I5OA 1PHPA 2XNJA 3OCWA 3R7AA 4FJ0A 3NDJA 2B7BA 5AUNB 1IXSB 4MKZA 5SZJA 5DF1A 3SQMA 1Z28A 5CH5A 1U3TA 3L79A 4TLBA 1X94A 1XZIA 2WP0A 1YS9A 1JFSA 4L57A 1V16A 1ZBQA 1OGJA 4DILA 4INPA 3U60B 3EXG1 3KT6A 4PPGA 1CY6A 3VI3B 1DWQA 4N3BA 5JZBA 3ELYA 3W8FA 4HVCA 4XM0A 2GCOA 2YV1A 4UKDA 3W6NA 4GOND 1OAOA 4NL4H 2Y2UA 1NBMA 3PSHA 1ZJYA 3G6WA 1SXJE 3JZMA 5EUQB 2XDWA 3MJTA 4JGGA 1MAUA 2GJSA 1RKQA 1SHZA 5B1HA 4BVKA 5AXAA 4ZVTA 2HEGA 2AFRA 1QS0A 2AC2A 4CHGA 3EGCA 3WMGA 5HUHA 1MO2A 1T1EA 4OTZA 1YR6A 1XNJA 1ECJA 5EJ2A 1P6UA 3V8NA 3A7EA 1KKUA 1JH8A 4NDNE 4H15A 1CD5A 2QM7A 4N18A 2RI0A 3RC8A 4GWGA 4QYIB 1QX3A 1P9WA 3NEJA 4YJGA 4YPVA 2FUCA 4JLJA 3B1ZA 2PWBA 2CB0A 2GCPA 3KYCA 1YUBA 2P9FA 5JD3A 3UT5B 1RWVA 1UPFA 1WM1A 5FPQA 3BS4A 3S29A 4XJSA 4ZCIA 2P2LA 5LM3A 3FPCA 2D6FA 1DIBA 1EX9A 2ZI4A 3MWKA 3O2JA 2RGAA 3JQAA 2H4JA 3HJGA 4KDEA 3PRYA 5E95A 3VC1A 4TUYB 1ST2A 1Z68A 2GBPA 4ZJYA 4ZV9A 4LFBB 1V47A 3QUCA 3ZHBA 1F9EA 3LYHA 1I80A 2HGSA 2NU7A 2PX0A 1G2QA 1N5IA 3CMCO 3O8BA 1SMKA 4FNOA 4JB3A 2IQ5A 5C1IA 4HB0A 1YRLA 2PDAA 5BPHA 1OH7A 1SC3A 4PRZA 4AJ1A 2RHCA 1C7JA 3WICA 5MGBA 5EMMA 2LDXA 1FP7A 2JHGA 3RIXA 3JPYA 5D5PA 4GXQA 5M34A 2CMGA 4OY3A 5E2BA 3TZHA 2BFWA 1HTWA 1OXVA 3AKEA 2VG8A 3FNBA 2IF0A 3E1KA 3OCZA 4Y2QA 2CNDA 3R7SA 1UBSB 5B7NA 4EZIA 4LBVA 3MTDA 2GJKA 1T26A 2IUFA 3DC7A 5KDLA 3TH5A 3WBKA 3NGMA 5C7OO 4BCCA 1E1NA 4RD3A 3U7QB 2YN4A 3T1QA 3IODA 4B17A 1N2EA 3MTAA 1K06A 3CVVA 1UBGA 3UK2A 3GZJA 5FWYA 3OE5A 5F33A 5KBYA 2E3JA 2NO7A 3KXLA 1RJGA 4RVFA 4LF8B 3P96A 4EAAA 1YTUA 1C1DA 3KQWA 3KOZA 5FAKA 3I5MA 5DEOA 4J0CA 2VZ0A 4B3CA 3V1KA 4XVUA 4J2TA 1IOVA 4XARA 2KLHA 5J4HA 2GSWA 3OKCA 3EZ9A 3T94A 2JA1A 4J9UE 3BGSA 5I7EA 4NESA 3KU4A 4WXHA 4O2RA 1FNNA 4DMUB 1GY8A 2ASVA 5TGDA 1OFUA 1YRAA 1TZMA 3NBFA 3RW9A 4ZYLA 3CPEA 1D03A 1U2PA 1W5TA 4OP3A 4WNCA 1CR4A 1V96A 1N2BA 3I62A 4AX4A 1E2MA 3CH5A 1I3MA 2VHZA 3BEDA 4AJHA 2C97A 4WXEA 3GXBA 2AOUB 1C1YA 5JO9A 5JLJA 2JCBA 3NWJA 1F9AA 3SOPA 2AJBA 2P41A 1R5OA 1SD2A 4IGFA 5F76A 3V1LA 4FNMA 5U1PA 2G28A 4LE2A 2H00A 1RQ2A 5D5HA 5EUCA 2B7CA 1XNHA 2JLUA 3K2EA 3DBVO 4B84A 4QM6A 5JYDA 2M32A 5BWLA 2HA6A 5SICE 2Y99A 5SZKB 3GCDA 4E6PA 2P79A 4KFCA 1Z29A 5F23A 3ELDA 3G2QA 2J31A 2PYDA 1WF6A 4KMSA 3VJRA 5LU9A 2V7GA 1JG7A 3W7AA 3S0JA 4LFCB 3S2GA 4BJ5A 2E85A 3H99A 2NQ2C 5JSQA 3SP1A 4PCUA 4BQQA 1VA4A 2OHGA 3HRHA 1PS9A 1P7PA 1K8YB 3AEUA 3LYAA 3N05A 4MWTA 5FPPA 5H0IA 1T0BA 5K3CA 5AHXA 4LJ4A 2GBLA 3O91A 2WF5A 3EVFA 4HFRA 4WKCA 4P0PB 4RWZA 2YN0A 4R7TA 1E8NA 1FOEB 2HA0A 2NP7A 2A9OA 1J8VA 2HEIA 2ISQA 1NE2A 3JQRA 4HEQA 4BQOA 4EKNB 4ZFNA 5KTYA 1ZHFA 4ETMA 4G0VA 1E1CB 3TBKA 5D3QA 3N7UA 2XH8A 4PFJA 3RE1A 1G8GA 4Q7JB 4U2KA 3ZS8A 1I2BA 5FDFA 4DGSA 3ZTYA 2CXSA 2IU0A 3DDSA 4CIDA 4UTRA 3BHMA 3PXXA 5IUKC 3SJBA 1FMJA 4MR8B 4BV3A 1D2MA 2BM8A 4BNUA 4LYAA 4ENPA 1IBKB 2D2FA 2BP7B 3A4LA 3K35A 5CFQA 2XV1A 2GN0A 1XZGA 1ZI9A 1P9NA 3L77A 5JFGA 3CW8X 5E4YA 3TW6A 4E2FA 1I4TD 2BM0A 2CLKB 2FG6C 1SOVA 2QN2A 1VGRA 3EPPA 5JC1A 3W5BA 1WBBA 4Y9DA 3RBVA 3W3AH 2NSYA 2UV8A 5FOUA 3QUBA 4XVHA 1MZVA 4EDFA 1FS5A 5TPWA 5IKMA 3AESB 1DAHA 2NSHA 4FR2A 4TWAA 2CFIA 1Q91A 1WHSA 3QXSA 5FKJA 3T4EA 4YASA 1M6YA 2WWVD 3DZIA 2Q5QA 5KHLB 3COJA 1AKEA 1S2MA 1EJBA 2RHBA 3HFGA 3UV7A 5LQMA 3LQQA 1HSZA 4KWIA 2KM1A 4C30A 1B1AA 2ZUUA 1CQZA 1UXJA 3H7AA 1LPNA 2I6TA 3HKCA 4M55A 2EP7A 4Q3OA 4EPRA 2JLYA 1XQ1A 3KYIB 3RHSA 1RSZA 1UBUS 2I3AA 2J5QA 1K7CA 3E1SA 3PF8A 4MAMA 3B3QA 1SUBA 2DGDA 4NY1A 4QT0A 1Z4QA 4ZOLA 2VZ8A 2Q6OA 5J47A 2BTQB 3CG0A 5DLDA 2ANBA 2EKLA 1ZHHA 3F97A 3CNLA 3U0BA 1EXDA 1PV2A 3G5UA 5JARA 2V7VA 3E2IA 2C4UA 4UZFA 3USCS 3D8RA 3JZIA 2C61A 1XMPA 1I8TA 2W2KA 1SA0B 1FFBA 3KLOA 4US2R 1ES9A 3H19A 1XTKA 4CM1A 4IQ8A 1QQ7A 2O1XA 2XF2A 3CV3A 3ZN2A 4K3UA 1C1XA 2VBCA 3FMFA 1LA2A 5DSZA 4BOYA 2QYSA 3W8NA 2QVCA 3ZXSA 4E5VA 4XTRA 2OV1A 2XOKD 1TLFA 2XXAA 1Y3HA 5HJEA 2RI1A 5I7OA 1V26A 4U6QA 1P17A 3F8WA 3AX6A 2C4NA 1E9DA 1FPMA 5ALYA 5GJCA 4CEHB 1A2KC 2D2IA 4HPXB 2Q6IA 1O97C 4L4RA 4U2FA 4ZCPA 4C6RA 4Z4HA 2IYAA 3GX1A 3VVMA 3LBHA 1LBQA 3UQYS 3A1CA 4JROA 4AS1A 2OPBA 3BDVA 4IH4A 4JJ7A 2KPOA 3J81k 1IK6A 2G0TA 4BS9A 4JY7A 4QUHA 3P71T 4G6ZA 3B9BA 2GPJA 1N6IA 1NFRA 3OTGA 2WJHA 5A3JA 5LKRA 4HUQA 2XWQA 4ZVKA 2QW1A 5C4GB 3DPSA 3EA5A 2IYRA 3NKVA 1T43A 2J5BA 3FCUB 3OQOA 3SC4A 5KREA 4P4NA 2VQSA 1L6IA 3SS9X 3IUEA 3KYBA 5DXJA 3IS3A 5CBKA 4RQBA 4EIWA 3P9PA 1XPUA 3WLJA 4KN6A 2I99A 3L7LA 4UFNA 4EPWA 3AFHA 1UPBA 4KV7A 4PFSA 4R98A 3G89A 3WKBA 2HQBA 4UXHA 2AFIE 3BD8A 2FMHA 1NW3A 1X2EA 2HA7A 2RCYA 3ILVA 4W8GA 5EQTA 4FE7A 2CCJA 5AR1A 5CCDA 1NP6A 4LRXA 3SIWA 4G9BA 1GM5A 1I1NA 2G5GX 1R8YA 1GR1A 1Q44A 3BC1A 5B6PA 3OM1A 1SUWA 1RYBA 1DO8A 2BI7A 2UDPA 4QVKA 4AWBA 3KJHA 1UDCA 1U5BA 2FE4A 1KGDA 2R6DA 3CY6A 3NOQA 4XAQA 3PR2B 5DULA 4Q48A 3WGGA 4CM9A 4D98A 3UUEA 4D9JA 4EA9A 2C54A 5LLSA 3GNQA 1F0NA 2QTAA 3EJWA 2Y71A 3VX3A 2PN1A 2E82A 4R0MA 3CLSD 4RVHA 1Q7TA 5HKOA 1X8XA 2IXAA 1FVXA 3NHFA 2CDRA 4J43A 1CP2A 2WNIA 1IG3A 4V2UA 2JZCA 4C4OA 1QH0A 3VO1A 4ZQHA 1NI5A 3B3FA 2AQ8A 2OFFA 1YOVB 3PUJA 1QZZA 1LW7A 4PXAA 1BFUA 2Y2VA 4BNJA 1RBQA 3TLBA 1RWPA 1HE1C 2IEDA 3IUNA 1WU7A 4EYOA 4OFWA 4ENRA 4JEIA 1EVKA 1OBFO 2LVBA 1MT3A 4K1LA 1QBKC 4RCZA 4ARBA 5BSKA 1GLVA 1TPZA 1WG8A 4JC8A 4ZV4A 4I4CA 4EFNA 1XMQB 2W6JD 3U3KA 2CXUA 1T9HA 4QFCA 5L7YA 2KYRA 1XZMA 3IULA 1IY0A 1X1RA 1UJ6A 5CT8A 5EQFA 3N59A 4X6LA 4CM6A 5BMVF 1ZFNA 3AKDA 4R9UC 4OQLA 5ALRA 1T8YA 3UNXA 3OOJA 4HDSA 3ESCA 2AUMA 3H1PA 3D7RA 4F4DA 2IIPA 2Z6AA 1V11B 4XDGA 2PH7A 1OLOA 3ZZNA 2DG2A 5I8PA 4KV9A 1AX9A 4J7UA 5K09A 2IPLA 4QAJA 1ZNXA 3OKAA 3ZD9A 5JD4A 4LY6A 4GPIB 4B31A 4G8CA 3A04A 3I6MA 5DHPA 1GR0A 1QE0A 1OX4A 3AUUA 3LS2A 4DCOA 5BMVB 2HJVA 3RREA 5HUQA 2ZDGA 5CB4F 3SVZA 3WZ2A 2QE7A 3R23A 2XX3A 3EGXB 2NU8B 1Z7YA 1U3WA 2CYAA 1ABEA 1LSOA 3CCCA 4HTFB 4IDFA 3ZZ1A 1XTIA 1X3LA 1WWKA 3IIKA 4QD3A 4K9SA 1MJGM 1YZ3A 3QXCA 5TMBA 1Z34A 1QDUA 1NXSA 2HPVA 1GUDA 2M1ZA 2I2AA 3ZKWA 5FIUA 2WV9A 3Q3CA 4W4TA 2J6IA 2DPMA 1QVWA 3JAWB 3KKKA 4LXGA 3TTTA 1XROA 2WJAA 2XA1A 3JZDA 3K9WA 1N32B 2Q49A 3ZDZB 1DRVA 4ZQBA 2WYOA 1FX1A 2B94A 3HJNA 4ZC1A 1PZEA 3C3JA 5L8VA 1SCAA 5HNKA 4M9ZA 1XQXA 2A0FA 1ISGA 2PLRA 4RSRA 1M2OA 3PEEA 4Z0HO 3WJ7A 3R44A 4RK1A 1YS6A 1FQWA 2R1UA 1ENYA 4A7PA 2O8EB 3CEJA 4FCVA 4K9MA 2OHXA 1QV7A 3FX2A 1U0LA 4J0EA 3RUPA 2G07A 3BQNB 1GHTA 2GWRA 3WGTA 3BGOS 3C5WP 3UJPA 3AYXB 2VNAA 3B1YA 1V8OA 1TX4B 1CZKA 2RH9B 1FFDA 4OVKA 1MAAA 1Q0UA 1NN3A 1Z6XA 4MITA 4YP0A 4C22A 2EFYA 3W5DA 4B3GA 5J58A 1PZMA 3SEZA 5I01A 3G2IA 1V48A 1BQ4A 3CZPA 4DM4A 3C45A 4Z7OB 3ZE2B 1A5BB 3O7WA 3UK6A 2PX6A 2GCIA 4QNMA 4AY3A 1KI8A 1JR2A 2JGAA 1CUEA 5JG7A 1D2NA 2Q3MA 3FDFA 1KQFA 4KR0A 3ZIUA 2PUCA 4AT1A 5K0NA 3W1EA 2IYNA 1K5PA 1JJVA 1ZK3A 6AT1A 1V5WA 1JQLB 3OZBA 4HYYA 1N6RA 2XECA 2WIJA 2ID8A 1NTRA 1D9XA 4NFYA 4I2NA 1P60A 3W6UA 4GGMX 3DLAA 4DLTA 2BMVA 2EW8A 2UZ0A 4K87A 4TL6A 1JXQA 4V03A 1SEVA 2JARA 1EMDA 3GEIA 4X95A 3ZHSA 2EX0A 4ZYWA 2VP4A 3OY2A 3WBBA 4UTZA 1TKRA 2HO5A 5E1BA 3HNOA 3T7EA 2MSWA 3TOCA 1KARA 3EZFA 3CVOA 3L01A 2Q2QA 4RWEA 2V6FA 2VYFA 4L0CA 4MUHA 2OMEA 4XGQA 4TKZA 3CPJB 3O1IC 4WY2A 3VOAA 4KBGA 4B79A 3GWZA 3ZCUA 3IA2A 1U7UA 3UMYA 1JHXA 1QFJA 3H1TA 3KNZA 4LSMA 4V0RA 3WKCA 4TSKA 2IEGA 4E1BA 2BSXA 4NF2A 4EUSA 1CUZA 1ONBA 1YBHA 2AC4A 1RBZA 3GBPA 2HQOA 2QN9A 4IDDA 4HR7A 4K05A 3A6JA 1AZSC 1GFZA 3X43A 2XQGA 3MEQA 4P7FA 4RGYA 1UZAA 3NHAA 3WL6A 4RJJA 5GM2A 2DU8A 4I36A 2J0EA 4YT4A 1E5XA 1YJCA 1VRCA 2IIVA 4CKZA 1N5KA 3H9EO 2ZDHA 2WHEA 1DAPA 5EKTA 4IJ6A 4O0MA 5C1BA 1JSCA 2CMDA 3FYHA 4GUAA 5H1YA 5IJWA 1W4RA 4TQUS 3OM9A 3KLPX 2JB9A 4MJLA 1T5DX 2BJVA 2RH4A 3FNFA 3ORQA 3G59A 3TR0A 4HY3A 1TO2E 5D85A 3QITA 1RAHA 3ZG6A 5K5EA 2P40A 4BUJA 4EF6A 2V6JA 3JYLA 4QYIA 1I1OA 3N53A 2WUDA 4MRNA 1XZNA 1KMQA 3UGKA 2QRLA 3P2EA 1KZHA 3UT5A 3AHFA 2H31A 3SAJA 2EX4A 5ENVA 4MRVA 5AQEA 2PT6A 2GD2A 2XRYA 4YCAA 4BX8A 4PSCA 2XT9A 4TUYA 2CL6X 3NBMA 3FRJA 4BMOB 2B36A 3RJ5A 2ACVA 4OL9A 5CIWA 4U6SA 3QMVA 2C2BA 5ENDA 1PJ3A 1NVWQ 1TIKA 2WWWA 4RNDB 5A5DA 3F96A 3DTTA 2RFLA 2HA3A 4X5OA 1DAGA 5FPHA 1K0UA 4KAAA 4FE3A 3QVUA 3RUFA 2GYYA 4YXWA 2VSQA 1WB5A 2XTAA 3K8QA 4YRDA 2FQYA 2O3JA 1TVMA 4F1JA 3L1UA 1M2WA 2V7WA 4I5GA 1MFZA 3GEEA 2PRIA 2X2OA 3AUXA 3W8DA 3LNTA 1NUAA 3BWVA 1THTA 3JATB 3IYLW 4P4SB 1LNSA 4AXBA 1Z4NA 1UKEA 1X77A 3LMKA 1H5UA 4RCYA 5JE8A 3U7QA 4WL0A 4BKOA 4HNVA 2JH8A 1AJEA 4XVCA 1BOOA 2IVZA 2XRMA 4RKYA 1IQ0A 4TTVA 3B5IA 1RMQA 2V6GA 1W2GA 2X0EA 1DIGA 3WR5A 3GGSA 4AWXA 1K89A 2NUBA 4H7PA 3KBBA 4HGOA 1EINA 3I01M 1LLQA 2YMLA 3HWWA 4WRRA 2OFOA 3PXGA 1EG2A 1DMSA 1RHRA 3DMHA 4MW0A 5LQNA 4M1TA 1DC4A 3L4KA 4Q93A 3A25A 3ZI0A 2CBGA 4EHBA 2XYPA 5HZGA 3T5DA 3BF7A 3ORFA 3HZZA 1V41E 3SM9A 3D6VA 4MKFA 1ID1A 4PYMA 1T9DA 1KQ3A 1VIMA 2DF8A 3FVRA 3LO5A 4G41A 4R1TA 1T2EA 1TYBE 1QCZA 2H48A 1IY9A 3C16C 3FA2A 3PITA 4PLFA 5FF9A 3P9KA 3TNJA 4DNFA 1E2PA 3SBOA 3FHCB 1WOYA 3MJEA 4WK4B 4AD8A 1W35A 2G9QA 3WLAA 4B81A 5I9IA 4GI5A 2GZRA 1L7EA 2AOUA 4KFUA 3O4JA 1G7CA 3VDQA 3K71B 3SIPA 5DM70 2CLHB 2PU5A 1YL5A 1O97D 2UYCA 1CQIA 4OBEA 1YNSA 3GZNB 1P4GA 2VZLA 1XVLA 4LY0A 3IC5A 1SZDA 3A05A 3IPXA 1JZSA 2F6RA 2EQAA 1CUHA 2DWPA 2YFKA 1I36A 3X44A 3LY8A 1EFRD 3FNQA 4AY2A 5AJZA 2FR8A 3BM5A 4GDMA 1Y7TA 2H0AA 1P5RA 1UT8A 3NNDA 3QTTA 2GHIA 4UXIA 5T8KC 3CNHA 4I66A 4ZHQF 3G85A 2A67A 2BM1A 2XCOA 4BNFA 3I53A 2HYDA 2JDIA 4O4IF 1NYRA 2PS3A 3L8YA 4XGNA 4JJ4A 2Z9BA 4AKSA 3QV1A 4JV5B 4UNPA 1JR6A 3AILA 2H4FA 3HCPA 2E21A 2V8BA 1E2EA 3PPYA 3ESBA 2DUMA 3D3JA 3L7KA 3LF2A 4W1PA 2GVZC 3AVXA 5F9MA 3VSDA 1B26A 4YRSA 1JIIA 3ICOA 5DVZA 3S4YA 3E15A 4P3XA 4P4GA 4YRZA 1ILEA 1P44A 2XCSB 3I2FA 1IXKA 4JA0A 4QYWA 1RJ9B 4ZHQB 3PU6A 4K0RA 3G23A 1E1CA 2Y1XA 3CINA 1RKBA 1M5TA 1O03A 1U5AA 1GOTA 3EEYA 4O4IB 4RK5A 1WDWB 3FY4A 2PV7A 4BO7A 3KJZA 4BV8A 5ILGA 3DBRB 1MFPA 1EP2B 2G9VA 1YKSA 1TJ3A 2G36A 2A9FA 4MR8A 2W6IA 5C53B 3NXKA 4OQYA 2X1MA 2XKJE 2J4FA 4HN4B 2BP7A 4P83A 5F7OA 4X6UA 2ZI9A 2XDQB 3UUGA 4DQUA 1L4UA 3ABQB 3OVMA 2QVYX 5KYNA 2W48A 3PEWA 2C4WA 2PBZA 1C7FA 3ZUPA 1JIVA 4GL2A 5C3MA 3GRKA 5JNSA 4DR4B 4ZJZA 3JWIA 4LRYA 4WCVA 3VU1A 5B7GA 3HY3A 4BE4A 1BVUA 1ZWKA 1ZVQA 3WYNA 3A6DA 2O0MA 4JHLA 3AESA 4QYTA 5IP5A 4BFXA 3DPUA 5DTEA 3Q11A 1HWYA 2G0NA 1NNUA 1Q77A 1XQVA 2Y77A 4H2DA 1V5EA 4JITA 1OC4A 1MA0A 3OKPA 3Q2IA 5GGYA 2DSNA 2I87A 2Z2JA 1ICEA 3TI9A 1E5DA 3FCSB 4RKRA 1E4VA 1JLMA 1E2BA 1RAIA 1TAHA 1XRJA 2IHTA 2Z1MA 3EYAA 4GLJA 1U1CA 2DFNA 4LX0A 3T1OA 3EN0A 4KLRA 4XVRA 4ZKDA 1WRBA 3FOEC 2O8DB 3FETA 2AH5A 3EY9A 3G79A 1M34B 1ODLA 4GP6A 3T0FA 5BYBA 1UOPA 2YV5A 3DQPA 3MMXA 4ZU3A 2GD1O 4ZP1A 1HOTA 2BTQA 1TCBA 3E5RA 3HO6A 3RIYA 2WFMA 1MC8A 1UFVA 1CZRA 2H4YA 3IUSA 3C97A 3ROQA 2GH1A 3BB3A 3F6RA 2WB4A 3L7YA 3TGPA 3I39X 1G5FA 2OM6A 1SA0A 3M6IA 1VLHA 3O2QB 3E9CA 4BNDB 3ROEA 2UUOA 1GQ2A 4GYWA 3LLVA 5EN4A 2BE9A 1BU8A 1HL7A 4X1OA 3R6TA 1CKEA 5LC1A 2ERYA 1FDRA 1XRSB 2NXCA 5CHYA 1ZRSA 5LP6F 4D4JA 1P1HA 4CEHA 3UWMA 3TLGB 3H5RA 5ALMA 2OE2A 3DAHA 3W0LB 2OBBA 4IV8A 2X6RA 3CKYA 1NJ6A 4TYMA 1FFWA 3EY4A 1OV6A 1R4MB 2C5HA 1Q19A 5KNDH 3NDRA 4UFOA 2CVQA 3KOUA 5LLTA 2ANCA 4BX0A 2D0IA 3DH0A 2WWGA 5FUMA 3EC7A 4KXXA 4FQ8A 4CF3A 1NMYA 2P6OA 1DC3A 1BFKA 4IZHA 5TF4A 5ERGB 3JRWA 2HJRA 1E9RA 4IDCA 3HU3A 3REQB 2I2WA 2R8YA 3AL2A 3D7KA 5DE3A 4DV1B 2R60A 2X77A 3OEED 3MQFA 2DP4E 3AKYA 5KC8A 3LLUA 1VGVA 2ECPA 1Z13A 3MGAA 4G2TA 1UC9A 4HYQA 4MUKA 5F12A 2Y0BA 4CIVA 1GV0A 1LV7A 1QAOA 3DWFA 4S2UA 3RBXA 2Z08A 3U1TA 4MB2A 1T3HA 3KT8A 3OLZA 2VP3A 4BBJA 1IJBA 3ON5A 2JGNA 3TLAA 2WPNA 3ZY4A 3DAOA 4YMVA 2GPWA 4DKJA 1KAEA 5B64A 2ODNA 3AUSA 2ZIWB 5C31A 2PRKA 4GMXA 1BJRE 1VG0B 3WP0A 4QDZA 4R51A 3TZEA 1ABBA 3TLZA 3UH0A 2AQIA 1NJ2A 3S3TA 4JLPA 3KKMA 3T5AA 1T6YA 2GARA 4C0LA 1JXAA 2QTBA 2YUTA 5AI5A 4FN5A 3H5AA 1EFHA 2VHJA 1GPYA 4PGAA 3C3DA 1VJ1A 1YRHA 5ECGC 4KAJA 4Q66C 1WDLA 1WKVA 1RIFA 3OWOA 2CLIB 4Q9KA 5CK4A 5DOVA 4MYTA 3RKSA 2CNWA 1F20A 1BROA 3HXPA 1OU0A 1S3GA 2R5WA 3R4CA 4BP3A 1RAGA 5CDSA 2RKBA 2PGNA 5AM3A 3C2QA 1WY7A 1WIWA 1Z82A 2XMGA 3MYRA 1X0VA 1UJNA 1YOVA 2F1HA 3NTUA 4EPYA 1U81A 1E89A 1NMQA 4F6CA 3BMCB 3RJTA 1Y4UA 2PMBA 3P0HA 4DCMA 4L7QA 1V9LA 4NAHA 4BNZA 1YCDA 1YULA 5ADUS 4PS0A 5JAHA 5KJ6A 1XGKA 4LF6B 2F4VB 2NVWA 3NI2A 3CUWA 5DW3A 1JV2B 1YE5A 4FEAA 4IIJB 4UOEA 2O0HA 2C4KA 5UKDA 4B46A 2H1LA 4J07A 3CE9A 1PV4A 3KB8A 3AHEA 3M2TA 2B9EA 3U3MA 3AEKB 1OTXA 1GL7A 1Y1KE 2QN8A 2YWGA 3M70A 4Q1EA 3TNYA 2WD9A 1MPXA 1MX9A 1XXHE 4I5FA 1K4KA 3NJ8A 4JT8A 1NX9A 2EBWA 2I66A 4RD0A 4Y7CA 2HQRA 3WL4A 5F7ZA 2CJYA 1BDBA 5G4KB 2E55A 3EASA 3MT9A 1N9KA 1P5FA 5TS2A 1PZFA 1ZMRA 1WULS 1V11A 2CXPA 3ILXA 4RH3A 2W6NA 1WBJB 1X7YB 5AQ1A 3PQDA 1EWRA 1JPJA 4NONA 3ZWYA 1GTL1 1NLFA 3ZWBA 4FEYA 3ND9A 4UTXA 3CQ9A 4RKWA 1ML4A 1YK0A 2GKOA 1EK6A 3HFRA 3TVTA 2YXNA 3CSDA 1G9XA 1YJAA 1MW9X 3PRHA 3QU5A 2O3QA 3A4NA 2AB0A 2EIXA 4I6JA 2CF5A 3S70A 5BMVA 3Q40A 3TIFA 1VPTA 1RXEA 3EGXA 1V4NA 4FPXA 2PNJA 2NU8A 4HTFA 1WTCA 5H68A 2I6UA 2WAMA 1PFKA 2YV2A 4UE6A 5BSVA 2OHFA 3RFXA 4NEQA 4CWAA 3JQ9C 2A5DA 3K9QO 2NZXA 1PYDA 1OZ0A 2BEWB 2C20A 3JAWA 3X2FA 1CJUC 4V0OA 4NFLA 2F67A 4UCXA 3LC1O 1GVHA 2HDHA 3LSTA 4L8FA 4YRJA 1SBNE 3W7BA 3M7IA 2OFWA 3ZHTA 1ZL0A 2JLSA 2RG1A 3OFNA 4GBED 3ZDQA 5BQ5A 1QH1B 5GZ1A 1T0IA 2P62A 4LNAA 5FI1B 1WVMA 4B48A 1M66A 1V43A 4R71A 5KS2A 2O8EA 1YDEA 3T7TA 2VPYA 3KQPA 4AVYA 2QUKA 4E2XA 3G2JA 5AXDA 3WJAA 4E3ZA 5A4DA 1N2JA 4OJNA 4FWTA 4WASA 4FUQA 4GXRA 2ZWPA 3C7TA 4NJMB 4F4JA 2XSZA 4OQMA 2OCGA 2EW1A 2AFIB 3NU1A 4URUR 4MGYR 5IKPA 1MZPA 2C9MA 3QA9A 1SXIA 2DLNA 4X63A 3LRPA 4EAQA 2YFYA 2B2NA 3MWLA 3WQRA 3PEFA 5TGTA 1J2TA 1PL7A 5ALQA 4PYRA 1VIDA 5CBPB 2BGIA 1IAVA 4GIBA 1VKHA 1ZS9A 4LDNA 1QC5B 4XDYA 5L4NA 2WVJA 3GN1A 2JI9A 4EKDA 5L6MB 1KP3A 3EEIA 1O6BA 3QYJA 4AIRA 3OFKA 3GVPA 4A8JB 2O9JA 3RFFA 4DLBA 5I9NA 2GVNA 1LLCA 3S2ZA 1VBMA 3T6KA 3WDLA 1E6LA 2PBLA 1TD1A 4XJVA 1AGXA 1DC6A 2BELA 3TZ6A 3THSA 1Y0BA 1FS4A 1UKVY 1K1EA 1OA0A 2BDUA 2EATA 1J0XO 2P30A 3PL1A 3N0WA 4TL8A 2ZTVA 1DKPA 1L7BA 4UCWA 4KQWA 3T7SA 4EFMA 4ENUA 5HKKD 1F6DA 3V34A 5FL3A 2GPSA 4K9NA 2YWCA 3AHCA 4PIPA 1KS2A 1XZEA 3C6ZA 1FL9A 3QTLA 1YU9A 2RGUA 3PI7A 3L82B 4QASA 3PBKA 4GPAA 4Z2AA 2IU6A 1TVEA 3TF5A 4JI0B 4XM1A 4PC2A 4GOXA 4TGLA 3F98A 5KVAA 3OZWA 1M7GA 1T34A 2PXXA 4BV9A 1A82A 1U2SA 1Y9AA 2VKTA 3DHYA 4KGXA 4R9VA 4WJLA 6YASA 3U19A 4RK7A 1JQAA 4G0ZA 2VQEB 3CUUA 4BLOA 1X3SA 2REXB 5TT0A 3FSJX 1PN3A 1H23A 4BKUA 1RRMA 1F38A 1ZSYA 2DEUA 1H0RA 1DC5A 1P2UA 2QI9C 1UOOA 2VK1A 3PLAE 3U7IA 1CF4A 4P33A 3RYCB 4HV4A 3L4SO 3JYHA 2B4KA 3AWIA 3KR9A 2V7QA 5T4HA 4BFVA 1X92A 3M5PA 2OCPA 4JC0A 4EGQA 4JBWA 1SHKA 1UPUA 1KI4A 1AB5A 3EPKA 1PKXA 2QX8A 4N5DA 4PSAA 3OX4A 2GETA 2CYBA 3OBBA 1J70A 1QDEA 4JNKA 1XPJA 1ANKA 2JJYA 2QPOA 3IP6A 5DWDA 4KX5A 5BN5B 3Q8XB 2WWFA 2KBFA 1II8B 3F3YA 1UBLS 5H9VA 2ZAIA 3BSYA 3TS1A 3QJ5A 3BULA 1AURA 2NO5A 1JXOA 2DWCA 3IQGX 3QOXA 5BVGB 2QX6A 4LZJA 3ZGOA 1EK1A 1ZONA 2I6SA 3HBJA 4G2NA 2N75A 5T4FA 2JK0A 4CM4B 4MI6A 4EDHA 1LSUA 1OFIA 2DKNA 3H18A 3LRTA 2Y4NA 4JWKA 2Q4RA 4R5HA 4EOGA 5A5EA 1QMPA 2QTZA 1IEWA 4KYIB 3K2IA 2CK3A 4A2QA 4HK4A 1M1YE 3CFYA 2VUUA 4LXYA 4Y1GA 3U2QA 1NUPA 1N77A 4C2UA 2FFHA 5AOCA 3W1WA 2OGWA 3BCRA 121PA 3I9LA 3VZBA 2EC5A 2I4NA 3QXGA 2R8PA 1F2TB 4MMYB 1J97A 2IV3A 4IDQA 3C3YA 3QVKA 1BDJA 4ZVRA 1ZESA 2Z8YA 2C8VA 4RS4A 3WZLA 1C9NA 5BR4A 1OHHD 2WU0A 4RANA 1Y5MA 4X7MA 5F52A 4GH5A 3CN9A 4HRVA 5CVTA 1HSOA 2WD8A 2ZVJA 4MPJA 2XB2A 1MH1A 3DDWA 3OCYA 5TMEA 3TSZA 3KEMA 3KDSE 4K40A 4AB1A 2FN3A 2VHEA 2CCGA 2G1KA 3ZCVA 4UM8B 2IJGX 2V0NA 3EZNA 1M2FA 3P9SA 2BV3A 3SE7A 2VT7A 3JATA 2P9BA 2XHEA 2X5NA 3Q9LA 4KTVE 2W2VA 4P4SA 4ZQEA 1DKMA 4ER6A 2YYSA 3KQSA 4JLDA 4LAFA 2EJVA 1QLWA 5BW4A 2FPIB 1P0QA 3CT4A 4B0PA 4Q9JA 5M04A 2RMKA 2R8OA 5A4FS 3QEOA 2JI4A 5IJZA 1NLYA 1PF7E 5DGHA 2J07A 4HLNA 2L19A 3HDHA 1RLTA 2BRUA 5TT1A 3BSSA 5EWJB 3E3AA 1DKLA 1GPUA 3MB8A 1C8KA 2JLCA 4BRZA 3R9WA 1HPLA 2W37A 3L1VA 4Q1FA 3KEFA 4MIOA 4DRZA 4Z51A 2VT3A 4UAUA 4URFA 5TQVA 4G86A 2HMAA 3JQBC 3H4TA 3JD1A 4A8TA 5BV0A 4GG1A 4Y2YA 2R66A 4KN9S 2R8EA 3UAZA 4QPZA 3GGDA 3PX3A 1CQWA 1ACJA 2ZJ3A 3PXDA 4U0KA 1LRKA 4DV7B 3RTDA 5EJ8A 8MHTA 1CEQA 4C87A 5F4ZA 5F5LA 3F9CA 3HA5A 4B80A 4DUGD 1D4OA 4ZVMA 2OL4A 4IV0A 4ZDJA 4X41A 2C7BA 1NQUA 1OA1A 3JQ8B 4U7HA 1G8FA 1UQRA 1XWFA 5D8DA 1DX4A 2D1QA 3GZNA 5FX2A 4TWBA 4A23A 1B0UA 1XUOA 3ACDA 3E84A 3FG9A 1DADA 1QO0D 3I73A 2ZRQA 1HV8A 2C03A 1J8MF 2ONZA 3BIOA 2JASA 2P67A 4MEJA 4Q5IA 3SSNA 1U4OA 1ZYUA 2ZJOA 4QTYA 4M0UA 2QL7A 2J4DA 1QVRA 4NMHA 5LP1A 3QWFA 3SJZA 3ZTWA 2OB1A 3OETA 1PGJA 4CLEA 2AD5A 3VR5A 1SQ6A 2P2DA 4FDAA 1EJ0A 2BJHA 3E0QA 5DHTA 4ZICA 3OZUA 4E32A 4ITUA 5H59A 4XDHA 3VNSA 3JQFA 3LTEA 4NPAA 5AI4A 5I9BA 1FDSA 4HVLA 3Q7SA 1NVDA 3U1BA 1J5EB 3OBIA 3QA3E 4EI7A 2IYPA 1JEEA 4LYJA 2JFHA 5F3RA 4C76A 1Q7CA 5KAPA 1RJ9A 4ZHQA 3AR7A 1EGVB 4O4IA 4FYKA 3HGQA 3IAFA 1I13A 4EL5A 2P2YA 1JR3E 3M83A 4MAFA 5JH7F 3DBRA 3F2VA 3F5MA 4EHKA 5JRJA 2X3YA 1S4MA 2I0FA 4NULA 4UM5A 2OUKA 3HEAA 4R8VA 4TRNA 4TZTA 1GP2A 3IUBA 4MYSA 2RAUA 4EFKA 2XDQA 4P32A 4EI2A 1G17A 2JI7A 2VI5A 3MCUA 1II9A 4OHMA 5HFJA 4G25A 3WY9A 1K6JA 4D2IA 1ZC4A 3R5KA 4YIHA 1RLOA 3MRVA 2OZPA 1F8UA 1AXRA 2BONA 1VLQA 2RGBA 3ENNA 4KTTE 5LXTF 5LYYA 3SY8A 5BV7A 2XZLA 3O38A 5JH7B 5KTPA 1RM4A 3W2FA 2P78A 3B12A 1G6HA 1UANA 1YB1A 1H8HA 3EVDA 3HSYA 2OV3A 3KEOA 4IXWA 1TCVA 1TJYA 2HBYA 3EW9A 2WAXA 3IDOA 3LDFA 2ZETA 4DA7A 1VJ0A 2CLDX 3JV7A 4CYMA 4ESEA 3V2UA 2CFRA 4J0IA 5ESRA 4MNTA 4X3CA 5ALXA 4IZOA 3V8PA 1E79D 3EVNA 1YUMA 2ZWMA 4DQVA 3SHTA 5LXTB 1PFUA 4F86A 2O8DA 2ODBA 2V74B 2R7NA 3MCAA 1M34A 3GGOA 3GELA 1VBNA 4J29A 4OM7A 5FOTA 4L6AA 4C9BA 4C2TA 4N65A 1MC5A 1UKZA 4HATA 2XRFA 4CIAA 3UIEA 1QG2A 2I54A 2DHDA 1C3XA 1VA5A 2PUWA 1BKYA 1MJFA 2Y1DA 4G1VA 5FUQA 1KWGA 4EG8A 1SCQA 1P1RA 3TL2A 2X9LA 4MV5A 4Y6SA 2P65A 1N75A 1VE3A 5CG2A 1MJNA 3DEFA 4PF1A 4B8ZA 3B6KA 2RH8A 2JGJA 1HDEA 2IPXA 4OHXA 2CV0A 1NYTA 1U11A 2BWJA 2O06A 1MW8X 4ABTA 3UV6A 3L9WA 4G3XA 4BNDA 1LDBA 1RWXA 4YT2A 4LXXA 4JS0A 3ISTA 4YV1A 2H65A 5LMCA 4NBNA 2D59A 3TPZA 2DBRA 5LB4A 4AULA 1SFRA 1BD4A 3VKFA 1B00A 1V3QE 2JFFA 4JCCA 5ULLA 3TLGA 2AL7A 1LVHA 1TMKA 1OGIA 2Z8YM 1FC0A 3QWBA 4MV8A 4P2BA 3ZQKA 4DTIA 4MKIA 1OBCA 1WTAA 2QMUA 3EVEA 3RG8A 4JYBA 3R7BA 2V9ZA 2XB4A 2YHSA 1CUAA 1J8FA 1IYZA 1R4MA 1N3LA 3DM5A 1QB8A 3DTVD 4XXHA 3A4MA 3H75A 1DJOA 4O8ZA 3WOHA 2J3DA 4PCVA 4X00A 4R4JA 3U7JA 4Q03A 4OFXA 4YYEA 2W5UA 4ETIA 1YR7A 1Z8DA 4NZ9A 4RXTA 3REQA 4F2WA 1RCFA 2HNAA 3UBMA 2FQ1A 1SVNA 3HDQA 3NRJA 1XLTA 1Z2DA 3C6YA 2DC1A 1M72A 1P2TA 1HH4A 4HAZA 1KF0A 4BEJA 5C8XA 3ABSB 5THXA 5B2FA 3OLVA 4BNGA 5B58T 1ETUA 2ZAGA 3KVNA 3NJRA 3SQDA 4DXAA 3GQVA 2XTZA 3AKCA 2XMCA 3QWHA 1Y1LA 4YUZA 3MMSA 2CY0A 4HYTA 1WXHA 5A05A 1IVNA 1V25A 4V0QA 3LSYA 2GRJA 4MRPA 3RASA 5H9WA 5KVVA 3U5TA 5LD2C 3GUCA 4Q9IA 4NHEA 3MTBA 2YTZA 1OFTA 1ISRA 2E4ZA 1FRQA 3I8OA 4XYMA 4DG9A 5BV1A 1PJAA 3FKSD 2I62A 2NG1A 2RKWA 2DECA 3AK4A 1USUA 3MJVA 2GF2A 3RJ9A 3JQQA 2JL1A 2C7VA 3S2EA 1WUJS 5EKDA 3AT1A 4M3NA 3IKVA 1P4HA 3K1ZA 3RSZA 3WWYA 4YV0A 2WJVA 5JEEA 2WWIA 3OFSA 1WCV1 3QVWA 1BIFA 1JWLA 1RRCA 3FGPA 1WW3A 3RROA 4HXEB 2F1OA 4JELA 4BFWA 3U6KA 1RWBA 3K4PA 3IAS1 1Z0FA 4LBWA 4NEHB 1DI0A 4TTQA 1XZ8A 3BMCA 3TQIA 3ACCA 3DE1X 4GMHA 3H2BA 2H8GA 3U4GA 4P1ZA 1DCFA 1I0LA 1EM8B 1QFMA 1XFDA 3D81A 3DR3A 3FUUA 3LUAA 1GPAA 4HQLA 4OXIA 1BN6A 4IIJA 4POAA 3TEJA 1J5XA 3A9WA 3EGEA 2VDVE 3TJMA 2ZSAA 4YGXB 3W78A 3M3HA 4RF4A 5ER6A 1LQUA 3PEYA 3DDUA 2F8TA 3AEKA 3KSRA 1OREA 1HNWB 4B6OA 1XAGA 1IZ7A 1DJPA 1ONNA 2ZUSA 3R3UA 4PLCA 1Z35A 4DARA 4WFQA 3ZDDA 3RI3A 2MTBA 1LJUA 2AJDA 3D7MA 5B3JA 1YHNA 2ZRAA 3K9NA 3J7TA 1AO3A 1LVGA 1AMNA 3FI0A 2HA4A 2JBHA 2MYPA 4DCTA 3LGSA 1X7YA 3R6LA 1E2IA 3RUEA 4OXQA 4CDRA 3G2KA 2PSJA 5JQGB 5EXXA 2Z4SA 3RFVA 2J45A 2KQUA 4J0DA 3D6HA 3K05A 1I10A 2LXNA 2QNRA 1H9AA 3AIIA 2I8CA 1IY1A 4ZI3A 3LL4A 3TD2A 4ALJA 2LWIA 2GAJA 3T1TA 2OBMA 3SJUA 1QIEA 3ZE9A 2AZDA 3MQ2A 1W0CA 3UB2A 3OQNA 1GGJA 4E5YA 2EU8A 5HK9A 2QG4A 1KZ6A 3ZWDA 5KIAA 4IDNA 1FUKA 3AIKA 5K4GA 2Y0PA 3EPLA 3GT3A 2ZDQA 1GPDG 4LZNA 4V0KA 1NVVR 2EW2A 3ROGA 2HKIA 2OT3B 3NWBA 2BEWA 3SKXA 2VJMB 4CIBA 3SX0A 1OB2A 2A1TS 4PZZA 1R0LA 3QJGA 4PAMA 4E08A 4J4TA 3RHFA 2G77B 5JWOA 1JLLB 3HCAA 4H6XA 2JFBA 4PN7A 3B6IA 4WUTA 1DQSA 1CV2A 3P4YA 1MENA 3ECAA 1QH1A 2CT8A 2JBWA 3DEYX 2C96A 4B3DA 4G09A 5CDHA 3VDNB 4NYMQ 4NZPA 1VPLA 2XYRA 1BE6A 4RK0A 2HMVA 2WWHA 4Y9SA 1QTNA 1JL3A 1B2LA 3UHOA 2UXDB 1RZRD 5IFLA 2HTFA 2P9JA 1C81A 3GAMA 1N6NA 4F45A 1JN0A 1SJ9A 4NJMA 3SR4A 1DEKA 1NKTA 1UINA 2VPQA 1NQOA 2AFIA 4HZGA 2IXFA 3A27A 4JLKA 3ULKA 4L4SA 4ZYTA 3ADBA 5FYDA 1HNNA 1P2SA 2RAVA 3BE6A 4RE6A 3SZRA 2AG0A 2IPMA 4BKQA 2YINC 1IXZA 4FW9A 4XB1A 1PYGA 2FF7A 1RMTA 1QR2A 3GT7A 4CMKA 1ZCFA 5KU1A 1R0RE 4YV2A 3WNBA 1XMIA 2V5AA 3Q0IA 5CBPA 3Q41A 3LGXA 4MUIA 3EGIA 4G0MA 3RVQA 4P0QB 4OJTA 3ADPA 3ZHQA 1QC5A 5K0LA 3VU9A 4GQAA 5KTNA 1PD1A 2FCAA 3GGJA 2RHHA 4RD6A 4A8JA 2OSBA 3DD1A 3PZBA 4RH1A 2IUUA 4H6PA 3JYNA 5IAJA 1T4BA 1FEZA 1N3YA 3WADA 4NXMB 1PWHA 4AJ4A 4RVDA 3WQHA 3E1GA 5JZVA 2WTMA 3IA7A 1FFSA 2MSCB 1DDGA 3WOVA 2OWEA 5HW0A 1BGVA 3RVLA 5F1OA 3NOVA 4NOLA 5I9TA 1NUUA 5JISA 1OFHA 4WN9B 3PC4A 1WMEA 1J49A 3FTEA 4MVJE 4ZT6A 5BQFA 4OI0A 2WB2A 3CLUC 3E4CA 1UEJA 4A91A 1L7MA 4N7MA 2OCIA 2ZPAA 3UMVA 4M7RA 3RUCA 4E14A 1MORA 1L8OA 3NAMA 4IUDS 1T6BY 4N6NA 2M6LA 1RC0A 1CRZA 1Q0ZA 1C4XA 4MVJP 3SFVA 4FD2A 4KPYA 4ZVSA 5AW2A 3UCXA 2L18A 3L6BA 1Z16A 1R88A 4IR7A 3BYZA 4R9SA 3N74A 1C80A 1OBOA 4F5ZA 1YFKA 2IE8A 1Y7IA 2FEKA 3D8TA 3E9NA 2GZ2A 4KO2S 4JD5A 5FNVF 1BHJA 4IOLA 2GEBA 3UY4A 4M2LA 2QL6A 2ERXA 1RHKA 1U02A 4C04A 4DG5A 3E18A 3EDRA 4Q24A 3RC3A 4MQEB 1O57A 1WZCA 4JVSB 5EMLA 4E2WA 5BN5A 5YASA 3ZJTA 3IIMA 3THWB 3AU9A 4BTVA 1II8A 2R6AA 4M7WA 4X44A 4EMTA 4DREA 2C9YA 2N0SA 4BU0A 3TGWA 3V6MA 5ECWA 4WZ6A 3FYUB 4K9KA 3CX3A 5CT9A 1OKKD 4QL3A 1V7PC 3OU2A 4Z9YA 1K8ZB 3IJEB 4P3NA 1MRZA 5BVGA 5LLDA 5FNVB 1YQWA 3F78A 2VC2B 3NTQA 3OX2A 2EKBA 4CM4A 4TS1A 1SVWA 4LCEA 1UOEA 1FJGB 5JPIA 3NC4A 1M67A 1CFZA 3FUXA 3SQLA 1M2KA 4F5EA 3WWCA 4D9EA 1O08A 2DBQA 4JXKA 1SHLA 2AI2A 4Q4JB 5LJIA 1Y80A 2H9IA 4JOQA 2DQYA 4YS6A 4EHDA 2B2XA 4YMWA 3NHBA 4K88A 4UHKA 2X1VA 1AK2A 2PX2A 1EFUA 3L05A 3K1JA 3TNFA 4BBPA 2OB2A 1F2TA 4KBFA 4XOUA 5EXPA 5EZYB 3RS2A 2IA5A 1JDBB 2O4UX 2IV7A 3WMFA 5K0CA 4ND4A 2X8AA 4HLUC 2BKAA 3CUTA 4UHFA 2AN3A 3K9HA 3MNFA 3GDWA 4WKPA 5ARDA 4DA9A 4R83A 1GYRA 4F04A 5AVSA 3CNNA 1SU7A 1WUKS 1S8OA 2Q46A 5I6DA 4C01A 1FU4A 1OROA 3A1TA 3ORSA 4BKRA 5JDIC 4MDEA 1A2OA 1H1TA 2JD1A 4ECAA 1PHRA 2H2DA 1A9PA 2OTCA 4R8LA 2FSSA 1JIXA 2BUAA 2OO3A 4WN3A 2DUNA 1M0SA 3E7XA 1LPOA 1G66A 1GDHA 4HWGA 2Q3HA 4X6XA 1E62A 4CG3A 1XZPA 1GEEA 3ANYB 2FPIA 3FDIA 3SR3A 3I2IA 3WO1A 3HB7A 3P0JA 5BYKA 2PV0A 4R2KA 1FBTA 5IXSA 3A6ZA 5EKXA 5J4KA 3IKLA 3ZU5A 5EWJA 4CMEC 4CQLB 3DZJA 3RUDA 1YJBA 1M7BA 3O94A 4U5QA 1QPBA 3BH7A 3WWPA 3D3WB 1U3GA 3QJYA 5ALZA 5C7IO 2EDAA 1JEYB 1WHTB 4OSEA 5J5AA 2PZJA 4O4JF 4DV0B 3P2IA 4MUFA 1HT2E 3GLHE 4WK0B 3MG9A 5B1IA 4YXFA 2HWWA 1QV9A 2JGMA 2ZRDA 4HFNA 5CM8B 1YO6A 3DHNA 4CNBA 1ZVKA 3BRWD 3DOIA 3E35A 3MAAC 4RZQA 1X9HA 2OFPA 3FPBA 4JT2A 1HLDA 4I2VA 1OXMA 2ZUDA 4AF7A 1GNVA 1JYFA 1A9SA 1S2GA 3JQ8A 1WD7A 2PS9A 4IIDA 4KYUA 4O4JB 1I4LD 3ZOZA 1T1JA 1NAHA 3D2LA 1PJCA 2G04A 4WXRA 3HJCA 3ESXA 5AXBA 4JLVA 1T1RA 2QA5A 4HNRA 5K3AA 1D8AA 1J8DA 1TZCA 4Z4EA 1E59A 1P1IA 2IV2X 3CA8A 4YCLA 3L02A 4Y2UA 3NC0C 2HNBA 3ED5A 4EELA 1O5OA 1ZD2P 1KVRA 1YVRA 3HGTA 4UTPA 4IF6A 1CR2A 2PGDA 3FCEA 4YR9A 2FZCA 3CH4B 1KVSA 2WIBA 3OF3A 3OZIA 4EB6B 3SVTA 4HWKA 4FLFA 4P3OA 3ZW7A 3ZW9A 1T9KA 5BSHA 4RW0A 3IXLA 1LQ2A 5HZMA 4UM9D 3UO8B 3U49A 2N46A 1FQOA 1I3CA 5JLAA 2PTGA 4QBIA 1HLFA 3RSFA 2FW6A 2DWUA 4UUNA 1Q3KA 2MSNA 5ALOA 4FC7A 3W2GA 2YV4A 1NUSA 3DWIA 3PPVA 1W94A 4JWTA 3UJ6A 3UN1A 3PICA 4P6VF 2CLSA 4GL4A 1FUUA 3VO8A 1XJ5A 5DP2A 3TIVA 3ZVLA 1R6TA 2MMGA 4MVJG 2Y1CA 4Z0PA 5LQDA 1CQPA 1QRUA 1P2BA 4KEAA 4RTOA 5PGMA 5TGZA 4FYIA 2QZ4A 4UBOA 1ENPA 3RFUA 4PN3A 1L5MA 1YZHA 1FRZA 4HG2A 2VQDA 2ARKA 2JFXA 1G5QA 3PNYA 4JP8A 4LGVA 3ZJUA 5BORA 3NW9A 4OBWA 3HSKA 3PVZA 4D6PA 1UPCA 2P90A 2V7XA 5SV2A 2D54A 5DSTA 4GGOA 5JH7A 4E30A 3EC1A 3LO8A 2IH2A 1X1AA 2Q21A 1XP8A 2AR7A 1U1EA 4FS3A 4G4SO 4TQAA 3WNDA 2ZIEA 2ZIVB 1OR8A 2Q7DA 6CHYA 5KYXA 3NM4A 2CXOA 3EQ9A 3SJ7A 4TTRA 3G2HA 4F2PA 3WA7A 1UKCA 1TK9A 4H6WA 3H9JA 4FFDA 4KQ6A 5JNLA 4KRFA 4RLFA 3H6HA 5F2NA 3L6CA 1WX1A 1EDBA 3QUTA 1CJBA 2XYGA 4LOIA 1Y4DE 2ZJ6A 1EVQA 1G4UR 2QHXA 1ZINA 2ZSIA 3P9IA 3HHPA 3N5KA 4I99A 1X7ZB 4LYYA 5DTRA 1UIMA 2VJQA 4FFBB 4Q7EA 4A1FA 4P5EA 4W5TA 2VCHA 1JQ3A 1RP7A 3EPHA 1STOA 2LP4Y 2R84A 2QRPA 4Z49A 4IKOA 2VWPA 4PO8A 1NNLA 4A6DA 4FOTA 1QDLB 1UMCB 3AH8A 3ICVA 2EJBA 1Q11A 3GIWA 1W52X 2FRDA 1XFAA 2IQIA 2PIAA 2Q3LA 4GSKA 4K6GA 5JDCC 4AMBA 2IZ1A 4JX8A 4HEA6 1GGHA 1BXRB 2PEYA 2FOXA 4ESOA 5LJLA 1GTZA 1VE9A 2ZUWA 4PPFA 5L3QB 1Q1NA 4XCVA 2O2YA 3LPMA 1WCXA 1YFLA 4G0WA 4Z86A 1A71A 1PNOA 1VHDA 3KHUA 4QPNA 3TLXA 1ORWA 2Y0EA 3V7YA 4CKYA 4P08A 1TU0A 4IFEA 2YKGA 3HBLA 1GYPA 1HDIA 3ZDYB 3BMNB 1PR5A 1VOTA 3A26A 2JFUA 1D5CA 5BO5A 5K8LA 4O6VA 4R31A 3TSAA 1F0YA 1D2RA 3HYRA 2IY8A 4DY4A 4YAEA 4OXRA 4QHTA 4AKIA 3HWX1 1JTEA 1XJCA 2ACWA 4PGGA 2LIVA 1B8NA 3O47A 4IIUA 3GJZA 1CUYA 1DIRA 3O3CA 3F9IA 3VYSB 5CPFA 4REOA 1J39A 2ZBDA 2AJLI 2AV6A 2WICA 1FP2A 2O52A 2WTNA 4D3ZA 1WZNA 3KL2A 3T5TA 3FNGA 2VPIA 2Y4OA 5IJAA 1UWVA 4RAQA 5JAPA 1SU8A 2QR3A 3BXFA 2SICE 4B4OA 4GKJB 5BURA 3V1NA 3K6SB 4FNGA 1A7UA 5EGSA 2F64A 3V4LA 1RWKA 3BL6A 1IHDA 4DWOA 1X7GA 3OC6A 4XUEA 5KSOA 1H6CA 1R64A 2ATCA 3FDZB 1PJ2A 2V96A 4J3FA 3FTPA 5F77A 2F00A 3V8BA 3MWGA 4S1TA 2PUFA 4E7PA 2WT8A 4GOJA 3AP3A 2WP8J 5HG0A 4GVXA 3D8NA 3MTQA 5AVUA 2GBCA 4S04A 1NSTA 4RV4A 4X90A 4PZAA 3A3PA 1T35A 2EV9A 2HNKA 3GH1A 5EJFA 4BN5A 3GFRA 5LBIA 3VNQA 4L02A 1H94A 3BREA 1U1FA 1CUDA 3FFBA 1TM7E 2QNBA 2YHIB 3BZWA 2VWGA 1ODJA 1RHUA 1K6IA 2O3RA 3BF8A 3G8YA 1WXQA 1WBDA 5JANA 3LXUX 5AW9A 1IWPB 1HBJA 1KJ8A 3AB7A 1EM6A 4DCUA 3JU3A 3EAFA 4MXDA 5ERYA 3O9MA 1NR1A 4N40A 3FHJA 3LXRA 3A4IA 4MKGA 5AVJA 1CF9A 4PLWA 5SYNA 3PQ4A 5BMOA 4KNYA 2EFHB 2ZT5A 4J1TC 5C1PA 4QFMA 3CLUD 1B6SA 4R1OA 1EM8A 4PG4A 3FN4A 3D4LA 3WLPA 4AKEA 2VDWB 3AUAA 3NNNA 3FFXA 5CGZA 1Z4PX 3E0XA 3M5WA 2ZYHA 3W6PA 1W88B 2H3HA 3PKJA 4Q21A 5E9JA 4EYGA 2QRGA 3QMWA 3UK1A 3ZJ5A 4CZ2A 4P53A 5JALA 2A5YB 2DFLA 3DQZA 3K72B 4JJAA 4ER3A 1RHJA 4RY0A 2Q0SA 4TT3D 4BCBA 1S8NA 5JR3A 1VLZA 4FWIB 3KHSA 4GRIA 3QVOA 2RONA 4B74A 2AI1A 1QYDA 1QZTA 2E4UA 1KMMA 1EUQA 3HJUA 3D8BA 4L6CA 3T3MB 3WV5A 5JQGA 3O31A 3R3SA 4P80A 1JLSA 5FH9A 4JI8B 4OREX 4WCFB 4NYIQ 4ND1A 3ZLUA 4A3SA 4L9WA 3LDHA 4BMYA 3G2OA 2C98A 2ZWOA 1OI4A 1I7SB 3MS4A 4I0WB 4PPQA 4HAWA 3VPXA 2PUGA 1JU3A 1RFGE 1VLVA 3GUHA 3MPUA 4ZK2A 1U0GA 3S5JA 1DRJA 3FGOA 4Z0TA 4L8WB 4A15A 4DS3A 4OYRA 2W2TA 4IHKA 4XB2A 3UANA 2HPAA 2IEAA 3W3AA 1OXTA 4DMGA 3M1AA 1B15A 5CXQA 4AO6A 3B89A 5LWHA 3UJNA 3WGMA 4DLNA 4BVJA 2YICA 3QPDA 1P0CA 2IXEA 2VJMA 3O7MA 4ZGGA 1HRDA 4YWHA 1XEAA 1SVKA 4EB0A 1ITZA 4EO7A 3LZDA 4PV7A 4F8YA 3OT5A 5J2UB 2X0JA 4XYBA 4BRSA 1PFVA 3THYB 1JLLA 5HQ3B 3NRCA 4IEEA 2WJJA 3OE7A 1P2GA 1EDZA 4TLLB 5DNUA 2J3LA 2IHKA 2WVGA 1PR2A 1MV8A 5KDOA 3WXMA 3FXAA 3LC7O 2E9SA 4IJQA 5LQUA 2XZTA 2QJFA 1E99A 4PZUA 3SYLA 2GTIA 4FINA 2D0DA 3W5VA 2QRJA 4BX9A 1W1IA 2FEAA 1JMKC 4PNPA 2CLOB 1EYZA 3QG5A 3R3HA 1Z5UA 3H2YA 1LWNA 1OOEA 3GMTA 4H77A 4TM7A 1EGHA 4IJ5A 3LVQE 1OILA 3EH2A 4Q3LA 4IQGA 1C30B 1PGOA 4EGAA 1DCTA 4F3KA 2CEKA 1R0XA 2XXBA 1R4ZA 2P8SA 2XNSA 1CDZA 1OGYA 4PY2A 2HJWA 1EFLA 3QVTA 2V1UA 4CMHA 4GX0A 3HWSA 3VGPA 2FMFA 2QD2A 3IUYA 4IILA 3EFBA 4UPEA 1MG5A 3BCSA 3VZDA 2AJTA 3ER8A 4H27A 2ONJA 2XOEA 4KVGA 4ZZIA 4ISCA 1WV0A 3BIWA 3IQIX 5D6OA 2ZCJA 1ISIA 4JI7B 3ELWA 2GERA 4ZTUB 2E48A 2IBMA 4LI0A 5JBIA 1CUBA 1S3IA 2FWRA 5CJJA 1XVVA 1SOWA 2PZEA 1ECGA 2K6GA 2FGJA 3A28A 2IX3A 3C6BA 3ABIA 1FVHA 1ULTA 2ID9A 2BMEA 1NRWA 2FDXA 3MGCA 1GAWA 3DYBA 1UCFA 4WN9A 1BA3A 2DYKA 4B2LA 1WV1A 1DAOA 1W581 3UA3A 2NYUA 3KM0A 1YVEI 3GU3A 1RZ3A 1LPMA 1W2WB 3MA0A 3GD5A 5CDUA 5AP9A 5ELLA 2I34A 3L04A 2C92A 1VCMA 1PZGA 2D1YA 3AJEA 4RX1A 3UW1A 1XLUA 2D74A 4L0MA 3FE2A 2Q3CA 2VYVD 4PSVA 4US1R 5CLJA 4GVPA 1RVV1 2NV2B 3VTAA 1L5WA 1J2YA 4MEBA 4UU1A 5FWDA 1FE8A 1HETA 1W6RA 2FPRA 1F60A 1OAAA 1ZN2A 2NVBA 3WYFA 4JXXA 4ZV7A 3R7LA 1LDMA 3FMOB 1I6WA 3QK7A 3SLRA 4PHCA 4BASA 2NXJA 1L1FA 2IYSA 2QY9A 3BTVA 4DV6B 3OESA 4IDGA 4MQEA 3NBQA 4TLCA 1Z7BA 2FHSA 3DB2A 3CUSA 3LOPA 1YS4A 2Q6TA 4G0NA 4OQZA 4BNYA 1XDDA 4XEHA 3RS4A 5IG2A 3THWA 2QYHA 4YUXA 4MW5A 4GKKB 3IILA 3LT1A 1EEHA 3TR6A 2ZIGA 1DBWA 2O2JA 1VRVA 4L5BA 2JLWA 3PC8C 4LHXA 4JENA 2RHOA 1CVRA 2H2IA 1ZQ9A 1KYTA 1A9QA 3D7SA 4UUPA 2ZSBA 1GZ6A 5FNVA 1S8AA 3FCYA 2A88A 4XWKA 3H2IA 2G1UA 4KIUA 5AVVA 5JRDS 4P7GA 4EX6A 4UQPA 1ZD3A 3LT4A 4IAOA 5EHIA 3F6YA 4ID3A 4CLHA 3NM5A 3B48A 1AC5A 3BORA 2PR7A 3KSMA 2IHYA 4UNQA 4Q4JA 2GXUA 2OYSA 3JQEA 1FFHA 2B1QA 4P7BA 3S99A 2BN4A 1VG8A 3M0EA 2J7KA 2L0XA 4G0PA 1U7PA 3CZCA 5EZYA 3WWOA 3PIIA 2C3PA 2NP6A 2RB4A 2WVHA 2YVAA 4WH0A 3IXMA 5EZQA 3R2JA 1JMYA 2DULA 1VMEA 4JH0A 5DTMA 3P0IA 5ICSA 1JSRA 2YNMC 3NORA 1I6KA 3SZGA 2GF9A 1NL3A 4EYEA 3EXG2 3FKQA 3V3KA 2D5CA 2PXHA 3JAKB 4NAVA 5H3CA 5K20A 2IYOA 1IY2A 1DTSA 2BCGY 4KE6A 1ZNYA 3GCWA 2YIVX 3RQSA 3S44A 4AJEA 4DYDA 1AVTA 4AKHA 3N76A 1E61A 2Q99A 4TVBA 2Q1WA 1X87A 1GQYA 1MNQA 2OAEA 1DIHA 4LVNA 1EHYA 5TR9A 1RW4A 2GNOA 3H0EA 4REQB 3WSVA 4CV2A 4AQYB 1IEXA 1WPRA 1YVPA 1USIA 1XYGA 3KXKA 3A7DA 5FHRA 4CFSA 1ZJWA 4CQLA 4C4XA 5ADHA 3THOA 1IQPA 3T9DA 3SEFA 3D3WA 4PYJA 4BDSA 3KXIA 3FTNA 2YFQA 1ZCZA 4PQGA 2ZRHA 4OXKA 1JEYA 1WHTA 3F8SA 2X1HA 2PFGA 4KQGA 3S2SA 5K7SA 2PBRA 1GWNA 1U8FO 2OCBA 2WE8A 4X1IB 1RHQA 4JI3B 2F1RA 1NA5A 3RBZA 5D00A 4RZ3A 1MPTA 1TAQA 3T3HA 3VU8A 2O8FB 4QDTA 4ENWA 5JAQA 4RTQA 1IHXA 1XZBA 2PZGA 3ANLA 3JRXA 1SO8A 4B4WA 2J67A 4GRAA 4BNKA 5D2CA 5CTJA 2JIQA 1QYXA 5FOXA 1KBZA 1XL1A 4OK5A 1D2GA 3ZH9B 2GMWA 3IAHA 1U8TA 5KYVA 3TCKA 2NO4A 4O4JA 1QG6A 2GK4A 1Y33E 2VHVA 3R4VA 1T4GA 4QVGA 4WZBE 3ANXA 2RC6A 5LQAA 4YRRA 1U0HC 1C8LA 1JTVA 1H6AA 1RQGA 2NX2A 2POCA 2QROA 3IPAA 4PE5B 2AZTA 2I4TA 2AC7A 3H9QA 1N2IA 1YQQA 1ONSA 2GEFA 5IZCA 2W6ZA 4NE9A 2GAFA 4GI1A 1PK7A 3TFWA 3HI4A 4BLVA 4DV5B 2BCJQ 4PBRA 4UJ3A 1W48A 4J3NA 3KLMX 3T1NA 3MJSA 1E3MA 1E9AA 2P5SA 2WVAA 3HPRA 3I5AA 2BTEA 4EB6A 5LOVF 2O2IA 1IN1A 2I7DA 2RCNA 4GGPA 1DFIA 3IDSA 5CH3A 1AM4D 3VQTA 1YC2A 4BO8A 4CIXA 1HORA 3D64A 1LPSA 1VGQA 1O2DA 3EZXA 1FMCA 3OIGA 1H2XA 1WSDA 4TWJA 4D4GA 4D8TA 5JY6A 3NEPX 1U3VA 1OI2A 3LKZA 1DRWA 1M1YA 4IGKA 4ZCTA 4FYHA 5I7UA 5E7QA 4ZCSA 5IDYA 2YXLA 4EL0A 3A4YA 2C9CA 4UAGA 1KYIA 1YQ9A 1Y4ZA 3OJLA 4FI3F 4HAVA 4PZEA 3I23A 2MR6A 5FPTA 4D74A 5CD9A 3ROPA 1JMVA 3DWEX 3EXFB 3RJZA 3SI7A 4LYFA 4YJ3B 2IHZA 1U0JA 4OF4A 1KY3A 1NQ5A 4D4LA 3C85A 3GZTB 2FXIA 5AW1A 3DOEA 5M29A 4GWKA 3OLXA 3KVOA 1N5MA 4AMGA 3LIIA 1GLNA 3JWHA 1UBEA 3LX5A 3G9XA 5G1OA 3UJAA 3OQBA 4RTJA 3QUQA 4YQYA 4MVCA 2FTKE 1QAQA 4ZCQA 2B1IA 1U6IA 2O6LA 1D07A 4RCVA 1CYEA 3LFHA 1XX6A 1L5SA 1L7RA 5F35A 2P0EA 4O5AA 2BMDA 1EAMA 3PRJA 3MJDA 3R40A 1GZ5A 2GBIA 3OIFA 4GP7A 5F78A 1FVOA 1PX2A 5KQMA 4QUDA 3O8RA 4AG5A 3EJ6A 4KN5A 4M0DA 1X7ZA 1S89A 3HCWA 4H31A 4ZALA 4ZMRA 2AEMA 4FFBA 4GQIA 4F2HA 5K4HA 3BIXA 3UWDA 4GBJA 5CDYA 5J3JA 1RM0A 4MUMA 1Q7RA 4RH0A 4EUFA 6NULA 3OG9A 1URPA 4P36A 3BWBA 3HXQA 3PQ2A 2RAFA 1WAMA 3M6UA 3GLHB 1ZNQO 5I4KA 1GL6A 1UMCA 2I80A 4TX1A 4MS4B 4U63A 4L3OA 5AWFC 1R6VA 2BFEB 3DCNA 3CVJA 4XJXA 3GPCA 1BXRA 2Y1WA 1BAPA 4MW7A 4YN3A 3NANA 5EIOA 3HDTA 3PGVA 1BJTA 1B6GA 1LK0A 3MXOA 5HIKA 2BKEA 1SCJA 1WMBA 2V65A 2BMJA 3TTUA 2O1WA 4LF9B 4JKIA 1NFFA 4PQFA 4QOFA 3BMNA 5JCOC 5JBNA 4IX1A 1MHPA 2FR1A 7MDHA 1IZYA 3HLYA 5IKXA 2VSXA 1QVAA 1DXYA 2V6BA 1EB9A 5ABPA 4FYPA 1PU2A 4LYGA 3MJ4A 4MR9B 4RHEA 5IRCD 1T3ZA 1IC6A 3H6KA 3SHFA 1ULHA 1EE9A 1VP3A 1IH8A 3T3NA 1D5WA 1W59A 2EG9A 2VRCA 1QQ5A 1Z39A 1L5GB 3ETNA 3I45A 1S2NA 1N57A 3NHLA 2G5PA 3H8SA 3K6SA 4NMLA 3A9VA 5BR8B 3S40A 1RI4A 1OI7A 4PU0A 3LUCA 4Y2HA 3FDZA 4EG4A 1IEVA 3GEGA 4G1MB 1V5GA 4NRDA 3ND7A 1JR3A 1E1RA 2WMYA 2WSIA 4RTMA 3KKNA 1MGPA 4TKLA 5BXQC 1Q0LA 4FX2A 1I3NA 3FSEA 2QS9A 3IMFA 1LH0A 3SEAA 2QX4A 1BW9B 3SDZA 3MD0A 1XVUA 1I2DA 2IDJA 3FBTA 2ODPA 2OWDA 4I1SA 4WSOA 3GDGA 3ZVKA 2Z6QA 1IJFA 1IXRC 2X2FA 5TVGA 4INJA 4CG1A 3WIOA 2AWNA 4F97A 3KE9A 1WUHS 1KXJA 1HO3A 1W0KA 4OIFA 2JF0A 4QQFA 2YHIA 3TSWA 4AUKA 2PKXA 1NFQA 2P2GA 3Q9NA 1C3OB 1JJFA 4RHCA 4C0WA 4UVGA 3CS3A 3ENZA 3LT0A 1KGSA 5BUCA 2AN1A 1XC7A 1TEVA 1WUIS 3EIEA 4DQLA 4C5BA 2HSEA 3D5TA 1RLUA 3W06A 2ZRIA 2C07A 1FMLA 3KS9A 4FWBA 4DA0A 1A98A 2YRXA 1U1GA 1E7WA 4MQBA 3BCUA 2ZQYA 2Z4TA 4ILEA 4WLOA 1DLJA 1NYQA 1BYIA 2WW8A 1DJQA 2FN8A 3C6QA 4OJKA 4IFIA 4GDFA 2GASA 1P74A 4Y9TA 3ZS9A 1HYHA 1BWPA 1Q17A 1W88A 1WMDA 2ZP1A 1ZK0A 4I7EA 4O4LF 3DDOA 4PYOA 3V4PB 1DV2A 1W0JA 1O0BA 3IHTA 3C14C 1WXGA 1H65A 4S2EA 3U3ZA 4WXMA 4OKSA 2OXIA 4BMZA 1IIBA 4WLNA 4LTMA 4QO8A 4D43A 5JOQA 3OURA 5SY4A 5CFLA 4RDIA 4WDQA 1ACLA 3U1VA 1RBYA 1KMCA 4Z1OA 3F6PA 3W8RA 3SWWA 2II6A 1KSGA 4UMEA 4G9GA 4QFDA 1YA8A 1NULA 3H1BA 4O4LB 1IBRA 4WCFA 1EP9A 1TE2A 4WIAA 4KIJA 2JAOA 5FUYA 4MV1A 3UT0A 3PUXA 3RVBA 4N0QA 2CMHA 4YQEA 2ZSFA 2COEA 1DARA 4U39A 2CBZA 2WILA 4FK8A 4KR9A 4DEXA 3BFVA 4C1NA 1JZQA 2ADMA 2QK4A 3CUVA 4ITVA 2Q29A 4LKRA 4E6EA 1UPTA 2AMYA 3E6AA 3I1FA 2YWBA 5C0OE 3V7UA 3Q9SA 1IK4A 2DQ4A 2I2CA 4EW3A 4GM1A 3EX7C 4N5NA 1IQRA 3WMXA 1O3YA 3HBNA 3KQOA 1P2DA 2BMWA 3G2LA 5E1OA 1ICIA 3MS7A 4N7RA 2IDZA 4RQAA 4Q3NA 3V5NA 3WLSA 4K0KB 3K8OE 2XUOA 4QARA 1WLSA 421PA 1DBVO 1N25A 4CMIB 4HNQA 4GE3A 3T95A 3IEVA 2C95A 4YIKA 4WESB 2J30A 2OG2A 3R0QA 2FDCA 2C3UA 1RYDA 3R3VA 4MQMA 3WDMA 1P0MA 1M2JA 1PSWA 3GJ8A 1JNXX 2W71A 1GYQA 3PP8A 4JUIA 3RIGA 3TQHA 3RADC 1M2EA 2YNMD 1G1MA 3BXEA 4X3PA 4AIIA 4KUHA 4NABA 4EJFA 3OIDA 1ECCA 1NKSA 3VOBA 1DEAA 1WY5A 4UDYX 3G88A 2O2HA 3EQ8A 3AR3A 2F55A 3RG2A 5BW8A 2PO5A 4EBBA 4K6KA 4TTJA 1KE2A 3NLLA 4MA5A 3U56A 1C30A 1IUKA 2QM0A 1KO1A 4RZIA 4YJDA 3H3XA 1QJ4A 3L0SA 4U1RA 1IB6A 2P1ZA 3GCXA 2JFYA 2PGXA 3DJYA 3VPGA 5K6AA 1M2GA 3QKRB 4HDCA 5ITVA 3V80A 3A32A 4RORA 1CK4A 2Q6LA 2M98A 1DJMA 2O5RA 3S2YA 2CD9A 1F1JA 2HAEA 1OVMA 3Q3JB 4O08A 1MBZA 1JIJA 5KNDA 2D1TA 3IDQA 4P0TA 3COVA 2PSHA 3C41J 2P6RA 2JANA 4Y1EA 3UPDA 2H5EA 2FPWA 2VFAA 1UWCA 1NQXA 1KYQA 2XUKA 1UT6A 2WU8A 3GJ6A 4I3FA 4H3KB 4R1PA 5TB5A 2V54A 1H5QA 4MI9A 1SCUB 1Q6YA 5T4BA 3LT2A 3U3JA 4DHWA 3KL4A 4DJAA 5JSUA 1F8YA 1FNCA 4X64B 3RAPR 3MWYW 3NP7A 3CSUA 4BLWA 3I8SA 4INAA 1P3DA 4K03A 3UJHA 2WFZA 2OV8A 4FZ5A 2IIQA 4DEVA 2GTHA 4M46A 1Y8AA 3GLKA 2I4OA 4BNMA 2ZBFA 1IN4A 1HTBA 2XGGA 1WS6A 4MV6A 4MV4A 1M5RA 4ENTA 2O7RA 2PIDA 1WW8A 5NULA 2L82A 3KALA 4J0HA 5BQPA 3TPFA 1F17A 4Z9AA 1ZEMA 1NQTA 3OQPA 4UUMA 5DT9A 1JHUA 1LX6A 1CIPA 2YYYA 2A1UB 1CZUA 1NR7A 1CVLA 4WZAE 1D04A 3ZYCA 4RACA 4HQ0A 1MV5A 5KHOC 3NUGA 4X3OA 3VH4A 1IB0A 1SBQA 4MW2A 4RJKA 2ZFUA 5FP0A 3WHPA 1NVMB 3EISA 2QMZA 5A62A 1TA4A 4KGVA 3AY6A 1Z4KA 4KNWA 3NWPA 4WBNF 5G0TA 2P77A 1FTYA 1PT9A 3AETB 3B9RA 3ZI4A 3F67A 3A14A 5KINB 3DL7A 1N5DA 5K0ZA 1QM5A 2IP4A 4LRQA 3VMFA 2WF6A 1QFZA 3G7UA 4RPJA 2V45A 2YC4C 3C3XA 2EZ9A 5K99A 1QKKA 4TS3A 4G56A 2PZKA 3GEBA 4M0MA 2VDKB 2ZB2A 2PQ0A 1G6Q1 1HDGO 3K6RA 3NUQA 4RV5A 5I45A 4TXNA 2QG9A 5JSZB 1MHTA 1QHIA 5EHQA 1SVUA 4DJ5X 4GHWA 1CHNA 5IX8A 1OMOA 2Z5GA 4QU8A 4WBNB 1N4AA 1ZZEA 1RKUA 3K94A 2W4MA 3OPYB 3UPTA 3H9UA 5FBWB 4IDHA 3RARA 1FVFA 1ZSVA 4Z3DA 4K81B 1VQ1A 3M3DA 3EF0A 2WSBA 3K6KA 5FLYA 5HPYB 4TMWA 3ZGXA 3NETA 4I9HA 2D2EA 3PRKE 3GFBA 3FPGA 5KOHA 4BMXA 2LCIA 1ORRA 1E5LA 1H8ED 1A8SA 4BLRA 4KXWA 1H1LB 1VL8A 3OZVA 3ZR4B 1C3LA 2H85A 1Y8RB 3TKLA 4EYQA 4XEUA 1IG0A 2ZUCA 4H0FA 3UQZA 5LZ9A 2QKYA 3CX4A 3JAKA 5CNIA 3WLKX 4TTAA 5I3ZA 4XW2A 2F3TA 5DI9A 4EMSA 1B0ZA 5TXGA 3IP1A 2CFSA 1VYUA 5JY1A 4GC9A 2QM8A 4IFBA 3NBZC 5GPBA 1E6KA 1ZI6A 3TSCA 2J3QA 3O75A 5KWIA 4XIIA 3I9NA 4OXNA 2BYTA 3TJZA 2FOLA 1Y3AA 4REQA 3QP9A 1VIYA 2R79A 2XJ9A 3EW7A 1U0SY 3G9UA 3AC0A 2YDXA 3DNPA 1YXMA 3OD5A 1Y4AE 5JSYA 4FKMA 4XCXA 2OVBA 3KR1A 3ONDA 4KQFA 2BTOA 3E9ZA 1TW2A 1BNCA 5JWHA 3C7CB 3CONA 1Z47A 2OHHA 4U7DA 4Y2TA 4KACA 5B1SA 4AMUA 1ZK1A 1XMJA 1L4KA 1NXPA 3H9BA 1S7CA 4QTZA 4RVCA 1FUYB 3LX6A 4COKA 5D6NA 2F9LA 4P2GA 3GLGE 3HJRA 1TTPB 3DUFB 4FCTA 3SKVA 1T5IA 4E33A 1TLTA 3AV3A 4LDJA 1OVGA 2HMTA 1Y42X 4LK3A 3ESYA 2VQ3A 2ZJ0A 2V6IA 3LT5A 5AHRA 4L4UA 4UBMA 5LQRA 3K6JA 2O8FA 2R11A 3MB5A 3VHQA 1G3IA 1FUIA 3K5WA 1C7ZA 2QTHA 4KK3A 4CR8A