4JJ7A

Caspase-3 specific unnatural amino acid-based peptides
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
256
structure length
241
Chain Sequence
b'DKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-8
publication title Selective Detection of Caspase-3 versus Caspase-7 Using Activity-Based Probes with Key Unnatural Amino Acids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 88
structure length 241
sequence length 256
ec nomenclature ec 3.4.22.61: Caspase-8.
pdb deposition date 2013-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4jj7A00
1NMQA 2H4WA 2H4YA 2XYHA 4FDLA 4N7MA 4EHFA 3SIPA 5K20A 2Y0BA 1SC1A 1I4EB 5I9BA 4NOKA 3PCXA 1NMSA 3IBCA 5IBCA 1NW9B 4QTXA 4HVAA 4NOJA 4ZVRA 3GJTA 2HBRA 4PRZA 1GQFA 4QU5A 4QUAA 1I51A 4JJEA 4QUBA 3BIJA 2FP3A 5IBPA 3V6MA 4AWBA 4NBNA 4QTYA 3DEHA 3UO8B 4NOLA 4QUGA 2J33A 3P4UA 1KMCA 4ZVSA 2FQQA 4FGUA 1F9EA 3NKFA 4QUIA 5IAEA 4EHLA 3V4LA 2K7ZA 3D6FA 3D6HA 1SC3A 3V6LA 4IEFB 4I1RA 2QL9A 3R5KA 2DKOA 5JFTA 5I9TA 4D3XA 2HBZA 3H0EA 3H13A 3IBFA 2QLJA 4JB8A 4DCJA 1RHJA 3V3KA 3S8EA 5IAJA 2FUNB 1PAUA 2XYGA 2XZTA 4JR1A 5LUBA 4DCOA 2C2ZA 1RWKA 1RHMA 4ZVPA 5IC6A 4NBKA 1F1JA 2H54A 2J30A 1RWWA 2QLBA 4QU8A 3GJQA 3R7BA 4HQRA 1SHLA 3R5JA 4LSZA 4EHHA 4N6NA 3OD5A 5IC4A 4IYRA 1RHQA 1M72A 1RE1A 2H51A 2CJXA 1RWVA 2H65A 5LU9A 4JR0A 3GJRA 1RHKA 1GFWA 4EJFA 3UOAB 3H11B 1RWOA 2C1EA 3QNWA 4ZVUA 4EHAA 4PS1A 1IBCA 2C2KA 3KJNA 2XZDA 4D3YA 3P45A 5IABA 4FEAA 1CVRA 3E4CA 5IASA 3D6MA 3GJSA 5IANA 2XYPA 2CDRA 4NOMA 3DEJA 3V4OA 3NS7A 1JXQA 5IBRA 1CP3A 2C2MA 5H0IA 5LUAA 2C2OA 3KJFA 1QX3A 3KJQA 2CNNA 4HQ0A 3R6GA 1SHJA 3RJMA 4JQZA 1QDUA 1NMEA 4D3ZA 4QULA 4EHNA 3K7EA 1K86A 4ZVTA 4ZVOA 3ITNA 2J31A 2QL7A 4QU9A 3S70A 3V55A 4JQYA 5IAGA 1ICEA 3R6LA 5IARA 4DCPA 4N5DA 2WDPA 4PRYA 4QU0A 4ZVQA 2CNLA 1I4OA 4QUHA 4QUDA 3DEKA 3H1PA 2HBYA 2CJYA 4JJ7A 4QUEA 1I3OA 4EHDA 5IAKA 2QL5A 3EDRA 3H11A 2Y1LA 5LU8A 2P2CA 2H5JA 3PD0A 3R7SA 4NBLA 1RWNA 4PS0A 1K88A 4N6OA 4QUJA 4N7JA 4I1PA 1RHUA 1BMQA 2CNOA 2QLFA 4M9RA 3R7NA 1RHRA 1RWXA 2AR9A 2H5IA 2NN3C 4JR2A 1QTNA 3PD1A 4AWAA 3NR2A 3SIRA 4EHKA 1RWPA 1RWMA 4N6GA 2CNKA 1PYOA 4FXOA 2HBQA 4JJ8A 3DEIA 2H48A 4AW9A 1SC4A 2J32A 3EDQA
chains in the Genus database with same CATH superfamily
1RM4A 4US0R 3ADPA 2I6SA 2P5YA 2VBGA 1TL7C 4V39A 2BMDA 5K3SA 5BSWA 1MZVA 3AWIA 4F86A 3EODA 1A88A 2MYPA 1QIIA 3L8HA 1PJCA 1AE1A 2OO3A 5K3DA 3L8MA 2VQ3A 1PQUA 2XWQA 1GZDA 2G40A 1MJFA 1YONA 4BC1A 3JY6A 2BGLA 3L4SO 4E08A 1NKTA 2REQB 5E2BA 1W4BA 1ZY2A 1W96A 4EB3A 1LS6A 3DBHA 4HH0A 2ZJ7A 1II0A 3QVUA 1LK7A 4PGFA 4D1YA 1NVBA 5KEIA 1O6GA 4H9GA 1MPTA 1YBAA 3WVNA 2G72A 2RBEA 3CUUA 3ZXYA 1T6BY 4BMVA 4MPRA 4QBKA 3R4CA 4YHHB 4DM3A 3PVCA 1N8NA 2GTPA 3U37A 3NH9A 4A16A 1GAWA 4YT4A 4WKPA 4COOA 2XUFA 4A82A 3L7IA 3K0CA 3IX7A 4AS1A 3FPSA 3RKSA 1W4RA 5JQGB 1AQJA 3GI1A 2MJLA 3PF9A 2QLBA 4NL4H 3Q85A 3SLGA 3NQ41 4N5MA 2DP4E 2YRXA 3U4MA 1E0SA 3RANA 5BSTA 2PT9A 3DE3X 1OX4A 2ST1A 4L75A 4RXTA 4X00A 3VZBA 4RNDB 5EPOA 4EYSA 3D4NA 5IULC 2GX6A 3R7WB 2VH5R 5LP6F 3L7YA 1EFUA 1LC3A 1LJ8A 5HKBA 2J3IA 5LPNA 2NO7A 4DV5B 1A2KC 2I3ZA 4Q9KA 4YXWA 5I8WA 2BY4A 5AHRA 2VT2A 2NP7A 2OOKA 4KP7A 2AFRA 2FZLA 5ECYA 4ER5A 3LXUX 4OGWA 2GERA 4H7JA 1G3QA 3F5SA 5JZSA 2IIPA 4MA4A 1IPFA 1JH8A 4ZAXA 4YC7A 2W2OA 2YXBA 4ZP1A 2VHYA 2GJAA 3W3ZB 2ZYRA 2X8JB 1IPHA 3INNA 2CLSA 2GETA 2OLKA 3RC7A 4DHWA 1H1LB 3HNOA 3TQQA 3WLJA 3FOEC 2PWBA 3AGPA 3HL4A 3OF5A 3GRKA 2B82A 4RW0A 3VZSA 3CUWA 4JSYA 1J7KA 3BE8A 4BEWA 1SBQA 3VNRA 3DLBA 4I1VA 4R1TA 2M6SA 4G5RA 4NBTA 4JSTA 1PV1A 3DR5A 3TRKA 4JOQA 1FS6A 1I2DA 3O1IC 1CUSA 4B71A 4YAKA 3RADC 1I4OA 2V7VA 1OZAA 1MQ8B 2ZUSA 1Y1KE 2ZUFA 2XOKA 1BHSA 2IU3A 4YA6A 4WZAB 3DPSA 3GA0A 3NHAA 4ZT4A 2AMYA 3LI2A 4DA7A 1KYTA 2P30A 3EMBA 5HG0A 5EY5B 5A4DA 2ZIAA 1T9BA 4YRGA 1FDTA 1PJTA 4Q39A 2WTUA 1L7QA 3TCKA 3HCDA 4A0RA 4GM4A 4GHWA 5K8IA 5IEBA 1WBDA 2FK7A 1DCKA 1PZNA 3KZXA 1O94C 1SRQA 1YULA 3BSWA 3L8CA 3Q3IA 2HJSA 1E2GA 1OGIA 2GZRA 1P61B 2I99A 2OV8A 3ACBA 4KLNA 4JBLA 4P38A 5C8DA 3V8EA 4EG3A 5CDHA 4J0GA 2OUIA 3DGEC 3OEED 4YUXA 1FXWA 1XPRA 4ND1A 3X1ZA 2F1HA 2F7SA 5KO2A 4G9GA 4C7XA 4DMRA 1I9CA 3IQEA 3VVLA 2B8JA 3TG2A 2FG7C 3KLOA 1JHQA 1E3WA 1HTTA 4HDSA 5J4YA 5A5EA 3GRZA 3EWIA 2ZWOA 1SZJG 3R3WA 1IUPA 1QNFA 2AG5A 2CBXA 3PQEA 1T0IA 2RI0A 5FULA 5GTDA 3FKSD 4Y9TA 1QJCA 2NACA 4ZVRA 4LHEA 4QO7A 3K2IA 1UK6A 1I51A 1SU6A 1GFIA 2QYOA 3PR1A 2Z8YA 2JG3A 3S1LA 2QTWB 5AHWA 1UAAA 3DL0A 1ZFNA 5FLKA 3TFWA 5EJ8A 1OLXB 4LK2A 4ZXFA 2O5EA 2A9QA 4JCOA 2GFHA 1WV0A 2K7ZA 4UZFA 1CUJA 2HDOA 2FPIA 4WOJA 3URKA 1I36A 3VUEA 5LSAA 1K9SA 4YJFA 1AX9A 5K3BA 1DI0A 3QU5A 3DB1A 1N36B 1ATZA 3WHLA 1ZL2A 3N05A 3SZRA 3FFBA 1V6SA 3AVTA 3P9QA 1HT0A 3KR1A 1R0WA 1N75A 2C5AA 3KOMA 1PG0A 3FNRA 4PLGA 1JEQB 2GBIA 2WSYB 4A6PA 1EZZA 2C9ZA 2ACEA 1JRLA 2H4XA 2PUDA 3KSBC 2NIPA 3LRPA 5CFQA 5C0OE 3N2NA 2G1PA 4NEHB 4FT2A 2I5PO 3I09A 4I0WB 4IXNA 4TWBA 2GD1O 5DE3A 4KRFA 3IVGA 1ARZA 3N1UA 5HRCA 4P93A 1BQ4A 4QAQA 1E94E 1G5QA 1Q7EA 2Y3IA 3HR4A 3MMSA 3R6DA 4K9NA 4U2FA 5FBQB 5MFPA 4BVFA 2HW8A 5FD8A 3S40A 2V5VA 4YRKA 1R6XA 4KQKA 421PA 3H86A 4EH1A 4EVSA 1CU1A 3I45A 5TLSA 4XYLA 1AKNA 3H6KA 4LQLA 5LLTA 2I7CA 3A1WA 4CZ2A 3RC2A 2HMSA 3MMXA 4HZIA 4CNQA 4RH3A 2O8CB 1N6LA 3WP1B 4G24A 4PNHA 2NU9B 3VBCA 3DR3A 3CUKA 1JBQA 2ONZA 2P6OA 2WIJA 3UJ8A 1FC0A 6REQA 3HBJA 1UJNA 1POWA 2YS6A 4M89A 5JD3A 3LLMA 3HDGA 3LIIA 3SHVA 3TS1A 4V0SA 2FDCA 2HJRA 2BDEA 3GLUA 3T5MA 3AW8A 1Z35A 4FHEA 1PT5A 1YZVA 2NZXA 4ZQIA 5HHTA 1UR5A 2J31A 2H0QA 1GCAA 4WKNA 1QIEA 1CUFA 3SXJA 4OB7A 4GUAA 1EFTA 1ZITA 4OLBA 3LY7A 3KC2A 1LXCA 3OQPA 5AW0A 4NE7A 3WLFA 1C14A 2IDKA 2CE2X 2X5NA 4MS1A 3A7EA 5JDCC 4FZRA 4WGFA 3ASVA 3BMCB 4KI0A 4KXVA 1O96B 2I29A 3K20A 3EH2A 5AK5A 3S1AA 1QMGA 1T0JB 3T61A 4DQKA 3PXCX 4Z4GA 1W2HA 3M6VA 4N12A 4QXMA 1DPGA 1JIQA 2JAXA 5FQNA 3GFBA 3U7EB 2Z43A 2J6CA 4AJ2A 2B36A 4MO9A 5K0TA 2I6XA 1E8MA 1FXUA 2C20A 3DHVA 4OEHA 4AJ4A 4CRWB 1QQ7A 2FR8A 3DBHB 4YI5A 5FLEX 2XRFA 4X95A 3V32A 4NENA 5BWOA 1D04A 3LLSA 1CJTC 3UXHA 2L17A 2JLVA 1CULC 1D1QA 1EM8B 2EFGA 3IP6A 3X43A 5K8CA 3PD1A 1TD9A 5EZYF 3IDOA 1QP0A 2PSDA 3I9V1 1D1TA 1NUAA 2AOUB 4KWHA 2XUJA 2CJWA 3C6YA 2JGNA 4PX3A 4YQFA 3DMGA 3F97A 1T6XA 5EA2A 1YR1A 4DV0B 3QXCA 1N1GA 1VGRA 4BO6A 4RY0A 5CNJA 1V11A 4C0QC 3E7WA 1TJ3A 3IDQA 3W3AH 3K9FC 3F6RA 4H4DA 3CKLA 4RAQA 1VE5A 1OX4B 4KDCA 4YAGA 3RHTA 2ZIUB 3HFJA 1HM5A 5KYWB 1NW9B 3PEEA 4MVJF 1ZPDA 4YWJA 3CH6A 2XQJA 3LLUA 2XUOA 4N8EA 2CJPA 3AF3A 3CLSC 2X13A 2C2HA 1NQUA 4JFRA 2JAWA 1KP2A 5FUMA 4UQLA 1U8ZA 1UC8A 3TLXA 2WR8A 4E5YA 3Q3VA 1ODTC 1W35A 5IS2A 3GJYA 2GO7A 1JT2A 1PDVA 1FNCA 4HYTA 1T0PA 3S99A 1P74A 3BGVA 3Q8MA 3FZNA 1RYYA 4N3CA 5TDHA 3HGQA 4CGYA 4V1CI 3RG2A 1ZIPA 1T5TA 4AS2A 4CDGA 5LZ2A 5FLXA 5JU6A 1R9MA 2H17A 2JIDA 3U9SA 5ALYA 5TMEA 4IZHA 4JBNA 3CSUA 4P1ZA 4ZC8A 1I9GA 1TO2E 2O0MA 2HRQA 4X61A 5EJGA 1HFJA 5FA5A 3M9XA 5EG5A 4P31A 5BUSA 2FG6C 2QRUA 3SEQA 3SBXA 4JBIA 4II2A 1G2QA 1G0NA 2XGMA 4F04A 2JK0A 5AVZA 1OTXA 1P45A 1P60A 4CTNA 3IDSA 2H65A 3BKWA 3IUNA 3R09A 3DKVA 3Q6IA 3DHYA 3C41J 2UUAB 3NHKA 4F1JA 1LD3A 3CRMA 4GX5A 4L27A 2GD6A 5HCUA 1Y4DE 2YWCA 1K0UA 3EXIA 3R2JA 3K9WA 2YVUA 4QICA 4JV5B 4EIWA 1O9HA 3NHYA 3NW9A 5FOXA 5IANA 2I9KA 1K8ZB 4C20A 4IF6A 1ORIA 4L85A 1UQUA 1UL1X 4LISA 3DE1X 3FPCA 4HH4A 3BE6A 3G2IA 4Q9LA 2QQ5A 2HMVA 2WAXA 1S02A 1YHYA 4FGLA 4TXNA 3EX7C 1LRJA 1HEYA 1X3LA 3OEEA 1C80A 2DQYA 5T4BA 1M2EA 1E9VA 2B3DA 3MBKA 5JQGF 3I2JA 5JAIA 2B25A 1FX0A 1NN5A 1S2DA 1L4NA 2VNKA 3EF0A 4NPCA 2C0CA 3O9VA 1W87A 1L5KA 2JA1A 3ZHUA 3NBMA 1UFKA 3E81A 1ZXLA 2G83A 4MAMA 4WLNA 1VLLA 1E3WB 1OI4A 4ENRA 2I7DA 3FKSA 1Y8AA 4MHSA 5HA5A 1ESEA 3MWKA 3UM9A 5ALOA 4DLNA 4JD5A 4LCJA 1T8PA 2BHNA 5M7EA 4AMBA 3FCEA 5HBGA 1LC0A 5DI3B 3C5WP 1E9CA 1WIWA 4JVSB 4M0LA 4BB9A 1VCNA 4B43A 3MILA 3BMXA 2IBSA 2X4IA 3T34A 3T7KA 3V1UA 1ZVJA 2ZTMA 3AY6A 3FI9A 4D80A 1JTFA 2FPIB 5EQFA 1AK1A 2QWXA 4Y30A 5IJZA 4KQWA 4YJFB 2PTGA 2D2VA 4RFLA 2WWYA 4UHCA 3FLEA 4RTKA 1RWPA 3ZY3A 5AVJA 5B64A 2CNKA 3B5IA 5DXJA 3KUXA 3UB4A 3U16A 5J2TA 5DBEX 1YZYA 4IKPA 2D06A 3SVZA 1P1IA 2ZBVA 5AI4A 1NNSA 1UPTA 4G97A 3QBEA 2XLCA 4FDVA 5FRDA 1Q5PA 4FILA 2PKRA 4NZPA 2R86A 4KBFA 1XA4A 1ZEJA 2BGKA 1GPDG 1NMSA 2RGGA 4C78A 5I3CA 5K5EA 1BXZA 1IZ9A 1HZZA 2CDNA 1G7TA 3GP3A 4Q6BA 1NUHA 4YLEA 3UANA 2V7EA 2BM8A 1U2TA 2QTAA 3I04A 1JEEA 1HOXA 4UAGA 4AJEA 2Z57A 3TTYA 5KJEA 1I4DD 2C98A 4XAQA 3N87A 3ASYA 5DLPA 4TRMA 5ALQA 2ZYWX 3A4YA 1AA9A 1TVKA 1JHYA 3DVLA 3G0DA 1ZN9A 2XVYA 5KCZA 5KKAA 5FR2A 1SBCA 1PEDA 2Q4DA 3G1TA 4H6VA 4LDPA 1M10A 3OWXA 4K1XA 4TTPA 4NV3A 3LAWA 1OAOC 2WSBA 6REQB 3R75A 1TDJA 2FFAA 1TJPB 2AL7A 2P9TA 4XDYA 3UJ7A 4A26A 2Q5LA 4C7MA 3RW9A 3H2KA 4HEJA 4LZZA 3PFWO 1PR3A 3CO0S 4EHIA 1J1UA 4UU1A 3KYDA 4HGRA 3GFPA 4YCLA 1LW6E 3GUZA 4W5WA 2ZTVA 3WQHA 3LKVA 2V9ZA 1YVDA 2F00A 3MOSA 3OHPA 4BWVA 3ANNA 3UHPA 5LOVB 4PO1A 2J3JA 1A97A 3QLJA 3ZZNA 5KTKA 2ZIZA 4PPNA 3J80A 3S1AB 4BVAA 1T8RA 2B69A 1DG3A 1DSSG 5LBUA 4MMXB 4GW3A 4LUCA 4RK5A 2C2KA 2D0DA 1PLJA 3G7NA 2ECKA 3D0KA 2B1QA 4M7WA 4X60A 5TNXA 1L8AA 1K3FA 2AEEA 3DGFC 3F73A 1BS2A 1GRRA 2KX7A 4HRVA 1GGNA 1QAOA 4P0PB 4NHEA 4HWGA 2FUKA 2GK3A 2WSLA 3FTPA 4G26A 4NENB 4PC3A 3BB1A 1V96A 2HU8A 2VYFA 2JFQA 5DRYA 2QRLA 1E2KA 3EQ9A 2X3UA 1HDRA 2CJWB 4HWPA 1K4KA 2QDXA 3QA9A 2IZ5A 4E11A 2Z09A 3A4VA 3UENA 4A27A 1V11B 4L5YA 3Q2OA 5DSTA 5CFOA 3UPDA 4Z7QB 2XYRA 2YS7A 1S3GA 1U02A 4RORA 3WGLA 1KJJA 1QQ5A 3PTLA 3PP8A 1RKXA 3CTPA 4EI7A 1UCFA 2HHJA 3JTMA 1BD3A 3LOPA 5EWLA 3QXXA 4K1LA 1IZYA 4QOHA 1CY4A 4O08A 1C81A 2JGMA 3AO0B 3MQ4A 3THRA 2OO7A 4P32A 4NV0A 2C5SA 3DUWA 2PE5A 1U2PA 3EFOA 1QYRA 1XHLA 4RD1A 1DRVA 1KYWA 1Y4SA 2NNLD 2QLFA 5ENZA 3SCZA 3U4GA 4AN1A 5LR6A 2HMYB 2BF4A 3DULA 4C4TA 3ZE6A 4OHRA 1F5SA 4ZDKA 3M81A 1XE3A 3DYVA 3I1IA 5C53B 3W3AD 3O1JC 3ZOZA 5HVNA 1CEQA 1YNOA 3OTIA 5JNLA 3NI2A 4QC2A 1WCWA 4TROA 2BGUA 1SJ9A 4BCBA 1PR5A 2D74A 4HUTA 3OSUA 5C81A 1FFYA 2YC2C 1M73E 1LS1A 4IJQA 3P9ZA 1IN6A 4D3DA 4GZMA 2Y0BA 1VHQA 5LKAA 1XC7A 5I4IA 3WGOA 3BFJA 1WX1A 3VZCA 4A23A 2A7XA 1XN4A 2LW7A 2XRYA 4JT4A 1GUYA 1EBBA 1BOOA 1QHHA 3LQFA 2GJ4A 1R9JA 4NBSA 4S3MA 4OI1A 2DWQA 2RDMA 5ALJA 4UBOA 5HPYB 3HFSA 2Z4RA 4ML3A 3TOVA 3AHIA 3EEIA 3IJPA 3EXIB 3EA5A 4QFCA 4X1OA 1VLMA 1XZGA 2AEJA 2AR7A 3B89A 4QUGA 1KMCA 4E13A 1B93A 1H6DA 1XMPA 2X0DA 4X97A 2ZZNA 4HI0E 1USUA 2R6GA 1I5RA 1M75A 3D6FA 4QOSA 4PZZA 1M2OA 3SP1A 1QU3A 2FSVA 2O7SA 5B7GA 2F3SA 2RKBA 2LV8A 2EKQA 3OCJA 3KZOA 4DSUA 1E1KA 2HRBA 3HRIA 1XZIA 4FNAA 1T1IA 2DJ5A 4LOLA 1OV6A 4PRKA 1DE0A 1DIAA 1UBFA 4AP9A 1D2NA 1FX0B 4NU5A 4RFVA 3TD9A 3A2NA 4HN2A 1KOLA 5EJ5A 1ZM2A 3PYXA 5JZBA 5CA1B 3M3HA 1JAHA 3WDKA 2RGEA 2QW1A 3EAFA 4FZJA 1BKSB 1SG9A 4KX3A 3GGJA 3O7MA 1S8OA 1Y3FE 1Y1QA 2VF7A 5J40A 3N2LA 4I6JA 4JP2A 3HQ4O 3CX4A 4MWTA 4ZALA 3RVOA 1LU9A 1JV2B 1VHJA 3I23A 3NVKI 4IGAA 3THSA 3IXLA 4E03A 1ZGHA 2OFXA 1PWYE 1JSZA 1YJBA 1CUYA 1UMBB 3ELYA 2V7QD 3CIOA 2PLFA 4NMXB 1C4XA 1DO8A 1MVOA 3CJRA 4IILA 3RARA 1NMYA 1C2TA 1A71A 1BA3A 1O95D 4JBXA 2QDKA 3FY4A 4AROA 5HXAA 3H2ZA 3UT6A 5LXTA 1IXKA 2XBLA 4BUZA 5J2TB 3WQQA 2EX1A 3PNVA 3QKRB 4FCVA 3IYLW 1A82A 1R10A 2VWPA 4F71A 2JKZA 3JAWA 4XM0A 5A4JA 5JZOA 1ZKDA 1R16A 3B1WA 4NXMB 1TZCA 3K9NA 5EUCA 2OBBA 1R5OA 1DZ3A 2VQFB 1SXJC 2DTDA 2GPWA 5DTJA 1OWOA 1PVVA 3MCZA 3ZHBA 1FB5A 3LPMA 4LHZA 3T41A 3UNXA 4G2NA 2WJZB 2GJKA 1EJ6A 1J39A 3BMQA 3LCMA 3HM9A 3OZFA 2ZSFA 3L6OO 3NVAA 5F9HA 5J5CA 1U2EA 1NN0A 2PD6A 1FDVA 3T7TA 4RPCA 4JIGA 3NEPX 4ZYTA 4ZOQI 2GEBA 3MD9A 1E32A 1TYDE 5GZ3A 1TVKB 3ER8A 3E3MA 4MP8A 5HKKA 1HYQA 5BYAA 4M3NA 4L08A 4X90A 4JR2A 4KXNA 1Y42X 4OIMA 2BMJA 2QZ9A 2YWFA 4CDRA 1RBZA 2ECOA 3D3WA 5BV1A 1E77A 2CN1A 3I3OA 3MGKA 1ATIA 3AFGA 4NIMA 4J9VA 2FFHA 4NU6A 1MR3F 4PPYA 1FXWF 2EHDA 4ZO6A 5HF8A 1N78A 3HDYA 1I2ZA 1QK4A 5BSRA 1ISSA 3NHWA 1K06A 5KX5A 4FDLA 3I2HA 2BGGA 3ANXA 5I51A 3EY4A 1TXGA 1E1YA 4AAYA 2FE4A 1IM8A 1M0WA 4MGEA 4QTZA 4IIHA 5GQSA 3RVPA 5AVWA 1N3BA 1MBZA 1Y5LA 4BRSA 4DAEA 2RGDA 2H1SA 1LSSA 4GF5A 5EJAA 1WAMA 1MN6A 1XF9A 3AI1A 4J0QA 2F2TA 4LCBA 5FQOA 4B32A 2EV9A 2XCSB 1KY2A 3I92A 2PH7A 1D6NA 5CUQA 1XD2A 1Y1PA 5AUQA 5LBTA 2YW2A 5F12A 1AQNA 2JCXA 1G6Q1 4TLEA 4ZI2A 3CCBA 3IUMA 5K45A 2W6JD 4TZ0A 3LQ2A 3WWEA 2ATVA 1T10A 2IOYA 3JQFC 4XCXA 4LSMA 4GL2A 4GRAA 4V0NA 4EDFA 2E1PA 2MT9A 1U90A 1QG6A 1U2DC 2W2MA 3MXOA 4JIMA 4MR7B 2J08A 1F4PA 1L4LA 2ECPA 5I7AA 4WEQA 1VBKA 2DHCA 3WLEA 2CDAA 2RK6A 2O3TA 3NTRA 4GWLA 4XGNA 2Z6VA 1FSPA 4MO2A 4Z3KA 4ALMA 3NTXA 3JYNA 1IXSB 1ODLA 3PXGA 4ZAGA 1G3IA 2B2CA 1MT3A 3KL4A 3OPYI 4MVJG 2PCJA 2PCLA 2OECA 1TCAA 4FGSA 3GJ4A 3GJRA 4Q37A 5LZ8A 1AQIA 5TGTA 3FDZB 2GPNA 3SKVA 3UAYA 5BR7A 5JJIA 5EWLB 2FXVA 3TLJA 2L82A 3K09C 5EHNA 5KVCA 4BCCA 4RHCA 4ZD6A 1UKBA 2SKEA 1MB0A 2XF2A 2XMGA 4B2YA 3R3XA 3DKRA 4BFUA 4H7DA 1CZNA 4RADA 4C2AA 2UUBB 4RJLA 1MP0A 1SCUB 4Z9YA 4EKGA 3C5EA 3I83A 3QBTA 3LUFA 1Z34A 4JB0A 3W3AA 4G5XA 2HU2A 4YJHA 3DBRB 1P4AA 1Q0HA 5CJPA 1XAJA 2Z4SA 1LLUA 2EKLA 1JKIA 4Y1GA 2BBWA 4IGEA 4Z53A 1VPEA 4QULA 3X1YA 1BKYA 3WGMA 3L7BA 3W90A 1OILA 2FF5A 2WT8A 4A2PA 4BO9A 9GPBA 1YVUA 4NP6A 4K40A 3WR5A 4OKNA 1SHKA 3D5QA 3I5YA 5LOVF 2IHUA 3FZQA 4EELA 4AMYA 3DTYA 4PQRA 2XX3A 1HLPA 5A6SA 2HB6A 4KO8A 1ZCAA 2GZSA 1VYHA 2Z1MA 1J42A 1QHHB 2ZWAA 4QUEA 2TMGA 4R05A 1II8A 4ZOEA 5EGNA 5M34A 1CY6A 4EQ6B 1X38A 1NLYA 1TUIA 5H9WA 2UUCB 3BF7A 3W6OA 4IRUB 1XTIA 3DDUA 4RDHA 3HHEA 2P41A 2Q6KA 2GHQA 1W19A 2YHUA 4G1EB 1NV9A 4R1PA 2PIAA 1HFWA 1N7IA 1WSBA 3PL5A 3HDTA 5DGTA 1I4LD 1EWTA 1H05A 1TJ5A 3MGGA 3DE4X 2WTBA 5IP5A 3OM0A 2TMKA 3FPEA 4IQ0A 4BZXA 4DJAA 3B51X 3WRXC 1M2OB 5EE9A 1XRSB 3CGGA 3G7UA 1LPNA 4CMKA 3DXYA 2Q1WA 4TSKA 2A0XA 2CUTA 4ZU1X 5EIHA 2Y1OA 1JIJA 2G9ZA 4BMOB 5KSZA 4DNQA 2IX3A 4M8KA 4CMEC 2H48A 5FYQA 1J09A 4N7RA 2AMFA 2LBPA 3HJUA 3IPYA 2QOEA 4J2HA 4OP3A 1C41A 4JLNA 5C31A 1TF2A 2FDXA 4TKUB 5JASA 3U40A 3SE7A 4WJLA 1E5TA 1T2CA 4LG1A 1RKBA 1DWOA 4KXUA 4ENPA 3T1YB 2QMOA 5JVDF 3KALA 1GGMA 1K5HA 3TW0A 2J5XA 4AXBA 4QHSA 3GLVA 3EAQA 3II6X 2VF5X 3P52A 2HPHA 1KZ7B 3DLAA 1C5KA 1PWEA 2H5LA 4LZAA 5L3VA 1PG5A 3NUGA 4FWIB 4OXNA 5DYIA 2GJ9A 2C57A 1HR0B 2QUIA 1A2OA 3A9TA 4MVCA 4Q9HA 5ALMA 3SD7A 1NE7A 1DG1G 4YJDA 2OAGA 3H6GA 4K9MA 4LVCA 5JNSA 2V7QA 2PY6A 5KJCA 2FRXA 3F78A 1GDTA 3G1WA 2EBFX 1ODSA 3RK1A 4LXXA 5GVRA 5A6VA 3G02A 2D2FA 3ZJVA 3ONVA 2A84A 1O95A 3IB3A 2B20A 4HRXA 1H1DA 3L6BA 3Q7PA 1XVAA 1QHFA 1ZMOA 3FFWA 1RAAA 5FAXA 4ATNA 2ZSAA 3O2QB 4DWOA 3S1SA 5LXTB 4KQ6A 3ZHQA 2C9MA 3IALA 1IN8A 2BFDB 4E21A 3DZJA 1QZUA 4LNHA 3QX8A 1GV0A 3L2OB 3TLCA 1JDZA 2EYUA 4KSYA 4FLEA 4D26A 4G5SA 3ZQ6A 3R7BA 2OBMA 3OD5A 3TVTA 3EARA 3CEHA 3S5UA 3IKVA 4CM7A 4UEKA 5IH7A 4K0RA 1U0RA 4LDJA 1IVYA 3ILSA 2CLFB 2P3QA 2HLHA 3GRYA 2OOSA 3AINA 4MW4A 1L7EA 3U4CA 3L79A 2H08A 4GBGA 3SHQA 3F4BA 1R8QA 4DCCA 5LMZA 4CJXA 3W8DA 4IVNA 3FR8A 4HVLA 5K0GA 3ZDXB 1BXKA 5JNTA 1N25A 3OP1A 2IIBA 4Q6WA 3S6JA 4CEHA 1UPAA 3NT5A 3GPIA 2JCSA 3UMVA 4WY8A 1IFXA 4EF4A 2FW9A 2ZW9A 2RGUA 1R37A 3OFJA 1JUDA 2JFZA 3KD3A 4B0OA 3D3WB 4NXNB 1T0BA 1PGOA 2WHQA 4TKMA 1INLA 4G4GA 3ZCQA 2FW8A 3GCGA 3MUNA 4HDNA 3MG9A 4E6PA 2PNJA 4KQ1A 3RVBA 4QYTA 2J8ZA 4JI4B 1C0PA 3E9QA 1ZU5A 5CA1F 3Q3GE 4WERA 4FJ1A 3VYSB 5KX5B 5G0UA 3ZHCA 1RJGA 1E66A 2HHLA 1IWPB 1ZBDA 2IUYA 5D3MA 3PWZA 4C0AC 3OF3A 4G25A 4G84A 5HILA 4PHCA 4HAXA 4D2IA 1P2TA 3OPMA 2CV1A 4B3SB 4PIMA 1EFVB 3WKCA 4XWAA 1UXGA 2HA4A 2WVHA 4I9NA 3BD7A 2ID9A 4NE2A 4PTYA 5ALXA 5CVTA 2GEKA 1EFPA 4A5SA 2F8TA 1BS1A 3FFAA 1HLGA 1ODIA 4FK8A 4KWEA 3W8NA 1XVUA 2P8JA 4IIYA 1XD2B 1UWLA 4M1YA 3BH6A 3SAJA 4B4DA 5IXJA 2DXIA 1F6DA 2BEVB 2V7GA 2W6JA 3L5OA 4OYRA 3UGKA 3ZI4A 2GF0A 3F3MA 3JQ9A 3HN7A 3W2GA 2R8YA 4FOTA 1VDMA 5J2TF 4RKFA 5KYYA 3SG0A 3I4CA 3A6DA 4YAEA 5DEOA 3FCAA 2BFAA 1MAVA 4X85A 2CZCA 5BOSA 4OHBA 5K0CA 4LN1A 4F2DA 3KSUA 3WBJA 3E4DA 2Z1DA 4MHOA 2YJ3A 5FBKA 3DEFA 1VHLA 3NG1A 5TGDA 5IT5A 5J58A 1F8FA 1UFQA 1Q16A 4WK6A 4ZOCA 3QI2A 1AUXA 1THGA 2BFPA 3FDJA 3PC3A 2P40A 3EUAA 4ZQGA 3OQ1A 4DQVA 2PX3A 1Y9EA 2EQ5A 4MYSA 5GGXA 1U6JA 2B7CA 3PNYA 2GD2A 1GITA 3UWOA 3VPCA 3E9CA 5I9MA 4V0RA 3T1TA 1Y8CA 3P2KA 3T06B 1DIHA 3VKUA 3L77A 2RH4A 1AUQA 3U4AA 1F9EA 2WVAA 4HDOB 4MRMA 4PXSA 1MIOA 1ID1A 4E1BA 2I76A 1QFXA 5KJFA 4J0CA 3JSXA 4DAOA 1O9BA 1T9AA 1XKLA 2QRKA 4U6NA 3D54D 4CTKA 8ABPA 4JB8A 3D5EA 4Y2GA 4YJHB 1CP2A 4Q1AA 4LV5B 3RQIA 4DCSA 5TQVA 5ULLA 1QUEA 5CB4A 1KRHA 5EVCA 1JDSA 3NH6A 1DEAA 5EMMA 3ZYCA 3LW7A 2O20A 3ND7A 4UNIA 1XEWY 1P2DA 4LDZA 2H54A 5CP8A 4ZCQA 5ADVA 4P53A 4PZCA 3LHFA 4FX5A 1Z08A 1VA4A 4RQAA 3DTVD 4TKVB 1I3NA 4BNKA 4KV9A 3VR0A 5IJ9A 1IIBA 4JZYA 3PENA 3J81k 3EGWA 3ND9A 4A0GA 4N6NA 4IO0A 2JD1A 3DQZA 4ZCTA 3F8TA 2V58A 4IV5A 4ZO4A 5A6SB 4B6JA 5JCOC 5JAMA 4H7PA 5JHGB 3U26A 1CUHA 2ZSKA 3SBEA 1II8B 1V9SA 3FNHA 3PQFA 1JR2A 2A92A 2PLAA 4I4NA 1E0JA 3JWEA 4BB5A 3W2HA 2ZRCA 2FCRA 1C30B 4TS4A 5IWCA 1ABFA 4IF4A 5KTYA 1XKXA 5E9AA 1X1DA 2O1XA 4RSMA 1SUAA 1XKTA 2W00A 4XEHA 3KXDA 3O0TA 1NULA 1ZW1A 4ZO8A 1F20A 4EO9A 5LQMA 4CU2A 4G5GA 4KU4A 4S2EA 1CIPA 3VH3A 3WICA 1JLKA 1A5BB 1E2EA 2XIQA 5ALZA 2QRPA 2FETA 1QRSA 1NSYA 1O5TA 1EJ0A 1LPMA 3UCXA 1E2LA 1LCIA 4WOKA 1IN1A 4A8HA 3G5LA 3CN7A 3QWIA 4BTLA 3E22A 3HWX1 4PR0A 2P9YA 3MQ2A 3ORQA 1P2SA 4XWGA 5CVDA 4F8YA 5LLDA 2E4YA 4ZV9A 4FOOA 3WFZA 3Q3JB 1P0IA 2BD0A 2VC2B 1YBMA 1L8LA 3N0VA 5HOEA 1U8AA 2PL5A 1DWQA 3OEWA 4UVIA 1HNNA 3I73A 1NVAA 1P4SA 5FPHA 4XCVA 2Y99A 2WA2A 1N33B 4JJ7A 2XGSA 3I0MA 4RENA 1L7BA 1YS6A 4MW2A 5B6PA 5LU8A 4MW1A 4MW0A 1U0BB 1E3QA 2FVYA 3MTAA 1V8PA 2D7CA 3BWDD 1E99A 1NW3A 1M34E 2R79A 4UQOA 4G1MB 1NLZA 4OX9B 2GXSA 3WWOA 3AF1A 4MZXA 4O5OA 3GIWA 1RYDA 3HZHA 4J0FA 2GXUA 1WRBA 4WPGA 4N47A 4DWWA 4LAFA 1IB6A 2VCHA 3EFBA 2FR1A 3IAM1 4JT9A 4XGQA 3SNHA 3H0KA 3FTFA 1E3MA 2NZ8A 4REMA 3NAGA 2Y1GA 2C95A 4JENA 4E2FA 1AGPA 3D7RA 3EA0A 3KFLA 1DAIA 4Z3DA 1HLDA 2OCPA 3D81A 4FB5A 3DOUA 1I01A 3A1UA 2LKDA 2Q6VA 4QFMA 4YHBA 4IFIA 1UZNA 4BWFB 2CL6X 2EL7A 2GEFA 1XRLA 3AHEA 3PITA 3X1XA 1U7UA 2CXRA 1I4EB 1L8XA 3B1YA 3FJOA 3OX4A 2WG0A 4XXHA 3QA3E 4OG2A 3VU0A 1KI1A 4AI6A 2BBTA 2MWMA 1GQ2A 3P96A 2PKQO 2XNCA 4ZO7A 3TJMA 4C30A 3C8DA 4OAPA 3RI3A 2UZAA 2VPIA 1K4YA 3DMFA 4JUIA 4Q0MA 5TPWB 3WRYC 4D4HA 5DHTA 4CEHB 3V4LA 3NOVA 3RJZA 1E92A 3P2EA 3VZDA 2IY7A 2H3EA 1DO2A 2VF8A 4U5QA 1DTEA 3FSEA 2VO1A 2ECFA 4CM4B 2ASEA 1AKQA 2GRAA 2ID4A 5AUNB 4I55A 2P2SA 2ZE7A 1B3RA 4R7ZA 3RWOA 1VJRA 4PQEA 4DQLA 1PEKE 2H07A 4PBRA 3KQVA 2C7OA 4HDNB 1SB9A 1SC9A 3BT7A 4HRAA 3MIIA 1AM4D 1TRKA 1TIBA 3HDJA 4MTCA 3EFEA 4LV8B 3AM4A 2XT0A 3QVLA 3CHYA 4F4DA 5FBLB 4MCHA 1P0QA 5TEWA 2GXAA 3C3XA 1Y4UA 2ZSEA 1X7DA 4R0VA 4IYRA 5D3MB 1U0HC 3W5AA 4UE2A 2FPXA 2PYZA 1SIOA 2PSFA 1SVMA 3IAAA 4LMAA 4R1QA 3PEYA 2P91A 3T3NA 3NX4A 4OHFA 2COKA 3GJ6A 1B73A 1DIOB 1NX9A 2EG9A 1NQXA 1PT8A 4GOKA 4RJTA 2R9VA 1D1SA 1HE1C 4ZAWA 9ABPA 1MRZA 1J25A 2RGWA 2WF9A 1XU7A 3EUFA 2B0JA 4BQOA 4H27A 3EPJA 1XNQB 1Q3KA 4CTOA 3OBIA 4B83A 2H1VA 1FNSA 4LX8A 3ZDCA 4WA8A 2WD7A 4FONA 5KWIA 1LQUA 3M3DA 2HMTA 4QYSA 3U2QA 3UCFA 1NBWB 4DG9A 1U0JA 5LXTF 4GDFA 3FYUA 1YVRA 4HDMB 4M8SA 4C43A 5HIIA 1MCZA 2OYRA 5KYYB 3EVFA 4K03A 4I8DA 1D8TA 2EFHB 2H1FA 3MSCA 4TVBA 1B0UA 1JN0A 1YDGA 3LC1O 4HAWA 4YLGA 4HAZA 3TX6A 4JI6B 1E4EA 1N1MA 2IE8A 2SCUA 3FF1A 1PDWA 1QGZA 5AW9A 2OWEA 5B3JC 4YCJA 5J59A 4RVNA 4CYMA 1ULHA 2Q3LA 3LUAA 4N03A 4BU0A 4YAJA 3H1PA 3O74A 4EHDA 1T5IA 3NBZC 4Q1DA 3P7MA 5FXMA 3IEVA 1F17A 3KFXA 4P2GA 3NHFA 4Y9SA 4I81A 1OBFO 1G2IA 2PYIA 1RAIA 1WE2A 3CZAA 4G3XA 4OK3A 4XWTA 4EJSA 1D2RA 2BUBA 1OGYA 3GNSA 4MRMB 1KZ6A 1MIOB 1NVUQ 1RABA 2QMEA 4G8BA 3VSDA 2HMAA 4MEBA 1NT4A 4RXMA 1KQFA 1SEPA 5C4MA 3K5IA 1IYZA 1T9HA 1A9YA 1OPRA 2G06A 3QVSA 2N47A 5CB4B 2G4VA 3IVCA 3OKCA 4JLBA 4W82A 2ZT6A 3D8UA 1EX9A 1GPAA 2H1HA 4GPIB 4CMAA 4L0DA 2V8BA 1N9KA 4ZICA 5KX5F 3DTVA 2VI5A 3ETJA 2CYCA 2HHAA 4NYMR 5IUKC 2DR2A 1UKZA 1UMKA 2WILA 1N8SA 1DXHA 1Z7WA 1JXMA 1UBTS 1FRQA 2JLBA 4J1NA 4OYYA 3ABQB 4Y6RA 4RLFA 5DCUA 1SEVA 4D9IA 4EKIA 4X62B 2TMDA 1JU4A 3NHJA 3WLKX 1XCBA 5ED0A 1U28C 1DJPA 1B8PA 2IZ1A 2PBFA 2QK4A 2W43A 4XJSA 4UM8B 2B7BA 5CLQA 2PKWA 5CPBA 3RBZA 1AB6A 1KAOA 1DBIA 2FMXA 4MW7A 1JHMA 5ALDA 4FYPA 3TQTA 3WQBA 1NR7A 2HA7A 2UYOA 4YRMA 4W1PA 4R81A 1H94A 4Y2JA 3WIVA 3T0FA 3GDGA 7AT1A 1KVRA 1JTEA 1ZOOA 2VLBA 2CHVA 3QY9A 4CLRA 4DV7B 3IESA 4DKJA 5ES4B 4I4IA 1J2JA 2IZ7A 1K7SN 1RT9A 2NXCA 5CK4A 1A9ZA 2M6RA 4QPNA 3QITA 4HDAA 1G4UR 1JQDA 3E22B 3LD9A 4DOMA 3P5BA 2GA8A 2YXNA 1U0GA 1W0JD 1WJGA 4EPRA 3WBKA 2HD4A 2DWCA 1FK8A 3KUDA 3P5SA 2HA3A 4H0CA 4XH9B 1H2WA 4C2UA 3DV0B 4OXYA 3T1OA 1TKCA 4IMIB 4L0CA 3OOHA 2R85A 1YBVA 2KPOA 3GVCA 4J7XA 3PDJA 4UMDA 5C1PA 4ACAA 5A7GA 1ZNYA 2JJ1D 1FSSA 1NW6A 3G9QA 3HKEA 4PLWA 2WEKA 5DF1A 3DPUA 1C8BA 1Z18A 3I9LA 4RVOA 1Q1ZA 1IY0A 5HRAA 1FDIA 4OQZA 1EDBA 5CG2A 3OICA 3NS7A 4FINA 4P34A 4G0PA 2KHZA 3O7WA 3H1EA 3MJTA 4BFSA 4HAYA 2ZFUA 1LLFA 1UPFA 1ENPA 4FHFA 4G5QA 1N6KA 3QIAA 3RIYA 2XF8A 2QRNA 1W5FA 1A4XA 1ISMA 1K86A 1OX5A 1NMZA 4UE6A 1XZBA 3IP1A 5H82A 3TD2A 3JWJA 2D1RA 1ICEA 3NBQA 4FYIA 1CC1S 1TFUA 2R00C 3U1TA 4V1CB 4HT3B 1EZ1A 4P86A 2FX5A 4BLWA 1NRIA 1BYIA 5KJ1A 3GYBA 4QEZA 2WIFA 1TEVA 2QD2A 1JDBB 1XNHA 5J47A 1Y3DE 2FB9A 2GBLC 2F9MA 3O92A 4XARA 3PD0A 3ZNNA 4BO2A 5KHOC 3V34A 1EVEA 1YR2A 4JOCA 3HJHA 4D8XA 1NW4A 2YZ2A 2QW0X 2RI1A 1PUIA 4TKLA 1TU0A 4E5MA 2FWPA 2IKQA 2FJ0A 3K31A 4KN5A 3BIXA 1ZD1A 4GP7A 2Q29A 3LQYA 1GOTA 1Z0JA 3UA4A 2X42A 4G0UA 1J0AA 1GNLA 1VFPA 3SE0A 1UJ6A 2B35A 2VATA 3A26A 3ANTA 4DA6A 3ICOA 4RD4A 5L7YA 3QTBA 4I55B 1NHGA 2PX8A 1P2UA 3LW8A 2RHMA 1XZ8A 1BJKA 1KK0A 1Z83A 2Q2VA 4YCAA 2H7XA 3KR9A 2M2IA 1I30A 4JP3A 1NNUA 4O2AB 2JGFA 1WDWB 1ZIYA 2RI6A 2TYSB 4R0NA 2DMRA 2PLRA 2Q3DA 4YNBA 4DIOA 4G1UC 2A58A 4FEEA 1KYYA 2G5PA 2NZJA 2PL1A 2QMUA 4KQMA 5EJ4A 3TXAA 4WECA 2GD0A 1GZ5A 1GZ4A 2V6FA 4HPJB 4O4LF 4QM6A 1HYBA 3ED5A 4GKBA 4D8UA 3L06A 1GYPA 1NZJA 2J3EA 3M9WA 1MNAA 3I6BA 4RK1A 4DKXA 4ZI7F 2WYVA 2Z2YA 1JG1A 3FVVA 4MYRA 3ZN2A 1VE3A 5KNCD 2QE6A 4X8OA 3M7IA 4H60A 3ZHSA 4DE5A 4ZMRA 3NHLA 3SLRA 3PSHA 3TLEA 3Q8LA 5DM1A 1N2CA 4V3CA 2OAEA 1IEQA 1CZUA 1LLQA 2WSSD 5J2UA 5JFGA 1R15A 3DBLB 4RVHA 2ZIXA 2QVLA 1PWHA 3NV7A 3G9ZA 4MLZA 4BX9A 3S8EA 3Q7IA 4B6FA 2ZDHA 4JX8A 3QKSA 1D9XA 1T0UA 4J8PA 1L3CA 3L0CA 4PCAA 3L7NA 4HPWA 4EVRA 4DDWA 1VHTA 1TEHA 4CR7A 2W90A 5JXJA 4JA0A 5EN4A 1G8AA 4FKZA 1L4MA 1XUOA 4X6YA 4ENTA 3A0RB 1O8CA 3PXBA 4PN7A 1PVOA 1SFRA 4NATA 1E4EB 1WQ4A 4C0WA 3K1ZA 4AL4A 1M2HA 3KSMA 1PX0A 1A50B 1RKVA 3JVUA 2YWXA 1RWVA 2FLWA 1FL9A 2QD4A 3H83A 5H3LA 5KTMA 5JBQA 4DLKA 3JQEA 2PV0A 2FSUA 2O0HA 1AKMA 1MU0A 4RK4A 4TT3D 4F4JA 2VK1A 3M4ZA 3R0IA 4KK4A 4NAVA 5C46F 4Y1RA 1P4GA 1N3IA 1L5FA 2ZXFA 4EJSB 3LHIA 1VLQA 3EVBA 3DZFA 1KO4A 4RPIA 1SKBA 4UTRA 4EG0A 4MRNA 5BR4A 3FBGA 4P4UA 1U7OA 5EMKA 3TQRA 3EVZA 3W2TA 1WG8A 4GR9A 1E3TA 4AZWA 4XUEA 1M2KA 2BFFB 3PNKA 3ZD8A 1P73A 5CURA 3LBYA 4KZPA 4N01A 5JS7A 1OA1A 2BDUA 5AI9A 3L4JA 4LF7B 5LYYA 2EBWA 2XTAA 1N5JA 1E6EA 1QB8A 4RA6A 4C03A 3M6MD 2OBLA 3IO3A 3LVFO 3QYFA 4EX6A 2GO1A 5KQGA 1JIXA 3EZLA 4ZT6A 2IW1A 1PGQA 3CVOA 3EOBI 3BSSA 4FLFA 2WUFA 4BLQA 1FJGB 2BMVA 3CPHA 1Y82A 2HTFA 1BO6A 1SUBA 2QYSA 4JUFA 3DOFA 1A0OA 1T5OA 1WHSA 3L8EA 1XYVA 3RJTA 2OHJA 2F4VB 1ZGAA 3ZDYB 4KPUB 1T0HB 4OKIA 1JA1A 1WMSA 4RSRA 4KRXA 4MQEA 4N40A 4HBGA 2C8KA 3E1KA 5KREA 1F8UA 2CYAA 1Z8NA 1IDN1 2PKXA 3NEYA 4PAOA 4NJEA 1EQUA 3EXHB 3QLUA 2RG7A 4FR5A 2HMWA 4IQGA 4YREA 4PIPA 1NSFA 3K53A 3SS9X 3LY9A 5LQSA 4C5BA 4CLRB 3T12A 4E15A 4HV4A 2J5BA 1OFVA 4O4IA 2NPIA 4PY2A 2HT1A 3VAYA 4ZAYA 4OMCA 2XUPA 1L4UA 2N75A 1C8LA 2AD5A 1W0JA 4MV3A 3SIXA 2VYCA 1CUGA 1LEHA 5C37A 4N76A 1G8PA 4CM5A 2O59A 4C2BA 1TC2A 4AZ0A 2P4SA 2R25B 2I22A 2X9GA 3OM9A 1ZI8A 2Q6TA 1FU8A 2AN5A 1YZQA 2ATIA 3E0QA 4YJ2F 3DEAA 5K8TA 1X7WA 2X0IA 3M6LA 1JAYA 3MHPA 3TPFA 1WW8A 2JJ1A 1C7IA 4REQB 1TAQA 2WKWA 4OGFA 1J9ZA 5EIFA 3KQNA 2J0UB 2UU9B 3L0PA 1UANA 2NSJA 3HKEB 1BWQA 3MCAA 2LGJA 4BMNA 2VP9A 5JSQA 1FQKA 2YVQA 1PK7A 2POCA 3BRQA 1LK0A 4BEVA 4KFSA 1XXHB 3OTQA 3KQSA 4FSXA 4QAJA 1AURA 4DC1A 1WHTA 4IIVA 2BFEA 1QFMA 4LKOA 5DRTA 3GVIA 5BUQA 4W9RA 1M0SA 3K32A 3PIRA 2JCYA 4QHYA 3ZU4A 1Z4MA 1EUDA 2IYSA 2A57A 2QAGA 4C4YA 1ZISA 5E4TA 1HG0A 4XSGA 4LYFA 4GVPA 3ZTWA 1FIUA 1GT91 3PTAA 3ZZTA 2NWQA 5HX7A 2NU7A 1TLFA 1Y89A 2Q50A 2R62A 1AS0A 3C15C 3C5HA 2VT6A 4JB3A 1IHXA 1PGPA 3ZBQA 2YMLA 2ZIWB 3IIJA 1WZCA 2B94A 1OVMA 1R12A 4HNTA 4RVGA 1CLUA 5FADA 3E2PA 5FX2A 3O8CA 2Q5IA 1L7XA 3C5VA 3G2LA 3K0FA 1YVPA 3ZQJA 4R51A 1MABA 1VJ5A 3N2EA 1Y80A 2FPLA 3AFHA 1GTL1 4M2LA 4II3A 4D4IA 2QT9A 3EDMA 1SMKA 4ZYLA 2BHTA 1SGWA 4HUJA 5EVJA 3P2OA 4LX0A 4OHZA 1G8JA 4B7AA 1XD9A 1P0PA 2CL0X 2FWJA 2WM9B 3ABZA 3SR4A 4BAGA 1W88A 2FFQA 2FPPB 4J90A 2Z08A 3LX6A 4IP0A 1QS0A 2CCKA 4JLPA 5GJWC 5TT1A 4CQJA 5ISMA 2G77B 3GW8A 3QHPA 1M1YA 2OV6A 2CNNA 4LWOA 3TSAA 1QKJA 4G67A 1YQQA 1RJDA 4HL6A 3ANMA 4FYKA 3L40A 1W4LA 1XDBA 4OHKA 2QL7A 4QU9A 4CCYA 3BD6A 2JHCA 3EIHA 1ENYA 1L9XA 3AFOA 3DV2A 2HIMA 1H1TA 5BNIA 1AQYA 3G5AA 2I1WA 1PZXA 4ZT2A 2BGNA 3A2KA 1EG7A 4RPJA 4MKXA 2ICAA 1NQTA 3CURA 1BX1A 2VBCA 4C1NA 1EBUA 3PQ2A 1S01A 1TE2A 4TKZA 4Q3AA 5EKXA 2E87A 2GTIA 1VE1A 1DJOA 4UAJA 3CLUD 4UW9A 1L8QA 5KNCA 3ILXA 2IU4A 3FBWA 2Y0PA 4GOND 1HDEA 3OAAD 4IIDA 3VPHA 1RYBA 4QWWA 5AVKA 3KYCA 4RETA 2WSSA 1EJBA 2G9VA 2IYEA 3HXPA 1GY8A 3DOCA 4WFJA 1U5BA 4HPXB 3O2NA 3PDUA 4Y0VA 5J2UB 1XMQB 1IU9A 3BD8A 2R6JA 1I6LA 1V25A 2ZIXB 4BVBA 3U3XA 1M54A 4P4LA 4EEZA 3QV2A 1J2YA 3ZCSA 2WFMA 3G17A 3QKSB 4PX9A 3S2FA 1RVV1 4QYMA 2Y9PB 3I58A 1EK6A 4ZVVA 5TVKA 2H6EA 1KS9A 1YNSA 2E85A 4MS4B 1G8SA 3H2SA 3PE3A 3OLXA 3N8HA 3Q7EA 4WV3A 4Z1OA 2JH9A 1JHZA 3FUWA 2Z2ZA 3M6IA 4CWAA 2R6ZA 1MW8X 1NVVR 1TTPB 3U48A 3G79A 5EI5A 2Q46A 3MRSA 3HUTA 4HNVA 2Y0EA 4MROA 5K2OA 4BECA 1BMTA 3HCRA 4TT3A 4ZHSA 1U7HA 4HGNA 1C1HA 3V2GA 2FHSA 3OE7D 1NBME 2BT4A 3W4KA 3IIEA 4PZUA 5L51A 1RMTA 2C88A 2ZRIA 3LZ6A 5CA0B 3GNQA 4Y1RB 2QVXX 1U4SA 5B12A 2V6GA 5ITZB 4MR8A 2H7CA 3DMDA 2YJZA 1ABBA 1TIKA 1VSQA 2DKOA 4Q93A 1Q1QA 4D3XA 1VDZA 4F4HA 2NVWA 3CLKA 2H9YA 1EAYA 1MH9A 4IGKA 3F9RA 4I99A 3K5WA 1KAHA 3T7SA 1RBMA 4E0BA 3HEMA 1XL0A 4L9SA 4O2AF 2GPSA 2CV0A 4JC4A 3W5JA 4EF5A 5L3QA 2PUCA 2ZR0A 1HTWA 2GAJA 4KE9A 5FOTA 1A9QA 4PGAA 4EYOA 2ENWA 5A2GA 3HKBA 2UXCB 2ZTHA 1OC2A 3U3KA 3VH1A 1FRNA 1XJWA 2ARKA 4MGIR 1UJMA 2ZK7A 1G4AE 1NP7A 1T91A 3DE2X 5A3VA 1WHSB 1Y7IA 5TY0A 2DQSA 2PFSA 3G82C 3AQIA 3ORSA 4TTJA 3V7NA 4NULA 3EZFA 4LY6A 3OIFA 2FEKA 2QMHA 1B26A 1OCEA 3BVPA 2HN9A 1T3SA 1CS0B 1Y98A 2A6PA 2L69A 1P1CA 1JG2A 2WHRA 2NU6B 2XMSA 5EPUA 1Z6TA 4XWKA 2CSXA 1DC6A 2LPMA 2YUTA 3MRXA 3KETA 2W2QA 3CNQS 1T5BA 1O58A 3KBOA 1E9BA 4NJEB 4PWYA 4TPKA 1A9SA 1D0IA 1P4HA 4IDQA 4RY8A 5CBKA 5KOYA 5AKJA 1SCQA 5CB8A 1HNXB 4DLPA 3IP8A 1KO8A 4FOSA 3LTEA 1OQAA 3L3BA 1YTUA 3HTXA 5JV5A 4O4IB 4NJMA 5E9QA 4IIJA 1EFKA 2GCIA 5FO0A 3UKJA 2XUAA 2NMVA 1CB7A 4U7GA 1RXVA 5L7TA 2GR9A 5JANA 5AVTA 4CKZA 2YFQA 1T5LA 1XZMA 4RE6A 3TZCA 5K6AA 2OHHA 1H65A 4PV7A 4BTVA 1ML4A 2J87A 1XAIA 1Z38A 3RFVA 1T6YA 2BWJA 1JAZA 1OH6A 4K6OA 2QTGA 1MJGA 1X7WB 2OR3A 4I50A 2RH8A 2HA6A 4U2EA 3IR7A 2R7MA 4Y2UA 5AVQA 1Y1LA 3MJRA 4R98A 1HYEA 1J21A 1E7MA 1MFZA 2A67A 1KI4A 2ZBPA 3HR8A 3VC1A 1YE8A 2OZEA 4NZZA 2O7VA 4C6TA 3CEJA 3KR0A 4UNRA 2ERXA 1D2HA 3IOMA 1TA0A 3MAAC 2V4UA 4J6FA 1V16B 3TIXB 1WHTB 2W6ZA 2BGMA 2XOEA 2DH6A 1M74A 1CXZA 3D59A 4R7TA 3O4GA 1QVWA 2W6QA 1A8HA 4RV4A 1B8OA 2IITA 1YB5A 3N6VA 2QAGB 3VISA 2PZEA 1K7CA 1X7YA 4Z9FA 2BR5A 2AMLA 2Y77A 3CF2A 3VX3A 5JPDA 1S5PA 5K3CA 5E0KB 2Q8NA 4M9ZA 2H4YA 2JH8A 1NVFA 2NU7B 3SZOA 3H6HA 4TV8B 4X64B 3C6BA 3HYLA 3KPYA 1VMAA 1Z5VA 2UVQA 1JLHA 1E58A 1RXEA 5LZ9A 1P72A 1M34A 2GK7A 3DMYA 5GPBA 1Z0SA 1QV9A 1GUBA 3LUBA 3X1DA 5JDIC 3G0CA 3SOPA 1G20A 3B12A 3K0FB 2NO4A 2C5EA 1NJSA 2RCYA 1MABB 2AG1A 4A2CA 5A9RA 3GX1A 4ITVA 3RSCA 5IAEA 4EARA 1ZRMA 4IIGA 1F3LA 4Z1MD 4Q4HA 5JXWA 1W88B 2GS9A 2FEWB 4JX9A 4Q3NA 1QS0B 4GXQA 1Z2EA 2JLXA 1HRDA 1ZUNA 1M1YB 5T4FA 3ZCPA 1PAUA 4BKQA 4LJ9A 4Y98A 3RHSA 3C70A 3QWAA 1TIPA 3JVDA 4KMRA 2O14A 2Y05A 2VAMA 3TZBA 1GG2A 4PAWA 3CNHA 2ZJ3A 1L7PA 4U2BA 5HRUA 3IVMA 1U0SY 1QO7A 3FPHA 3JWHA 2P2ZA 4OHYA 1WMDA 2X76A 5JAUA 2YRFA 3D2BA 3ZK9A 3MBIA 5BSEA 4ZVUA 1ZN8A 2HO4A 1OFGA 4EG5A 1T8YA 1BEUB 2FJPA 3NWBA 3OAAA 3ETCA 3A3YA 5K1ZA 4B35A 5DULA 1TYCA 1M66A 3KYCB 3PXAA 1CG6A 2ZM6B 3GLGE 3T3PB 1N4DA 5ESXA 2B4RO 5DX0A 3ETHA 4RHFA 3WTBA 1TF7A 3L7AA 1JKFA 1K7EB 5FF9A 4BMDA 4EDHA 1BWPA 3G5MA 4RTOA 2J9RA 4B5KA 1C0LA 3LHKA 1L4KA 1Z39A 5KTOA 1RMYA 3C8HA 1NRJB 1TTQB 1N2XA 1WY5A 3ZI0A 3ZWNA 2R8EA 2RJOA 2Y9MB 1FTGA 2WTEA 5AI8A 3SSAA 5JHHB 4GKKB 1TW3A 3RABA 3JD4A 1YJXA 4OA5A 2JRLA 3A28A 3OPXA 4U02A 1MXHA 2I7TA 4J7UA 2PV7A 4BX8A 2GKGA 1DRKA 2OZLA 5DNDA 1GDHA 2BFBB 3D4OA 4R16A 1UIMA 2JKVA 3BJEA 3QYJA 2NXWA 4NDZA 3I34X 1TUBA 4ZCRA 2IIQA 3KYBA 1DV2A 3OE7A 5AOAA 4AO8A 1JEYA 4W7SA 2WD8A 4YP1A 2QZZA 3NHBA 2VRCD 3M6XA 3E27A 4G8CA 3FG9A 1VHDA 2EZUA 1R3UA 1B6RA 1D03A 4MINA 4RJKA 4EUHA 3D4BA 3PE6A 1KOGA 2JVKA 4MR8B 2VNHA 5B37A 3AM3A 3AVVA 3VOBA 5D86A 2YL2A 2IYVA 3IXMA 4GWGA 2J85A 3UK0A 4CDNA 3EEFA 1DUIA 4FCWA 4CG1A 2WYWA 3GGDA 3IT3A 1RZRD 3OE4A 3NJ8A 1SHTX 1ZJZA 2G9UA 2ZIVB 3AXSA 1JQBA 3DF7A 1V1MB 1L5RA 3MT9A 4RPKA 5I7VA 5L3QB 4BJHB 3A4TA 4IW3B 5BVGB 5CITA 1M9NA 2RBGA 3HKBB 2C92A 3VFDA 3EGEA 2JGDA 3OQIB 1I1QB 2EBHX 2H63A 3L4EA 3E03A 5EXDA 4ZYWA 2DT8A 2IHNA 1U63A 3LDFA 3MWYW 3QKUA 1PFGA 3NEJA 4L2IA 4OQEA 1XB2A 4L9AA 4DREA 6Q21A 5C51B 3I72A 2EZTA 1ENOA 1U4OA 1GZ6A 4FZ3A 1CQIB 2C8VA 1HH4A 2FQQA 3EIEA 3AP2A 1DBPA 1O87A 2F67A 1O5IA 4NZMA 4QUIA 5GY7A 3TOXA 3ZDZB 2CGEA 3JYHA 5J2UF 3PCTA 4LKRA 3SS7X 3SHWA 1GKUB 3B6ZA 2PLWA 3AOGA 4DV2B 3QE9Y 4WEOA 2PQ2A 4E30A 5B2ZA 4BJ3A 1EG2A 5LUBA 3ZD6A 4CEJA 4Z8YA 5K2MA 5AVRA 4DT1A 5HS4A 3SQXA 2HYDA 1H4TA 1US8B 3G2KA 2JLWA 4IUCS 2XVZA 2NADA 5EHGA 4E22A 4QKQA 4LSZA 3PGXA 2EQBA 2ENUA 2VHVA 1GU7A 1SCBA 4JLWA 4L7VA 1J0XO 1JQ5A 3ZLJA 4GR5A 3M5DA 5IM5A 3H4MA 5B1YA 5BW5A 4Y6OA 3GDFA 1YCHA 1CRLA 3D6MA 4IJ6A 1Z9BA 5J5VA 4CLHA 4RHXA 5CA0F 2MTBA 4C6TB 1OR8A 1Q50A 4KYIB 2H06A 3V1NA 1OKKD 2GEDA 2HSEA 3OQBA 3ZWMA 3DV9A 3DE0X 2FW6A 3WYDA 3VKGA 4BLSA 2ATCA 2XQVA 1P5ZB 1Z16A 2PX2A 5BRNA 5EEGA 2WUWE 3JVEA 3RU7A 1EFAA 4NNOA 1SR8A 3IMEA 4FFVA 3DDZX 4GPEA 2GRUA 4Z0NA 4ESHA 1X7YB 1A8UA 1AY0A 2P9BA 3L92A 3QXJA 5TX7A 1NI5A 2Q5CA 5F21A 1JSRA 3F6EX 1LDEA 4UBLA 3KSRA 5IAGA 3TRJA 2O8BA 3V8PA 3K9BA 2WWTA 3BILA 3D3JA 3E5RA 5AJTA 5ALHA 3ZGXA 1PJ4A 3N8NA 2FR0A 5BUCA 2R96A 2FZGA 3GUVA 3IPXA 4JODA 2R6AA 4UATA 1A7KA 2PZFA 3RSSA 2YMMA 1WXWA 5E2IA 4W5QA 4IDGA 4O5AA 5KNLA 1WXQA 4R2WA 1T2NA 2OWDA 1I3CA 3DDWA 2QMQA 4DJEC 1N9GB 2VP2A 1KDVA 4DY6A 3GNLA 4Z4QA 3A4LA 2XD4A 1SO8A 2W9XA 2FMIA 3HCNA 2FUEA 5T4EA 4TTIA 5IW8A 1VRWA 1DBVO 3ESQA 4YH1A 4BKRA 5K03A 1ECJA 3HP1A 4D6YA 5A06A 4Z1MA 1IVSA 5MHTA 4RK6A 1A69A 1EDZA 5HS6A 4U00A 2VRWA 3LTNC 2ZTSA 2VP6A 2D8MA 1E8NA 2XMDA 2D1TA 1ZUNB 3I28A 1UP6A 3PVSA 4GVXA 4RF2A 4YCDA 2DHDA 2J0EA 3VYRB 4AW9A 3OLVA 4KOAA 3PGMA 1ODJA 2POQX 4FYVA 5DM0A 4CEIA 3RF7A 1Z37A 5DHQA 2J3HA 4BKMA 1U9IA 3INGA 1XMOB 1GAXA 2H00A 5COBA 1N5LA 2E3JA 5T41A 1H5UA 1NXXA 3VSEA 1NR5A 1YRHA 4CF7A 4KPYA 4XD2A 1FSZA 6ADHA 3M83A 4UAUA 5JH7F 2I2AA 3HB9A 2H2AA 5L3SA 5B57C 3E3NA 4EFDA 2XQGA 2D2XA 1VIVA 2G71A 2GPBA 4XX1A 3FN4A 2I7VA 1C7RA 2INGX 4FGUA 5FI5A 1KQNA 2XUQA 3UATA 4XUCA 3PX2A 1LWNA 2BI4A 3DFFA 3H9BA 4QT0A 4PG5A 2YVAA 3EDOA 1MB3A 3B53X 1ZK3A 1YR9A 3FETA 3GJ8A 2XNDD 2WLSA 4JWKA 1GLVA 1MRSA 1KS2A 1U7ZA 2XSZD 3TD6A 3COSA 3LCCA 1V7PC 1Z6XA 5JI3E 2G80A 3FSRA 3H3XA 3PQ7A 4ZPJA 5JNWA 2WT4A 1YS1X 4HQFA 4R0MA 2ISSD 1I33A 4KKVA 3O8RA 4R83A 3S81A 2QX4A 3IEXA 1JVNA 4KXXA 4E7PA 3IEMA 4J29A 3I6YA 4TV8F 4RM2A 1NVKA 1Z68A 1N2BA 1KH1A 1N92A 2I33A 3WNZA 2OZLB 1RAFA 1CJKC 1S2GA 1C9EA 4DW8A 3PXXA 1N6HA 1TUBB 3RVRA 1IZZA 1NWHA 3U4DA 5J4KA 1OIXA 2VRCA 5JNVA 1JEYB 2WMYA 4A0QA 4FBMA 2BH9A 3CLTD 3O8DA 4RMGA 5FYDA 3D31A 1WTAA 3HSYA 3NVDA 3OCZA 3WYBA 3QVWA 3AEKA 2YX1A 1JQJC 3WK8A 2AX4A 2R6HA 4NYJQ 4HQOA 5FTKA 2VYND 3Q6NA 1QRUA 5JMWA 2P9FA 1IJBA 3W5UA 1RZRA 4ZGBA 4EK9A 4LE1A 2Q0QA 1VE9A 1U99A 4DRXA 2Y1CA 5LQUA 2W6MA 1AN9A 3TZ6A 1EB9A 3DP9A 2PXHA 4B3FX 4FD2A 1B6TA 2CLMB 4LC0A 2ZAOA 5CT5A 4AWXA 4EB0A 2HLDD 1UBUS 3IUQA 1IQUA 3KTAA 1RRKA 2ZJ2A 5KWJA 1A1SA 2UZ4A 1XTJA 2JGDB 3WADA 4ANFA 4EQZA 3M1AA 3EWSA 2QL6A 1G66A 4P7KA 4MQFA 1XPUA 3AR9A 4L2IB 3RVLA 4RC9A 1UBMS 1L2TA 1W1WA 3S2UA 1JLLB 1Q0RA 4UFOA 3BWXA 1FCJA 3S0JA 5DM60 2AK3A 1E0DA 4QYIA 2WSIA 2WIKA 3GVHA 3IT0A 4QGAA 4CNBA 5LDHA 4D9NA 3CLRC 4WOPA 4BVGA 1BE0A 1SRRA 2DPYA 1Z3CA 2VPXA 3T5DA 5ESWA 3WRWA 4BGEA 5D00A 1ECPA 3EYWA 5FV7A 4XIFA 4AG5A 2W11A 1G21A 2G5CA 1C3JA 2WF6A 2YQ5A 2QTBA 3N5KA 4HXYA 1FEZA 5EXSA 5CDFE 1U7DA 5HOQA 4CEJB 3GQVA 3KQYA 5H4GA 1HSZA 1ACMA 3B6EA 3K2BA 2V0NA 4KIFA 4DT1B 4BZWA 4EPYA 3O75A 1H93A 4AY4A 4HNAB 3I5UA 1TAGA 4KIGA 2HYIC 1KMHA 2NVUA 1QJ4A 2MYUA 2O2JA 1YWGO 3DOJA 4FHZA 3H97A 4PO3X 4KCGA 4QTXA 1Q0TA 1NC3A 1RZUA 4Q7EA 2VRNA 4W7IA 4KN8A 4WLFA 3VQTA 3WLLA 4KXMA 2P2GA 3M3PA 4MUMA 5KJ6A 3NOQA 1FJ2A 2ZQ5A 2OXTA 1Y1SA 1TZ2A 3BIJA 5E3IA 4ZAZA 4F72A 1SXJB 1Y3BE 1A5TA 4G81A 4Z0TA 3EEYA 5KDOA 1R6BX 2NPFA 4KAXA 1W94A 1G1MA 1OKKA 2VFAA 1E2PA 1G16A 1VRVA 1DQZA 4U9HS 5H7XA 5CDTA 2IHVA 2DLCX 4FI3C 2XMQA 3QVVA 1AQUA 2DPHA 2ILTA 3QU7A 2E4ZA 2YYYA 3KEGA 2AOVA 4LHVA 3T9DA 1KAGA 4KODA 4C87A 1PNRA 4ZYZA 2OCLA 4J1SA 3MHTA 2G7ZA 4A0FA 5EHIA 2HA2A 2W37A 2W71A 4GLOA 2FOXA 4NBKA 5T4HA 6ABPA 1VSVA 5LYJA 2QI9C 4PTLA 2HA5A 3L7DA 3DDHA 4PHHA 1FFHA 2KS6A 3A6HA 3FXAA 3R5JA 1H2HA 4U0JA 4W5HA 3DG9A 5EEHA 1BDMA 3COZA 1FUEA 1ZMBA 4RPLA 3TNYA 2BELA 2CB0A 1K27A 3MW8A 1Q83A 2AZTA 2JKYA 4D9HA 1E3SA 1NR1A 1GN9A 1SVLA 1WULS 1YOBA 3EGXA 1TM7E 3KCQA 1PG2A 2JGAA 4DPMA 5J4VA 2J09A 3H19A 4LXUA 4TOIA 5DHRA 4C22A 5JWOA 2J4FA 5C80A 5I4KA 2A0YA 3H75A 3UPTA 2V03A 1Z47A 4RZ3A 3CYFA 4ZK2A 2ID8A 1QYIA 2Q45A 3I2IA 4EP1A 5JJKA 1T8SA 2OMEA 3SYNA 1GZHB 3DD5A 4FFBA 4MCAA 2ZT5A 5AM4A 3RK0A 1NJ5A 3RS0A 4JZKA 4C4AA 3DLHA 2B37A 2QT1A 2F4NA 5JATA 1D09A 4PBSA 3WMXA 1IHUA 3KDAA 2UAGA 1I6KA 1NU8A 1OAKA 2ZRKA 4G0XA 5BSMA 5TQJA 3L1VA 1BHO1 3RFUA 4AJIA 2HOQA 2FZKA 3BWEA 3D3KA 3L1JA 2VQ6A 3RM3A 4D98A 5HJEA 3T9AA 1OBVA 2WSMA 1UWCA 4LOHA 4FN5A 4U6SA 3QEAZ 1R4NA 2WWWA 2Y68A 2VSQA 4PC6A 5FWXA 4KLRA 5GM1A 3LDUA 2X6RA 4IOLA 4NBUA 4ZVQA 4BQNA 5DYNA 1DDGA 4NU0A 5BVHB 2BCGY 1F0PA 1Y9AA 2G88A 2F3UA 3AC0A 4LDAA 4EY3A 2K7FA 5KS2A 2OGWA 2Z5FA 5BV7A 1II9A 3HL0A 3HBAA 4Q00A 4F60A 1JLMA 4P7BA 1DFIA 2BSXA 1U3UA 3MA0A 4YGYA 4A2WA 1AMOA 4DIUA 2N46A 1WW2A 1P2GA 5L3SB 2HL6A 3RK4A 3RYIA 2GNAA 2V9CA 1ONPA 2IYXA 3EQ7A 3NP9A 2E7ZA 3PIIA 4IQFA 3BMOB 3SS8A 2JFNA 3TJZA 4KVFA 3TLAA 4BNNA 1V8BA 1ZWLA 2AFHE 2XNDA 3K1TA 2BLNA 4FPXA 4JKOA 2XSZA 4YQZA 3OQNA 4FCCA 3AM1A 3VNAA 4DSNA 3DWFA 5E6RB 5JSKA 3IOBA 3SIRA 3AIIA 2AS0A 3WJ2A 5H68A 1YDMA 2ZXUA 3IRVA 3E53A 1O9GA 2ZSHA 5AP9A 1KFEB 1Y7TA 4OQDA 1H2XA 1E3DA 2BKEA 3C7DB 3C45A 1AMNA 4G09A 5A3RA 1TK2A 2XMPA 3CF6R 4N7BA 4BYGA 5F7JA 1FBNA 2R8PA 1FSGA 3OG9A 5C52B 5ITZA 4C0JA 2FX3A 1XYGA 2ZBUA 2VIIA 3DMTC 4EBFA 4QM7A 5DK6A 3GC6A 1RRVA 3KPJA 2J0QA 4CGZA 1SOVA 4G9BA 4OMUA 2HDWA 3GA7A 3O8QA 3SX4A 1C3VA 1JQ3A 3AY7A 2DX7A 2RIRA 4YCCA 1ZHOA 4CFZA 3D1VA 3DOEA 1DXYA 1XP8A 2GDZA 3G9UA 3FOCA 3SDBA 3NKFA 3TDNA 4RTPA 2ODQA 3UK1A 4EGCB 1O03A 4MEAA 2VYNA 1OYVA 4PU0A 2O6LA 3AEKB 1Z06A 3EVNA 4MLCA 5AM5A 3NM4A 4AIRA 4XJVA 2G8NA 2V6JA 3LUJA 4LHSA 4B45A 4DB2A 3VDQA 4L07A 2X6TA 4LFBB 2P4EA 4OQLA 5EKTA 1J0EA 1HDGO 3CLVA 4DDHA 3LSTA 3OSZA 1NBIA 2CHUA 2IWHA 5EPEA 3TR5A 4EY8A 4WBNB 2Q27A 5DPMA 3F49S 1ADGA 1FRZA 1K8RA 1V47A 1FYXA 3EEBA 2D7DA 2HLDA 3WMRA 2Y27A 2LVBA 2HF7A 5HIAA 2IYRA 1P1RA 2X3YA 4TTTS 3PQ3A 3KTAB 3ZWBA 3SXPA 1MPXA 3PUVA 4U7JA 3BRCA 2WWVD 5IRCD 5CVVA 3EQZA 3NLLA 4N39A 4DBZA 2NAFA 1LBHA 5AQEA 4J6EA 1XAHA 1M7GA 4P3NA 4PZDA 2YIDA 4MQFB 1APBA 1F2TB 1ETHA 4WK2B 2IU6A 3SYRA 3FJ1A 3U3OA 3GLFA 6AT1A 1U1GA 2EHJA 1H69A 3I64A 1L7MA 5U9CA 3BAFA 3TEMA 4FX2A 4DXHA 4QYIB 4EITA 1IE3A 1JXQA 1YFKA 3ICWA 4AP5A 1LI7A 4RHUA 3AVQA 4G07A 4BP1A 1UZAA 3B70A 2XE7A 1Z56C 5DHPA 1HSOA 4HGOA 2I8CA 1G21B 3K7EA 1R6VA 3W05A 5D5PA 3LY5A 4D81A 3T8YA 1NUTA 1OC4A 3GVPA 4LOKA 5FWDA 3WGNA 1KVSA 2CVPA 1UPCA 2GLXA 3T35A 4R9SA 3A9UA 2NXJA 3H5NA 4R2IA 4UTPA 3ILYA 1JEJA 1G6OA 4W99A 4X93A 5J9FA 3DWIA 4A0HA 2D8AA 4HOYA 4CT5A 4Q01A 1OTHA 2VPPA 9LDTA 4GOMD 4JUAA 2ZITA 1SBTA 3W9YA 4W9NA 1PEYA 1BOFA 5HR5A 1TNDA 2R8XA 4YCNA 4QTUB 2HZ7A 1KHTA 4KR3A 4PS0A 1YRAA 2Y93A 4IFEA 4NI5A 2UYCA 1NDUA 1VSTA 4NAUA 1L7OA 5AKHA 3UGTA 3U31A 3NTQA 1N3LA 3A6FA 3KZVA 2J9XB 3C7TA 3HKDA 1BFKA 2OQRA 1CY1A 2FF7A 3OM1A 2DBYA 1N5OX 1S8NA 3AR6A 2JVIA 1OT3A 2FDRA 2IF0A 1R64A 1QZXA 2PGDA 2XTNA 2H59A 3EJWA 4O4HA 3HO1A 3BDVA 5EMLA 2WWHA 4H3KB 5DP1A 5CT8A 1A4IA 1LW7A 2PZJA 2ONYA 5AD1A 4M4SA 3SIPA 1V26A 1YIDA 4BIIA 3B3JA 4OSOA 1COWD 3GAAA 1E4VA 4C07A 3U7FB 1OMOA 3TL6A 4W5OA 4NOJA 5CCBA 2FN3A 4YCSA 4NCNA 4QOGA 5SYNA 1CRWG 3EGXB 4LPSA 2VRBA 4JBGA 4B4VA 1CX9B 3NETA 4EKDA 5ICMA 4QDJA 5AMXA 2ZB8A 4BQEA 2K4MA 1GGHA 5LA6B 4CW7A 5E6UA 1M8PA 4LJKA 3KAKA 2QYHA 1UEJA 1LTKA 4G2TA 4IJVA 2IGTA 3OZ7A 3H9QA 5BPHA 5AKGA 4CG0A 4FFBB 3ILHA 2E2WA 2XCTB 3M6UA 1ZC3A 3EIXA 1FMTA 1Z26A 3V80A 1HEUA 4WJZA 1P1FA 1ZHHA 1V8ZA 2ZS9A 3UK7A 4FFPA 2WMNB 3KJXA 1SOMA 4KMMA 5BQOA 3VO9A 3GGGA 3E15A 1IN7A 4X6LA 3H8SA 1P4JA 2R751 5FBRB 2P77A 1TK3A 821PA 5FWXB 1SA0B 2YHAA 5HQJA 1GSOA 1ND6A 1YQGA 2MU1A 2NO1A 1L5VA 3GCZA 3BK2A 3IFSA 3IPLA 3MMNA 1JWBB 3OUZA 4WXYB 4HNGA 2BFWA 3AILA 1SULA 2J48A 3KHKA 1MOZA 1QHSA 4G56A 1WZEA 4B75A 1U8CB 1NNEA 1PFVA 8ATCA 4EHAA 1A4UA 3IBSA 4GX2A 4FEAA 3STWA 4FYXA 1SKQA 3I9KA 3IUPA 4H08A 2H8KA 1ZIXA 1GL9B 2OUKA 2XYPA 4N3GA 4RKRA 1F8GA 4QOJA 3TK1A 4WZBB 1K6EA 4DZZA 3IKJA 1Q2UA 2QVYX 3BTSA 1BEEA 3OJLA 4P7JA 4PG4A 5KAPA 4AXXA 4F2WA 3U56A 1KU0A 1L6IA 3LY8A 3EIUA 3FYDA 2EWWA 1MO6A 3HZRA 1GTG1 4M54A 2AOTB 3EQ6A 3H9UA 4RTQA 3R6GA 1S4MA 3G8BA 4YDSA 2VZEA 3SBDA 4C5AA 5IZCC 1Z5ZA 4LDQA 1VI2A 1POXA 2XHZA 2D0PB 1FNNA 3WV4A 4UUNA 2AJDA 4MUIA 5MN6A 4B1FA 3WJAA 3Q5DA 2RHRA 4UU0A 4JI3B 1P5JA 4KR9A 2NW6A 3EGCA 3L41A 3NEAA 4ETNA 4UUQA 4LJRA 5F98A 3HACA 2XTZA 2QVZX 2EP8A 2XYQA 4WW0A 5T8KA 4BFLA 1FMJA 4AMUA 2OY0A 1BD4A 1EVYA 4BP9A 5I7RA 3CF4G 3OZTA 5LB4A 3HUEA 4JGIA 4YYEA 4FB4A 5CDSA 1HC7A 3IOYA 3KU4A 5HGXA 4QVIA 4WXEA 4F1KA 2P2CA 3LHSA 2VVTA 3SF8B 1Y6RA 1XZNA 1Y6ZA 5DBHX 3BM5A 2FPSA 3PUKA 2I54A 4Q3CA 1TMKA 2R4TA 2YN0A 3ZWKA 2WC1A 4RWEA 4TWJA 2O8EA 3Q2KA 3BXFA 5CDUA 2G09A 4NPAA 1FNMA 4J4HA 3PEVA 3A6EA 4BJ1A 3K70D 1H2AS 3FW1A 3K9LA 4P3OA 2HCFA 2X0JA 2AN9A 1NJ2A 4AO6A 1XLVA 3PL1A 5KTNA 3WFIA 2ROQA 1K08A 2FPKA 3NIWA 2HH9A 3GFOA 2EFDB 4HATA 1C9KA 1SQ5A 4OKSA 2P2YA 1KC3A 4QQRA 4UUOA 5D1NA 3T9CA 3TBHA 5KNCH 2IEIA 1TCCA 1BXRA 1G2PA 1E5XA 2WF5A 2IXDA 3Q7TA 4G89A 4EG7A 1PUXA 4YYZA 3TL2A 1IHYA 3OOJA 5BN1A 5F73A 1Z88A 2FMUA 5EWMA 2J41A 1DB3A 5ERYA 5FUBA 1MV8A 3ZU2A 1PQWA 2QQFA 1VLVA 3SIWA 5A5GA 1YXMA 2I34A 4GD3Q 2ZSIA 4FYJA 1DINA 3VHXB 1ADFA 3HVJA 2BKAA 1MAHA 1ZUWA 2B1IA 3AJAA 3M2PA 1XRPA 4LTNA 5I8ZA 3R76A 4ZT5A 1IXRC 3FX2A 3NATA 2PDAA 2NZVG 3GLFB 4MI6A 3WAKA 1SKMA 3ZD9A 2I66A 1FTWA 2V74B 2WHXA 4G8DA 5B3KA 4X91A 4C88A 1A04A 3D64A 2BV3A 2DPXA 1DHRA 1HT2E 1U0LA 3QF4A 5ARDA 5BNFA 3RT7A 4EHBA 5TS2A 4UHFA 4IGFA 4QQFA 4KPFC 2BCEA 4KFUA 2FMKA 1R0LA 1XEXA 3HPRA 4JVNA 4EUKA 2AJBA 1NQVA 1MX3A 3EIOA 2ID7A 2O7QA 5AH0A 3NGXA 2FV8A 1PTKA 2GEJA 3OI7A 5KYTA 1YL5A 5LQAA 2G17A 1GGVA 4AY2A 2BSAA 4KGXA 3TPZA 4DQ0A 5I9IA 3OKFA 5BN3B 1HK7A 4G5OA 5KB3A 1C7QA 3IHTA 4FKMA 5ILOA 3K35A 5KVAA 5C7LO 4LYHA 2VJOA 4F0JA 3IELA 1CTQA 4KTTE 4IWNA 4BLTA 2DOKA 1QVZA 1G17A 4EPVA 3LRTA 1B15A 1KAMA 5IABA 2C9YA 3HA3A 1QQBA 1HYHA 3HXMA 1ND5A 4YALA 3NXSA 4GECA 4BATA 1FS5A 4RS4A 4QSMA 3TINA 4LF5B 4HFMA 2YFHA 4JLOA 5H0IA 3HKDB 4BNLA 4UFPA 5EWJA 3R6WA 3ZTYA 3WBBA 1CB0A 3INRA 4Q1CA 1EP1B 1XDDA 3FWZA 4O4HB 4WBNF 1YH3A 3BFKA 3H9EO 3LC0A 5EJMA 1J5EB 4ZZ3A 1TEXA 2E4VA 1SCKA 1JPUA 3OLQA 1LPSA 1G9TA 1M67A 1J1ZA 2A35A 1U94A 5E3JA 2VT3A 3UH1A 2VPQA 1COWA 1GCGA 3IQFA 4IJ5A 1Z6PA 3NOXA 4K8OA 4S24A 1KJ8A 2IDMA 3UT5A 3NBXX 2P90A 4QNMA 2D13A 2H0AA 5D3ZA 3KNZA 3S3TA 1JI3A 1HETA 2NYUA 1A2BA 2Z3VA 5A3JA 5AM3A 3MCTA 5FTJA 1FMLA 3H2GA 5HKOA 3C4VA 5AM0A 2E5FA 2ZI3A 1PJRA 2H2HA 2IGBA 1HV8A 4W5NA 1LTQA 2IT1A 2X2PA 3L6UA 4RFSA 1FFDA 1TFRA 3HYCA 1XJCA 3IP3A 5E6UB 4RCZA 1FYDA 5K99A 1E0AA 3VZQA 3IDAA 5TIIA 1KZ4A 1MQSA 3OFND 3AESA 3DE6X 1G3MA 3W0LB 3CA8A 1YL6A 2R68A 1XWIA 5EXTA 1HE4A 4GT1A 1U3GA 4CN9A 5LNK6 4KOEC 5DN6D 3DLCA 4OU5A 3R5XA 4KLAA 1M2GA 4PCLA 2JIMA 5IBQA 1AUPA 1ZD5A 3GDOA 2GNPA 4RCYA 3PHHA 1JE0A 1OXKB 3ICQB 3KWLA 121PA 1NW8A 1B0AA 4R69A 3CC8A 4CM8B 2XWPA 1GPH1 5EIXA 5KPJA 2R44A 2WABA 4MV7A 3D43A 2G0AA 4HKTA 3CT4A 3E35A 1C1YA 2JLQA 4J0HA 1T36A 4NBRA 1KETA 4ZRMA 4GMHA 2J9FA 1JQKA 2WKRA 5FOWA 1CUEA 4WVFA 1SU4A 4QUKA 1GSHA 2VHWA 2WM2A 4GX1A 1YBFA 3OE5A 1U1CA 2VBFA 2QR2A 4X84A 5CT6A 5FCDA 2EWVA 4I9HA 4B6EA 4FBLA 3T3HA 2UZ3A 1AGXA 3C3WA 1K68A 1VHWA 2C9CA 4N5LA 3O3MB 5DU2A 4E2YA 4ES6A 2XKJE 1JDNA 5HTKA 3AVPA 2P67A 4KAFA 4M1ZA 4MTLA 2ZPUA 1OXSC 2GSWA 3E9EA 3Q7QA 3QKWA 4R5HA 2E55A 1NDHA 3SBOA 3VNUA 1OBOA 2EW1A 1J07A 2HBZA 2JATA 4Q1FA 2ZLBA 1Z4QA 4QXAA 3BAZA 1X8LA 2V6MA 1Y63A 4DCOA 5J4LA 3ZNQA 2DT5A 3QXSA 1CJBA 2YNMC 4YUVA 3SLKA 1Y8RA