1SNYA

Carbonyl reductase sniffer of d. melanogaster
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
248
structure length
248
Chain Sequence
b'HMNSILITGCNRGLGLGLVKALLNLPQPPQHLFTTCRNREQAKELEDLAKNHSNIHILEIDLRNFDAYDKLVADIEGVTKDQGLNVLFNNAGIAPKSARITAVRSQELLDTLQTNTVVPIMLAKACLPLLKKAAKANESQPMGVGRAAIINMSSILGSIQGNTDGGMYAYRTSKSALNAATKSLSVDLYPQRIMCVSLHPGWVKTDMGGSSAPLDVPTSTGQIVQTISKLGEKQNGGFVNYDGTPLAW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sniffer CG10964-PA
publication title Structural Insights into the Neuroprotective-acting Carbonyl Reductase Sniffer of Drosophila melanogaster.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Oxidoreductase
total genus 87
structure length 248
sequence length 248
ec nomenclature
pdb deposition date 2004-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1snyA00
1SAYA 2BRUA 4BNXA 1XLTA 5DBGA 2FOIA 4OXYA 4D79A 4E21A 3RROA 1GD1O 1EVZA 2C82A 1T4DA 3H2SA 4CR8A 4ZU3A 1YBAA 3ZU3A 5CG2A 3WFIA 1YXMA 5ICSA 1UXIA 1YQXA 4DVJA 1F0YA 4BO8A 5I7SA 4YAJA 3HDQA 4DTIA 3FCOA 5EESA 2WMDA 4HFJA 5A3JA 3MTJA 3U0BA 4DQUA 3I9KA 2NLOA 2VUUA 4S1VA 1DC4A 3KVOA 5DBFA 3ZWPA 1O9BA 3K30A 1NXQA 4NPCA 2BFMA 3HJAA 1CWUA 4XKJA 4CR7A 5JCXA 3DZBA 4XIYA 1PJQA 1KY4A 5ENVA 3WR5A 4Q9NA 4JX8A 1JWBB 4IJVA 2XOXA 3HADA 1MLDA 4GSLA 3G3EA 4UEJA 1ZK2A 2QRLA 3GDOA 3L4SO 3PP8A 4JP3A 3RKUA 4KP7A 4J1SA 1J5PA 3ONDA 4BL5A 3OHSX 4NK5A 3W6ZA 1DFIA 3I9LA 4MVJA 3AY7A 5G2OA 1L7EA 3AM4A 1YJQA 2H5LA 3FRJA 3WOHA 4BO7A 3GVCA 1R15A 5JAQA 1PS9A 1DRVA 1M66A 2FPIA 3TZKA 5L53A 1C1XB 3A14A 2W2LD 4GMFA 1HSZA 3A28A 1PZGA 2IZ0A 5HBRA 4BNUA 1O5IA 1HEUA 4IUYA 4YJHB 3EAGA 1C0IA 2WWRA 4R69A 3I9JA 4HNGA 2EJWA 3DL2A 1GYPA 5C7IO 1B2LA 4CMGA 3ASVA 1LDGA 2Y1OA 4ND3A 3ENKA 3WSVA 4CM8A 5JBIA 3CMMA 5G0WA 4U6QA 1MXHA 1D7OA 3TZQA 5JYEA 3KLPX 2GZ2A 4Y6PA 5COBA 5IF3A 4JIGA 5BNIA 3TOZA 3D5TA 3HWRA 2PGLA 1R6DA 4RDHA 4GWKA 3E82A 4CUKA 3OECA 4L9RA 4JK3A 2Q4EA 1NVTA 1N7HA 4YQZA 2EV9A 3V8BA 1JKFA 1MX3A 1Y8QA 1Q7BA 4AJ1A 2RBEA 4J7XA 1FDWA 3VH2A 4UAGA 3DMYA 4QFCA 3DBRA 3ZNNA 3Q1LA 2YFHA 3ZV5A 2W2KB 5L7YA 3S55A 2Q45A 5IDXA 1EZ4A 3DMTA 4YCAA 1WMBA 4P4LA 4YEDA 4AVYA 1BG6A 4J2HA 2I9PA 4FR5A 4ALKA 1WMAA 3VPSA 4BKRA 2HQ1A 3IKVA 5L51A 5BSEA 1DC6A 4P4GA 3PGXA 2P91A 3A9WA 3HDHA 5DCYA 2PGDA 3ROKA 3TWOA 1BVRA 4ND5A 4D41A 4ZQGA 1YBMA 3EHEA 3Q9UA 3WGHA 5CEEA 3F47A 4YAKA 2PTGA 3GT0A 2POQX 5HTOA 4IPTA 1SEVA 1X13A 4WNIA 4WECA 1VKNA 1ZH8A 2ZJ0A 4PLFA 1IULA 4B4OA 2X0RA 1AN9A 3TSCA 1WWKA 3WQQA 1YB1A 4BGEA 3VAZA 1V3VA 2Q99A 3STHA 3X2FA 4LGVA 1A9YA 4FJ2A 2BFOA 3GRKA 1BSVA 1GCUA 5A5EA 3JYOA 1OMOA 4GLOA 4GX5A 2JD1A 1JU9A 1D1SA 1T2FA 4R16A 3C8MA 2CVQA 2B5VA 2FSVA 4DBVO 2B37A 3W8EA 2B0JA 4TROA 1WZEA 4L4RA 2YV3A 2PKQO 1E0DA 3BHIA 3GNSA 4L75A 3UOGA 1Q7CA 3CINA 4DUPA 1CQIA 4NDNE 2YFQA 4YT5A 1HE2A 5KIAA 1EUCA 1KVSA 4KTVE 3DOJA 1P0FA 5I9NA 5HRUA 2VZ8A 1VE9A 3GPIA 1B14A 1OZAA 1P74A 1B16A 4GGOA 3HFGA 4MP3A 3LU1A 1MG0A 3AY3A 3RC9A 3I6QA 3QVSA 4HY3A 4WKGA 4XYGA 4J4TA 2VWQA 1A71A 1DAPA 2C29D 3FTPA 2JL1A 2CNBA 1ZMOA 2PZJA 4KQXA 2GN4A 3EMKA 4NU5A 2EP5A 3ZI0A 4E5NA 3KO8A 1QYVA 1H6DA 2A35A 4YJDA 2OFPA 5F5NA 3VPXA 4IQ0A 2Y0EA 1V3TA 3ROMA 1A4IA 1OC4A 3PDUA 3QWHA 1UH5A 2YHIA 3L4BA 5F1OA 1QP8A 2CVOA 1U2DA 5IZCA 1PGOA 4LRSB 1ZEJA 5KNLA 2AE1A 3DZGA 1DIGA 2Y05A 1T2EA 4WUVA 1RPNA 5L95A 1SC6A 2NVBA 4J1TA 2PKQP 2UUPA 4ZQEA 5EPOA 3WTCA 1ZZEA 2R00A 2ZYAA 1N1EA 2RAFA 1Q1NA 4OXKA 1Q7GA 3NTRA 4O1MA 3PHJA 4XX0A 4YPOA 4OOFA 2W8ZA 3WLEA 3K73O 1EDZA 3FPLA 1PR9A 3ZWVA 1PGQA 3LQFA 4H3VA 1YL5A 3JYQA 2NADA 2QRJA 4IGEA 2F1KA 5B4TA 1T2AA 4QFDA 2VZ0A 3W4KA 1NWHA 3B1KA 4NBWA 3SC4A 3ETGA 2NQ8A 1T26A 2ZTMA 4B8WA 4BNLA 1EUDA 1O0SA 4HFRA 4KDEA 5IDQA 1U3UA 4ALLA 5G0UA 1PL6A 4TRRA 4E6PA 1GTMA 4HXYA 3WXBA 3MJSA 2QHXA 2YUTA 3GVHA 4UVHA 2EW2A 4CM6A 4GSKA 4CLRB 3QWBA 5JFOA 2PA3A 2O3TA 3PPIA 4PCVA 3VH1A 3HNPA 3WX0A 4DIOA 4KQWA 2Y1GA 3I52A 2D8AA 3BAZA 3BHMA 3NUGA 4ESOA 2QYTA 1YB4A 3JQ7A 2BD0A 1WNTA 3HSKA 4DRYA 5G4KB 1K89A 5HA5A 4C4OA 3K5PA 3PZBA 4DC1A 4G2NA 4MOWA 1NX6A 3GHYA 3R6DA 4JBGA 3OJFA 4TVBA 4EITA 3E6AA 4MINA 4PG7A 4JJIA 1XEAA 3DXFA 1G0NA 3BZUA 2Q2WA 3BXXA 1Z75A 2HDHA 1VSVA 4ZRMA 4DIFA 2VYVA 3MOIA 2HCTA 2VOJA 1E7YA 2EEZA 3BIOA 3DTTA 4ZVVA 1YDEA 1GEEA 3CZRA 2BGLA 3RUFA 4CLHA 2A9FA 5C3MA 4DA9A 3DZFA 3U9LA 1Y5RA 1WPQA 2CUKA 5EN4A 4CODB 1TT5A 1OAAA 2AG8A 2PFGA 3V1YA 3ZWNA 3GDFA 4HWKA 5AXAA 2YQ5A 1O89A 4WNCA 4WCDA 1X7GA 1E7QA 2G17A 2VT3A 3PJEA 4E4YA 4NJOA 5A9RA 3KYDB 2EWMA 1ZK0A 3HN2A 4IIVA 4PLTA 1QYWA 2QG4A 3FN4A 3IUSA 1MP0A 2DAPA 3PHIA 1BGVA 3W6UA 5F3RA 4YRDA 5FYDA 3DR3A 2VNAA 4MVJM 4E32A 1I2CA 3RUAA 5GZ1A 4UREA 4G65A 4WLEA 2GUGA 3H3FA 1E1NA 5JE8A 1P33A 3N58A 3WJ7A 2ZKLA 3WTBA 2IYOA 2ZB3A 2GASA 3ZNOA 3RFVA 1H94A 1I32A 1LQUA 2ZYGA 3FPCA 3TFQA 3CUKA 3JQ8B 1AXGA 2OBYA 4F46A 4M54A 5JY6A 1G6KA 2EGHA 5GZ6A 4EZBA 1G1AA 3A4VA 4I9NA 3NGXA 1YWGO 1YOVB 4L0QA 1IPEA 1VLLA 1MFPA 3HE3A 4AJNA 1VL8A 1JKIA 4CV2A 1H2HA 2DQ4A 9LDTA 4BO9A 4PIVA 3KM0A 4AJHA 2UVDA 3HDYA 1Y6JA 4WLOA 1JLLA 4CMIB 1PGPA 1A5ZA 4EBFA 3BTVA 1A9ZA 5IN4A 5KJ6A 3ZHZA 5TT0A 4CM1A 4E0BA 4HFNA 2J3JA 4FB5A 3WBBA 1C1XA 1WDKA 1RYEA 2TMGA 2NU6A 4UUPA 1N8KA 3Q9NA 4YJHA 1ZSVA 4BMNA 2OL4A 5L7WA 4IDAA 4LCJA 4KZPA 3SJ7A 2X6TA 2GCGA 1ISFA 4FFNA 1QKIA 4AJ2A 3VTFA 4H16A 4ZGWA 3PGJA 1SEPA 5HS4A 5IAAA 1LEHA 2O2SA 2V6BA 2VUTA 2NVUB 1Q0HA 3GN2A 2VWHA 1H5QA 1S7CA 4ZICA 5JAZA 1LLDA 3IP1A 1EFLA 2CY0A 1EVYA 1E77A 1Y9AA 3B1FA 2O3JA 1EEHA 1ZK3A 5C7OO 5MDHA 1R66A 3AM3A 3PIIA 2O3QA 1MC5A 2G0TA 2Y93A 2DFDA 4O59O 4BQPA 1UP7A 4BNHA 4OM8A 4EUEA 4XQ9A 3JQ9C 4CQMD 4GLLA 1Q0LA 4CM3A 1YJ8A 2QZZA 3GDGA 4WE3A 2W2KA 4D0SA 1U5AA 3S2EA 2VHVA 3GGPA 4XWYA 3CZMA 1E7MA 2X8LA 4X54A 2PH5A 1ZKMA 4CR6A 1GEGA 3UCFA 4CM5A 3JQBC 5EERA 4YAGA 2I3GA 2AEFA 3ULKA 4O0LA 1GR0A 4Q3EA 1GYQA 2RCYA 1HF3A 2P4QA 2V6MA 4GPD1 4TZKA 3W8FA 4RVHA 4GVLA 3NTOA 3VDRA 1AHHA 4B7UA 1ISMA 1PJ4A 1XU7A 1K5HA 5K0ZA 2FY8A 5EINA 1NR7A 3I83A 4HV4A 3EY4A 3WLFA 4TRNA 1K2WA 1ZW1A 4AJOA 4BNNA 1BDMA 1VKOA 4JCOA 3AOGA 3VC7A 4XR9A 2PV7A 1M6HA 3GC6A 3I4CA 1J0XO 4L74A 2FN7A 3NJ8A 5DOZA 4CMEC 1HDOA 1HYHA 2D2IA 2JFGA 4JJFA 4XYEA 4Y98A 2EF1A 3QLJA 5TGDA 4XCVA 2VRCD 2EGGA 5KJEA 4OSOA 3ZHBA 3MWEB 2OORA 4ZRNA 2BGMA 4MVJH 2GZ1A 4ZQBA 4AFNA 3D4NA 3ONFA 2HK9A 2E49A 1B8PA 3M1LA 3VTZA 3GAFA 4MVJG 1PJBA 3RUEA 5KVQA 2DLDA 1W4ZA 3LT1A 4WASA 4NBUA 1U4OA 4MKZA 4IINA 4N5MA 4AJPA 1KS9A 4CPDA 4FW8A 3G17A 3ZU4A 4XDYA 3ZV4A 1CYDA 2PH3A 1GFSA 2AMFA 3FF4A 3Q2KA 4BO5A 2C20A 2NU7A 1EE2A 2DM6A 1R0SA 5A1TA 3G1UA 4TVOA 1LDMA 3H9UA 1DIBA 3DFZA 4HX5A 3BMNB 2NWQA 5L4NA 1DBVO 1DC5A 2RHCA 2IXBA 2Q1SA 5DF1A 5L4LA 1I8TA 1TI7A 2GGSA 3QSGA 1NQAO 4UUNA 4A26A 1UXGA 3K9QO 4M89A 2Z1NA 1U8XX 1XSEA 2Y1FA 4B4WA 3K2BA 1LSUA 1EFKA 4J7UA 3S2IA 2X4GA 5BNFA 3AI2A 3EYWA 1C1DB 4FFPA 3MOGA 3VZPA 5TX7A 4TKMA 3GNQA 5LDHA 4ND1A 2WTBA 1Z7BA 3SX2A 2J5RA 4J16A 3F3SA 5G0TA 4DC0A 4PZEA 2AA3A 1IZ9A 1PL7A 5JAMA 5BQFA 4OQZA 4WPGA 3FBTA 1UAYA 2UYYA 1NYTA 3WSWA 3OEYA 1U7TA 2D1YA 3MEQA 4KWHA 3IL2A 2ZCUA 4LVUA 3ZNPA 4S3MA 3RIHA 1F8GA 1PS0A 2BMAA 4BO4A 3TOXA 3O4RA 1PZHA 2WM3A 2GRAA 1Y8RB 3F5QA 2VZ9A 1YL7A 4XGIA 5CDSA 1U28A 3UCXA 1R4MB 3SEFA 1PX0A 1R0LA 1GV1A 3LLVA 4K26A 2VRBA 4A73A 2O50A 2GF2A 2UDPA 3L9XA 4QO8A 4EGFA 1RM0A 2E82A 3E5MA 1DC3A 3F1LA 1Z7EA 4MVJD 4Q3CA 2GNAA 2HLPA 1W0CA 2B69A 1XYGA 3F4BA 4CLRA 1XDWA 2EKQA 4BNJA 4LSMA 4XR4A 5A06A 4PRLA 1HZJA 3LC2O 3BTUA 3D64A 3L6EA 4A0SA 3T7CA 4HBGA 4CV0A 2EKLA 2JCVA 2PLAA 5G4KA 1A4UA 3KYCB 4I08A 3RFXA 3H2ZA 1PL8A 1B8UA 2PZKA 1EUZA 1FDVA 1E3IA 4WK6A 2FZEA 2OO5A 3C7DB 3E1KA 1B26A 1DXYA 4J9VA 4IY1A 4OGWA 1CF2O 2B4TO 2DT5A 2FZWA 3PYMA 5KVVA 5I7VA 3KEOA 4W82A 3TNLA 1FJHA 1ORRA 5IDYA 4AICA 1ZUD1 3NEPX 3H5AA 3KSDO 1NFFA 1JVSA 5TIIA 1I3NA 2DBQA 2HUNA 2Y99A 2ZTVA 4RV9A 1YO6A 3RC1A 4L76A 3U4HA 4CM4B 1N2SA 4Z6KA 1JDJA 1UXKA 1NP3A 5TLSA 4GH5A 2GN9A 3DAFA 1B0AA 4FBGA 3D1LA 4FOSA 1GAEO 4IQGA 1UJMA 3UHAA 3WQSB 1UZLA 1N92A 3HB4X 2JD2A 4R9RA 4RVDA 3UICA 2EW8A 2G5CA 2VHYA 3KYDA 5C5IA 2VN8A 1N1GA 4OHUA 3D3EA 1SOVA 2HMSA 2ILTA 2Z1MA 4OKIA 5H83A 1UZNA 4I5FA 1E7WA 2WSBA 5KKCA 3KETA 4TSKA 2FWMX 4CMHA 1E3SA 2Z5LA 8ADHA 1IYZA 1V0JA 4J3FA 4FPXA 1LA2A 5FI5A 3KSZO 5A9SB 2QQ5A 4Y8VA 3WGZA 3JQ8A 1R4NB 3FWNA 1JWAB 2IZZA 1GZ6A 3GHHA 4R1UA 3TN7A 1ISIA 2HK8A 3JYLA 1I3MA 2ZATA 1GYRA 1E5QA 1HLPA 1EVJA 1FMCA 3ZWOA 1HDCA 1LRKA 2J3IA 1FK8A 4LMRA 1KETA 1ID1A 3WGGA 5JC1A 3I9OA 3WYEA 5T8KC 2GZ3A 2WD7B 3BTOA 2WYUA 2EG9A 4DPMA 5COQA 1ADBA 4IMPA 3I3OA 4Z3KA 2SCUA 1GU7A 4I5EA 4CMIA 3LZ6A 2O7QA 4ALIA 3H8VA 3ZWMA 1BXZA 2QX7A 1GADO 2GERA 3I4FA 1YB5A 4FGWA 1R16A 3AUSA 4RQUA 3V1TC 3JQ6A 4AJKA 1O8CA 2X58A 4PLVA 1ZEMA 4RPLA 4MO2A 5JO0A 2OP1A 1ISHA 1QXSA 2IDZA 2X9VA 5TT1A 3SXPA 4TWRA 4CLDA 3JSAA 5KWEA 2AG5A 1AE1A 1XA0A 3ZU2A 4Q3BA 1D8AA 2HJRA 3IJPA 3GUCA 4UULA 3U3XA 3VPFA 3D4OA 4H15A 4E12A 4CLEA 1NPYA 2JHGA 2NVUA 2YYYA 1PEDA 3JQ9A 5TC4A 1BVUA 4OAQA 5DBIA 1HDGO 2BFPA 4IS3A 3DB2A 5CEJA 3EZLA 4L4XA 1ZJYA 4R3NA 3PRJA 3GZNA 1B3RA 2JCYA 1HT0A 1GPJA 3LSYA 1WW8A 3JQBA 4A03A 5JMWA 4IDFA 4DXHA 1WXDA 3GG9A 3PJFA 4GL4A 1YS4A 3ZV6A 2Z95A 1DSSG 3MCVA 3JV7A 3OF2A 1T1SA 2ZK7A 3NDIA 3B6ZA 3PJGA 4WLUA 3JYPA 3NV9A 4UVGA 3OFSA 3E9MA 3QVOA 4B4VA 4BGIA 4CMCA 3CMCO 1X14A 3DOCA 5JY1A 4OQYA 1M76A 1PGNA 1DO8A 2D5AA 2WEKA 3BTSA 3ZCXA 3EZYA 2H63A 5L7TA 1IUKA 2QW8A 3GVPA 4XB2A 4CMEA 1P3DA 1YGYA 4FFRA 1EBFA 1NR1A 1YDWA 4WEOA 1SPXA 1QMGA 4BO6A 3MJTA 4L8VA 2B4RO 2VWGA 2PZMA 3V2GA 5B4VA 1U3WA 4FFLA 2FR1A 3OJLA 4M55A 4OYRA 4RL6A 3SBOA 2NV6A 2B5WA 3W1VA 3EVNA 2I65A 1X1TA 4RGBA 5F5LA 3VDQA 3NRCA 4PG4A 5LCXA 3VZRA 3GMSA 1PZEA 2ZTLA 4IBOA 4BO2A 5L9AA 4QTZA 4D7AA 1P9LA 1M67A 1VRWA 3AJRA 3FNHA 3CIFA 5A4DA 1CQJA 3RFTA 1NFRA 4J4BA 2AQ8A 1N5DA 2YJZA 4KOAA 4DPLA 4YVFA 1HTBA 1K6IA 2YZ7A 3GK3A 4HNHA 5L40A 4IDCA 4XQEA 3WNQA 2NQTA 3BA1A 2GLXA 3RCBA 4YT8A 1I24A 2IRWA 2X1HA 4BKUA 1NVMB 1AXEA 3ICPA 3ADOA 2Q4BA 4HUJA 4E3ZA 4YJGB 5JAIA 2XAAA 2H6EA 3GOHA 4I8XA 3S1LA 3PYXA 1CDOA 2O4CA 1W8DA 4JP2A 2X0NA 4NR0A 3RC2A 2BI7A 1ZJZA 5I8WA 4NQZA 4YR9A 1GQYA 1P44A 3R1IA 2YW9A 3VZSA 4CUJA 3NX4A 2PGJA 4NFSA 1DIRA 4B7CA 4PLCA 3UGKA 1EK6A 2IEDA 3NGLA 3RUIA 3PWZA 3BMNA 2W98A 2VYVD 2IE0A 3JQAB 3G79A 2AE2A 2CDAA 2J8ZA 1UXJA 4QO7A 2P5UA 4PFJA 2DKNA 1R0KA 4I1IA 4RLSA 5JPIA 1RWBA 4CM7A 3ANMA 1ULSA 4BNWA 3DAGA 3ZW9A 3B70A 1XELA 1T24A 3M6IA 1C1DA 1DIAA 4WCFB 1K3TA 2Q1TA 1DIHA 1PU2A 2DPHA 1TXGA 1XQ1A 3H3JA 3PI7A 4Q3DA 4RVUA 3TRIA 5I7EA 5JSFA 4TRMA 4YBZA 4NFHA 3GUYA 1ENOA 5DDIP 4WLVA 5K6AC 4E2YA 2NTVA 4CMAA 4IGFA 1WVGA 4RF4A 4RLHA 1LBEA 3DQPA 4WCFC 1O6ZA 3JD3A 4GWGA 3JQGB 2I5PO 1Y8RA 2JAPA 4BVAA 1EQUA 3DHNA 4KUGA 4M86A 3UCEA 3FNFA 5C37A 5JMPA 3V1UA 1R4MA 5ITVA 3HDJA 4Y6RA 1LUAA 1QV7A 4IS2A 3EC7A 3RWBA 2HAEA 3VVCA 1ISJA 1NHWA 5KKAA 3CEAA 2HU2A 2I76A 4A2CA 3ZWWA 1ENPA 1PJCA 2Y68A 4IJUA 3DZJA 4DPKA 1P1IA 1KVTA 1D4FA 1V35A 3NDJA 1GDHA 3AY6A 3QWFA 3F5SA 4K1LA 4CV1A 1F14A 2JFHA 3Q3CA 3SLKA 4D3FA 4EW6A 2VTDA 3F6YA 2RIRA 4R3WA 5CDYA 5ADHA 1BTOA 1BXGA 2CDBA 3GEMA 1IL0A 1FDTA 1Y9EA 4U8GA 3UFXA 4YDRA 4YT2A 4FQ8A 4YAEA 3KYCA 5I7FA 2X0IA 4I9UA 3ZV3A 5MGBA 4E5MA 4MKRA 4OIMA 4JLWA 1E3WB 2WYVA 3WGTA 1ARZA 3UN1A 4XEHA 4E31A 2D5CA 1KYQA 2YV1A 4DREA 2PWZA 2TMDA 1GUZA 4E30A 1OOEA 1YL6A 1XCBA 2AEJA 2ZTUA 4HKTA 4P22A 4NJMB 2RH4A 1TA4A 3WMXA 3WYBA 5KJFA 3DEYX 3RU7A 3AK4A 3EW7A 1ZFNA 1IY8A 4B3JA 4CM4A 3I9NA 2IZ1A 3M2TA 1P45A 2OXIA 3CTMA 4YYZA 2DBRA 1HDZA 2NSDA 3OJOA 3KV3O 3L9WA 1DHTA 1BXKA 5AXCA 1NHGA 4E2XA 5BNTA 1X7HA 3GQVA 3B1JA 2FMUA 3D3WB 4JJGA 3ADPA 2V6FA 5T67A 3JQEA 5HM8A 4N54A 4PG5A 3ZW8A 3D5QA 1KEPA 4XYBA 3GG2A 1A7AA 3IIEA 1U9JA 5EQFA 2PD4A 3FR7A 2FPGA 3ZNQA 4D44A 1JW9B 5AVOA 4CUZA 3WGQA 3FR8A 5T8KA 1C0PA 5A9SA 3ASUA 3Q0EA 5L45A 4PLYA 1RJWA 2Y0DA 3WGIA 1R4NA 1K6JA 2UUOA 1FF9A 2D59A 2IODA 2ZB8A 4R54A 4FOOA 3GFGA 1IOLA 1V6AA 1LNQA 2C5EA 4UUOA 1T25A 1LQTA 2QYSA 4GX0A 4KMSA 4MJLA 4RF5A 4W7HA 3C1OA 4NK4A 5TJHA 2JAHA 4BKQA 1X0XA 3WJAA 1H9AA 1VL6A 2CMDA 3GMDA 4GX2A 2VOEA 3H9JA 4YXFA 1JQBA 3ITDA 3NDRA 1E1LA 3GEGA 3OSUA 2X5KO 3H9GA 3RASA 4ZJUA 1UXHA 3FSRA 2HMVA 3NKLA 1RKXA 3AUUA 4IXTA 3ZWBA 4Z9FA 3OICA 3FWZA 3KSUA 4QQRA 3WFJA 4DMLA 5KOIA 1QG6A 1SMKA 4HP8A 5G0VA 3QWAA 2QIOA 5IJZA 1L1FA 1KBZA 6ADHA 3NYWA 4IDGA 3JD1A 4RZHA 1YVEI 5ENDA 1VJ1A 2BELA 1E3LA 1YKFA 1HLDA 4BNKA 5F1KA 3P7MA 5THKA 3UUWA 2LDBA 3E5RA 4INAA 2BH9A 4CM9A 2VYNA 3K92A 1HE5A 3HB5X 3C7AA 4I9HA 1T4BA 3DONA 4KDFA 4XYMA 5F1PA 5FI3A 3GRPA 5AYVA 5IZ4A 1DJNA 4IQ8A 1UDCA 1EVIA 3H7AA 4NH4A 4E5YA 3NT4A 4FSHA 3KBOA 3VH4A 2D0IA 3AW9A 4DMMA 1NQOA 5HWSA 1XR3A 3RI3A 5L4SA 1OI7A 1HRDA 3RKRA 1K0UA 4BGUA 1LDYA 1QR6A 3ETEA 1ADFA 3F9IA 4LW8A 4QX6A 4B8ZA 3OIFA 1LJ8A 3U4DA 4PRKA 3AU8A 3RQSA 5T6BA 5KVSA 4R9SA 5TS3A 3OP4A 1YQDA 1DJQA 1GY8A 2ZQZA 3DHYA 4BHTA 1LC0A 3L6DA 3T4EA 1DRWA 1SZJG 1UR5A 5JS6A 4FC6A 1KERA 2AEMA 1I10A 5THQA 2DUUA 3QW2A 1QRRA 1U1IA 2C54A 3DWFA 3P19A 2AHRA 1LSOA 2XF8A 3PYLA 4J1NA 4QUKA 3WICA 5IDWA 5A3VA 4LVCA 3NT2A 3LK7A 5DP2A 3TZ6A 2X5JO 3D0OA 5JO9A 3ROQA 3U49A 4AJIA 2A94A 1ONNA 5ICMA 4MP6A 7MDHA 4GKBA 2DTXA 5AQ1A 2X0JA 3PQFA 1PJLA 1Z73A 5EJ2A 2AQIA 5CDTA 4HFMA 2GO1A 1ONPA 3GGOA 2JHFA 3EK2A 1A7KA 4URFA 3L6OO 2C2YA 1QORA 2O48X 2CZCA 3JD0A 4DLLA 1NWCA 3RJ5A 1SB9A 3VH3A 2E6UX 1JAYA 3QA9A 3OETA 4YJGA 3GVXA 2D3TA 5ER6A 4BGVA 3ENNA 4WGGA 2W90A 3ANNA 1M6WA 1H9BA 2UV8A 4J90A 3RUHA 1LDNA 1ZBQA 4F3YA 5AXDA 4PLPA 1E7RA 1I33A 1XKQA 3QV1A 1KC1A 4OH1A 3E8XA 2DVMA 5LC1A 1WDMA 1U8FO 1JVBA 4CL3A 4AJEA 1NASA 5ILGA 1D1TA 2OOSA 2NU9A 3DBHB 2HSDA 4B79A 1WZIA 3K6JA 3AI1A 4J0FA 1ML3A 3JQAA 3QVTA 5EMHA 4D46A 4O63O 4ZQHA 1ZO8A 2Q3EA 3TL2A 1BRMA 3AOEC 3UKOA 2AQHA 3AUAA 1DB3A 4WEQA 2WDZA 2JCXA 5K6AA 2C7VA 3I5MA 3OJ0A 4OMUA 3TFOA 2O3RA 2R2GA 4JN6B 3RU9A 3WBFA 1VI2A 3WB9A 2G82A 3LF1A 4WCFA 4XDZA 4BNMA 3TZHA 4MVJE 3OM9A 4I5DA 4NBRA 4BNVA 2VHZA 2GDZA 4BB6A 4LISA 4RCVA 4U0KA 3CE6A 4FFOA 1F06A 4YT4A 3WIDA 1GCOA 3ETDA 4K9DA 4MKXA 4XQCA 2UAGA 2Q2VA 1FDUA 3DAPA 3HQ4O 4FJ1A 3PFWO 1HDYA 3HG7A 2PY6A 2YHUA 3IQDB 2ZCVA 1V8BA 4XGNA 1MXFA 3PZRA 4GI2A 4Z0PA 1C0LA 2B83A 4CL8A 1E1KA 4RPHA 5TRTA 3JQGA 3DDNA 3H65A 2J6IA 3I6IA 4KUHA 4IDEA 4B4UA 1YH3A 4RQTA 3H5RA 1LU9A 3GN1A 3BMQB 3ROPA 3AWDA 1IZ0A 1QSGA 1HYGA 1YONA 3GAZA 3A1NA 3RVDA 3VVBA 4E13A 4I5GA 4M8SA 3U5TA 1C0KA 1WDLA 5T64A 5KTKA 4FJ0A 4FGSA 1MGOA 3LYLA 2C59A 1YBVA 1R12A 3IJRA 4XD2A 1HXHA 1PQUA 3V2UA 1XGKA 1KY5A 3RAJA 2R6JA 2NTNA 2ZYDA 1ENZA 3L77A 5F21A 3X2EA 5FF9A 4CQLB 2X9NA 2XPCA 5TNXA 1XIVA 4CLXA 4K6FA 3E48A 2X5OA 2OMEA 3KHUA 4RVGA 2JD0A 2J3KA 4YWJA 2NTJA 3JD2A 3W8DA 4LMPA 3OBBA 4W99A 3LT4A 3JYNA 2GR9A 4ILKA 4FIZA 1H6BA 1KEVA 1VJ0A 3OEWA 3K31A 4DQXA 4E5KA 3I9MA 1E5LA 1QLJA 1DHRA 3IUPA 2H9IA 1BDBA 1UAGA 1P1KA 3I1JA 1E3WA 4JBIA 4NZ9A 1ZVMA 3QJ5A 5DOVA 1VJTA 4TZTA 3P5SA 4K28A 4OL9A 4A5OA 4YJFB 2WE7A 4RZIA 1N7GA 1H6AA 1XWFA 4J9UE 4NJMA 3IC5A 4TMFA 4Z9XA 3PLNA 2JJYA 5G0SA 5JW6A 4A7PA 3EGOA 3E03A 2HKIA 4BO0A 1UDAA 3RBZA 3GLQA 2FR8A 4BNZA 5BSFA 3CXRA 4L73A 2YDXA 2GN8A 4AG3A 2A4KA 1JTVA 4EI2A 3AU9A 4CMKA 3QP9A 2I66A 3WYCA 1IB6A 3QWIA 1CIVA 4RJTA 4K6CA 1EQ2A 2C0CA 3Q6IA 3D3WA 1IHXA 1NPDA 5ES3A 2NU8A 4QXMA 5T57A 5JCJA 1I5RA 4B3HA 2EKPA 1L7DA 1D3AA 1MUUA 3PHLA 2HMUA 3GFBA 4J2OA 1U3TA 3U4CA 1CJCA 4AL4A 5H81A 4ZHSA 4IDBA 3MJEA 1SCUA 1H93A 2E4AA 1NPTO 2I3AA 1AUPA 5DCWA 1MC4A 3IS3A 3SJUA 2BGKA 2EJVA 3QHAA 1J49A 2D4AA 2Y67A 4ID9A 3IMFA 1NBOA 3EUWA 3K8ZA 1KC3A 2DTDA 1EE9A 3KB6A 1YOVA 2FSSA 4Z0HO 2CF5A 1I0ZA 1KVRA 2BI8A 3PVZA 3ZHXA 2CD9A 1I2ZA 2O7SA 3RUCA 4DLAA 3QRWA 3SVTA 4DGSA 2EXXA 3JTMA 4LN1A 1ULUA 3PK0A 1HE4A 2Q1WA 2HRBA 4GKVA 4IIUA 2OZPA 2OP0A 2V6GA 4PG6A 4YRAA 4CV3A 5BSGA 4FFMA 2Q50A 5J23A 4DL9A 4OXNA 4E33A 4KWIA 4XRRA 3FNGA 4DIBA 1PQWA 1I30A 3OIGA 4MP8A 3TQHA 1GUFA 1N9GB 2C07A 1DLIA 1LSJA 4D3SA 3LDHA 4BNTA 4IZHA 4YQYA 4J0EA 2V7PA 3GH3A 2WD8A 2EERA 3GZ4A 5I8ZA 3IOYA 4TRJA 5CHEA 3PWKA 5BT9A 4LK3A 4DWVA 4TKLA 5CPFA 2VHXA 1UDBA 5EIOA 3OMLA 1XG5A 4QT0A 2J3HA 3WIEA 3ZWXA 4RF3A 4YTEA 4BQRA 4F6CA 5TF4A 4N7RA 3L07A 3JCZA 3PLRA 4OJNA 4BS9A 2B4QA 3G0OA 4F6LA 2QZ9A 4U0JA 4N5LA 4WLFA 3CPSA 2PNFA 1LRJA 3PHGA 3VPHA 2YV2A 4IZIA 3WS7A 1LLUA 1F17A 1M2WA 1NTOA 3R3JA 4PVCA 4Y9DA 3VPGA 4ZD6A 1NFQA 5U4QA 2P9GA 2BFAA 4NG5A 2Q1UA 3U4IA 5JDCC 3K2EA 1K6XA 3DZKA 3JQFC 3MWDB 4IXWA 1AGNA 4JXKA 1BMDA 3VHRA 2Y66A 3ZWCA 5GMOA 1VC2A 3KXDA 5A9TA 4EUFA 1Q2XA 4J6FA 3QQPA 2FP4A 4BKPA 3RJ9A 1Z6ZA 1Y7TA 3AI3A 4RVSA 1KEUA 4KUEA 4MVJI 1Q0QA 4XIJA 3WGOA 3GR6A 3INTA 1OFGA 1RM5A 3IAHA 1PSDA 3LT0A 2O3SA 3BMOB 3W4JA 3GF4A 2LDXA 5IXSA 1DFHA 5JDIC 3KUXA 3F1KA 1NAHA 3E9NA 4G81A 2BHLA 3UF0A 4R1SA 3UXYA 1SOWA 3PWSA 1QYDA 3GEDA 4R01A 3H4VA 1MB4A 5CG1A 2G1UA 3FD8A 3NTQA 3TZCA 4R5HA 1NAIA 4PLHA 1TEHA 4DYDA 1YE3A 2EIHA 1JN0A 3HFSA 2NUAA 2ZIZA 4BV9A 1JKJA 5CFZA 3QIVA 1DOHA 5TJ9A 1B7GO 1XQ6A 4RPJA 4EJ0A 1I2BA 3CSDA 4AJ4A 3AUTA 2O3UA 4J4HA 4R51A 3AOEA 2YY7A 4R1TA 2W2LA 2NACA 2PD3A 4PZCA 5BR7A 3H9QA 1T2DA 3GA0A 3JQDA 1MA0A 4GQAA 1P1RA 2IEBA 3FNEA 4NBTA 3DBHA 4YACA 2GYYA 3HN7A 2V65A 1ENYA 4P8RA 4JBHA 1HWYA 4RDIA 3PQDA 1YQGA 1Z74A 3O8QB 1Y5MA 1E1MA 3O26A 2PR2A 4QEDA 4UEKA 1ONOA 4U6SA 5K9ZA 3LT2A 4W9NC 2P68A 5JLAA 3RD5A 3EVTA 1J4AA 2CFCA 4ZQFA 5CP8A 4ONEA 5JXWA 2OGUA 2HRZA 5COAA 4H7PA 1DEHA 1HDXA 3SC6A 1CRWG 3TJRA 3V2HA 1E92A 1ZXLA 4W4TA 3AM5A 4XZ3A 3ZHYA 1NQTA 2Q2QA 1NNUA 4BB5A 2E48A 5DCUA 4J1QA 1HKUA 5CPBA 2Y1DA 3DBVO 2J5QA 3CKYA 4YRBA 2PKRA 4CQMB 1VPDA 4U5QA 4HADA 3WWZA 5LDGA 4PZDA 3ZDFA 4FC7A 4RO0A 4RPGA 3KTDA 2JKVA 4CLOB 4GAEA 2VNSA 4ND4A 3S2GA 1M75A 4GBJA 1A72A 5CDGA 1AHIA 3RBXA 3PTZA 1QLHA 1HYEA 5KVCA 3BYZA 2YQ4A 2ZB4A 3DZHA 3KLMX 1Y1PA 3ZWAA 3BMQA 4D42A 2I67A 4OSPA 3GGGA 3OH8A 2WJPA 4R5MA 4BMVA 4BV8A 2XXBA 2VUSA 2ZJ1A 3DZIA 4DBZA 1PJSA 1E3JA 3INGA 2PZLA 4IJKA 4BOYA 4BO1A 4B3IA 4A10A 4CMJA 3LF2A 1ZK1A 2OUIA 1HSOA 1PGJA 2IYPA 3WMWA 3F4LA 4CQLA 3QVXA 1LSSA 4II3A 4II2A 3COSA 1PZFA 2C2XA 1Y81A 4E2ZA 1PTJA 2DTEA 3C1TA 1P0CA 3CH6A 4FS3A 4D3DA 1QYCA 2Y0CA 3E9QA 3GY0A 1FXSA 3KZVA 4E2WA 3IP3A 3C1AA 5AXBA 1PQPA 2ET6A 4PLWA 3ZWYA 1SBYA 3LC7O 3DBLB 1UZMA 4EEZA 4JROA 3QE3A 4JGBA 3UAGA 5EL0A 2HO5A 4BNGA 4EDFA 2QRKA 1JAXA 4DQVA 2P2SA 1F8FA 2EP7A 3Q11A 4TQGA 1P1HA 3OA0A 3C7CB 2X86A 4RVFA 5DT9A 5DULA 4CM9D 4YJFA 2VYND 4D45A 1Z45A 3BMCB 5B37A 2VQ3A 4J49A 1U4SA 2CVZA 4R1NA 2DPGA 1ZK4A 3HHPA 3W4IA 3BHJA 5IFLA 5FFFA 3MJVA 5CAEA 3ZZNA 4YB8A 2FRDA 3RSHA 4NNJA 4PLGA 1IHYA 1I01A 1BW9B 6LDHA 3PFFA 1GPDG 3Q2IA 3JQCA 4BMSA 5L3ZA 2B35A 4NBVA 4UEOA 4EEXA 5JNLA 3NAQA 3QY9A 1C14A 4LRTB 4Q39A 3WGYA 2CDCA 4F45A 4ZN6A 1V9LA 4FDAA 1ZMTA 2DUWA 4DYVA 3OA2A 4YAIA 1W6UA 1HZZA 3R3SA 5HS6A 3PEFA 5ILOA 4JQCA 4NIMA 1LI4A 2NM0A 2WYWA 1KOLA 1ADCA 4M87A 4D0RA 3G49A 4L4SA 4Y6SA 4XYLA 5GZ3A 1LDBA 3TDKA 4R68A 1W73A 2I99A 3TF5A 1MG5A 3MZ0A 5CDUA 4FD3A 1F12A 1TLTA 1B3BA 1ZNQO 3KEQA 5G4LA 2YDYA 2F00A 4FN4A 4IJWA 1WAMA 3AFNA 5A5FA 1J6UA 1DLJA 1VL0A 4Z0TA 1E7SA 3ORFA 3VZQA 3ZGYA 1DAOA 2Q49A 1EMDA 4QSMA 2WD7A 1VM6A 3C3XA 2ZQYA 4KTTE 5BSHA 1RM3A 5JYDA 1UP4A 3C24A 1LRLA 1TVEA 2X22A 1OC2A 3V5NA 1UP6A 3GVIA 3PDJA 5A03A 1X1EA 2B36A 1HETA 1PJTA 2HJSA 3S8MA 1KIFA 2Y1EA 1HL3A 5TQVA 1N9GA 4MVJP 3WWYA 3O38A 1IPFA 1LX6A 3R0IA 5GY7A 3ICCA 5T5QA 3PIDA 3KRTA 3ONEA 1U2GA 4EJ6A 2P4HX 4BNIA 3H9EO 3IKTA 3P2YA 1PJ3A 4BIIA 3ZN2A 4XB1A 4R4JA 2X9GA 3AFMA 4BNYA 2GPTA 1JA9A 2P5YA 2H1SA 4GX1A 3DTYA 4CM8B 3JQAD 1DDOA 3A06A 4Y67A 4IM7A 5U9CA 4JNKA 4RORA 2X23A 1E6EA 5B4UA 4AJLA 5JDCA 3JQFA 3VKUA 4LSWA 3ON5A 2BF7A 2HMWA 2CSUA 4ND2A 3PJDA 3GNTA 1BHSA 5CEFA 3PHHA 4OO3A 1QYXA 4ITUA 3GZNB 1E3EA 3RBVA 1Y8QB 3T7EA 1HDRA 3NT5A 3G1TA 3KYBA 4EUHA 1P1JA 2ZB7A 1X15A 1Z82A 4WLNA 1WP4A 3DBRB 4FCCA 2P9CA 3C85A 4PN3A 3QVWA 4IMRA 3DC2A 2NNLD 1ISGA 1PJ2A 1KVQA 2DBZA 4MVJF 4WJZA 4XA8A 3L0DA 5JDIA 4UUMA 4EJMA 3OQ1A 4D43A 3OQ6A 2G76A 2DBVO 1SB8A 5ER9A 3INRA 4NI5A 2JFFA 4PVDA 2DU8A 1TB4A 2DFVA 1U7HA 4G5HA 4NMHA 1A27A 3WNVA 5ITWA 1LLCA 2Q46A 2AQKA 1O95A 2C5AA 3BMOA 4NFYA 1DPGA 4Q3AA 5H82A 5IG2A 2J5KA 2RH8A 4UVDA 1LTHR 3M2PA 3ST7A 1GV0A 1LXCA 3F46A 3O9ZA 4BKOA 5B1YA 3DMTC 1VSUA 2WE8A 4NU6A 2FHSA 4Q3NA 2I6TA 3MJ4A 4CMBA 4P38A 2W4QA 2IXAA 5B12A 3OQBA 3PXXA 3TL3A 1I3LA 5FWNA 5U1PA 3I23A 3U62A 1E6UA 1GQ2A 5C7LO 2VWPA 3ZH2A 3LC1O 1KEWA 4GMGA 4MPDA 5DP1A 2O23A 1S6YA 5A02A 3LLSA 1PR3A 4GGPA 4ALMA 2FR0A 2GD1O 9LDBA 1KVUA 4MIYA 1GZ3A 5A04A 2VHWA 1BWSA 1T2CA 2AXQA 5EQDA 2FPPA 5TSDA 1SO8A 4W9NA 4PG8A 3N7UA 3N74A 5I9LA 3D4PA 1O94A 1HE3A 4ALJA 3SLGA 1U3VA 4XJSA 2OHXA 4BUCA 1LC3A 4MIOA 5AOVA 1ZIDA 4C7KA 1LDEA 1G0OA 3H5NA 3O8QA 4J7CA 2BLLA 4DLBA 1P77A 4LCEA 4CJXA 4NHEA 4A27A 4O5OA 4RF2A 1ZSYA 4UVIA 5FEUA 1GL3A 5DNAA 3S2FA 4E5PA 1DRUA 4P4NA 1QV6A 8LDHA 1EK5A 4J91A 3HZZA 5IN5A 3WG9A 1PWXA 1NQ5A 2BKAA 2O4UX 1H2BA 4MIEA 5DZSA 3DOOA 2VTEA 1P31A 5JC8A 4MDHA 1V3UA 4R41A 3JD4A 1TT7A 4XRGA 2VCYA 1OBFO 1B15A 2OBNA 3PQEA 5JCJD 2DC1A 4CQMA 2YHIB 4BNFA 2HMTA 4UVEA 3DO5A 3RC7A 2PK3A 3GPDG 3FHLA 1ZXBA 3NJ4A 1CEQA 3KOUA 3H6KA 4CLOA 1SNYA 1ZCJA 1YRLA 2HK7A 5IXYA 1I36A 3ZU5A 4GVXA 4B7XA 3WQRA 4PLZA 3L4BC 2GN6A 5IZCC 3LVFO 4IDDA 5KCZA 3ABIA 3DHEA 3MJCA 4Z3DA 4ZA2A 1NVGA 3UVEA 1X7DA 2VT2A 4PGFA 4RPKA 4EYEA 4XJTA 2R00C 5KJ1A 4AJJA 1GZ4A 4OOEA 1GQQA 3RUDA 1E6WA 1H0KA 1MV8A 3VOSA 2EHDA 1ZSNA 3UH1A 3ANLA 1UUFA 4J43A 5KJCA 1X0VA 2VRCA 1XU9A 4W6ZA 1CERA 2PD6A 1MFZA 3FI9A 1WLYA 4M1QA 1FDSA 2RHRA 4N5NA 4O6VA 1XHLA 3DBLA 3MTGA 1EDOA 2O2YA 2P9EA 1R37A 3ITKA 4XQGA 1NM5A 4WOKA 3JQ7B 2A92A 1BXGB 2NVWA 1EBUA 3IDSA 4ROSA 2X7HA 3UW3A 5DN9A 4BO3A 1ADGA 2E37A 2AW5A 3OJEA 3D7LA 1RM4A 3BMCA 4YA6A 4OKNA 3E18A 4N18A 3O03A 1IE3A 1B8VA 1U5CA 2C7GA 7ADHA 1GUYA 3K96A 4ALNA 3B20A 3FTNA 1PWZA 3HUDA 5A05A 4U7WA 2CF6A 1BW9A 3WDSA 1I3KA 4QECA 1C3VA 4M49A 1H6CA 1PIWA 3FBGA 1RYDA 4WOJA 1PS8A 1DFGA 4C7JA 3U09A 1CETA 2GSDA 3DFUA 1LLQA 3M1AA 2Y1CA 3EDMA 3OIDA 5I9MA 3TPCA 4W7IA 1P1FA 3VKVA 1TT5B 4Z9YA 3P2OA 3T4XA 1T1RA 4XGKA 2XXJA
chains in the Genus database with same CATH superfamily
3ZIAA 1SAYA 5DU2A 3T9AA 1GSAA 1XLTA 2RC5A 4BNXA 4QGSA 1YTUA 3ASZA 1QTNA 4V38A 1DJMA 3RROA 3L0BA 2AOTA 4B82A 4CR8A 2NO7A 2FW7A 1USGA 1RC0A 3H2SA 5LP6C 4ZU3A 4FP9A 1EFRD 1BCRA 2RAPA 4RGQA 4GZ5A 1RMYA 4X93A 4BO8A 5I7SA 4MX8A 1H05A 1NE7A 5KPDA 2PZEA 2W4MA 2WMDA 1M2FA 2FQWA 4X7RA 2DMRA 2C3UA 3MOSA 4HFJA 3N2ZB 3H8SA 2GFQA 4G0XA 1U9ZA 5E1OA 2RHJA 4HQKA 1QP4A 2AR0A 4IG4A 4PNHA 2DB3A 1JDTA 2VUUA 1FFSA 1MT0A 1XTBA 3KVOA 4S1VA 1BQ4A 4QUEA 5K2MA 4UDYX 3WK7A 2UZ1A 4D1YA 4NPCA 1CWUA 1NQVA 3W2FA 3WJ1A 1P7CA 1WKCA 3DZBA 5E3IA 3UC9A 1YBHA 2IY9A 1FYVA 1EWYA 2EJTA 2C2KA 4WKCA 5ENVA 4EPYA 3CZ4A 3B1VA 4B84A 4U4AA 1SGWA 3RNLA 2XOXA 3HADA 1MLDA 4M46A 2YWGA 1HT2E 3DVLA 4IRXA 3NO4A 5JNTA 2XNCA 2QRLA 3OT1B 3PP8A 5JJBA 2YINC 5LP6F 1UPXA 4REOA 1CQZA 1M1NA 1J5PA 4J1SA 4RKFA 3SOZA 4Z3OA 3CKMA 2NYRA 4NK5A 4NNOA 1R8JA 4DRXB 3MHTA 3I9LA 4C5BA 1Q19A 3DHVA 1OX4B 3IMCA 5KINB 2PBLA 2BGNA 5G2OA 1L7EA 4HAXA 1A5TA 1YJQA 4R9NA 3RSCA 5CLFA 3VR4A 1OA0A 3AZPA 1R15A 1YQQA 2H2AA 1M66A 2BGGA 1NLZA 1T3GA 3FCSB 4XI9A 3Q8KA 3A28A 1R27A 2NU6B 2IZ0A 3R4CA 1HEUA 4IUYA 4AUNA 4US2R 1FVFA 1XKXA 4CCAA 1ECBA 4L6AA 5EMJA 3AIKA 2ZRDA 1GYPA 4QATA 4CMGA 1BOFA 2CD7A 1VYHA 5DLDA 5L3SB 3GLGE 2IJGX 1COWA 4JLAA 1KTVA 5LOVB 4JQOA 3WXMA 1N2JA 1MORA 3NH6A 5JYEA 1QU2A 1T8WA 2GZ2A 4GUAA 5TQ0B 1A82A 1G59A 1SIWA 5KNDH 3PF9A 3GGDA 5F23A 4HNTA 1QHYA 2V98A 3Q7SA 4MCHA 2F62A 1B4DA 2WW8A 3ECAA 4WVFA 4E70A 2Q4EA 1QPBA 1NVTA 2BEUA 2I4OA 4XVQA 1NNEA 1RWNA 1WUYA 1J70A 1E1QD 3BJZA 1I80A 1U6KA 1JI0A 2FPMA 1Z2AA 4PAOA 2E18A 2G9QA 4QRIA 1NW7A 4FHEA 2X19A 4AJ1A 1FDWA 4Q7JB 5A1JA 1NG9A 2HJHA 5CGQB 1X7WA 5DV9A 2PKCA 1G8GA 4G09A 3MBOA 2YFHA 3JTEA 1WW3A 3ZV5A 1Z4OA 4BFYA 5L7YA 3DOFA 3S55A 3IT0A 5IVIA 1INLA 3KQTA 5KTPA 3D3QA 1QHNA 2GK6A 1EZ4A 4GM4A 1E0AA 2OK8A 4C01A 1WMBA 5DM4A 4ZKEA 1J22A 3IQGX 2NGRA 1W5FA 1BG6A 3DEJA 2B7BA 2QXYA 1MJNA 2XDQA 1BROA 4BJHB 5CB0A 5H1YA 1D4OA 1WMAA 4MQ6A 1KI8A 1XRNA 2HQ1A 3IKVA 4R83A 2H7YA 3VPSA 1Z17A 3PE6A 2XZOA 1W52X 4P4GA 1AKNA 1SKAA 2P91A 2Z2ZA 5DCYA 3ROKA 2PGDA 1SZCA 1EX1A 4FKMA 4RD1A 1YBMA 3WGHA 5KCMA 1ABBA 2NUPA 1DS6A 2QY9A 5B7PA 1PV2A 4BJ6A 5D85A 3UV6A 2POQX 4IPTA 3BSSA 2IHBA 3AR9A 2GBLA 3CWCA 4V0NA 3ZVRA 1ZH8A 1YJCA 2ZJ0A 2CFTA 3LWZA 4HJRA 4PLFA 1IULA 4B4OA 3HI6A 4QGHA 4G5XA 3W2IA 4DIMA 4MR7B 3CZAA 1NQWA 3A4TA 2GF9A 1A9YA 4CDNA 1G64A 4OIFA 1BO6A 2QR5A 1GCUA 3H75A 5D1NA 1UANA 5T3YA 4LGYA 1CCWA 4GX5A 2JD1A 3LYHA 5EGSA 3W5JA 5HZKA 2CVQA 3OZFA 2FYTA 3IGFA 4ZANA 5E8RA 5JD5A 2O8BA 2FSVA 3ZX4A 2OV6A 2YWCA 2AX4A 2RFLA 3W8EA 1KQPA 3LY9A 3DE6X 4UZSA 2ZIXA 3BH6A 5AHWA 4IVPA 1RLIA 3O1HB 2YV3A 1RTTA 4FFWA 1KYWA 5CDFE 1QO0D 1Z4KA 3EWIA 5CK4A 3UMJA 2OHOA 4KQ6A 2K2QB 3I9FA 5J63A 5IAKA 2OCGA 3DOJA 4HK4A 1G4UR 2VZ8A 1KNQA 3BZBA 3O73A 2B2XA 4QJ3A 1QYRA 1QX3A 2PIDA 4OBBA 2Z9BA 1EFVA 4P80A 3IAFA 2GS9A 3L84A 4QIHA 4GGOA 2VK4A 4KN8A 3V8EA 3WK4A 1IAQA 5FI1B 1S96A 2QSUA 4NQRA 4RQAA 3AY3A 4YHBA 4KQIA 3TO5A 3I6QA 4XVUA 2O5VA 3QVSA 1WF3A 4XYGA 1OHHD 4HAZA 4EFNA 3S68A 4LX0A 2GBFA 4MGYR 2XMQA 5EJ8A 2NP7A 1GVHA 5FLKA 2PZJA 1Y6QA 1ZMOA 3H0EA 1GUBA 3EMKA 2A78A 2YYZA 4AQDA 3RJZA 3FHOA 3EFEA 4ZEVA 1E6CA 1HLGA 3OWOA 4BFZA 2CXQA 2A35A 1OBVA 2OFPA 2I1VB 2XCSB 3NOOA 2HF7A 3WKEA 3GRAA 1DG3A 4X95A 3DWEX 3CB4A 1Y5LA 2IUTA 3PQ4A 4B33A 2YRXA 1CF4A 3R0XA 3PSAA 3VR0A 1E69A 3KZNA 2BR3A 1U2DA 3GRRA 4DV3B 3V4RA 2VBFA 1JSLA 1W2GA 1IQ0A 4LOIA 4CDMA 2AF3C 2HREA 2E5WA 1IZ8A 5EPOA 2UUPA 3NUZA 2R8YA 2WM9B 2ZS7A 2QPTA 4M37A 2R00A 4EVQA 3CUYA 3IP5A 3PRHA 2I2WA 2RAFA 1Q7GA 1JQLB 4XVCA 3H2IA 4S1OA 3C7KA 5BRNA 1UQUA 1XTRA 1OSNA 2Q4RA 4K46A 1E2GA 3FPLA 3THXB 1POWA 4JA0A 3ZWVA 3DFKA 4LYGA 2OZLB 2PKWA 2XRMA 4JBYA 1XEFA 4RFSA 1T5HX 4E3WA 2FN9A 2QRJA 2P3QA 5REQB 2AWNA 3Q3JB 2I2XB 4QFDA 1ZGJA 1OROA 3VDMA 1XNGA 4GZ3A 3ONNA 4G5OA 4XVRA 1FU8A 5UKDA 3SC4A 5DEOA 5ALMA 3K0AB 1P8AA 1OI4A 4BNLA 1UFRA 3RYHB 1EP3B 1EWRA 2XWBF 2YRWA 4HFRA 4MQUA 4FKBA 5DT2A 5EEGA 4B3BA 4ALLA 1YZHA 4REQB 2QTNA 4MMYB 1JTFA 4LV8B 1M10A 3N05A 1IUOA 1FVOA 2B4KA 4Y2XA 3MJSA 3RRJA 3WXBA 1HBJA 1AQLA 2JEZA 4PCAA 4LZPA 2EW2A 2R7KA 2G0NA 2I6QA 3A3KA 3QWBA 4CLRB 2PA3A 3JAKB 4INPA 3ER9A 1RC1A 3VH1A 3E61A 3HNPA 5EJ6A 5JLJA 1V48A 2BFEB 3ZLBA 2WHPB 5C1PA 3DCJA 1WZNA 3BAZA 3BHMA 3PFIA 4QUAA 2G63A 3BGOS 3EH1A 4O4HF 3DLCA 2EWWA 1YB4A 3KPYA 3EVFA 2H9AA 3UT6A 5K0BA 1JQ5A 3HSKA 4OHWA 4WBSA 5JS8A 1CE8B 2XSZD 5HA5A 5IH3A 5IYZA 2O0LA 5HUJA 3GHYA 3NM5A 3VR5H 1PG0A 4GIBA 4Q21A 4JT8A 5AUNB 1W2WB 4MINA 1CY1A 2R5FA 3R23A 4PG7A 4P32A 1E5VA 5FPSA 3TNYA 3UUEA 4JA2A 1XEAA 4HF7A 1SBQA 2Y9MB 4DV4B 4D26A 1G0NA 1YDHA 2ACVA 3RNOA 3C3JA 2ZE7A 4H0CA 1YR1A 1Z75A 1VJ5A 3HZRA 4MYTA 4ZRMA 1TL7C 2H4YA 4KO4S 5E4FA 1PT7A 3FPBA 3MOIA 1MAVA 3PE4A 3QFFA 4X24A 4YS6A 3UUGA 3OX3A 1N9KA 1OIVA 2RI0A 2VL7A 4BLRA 4B3SB 3DTTA 3BCRA 3V4LA 2ZJ8A 3L04A 3T7AA 3WBJA 4EG5A 4CLHA 2IUYA 3Q3VA 3IEXA 3L5OA 2XEXA 3ZJYA 1DKPA 2XJ4A 1OKKD 5C3MA 3WGMA 1A9XB 2WA1A 3K0BA 4AF6A 5FCDA 4DQDA 4M0MA 1TJYA 1VKHA 3NRBA 1YS1X 3NR2A 3ZBPA 1D2NA 2GEBA 1OXBB 4ZFNA 2JHPA 1KO4A 4LWOA 3OJXA 5EZ5A 2RONA 1BE6A 4MW4A 2PFGA 3ZWNA 2RJOA 3WLMA 1ZCAA 3MD9A 4QXOA 5CJPA 4MVYA 4QEKA 1O89A 3EARA 3MINA 4S0ZA 4IV0A 4CNQA 4ZZ0A 4Z4FA 5BSRA 4E22A 3PJEA 3U7FB 4MLDA 4NJOA 1FP4A 1JPUA 3KT6A 4ZQEA 2EWMA 1ZK0A 3HN2A 4IIVA 3QE0A 2FWPA 3W6UA 4CIBA 1YR7A 5EHGA 1H85A 4N01A 5FYDA 1SXJC 1YR8A 2VNAA 3AP3A 2APJA 2BGRA 3WQBA 4E5VA 1VPWA 2ZZMA 1IBCA 3SE7A 1WRBA 1QTRA 2D74A 2ZEJA 5JE8A 3WJ7A 1KSFX 1ND6A 2ZKLA 3C14C 2PRSA 4ZT7A 3WTBA 1PJ8A 2Q9BA 5LNK6 2WAXA 4FBLA 4TN1A 3W5VA 1LQUA 2VP0A 2VCEA 3VX3A 1T8YA 1Z63A 1SXQA 1G6KA 2EGHA 5JNUA 4HEJA 4RJJA 2Z6VA 2F64A 1A5SB 1YWGO 3SU8A 5LD2B 4DCTA 5F12A 4ZVTA 2H52A 4OL0A 1V26A 2A57A 1JKIA 4HDSB 2DQ4A 3U6BA 5J5CA 4I4TB 3MFYA 3DO8A 3EGDA 1II0A 1Z5ZA 3I5YA 4F11A 1Y6JA 3AHDA 4RWEA 4EFMA 3F3YA 4KIWA 4RE6A 1LFAA 3AGPA 1PGPA 3JVUA 4KGXA 3O84A 4WI1A 2IYFA 1YRQA 1IMJA 1VMDA 4Q19A 1BJRE 2GNPA 3WC4A 1QG2A 2O2XA 5TT0A 1L5OA 2J3JA 4CRWB 3WBBA 2D5IA 4JITA 4C7VA 1CQXA 1YMQA 2NQ2C 1QZXA 1ZLXA 3LUBA 3LBFA 3PL5A 3R7WB 3RTAA 3WA7A 4YJHA 5EFOA 4C4AA 2IHJA 4P5DA 1RQ2A 4BMNA 2OL4A 4R98A 4R1QA 1KDRA 3E9EA 2FEPA 2P1DA 4KZPA 3SJ7A 4FTWA 1YE5A 1PK9A 4IXDA 4ND6A 5TS2A 2HA5A 2HA3A 4ZGWA 5IUKC 5K4HA 1SEPA 1WUTA 3LPDA 4KITB 5DYTA 5HS4A 3H1EA 3QEAZ 1EJ0A 2PUHA 3SSNA 4HRAA 2O2SA 2V6BA 2ASEA 2VUTA 3G2KA 3L0IB 3MRVA 4LF9B 1G6HA 3UHJA 3M6VA 2XRYA 2ID7A 1O7JA 3HJNA 4FCTA 1K1EA 1YKSA 2WIKA 4IMIB 2C5FA 3DYVA 4F2HA 5D86A 3GLIB 2O3JA 3IQZA 2WYIA 3SK0A 5IVKA 3V7NA 4DAEA 1XRPA 2AFIE 2ZRNA 1ORHA 1KJWA 2G0TA 1BS9A 3LUFA 2Y93A 4O2BA 2AD1A 4O59O 4JU9A 2P0YA 1FPMA 2PWBA 2H4FA 2PUVA 4HB3A 4KXFB 4FZ3A 5EE1A 4CQMD 5MFZA 1H42A 1O08A 4F4UA 3PD0A 3CW9A 3B38A 4QJBA 4D0SA 4GECA 5CDHA 3E81A 5DGIA 3AKZA 1ACJA 4J0JA 4P7FA 4CEHB 1QVVA 4MS1A 2GJSA 5FUYA 5FWYB 3PPWA 1P4HA 5EFZA 1HFWA 1Z5NA 4DLWA 1NJ5A 1QH1B 3RK0A 4EELA 2AEFA 1NBIA 4B0PA 4JL6A 3RYFB 2HN9A 2G1JA 2XUOA 4EKYA 3HYSA 5IPFA 4H77A 4HCJA 2WWFA 2PUTA 2P4QA 3QFCA 4NBNA 3RTBA 2IX9A 4TZKA 4C2BA 3AJ9A 3FRHA 1H3FA 1UBUS 4RA9A 1WOMA 2CEKA 1KZGB 3HB0A 5EHIA 3TLEA 3W1WA 5KTSA 1PJ4A 1XCOA 2ZBRA 1XU7A 3EWNA 3WP1B 3FYTA 3I83A 4FFSA 4WZAE 1ZW1A 1GKLA 1V4VA 4O3MA 3UBMA 1BDMA 1VKOA 3FDIA 4JCOA 1CUVA 4BVLA 4OF4A 1ICIA 5ETJA 5CCDA 1CY8A 3GC6A 2VATA 3I4CA 2VQFB 5E6UB 1P2GA 2A5YB 4JJFA 4JWKA 2YJGA 5TGDA 2C9MA 4DUGD 4UHBA 1GN9A 4EUNA 4I4CA 4LCBA 3GPBA 1ODCA 5CB8A 2PPVA 4GXNA 2OCPA 4KXWA 1VHLA 3V1LA 1U1EA 2HK9A 3V33A 2E49A 2FLVA 5KX5B 1ISRA 3M1LA 1QS0A 3VTZA 3Q9SA 2J0SA 4WERA 1ULTA 5CIYA 2XX3A 4ZXPA 4IINA 2ADMA 4N5MA 5FTNA 1ECPA 2QE7D 1BH2A 4DA8A 1D4ZA 1AMNA 3EQ2A 2FXVA 4XDYA 4D0NA 1J0EA 3BVPA 4TL8A 2NU7A 4ZVMA 2XKAA 5ANRB 1FJGB 2KBEA 1WHSA 4L7QA 4LXTA 2J41A 4YQFA 1JZQA 1XHEA 3G1UA 3K2QA 4H7FA 4TVOA 3U7EB 3FOEC 4HZUB 1DIBA 2AKEA 4H6VA 3R3ZA 1DC7A 3FW1A 3FPHA 1H1DA 3MIZA 3A31A 4POOA 2RGWA 5L4LA 3ZE6A 2XT6A 4TV9B 4FM9A 3ERCA 3K9QO 1BDJA 3IDQA 4M89A 5IMSA 5SYMA 2P41A 4PO9A 1U8XX 3MXTA 3OE4A 1T9GS 1XTSA 5ESXA 4C08A 4B4WA 3GFFA 3AP2A 3R0JA 4TYWA 5SY6A 3A6DA 3M33A 4CW7A 1PW7A 1DQSA 4B2YA 2YBEA 4FWIB 2VNKA 4IP0A 3AI2A 3KTAB 4JJAA 4BMYA 1EVLA 5LIRA 3KEMA 1IBLB 1L1RA 2LR0A 1Q2UA 4YLEA 3KQNA 1YRAA 3WE7A 2QJRA 3LQ4A 1SKQA 2P3LA 3HKBB 1RYHA 1R9GA 3HR8A 3IBSA 4RU1A 4TKMA 2A14A 5JQGF 5LDHA 1F0NA 1PN3A 1G3UA 1NC3A 2ZSIA 4KSBA 4Q4LA 1PL0A 1Z7BA 2VSNA 2BFFA 2H2DA 3EQZA 3KZ1E 4HTFB 4J16A 2CK3D 3NIWA 1F0KA 3F3SA 4IYRA 5G0TA 4PZEA 2A1UA 4LDJA 3T9FA 2AA3A 2ALJA 3NWJA 2WIDA 2I1LA 2EYUA 4Q03A 1ORTA 1YCFA 3AR6A 3WSWA 3MEQA 1JE1A 1U5BB 5KTRA 2ONCA 4C04A 4LVUA 4W5WA 1C7RA 4RC9A 4HGNA 4H7KA 4BO4A 3TOXA 2PAAA 1PZHA 1R0RE 2QT1A 3D8BA 2QROA 3JZAA 1M1XB 2BJWA 3OIYA 5HZHA 3F5QA 2ZUTA 2VZ9A 4DE5A 1YL7A 2GEDA 4XGIA 1U28A 2J9FA 3S3TA 1NVVR 4YMIA 3SEFA 2RGYA 3OOWA 4ISCA 1GV1A 2ZR8A 2IV2X 4RMNA 3LY5A 1W4RA 2AZ4A 5EWMA 4A73A 2H5EA 2GF2A 4GL2A 3GZJA 3VUEA 5J2UA 3HLTA 2FWAA 2C7OA 5FBVB 3M6FA 3HYRA 4OLJA 1QR2A 3LFHA 2Q29A 4EHJA 3X1DA 4TTRA 3PL1A 2HC9A 4XE5A 1Z8HA 1JDBC 2P8SA 2GRUA 3QG1A 2J3MA 4M60A 4MSUA 4Q3CA 5D1HA 4DARA 721PA 1W0CA 4ZEWA 1Z9BA 1L5LA 3SBXA 1XDWA 2SKCA 2V3CC 3MK31 4X8MA 1R18A 2EQ5A 4HNQA 1HZJA 4RS3A 4I3FA 2ORWA 4JYCA 1ONBA 3LBAA 3MS4A 4KB5A 4QQKA 5DLEA 2ECPA 3CX3A 2WJ6A 3GUZA 4A0SA 1D07A 1ZLYA 2PRJA 1X8JA 5EP3A 1PSZA 4HBGA 2XQIA 3T7CA 3TNDA 3VAAA 3B78A 3OCJA 1V7QA 2EKLA 2JCVA 2XBMA 3CSUA 2CJWA 3EFHA 3EXEB 1Q21A 4P2GA 4A6XA 3L93A 4DR4B 1XEXB 4L85A 3RFXA 2Q5OA 1EUZA 4BXOA 1KJYA 1Z2PX 2OO5A 2PSFA 1J0AA 1CKEA 1URPA 3K7EA 4U7GA 1I7SB 1DXYA 1LK7A 2ID4A 3OTOB 4IY1A 1P5RA 2C8LA 3FCXA 4HB0A 4OGWA 3TKYA 1BD4A 1CF2O 2B4TO 2FZWA 2XR1A 3JARB 4LJ5A 3HKCB 5I7VA 4W82A 1HFJA 1FJHA 2ICAA 2CXHA 5IDYA 2YHAA 4N5IX 3BJEA 2ZVJA 3V8VA 3BCSA 3NEPX 4YGXB 1V11A 4O3FA 4YLYA 1RQRA 1C4WA 4DIEA 5TIIA 4HWGA 4UDXX 4GLJA 4A0HA 1PUIA 4RV9A 1RVV1 1ADYA 1ZMXA 2VHEA 3PCXA 3BK7A 2IY7A 3GRYA 3JQQA 3R6GA 4BLSA 2BUBA 3O91A 3ZCRA 4B3TB 1NP3A 1AKYA 4N1AA 3MLAA 4DR2B 4PZPA 4OHXA 2RD2A 3O74A 3HBFA 3W9YA 2WIBA 3MS7A 3PNBA 1L7AA 3IPLA 3DAYA 3UHAA 2EL9A 2XUHA 3KAJA 3WQSB 3DCYA 1NN0A 1UZLA 1N92A 3HA3A 3HB4X 2JD2A 1ORDA 2V03A 3SSMA 5HUQA 2G5CA 2L42A 2REQA 3RS2A 4L9SA 5C5IA 3ADKA 2IVZA 2VN8A 2ZRQA 5BPFA 4D4JA 2ZWOA 2X3YA 4Z4EA 1FE8A 4OHUA 4AS1A 4ETWA 2ZREA 1A5AB 3QX9A 4PTYA 4Y2QA 2ILTA 4YQEA 3QV2A 3IOBA 4I5FA 5AVKA 5LQAA 5KKCA 2FWMX 5FQOA 1E3SA 2QUKA 2I7TA 8ADHA 3AW8A 1Q7EA 2H85A 3TEMA 1ST2A 3M5CA 2G36A 5TPZA 2WSMA 1LA2A 3RU3A 5A9SB 3ZVLA 1KFCB 5K8JB 3WGZA 3JQ8A 4M36A 3FWNA 1MQ9A 4YCJA 1GZ6A 5F1YA 4BAGA 3M3HA 3CZCA 1I3MA 5DHUA 3BK2A 3V55A 5DRYA 4RTOA 1VLVA 1F9AA 2IZ6A 1YIOA 2QV0A 1JR3A 4OQLA 2PGXA 3DXYA 3D6TB 3TQSA 2GPBA 2B4YA 1ODTC 3T7SA 4RA6B 3AYZB 4L5YA 2WD7B 4TKUA 2WYUA 2X0DA 2EG9A 1TU3A 1F7UA 1TQ2A 4RZ2A 4LRXA 2D0OB 4HVAA 5ECYA 3HEAA 2BMDA 4NONA 3N8DA 1OU0A 4RQUA 2O2JA 4AJKA 3BB3A 3JQ6A 4RZQA 3X2SA 4C5AA 1Q0TA 5I51A 1RI2A 2VDWB 2CJFA 5B6JA 3A3OA 3FDZB 3S40A 2B82A 5DLPA 1ZH0A 1PNQA 1EINA 1ZN8A 5K4GA 1II9A 2X9VA 2QN9A 4M1MA 4TWRA 3PKJA 3W5SA 2P69A 2I3ZA 1KWGA 1Z0JA 3TQRA 1R8SA 1XA0A 4H7HA 2HEGA 1BD3A 1D8AA 2HJRA 4YREA 3IJPA 3GLVA 1UKZA 4YDQA 1UPFA 3U3XA 3VPFA 1KH1A 4JI8B 3D4OA 1KNXA 4BE4A 1I4TD 3QKRB 2HK6A 2P5TB 4ENSA 1SD1A 2ZT8A 1OYYA 2YYYA 2J0UB 3RO7A 1LTKA 4KNVA 3IBCA 1BVUA 3PTAA 2VF5X 4IS3A 2CLMB 4CFSA 2FETA 5HJ7A 4WX2B 1VPLA 3UXHA 3PS9A 2R8OA 1HT0A 3FM9A 3L46A 3LSYA 3PUVA 1ZM9A 4F2DA 3ZWKA 3SF0A 4B81A 3UOGA 4YX9A 4JR2A 1SU4A 1FRFS 1T8RA 4OFXA 3WISA 1ZCZA 4IDFA 2P2LA 3PJFA 4QU9A 5BURA 5CVEA 3ZV6A 3BJIC 3ZD9A 3MCVA 2C2OA 4BRZA 2PE5A 2RGEA 3WNCA 3PJGA 1W2HA 1ZVQA 1RWQA 4UVGA 3UKJA 1MU0A 3OFSA 3PQCA 2YV5A 1G2PA 1NI3A 1JSRA 2GHTA 2WWXA 3IHKA 3IQEA 3PNYA 3TYXA 3ZKAA 4B6OA 4DG9A 2EOAA 1DAKA 5J4LA 5JY1A 1PGNA 5AVZA 3ZXUB 2XJ9A 1DO8A 2JAQA 4ZMSA 1FZTA 1DARA 2WEKA 3BTSA 4TMWA 2B3TA 3Q98A 5LUBA 1UIMA 3T1OA 4I1VA 4ME6A 4ZOEA 3U6KA 2QW8A 4XB2A 4WOBA 2QS9A 4ZI7B 4MYCA 3T3OA 3V9AA 4FFRA 2FPUA 5C4GB 1NR1A 1W85B 3HU5A 3VU0A 4AKTA 4B6JA 2I0FA 3DFIA 2PSSA 3HXLA 2R87A 3P9YA 3OQIB 2VWGA 2PZMA 3CM0A 3O0TA 1U3WA 1TNDA 5BW8A 2FR1A 4HGQA 4M55A 4OYRA 4RL6A 5ADWA 2B5WA 3IILA 3TRFA 2I65A 1WETA 2NO4A 1VYVA 5DE3A 4C4YA 4B6QA 4QJ4A 2ZTLA 3G88A 4BO2A 2D7JA 2V58A 1N2BA 2KMLA 2H5IA 5L9AA 3QUAA 2C7RA 3AJRA 3FNHA 3G7SA 1NI5A 5DX8A 2QA5A 1GHTA 4I1SA 4J4BA 4KBYA 3EPPA 5HYVA 2HA6A 2WK1A 1XVAA 5K0TA 2YJZA 1X1CA 2W0MA 4DWOA 2C2MA 4MB2A 1KK2A 2C58A 3JVVA 3KNZA 4ZMRA 2XTZA 4DHEA 5GINE 1IWPB 5JD4A 1DDGA 4XQEA 5L40A 1QGED 4YT8A 3RCBA 4TKVB 2DQSA 2X1HA 2UZ0A 1SHLA 3QX8A 3ICPA 4HUJA 1GPBA 3ABRB 5HXAA 5FYQA 2H6EA 3L8GA 2VTBB 1GL7A 1FP6A 4E1BA 4ZT3A 4TKZA 2O4CA 1XD9A 2LV8A 4XUCA 2B9EA 2BI7A 4GE3A 1K92A 4JBWA 4D57A 3T0GA 1L1QA 5HM6A 1SOMA 4HO1X 4Q66C 3E3LA 3VI3B 2YW9A 3VZSA 3NKVA 3TM4A 5C52B 1HV8A 5LYJA 4B7CA 4PLCA 5JWHA 2IEDA 3TAXA 4F3TA 1RPTA 2O7RA 4JASB 5DM60 4CI0B 2Y77A 1D6MA 3BMNA 4HQFA 2VYVD 2IE0A 1LD3A 3GIWA 3CN7A 4LX8A 4ODIA 5LLTA 1TVMA 2J8ZA 3QF4B 2HBRA 2EZTA 2P5UA 3WV5A 4PFJA 4RHYA 4N3GA 2DFLA 2XYRA 3K0KA 1U6IA 3WLTA 3DW3X 5LMZA 1FNDA 2JFVA 4ENRA 3QMWA 1J42A 1N6PA 2ZBPA 4P0QB 1RWBA 1IHDA 2QPOA 4PSVA 4R6XA 1NLMA 3TBFA 3ANMA 1ABFA 1GZUA 3FMOB 2IUUA 3ZW9A 1TO1E 3PA6A 5LZ5A 1RI5A 3ANYB 1C1DA 3DMGA 4WCFB 3OC6A 2WT4A 3JPWA 3TZBA 1G60A 2G9VA 2Q1TA 4YIHA 3R75A 4GVPA 4RVUA 4Q3DA 3MCUA 4TN5A 3VI4B 5I4IA 2SHKA 5EJ9A 4AMYA 5K3AA 2HHHB 1P4SA 3F71A 4JLMA 4TRMA 3U4QA 4FB4A 3GUYA 3FZYA 4KQCA 3UO8B 1EFPA 4MUKA 5E3HA 1P5JA 2J67A 4E2YA 1FMLA 2NTVA 3Q0IA 4I3HA 4Y1RB 4CMAA 4MRNA 2JLRA 2BMVA 4HDKA 4MMZB 5JJCA 1YD7A 1TK2A 1TK3A 2JIOA 4PGMA 4KLCA 4EGCB 3O7MA 5K4AA 3JAWA 4A9AA 4JB8A 3K32A 4AJ9A 3OZTA 3MMZA 1A8UA 4WOCA 1Z8DA 4YRCA 4C6HA 3SF8A 3BWYA 4KAJA 2BKVA 2PL9A 1R4MA 3V1UA 4LBWA 2JDID 3L41A 3AINA 3MGBA 4IS2A 4AZWA 3W5CA 3I2FA 5D5HA 3LKDA 1ISJA 1YZTA 4DSTA 1CV2A 5KKAA 1WB6A 4A5SA 3U16A 4A2CA 4C0WA 5GOTA 2J09A 3EG9B 3Q41A 1ONSA 1NF3A 4I66A 2ZWAA 1QWOA 2W6JD 5EY5B 2O1SA 4MO9A 4BFTA 3AETB 3DZJA 5AP9A 1TCAA 4UHFA 2ZAMA 5CFQA 4G1MB 1V35A 2GPAA 1W0JD 1NJFA 1GDHA 1NXVA 1TK9A 2GZRA 2Y92A 3AY6A 5CVVA 1ODIA 3QWFA 3UT5A 1RHUA 1K66A 4IF4A 1YQWA 1HMYA 2VEOA 4HQRA 4EW6A 3FLEA 2CXUA 2VTDA 3I04A 5E1DA 4NWIA 4OHOA 4RIGA 1BTOA 1XU4A 3RARA 1BXGA 3A4IA 3NJRA 2CDBA 3ZWQA 4U8GA 1IL0A 1DT5A 4YT2A 3DFFA 3C7TA 3KWMA 4AX4A 4O4IF 4YAEA 2OQVA 2OZVA 2BIFA 4X1YA 4I9UA 3AV0B 3M82A 2JANA 4TSFA 3TTWA 5K45A 2R47A 2CCGA 4YN3A 4NCXA 2WYVA 1F7VA 1XD2A 2GD6A 2OECA 3UN1A 1R6XA 4EM6A 4GNRA 5KQMA 3KFVA 1L4YA 1OD6A 3CRRA 3C5WP 3D6NB 4E30A 3OU6A 1YL6A 2WWYA 1GA4A 5AW2A 4LUCA 3O90A 4EHHA 5B58T 3PFNA 4P22A 5PNTA 2TRSB 3IVAA 3K0FB 4FX5A 4NJMB 1CEEA 3NALA 1T13A 4C1NA 4Z4CA 3SI7A 2YFKA 3AEKA 3C45A 2QRZA 4K9NA 2GD2A 4AO7A 4I19A 4RK4A 1FLNA 5FWXA 2RGRA 4JI0B 2B9VA 1I7PA 5EJEA 3I9NA 3RHZA 1Y4DE 2XTNA 3CVUA 3CTMA 3U13A 2NSDA 3OJOA 2F2TA 5GONA 3ELUA 1DHTA 1BXKA 1IJBA 5AKYA 5A5GA 1CRLA 1QCDA 5BNTA 4FMPA 1X7HA 2HZ7A 3GQVA 2DR2A 4MRSA 5E3JA 4U1RA 5T67A 1MABB 4DIUA 4IIBA 3X1KA 4N54A 1U3GA 5LZ7A 4ZIRA 4L08A 1A7AA 2HFJA 3IIEA 5LZ8A 1GTRA 4Y9SA 2IIBA 5CDFA 4RY8A 4A6EA 3M9WA 3T1VA 5EMMA 3U60B 1JW9B 2RARA 2EHJA 4IO1A 1XYYA 3QJGA 5AVOA 3RT1A 4B43A 2FH5B 2A9VA 2PVPA 4DLKA 4A15A 3X1YA 2PL3A 4G0OA 3EIHA 2F55A 3BSYA 1OASA 2WWVD 2FX3A 2CMKA 3Q0EA 3IP6A 5P21A 3T5GA 4RKYA 4ETIA 2CNDA 4DCOA 3GLGA 1CSEE 1X86B 2QSYA 3MD0A 1FJXA 3VR6H 1EM8B 1XBTA 4LV6A 1Y37A 3GFGA 4RJLA 1MO6A 2LCQA 3TW0A 1JG7A 1K6EA 3SD7A 1X9GA 2WZBA 5JR3A 1G8MA 3LBIA 1V6AA 3LHFA 4X8OA 2YVUA 1KAQA 3B3GA 4KMSA 1KP9A 5TJHA 1GPAA 3PXEA 2CLKB 5I7AA 3E3AA 1F3OA 1TYDE 1MV5A 2Z3ZA 3WAGA 4JXZA 3FYUA 4CKEA 1KMMA 4YXFA 3WL3A 3DZDA 3DLPX 3EZXA 3PQ7A 3QPWA 4YP5A 4H35A 4UPVA 5ERGB 4EPXA 3AESB 1U0GA 5HFNA 5KNBA 3FSRA 3PQ6A 3NKLA 1M1NB 3AUUA 2IOQA 2FE1A 4Z9FA 3VPCA 4KYTA 3MT7A 1SXGA 2A9JA 3OICA 3VYWA 3B2EA 4OMDA 3GOQA 4L51A 2M6SA 3AONB 4DMLA 3ESXA 5CB4F 1S3IA 1SMKA 5H4GA 1I9CA 3FDXA 3QWAA 4Y2RA 5HRCA 3QZUA 3O3CA 3F6RA 3NORA 5AVQA 2GESA 3AV3A 3NYWA 3GA5A 4V02A 3JD1A 5EIWA 2M98A 4RZHA 1YVEI 3R9XA 5ENDA 1VJ1A 1CBUA 2HT6A 3C3BA 1HLDA 5F1KA 5BMVB 2R8RA 3TTSA 1SKBA 2RAVA 1TUGA 2LDBA 1IBMB 2QTBA 2VYNA 1GNRA 1S2IA 1HE5A 4CVNA 2BUAA 3OZSA 4RD6A 3UG6A 4ENPA 5HK8A 4Q82A 4QUBA 3GRPA 5AYVA 5EWJB 2RGBA 4TTVA 1QIGA 4TYPA 1TECE 1CEXA 3F8SA 1A76A 4NH4A 2BI4A 1USWA 4LZAA 4AMGA 5ICFA 3KBOA 5KNCH 1NSFA 2WFLA 1GKKA 4Y6GB 4KFSA 1O5TA 4P7KA 3WMGA 4RD3A 5HWSA 2FMXA 2PR7A 3M6AA 3OEHD 5J47A 2P7IA 2R6FA 3FLMA 2WTNA 3QMMA 3B3AA 4L16A 4LTMA 3RKRA 4ER7A 1M7BA 4QX6A 3BWVA 1W5TA 4M7WA 5IVPA 2JFUA 4Q4DA 3IAS6 2XUIA 4R81A 2FGJA 4MGHA 1KXZA 1LJ8A 1R10A 3FROA 3NXSA 2XYVA 4G4JA 3EEOA 2PRYA 2WV7A 3FTCA 1SXHA 1KIAA 1N5KA 2WSIA 4O8ZA 3R9WA 2XMGA 1XVLA 2WAYA 5ICEA 3LPLA 3L6DA 1GG5A 1UJ5A 4UM9B 1SZJG 2EW1A 2FP4B 5DN6D 4K6OA 3JRXA 5JS6A 2DUUA 1X1SA 3HL4A 1L6RA 3TW8A 5K2OA 3F7MA 2XF8A 1GGJA 1W30A 3RVNA 5IDWA 2OB1A 2HF2A 3ZZMA 1NC1A 3NTXA 4LVCA 3KJZA 3KDSE 5EZYA 1M2VA 2H7CA 3QHQA 4KODA 1ZN7A 3LK7A 2X5JO 3D0OA 4FILA 1NJGA 3ROQA 1NX9A 3H1AA 5AI0A 3VO1A 1W29A 5JMOA 1V6SA 4OY3A 4V0SA 5BUZA 1JHMA 5AQ1A 1ZISA 4NLLA 4LJKA 4QGGA 1DZ3A 3OMXA 2JJQA 1ECGA 3DUWA 1JYFA 1DKMA 5EJ2A 4UXJA 4HFMA 4GXQA 4GMDA 3GGOA 3Q72A 1A7KA 1EX7A 1KYYA 1C3OB 1DOZA 2HWYA 1QIHA 2WAMA 4Y0VA 1EG2A 4C7MA 4MUXA 1P1CA 3S8YA 2O48X 1XROA 1NWCA 2XUKA 4H08A 4M22A 2GM3A 1FXWA 1Q7TA 1SXJE 2BAGA 1VLJA 1XD8A 2FZKA 2DJ5A 2OXCA 3I1YA 3L0YA 4QG7A 3T94A 2W93A 2GKOA 1QFYA 4U7JA 4CKWA 1W8IA 2J07A 4LRQA 3H5VA 4ROTA 3WNBA 4L8LA 1NRWA 2P1ZA 3HO8A 4INJA 2FGKA 2VJBA 3RUHA 3T0IA 2VDQB 1ZBQA 3LE8A 2IU6A 3MT9A 1E7RA 4MNTA 4PU0A 2ZJ4A 3QV1A 3ZBTA 1KC1A 5LVAA 5BYJA 1DEXA 2DVMA 1QH8A 2WNSA 1O3YA 5ERYA 1S3FA 2ZI5A 4AO6A 2NU9A 3U48A 2H1HA 3G13A 1JEQA 3K6JA 4B79A 3U3ZA 2EKDA 2EYQA 4J0FA 2P3OA 2C0PA 4C0KA 2BDTA 3GJTA 1GNVA 4D46A 1OIXA 2P78A 4Q9HA 2DFPA 4KCGA 2UYCA 1RBMA 1Z37A 5C8YB 2ZYVX 1DB3A 1CX9B 4Q12A 3UH0A 1CFZA 1CPYA 1F8XA 1UM9B 2ZZKA 2JCXA 4D4GA 3I5MA 4CXMA 1UPTA 5A2QA 1E79A 1NN3A 3LLCA 2O14A 2O3RA 2RHOA 3MUFA 5FA5A 1XRQA 1C5KA 3RU9A 2HT1A 1SXJD 4HNVA 1PVOA 1TCVA 3PQ2A 4XDZA 4BNMA 2HUPA 3LY8A 5ALIA 1QPZA 1JF8A 2BTQA 3U39A 3W3AH 4NBRA 5DTEA 2QL9A 3LY7A 5GM2A 4YUVA 2VHZA 2FZ4A 4J7AA 2Y8EA 4EZEA 1B23P 4RCVA 2I22A 5EJFA 1WM1A 1GCOA 2I7DA 1LZLA 2YL2A 3NYRA 4FJ1A 3OIWA 3UMSA 3TK1A 4ZREA 1XWWA 4ID3A 3GUHA 1UPBA 3RS8A 4EY7A 1S02A 1V8BA 5DGHA 3JATA 4M1YA 5EQTA 4Z8XA 3WZLA 4KGZA 4MK4A 4XGNA 5HOQA 2CVFA 3SG0A 2B83A 2X0EA 3B3FA 2KI5A 1J7KA 2RKBA 3MB5A 1X1DA 2JBAA 5DM70 1CDDA 1KI1A 1YZLA 3PT9A 5FHRA 1DOAA 1D2HA 4MW1A 4DILA 4RQTA 1XTIA 3H5RA 3ND8A 3BMQB 2P7HA 4KIFA 3TXAA 2QUBA 4TT3A 3ROPA 3UY4A 1EJBA 4CHGA 2BFDB 1YHZA 1SPBS 1YONA 3DLAA 5F2EA 2YCLA 1OTXA 3A1NA 3RVDA 1E9DA 3A26A 1YS2X 1OB2A 3TIIA 4I5GA 4XWKA 1TQ6A 2A0XA 1JG3A 1SVNA 1C0KA 2KX7A 2Q5EA 3KKQA 4MQ5A 4R9VA 2WF8A 2O20A 4RJ2A 5DNCA 5KOJB 2Q4DA 1MGOA 3T7TA 2GN1A 3IJRA 4D74A 4OHYA 1XGKA 1FY2A 3SXUA 2WB4A 4LQCA 3J7TA 1L4EA 3B13B 4J07A 4M76B 3RGGA 3ZX5A 1RJ9B 3MNFA 4R71A 2IUEA 2J3KA 2RDMA 2I4LA 4ARCA 2NTJA 4B0OA 1KGSA 4Q02A 2GR9A 4ILKA 3D8SA 4FIZA 3EAQA 1DUSA 3DR5A 4Q4JA 3VHXB 5JROA 1OWMA 4PPNA 3F8WA 1WXHA 4ZODA 5FOQA 1B74A 4DQXA 2BC9A 3L0SA 1TO6A 1TMOA 3C6BA 1T2NA 3MTDA 3DE4X 2H9IA 1BDBA 3NWOA 3V48A 2BGIA 5F3WB 4MCJA 4JBIA 1QDLB 4MDFA 4G0UA 2PXXA 1ZVMA 3OX2A 4WBNA 4EHKA 1U2PA 4ZT5A 4K28A 1U2SA 4KVGA 3WGNA 3TTYA 4IX9A 1IG0A 2G7ZA 3Q85A 3RE1A 2KJQA 4RZIA 2PUEA 3ADCA 1QGZA 2F43B 4KLZA 5D51S 8GPBA 4R8RA 3PUHA 5BQ5A 1OA1A 4ZARA 5B53A 1JMYA 1WPRA 3HP7A 4Z9XA 1CUUA 4YMGA