1SNYA

Carbonyl reductase sniffer of d. melanogaster
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
248
structure length
248
Chain Sequence
HMNSILITGCNRGLGLGLVKALLNLPQPPQHLFTTCRNREQAKELEDLAKNHSNIHILEIDLRNFDAYDKLVADIEGVTKDQGLNVLFNNAGIAPKSARITAVRSQELLDTLQTNTVVPIMLAKACLPLLKKAAKANESQPMGVGRAAIINMSSILGSIQGNTDGGMYAYRTSKSALNAATKSLSVDLYPQRIMCVSLHPGWVKTDMGGSSAPLDVPTSTGQIVQTISKLGEKQNGGFVNYDGTPLAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Neuroprotective-acting Carbonyl Reductase Sniffer of Drosophila melanogaster.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Oxidoreductase
molecule keywords sniffer CG10964-PA
total genus 87
structure length 248
sequence length 248
ec nomenclature
pdb deposition date 2004-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1snyA00
1M6HA 4NJMA 1VI2A 1BDBA 3C1OA 2O3TA 4DIBA 3F1KA 4IJVA 4J7XA 4RPHA 4C7KA 1GQYA 1C3VA 2YDXA 3DO5A 3W6ZA 1NQOA 4IBOA 1NNUA 1GAEO 2ZJ1A 4D3SA 3C7CB 1HE5A 4YQZA 1AE1A 2JCXA 5CEJA 2X5JO 1DC5A 1PL8A 3INTA 3PJEA 3EZLA 4IMRA 1PR3A 1YXMA 5ADHA 5JCXA 1K6IA 1EBUA 5IZCC 2CDAA 4MP6A 1LU9A 1QMGA 1LDGA 4QQRA 2FWMX 3TRIA 3Q9NA 1GV1A 3E03A 2B0JA 3ZCXA 1T4BA 3TZCA 1ISGA 2WJPA 2VUTA 1H9BA 3C7DB 4R3WA 4BNIA 3PZRA 2HK9A 1ZK0A 3RROA 3VPXA 1XGKA 1DFGA 4OM8A 3OJOA 4MVJG 4NI5A 4NFSA 2HAEA 2JFGA 3FCOA 4IUYA 5L45A 3GA0A 1YWGO 4KOAA 3CTMA 2AQIA 4J43A 4M8SA 4YACA 4E3ZA 1IY8A 5DBGA 4N5MA 3V1UA 4S3MA 2P4HX 4Y98A 4AFNA 2HCTA 3JD1A 3MJSA 2I5PO 1U4OA 3GVHA 4OJNA 4BO7A 2VT3A 4OQYA 1I33A 3FNGA 4NJOA 2YUTA 2VUSA 4ZD6A 2V6BA 3JQ8A 4NBUA 4Z9YA 5HRUA 4IDGA 1EBFA 2JD2A 3HB4X 3FTNA 5G0SA 2QHXA 1WDLA 2EKPA 2QYSA 4KQWA 1ZK4A 3AY3A 1BTOA 2PTGA 3WQQA 1W4ZA 2EF1A 5JYDA 1RM4A 3DBLA 5FI3A 4UUPA 3EK2A 2HMTA 2G0TA 4BKPA 3DBHB 4PLGA 5JC8A 4BNNA 3E48A 1VJ1A 2AEJA 1PQWA 1TT5B 1I3KA 3PEFA 4F6LA 4RCVA 1V35A 1F14A 2C29D 4AJ4A 5CDUA 1E6EA 4UULA 3WICA 3TN7A 2GN4A 2WWRA 3R0IA 4B8ZA 3PYXA 4JNKA 3S55A 4IMPA 4R3NA 1K2WA 3ZNOA 2PGLA 1NR1A 4A7PA 4GX2A 4Y6SA 3HFGA 5CAEA 4L76A 3ZHYA 4YYZA 3PQFA 5K0ZA 4WCFA 1QV6A 3FR7A 3QVSA 7ADHA 1C0LA 2CF6A 3LLVA 1E1KA 5T8KA 3INGA 4DLAA 2O50A 2PZJA 2B69A 4ILKA 4J9UE 4IY1A 4BO4A 2DKNA 4QFDA 4H15A 4PG5A 1EE2A 3DMTA 3WGYA 3S1LA 4FPXA 4GVLA 4XRGA 5JMWA 4AJKA 3BTOA 2AMFA 3LQFA 4H16A 2PZMA 1GZ6A 1Y9AA 3UCFA 2BD0A 2FPPA 1N7GA 2LDBA 1Q7BA 2F00A 4DPLA 2C20A 2VTDA 4E4YA 3DZBA 3UXYA 4B3IA 1E5QA 3ZDFA 3RBVA 1SCUA 2GDZA 2BFOA 3GVPA 1O94A 1C1DA 5JCJD 4R16A 4DVJA 1L7EA 3KYDB 2C7VA 2HMWA 1Q2XA 3H4VA 4K26A 3FD8A 2H1SA 5B4VA 5I9LA 2RH8A 1Y8QA 4M89A 2GZ3A 1Q0HA 4CLXA 3M6IA 4MINA 3W4IA 4D41A 3JQEA 1VJTA 4L74A 4PG6A 5F5NA 1X7HA 3QWFA 5IDXA 5BSHA 3UH1A 2B36A 1R4NB 3A4VA 4IDFA 1OC2A 3DAGA 3NT2A 3ZWYA 4Z9FA 4WLNA 5EERA 1XLTA 4IXTA 5ENVA 1T24A 5B4UA 3C1AA 1LQUA 4MKXA 4WOJA 4YJGA 2AG5A 4UUMA 4YEDA 4PRLA 3RKRA 5EL0A 1K5HA 3ZV4A 1C1XA 3W4KA 1HKUA 2O3JA 4KP7A 3SC6A 4HXYA 2JCYA 2C59A 3RQSA 2PKRA 5CPBA 3VH3A 3W8FA 5C37A 5L53A 2FN7A 5COQA 1BW9B 5TRTA 3U49A 3F3SA 4B3HA 2CDBA 2ZQZA 1P45A 3MJ4A 1WVGA 4PN3A 3OETA 1Y5RA 1PGNA 4YT8A 2GRAA 2NUAA 4RVUA 3JV7A 3VC7A 3RUCA 1H6CA 3A06A 4R5HA 5CP8A 2YQ4A 1OOEA 2FSSA 1ZMTA 3GVIA 4YJDA 3D4PA 1RM3A 1ADBA 3HDHA 5KKAA 2ZKLA 3WSWA 2WYUA 2OORA 2FR0A 3RJ5A 1I5RA 5JNLA 1L1FA 3PLRA 3G17A 1F12A 2VWHA 3GMSA 4ZQBA 1ADCA 3EDMA 2CY0A 1NFQA 1PGJA 3C85A 1DB3A 1MB4A 2NQ8A 4KDEA 3V1YA 3VPHA 3HN2A 3BHMA 3OJFA 4FS3A 4J91A 3DOJA 4P22A 4I5GA 2DTDA 5L7WA 4O63O 2I67A 3WNVA 1RYDA 4KWHA 5TC4A 1NYTA 5KVVA 1NTOA 2B4RO 4JP3A 3WNQA 4XCVA 1ZJZA 1AUPA 1C0PA 1ZH8A 4AVYA 4RVFA 1Z74A 2OO5A 4IIVA 4NBVA 3ZW9A 1I2ZA 4BQRA 1PJQA 3EYWA 1J0XO 2VUUA 1XWFA 2PNFA 4GVXA 1R4MA 1WMBA 4XZ3A 3GQVA 5DP1A 3JD4A 5A05A 1UDCA 1QSGA 2EIHA 2IXAA 1U7TA 1O5IA 4FIZA 2HK8A 5TQVA 3ST7A 5IZCA 2FY8A 1P44A 3U3XA 2QRJA 4ZVVA 3GNQA 3HFSA 3FHLA 1MUUA 3FBTA 3CZMA 3DBHA 3L4SO 4E5KA 3QP9A 3LZ6A 5TSDA 4CMIA 3CE6A 3UHAA 1UDBA 4INAA 3GDFA 2WYVA 3ZGYA 4GSLA 3WXBA 1E3SA 3RBXA 3M2TA 2DBVO 3NDJA 4CL8A 3WX0A 3WIEA 1SBYA 3Q6IA 4XJSA 1M67A 3CINA 5KNLA 3V2GA 1IYZA 1UXJA 3AU9A 3KLMX 2W4QA 5FF9A 2Q1TA 2TMDA 1ID1A 1VJ0A 3ITKA 2VHXA 3TZHA 3KYCA 3AI1A 4CQLA 2BMAA 1IL0A 4E5PA 4BGVA 4GWKA 2HMVA 2G17A 2QIOA 1X7DA 3ASVA 4O1MA 5C3MA 5L4SA 2P68A 2VOEA 2ZQYA 5H83A 3ANNA 4HBGA 4XA8A 2Y99A 1ISHA 1H6DA 2Q49A 3T4EA 4A0SA 1YJ8A 3HWRA 1B8VA 4OAQA 4CV1A 2JHFA 3F6YA 3GRKA 1PX0A 3Q2KA 2JD0A 1T2AA 1MLDA 4IDCA 5I7FA 5ILOA 2AEFA 3RFXA 3H9EO 1X0VA 2H6EA 3CMMA 3CIFA 5B37A 3Q2IA 4CR7A 2FSVA 3PK0A 2LDXA 1QLJA 2Z1MA 4YJFB 2QX7A 4EJ6A 1FDVA 2J3JA 2R00A 1Q0QA 2Q2QA 3H6KA 4L4SA 4C7JA 4DXHA 4B4WA 5JXWA 1X14A 2Q4EA 4ZN6A 3DBVO 5MGBA 4CLEA 2I6TA 1PZFA 3ROMA 4U6SA 3DL2A 3ETGA 3FNFA 3U0BA 4TVBA 1PS9A 4I5EA 1P1KA 2QRKA 3PGXA 4ROSA 4W9NA 5L95A 1U7HA 4OYRA 4URFA 3V2HA 5L40A 1JN0A 1CJCA 1EVIA 2VCYA 2Q50A 3JYQA 3QWAA 4D7AA 3N58A 3O8QB 4O0LA 1NR7A 1EE9A 1ULSA 2BH9A 4Q3NA 3VZPA 3JQ7B 4HNGA 1VM6A 4E6PA 3Q9UA 1Q1NA 1CDOA 4FN4A 5CDTA 3JQAA 3QIVA 4W82A 1IPFA 2D4AA 3GF4A 1YB5A 3P5SA 2ZJ0A 3KUXA 4LCJA 1T1SA 1AXGA 3G0OA 2YV3A 1QV7A 1I3LA 1M6WA 5FEUA 1BDMA 1P1RA 4DA9A 1GTMA 3PHLA 4ZHSA 3F47A 3LF1A 2UUOA 4N5LA 4D79A 1SOVA 2DAPA 5JC1A 3A1NA 4RPGA 5C5IA 4BQPA 4D3DA 3AUUA 2BI7A 3X2EA 4F3YA 4MJLA 3D5QA 4WLFA 1B2LA 1UXIA 4ZQHA 2R00C 4J1SA 4CMJA 4H7PA 2ZIZA 1O6ZA 3IC5A 2CFCA 2PH5A 4OKIA 2I9PA 1NM5A 2YZ7A 3GEDA 4IQ8A 1PJTA 1JVBA 4IZHA 4L4XA 4PVDA 1B8UA 1JDJA 4FFMA 1PIWA 4ND4A 1YBVA 2DPHA 4MVJH 2QW8A 4N5NA 1I36A 1NHWA 2DQ4A 2JL1A 4TSKA 1I3MA 1V9LA 3DZIA 1GR0A 5DNAA 1UAGA 1ZVMA 2GUGA 1HDYA 1Z75A 5IF3A 1ISMA 1FXSA 1RYEA 2B37A 3Q0EA 4MIOA 3WBBA 3NKLA 4AICA 3GVXA 3IL2A 1Z7BA 3O38A 3RIHA 3BMOB 2VHYA 2IZ1A 3BTVA 1ISFA 2G1UA 2VTEA 1OC4A 2QYTA 3DHNA 5FYDA 4Y9DA 4TVOA 2DC1A 2JD1A 1LLDA 3TZ6A 3OMLA 1JTVA 3K96A 6LDHA 4R4JA 1R0KA 2YDYA 3ICPA 1N8KA 3MWEB 2GF2A 4NHEA 3PHHA 3JYLA 9LDBA 2NVBA 4BO0A 3U9LA 4IS2A 4RVSA 3MCVA 4XGKA 4XQGA 4CMBA 4JJFA 4PLWA 2I66A 4MVJP 4BNYA 3F5SA 2EKQA 3LT0A 3JQBA 4NK5A 4GAEA 5EQFA 3W4JA 4F46A 1HEUA 3R6DA 1CERA 1DOHA 3DZHA 4OXKA 5THQA 1TB4A 4DLLA 4CUZA 2JAHA 1U3VA 2DM6A 5ILGA 4Y8VA 1P3DA 3LYLA 1J5PA 4FFOA 3O9ZA 1EVZA 4U5QA 5IJZA 4GLOA 4YPOA 1B3RA 1U5AA 3WGIA 4YB8A 1C1XB 1TT7A 3DXFA 3GZNB 1EFLA 3HG7A 3U4IA 4ND5A 2YY7A 5G0VA 2NTNA 4U6QA 5FI5A 4X54A 3FPCA 4R54A 2Y68A 1UXHA 4OOEA 1DFHA 1M2WA 1PZEA 2GZ2A 4NBTA 5JO9A 3AJRA 1UP4A 2ZB4A 2PD4A 1E1LA 1EQUA 5T67A 1LDEA 4FC7A 4CODB 3GGGA 3ABIA 3DTTA 1BXGB 6ADHA 4I5FA 3RD5A 4Q3DA 3IIEA 3QVOA 1F17A 2GNAA 4RDIA 3RUFA 3UW3A 3IP3A 3TDKA 5IG2A 4IS3A 3ZNQA 2UAGA 5TT1A 4FGSA 3WGQA 1ISIA 5DT9A 3L6EA 4EI2A 4D0SA 1Y1PA 4MP3A 5AYVA 1KEVA 1TLTA 3GUCA 4AG3A 3ZWVA 1U3UA 4ONEA 2CF5A 2ZATA 3OEYA 4UVHA 4CLHA 2FMUA 3SLKA 5L7YA 4ZQFA 4DREA 4HV4A 1QYDA 3EMKA 5DP2A 2JCVA 4YJGB 4ZICA 2PH3A 2GSDA 2IZ0A 2VN8A 3I4CA 4QSMA 1HF3A 4ZGWA 4EW6A 3SEFA 3OHSX 4ALMA 3AUTA 3N7UA 1SZJG 3OA2A 4RPJA 4WE3A 3UGKA 2Y67A 2X7HA 2IE0A 4P4GA 1W6UA 4J2OA 1YQGA 2DUWA 3KM0A 4TRRA 3E9NA 3MOGA 4UUNA 5A1TA 5BT9A 1EVJA 1NQAO 1UZNA 1DLJA 2AE1A 4YT4A 3I23A 2IYOA 1PL7A 4DWVA 2A35A 2OP1A 3TZKA 3H5AA 4UVDA 4BNKA 3WYEA 3VTZA 3W6UA 1K0UA 3QRWA 2O4UX 3RFTA 1LDYA 4CM3A 3PHIA 3WB9A 2C0CA 1M66A 3WJ7A 4DMMA 4DIOA 5EPOA 4E33A 3ULKA 5BQFA 3DFZA 2CVOA 2AHRA 3IUPA 5JPIA 2BELA 2I99A 4TKMA 1I30A 3TL2A 4ND1A 2P9CA 1IUKA 4K28A 3BTSA 3ASUA 3ZN2A 3ZWPA 1GDHA 1UJMA 4FBGA 4XDZA 1GY8A 2OL4A 3D1LA 3DONA 2VYVA 3LC7O 4AJ2A 5AXBA 4AJEA 3GLQA 1BG6A 1EFKA 3VVCA 3ZW8A 1Y9EA 1VSVA 1WW8A 3H5RA 3RC7A 5ICMA 4WCFB 1YRLA 4S1VA 4HNHA 5T8KC 3PWZA 3GC6A 1V3TA 3NGXA 4MKRA 2W90A 1T2FA 2JHGA 4KDFA 3GY0A 3RVDA 2TMGA 2VOJA 2O48X 4XB1A 1SB9A 3CUKA 4N18A 3RI3A 3JQ9C 1DJNA 2Q1WA 3WLEA 1KC1A 5HM8A 1LLQA 1N1EA 1VPDA 2ET6A 3E18A 3H2ZA 4JJIA 1XG5A 4J7UA 5JAIA 5I7EA 4XEHA 1YL7A 2Y1GA 1ZEJA 1YDWA 1LDNA 4MVJI 2Y0EA 4W4TA 3ZWBA 2GO1A 5KVCA 5L9AA 4B7XA 1DDOA 3VPSA 5AXAA 5TGDA 5JY1A 4B3JA 3PYMA 3COSA 5B1YA 3D4NA 3U4CA 1KY4A 4XQEA 1ZXBA 1X1TA 3NRCA 5G0UA 3ZV6A 2VRCA 1PJ3A 3PVZA 4RVDA 2NLOA 4XYEA 2YYYA 3HQ4O 2E6UX 4RDHA 2A94A 3DAFA 4EDFA 1OAAA 3LU1A 4B79A 4MO2A 5BNTA 2IZZA 3FBGA 3I52A 1PEDA 1A7KA 2EKLA 2NTJA 4NBWA 4PLHA 3FWZA 3KYBA 3WYBA 1U5CA 2G76A 1I2BA 2P4QA 3F46A 1KOLA 3FRJA 4J4TA 3CEAA 3GN2A 2VHZA 4GMGA 5GZ3A 3KSUA 4D3FA 3BAZA 2HMSA 1I3NA 2XAAA 3CMCO 4CM4B 1MGOA 1LLCA 4JQCA 2AG8A 2E37A 4IPTA 1LUAA 1A4UA 1U8FO 2PGDA 5DF1A 5DN9A 5HBRA 4ZQEA 2EERA 2H5LA 3ZWAA 3JD3A 3TFOA 2HU2A 1PJBA 2WDZA 1LXCA 3VTFA 3S2IA 4FFPA 4WCFC 5HA5A 3I6IA 1ZSYA 3KLPX 1P31A 3OP4A 4YRDA 3AI2A 1NQTA 3UFXA 3ETDA 3PI7A 4BNVA 2J6IA 2ZTUA 2X9VA 4WK6A 3SC4A 2EWMA 4BNUA 3CZRA 3W8DA 1ZK1A 5DOZA 1WZEA 3PHGA 5EINA 4TZTA 3AW9A 2B4QA 3K9QO 4BMVA 3VDRA 3EGOA 2YFQA 3DMYA 3BHJA 4JROA 2UDPA 5KJFA 1YQDA 4LMPA 5JYEA 3UF0A 1R4NA 3S8MA 1A7AA 3KXDA 4QECA 4A2CA 3PTZA 3JQDA 2RAFA 5ICSA 4Z9XA 4Z0TA 2GN6A 3L9WA 3ON5A 2FZWA 3AOGA 3K8ZA 3ZHXA 3ZU2A 1BWSA 1DSSG 2C2YA 3M1LA 1DAPA 2GD1O 3AFMA 4MOWA 1ISJA 3LVFO 3NUGA 5JW6A 1O8CA 4XYGA 3NJ8A 4CMGA 2O3RA 4ITUA 3GZ4A 3GNTA 5G4KA 1LC3A 1KY5A 2VHVA 1HDOA 4B4OA 1KERA 3B6ZA 2Q99A 5ES3A 1H93A 1Q7GA 1V6AA 4E30A 3R1IA 4GH5A 2E49A 4QO7A 2P5YA 4EUEA 1GZ3A 3LSYA 2AW5A 1UDAA 3DHEA 3KSZO 4J1TA 2OOSA 3DR3A 1A71A 5LDGA 2Y93A 2PD3A 1WXDA 2NU6A 3G79A 5KKCA 3HHPA 5A5FA 5DZSA 4BOYA 1QG6A 3PQEA 3DAPA 4UEJA 3E9QA 4CM9A 4R51A 3WJAA 2VWGA 3LF2A 4R69A 1XDWA 4UREA 5I8WA 3TF5A 4MVJF 3D3WA 5BSEA 1QR6A 4LGVA 3HZZA 3ENKA 3TNLA 1G1AA 3RU7A 1Y8RB 1UZMA 2I3AA 3PJGA 3FNHA 1Q0LA 3ANLA 1PGOA 4Z3KA 4PLTA 2BF7A 4LVUA 5CFZA 4YAJA 4CLOB 2Z1NA 3AWDA 2OGUA 2BFMA 1R15A 3JQFC 5IXYA 2VZ0A 5F1KA 3VKUA 4R68A 1R0SA 3F9IA 1D3AA 5G4KB 4D46A 4BNMA 1JKIA 3G49A 1HXHA 1CQJA 1ONPA 3ONDA 4XKJA 4KZPA 1XCBA 3DOOA 4BIIA 2RHCA 3ENNA 1EQ2A 1FMCA 3E6AA 3IP1A 2PLAA 3ROKA 3M2PA 4E5NA 4J1QA 2CVQA 4WLOA 4WEQA 4B7UA 1WDKA 3B1FA 4BO9A 4BKQA 3ZV3A 4OIMA 1T25A 1HLDA 5U4QA 3PJFA 4YTEA 1NVGA 2B5VA 1ZBQA 1E7QA 3HADA 2W2KB 2J3HA 1UZLA 4J0FA 2O4CA 4DGSA 1T1RA 2WYWA 4XYLA 3I4FA 4BL5A 4OOFA 3SBOA 5ITVA 4DQVA 1LNQA 4A26A 1GV0A 3PHJA 5F3RA 3D7LA 3KB6A 1HZZA 4GX0A 3D64A 5TJ9A 3RKUA 5JAZA 4J6FA 2IYPA 1DIRA 4WECA 1KEPA 3WTBA 4XYMA 8LDHA 4Q3CA 4L4RA 4J49A 2A4KA 1QYVA 3IQDB 3V2UA 1GPJA 3JD0A 2VWPA 3JCZA 2JJYA 1N92A 2V6FA 2AXQA 4OGWA 3ZU5A 5JE8A 4M54A 3FF4A 2NVUA 3DMTC 3KOUA 4I08A 4CMAA 1JU9A 2WM3A 2Q1SA 3RSHA 1CRWG 3JQ9A 1UXKA 1Y7TA 4N54A 3OM9A 4XR9A 4NU5A 3PDUA 3DB2A 3VVBA 1O95A 3JQ6A 4BV8A 3QY9A 4UVIA 3AU8A 1U2GA 5JBIA 3PIIA 1RJWA 4BO1A 1LSJA 4CM6A 2OMEA 4DQXA 3BMNB 3QW2A 3S2GA 3RUIA 4L9RA 1EDOA 4JJGA 4YVFA 3IKVA 1G0NA 1V0JA 5FWNA 1DRVA 4NK4A 1IZ9A 3PDJA 2O2YA 3RBZA 1XYGA 3AY7A 3KVOA 4L75A 3RASA 3UUWA 4JN6B 3WQRA 2FHSA 1XSEA 1LJ8A 4KMSA 3V1TC 4I9NA 4M49A 1QXSA 3PP8A 1NX6A 2HJRA 2YQ5A 3RC9A 3ONEA 3H7AA 3E8XA 3B1JA 4XYBA 2G82A 4YJHB 1X0XA 2GCGA 4BNJA 3OEWA 4YAKA 5F1OA 5AVOA 4JBIA 5TX7A 5IAAA 5EJ2A 3JQGA 1BHSA 4II3A 1SOWA 1FDTA 1LDMA 2DBRA 4JBGA 4WKGA 1A4IA 4ID9A 4NH4A 4JBHA 2RCYA 1I24A 4P38A 4R9RA 2NV6A 3TFQA 2AA3A 2DUUA 4XR4A 1VSUA 3DZGA 2BHLA 3IUSA 2P2SA 1JAYA 1GD1O 2DU8A 3C8MA 3ZU3A 1L7DA 3DBRA 2ZYAA 4R41A 4XJTA 4I9UA 1LA2A 2HK7A 2WE8A 2QZZA 5IN4A 1E3JA 4XX0A 1NBOA 1BVUA 3BYZA 5HWSA 2BGMA 2C5EA 5HTOA 4K6CA 2HUNA 1ENOA 3D5TA 4PG8A 1OMOA 1H9AA 4IGFA 4YXFA 4HADA 2WD7A 5TT0A 2WEKA 3LC2O 3BXXA 4LISA 2GLXA 1AHHA 3UCEA 4BUCA 3H9JA 1XELA 3ITDA 1DLIA 3H9GA 4PIVA 1U8XX 2R2GA 2VYVD 2XOXA 1J4AA 1D1TA 3G1TA 1EMDA 4W7HA 3IS3A 3OJ0A 1P1HA 3K30A 3KO8A 1Y8QB 1FDWA 5CHEA 5I9MA 4R1SA 5DCYA 1UH5A 4BO5A 1E3LA 2CSUA 4JK3A 4DPMA 4EYEA 5JLAA 1NVTA 2C54A 4IJUA 1GL3A 1HDZA 4A73A 1F8FA 3VPGA 4CM7A 2VZ9A 1ZMOA 2BFPA 3H5NA 1F8GA 2Q45A 1HE2A 3AM5A 1KEWA 1VE9A 3MWDB 3OQ1A 3QWIA 5IN5A 2NACA 5KJ6A 4FSHA 3MJCA 4GX5A 3VHRA 1HE4A 4YJHA 3V8BA 2EJVA 5J23A 3DEYX 3BZUA 4AJ1A 4MKZA 1HRDA 1YL6A 4DBZA 4U0KA 1JWBB 3I9NA 2FR8A 4R1NA 4DIFA 3PJDA 4YCAA 2VHWA 4Y67A 2DFVA 2YHIB 5ENDA 3TWOA 3GZNA 2I76A 5DBFA 5EN4A 4YQYA 3DQPA 3TSCA 1PZGA 5EESA 1HT0A 2W8ZA 3KSDO 5T64A 3VZQA 1GUYA 2G5CA 4QTZA 2X5KO 1E0DA 5A9TA 4A10A 4DLBA 2FZEA 3OA0A 3HUDA 4OSPA 3RC2A 3B20A 1CF2O 1RM5A 1GQQA 4O59O 4RZIA 5DDIP 4QX6A 1E7RA 4MVJA 3NDRA 2VRCD 2PKQP 3T7CA 1T2CA 1BXGA 3AFNA 2IEBA 4H3VA 1ZSVA 4U7WA 3TZQA 4NIMA 2ZCUA 1SC6A 2EEZA 1U9JA 5AXCA 1MG0A 1DIBA 1LRJA 5T5QA 1SNYA 3WG9A 4CMIB 4CUJA 5A03A 2DLDA 3RAJA 4JLWA 3AOEA 1VKOA 2W2LD 3GG9A 5A9RA 3I3OA 4RZHA 2W2KA 2EXXA 3VOSA 1YO6A 4Q9NA 5CG1A 3ZWCA 3BMOA 1DHRA 1NAHA 4XGNA 1P74A 4I9HA 3Q11A 2CUKA 2EV9A 1ZXLA 3GHHA 1EK6A 2YV1A 3JQ8B 1YONA 4E2YA 3MZ0A 1HDXA 3E82A 1SO8A 1QORA 2Q1UA 1BW9A 3MTJA 2UYYA 3B70A 4PGFA 1DHTA 3AY6A 4RJTA 3O4RA 2SCUA 3SX2A 7MDHA 2X1HA 4CLOA 2H9IA 3WDSA 5KIAA 5F21A 2YHIA 3RUEA 1NAIA 4IDAA 1FK8A 1U2DA 3UCXA 2X5OA 4RGBA 3DTYA 4LSMA 5L4NA 3GDGA 4GL4A 5A4DA 4FFRA 4OL9A 1PQUA 4XGIA 5C7LO 2DBQA 2ZYDA 5KCZA 4MIYA 1NXQA 1H0KA 4E31A 3L0DA 4CM5A 1S7CA 2D2IA 4PRKA 3ADPA 1LDBA 1YVEI 5DCUA 5KWEA 1EVYA 1DIGA 2H63A 1YOVB 2CZCA 1W8DA 1H2HA 2J3IA 1I0ZA 4MVJE 1RKXA 2ZTVA 4GWGA 1QLHA 1E6WA 1A9ZA 4GBJA 4I8XA 4DRYA 2C07A 5CEEA 2Y66A 3ZV5A 3ZWMA 4XB2A 1ZNQO 3VKVA 3JQAB 3VH2A 4IINA 4U8GA 2O7SA 1ZIDA 1NWHA 2OP0A 4E5YA 2R6JA 2EHDA 4BO8A 2O7QA 1IULA 2UVDA 2HRZA 3GFBA 4BKUA 4R9SA 4R1TA 1R16A 1YS4A 3HE3A 4PLCA 2WD7B 4YT2A 4M87A 2B35A 5CPFA 1Z45A 4B4UA 1ZO8A 3DZKA 3F4LA 2DTXA 4RLSA 2RBEA 4G81A 5AQ1A 4BNHA 1N2SA 4K6FA 4EEXA 1DJQA 4OQZA 3WMWA 4YJFA 4IDBA 4ZU3A 4MVJM 4Z3DA 3EVTA 1GADO 3HSKA 3ICCA 4D44A 5CG2A 4NDNE 1DC6A 5DULA 3ETEA 4L8VA 3CPSA 1U1IA 4R01A 2D5AA 3VAZA 5F1PA 4F45A 3K2BA 1E77A 1I10A 2EW2A 3GEMA 4JIGA 4RQTA 3VZSA 4D42A 2I3GA 2GERA 3HDJA 1EZ4A 3BMQB 2ZYGA 4B8WA 4QEDA 2EGHA 5COAA 2FRDA 4A27A 4BB5A 2GPTA 4RVHA 1FJHA 2PV7A 2Y1DA 5G4LA 4DL9A 3RUAA 2ZTLA 3GEGA 5IZ4A 4TQGA 2OFPA 4E2XA 2VZ8A 1S6YA 1HLPA 3NTQA 2X8LA 1CETA 2ZCVA 1E3WB 3K5PA 3BIOA 1HETA 5COBA 1FF9A 1GEGA 2Q3EA 4DPKA 2ZK7A 2X0NA 1XHLA 2V65A 3KRTA 1C0KA 3O26A 5IDWA 3N74A 1VKNA 3OSUA 1YKFA 1I32A 4ZRMA 5I8ZA 1HTBA 1NHGA 2EG9A 4ALLA 4WOKA 2BGLA 3SVTA 4PG7A 1J6UA 4PG4A 2OBNA 3U5TA 1ORRA 2JFHA 4AJNA 1V8BA 1ADFA 1O0SA 4OXYA 2ZB7A 4NZ9A 5THKA 3TOXA 3ZNNA 3WFJA 3PGJA 3PFFA 3QWHA 4KUEA 1DRUA 3AOEC 4OHUA 2XF8A 2X0RA 2Q2WA 4OMUA 1B26A 1TI7A 4J4BA 3L6DA 3GG2A 3MEQA 1JW9B 3WTCA 4F6CA 3OBBA 3UOGA 4EJ0A 1ML3A 2O23A 2P91A 3JYPA 3ZNPA 1ONOA 2VWQA 2X86A 4TRJA 3TQHA 1EK5A 3EHEA 3GMDA 4QXMA 4PVCA 1D1SA 1SMKA 5IDQA 5KVSA 4BNLA 4B7CA 3F5QA 5L4LA 1E3WA 3WIDA 4BVAA 3P2YA 1K6XA 4EBFA 4GGOA 4FOOA 2ZB3A 3NAQA 3NYWA 4IM7A 4CQMD 3QHAA 4NU6A 1K6JA 5A3VA 3A9WA 4N7RA 2NWQA 2YJZA 3GN1A 2NVWA 3ZI0A 3U4DA 1IOLA 3TJRA 3GK3A 5F5LA 5T57A 2HJSA 3O8QA 4XRRA 1E6UA 1KVUA 1Z7EA 1QP8A 2EGGA 2IODA 3ANMA 1LTHR 4NG5A 2JKVA 4G65A 2X9NA 3JQFA 3MTGA 4BNXA 4GKVA 3OJEA 5G0WA 1KVTA 1R4MB 4FDAA 1WLYA 3AK4A 1XQ6A 5CDYA 1PL6A 5EMHA 1HSOA 4NPCA 2Y0CA 4LVCA 4W9NC 1SAYA 3ROQA 4CV2A 4J7CA 1I8TA 3UVEA 3JQ7A 2GYYA 1C1DB 2NU9A 2OUIA 5IFLA 2B83A 4ALNA 1YOVA 2WTBA 1P1IA 1Z6ZA 4UEOA 4RF2A 2Q46A 2PWZA 2QG4A 3JYOA 1PS8A 2BKAA 1PJ2A 2D1YA 1SEPA 1YBAA 2W98A 5CDSA 1ZK3A 4FJ0A 5TJHA 1EUDA 1SPXA 2EJWA 3GRPA 3KHUA 1MX3A 3DC2A 4Z0PA 4FJ1A 3WLFA 4RV9A 4CQMA 5JS6A 3I83A 1F06A 1TEHA 1B16A 4OKNA 4GI2A 1QKIA 2DT5A 3JYNA 4M55A 3I9JA 3ROPA 2GZ1A 1KVQA 3W1VA 1MC4A 2OBYA 1AGNA 3G1UA 4UVEA 4RO0A 4J1NA 5JCJA 2Y05A 3JQBC 1ENZA 2BI8A 2EP5A 4E2WA 3PRJA 2EW8A 3AM3A 3WMXA 3DBRB 3P2OA 4E21A 4ZA2A 1P0FA 1W0CA 2A92A 4BB6A 1ZUD1 3PZBA 3HJAA 2P9GA 4YBZA 2O3UA 3AM4A 4IXWA 4OSOA 4I5DA 3P7MA 1H6BA 3RJ9A 4J3FA 4CM8B 1GEEA 4QO8A 3WGOA 1PWXA 3D3EA 3OQBA 3QVWA 2FPGA 3C3XA 3G3EA 2B5WA 1E1MA 4AJOA 5EIOA 9LDTA 1BRMA 1WWKA 1N9GB 3L9XA 3K31A 3PFWO 1R66A 1NVMB 3BA1A 5HS4A 2E82A 2OZPA 3LDHA 1UP7A 4A03A 1EUCA 4QUKA 4HX5A 3VPFA 4CJXA 1R0LA 3A14A 4MDHA 4Z6KA 1VLLA 1BMDA 1ZZEA 4O6VA 5LCXA 4AL4A 1V3VA 4LSWA 3WGZA 2RHRA 3H65A 1HDGO 1OBFO 1QYWA 2BRUA 3HNPA 4PCVA 1D4FA 5ITWA 1E7MA 3L77A 1MV8A 4O5OA 3QWBA 5LDHA 1UR5A 1B8PA 1H94A 2X58A 5JDIA 5GZ6A 5U1PA 3C7AA 4FR5A 4PLPA 4CV0A 1ENPA 1RM0A 2PK3A 2YFHA 2J8ZA 5JY6A 3NV9A 3DFUA 2QQ5A 4QFCA 1IE3A 1HE3A 2BGKA 4IQGA 3LT4A 3KTDA 2HDHA 2X0JA 3BMNA 5GMOA 3OFSA 5A5EA 4KQXA 3WWYA 2VYNA 2ILTA 4HUJA 1KIFA 1P1JA 2V6MA 2HO5A 1VL6A 1K3TA 1HWYA 2J5RA 2W2LA 4JGBA 3A28A 4EEZA 3OQ6A 3L4BA 1N5DA 4J4HA 1NPTO 4DC1A 2POQX 1W73A 4UUOA 1LRKA 3KETA 2E4AA 3L07A 1A27A 4BNZA 3GH3A 2JFFA 1GYPA 3BMQA 3T4XA 4CL3A 3JQAD 2PD6A 4DTIA 1C14A 3QVXA 4OXNA 1EEHA 5TS3A 3OH8A 3O03A 4IJWA 4BO2A 1WPQA 2J5QA 4I1IA 4Q39A 5I9NA 1BXZA 4LRSB 2PKQO 4D45A 3NTOA 1Q7CA 4NJMB 3GPDG 3QQPA 3ONFA 1WNTA 4E32A 4ALKA 4NNJA 2V6GA 3LLSA 3RUDA 3E5MA 2UUPA 3DWFA 3GHYA 3E1KA 4KTTE 4GPD1 4L0QA 1TT5A 1E3EA 2EP7A 3RC1A 1Z82A 4G5HA 4JXKA 1Y8RA 2PR2A 3AUSA 4JCOA 3DZJA 1HDRA 4CLRB 1KEUA 3E9MA 1Y5MA 3IJRA 4J90A 5JAQA 1UUFA 5CEFA 1UP6A 5A04A 3WS7A 5TIIA 3LT2A 3HDYA 4MIEA 3TPCA 1YH3A 1TVEA 1VRWA 1BGVA 2AQHA 3H3JA 3UAGA 3EAGA 4NR0A 1DIAA 2PY6A 4HFJA 4UEKA 1ENYA 2Y1FA 4CMKA 3UKOA 4JP2A 1GPDG 2D3TA 1I2CA 3NEPX 5JDIC 2AQKA 4YAIA 2VYND 1AN9A 4W7IA 2HKIA 3E5RA 3NGLA 3R3SA 4WLUA 4AJHA 1DRWA 2DTEA 1PZHA 2NQTA 1X13A 4R1UA 4Q3EA 5BSFA 3H2SA 3Q1LA 1TXGA 3GFGA 4YT5A 4CV3A 3EZYA 4K1LA 1UAYA 1OZAA 3WBFA 4CLRA 1GUFA 1MG5A 3IDSA 4YAGA 2HMUA 3EC7A 1JKFA 1YDEA 2AE2A 3FI9A 8ADHA 1NPYA 5IXSA 2OXIA 3JTMA 5DBIA 1B14A 3W8EA 3KEOA 4EGFA 4AJPA 3PIDA 4Q3AA 1Z73A 4OO3A 3ZWXA 1MFPA 1ZK2A 2WD8A 2BLLA 4EUFA 1PJCA 1Y81A 1ZEMA 3BHIA 1T4DA 5TF4A 1CWUA 2B4TO 1GYRA 3NX4A 1NFFA 4FB5A 1GQ2A 1PJLA 4XDYA 2OHXA 1DC4A 3BMCA 3DHYA 3UICA 1E3IA 4BGIA 3WSVA 1GU7A 1H2BA 5ER6A 1E92A 3U62A 2X0IA 4MVJD 1HYEA 3QJ5A 3RUHA 3RWBA 3JQGB 2WMDA 3NT4A 3ZZNA 3WWZA 4RF5A 3C1TA 1PQPA 1X7GA 1GYQA 1N7HA 4TROA 4CQMB 1EDZA 3KZVA 2O3SA 5TNXA 3MJEA 3PQDA 4BV9A 4CMHA 4BMSA 1MFZA 4BO6A 5C7OO 3OF2A 5CDGA 3QLJA 4BNWA 1T26A 1YB1A 1O89A 4HFNA 4DYDA 2NNLD 3GAZA 4CMEC 2NM0A 5DCWA 4IIUA 3L4BC 4J2HA 4RLHA 4LN1A 4DMLA 3DDNA 2J5KA 2AQ8A 1WP4A 1F0YA 4ALJA 3KEQA 4W99A 2GN9A 3ZU4A 4Y6RA 4AJIA 4CM9D 2D8AA 1H6AA 4W6ZA 3IKTA 2GGSA 3R3JA 1XU9A 4E5MA 4LK3A 3VH4A 4DUPA 4ESOA 2WE7A 4HWKA 1A72A 3WGGA 1B3BA 3CH6A 2PFGA 5JSFA 2E48A 4LCEA 5IDYA 3GNSA 2ZTMA 1BSVA 4WASA 4E0BA 4YDRA 2X9GA 3DOCA 3DBLB 3NDIA 4ND3A 1DO8A 4GSKA 1JKJA 2DBZA 2WSBA 4WJZA 4IGEA 3FN4A 1G6KA 2JAPA 1WMAA 2CD9A 3WGHA 1BXKA 1PTJA 2O3QA 4CR6A 3HDQA 2XXBA 1ARZA 1ONNA 4YA6A 4WEOA 1LEHA 3D0OA 5BNFA 1XEAA 4WNCA 5T6BA 5AOVA 1HSZA 3ORFA 1LLUA 3K2EA 1KBZA 3I6QA 4TRMA 4RF4A 4YAEA 2VT2A 4FFNA 5KVQA 3I9KA 1WDMA 4J0EA 3PXXA 4KWIA 1JVSA 3OECA 5KJEA 4BKOA 1E7YA 4KUGA 1R37A 1SEVA 4ZQGA 3NTRA 3FNEA 1RWBA 1CIVA 3JQCA 1X1EA 1B7GO 2VNSA 4WUVA 4J16A 4DYVA 2CDCA 1LBEA 5H82A 1NPDA 4YR9A 1CYDA 4WPGA 1XU7A 3SXPA 2RIRA 1KS9A 3P19A 3TOZA 4IZIA 4XQ9A 3X2FA 2FR1A 4IJKA 1KVRA 4P4NA 4L73A 3ADOA 1GZ4A 2X4GA 2Q4BA 2Z95A 3K6JA 4BS9A 4RORA 1P77A 4GX1A 5A9SA 3QVTA 5EQDA 3UN1A 1Y6JA 1QYCA 1XKQA 1PJSA 4HKTA 4HP8A 1KC3A 1TA4A 4K9DA 2XPCA 2CNBA 1MXHA 2C5AA 3ZWNA 5JDCC 4PLFA 1XQ1A 4IDEA 4ND2A 5A3JA 2FOIA 3OIGA 3BTUA 3WGTA 1A9YA 1I01A 3SJUA 3ZWWA 4FJ2A 4YWJA 3OIFA 4FGWA 3PWKA 1KYQA 3FWNA 4PFJA 1PJ4A 4U0JA 3QA9A 4WLVA 1E1NA 3I1JA 2DFDA 3KV3O 1SB8A 1YJQA 4WCDA 1R12A 2PGJA 1JWAB 1DPGA 1G0OA 1VL8A 4UVGA 4IQ0A 3IJPA 1WAMA 3QSGA 3RCBA 2I65A 3FTPA 3K92A 1KVSA 1LSSA 2QRLA 2X22A 4GMFA 3OJLA 2O2SA 4RQUA 1YBMA 2C82A 2CMDA 2YV2A 3KYCB 5MDHA 5AXDA 1GCUA 1H5QA 2D59A 1YGYA 4CM8A 2IDZA 4AJLA 2X23A 1LQTA 1IZ0A 1OI7A 4PZDA 1R6DA 1HL3A 4C4OA 1AXEA 2ZB8A 4HFRA 3T7EA 4YRBA 4NBRA 3VH1A 3K73O 3SJ7A 4KTVE 5A02A 5GY7A 2CVZA 5B12A 5KJ1A 1J49A 3VZRA 4CPDA 1JQBA 1WZIA 3WR5A 4BMNA 1A5ZA 1T2DA 5BR7A 1P9LA 2Z5LA 1HYGA 5JMPA 2PA3A 4Y6PA 4CR8A 4TRNA 2BFAA 4NQZA 4BGUA 1LRLA 2IXBA 5K9ZA 1CEQA 5G2OA 4CM1A 4PLYA 5KJCA 1NASA 5KOIA 1YQXA 4GGPA 4RL6A 5A06A 2J3KA 1ULUA 3QE3A 3I5MA 1EUZA 2NU7A 4CQLB 4EZBA 3C24A 3WQSB 3Q3CA 4XIJA 2PZKA 3MOIA 5L51A 3GVCA 5TLSA 1C0IA 3FPLA 3GGOA 4BNGA 1JA9A 4DQUA 3MJTA 2HRBA 2D5CA 3NJ4A 3QV1A 4CUKA 1M75A 3LT1A 2PZLA 1FDSA 1PS0A 4LW8A 1XR3A 2NADA 2P5UA 3D4OA 5KTKA 2Y0DA 1N1GA 1LI4A 3PPIA 1D8AA 1DFIA 3V5NA 2Y1EA 3LC1O 4KUHA 1FDUA 1E7SA 5I7SA 3PLNA 3ZWOA 3IAHA 4D0RA 1D7OA 1K89A 1MA0A 4UAGA 2NVUB 2NU8A 4DBVO 3ZH2A 4M86A 4PLZA 1JAXA 5I7VA 1T2EA 1M76A 4EJMA 4LRTB 5L7TA 1MC5A 2YHUA 3GT0A 4AJJA 1PSDA 1P0CA 4GQAA 1KETA 3WYCA 4YRAA 4XD2A 4HFMA 2C7GA 4XIYA 4JX8A 1ZW1A 3H3FA 5BNIA 1DXYA 2UV8A 1V3UA 5U9CA 4TWRA 1LSUA 5JFOA 4NMHA 5L3ZA 1E5LA 3ZHZA 1IHXA 1LC0A 2Q2VA 2IRWA 1BVRA 2VRBA 3F4BA 4GKBA 4PZEA 1ZKMA 4PZCA 5B4TA 1OFGA 1ADGA 4E12A 1LX6A 1YL5A 2DPGA 4CMEA 2Y1OA 1DAOA 2NSDA 3CKYA 3FR8A 5A9SB 2RH4A 1UXGA 1HZJA 3GR6A 1MXFA 3S2FA 1RPNA 4WNIA 3EVNA 2A9FA 4RPLA 1PU2A 4P8RA 1MP0A 1NWCA 4R5MA 1NFRA 1PGQA 3JD2A 1CQIA 3U4HA 3MJVA 4NFHA 4IDDA 4MP8A 4XWYA 3PYLA 1B15A 5H81A 4Q3BA 4MPDA 1ZJYA 1QYXA 2D0IA 1U4SA 4A5OA 4GLLA 1P1FA 3OIDA 4Z0HO 5JO0A 4TMFA 3H9UA 3AUAA 4TZKA 4E2ZA 3JSAA 4CMCA 3GOHA 3EUWA 4II2A 3DZFA 3BMCB 4ALIA 4FOSA 3L6OO 4G2NA 1VL0A 2GN8A 3EY4A 4TKLA 4BGEA 4BNTA 4ZJUA 2HSDA 3D3WB 2QZ9A 1QRRA 3KBOA 4D43A 3RU9A 4PLVA 3I9LA 4EITA 3GAFA 4FCCA 1U28A 1E7WA 5JDCA 3NT5A 4HY3A 4M1QA 4FFLA 3ZHBA 3IMFA 3OICA 1ZCJA 1U3TA 1DIHA 1O9BA 3FSRA 2VNAA 5K6AC 4ZRNA 4WGGA 3PWSA 2NTVA 1XIVA 3TL3A 1P33A 5G0TA 2FP4A 3CXRA 4BNFA 2FPIA 3U09A 4NFYA 4RPKA 1HYHA 4OH1A 5GZ1A 1YE3A 3LK7A 1PWZA 4FQ8A 3I9OA 5JAMA 3WFIA 4B4VA 2V7PA 4BO3A 3F1LA 3AI3A 2YW9A 2GR9A 1N9GA 3I9MA 2VQ3A 1GCOA 1XA0A 1GUZA 2AEMA 3GUYA 4EUHA 4P4LA 4BHTA 1JLLA 3GDOA 2C2XA 1IB6A 2Y1CA 2DVMA 1ZFNA 3H8VA 1PR9A 5DOVA 2HLPA 3KYDA 2GASA 2X6TA 3HN7A 1IHYA 3HB5X 1PGPA 4LMRA 3EW7A 3S2EA 3SLGA 2HQ1A 4RF3A 5C7IO 2XXJA 4FC6A 4RVGA 4CLDA 3STHA 1AHIA 1DEHA 3H9QA 5HS6A 3RFVA 1ZSNA 4FD3A 5ER9A 3CSDA 4XQCA 4DC0A 2IEDA 3IOYA 4QT0A 3M1AA 1VC2A 1U3WA 3VDQA 1NP3A 1HDCA 2F1KA 1LSOA 4WLEA 4J9VA 1IPEA 2P9EA 1B0AA 1GFSA 5K6AA 5LC1A 4BKRA 1DC3A 5FFFA 1X15A 1YB4A 4FW8A 3GPIA 3GGPA 4CM4A 1NQ5A 3INRA 5BSGA 3B1KA 4E13A 3WOHA 1DBVO
chains in the Genus database with same CATH superfamily
1M6HA 4JI4B 3ILVA 2JIBA 1U7XA 1SOUA 2O7VA 4OFZA 3SU8A 1LF0A 1OR8A 4RZXA 3DKPA 3C1OA 3U44B 1N4AA 4BZPA 3QLUC 5GP1A 2O3TA 3QXXA 4IL5A 4EZIA 1MO4A 5KNCH 1C3VA 1R0CA 3QF4A 2YDXA 4PRYA 1GLGA 1R0XA 4ZALA 1EI9A 3DD1A 1WVIA 2YVAA 5FTNA 1GAEO 5HJ7A 2QRHA 4D3SA 2PQ2A 2RCNA 2ZR7A 4IRXA 5C1IA 3TD9A 4FQ5A 3AC0A 2X5JO 4ZO9A 2NOAA 4F4HA 4IMRA 2W58A 1EAYA 4P7FA 2AJ8A 1NV8A 2VPIA 4XTRA 3TTXA 5KQLA 2BEKA 3KJEA 5IKEA 4QQRA 2IBSA 3KKLA 2BKUA 1GV1A 1PI3A 4ZEWA 2VQEB 4L50A 3K16A 1P0IA 2DHEA 3TZCA 2CK3A 1KSFX 2Q5EA 2QLMA 3LWDA 4GR9A 4R3WA 5EJ9A 3VOAA 1O9GA 4X61A 1FYWA 2QRNA 4OM8A 3V80A 4IUYA 2AOTA 3UT5B 5TPZD 4NF2A 2R85A 2QL5A 1N5OX 1L4EA 3A25A 2AQIA 4M8SA 5DH9A 2AOVA 4TLMB 5KDDA 3U9TA 1QP7A 1QQBA 1G2OA 4S3MA 2QTMA 3A9CA 1CS0B 4AFNA 3Q7QA 2AUTA 1A69A 2I6UA 3RSSA 1EWVA 2R1UA 4BO7A 3TMYA 4CTOA 1I33A 3FNGA 3HVHA 3H17A 2YUTA 2YWBA 3IURA 3TI7A 4WIAA 2Z5FA 1ZIOA 4ZMRA 3TGPA 1OI2A 5GJCA 4E5UA 4IDGA 2XCRB 4P35A 4YGYA 2QE7A 2FPXA 3TFWA 2QHXA 2XUDA 4RFVA 1XF9A 2WPDD 3N2IA 1FYXA 1JHOA 2PTGA 5J2TA 2FSHA 4G1MB 5FTWA 4B33A 1W581 4MWDA 3PPVA 1JHQA 1N2ZA 1R18A 4IKPA 1QBKC 3H1FA 3DBLA 3GBVA 3PTLA 4UUPA 1TQ4A 3RH0A 2WTUA 5IKMA 2HMTA 4G4JA 1KNXA 1EFRA 1AF7A 1P5JA 2G0TA 2Q0QA 1IY1A 4IVRA 4ZCPA 1C9KA 3L06A 1IY9A 3E48A 1D09A 1T8WA 1M8KA 2C96A 1JR3E 1GA1A 1TT5B 3PUZA 4FLFA 1T9HA 3KWLA 3LPLA 3W90A 4RCVA 4F6LA 2FQYA 1P5ZB 4XI9A 1AKEA 2SKDA 5CDUA 1O94D 3HJGA 3MIZA 1DIOB 3P4XA 3FCCA 2WFZA 4LGMA 4M9QA 4KE6A 4Y0AA 2BZSA 2GN4A 2VJQA 4HDKB 3R0IA 4I2VA 3PYXA 2XB8A 4B8ZA 7GPBA 1RADA 3BQMB 5P21A 4HDRB 3J7TA 2MYNA 2W43A 3VNRA 1PR0A 1OYVA 2H07A 5ALXA 1VYUA 1XJQA 4Y6SA 4K3VA 5EE9A 1QX4A 10MHA 2X14A 2WZDA 2ZULA 2PX8A 4YQEA 4EA8A 3DBOB 4X41A 4TS3A 1GM5A 2HU7A 3KR9A 1CUVA 3D9QX 2M1ZA 3X2SA 3QVSA 1C0LA 3H7IA 3LLVA 3NM4A 3NP9A 3W34A 2FMHA 4ZZ0A 2C0QA 2PZJA 4BO4A 2B69A 3ABQB 4XDGA 4D92A 3AIIA 2RGNA 1UMCA 3IKLA 1OAOA 1FYDA 1XTJA 1E1DA 2W2MA 3ISTA 4GVLA 5JMWA 1C81A 2R5FA 3KB2A 4YY3B 3WZLA 4A1FA 4AY2A 2Q5IA 3R75A 3B5EA 3FJ1A 3ANYB 3OOYA 2G83A 2CE7A 3OESA 3O8OB 3UCFA 2BD0A 1N7GA 2LDBA 2F00A 4P58A 2WHYA 4DPLA 4YV7A 1O5OA 2C20A 1E8NA 2UZ0A 3FPHA 3R7SA 4HWOA 4LGCA 2VG8A 1NQWA 1Z2CA 2W2NA 2YWEA 3NWBA 3PVSA 4QGFA 2F64A 2D7JA 2IW3A 3GVPA 3KEFA 3CSUA 3KPUA 1ZGHA 4JYPA 4QU5A 4P2GA 2XCSB 5BWOA 4Y2JA 4L27A 5JTUA 3KYDB 2OT3B 5B1HA 4B82A 1EBBA 2C7VA 2HMWA 5LYYA 3O92A 2JW5A 2AC2A 3KZKA 3D3NA 4ZVSA 4K26A 4DRZA 3HCFA 1WRBA 4LXUA 1F60A 3NWJA 5HRAA 3DCNA 4I9GA 4LBVA 1Q0HA 3FZNA 4L8YA 1O6BA 4F72A 1FFCA 3DMRA 4MINA 4OATA 1AS3A 3ZY6A 3L0IB 4IHKA 1USKA 1Y6RA 5IDXA 1X7HA 3QWFA 2DFTA 3ZOKA 1CX9B 3WLJA 1XDUA 2FPPB 2WKRA 3AQ4A 3QEOA 4PC3A 2RHOA 5E1BA 3SC2B 3IHWA 3SYRA 2JAQA 3VQTA 2B36A 1R4NB 4X1IB 3FMVA 3KBBA 4IOJA 3DAGA 5K01A 4GXNA 5ENVA 4WLNA 3DLPX 1XLTA 1Y9JA 3MUEA 4BFLA 5HK9A 1JG2A 3W5DA 3C1AA 4X1IA 3L7LA 1XXHB 1L5VA 4D8YA 2Z2JA 2V1UA 3LKBA 4ZPJA 1S8NA 4YEDA 2WM8A 5INTA 3RKRA 5EL0A 5EWMA 2N42A 4DT1A 1RQPA 1K5HA 4LNUB 5F52A 1Z4JA 1HKUA 2ISQA 2O3JA 4LDRA 3VH3A 2JCYA 4XGRA 3BFKA 3W8FA 3DVLA 5GJBA 1EHIA 3H75A 2FN7A 3ND8A 3OOJA 4YMUA 4YX9A 4JXXA 5JS1A 5AUPB 1D0IA 1V96A 2GEDA 1XDSA 4XM0A 2RJNA 4MHOA 3F3SA 4FONA 4B3HA 2ZQZA 4UHHA 1K9VF 2WHQA 1WVGA 2G25A 4HC4A 5FUXA 3ECSA 3QKRB 5KHAA 4PN3A 4PZPA 1I51A 3SR3A 2GRAA 4RVUA 3JV7A 1LPAB 1ZGZA 1RQRA 3OTIA 1H6CA 3ECAA 2R4TA 3JZFA 4KAFA 5CP8A 2YQ4A 4F6RB 1TU3A 2GAAA 5FBVB 2NXWA 3GVIA 5ULLA 4LTMA 4Q48A 4WADA 1RACA 1QPGA 3KXKA 1A9TA 4L57A 5KKAA 1JDZA 2EBFX 1KDPA 3NR2A 4ZOCA 2OORA 3B85A 4G4GA 5JNLA 1OBHA 3PLRA 1F2UA 1D9ZA 1PX2A 3P0HA 3QVVA 1T6BY 1IIRA 2IYVA 3CX8A 4ZQBA 2Z6AA 1ADCA 3EDMA 3IOCA 1NFQA 1WUJS 1EX1A 1DB3A 3WQHA 2R87A 1PSWA 4C0AC 4ZVUA 2WDPA 4KDEA 3VPHA 1SD2A 2G06A 1DP4A 3I6YA 1TADA 4KXNA 3X1YA 4QGGA 3B38A 5K3OA 4J91A 1ISSA 3SEAA 2HIHA 3KB1A 1MOPA 5LZ2A 3S7ZA 1C5KA 4B09A 2GPWA 3KXLA 5HF9A 4KWHA 5JWOA 5TC4A 1TMKA 2VBIA 4QG7A 4R31A 3DL0A 5LQKA 3OZFA 2B4RO 4KFUA 4AZVA 1C9DB 5EIWA 1ZJZA 1GPNA 2IP1A 4HVCA 3L0OA 2OO5A 2OHGA 3QE4A 1NBMD 2RBKA 1D2MA 3A3OA 4BRSA 3WZMA 2F62A 1J0XO 1DCMA 4GVXA 4XZ3A 4Z49A 4PHHA 2FB9A 2Z2YA 4G0NA 3E3NA 3ESYA 1TC2A 1HZZC 3ESCA 3GQVA 3QQ5A 4QXQA 2GX6A 4PC6A 5DP1A 5A05A 2OHFA 3D2LA 2AJBA 3OFKA 3IDQA 4LOKA 1E1RA 1N3LA 2B78A 5KYVA 2H29A 2FY8A 1R50A 4ABYA 1A4XA 3RTDA 2R8PA 4I1UA 1U9IA 4N5HX 1NP6A 5B30A 3BOSA 2XECA 3QP9A 3ZUPA 2ZRNA 3CNQS 2RGUA 3R77A 2EFJA 2EF0A 3A6EA 4QJBA 4RC9A 1ZVVA 1SM4A 2JDID 4V2IA 4CIVA 3GDFA 2HC9A 2WYVA 4UAVA 2EYQA 4BN4A 3L43A 3QU2A 2WICA 4GSLA 3UF0A 4GOJA 4KDCA 3WXBA 3RBXA 3KL4A 1R6XA 4MUBA 2I1VB 3NHUA 4CL8A 2VJLA 3WIEA 2HWKA 3T34A 4IIDA 3TIIA 5LJIA 5BWMA 3LUPA 3PR1A 1K8YB 3TZLA 4NC9A 1YDFA 2ZJYA 3UOWA 1IY0A 4BMOB 2WIBA 2V7TA 4FVTA 3W5IA 2D2EA 4TQ9A 4LX8A 4ZAGA 4CQLA 1SHZA 5MN6A 5ALJA 1BCRB 3BDIA 1JIVA 3IYLW 4KRXA 2OAP1 5EXSA 1PHPA 3OG9A 1PJZA 1WCXA 1X7DA 2PKWA 4LG1A 4S1OA 4C0XA 2VOEA 1VPWA 4IZ6A 2XUHA 1CY8A 1EXMA 2VH2A 2VDNB 3OBIA 4PO8A 1K7CA 1I9CA 1ISHA 2HSJA 3F6CA 4JJEA 1ZITA 3DPSA 5DSZA 4BN5A 5JSYA 4Q47A 3FRHA 1S4MA 3EIWA 3HWRA 1Z2OX 2EQAA 4OAQA 4HRXA 2GHRA 1XF1A 4JDPA 5EE5B 5TQ0B 3QEAZ 4Z1MD 1KARA 3CG0A 3Q2KA 1PX0A 2ZJZA 1U7ZA 1T2AA 1W5SA 3RHTA 3KOZA 2PMCA 1CUBA 3PUXA 4GRDA 1ESZA 5H5JA 3CIFA 3HVJA 2ID4A 5B37A 3I9FA 3K0FA 2FSVA 3FHCB 1U2TA 3RIMA 5KINB 5JAPA 3KV1A 2QX7A 4NAUA 4UC0A 3A4IA 4MR7A 4P5DA 3ZU6A 2R00A 1EK2A 2Q2QA 5TQ2B 1N5RA 2RC5A 1IRIA 4B4WA 1SUSA 4WFJA 3U26A 4CETA 1YA6A 3DBVO 3HXTA 4EQ6A 5MGBA 2GPJA 3NHFA 4US0R 5JD6A 4DXAA 2VKQA 1GUDA 2I6TA 4U6SA 4QFMA 3LQ1A 3DL2A 5F2EA 5PGMA 5HBGA 3ZCRA 3N07A 3CY6A 3FNFA 4I5EA 1W5BA 4ZCTA 1GFWA 3W8RA 4DUGA 1JEDA 5EHIA 4BBPA 1BX1A 4CCSA 3BD6A 3E2IA 2XQFA 1PDWA 4EG1A 3V2HA 1LBHA 1C7IA 4F9GA 4LNHA 2QR2A 3N58A 4K8RB 4TWBA 3PQCA 3SQWA 3ZDRA 4Q3NA 1ULSA 2O2GA 4DZRA 2J48A 3JQ7B 5GVSA 2BBWA 2NXEA 1CDOA 3HCDA 4MWCA 3X0DA 4F60A 1BCSA 1ACMA 3QIVA 5LKAA 3QXHA 2P5SA 5BYJA 1VL2A 3KKPA 2IWRA 3EEYA 3JARB 2JCBA 1WSBA 3F7NA 1FNSA 3KUXA 1GL7A 1TFRA 4WY5A 1DL5A 4AZSA 2W71A 1FUEA 4V3CA 3NM5A 1AXGA 1VIYA 3WRYC 3V1MA 1M6WA 3OZSA 3TTTA 4C3OB 1Z6QA 3PD1A 3H5VA 1T3LA 3ONWA 3PHLA 3R8CA 2QJRA 4ZHSA 3M6MD 4RVOA 2PUCA 4KRYA 4XPIB 1JKJB 4Q1FA 3MS4A 5JC1A 1TTTA 2INGX 5K20A 4BQPA 4D3DA 1SIUA 2RGCA 4N03A 4PFQA 5E8RA 2V4MA 4GXQA 4J1SA 5FCDA 4DV7B 1O6ZA 3IC5A 3VISA 2YIDA 1D0SA 3R0XA 1Y8CA 3A1TA 4MRMA 2I9PA 1XNJA 1NDHA 3IQEA 2GPAA 3IVAA 2O1SA 4Y2XA 1P4GA 3VBEA 5CCEA 4JX9A 3OTGA 4EY8A 1NLYA 4PVDA 2X2PA 5TMDA 3IQZA 4ND4A 1LBSA 1Y8AA 2BM8A 4ZV7A 4C29A 1CNFA 4I8DA 1I36A 1NHWA 2DQ4A 4TSKA 4LK2A 5D00A 4PXYA 3GMTA 5DNAA 2O2XA 2Q21A 4L7VA 3I73A 3UMRA 2ZE7A 5A2QA 5LYJF 3K9FC 4ZCSA 5H0IA 3Q4GA 1WD5A 4JVOA 4X44A 3PE4A 1FXSA 1RYEA 2JFQA 1EWTA 2Y9MB 2YH2A 3WK9A 3GDWA 3M33A 5ERXA 1P61B 1XD9A 3A9VA 1JIXA 3Q3JB 3ZYZA 3GVXA 1SXQA 3IL2A 4ARBA 1THZA 1Z7BA 3DUWA 3KELA 3O38A 5I51A 3BMOB 3WWDA 2NP6A 3K0HA 1VHQA 3G5UA 2G1UA 2R7KA 4W5WA 2QYTA 5FYDA 5CIQA 3H2GA 3HPRA 1LLDA 1GPYA 2JGEA 3CO0S 1TMOA 2AB0A 3GB9A 4JBXA 4LYDA 4MLDA 4XIGS 1OZ0A 1VSBA 1HDEA 1W47A 4OQDA 4O02B 3V4VB 3ZVLA 6LDHA 3EXHA 1RHKA 1ZRMA 1JXMA 1ZN9A 3JR7A 1ZIYA 3ADKA 1SU4A 2GF2A 2BUBA 1N5IA 4F97A 1B76A 2A0UA 2VYFA 4KKVA 4DDUA 1J90A 2NVBA 2Y77A 4LMAA 2FMFA 3GLGA 5T41A 1QO0D 6REQA 2ZREA 3GLFE 3KYIB 1H2YA 1WHTA 3SHVA 4NK5A 3JQBA 4GAEA 2WAAA 3DCYA 2V8OA 2B4AA 3R6DA 3CRNA 1J20A 4KZKA 4OXKA 4YI5A 2ONJA 2B1JA 5ESRA 1QAMA 3RTEA 4AY6A 1H65A 1N2CE 3RYFB 1DAMA 3GGCA 3IO3A 2UUCB 1U3VA 5ILGA 4IDQA 3HJBA 4YUXA 4B2IA 1SHTX 4FFOA 4ZJZA 4LPKA 1QFYA 5EJGA 1XKLA 4V03A 1ZWLA 3ZZMA 2YC4C 4AB1A 2JIOA 4X60A 4KQ1A 5DNWA 1EFLA 1SU7A 3U4IA 4G01B 4LYJA 1ZJ6A 4ND5A 5G0VA 2NTNA 1XQYA 2V6JA 5FI5A 3TLGB 1S1MA 3KQHA 4KH1A 1XQ9A 4M88A 4PZ0A 3LGAA 3BBPA 4J76A 1ADJA 1E9AA 4BU1A 5SZHB 1UXHA 3DXZA 3FAZA 5DGCA 5EKUA 1M2WA 1PZEA 2JJMA 2QVGA 2VUIB 2WP8J 2XNDA 2AUNA 2GEFA 2Y4NA 3C5EA 4RZQA 5AJZA 2OBFA 2XA1A 4G36A 3VPBA 5JO9A 4PPNA 2OBXA 5FA5A 5IH3A 3C87A 1EQUA 1JA0A 2IV3A 1RI3A 1JT2A 1PFKA 3NRBA 4UARA 3PNQA 1BXGB 3U17A 3RD5A 1GP2A 3E84A 2I7DA 4Q01A 3UW3A 3TDKA 4IS3A 3ZNQA 3A1EA 2PSSA 2OFFA 2Q9BA 2VDVE 3TQOA 2HCJB 4IF6A 4B3MB 2I1QA 4HNRA 2AMJA 3SNHA 3L7OA 1KI7A 2C2ZA 4YMIA 1P75A 3ZWVA 1U3UA 1OBOA 3MWFA 5DTIA 3U3DA 4DEVA 1GGVA 4TKVA 3L6CA 5I7RA 3HCWA 4UVHA 4CLHA 5IK2D 1V5FA 1U0GA 4O4IA 4OJMX 3B12A 3VU8A 1DX9A 1JBKA 2WA1A 2Y1LA 1X1RA 1FVHA 3BF8A 2IDJA 3S70A 1JLMA 1HF3A 3T3IA 3KT0A 1U99A 4UM9B 2J67A 1RLTA 2XVXA 4EW6A 1UF9A 4LZOA 1TUEA 1O96B 3I39X 3NHWA 3SEFA 4LDJA 4XASA 3EA0A 3UJAA 3AY0A 4KN9S 4M3NA 4OGKA 3RFCA 3TKYA 4EMBA 4QM7A 2HRRA 1AKYA 4WE3A 1RTKA 4DIDA 3A27A 1YRQA 4HPXB 4P4GA 1A2BA 1RU3A 3U16A 1YCHA 4J2OA 1YQGA 2DUWA 2Q6KA 1QIIA 4UNRA 3NU1A 1FIUA 1GRQA 3GOQA 1YRBA 3KSRA 1XZPA 5BT9A 3ICQB 1NQAO 2RC6A 4Q24A 3KD2A 5TR9A 3TLBA 1DX4A 5ALRA 4G5GA 2HL6A 1T5LA 4GS5A 2WTAA 3A7DA 4Q4HB 2OP1A 1SQ5A 2VI5A 3TZKA 4OGLA 3X43A 4EYOA 3QRWA 3S44A 2O4UX 2XODA 5E1MA 5IASA 4B3TB 4HGNA 1WPXA 4O4HF 3RFTA 4Y1RA 3OPXA 3WB9A 2VTVA 4U7PB 2VAWA 4RLQA 3CEHA 4QHYA 4DMMA 2QQ0A 2YICA 5DLEA 2BW0A 4X63A 2JATA 2V4UA 1QH1A 3SJBA 4ZT2A 2BWJA 1ULHA 4R1PA 1UBRS 2HHHB 3RAFC 1ODCA 2BELA 3JSXA 3AKEA 2I99A 5JVDA 2ZUBA 2WBLC 4TKMA 1I30A 4ER5A 1W5FA 3V9AA 1RCUA 2Z5VA 1JYEA 2BOVA 3GROA 5HDQA 3S29A 1HQYE 1QC5A 4MQEA 3TTVA 3QW4B 1XYVA 2NPIA 4ZKDA 1X9HA 4N82A 2ZRDA 3IFSA 2B3TA 3DF9A 4JXZA 5KOYA 3N2KB 1UJMA 4XDZA 5D7BA 2OL4A 3DONA 4AJ2A 1S4QA 2VYVA 4I19A 3OQMA 3G0HA 1W9MA 2SCUB 1EFKA 3FLBA 3QLVC 4AXXA 3LX5A 4YDSA 1WW8A 3WLQA 3BFXA 2WZBA 1U8YA 2AH5A 1CY1A 1P7ZA 4HNHA 3EIQA 5LD2C 3PWZA 3KKQA 4JQZA 3GC6A 3S4YA 2I2WA 3FKJA 2BFCB 4KIUA 4C07A 1T2FA 1JZTA 1UBJS 2RGNC 1MOQA 4KDFA 5FKJA 1YHYA 1YR9A 5D3MB 4ZKEA 4RY2A 4DMGA 4Y2TA 3ND7A 5LB2A 3EQ9A 3QJGA 1SWWA 2QSYA 3CUKA 2WINI 1RAEA 3OCVA 3BXOA 1PLLA 3FY4A 1DAFA 3OQHA 1QAOA 4QU8A 4TV9F 5IVIA 4MYDA 3RI3A 4AYTA 4BFWA 1DJNA 3AO0B 4TLBA 2IY9A 2Q1WA 3WLEA 1OT5A 3A04A 1N1EA 3E18A 5AKIA 2GJKA 1PK9A 1G19A 1G64A 1MOSA 3B6KA 3OU2A 5JAIA 1NRWA 5KWIA 1Z63A 1YZFA 3FA2A 3Q10A 1J0DA 1Q0PA 1YL7A 2H8KA 2NSLA 2P2ZA 3C43A 1Z88A 3KKMA 2Y1GA 3RK0A 3T5PA 4KW7A 1YDWA 3H99A 4JLKA 4IFBA 4LJLA 2OHVA 4H59A 4OV6B 4N40A 3TLAA 1XTUA 2BKEA 5KREA 3PLAE 1JBQA 3EEBA 2IU3A 4DSUA 1TZ2A 5AXAA 5CMLA 2NIPA 5TGDA 3PYMA 5K8LA 2GM3A 3COSA 3PC2A 5TS2A 2J87A 1GRNA 2CFSA 2MMGA 3ZHOA 1AKNA 1X1TA 5DHAA 3I2IA 2Y1WA 2VRCA 1ESEA 3PL1A 2C61A 1BMQA 4QZVA 3TVYA 3OWOA 1VSQA 4MTCA 2EFEB 4RV4A 2BGWA 2EZUA 3M3PA 1FQWA 3DAFA 3EAFA 4XIIA 2ARKA 2V0NA 5EZQA 5FHRA 1OAAA 2AW3A 1PJ8A 3RS3A 2JLRA 1DKQA 2CLLB 3SN6A 5EIBD 1JDNA 1ISRA 1WX1A 3RVBA 1XRMA 1PEDA 3JPYA 2XHZA 3QKSA 4NBWA 2EQBA 5IJ9B 1DNPA 1I2BA 3F46A 3AYZB 2QAIA 5A3RA 1P7CA 3CEAA 2C4MA 1QDUA 1W59A 3KSUA 4KIJA 3CA8A 1RSZA 2H4JA 4D3FA 4F3TA 1TVKA 5JLJA 3FOCA 3CMCO 3FZGA 3NIFB 2M6LA 1LLCA 4NCAA 1G21B 2AVDA 2E37A 2PU7A 3PDCA 4MQ6A 4YXWA 1U8FO 1OH8A 4RDXA 2Y27A 4KPFC 1R74A 3RTGA 5AW5A 3WP0A 5HBRA 1U3CA 5DN9A 2BF4A 1ZH2A 2QRVA 1PFQA 2REOA 3TFOA 3NG1A 1PJBA 2ACVA 4G23A 3KVVA 3S2IA 1AQLA 2B94A 1PNVA 2LIPA 2OV1A 2X1MA 4WCFC 1E18A 5HA5A 2QD4A 4HEJA 4Q0MA 3HNRA 3RJMA 3OP4A 4X1KA 4YRDA 3WWCA 4H18A 2F55A 3TMAA 3PI7A 3SG0A 4ARIA 2J6IA 3N8DA 1P4JA 4BNUA 4GR5A 2Q1XA 2O07A 4IAOA 1CFZA 1GZUA 1U2QA 2P62A 3PHGA 1NJGA 3AW9A 4JASB 5DM2A 5DOZA 4CRWB 4MW1A 1ZAKA 2YFYA 3RYHB 1AKQA 1E4VA 2I2BA 5E0OA 3FM9A 3VDRA 1HFKA 1IJBA 3UM9A 3DMYA 1CBUA 1P5RA 3BHJA 5H3HA 3CX3A 5KJFA 3L0BA 1OCEA 3D2BA 1O7JA 4KN8A 4LMPA 3WO0A 1XZGA 2QV7A 5LXTB 1YZLA 3OJXA 3DH0A 1DQRA 5HUJA 3G2OA 2IK8A 2LVBA 3PTZA 5EUQB 4A2CA 2VNKA 4G0OA 5LP6C 1QBGA 3L9WA 2FZWA 2G5GX 3WGUA 1THTA 5AUQA 3M1LA 2H1CA 4M0LA 4YI3A 1NMSA 1EDDA 1QCDA 3LVFO 3W7AA 1X9IA 2X41A 1VGQA 3K2QA 4DA4A 1C4OA 3NJ8A 1AD2A 4R6XA 4BQQA 2IBTA 1JKMA 1O6FA 2FQQA 1NJ8A 2AD5A 3RSGA 3ZWKA 2VHVA 2B8JA 3B6ZA 5EHXA 1BD4A 4DG9A 1A9XB 3PUWA 5IBPA 2D5BA 2J9FB 3ZE8A 2DEUA 4D4IA 2J3LA 4E30A 4DV2B 3OTWA 2BGJA 4FYVA 2IQIA 1TW3A 1EAMA 2FW7A 3AIMA 4JSTA 1E5DA 5TARA 5DX8A 4GG1A 1KE2A 1YQQA 1G8HA 3ZLBA 5BR4A 3TG8A 2W6IA 2HCFA 2C97A 2X1VA 1U2ZA 2AW5A 3O93A 1XYYA 1Z6GA 4TXMA 1XZBA 1DCKA 1FS5A 4OQEA 3SF8B 3CF6R 2ZIAA 3DG9A 3BJRA 1GPBA 4NAHA 5E6UB 4CG2A 4BXOB 4CGZA 4RM3A 5CFQA 2NO7A 4P80A 1HURA 3HSYA 1FUUA 2P79A 4K5QA 3RVRA 3FLMA 1NATA 1QRDA 3F5DA 3FAKA 2PD3A 1Z6TA 3EJ6A 5DZSA 1V5EA 1L7NA 1YNSA 1XTIA 3PQEA 3ZHSA 3KPJA 3CR8A 4AN1A 4P4SB 2ZYRA 4WZAE 1UPTA 5D86A 4DLKA 3LF2A 4UREA 2FPIB 3TF5A 1XZDA 1ABFA 1QR6A 3A1SA 4FYJA 3HZZA 3OLXA 2JIMA 4HAXA 2W2PA 2FFAA 2FZLA 3N8KA 1VMAA 2ICAA 4JKIA 2AG1A 2OKGA 3GV0A 1ZZGA 2J30A 3PJGA 4IDHA 1Q0LA 4O25A 2QTBA 3U2QA 1YUBA 1T3SA 3ANLA 1DJLA 4PLTA 5DM0A 3IUEA 1RJDA 1EP9A 3FPEA 2W2OA 4FMBB 2QN6A 2IPXA 4CF5A 2VPQA 4HXFB 1T13A 2X7XA 4OIFA 3AWDA 4O0MA 4WL0A 3OX1A 5AKGA 1J2JA 4N5DA 3WLNA 2JJ2D 1M54A 1UBHS 3JQFC 1SCQA 3MSCA 4L9WA 4A1OA 3DE5X 3F9IA 1YE8A 3G8DA 4R68A 1JH8A 3AESB 1IOZA 3M1IA 4D46A 1XCGB 1X1BA 3G49A 3KD3A 1CQJA 2ZUTA 4BTVA 1TUGA 3ONDA 4KZPA 4XKJA 3T3OA 4E4RA 5DNDA 1KDOA 1TF5A 3L1KA 3QXSA 1K5DA 1EQ2A 1NW9B 2P2DA 3HWWA 4IHJA 2PLAA 4MVCA 1CV2A 4QYSA 3ROKA 2XYGA 4GXTA 1AVTA 3Q41A 4OK3A 4WEQA 4WLOA 5AI0A 1YDHA 1WDKA 3KQQA 3ZR4B 5IRCD 4BKQA 3ZV3A 3GXBA 4HZUB 2DKFA 3RHSA 2G4VA 2PCJA 1DUSA 3NBFA 3VPCA 4V02A 4WOPA 2R5NA 3TJZA 1Z06A 3IIMA 4N6OA 1CZOA 2BUAA 2YBEA 4YLEA 1JJ7A 4YASA 1UZLA 4DJAA 2QLLA 4H6VA 4N6NA 1W25A 3BCSA 3AR5A 3BFJA 1T1RA 3EVZA 1DBIA 2HI0A 4G5FA 4L4UA 1YB6A 5EFZA 4B34A 2EU8A 4JY7A 2D2XA 4Y7DA 3PNKA 4D98A 5EJ7A 1DDIA 4LV8B 5JS2A 3K4QA 1KSHA 4GNRA 5DM1A 1OWNA 2VLIA 3HYRA 3LRTA 3OLZA 3PHJA 2FGJA 4PANA 4I3HA 2XWPA 4H3KB 1RWOA 2YMPA 3LKDA 4NE2A 2VSNA 4A8JA 4X3PA 4I1SA 8LDHA 4QDZA 2F1IA 4RTJA 2VNJA 4J49A 4N41A 2YJGA 4XVRA 3JD0A 4BQNA 2VWPA 3JCZA 4OGWA 3BEDA 2V6FA 2XXAA 2Y1KA 3STYA 4M54A 5DJ5A 2F8LA 2N9UA 3KOUA 2OC9A 2BM9A 2CLOB 4XUEA 4F5YA 3AV0B 4CMAA 1FRVA 4IFEA 1A76A 2Q1SA 3LL7A 2PZ8A 5DT2A 5GONA 4L5JA 4AG6A 5KOJA 2OHHA 2WPNA 3UNXA 1NQUA 1PYOA 3R5SA 2L0XA 4N54A 1H2XA 4W8HA 5LA6B 2PPVA 2Z6VA 1N6IA 3VVBA 2X2OA 3HCRA 2WSYB 4ESHA 1YKSA 1KQ3A 4ZI2A 3DMPA 1CRPA 1MHPA 3A37A 5FT9A 3HMQA 3QY9A 1XD8A 4UVIA 2WPDA 3DYBA 3AEQA 4ZK2A 4N9QA 3I2YX 4BO1A 3T5TA 4CM6A 3S1SA 2GN0A 2BP7A 4EJ2A 2AOXA 4CEJB 3S2GA 1LW7A 2BVNA 1TJ4A 2ODPA 1IN5A 3USES 1BQ4A 1SD1A 2ZYWX 4JI7B 1OTHA 4LY0A 3OQIB 3GT4A 1ZM9A 3GJYA 4UBIA 1Z13A 2QLFA 3ZIAD 1XNHA 1IZ9A 3PDJA 1OYYA 1B73A 2GTHA 2V9ZA 3TX6A 2XUGA 2AGVA 4MS1A 3RASA 4RTLA 5BR8B 4DQKA 4Y6LA 1K2VN 4PGHA 3TGLA 2ZJAA 4XVUA 2P41A 1K8QA 4WMLA 1Z56C 2Q3MA 3N2LA 4IQFA 5BSWA 2ZM6B 3K1TA 3MD0A 4I9NA 4M49A 1JI0A 2VSXA 1NX6A 2YQ5A 3RC9A 3ONEA 3VI3B 3E8XA 2NNWB 5C1OA 2G82A 3TQSA 1EUDB 1O94C 1KZGB 1X0XA 2ZSFA 3MQFA 4FILA 5ERYA 2C4UA 3HJNA 4ME6A 3WLRA 3OEWA 4YAKA 5F1OA 5AVOA 3UPDA 1R8JA 2ACWA 3NC1C 2XADA 1W49A 4OQLA 5EJ2A 4RJ2A 2AD1A 1I7LA 1H8EA 2I2DA 3JQGA 2FQWA 4YJ2B 4ZT7A 2HQBA 2CFOA 1SOWA 4M98A 1OI3A 2GM9A 1G18A 3QYPA 1C1YA 1Q6ZA 3BUSA 2AUMA 2G72A 3IQHX 4MUIA 1T36B 2MYPA 3DV9A 2XNDD 4JBHA 1DBRA 2BTQB 3QVJA 3TFQA 1T4CB 1XD2A 2YHSA 1S2IA 1V2GA 2AA3A 4BECA 1VSUA 1BJKA 1M1YA 3T6KA 2BHLA 3T35A 4J3JA 2F8MA 1GD1O 2DU8A 2QOEA 3C8MA 3EPPA 3IMEA 2CMHA 3AEUA 1TOAA 5B2FA 3EFOB 1L7DA 1L5WA 1RIIA 2AG6A 3VYRB 4YRNA 5JALA 4DT1B 4QVIA 4I9UA 2W42A 4Q9DA 4RHTA 1I4WA 3HGMA 5IABA 5IN4A 3G6WA 2HRCA 2VJYA 3LDFA 4DEXA 1VIAA 1N5KA 4P93A 5HWSA 1VBFA 4K6CA 3D5TA 4QU0A 1JDBB 1U1EA 2Z4TA 2IIBA 4YAWA 5D6OA 5FORA 4YONB 3R7BA 3S2YA 5JV5A 3HY4A 4IGFA 3KWJA 4QNRA 2WD7A 5TT0A 1SXJA 2VS1A 4BUCA 4O8CA 2B5OA 5A4FS 1MW8X 3AILA 4LKOA 3H5TA 5BNWA 3B9BA 3AKZA 2PUAA 1Z4QA 4KPGA 4X24A 5AUOB 1ODSA 1OB2A 1J4AA 1MIHA 1EMDA 2FUG1 1SRQA 1P1HA 2BM1A 4YMSA 2XYQA 5JANA 2I7XA 1QQ6A 1Y8QB 1TM2A 3M3HA 4ZMBA 5EIEA 5JXHA 1ND5A 4FNOA 4X0EA 1ODLA 2IQ5A 3TYXA 1E3LA 3QKIA 4YV0A 1VSTA 2FE1A 2QL7A 4LNAA 1Y3DE 3AGPA 4DPMA 3K9LA 3HABA 4EYEA 1CS0A 4I4TA 3E1GA 4F04A 4HX9A 1G63A 4QDJA 5K0LA 1F8FA 1VMEA 4KR6A 4NJEA 1N6LA 3H5NA 4X6LA 3IT0A 3V34A 1C3OA 1F8GA 1NA5A 4KE8A 4PPGA 4TLEA 1W36B 1KEWA 1Y33E 1U04A 2A5YB 2FSGA 2NACA 5IN5A 4HO1X 1C4XA 4GX5A 2CFTA 4YJHA 3HKEA 1GCAA 2WWIA 5D7NA 3I61A 2E55A 3DEYX 4IDOA 2I62A 3AR7A 1K0FA 1ZN7A 4ZK6A 3B6JA 2FKNA 2ZSKA 1D0VA 2O0JA 3I9NA 3MIIA 3KXIA 5CLJA 4HZIA 5E1DA 2FOLA 3ILHA 4BVLA 5A7GA 2YHIB 3JRXA 3TWOA 1YZ3A 2EAUA 3GZNA 1UBSB 1T5DX 3TNJA 5DBFA 4LJRA 4ZTBA 1FSFA 3CKMA 1DKOA 1QS0B 3ZDQA 1AKVA 3DQPA 1PZGA 4RS3A 2ZCJA 1U7DA 1OPXA 1Z5UA 2Z8YM 3AUKA 1GGHA 1EJ2A 1IN7A 4QTZA 5HMLA 1II8B 3CUVA 3UMFA 2FZEA 1PO7A 2E85A 4OSPA 1Q1ZA 1GFZA 3BRWD 3U4GA 1EXVA 2RHGB 1DT3A 1R6UA 2VDLB 4C78A 2ZP1A 3AG5A 1PUXA 4O59O 3H2IA 3NDRA 1YB7A 3NWPA 4V39A 2YBDA 4MDYA 3T7CA 1G7CA 4D81A 1GGJA 2EDCA 2JIDA 4MS3B 3THRA 1KMHB 5ADWA 3HO1A 1X2BA 3K0CC 4NIMA 3WAKA 4CBVA 1FU4A 4EHAA 1RHQA 2EEZA 3HFRA 2G71A 2Q0XA 4H0CA 3UJNA 4WFQA 4ERNA 3FZQA 1FPQA 4CMIB 1SNYA 3WP1B 4CUJA 5A03A 2II6A 3ELYA 2DLDA 2RGAA 2P2GA 3OZWA 1P72A 4G5OA 3RAJA 1PV4A 3FCUB 3BGIA 1VKOA 1G21E 4QBHA 1SBZA 1L1EA 3I04A 4E5SA 3I3OA 2CFRA 2XYHA 4MV0A 3W5JA 3F8SA 4R2LA 1KFEB 5EJIA 2NPFA 1YO6A 3FDFA 1TO6A 5CG1A 4ZEXA 1X87A 3BMOA 3ZWCA 5IS2A 1E8MA 2X8AA 1DHRA 3VO2A 1W7AA 2F17A 3CCCA 3IBSA 1ZNZA 3X1MA 4D9EA 3T3NA 1P74A 1ZHHA 5C5DA 4QE3A 6ABPA 3KFXA 2EV9A 1T35A 3OZIA 1C4WA 3WYFA 4DR7B 3SX4A 3I6ZA 1X42A 1SVWA 1HDXA 5I3CA 3E82A 1SO8A 3A3YA 5JUWA 4BZQA 1QORA 2AN5A 4PFSA 4Y6GB 1HPLA 3DV0A 2C42A 3HB0A 1G5IA 1IAVA 3CM0A 1JHZA 1P17A 3AY6A 2JEOA 2XD9A 1KI1A 1NT4A 3O4RA 1UMDA 1MAAA 4EF5A 2H9IA 3WDSA 3WB1A 4RA9A 3H5OA 2VP9A 3M5PA 3U1BA 3M9XA 2YHIA 3RTBA 3BB4A 2ZIWB 4GMDA 4IDAA 1FK8A 4DY6A 3DTYA 4LSMA 3ZUGA 6Q21A 2CT8A 1T10A 2CLFB 5EP2A 2H2AA 4OL9A 5U4XA 2OHIA 2IUSA 5FRDA 2ZYDA 5KCZA 1O0CA 1NXQA 1OV6A 3D6JA 4TQUS 1YE5A 1KAGA 3IALA 3VOBA 4EQ6B 1KAEA 2XTJA 5A6VA 1Z18A 2D2IA 4X6YA 2MIIA 1NBAA 3T52A 2AXPA 2QVCA 3M5WA 5DCUA 3RNOA 4C4XA 1YQWA 1ESDA 1EVYA 2TECE 3PCXA 4F2WA 4B3RB 3NHYA 1B6SA 2AT1A 1CB0A 1EH5A 2G77B 2H63A 1YOVB 2HDWA 3I6BA 4Z7OB 5AVVA 1P9OA 1CDEA 1W4CA 1XA4A 2XYPA 1WXHA 4J0QA 4KXQA 4NICA 4V0OA 4C6HA 4JC4A 1RLOA 2GO7A 4GWGA 5L9AA 1Z28A 2HTFA 4LJ5A 1SKQA 3GRFA 1SQSA 1V16B 4I1OA 1F0KA 4H3SA 3KWFA 3ZV5A 4AO8A 3ZWMA 3VKHA 1UPAA 4B9AA 4DARA 4YREA 4EENA 4O2BF 1K75A 4JBYA 2RKBA 2OKCA 4U8GA 2QG6A 2J4FA 5C18A 5CH5A 3W2TA 4E5YA 1NWHA 1QV9A 3DMGA 2R6JA 3JASA 1RXEA 4QUAA 1KMCA 1IHDA 3VMMA 1IULA 3BWMA 3B6MA 4BO8A 4Q1BA 1GRRA 2O8VA 2QL9A 1UJ6A 2A78A 4YCNA 4R1TA 4EHNA 1JF8A 2ZBUA 3BIXA 1T9GS 4LC1A 4IIGA 1ML4A 3L0CA 1HNWB 2MU1A 2WD7B 4YT2A 2R0QC 3V1NA 4R8RA 3HDVA 2H5IA 2COKA 1VIVA 2QJOA 2R4QA 3AUYA 4J7AA 1FFWA 3DZKA 1Y1KE 4FUTA 4RLSA 1OUMA 2FJ0A 2QRGA 1E1YA 1NVWQ 1FNCA 1NXTA 1RE0A 4BNHA 1GAQA 2PL9A 2WIGA 3NCTA 3B8EA 4IDBA 1PR6A 1N5MA 3O1JC 4BE7B 2R1TA 5CG2A 4NDNE 1QZUA 1ORWA 1DC6A 4L8VA 5AJYA 4BEVA 1JIKA 3E3LA 2D5AA 3VAZA 4YMTA 3NDBB 4M1EA 1I10A 4J3NA 2ZE6A 2CV2A 4RQTA 4JL6A 1AQUA 3L01A 2GERA 4LYGA 2HV8A 3BMQB 1FW8A 3FTCA 5DIZA 2IHJA 3WA7A 2ZYGA 4QFBA 2FCAA 3FUXA 4QEDA 2PX5A 4L3OA 3O7MA 1U0SY 1T9CA 2EGHA 2QM3A 4OBEA 2IBMA 1LPNA 3PRYA 1BGXT 4MMXB 4A27A 4GXRA 4BB5A 1BQ3A 5IDVA 3BD8A 3DNFA 2VXCA 4O5AA 4Z8YA 5EG5A 3GI1A 2H0QA 1G4AE 4DL9A 3RUAA 2ZTLA 5AFSA 5IZ4A 3C6KA 4TQGA 4D3XA 1NQVA 4CKZA 4IWNA 1HG0A 1RI1A 3G8AA 4X6UA 2G80A 3II6X 1AHNA 1JHXA 3BERA 2WIKA 1HLPA 2GXUA 4MYUA 3B3QA 4ZGBA 2X8LA 5EJ4A 1CETA 3A3PA 2OYRA 4BQSA 1SR8A 4CTNA 1ZGAA 2Q8PA 4MA0A 3QVLA 2HEIA 4DPKA 3KLOA 1XHLA 2FQ1A 2PH1A 3BWEA 2G9QA 5ALEA 1L0BA 1XDGA 4C0BA 3O8RA 1ZLYA 3VTAA 2AZMA 3RHFA 3SFTA 2KLBA 1INLA 3ORRA 2ZR0A 1CT9A 1HTBA 4AMZA 4LS3A 4C0SA 2BGLA 4K88A 2ZANA