1SNYA

Carbonyl reductase sniffer of d. melanogaster
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
248
structure length
248
Chain Sequence
HMNSILITGCNRGLGLGLVKALLNLPQPPQHLFTTCRNREQAKELEDLAKNHSNIHILEIDLRNFDAYDKLVADIEGVTKDQGLNVLFNNAGIAPKSARITAVRSQELLDTLQTNTVVPIMLAKACLPLLKKAAKANESQPMGVGRAAIINMSSILGSIQGNTDGGMYAYRTSKSALNAATKSLSVDLYPQRIMCVSLHPGWVKTDMGGSSAPLDVPTSTGQIVQTISKLGEKQNGGFVNYDGTPLAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords sniffer CG10964-PA
publication title Structural Insights into the Neuroprotective-acting Carbonyl Reductase Sniffer of Drosophila melanogaster.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 87
structure length 248
sequence length 248
ec nomenclature
pdb deposition date 2004-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1snyA00
4PRLA 4XYLA 3C8MA 1Q0LA 2OP1A 3JQGA 2Y66A 4R3NA 4R4JA 1IB6A 4A03A 1JQBA 2P9CA 2EP5A 4FQ8A 3G3EA 2J3KA 1QG6A 4FS3A 1ORRA 3N74A 5I8WA 1XQ6A 4UVHA 2HQ1A 1VRWA 2P5UA 2NWQA 4XYBA 4JJGA 2D1YA 4P8RA 4DYDA 4BB6A 9LDBA 1QYVA 4ND5A 3TWOA 3VC7A 1L7DA 1NFQA 3RI3A 5HM8A 1GDHA 4IDDA 3TRIA 1M6HA 1UAYA 1GQQA 4QTZA 4BNNA 3O38A 3SC6A 1ADGA 1HEUA 2VYND 5MDHA 4MPDA 1GR0A 3WR5A 4U7WA 4RJTA 1UAGA 4E5NA 1I2BA 3F47A 3H9UA 5G4KA 3PHHA 3WSVA 2D5AA 2B5VA 1ZEMA 2PFGA 1DXYA 1E3WA 3AW9A 1F06A 3H65A 3ITKA 5TF4A 4XIYA 4RVUA 3PWSA 5DCUA 5ITWA 4PGFA 1E77A 3PJDA 1UH5A 4HP8A 2UDPA 1N7GA 2JAPA 1ZW1A 3BMCA 1BDBA 5HWSA 1W4ZA 4XKJA 4PZDA 4RQTA 1WAMA 2QG4A 3G49A 2I3GA 4R5HA 4PN3A 1LEHA 1FJHA 4HFMA 1UP7A 1ADFA 1XQ1A 3ZHYA 4EBFA 5JYDA 2P9EA 4R16A 3NTRA 4IY1A 3GUYA 1Q7BA 3KHUA 3I23A 2GD1O 1EFKA 5L9AA 1K3TA 3QSGA 4PLPA 3DBHB 1QKIA 1X0XA 3L07A 3DB2A 3ONFA 3JQAB 1YB5A 3AFNA 3RU9A 1FDTA 1SNYA 3EGOA 3LLVA 2W2LD 1LSOA 3HHPA 1TT5B 3D3WA 3DBHA 4Z0HO 3WFIA 1CDOA 4D46A 1QMGA 2O2YA 2VZ8A 5K0ZA 2X58A 3LZ6A 3JQAA 4CMHA 1LTHR 2NADA 5COAA 2P4HX 4J1NA 5T5QA 1CQJA 5KVVA 1PR3A 5BT9A 2NVUB 1TT5A 4J1TA 4D0RA 1RYEA 2B36A 4IINA 3O03A 2PZMA 2V6BA 1LU9A 4YBZA 3B1JA 1HYEA 1PGOA 2JAHA 3U9LA 5TJHA 1SOWA 4DQVA 1Y5RA 3E48A 2PY6A 1IPEA 1CYDA 4WEQA 3CPSA 3DZJA 3ZNOA 2YUTA 4CODB 3HN2A 4MKZA 3KLPX 1OMOA 3ONEA 3E9NA 4BNJA 1I8TA 3BXXA 4NI5A 3L4BC 3LDHA 1NXQA 1KEUA 4ALLA 4OKNA 4PLVA 4WECA 3HDHA 5JDIC 4R1TA 4TKLA 1I2CA 2BFMA 3ZWMA 1ZXBA 5L3ZA 3KETA 1Y81A 3INTA 2EF1A 1FF9A 1ZFNA 5JW6A 5KCZA 1WP4A 3F6YA 3A14A 5K9ZA 5DCWA 5DOZA 4GL4A 3UN1A 1YJ8A 3JQBC 2R00A 2X5KO 3G0OA 3UHAA 1NTOA 1WZEA 2AEMA 2G76A 2X9NA 4NK5A 3OIDA 4WEOA 3VTZA 2V7PA 1O9BA 4CLHA 2BH9A 2HMVA 4RGBA 3QE3A 4J2OA 3CE6A 3ASVA 3ZV6A 4JXKA 4D79A 5JY1A 3WXBA 5JCJA 4NZ9A 3MEQA 4KMSA 5JDCC 5I9MA 3ZWPA 3BHJA 4XGKA 5IZ4A 4CM6A 4QFCA 1PQPA 5KJEA 1LC0A 4B8ZA 3E5RA 4E6PA 4NBTA 3NJ4A 2E48A 3AY6A 2GF2A 3U09A 3IL2A 5KJCA 3K30A 3BA1A 1NQAO 1NAHA 2OZPA 1N92A 3A9WA 4IPTA 5U9CA 3N58A 1YOVB 3EMKA 2BF7A 4BNMA 2VNSA 2CF6A 1HXHA 1E3LA 2NACA 3LT0A 3DAPA 4RV9A 2DUWA 2IZ0A 2D2IA 4IQGA 1G0OA 4UVDA 4IJKA 1GQ2A 3NT2A 1LRKA 2P5YA 3OBBA 4GQAA 4BHTA 4E32A 3PGJA 4I5FA 1YOVA 4LMRA 4RL6A 4UEJA 4BO1A 4ZGWA 5TGDA 3ZWXA 2ZQYA 3RBVA 4DTIA 3ZH2A 2PH3A 4D7AA 2PWZA 1HDCA 1NQ5A 3ANNA 4ALIA 4C7KA 1CETA 1XKQA 3WDSA 3NJ8A 4CM4A 1B8VA 4XJTA 2VQ3A 2X22A 4HNGA 3EYWA 1WVGA 1UP6A 5I7EA 1KEWA 2DU8A 4BO5A 1AN9A 5IN5A 2NVBA 5A3VA 3HB5X 4EZBA 4AJ1A 3VZQA 5I7FA 1V35A 2O4CA 2XXBA 3H3JA 1T1SA 3PHGA 3DZFA 4UEOA 3VPGA 3DDNA 1EZ4A 5EPOA 4EITA 4W7HA 1U2DA 3KSUA 3U4IA 2HSDA 2X0JA 5FI5A 3GF4A 2DUUA 5EN4A 5DBGA 2C20A 1XYGA 3OQ6A 3PEFA 1SBYA 2G82A 4E2WA 1PL8A 1F17A 3QY9A 2QX7A 4K28A 3PJFA 5CG1A 2HMWA 1GUYA 1R4MB 5CFZA 2O3UA 3HB4X 5T6BA 4RDIA 1MLDA 2VUUA 4IIVA 3QRWA 4ID9A 2C2YA 3DR3A 1VJ0A 4OH1A 4CMEA 3OETA 2FR8A 2XF8A 4KTTE 4RVGA 3ZV4A 4CM7A 1DIGA 1R4MA 3WJAA 1E1MA 3WFJA 1H9BA 2Y1DA 3VVCA 1D3AA 1P9LA 4MVJM 1VLLA 2C7GA 3I52A 2AMFA 2PD6A 3K5PA 3JQEA 3AFMA 2LDBA 1KC3A 1PX0A 4KTVE 4AJ4A 3IP3A 4AG3A 1JVSA 2Q46A 3W6ZA 1HDGO 2ZIZA 2OL4A 4E12A 3BHMA 3DFZA 3WGHA 1J49A 4BMVA 2Y1GA 3GLQA 3V8BA 3WX0A 4GKBA 4A2CA 2AEJA 3K9QO 4XZ3A 5CP8A 3ETEA 3WLEA 1IPFA 1T2DA 1Z75A 4X54A 4KWIA 5AXBA 4YRDA 4RPGA 4L75A 3FBGA 1PWXA 3ZGYA 2ZTMA 2O3JA 2OO5A 4HFJA 1R66A 4ILKA 1LNQA 1NAIA 1A27A 4CQLB 4O63O 1C0LA 5B12A 3TF5A 1H9AA 2I67A 1UP4A 4CM3A 4HADA 4XGIA 1QYXA 5JE8A 1H6BA 3GNTA 5EMHA 2FMUA 3OP4A 1ISJA 1UDBA 3JD4A 1KVRA 4B4OA 3QVXA 1GYPA 2CDAA 4FIZA 4CQLA 1EQ2A 3CZMA 3HN7A 3SLGA 1MX3A 2PK3A 5DF1A 4J1QA 4YEDA 2CSUA 3O26A 8LDHA 4XA8A 4M54A 1HL3A 1QRRA 1TVEA 2EXXA 4JK3A 4UVGA 2VT2A 4IIUA 3DEYX 4D45A 2WD7B 4MP3A 4TWRA 2FWMX 3MOIA 1IHXA 1P1HA 1AHIA 1A72A 3GDGA 4E5YA 2IEBA 2VWGA 2C07A 3HDQA 2Y99A 4OOEA 4O0LA 3DOCA 4H16A 1I30A 1VI2A 3LLSA 1XU7A 4WLFA 4MVJI 5G2OA 5IXYA 1ULUA 2WD7A 3TSCA 3IKTA 3LU1A 4XGNA 3JQ9C 4YTEA 3AI1A 4WNCA 2FP4A 3F5QA 1QV6A 1J4AA 4E5PA 3L9XA 3ENNA 5DT9A 2E82A 1YRLA 2CVQA 2I66A 5IZCC 1LUAA 1SCUA 3GEDA 3KYBA 3RUHA 1BVRA 4J9UE 1ISHA 1DLIA 2AHRA 1FDWA 2DQ4A 3ZWAA 5FWNA 1ISGA 3H5RA 3KTDA 1ID1A 1K5HA 4JN6B 3KOUA 1E3JA 1RJWA 1U8XX 1YONA 3PQDA 2BFOA 2Q1WA 1LC3A 1NWHA 3STHA 1WDKA 5AYVA 1Y8QB 3TZKA 3IC5A 3GGPA 4IMPA 1YDWA 1ISFA 3TN7A 1O89A 3DTTA 2TMGA 2IZ1A 3BTUA 2ZYDA 4QXMA 4BIIA 2OORA 2I99A 4XQCA 5A9SB 1LXCA 3DZGA 4ZD6A 3UICA 2EV9A 2HK7A 1Y8QA 4O59O 3G1TA 5JPIA 1N1EA 3IMFA 1O5IA 2OUIA 4ZJUA 3IKVA 3I4CA 1GEEA 4UVIA 4CR7A 5EIOA 1OBFO 1ZMOA 2ZTUA 2X5OA 3DBRB 3AUUA 4RDHA 4TRMA 2I76A 5TX7A 3FSRA 4RO0A 4A26A 2IXAA 4CUZA 4E3ZA 2NU6A 4H15A 1OOEA 2DPHA 1ISIA 3CH6A 3NDRA 5F1KA 1R15A 5H83A 2XOXA 1M6WA 1LLCA 3FPCA 1T24A 3EUWA 4CLRA 3C7AA 4NR0A 3DBRA 2QZZA 4EUEA 1E3IA 3CUKA 4R41A 4ROSA 4G65A 3WB9A 4AJPA 1NVGA 4LRSB 1N1GA 2X9VA 3R3JA 4DREA 4G81A 4ZN6A 3UAGA 4ZHSA 1PJ4A 3AY3A 3RJ9A 1D4FA 4IZIA 3PFWO 1P1KA 1A7AA 3ADOA 1ZSYA 1VSVA 4OAQA 3TZHA 4EJMA 5KJ1A 1KYQA 1IL0A 4GKVA 4ND1A 1YVEI 1MG0A 4CV3A 4HXYA 2HAEA 1SEVA 2VTDA 3RQSA 2TMDA 4OKIA 4PG4A 4BV8A 5IN4A 1DPGA 2EWMA 2ZJ0A 1U4OA 3JD0A 2IXBA 4FFOA 3HUDA 2P91A 3QLJA 3I9OA 3AOGA 3RUFA 3ZDFA 3GFBA 4LN1A 3WIEA 3WGYA 1C0IA 4ZICA 4BO0A 3AOEC 1CEQA 5TSDA 5FF9A 4J1SA 4XQEA 4YJDA 4JJIA 1W0CA 3AUTA 3SBOA 2DTXA 4M1QA 1LSJA 2O50A 3HNPA 4M8SA 1GPJA 1V8BA 1YL7A 5IDXA 3P5SA 3WNQA 4AL4A 3NX4A 4JNKA 1KVTA 2VN8A 4XQ9A 5A04A 3JQ6A 4DPMA 4FSHA 1Z82A 3VH1A 5B1YA 4L4RA 3NTOA 1NPYA 5EQFA 1WWKA 3BYZA 2HJRA 4NQZA 5L4LA 3DHYA 3V1UA 2DPGA 4A73A 1UDAA 4XEHA 4DA9A 4BS9A 3HDJA 4BNWA 4GMGA 3GVHA 3LF2A 1ENPA 1NR7A 2DT5A 4YCAA 5K6AC 5FFFA 3TNLA 5CPFA 4TROA 3IUPA 4BNZA 1NNUA 4XYMA 3FI9A 4IBOA 5A5FA 2WTBA 3TPCA 4HFRA 1EK5A 3WIDA 2YDYA 3ANMA 4YAGA 2X6TA 3AK4A 2EEZA 4LCJA 4YA6A 2FHSA 1NR1A 1VPDA 2NU7A 4K9DA 4XWYA 2RH4A 1P0CA 4MDHA 4YT8A 4WLEA 3FBTA 1T2FA 1C0KA 2PV7A 2WSBA 5TRTA 4BNTA 3HADA 4WCDA 2YQ5A 1JDJA 2Y1CA 4I5EA 3S2GA 3JQ8A 1Q0HA 3FNHA 1FXSA 4ND3A 1U4SA 3RAJA 4MINA 2UYYA 1E3SA 3D5QA 3GRPA 3GMDA 2BGKA 1WLYA 2FRDA 3ONDA 2NM0A 1PGQA 1BW9B 3HSKA 1P1RA 3DZKA 3EVNA 1PS0A 4Y6PA 3V2GA 3ZW9A 1JAYA 2AG8A 4YRAA 2GN4A 2VHZA 3JYPA 5IDWA 3GQVA 2GN9A 1LQUA 3OSUA 4XQGA 1JU9A 1QSGA 1NHWA 1BW9A 1E7WA 2Q3EA 5GMOA 5ES3A 5A06A 4FGWA 4Z9YA 1PJCA 5IG2A 1BXGA 1BXKA 5DBIA 1E6WA 3A4VA 3RROA 2X7HA 4YT5A 4AVYA 1QORA 3H3FA 3ZNQA 5A02A 4R9SA 1I01A 5G0VA 2GNAA 4BUCA 3WJ7A 4W4TA 1HDXA 1BG6A 5I7SA 4XJSA 3OECA 1KVUA 1GU7A 3HG7A 3O8QB 3ZWYA 1YBMA 4YQYA 5C3MA 3R6DA 3PIIA 1ZBQA 4OXKA 4BL5A 1B15A 3EHEA 3A28A 2C2XA 1TLTA 4DBZA 3O8QA 1G6KA 2AQKA 4HUJA 4OQZA 3ZV3A 4BKRA 4PLHA 3I83A 4H3VA 4ZU3A 4FR5A 1S6YA 3R3SA 5EJ2A 1V3TA 5A1TA 3QA9A 2PR2A 1IZ0A 4GVLA 1T1RA 3L9WA 4R1SA 1VL6A 1NWCA 2ZCVA 3ROQA 3QWHA 3V2UA 4ZQBA 1H6CA 3MZ0A 5GZ3A 1HETA 1YBAA 1PS9A 1E1LA 2GPTA 3QWAA 4WK6A 2ZK7A 3MJCA 3KYDA 3QVTA 1OZAA 4BNUA 4YAKA 2GERA 1LDYA 3L4BA 1R4NB 3WYCA 3UF0A 5B37A 4ALKA 1I5RA 4DBVO 3K73O 3IP1A 2VRBA 1LRLA 1EMDA 4BNHA 5I9NA 3GK3A 4YT4A 1GZ4A 3KYCB 2SCUA 5U1PA 4WUVA 4D3SA 3K6JA 3GG2A 1R4NA 4WGGA 2PGDA 4HFNA 2EW8A 4YJHB 4GX5A 4IDBA 3WICA 2AQIA 1C0PA 1F8FA 3FNGA 1DLJA 3BZUA 4G2NA 3T7CA 4IM7A 3ZWBA 3P7MA 3M2TA 4BB5A 3C1AA 3JQBA 4W9NC 4CMKA 4XRGA 3UVEA 1Y9AA 1A5ZA 2DKNA 3ICCA 3P2OA 1GEGA 1P0FA 5DNAA 1R0LA 1E7QA 4E2XA 5LDHA 1PU2A 3AJRA 1QYCA 3VZPA 4BQRA 2DBQA 1HDYA 2CMDA 3Q2IA 1NPDA 1KS9A 5FYDA 4NG5A 5TT1A 4IDFA 4R68A 2DTDA 3H2SA 3X2EA 4B3HA 3WTBA 5JDCA 2EKQA 3LT1A 1UXKA 4K6CA 4LGVA 4Q9NA 5JAIA 1DDOA 3COSA 1GUFA 4XR4A 4EJ6A 2QRLA 5JNLA 4FFRA 2AW5A 3VVBA 5L53A 1VSUA 5FEUA 4II2A 1OFGA 3LQFA 1FDVA 2Y1EA 4H7PA 3H9GA 2C5AA 2EHDA 4P4GA 4BGUA 1XLTA 6LDHA 5IAAA 3ZU2A 2AEFA 4DPLA 2OBYA 2PGLA 3FR8A 3IQDB 1B2LA 4YACA 4E2YA 4BV9A 1MC4A 4J4HA 1T4BA 4AJIA 2IYOA 4ITUA 2G5CA 3VOSA 2PH5A 1V6AA 3BMNB 4DIOA 5CDTA 2NQ8A 2WE8A 1EVZA 3W6UA 1Z73A 1SZJG 1SB8A 1UZNA 2Q1SA 3V5NA 4RPLA 3H9EO 4OL9A 3ASUA 2DBVO 3M1AA 1B3RA 3PZRA 2NUAA 1I36A 3Q9NA 4XYGA 3PLRA 1Q2XA 2FZEA 3Q11A 2JL1A 1LLUA 4HX5A 1YL6A 3BMNA 3PTZA 5F1PA 3LC1O 5C7OO 4WLVA 3EVTA 1V9LA 4CMAA 5JXWA 4J16A 1JLLA 2DBRA 5JAQA 4LSMA 2WEKA 3MWEB 1K2WA 2GSDA 3Q2KA 2GDZA 4RORA 4BNKA 1S7CA 5AXAA 5C37A 1I3NA 1XELA 4JLWA 2Q1UA 4PLZA 2PZKA 2NVUA 3CMMA 2RCYA 4JP2A 3G1UA 1WDLA 1XG5A 1DC6A 2CDCA 4NBWA 4WLUA 4TRNA 2WYVA 3ADPA 3F1KA 4B7XA 3OJLA 1P33A 2Q50A 3DTYA 3RCBA 4Q3BA 1YO6A 1MXFA 2VHVA 3GGGA 4NNJA 4EJ0A 1NASA 1YBVA 3I9MA 2Q99A 3MCVA 4M87A 1TEHA 4TMFA 2BFPA 3W8FA 3ZWCA 1VKOA 2EGHA 5DULA 1ZK3A 1BWSA 2W2KB 3PRJA 1JKFA 1ONOA 2EJWA 1WPQA 3MJTA 4LCEA 4I9UA 3F5SA 2YZ7A 4NH4A 4PLFA 2GRAA 3K31A 4BNGA 4OMUA 1YGYA 2B4RO 4D0SA 5BQFA 1M2WA 1UUFA 4G5HA 4UUOA 4WNIA 5COBA 3DMYA 5TNXA 1ZUD1 2W2KA 1A4IA 4KQWA 2JHFA 1N7HA 1WZIA 2DFVA 2VZ9A 3L0DA 3RUCA 3L6EA 2UUPA 4OSOA 1JKJA 1HDRA 1TI7A 4YAIA 3ZNPA 4L76A 1IULA 5AXCA 1Y5MA 4IDAA 3A06A 3LVFO 3HE3A 4TRJA 3GVXA 7MDHA 3NDJA 1R0SA 2HU2A 2J5KA 1VC2A 1EUCA 3I6IA 1U3TA 2B0JA 4ZRMA 1V3UA 2ZCUA 4PG5A 2FSSA 4BNLA 2VWQA 4J49A 2DBZA 5GZ1A 3JSAA 2B35A 3VZSA 1U3VA 2GZ2A 4DQXA 3UH1A 3BAZA 1O6ZA 1H5QA 2BI7A 4CMCA 1I33A 1U8FO 4EI2A 4OQYA 3E8XA 3ABIA 4OXNA 4IZHA 5JFOA 1M67A 2E49A 3ANLA 1GYRA 3LSYA 4DMMA 5KIAA 1EBFA 4TZTA 4XIJA 2YQ4A 3GC6A 2VUTA 1C14A 1PJ2A 3SXPA 1BHSA 3GN2A 4GBJA 3SVTA 1FK8A 2GUGA 1JW9B 5T57A 3ZHBA 1PSDA 1JN0A 3TOZA 2IZZA 4K6FA 3QHAA 2G17A 2GR9A 3GVPA 4R01A 3HFSA 3D4OA 4CLEA 5THQA 2NSDA 2Z5LA 4ALMA 3U49A 4Q3NA 1PIWA 2YFHA 3JQFC 5TJ9A 4AJOA 3RFVA 3JV7A 3D4PA 4AJHA 1YDEA 4W6ZA 1HZZA 2VYVD 3OH8A 2DTEA 1ZSVA 2ZB3A 3RC2A 5LC1A 2HMTA 2JFFA 4MOWA 3JQ9A 3GN1A 1HT0A 4NBVA 3LK7A 3WQRA 2F1KA 3PIDA 1V0JA 2BELA 4IDGA 4Z0PA 1HKUA 4JROA 3MOGA 4E0BA 3B20A 1RM3A 1OI7A 4UREA 5IZCA 3PI7A 2Y67A 3H9QA 1T2AA 4WCFC 4YXFA 3CMCO 1LSSA 2C29D 3ZCXA 2O3QA 1EUDA 1H6AA 2YJZA 4KDEA 4OOFA 1Q1NA 2O4UX 4YT2A 1A4UA 1YQGA 3GZNB 3V2HA 1TXGA 4Z3KA 5T67A 3I3OA 3WYEA 4P4LA 1SOVA 4MVJD 3QWFA 5BNFA 2VYNA 5BSGA 1ZJYA 4PLWA 3VHRA 5FI3A 4J9VA 4XB1A 1E1KA 3C7CB 2YFQA 1ZIDA 1HE4A 5A3JA 5DDIP 3GZNA 4QT0A 4Y9DA 1KC1A 3SJUA 2E37A 5CPBA 4MVJE 1UXGA 3S55A 3DZIA 1A71A 3M6IA 4IS2A 5A05A 1EFLA 3PYLA 2ET6A 4WLOA 1Z74A 2VRCD 4C7JA 5B4UA 4FFMA 4IGEA 4E2ZA 3NV9A 3C24A 4LSWA 1OC2A 5CHEA 4OGWA 2HLPA 1J6UA 2VWPA 1RYDA 1XSEA 2HRZA 2IEDA 2X0RA 3DQPA 4PG7A 2D59A 3F1LA 1F0YA 4LVCA 2DM6A 5H82A 1OC4A 1LJ8A 1HYGA 1PJ3A 4CUKA 4Q39A 4IS3A 1L7EA 1O0SA 4NK4A 4UEKA 4UUMA 1Z7BA 3EC7A 3U5TA 1VL0A 5DP1A 4PFJA 1UJMA 1H0KA 2CFCA 4GGOA 4BNXA 2ILTA 5EESA 2CZCA 1ZEJA 2VWHA 2W2LA 3CSDA 4BO7A 3WQQA 4L9RA 5DCYA 1E6EA 1YL5A 5JY6A 2W90A 5ICMA 4NU6A 3TZQA 3D5TA 3E6AA 4FFPA 1YQDA 3VDRA 1ZZEA 1KY4A 3FRJA 2QRKA 1YWGO 2I3AA 4NHEA 1LLQA 1K6JA 2GYYA 3ROMA 3UFXA 8ADHA 1BRMA 1ZVMA 4XDZA 1PJBA 3VH2A 4I8XA 4PVDA 1ZK0A 4FDAA 2Y1OA 2YV2A 3PP8A 1K89A 3KBOA 3BTSA 4PVCA 3PZBA 3BMOB 1DIHA 2H1SA 1MP0A 1PGNA 5F5NA 1A9ZA 4F6LA 2JCYA 3AOEA 2JCXA 5ADHA 4PRKA 1AUPA 1SAYA 3I9JA 4J4BA 1DOHA 1BTOA 1PEDA 4CM8B 3IOYA 1IOLA 4JJFA 3DWFA 3BMOA 1JKIA 3DFUA 4M86A 4RF3A 3P19A 1D1SA 1U28A 4ZA2A 2GGSA 2R2GA 4J0EA 3JYNA 3I6QA 1PTJA 1EVJA 4CM8A 4BKQA 4R1UA 2YYYA 4WLNA 2YDXA 1B7GO 3TJRA 5KVSA 3PQFA 4EUHA 4HNHA 5CDUA 2DC1A 3QJ5A 4YAJA 4IJUA 3C3XA 2Q4EA 3RASA 5CG2A 5KKCA 2C54A 2ZYAA 4OO3A 4YDRA 1SO8A 3P2YA 1D1TA 4AJ2A 3F4BA 4BGEA 3UW3A 4DIFA 4Q3DA 3BTVA 5K6AA 4DLBA 3KVOA 1CQIA 4F3YA 5EERA 3EK2A 2EKLA 3T4XA 1O95A 2PLAA 1I32A 5T8KC 2WM3A 3OHSX 3U0BA 3GFGA 5JC1A 1DAPA 5ILOA 3Q0EA 2AE1A 3GPIA 3S2FA 3S2IA 2CVOA 4DGSA 1CRWG 3EAGA 2EERA 1UZMA 4FFNA 3B70A 3WGOA 4D43A 4ZQEA 5KNLA 4IUYA 2AQHA 2X4GA 4I9NA 4AJKA 4L4XA 3OM9A 1DO8A 3GY0A 4BGVA 4YPOA 1HLPA 4NDNE 3OJ0A 4OSPA 4QSMA 5G0TA 1I3KA 4GLLA 2B83A 1PJSA 3BMQB 1HE2A 2IDZA 3NT5A 3QV1A 4GX0A 1DIBA 4JBIA 3ZU3A 3WNVA 5DZSA 4L74A 2VHWA 5A9SA 3RBXA 4BKPA 3ZZNA 5G0UA 4S1VA 1P3DA 3UCFA 3L4SO 1SC6A 2JKVA 3F4LA 2EP7A 1T26A 3FR7A 3R0IA 4LMPA 3BMQA 3JTMA 5H81A 3WOHA 1U5CA 4ESOA 2O3SA 2D5CA 4E30A 4FOOA 4RZHA 2Y0EA 3ZU4A 4RF2A 3RJ5A 2PGJA 2QYSA 4HKTA 2X0NA 5BR7A 3PVZA 5KVQA 1QLHA 5A03A 6ADHA 3E1KA 4R51A 1BXZA 4CR8A 1FMCA 3KO8A 4M49A 3CXRA 4CLOB 4Z9FA 4NPCA 2FZWA 2EIHA 3OJEA 3S2EA 3ZU5A 3ZI0A 1U7TA 3PYMA 1YS4A 3KV3O 3RUIA 4CLOA 2Z95A 1KERA 2Y68A 3ZW8A 1BGVA 5L7YA 3K92A 1U1IA 1KVSA 4AJJA 1E7RA 1N9GB 2D0IA 2FY8A 4CMIB 5KVCA 1GPDG 3U4HA 2BD0A 5JO0A 2VTEA 4Z0TA 4F6CA 1MV8A 4CR6A 4JCOA 4I9HA 4W7IA 3NUGA 3PYXA 2WYUA 4XR9A 3RKUA 1W73A 1N9GA 3M2PA 3VH4A 1ARZA 4CMIA 1G1AA 4RF5A 2YW9A 2Q4BA 4IMRA 4AICA 4RVFA 3AUAA 3NDIA 4FD3A 4YQZA 1SEPA 2X9GA 4M89A 2J6IA 2Q1TA 3ST7A 4LK3A 3NKLA 5HS4A 3I9NA 1Y6JA 3BIOA 4YWJA 2AQ8A 1CERA 2V6FA 2EGGA 2HO5A 4I08A 3SEFA 4IDEA 4MVJH 4P22A 2OP0A 5T64A 1PQUA 1BSVA 1B8UA 3QWBA 4A5OA 2PTGA 3OFSA 3BTOA 4F46A 1P1JA 4II3A 2WWRA 4D41A 4DUPA 4FJ2A 3WGZA 4CJXA 1DFGA 3H5NA 4AJEA 3G79A 2JD1A 3MTGA 4RPHA 1IE3A 1EK6A 3B1FA 5DOVA 4BNYA 4DPKA 3JQAD 5JBIA 3QW2A 4KUGA 4ALJA 2Y93A 1PR9A 1EEHA 4BOYA 1NYTA 3JD3A 5GZ6A 1N8KA 2J5QA 3OF2A 4GAEA 4W82A 4BO3A 3KRTA 5BSFA 3NT4A 5ENDA 2DVMA 4LISA 1IHYA 2C82A 4W9NA 1GCOA 4E5MA 2CVZA 2ZB7A 2EG9A 2G0TA 5JYEA 5IDYA 2VCYA 4ALNA 2AA3A 3T7EA 2AXQA 2A94A 4B4VA 3QQPA 3EY4A 4MIEA 1P1FA 1YB1A 3AWDA 2OMEA 1EVIA 1BVUA 4GWGA 4J43A 1NVMB 4CQMD 1E7YA 1GZ3A 5CEEA 3I1JA 4U6SA 1N5DA 5C7IO 3ZNNA 4KUEA 3GUCA 2OXIA 4ZQHA 1M66A 1J0XO 3U4DA 4DVJA 1DHRA 3D64A 5A4DA 2J8ZA 3MJSA 5C5IA 2B5WA 4MP6A 2VHXA 5ER9A 4TKMA 4DC1A 2HDHA 1IY8A 1ZSNA 4R9RA 1D7OA 1U3WA 3RKRA 1JVBA 2Y0DA 3H8VA 3I4FA 4RVDA 3W4JA 3K2EA 1WDMA 2WYWA 2Y0CA 3GOHA 4J3FA 2I65A 4MIYA 4BGIA 4D44A 1B16A 2FPIA 1ENOA 3KXDA 4NJOA 4FFLA 2AE2A 3R1IA 4Q3EA 4FBGA 1H6DA 1ZKMA 4FJ1A 5A9TA 3JQ7B 1C1XB 1PZHA 1O8CA 3VDQA 4NFHA 1C3VA 1B0AA 1NBOA 1HDOA 1O94A 2PA3A 3HZZA 5JCJD 2POQX 2C7VA 1LI4A 3DMTC 3OQ1A 1AHHA 3U3XA 3H4VA 4BMSA 1LBEA 3CINA 5EINA 1T4DA 1UXJA 3LT4A 1X0VA 2IRWA 1Y8RB 1NFFA 1ZCJA 2Y1FA 3JQ7A 3C1TA 4BNIA 3NGXA 1XU9A 3F3SA 4GX1A 2CD9A 2C59A 2Q2WA 2Z1MA 2WE7A 1V3VA 5HS6A 3WSWA 1DIRA 1E7MA 3CKYA 1DRWA 1VKNA 3AI2A 3OA2A 5JMPA 1E0DA 1X7GA 1Y8RA 4Y6RA 2RAFA 3I9KA 4TSKA 2BHLA 3ZWNA 5KWEA 3RUDA 1XCBA 1DC5A 2GZ3A 2NV6A 4RF4A 4BNVA 1B8PA 5JC8A 4OYRA 1Q7CA 4OIMA 1RM4A 2JHGA 2YHIB 4CLXA 2V6MA 2W8ZA 4RPKA 4WOKA 3B1KA 4YB8A 3DAFA 3ETDA 1A9YA 2PNFA 2D3TA 4Y67A 2BKAA 1Q7GA 5G4LA 1SB9A 3I5MA 3PWKA 5JDIA 1Z6ZA 3DOJA 4BKUA 4DQUA 4PZEA 1VM6A 3JQCA 1P1IA 2JFGA 3RD5A 1PL6A 2XXJA 3FCOA 1X15A 4F45A 3IIEA 2NQTA 5L4NA 2YHIA 4CV2A 2YV1A 4TZKA 1YQXA 4PG6A 2UVDA 1PZEA 1WW8A 4BQPA 5HA5A 1LQTA 2QRJA 3GVIA 1PGJA 3MJ4A 2V65A 1EDZA 2HK8A 2W4QA 3KYCA 4L4SA 3JD1A 2VUSA 4O1MA 5B4VA 4R5MA 1CWUA 3ZWOA 1NX6A 5IJZA 4E13A 4YJHA 1F8GA 3OEYA 1BDMA 1FDSA 2WDZA 1X1TA 1YXMA 2PKQO 4CM1A 3K2BA 2NTVA 5L40A 3K8ZA 1E7SA 2H6EA 5L51A 1GY8A 2RIRA 1NQTA 1VJ1A 1HF3A 2UUOA 3TFOA 4KOAA 1M76A 5G4KB 1QLJA 2CF5A 3S1LA 1KEPA 3Q1LA 4J4TA 1E3WB 4UAGA 4PCVA 4IJWA 4CV1A 1R6DA 4N5MA 5G0WA 1LDNA 3QVSA 5KKAA 1PJQA 3NAQA 3BMCB 4CMBA 1MC5A 4E33A 4IDCA 3SJ7A 4HBGA 3RC7A 2P68A 1KEVA 2JFHA 5IXSA 5KJ6A 4AJLA 1FDUA 2IE0A 5BSHA 3PDJA 1LDGA 1EUZA 2OGUA 4ZQFA 5JMWA 5J23A 2Q2VA 1I3MA 2EJVA 4DWVA 1W8DA 3FNEA 2B37A 1X7HA 5HTOA 3FPLA 2C5EA 3QWIA 2W98A 4Q3CA 3GDOA 4BO6A 3E9MA 4Z3DA 1KY5A 1RM5A 3RFTA 3JQFA 1XGKA 1DIAA 3D3WB 4FCCA 1GAEO 1VL8A 2D4AA 3D4NA 4N5NA 4Z9XA 3QVWA 1GQYA 3DBVO 1DRVA 4UUNA 5U4QA 2BRUA 1ZH8A 1NFRA 2JCVA 3NEPX 7ADHA 2PZLA 1A7KA 1DBVO 3GG9A 1LRJA 2GASA 4FOSA 4NFSA 4WCFB 3OJOA 1MXHA 3AY7A 3GHYA 4GSLA 3UCXA 2ZB4A 5I9LA 1GTMA 4XYEA 3EDMA 4KP7A 1R0KA 1ZK4A 1QV7A 4WCFA 3VKVA 5JAMA 2AG5A 3RIHA 4S3MA 2GO1A 1DSSG 3MTJA 4FW8A 5TS3A 4CQMB 1JTVA 2ZTVA 1HSZA 4J90A 4QQRA 2HMUA 1EDOA 3SLKA 1OAAA 1RKXA 1YE3A 2FOIA 3D3EA 1KIFA 3ETGA 3RVDA 1HZJA 3PHJA 4JIGA 1EVYA 2XPCA 3HDYA 5CDSA 4CQMA 4IXWA 1TT7A 4N18A 1QYDA 5BNIA 4J91A 4QECA 1GV1A 3GNSA 5HBRA 5CDYA 4J2HA 4QUKA 1P31A 3NYWA 5EL0A 3OEWA 4BO2A 3WMWA 1CF2O 4BVAA 5BNTA 4P38A 3PFFA 1UR5A 4IQ8A 3WMXA 4PG8A 5L95A 5DBFA 4ND4A 4GH5A 3AI3A 3L6OO 3RWBA 1E92A 4QEDA 3F46A 2ZKLA 2FR1A 3INRA 4INAA 5C7LO 1U2GA 2DAPA 4AFNA 1QR6A 4IQ0A 5CAEA 1HE5A 4L0QA 3DONA 1R12A 2GCGA 4B3IA 4GX2A 1K6XA 5AOVA 3TOXA 2RH8A 3OIGA 4LVUA 1GCUA 1XDWA 5JSFA 2J5RA 1B14A 1ZO8A 1HTBA 4WJZA 4MJLA 4OJNA 4ND2A 4D42A 3WWYA 3OIFA 1HDZA 3CZRA 3JQDA 1P74A 4JBGA 2RHRA 2X86A 4Y8VA 1H2BA 3NRCA 3DHNA 4KZPA 4BNFA 5IFLA 2HRBA 3JD2A 3PWZA 2NTJA 4P4NA 4W99A 4NJMB 4YJGB 1B3BA 4I5DA 3KM0A 4IXTA 3KUXA 3KZVA 4PIVA 1UDCA 1NPTO 5TC4A 2YV3A 3PDUA 3VAZA 3E03A 3TL3A 3DOOA 3PGXA 4DLLA 3ITDA 5CDGA 4NJMA 4YJGA 3D7LA 2R6JA 1GL3A 1DAOA 2D8AA 4YJFB 2B4TO 4EW6A 4CM4B 4L8VA 3DL2A 1YH3A 4CMJA 5LDGA 1X7DA 1DHTA 4J0FA 2O7SA 4Q3AA 3WBFA 3T4EA 3OA0A 4QO7A 2P4QA 3UOGA 3D0OA 3UUWA 4CV0A 2GN8A 2QIOA 4WOJA 4WPGA 1R16A 1X13A 3DXFA 4YJFA 4C4OA 2ZATA 4R69A 4YVFA 4MO2A 2B69A 1UZLA 3U4CA 1GV0A 2GN6A 3GRKA 1U9JA 2Q49A 2JJYA 4UVEA 3TZCA 3S8MA 1PJTA 1GUZA 3RUAA 2YY7A 2JD0A 4AJNA 4FPXA 5F1OA 9LDTA 2H9IA 3GEGA 4BO9A 5ENVA 3GDFA 4NU5A 3CTMA 3IDSA 4MKXA 5JLAA 3AU8A 2O23A 3KEQA 4JX8A 5T8KA 4ZVVA 4CLDA 3W1VA 4JBHA 1GD1O 2P9GA 2FPGA 3PPIA 4A7PA 4CMGA 1ONPA 3DZHA 1MUUA 3FTNA 4GWKA 4CPDA 4EUFA 1KETA 1GADO 2FSVA 3RU7A 1QYWA 2QW8A 3UGKA 2I9PA 3ZHXA 3ZHZA 1LX6A 2C0CA 3VPXA 1BMDA 1MFZA 4CM5A 3GPDG 3GT0A 2I6TA 5COQA 2OOSA 3IUSA 4PZCA 5I8ZA 3KSZO 1R37A 3VPFA 2PKRA 5AQ1A 3CIFA 3E82A 1AGNA 1RPNA 5JO9A 1L1FA 1GYQA 4QFDA 3DAGA 3LYLA 4JP3A 4DC0A 3KLMX 3C1OA 2R00C 1DJNA 2O48X 1JAXA 1SPXA 1ENYA 2EW2A 5CEFA 1HYHA 5MGBA 4I1IA 4A27A 4LW8A 5IF3A 2ZB8A 1DEHA 2PD4A 2BLLA 5BSEA 1LSUA 5ITVA 3W4KA 4RPJA 3TFQA 4D3DA 1MFPA 3SC4A 3QIVA 3W8DA 1TA4A 1VE9A 2CUKA 1W6UA 1JWAB 3H7AA 1XA0A 1K0UA 1WNTA 5ILGA 4EEZA 5F5LA 4K1LA 3TL2A 2Z1NA 1LA2A 3L77A 3GH3A 1PZFA 2WD8A 2YHUA 3GAFA 3DO5A 4O5OA 3KEOA 1DJQA 1DB3A 3PJEA 3PHIA 2Q2QA 5ICSA 4QX6A 3E9QA 4FGSA 3RBZA 4A0SA 1XR3A 3WG9A 1WMBA 3W4IA 4BO8A 1X1EA 1EQUA 3KSDO 3ORFA 3FWZA 5TT0A 1DRUA 3U62A 1PQWA 2NLOA 4LRTB 4DXHA 5DP2A 1EE9A 3K96A 1E3EA 3OICA 4CM9D 3WWZA 4J6FA 1CJCA 2BI8A 2UAGA 5F21A 3UKOA 3AUSA 4E4YA 1T25A 4NMHA 2X23A 4CL8A 5L7TA 1AXEA 1U5AA 1X14A 1E6UA 4KWHA 1IYZA 4KQXA 5KTKA 5JAZA 1LDMA 4IGFA 2B4QA 3WBBA 3JYQA 4DIBA 3VPSA 2UV8A 3RFXA 3DC2A 4B3JA 4M55A 3ZN2A 4TQGA 2HJSA 4YR9A 4EGFA 5JCXA 3PXXA 1JWBB 5KOIA 3TZ6A 4YYZA 1I3LA 1NP3A 2J3JA 3ENKA 3AM5A 3IS3A 4Y98A 3RSHA 2BFAA 1ZK1A 4EEXA 3PJGA 2EKPA 3WS7A 4RVSA 3ICPA 1LLDA 2VNAA 2PZJA 5B4TA 1SMKA 1RM0A 4MVJG 4DRYA 2NU9A 1DC3A 1T2CA 3GNQA 2J3IA 1YB4A 3DHEA 3E18A 2A35A 1HLDA 3E5MA 2A9FA 4D3FA 2NVWA 3BHIA 2V6GA 1GZ6A 1E5QA 1U7HA 3N7UA 5TLSA 5AVOA 5THKA 3ZV5A 4ZQGA 1ML3A 5A5EA 4E5KA 2VHYA 4CMEC 4PLTA 1Y7TA 2WMDA 4TVBA 3GAZA 3VH3A 4L73A 1J5PA 2ZYGA 2VOEA 1DFHA 1HE3A 1NHGA 3LC2O 4NFYA 1F14A 4DLAA 2A92A 1UXIA 3FHLA 5EQDA 4J7CA 3UCEA 2BGMA 3Q9UA 3HJAA 1ZK2A 4WE3A 4OHUA 2FR0A 2DLDA 1JA9A 3O9ZA 3PK0A 1N2SA 3ZWWA 1ENZA 4MKRA 3NGLA 2PD3A 2X1HA 3LT2A 4UULA 4J7XA 3V1YA 3AM4A 1NM5A 3EW7A 1I2ZA 4JGBA 2O7QA 1H94A 1RWBA 1XIVA 3QVOA 1KOLA 3WGQA 3WQSB 4CLRB 1MGOA 4OXYA 3A1NA 3D1LA 2OFPA 4URFA 2NTNA 3Q3CA 2CNBA 1WMAA 1ZXLA 4GSKA 4MVJP 4HWKA 3FWNA 4Y6SA 4B4WA 4QO8A 5LCXA 2VYVA 3FD8A 4CL3A 5I7VA 1KVQA 2OBNA 3OMLA 4NBRA 2HK9A 3DBLB 4YAEA 4R54A 3ZWVA 3TQHA 2NU8A 2PKQP 1ONNA 2CDBA 4PLGA 1NVTA 4GGPA 4GPD1 4RVHA 3DMTA 4DMLA 3ROPA 1Q0QA 4KUHA 1CIVA 1TB4A 4RLSA 2X0IA 4FJ0A 4N7RA 3HWRA 3DBLA 3FF4A 2J3HA 1XHLA 1ZNQO 1XWFA 4XDYA 5ER6A 4RLHA 1ADCA 3GR6A 1UXHA 3GGOA 1ADBA 4U0JA 5L4SA 4RCVA 2ZJ1A 4MVJA 4DYVA 5A9RA 3WGGA 4U8GA 3GHHA 4I5GA 2QHXA 2DFDA 3L6DA 3WYBA 4XX0A 4MVJF 4XB2A 3WGTA 1IUKA 1P77A 3MWDB 1I10A 4B8WA 3CEAA 1ZJZA 1YKFA 4ONEA 5GY7A 1H2HA 4MIOA 2JD2A 4B7CA 1PGPA 3UXYA 3G17A 5TQVA 2FN7A 2VRCA 3WGIA 4EDFA 3GA0A 3FNFA 4HV4A 1NQOA 1PZGA 5IDQA 4R3WA 2VZ0A 3X2FA 4E31A 3DZBA 4DL9A 1Y9EA 4EYEA 4NIMA 4OM8A 2IODA 2XAAA 3HQ4O 4GVXA 1G0NA 3EZLA 1KBZA 3I9LA 3M1LA 1DC4A 1C1DB 3RC1A 3WLFA 3VTFA 1T2EA 1Z7EA 2H5LA 2E6UX 2GZ1A 2O3RA 4PLCA 4XRRA 2Q45A 3C7DB 4ZRNA 3ULKA 4BMNA 3V1TC 4WKGA 5DN9A 3F9IA 1P45A 2GLXA 4Z6KA 2BMAA 3B6ZA 1C1DA 3AM3A 5G0SA 3WTCA 4B79A 1MA0A 1GFSA 1LDEA 4BO4A 2E4AA 1AE1A 2HMSA 5L7WA 4N5LA 3TDKA 1AXGA 3H9JA 3JQ8B 4R1NA 5KJFA 2WJPA 3IJPA 3JCZA 4FN4A 4JQCA 1H93A 3PQEA 2IYPA 3MJVA 3Q6IA 1EBUA 3HFGA 3PLNA 3H2ZA 4NBUA 2VT3A 3GZ4A 4A10A 3VKUA 4U6QA 2LDXA 1I24A 1I0ZA 2OHXA 1DFIA 4RZIA 3JYLA 1VJTA 2O2SA 3VZRA 1WXDA 2O3TA 3OQBA 2VOJA 2ZQZA 2F00A 3IJRA 4KDFA 4CM9A 5F3RA 2RHCA 1BXGB 1QXSA 1PS8A 3RUEA 2I5PO 2RBEA 1F12A 3LC7O 1B26A 2HCTA 1LDBA 2H63A 1ZMTA 1ISMA 4HY3A 2A4KA 3KB6A 1PWZA 4E21A 1ULSA 2HUNA 4J7UA 1IZ9A 1U3UA 1P44A 3NTQA 1QP8A 3SX2A 3FN4A 4IJVA 1M75A 5CEJA 4FC7A 4B4UA 3ON5A 4N54A 5AXDA 3FTPA 4YRBA 3PHLA 4K26A 2CY0A 1EE2A 4U5QA 5HRUA 3MJEA 4WASA 1C1XA 4GMFA 1HWYA 2FPPA 5TIIA 3RC9A 2Y05A 3QP9A 3ROKA 3OJFA 3H5AA 4GLOA 1HSOA 3INGA 3EZYA 2X8LA 4O6VA 3GVCA 3W8EA 4TVOA 3JYOA 2G1UA 4TRRA 4CUJA 2HKIA 5JS6A 3IAHA 4XCVA 4FB5A 1Z45A 2X5JO 2NNLD 2QZ9A 5L45A 4RQUA 4FC6A 3LF1A 3AU9A 4U0KA 1XEAA 2QQ5A 2BGLA 1Y1PA 4BKOA 3H6KA 4UUPA 1E1NA 1E5LA 2ZTLA 3GEMA 1MG5A 4GI2A 4B7UA 2QYTA 1K6IA 4PLYA 3JQGB 3VPHA 1YJQA 1PL7A 4MP8A 1D8AA 1MB4A 2P2SA 4XD2A 3KYDB 3O4RA 3GMSA 1PJLA 1HRDA 3C85A
chains in the Genus database with same CATH superfamily
1CLEA 2C94A 2IK8A 3ITNA 4RSRA 4HTAA 1ODJA 1SC1A 3TD6A 3MB8A 1MV5A 2OP1A 3JQGA 4HB0A 2EEPA 3TIVA 4KXUA 3QFHA 4B09A 4DIDA 5J3JA 1ODCA 4R4JA 1IB6A 2IY8A 2ZM6B 5EAIA 1JQBA 2DCUA 3KHSA 3OE7D 3NCHA 2ZIXB 4WV3A 5EXEA 5IVHA 5E0OA 1KMHA 5KYGA 4LHWA 1QG6A 4FS3A 1IG3A 5I8WA 1XQ6A 1VRWA 2QM0A 1L4NA 4LG1A 1QO7A 3AV3A 4QUIA 4M6WB 3QVUA 1I4OA 3PXBA 4L3WA 4Y6QA 3AEYA 3SIRA 3AHJA 2HI0A 4AYTA 4EELA 4WGFA 3UWMA 5E1BA 1ESNA 1QYVA 3BB3A 4FZVA 1GZSA 1ISPA 4WHMA 5BVHB 3ZHCA 4GM0A 4RNCA 4UASA 1H4VB 2X0FA 3VC7A 2XIJA 2WTNA 1XT6A 3AI7A 2Z4SA 2C2BA 2QTTA 4RJ2A 521PA 1RWWA 4N8EA 4IDDA 5AJYA 1QJ4A 4GZLA 4K8OA 3G89A 1K7CA 1VLMA 3IRUA 2VYND 1HEUA 3NUZA 1Q1GA 1GR0A 4MWGA 5CLGA 4RK7A 4RJTA 1A2BA 1UAGA 1AKEA 2ZUFA 1SC3A 2PUGA 1L5VA 3WSVA 1DTSA 1VFPA 2D5AA 1ZEMA 2LW7A 1JRLA 3AW9A 4EENA 1OFVA 2Z8ZA 3H65A 4IXDA 2IXGA 4BRWA 2PMWB 1BMFD 4RVUA 2K87A 4L9WA 5WRFA 3SI7A 1NLZA 3TYXA 1FSSA 2D1FA 4PGFA 2C95A 3PR3A 4ITVA 4A8TA 1E3DA 2ABWA 4DLVA 1V4BA 5ALDA 2QM3A 3BMCA 1IDN1 3FCSB 1BDBA 4U4AA 1C30B 2BKUA 3C6MA 3IIJA 4M88A 1F6DA 1IOZA 2DKOA 2Z2YA 4G63A 4NSNA 4Q1DA 721PA 3EPPA 1HG1A 1CS0A 2FYTA 4PZDA 4Q0MA 4RQTA 5IAEA 4JR1A 4Q12A 1FYFA 2EZ9A 3I04A 2IE8A 2P0YA 2ZYWX 2ZIEA 1LEHA 1UP7A 4Q1AA 2WKQA 5KNBH 1ZISA 5K3OA 3MJFA 4UBOA 4R16A 1ZH4A 3GUYA 3N0XA 1OWMA 4POOA 2GCOB 3OLZA 3PEEA 3TBFA 2LRHA 2JGIA 1XDSA 3S68A 4RDCA 3ZI4A 3DBHB 2HA7A 4JQOA 2OC9A 5TB5A 2O06A 3IVGA 1F2UB 5JAHA 4BFCA 1X0XA 5LIPA 2XMPA 3L07A 3CCBA 1XZKA 1QONA 3ORHA 4MQEB 5DNVA 3W5HA 5CMLA 2BWJA 4HJRA 2GLUA 3LLVA 4HQOA 2W2LD 4WNAA 2E4WA 2WZCA 5EMJA 1QDUA 4CNQA 3EW9A 3GARA 3L01A 4EGCB 1GLVA 4EBBA 3WFIA 2G7MC 4DJFC 1QMGA 5GONA 4TXMA 5KDDA 1O97D 1ESEA 5HM6A 3RRFA 5GGYA 1SXJC 1LTHR 1AGPA 2NADA 2XVMA 5GONF 2P4HX 3CZQA 4J1NA 1CQJA 3TLXA 5KVVA 3HKDA 1JQ5A 2G06A 2XT6A 4NPAA 3RIEA 4WJLA 4D9MA 4IINA 4US2R 5EJ6A 5DTMA 3QEMB 4ZV9A 1ECPA 2XA1A 5FL7A 2PZMA 1NC3A 2MSKA 1PJ8A 4N0PA 4LYGA 2JAHA 1JDVA 4WFIA 1RZRD 1SOWA 2PSFA 3WP1B 5EIFA 4BP3A 3BULA 3E48A 3WHLA 1IPEA 1U65A 3DFIA 1J0EA 3ZNOA 4CODB 1Q1AA 5CVVA 4DJ5X 1HX7A 3CE9A 4N7BA 3OOWA 5L3VA 5LQMA 1KHHA 2PKYX 5BR1A 3BXXA 3ZK8A 5JAPA 4KWEA 3L4BC 1S7GA 2DQSA 2GVNA 2J5XA 1D0VA 3A4IA 4BBZA 4LWPA 3U1TA 4B3MB 2VBGA 5HUJA 4B81A 3CGWA 3AERB 3ZHSA 1Y4UA 3LCUA 3A9UA 3NW9A 1I2CA 3OWHA 2BFMA 3QUAA 4Y2VA 2W8BB 2WWTA 5ICCA 1K2VN 3TGPA 5TPWA 1V5FA 3SXJA 3UT0A 3LI2A 4N9QA 4N8DA 3U7JA 4W5OA 3QJGA 5INTA 1Z56C 1FF9A 4NCIA 4YO7A 5KTYA 2OYCA 4MW1A 2PX5A 4MJ3A 1BMTA 3SD7A 5JW6A 2Q6TA 1JFLA 1TYZA 3IT1A 2M6KA 1CUZA 2AYXA 2YIVX 4U63A 2HIMA 4KQ6A 1SUPA 2A9JA 2A67A 1GPYA 3UV7A 5K9ZA 3UN1A 1YJ8A 2JRCA 1V5IA 3CZ5A 3JQBC 2R00A 2I34A 1AY0A 3CX4A 1G59A 3F5FA 2NYUA 2X5KO 1QNLA 5SV2A 2YBDA 3ZIAD 1NTOA 3KR2A 3HJHA 4GR4A 4I1YA 4XCXA 3HBJA 3C4VA 4BMYA 4BZPA 3G0DA 3OD5A 4NK5A 3EDYA 3HKEB 5A6SA 3W3AD 1Y1KE 1QHHA 2VPQA 4CLHA 1XA3A 1YCDA 3LG2A 5GIOE 1VOTA 4N40A 1P2TA 5C8XA 2A3NA 3ASVA 1JIXA 2I6GA 2IHYA 3O84A 4HQ6A 1WNFA 3ETCA 4NZ9A 2GEJA 5JCJA 2GEBA 5LB2A 3MEQA 3BHJA 1ZQ9A 5LA6B 1Y6FA 1G2OA 1X7YB 3KKKA 4BRSA 1YD7A 3NJ4A 1QO9A 3AESA 4GZ3A 3IL2A 4MRSA 1Q15A 4GL2A 2N42A 3ZY6A 1TGVA 1NAHA 2KLBA 3K9CA 3L6CA 3NC1C 4IPTA 4LQDA 3DP9A 5HOEA 1YOVB 3O1HB 5PGMA 2TECE 3NORA 1JT9A 1P39A 3M4XA 1D4AA 5DM0A 1RQLA 4YV1A 1GAXA 4JT8A 4DR1B 2D2IA 4H7IA 3P94A 3B7GA 4XFDA 4F6RA 4IDHA 4X84A 4QM6A 1W46A 4BHTA 2DY1A 3M9WA 4I5FA 4UEJA 4R40A 3ORRA 5T41A 1TD9A 4UXHA 1UKVY 2BOVA 1CIPA 3A9TA 4L5YA 2B1GA 3L0IB 1WHSB 1ULZA 4M1TA 4BFSA 3EXHA 3LK6A 2FF5A 1S2MA 3E84A 1NF3A 3VYSB 1CETA 1N57A 4LHVA 1S5PA 5HRCA 1TGYA 4B0PA 1K8XB 2CMHA 4G1MB 2IX9A 1YIOA 3A27A 2ZM5A 3MAGA 4G0MA 3CLTC 3VU9A 3ELUA 4N5DA 2WNIA 2HDOA 2NVBA 3Q1KA 3V7FA 4WZAA 2Z8XA 1JHQA 2VDJA 4U00A 4ARCA 3HB5X 4EZBA 4AJ1A 3VZQA 1ANKA 1V35A 3E05A 1VDMA 1K08A 2QXUA 2O4CA 1ND6A 2ZJYA 1T1SA 4KN5A 2QMZA 4RV4A 3TIGA 3VPGA 3JASA 2H0AA 1EZ4A 5DB4A 1OWOA 1S89A 3MT8A 3ZEIA 2R8PA 2ZBDA 5TQJA 4AN4A 1U04A 3KSUA 3ZE8A 3HCOA 2PH7A 3AP3A 2RGGA 3QBVA 2WF8A 3IO5A 2Q1YA 2DUUA 4ZDKA 4GS5A 4QHYA 4C6HA 4DMHA 5JHHB 1BCSB 3MCZA 3CF4A 4KKVA 3NC0C 4HDNB 1XYGA 3HKBB 3D6UA 2Y0BA 5FUBA 4AN0A 3AF2A 2ZETA 4KGVA 2QX7A 2ZWPA 3TTXA 1GUYA 3H42B 4MS4B 4TOIA 2I4OA 2MR5A 3PL5A 2G0AA 5CCDA 1GL6A 5HVNA 4I6EA 4MQMA 3N0RA 3GDWA 2C7PA 2BPOA 2FW6A 3PQ3A 2FR8A 5NULA 2HUPA 2YYSA 1EWKA 3QFCA 4IUDS 4IV0A 4KTTE 3W79A 4CM7A 3HGQA 2O0LA 1VL5A 2WWVD 2ANCA 1OXUA 3WJAA 1H9BA 4JB0A 2WIFA 3IESA 3MMPA 4M9CA 3OU7A 4LJ6A 3O4VA 2OY0A 5GOZA 3VVCA 4HDKA 5C8DA 4DB4A 3PNVA 1AKMA 2GI4A 3I52A 1GR1A 3K5PA 4EF6A 1KC3A 4RYDA 3HA3A 3QYJA 2ETVA 5DTIA 2RGXA 4WY5A 1UM8A 2JGDA 3FAZA 2JS7A 2V4ZA 1HDGO 2ZIZA 5FA8A 3VSCA 1WB4A 2C7RA 3KLNA 1J49A 3CUWA 4XVUA 5LMNB 1GFWA 1X80B 1L5ZA 1N2JA 2QD3A 3A9VA 2APJA 3ZLUA 2Y1GA 1J5XA 1G5HA 3D8SA 4KKXB 1TMOA 5CRIA 4JMLA 3N5KA 4XZ3A 5CP8A 4EYOA 4P2BA 1CF9A 3OQPA 1WTAA 2P6PA 5TGZA 3OQMA 3C3MA 5AXBA 4W9RA 1FJGB 5IABA 1KKMA 1D7AA 3FBGA 5IBRA 2P4SA 1UJBA 3HJTA 4PICA 1J90A 1NAIA 3WBJA 4C29A 4CQLB 1C0LA 2Y1KA 2ZP1A 5B12A 4XM2A 1UP4A 1QGUA 4RHEA 1II0A 4B73A 1H05A 1QYXA 4P3YA 1QAQA 3ESXA 1KXZA 4LV6A 4R6WA 2PUWA 1NUTA 1YDHA 4FILA 3QVGA 1KVRA 4B4OA 4RULA 1W4BA 4BFLA 2QUHA 3HFJA 3QVXA 1U8CB 4FIZA 5DSXA 4JJ7A 1EQ2A 4EY3A 3CZMA 3SLGA 4Z1MD 3HXKA 1KQFA 4EJ2A 2FUG1 1QANA 2CSUA 4YEDA 3PXUA 5FBQB 3UJ7A 8LDHA 2PPLA 2RHBA 3C39A 4C0LA 1IMOA 3FIJA 4Q1EA 4JK3A 3B9RA 3DEYX 5I7UA 4I50A 4QTUB 2I2BA 3PVSA 3U61B 4MP3A 1SA0A 1ZRNA 3EZGA 3WWPA 4TYYA 2I2AA 2NUPB 1ETUA 4I50F 3UMMA 2AXEA 1FFHA 4E5YA 5A4MS 5JSHA 2CFTA 2CNKA 3AM1A 3IP9A 4O0LA 3DXZA 2BKVA 4H16A 3LBAA 4PF1A 4ZKDA 4KPUB 3LLSA 5JNRA 4AU1A 1E6MA 2YHSA 3A9RA 2C4HA 3ESZA 1ULUA 3WKEA 1TUGA 2WD7A 1H2ZA 3TSCA 3LU1A 1BOOA 1RFLA 4XGNA 2B3DA 1E79D 1J8QA 1SCUB 2CCJA 2RAPA 3KJFA 5A2QA 3AI1A 2P3LA 1AZLA 2DFPA 3NWPA 1EFTA 2PCLA 2L2QA 5BSWA 2DX7A 3MNFA 3TK1A 3R7DA 1TECE 1QH1B 2F1IA 2I6FA 2E82A 5HTKA 3UUEA 1YRLA 1L7XA 2RJNA 5L3SB 5KYYB 1NIJA 2ZBFA 3KQMA 3WGNA 1X7XA 3TBKA 3T5CA 1K4YA 1IY2A 1LUAA 3KYBA 1SXJD 4CT4B 1AD2A 3JRXA 3P2JA 4JASB 4QDOA 4REOA 2VQSA 2HJ9A 3ZTYA 1LTKA 2YBEA 1ISHA 1DLIA 2RK4A 4POAA 4H7JA 4RHTA 3RVKA 2DQ4A 3ZWAA 5DX1A 3IHTA 4MPRA 4L22A 3ESRA 3K0FA 4LPKA 3KTDA 2LKDA 3RC3A 4UZEA 5EHZA 4JN6B 1JBKA 2MYNA 3G2PA 4RMIA 2F8TA 4KREA 2NZYA 3KKZA 2J46A 3PQDA 5JUWA 2BFOA 2W11A 3AV0B 2IITA 5AYVA 4ERNA 2O8CB 3EVBA 4AKGA 1O4VA 1P6XA 4H9GA 1VSTA 3IC5A 2V6JA 1TCVA 1GGMA 2ONZA 4NS1A 3RRMA 3I45A 4MGEA 1E2GA 3DTTA 1ZJ6A 2PUBA 2TMGA 2IZ1A 3BTUA 2I6SA 5H68A 2FWAA 2VDVE 3SDBA 2ZYDA 3E22B 4QXMA 2NXEA 5MFPA 1GTL1 5A9SB 5LSAA 3DZGA 2Y6UA 4AK9A 1PFVA 1MQ8B 1U90A 2BFBB 2EV9A 2HK7A 3PXCX 2WU4A 4QYXA 4W1QA 5DU2A 3F78A 1ECJA 5HDQA 5KPJA 2X14A 3IKVA 2H2IA 4X0EA 4CR7A 5EIOA 1OBFO 3DGEC 1TZMA 3PPVA 5IHPA 1V26A 4OD0A 1FNBA 3HACA 4RDHA 3QHQA 3UK1A 2XZTA 5EKUA 3K1TA 3CLVA 4CUZA 1EHIA 2NU6A 1K7EB 3NDRA 5H83A 1EINA 4UPEA 1I7QB 1WDTA 4TL8A 5G53C 2FF7A 4BVLA 4E70A 1HURA 3EUWA 4CLRA 3C7AA 1M8FA 2QZZA 4RHXA 3CUKA 4ROSA 2XTNA 1GITA 3N07A 3BD7A 4G65A 3ND9A 4G67A 1A88A 3I61A 2VDKB 3R3JA 1CVIA 1OLSA 1PJ4A 4ZHSA 2J87A 1N0UA 3EZ9A 3PFWO 2Z2IA 1FP1D 4EA7A 1A7AA 1ZA2A 1VSVA 3N76A 4YONB 3L0OA 3HEMA 1UOQA 2CWDA 4M0DA 1HH4A 4M0KA 4PIMA 2X8JB 2IZOA 4X8LA 1IXYA 4NBNA 3IT2A 2CL7X 1WUKS 2IU0A 1G3IA 3R75A 1AQLA 1GXSA 3RQSA 3SSOA 3X1WA 2TMDA 1RRVA 4OKIA 4L72A 4UHCA 4GECA 1V9SA 3H1EA 1USWA 4BV8A 5IN4A 1K7YA 5AW8A 1DPGA 2Z43A 2EWMA 2ZJ0A 3JD0A 2V6IA 1TM7E 1Z06A 1NQWA 2BZ0A 1VTKA 1L5GB 3RS0A 3VZCA 2IXBA 3GB9A 1FSFA 4WINA 1KK3A 3A1WA 3EE6A 1QFZA 1IC6A 2FWPA 2NZ8A 3MILA 4M60A 5LMCA 1DKOA 1C7RA 4W5WA 2OTCA 3TTYA 1C0IA 5MN4A 3C6BA 1X1RA 2OKCA 4PWYA 4UHEA 5DT2A 2B1QA 1XZNA 4E1AA 4J1SA 1ZHHA 3G5TA 5CLIA 3UGQA 4TN1A 1B8OA 1CE8A 3U56A 1OWPA 4AUEA 3U26A 4KH0A 1LSJA 1U28C 4C0WA 3QOYA 3EEYA 1OQAA 1YL7A 5IDXA 2IYAA 1DQYA 1Z5UA 3R0QA 4JNKA 4UNNA 2RONA 3GRAA 2ZIUB 4YRLA 4Q4JB 1NUSA 3HRHA 3TRHA 3VH1A 4AULA 4L4RA 3T1YB 3IPCA 2QMYA 4MZXA 3S29A 3U4QA 1WWKA 1SVNA 2LCQA 1X9IA 2WJ3A 3WMFA 4GXRA 4CFSA 5I5EA 3THXB 5L4LA 3DHYA 2PM8A 4U6NA 1UDAA 4A73A 3WYDA 5KSZA 4DA9A 2RHMA 3KQVA 4F8YA 1MVOA 4KN6A 3VDMA 1GT6A 2C8JA 2W0MA 2VJYA 4GMGA 5AHRA 4CF5A 1ENPA 3ERCA 2NU7B 4FHDA 5JZOA 1NR7A 2QQFA 1LK7A 3A6LA 4KW7A 1DELA 2J67A 5FFFA 3RTEA 4TROA 1TJ3A 1DBSA 5DWVA 3L8EA 2RK3A 1QB7A 4ARZA 4C1BA 4E94A 3EXIA 4M7RA 4IBOA 1X86B 3BWEA 3LCRA 3PC3A 3BWXA 1NZFA 2BJVA 3QU2A 2XSZA 3UBMA 3NZEA 5GQSA 1IM8A 4LCJA 2C2MA 1M74A 4A1OA 4M0LA 1KZYC 4D99A 2O1WA 3O31A 5KOHA 2FN9A 4EHHA 1W8IA 2O5CA 2CEKA 2R97A 2RI1A 3AMVA 3FBTA 2OA0A 4LYFA 4GE3A 4ND8A 3SJBA 4DKJA 2A30A 4A16A 1L5KA 4V0SA 2WSBA 1XRQA 2ZVJA 5FWAA 4DCGA 1CHDA 4RA9B 2MINB 3NRBA 2FRXA 4YWHA 4RCZA 4WCDA 1GPAA 1MOQA 4QOSA 3UY4A 4UOZA 5IF9A 2Y1CA 3VU3A 4EL5A 4I5EA 3BS4A 3PGKA 3X0DA 3FNHA 2F6RA 4X64B 1ZH0A 1Y1QA 3KXPA 2WG2A 1KE2A 4EMTA 1U0BB 4L0DA 3RAJA 4MINA 3V1KA 4KWCA 3GMDA 1MO3A 1KOFA 1A9XB 2C1XA 3UAYA 1BA2A 2NM0A 3K94A 4FEGA 1BW9B 4KXQA 4L16A 4QRDA 4A4DA 2OBFA 3EVNA 4QHTA 1H0SA 4Y6PA 3T3DA 1JAYA 1J1IA 2HJVA 3L43A 3T1VA 2GN4A 3KVNA 4IRUB 2AR9A 3EBOA 1N36B 1TTQB 3JYPA 3QXGA 4MRMB 3W6OA 2RFLA 2AMJA 3M6VA 2PU7A 3U5ZB 3OSUA 1PNVA 2PUAA 1QSGA 1NHWA 3OX4A 4KB5A 4Z9YA 1PJCA 3P8ZA 2X42A 3QKUA 2GJ8A 2YWGA 4TMTA 3A4VA 3F96A 1P75A 1SUFA 5IUKC 3RROA 4F5DA 4YT5A 3M70A 5FOXA 3C6XA 3RNOA 3H3FA 5A02A 3QE9Y 1CR6A 1U80A 4FX5A 3TIIA 1P9OA 5FIUA 3ZIUA 3BERA 1CIJA 2VF7A 2NSHA 4G5XA 1DV2A 3WJ7A 5FFNA 1HDXA 1XP5A 4R7GA 1T34A 1ZGGA 5DKFA 3W3ZB 4O08A 2O2EA 2BMVA 2HH9A 1V45E 2N3ZA 3OPXA 1FSPA 1IATA 3ZWYA 2RHLA 1ZUIA 4YQYA 5C3MA 1NT4A 1B43A 2ZFUA 3C3KA 2P1DA 4XPIA 1ZBQA 1MO2A 1PQ4A 4OXKA 1FOEB 1OF1A 4FOTA 4BL5A 1JG7A 4Q1VA 1YJBA 4L2IB 3EHEA 3MELA 1E69A 4G25A 4H17A 2C2XA 4HGZA 4NDZA 5F2NA 4DBZA 4A8JC 4OQZA 5HPYB 4G0ZA 4PLHA 5I9SA 1FRFS 1E4EA 5HGXA 4BYGA 1QGYA 3LHDA 3KEFA 4G1UC 2F67A 5FV4A 2Z98A 1H5UA 3QLUA 1OBOA 1ZICA 5A1TA 4QJBA 2PR2A 1UT8A 5EP4A 3WV5A 3CLHA 1BKSB 1YR8A 2GBLA 3KUDA 3L9WA 2AXNA 4BLRA 5LIRA 2KBEA 3R40A 3P9CA 1W0JD 2HC9A 3Q3IA 1QYRA 3V2UA 2BFWA 1H6CA 3MZ0A 2GK6A 3LHIA 1GZHB 5GZ3A 2ZKIA 2QN1A 1RWOA 2ZLBA 2W4MA 3JVIA 4Z8YA 5L6LB 2EJCA 3KYDA 1K5DA 2OO3A 3QVTA 4YAKA 1G21A 3K70D 1R4NB 5GJCA 2VPTA 3ICEA 1ZWKA 5FUWA 2FQWA 2ZDHA 1D07A 1LRLA 1EMDA 4RAQA 5IMBA 5I9NA 3GK3A 4RLQA 3CNNA 4DG9A 3KYCB 2SCUA 1JSLA 3A04A 3K6JA 3AVUA 4HLDA 3SZGA 3ICOA 4EKEA 2IBTA 4HR7A 4MXDA 2PGDA 4MYTA 3Q3GE 4Q01A 2EW8A 1L7QA 2OCIA 4LRWA 3UB3A 3ZVKA 1ZI8A 3UJ6A 2CV0A 4LTDA 1BS1A 3M6WA 2OILA 3BJZA 3CO5A 3L0PA 5C1BA 3VJMA 1Q92A 2YXPX 1IHDA 3P7MA 4AG5A 3V1LA 4XXHA 3T7RA 4R71A 1A5ZA 1M10A 1HEIA 1V8FA 4W1SA 2OE2A 4Q9IA 1P0FA 4KBFA 3QMWA 4KO3S 4WCVA 5DWQA 2W6QA 3VGPA 3HBMA 3LHFA 5HGJA 2FMIA 4CT5A 1YJAA 4EB3A 1PU2A 3ECCA 3PIRA 3PXEA 1ZWLA 1OJLA 5I9IA 1EZZA 1YRHA 1ZN9A 3Q2IA 1B23P 3Q3JB 4Y6GB 1NPDA 1O6GA 2Z08A 4TT3D 4NG5A 4K9RA 5TT1A 1KQNA 4IDFA 1HQDA 3KZKA 3OBIA 2DTDA 4N1AA 3X2EA 3LL7A 4ARSA 4LJ7A 4K6CA 3M3HA 4DDWA 1DDOA 1GUFA 4XR4A 5JNLA 2IVZA 1WSWA 2AFIE 1VSUA 2FG7C 5FEUA 2FQYA 4H7FA 2JJ1D 5ECWA 4M2LA 2NO0A 2B1JA 2V7UA 4TWIA 2CZQA 3H9GA 3IUMA 2O57A 2QX9A 3NFYA 2NYAA 3JVEA 3SXUB 5IUJC 2P30A 6LDHA 5IAAA 1MZPA 3QFFA 4TTTS 2PNJA 3AHGA 4H4EA 4HWGA 1QYIA 4PTYA 4B6GA 2PGLA 4C4SA 4EPTA 1QVWA 4E2YA 1RWNA 1MC4A 4FN5A 1VPVA 2GHIA 1T4BA 4AJIA 5C8YB 1O3YA 2IYOA 3EHDA 3BSFA 3FDZB 1JYEA 1PUJA 4DIOA 1Y6GA 1ZMBA 2WE8A 1Z5OA 3DVSX 1Z73A 3W6UA 1M7GA 4RPLA 1OSNA 3G9ZA 3V8VA 4ZOBA 1K68A 1OAKA 3FHCB 1DO0A 2NUAA 4GM1A 3OT1A 4QYSA 3W6NA 3Q9NA 2D5BA 1US8B 1DL5A 4J75A 1S8OA 3RNLA 3PTZA 5F1PA 3KLBA 5C7OO 4YHHB 1QZZA 2I2XB 1JQKA 1F7VA 1V9LA 2WF7A 3IAEA 2ADMA 3AR5A 1CY4A 4L4UA 5BUSA 4ZU6X 4RTJA 4DDTA 1V7ZA 4TMWA 2G8NA 4RGVA 1JLLA 4HPWA 4BNKA 2GSDA 2GDZA 3JSXA 3RRZA 4M9SA 4KNYA 4Q48A 3SOPA 4Z5XA 2P9YA 1Q1ZA 1E2FA 1SKUA 5EWJA 4PE5B 2Y2VA 2PZKA 1E2HA 2NVUA 1U63A 3H11A 4MEAA 2D0PB 5F78A 4HDSA 4YQEA 1PR5A 1O96B 1N2CE 1WDLA 4ABTA 1XG5A 2CDCA 2Q5QA 2CBZA 1GHTA 4TRNA 1ZINA 3M6UA 1YS1X 3OJLA 4U2FA 5GP1A 2X0EA 4IIFA 1S2GA 4Q3BA 3RCBA 1SK9A 1JHVA 2VHVA 4IHJA 1WOMA 1NBEA 3ZJYA 1COWD 3QBDA 4R8KA 5AVYA 2BFPA 3O4HA 1IEVA 4IHJF 2P0AA 2EGHA 5JZBA 1KHTA 2PR7A 2D2EA 3I53A 3MINB 3UPTA 4C0SA 1ONOA 1DI0A 3TKLA 4BRUA 4LCEA 4OI4A 1GSAA 1GCGA 3F5SA 4PLFA 2YOHA 2ODWA 1FZQA 1G7TA 1QKJA 1FA9A 4XVCA 1YGYA 2B4RO 2FLWA 4DT1A 4WNIA 1I7LA 3DCJA 5AM5A 2C4NA 4L8WB 2JHFA 1N7HA 1WHTA 3HXMA 1WZIA 2VZ9A 1NVEA 2TSYB 4KRXA 1HDRA 3K16A 4YAIA 1NYLA 1EUCB 3UMFA 1EIWA 4I1SA 4KX5A 3HJNA 2AX3A 2L19A 2I3DA 4HX9A 3ZU6A 4C6TB 4DABA 1Y5MA 3ZDAA 3OQHA 5G1OA 5BW4A 2YNMC 1SXPA 2ZT6A 2RGNA 3GVXA 2YMPA 3NDJA 3TDMA 5HR5A 1JGTA 2IYZA 4CTJA 4DM3A 4KNWA 4O2LA 1GSIA 1Y0BA 2C2OA 1YRBA 1CUBA 1M1NA 2DMRA 4PINA 2XZLA 1BEZA 1EWRA 5JJIA 1U5BA 2F3QA 4FFDA 3KWMA 3N2LA 1SHZA 2FMHA 3HCDA 3I2GA 5C35A 1IMJA 2X76A 2ZCUA 4M1SA 3W5BA 2X1VA 4B2PA 3ANXA 4J49A 3ZGXA 3H5LA 1BQEA 4G8CA 3T41A 2DBZA 2PIAA 5EC8A 4UHDA 3HWX1 5HK8A 1CJBA 3NOQA 5AKZA 3VZSA 1U8TA 3FF1A 3QNUA 3SX0A 1TQ6A 3PE6A 5MN5A 5E4FA 5JI2E 1U1GA 3FOCA 4FUTA 3EB9A 2J9FA 1O6ZA 2ZPAA 4EMBA 1U8FO 2V98A 1IBRA 1D4OA 2NO5A 3QX7A 4Y30A 5LB4A 1O6FA 4G36A 4C3ZA 1KYVA 3VX3A 4NXNB 4GPEA 4LZJA 1VLVA 1M67A 3LDAA 4C7BA 5KIAA 3M1IA 2YQ4A 3WGUA 2P77A 1R9JA 3SXPA 1BHSA 2XYQA 3KXLA 3S2ZA 3SVTA 2J09A 3OZSA 3KKPA 2GUGA 3LOPA 1ZAYA 4IXNA 3P9YA 4PPQA 1JN0A 3TOZA 3ER8A 2IZZA 3MIZA 4BDTA 2PRYA 1Q83A 1NL3A 3UHFA 1OXXK 2G17A 3GVPA 3II6X 4LKOA 4R01A 4B82A 3O0DA 1HMPA 3P1JA 1RXYA 2XE7A 2ZTSA 3KALA 3D4PA 5JASA 4PU0A 1U7ZA 3OH8A 2DTEA 3AR9A 4OH7A 4XLLA 2X4IA 3FYUC 3TLAA 3RC2A 3K0CA 5AVTA 4O1HA 4QOHA 1COZA 4ZRDA 4FCTA 3IDFA 5KS2A 3OE7A 2JIDA 4MOWA 4TS9A 1HT0A 5CURA 1GZ7A 4JUCA 3UA3A 3FH0A 1NV9A 1NSYA 4CHGA 1RQXA 1N5LA 1CZOA 2YIJA 3QW4B 4L4ZA 4Z0PA 4LYDA 1HKUA 2V7VA 1QR2A 4HVTA 5E3JA 2DWCA 1G9XA 1L8QA 4K6GA 4LRXA 3RS4A 3TOVA 1XRNA 2Z0MA 2O8DA 2B7CA 5U4XA 1Z2PX 4YXFA 3N0VA 2C29D 2YWDA 3ZXSA 2DEUA 1ZM4A 3ZCXA 4OOFA 3VRHA 1TTPB 3E3AA 4DDHA 4JI5B 2ZBGA 3OCCA 5FTJA 1YQGA 3R7SA 3TIFA 3K5WA 5ERYA 1TXGA 2H4FA 5T67A 2R25B 4ZOLB 4W63A 5CDHA 3CCFA 4F12A 2QENA 1FXUA 4YRRA 1UBTS 2HQBA 2VYNA 3IBCA 1PFQA 5JMOA 5K2MA 1LGYA 1MB9A 1YVRA 3HCRA 4PLWA 3HS3A 5FI3A 4J9VA 2ERCA 4XB1A 2YFQA 5FNVB 1M8GA 1ZIDA 2V96A 3WO1A 5JH7A 5CLHA 4E88A 1SKYE 5DDIP 1W9MA 3GZNA 2JAOA 3S7TA 2FEOA 2O5RA 1GL7A 4MQ5A 3ETNA 5CNMA 5JH7F 5JD5A 3PYLA 5CFPA 4LJKA 2FFQA 2H2DA 3E1GA 4KQMA 4QFMA 5JWHA 1VIMA 5CVTA 2PRSA 5SICE 5AW3A 4UAVA 2A1UB 1BN6A 4IGEA 2PWBA 3KAKA 3NV9A 1LNSA 4LA4A 4LSWA 4N7MA 2C4KA 3OIVA 4GOXA 4YUZA 4FT2A 5K8TA 2FEMA 3GOQA 2AYYA 3ENZA 2ENWA 1ECFA 2IEDA 3HB9A 1E2UA 1WZNA 4JS0A 2N75A 1B0ZA 3BDAA 3DQPA 4BP1A 3RVLA 4PO1A 3T9BA 4GR5A 3B1VA 3ZK9A 2UVPB 2DM6A 5H82A 4Q9HA 2R1VB 3AQ4A 1YSCA 2CMKA 1CT9A 4BTLA 4CUKA 4GP7A 1GG5A 1EVKA 1KJWA 1O0SA 2IXTA 2N1BA 3AKDA 4A6DA 4B75A 2OYSA 3OE5A 4TTJA 1S9DA 1RP1A 4DANA 5ERGB 1G42A 3FCXA 4F91B 3CZAA 1VL0A 4M9QA 4RYLA 3DE4X 1UJMA 4GGOA 4PFJA 4RBNA 4QT4A 4BV3A 1JDBC 5EESA 3R5HA 2VWHA 2VSOA 3FGPA 1QG0A 2W2LA 2X3UA 1SCIA 3UFXB 1AA9A 3RAGA 2C96A 2WP8J 4L9RA 1L4YA 5JY6A 1YBHA 1C8BA 2OK7A 4R98A 1E5TA 5DTQA 4RFLA 5LP6C 3OPYI 3IA2A 2FDRA 3C43A 2QU8A 1V1RA 4V2IA 1JPNA 1W59A 1EJ0A 3DDSA 3VDRA 2J0UB 4BASA 4IOLA 4NHEA 4MNTA 1G6HA 1K6JA 2P4EA 3BG5A 3O6VA 4H7EA 1BRMA 5CR9A 4EATA 1ZVMA 4XDZA 1PJBA 1G8PA 3CVYA 3W9UA 2Q3MA 2FVXA 1K3FA 1TE2A 2CCKA 2YN2A 2W6JA 3MLBA 3PP8A 1RZRA 3BTSA 4LOLA 3BMOB 3FGNA 4GMXA 4YP0A 4B48A 4XWOA 1RAIA 1U3FA 1IN5A 1A9ZA 4F6LA 4HN2A 4KNVA 4L7VA 2Q3DA 5ADHA 4JLOA 5LQJA 4J4BA 3MD9A 2XMQA 4KVAA 2G5PA 4IMJB 3U9SA 1EA5A 5HOQA 3LC0A 3JQPA 2GKOA 4CM8B 2W2XA 1L8LA 4ARVA 2AUTA 3EWNA 4EA6A 3MCUA 5FQNA 1FUUA 5K09A 3UANA 3P19A 2Z2JA 1UOEA 4FZ3A 4QBFA 4WVFA 4BZWA 2HNKA 1KYTA 5EE0A 4RFVA 3LZCA 5KYXB 3GBVA 3JYNA 1Z8FA 1YU6A 2FK7A 4URHA 5FWYB 4XB6B 4I2NA 3NO4A 4YH1A 4F2DA 1M6NA 1XRLA 2GXSA 3K6SB 1DU4A 2FWRA 1Q17A 3OUUA 4X8MA 3EULA 4HNHA 1P2VA 6GPBA 3T94A 2DC1A 4YAJA 4I4NA 3C3XA 2CVHA 2Q4EA 1EFDN 4ENQA 5CG2A 2XRYA 3I09A 5IX8A 1T0JB 1Y1RA 4CMBA 4IWNA 4C5AA 4AJ2A 3EEBA 4U7PB 4BGEA 2ZEJA 4CYMA 2D13A 2JBAA 1EP2B 3CKLA 3QKSA 3TGWA 3FTDA 1QP4A 3W3AA 2WVGA 3DAHA 3M4ZA 3OHSX 3U0BA 4BBAA 2ZSDA 3DPUA 2C58A 1DAPA 3VDXA 1J2TA 5ILOA 4PZUA 4L3OA 4L15A 2VDWA 4XGQA 4DGSA 3EAGA 2EERA 1UZMA 4OQLA 3WGOA 4BVFA 5KNLA 3D43A 3AUXA 4JEMA 1U2EA 4IUYA 5DEOA 3KU1A 1Y9JA 3WHKA 1DO8A 3GXOA 4HMQA 3ZYZA 5EXTA 2M6RA 4OSPA 1OX6A 1PJSA 5I6DA 3A3PA 5JS1A 4EB6A 2M9MA 3EF0A 2IHTA 3BQMB 1VZ3A 3QG1A 1SHLA 4UUAA 5DZSA 3VUFA 5EIWA 3F6BX 3T1HB 3L7OA 1MEOA 2XVZA 2AJCA 4MQ6A 2H2AA 4MAAA 2F43B 1AGXA 1T2UA 2ZTHA 2GEDA 2JKVA 3U37A 3R0IA 3IGFA 3BMQA 1J2JA 1U0LA 5K0TA 4DIEA 1AKVA 2XOKD 1M0EA 1ZCZA 3TO5A 1ZJJA 1PFYA 1AMOA 1P5RA 2K7ZA 2Y0EA 5IANA 1EU1A 5DW0A 1Q6ZA 4UHKA 3CLSC 2DF8A 1G2PA 3FCYA 4UEWA 4HKTA 4YMSA 2Q9BA 3G5MA 1OXSC 1QLHA 4MMXB 3BAFA 5IYZB 1QIDA 1WSAA 4KR6A 4CR8A 2YNMD 1UL1X 4OM7A 1FMCA 1Z15A 3KO8A 1O03A 4JVMA 4M49A 1JT2A 4OP3A 4NPCA 2FZWA 1G5IA 1H3NA 3C97A 1VCOA 4IFEA 2F3UA 1L3CA 1WMSA 3LECA 3ZWKA 1UBOS 3H75A 3REQB 1D2GA 5T6MA 3VO2A 1CUUA 3HDTA 4JLNA 3AEZA 2FUKA 4CRWB 2YY6A 1U7TA 3LA6A 1SH7A 3ENQA 4G0XA 3H0EA 4G1CA 4JH0A 2Z95A 2XWJI 4HLQB 3TDNA 4DFDA 3DO8A 1LPOA 4M53A 1BGVA 1JQ3A 3RABA 5JCZA 1KI6B 1U1IA 4YGXB 4AJJA 4DEXA 3T5BA 4HS4A 2G9ZA 4RZSA 5KVCA 3QX8A 1MAHA 1P61B 3U4HA 4FZ5A 2WVHA 4M7PA 1ULHA 2VTEA 4HTFB 1DXQA 3F7MA 2R8OA 5KMGB 1YZGA 1H8HD 1MV8A 3MMXA 4JA0A 1CSEE 4OQPA 4F6CA 5JCOC 2X41A 3GFPA 4JCOA 3GUVA 2DUMA 2O2XA 2OLEA 1ESCA 2ZT8A 4L51A 2BAGA 4W7IA 3RKUA 4WADA 5J47A 2OECA 1NI4B 1SHUX 4KMOA 5FOVA 5FR2A 1ARZA 3AKEA 5DYNA 1NW4A 2HSEA 2UZ3A 4MUGA 4RF5A 5J4YA 1V5GA 2YW9A 4UTVA 3LXMA 4TT8A 3Q7TA 1MQSA 1YDFA 3KK0A 4L5JA 1EGHA 1SEPA 5D6OA 2X9GA 2G1AA 5KKNB 1Q14A 2J6IA 2AG1A 3KOOA 3OF5A 4JLVA 3C4QA 4LK3A 3VVLA 3UUFA 2ONYA 2CLEB 4YWJA 2WOOA 2IF2A 4I4LA 2HO5A 3LDGA 4KC0A 3SEFA 5JYCA 4MVJH 4YLGA 5T64A 2DQKA 3W5UA 4QGBA 3ZR4B 4LF8B 1RLUA 3JWJA 3C87A 3PTAA 5BV7A 3AWIA 4CDGA 1BN7A 3QWBA 4A5OA 7REQB 1MA3A 1KA9H 3OFSA 3CG4A 1HT3A 5C5CA 2FVYA 1CK4A 1VB5A 1BE6A 4YI3A 2NMVA 1E8NA 1YS7A 2Y9MB 4DUPA 1NRWA 3NATA 2BIFA 1DFGA 3R09A 4AJEA 3MTGA 3PUHA 1PNOA 3GJRA 1U0SY 2GK4A 3B1FA 3NGMA 4G5QA 3K0BA 5C1IA 2WKSA 3BOSA 4HAXA 4JQSA 5BWMA 3ZY3A 2FSIA 3QW2A 3H4TA 1G9TA 4BMXA 4P53A 2WYHA 3P2MA 3AF4A 4BOYA 2QEQA 5GZ6A 1I80A 5GIPE 2Z4RA 3O3OB 4W82A 2GZHA 2XDQB 3PE3A 4UQOA 4B6SA 3L6RA 1U0RA 1J33A 3DOFA 3KRTA 4TXJA 2DVMA 1PBTA 4IYRA 1AQ6A 5CYPA 1T36B 1XQ9A 2YICA 2ZB7A 4U7JA 3P9PA 4S1TA 4AC9A 2O19A 3DL7A 2IUUA 3AEQB 3CNBA 2R1TA 4BJHB 3G7UA 1UC4B 4ROTA 2A94A 3FE2A 4MIEA 2F3SA 3KFVA 4ZAWA 4QWMA 4HWTA 4ETMA 5ITZA 2NT4A 1T6BY 4UTRA 1E7YA 1GZ3A 4IZ6A 2BI4A 2IP1A 1KMIY 4LYYA 3TCKA 1BS2A 1P9RA 2DPLA 2JIMA 2CUZA 1ORHA 2VDMB 2YKGA 1UFQA 2OXIA 1MORA 1ZRSA 2OXRA 3AF3A 4LE2A 4Z1MA 4ZQHA 4AP9A 1M66A 4OMDA 1OH8A 1DHRA 2LWIA 1IJBA 4AUMA 1FTYA 4Z99A 3Q2OA 2JG3A 3NTUA 5ER9A 3O47A 1Z4NA 4NBKA 2Z5FA 1VG1A 1Y5LA 5LZ5A 4DKXA 4E3WA 9GPBA 2HDHA 3MFYA 1L5SA 4R9RA 1X1DA 2DPXA 1LVHA 5HSGA 1GNQA 1RU3A 1U99A 2AH5A 2IPXA 3ANYB 3BB4A 2X0KA 4A91A 3OQNA 4UM8B 1J39A 2P0EA 4C3OB 3HVUA 3I4FA 3C8DA 4O02B 2GPBA 5CJJA 1CQZA 4RTLA 3W4JA 1WDMA 2WYWA 2XMDA 4JC8A 3K9FC 2MDTA 4D44A 4QG7A 1MIOA 2FPIA 1TJYA 4OLBA 1WQ3A 4NJOA 4MQ4A 5LD2B 2H1WA 1P2DA 2AE2A 5JALA 1ZKMA 4FJ1A 1C1XB 1PZHA 5SYAA 4YPVA 1E79A 2WQ6A 1O8CA 2OB1A 3ANTA 1E8MA 3OC6A 3VDQA 1NBOA 1B0AA 1O94A 1HDOA 1VG9B 5IS2A 2ZJFA 4W5RA 1ES9A 2POQX 3DMTC 5B30A 3DD5A 4KQ1A 1EZ1A 4OMFG 3GEHA 1OA1A 2V54A 3LT4A 4M1ZA 4RACA 4CCSA 2N1MA 4RZUA 1JEQB 4WA8A