4JJ7A

Caspase-3 specific unnatural amino acid-based peptides
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
256
structure length
241
Chain Sequence
DKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-8
publication title Selective Detection of Caspase-3 versus Caspase-7 Using Activity-Based Probes with Key Unnatural Amino Acids.
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 241
sequence length 256
ec nomenclature ec 3.4.22.61: Caspase-8.
pdb deposition date 2013-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4jj7A00
4N7MA 1RWKA 1QDUA 1NMQA 2XYHA 1JXQA 3H13A 4ZVUA 4ZVTA 3R7SA 2NN3C 5IAJA 4AW9A 3GJRA 4JJ7A 1RHUA 4JJ8A 1NMEA 4D3YA 4NBLA 1RHJA 2HBYA 3KJQA 3P4UA 4JR0A 1RWMA 3NS7A 2QL9A 4JQZA 1M72A 4NOLA 4ZVQA 2H5IA 3R7NA 4N5DA 3EDQA 4EHNA 2H65A 5LUBA 2H5JA 3R6GA 4EHKA 2XZDA 3DEIA 3GJQA 1NW9B 4IEFB 4DCOA 4HQ0A 3S70A 3GJSA 2AR9A 1SC4A 3H0EA 3IBCA 3SIPA 2H48A 4I1PA 2CNKA 4LSZA 2QL5A 3EDRA 4JQYA 4EHFA 1RHKA 2K7ZA 3P45A 4FXOA 5IC6A 4DCPA 4AWBA 4N6OA 3PD0A 3KJFA 4JB8A 2CJXA 2J30A 4QUJA 2QLBA 4JR1A 3NKFA 2J33A 2FQQA 2C2OA 1PYOA 5H0IA 3OD5A 2J32A 1I51A 1RWOA 4IYRA 4QU5A 1SHJA 2Y0BA 3GJTA 5IBPA 3RJMA 4QU9A 5IC4A 1RWXA 4QULA 5IBCA 3DEKA 2XZTA 4EHLA 5LUAA 1SC3A 4JJEA 4EHDA 1RWPA 2C2ZA 4ZVSA 5IAGA 4D3ZA 4QU0A 4EHAA 4NOJA 5IABA 2QL7A 4QUHA 3IBFA 1I4EB 1RWNA 1RHRA 2CDRA 3PCXA 5JFTA 3DEJA 3R5KA 4QU8A 5IAEA 2WDPA 3UOAB 4D3XA 5IANA 4QTYA 4DCJA 1I3OA 4QUIA 2HBRA 3UO8B 2CNLA 4N7JA 4EJFA 2CNNA 2XYPA 4AWAA 4N6NA 1ICEA 1K86A 2Y1LA 4NOMA 4PRYA 5I9BA 2H4YA 3D6MA 1RWWA 5IAKA 4QUAA 3PD1A 4FGUA 1NMSA 1GFWA 4M9RA 2QLFA 1RE1A 1RHMA 2J31A 3ITNA 4HQRA 4FDLA 4PS0A 3V4OA 3H11A 1QTNA 2H4WA 3D6HA 4ZVRA 4ZVPA 3K7EA 4ZVOA 5IARA 4PRZA 3V6MA 2C2KA 2HBZA 1K88A 1CVRA 2FP3A 3V6LA 4QUDA 4EHHA 3DEHA 3QNWA 3R6LA 4NOKA 3SIRA 1QX3A 1IBCA 2CJYA 5I9TA 3R7BA 5IBRA 1CP3A 4NBKA 1RHQA 1SC1A 4QUGA 4QUEA 2P2CA 1F1JA 1KMCA 2CNOA 3NR2A 2C1EA 3H11B 2H54A 4QTXA 4JR2A 3S8EA 4N6GA 3V3KA 3D6FA 4I1RA 3V55A 1GQFA 1I4OA 1RWVA 2XYGA 3E4CA 5LU8A 2DKOA 2HBQA 2C2MA 3R5JA 3KJNA 1F9EA 1PAUA 1SHLA 3V4LA 5IASA 3H1PA 5LU9A 5K20A 2H51A 4PS1A 4FEAA 3BIJA 2FUNB 2QLJA 4HVAA 4QUBA 1BMQA 4NBNA
chains in the Genus database with same CATH superfamily
3F73A 1E2IA 1Q0UA 3K8YA 4WLEA 2BUAA 4MH0R 4F2HA 5CCXA 1SXJD 1Z39A 2R3SA 4Q24A 1OIXA 5E4JA 2B5WA 4DNFA 3KSAC 3H2GA 2P4SA 4FNAA 3AT1A 2PT7A 4FFMA 1JG1A 5L8VA 2VPIA 5DLEA 4UVIA 4GO1A 5AUPB 2G36A 1QHYA 1E61A 1X7GA 3QPBA 2B21A 1E79D 3WL4A 1YI0A 5BWBA 3P4YA 1XV5A 2AX3A 2FUG1 4MR9A 1U3FA 1D04A 2QUIA 1LGYA 4DARA 4JASB 3H04A 2BL4A 2VK8A 3ZH2A 1OWOA 2Y6UA 2DULA 4I8XA 3TTXA 5A5VA 1TU3A 1YQQA 3BERA 5K0EA 3LHFA 2Q21A 2LV8A 1E9VA 4JHXA 1EUCB 1NQWA 4GMXA 4PTLA 3WBFA 1FC0A 3E7PA 1PV1A 2V7XA 4G0OA 4OG2A 1D0VA 1YVDA 3T0FA 4HAWA 2QUHA 1E2LA 3PCRB 5KYGA 4CF6A 1GTSA 2HJHA 3DL7A 5HJ2A 4GPBA 1Y6ZA 2YTZA 4DR5B 1DO8A 2D2EA 3EQ8A 2AEJA 3IFSA 4G63A 3J7AC 4BGUA 4BFSA 4P3OA 4QXRA 3DONA 3JR7A 4JQCA 3SHQA 1C1XB 5FOUA 4G0QA 1TA9A 2IQ5A 3BD9A 5SYAA 4EY4A 1DKRA 2AFHA 3E3AA 1L4NA 5KSPA 3SN6A 2G07A 5T8KA 3NIDB 2FR8C 2PX6A 3ZN2A 4BKUA 3HYTA 2CFTA 3H5RA 1UCFA 4ZU1X 3N9IA 3DYIA 5JC1A 3F97A 1CUYA 2VHJA 3DMNA 3BTVA 3AESA 1MB2A 3DPUA 2PX3A 3WGIA 1O9GA 4YLEA 4PZUA 2XEXA 4Z53A 5CPBA 1K5GA 1KA9H 1R0KA 1U3VA 1T2CA 2YR0A 3GNTA 3HCPA 3OJWA 3T9DA 1VIDA 1Y4DE 2H1FA 1Y1TA 4ZOLF 2JRCA 5F2EA 3SICE 3VTZA 5HBRA 3UHFA 2AMVA 2VP6A 2G25A 2IX9A 2WM3A 2XB4A 3JZAA 2H7CA 5SYMA 3CRVA 3GL9A 1JF8A 4PG6A 1RR6A 2WV9A 4X45A 2PKQO 1ONBA 3ZNPA 2GFQA 5ANRB 5K1ZA 1U6IA 3JWIA 4YN3A 3ZHCA 3AZQA 1Q21A 3C74A 2AD1A 1UOPA 1DBQA 4IO0A 3I8SA 4LBZA 1PBTA 4C0XA 1ZIOA 1T9KA 1NLFA 2PYIA 3AKEA 4NJMA 3PA8A 3FPJA 1V8ZA 4ZXPA 5TJ9A 4Y2YA 5FLKA 5IH3A 5I01A 5K45A 4NHOA 3WSTA 2OKGA 3TSOA 5K8UA 1Q50A 1V11A 3KQHA 4RVHA 4ZMSA 3P9ZA 1M10A 3MSXA 4CCWA 2WMDA 4YPFA 1QCYA 4YS6A 1M5TA 3KDAA 2EX4A 5FL7D 5TQ0B 3RFVA 3ZIAA 5KSWB 4TSKA 1IBLB 1ZM4A 4C01A 1A4UA 1PN3A 1QE5A 1H3NA 1MABA 4FM9A 3KU1A 5E1BA 4KU4A 4TQAA 3OPVA 4Q1EA 1C8VB 3V2GA 5JS6A 1DMRA 5GJCA 2CXTA 2NTNA 2VUSA 3IAEA 1NHWA 3K09C 1ULAA 3MXTA 1R7RA 1TJNA 4HDMB 1EUZA 1ODIA 2A1TR 2ORED 4PO3X 1N34B 4KXWA 3F5QA 4M38A 3CR3C 5BOSA 2OBFA 1BD3A 4GP6A 4H3HB 2I8AA 5FWAA 3TEFA 4EDHA 3QUSA 1YVEI 3LWDA 3CCFA 4FIZA 4FMCB 2QOEA 1KAQA 2O2HA 1JHOA 3MCTA 5GMOA 4AKTA 5DHPA 1V5WA 2FG6C 1EZ1A 4IG9A 3F2VA 3WSWA 3ERCA 1EA7A 3ZCXA 3RPEA 3SSMA 4C7MA 2BHLA 1J0DA 4HPJB 2DT8A 2RGEA 3O9MA 3BIXA 4DLBA 3PCTA 1K3TA 3W1VA 5BW8A 1QP8A 1YNOA 2BYTA 1S2NA 1PDVA 2PSEA 2O8VA 3BH7A 1XD2A 2Y3IA 3HJAA 3PU6A 1KEEA 3QQ5A 1SZDA 3FUTA 4JKYA 4US0R 1UEJA 3HLTA 1DEXA 2QG4A 3NXSA 1DMSA 3I9JA 5IZ4A 3S81A 1LFAA 2IYNA 4NI5A 5JR3A 3DQQA 2ZAIA 8GPBA 2C92A 5AKLA 1FRNA 4LZPA 4FZRA 1GYQA 3JWEA 1MDFA 1A8UA 4WKNA 3JVDA 3F3KA 2OXRA 3JD4A 4EY7A 2AJCA 3IEXA 4HNTA 5FUQA 2AI2A 5AM0A 3PS9A 2JLVA 3I6ZA 2VI5A 1WHSA 3P2MA 1R27A 4YJDA 5BSMA 4NYMR 4LDZA 5DBOA 2JL1A 3T5MA 2EJUA 3HKEA 4UARA 1UBMS 3ZD7A 3WA7A 3HADA 3U7IA 5B3KA 4BVLA 4EPXA 5I4IA 1IH8A 2E4VA 3FA2A 3CQ9A 4QX6A 2XT9A 5CXQA 2QP3A 4RVGA 1OXSC 2WWGA 4QGFA 2GVZC 4TLAA 1B42A 3E1KA 4QULA 5K03A 3BD8A 4LYGA 1CUUA 3M70A 1XRMA 1P4RA 1VE5A 1QH1B 2V6MA 2TSYB 5AJTA 2PRJA 3FWPA 3OZCA 1GDDA 2O2GA 4LXTA 4F4CA 1M33A 4O33A 3R74A 1AKWA 3V8BA 4ILEA 3HVUA 1CRLA 2GK3A 5B4VA 4RHUA 4LJ9A 1G7TA 2JLXA 2I6SA 3KAQA 3JATA 3Q12A 4K8RB 3S6JA 1NQXA 1DE0A 1Z18A 4PHGA 3ZHYA 4BFZA 3SHFA 3QVTA 5JLAA 5KC8A 2J3QA 4AYWA 3HSKA 3AUSA 4RGBA 4MPDA 5AJYA 4BLWA 4DWOA 4MW7A 1DX6A 3H5AA 1IMJA 1SVMA 3GP8A 1AUXA 4HD8A 1DRWA 4BMYA 1AQIA 2P2DA 3CBGA 3F6RA 1S8AA 1N2OA 4CMBA 1JU9A 4IOLA 5EJ2A 4X3CA 2WVAA 3VTAA 3RUDA 4ARBA 4HEQA 5DNAA 3TR6A 5J58A 1RXYA 4ZTZB 3SR0A 1LPAB 1R18A 4QLOA 1BQ4A 3GUCA 4CT5A 3HNRA 2LW7A 3KEQA 1HQCA 4FDMA 4TZ0A 2WYOA 2PMCA 3AL0C 1P8AA 5EG5A 2ZWIA 4IMJB 2ADMA 2IZ7A 4ZOEA 3RSGA 4ZD6A 1CW2B 1HM5A 4G8CA 3VPFA 3A36A 5FUBA 5ADUS 4QDUA 1T3LA 3B89A 4BDTA 5F33A 1LF0A 2OC9A 4MWOA 4BKMA 1M34E 3UBTA 3QU2A 4D92A 2PUTA 4QOHA 2XE7A 1H6BA 1KRHA 3F74A 2AXNA 4KAXA 5AOVA 3WIVA 4DIKA 5FBZA 2OZLB 5EE1A 1YBAA 4JZYA 3UJPA 1TA4A 5HZKA 4MR7B 3RWOA 1QO9A 3DTVA 2QI9C 4NBNA 3QA9A 1FEZA 2QKYA 2O59A 1EBFA 4D0RA 5DX0A 5BWCA 2ORIA 2G09A 2EWWA 3KDSE 1FP2A 4FDVA 4ZRNA 4YMLA 4E12A 1F3OA 2CLKB 2O8FA 3KXLA 4W99A 5IF9A 1NBHA 1YACA 3A70A 3OP1A 2MINA 2XD9A 3H84A 1DZIA 1UBOS 3ROMA 4C76A 5KTRA 4UZSA 1ZHFA 1PE0A 5GZ6A 3TTWA 4B6EA 4QWMA 1P18A 2WWIA 3BKWA 3K94A 1WMSA 2VP5A 4JLDA 4Z2YA 3GDGA 1PWEA 1L6IA 4A8JB 1E3WA 3E2IA 1EFCA 1V8DA 1NNSA 1SHTX 3BXPA 1W93A 5HKKD 3VSAA 1NXOA 1M0WA 3A1VA 5G0UA 4PBRA 1JQAA 3EZNA 4XYBA 5EJIA 4WZAB 3MB8A 3U48A 4QDXA 5TMBA 4QHYA 2FWPA 3L7YA 3AUUA 1EH5A 1I4DD 2Q3EA 4HX9A 4MITA 4PPYA 3RUAA 1VJGA 3WNCA 2WKRA 3GEEA 3PG5A 4XSGA 4DKXA 1U81A 4YAIA 1P2DA 1NFRA 4MUHA 4CCAA 2VYVD 1JPNA 5AVXA 3OM9A 2A4KA 4BBAA 3T9AA 2CZGA 3QBVA 1U3CA 4HB4A 4O63O 2W2XA 4RZSA 2WSYB 3FVWA 5F4ZA 2O1EA 3SC2A 3WGTA 2XVAA 2IXAA 2BGTA 3JQAB 4Q82A 4U6QA 2DTDA 2Q5OA 3CF2A 4QT4A 4GRAA 3H3JA 5IBPA 2ZE7A 4RBNA 3HUUA 3CH4B 4CLOB 4R16A 2PGXA 3CPSA 3D3KA 3QFTA 4JLSA 4R1PA 3TLKA 2CWDA 4B6GA 2XVMA 1F7VA 3G0OA 1YDWA 4OHUA 2VAXA 4GQBA 2Q46A 4E4YA 3OJLA 4TKLA 2BFFA 2QD1A 4F5EA 1FQWA 1P1FA 3PVSA 1HRKA 2W6ZA 1DC6A 3CGGA 3HA3A 3EGVA 4L4RA 5B7QA 2P35A 4UCQA 1JFVA 3N76A 2QUKA 2GOYA 1CDOA 3HXQA 3B85A 1IY0A 5EEGA 3TSYA 5I8PA 5ARCA 1HDGO 3GGOA 2Q5CA 3VJMA 4DRXA 5L6MB 5FLXA 3AIMA 4Y0NA 3C7AA 5BQFA 1J2UA 4RFLA 4MTLA 2VHZA 3TRIA 2F4VB 1FL9A 3A6DA 4C78A 3MUEA 1SCQA 2CXHA 1UK8A 3GFTA 1QDEA 5JZMA 3BQMB 3NAQA 5JJLA 1GQRA 1VBFA 2QN9A 3K31A 1DBRA 1CUDA 2K4MA 3LWBA 1VB5A 3O8OB 3SIRA 5AW0A 4HRAA 5ES4B 1UBTS 2M6KA 2WFLB 4MJ7A 2W42A 2EOAA 3DWGA 3TFWA 1LJLA 3C3YA 3BH0A 3E70C 1VIAA 1EVZA 4I81A 4M86A 5B2ZA 2JA1A 3E5HA 3F2IA 2RHGB 4J3JA 2PBFA 1GARA 3EVGA 4MJLA 4TM7A 3AR5A 3WP1B 4E03A 5B7NA 5AHWA 3LVRE 3W5HA 4D4MA 3TQOA 4S35A 3ZCQA 4NENB 1G8AA 2I29A 3WLOA 3C8MA 2B5VA 2O0LA 2QRNA 5AXAA 4YYZA 3TKYA 1Z7GA 5CG1A 4XGQA 4OHXA 3K4HA 2DCMA 1PZGA 2R87A 4B3XA 4ER6A 4Q3CA 1J90A 2RONA 3L04A 5KYKA 4JI0B 3F5MA 4K81B 1IHPA 3FDIA 4J7UA 3HE3A 1ZIYA 2XXJA 1P6QA 5CT8A 2VEOA 1R3UA 4GOND 3TH5A 1CQWA 3VHXA 4F71A 1KEPA 3DKIA 5EMNA 5SZKB 4WBNF 1T0PA 3QK7A 2QUAA 1P31A 1J24A 3PEVA 3ZZNA 5IJ0A 3I5XA 2ATEA 1F5NA 5BNZA 1B8OA 2YXLA 4WLNA 1YK1A 1I32A 2KW5A 2GO7A 3B3QA 5FNVF 4BJHB 2FMTA 1CJMA 1BHO1 2AWNA 3K9CA 2BFCB 2FSPA 3AHEA 3GLUA 4JUFA 3QUCA 4JQZA 2J07A 5CXXA 3TPCA 1JEQA 1VFPA 2FEOA 4XUDA 3MA0A 3W9SA 3ABZA 5JCJD 5AVYA 4IIJA 4PQGA 2WB4A 3BIOA 1NOKA 3QVSA 4UAJA 1FYEA 2P2YA 1C7FA 4IP0A 4LZLA 1U0SY 1TO2E 1Q83A 1TEVA 1AXEA 2D2FA 1WXHA 3HJGA 3WAGA 2I2WA 4GWGA 2AA3A 1W1UA 2JC3A 3QPVA 4OK3A 5ESXA 4LCBA 2WYIA 4OV6B 1AHIA 5KNCD 3TL2A 1YRHA 4AYTA 4RIEA 1T2AA 1O57A 2JZNA 4UU7A 1QFXA 1WMDA 3U9LA 4BNIA 3G5AA 1WE2A 2QJOA 2E55A 4M0LA 1EM8A 2CXNA 1NA5A 2IXTA 5AVWA 2GR9A 4QNRA 4AIRA 1MOSA 5TMDA 3RHTA 1IHXA 1T25A 3WDKA 2QE6A 5HKOA 4B6OA 3U62A 2BTQA 3G0HA 3REQB 4WFKA 1VGRA 3M5DA 3I39X 1C3JA 5FUVA 2GHIA 1VDZA 3GH3A 1W5AA 2F9MA 3HJUA 4K9QA 1IB0A 5FFFA 5JZBA 1VJTA 1CUAA 1SXIA 1NBIA 4XARA 4QO8A 3ROZA 1UPTA 4D3ZA 3ZBPA 1ZJ6A 2XZLA 1SG0A 1XROA 2EKQA 2VG8A 1L4EA 1SVNA 1BN7A 3DUFA 1ZGHA 5B7GA 3H4TA 4ZI7B 1RWNA 2CMFA 1BGWA 3LUGA 1EM6A 2PMDA 4ZOLA 2RGBA 2VZEA 3A1TA 3OOEA 3EGDB 2ENUA 2VKQA 2XOKA 3KU4A 3NDPA 4M3NA 3RRYA 4C6TA 2YZMA 4R7ZA 4MVXA 4X91A 1T9GS 1O54A 3IE1A 1YZUA 1DOHA 1JIXA 4TVKA 2AEFA 2PWAA 3ICOA 4QJIA 4HXEB 1PHRA 5EWMB 2Q1YA 5LQJA 2VJCA 3DCIA 2VHYA 1T4DA 2VRNA 1H9BA 3EA0A 4O4HB 3WYCA 1AKYA 1WB5A 4RFVA 1JGTA 2WWTA 4CDGA 3KX2A 4WH0A 1A2KC 3W5BA 3NHRA 4KWTA 4ZVRA 5LYJF 4UUBA 3OLZA 3R9XB 3VPSA 2NSDA 2H2FA 3PWSA 3C3DA 2C2KA 5KJEA 2HK8A 3RAFC 2GM9A 2O0MA 2IVZA 4FYHA 2AV6A 1EMDA 2YJNA 4LYHA 1VPEA 4RCYA 4IXMA 3F90A 3WWOA 5DM60 1QYIA 2RG7A 3WRXC 3OJOA 1KI1A 3S1AA 1GKLA 3CEJA 3HA7A 1FFCA 3IH5A 5DYYA 5ELLA 1EDBA 1XZKA 1FLDA 1R12A 3AIOA 2PXCA 3I9MA 4BMPB 4FINA 3S1SA 1NXWA 4NY1A 5CDHA 2D62A 1ABFA 3HDQA 5CVUA 1D07A 2JI4A 3LQKA 5KYXB 4C0KA 1JZTA 2XB8A 4M0CA 4HT3B 2QX6A 1R5JA 1UIMA 1WZEA 1DC7A 3Q2IA 4ZFNA 2A4MA 1HGXA 4JX8A 1J23A 2FUG6 1E79A 2PANA 2XQFA 5AH0A 4G41A 2Q3DA 4TYMA 4Y30A 5C8XA 3L2OB 3HVHA 4GH5A 3U3JA 4KNYA 5DK4A 1X13A 2PQ2A 2GRAA 3R23A 4DM4A 1K89A 1DHRA 1NFQA 1XCBA 1Y8AA 2J5BA 5HEKA 1Z16A 2FPOA 3PR3A 1PUJA 1WU8A 2GEUA 3LGXA 4FSXA 4GEGA 4PYNA 4XWGA 1AG9A 3EEQA 4EGFA 3DM5A 4NCXA 4TYWA 2BGUA 3H1TA 2FF7A 2XUKA 4XB6B 1Z56C 2FWBA 5AOCA 1Z6TA 2DCUA 4KXUA 1C4OA 1HY3A 1U2GA 1I3CA 2H2WA 2RHHA 1UXIA 3PFCA 3WGQA 2IDJA 1T9AA 3C6YA 3O91A 3UK0A 3CRMA 2AN3A 4LDQA 2V97A 3PQ6A 1FJHA 2B4TO 4RF2A 5C51B 1R15A 1Y89A 4R0VA 3RBVA 3CX6A 3TQRA 2E5LB 1XI2A 2H8KA 4B35A 4R3WA 5H68A 4UUOA 1KS9A 1NU6A 3T1YB 3HMKA 1A72A 4PO1A 3DWIA 2O5RA 5LKRA 4C7JA 1I7QB 1LNQA 3CN7A 5IYZB 2WTAA 5T4EA 2I22A 3STTA 3KPWA 4LF9B 1U7DA 1F0KA 4G4GA 1RHKA 1XEFA 4YLGA 1J8YF 4QBTA 2IK8A 1XK7A 5AW7A 1KOLA 4ECEA 2JDIA 4WZ6A 1B43A 2NX2A 5EHNA 4QATA 4JBYA 5LZ9A 1E0SA 1AH2A 1DV1A 1I7DA 2ZP1A 4L02A 2FQQA 1KH2A 1QG0A 1CR4A 1ZN9A 5DGIA 3ZK9A 4ZYZA 1ECBA 1FS5A 3FXAA 2JHAA 3SJBA 1B8VA 2NVUA 4FLEA 3KR9A 1KJYA 3TK1A 2JLBA 1JQEA 5DT2A 5JMOA 5CBKA 4L5CA 2G7ZA 2CMHA 3QVOA 3N28A 4ZVSA 1XZ8A 3IT1A 2VA8A 3JQ9A 1Q6ZA 3VDXA 4PZ0A 1YAHA 3NMUF 2P9ZA 4XYGA 1Y4SA 3WK9A 4W5HA 4DLLA 2W8BB 4BV3A 1M0EA 1NQ5A 3AIKA 2CEKA 1P0IA 3LRTA 4G5GA 3GFRA 5BSWA 2RHLA 5DXFA 2FWNA 1OXUA 2O50A 1TQ4A 4RZ3A 5EP4A 3S3TA 3R4VA 4LDRA 4IUBS 4Z9FA 2ES4A 4XJVA 1G21B 4KYIB 4MWEA 2IC5A 4QIHA 4EB3A 3ZQKA 4EYKA 4GM4A 4IDOA 2YVAA 2HXYA 4IGEA 5IEJA 4AQ7A 1JRLA 1OAOA 1IQPA 1QLWA 2ODPA 3SE0A 3HU3A 1W4RA 1FFBA 3M1IA 2HMWA 3DEYX 3PYMA 4ZVPA 1UM8A 4ZCPA 3WB0A 2QVBA 3CC8A 2E85A 1RJ9B 2JNWA 4G5HA 3GNLA 1ILWA 1YK0A 3U3OA 5KVCA 1HOXA 3NUGA 1D2AA 2IEBA 3LOUA 3QPWA 5DWQA 5BUCA 3LPLA 5ITSA 1PL7A 3VQTA 2N47A 1I6WA 4Q21A 3DAGA 1K6EA 4YX9A 4PZ9A 4FCVA 2DF8A 7GPBA 4RKQA 3NO4A 3KOOA 4KL8S 4YJ2F 2YWBA 1HR0B 3EHDA 1FNSA 1GT91 4MO9A 4RQUA 1VG0B 5CLIA 5ARDA 4R9SA 2XDYA 2Z2KA 3L1JA 5DSTA 2GKGA 4I1RA 2WPDD 4M7OA 3FDZA 4FWIB 4NFLA 1V1JA 5JSZB 2AG6A 2QDKA 1E7MA 3ONFA 1QGYA 3OF3A 4DC0A 4QGSA 2P9CA 1V8OA 4RY2A 5HXAA 4JIGA 1T6BY 1QP4A 2BGIA 2ZSIA 4RK1A 4R0NA 2NQ2C 4FX2A 2YV3A 4TMTA 1J39A 3U7JA 4NV0A 3B1VA 2BDTA 3FNQA 1NX6A 1YOVA 2HTEA 2YOGA 4S24A 2JVIA 3FAZA 5KTKA 3CLTD 3JQCA 1XLTA 2QU7A 2BI7A 3EE6A 5K8LA 3C15C 3SBXA 5IM4F 4IMIB 5AICA 4QZVA 2F8LA 4FYJA 2RJ3A 4YWHA 2X7HA 1A97A 3DW3X 3HCEA 2ZIUB 5GVSA 5DGDA 3RVBA 1PS9A 4HBGA 4I5FA 5CMLA 3QKSA 621PA 1PR2A 4A1OA 1N2IA 4IX9A 5FP0A 4NJOA 3U7RA 4BP9A 7REQA 1TOAA 2ZRMA 3R3ZA 5T8KC 4LZZA 2I1LA 1WXWA 3PGA1 3PNQA 3E7XA 4W9RA 4R9NA 1XTQA 2XY4A 3N3BC 1QH8B 2NGRA 2YNMC 3HY3A 3JQDA 4WFQA 4RX1A 4HB2A 5F73A 2ZRFA 4RF4A 2BFPA 1L3CA 3ZYCA 4X61A 4PBTA 1KJZA 2AFHE 3I2JA 4GM0A 2BP7B 4HH1A 1PD1A 2H8GA 4YRRA 3E7DA 1I9CA 4NJEB 1GTRA 2H1IA 4MV8A 1MPTA 3DBRB 3HJCA 4EHIA 1ADBA 2IWHA 3LP5A 1DCTA 4JVSB 2IDZA 2QVZX 4PFJA 1U8XX 3R75A 1YJXA 1Y5LA 2DFLA 2OHHA 2Z1MA 2HYDA 3AZPA 3BMNA 1JYEA 4FC6A 4EGCB 2Z5LA 1KO5A 1Q17A 2PKYX 4EO9A 4QGAA 4Y2HA 1Z4NA 3WMGA 5FPSA 4ADSG 3GAFA 3V4PB 1B1AA 3EH2A 1LTKA 3JQ7B 1C4XA 2QTRA 1JBKA 1RP1A 1TMKA 4H7KA 5CIQA 1NQUA 2IOFK 3T3MB 3UAGA 2D0DA 4CEHA 1MFZA 1K8XB 3G2KA 3K32A 2GN6A 2ISSD 1X7XA 4BO9A 1R0BA 1UEXC 1FNDA 2Y4OA 2RG1A 3LCCA 1X92A 2QA5A 1VJ1A 1ULUA 2I6QA 4WN9A 4KQFA 3D7NA 3EODA 1ABBA 2WJJA 3F8TA 3W2GA 4ZOQI 2H9YA 3R5KA 4RF5A 1S2DA 4C1BA 2JHFA 2QSYA 4MGYR 4IF6A 2QRJA 3FVTA 5CDFA 1CS0A 2WAMA 2YASA 2CT8A 4IHKA 1Q92A 3EK2A 3INYA 3MHTA 3LXUX 2IS4A 4REQA 3ZGOA 3FE2A 2ZCJA 3QVLA 2EQAA 5BWOA 5C7OO 3F7MA 5EZYB 1H4VB 2QEQA 4R8VA 1GZUA 2BBOA 3GW8A 4R05A 3AV3A 3VTKA 1UXJA 2O1XA 1KVRA 2ZIZA 3L8HA 1UM9B 2Z5GA 2GD6A 3H86A 4ZRDA 1MAVA 3OZXA 5F64A 3A31A 4HUQB 3UMFA 3UT0A 4CQMA 3W1EA 1PW7A 1KSJA 1BGXT 2Z9BA 3E84A 1K7YA 1SOWA 4F5ZA 3NHKA 1EDEA 2H0RA 1V3VA 1K6JA 3QPDA 4FCWA 4NBKA 3S68A 2CLFB 2EBUA 1MAWA 2MMGA 3VI4B 1WDKA 2QHXA 1BXGA 1MVNA 1N5IA 2C1EA 4EM6A 1G38A 5A71A 4DREA 1VPTA 3WLTA 5AVSA 1GXSB 2FEXA 5TT0A 3QVKA 3K6SB 4Z4IA 1D7AA 2JA2A 5GV7A 4LHVA 1C3OB 1G18A 2QT1A 3I2GA 1Y3BE 4U2EA 3ZK8A 2WSMA 1NDUA 1N5KA 4MUMA 2JD1A 4A2WA 4NF2A 2ZR7A 4JD5A 1XDZA 4PY2A 5B4TA 3WWDA 4AL4A 1BKDR 1XTZA 4G5FA 2ZXUA 1GZ3A 3FDFA 4L8WB 1NW5A 4XB1A 1RQXA 1RZUA 1G5HA 5AVQA 2ZR9A 5DYIA 1PFWA 3QJYA 4NMMA 1N6OA 1CQJA 2Z8YA 3VDQA 2X0EA 4BB0A 2GWRA 1UT8A 2QG6A 3QLVA 3WL5A 2EG9A 3LY5A 2FSVA 4PGAA 4GKKB 1KAEA 1OUMA 3GA0A 3I12A 4LKOA 1IXZA 1R5NA 4N1AA 2VDUE 1PNRA 1I30A 2FX3A 4RD2A 4Q9AA 2A9VA 5KNDD 1L7DA 5JY1A 3QFFA 1PG2A 2V1XA 4L2IB 4MAFA 2EU8A 2FH5B 1EFUA 2PRKA 3KIPA 4MMYB 1JDVA 1KYIA 2NG1A 4OXXA 5AJZA 3THOA 4DDTA 3I9V1 5A04A 3LZCA 5KNBA 1J0EA 4MI3A 3THSA 2PFGA 3MS4A 4JCCA 3AG5A 3KXKA 4N5IX 2L42A 4NYMQ 1M74A 3EYAA 2DERA 4XQ9A 2C97A 5E0OA 5K3FB 2B9VA 5KYWA 2CNKA 2JLAA 1QKIA 4LSZA 4WA7A 4P3NA 2BRUA 4V38A 4HWGA 1JI0A 4EX6A 2H2DA 4RH1A 3HB5X 2X1VA 1JJIA 1XMPA 4BOYA 3FPKA 4HF7A 4JEHA 1SUWA 3TBKA 2VYFA 4PIVA 3WYEA 5ITZA 1JLSA 3UXMA 4RVUA 3UAVA 4YDHB 1KSFX 3DFFA 3C1TA 3VRHA 2BTOA 2HDOA 1SU7A 4I55B 4Y9DA 2GKOA 2P78A 2F6RA 3PUYA 2Z2YA 4TZKA 3VOBA 4ZJPA 4FHGA 2E4AA 1JQ5A 4P9NA 1U2DA 2ZJ2A 2KPOA 4BQPA 1EYZA 1LXCA 4KQKA 1ZINA 1GM5A 3N1UA 5ALKA 3SCZA 2HREA 2VJBA 3GPBA 3AY3A 3IP5A 2RARA 2VZLA 4GQAA 4NOJA 3HYSA 3UVEA 3RF7A 1K4MA 3DYVA 3IKMB 4BN4A 3UOAB 4QTYA 5ALLA 4QUIA 1EVEA 1JHYA 3LC7O 3X1KA 1MB3A 4Q39A 2CHFA 4PZZA 4TMVA 2B2NA 4K9SA 4LXIA 3UK7A 3EZ7A 3E9CA 1QSGA 1XEAA 3EXEB 3L05A 4ND4A 5BOVA 3T6KA 3NHUA 1Y3DE 2OQRA 4KXMA 1MJHA 1Z6ZA 3PD1A 5F52A 4JXZA 4YWJA 1KQ3A 1Y8RB 3SLKA 1F38A 3EA5A 2PZBA 2XWBF 4ML3A 5EE9A 3B48A 4ZI2A 2JI6A 4RVDA 4DYVA 3PIDA 4E2YA 2DZDA 2JLWA 2BC9A 2WRZA 1OLOA 2OB2A 1QVWA 3NWJA 3V1NA 2ZYGA 3KALA 2O8CA 2VBGA 4ICIA 3ESZA 4OHFA 3Q41A 1KBZA 5DLQC 1NWCA 4J49A 1NV8A 1YBVA 2PL5A 4XIGS 3WDLA 2ZPAA 4R8RA 1E1RD 1T3ZA 1V6CA 1WD7A 2B36A 4N82A 5K99A 3NR2A 2UVQA 4NU8X 2QJFA 5G41A 3RAPR 2Q5QA 4KQ2A 2XMBA 2C2HA 3SHOA 1N8NA 2PHZA 3A26A 3EMVA 4IFTA 2FG5A 1YONA 2ZIAA 3PGLA 1QF9A 4IKPA 4PSVA 3N2GB 4Y1EA 4Y2VA 4RQAA 2JFGA 3T1QA 3V2UA 3PEYA 1I4OA 3I1FA 1M66A 4P4SA 3PYLA 4QDTA 3GBSA 3RNLA 3OOHA 4CF3A 5JVDA 3KXIA 4GPD1 1H2YA 4DLTA 3H5VA 1G8SA 3PTZA 2XT0A 4L4YA 4LOIA 1HBJA 3KQMA 2VQ3A 2MYPA 2IYOA 4DZTA 3OT4A 1F0NA 1U8AA 1O96B 1IATA 2KHZA 2QBYA 5CU7A 4J0FA 3BTOA 9LDTA 2FOXA 3MT9A 1XP8A 4BVAA 2OV8A 2XYHA 4BO8A 1W36D 1RACA 3P96A 4XQ0A 1Q7TA 2IHYA 2WF6A 4KAJA 4F9TA 4MEBA 3CSSA 3F4BA 1I33A 1CUVA 1NGSA 2BMVA 1C7QA 1BXKA 1ZJZA 2BKXA 3O1LA 4QAJA 4V03A 3ZDRA 4DXDA 2CCJA 4BIIA 1S8NA 1XG5A 3AU8A 3KB1A 1UJCA 1FUEA 4U02A 4L28A 1WAMA 4A2QA 3AF4A 4RW0A 3EQ6A 1YDEA 2XE6A 5DU2A 2EFYA 5A5FA 1U6JA 5INTA 4IDQA 1Y1QA 5C8YB 4GPZA 1QZ3A 2MR5A 4QYIB 1R6XA 1HYHA 1ES9A 3WB1A 1GNQA 3DEIA 3HKBB 1NW9B 4L85A 1GGMA 1G66A 3UAOA 2GJSA 1SC4A 3TNDA 5L4LA 1EXMA 1TQ6A 5BVHA 1EUYA 1SG6A 3C3MA 5J4HA 4P98A 4PEVA 2XNDA 4PHTA 1DKPA 1B16A 2GXQA 5ALTA 3ZK7A 2WG0A 5KTNA 4KIJA 1W4ZA 4DANA 1B23P 3HGQA 3OIFA 1NSTA 4PSAA 1DOZA 4NMWA 1EVLA 2A9OA 2C5SA 1YMVA 8OHMA 3LWZA 4BPBA 4YCDA 1Y7HA 3VKHA 1E2PA 3RFUA 3WKAA 3IPYA 2P6PA 3T3EA 2JFVA 5JH7F 3IR5A 4GXRA 4IDGA 4LX8A 4YP7A 1K68A 5FQOA 3KD3A 2BFAA 4KIWA 3UUFA 1N7JA 1X8XA 1R8SA 2HTFA 3V4SA 4LFBB 2PH7A 1U28A 2JIZA 1P44A 1R0SA 4BMSA 4TTIA 3VZSA 3EEYA 4TLCA 4YBRA 3AB3A 2H11A 3FKQA 3PHLA 4EITA 2OQVA 1TADA 3G85A 5FAKA 4RKFA 3UW1A 1A76A 3WLFA 3KVRA 3DZHA 2Y1LA 3QIAA 4CLXA 4FSHA 4L8LA 3QSYA 2Z3VA 2DR0A 3LX6A 5GM1A 3VU9A 3KKNA 1EK2A 1FTSA 4QUAA 3ZS9A 4DMHA 1J9ZA 4I4TF 3ORQA 5DM0A 1JB9A 4OAQA 4B3GA 1LKZA 2QIPA 4IWNA 5C4MA 1J99A 5LNK1 4ESVA 4MPPA 1I1NA 1UJBA 2FEPA 3NWEA 5FA8A 2IYPA 1M6VB 1TYBE 4RHFA 2ZAMA 1SAYA 1WULS 3O0DA 2WF8A 2C0PA 4MUEA 1QQ6A 3KTFA 4TGLA 3WWYA 4M9XA 1YZLA 4IFIA 4W82A 3SPXA 3WK7A 4YJ2A 5JJ5A 1J6UA 1JDBB 2ET6A 1J21A 5K0LA 1JQLB 1PSDA 2QY6A 1ZVQA 2G77B 2J48A 4C0HA 2O7NA 3GCDA 1ULBA 3FIUA 1M0TA 5K0NA 1E18A 3U16A 3V2HA 5LXTF 1RTTA 1ZNWA 1GQFA 1L5VA 3U7EB 5JS2A 2ZTMA 2NTVA 4JWTA 2JBHA 4KITB 3CEMA 3HVJA 4MRPA 4QBGB 4QDZA 1ZBDA 3MJVA 1YS1X 1ORHA 3RUFA 2BCJQ 4JT2A 3PSAA 3RYFB 1KR2A 1JKXA 3EDCA 4MS1B 1ZLYA 4K46A 5IM4A 3D4NA 1XWWA 4QUBA 4EKEA 3JWHA 2B1QA 4YP5A 2RI6A 2BIFA 4BKQA 4UUNA 2XCIA 1Z2CA 1PT7A 5FR1A 3C16C 5FA6A 1KZ9A 1SK9A 1S4QA 5DYGA 5AVZA 1Z6YA 1TMYA 3MEQA 5HF5A 5K4GA 4A15A 3IB6A 2Q5HA 3B9PA 4J90A 1TCBA 4MO2A 3ZYZA 4JGBA 2VJDA 2YBEA 4EFDA 3AH8A 4JYBA 4TWZA 4UQPA 3GFBA 1F6DA 4TTAA 4X54A 2FSFA 4N5DA 3V8RA 1G3QA 1LQTA 2O4CA 5TIIA 1A9PA 2VCEA 1Z06A 5DHTA 1G0OA 1ORWA 3JAMA 1JMYA 2C7BA 2C03A 2CVPA 1DJNA 2D8MA 2EZ4A 2V6GA 4I99A 5CM2Z 1B15A 2Q6LA 4P35A 5TDHA 3HXLA 1Z75A 1UDXA 2C3PA 4MQLA 4EYEA 2GI4A 1F51E 5SZIA 1ARZA 1T9HA 1ZYUA 1UBCA 1HDCA 3N7TA 4JOQA 1SC9A 1U0LA 1QP0A 3BL8A 4TKUA 3N2EA 4NHEA 2PU7A 5DNYB 4PFSA 1KDPA 4HWPA 2IKQA 3EXIB 5D00A 4OK6A 4LIPD 5E6SA 3SF0A 3D43A 3C6XA 4AZ3B 2PRIA 1NLZA 1UK9A 3LOPA 4X44A 1L4YA 1YB1A 2XQKA 2ZBPA 3LUDA 4I19A 3NJ4A 3SF8B 3SR4A 4KPEC 3GVIA 3C3XA 4P2BA 2A9FA 4FOOA 5T7BA 2YVUA 3CW8X 3O8NA 2QORA 4LJSA 1HE4A 3EIOA 4IQ8A 3CVXA 2EC5A 2DAPA 4FD2A 3ZVMA 1Z0KA 3DAYA 1RZRA 2XCUA 2Q9CA 5F1KA 3MINB 3TNJA 3G9QA 3QUAA 3DMTC 4MV3A 3W9YA 1AQNA 1FXSA 1C9KA 4E2WA 2LP4Y 3A9UA 5IAEA 3A25A 4RFSA 1FFEA 1ND5A 1NUHA 5TR9A 5IDXA 1KRWA 1SXPA 5E6RB 1X1SA 1MX3A 3OFSA 2DR2A 2G71A 2YV2A 4MW9A 5EXXA 1IM8A 4BRZA 5JO0A 3RS7A 2M6SA 3WXBA 1CY8A 3DLTA 5TQ2B 4BO7A 4QHSA 4JU8A 2NVOA 3M9XA 2AN1A 4H27A 3MT0A 4YRSA 4BGIA 1U3WA 3GU3A 3TIGA 2JIBA 2XIQA 3EBPA 2E48A 3ZLBA 1JYSA 3VR5A 1L1EA 3UTDA 3S2SA 3IDFA 1OTHA 2MTBA 1ISPA 4EHFA 5HCNA 4F21A 1E9AA 2OCIA 3SNKA 4AS1A 2R4UA 5BURA 5EJ8A 2PVPA 3FR7A 1EE1A 3JW8A 3I1JA 5TY0A 4DEVA 4XWAA 3CB2A 4RY8A 4URFA 2AN9A 1Y6GA 3VNBA 3HO1A 1U2GC 2KYRA 2VCHA 3BORA 1QK3A 2NZ8A 4E3ZA 3O4RA 4EK9A 3G5UA 4HAUA 2FPIA 4GIBA 4RC9A 1YI1A 1E59A 4AJNA 1NX9A 3A10A 2NO0A 2X9NA 4YUAA 4OI0A 4NPAA 4KQXA 4G4SO 3ZE2B 3OEED 1COZA 2VBIA 2QGFA 1Q0ZA 3NEAA 2YOHA 5E1OA 3AOEC 5TEVA 3RJ5A 4HATA 4P34A 2WYVA 5A5DA 3D0QA 3UF0A 3AMVA 1DC8A 3RU3A 5HZHA 1TCUA 4WECA 2XDQA 3TE7A 4DIFA 4GF5A 4BXOB 4JL5A 3TR0A 2FJUA 4HFJA 4QOJA 1KO8A 2EP8A 3G9XA 3NS7A 3RVRA 1WWKA 2VAPA 3MB5A 3WGNA 1CY1A 5K6AA 4GXQA 3TZBA 2OC4A 2WAAA 1GNPA 2YVLA 1XZFA 3JQ9C 4YRCA 2I66A 1WPXA 4V1CA 2A0UA 1E9DA 1YJ8A 3EIUA 1GLGA 1TKAA 5FWDA 1K4KA 1I1QB 3SWWA 2GM4A 1RAHA 4GLJA 5CX4A 3TBFA 2XAAA 3G17A 1V9CA 3WE7A 5CH8A 1PEAA 1ORVA 4AN0A 3SSAA 4JYZA 1VKZA 1U7XA 2ZRJA 3Q9LA 4CLDA 3Q8LA 2DEUA 5DBFA 1E63A 4GRDA 1O6GA 5EZSA 3FCXA 4OGGA 1RCTE 3DV9A 1GA1A 4FWTA 1IN6A 3RS3A 1DAIA 1UDRA 2XADA 3L77A 3I6MA 4X1KB 3FBTA 1YCDA 4C9BA 3EFBA 4E5MA 4D9CA 1IHUA 1OAOC 2FK7A 3G1WA 3QF4A 3P4XA 2CSXA 3PUVA 3NKFA 1JKMA 1WZCA 4D44A 2C31A 2XTMA 1FFWA 2O20A 4KSCA 3PX3A 4WKGA 5AO9A 5AIAA 2HJ9A 3STUA 3HJFA 1CUZA 4C3ZA 2OGTA 2XUDA 3E3LA 3WNVA 4CF5A 1J06A 5DRYA 4O4JF 1G5PA 2BY4A 1R4MA 2C9MA 3T3DA 2BEJA 3INNA 4UJ5A 1Z83A 1UMBA 4MVJH 3ZXYA 3Q6MA 1SU8A 4QL3A 1F5SA 4OGFA 2X3UA 3ZHRA 4A0SA 4LW8A 1DG3A 1W2GA 1UFKA 1BQEA 2OHGA 3BQ9A 4XR4A 2WWVD 4ZXFA 3WP0A 2AZ4A 3MS7A 3N6XA 4PYMA 5EUCA 5KTMA 1Q0TA 3VPBA 2N1MA 1RMTA 3L7JA 2OESA 4KO1S 3DLAA 4IQ0A 2QQGA 4D6YA 1YRLA 3Q9SA 4BASA 1VL2A 1AO3A 1BS2A 2AYZA 1XKLA 3EY4A 3JYLA 3OJEA 4XKJA 4ZJUA 3NBYC 1C0KA 3W6ZA 3EARA 2IHJA 1CX9B 2IU0A 4MIYA 4NMLA 3KKPA 5G1PA 5A9TA 1CC1S 3SZUA 3E05A 4F3CA 3RGGA 3GNSA 4Y9TA 3H16A 4KLAA 4YFVA 1CYEA 3ACCA 3B60A 3OETA 2OXEA 5B57C 4F93B 2F8MA 2JFFA 2PM8A 1BJRE 1J1UA 3BKXA 4MV1A 5DI3A 4F96A 4PVDA 1XNJA 4UAGA 5D6NA 2GARA 3K9WA 5DBGA 1VLVA 3HJBA 1YZQA 3LKBA 4KH1A 2X2FA 3DTTA 2FE1A 2WZCA 1SQ0A 1SC1A 2XCRB 2OP0A 2O7QA 4CNBA 3MWLA 3FOZA 1VLQA 2IITA 4OBEA 3TTSA 1YKSA 3C5WP 3RUPA 1T4BA 1Z4OA 4GX1A 4W6ZA 1NVUQ 3LIPA 3MOIA 5DHUA 3U4IA 1CZHA 1N0IA 3LDHA 5HRAA 1E3TA 3W3AD 5D01A 1ZUIA 3DO8A 3OWOA 4OMFG 4UTRA 5IVKA 1NG1A 3PA6A 3R3WA 1SHLA 2C84A 4J3NA 4ZHSA 2PUWA 4AX4A 4EJMA 5LDGA 1B8UA 1OXXK 1OFHA 3D3EA 2CFSA 4J1TA 4WI1A 5DISB 3RKSA 4YYEA 1A9XB 3BRQA 1Z68A 3WB9A 2OG2A 4PAMA 3U19A 1OFTA 4EI8A 3V7FA 5C7YA 2BFNA 2VHQA 4ZDJA 2W7TA 5JXIA 4RTKA 5FBKA 1L4GA 1PQPA 4O4LF 3HYRA 4OI4A 5EFZA 2BM1A 3Q9NA 3RK4A 3V2IA 4CUZA 3LUHA 1C5KA 4HWOA 1E0KA 1IXRC 3IILA 2JGNA 3ZS8A 4F72A 5JD3A 4R31A 4OP2A 1NVMB 3DCJA 1XLUA 3A06A 1DQYA 3GGGA 4N7BA 3WLRA 4RK7A 3DHYA 3R6GA 3TLMA 2JJYA 4CI9A 5DX8A 2QAGA 3NHYA 3TMAA 5IT9A 3L7DA 3H0EA 3FOBA 4B8YA 2AMLA 4WXRA 1G8JA 4DA4A 4LSMA 2OXTA 2CXSA 3WSVA 5BYAA 2RC5A 5IDYA 4D81A 3P71T 1SIOA 2CL6X 3JXEA 3FVQA 3OVMA 4I46A 2CWWA 4FN5A 2Q4EA 2R47A 3N2ZB 5CNKA 3CUKA 3OFVA 4JBGA 4D7AA 5CDFE 4ER7A 1JHUA 1G4AE 2ZGVA 3PQEA 4KWEA 1XNGA 1ZMRA 4MMXB 3LLCA 1BX0A 1KAMA 1N3LA 2AFVA 3JQRA 4HMPA 3W6UA 1F20A 5JNWA 1YQXA 4C1NA 1NE2A 4PAGA 3AQ4A 5HQJA 5LC1A 5GV8A 3MIZA 3OJXA 5J5CA 5FLEX 4ALLA 1R3DA 4LRSB 3N2YA 4TM8A 1O8CA 3T7AA 3ZW7A 3TE6A 5JCPA 4K88A 3KQUA 1USUA 2EGGA 4LWQA 4B6PA 4AXBA 3W8RA 2O8EB 4BNWA 5CDUA 3OPQA 2BKAA 1E7QA 2XF2A 1GKYA 4J03A 1NUUA 1FUYB 1ZH6A 3ZXSA 2W0MA 5AKYA 2P0YA 5ALFA 3R9WA 3RG8A 4ATNA 4F46A 1Q0PA 5HDQA 3QTTA 1TW3A 3R0XA 1UBKS 1ZD3A 2IEZA 1TAGA 2CKMA 3P9KA 1X86B 2F8TA 3ETCA 4I4TA 4JLJA 1G20B 3K0SA 1NULA 3TL3A 4E4TA 3NPMA 1VHLA 1A5TA 1RYBA 4L75A 2WHQA 4B7UA 5I7UA 2GXUA 5HILA 1E1RA 2ZDGA 3OLVA 3MF4A 2JK0A 1XEXB 2OLEA 1IQRA 5IXYA 1U11A 1YJQA 4DNXA 3EEBA 5J4VA 1SA0A 1W4LA 3QLVC 2FSVC 5A9SA 5MFPA 4N65A 2HPVA 4KQMA 1P9OA 1RLUA 4HEA1 1H2RS 3M83A 1MLDA 1P0FA 2YUIA 3IGFA 1RYDA 1P7PA 1S3GA 1PO7A 2IHBA 1NKSA 2TMDA 1N3BA 2EHDA 2LCQA 4ETNA 3OY2A 5LXTA 4IEIA 5K3EA 4WPGA 4IIEA 5CUQA 4OGWA 3Q6NA 3DKKA 3GUYA 1V8PA 2PQ0A 3BC1A 4WNYA 3UEOA 1QC5B 4BFVA 4XVCA 4YRAA 2IYLD 1D2NA 3Q10A 5DRTA 3GCZA 3AR7A 2PH5A 1XRRA 5H16A 1U0FA 2BONA 4PYJA 3NOVA 1FE8A 3JQPA 5JASA 2BRUC 2Y1KA 4PU0A 4S1TA 4DV5B 5F2OA 1TKRA 2Q8QA 4MQBA 1TA0A 3O2SB 3NU1A 3QI7A 4HFNA 3ZE8A 1B0UA 4G4JA 1YFLA 1GQYA 1GPLA 3GCGA 4QRIA 3WJ2A 2EP7A 3ED1A 4NCHA 1G0NA 1A7UA 3PE6A 4GYJA 4ITVA 1IB6A 1FYWA 2D4AA 4Q48A 2D1FA 1R88A 4I2VA 3WDMA 1JDNA 2MDTA 3QLTA 1DJQA 1G6HA 2BGKA 4PNPA 5HG0A 5LMUB 4YUYA 2C5AA 2PD4A 4GMKA 4MA4A 5L40A 1GUZA 2PAFA 4RACA 1J0CA 4Y7DA 3RARA 5EXDA 1EFRD 2ZSUA 4C5BA 5E4TA 3LSTA 4TTJA 2KMLA 3THWA 3ML1A 1QG2A 2JFYA 2IOHA 2PR2A 3GJQA 2WUDA 2R79A 4XTRA 4RH3A 1T15A 2C4KA 1WUJS 3DT8A 3L4BA 3P27A 1YRYE 1ZLXA 1BFKA 2EL7A 1HFWA 2VPZA 1V9SA 3HEBA 5ESRA 1JJFA 1XZJA 1XZIA 2PGIA 4QPJC 2HCBA 3FJOA 1KK2A 4W1QA 1MAHA 1YZKA 5TF4A 3WO1A 1RT9A 3E9NA 3CINA 4DIDA 2FPPB 4EIWA 3LBAA 3LQ4A 1BFUA 2NUAA 2QDXA 3AX6A 2YICA 4QE3A 1HYEA 1ESDA 3GY0A 3B78A 4M0UA 1FNCA 4MX8A 1HKHA 2IYEA 3QENA 4DBVO 2B20A 2BFBA 1HL7A 5IDQA 3IRVA 1T35A 3P0FA 5B37A 2VJNA 4ALMA 2X58A 5TARA 4P54A 3TNFA 3BHJA 1MC5A 4GBMA 4HQLA 1YE8A 4LV6A 1B3RA 2ADFA 3P0RA 4RORA 3EBLA 3PEUA 3CBQA 2C95A 2GA9A 3CF4A 4LZNA 1JLLB 3P26A 3KKQA 4MKXA 1OASA 2V3WA 3CR8A 3M4NA 3MIIA 3QPAA 2FLWA 4B6RA 1Y8QB 1P1HA 1QE3A 4QKQA 5IANA 2D5IA 1HDRA 4CM8A 1Z63A 2H85A 1TAHA 5E2BA 3VR6D 3PQDA 3FNRA 3P9IA 4L7VA 4NMHA 1CU1A 3TZQA 4CKZA 1YO6A 3K0KA 4KGDA 2H1OA 1WUIS 1WP9A 1OREA 1P5ZB 1PX2A 3EXG2 1N2CA 2XQJA 3JQBC 3OQ6A 4TLBA 2VPWA 4UCXA 3CT6A 5KQPA 4LGYA 1FPMA 1RLMA 2YIJA 2WJ6A 4FFNA 4ZKEA 3WIDA 4OLBA 5CHEA 5C1DA 4LMRA 1OJ7A 2ZRPA 2G0NA 3GLTA 2AK2A 4PC2A 4B46A 5BUQA 1AB5A 5BNTA 1QR6A 2PGDA 4TS3A 3RRFA 3V33A 5K0CA 3DT9A 1QB8A 3M6WA 4TUYF 1TPYA 2NU7A 4U9UA 1R4NA 4RV9A 3GELA 5BT8A 2ZOSA 1NMXA 2PZJA 1GZHB 5I9SA 4F9GA 2ZBVA 3O47A 1PLJA 3EZLA 4IX1A 2WF5A 4WZBE 3MMXA 3WKCA 1L4LA 3ZLJA 1B6SA 2RK4A 3BMQB 3Q9UA 2PKRA 2W2LA 3DFZA 3H4IA 5JQGB 2QRMA 2NT3A 3N87A 4YRBA 4EY5A 3Q2OA 1ZXXA 2QSZA 2G1AA 3K0FB 1WM1A 3RI3A 3U39A 3HCBA 4HTFB 2WG2A 3MG9A 3CX7A 4Z8XA 4BMCA 1T26A 4DIEA 5FTJA 1L5GB 5BWMA 2L2QA 2K7FA 3UPTA 2ZVPX 2VP2A 2WJ3A 4LMBA 4JP3A 4FGJA 2GPNA 4UBNA 3DE6X 2QLJA 3JD0A 3UA3A 2M9MA 2OOKA 1CD5A 1IRIA 4L95C 5JXWA 1H2AS 4G81A 3UT5B 1DLIA 4F11A 1ZSVA 1GSAA 2BFEA 1YR1A 2JGRA 4QPCA 1MABB 2POQX 2HHLA 4YC7A 3FTDA 1MFPA 3O2NA 2DKNA 4I08A 5B3AA 2ZT7A 3LZ6A 1LUAA 4EARA 4AJ2A 1Y9JA 1N4AA 3CHYA 521PA 4EMUA 2IBMA 3BK1A 1XRNA 2UZ1B 1P19A 2WHXA 3E81A 3IDSA 2PSJA 3QBJA 3AEQB 3E9DA 4MYTA 1J70A 4CM1A 4EI9A 4DUGD 4POOA 4UM9D 2QD4A 5K2OA 3PSHA 3LTEA 3Q3VA 4U6NA 3VI3B 2P6NA 1OH5A 1AT1A 2J85A 1YZVA 3BFPA 3OQ1A 3RTCA 1PL6A 3PWZA 5KREA 1J25A 2ABWA 2BPOA 1QE0A 4M49A 1UP4A 1WIWA 1OWMA 2X8JB 4ES6A 3OZSA 1U28C 5KU1A 2GZAA 1OH8A 3Q8XB 4YR7A 1V7PC 1YHYA 3EFOA 4MDHA 1MU0A 2XVYA 2JIOA 3AJEA 4KP7A 2OLKA 3VH4A 3OIVA 2CFOA 1N3IA 1D4FA 2ONYA 1K9SA 4OQQA 4PAQA 3ASVA 5ECGC 4X64B 1S01A 2WPNA 2HQ1A 4OSPA 3HL0A 1XEWY 4FGZA 1KZYC 4HXFB 3DL2A 2J30A 3GRCA 4O0MA 4H1TA 3O93A 1OWLA 3FNGA 5C81A 1DELA 3QHPA 4JYMA 4YJ3F 3LSYA 3CVUA 1CVLA 4O4JA 5ERGB 2NPIA 4K7JA 4ZCMA 3KZOA 3L0CA 1Z5ZA 3K9BA 1E0JA 1ZNZA 4OHCA 3QVUA 3I05A 4G0MA 2VEDA 3HQ4O 2FXVA 3VR4H 4DUZB 1B0AA 3SC3A 2NZWA 1IEWA 2JJ2A 2VF4X 1YDGA 2Q07A 1PTJA 2PKQP 4Y6SA 1MCZA 1YJAA 1YR8A 5DEIA 5L3ZA 3IQZA 4LGMA 2C58A 1BKSB 4M53A 2ZCVA 4FKMA 4X9XA 4EI2A 2Q4RA 2IX3A 4CMEA 1J7KA 3E1GA 4AY3A 2Z6VA 5E1MA 4IMRA 2I03A 2RB4A 2VF2A 4JCOA 2I65A 4CCSA 2OCXA 2JPDA 2PZAA 2R65A 4ZHQB 4ZIRA 4XM0A 2OL4A 4GMHA 3IR6A 2PG3A 4R9RA 2IIQA 4R83A 3UQZA 5KDOA 3WKBA 1SULA 5CA0A 3AUAA 2XJ9A 1DIHA 3TINA 2LD4A 1MEOA 2C9OA 4IY1A 3OKAA 1EIWA 1O7JA 5HJEA 3F47A 1AKRA 3ABSB 1VCIA 2OGSA 1JE1A 1CUBA 2GNAA 2FPLA 3OP4A 1BHSA 3J81k 2QM3A 3RODA 1II0A 4WLOA 3A11A 3BDVA 3H2KA 4QXQA 3K8QA 4ZAVA 4BX3A 4CEIB 4FZ3A 2I2DA 2IZ1A 2LKDA 2OO3A 4UHFA 1Y9AA 3KTAB 1DIBA 2GASA 1Z73A 1PDOA 2BEUA 2O57A 2V58A 3ER6A 1I8TA 3H17A 3KQKA 4EQZA 2QSUA 1RWVA 3F7OA 4Q4HA 2V7EA 4BQSA 3GGCA 3P8ZA 5K8CA 2PSHA 3K53A 5GGXA 4DPMA 2UZ4A 5ADHA 2HFJA 1UOEA 2UYCA 2P67A 4BMNA 1QVVA 2VHUA 4JA0A 3ZHOA 1H23A 1OFVA 2QX4A 1CUJA 3UG6A 4NULA 3OZTA 4OLAA 1MB4A 1E5VA 2W37A 3OM0A 4O4LA 2W71A 1E7SA 1G55A 1CKEA 1KY3A 2B4RO 4HEJA 4RDHA 4WY8A 4GX5A 4Y7CA 5F3WB 1NF3A 4JHLA 4OM8A 3G5TA 4AW9A 4F9FA 3HP4A 3TRHA 2ETVA 1CP2A 1Z07A 2QU8A 2GK7A 5CURA 4J0QA 7ADHA 1N32B 2P9QA 3H9CA 3VVMA 4ENWA 3UZUA 4K9RA 1OYVA 3IB3A 1F60A 2CW5A 5BN5A 2GHQA 4HLQB 1O94A 2H4ZA 1B26A 4FU0A 4JFAA 4O0LA 5AI0A 1OYWA 1U2SA 1YBHA 1M83A 1VOTA 2ZAOA 3AP1A 3G8DA 2O8FB 4GDMA 5BSGA 3LQRA 2E82A 4JY7A 4NAHA 5ICEA 3E82A 3KUDA 3Q0TA 3VYSB 2W6OA 4EEZA 1Z6GA 1X8KA 3I6BA 4HNUA 4OYLA 4LAFA 2HRBA 5DN6D 1SVIA 1DDIA 1P6UA 3NHBA 1IEXA 5DGHA 3ANMA 1VLHA 3MBOA 2WA2A 4WNCA 5DXJA 3RASA 4CF7A 2H1RA 2X5KO 4AKHA 2M32A 1X94A 4TMZA 1IZZA 4ARUA 2ZUCA 1BMFD 1FP4A 1PNVA 2VLIA 1QANA 3S55A 1AUQA 3UWPA 2JB9A 1KARA 1MH1A 2CNWA 3WAJA 4W5RA 1WHTA 3EUWA 1G3IA 3DE1X 4OCZA 2QP9X 2VAVA 1SWWA 3PHIA 3D3JA 4YRFA 2WYHA 4BBJA 3BCSA 4BNFA 1M2VB 1VM6A 5CDTA 2JGAA 2VK2A 3PFGA 8ATCA 1PX0A 5ICSA 3B6JA 1P29A 3K1YA 2OOSA 5JDIC 1PFVA 3R7WB 1ECLA 3CZAA 4I9NA 1U04A 3MHPA 1D2EA 3AYXB 4I66A 1CPYA 1KXZA 3R5SA 2GZ3A 1CHDA 1N2HA 2CDRA 2FKNA 4WXPA 5CNMA 1ECFA 1P45A 2OAGA 3CLTC 4IL5A 4JOBA 4YEDA 5DCLA 1W9MA 4JNKA 1UPCA 2HX1A 1MT0A 4LOAA 1W76A 3TIFA 4EDFA 5BR1A 3B51X 5GZ1A 2P4QA 2V4MA 2A33A 4GYKA 5DCWA 4ZQHA 4ASUA 4LNAA 4RPLA 3LXRA 5UKDA 4AWAA 3CVVA 4NOMA 1U5BA 4JENA 4ZODA 3BE5A 3FM9A 1Q7BA 1XRQA 2AG8A 3H5TA 2B8TA 4NK5A 1QF6A 1BWRA 4CBVA 4PS0A 4FDLA 3BWVA 3BG5A 5ALPA 4OHZA 3BRSA 1RYNA 3W2EA 2PXXA 5BMVF 2QTZA 1D09A 1CUHA 1UK6A 4DDWA 1KKUA 2EZ9A 4KODA 4B17A 1Y4UA 3EC2A 5EVJA 3PRJA 3W3AA 2ZUEA 2QE7D 2ZYIA 3JALA 4INOA 4EHJA 1Q19A 5K6AC 4IKEA 1FJ2A 4UOQA 3L40A 5HVNA 4M8SA 1ILEA 2GYUA 1LDYA 3U4QA 4F4IA 1YA4A 2A92A 3DZFA 3E9YA 3FPHA 2WT4A 4MKGA 5I9LA 5IEBA 4B80A 2XTJA 1TM2A 4ITUA 1EWKA 3HCCA 4TS4A 5AW6A 3HLYA 3U5ZB 1TKCA 4G5RA 1KMNA 1WZNA 1YVRA 3RJ9A 5A2QA 1HK7A 3M3HA 3IEVA 1Z2EA 1C3VA 1L5HA 2G83A 2HDHA 1E1CA 2QZ4A 1YHNA 2XIJA 4CM4B 1SXHA 5DT9A 4U7HA 1LBTA 4HNAA 1V4NA 3SXJA 2YW2A 4ISCA 4E2ZA 2GNPA 4ID9A 2FUCA 5ALMA 2WVJA 5B2EA 2CKDA 2NYAA 1DRUA 5F5XA 1GQOA 3S1LA 3G9TA 1VL6A 2KE5A 2VQ6A 2ZWPA 4QSMA 3AF5A 4Q0MA 2B8JA 3I8XA 4IRUB 2VC2B 3RRBA 10MHA 3LK7A 1H9CA 1RAAA 1GVHA 1L8XA 2Q2NA 3O8CA 4OXYA 3ORFA 5A5GA 3BWMA 2W83A 1OT3A 2WTMA 1DC5A 3WLSA 2B98A 4FFRA 1MIOA 4MCJA 1WUTA 5KDDA 3HC7A 2YS7A 3HWWA 3K2EA 4TTRA 5FO0A 1SCNE 3NT2A 4Y6RA 2V7TA 3L46A 1JAZA 2WWYA 3Q40A 4G5XA 4IXDA 3PFKA 1K75A 4UD6A 3UCEA 1IOVA 1GU7A 1V43A 3IYLW 4P4NA 3UXHA 3W6OA 3C1AA 4DPKA 4FUQA 1P73A 4BIMA 4GI7A 2I3AA 3TD6A 2DBZA 3FPGA 4XB2A 5IN4A 2Y2VA 1F2TA 1W5BA 2WQ6A 4BZWA 1TFRA 2GXSA 4JBNA 4K87A 1U5CA 3M4XA 3PJGA 4M37A 4N7RA 4OY3A 3FRJA 5AVOA 3RGWS 1XRSB 2OUIA 3L0BA 2FE4A 3QKIA 5KJ1A 1NUPA 1YB4A 1MT3A 2RGXA 4OUDA 4Q3BA 5FIUA 3HTXA 1COWD 5F23A 2A0FA 1DTSA 1PV4A 2W6IA 1BOOA 4H3SA 2QPOA 3DBHA 5EESA 4M9QA 1DQSA 1M1XB 3BB1A 4BTLA 3GLIB 3LK6A 4BE9A 4CT4B 3EJ6A 3GBPA 3ASZA 1JWLA 3A4LA 2QN3A 3HH8A 3IUPA 4D80A 3G2PA 3AJ9A 1XA3A 2DBVO 4YAEA 5H83A 4EHAA 3PJRA 1C30B 1PR5A 3Q11A 3JS5A 4H1VA 2BR3A 3LUPA 2BTQB 1JZQA 2PGNA 1R0RE 2F43B 3GX1A 4KNVA 4OK5A 2I67A 1H2XA 1NZDA 2GPBA 4N7JA 5JANA 5H82A 3GGPA 4RPCA 1IZ0A 5K05A 4HEA6 4FYXA 3CU5A 1J56A 3KEGA 3NEPX 3JQGA 4J1TC 4UATA 1DDGA 2IHKA 1F6BA 4OYRA 4EW3A 1NMSA 2I6FA 4P36A 1L7QA 1YZFA 4YT8A 4RD4A 2P2ZA 1Z0ZA 3MXOA 3OT5A 2GYVA 3PIIA 4NH4A 2J9GA 4TUYA 4K9OA 2FRXA 3CZ9A 2DQKA 4MIOA 1U3UA 1N8SA 3DQPA 3R3UA 2QMHA 2ATIA 3AY0A 4EHHA 4ZI3A 1P7VA 2YJ6A 1DAGA 5K9ZA 4CIWA 1G1MA 1FUIA 1FTNA 3LKVA 3U80A 4URZR 1YASA 1ISFA 1PFGA 1U0TA 1XC7A 1LA2A 2IHVA 3BZBA 2G80A 3N8IA 2BKLA 4J1SA 4MB0A 4Z9XA 4HX2A 1KYZA 4GS5A 1RQPA 5L53A 1QG4A 1JDPA 3GFVA 2LNDA 1QZZA 1NVVR 1CIJA 2J0SA 2QRHA 1DIGA 2MMCA 4U6SA 2DHDA 4FVTA 2QAGC 3JZIA 1DIAA 3U4CA 1W0KD 2V8BA 4HGOA 4F9EA 4JVOA 2G40A 2VATA 3MELA 3ZWPA 1T4CB 2I33A 3ER9A 1EK6A 4BJ5A 2ZE8A 3C7CB 3K2BA 4YP0A 3C5VA 3KR0A 3VJRA 1IVNA 4QASA 1JMVA 1O5IA 1D4OA 1VFNA 2JGIA 3VR3D 5JT1A 1JFSA 3GDHA 3GVXA 3H1AA 4OJNA 4Y6OA 3WLKX 2ZQ5A 1SXJB 4YRDA 2XUJA 4L8FA 2NAPA 3FKJA 2QRVB 3KSZO 4UPDA 3WOVA 5A03A 4D4IA 4JJ8A 3ASUA 3Q7QA 1W94A 1WVGA 2AK3A 2KQUA 2EZTA 3AR3A 1H94A 1NJ6A 4E5UA 2XKBA 3COVA 2G9RA 3PT9A 4MZXA 3TOCA 2LR0A 3AEKB 3W2IA 1LLFA 4WKOA 5GONF 1EQ2A 2VHTA 1QK4A 3VUFA 3IALA 4CMHA 4DDUA 1X15A 2Q3HA 4YALA 3U6KA 2D7DA 1O77A 1XPRA 2ZJ7A 1JB1A 3G13A 1WCYA 1T1JA 4TROA 1XMJA 5EUQB 1YL7A 2C5HA 3BWDD 4OX9B 1OV6A 2Y68A 3L6BA 2AR9A 4D9FA 5ER9A 3QVGA 2H63A 3HU5A 5FADA 4E21A 3PPWA 4YCNA 5ALUA 1XN1A 1SHKA 1OGIA 1AQJA 3DP9A 1J07A 2RH8A 1DS6A 1UJ6A 2OVBA 1EXNA 2YYYA 1VJ5A 3HBJA 3I3OA 3PD0A 3QEMB 4YJ3A 1MZPA 3ZD6A 4BQNA 4I7EA 1S96A 4KBFA 3KKMA 1FRFS 3SU8A 2FQ1A 5JISA 1TM1E 1Z88A 2GHRA 5DMHA 1BJTA 3UFXA 5B6PA 1YS6A 4HNQA 1HDIA 1WETA 3GJTA 4N01A 1ZWLA 4CMKA 5GP1A 2RH4A 1OH7A 2Y9PB 2Q49A 5JCXA 2FJPA 3EZFA 2CMDA 4BUJA 3FPLA 4EYSA 3QYAA 4LK3A 1Z8NA 4PNHA 1EPUA 2ZWOA 2QW0X 4R2WA 2AOXA 4JELA 5KSZA 2YKGA 5F77A 2BCGY 4DWVA 3DBLA 4S1VA 5CJJA 2DWQA 2NVUB 3VC2A 2PEZA 3EJWA 3U81A 4GT1A 6YASA 2DQZA 4N6NA 1AUVA 1RYEA 3LBHA 4NCKA 5F12A 5ENVA 1EWVA 1VYTA 3OPYI 5KKNB 1P74A 4B84A 5D5PA 2IP1A 1PTKA 3CM0A 1VP3A 3NYIA 2Z2JA 3D1VA 4G0NA 4UZFA 3T35A 3Q3IA 3GLKA 1OFGA 4LC9A 4DYHA 1WCIA 3COZA 4OUKX 4XFJA 1IY1A 1PJRA 1O6FA 4J9VA 1KIAA 3UK2A 1D6NA 2PQMA 1RXSA 3RBZA 1RAGA 2ORVA 3AY6A 3WMXA 1ZL0A 3L1KA 4FFDA 2RGDA 4G8JA 3Q1KA 2AR0A 4EO7A 2PLFA 2WMOB 1IRXA 3DFIA 4EGJA 3ISVA 2W6MA 2D13A 3W06A 4BC1A 3TUZC 1J2RA 1YA6A 1HG0A 1W49A 4CEJB 2XGJA 3IXLA 1EUCA 1R9GA 3FN4A 1R6TA 1FDTA 1KQPA 2GNOA 3ZDYB 2JIQA 3TS1A 1VE1A 4EVRA 1L5KA 4D99A 4N3GA 1TVMA 1CYDA 3TLBA 3L4BC 1MO2A 4URYR 1R0CA 1W73A 1AZTA 5ILOA 5LKAA 4K26A 3PNLA 4US2R 1QAMA 3DDOA 4ZEOA 5FEUA 5LIRA 1C9NA 3OM1A 2D00A 2R1VB 3CYFA 4KSBA 4X95A 4E32A 4EYGA 2QYOA 4P6VF 1AKVA 2Y8EA 3NASA 2O8BA 1ENYA 5B7PA 1SJ9A 3T3HA 1VHTA 2GCPA 3CJTA 3ZNOA 4C6SA 3G0IA 3AR6A 3C1UA 1BDHA 2JI9A 3LYUA 1YQTA 2F90A 2WYWA 3OIGA 4AMYA 1E0DA 2ZSDA 2OCDA 1RWQA 2EDCA 4O02B 2FDCA 1YOVB 2AN4A 3A2LA 1M72A 2FZ5A 4WOPA 2OPHA 1Y6RA 3O83A 2DGDA 3M6LA 4JT8A 1VA4A 3F8SA 4G2TA 2IZ6A 3FRHA 4P93A 1KP3A 2V5UA 1YKFA 1PLKA 2IIPA 2DP4E 2W2KB 3QEOA 4P84A 5SY4A 4MDFA 1XP5A 2HWKA 3IKJA 5C1PA 2MWMA 2NNWB 2QN8A 2V4ZA 3AWIA 3W6NA 7REQB 3WLHA 1TQDA 4WY2A 3BWYA 4O4HF 3X2EA 1KKLA 1FP1D 5CLJA 2OHXA 5D51S 1YJ5A 2Z1NA 1RI1A 4MA0A 1Z33A 5HFNA 4BB6A 1K92A 1JQKA 5HP4A 5CT5A 3RB8A 3FZNA 2VXOA 3LCJA 4BECA 4LXQA 3F1LA 1WQ4A 1NPDA 1QFYA 4P7JA 4UEKA 3EXFB 3W34A 2YHIB 2HJWA 4I8IA 4QU5A 4BO1A 1ZZGA 1PGOA 3KUKA 1RWXA 1SBNE 2YY5A 1H2FA 4U3JB 3NIGB 5TQ0A 3TQTA 3VHRA 2J6BA 5A1TA 2W11A 4V0SA 2RHWA 3RVKA 2V96A 1VG8A 3ADOA 4ZOCA 2ERYA 4BLUA 4WIAA 1LLUA 1IPEA 1U9CA 1C7EA 4WN3A 2NP7A 1Y4ZA 5FI3A 4PLCA 3PITA 1EP1B 4HDMA 3H0CA 3IA2A 3LFTA 1QQ7A 4O5OA 5ALQA 4IO1A 1V8BA 4B3IA 2FVXA 3LOQA 3EVFA 3RJTA 4BE4A 2J3HA 2F1RA 1X7XB 5ED0A 3PPXA 1KVSA 2XKJE 5EQJB 3FUUA 4MP8A 1VSUA 2VF7A 4ZCSA 5IAKA 2Z0MA 2NXCA 4C4PA 1PWXA 1CS4C 1FBNA 3WYNA 1DG1G 3KLNA 4CVNA 3D64A 2DHRA 3DLPX 3ND8A 3E9MA 1JKJA 5JRZA 4BWYA 2Q27A 5KTSA 4ABTA 1A04A 1O03A 3DZBA 3K9HA 3IR7A 4RY9A 4URVR 4U2BA 2VCYA 1BDIA 1SQ5A 3VZDA 3MRVA 1E2UA 3N0WA 4JXJA 3R09A 3CLUD 4B83A 2DFPA 4PN7A 1Y6JA 4ZT4A 5BW4A 1FJXA 2C20A 5EJ4A 2FZLA 2ZTVA 4MUGA 2VQFB 3ROTA 3LX4A 4BO0A 2MSWA 1QK5A 2OBNA 4N39A 4UTPA 3E58A 2FRVA 1XKQA 2HMUA 1Q2UA 2I62A 3PFFA 4ESOA 2XCTB 1TT7A 1P80A 4AAYA 4DLWA 2V3CC 1KRXA 3UCXA 4AO7A 3J80A 2JCBA 4WLVA 3RFTA 3V4LA 2B34A 2NU9B 1CZLA 5M5BA 3IUJA 1SD1A 4GC9A 4R1OA 1AHHA 1MZVA 3JVVA 1NOJA 2WMYA 1JWAB 2GCIA 3FDJA 4HRXA 4RM3A 5AW5A 2HOQA 2X4GA 2Q9BA 4BNYA 3ILXA 4MHOA 1C81A 3ABIA 4NKRA 1FK8A 3V4VB 4IJ5A 4UNRA 1KBOA 3ND9A 3KHUA 3Q0IA 4YRTA 3IO3A 1IVSA 1E0AA 1IUNA 1GKUB 1QH1A 1ZI9A 1IG0A 2W43A 3D02A 2VRCD 3LLVA 3LNTA 4R2KA 4REMA 4WBNB 3K8ZA 2QL9A 1G16A 1L7AA 3RFCA 3RC8A 1IBMB 3CG4A 4LQCA 1PUIA 1XZCA 1GRVA 1KJ8A 1BH6A 1UKVY 5EA2A 2GZMA 1QLJA 3KOYA 3NVDA 4X60A 2BW0A 1SBTA 5FNVB 2QTMA 3ESAA 1PTJC 3TRDA 1QQBA 4ENUA 5EIOA 4MQEB 5AJHA 5GVRA 2J1LA 3BS4A 1AV6A 4X8MA 1RNLA 4XDZA 1HZJA 2ZKLA 4CMEC 5I7SA 2P9FA 2I55A 3KSRA 2ZJ3A 1IEQA 5BW6B 4K0RA 3FR8A 5K0GA 1X9GA 2FXIA 1GA6A 1FS4A 1KQOA 2K2QB 1XAGA 1TC1A 2OXCA 2R8YA 3B1JA 5H4HA 3IQHX 1OX5A 4BMZA 2OFPA 4ZMRA 5DZSA 4DDKA 3CUWA 3AJ8A 3NHJA 3V7WA 1RBMA 1URPA 1TYCA 3GB9A 1WABA 4HWTA 1M2OB 3AVUA 2XW6A 5IWAB 2GRUA 1T0JB 2ZJZA 1CEEA 3ROEA 3DULA 4EPWA 1Y5NA 1KETA 3GLRA 4N0EA 1X87A 4XGRA 1K3UB 3G2MA 4B0OA 5FX2A 3DXFA 3OMWA 2GFHA 1I7NA 3AWDA 4XWYA 4QSHA 4CR7A 3EHEA 4P81A 4EG0A 5GY7A 1I2AA 4EFKA 3PGXA 4LJRA 4KWCA 2MYUA 3L7KA 1SQGA 2C9BA 3WLMA 2HSZA 2HA0A 3ZXIA 2OZLA 5IN5A 4JJIA 2F55A 4X90A 3NBFA 4RVSA 4PFQA 2VT6A 4MR7A 5KYTA 1XF9A 2ZB4A 4AJ9A 4NVRA 4WEOA 1M2GA 5AVVA 2VSQA 5ALSA 3ZQUA 2Z5FA 4ZO6A 2FN9A 3DAFA 3ZH9B 4IQGA 1WVMA 2RHBA 4FGUA 5KYUB 3L4JA 4K8OA 5KOJB 2J0VA 3ZZUA 3H11A 5CA1F 3RNOA 1ZUWA 2P41A 4H59A 2XNSA 4WK0B 2R6JA 4P22A 2YZNA 3U61B 1R9NA 3TZCA 2X6QA 1RM5A 3GDFA 4HOYA 4OBXA 3KZ1E 4A8JA 4RMNA 2FWRA 4KO3S 1U9JA 1G17A 3HRIA 5LYJB 3PR2B 1NW8A 4CPDA 1U99A 3RRXA 4WZAA 1AKMA 1R1DA 3RS2A 3TFOA 4IVRA 2VSXA 1ZH4A 3UN1A 3ZDZB 5BQOA 2GXAA 1YB2A 3JARB 1EJBA 5E3JA 1C8LA 1AVTA 1T10A 2WIFA 3DC2A 4CTOA 5BQPA 4JI8B 2UZ0A 2FDXA 3QU7A 5CNIA 2W6JA 4IOJA 5AK3A 1DSSG 2QAJA 2ICAA 2ERCA 4HJXA 1KGSA 4DCVA 6NULA 5LU9A 2OAQ1 2NTJA 3URMA 3WQQA 5JPDA 3EIFA 4R3UC 1WXEA 2DYKA 3CXRA 5AK0A 4BO2A 5IF3A 1PBNA 3HXKA 3JQAA 3K6JA 3KOMA 1TK3A 4R9UC 1JSLA 3VSDA 3LY8A 3AUYA 1Z34A 5I4CA 3LUCA 1KE2A 2ZIXB 4S0XA 4CLOA 3FSGD 1T2VA 4RVNA 5GPBA 1GQSA 1NJ8A 1YUNA 4KNWA 1HDEA 4FGLA 3GUZA 3FVRA 1OOEA 5DK6A 1Y80A 2ECQA 1NAIA 3PJFA 1JX6A 5LLTA 2ORWA 2YY7A 5JAQA 1L5MA 1VB3A 1T6XA 4WZBB 1AK1A 2J3EA 1D1TA 4XJTA 4MR8B 4UPEA 4EI7A 3C8DA 1TC2A 2Q0QA 5EKUA 2BFDB 5K3CA 3EDMA 4YRGA 2FI1A 4XIFA 4RTPA 1TTTA 2XI4A 3QWAA 1QYRA 3B6MA 4MRMB 4PQFA 1N36B 1DKNA 3EDOA 2I80A 1KYVA 4HKTA 3WLAA 1ZD1A 1T5SA 3N0VA 5ITVA 1KZGB 1PP4A 3WL3A 3X1DA 1Z08A 1NUTA 1OAAA 1ZD2P 4UEQA 4WQMA 1ZMTA 5DWDA 3S8YA 5HJ5A 3HU1A 1VMEA 2C7RA 1X42A 4GMDA 4XSHA 3HUDA 1MOZA 1P5JA 5ESDA 4DIOA 3QJ5A 3ZCPA 3ICPA 2CJXA 4K40A 5CVJA 2WFLA 2F4NA 1PYOA 2ENWA 4M76B 3AR4A 1ONOA 2HZ7A 4DCUA 2RKOA 4E5NA 1FTYA 4IH4A 1T9ZA 2JLUA 5MGBA 2AHOA 1NVFA 4FFOA 2Q3BA 4EHLA 2H18A 4I1IA 4KMSA 2XMCA 3AQIA 4NENA 1NRXA 2FPKA 1BE6A 4FP9A 5T4BA 1G8KA 3KB2A 2Q1SA 1HURA 5GWXA 1C0IA 1SZPA 3KNZA 4KQCA 1A5BB 3OMLA 3WLQA 4AJKA 1SBYA 2J59A 4A0HA 2IYTA 3EMDA 3UH0A 4ACBA 3RIHA 4F45A 3KD2A 3AF0A 2B4KA 3BGSA 4DRYA 2P9HA 3D6UA 2HJSA 3TAXA 1W6UA 3A9SA 1EB9A 5EPOA 3DOUA 3KQLA 1GGHA 2PX8A 2J0QA 4M60A 4LRQA 4D1YA 1X0XA 2Q6KA 3IAHA 4CU2A 1DT5A 2JJ1D 4OXIA 4FMDF 2ZJ1A 3F49S 4IZOA 1ESNA 2YYZA 5TNXA 4DSTA 1LV8A 4DLYA 4Y2UA 5BP7A 1K2WA 4OMCA 3SKVA 2BFCA 4EB6B 4UEWA 1J8VA 1QTRA 2XCLA 3ESXA 3G0DA 3ER8A 5EIBD 4CDRA 4H77A 1M8KA 4K6CA 1XA4A 5T64A 4QYMA 3BMCB 3QYJA 5A3SA 3M9WA 1KO7A 1N57A 5D3KA 1QPZA 2E4WA 3GFSA 2JAWA 1E3LA 3DDZX 4FR0A 4MV9A 5JPCA 4OAPA 1E9EA 5AKGA 2I1WA 5F7JA 2CBZA 4DG8A 2OD7A 1Q1NA 1O2DA 2JANA 3ANYB 3ZTTA 4EY6A 1QONA 1NU8A 2JCVA 3PNSA 2C7GA 4LK2A 1NWHA 4JODA 3E4CA 2V7WA 5E8JA 1J9GA 2B3DA 3GI1A 2QAIA 4ON9A 3MMSA 4L1KA 1K98A 2CDBA 4YJ2B 1LDMA 1CEYA 3VNVA 2EQBA 1YQDA 2RH9B 1I6LA 2EZUA 5HWSA 1F8UA 4W5QA 2O1SA 3INRA 4P86A 4YO8A 3RD5A 5LBIA 3CLSC 5FWXB 3KP1A 5IWCA 4EG7A 2IUYA 2CYCA 2A8YA 5GM2A 4WVLA 3REQA 1O89A 3UUGA 1H6DA 1FSFA 2NO6A 3IVRA 3ILVA 4R51A 1Q16A 3DF7A 3I2HA 5IAJA 4XUGB 4TYQA 3KYDB 2R8BA 1EI9A 5BR4A 3LGSA 3L0YA 4HGZA 2LDXA 2EEZA 3G2NA 2AL7A 4U2FA 3REFA 4ZI7A 4K9LA 1DHTA 2AYYA 4GVXA 4M36A 1JNYA 4B32A 4CTNA 1NW7A 4ETWA 3EAGA 4F86A 3ZDBA 4QTTB 4IZ6A 1NUAA 4MAAA 2JIPA 1OV4A 1H8HD 1LY1A 5C46F 2G5PA 3UJNA 3DB2A 1E20A 2WT9A 3RHZA 3THRA 2QTBA 3KOWA 3VPAA 5D3ZA 3UMJA 4KKXB 4R2XA 4CKYA 3HABA 1D2HA 5BWNA 5EWMA 2NZJA 1SKQA 3G2HA 4O4HA 3ZU5A 1MB9A 2JHPA 4I4CA 5KSYA 2YXEA 4FOTA 3HSYA 1KSGA 1FLVA 2XRZA 2DETA 4F0JA 3R9XA 4QTZA 2QMYA 4UREA 4JQYA 5FTKA 5TX7A 1RADA 2BGRA 3ECAA 3U7HB 1RKBA 3L6OO 1UXHA 3KDPA 2P27A 3PDCA 4OATA 3MCZA 1U1DA 3FYCA 4WOJA 4Y2QA 4NZOA 2ACEA 3WK6A 1L5OA 1YZGA 1TVKB 4H60A 1SR8A 3L0IB 2FWJA 3QG5A 3ZV7A 3SYMA 3AZOA 1AUOA 3KJZA 4B8ZA 4Q9JA 4DDVA 3U7FB 4BCCA 4QG3A 4MKFA 2O07A 1ZUD1 1GPJA 1TO6A 4GG1A 2XUPA 4K6KA 2C2ZA 3FW1A 4U7FA 2W2QA 1P5RA 3WQRA 3BWCA 2DH5A 2YFYA 3P0IA 4KIUA 3N5CA 4AI6A 3HV0A 5KOHB 2VR1A 5KYXA 4QVGA 1I4EB 3PD7A 3D81A 2RHCA 3HFJA 2W6QA 2C4HA 1W46A 1NKVA 3QWBA 4JN6B 1CRZA 5EWLB 4DAOA 2WJWA 2I6TA 4XEUA 2C0QA 2VLBA 1J8DA 2KJQA 1N2JA 2WHYA 1NZJA 6REQB 2XXAB 3OZGA 2QROA 1XTSA 4BYMA 3IKVA 4NFYA 1ZVVA 1U4OA 1T8PA 3OCWA 4HQRA 3KZXA 1VL1A 2JEYA 1U0GA 2RMKA 4PRZA 3ZR4B 4NABA 4LBVA 2LKCA 3PDHA 1JEYB 4OA8A 1NVVQ 1QHHB 4D41A 3GPCA 4Q16A 2HRRA 5HTKA 3QP9A 1Z7YA 1VHWA 5KCZA 2Q3MA 5KJ6A 1MGOA 1RLIA 3O3CA 3RC7A 2J3DA 4IDDA 4H35A 4L0MA 5HMLA 4ZRMA 3TX6A 1CJSA 5LYYA 4UHHA 3F71A 1PL0A 4GI3A 4CM7A 1J5PA 3DXYA 4HAIA 5IAOA 4DR7B 3MFYA 2XZOA 2EKZA 2EJWA 3TQHA 2O2ZA 1GCAA 1YRWA 5ALXA 5IYZA 3VNUA 2GJKA 5I7OA 4DLUA 5FOTA 4G0UA 5D5HA 3R24A 1IUOA 1LRKA 2D1SA 3L8MA 3PEFA 2OWEA 3B6ZA 4QD3A 4DKJA 3QMWA 1D2MA 1LB1B 1W4CA 2JLRA 4NU0A 2KB0A 1S8OA 5CRIA 1JR6A 4W5NA 2WZQA 2VJAA 2PS9A 3NP7A 1KFJB 4PQEA 5CLHA 4CR6A 2PUBA 3H7AA 3SVTA 5B64A 4PC3A 1K0FA 2BD0A 1KO1A 4QGBA 3SQDA 4B44A 4Q15A 4YRJA 1FFDA 3EEIA 1DARA 1XAIA 2V4UA 4JJ7A 3AILA 3TSCA 5KVSA 2V6JA 4Z9BA 1EDZA 4D3YA 3QITA 4TWJA 3VOAA 3ZCTA 4EA7A 2W8BA 3VVLA 1BVUA 3SDZA 1U3TA 1W0JD 3P2YA 3RE1A 3EFHA 2GSWA 1P3DA 4GKJB 3FTEA 5L3SB 3VZQA 2BM0A 5B4UA 2MHCA 2O6LA 2DH6A 2BUBA 4J76A