1SNYA

Carbonyl reductase sniffer of d. melanogaster
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
248
structure length
248
Chain Sequence
HMNSILITGCNRGLGLGLVKALLNLPQPPQHLFTTCRNREQAKELEDLAKNHSNIHILEIDLRNFDAYDKLVADIEGVTKDQGLNVLFNNAGIAPKSARITAVRSQELLDTLQTNTVVPIMLAKACLPLLKKAAKANESQPMGVGRAAIINMSSILGSIQGNTDGGMYAYRTSKSALNAATKSLSVDLYPQRIMCVSLHPGWVKTDMGGSSAPLDVPTSTGQIVQTISKLGEKQNGGFVNYDGTPLAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Neuroprotective-acting Carbonyl Reductase Sniffer of Drosophila melanogaster.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Oxidoreductase
molecule keywords sniffer CG10964-PA
total genus 87
structure length 248
sequence length 248
ec nomenclature
pdb deposition date 2004-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1snyA00
1E6UA 3AM3A 1C0PA 2RBEA 1KEWA 1SMKA 2VHXA 1VJ0A 8ADHA 4R41A 3DOJA 2ZQYA 1BVRA 4IIVA 2NM0A 5C7IO 3IMFA 5B4VA 3KRTA 4CMJA 4JNKA 4AJNA 3GF4A 1FXSA 2OZPA 3WNVA 2TMGA 3JYOA 3JD0A 1DIBA 4RF2A 1NAIA 3BMOB 3HB5X 5DOZA 3O38A 4Z0HO 4H7PA 3C85A 3QRWA 4RVSA 3SLKA 2BKAA 2YDXA 4E5PA 4G2NA 4ND2A 4BKPA 2RH8A 2Q50A 1UZLA 2GN8A 5DCWA 5FWNA 2PKRA 1NR1A 4GAEA 3LC7O 4XRRA 3RROA 1MC5A 1LA2A 1UH5A 4JBIA 5G4KB 4EGFA 4YAEA 5KNLA 4CMAA 7MDHA 4R5MA 3NJ4A 1R4MA 1ENYA 2W2KB 1LU9A 1A9YA 1Q1NA 1ZJYA 4D42A 5HM8A 3ZV6A 1FDSA 2VHZA 1E92A 2X5OA 2RHCA 2CSUA 3D5TA 5JE8A 3RIHA 2ZB8A 3I3OA 1SOWA 1MFZA 3ZWBA 4FJ0A 1DAOA 3TSCA 5C7OO 1EFKA 3GDOA 4CLRB 3IS3A 3ADPA 2QQ5A 1LSJA 3UOGA 1BMDA 1W73A 5JS6A 1U5AA 2FR0A 3ZWNA 2I5PO 1I30A 3SLGA 2PZLA 2X86A 4D79A 1LC3A 4Y98A 3G49A 1YB1A 4FQ8A 4BNKA 3U4HA 3HADA 1MC4A 3IL2A 1P1JA 1SO8A 1PJ3A 2FOIA 3F1LA 2YV3A 1B8UA 4O0LA 3E9MA 5TF4A 3C3XA 3KB6A 2JFGA 1QYDA 3HQ4O 2LDXA 4MVJP 4BMVA 4I08A 2Y05A 3NGLA 2AHRA 4IXTA 4R3NA 5L95A 3LC1O 3VH3A 5BSHA 3KEOA 3WMWA 1IUKA 1ADCA 3GVXA 4BKQA 1CERA 2YDYA 4Y6RA 4CLEA 4PLPA 1ZMOA 4W9NC 2EV9A 3W1VA 5K6AC 2P9EA 3PFFA 3B1FA 1VKNA 2G76A 4CLOB 1F12A 2GPTA 3GOHA 2X0NA 5U9CA 4KUHA 3F5QA 1C14A 4TRRA 4F46A 3KHUA 5DCYA 2ZYAA 3BZUA 4PLVA 5FF9A 3G3EA 4P8RA 1YB5A 3DHEA 4XEHA 4Z0PA 3OH8A 2UUOA 1Q7BA 2HUNA 3GNQA 4YT4A 4P4NA 4Z0TA 4JX8A 1AE1A 4FC7A 2BGMA 3RUCA 2DT5A 1E3JA 3QWAA 3S1LA 1GCOA 1LQTA 1AGNA 1I2BA 4TQGA 1WP4A 3PTZA 1UJMA 1S7CA 1NM5A 4MP3A 2JKVA 1W4ZA 3W8FA 4E5NA 4BV8A 1N8KA 4IQ0A 5G0SA 1PZHA 3ZNNA 3TF5A 3GH3A 3KM0A 1E1NA 2FSSA 4UUOA 4XDYA 3O26A 1LDEA 2YW9A 3TWOA 1J6UA 1XHLA 5KJ6A 4MP6A 1HZJA 1T2CA 1TT5A 5F3RA 3BXXA 3I83A 4GPD1 3EZLA 4IS2A 3PHHA 3RBVA 4AL4A 1Q2XA 2EGHA 1ZKMA 2I66A 3GGGA 1U3WA 4O59O 3NTRA 5LCXA 4ZVVA 3PQFA 2BFPA 4R01A 4BO3A 1IE3A 1WVGA 5L45A 1NHWA 3OETA 4YAKA 5AXCA 5JDIC 2FPIA 2GGSA 2IDZA 5T5QA 2D5CA 1V8BA 1M2WA 2BI7A 4IGEA 5KOIA 3KSDO 5LDGA 1E7RA 4LRSB 1HDOA 5U1PA 4NJMA 4B79A 2PZJA 4NR0A 4ZICA 4HWKA 3WFJA 3WICA 3X2EA 3RQSA 3EGOA 1P3DA 2VTEA 1Y81A 3WGHA 2EIHA 4I8XA 1VRWA 1NAHA 1SZJG 3LDHA 2Z5LA 1LJ8A 1MG5A 3D4PA 4PLTA 2YJZA 4MKXA 2FR1A 2X9NA 3GK3A 1GAEO 3AUTA 3S2EA 2VWHA 4WLOA 1J49A 3F4BA 2X7HA 3TZQA 5HS4A 2EW2A 3DTTA 2C82A 3K2EA 4QFDA 3AU9A 1J0XO 4O1MA 1M75A 4L74A 1NVMB 2QIOA 1ARZA 2B5VA 4RVGA 2PLAA 3AOEC 4H15A 1H94A 1MGOA 4J0FA 5EJ2A 3DBVO 2D3TA 3DMTA 4OOEA 2C7VA 3VZQA 3GPIA 1R37A 5I7FA 2IXAA 1IHXA 4KTVE 1WXDA 5CG2A 3HE3A 1O5IA 2C5AA 3KETA 2J3IA 2YHIB 4Q39A 4XCVA 5ICMA 1ZNQO 3PQDA 3ABIA 2YFQA 3DONA 1AXEA 4EJ6A 3BHJA 1P77A 1IHYA 4R51A 1Z74A 2VHYA 1IY8A 4NG5A 1ENPA 3HG7A 4YB8A 3DEYX 2EP5A 3GEMA 1E3SA 1O94A 3DMYA 2DC1A 2E37A 1LSOA 2JAHA 3JQGA 4IUYA 2CDAA 1VI2A 4YACA 5T8KA 2AQ8A 2WD7A 4IBOA 4CLOA 4PGFA 5L4LA 2JAPA 2W4QA 4BKUA 3TNLA 4J4BA 4XA8A 4ND1A 2O2YA 3COSA 1O8CA 1V9LA 2HK9A 3EK2A 4L0QA 4PVDA 3I6IA 3DL2A 4DBZA 1LXCA 2BHLA 5ILOA 3HHPA 1HLPA 1K2WA 1DC3A 1X7GA 1B8VA 3JQBA 4KWIA 5HBRA 4OXKA 2PNFA 4LN1A 3FR8A 3NKLA 4IDGA 4N7RA 2DLDA 3QP9A 3GR6A 1H9BA 1KEVA 3Q3CA 4Y6PA 1KVSA 2VNAA 4RV9A 4S3MA 1MLDA 3V1YA 1P0CA 1PJSA 4IMRA 4Q9NA 5A04A 2EJVA 2P4HX 1H6AA 3H8VA 3IOYA 1YGYA 5DOVA 4LMRA 3LC2O 4XJSA 1T4BA 1EQ2A 1PZGA 1UXHA 1U3VA 3ITDA 1KETA 1EUCA 3ZGYA 3NJ8A 1KC3A 3IQDB 4BNZA 2DBQA 4BIIA 2OFPA 1XLTA 1M6HA 4YJGB 1GUYA 1PJTA 2UDPA 3M1LA 5DDIP 3TN7A 1T26A 5JAMA 4F45A 1XCBA 3RUIA 3JQAD 2BH9A 3T4XA 2LDBA 4IZIA 5IDYA 1DC4A 1HLDA 4IDEA 3CXRA 3WQSB 1DC5A 5JMPA 1A7AA 1FK8A 2Q3EA 2C59A 3GGOA 5THQA 2JFHA 4QUKA 5A06A 4NJMB 1D3AA 2C2YA 4RDHA 4FIZA 3S2FA 3SJ7A 3LLSA 2WEKA 1GDHA 3VHRA 1VLLA 2FZWA 3DOOA 3ASUA 4CMHA 3AI2A 4J6FA 3RFXA 2Z1NA 3VZPA 3UW3A 3UICA 4LGVA 1BRMA 4L4XA 4UUNA 3I9MA 1K89A 2PR2A 3JQCA 3DZIA 1TT7A 4A5OA 4CM1A 1GYQA 1E5QA 1EMDA 3UCFA 5TQVA 1QMGA 2RCYA 5JNLA 4U5QA 3HDQA 4E5MA 3AJRA 3OJLA 3QVOA 5DBIA 1JWBB 2ZJ0A 3D64A 3OICA 4L4RA 3C1AA 3ZV3A 4B7XA 1JN0A 1XIVA 4MIEA 1RYEA 2HCTA 4EITA 3CZRA 5DBFA 4PVCA 5L40A 2RHRA 4DYDA 1MV8A 1VSUA 4WEQA 2O3RA 4WCFA 5A1TA 3NAQA 1YB4A 2H63A 5F1PA 4LCJA 5BSGA 3ZV4A 1KY5A 1XEAA 2VYNA 4Q3NA 4CM8B 2Q4BA 1YDWA 2CF6A 3DAFA 2PD4A 1P1FA 2VUSA 1OC2A 3W8EA 3FI9A 2QHXA 4CR7A 3P19A 1E5LA 1P9LA 2J6IA 2AEJA 3ZHBA 4D46A 4GVXA 2AQIA 4K1LA 2I9PA 3EYWA 1IYZA 3JQEA 3LZ6A 3G0OA 4R16A 2GN9A 4HFNA 1B14A 1ZXBA 4II2A 5U4QA 3JQ7B 3HUDA 1WMBA 3JQGB 5K6AA 1GADO 1HYGA 1EDOA 1ZH8A 3GMSA 5H83A 5JDIA 1AHHA 3PJDA 5B4TA 4WOJA 2C07A 4B8WA 3JQAB 2G82A 4D43A 4BKOA 1G0OA 2A9FA 1IL0A 2NVUB 3PQEA 4B4UA 1OMOA 3GPDG 5A9SA 4N18A 5FYDA 5TNXA 5TJHA 5KJCA 3KYCB 3P7MA 3QVSA 2PTGA 3ZWMA 3NT4A 3I9NA 1LRLA 2CDBA 3RBXA 4FGWA 3OJOA 4AJIA 4DWVA 4DLAA 4A2CA 4FJ1A 3HNPA 1KVTA 3WGIA 4GGPA 4I9UA 2Q99A 5TRTA 2B4QA 1H5QA 1YL5A 2X0IA 3VC7A 1SEPA 3VDQA 1M66A 1UXKA 2B69A 1M76A 2XXBA 3PWKA 1V6AA 5JYDA 2GCGA 1U4OA 1QXSA 2GD1O 4GBJA 4TWRA 5AOVA 3KYBA 5JXWA 5AQ1A 1O9BA 4PG4A 4FDAA 4XQCA 4KUEA 4PLGA 1VE9A 3V8BA 4R1SA 2J5KA 5I7EA 3PDJA 4AJJA 1R0LA 1P31A 4K6FA 3WMXA 1UUFA 1DFGA 4TVBA 1HWYA 4E5YA 1E7WA 6ADHA 2YHIA 4RF4A 5IF3A 4RGBA 5C3MA 1Y5RA 1LLDA 4XR4A 2V6BA 3EMKA 2O50A 4IDCA 1AN9A 5JW6A 1I24A 3SEFA 2HJSA 3FTNA 1PU2A 3AUSA 3G79A 2ZTMA 3NTQA 1Y7TA 1E7MA 2ZCVA 4IINA 4UEOA 4CMEC 2VYVA 2WD7B 4RZHA 1F0YA 1VJTA 3L6EA 4I9HA 2NTJA 3GVCA 4JQCA 4A26A 1XGKA 1QV6A 5BNIA 2BFMA 5JAQA 3LQFA 4M55A 5HWSA 3H5AA 4OQZA 4R9SA 3ONDA 2ZB7A 1DAPA 4EEZA 1ONNA 1MG0A 4UUMA 3EY4A 3RCBA 5AXBA 1C0LA 4DYVA 3EW7A 2NTNA 3FWNA 4BGEA 4Q3BA 4ND5A 5JBIA 3N7UA 4RPJA 5BSEA 1I01A 4R9RA 5A5EA 6LDHA 1NP3A 5HRUA 1XSEA 3ONEA 5CDYA 2GZ2A 4YWJA 2X0JA 1DIHA 4BO7A 3CEAA 5G0VA 1AUPA 2E82A 3N74A 3WGZA 2D5AA 3WYEA 1IPFA 2Q1SA 3Q2KA 1N5DA 1GL3A 4FPXA 2Q1WA 4CM4A 2ZKLA 2NVBA 3IP3A 4B4OA 2FN7A 3IUPA 3GFBA 4AJLA 4CQMD 1BSVA 4DQXA 5IAAA 1ZJZA 1I2ZA 4NBRA 4RL6A 4EYEA 2FY8A 1T2DA 1SC6A 3EUWA 3PYMA 3INGA 1N7GA 3S8MA 4N5NA 3E1KA 4IDFA 2Q4EA 4W7IA 1I5RA 2IZ1A 2BGLA 1HYHA 4J1NA 3O03A 4I5EA 4YRDA 4Q3DA 3W6ZA 1ISIA 4DMLA 2E49A 1GD1O 1YWGO 3PLNA 3P2YA 4WE3A 1YQDA 4Z9XA 4B3IA 1R4NB 5KJFA 4D7AA 3QV1A 4PZDA 4CV0A 3T7CA 1YXMA 2HLPA 4DXHA 1W6UA 1NHGA 2Q1UA 2WE7A 1NBOA 3H2SA 1Q7GA 3E5RA 5KCZA 4GLLA 5K0ZA 4E0BA 3ZWAA 3RFVA 1WDKA 5IXYA 1U3UA 4PLWA 2X58A 3VPHA 3HN2A 1EDZA 2GRAA 3GRKA 4J1QA 3WIEA 4XRGA 3NDIA 4HY3A 3ADOA 5IZCA 4MPDA 3WIDA 3KZVA 4L8VA 1ONOA 4MJLA 4Y9DA 1RYDA 3KSZO 4ALMA 4ALKA 1A72A 1CQJA 2VZ0A 2JHFA 3I4CA 4QO7A 3U4DA 2ZYDA 3BTOA 4OJNA 4CM6A 4GGOA 1Y1PA 1I0ZA 2VUTA 4DTIA 2HMSA 4YQYA 1D4FA 4MVJM 2EKPA 3D0OA 1LX6A 4JN6B 4EEXA 4BO2A 1XYGA 3WSVA 2NUAA 4I5DA 2OXIA 3O8QA 2D59A 2HMTA 5CDSA 1IPEA 3SVTA 3UAGA 1ZK3A 1ZXLA 5JY6A 1ZW1A 4ND4A 4BOYA 2UAGA 3L0DA 3IDSA 1RM3A 1KVRA 1BXKA 3KBOA 4Z3DA 2Y0EA 5CPBA 1I3MA 2V6MA 1OAAA 4R54A 3GAZA 3V2HA 2DPGA 2X22A 3WGGA 2NACA 1I32A 3U49A 2CDCA 3ROPA 5EL0A 2JHGA 2NU7A 1QLHA 1VL8A 4BMNA 4DPMA 4GQAA 1U28A 1T24A 2NVUA 3ZW8A 1CJCA 1NQTA 3JQBC 1RM4A 1KVQA 4LMPA 5A9SB 3PZRA 3I23A 1XQ1A 3UKOA 4NK4A 1QKIA 3L4SO 3F46A 5F21A 1HSZA 2HU2A 2Y0DA 4D3FA 5GZ6A 1BG6A 3C7AA 4OHUA 1UXIA 2G0TA 1KVUA 4OMUA 4HBGA 3RJ5A 2DUUA 1DHTA 3JQ9A 5FI3A 4BUCA 1GQYA 2W90A 4TRJA 1P74A 3VKVA 2FP4A 1K6IA 3GN2A 3ROMA 2HMUA 1HSOA 1HETA 1LRJA 1NTOA 1UP7A 3SXPA 3ETEA 1DRVA 5L3ZA 1ISJA 4JROA 4WEOA 3U9LA 3H6KA 5A02A 1PQWA 4NDNE 3WQRA 2VWGA 5G2OA 1UDCA 1A71A 2PV7A 2VHWA 1J5PA 4NQZA 5HA5A 4A73A 3ZZNA 3PFWO 3M2TA 3V1TC 3DFUA 4JLWA 2CF5A 3JQDA 4O6VA 1GFSA 1H2BA 1T2AA 3ZWXA 3QHAA 3L6OO 2E48A 3C24A 3GC6A 1ZCJA 4WGGA 2PH5A 3DXFA 5CDTA 1E3WA 1PJ4A 3ONFA 3TOXA 1EQUA 1QYWA 3OQ1A 4H3VA 4A0SA 1R16A 3PHLA 4RLSA 5L4NA 4WECA 1E77A 2O2SA 4IS3A 5MDHA 1Q0HA 1ORRA 1O0SA 3GA0A 1HKUA 4RLHA 2D2IA 2DBRA 3PXXA 1P1KA 4RPLA 4YDRA 3PDUA 4LK3A 2PGJA 5KVVA 5L9AA 2DUWA 5AXAA 3H9GA 3WR5A 1LTHR 2PZKA 1C1DA 1NFQA 2V6GA 2YYYA 1DPGA 4IJWA 1HE4A 1Z82A 3Q11A 4TKLA 4IQ8A 3PP8A 3RUFA 3K2BA 3K96A 2NQ8A 4DMMA 1SAYA 2QYSA 4E2XA 3H3JA 3LT4A 4BO5A 1HDCA 2OO5A 3PWZA 1Z45A 4CUZA 4EUEA 3CTMA 4YJDA 4YEDA 4XQEA 2GF2A 2NSDA 3E03A 1BDMA 5IG2A 2BI8A 4HX5A 2HJRA 4GSKA 3UCXA 1NPDA 4NFSA 2X5KO 3PI7A 2O7SA 3AFMA 3GNTA 1DRUA 1PGJA 3FNHA 1PL6A 2PWZA 1VPDA 5I9LA 5KVQA 2NU8A 4FOOA 3RUAA 3PJFA 1Y8RB 2Z1MA 3FF4A 4OOFA 4ID9A 3ROKA 4YQZA 3PRJA 4KOAA 4DL9A 3TQHA 3F6YA 3WLFA 1I2CA 3JD3A 2CMDA 3A06A 1A4IA 4RF3A 2P68A 4UUPA 2EHDA 1F17A 3QVWA 3LT1A 2PGLA 1PGQA 2NV6A 3WDSA 5CEEA 1R0KA 3IKVA 4GL4A 1SPXA 4YJHB 3R1IA 3VZSA 1JW9B 3T7EA 5AYVA 4QX6A 3GNSA 1BHSA 4UVGA 3MOGA 1YL7A 1CRWG 4BVAA 4MVJA 5CAEA 3VOSA 1KERA 3AUUA 4UEJA 2VN8A 3CMCO 4MKZA 1MUUA 3E48A 3EDMA 4KTTE 3KO8A 3RUHA 1NQAO 4DLLA 4P22A 1G0NA 1UDBA 2PK3A 2ET6A 3CMMA 3BTUA 3KLMX 4A7PA 5COBA 4L4SA 1PQPA 4B7CA 3RU7A 3ORFA 1BXGA 1MB4A 1PWXA 2QG4A 4ESOA 1P44A 4RO0A 1GCUA 1JQBA 1PEDA 1QYVA 3PHJA 3FN4A 3W6UA 1NFRA 2UYYA 5JAZA 3V5NA 4BNYA 3VTZA 4NNJA 1HEUA 5FI5A 3HDHA 4Y67A 3VVBA 3AOEA 2CY0A 1KEUA 4HFJA 4JGBA 2RH4A 1NPYA 4CV3A 3K9QO 1H6CA 2D1YA 4HV4A 2EW8A 2Q49A 3KTDA 4ZD6A 4EUHA 3EHEA 4CM5A 2IYPA 3OA0A 3OJEA 4CMKA 5L7YA 1EEHA 1ISFA 3OM9A 4XGIA 4B3JA 2HK7A 1F14A 3A4VA 1LLCA 4OIMA 2VZ8A 1C0IA 1U9JA 2ZATA 2VZ9A 2O4CA 1ENZA 1ULSA 1RKXA 4CM3A 1EE9A 4U0KA 1G6KA 2BF7A 4IDDA 2BD0A 3WYCA 3Q9NA 3QSGA 1V35A 4OSPA 1HT0A 2GN4A 4Z6KA 5A03A 3DBRB 3OECA 4ZJUA 3ASVA 4GWGA 3QVXA 1KIFA 3ITKA 5DN9A 3QQPA 1UZMA 2X5JO 4M54A 3ICCA 4L73A 3B1JA 2Q2WA 2P9GA 1NPTO 4J1SA 2EEZA 3TZ6A 3PHGA 3KLPX 2H1SA 4J1TA 4MVJI 1GZ4A 4LCEA 2Y1GA 1OBFO 3AW9A 1EE2A 3NT5A 4MVJG 4Q3AA 3QY9A 4QT0A 4E33A 2P5YA 4JP2A 5G0TA 5KJEA 3UVEA 3UCEA 1DLIA 2GNAA 5JMWA 4D44A 2BFAA 3Q1LA 5B4UA 3TZHA 2WMDA 1E1MA 4BKRA 4W82A 4YT8A 4KZPA 4FFRA 5C5IA 5COQA 4ZA2A 1U5CA 2X8LA 2Y99A 4RPHA 4NK5A 4BGUA 2ZK7A 2GLXA 1E3IA 2NQTA 1B15A 4ZQGA 3OQ6A 1HDZA 1LRKA 2V6FA 1NR7A 5DF1A 2IZZA 4BNMA 1WDLA 2FZEA 2GDZA 2I3AA 3M6IA 5DP2A 4BO1A 1QV7A 3PGJA 4JJFA 2HRBA 4UVHA 2ZTVA 2BRUA 4Q3CA 3RVDA 4C4OA 4TRMA 5G4LA 4FFPA 1R12A 1TLTA 4FJ2A 3AM4A 5G4KA 5KVSA 4KWHA 1YBMA 2J3KA 2W2KA 1HE5A 2CFCA 2AQKA 1JU9A 4YJFA 4CMIA 1Y8QA 4FGSA 3ST7A 2Q1TA 3PPIA 3WTCA 1T2FA 1C3VA 3DB2A 4NHEA 1C0KA 3RD5A 4J43A 4YPOA 1TT5B 3F47A 4TZTA 1SBYA 1I3KA 2EWMA 4JCOA 3K31A 4DC1A 4XGNA 4CM9D 4A27A 4KQXA 5ER6A 5I9MA 4CQLA 1KY4A 1DXYA 4DIFA 4BV9A 5JO0A 2I65A 1DSSG 4RPKA 5ILGA 2ZQZA 1K5HA 2C5EA 4A10A 3ZW9A 1I36A 1LBEA 1QP8A 5BNTA 2OP0A 2QX7A 3CINA 1HL3A 5JAIA 3PYLA 5KJ1A 1ZVMA 3KXDA 2J3HA 4RJTA 3WNQA 3F1KA 4XJTA 1C1DB 3FPLA 4XYMA 4HKTA 4KDFA 3BMQA 2ILTA 3RSHA 4HP8A 4WJZA 3DQPA 4KMSA 2DQ4A 1TEHA 4GWKA 4XB1A 3KVOA 9LDBA 3DWFA 4FBGA 3AI1A 3WGQA 1R15A 4L9RA 1OOEA 3TZKA 2GZ3A 3NUGA 2BELA 4DBVO 2DTDA 5G0WA 1PSDA 1FDVA 2XPCA 1WLYA 3PYXA 3ZWOA 2DM6A 2F1KA 2O3JA 4HXYA 4U8GA 3MJEA 3WXBA 4UEKA 1ISGA 1B3RA 3D1LA 3U62A 1GV1A 1ZIDA 2QZZA 1Y5MA 1ZEMA 4URFA 1E3EA 2B4RO 5IDXA 1X7DA 4E12A 3BMCA 4J7CA 2J8ZA 3HWRA 3QVTA 2VYVD 2WSBA 4OAQA 2EF1A 3OA2A 3GZNB 5TS3A 5IZCC 4JIGA 1H93A 4GKVA 4CMGA 1GY8A 1V3UA 4QO8A 4WNCA 3BMNA 3R3SA 1H0KA 2FWMX 1BW9A 3ULKA 1A5ZA 4DQVA 1QRRA 2VOEA 2V7PA 4LSWA 2AE2A 4XYGA 3JD4A 4YJHA 1C1XB 2F00A 1DIGA 3HN7A 1PZFA 3Q0EA 2WE8A 2C20A 3IP1A 1KOLA 3OHSX 2GUGA 3Q9UA 2G17A 1CF2O 2ZJ1A 2DFDA 1NQOA 4XIYA 2YY7A 5ENDA 1SCUA 1YOVA 3AI3A 3INRA 2VUUA 4U7WA 4HUJA 4ND3A 3V1UA 3FCOA 2Y0CA 4TRNA 2BMAA 2NNLD 4YAIA 2XOXA 3BHIA 3ZWCA 1F06A 2A94A 3C1OA 2EP7A 4D3DA 5BSFA 3JQ8B 5GY7A 4E30A 4B4WA 3LT0A 1ZMTA 1ENOA 3HSKA 2ZTUA 3ZHXA 4N54A 4I5FA 1X0VA 4G81A 1GZ3A 1PQUA 1WZEA 4EUFA 2O3UA 3CPSA 1ML3A 1RM5A 1T1SA 4B7UA 1Y9EA 3OMLA 2JD0A 1PR9A 5JCXA 1ZBQA 3CZMA 2DFVA 2J5RA 3OQBA 1LI4A 3NRCA 3INTA 3S2IA 4CMIB 1EVIA 3JQ6A 4XGKA 5CEJA 1LDNA 2PD3A 4ALJA 5ICSA 1HTBA 2NWQA 2PA3A 3D4NA 3H9UA 4MVJE 2PD6A 2CD9A 4C7KA 4GX1A 1B3BA 3K30A 3WWYA 3NYWA 5EPOA 4X54A 2YUTA 2GO1A 5EQDA 2X1HA 3F3SA 2YV1A 3WWZA 4CQLB 4DGSA 5KVCA 4XYLA 3E5MA 1B16A 5IXSA 2EJWA 3WGOA 3VAZA 5CP8A 1HE2A 3LSYA 3QJ5A 4RQUA 3UUWA 2P4QA 4TROA 4ZU3A 5K9ZA 1I8TA 2FHSA 3CIFA 1XKQA 4J90A 4BNWA 1YO6A 4OXNA 3B70A 1X14A 4BNXA 3F4LA 4CUKA 4R68A 3HDJA 3GGPA 2H6EA 3TFQA 3G1TA 4YAGA 3VPXA 1ZK4A 1ZSVA 3Q6IA 1MA0A 1EBUA 3M1AA 5EINA 3MEQA 1LNQA 1NX6A 3OJ0A 5JSFA 4NFHA 3B1KA 5A05A 1ISMA 2WJPA 2XF8A 4E13A 3TFOA 5B37A 4WOKA 5JDCA 1BGVA 3TPCA 2AMFA 1JKJA 3WX0A 1SB8A 3ETGA 4Y6SA 1Q7CA 4ZQBA 5IJZA 2H5LA 1B2LA 2QZ9A 3LVFO 3P2OA 4R69A 2C54A 1BXZA 4ALIA 3S2GA 4CMCA 4KQWA 3D3EA 1VKOA 2AG5A 2I3GA 3DZKA 1PJ2A 3O4RA 3TJRA 1CWUA 1XU9A 4EJMA 4M49A 1DHRA 4I5GA 4CQMA 4WCFB 4J7UA 4XZ3A 3RJ9A 4EW6A 3NEPX 4CV1A 1RM0A 3L77A 2FMUA 3C7DB 5GMOA 4IDBA 4DRYA 4CM8A 3ZU4A 5TGDA 1QLJA 4CR8A 5I7VA 4MDHA 4CODB 1NASA 1FMCA 1HF3A 3PWSA 4YJFB 2AQHA 1VC2A 1Y8QB 3ZNOA 1C1XA 3WSWA 1UZNA 3FBGA 2BGKA 4BNLA 2C29D 1MXHA 4BB5A 2GZ1A 3FPCA 4TZKA 3WBFA 1IB6A 3JQ7A 3WTBA 1DC6A 1HXHA 1X13A 2I67A 3FRJA 4GLOA 4E3ZA 4MP8A 3OIFA 4WNIA 1FF9A 4IJKA 3MJCA 3P5SA 2OL4A 3R6DA 1XA0A 4OKNA 2D8AA 4FOSA 2P5UA 3JQAA 1P0FA 1TA4A 1IULA 3KYDA 3NT2A 1I3LA 2GERA 3UGKA 3VPSA 2DAPA 2OGUA 4BO0A 3ENKA 4D41A 3HDYA 3GZ4A 2HMWA 1SEVA 3NX4A 2EKLA 3MTGA 3LK7A 2JD1A 1ZUD1 3DTYA 4E32A 4M87A 4XX0A 4UVIA 3RC2A 3RFTA 4FB5A 4PG7A 3VVCA 1ZFNA 4K26A 1D1TA 1LDGA 2P2SA 3VH1A 4F6CA 3PJEA 4DLBA 4G65A 4RVFA 2DU8A 3E18A 1K3TA 2X9GA 3ZH2A 3JYQA 2AW5A 3N58A 2AXQA 3UH1A 4BL5A 5KKAA 4PRLA 2BLLA 4PZEA 4Y8VA 1G1AA 1GYPA 1PR3A 1T4DA 1V0JA 3AU8A 1YBAA 1DIRA 3GFGA 4BNUA 3L9XA 1E0DA 1NFFA 4H16A 4R5HA 3CUKA 2W98A 4YYZA 3AM5A 3DBHB 5H81A 4CLHA 1IZ9A 1GZ6A 3TDKA 4CR6A 1Y9AA 4NZ9A 1YH3A 4RVUA 1LDBA 4GMFA 4QSMA 4WASA 3WQQA 4MOWA 4FFMA 4HFMA 3TZCA 2E6UX 4HNHA 1QG6A 2O3SA 3BMNB 1XELA 1E6WA 1Y6JA 4BNNA 2A35A 2ZIZA 5FFFA 4BNIA 5A3VA 1E3LA 3AK4A 2VT3A 4BO8A 3H5NA 3G1UA 5TIIA 4DUPA 2OP1A 2O23A 3I6QA 4AJHA 3QE3A 4PIVA 4RPGA 2VRBA 4GSLA 2YQ4A 3AY3A 1PIWA 1ZO8A 4CL3A 2A92A 4N5LA 1U8XX 1UP6A 3GRPA 3MWDB 3CE6A 3JD1A 4MVJD 2NU6A 1YKFA 2X23A 1U2GA 4U6QA 4LSMA 4ZRNA 5F5LA 2JCXA 1O89A 4R1NA 3ZU5A 2X4GA 1PGPA 5IDQA 3VPFA 3H9QA 1JTVA 3IJRA 3JQ8A 2IZ0A 2CVZA 1PS9A 5A9TA 1UR5A 4ZQFA 1A27A 3ZNPA 1BDBA 3AY6A 4Z3KA 1U4SA 1PL8A 2AE1A 5AXDA 1NQ5A 1DFIA 3I9OA 3A9WA 4DREA 2QW8A 4NMHA 3WGTA 1X15A 2DTEA 4PG8A 3BTSA 3PLRA 3H9JA 2NVWA 3LLVA 1X1TA 2G5CA 4RVDA 1IZ0A 3H5RA 2DBZA 2NTVA 2W8ZA 1LC0A 2PFGA 3CKYA 1DEHA 4AJKA 4OXYA 4XIJA 5ITVA 4CPDA 8LDHA 4UVEA 2B35A 4IXWA 1RWBA 5CFZA 5L4SA 3BYZA 4QFCA 4NPCA 1VL6A 3DOCA 3HZZA 3SC4A 3VH2A 5F1OA 4J2OA 4Z9YA 2WYWA 4PCVA 1GR0A 2VT2A 3K5PA 3QWFA 4IDAA 4NIMA 4W7HA 4EI2A 3UFXA 3BHMA 3NV9A 2JJYA 3RUDA 4DC0A 5HS6A 3U5TA 4R3WA 3C7CB 3AUAA 1OI7A 5ITWA 4E2WA 1T25A 3DO5A 4N5MA 2W2LD 1R4NA 2EERA 3MJVA 4WK6A 4YA6A 1UXGA 3K8ZA 2JD2A 4RVHA 1GTMA 3DZJA 4XKJA 5GZ1A 4ZQHA 1DRWA 3U09A 3VTFA 5I7SA 4U0JA 4CLDA 5JPIA 4XQGA 2R00C 2I99A 4BHTA 4C7JA 4L75A 3GDFA 4WLEA 2Y1EA 2AA3A 1LSUA 4BNJA 3ZWPA 3MZ0A 3QW2A 2RAFA 3L07A 1SOVA 1LDMA 4CMEA 4PLFA 3ZDFA 4AJ2A 2O4UX 3ANMA 2IE0A 2CVOA 2YQ5A 3LT2A 1LQUA 3NDRA 3V2UA 2Q45A 5BQFA 1ZEJA 3D3WA 3UXYA 1H6BA 3DHNA 5CEFA 1H9AA 3GLQA 4GX2A 1S6YA 3H9EO 1GUZA 2VRCA 3STHA 4LVCA 1I3NA 1LUAA 3JQ9C 4AJ1A 3QWBA 1A4UA 2IXBA 3DBLA 4PRKA 1GV0A 5C7LO 4A03A 1ISHA 1DJNA 5A4DA 1U1IA 3A28A 1JKIA 2EG9A 3GN1A 1N9GB 1GQQA 3Q2IA 3EZYA 2D4AA 3OFSA 3DR3A 4J0EA 3GY0A 4MKRA 5JCJA 3C8MA 4CM4B 3IUSA 3AWDA 3GG9A 1CETA 4W9NA 3QA9A 1ZSYA 3KUXA 4OQYA 4UAGA 2Q46A 2C7GA 5BR7A 1XU7A 4CUJA 4NBUA 3KYDB 4AJPA 4I9NA 4W99A 1JDJA 4ZQEA 2Y93A 2UV8A 2CNBA 3U4CA 1P33A 2X6TA 5B1YA 2O3QA 4J3FA 4KDEA 1E7YA 3GEGA 4ZHSA 4J7XA 3H7AA 4FS3A 5AVOA 3BA1A 1YE3A 2AEFA 3V2GA 5L7WA 1L7EA 3JD2A 4IJUA 4NBTA 4XYEA 3EVNA 1NWCA 4XWYA 5DT9A 1XDWA 2B36A 3IC5A 1NYTA 3VDRA 4NU6A 4YJGA 4FC6A 2DKNA 5IN5A 3PGXA 4K9DA 1LSSA 2E4AA 4JXKA 4XR9A 2P9CA 2VWQA 2NLOA 3PIDA 2JL1A 5I8ZA 3S55A 3EC7A 3WGYA 3UHAA 1QR6A 3IKTA 1KC1A 4J2HA 2HQ1A 1H6DA 4II3A 3FWZA 3I52A 5THKA 4YR9A 5A5FA 5L7TA 2DBVO 4IM7A 2R6JA 4NJOA 1D1SA 1A7KA 5C37A 5TT0A 4YAJA 5T64A 1JKFA 1LLUA 2H9IA 1NVGA 5IFLA 4PG6A 4O5OA 4E2YA 3ZHZA 3IJPA 4FFNA 5CHEA 4D3SA 1Z73A 1X7HA 4XYBA 5JC1A 3JYNA 1PJLA 2VOJA 3DZFA 2XXJA 1XWFA 1TB4A 1CYDA 1D7OA 3HJAA 2Y1CA 4ALNA 4WLNA 2EXXA 3MJ4A 1DDOA 5JLAA 3FBTA 2FRDA 3DAGA 4J91A 5TLSA 3RI3A 3D7LA 4BQRA 3DC2A 1YS4A 3M2PA 4J16A 2WDZA 4FFOA 4G5HA 5COAA 1TVEA 1EUZA 2IODA 1DJQA 3LU1A 2ZCUA 2VYND 1L1FA 1W0CA 1YDEA 3DDNA 2DTXA 3FNEA 2QYTA 3NDJA 4IPTA 2FR8A 2O3TA 4TMFA 3W4JA 1R0SA 3ON5A 3FR7A 4BB6A 4JP3A 4BO9A 1Z7BA 4MVJH 3KEQA 3O9ZA 4RF5A 5EESA 1DO8A 2OMEA 4AG3A 5KTKA 2PKQO 4ILKA 5ES3A 4FFLA 4R1TA 1FDUA 1KBZA 1T1RA 1L7DA 1U3TA 3RKUA 2POQX 4DA9A 4YRBA 1K6XA 4IZHA 1WNTA 5DBGA 3GG2A 2QRKA 2YHUA 1FJHA 3RWBA 2AG8A 3DZHA 3OP4A 2GN6A 3I5MA 1EBFA 3BAZA 1YL6A 2DVMA 1GEEA 1P45A 3D5QA 1J4AA 5JDCC 3QWHA 2X0RA 4AICA 1TI7A 1VL0A 7ADHA 3TOZA 1E3WB 4P4GA 1OZAA 3GVHA 5LC1A 1P1RA 1YONA 1EFLA 1F8GA 3KYCA 5EN4A 3H3FA 3JV7A 4UVDA 3SX2A 1I33A 4B4VA 3CSDA 3W4KA 1ONPA 5DNAA 3A1NA 1KEPA 5F5NA 3WJAA 2R00A 4AVYA 1HYEA 1M6WA 2WM3A 1HE3A 1HDRA 3H2ZA 3L9WA 2Y1FA 4M8SA 1ULUA 1W8DA 5DZSA 5G0UA 3NTOA 1ADFA 3UF0A 1HDGO 2NADA 3ETDA 5EERA 1MP0A 4WCDA 1JVBA 4D0SA 3FD8A 1UAYA 1AXGA 3RBZA 2ZB3A 3GUYA 5EIOA 5T67A 3VH4A 1DLJA 4EDFA 5IN4A 4I1IA 1CDOA 5JCJD 4BNHA 2W2LA 3L4BC 4AJOA 3ANLA 4OGWA 1U7TA 4TVOA 1IOLA 3ICPA 1P1HA 1Z7EA 5KKCA 4B3HA 2DPHA 2YFHA 1M67A 3D3WB 4PZCA 2YV2A 3HB4X 1GUFA 4CV2A 4AFNA 4R4JA 2OBYA 4UREA 4E21A 1NNUA 2PY6A 3JTMA 1BVUA 4ALLA 2VTDA 2Z95A 1E7SA 4OKIA 5TX7A 3DBLB 1X1EA 4K28A 1B0AA 4Z9FA 5JC8A 2HO5A 3GQVA 5A3JA 5GZ3A 1V3VA 1N9GA 4DPLA 4J49A 1EK5A 5I9NA 4DIBA 2EGGA 3VPGA 2Y67A 4Q3EA 4OM8A 3WYBA 3H4VA 4J4HA 2GR9A 5FEUA 3DZGA 3WJ7A 2I6TA 2Q2QA 1SB9A 4UULA 4M89A 3VKUA 4RDIA 4L76A 5JYEA 4BNGA 3H65A 1ZK0A 2CVQA 5KIAA 3DZBA 3PJGA 4J4TA 2OOSA 5TT1A 4CL8A 4CM7A 2IEBA 2IEDA 4IIUA 1NXQA 2Y1OA 1YJ8A 1EUDA 1NVTA 3GVPA 1BTOA 1LDYA 1Z6ZA 2RIRA 1EK6A 3BIOA 1QYXA 4INAA 1BXGB 4FR5A 3K6JA 1SNYA 4BQPA 1E7QA 3OIGA 1QORA 1GYRA 1N92A 3JQFC 1UAGA 1O95A 5ADHA 4RCVA 1Q0LA 4QQRA 1DB3A 1E6EA 3TL3A 4E2ZA 3D4OA 3I1JA 1JVSA 3ANNA 4MIOA 4TSKA 2HAEA 1EZ4A 3OEWA 4FD3A 4NBWA 5ER9A 3GEDA 4IMPA 1N1EA 1R6DA 2PZMA 3DAPA 3NGXA 4PG5A 1PJCA 5HTOA 4W6ZA 1XQ6A 4WCFC 1V3TA 4ONEA 5CG1A 3WFIA 4WLVA 3WB9A 3E9QA 4NU5A 4GH5A 1CEQA 5TSDA 3ZNQA 1EVZA 1YRLA 3PIIA 5LDHA 5H82A 5A9RA 4PFJA 4JBHA 5EQFA 3UN1A 4XB2A 2B37A 4R1UA 4PN3A 2JFFA 5J23A 3GHHA 2ZB4A 2BFOA 4AJEA 4GMGA 5CPFA 3OJFA 3RU9A 1DBVO 2JCYA 3G17A 3WS7A 3IIEA 3IAHA 1F8FA 4RQTA 5F1KA 3F5SA 1OFGA 3SJUA 1KS9A 3W4IA 3OF2A 4RZIA 3DFZA 3RUEA 1FDTA 3WLEA 3BTVA 2GSDA 1JA9A 4K6CA 1N2SA 3DHYA 3F9IA 5JO9A 1X0XA 2WD8A 5L53A 1WAMA 4YTEA 2NU9A 1RPNA 3C1TA 3ENNA 4IY1A 1PJQA 3AOGA 3GUCA 1NWHA 1ADBA 2CZCA 1GPJA 4YRAA 2HK8A 5B12A 3FNGA 3SBOA 3FNFA 4M1QA 4PLZA 4JJGA 3E8XA 4FSHA 1QSGA 4F6LA 5L51A 2AEMA 4HFRA 3X2FA 1A9ZA 1RJWA 2P91A 2ZTLA 3GDGA 3K73O 3RAJA 1GEGA 4BNFA 5CDUA 3AFNA 3RASA 4DQUA 1D8AA 1VSVA 2JCVA 1B7GO 2O48X 3GAFA 4BO6A 4BS9A 1YQXA 1CQIA 4D45A 3WOHA 1B26A 4QTZA 1E1LA 1PWZA 3ZI0A 1PGNA 3FHLA 5DP1A 3JYLA 1HZZA 4CMBA 1TXGA 2J3JA 4WUVA 5TC4A 2OUIA 3ZU3A 4IGFA 5DULA 4QXMA 4GX0A 3AY7A 3SC6A 1EVYA 2QRLA 3ZCXA 1MXFA 3LF2A 3PEFA 1B8PA 4NBVA 2WYVA 3B20A 4J9UE 1FDWA 2FSVA 3RC7A 2ZYGA 4JK3A 4WKGA 3GHYA 3OBBA 3R3JA 2FPGA 4PLCA 3I9JA 1H2HA 1YOVB 1K6JA 2Q2VA 3ZHYA 1UDAA 2UVDA 3PK0A 1R66A 1WW8A 1N1GA 5ENVA 2UUPA 4FCCA 4YXFA 2J5QA 3MJTA 4KUGA 4J9VA 1LLQA 1PX0A 4FW8A 4EZBA 4XD2A 2WWRA 1HDXA 1QYCA 4YT2A 4WPGA 1GQ2A 2GYYA 3BMQB 4ITUA 4DIOA 3EVTA 1R4MB 3I4FA 3E9NA 2OBNA 5KWEA 1JAXA 4ZN6A 4E6PA 4MIYA 4ZRMA 3KV3O 3RC1A 1BWSA 1ZSNA 4NH4A 3ZWYA 4FN4A 3JSAA 1PTJA 2B83A 2WTBA 4PLYA 3ZU2A 1AHIA 4OSOA 4LRTB 5TJ9A 4NFYA 4O63O 2HSDA 4DVJA 4ZGWA 2VNSA 3ZWVA 3WBBA 1U8FO 2Y68A 3MWEB 3GMDA 1GU7A 4BO4A 3RKRA 4OYRA 4P4LA 5T8KC 3K92A 3ZV5A 4B8ZA 4QECA 1PGOA 3MOIA 1JAYA 3KOUA 4HADA 4LW8A 4LVUA 4YBZA 2YZ7A 4M86A 1ZK2A 3BMCB 1LEHA 4YVFA 3O8QB 3GZNA 1YQGA 3OEYA 4PLHA 4MO2A 3TL2A 4JBGA 4XDZA 5JY1A 4WLFA 3E82A 1BW9B 4KP7A 2XAAA 2O7QA 4OO3A 1DOHA 4HNGA 3LF1A 1OC4A 4D0RA 1XG5A 4E31A 2EKQA 1PS8A 1GPDG 3L4BA 2VHVA 2VQ3A 5EMHA 4IQGA 3L6DA 1CIVA 1UP4A 1HDYA 4GI2A 5DCUA 3BMOA 3FTPA 3E6AA 3W8DA 4CM9A 2GASA 3HFGA 3MCVA 4NI5A 4BGIA 3RC9A 3U3XA 2IRWA 4LISA 4ROSA 5JFOA 1ID1A 4P38A 2PKQP 2SCUA 2FPPA 1YJQA 1DFHA 1T2EA 2X9VA 4E5KA 1Y8RA 4F3YA 2C2XA 4CQMB 1ADGA 2D0IA 1ZK1A 3CH6A 4TKMA 5IDWA 2VCYA 1VM6A 5CDGA 1HRDA 4WLUA 4CJXA 3PVZA 1PL7A 1P1IA 3DMTC 3KSUA 1VJ1A 5BT9A 3PZBA 4OH1A 4QEDA 2B4TO 3MTJA 2TMDA 2Y66A 4U6SA 4MINA 4OL9A 5BNFA 3VZRA 4IJVA 3EAGA 4CLXA 3QIVA 2PGDA 1Q0QA 5I8WA 4MVJF 2VWPA 3B6ZA 2OHXA 3A14A 1JWAB 4S1VA 1PJBA 4CLRA 1WMAA 2HKIA 1E1KA 4YCAA 4BNVA 3ZN2A 2Y1DA 1U7HA 4EJ0A 4DPKA 2OORA 3GT0A 2B5WA 2QRJA 3QWIA 4BGVA 2VRCD 3FSRA 2WYUA 1WPQA 4JJIA 1Z75A 3U4IA 3HFSA 3JYPA 1XR3A 5T57A 3ZWWA 3MJSA 4GVLA 3JCZA 1KYQA 4EBFA 3OIDA 2IYOA 5T6BA 1EVJA 4GX5A 3GVIA 3I9KA 1WWKA 1K0UA 1PZEA 2HDHA 1O6ZA 3I9LA 3LYLA 3U0BA 3WG9A 1WDMA 1MX3A 1N7HA 4GKBA 2C0CA 1DIAA 2R2GA 4BNTA 2CUKA 3OSUA 1ZZEA 4RORA 2I76A 4BMSA 1JLLA 2A4KA 1MFPA 1U2DA 3JQFA 2HRZA 3QLJA 4YT5A 3ROQA 3T4EA 4AJ4A 4W4TA 4XQ9A 3DBRA 5IZ4A 3DBHA 3TRIA 1I10A 1YBVA 3R0IA 1UXJA 1PS0A 2HMVA 9LDTA 2PH3A 5MGBA 4E4YA 2G1UA 1WZIA 1YVEI 2V65A 3PHIA 2B0JA
chains in the Genus database with same CATH superfamily
3AM3A 4DQ0A 2Q21A 3KFXA 2C2ZA 4KYUA 4N8SA 4C22A 2FHPA 3QF7A 2CK3A 1BZYA 3KLOA 1BVRA 3C3PA 4IIVA 4K9RA 3UB2A 3UXHA 4CG3A 1PLKA 3E05A 3IBCA 5A2GA 3L43A 5BNWA 3P2MA 4CMJA 5BSWA 1NDQA 4AS1A 1P5HA 5ALGA 5EXEA 3T52A 2GA8A 3U3RA 1C50A 1UF9A 4HOYA 3U2QA 2A1TR 5DWQA 3F9RA 1MX9A 5CJJA 2BMJA 3HVHA 5DOZA 1ELOA 4ATNA 4Q1VA 4D80A 1B00A 1UKEA 4RVSA 4M76B 3TRJA 1RBYA 5SY9A 1OJLA 2BKAA 3C5VA 2FMTA 3BH0A 2AYYA 3FI0A 3I2KA 3OURA 4IEFB 2FPPB 3T0GA 2CV2A 2GFIA 1DPFA 1NATA 4JR0A 3TW0A 3ZY5A 1N75A 2GN8A 3WDKA 1WXFA 2D4HA 4LWOA 3SQWA 4HPWA 1NR1A 1MT0A 2QMQA 4A82A 2EYQA 4BCDA 4E15A 1K7SN 2VJAA 2IITA 2HIAA 2A33A 5FI0B 1LA2A 1WZUA 4JBIA 5G4KB 3T1VA 2JFZA 4P31A 4YAEA 4KQEA 3RYIB 2HXSA 3F2VA 1J97A 2HHAA 3KPWA 3OZWA 3HA2A 4QYWA 3LQ4A 4R5MA 1R4MA 2AKAB 3SSOA 3W04A 3MUFA 2QV0A 4MEAA 1A9YA 1Q1NA 4CCYB 5CLGA 4V02A 2AL7A 4BJHB 1YZLA 2QN7A 3WB2A 1F60A 3EIQA 3M83A 3N8KA 2E18A 3N2KB 3BL6A 2ZUWA 2AZMA 3TINA 1R0XA 1DAOA 3N9IA 1QGUA 3BIXA 4MCHA 2WP8J 2ZT5A 1JIIA 2XUQA 3GDOA 4TPKA 4PM4A 1IJBA 3G85A 5EMJA 1BMDA 1DQNA 1R9GA 5JS2A 1MAWA 3UOGA 3VR2D 2EGUA 3LECA 1V8ZA 4BJ5A 5BT8A 2G1KA 2ZIXB 1NURA 4KQFA 5EJ7A 5BN4A 3MJHA 2G5PA 4D79A 2PZLA 1LC3A 1UJ5A 1C7JA 1YB1A 1M10A 4BNKA 4MQEB 5FHRA 3HADA 5JCXA 1SOMA 1JJVA 3FSEA 2IC5A 1V96A 1SO8A 4RZQA 4B48A 4D8XA 4WBXC 4IHJA 2GM4A 4NESA 3S5JA 5TY0A 2ID9A 3SPXA 3E9MA 3QU7A 2I6QA 1E94E 5EHIA 1CUWA 2TS1A 3HQ4O 4DLWA 6PFKA 1YZYA 3NGLA 4K6HA 3M6LA 4IXTA 3EZ9A 4MYUA 2ZXUA 3KNZA 3BILA 3VH3A 5BSHA 3KEOA 2R44A 4RKQA 4DDWA 1AX9A 4JVSB 4G0QA 4BKQA 5FR2A 3LQQA 4Y6RA 1M2VA 4ZJZA 4W9NC 3W1VA 1KORA 3PFFA 2W22A 3B1FA 3P5BA 2J5XA 2GPTA 3GOHA 2AOVA 1TD9A 1WCIA 1Z6GA 2EAUA 3KHUA 3Q0IA 4HG2A 4DT1B 2ZYAA 3E8MA 5D86A 1M1YA 1N4AA 1RADA 2EFJA 1YB5A 3NETA 4FLMA 4JUDX 5CIQA 5PNTA 3OG9A 3AV3A 3OBIA 5FNVB 3R20A 3TW8A 3LP8A 3EEYA 2RGCA 2HUNA 3GNQA 1GILA 4YT4A 1M54A 4Z0TA 1DJPA 4JX8A 4ZEVA 3C15C 1QCZA 2W6QA 4OMDA 4FE4A 1XCJA 4Q4HB 4F2DA 2LKCA 1CJVC 4DRXB 2BGMA 2VBFA 3RUCA 1H2RS 3S1LA 1XF9A 1YU9A 1AGNA 3PGKA 4EA8A 4TQGA 4M22A 1GM5A 1P7YA 1KR2A 1YZ3A 1SG9A 1UJMA 1NM5A 2AUNA 1W1UA 3AVOA 3EXHC 3W2HA 4MP3A 2H57A 3RJZA 1N5RA 4CIWA 3W8FA 4QDZA 2CUNA 3Q7IA 3DLTA 3AP2A 4BV8A 5CA1A 1QWOA 1JR6A 3OOYA 2FSSA 2V03A 4O33A 4A36A 4EKIA 5L3VA 2YW9A 3TWOA 3S68A 1EUCB 1XFDA 1JEDA 4RNDB 4HB3A 5KJ6A 4XLZA 5EIHA 2QM0A 2YVQA 2Q5JA 5H7XA 1PO7A 1RRFA 2Q0HA 3WLJA 1ORIA 2FK8A 3CYFA 4GPBA 3VYWA 4HVCA 2QTBA 2O8BB 3ZX4A 2QTGA 2Q1YA 1UXOA 3OAAA 2YJ5A 3GD7A 1OILA 1ULHA 4FGUA 5DHSA 4MUKA 3RSQA 1KFCB 2ZRFA 2ASEA 1OLUA 1MMFB 3UWSA 4YHHB 2BFPA 4BO3A 1WVGA 3H1PA 1NHWA 3IAM1 4KQ1A 4YAKA 3AR2A 1EZZA 2KX7A 4WA7A 2R1TA 1W8IA 4Q7LA 2VXYA 2QP3A 3PXUA 2XT0A 2D5CA 1N2IA 1V8BA 2BI7A 4IGEA 2XD9A 5FI1B 4DLKA 3KSDO 5U1PA 5C53B 1QBKC 2OGSA 1JPJA 4O3FA 4W8OA 3WFJA 3G0GA 3LWDA 4HWGA 4RSRA 2F43B 4I1PA 1A1VA 2EIHA 4JLMA 4YDQA 2QL9A 3NV7A 1GU1A 3ZX5A 1VRWA 3UWKA 3A2LA 3LDHA 4WZAB 2UXBB 2AKYA 3PHBE 3G2QA 1Z35A 1MG5A 1GNSA 2YJZA 5IUJC 1TAHA 1JHPA 2X9NA 3UK1A 3EGXA 3IOEA 1GAEO 3DVRX 4DSTA 4WLOA 4ZOEA 2C2KA 3N2KA 1JH9A 5HS4A 3ZJUA 2AOWA 3RTAA 4R2LA 1AV7A 1AO3A 3WLAA 2C82A 1P2GA 3AV0B 5ECGC 4BU1A 5I7UA 2WZCA 1K1EA 4QFDA 2NPFA 1ZR2A 5K4AA 1Y89A 3RIEA 1J0XO 4O1MA 4NRDA 1P9NA 2W9XA 3CGWA 4ACBA 2XH8A 4KI0A 1R6UA 2OK8A 4MS4A 3KDSE 3QF4A 4ZVKA 4EPWA 2XA9A 2PLAA 4TZ6A 4H15A 1MGOA 4M60A 4ZV7A 5J4LA 4QBKA 3P9PA 4HQNA 1XCPA 5EJ2A 3DBVO 1PVDA 2IXAA 4KTVE 4BWVA 3U7IA 3EHDA 1WXDA 2RGBA 1EM6A 2OHIA 1JHZA 1YB7A 1CSEE 4KPGA 1PSZA 4CIXA 4CDRA 1X7XA 2QM3A 2VP9A 4LDRA 3B53X 1WMDA 1JIVA 4Q39A 4XCVA 1FRZA 4QQKA 3B85A 3ORRA 3PQDA 4WK2B 3OTHA 5EHNA 5HSGA 3I45A 1PT8A 2YFQA 3HU5A 3DONA 1JQLB 1GITA 4AJ9A 1JEAA 4XWKA 3DT9A 1Z12A 2G9QA 2VHYA 3HG7A 2QD3A 4YB8A 2HWXA 1R8YA 1O94A 1XE3A 4INZA 2YHBA 1N3LA 2E37A 3BRCA 5JU6A 2JAHA 3MM4A 5F7JA 2CDAA 3IAS1 4JEUA 1FMFA 2WD7A 4GR5A 3EXIA 2BEVA 5CYPA 1GKLA 2JAPA 5H02A 3GJQA 5JLJA 4AS3A 2WT9A 3QXXA 4J4BA 3D8RA 5KYXB 2C2GA 2FVXA 1M1YB 1PAUA 2H1LA 4WZBB 3COSA 3SQOA 4C20A 4DCMA 1ISSA 4L0QA 2WM8A 3AF4A 3WKBA 2IL1A 5AW0A 1QGZA 3E61A 4TTAA 1X7GA 1FA9A 4MKGA 4K6OA 1D0SA 3JQBA 3LM8A 4IFBA 4KWIA 5JALA 5JISA 2LV8A 2X41A 4A6PA 3FR8A 4HC4A 1PG0A 3QP9A 1DQPA 1TPZA 3R9XA 2NQ2C 2YQZA 3R8CA 2VNAA 4JNCA 4RV9A 4S3MA 2IBTA 4EW2A 2AJTA 5A04A 1N34B 2OGZA 5FKJA 2P4HX 1NVDA 3OZDA 2JKYA 3IOYA 1YGYA 2JHAA 2FVYA 2RHHA 5DOVA 4HQKA 3KQOA 2J3LA 4LV5B 1JQDA 1NMYA 4O4HB 4ZXPA 2Q9UA 4OHPA 2Q62A 3AIOA 3EFHA 2ZJAA 4LRXA 1LV8A 1XJ5A 4NQRA 4TMYA 1EUCA 2H2HA 3QITA 3NJ8A 1SBTA 5EJMA 1E5XA 4AT1A 1G42A 1RQLA 2DBQA 5HF5A 4CVNA 2FJPA 1E1QA 1WJGA 2G7MC 1GUYA 2OVBA 4YJGB 4IFIA 5DDIP 1AMNA 2UYHA 2VTKA 4QXQA 5JAMA 3TRHA 5BR4A 5JNUA 1JQEA 2JW5A 1NOKA 2BH9A 3T4XA 1B6GA 5KNCH 3WK7A 1LBQA 2H3EA 5IDYA 1HLDA 2V9PA 3NM5A 4ARZA 4W1QA 5HR5A 5KYUB 4EY8A 2HWWA 2R1TB 1WU8A 3KSAC 4JL6A 3R7AA 3Q1KA 4B6OA 1A1SA 1GPKA 2Q3EA 4CT0A 2VXCA 2W48A 3J81k 4MUFA 4IHJB 1T9ZA 4BRZA 5A06A 1G6HA 4NJMB 3IP6A 1SBQA 4LFCB 5DLEA 1DQYA 3NHLA 1Z8HA 1T5DX 1YE8A 4LZPA 3PCTA 4I1OA 1GDHA 3A1TA 3DZDA 1QIHA 1VLLA 1DU4A 2FZWA 2YWBA 1KQFA 2XIJA 3MYRA 4XOIA 1Q22A 2Z8YM 3LOQA 3M3HA 3R40A 5CXSA 3SBEA 1WPRA 3VHQA 3ENQA 1IXYA 1FDRA 4KLNA 5IJ9B 5KYTA 4FUTA 4UM5A 1VMKA 3I9MA 4B82A 4INJA 1TT7A 4ZV4A 5T4HA 1JG2A 4HTAA 5EKDA 4R0MA 3U3OA 4KN6A 3GJRA 5FDFA 4P3KA 2RCYA 1MF7A 5JNLA 3PUIA 2R6HA 2ZJ0A 1JFFB 5BR8B 1XMPA 3MRVA 2W2VA 4L4RA 1QIGA 4B7XA 1Z4JA 1JEEA 1AGRA 1P0PA 1XIVA 2E4ZA 4R9NA 4ZI5A 1E4VA 2QRHA 1KQ3A 3FPHA 3LCCA 4RYDA 4UHFA 2JFXA 3GLSA 5AVKA 3PKJA 4A23A 4EITA 1ZVJA 2Q6IA 3DBOB 5AM1A 3TR0A 4TTJA 1JFSA 3CZRA 4MGEA 3MD9A 5KYNA 4WEQA 3NBXX 1DQSA 3NAQA 3WLTA 3FGPA 4ZVPA 3IESA 4IDOA 1ZUNA 2AD5A 3SAJA 1Y5NA 1T35A 2R84A 3FHJA 2W5UA 1GARA 2P2ZA 2Q4BA 5KYYA 3AW8A 4GXNA 5K2MA 1Z7YA 1OC2A 2O2EA 2Q0XA 2IZOA 2DECA 4CR7A 3QXHA 1OLSA 1E5LA 3CUSA 2J6IA 2AEJA 1DP4A 1H2WA 2I7TA 2JGLA 3LWZA 4FZ5A 3LTEA 4K1LA 4QYIA 3ZHBA 1IYZA 1DKNA 3KKMA 4R16A 1QIIA 4V2UA 1FQKA 4LZWA 1WY7A 4X8HA 3TJMA 1XTJA 2CWWA 2HA6A 2PRKA 3L40A 1C9MA 3P9XA 2O07A 2BEVB 2CLLB 2XDQA 3CLHA 2GCNA 3JASA 4CDMA 4E94A 1ID8A 4YJKA 2E4XA 4HGQA 4QNNA 3GMSA 4AY2A 1NI4A 2QU7A 2W93A 4YJ3A 4YP6A 5C4MA 5KX5B 3PJDA 4W5RA 1QMPA 2WZQA 4WOJA 3KAJA 1PEYA 2G82A 3RSOA 4D43A 1LPMA 1OLUB 3EOZA 1TQHA 1W47A 3QBDA 4TKVB 1OZFA 3E2MA 1VL2A 4TT8A 5IU6A 4LI0A 2AUMA 3ABZA 2MR6A 3GPDG 2YWHA 4KN8A 3A36A 5FD8A 1CC1S 2YY5A 1GG5A 1VMAA 2D5LA 3LQRA 2WV9A 5FYDA 1R5NA 4JR1A 4C0LA 1BE1A 2MYNA 5BW6B 3WVNA 3QVSA 2C2WA 3T12A 5KI6A 4CG2A 5ITVA 1Z47A 2OYSA 2QVLA 3NBUA 1VDMA 3TKYA 1EXNA 3I9NA 1LRLA 1E32A 4HUQB 3OJOA 3SQDA 3C3DA 1NQUA 4TTSA 2QTCA 1I2AA 3ESXA 4DMHA 3IMCA 1FBTA 2W6PA 3D4BA 3HNPA 4E1VA 5ARBA 4X71A 3WGIA 2FSHA 3Q87B 1PDVA 2J07A 4GGPA 4I9UA 4UU0A 1I9CA 1P9OA 1TVKA 3WYAA 5CFRA 4IDQA 2IEAA 1SEPA 3JRWA 1NZJA 3T5AA 1EP2B 1DJMA 1UXKA 4HUTA 1W4AA 2XXBA 3NHZA 5L6LB 1ODSA 4QL3A 1KEZA 4XB6B 3ZCQA 1ZOIA 2CLEB 2XDYA 3MERA 3OT4A 4OQMA 3H6HA 3NVMB 3HA7A 5JXWA 4RHXA 4YC7A 1H2ZA 4NU0A 4U7JA 2G25A 2OO3A 4PLGA 1RJ9A 3OCWA 3W5HA 3ROZA 1H4QA 4B9AA 1J25A 5J4HA 4E70A 2FX5A 1FP6A 1W2GA 2J45A 1KAHA 5F5XA 3PDJA 1F2DA 3O4IA 2CL6X 5EXDA 4AJJA 1QHHA 3ZCUA 4DHWA 4JEHA 3LGXA 3QXCA 4JBNA 1VBFA 1FLVA 2HB6A 1E2QA 5IWCA 1UUFA 1DFGA 4L5IA 4E5YA 1E7WA 1L5SA 3HKBA 4H0CA 5IF3A 4L8LA 1RAFA 2PS3A 2IX9A 1LLDA 3DGFC 4OBXA 3TZLA 3KKZA 2PU5A 4RD4A 4IDCA 4K81B 1X80A 4XH9B 4AZVA 3A4TA 1P0QA 5I7RA 1I24A 5JW6A 3SEFA 4FONA 2KS6A 2RK3A 2E85A 1Z0KA 2PG3A 3HKEB 4HDOB 2RKBA 4C4ZA 2X40A 3NTQA 3UJBA 4B0OA 3WGLA 2ZCVA 1E7MA 2RCNA 3KHKA 1MCZA 3X0DA 2IBSA 1WXWA 2WD7B 4GDFA 4AULA 2PL5A 4RZHA 1F0YA 4AW9A 4FE7A 1NW8A 2NTJA 3C4JA 3FNIA 1DTSA 2ID7A 4JQCA 2XF2A 4A26A 1P17A 2O05A 4JB0A 4RM3A 5CURA 1F4LA 2GB4A 3LQFA 4M55A 4MQFA 3OVMA 5BNIA 1BE6A 1XWWA 1Q2UA 4ABYA 5HWSA 4MLDA 1P5RA 5K0JA 4NPHA 2ZB7A 3V4ZA 2ON6A 5EXTA 2A0WA 3LVRE 4L6CA 2HBYA 2WNSA 3WRXA 4BZZA 2CT8A 1C0LA 3K1AA 4H6PA 1C3OA 1RT9A 3EW7A 1CRZA 2V74B 4Q3BA 4BGEA 4E22A 4DDUA 5BSEA 3F8SA 2KYRA 4AZWA 1ZUNB 3QH4A 1Z4NA 2GYWA 2XE4A 4BC0A 5CDYA 3MWKA 4WAUA 1WOYA 2DR2A 3FY4A 1TKCA 1M8KA 3RO7A 3W8RA 2X0JA 2BEKA 4NFLA 1DIHA 3QUBA 2H8GA 4RVOA 1IQUA 4BO7A 4BVHA 2DH5A 1CUYA 5HKOA 3M6UA 2HLNA 2Q1SA 2ZS8A 3WLQA 4FWTA 3Q2KA 3ZCVA 1NJFA 1SU8A 2V0NA 2G80A 4FPXA 2WIGA 1V2GA 2BMEA 2QUZA 1GNLA 2R8ZA 2PBFA 1DQRA 4JLJA 4CQMD 1BSVA 5IAAA 3IMEA 2FY8A 1K27A 2QYHA 4HGNA 3EUWA 2I4OA 3ACBA 3VU3A 4QBHA 3W77A 2ZYRA 4N5NA 1N33B 2PGIA 1YACA 2JFWA 3HV2A 2CKDA 3P96A 4BQFA 4O5AA 4IDFA 2Q4EA 1ORWA 1TFUA 1RQNA 1N9KA 3R5SA 5IH7A 1KK3A 4J1NA 1PNOA 1SKBA 2RHWA 4Q9HA 4RJ2A 1H1TA 3HXLA 5H9WA 2HX1A 3LG2A 4FOLA 4JEIA 3G2IA 1WF3A 2FJUA 2QMHA 4JOQA 2PA0A 1YC2A 5CM2Z 3UC5A 1HNNA 1YWGO 2Q4DA 1YQDA 2H0QA 4Z9XA 2YN4A 1EINA 1YBFA 1RNLA 4UBLA 4B4KA 5JZOA 1A88A 1R4NB 1U02A 2CC2A 4MB6A 1A9XA 2AJ8A 1LVUA 2BSQA 4JI1B 3Q8KA 1GZSA 1SR8A 4CV0A 3WL4A 4FFDA 4D9KA 1W6UA 2XY4A 1NUAA 1L6RA 3O47A 3T3MB 1XZKA 3H2SA 4N65A 5EE5B 3ROGA 4GXTA 5K0ZA 4CT4B 4IEEA 2CN1A 2SHKA 1K06A 3ZI7A 3TSAA 4RIIA 4PLWA 3V4SA 3VPHA 3G2PA 1U3FA 1UQUA 5CT5A 3F3MA 2GRAA 3GRKA 1N2CB 2UVPB 4OFXA 3WIEA 1H0HA 3AR7A 3AB7A 4QNMA 4GKAA 1TU4A 1N5LA 4NSNA 3ADOA 1KO4A 4G0WA 1XNHA 3KZVA 4KE9A 5IWAB 2EX1A 1B76A 4OHKA 4JCCA 1CXZA 3DD1A 2BR5A 5EHZA 4QPZA 1RYDA 1YS1X 3KSZO 4MCAA 4D56A 2VK8A 4G0XA 2XWSA 1ITZA 1CQJA 1OLOA 2KBFA 1UFQA 2VZ0A 3I4CA 3CURA 3JX9A 1GPUA 1XEFA 4OJNA 3PQ8A 3W9BA 2CYBA 3O31A 4JENA 1KPIA 2HMSA 4TUYA 4U2DA 3SOZA 3RWMB 3PNKA 2RKWA 4GOLD 3TBKA 3JZDA 4IILA 1OXKB 3G68A 1GZVA 3FNRA 3A3YA 1GL6A 3ZDEA 2W70A 4JN6B 3SHTA 4BO2A 3A1DA 3V80A 3WSVA 2R8YA 2J5BA 4I5DA 2BDUA 2E6KA 2OXIA 2JBAA 1XMJA 1XJWA 4QYIB 1OD6A 4TTVA 5AKKA 5BN3A 1BN6A 3TTWA 4IDNA 2AVNA 1ZXLA 4LYGA 1I2DA 2O14A 1JXQA 2UAGA 3L0DA 1MO4A 4DLUA 2ZBEA 1ZY2A 1ZGCA 3UQZA 1RM3A 1KVRA 1BXKA 4N3NA 4Z3DA 2N42A 1UAAA 4PYJA 4ZK2A 1CUUA 2V6MA 3M7IA 2KHZA 1MV5A 2BBSA 3GAZA 2CMFA 4R54A 4WXMA 2KPOA 2H17A 4JA2A 4XSVA 1FXWA 4DA0A 4G8CA 5D51S 5B53A 2J4DA 1XQWA 4DR5B 4HS4A 1Q84A 2NU7A 1QLHA 4JAVC 4MYTA 4BMNA 4TKVA 5HGJA 3ID6C 3QKWA 1T24A 1SURA 3HCAA 3K1AB 2X0EA 3ZW8A 2HF2A 3LQ1A 1KVQA 3C3YA 2KLBA 4I50A 4KN9S 2IXGA 4KRXA 4LMPA 3TMAA 5A9SB 3A1FA 4NK4A 3AONB 3L4SO 4Q02A 1HSZA 2AG6A 1L5FA 4OHUA 3QMMA 1UXIA 3UOAB 1QGDA 1H4VB 1T3LA 3PFGA 3A7DA 3CZ5A 5F9MA 5H59A 3RJ5A 2YRFA 4M9QA 1XMXA 5CCEA 1W36C 1DHTA 1BIFA 4P3XA 4NE9A 1SUFA 4RADA 4BUCA 5IMSA 5JVDF 3T41A 1K6IA 4GPIB 4ZCTA 3SC2A 1EVEA 3ROMA 1NTOA 3DCJA 5B6IA 2VSOA 2DPLA 2SKEA 4Y6OA 2H51A 3S1AB 4JC4A 1CJUC 1Q0PA 4ADSG 3PQ6A 1ECBA 3WQRA 1NW4A 3CH5A 3KOXA 4OQQA 4R8MA 2VK2A 1A71A 1I6WA 3BWMA 3D9QX 1OAOC 4PRZA 5BQOA 2QZJA 2XE7A 2W6CX 5T4EA 4NQZA 5HA5A 4MI9A 3KIPA 5C8VA 4IIJB 3C3AA 2OBXA 4O6VA 3F3KA 3WBKA 1GFSA 2A14A 2FG5A 3C24A 3GC6A 3MINB 2CW5A 1BYUA 2D7DA 3V7YA 3U44B 4IKOA 5DM1A 4ZO4A 3TOXA 1K3UB 3OQ1A 3P45A 2FQQA 1NU6A 1USWA 4Q4LA 5L3RA 4A0SA 4EPTA 5KWIA 1W0JA 3HVUA 4WECA 3JPYA 1KZYC 3NIFB 5FH9A 3R74A 2P90A 4DLRA 2O2SA 4BXOA 1QB8A 3C5CA 3SBXA 5JSQA 2XE8A 1O0SA 4P3YA 5HJ5A 1J09A 4J2TA 3R8XA 4EGQA 3BN3A 3PXXA 4LC9A 4B6FA 2ZR9A 4DZZA 1P1KA 5B7QA 2QD1A 3EDRA 3P0RA 3DMGA 3MA0A 4WN9B 5FA5A 3QXGA 4GP7A 1AB6A 4ZOLF 1FU4A 3WWOA 2R4TA 1LTHR 1UFRA 1P5JA 4ZV9A 1NFQA 5TMBA 3UBMA 4IJWA 4ZYXA 3KX2A 4JY7A 1HV8A 4RY9A 5EZYB 3F4KA 3SG0A 1I14A 1LBHA 3Q11A 5EJ9A 1MOPA 2XUIA 2YIDA 4TKLA 4X93A 4IMJB 4KXLA 3UYKA 1TA0A 4E2XA 1PT6A 4UTPA 1BA2A 2QYSA 1OV6A 1ZESA 4FGZA 2BKXA 7YASA 1SHTX 4JSYA 1IEWA 2VPXA 4Q9AA 3ZVRA 3BF7A 1HDCA 3PWZA 2DFKB 4CUZA 4BZXA 3K94A 4HAOA 1QP4A 4XQEA 5F35A 3VQTA 4PQRA 3WIUA 4Z4GA 1E0SA 1BDMA 1EXWA 1SKAA 4M1TA 5IG2A 4C43A 2M6LA 3OM1A 2HJVA 1DWQA 2H2WA 3PI7A 3QX9A 1NDUA 4M4SA 3VJMA 4HEA6 4V0NA 3GNTA 1E0JA 1PGJA 1R6XA 3TXXA 4CN8A 3KCNA 1ZR4A 1DELA 5I9LA 3BMXA 5KVQA 2NU8A 4GE0A 4I99A 5LJIA 4BNDB 1P60A 1Y8RB 3FF4A 5CK4A 1P1BA 1QE3A 1V2HE 3RV3A 3ROKA 4MV9A 2QQEA 1VHDA 1NP7A 3PRJA 4KOAA 4ISBA 3TQHA 2X77A 2ZRKA 4PXSA 3JD3A 2CMDA 3DVLA 3GOQA 3L8YA 4RF3A 4BMDA 4UBKA 1ACMA 2WKQA 3R6WA 1EQAA 3X1XA 3QZUA 2J9RA 3AHJA 3GBVA 4FS8A 2YMLA 5DGTA 1IMJA 1N7IA 4ZVQA 4ARIA 1JW9B 1S0UA 2WPNA 3F90A 1OWOA 1BHSA 4UVGA 3L7OA 4QG7A 1NL3A 1L4UA 3C39A 1TL7C 2IQ5A 2IYWA 1CRWG 1SCAA 3MS2A 1QH1B 5F7XA 2IZ7A 4H7EA 3LLMA 3RC3A 2QVYX 3FRIA 3RVPA 4KTTE 1LFAA 1VHQA 1IVSA 1KJIA 3PCRB 4DLLA 5KOJA 1UDBA 3QJYA 3TK1A 5SZIA 2ET6A 3CMMA 2M6SA 2MSKA 1R5JA 1YA4A 3KLMX 2ZIVB 2E1RA 3SS7X 4L4SA 4GKJB 4L8WB 3QI2A 3ORFA 4NCHA 2PHZA 1T6NA 1XVTA 1CRPA 4RO0A 1JQBA 1M1NB 1SVWA 2YNMD 2D1QA 4HAXA 4WBNB 1TM1E 1L5ZA 2V5AA 5DW0A 3ZKWB 3BH6A 3W2TA 2UU9B 3E22B 4LECA 1UJ4A 4KSBA 1GPMA 2B3DA 3PA8A 1SKMA 3AL3A 4MB2A 1QV9A 1WCV1 4IQ4A 2UYOA 4JGBA 2RHGB 2FI1A 1PN3A 3KJFA 4V3BA 1H6CA 1M0TA 1SU6A 3S1AA 1D2HA 4UCWA 5F23A 3ZD6A 4LXQA 1CDDA 4R9UC 5KSYA 3OA0A 4ZC8A 3BD8A 4EA9A 4CIAA 3RNOA 3CN9A 1QYIA 3NKVA 5DHTA 4BJ6A 1F14A 2IT1A 4PHFA 1LLCA 4C87A 4OIMA 3PR1A 1G2PA 4YFVA 3E7WA 1G8JA 3OHMA 3IERA 1ENZA 3PC8C 3HGTA 1EE9A 5DXAA 5KEIA 2BF7A 3FWYA 3R0JA 4EFMA 2BD0A 3WYCA 2I2BA 4AWXA 1IZ7A 2XGMA 4L6AA 4LX8A 5J4YA 5A03A 1OFHA 1OFTA 2RBKA 4MRSA 3W7BA 4KFSA 4BBZA 3ASVA 4MWEA 3AEZA 5F3WB 3BSSA 1IHDA 1Y4DE 2WSIA 1KIFA 2AX4A 1WW2A 2W58A 3ENWA 4JB2A 5J1TB 4J3JA 1R0ZA 1USIA 1F51E 4KO3S 4R8SA 3RTEA 3RS7A 2Q2WA 2QP9X 1C8KA 4QJ5A 4M0MA 3FPBA 1KMMA 5A5VA 3FLAA 3A2KA 1ZOSA 2BTQB 3HH8A 5IKEA 4MVJG 5JASA 1OBFO 2HV9A 2I3ZA 1L8OA 3PE6A 1U0TA 4Q3AA 4Q16A 3IIKA 3UKJA 2XEXA 4JP2A 5G0TA 2OD9A 4C5BA 4MS1A 3P9ZA 2BFAA 2G1JA 3AVTA 2NZWA 3Q1LA 4XPZA 3A1UA 4ZU6X 4OGFA 4URUR 5FUMA 3QLTA 5CUQA 4HNVA 1Z18A 5C5IA 2PJZA 4GPZA 2W7TA 1Z7GA 4ZA2A 1Y0BA 3O8BA 1WCIB 3V4VB 4GR4A 2CBZA 4DT1A 3HBLA 4P6VF 4BFYA 1XV5A 3AKDA 4B4DA 1LRKA 2EWVA 3KQMA 4C30A 1NR7A 2QX9A 2IZZA 1KDVA 1WDLA 2FZEA 1TDJA 2I3AA 2Z2XA 5DP2A 3T38A 2VZLA 5KNCA 4BO1A 1QRSA 1JDBC 2PZ8A 2XA1A 2Y9MB 3L5OA 4UVHA 2ZTVA 2AI1A 4Q3CA 1RPJA 5FBLB 4TRMA 1Y48E 5AK4A 1FC0A 2ADFA 5A3RA 4FFPA 1L1EA 2XR1A 1U7UA 3NATA 5D87A 1EZ1A 5EKTA 1L3IA 2CUZA 2XLBA 4ZOAA 2Z5FA 5EG5A 4MW1A 2DPMA 3SF8A 4PZPA 5AKEA 1M0WA 1XOIA 4O4IA 3R6GA 1WOMA 2JLCA 1KHTA 1ZN2A 1Z38A 2HA0A 4BX8A 1MX1A 2G8NA 4C01A 5GJVC 1VA4A 3CRMA 4CRWB 3H75A 3CNHA 3AEKB 4RK0A 5JNWA 1GUAA 3BQMB 2Q41A 4ENRA 2HL6A 5EJGA 3UAVA 2VBGA 4X20B 1AKEA 1X7WB 4LYFA 4BAUA 1XQXA 2BFCA 4P7FA 2Z3VA 3ES9A 4CM9D 1B23P 1X1QA 4KQXA 2D06A 2ODAA 1KY4A 1DXYA 2QSUA 3CF6R 5ER6A 5I9MA 1CR6A 5FTLA 4BV9A 4DV4B 2JH8A 2IS4A 1WIWA 1U0NA 5SZJA 2ZB2A 5EIFA 3GB9A 1G59A 2BFNA 5K3SA 1RQRA 3R6LA 4A10A 3ZW9A 3IAAA 3GCXA 1RRCA 1AK1A 5BNTA 3FVRA 4RFVA 3VNSA 1HL3A 1GVNB 1SXJC 3KLBA 2H54A 1GPWB 3EXG2 3OX4A 3KXDA 3K9HA 2GPSA 1FB5A 1V5IA 3WI7A 3ZDDA 1EG2A 2N0SA 1IQ0A 3F1KA 3HBMA 4KQGA 2IH5A 3IULA 3AGPA 2D0OB 3A3KA 5HE8A 1CY2A 3DV2A 1JTEA 2ILTA 3H9BA 3T95A 3TQOA 3UG6A 3VZCA 3BL5A 2D1TA 4HP8A 3NWEA 4B6GA 4B3RB 1UFKA 2H16A 3DQPA 2ZAYA 4S1OA 3OZAA 5FP0A 4PNHA 4XB1A 4DLSA 3MXTA 3IBGA 4FBGA 3KTFA 2DWCA 3AI1A 3HL4A 3WGQA 1HT3A 1GNQA 1R15A 3O1HB 3OLCX 5EHQA 5JXJA 1M1YE 3QM1A 2GZ3A 3A6DA 2R65A 4B3MB 2XPCA 3SR0A 4PSKA 3PYXA 4YI5A 3WKCA 2REBA 4HXYA 2CL7X 1WL8A 2YIVX 3VR3A 4YUAA 1N4DA 1O6BA 2X3FA 4UEKA 2HLDA 4RDCA 5JD3A 3GT7A 5C1BA 1ZIDA 1XXLA 2BCJQ 3EOAI 1JFVA 3LK6A 3OE7A 4URFA 4D9IA 1E3EA 2B4RO 2E4UA 2GBLA 1G9XA 1QS0A 2RAUA 1KAOA 2BGUA 5AQEA 3QVTA 3ZDZB 4YAUA 3E9ZA 3PUWA 2WSBA 4OAQA 2PLNA 3GZNB 1LBSA 2HF9A 5TS3A 1H93A 4XVRA 5E38A 5J2TB 4WNCA 1EFDN 4O4LA 5BSRA 2Q3DA 3CX3A 3EDYA 3R3SA 4PFKA 3WGNA 3L4JA 1ZQ9A 3ULKA 3OZCA 3ER6A 1QRRA 1Y5LA 1DOAA 2VOEA 1ECLA 2FFAA 2IHTA 4KCGA 4EVSA 3QIAA 1Z6TA 4CDGA 4LSWA 4NYMR 3V8PA 4TLEA 4LMAA 2R0QC 1UC9A 1YASA 2RJ3A 1C1XB 1DIGA 4F12A 5JSZA 4YV1A 1JJIA 1JFLA 4HF7A 4JV5B 4R8LA 2HY7A 1G3IA 1Q14A 2AK3A 5DIFA 1H0RA 4YREA 2G17A 3WP0A 1H3NA 1VJCA 2PZBA 3DDSA 1MOSA 3D0QA 2YY7A 5ENDA 3EIEA 1YOVA 1FUIA 4U7WA 5T3YA 2PJDA 4JJKA 4LJAA 1E3MA 3FCOA 5D85A 4TRNA 2BMAA 2FV8A 3M4XA 5J40A 2CCKA 1E66A 3BHIA 2BMWA 3HWSA 4KGZA 2A94A 3C1OA 4U9IS 4Y6LA 3ZWCA 2NYUA 2PGOA 4D3DA 3JQ8B 3MB5A 4YJ2A 1ZUIA 2WR8A 1EVKA 1ENOA 1NQVA 3ZHXA 3OTQA 1X0VA 4G81A 3A10A 1I80A 4MW5A 4BDTA 2HPZA 3K9CA 3SJBA 4C0JA 1PG5A 4D8TA 1NQWA 1QKKA 1PR9A 3SF8B 1ZBQA 3CZMA 1XRRA 3B1VA 5C5EA 2HO4A 3FW1A 1ZNXA 5B1EA 2WICA 2H2DA 2IFTA 1R6BX 3TUJC 1EVIA 1DMSA 2WSMA 3E5NA 1LDNA 1JR3A 2YZKA 3JQ6A 4A0HA 4ER0A 1HTBA 1NY6A 3D4NA 3EJWA 3H9UA 2GJ4A 3VR5A 1JDZA 1WXXA 2KQUA 3EMBA 4C0QC 3EXG1 1U2SA 2ZOSA 3NWOA 4RA6A 3BZWA 4EMTA 5AD1A 1E2LA 1PJRA 2G9ZA 1RE0A 4JYPA 4YP0A 3KJHA 5EPOA 4V0LA 2YUTA 2GO1A 3MTIA 5EQDA 3MK31 3WRVA 4LY9A 4ZT2A 1BU8A 2YL2A 3F3SA 3NASA 1S9DA 4DMGA 4BYGA 4CETA 2WHEA 3TI9A 1XBTA 1RMYA 1L5NA 4OAOA 5ALNA 2EJWA 3WGOA 5AW4A 1J0DA 3GBPA 4TWZA 5CP8A 3LLCA 2IY8A 2X6QA 3LSYA 4E5UA 3QJ5A 1S02A 4ZTZB 1BJRE 5J2UF 2VBCA 1XKXA 3CIFA 1MQSA 4J90A 2RC5A 2BHSA 3K9FC 1OE0A 2RI1A 4XEUA 1P5ZB 3M6FA 5K3AA 3SP1A 2WWGA 5CBPB 3KKPA 1FSPA 3GL9A 3O7WA 4LK2A 4R68A 2JNWA 4RACA 3HDJA 3H11B 1BD3A 4L9SA 3DAOA 1UWLA 4DG5A 4JB3A 3G1TA 3DG9A 1PEAA 1ZK4A 1MDFA 1VA5A 2YC4C 3RVRA 3QU9A 1MA0A 4FZJA 3ZZTA 1KBQA 3MEQA 1D5WA 3QVGA 2OMKA 3THYA 4N01A 3FJYA 2PX3A 3B1KA 1ISMA 1GZ7A 3W6PA 2G67A 4YCDA 2K5UA 4HR7A 1EFUA 2C3PA 5DHFA 2IHJA 4B3FX 2AMFA 2DUNA 3ESYA 1YR8A 2BR4A 1QIFA 3EPPA 2X42A 1JKJA 3M9XA 3GGCA 3RG8A 3ZR4B 4P5PA 5HPYB 1E89A 1H05A 2VDWA 1SB8A 1OKKA 1G3QA 3ETGA 3MWDA 4XFKA 4ERXA 4M1YA 4LXTA 2Q8NA 4LY0A 4MWBA 1Q95A 1E60A 3H1BA 1PL0A 1SZPA 1POXA 2PGAA 2ZT6A 3PXAA 5HVNA 1AQJA 4ZOCA 3RK4A 3SM3A 3S2GA 1N7JA 4ALIA 1V8FA 2AWOA 3CEMA 1YKGA 4MQMA 5BQ5A 2KJQA 1N0UA 3DZKA 4U2EA 3TJRA 2CNDA 3BEOA 5K8TA 4S1WA 4RHTA 4A8JC 3D6TB 3K4QA 4M49A 4F4CA 4I5GA 4MXDA 5DRYA 4S0ZA 3RJ9A 4FFBA 1VHTA 4TXMA 3TAXA 2QGFA 4CV1A 4EPYA 1RM0A 3L77A 4EW6A 4EM6A 5JD5A 2FMUA 4DR3B 4DRYA 5I7VA 4LAFA 3O9MA 3U7JA 3ZU4A 4CM8A 1JHVA 3L0OA 1YMUA 4IG9A 3R3YA 3N76A 1K63A 4REMA 1FMCA 2VF7A 4LOLA 4TTPA 4O2AF 3PPVA 4JLUA 1XP5A 3WMGA 1C1XA 2RKOA 1Y7HA 4OQPA 1JKXA 3O8LA 2C29D 1G21B 3KWMA 3T9DA 2CB0A 2ZBRA 3L46A 2WOOA 1IB6A 5EP3A 1XTVA 2C9OA 1U31A 3OIFA 3DNFA 5FUQA 4YBRA 2XDQB 5HZKA 4DLNA 3EGDA 4TV9F 1F1JA 3FZYA 1EAYA 1NI4B 3HI4A 4X7MA 4YJ3B 5ALJA 4BDSA 2OL4A 3H4IA 1M8JA 3M3PA 2Z0MA 2VI5A 1OWPA 4FOSA 2OLEA 4JYBA 1RI3A 3NT2A 3QLVC 4RK1A 1MJGM 2GLTA 3FCEA 3UGKA 2X7JA 3VPSA 3OCZA 3STXA 4BO0A 3HCWA 3ENKA 1R8XA 3ND6A 1SUEA 5EXPA 5F77A 1B8NA 4TLCA 4EUSA 3NX4A 5LP6C 2BRUC 4RFLA 4ZGBA 2EKLA 2OBBA 4DFDA 2VS1A 1TCBA 3MTGA 2K7ZA 3LUGA 2XT9A 2I3BA 2OE2A 4FMCF 4WY8A 1VGRA 4FDTA 3ZEAA 1CT9A 1TM3E 2ZLBA 4P80A 2JIMA 1KJJA 3C98A 4EG3A 1RZUA 1UMCB 4JBLA 4LOJA 4F6CA 3G13A 2J41A 4G4SO 2E4WA 2DU8A 3FETA 4MV6A 5DHPA 5ALZA 1Z2OX 3N75A 4JC0A 3RYFA 1VXRA 4FEGA 3ZH2A 5JZSA 4RSMA 2OA0A 2BLLA 4W5WA 1I6MA 1AUXA 1ZM3A 1CUBA 1W7AA 3CG4A 2QUJA 4RETA 2PH1A 4JXXA 4B6QA 3BT7A 4RMJA 1DIRA 2H1HA 3WGJA 2I7VA 4RTMA 3K0SA 1E0DA 1U7PA 2PMKA 4FGKA 3K6SA 4MRNA 3CUKA 3DBHB 5H81A 4CLHA 3TSWA 4YRIA 2LBPA 4NZ9A 4RTRA 3N87A 5HJEA 5G40A 1SC3A 2DCUA 4GZLA 1YCHA 1J5XA 3A7EA 3IUYA 4FFMA 4HFMA 1RU3A 2C95A 2E6UX 3O4GA 1QG6A 3CRRA 5AKYA 1IQPA 4MTCA 2ZBFA 2A84A 3PQ4A 1HNXB 1YQWA 1E6WA 3L8DA 2F8SA 4LGYA 4P84A 2ZIZA 1X39A 3V4FA 2O8CA 1BXRB 2VP3A 2VJMB 3LT5A 5TIIA 1T36B 4DUPA 3GP8A 1UK9A 1V9CA 3RKSA 4E09A 5FJIA 3IEVA 2AT1A 2ZPAA 3EF0A 4I1YA 2VRBA 3JZIA 4L5YA 2NO0A 3NHPA 4HDKA 4MQ4A 1TA9A 3KE9A 1NBME 3LCMA 3NONA 3THXB 5DTJA 1XNQB 1PIWA 4NE2A 1B0ZA 1F2UA 3C6BA 3SXJA 1U8XX 1UP6A 2HUPA 2ZJ7A 4LXGA 4QPPA 3C8HA 4QUAA 3KTOA 3HI6A 1DWPA 3HNRA 4R81A 2IIQA 3JD1A 3RVMA 1L8LA 2NU6A 4N0PA 2X23A 4ZRNA 4NL4H 5ELMA 1BQ3A 4F85A 1YKSA