1SNYA

Carbonyl reductase sniffer of d. melanogaster
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
248
structure length
248
Chain Sequence
HMNSILITGCNRGLGLGLVKALLNLPQPPQHLFTTCRNREQAKELEDLAKNHSNIHILEIDLRNFDAYDKLVADIEGVTKDQGLNVLFNNAGIAPKSARITAVRSQELLDTLQTNTVVPIMLAKACLPLLKKAAKANESQPMGVGRAAIINMSSILGSIQGNTDGGMYAYRTSKSALNAATKSLSVDLYPQRIMCVSLHPGWVKTDMGGSSAPLDVPTSTGQIVQTISKLGEKQNGGFVNYDGTPLAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sniffer CG10964-PA
publication title Structural Insights into the Neuroprotective-acting Carbonyl Reductase Sniffer of Drosophila melanogaster.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Oxidoreductase
total genus 87
structure length 248
sequence length 248
ec nomenclature
pdb deposition date 2004-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1snyA00
3L77A 2VRBA 1QLJA 3ZNNA 4MKRA 4LCJA 3WOHA 4NPCA 1R37A 2NU9A 5GMOA 4WEOA 2QYTA 4RVHA 4JBHA 3PQEA 1DFGA 2UVDA 4ALIA 2X0RA 3O03A 2CVOA 4ILKA 1T4DA 1K6IA 3WS7A 3KUXA 2ZATA 4YJGA 1Z74A 3H9EO 1E1MA 3KSUA 4Z0PA 4JP2A 4BV9A 4E33A 1P1RA 3VPFA 5HWSA 4WCFA 4IXWA 3ZH2A 4MVJG 1E7SA 3CUKA 4PN3A 4FFMA 3FNEA 2V7PA 4UVHA 1P44A 1YXMA 2CDBA 2WTBA 3WGZA 4HFJA 3JQGB 2CMDA 3MCVA 4J3FA 3S2EA 2GCGA 1BHSA 1ENZA 1Q7BA 2Y99A 3WX0A 1DC5A 1ID1A 2ZB7A 3I4FA 2GDZA 3ZHBA 5K9ZA 2EV9A 1GYRA 1RJWA 3H9UA 4XRGA 3DBHA 2HK9A 2QX7A 5L4NA 1E7RA 4I5EA 5JPIA 3QQPA 2AQHA 4X54A 2EW2A 2NM0A 2C07A 2DKNA 1ISIA 4R4JA 1E3WA 4W6ZA 3W4KA 2OMEA 3MOGA 4ONEA 3Q9NA 4WGGA 2FMUA 3O8QB 1YGYA 1N2SA 5IDQA 4Y6SA 3RAJA 4BMVA 4AJOA 5U9CA 3OQBA 2YYYA 3RD5A 1EK5A 4I9UA 1F8FA 4AJEA 1RM5A 1R12A 4P22A 4CLRB 1RKXA 1V3VA 4LVUA 1B14A 4WK6A 4WCFC 5AVOA 4E31A 3TFOA 2JD1A 3I23A 4BOYA 2AQIA 4AJJA 1ML3A 5I7SA 1T2EA 5I9NA 3FR8A 4KTTE 1GCOA 3CKYA 3CZMA 2EKLA 4GL4A 1Q7GA 3ZW8A 2NWQA 3RC2A 1PQWA 1TEHA 4DLBA 1XHLA 3A14A 1TT5B 2PGLA 1UUFA 2HMWA 4BIIA 3LT0A 1A71A 1Y6JA 2PR2A 3D64A 1E0DA 1HE5A 2QRLA 3F9IA 2UDPA 1SB9A 4MJLA 1Z73A 1DC3A 2FWMX 1K3TA 2I3AA 1DB3A 2X58A 2W2LD 4H16A 4OSPA 1LXCA 2DBQA 2NADA 3V2UA 2EF1A 3DBRA 1LC3A 3ZZNA 2HDHA 3D4OA 4WKGA 3WGIA 5C7OO 4UUMA 4ZRMA 2EG9A 3JQ8B 5KJFA 1R0KA 1HLDA 3PHGA 2X86A 1XU9A 3PDUA 1LNQA 3GZNB 5IF3A 2HMTA 3RIHA 1ISGA 4BL5A 4CLXA 2GZ3A 4G5HA 4KOAA 4G81A 1ISHA 5ILGA 3HDHA 1QYWA 4I8XA 2BI7A 2VRCD 2FHSA 3PWZA 2BD0A 3GFGA 4BNNA 5I9LA 3HHPA 3BTOA 4YBZA 1AE1A 3U3XA 2J3HA 2Y1DA 4DREA 3M6IA 1O6ZA 3JD3A 1ISJA 4TKLA 3C3XA 3WFIA 2X6TA 5ICMA 3GZ4A 3VPGA 3WGYA 4XGIA 1XCBA 2P68A 2C2XA 1NFFA 2WD7B 1ZJZA 4IDDA 1X14A 1VL8A 2WMDA 4FFRA 1JVSA 3HFGA 4J4TA 1AUPA 3AFNA 4S1VA 5B4VA 1KVTA 2JJYA 2UUPA 2Y93A 2I67A 4A5OA 3VDRA 3E5MA 2JFHA 3FF4A 4JJIA 4XQ9A 2GN8A 1EQUA 1Y9EA 2FY8A 2O7SA 4DXHA 1LLDA 1BXKA 1E3IA 4CUJA 2YV1A 4RVSA 1UDBA 1J5PA 2TMDA 1JW9B 3HG7A 2QIOA 3EK2A 3OIFA 3GHYA 3DL2A 3H2ZA 2CD9A 1CYDA 1LSOA 4GX1A 3WDSA 2PD6A 1CRWG 1PGOA 1YOVA 4B8WA 5A3JA 4A10A 1IZ9A 3G79A 3W6UA 3ZHZA 3AUTA 5B4TA 4CLOB 4GBJA 1L7DA 3QWIA 3QWHA 2IEBA 4OGWA 2WWRA 1QYVA 2FSVA 4ZICA 2J5RA 4MPDA 2XXJA 5KVVA 4M8SA 3VAZA 4EZBA 3G0OA 1BXGA 5JY6A 3TZ6A 4BNKA 3IDSA 4ZD6A 1Z75A 3PHIA 2PKQO 3DZKA 1PL8A 1UXJA 2NU7A 2YJZA 4U7WA 2UAGA 3W8FA 1KY5A 1YBVA 1A7KA 1WNTA 3H6KA 3E5RA 2HJSA 5TNXA 4HUJA 2HKIA 4Y8VA 3UCEA 1NHWA 2G5CA 4LGVA 3D3WA 1NP3A 2C7VA 2D8AA 2JD0A 3TNLA 1ZMOA 4OKIA 3E82A 4Z9XA 2DFVA 3AM5A 1MXFA 1JAYA 1QORA 1W4ZA 2RAFA 4J1SA 3EW7A 2AHRA 3LVFO 3U4DA 2GUGA 3LT4A 1LJ8A 3GGPA 4LRSB 3GHHA 2C5EA 2PZKA 3OA2A 3DHNA 1H6BA 2OZPA 4DMMA 3F5QA 4CJXA 2PH3A 4IZHA 2DTDA 2ZYGA 5DOZA 3JQ7B 4AG3A 5ICSA 2W2LA 4Z6KA 3VZQA 3MTGA 5ADHA 1LQTA 3DHEA 5LDHA 1VL0A 3HQ4O 1U5AA 4DTIA 5TRTA 4ZU3A 5A9RA 2B4RO 2WM3A 3QVTA 4CM9D 4WLEA 4CL8A 2HRBA 2VYNA 5ITVA 4E2ZA 2ILTA 1KERA 1C0KA 1U2DA 3QVWA 2O48X 1PGNA 5DBFA 3JQ6A 3PYLA 4BNVA 4BMSA 2GN6A 4BO2A 3FWZA 3IQDB 2HK8A 3WG9A 4Q3CA 4WOJA 1TLTA 3PHJA 5IXYA 5JYDA 2YZ7A 1GUZA 1DSSG 2YHUA 4ZQGA 5DZSA 1DHTA 3NT4A 3O38A 4E5YA 4NZ9A 1R16A 5DBGA 1PR3A 4D42A 1T2AA 5L51A 4E2WA 4Q9NA 2CF6A 1R4MB 4D46A 2X8LA 3HB4X 1LU9A 4OO3A 2QRJA 1O94A 4MVJE 4PLPA 4ALMA 4XQEA 2GF2A 1QXSA 4DIOA 4BKQA 4YWJA 3EUWA 1Y81A 4MVJH 2P9CA 1SNYA 4J0EA 3JQAB 1Y9AA 3ETGA 3GG9A 3DBLA 4DMLA 5ILOA 1U5CA 3PQDA 1C0IA 3K31A 1JN0A 5TGDA 4NBUA 2WYUA 3NV9A 2QZ9A 1H9AA 3EZYA 4Q3BA 1HLPA 1YB5A 4P38A 1HYEA 1CF2O 3L6OO 3N7UA 1EVZA 3HADA 1ZNQO 4J49A 4HY3A 2GGSA 2J6IA 5TC4A 4P4NA 3MZ0A 3GF4A 3PJGA 4L74A 1YQGA 3ASVA 4O0LA 4R3NA 3GY0A 2JCXA 3L9WA 1XELA 4RVFA 1WP4A 4NBWA 1CEQA 4NNJA 3WMXA 4ZA2A 1PL7A 3OJLA 5J23A 3UW3A 3Q2KA 4QO7A 1V0JA 1PWXA 1QYCA 1T2CA 3DFUA 3Q1LA 2ET6A 3K5PA 4Q3NA 1ZSYA 8ADHA 3ICCA 3KYCB 1LRLA 3LLSA 3PZRA 3M1LA 4O6VA 2ZTLA 2ZTUA 1C3VA 2O3RA 4FC6A 3RQSA 3RBXA 2E6UX 2JHFA 3JYNA 1XKQA 3DAFA 5IDYA 4E6PA 5A03A 4DBZA 1B8VA 2YW9A 4BO9A 2VUTA 2EJVA 2IYPA 4CV3A 1NQOA 4R41A 2Y0EA 2JKVA 2WDZA 5CEJA 2FP4A 2OUIA 3U9LA 3A06A 3DBVO 3V2GA 3SLKA 1E7QA 2XOXA 2I9PA 2X5JO 4FQ8A 4NJMB 8LDHA 3GMSA 1HYGA 1C14A 1EQ2A 2I66A 4BNUA 2O3QA 3WB9A 1VJTA 2FR1A 1HSOA 2Y1EA 2O3SA 5A9SB 5JMPA 2DUWA 1BDMA 3KO8A 2DC1A 1A4IA 3IC5A 5I8ZA 4PCVA 1YONA 3FTPA 4YYZA 1GPJA 1XLTA 4DYVA 3V2HA 3I9MA 3D4PA 5T67A 1GD1O 1MUUA 3GAFA 4D79A 1GZ4A 4ESOA 3PPIA 3X2EA 2F00A 1PJ3A 3I9NA 1ONOA 4CM9A 1T26A 1E1LA 4J4BA 1UZNA 4DYDA 5T5QA 4B4VA 2W8ZA 1CQIA 1SEVA 5L4SA 4WLFA 1M67A 4AVYA 3OETA 2NTVA 4I5GA 3K92A 4U5QA 5GY7A 1ZH8A 3PHHA 4RDHA 5TJ9A 3TF5A 2GPTA 5T8KC 3I9KA 4W9NA 4KDEA 3TZKA 5JO9A 1F14A 2VZ0A 2YHIB 4J1TA 4BB6A 5CDYA 4MVJP 4GVLA 3PJEA 1C0LA 4UVIA 3E9QA 3K8ZA 3AOGA 2W2KB 3PWSA 3ONDA 3TOXA 3BTVA 5CP8A 1X1TA 4BO3A 2DT5A 2NQ8A 1I36A 3WIDA 2HQ1A 2VNSA 3UHAA 2Z1NA 4Q3DA 3IIEA 1PGQA 2AMFA 1I10A 2VUSA 3F46A 4IIUA 4IY1A 1ISFA 4MVJD 3U0BA 4XDZA 2O2YA 5K0ZA 3AUAA 1C1DB 3AW9A 4D3SA 4J1NA 2X9GA 4QT0A 3TZCA 3HJAA 4OJNA 2ZIZA 9LDTA 3C1OA 4ALJA 3RUIA 1E1NA 2ZK7A 1LDBA 2NLOA 3QLJA 4JJGA 5BT9A 2NVUB 5DCYA 1NVTA 1N5DA 4A27A 5CG2A 2HSDA 4HFMA 5AOVA 4K28A 2Q46A 3UF0A 4EI2A 3JYOA 5JW6A 4RLHA 2IXBA 3S55A 3RFTA 2ZB4A 4W9NC 3LYLA 4CM8B 4CR7A 1IULA 1JKFA 3AU9A 3GPDG 1Q0HA 2LDBA 4BNWA 4CL3A 3BMCB 1ZSNA 3RBVA 1JTVA 1ZJYA 4RF5A 4A0SA 1R66A 5HS6A 1GY8A 3E9MA 3M2PA 3VC7A 2ZCVA 5B12A 3HDJA 4YVFA 1YQXA 3WJAA 1AGNA 1I01A 1NYTA 2I99A 2QRKA 3ZHXA 1P1IA 4NH4A 3RC7A 3HNPA 4EW6A 4BKUA 1DJQA 1ZKMA 3NTOA 3CEAA 1E92A 1GYPA 2J3KA 1ZK4A 2HU2A 3GNQA 3GLQA 4CMIA 3ZWAA 2QQ5A 3MEQA 4BNGA 4DQXA 2OP0A 1HDZA 5ES3A 4F6CA 1NXQA 1O95A 4E12A 1KEVA 5KIAA 3R3JA 5JNLA 3GMDA 1XYGA 2IZ1A 2RHRA 3K73O 4J2HA 4IJVA 2EWMA 4IDGA 4TMFA 2HUNA 4DLAA 3MTJA 3CZRA 4YTEA 4W82A 1X7DA 4J9UE 3IKVA 2X1HA 1G0NA 3EVNA 4AJHA 1A72A 4IJKA 1QV7A 4GKBA 2AEFA 2P91A 3OJEA 5KNLA 4R68A 2V6MA 1GQ2A 2P4HX 4XDYA 3WWZA 3ZWPA 3I6IA 2O7QA 3GEDA 3PTZA 4OIMA 4KP7A 1MLDA 4GAEA 1E1KA 3ROQA 1B0AA 5JY1A 4UEOA 1EDOA 3FBTA 4A03A 5BSHA 4URFA 4YJFB 3WXBA 1WAMA 1BW9B 1LLQA 5CFZA 5KJCA 3ZCXA 4IDCA 1BVUA 4NI5A 4PLVA 4GLLA 5BSFA 3UAGA 4TZTA 1BWSA 2GERA 1N1GA 1IUKA 1BGVA 2IRWA 4GMFA 3L9XA 1LDGA 1U7TA 1U8XX 3JQ9C 3GVXA 1NFQA 3PIDA 4RPJA 1X0XA 2GNAA 2E4AA 2OO5A 5CEEA 2PFGA 2Y67A 3V8BA 4JXKA 5KKAA 4ZVVA 4IQ8A 3SVTA 2Q4BA 2C5AA 1GDHA 3K2BA 4N5MA 2HMVA 1GUYA 3C7DB 4XA8A 4U6SA 2I65A 3KOUA 4YAKA 4PG6A 4MVJA 1I32A 1MG0A 1VLLA 3NTQA 3FPCA 3GUYA 3GK3A 1HRDA 1DC4A 1NWCA 4TWRA 1NR1A 1T1RA 1VSUA 2QZZA 1KVQA 4LCEA 4FSHA 4BMNA 4CMEA 1QG6A 2FR0A 4Z0TA 1ZK2A 1ZVMA 1ZMTA 1E7YA 4CQMD 2E37A 4RCVA 2V65A 1KOLA 4R54A 2G1UA 4CM5A 3K2EA 1N92A 3ZNPA 5CDUA 1EVJA 1N9GA 2AEJA 1LDNA 2CY0A 2PWZA 1ZEMA 4BNIA 5CDGA 4M89A 3Q11A 1LDYA 1H2BA 2FN7A 1P33A 2OBNA 2VT2A 4CPDA 4F45A 5TIIA 1PS0A 4RJTA 1NPYA 2NV6A 4E5MA 1Z82A 4GSKA 4J0FA 5JCJD 5L4LA 3VDQA 3TPCA 3UKOA 2B5WA 4Q39A 4JIGA 4PG4A 2X9VA 5I7VA 4RPKA 2QG4A 3OA0A 4PG5A 1R6DA 2EEZA 4RDIA 5I8WA 3V1TC 2QYSA 4IPTA 3C7AA 1J49A 3C1TA 3H65A 1H0KA 4TQGA 4WCDA 2C7GA 4C7KA 3DZFA 4JP3A 5EMHA 2E82A 1XSEA 2HAEA 3JQAD 1MB4A 3KVOA 3PJFA 5IN5A 1C1XA 4QEDA 5COQA 4EGFA 3DHYA 1QMGA 1I3KA 3DEYX 1MG5A 2BLLA 4CMEC 1TA4A 5DF1A 1O8CA 1GADO 3B6ZA 4DPKA 1JAXA 1KIFA 5AYVA 1JWBB 1I0ZA 4IJUA 3DO5A 2O4CA 4DPLA 1P3DA 4JQCA 1EUCA 3MJVA 3SC6A 1NTOA 1LRKA 3OSUA 4JK3A 4F6LA 3PLNA 3ZDFA 2B4QA 4AFNA 3NUGA 5U1PA 3GAZA 4J4HA 4XEHA 3VKVA 3F6YA 4XJTA 2OHXA 4BKPA 4CR8A 2W4QA 4YQYA 1HEUA 4EITA 7ADHA 5KOIA 2J5KA 1KS9A 2EIHA 3RJ9A 2X4GA 5G4KB 3RKUA 3WNQA 2YV3A 3VH3A 3M1AA 4ALNA 1OFGA 3H8VA 1B3RA 1SMKA 1WMAA 2CF5A 2PGJA 4FFOA 1EE2A 4YRAA 1LSSA 5KJ1A 3D4NA 3AJRA 3EZLA 5JLAA 2AA3A 2O3UA 3GT0A 3ROKA 1W73A 4DGSA 1KEWA 3Q3CA 1NNUA 4CUKA 1HETA 4HV4A 3H5NA 3S8MA 3KHUA 2O4UX 1U2GA 1ZZEA 2BFMA 2GN4A 4NG5A 5IDWA 1HZJA 3HN2A 4R69A 3BXXA 4BS9A 4P4GA 4XIYA 3GGGA 1F0YA 4BO4A 3R0IA 3OBBA 3ZWWA 3EMKA 4PLGA 1P0FA 2FOIA 2OOSA 3RSHA 4MIOA 3KYBA 3W6ZA 4KZPA 3G3EA 1IY8A 3LC2O 3K6JA 4QFDA 1K0UA 4KWIA 1XGKA 4GH5A 2NNLD 4UEKA 3ITKA 1GR0A 1Y8QA 3OEYA 4R1TA 4FJ2A 1WZIA 2VHXA 3CTMA 4A2CA 1RYEA 5I7FA 1GUFA 4N54A 2EW8A 4YJDA 1N7GA 3R6DA 4BVAA 3NT2A 4WNCA 1IZ0A 2WSBA 5F1PA 1ZO8A 2DU8A 4JROA 4CQMA 2ZB8A 4R1UA 5C37A 4XWYA 4GX0A 1YB4A 3S1LA 3AU8A 3WQSB 3FNHA 1JLLA 4XR9A 1ZUD1 2D5CA 2IYOA 1D8AA 2Q50A 3OJOA 4FGSA 4PVCA 4ZQFA 1FK8A 3LDHA 2OP1A 1LUAA 3BMNA 2DAPA 3JYPA 3PP8A 5JCJA 4Y6RA 1E7MA 1V3TA 1I3LA 4OQZA 2GZ1A 4PLYA 1CIVA 5HBRA 1P1HA 3U49A 1PX0A 2VHWA 4IQGA 3WQQA 2NSDA 2WYWA 1GQYA 3OEWA 4FBGA 3OM9A 3AOEA 1HT0A 2VWPA 4R01A 4NBTA 1R0LA 3KZVA 1SAYA 3IUSA 1U4OA 1DIHA 4CLDA 5BR7A 1U8FO 3PLRA 1QP8A 5ITWA 2RH8A 3AY3A 1X1EA 4FN4A 1TT7A 3LT1A 2GASA 1VKOA 5JO0A 5JYEA 1ADCA 4OM8A 1PWZA 4B79A 1GYQA 4E4YA 1R0SA 4E2YA 1LC0A 2NTNA 4J2OA 1HE2A 4DIBA 4YB8A 1KETA 1IHXA 4B4WA 3GG2A 2X5KO 4YJGB 3TZHA 3VVBA 4TVBA 4BHTA 1NAIA 3KYDA 2IZZA 4AJPA 4HWKA 3DZGA 4WCFB 2BFPA 1I30A 1Y8RA 4F46A 1FJHA 4FDAA 3DB2A 4S3MA 1NPTO 4F3YA 5EN4A 3Q6IA 3PGXA 1R4NA 1D4FA 2Z1MA 3LK7A 4H3VA 3ZW9A 1PJCA 1NQ5A 4CMHA 2O50A 1M6WA 5CG1A 4GX5A 1L1FA 1U4SA 3LC1O 3DBHB 3WGHA 3GGOA 1MA0A 1SCUA 3VOSA 1QLHA 2P4QA 3NGLA 3RROA 3JYQA 4OMUA 2P9GA 3I83A 5EL0A 1S6YA 1V9LA 2WYVA 3UUWA 3UH1A 2Z95A 3AY7A 3LQFA 3ZU2A 3G17A 1B26A 3ETDA 1E3WB 4A7PA 4Z9YA 5L95A 1UZLA 4RV9A 2ZTVA 3JQDA 3O4RA 3F5SA 4E30A 4YPOA 2DBVO 5THKA 4B3IA 1XWFA 3WYEA 1YDEA 1ZK1A 4GWGA 4BNMA 1PEDA 1UP7A 3DMTA 4FC7A 5EQDA 3GA0A 3BMOA 1UDAA 1LBEA 3ETEA 5L3ZA 4OHUA 5LDGA 3MJSA 5IAAA 5TQVA 1LQUA 1EDZA 5TLSA 2NU6A 5GZ1A 3FI9A 4NFYA 4I08A 3OQ6A 2VYVD 1DRWA 4J1QA 4XYMA 5KKCA 1FMCA 4LSMA 1HF3A 3W4IA 1MXHA 2NVBA 5F5NA 1ADFA 4XYEA 1BMDA 3FHLA 1WXDA 3LC7O 4YA6A 1HZZA 4XB1A 2Q49A 4ITUA 2R6JA 4TSKA 2DUUA 4YACA 2B83A 5L53A 2JAHA 2PTGA 1U1IA 3QE3A 2IEDA 4L73A 3QVXA 3WGQA 1D1TA 1E5LA 1KVSA 1BSVA 2ZQZA 2JL1A 4DUPA 3PWKA 3B1JA 4D43A 1IYZA 3R1IA 3NDIA 1BVRA 2YY7A 2VRCA 5DOVA 5G0SA 3BTUA 3QWBA 4ALKA 1M75A 4NMHA 5TT1A 3GVCA 2IZ0A 3DBRB 3QRWA 1WZEA 1U28A 2YFHA 4O5OA 4PZDA 3BTSA 4E5NA 3DOOA 5JSFA 3FPLA 1NM5A 2YQ4A 3C1AA 4UREA 3V1UA 2FR8A 1I2ZA 1JQBA 1JWAB 3QVOA 4PZCA 3WICA 3ENNA 1G6KA 4OL9A 1QSGA 2BGMA 4C7JA 2V6BA 1OOEA 4YJHA 1ZBQA 1PL6A 3GR6A 2FSSA 3SXPA 3GVPA 3NKLA 4PFJA 1A9YA 3ZGYA 1FDSA 1VL6A 2Q1WA 1PJSA 2IDZA 4LW8A 2HCTA 4NQZA 4A26A 4OQYA 3DAGA 3GVHA 4GSLA 4Z0HO 1E6WA 5IFLA 3I1JA 4UUPA 3VZPA 3DTTA 1RM3A 4ND5A 3D5QA 1V8BA 1ENOA 1QRRA 2OGUA 1K5HA 4JBIA 4II3A 4BO0A 3U09A 4ND1A 3D1LA 1E3JA 5FEUA 3GFBA 3QA9A 4KMSA 1I2BA 2GR9A 2CSUA 2OL4A 1O89A 2SCUA 1P1FA 3BA1A 1T2FA 3F47A 4CV2A 1U3UA 1YB1A 1D7OA 4CLEA 4QSMA 5DN9A 4L4RA 4RQUA 2P9EA 2PKQP 3I4CA 5H82A 3WTCA 4D0RA 2ZYDA 5A05A 5ENDA 4QFCA 1QR6A 2UV8A 2YV2A 4KTVE 3P2OA 3INRA 4ND3A 2X23A 3RFXA 3FR7A 1BTOA 2I6TA 5JAMA 1DBVO 5KWEA 4EBFA 2J3IA 2BKAA 2C29D 3NGXA 3VVCA 4UVDA 3ADOA 1YOVB 4D3FA 5HS4A 2B4TO 3AK4A 4LSWA 4WECA 5F5LA 4Y9DA 1PGJA 4XGNA 4BO5A 5A9TA 2BELA 1E3EA 5IN4A 2Y05A 1OC2A 1IPEA 2VHYA 1DEHA 1M76A 4K1LA 1SO8A 1YO6A 4R9SA 5G0UA 3EYWA 1I24A 1BXGB 2VUUA 3NJ8A 5T6BA 5BNIA 3GDOA 4YRDA 3FNFA 3DWFA 2BFOA 5C7LO 3GRKA 1PIWA 3EGOA 2VZ8A 4XX0A 4XZ3A 5GZ6A 3ZWMA 4CODB 2DQ4A 4CQLA 4HFRA 4RGBA 2BH9A 3NYWA 1VC2A 4YAIA 1PJ2A 1I33A 3D3WB 4D7AA 1DIGA 2A94A 4W7IA 3ZNOA 3BHMA 4YQZA 1T2DA 4FPXA 1M2WA 3OJ0A 2J5QA 4W7HA 5IZCA 2YDYA 2I76A 4R16A 4I9HA 1HDCA 1HWYA 4BNTA 3IJPA 5AXBA 1JVBA 1VPDA 3MJCA 4CMAA 2DPGA 1HE3A 1PJBA 3ZNQA 4D41A 2C0CA 5U4QA 1VKNA 1UJMA 3L6EA 5KVSA 4H7PA 2B35A 4M1QA 4EEZA 2AE2A 1EFKA 4K9DA 3B1FA 1SPXA 1UXHA 4RPGA 2W90A 3ZWNA 2GYYA 3P19A 2VOEA 2Q1SA 2VTEA 1W0CA 2Q4EA 4IGEA 3U4CA 4CM4A 3JTMA 3TJRA 3LLVA 3UCXA 4J7XA 1QKIA 3QHAA 3W1VA 3JD0A 4JBGA 5DBIA 1WLYA 5IXSA 3K30A 3VH4A 1PU2A 1P77A 7MDHA 3BMQA 3WSVA 4ZGWA 1YJ8A 1LDEA 3KXDA 4BO8A 1BDBA 3GPIA 3IS3A 5COAA 5T57A 4BO7A 1UAGA 2HMSA 3FTNA 4L4XA 4J7CA 3N58A 1B8PA 2P2SA 2JAPA 4XRRA 5IZCC 4FJ1A 5DDIP 1M66A 3WWYA 4YRBA 4PIVA 5FYDA 2AQ8A 3RCBA 3I9LA 1PZFA 3FN4A 5LC1A 3CIFA 3RUFA 3GRPA 1PQUA 3AM4A 4EYEA 1IPFA 1UAYA 1FDWA 1PZGA 2X22A 2D2IA 3HE3A 4MO2A 3KLMX 1OZAA 3PGJA 5L7YA 3DBLB 2DBZA 5TS3A 3K96A 1NWHA 4JLWA 3C85A 4JX8A 4IM7A 1V35A 4E21A 3PIIA 3ZV6A 1KC1A 3RJ5A 3UOGA 1KEUA 4MVJM 3EDMA 4GLOA 4HKTA 1C0PA 4NHEA 1B3BA 1UXKA 1KC3A 4BKOA 3M2TA 1NAHA 1PS9A 4G2NA 3GDGA 1ZCJA 3IMFA 4NFHA 4CMKA 2PD3A 2PGDA 1KYQA 2IE0A 3PQFA 4RLSA 1UZMA 5T64A 1J4AA 1DOHA 3I9JA 4DQUA 2FZEA 1X0VA 5L9AA 3PHLA 3JQGA 4Q3EA 1B8UA 3ANNA 2B37A 3U4HA 1DHRA 2OORA 1MX3A 2RCYA 4B3HA 1YVEI 5G0WA 4I1IA 3UCFA 3OF2A 1DPGA 3CXRA 3G49A 4EJMA 4MVJI 3OMLA 1O5IA 3GVIA 3KM0A 1ZFNA 3X2FA 1EUZA 4D44A 4INAA 4M49A 3VKUA 1ULUA 1MV8A 1F06A 2BGKA 4D0SA 1H5QA 4EUEA 1GZ6A 4EDFA 4FB5A 1EK6A 1UR5A 5DULA 3A1NA 1EEHA 1Z6ZA 2X0IA 3GDFA 2GSDA 2CUKA 2OBYA 1K2WA 2Y68A 3GH3A 3O8QA 3ANMA 3DZBA 4RPLA 3BHJA 3ZV5A 4PLTA 1NQTA 3ZU5A 2V6GA 4OSOA 5DP1A 1H9BA 1GEEA 4CLRA 1P45A 4IBOA 4RQTA 2BMAA 2JHGA 1YQDA 3BHIA 5EIOA 5AXCA 5G0VA 4MKZA 4YT2A 4Z9FA 3E03A 3RFVA 4HBGA 1YL5A 1SOVA 4IS2A 2CDAA 1Q7CA 4I5FA 1HXHA 3BYZA 3MOIA 3E9NA 2WD8A 2PK3A 1YL7A 3MWDB 4YR9A 2DTEA 3OFSA 1LSJA 3DDNA 4RL6A 4BNYA 4CMJA 1YE3A 4B7XA 2X5OA 1MP0A 1X7GA 3DZHA 4IXTA 3GOHA 1EVYA 4FW8A 4M86A 4WE3A 1LI4A 3KSDO 2HJRA 3IP3A 1TT5A 3UFXA 4L0QA 4NU5A 3CINA 1B15A 3DAPA 2GD1O 4R1NA 3L6DA 2VNAA 3I3OA 4TZKA 1E6UA 3I5MA 2X0JA 2VTDA 1M6HA 2WJPA 1UH5A 1IOLA 1PGPA 2I3GA 4E2XA 4UUOA 1U7HA 4MIEA 2FRDA 3QVSA 5JBIA 3QWFA 3L4SO 3QWAA 3ZWXA 2VWGA 3INTA 3ZN2A 1X7HA 4HX5A 1YWGO 2ZB3A 1HDYA 3KV3O 1DAOA 3UICA 3SX2A 1RWBA 1EMDA 3HFSA 3WYBA 3JQ8A 4PLFA 2AE1A 3P5SA 3SJ7A 3AI1A 3GC6A 4LN1A 1KEPA 3GZNA 1SC6A 4MDHA 1IHYA 5CEFA 4Y67A 4WLUA 2VT3A 2C59A 1VM6A 4PG7A 3FWNA 3LSYA 2YUTA 5F1OA 5HTOA 3WLFA 1Z7BA 4LMRA 1J0XO 2WE8A 3CMMA 3AM3A 4M87A 4NU6A 2VHVA 3TQHA 3TFQA 4KQWA 1EE9A 4TRJA 3MJ4A 3DQPA 3AI3A 1I5RA 1TI7A 3DFZA 4XQCA 4IUYA 1AXEA 1YL6A 1X15A 2CZCA 4J91A 1DRVA 4AJKA 5KJEA 3UVEA 1VE9A 1VJ1A 1EBFA 3VPSA 2FPIA 1K89A 2WD7A 4EUFA 5JAZA 4LRTB 3AUSA 3OJFA 3Q9UA 1OMOA 3GEMA 4IJWA 3ZU4A 3ST7A 2D0IA 3Q2IA 2XF8A 1D1SA 4YDRA 1H2HA 2RBEA 1E5QA 1GQQA 1PS8A 4MP3A 1KBZA 3WTBA 2LDXA 4PLHA 1D3AA 2EKPA 3A28A 4NK5A 4PRLA 1NPDA 2P5UA 3NAQA 1UP4A 4I5DA 2PKRA 3PI7A 4WJZA 5DCWA 1ZEJA 4ZRNA 1YDWA 4HADA 1OBFO 2VOJA 4YAGA 3NTRA 1ENYA 2ZYAA 4ND4A 2DBRA 3IP1A 4M55A 5LCXA 1A9ZA 1NHGA 5F21A 3O26A 3S2IA 4CMBA 2C54A 4CLOA 1FDVA 2IXAA 2CDCA 1Y5RA 5TSDA 1BG6A 2BF7A 1NFRA 3VTFA 3PXXA 3QIVA 4CMIB 1LTHR 4U6QA 1SZJG 1DFHA 1I3MA 3KETA 3PYMA 3AY6A 2EP7A 3T7EA 2Y1OA 1IE3A 4FCCA 4KUHA 3TWOA 3IKTA 5MDHA 1LSUA 3L0DA 1LEHA 4E3ZA 4EJ0A 3VPHA 2V6FA 2YQ5A 3IOYA 5A3VA 4N18A 3UXYA 2B36A 4YT4A 3SEFA 3RC9A 3SLGA 1J6UA 5HRUA 2DFDA 5G0TA 4GX2A 1NR7A 4R1SA 3ZWVA 1H93A 1NX6A 1SEPA 1XA0A 3AI2A 3F4BA 3VZRA 4CV0A 3IJRA 1PJLA 1PSDA 2TMGA 4GPD1 4WOKA 4U0KA 5A06A 9LDBA 1ORRA 3RWBA 1YKFA 4DQVA 4AJ2A 4YEDA 3LF1A 3H9QA 2NVWA 1PR9A 2PD4A 4OXNA 1JKJA 1U9JA 2D4AA 1YH3A 2Y0DA 1P74A 4PVDA 3TDKA 3WBFA 4BKRA 2CVQA 2NU8A 4XR4A 4ALLA 4L9RA 4KDFA 4CM1A 1YS4A 3JQ7A 1ADBA 2E49A 2AG5A 3ABIA 3MWEB 3F3SA 3W8EA 1GZ3A 3H4VA 4M54A 5A5FA 5C5IA 1T24A 4J7UA 1O0SA 4R5HA 3SBOA 1B7GO 3RUAA 2ZTMA 3JD2A 5H81A 4DL9A 3TRIA 5BSGA 5F1KA 3JQBA 4TROA 1V6AA 3OQ1A 4CM7A 1P1JA 2Q1UA 2JCYA 2I5PO 4R5MA 4RPHA 1HDXA 3RUCA 3HN7A 1A27A 1JA9A 3ITDA 1DRUA 4P8RA 1XIVA 4QUKA 2EJWA 5COBA 3H5RA 4BNLA 4Q3AA 5CHEA 1N7HA 4CMGA 4D45A 5JE8A 4A73A 4B4UA 1NQAO 1G1AA 2Q99A 3RUEA 3DZJA 1LLCA 5TT0A 2XXBA 2JCVA 2AG8A 1ZSVA 2JFFA 4QO8A 1X13A 1Y7TA 2A35A 3NDRA 4AJ1A 4BO6A 5B4UA 1R4MA 1DO8A 2VYND 3D7LA 5DP2A 1VSVA 3PFFA 5AXDA 3OIDA 1HE4A 4GGPA 1P0CA 1N9GB 3G1TA 5B37A 2FPGA 3RI3A 3A4VA 3JQAA 4J16A 2CVZA 1XG5A 2B5VA 3CSDA 4MINA 4KUEA 4NR0A 1P1KA 5G4LA 2WE7A 1EFLA 1DDOA 3EAGA 4L4SA 4O1MA 1V3UA 2B0JA 3DMYA 3WR5A 1TVEA 3CMCO 3DZIA 5TJHA 3UGKA 2EERA 3EHEA 1PQPA 3JQBC 2GO1A 1Q0LA 4PZEA 2X9NA 3H3FA 1F8GA 2Y1GA 4UUNA 3RU9A 4E32A 1UP6A 3ON5A 3KSZO 3ROMA 3QSGA 3T4XA 2G0TA 1ARZA 4GQAA 3D3EA 4C4OA 1YBMA 3ZHYA 3RC1A 1B2LA 2RH4A 4ID9A 3F4LA 4DVJA 1C1XB 4UEJA 2XPCA 2F1KA 4BV8A 1OAAA 3FSRA 4HFNA 2D5AA 3MJEA 2YFQA 3ZI0A 1WPQA 4ND2A 3HZZA 3IUPA 1UXIA 4AJIA 2Q2QA 4UVGA 1E3LA 3WIEA 1Q2XA 1Z45A 1JKIA 2EP5A 1OC4A 1DIRA 3AOEC 1RM4A 3HUDA 3PZBA 1ZXBA 4CM3A 1ZIDA 1A5ZA 3HB5X 3MJTA 3KYCA 1CETA 3ZV4A 3BAZA 3HSKA 3BIOA 1GV0A 4RVDA 1ZK3A 1I2CA 2GN9A 3RUDA 1VRWA 2NUAA 4HP8A 5G2OA 2PV7A 4RVUA 4RF4A 1UDCA 5CDSA 1WW8A 3JQFA 3OICA 5FI3A 1YJQA 3ZU3A 3DONA 4KQXA 1BXZA 5EJ2A 3ZV3A 4HXYA 2GRAA 2Y1CA 1LLUA 4ZHSA 3ULKA 3WLEA 4NJMA 1CJCA 4ZQHA 2VZ9A 4R51A 2BRUA 1DXYA 1RM0A 1ZXLA 3PVZA 4NDNE 1GCUA 1S7CA 3OH8A 1Q0QA 4XYBA 4K26A 5EPOA 1DJNA 4XJSA 3E48A 3ZWCA 5A9SA 4NBVA 5A04A 4GI2A 2W98A 4HNHA 3VZSA 2PZMA 1UXGA 2VQ3A 1RYDA 3W4JA 3VH1A 4BNXA 4OH1A 4D3DA 4IIVA 1CDOA 3P2YA 1KY4A 1GEGA 3ICPA 4J90A 4Z3KA 4ZJUA 2PY6A 3P7MA 1F17A 3OIGA 1PJQA 3TSCA 2X7HA 5CAEA 5JS6A 4L8VA 1EUDA 1MC5A 3WMWA 2Q1TA 4NK4A 3DOCA 1YBAA 1Y8QB 2VCYA 3VH2A 5KCZA 1DFIA 4XGKA 2Y1FA 2Y0CA 2H6EA 3S2GA 5AXAA 1R15A 4GWKA 4I9NA 4FIZA 3EVTA 3JQFC 2HRZA 2YHIA 1P31A 2PZJA 4FJ0A 4FR5A 4TRRA 5L7TA 1U3TA 4DC0A 4DLLA 2EKQA 4BGIA 3GEGA 3DMTC 3LF2A 4CQMB 1H6AA 2W2KA 3ANLA 2P5YA 3E1KA 1NASA 4BGEA 1XDWA 2C20A 3PK0A 3GN1A 1XU7A 4NFSA 1BRMA 1LX6A 3WJ7A 1E77A 5BSEA 1WMBA 4IGFA 1C1DA 2BFAA 4BUCA 4E13A 5BQFA 1MFZA 1Y5MA 4YXFA 5KJ6A 2E48A 3BMNB 4ROSA 3C7CB 3I9OA 2BHLA 2ZKLA 5KTKA 2NVUA 4JN6B 4DPMA 3WBBA 3T4EA 1PTJA 2HLPA 1W8DA 3V1YA 5JAIA 1GAEO 3VHRA 1TB4A 2VWQA 2BI8A 4XQGA 4DBVO 2H63A 3L4BA 4XCVA 2CFCA 5A1TA 2H1SA 4G65A 1ISMA 1DC6A 3ZWOA 4TKMA 3H9GA 4L76A 1DLJA 3WGOA 4CM8A 3DR3A 2HK7A 4IDAA 3N74A 3JV7A 4OAQA 4N7RA 3ROPA 3KEOA 2A9FA 4PLCA 2PH5A 3BMCA 3COSA 4FGWA 4MVJF 2GZ2A 4TRNA 3O9ZA 1RPNA 2OFPA 4IZIA 4BQRA 3DOJA 4L75A 4JJFA 1WDMA 3FD8A 3HDYA 4FFPA 2Q45A 3WQRA 3R3SA 2EXXA 3RVDA 1W6UA 2ZCUA 2PNFA 5FFFA 3H3JA 2AW5A 3OP4A 3FBGA 4GKVA 4IMRA 4QXMA 3IL2A 3KYDB 2DTXA 1U3WA 4CUZA 5L45A 3KEQA 1WWKA 5DT9A 1Y8RB 1HYHA 5CPBA 3UN1A 3DXFA 2HO5A 3BZUA 1A4UA 2GLXA 3C24A 4QX6A 4BB5A 5GZ3A 3TOZA 3GUCA 1JDJA 1P9LA 3H7AA 4BO1A 5H83A 3NRCA 5BNFA 2VN8A 1R4NB 2RIRA 1EBUA 3STHA 1SB8A 3KBOA 1DLIA 1FDUA 1ULSA 1YRLA 2G82A 2NTJA 4EUHA 5EERA 1E7WA 4JCOA 3INGA 1G0OA 3HDQA 1PJTA 5JAQA 3H2SA 4TRMA 2CNBA 1T4BA 3L4BC 4II2A 5CDTA 4OXKA 3G1UA 6LDHA 2Q2VA 3ASUA 2OXIA 1VI2A 3FRJA 1SOWA 5IZ4A 1HSZA 3JD4A 3T7CA 2WEKA 3A9WA 3PRJA 4QTZA 2PZLA 3PFWO 2VYVA 4R9RA 4BGVA 2NACA 1TXGA 1Z7EA 5T8KA 1GFSA 4W4TA 1EZ4A 1FXSA 4BGUA 4O59O 4ZQEA 5JC8A 2H5LA 3ENKA 1XR3A 3CE6A 4EEXA 5C7IO 1GTMA 1PZHA 4FD3A 5FWNA 4OKNA 1GV1A 1XQ6A 5K6AA 3BMOB 4LMPA 4YJFA 3PYXA 2PLAA 4IDBA 3K9QO 1BW9A 3RBZA 1O9BA 3C8MA 3QY9A 4U0JA 4OYRA 5TF4A 5A02A 4QQRA 2DM6A 5JMWA 1NBOA 1VJ0A 1FF9A 1NVMB 5I7EA 1HKUA 4NBRA 3SJUA 2Q2WA 2G76A 4RF3A 4UAGA 3ZWYA 2J8ZA 1T1SA 2QHXA 2RHCA 3DC2A 3TZQA 5ENVA 3KB6A 2D1YA 2O2SA 3F1KA 3B20A 4AICA 2QW8A 1AXGA 4JGBA 1SBYA 3L07A 3OECA 4TVOA 4BNJA 3EY4A 4RZIA 1AHIA 4HNGA 2O3JA 2VHZA 3WFJA 4KUGA 1GU7A 1MFPA 1QV6A 1QYXA 3QP9A 4WASA 4DWVA 6ADHA 2JFGA 4MOWA 2IODA 3AUUA 1Y1PA 4FOSA 3RU7A 3U62A 5TX7A 2A4KA 2G17A 4J6FA 2PA3A 4WPGA 4RO0A 3PEFA 3QJ5A 1H6CA 4B7UA 1B16A 5K6AC 2R00A 3OHSX 5DCUA 2POQX 4IDFA 5CPFA 2AXQA 4DA9A 1WVGA 1ONNA 3LT2A 4AJNA 5JCXA 2ZJ1A 3B70A 2FPPA 3NDJA 5JXWA 4YJHB 3WGTA 4CM6A 5A5EA 3IAHA 5IG2A 3KTDA 5IJZA 3GQVA 4AJLA 4LISA 1HDGO 4Y98A 4LVCA 5I9MA 5DNAA 3JYLA 3U4IA 2R2GA 4OOFA 3WYCA 5B1YA 1N1EA 4DIFA 2EGHA 4QECA 4LK3A 4GVXA 1DIAA 4RORA 1N8KA 1GPDG 1LRJA 4RZHA 2VWHA 3ONFA 4UULA 5EQFA 5JFOA 3ONEA 1T25A 2DPHA 3GNSA 4BNHA 2Q3EA 3LU1A 5KVCA 3I6QA 3NT5A 3D5TA 1ZK0A 3E6AA 2ZQYA 1PJ4A 1PZEA 4O63O 4CV1A 4WLNA 2DVMA 4FFLA 2X0NA 3GN2A 2D3TA 4BNZA 4FOOA 4ZN6A 2JD2A 2R00C 4YT5A 5HM8A 2AQKA 2A92A 4XD2A 2EGGA 5JDIA 4DC1A 1FDTA 3DTYA 3TN7A 4AJ4A 4GMGA 1WDLA 1WDKA 4E5PA 2J3JA 2UUOA 4PLZA 5G4KA 4RVGA 3B1KA 4XYLA 3Q0EA 4CMCA 4H15A 1I8TA 4WNIA 4PLWA 3PJDA 4XYGA 2HMUA 3JQ9A 3V5NA 4AL4A 4P4LA 2Y66A 1XQ1A 3D0OA 5F3RA 1E6EA 3E18A 2FZWA 3PDJA 1JU9A 3RKRA 5C3MA 4MP6A 1HTBA 1K6XA 1A7AA 3S2FA 1H94A 2B69A 3AFMA 3EC7A 3GNTA 5EESA 3WSWA 4CLHA 1CWUA 1F12A 4Z3DA 3KLPX 5THQA 4MP8A 4FS3A 1I3NA 4E5KA 3TL3A 4B4OA 2H9IA 2C2YA 4J43A 5L40A 2C82A 4YAJA 4ZQBA 5MGBA 1QYDA 4CQLB 3RUHA 3FNGA 5IDXA 3E8XA 2Z5LA 3JQCA 4XKJA 4EJ6A 5BNTA 1K6JA 5JDCA 4YAEA 4N5NA 3FCOA 2EHDA 5HA5A 4MKXA 1CQJA 2NQTA 1E3SA 1CERA 1ZW1A 3QV1A 1IL0A 4YT8A 4DRYA 4IS3A 5JDIC 4IINA 4U8GA 1L7EA 2AEMA 4OOEA 4N5LA 3QW2A 1AN9A 1AHHA 4R3WA 4WLVA 1HL3A 4WUVA 3ADPA 2O23A 3CH6A 4PG8A 4WLOA 4CR6A 4JNKA 4GGOA 4K6CA 3U5TA 5FI5A 4NJOA 1LA2A 4B8ZA 5L7WA 4K6FA 2YDXA 1EVIA 5ER9A 1H6DA 4W99A 1MC4A 4CM4B 1GL3A 4XB2A 3WGGA 1DIBA 2DLDA 1NVGA 4NIMA 2O3TA 1ADGA 4B3JA 2XAAA 1OI7A 5A4DA 1KVRA 3HWRA 1HDRA 3NEPX 4KWHA 3ZWBA 3BMQB 3VTZA 1XEAA 3F1LA 1MGOA 4FFNA 2BGLA 3JCZA 4PRKA 4RF2A 5JC1A 5FF9A 5AQ1A 5KVQA 3W8DA 3H5AA 3LZ6A 4YCAA 4BQPA 5ER6A 3CPSA 1KVUA 5JDCC 1ONPA 3JSAA 3SC4A 5EINA 4WEQA 3H9JA 1Q1NA 3NJ4A 3AWDA 3RASA 3NX4A 1DAPA 4OXYA 4PGFA 4Y6PA 4XIJA 1U3VA 4IMPA 2UYYA 3TL2A 3KRTA 4BNFA 2ZJ0A 4B7CA 3ORFA 3VPXA 1HDOA 4IDEA 2D59A 1IB6A 4IQ0A 4E0BA 3I52A 1LDMA 3JD1A 4MIYA 4UVEA 4J9VA 3JQEA 1ENPA 3WNVA
chains in the Genus database with same CATH superfamily
3JQQA 4WDQA 3MXTA 3HUUA 4FNOA 4J03A 5BSMA 3LL7A 4D3XA 3GJ7A 1P2SA 4LCJA 4L2IA 3G2IA 3WOHA 2FN3A 5GMOA 3UANA 2ZBQA 3FY4A 3M3PA 4WBNA 3MTIA 4RVHA 1VLZA 1TMGE 2GJSA 4LYEA 4YLGA 3SQOA 4ALIA 3AVVA 5D84A 3V9PA 3F74A 2Q0SA 4HXGA 3O1JC 1CUIA 1O9GA 2VKQA 1JVNA 3CUYA 2ZATA 3OEHA 1JDNA 1BH2A 1E1MA 3H9EO 4ZO4A 2XNCA 1P1RA 3PE4A 1IXYA 6NULA 3HU1A 5CLGA 2D7JA 3A2NA 4BE9A 3EVFA 1XE3A 2WU8A 4KPGA 4MQUA 4ZYTA 2YWRA 3MFYA 3WO1A 4HDSA 4L8WB 4PN3A 3FNEA 3NHZA 3AUJB 3RNOA 3OMWA 1U6JA 2D1QA 2M98A 1P44A 4HDOB 4RE6A 3ZJTA 5EIFA 4FMBB 1BKDR 1QS0B 1YR7A 2CMDA 1TLLA 4J3FA 3S2EA 3PIRA 1D6JA 2VSXA 4JOQA 3VVMA 4JGIA 1RNLA 4O25A 1MABB 2GDZA 4LI0A 3ZHBA 4D8YA 1IWOA 1T3LA 2EV9A 4HB4A 4E88A 3N8GA 3KXLA 3DBHA 2B1QA 2PU5A 2CXOA 2HK9A 2QX7A 1WB4A 4WKOA 1PX2A 1KJYA 3WNDA 3THSA 3OCUA 2W6IA 3QQPA 3MRVA 2H54A 4N82A 2AQHA 3TEFA 4X54A 2EW2A 4MI1A 3B3QA 4LAFA 4YRMA 1XEFA 1N0UA 1S2DA 2R5FA 1HNXB 4J0GA 1YRYE 4X71A 5LKAA 3NETA 1L4GA 1E3WA 2B2XA 4LPKA 3MOGA 4B44A 3E15A 4JUFA 1Z63A 1QFZA 1YGYA 4JU9A 4Y6SA 3RAJA 1OAOC 5HKAA 3LO5A 3OQBA 1RCFA 1F9AA 3WGMA 3W5IA 1NA5A 1AKWA 2C9ZA 5C1OA 1U0SY 2SKDA 1SELA 1OPRA 1S8FA 4IFEA 4NU0A 4P22A 5HJ2A 4F4JA 1DQSA 3F6PA 4CLRB 1V3VA 1YZQA 1OFHA 1B14A 3HGTA 3T7JA 2IW3A 4ZYYA 1SRQA 4POAA 3KT8A 4EG5A 4ZI2A 2JD1A 3I23A 2AQIA 2C4VA 4L6CA 3S2ZA 3L40A 1SU7A 3B6KA 3O1IC 3P5BA 4OK3A 3KCNA 1EESA 1NN3A 5B7NA 1II8B 1Y7LA 1ZN7A 5GGYA 2R6DA 1WOYA 1PV4A 2OQRA 1Q7GA 5HK9A 4G0WA 4FHZA 3VR2A 2FHPA 4GZMA 3AILA 2ID9A 1PQWA 4U9IS 2F8MA 3BJRA 3BSYA 3I45A 1V16A 3DFKA 3LKBA 3C87A 4XJVA 4C03A 1Q7RA 5KQRA 1Z35A 4CQNA 1T9CA 3LT0A 3GUVA 2WKQA 1UKZA 3AF5A 1KAEA 3KFLA 3RSZA 3EEBA 1E0DA 2FX3A 5KTNA 1BMTA 3F9IA 1KK0A 4ACBA 3ZCTA 5K0CA 4MJLA 5LNK1 1JHOA 2W6QA 2XYVA 3IPXA 5KSOA 1DC3A 2X58A 3HJCA 1PFWA 3HYTA 1XKXA 1Z56C 4H16A 4J07A 1LXCA 4OSPA 2NADA 3IA7A 4QE3A 5GVRA 1EIZA 2ACWA 2YCBA 4K9MA 4RD4A 4WV3A 3TM5A 3ZE7A 3TB6A 3R44A 2G7MC 4LWQA 2J32A 4HEJA 5EJ7A 5IKMA 3C3PA 2XYPA 3ED5A 3Q5GA 4YJ3B 4R8SA 5ULLA 2A1TS 1Q1GA 1R0KA 1U2SA 1FXWA 4WDRA 3DJFA 2A58A 3CNLA 3PDUA 1ZRHA 3AR7A 4RK7A 4F93B 5IF3A 3RIHA 2FPXA 1OXMA 2B1RA 4DR6B 4XGRA 2OV6A 3OLYA 4Z4HA 2XY4A 4I8XA 3OFVA 3X1MA 4ENQA 4ZVRA 1YA4A 1MEEA 2OPBA 4BNNA 3OD1A 4DXAA 3JAWB 4UM7A 3RVQA 5J2TB 3LX4A 1USUA 5AVSA 2CNWD 4UBOA 3I0NA 4EG4A 4XD7D 1KORA 1W85A 2ZRBA 3GEEA 2HX1A 1NKSA 3AXTA 3Q3VA 5CYFA 1R88A 1VZ3A 1ZI9A 2IY7A 2WWFA 1KMMA 2NUPA 4UTRA 3GZ4A 3WGYA 3PDIA 1AV7A 1VDMA 2C2XA 3RVMA 4IDDA 1K3UB 1FNNA 3QXHA 1X14A 4MYUA 5F2KA 3K9HA 4EHBA 1JI3A 1GSIA 1JVSA 2V7BA 4G0UA 2ERXA 4TX1A 2X5NA 2XA1A 1A8QA 1AM4D 3CX4A 2B20A 4S1VA 3ACCA 4HNRA 4O4JF 4R9VA 2JJYA 5B4VA 1NC1A 2Y93A 3BHNA 2I67A 4Q19A 5IK2A 2JAXA 4JJIA 4CKBB 1N6RA 2R5WA 3OOHA 2YV1A 4B2YA 3TEMA 4CKXA 2WINI 5TXGA 1JW9B 1XDDA 2XCIA 1YV9A 3H2ZA 4RZ2A 3ESCA 5JR3A 2Z57A 3AEUA 1W88A 1VPVA 5K0SA 4XOUA 4PF1A 1YOVA 3RW9A 1I5EA 3CZQA 4N3BA 2OG2A 5IPFA 2W70A 1IZ9A 3W6UA 5KS2A 4ZMRA 3ZHZA 1Z0AA 3PE3A 3RYHA 2QR5A 3QKWA 1L8AA 3WYGA 3GCWA 1CUFA 2VPQA 3G68A 1N33B 4FDLA 1KTVA 2GYUA 1QYVA 3V42A 1B6RA 4KSBA 2FSVA 4YP7A 4F3NA 3CO5A 2XXJA 4BVEA 1G4AE 1RE0A 2CNLA 2GFQA 4ZO9A 1ZJ4A 4HLCA 3RIEA 5KQMA 3R5TA 3IKJA 3LQQA 3T95A 5JY6A 2OKCA 3FAKA 2X0FA 1E8NA 3NVKI 1YKSA 1Z75A 4D9GA 3PA6A 1EG7A 1ST3A 2QQGA 4M1EA 3DZKA 1UXJA 5CFNA 5AD1A 2AJDA 2NU7A 1EIWA 4U7WA 2UAGA 1KI9A 1KY5A 3DCYA 1W6RA 1YBVA 2VEOA 1KJ8A 3K9LA 3M33A 3H6KA 4H7IA 3ZD6A 5CA0B 5ALNA 1UDXA 5JFTA 4B2LA 2B6HA 2KSQA 2PUEA 2J3DA 3UCEA 1NHWA 4HYQA 5EUCA 5HJEA 1RZRA 3D3WA 2Q21A 1RZUA 1ZMOA 3O8BA 1XQ9A 3ZE0B 5JD6A 4DLXA 4LIPD 3ZHUA 2IYEA 3AM5A 1KPHA 1N8SA 3LDFA 4HXEB 3GHHA 3HYRA 4QFBA 2C5EA 2ES4A 1CNEA 2PX6A 3UJNA 3L1IA 5E0OA 1JG7A 2Z4SA 4C2TA 2GPBA 5IWAB 5BYBA 1VLMA 4XI9A 1ZH4A 5F7OA 3R5JA 1NDQA 2VDUE 4ZI7A 5B2FA 1IHOA 2FSVC 2AIRA 3JQ7B 4P36A 1TADA 5M34A 2O8DA 2X4IA 1I4DD 1U2TA 2NYRA 3CA8A 3EQ6A 3MTGA 4I4NA 3H18A 1R0YA 3HQ4O 1U3CA 3CZPA 2Q1XA 5CW2A 3VZBA 2HBQA 3CNBA 4DTIA 1AZTA 1QV9A 2FZKA 3EPPA 3L8CA 1K6MA 2ORVA 3MGGA 1VP9A 3EGDB 1GGEA 3R6GA 4RACA 4AKEA 3RADC 1XDUA 2HRBA 2ILTA 3E0QA 1C0KA 3KDSE 3K9NA 1MKYA 3TNJA 3VPCA 3ZHRA 1DWOA 3CF2A 1LV7A 3TW4A 2BGGA 3MRSA 2LP4Y 5CLIA 4FT4A 2IP1A 3N3AC 3IBFA 3T0IA 3R3ZA 3EQZA 4G0OA 4BO2A 1I80A 2OHHA 2Q8QA 3MJRA 4WOJA 1M1NB 1OX4A 5M3BA 5IXYA 2QD3A 1CY1A 2D5LA 2YHUA 4ZQGA 2I6XA 2RONA 2IEZA 5DZSA 1A95A 2HB6A 4E5YA 4NZ9A 3O5AA 1G59A 4N48A 5BN4B 1EVEA 1TUBA 1PR3A 1V25A 4X20A 4D42A 5L51A 5EWLA 1FFYA 1XL1A 4DE5A 4OO3A 4MVJE 5ED0A 1IEVA 1RXEA 3OWOA 4PHTA 1LNZA 1QXSA 2FI1A 4WZBE 2VCHA 4YWJA 4EO4A 1F51E 1XP8A 2JIOA 2FPGB 2XUPA 1GR1A 1FPMA 2PQ2A 3SZOA 4J0EA 4AMZA 3BK2A 3LYUA 1OUMA 1Y3FE 3QF4A 1U7UA 3BDVA 3GG9A 2NOAA 2ZT7A 2YOGA 3DBLA 3GP5A 3KD3A 3PGVA 4IUCS 4TMTA 5HQJA 5BW6B 4DMLA 5FV4A 1O6FA 1U9IA 3JVDA 4Z4FA 4KO2S 2OB1A 1J09A 1Z8FA 2GWHA 3AUKA 5TGDA 4MW6A 3EPLA 1POWA 2FMFA 1H9AA 3F7MA 1V2GA 1YB5A 2Q9UA 1NUUA 4Z7OB 4P38A 3N7UA 1A5SB 2R1UA 3DKPA 1H2WA 1EVZA 3HADA 3IALA 3VTKA 1M7BA 4DIUA 4HY3A 1M0TA 1PJ8A 3DNPA 1DX6A 1YULA 2GGSA 2J6IA 2OCAA 4OIFA 3HWWA 2A67A 2H92A 4W63A 4FZVA 1M1YB 3K5WA 4OFZA 4FFBB 3RRBA 2ZSAA 4PO9A 3PJGA 3OX4A 1ZQ1A 2XVAA 1E18A 4G1UC 4Y18A 4YMSA 5JYDA 1NRIA 2JCXA 4XM1A 3A6LA 1WP4A 4KFCA 4ZA2A 2F59A 4L5AA 2XHZA 1M8GA 1JILA 1N0VC 4JITA 3Q2KA 1V0JA 1XMIA 4KL8S 4IXDA 1IMOA 1QYCA 4G3XA 3Q1LA 1KYTA 2ET6A 2QOEA 2ZEJA 3B9RA 4S04A 1UBRS 3EEQA 3GO4A 3K5PA 4Q3NA 3AVUA 1ZSYA 3QFRA 5A7FA 5JHHB 1TTQB 3TW6A 2PFSA 3KJZA 4EHIA 2CL5A 3DXYA 2Y3IA 1K8XB 3EZ2A 3FYSA 1S8NA 2X8JB 4RYLA 4XWAA 3E05A 2FWJA 4KVGA 4MO9A 3T52A 4FC6A 4RIFA 5BVHA 5EPEA 1AVTA 1EP2B 2JHFA 1XKQA 3DAFA 4E6PA 3VKWA 1U0BB 1U9IC 2OV2A 1DAGA 1GARA 4DBZA 1MHTA 2YW9A 1DQYA 3UG6A 1P7ZA 5GONB 4CV3A 4QZVA 3GQBB 3WWOA 5HP4A 1GPNA 2R65A 2Y0EA 4C6TB 5G40A 3JWHA 1K3FA 3FPFA 2XKKA 1NV9A 2FEXA 4EFLA 2NXEA 3UJHA 4DQLA 2OHFA 1MH1A 4WW0A 3SLKA 3ADCA 2XOXA 2I9PA 2X5JO 2FQ1A 4FQ8A 4PONA 4G4SP 1VG8A 4CCWA 1HYGA 1X2BA 2D8MA 2J3QA 1C14A 3UA3A 1EQ2A 1ZMRA 4UEQA 5EPUA 3R5SA 3TSOA 2ZG6A 1OQAA 1WABA 1XROA 3FHOA 3DEKA 4LNHA 4K6MA 3T9CA 3X43A 2HIGA 4RXTA 4DL9A 2PX2A 2O3SA 4S0XA 5A9SB 3ME5A 3MWDA 4I66A 1BDMA 3RM3A 4C76A 4YGYA 6REQA 5BWLA 5KNCH 4P80A 1NX9A 3W6PA 1A4IA 1NRWA 3IC5A 3VNUA 2QA5A 4C20A 1GFWA 3FTPA 4ER3A 4YYZA 3DVAB 3BE5A 1ZD3A 4H18A 2RK3A 1DWPA 3D4PA 1J9GA 2VQEB 1E2GA 1MUUA 1R74A 3K0BA 1GZ4A 1LK7A 1AB5A 1E2IA 1PJ3A 4Y7CA 3T5DA 8ATCA 5EIEA 3F8WA 1T26A 1WMDA 1W4RA 4PZ9A 2GCOB 3Q2OA 5T5QA 2P1RA 4ZEXA 1U80A 2VEDA 2FFQA 4A8JB 2X3FA 1FLNA 4IDPA 1HI9A 2GVZC 3FB1A 3W9BA 1IATA 5B7QA 1FX1A 5ALSA 4QODA 3TF5A 2GPTA 5T8KC 2PQ6A 4LRYA 5AKXA 2FSGA 3OUTA 3IUMA 4M0UA 1D09A 4TV9B 2IGTA 4X61A 4ZVOA 4YRKA 5IKXA 5AKLA 5JO9A 1F14A 2INGX 2VZ0A 4BB6A 4I8DA 3QVGA 3ZGOA 5CDYA 5FB3A 4MVJP 4IW3B 2HA7A 4TVKA 3PJEA 4UVIA 5J5AA 4ATNA 3OTOB 1SQGA 2I55A 1M83A 1A9PA 1JHQA 3ZHVA 3AOGA 3R24A 2EWVA 4EARA 3BTVA 4BO3A 2DT5A 2QD4A 1H4QA 2HBYA 2W2QA 2FKAA 2VNSA 4ILEA 4P81A 4A16A 4JT9A 2Z1NA 4Q3DA 1MB0A 1GXSB 1PGQA 2AMFA 3I6YA 1SIOA 1CXZA 4EO9A 4P4UA 5MN5A 2QLFA 2PPVA 3NONA 1N5RA 5DLDA 1QTNA 1VBFA 4URXR 3AUAA 4D3SA 4XSGA 5DNDA 2X9GA 3KFXA 3GIWA 3LXMA 3DE7X 2YWBA 1RKBA 1OFVA 1VMDA 1XTVA 3G0BA 3HJAA 4OJNA 2V7WA 2WTEA 4HX9A 1MW9X 1XC7A 4XFKA 5FPQA 3PFGA 3ZUPA 4AP5A 9LDTA 5BT9A 5EJ8A 4F38A 1ORTA 2QRHA 1Y4SA 3CG0A 3AJ9A 3EDOA 2FOXA 1MO6A 1QWOA 3K1AB 1NVTA 1IIBA 3IV6A 3SHQA 1N5DA 2HQSA 2XZTA 3ESBA 4EQZA 5CG2A 2DFNA 5K7SA 2JLSA 4BCBA 1R8SA 3OURA 4E14A 5I4CA 2WJWA 1RC8A 2HLDD 2R96A 1NBMD 5JTTA 7YASA 1BEZA 2WA2A 1N8NA 3OIWA 1SVKA 2IXBA 3SXUB 1RYBA 3E5NA 2AOUA 3H3XA 2O7NA 3D3NA 3DGFC 2GN2A 1BO6A 2NZUG 5CT5A 3IB3A 3GPDG 1DAFA 5EP4A 4AECA 1NVWQ 1OI4A 2LDBA 4BNWA 3L18A 3RHSA 1QKJA 5LZ5A 5LA6A 1ZSNA 2XT6A 4QD3A 3NAMA 1YRBA 1BVYF 4TYMA 5TS2A 1FJ2A 3SYLA 4BB9A 3E9MA 4FVTA 4DEYA 4IO0A 4ZPXA 2BDTA 3AR3A 5C8YA 7MHTA 1DEKA 3DSRA 2GKGA 4C0HA 3K0FA 4YY3B 3P9YA 4I1SA 2DFPA 5LKRA 1NYTA 1A4RA 5TVKA 2QRKA 4EW6A 3H42B 4BCCA 3Q7PA 1KI7A 5KEIA 2ECOA 2Z6VA 1I7DA 5BSRA 1TM7E 1L4FA 1GYPA 3ZOZA 2QT9A 3A2KA 5C0OE 4KRGA 3GRFA 2HU2A 1WD7A 2F8LA 2G36A 1AMOA 1T91A 2P8SA 3EWAA 221PA 3EQ9A 5LD2B 1DO2A 2H07A 1RLIA 2XVZA 1J1ZA 4NCJA 4EX6A 1RI2A 2IC5A 2OP0A 2X2EA 2Z83A 2Y9MB 2ZJAA 3FH0A 5KYUB 4E12A 4RKYA 1KEVA 3FWPA 5KIAA 1DKLA 3IXQA 4F0JA 1IIRA 5CURA 5FBVB 2RHRA 3K73O 4J2HA 3EY9A 4N49A 4RD1A 4DLAA 4WT7A 3MTJA 1ADJA 5CW1A 4W82A 1X7DA 2JG3A 3IKVA 1GQOA 3EVNA 2LW7A 5DGIA 3GLFE 4R2LA 3CVYA 3EPHA 4BLQA 2O2CA 1IXSB 2ACKA 5J1TB 2KE5A 1F60A 1UMKA 4R68A 4HC4A 4KEAA 1GQ2A 2JIPA 4Y6LA 5EKDA 4BLWA 1NW9B 1G2OA 4RA9A 4RCZA 3IH5A 1WP9A 2GA9A 4QRIA 3ROQA 3ZTWA 1B0AA 3URKA 3NEAA 4UEOA 5JY1A 1E59A 1EDOA 2CK3A 4URFA 2VXCA 4YJFB 3SX0A 3TW0A 2PMWB 3EFOA 1BW9B 1LLQA 1UBCA 2KB0A 5EVJA 3TE7A 1KPIA 2GWRA 4A6PA 3ZCXA 1RXSA 3R7WA 1DX9A 3SC2B 2VDVE 5EE5B 2DHCA 2GERA 5A71A 1SVUA 5CA1F 2IS6A 2QW1A 3HYLA 3L9XA 2NT4A 3VU0A 4DJ5X 1HBJA 1U8XX 3EXAA 2AZDA 5D3ZA 3PIDA 3BEDA 5LQKA 1Z2CA 2SBTA 4FKZA 4KMRA 2P7HA 1X0XA 4MYRA 4REQA 2GNAA 1IQPA 2E4AA 4NDAA 1NDUA 4TQGA 1GKKA 5TE9A 4DUGA 3TRKA 1TU0A 2OKGA 3A1TA 4QPDA 4O2RA 1T1EA 1Z8NA 2FW9A 5IYZF 4IQ8A 2Q4BA 5FJJA 1GDHA 1W2GA 4GBMA 4EW1A 1FFEA 5KDLA 4AMYA 4XA8A 3LOQA 3RQIA 1EHIA 1DGQA 1E2BA 2I65A 3KOUA 4EIWA 1T9GS 5KINB 3K4HA 1QG2A 3OKFA 4MVJA 4WZBA 3ZTTA 1B76A 2YZMA 3AR2A 3CR8A 5IC5A 5HIKA 2WQ6A 1M0SA 4FYVA 4QUHA 4R7GA 4JB2A 2QZZA 1KVQA 4PYKA 2JLRA 2ODAA 3RRJA 4B3BA 1QG6A 2X7XA 1J8FA 2C3MA 4D9KA 3CT6A 4RIEA 5F4ZA 1E7YA 2H5JA 2GXSA 3LW7A 5E6SB 4CQMD 3AUYA 5HWSA 1J33A 1WPGA 4R54A 2G1UA 3NHBA 4D26A 1H66A 4QSHA 4Q9KA 1F2DA 2VA8A 3NO4A 1MX5A 2PWZA 1Q91A 2AEJA 2H52A 2RB5A 2SKCA 5PNTA 3K6KA 4UZFA 4M89A 4B6JA 1KTIA 2V3CC 1LPSA 1LDYA 3K2QA 1V1RA 3H6GA 4GOLD 4YHHB 1KMNA 2Z0MA 5DHRA 4RJTA 3KKZA 5E4JA 1Z82A 2VP3A 3N5KA 4GSKA 3TQTA 2OAEA 1I4EB 2JZOA 3A7DA 2ONKA 4P7GA 1UM9A 2QY6A 3JAMA 2QZ4A 2V7QD 3CRNA 1E1RA 5E38A 5L4LA 2HHAA 3TPCA 1S1CA 1YSCA 2XGSA 3LBYA 2IDMA 2B5WA 4GIBA 3ML1A 4Q39A 3UKOA 1ANKA 5MFZA 2IFTA 4PG4A 1EX6A 3P1JA 3FWYA 4MRMA 5DLEA 4EQ6B 4KE6A 4ZI7F 1EJ2A 2SHKA 1KFEB 4RDIA 4DJJA 1KAOA 5I8WA 3CLSD 1LBQA 1E79A 4IPTA 4QRHA 1XXHB 3C1TA 1NLMA 1A8PA 4KVFA 3HEBA 1NDHA 1E2KA 2OY0A 4I2VA 2FMXA 4LJ8A 2JEYA 4DDHA 5EMHA 1MO5A 4D4HA 1RXIA 3JQAD 1BN6A 5H80A 1T10A 2H8KA 3K0KA 4JJ4A 5IN5A 5CM2Z 1KQNA 4EFKA 5COQA 1NBIA 1YR3A 3KYJB 4FEAA 2EJTA 3ZY3A 1QMGA 2XWQA 4IVRA 3ZG6A 3M4XA 2Z8ZA 1MG5A 1FQOA 1HE8B 5DF1A 2CVFA 3B6ZA 3WL8A 1UKAA 4DPKA 2FQYA 2RKOA 2MSDB 2AOXA 1I0ZA 3IPCA 3HB7A 1GLNA 4IJUA 3UK6A 5EWJA 3VOAA 5C32A 2O4CA 2PT9A 4FYIA 3C6BA 1ZGAA 4HJRA 4JQCA 1EUCA 3H16A 5J59A 1NTOA 1LWOA 3K20A 1JH8A 1C9NA 3PLNA 3ZDFA 2B4QA 3NUGA 2VJAA 3VGJA 5EUQB 1U0JA 5U1PA 2P69A 5HHTA 4G0VA 3GAZA 1VB3A 2AZTA 4JNCA 1II9A 3FNQA 3TVDA 1N5KA 2KQUA 2P90A 1FIUA 5FUQA 4EF4A 1TD9A 3ZS9A 5HRAA 7ADHA 1U63A 1UFQA 5I7UA 3L43A 2HJ9A 3I64A 1NYLA 5G4KB 3RKUA 4J29A 1C30A 4LFCB 3WNQA 1UPTA 2QP9X 4HMOA 2YV3A 5K0TA 4JWTA 2IYLD 2L19A 1OFGA 3OZSA 2CF5A 2AKYA 4OHCA 1JG6A 4GQBA 1EE2A 4WY5A 3GUUA 3HN6A 2VIIA 1Y3IA 1EX1A 1KOJA 1LSSA 2PCJA 1GAWA 4UFOA 2KX7A 4DM4A 4RJKA 3D4NA 5KJ1A 1ZGHA 5CVJA 3AVQA 1NSFA 3R76A 2WSYB 1G3IA 2HIMA 2IXEA 3GT0A 5IUKC 4F1KA 2W2XA 1QCCA 1OGYA 4IO1A 4EA8A 1NNUA 4CUKA 4CKYA 1NJ2A 1HETA 5CFOA 1GPKA 4RLFA 5FO0A 2GBLC 2GN1A 5TEWA 4Q4HA 1OFUA 1HZJA 2F64A 2YN0A 3BXXA 4DV3B 3K7EA 3GGGA 1TPYA 1Z6AA 2TECE 4DANA 3WLJA 4BO4A 2BGJA 2MSKA 1QRAA 3DUFB 4DKJA 1U7DA 3FSEA 1P0PA 1DI0A 4C88A 2B2CA 2OOSA 5DHPA 3LDAA 5BWOA 2ZSEA 1XYVA 4YI3A 4Q15A 5IAJA 4I55B 3K6JA 1ZJWA 5E1DA 1KS2A 2J45A 4QFDA 3G8BA 3VKFA 1H0RA 1M73E 3U5ZB 2NNLD 4PC7A 3U4AA 2Z6UA 1GR0A 4XUGB 4KGZA 4M0EA 3SZ3A 2ZM6B 4TL6A 2VHXA 2JGFA 4TUYF 4AJ9A 3MJHA 2E5WA 4WWHA 1QGOA 5I47A 2AWOA 4DAEA 1UC4B 4YJDA 2WFLB 5ERXA 3R6DA 3ZY6A 4OTZA 4NXNB 4IUDS 3Q8WA 4WNCA 2P9FA 4MUYA 2CYAA 1IZ0A 2OAP1 4KXFB 3T35A 5JFGA 3U6KA 1CRPA 2GD0A 1EP1B 4O4IF 1KZGB 5GJBA 2DU8A 4JROA 1H65A 3LBNA 1DAIA 1Q7TA 3ZLTA 1NYQA 4GX0A 5DGCA 2PUFA 3IO5A 3AU8A 4EY8A 3DE3X 3ROZA 1AK1A 5KQLA 3A25A 3L7LA 2PKYX 4PVCA 3BDAA 1DBIA 3FPKA 2Z43A 3IQEA 3KAQA 1JHRA 2Z9BA 4FZ5A 1AG9A 5CCBA 2W2NA 2H4JA 1FS5A 1NJSA 2OP1A 3GJ4A 4GKKB 5CB6A 1T8WA 2AK2A 1V3TA 3QZUA 1I3LA 1PNTA 1IZ8A 2G72A 1XCGB 1XTBA 2PUWA 2WICA 3MD0A 5HBRA 4C6SA 4Q9AA 1VG1A 1A2KC 1JMYA 4K0KB 3F4KA 2WVAA 2IIBA 1RI5A 3H0EA 4KO3S 3OEWA 5GV8A 3FOCA 1PYDA 3RTAA 2VWPA 3MTBA 5BWMA 3DAHA 4G5XA 1SAYA 3V00A 2WU0A 3GD7A 3IUSA 3NHJA 4H7FA 3ZE2B 1LTQA 3WLOA 7AT1A 1NVXQ 2QG9A 3OPVA 4G67A 4JEIA 3X44A 3D7KA 1IUPA 2MINB 4B81A 3OE7D 1PD1A 3TKLA 3E7DA 3Q88A 4V3CA 4YUWA 2Z2ZA 2IQ5A 5A4KA 1X1EA 1DRKA 4RV4A 3LT1A 2NU9B 2GASA 2ZIXB 2ZUDA 2P9QA 3O3OB 4YRQA 3RLFA 1JIJA 3CW2A 2RI1A 1GYQA 1LC0A 4IEIA 4J2OA 3V55A 3VC3A 3UMYA 1NU6A 4F2HA 1T0UA 1R7RA 4OQPA 1KETA 5BNZA 3BORA 3OLXA 2YFYA 4EI9A 1ZGCA 1BWPA 1P29A 4BHTA 1SM4A 3IUBA 4TVSA 2H7YA 2IZZA 4D80A 3JWGA 1URPA 1NN5A 1XJ5A 3WHIA 1E2QA 4WCFB 1ABBA 1O58A 3KQQA 4ZV9A 3PB3A 2D0OB 5F52A 5TPWA 4ACAA 1FJHA 3PVCA 1FDRA 4IHJA 4S3MA 5BYAA 3ZLJA 1YI8A 2Z58A 1Z5PA 2VAWA 3GLFA 3DPSA 1THTA 3THRA 4F3YA 4GOKA 1V11B 3PGXA 1R4NA 5LQRA 2F4VB 2QN2A 3HU2A 2AD5A 2DQKA 1C9YA 2Z1MA 1ODLA 1JH9A 1EM6A 2DPYA 2FZGA 2TMYA 3D6VA 4H3VA 3ZW9A 3VKGA 4XQ0A 3JWPA 1CV2A 1OHHA 1RS0A 1N2HA 4XM2A 2KBEA 5ALGA 3IPLA 1WULS 1QH9A 3LC1O 1IUOA 1RJFA 3ZVNA 2QZSA 4HD8A 1MA0A 2BJWA 1EXVA 3CIOA 2P4QA 4NOMA 3IEIA 1BE8A 2P40A 4MR8A 4YP6A 2E6KA 3E7XA 1SHLA 2I7XA 1S6YA 3I83A 2WYVA 5EL0A 1RTKA 2ZJZA 3UH1A 3UK2A 1K6EA 2C92A 3UWOA 3G17A 3FUCA 3P2EA 1C3LA 5GJWC 3ZU2A 2IHYA 4Q82A 3SZUA 2X15A 5L95A 3I0MA 1UZLA 2B94A 3QPVA 4Q6BA 1YZVA 3B52X 1P7VA 4ZYLA 4E30A 2NGRA 1J23A 2GZDA 1CHNA 1C8VB 1OWOA 3CFYA 3OD5A 5FBLB 5THKA 3HKEB 4FWTA 3C3MA 3L0SA 1ZK1A 4GWGA 3HRIA 1V8FA 4P2BA 4DIKA 1PEDA 1BE6A 1WU8A 1FFXA 1H05A 1U9YA 1ZQ9A 5JSKA 3ETEA 4ZZ3A 1LBEA 4JI2B 5LDGA 5K1ZA 3MJSA 1V37A 1N5JA 3VR5A 1NKVA 4IOMA 1L5MA 1LQUA 1C7JA 2C94A 1EDZA 2VQSA 5C8YF 2RGNA 4K5QA 1IBKB 2ANBA 5AW6A 1DRWA 2PWBA 1ISSA 3AIKA 5KKCA 3OCYA 3GGCA 4LSMA 1RTTA 1XZ8A 1HF3A 2VAMA 1T8SA 5F5NA 4Y7DA 2ID8A 3PENA 3G2LA 3GRVA 4XYEA 2J4DA 3G9UA 1N32B 2D0DA 2Q49A 4ITUA 4ML3A 3O2QB 4IEFB 5BMVA 1SK9A 3F7NA 1Q14A 3EIEA 4PQRA 1OBVA 4YACA 2B83A 2JAHA 3IAM1 4C7VA 1U1IA 1N2IA 2ZOSA 4D8XA 3LHFA 2IITA 4KRFA 1S2LA 1CZOA 4QTUB 1D1TA 2J0EA 4TYYA 1KVSA 4I8IA 3QBVA 1BSVA 2WWHA 3AESB 1GCAA 3CS3A 4ROTA 4Y1RB 5AHRA 2OK7A 3UJ3X 1LQ2A 1IYZA 4NCXA 3HV2A 4DF3A 1BVRA 4I1VA 4UDNA 2VRCA 5G0SA 4ALKA 1M75A 4KDRA 4DVGA 5IWCA 3F78A 3GVCA 3ESAA 3GGDA 3HFRA 5KYVA 1GL9B 2IZ0A 2PUBA 4R1LA 2FCAA 1WZEA 2YFHA 3SKYA 3K71B 3V4RA 2CFSA 2IYFA 4FZ3A 4WK0B 2GFIA 1J2EA 3A8TA 4IIYA 3RSCA 3BCUA 4UREA 1QO7A 3V1UA 4YRSA 2ZAGA 3PF9A 1JQBA 2ONCA 4CF3A 3QUCA 1UMBB 3FSJX 1DV1A 3N6RA 5D7BA 5KNDA 3WWEA 1QFSA 4MV1A 5EJFA 4RTMA 1QSGA 1NJ1A 2RGNC 3I9V1 4YJHA 1UC9A 3BE6A 2FSSA 5FBZA 3NKLA 3SXPA 1X1AA 2IYRA 3ELDA 3REQB 4LJRA 3A1UA 1M2HA 5K01A 3ICWA 5KO2A 3ZGYA 4AN1A 5L8VA 2IDZA 5FUYA 4BP9A 4LF4B 5IANA 5HX7A 4OQYA 1TGYA 3GVHA 4ISCA 3SR4A 1Z22A 4ER0A 1ODTC 3RLIA 4CG1A 3I1JA 4JZKA 5HPYB 1F9EA 1SVLA 3BXGA 1JFFA 2WIBA 3FPAA 3PC2A 5L3SB 3PEWA 2PEZA 4ND5A 4RX1A 3KKEA 1J8YF 1U1CA 1QRRA 2WJYA 3OJCA 3SDSA 2QLBA 1TL7C 1I1OA 4BO0A 3IGFA 4MQBA 3G7NA 3U09A 4ND1A 2D3WA 3D1LA 3MPUA 5A2QA 5C35A 1E6CA 1JL3A 3Q0IA 3GFBA 1GFIA 3FPSA 2PSHA 3T7SA 1YZTA 1I2BA 3PNVA 5K09A 1LS6A 1O89A 2OZLB 3BA1A 3IUEA 3N2IA 2XR1A 4BQEA 3QKSA 2PN1A 3DF7A 1U3UA 3PUKA 3G82C 4CV2A 4AS1A 4TZ0A 1SD2A 1PNQA 4C04A 2GHRA 4IIXA 3I8SA 3U4QB 4EMSA 5DN9A 5KSYA 4LJKA 2P9EA 4C0QC 2WHPA 4YJ2F 3VU1A 1W76A 4PZPA 5AHOA 3TLKA 3U17A 5HUHA 1D2AA 1WHSA 2UV8A 3W5BA 2XX3A 3G8AA 3R0QA 4RGQA 2SKEA 3INRA 4ND3A 3RFXA 1C41A 2A0WA 2FWBA 2Q6KA 1NN1A 5KWEA 3TMKA 2J3IA 2C29D 4DTCA 2HA4A 1KNXA 1W49A 4MA4A 3FVVA 4D3FA 2GO7A 3LVQE 4LSWA 4WECA 1PGJA 2D54A 3WJ2A 2PVCA 3UB3A 2BV3A 4B6RA 2G1PA 4X7RA 3V8NA 4P7BA 4ZYZA 2EL7A 2VJPA 3W79A 4BB0A 3EVCA 1IPEA 2JFOA 1NSYA 1QG0A 2IUTA 2ZBVA 3VR1A 4D9IA 2CZQA 4F9FA 1DEHA 4GFDA 5LXTA 2F3UA 4MQ6A 3EW9A 2BCGY 3N2YA 3RS7A 3EYWA 1I24A 1BXGB 1JQAA 2EKZA 3FMVA 1J2RA 3FPEA 4Y2XA 2IYSA 3GDOA 3PPVA 2HWYA 2J9FB 3DWFA 3FNFA 4U2EA 5DTMA 3ZXXA 2FUEA 5C7LO 3GRKA 4M9UA 1UF9A 4P5EA 1Z6QA 3IV7A 3UAOA 4P35A 2EZ9A 2CMHA 4HLUA 3MXOA 3V8MA 2VZ8A 3E9YA 1JKXA 1YCDA 3WK7A 3VO2A 3B2QA 2RIPA 3THYB 1CZRA 5DNCA 4HFRA 4DG9A 2BH9A 1Y80A 4YAIA 1XZBA 5C31A 1G38A 5FBWB 4ESHA 2C4TA 4X5OA 4ARAA 2QN7A 4PSUA 4U2GA 1I94B 5FA5A 1FP4B 4W7HA 2XNDD 3V33A 2YDYA 5JAPA 1Q92A 2QTHA 1K06A 1HDCA 3EVDA 5IAKA 2WKRA 1NLYA 2YTZA 3JARB 4V2UA 4HQFA 4KWTA 3UY4A 4BNTA 5K3OA 4NZOA 4WN9B 4B7ZA 3U56A 4DR1B 3EMDA 3O4JA 1XZMA 4Q7JB 1HE3A 1M8JA 1PJBA 4BFVA 1BA3A 2QL9A 2VF7A 1MDFA 3HA3A 3K32A 2B35A 4KKXB 3VISA 4E1VA 1GG2A 2AE2A 5JJIA 1F4LA 2I2DA 3D6NB 4YGXB 3DZDA 1KDRA 3IUJA 3EG9B 1ZHHA 3OT1B 3N2EA 1M6VB 4HEHA 2IXGA 2PKCA 3FDIA 4R05A 2Q1SA 2RKBA 2VTEA 3OX2A 1W0CA 3U4CA 1FL9A 1W48A 2RHGB 2BCEA 3U61B 4F5ZA 1L5YA 4O2LA 3SF0A 1JDBB 3LLVA 1QKIA 4XTRA 5ALQA 5F1YA 1OLUA 3KKOA 1WLYA 5IXSA 3KXKA 3K30A 3KQSA 2AX3A 5LLDA 2AMJA 1PU2A 2B4AA 2F3TA 7MDHA 5IT5A 3NOQA 3V7NA 4ZGWA 1YJ8A 4DM3A 1LDEA 4H35A 4BO8A 1BDBA 1K7CA 3OQNA 2DY1A 1UT5A 4U3JA 5CX1B 3IS3A 1L7VC 5LYJA 2GPWA 4MUAA 2HCBA 1ZBDA 3HJUA 4WERA 1CB0A 5E4YA 3D9QX 3EGVA 4ZT3A 4ZT2A 1B8PA 2FZVA 2P2SA 1P9WA 2W6CX 4HHEA 4P08A 4X84A 1M66A 2C5LA 2HRRA 3QG1A 2MMGA 4X64B 4DB2A 1P7WA 2ZXFA 1LPOA 3RCBA 3I9LA 3QU5A 4DDWA 4J7AA 1PZFA 2BGIA 3FN4A 5AJVB 5LC1A 1CULC 3CIFA 1CNMA 3GRPA 3QEJA 2CVHA 3CZ5A 3ZUGA 1TPZA 4EYEA 3AR5A 2XT9A 2JRLA 5EZ6B 2X0EA 1J0CA 1RWPA 3ETLA 2HV8A 2XGMA 2D2IA 3O3NB 4L02A 3VR6A 4BQQA 5HOQA 1X3SA 3NH6A 3KLMX 1ZM2A 3QKRB 1LW7A 1OZAA 3HRHA 3PGJA 1WSAA 3V46A 3R8FA 1RXWA 3EH2A 2FEAA 4ZDJA 1TNDA 1Y5NA 5UKDA 3K96A 1WW2A 3QPWA 4TS3A 3AEZA 2OCIA 4ZARA 2IS2A 3EDYA 1V35A 3DL4A 3NBQA 4WSOA 3ZV6A 4CI9A 4BVFA 3HJTA 4BWVA 1BMQA 3ND7A 1KEUA 4MVJM 4ZC8A 3T0FA 1IOVA 4O4HF 4HKTA 1C0PA 2AUMA 3OTWA 4JLKA 4OQNA 2HUPA 4F7DA 2PVSA 1U99A 2F7SA 1FP6A 1QQ5A 2WAYA 3L01A 3VVLA 4D8WA 4HQ6A 1H2FA 5KBYA 1NAHA 2OLEA 1PS9A 3UAYA 1XLVA 3SJAA 5BRAA 1UC8A 1NMEA 1QOZA 4XFDA 4CMKA 3PQFA 1Q84A 2FSHA 4K6KA 3M4NA 2OGZA 3R23A 4ER7A 5D85A 2ZXEA 1RBMA 1NQUA 3IDQA 4ZO6A 1GKUB 1QS0A 2BT4A 1VCIA 3E9ZA 1IRXA 4JL5A 3QBEA 3LGAA 1Z08A 1G8AA 3RNLA 3U4HA 4GLJA 1NG1A 3TLZA 2QTNA 2EX0A 2XKBA 2GI4A 3GP8A 3OF2A 3OOSA 1MABA 5AT1A 1CUVA 2BN4A 3CXRA 2ONJA 4PAMA 2XLBA 4M0DA 3FKSA 3AYZB 1M1YE 3GVIA 4HWTA 3KM0A 2LVBA 4O1IA 5JXHA 3NHPA 1ZFNA 4J0JA 4GKJB 1Y5LA 1P4JA 1KE2A 2YZNA 4WKCA 2JLYA 4INAA 4M49A 1F06A 1E32A 2IZ5A 1H5QA 2IUFA 2GAOA 1SXIA 2FFRA 5DLQC 5DULA 3K9GA 3VSBA 1E1YA 1NXPA 1Z6ZA 2X0IA 2FPWA 3GDFA 1TA9A 2OBYA 1K2WA 3GH3A 4AXBA 4D82A 4FDUA 5ED4A 3DZBA 2WJIA 1FRZA 3I76A 4GGMX 4HMQA 3FMFA 4N9WA 2DRIA 2P3SA 3AGPA 3CU5A 4QM6A 1PZXA 2FGJA 5EZYB 2FP4B 4OSOA 1RI4A 3IR6A 3BGDA 2K87A 4HEA1 5DP1A 1E94E 1GEEA 2COUA 3LDGA 5K0NA 4CLRA 3PLAE 5JRZA 3CH7A 1GSOA 3EUEA 3NVAA 2JHGA 4X95A 5AXCA 4WXYB 2W6ID 4RM3A 4LQCA 4WFQA 5JZOA 4MKZA 4D4GA 1RU3A 4NCBA 4R2IA 5I51A 3SIPA 2WT8A 3E03A 4HBGA 4G5SA 5FYQA 1YL5A 2YNMA 3B7WA 3GLSA 2CDAA 1SBCA 2NZ2A 3N87A 3ROTA 2ODNA 3E9NA 4PNPA 1C3XA 1II8A 3TTYA 1W5EA 2PK3A 2O8VA 2I6SA 3ZK9A 2LIVA 2DTEA 3R3UA 3SHWA 3DDNA 3T7IA 1ZISA 1TK9A 2B8WA 2GPJA 1TC2A 3II6X 3VJRA 4KIJA 2X5OA 2H85A 1X7GA 2JFWA 4IXTA 5DEIA 4P34A 1FYDA 3N59A 1LI4A 2DKOA 2HMYB 2VF8A 2HSEA 4L0QA 3MMZA 1VI6A 3I5AA 3F6EX 3ZK7A 1ATIA 3BWYA 3W8RA 5AI5A 1G63A 1XRMA 2MHCA 3KV1A 4JR1A 5A7HA 2VKTA 1SCIA 3VZCA