1SNYA

Carbonyl reductase sniffer of d. melanogaster
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
248
structure length
248
Chain Sequence
HMNSILITGCNRGLGLGLVKALLNLPQPPQHLFTTCRNREQAKELEDLAKNHSNIHILEIDLRNFDAYDKLVADIEGVTKDQGLNVLFNNAGIAPKSARITAVRSQELLDTLQTNTVVPIMLAKACLPLLKKAAKANESQPMGVGRAAIINMSSILGSIQGNTDGGMYAYRTSKSALNAATKSLSVDLYPQRIMCVSLHPGWVKTDMGGSSAPLDVPTSTGQIVQTISKLGEKQNGGFVNYDGTPLAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sniffer CG10964-PA
publication title Structural Insights into the Neuroprotective-acting Carbonyl Reductase Sniffer of Drosophila melanogaster.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Oxidoreductase
total genus 87
structure length 248
sequence length 248
ec nomenclature
pdb deposition date 2004-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1snyA00
2X22A 1DC4A 2Y1FA 2ZQZA 2OO5A 1HTBA 1Z45A 3RWBA 1R0SA 2HCTA 2Z1NA 3JCZA 4NJMB 1H6BA 1XG5A 2OP0A 5GMOA 1U4OA 3LC1O 2D2IA 4B4UA 4NHEA 2CF6A 1DOHA 3OF2A 4LCJA 4WLVA 2Q1TA 1GV0A 4PN3A 2B5WA 3KBOA 3U49A 1Q0LA 3M6IA 3RBZA 1F8GA 4DC1A 4YQZA 5JFOA 1MLDA 4DPMA 3S2IA 3V1YA 3UKOA 5T8KC 1MG5A 3DZKA 4YWJA 4YJHA 1PEDA 1V3TA 2PKQO 3KEQA 3OFSA 1EBUA 2V6FA 3U4CA 4D45A 5LDHA 3CINA 4NDNE 2I66A 4Q39A 2JJYA 1KYQA 2ZJ1A 4L75A 4YYZA 1VPDA 5EQFA 2X5KO 1X7GA 4PFJA 3ENKA 2HLPA 3TOZA 4S3MA 5KVSA 5BQFA 4BMNA 1ZJYA 1QV6A 5A9SB 1EQUA 4QUKA 3FSRA 3IL2A 1E1NA 3GHYA 2FPIA 1LDEA 1OC2A 3E8XA 2IZ0A 2Z95A 3EW7A 4Z3DA 3E03A 1G0NA 4E4YA 4BNKA 4XWYA 1U2GA 3KRTA 3RBXA 3E9QA 4I8XA 3AUTA 4Y6PA 3I9OA 3OP4A 3QVTA 1EDZA 2YV2A 4H15A 2ZTLA 1LI4A 2VYNA 3MWEB 4XYEA 3JD2A 2OBYA 2NWQA 1ZKMA 3U0BA 2QHXA 5JS6A 4CODB 1BXKA 1X1EA 1Y5RA 4E2YA 3ICCA 3K6JA 2WYVA 1OI7A 1Z7EA 2G5CA 2VUUA 5JDIA 5JMWA 1DIBA 3JV7A 4FGWA 3PHHA 1XU9A 1F17A 1U5CA 4QSMA 4DLLA 2GUGA 3EHEA 1VI2A 4AJHA 5BSEA 2OUIA 4PG7A 4MOWA 2PY6A 5KJCA 1LQTA 2PH3A 1K2WA 2UDPA 2VOEA 3WGZA 5G4KA 3FN4A 5ENVA 3C7AA 4F6LA 4OKNA 2R6JA 5JCXA 3BMOB 1QP8A 1Q2XA 4EUEA 3WGIA 2BLLA 1SPXA 3DHEA 1FDUA 1VSUA 3M2PA 1YB4A 2W2LA 3GZ4A 5CDGA 1QG6A 1E7WA 4UVDA 1LBEA 5G0WA 3DO5A 4M1QA 1N9GB 3ORFA 1TXGA 2P9GA 2VHVA 1ZMOA 4XCVA 3CZRA 4RPLA 4N18A 4HKTA 3BMQA 4A03A 5CDYA 5TRTA 1HYGA 2V6BA 4I5FA 1SCUA 4TRMA 1E3IA 4QTZA 4FGSA 3OIDA 1Z73A 3EUWA 3OMLA 3B1FA 4XJTA 4AJIA 4YQYA 3DMYA 1ZNQO 2JCVA 5A05A 5L7TA 3DXFA 1AN9A 5MGBA 2JCYA 4RF5A 3FF4A 3GF4A 1BSVA 1TI7A 2FR0A 3PIIA 3F1LA 2QZ9A 4MVJG 4XB1A 1LSJA 1JKFA 1HDXA 2DAPA 1B8VA 5ENDA 2BRUA 4Y98A 1NHGA 3VTZA 5C7IO 1PJLA 1FF9A 4J7CA 2YUTA 4L0QA 3KTDA 5I7VA 4TWRA 1SO8A 3KYCB 4JLWA 4BO5A 1RM5A 2G1UA 3D7LA 5MDHA 2JL1A 4PLVA 4PIVA 1O0SA 1XCBA 1CQIA 1EVJA 1H2HA 4HBGA 3ZWVA 3OICA 1U9JA 3H9EO 5U1PA 4WCFB 5COQA 4KWIA 5BSHA 5IDXA 1ZEMA 1ZK3A 1I10A 1XKQA 2A94A 2O7SA 3TDKA 2XPCA 5ITVA 4KWHA 1BMDA 2PR2A 5G0TA 3MZ0A 3WJ7A 3MJVA 3L77A 1I01A 2V6MA 3DBRB 5B4TA 4HFMA 2D5CA 2JAHA 5KWEA 3D1LA 5JAQA 1IPFA 5EJ2A 4E33A 3NUGA 3I4FA 1JVSA 4EJMA 5GY7A 1BHSA 1JA9A 1EUDA 1P1IA 2VUTA 2E4AA 4Z9XA 1YVEI 1EBFA 1B8UA 4UEKA 4D7AA 1F0YA 2F1KA 3A4VA 2AW5A 3KUXA 3R0IA 3IP3A 4FOSA 2P5UA 3VVCA 4OM8A 2YHIA 4OJNA 2NACA 2BFAA 1ZIDA 3A06A 4WECA 4BNLA 2Q1WA 2UYYA 5EINA 4YXFA 1BRMA 3QVSA 2R00A 3PYXA 1AXGA 1E5LA 1IHYA 4S1VA 1UXJA 3RFXA 5I8WA 2BGMA 2VN8A 3WICA 1NX6A 4DUPA 4B8ZA 4N7RA 2NQTA 1VJ1A 3NRCA 3UF0A 3PJFA 1PGPA 4NBRA 1R6DA 3ZNQA 5JO0A 3L9WA 2VZ0A 3AY7A 1LSOA 3QV1A 3QE3A 3WX0A 2HK9A 4E5KA 4ZJUA 1ONNA 4CM9D 3ZU2A 1LUAA 2DFVA 5B1YA 1MUUA 2VHYA 3KYCA 1PX0A 4MKRA 3M2TA 4RQUA 2WYUA 4KDFA 1N7HA 3PFFA 4KUHA 1DC6A 2X6TA 1SAYA 2EW2A 3C7DB 1YXMA 1R0KA 2FSSA 1DJQA 2EW8A 2HDHA 5FF9A 1TT7A 4P8RA 2JD1A 3V5NA 1HYHA 4E5PA 3GRPA 1LC3A 2ET6A 5JC1A 4IDEA 2A4KA 2I3GA 2J5QA 2HMWA 3E5MA 4BOYA 4YT5A 3EVTA 3ROKA 1YL6A 1TA4A 4JN6B 2VWQA 2H5LA 1H9AA 3GAZA 2P91A 2H63A 1N1GA 4N5LA 3OM9A 4NFHA 4RQTA 3I9JA 1I3KA 3OJOA 2GZ2A 3PLNA 4IXWA 1VRWA 3RJ9A 3U4IA 2IODA 1A9YA 3AY3A 4ALLA 4MJLA 2YFHA 5AXAA 3LK7A 4E2ZA 2B37A 1OFGA 4HUJA 2YV3A 1NR1A 5BT9A 3ZWMA 1C14A 3LF1A 3JQ9A 3MEQA 2Y1GA 3D4NA 3G1UA 4YJFA 3FWNA 3PQEA 2JD2A 4RO0A 5H81A 3BTOA 2NVWA 4G5HA 1UXIA 5U4QA 2IXBA 3WFIA 3WTCA 1ENZA 3SX2A 5T64A 4UAGA 4W99A 3IIEA 3JQAD 1JWBB 2RHCA 1UZMA 2NM0A 2GRAA 4L4RA 3HSKA 5T5QA 4WJZA 1BWSA 4YR9A 4YACA 4NFYA 4DIFA 4P22A 1DPGA 2O3RA 1A7KA 1YBVA 2ZYDA 3VOSA 3WG9A 4F46A 3T7CA 1KVQA 1YE3A 1EMDA 3C1AA 3GGGA 2HSDA 3WQQA 3RFVA 1P3DA 1GZ6A 5DT9A 4RLSA 4JJFA 1HE3A 5TC4A 3QLJA 4WLOA 5DOZA 3RUHA 3OJEA 4DPKA 2W2KA 4RVDA 1OZAA 3OETA 4IJUA 1X13A 2FPGA 1BVRA 1MP0A 1WWKA 2Y05A 1WMBA 3C8MA 1T2EA 3JYNA 3ZWWA 1G0OA 1GCOA 2OORA 4QO7A 4EDFA 3DQPA 2Y0CA 4YA6A 1RYDA 1NM5A 1KEPA 2PLAA 1Y8QA 2I65A 2VOJA 2O3TA 3ANMA 4LW8A 1UAYA 4OOFA 1KIFA 3Q3CA 3LC2O 4K6CA 5L40A 3DAFA 4WKGA 2W4QA 4NBUA 1I2ZA 1L1FA 5DCYA 2AEMA 1NPDA 3INGA 5L53A 5HBRA 3EZLA 3DONA 5CDSA 3WTBA 2C7VA 3L6EA 5T8KA 4JROA 4CMJA 4ZRNA 1HE4A 3PK0A 4XIYA 4EYEA 5KKAA 4IUYA 4DYDA 3JQ8A 1YKFA 4Q3EA 2G82A 2NV6A 2Q4EA 1A27A 3Q9UA 4GSLA 2LDXA 2PZMA 3ASUA 4PVCA 1MFZA 2C5EA 1T1RA 1NR7A 4URFA 3W4KA 3GVCA 2Y1DA 3Q0EA 1G6KA 3FBGA 1K5HA 1ZVMA 3WBBA 1O95A 5FEUA 1IB6A 2P9CA 3WIEA 5HS4A 2ZB3A 5A02A 5CG2A 1FDWA 1ISFA 3IJRA 4A10A 1YL7A 4MIYA 1H6AA 4LN1A 4RV9A 2C29D 2NTNA 1PL8A 1PGOA 3GRKA 4DTIA 3UH1A 2DKNA 5HWSA 2ZYAA 3RC2A 2X0RA 2WMDA 2RBEA 4RCVA 4RVGA 3OIFA 2YQ4A 1EEHA 1YBMA 4N5MA 3WGYA 2CMDA 4M55A 3WGQA 5BR7A 3I6IA 4OXKA 4PRLA 5A04A 4PZDA 5C7LO 4IJWA 2B83A 1Q7CA 2CUKA 3GZNB 4J1QA 2QIOA 4AJ2A 4PLWA 3QJ5A 2WD7B 3UAGA 3AU9A 1KEUA 5ILOA 1H0KA 1NTOA 4IDCA 5L95A 4HX5A 1E3WA 1WDLA 2QYTA 3PFWO 4QECA 5TSDA 3NDJA 3EMKA 3C85A 2P5YA 4J3FA 2RH4A 1O6ZA 5G0SA 1K6IA 5CEEA 3G17A 3DAGA 5JY1A 3UVEA 3ST7A 4XX0A 4OHUA 4KQWA 1R4NB 1PR9A 2NVUB 3G0OA 3SC4A 4CM1A 5JDCC 1PU2A 1ZK2A 2A9FA 1PSDA 1H6DA 4BO2A 3AY6A 1E92A 1T2AA 2Z1MA 3ZWPA 2ZKLA 3D5TA 4L74A 2CZCA 1VL0A 3HJAA 1IZ0A 1GEEA 4KQXA 4YCAA 3KSUA 1NVMB 1D4FA 1GPDG 4CQMA 4GKBA 4DGSA 4FFRA 5IDYA 4QX6A 3DL2A 3H5NA 4B4OA 5K6AC 4OO3A 3CH6A 2WM3A 4M87A 1R4MA 3C7CB 3JD1A 5CP8A 2QG4A 5JLAA 3E82A 4NR0A 1FK8A 1ZH8A 4CMAA 3GVPA 2O3JA 4BHTA 2JD0A 2Q46A 4XYLA 3ZW9A 1WMAA 3DBVO 4LSWA 4LISA 1AXEA 3E6AA 3VKVA 4CMIB 1LDYA 2DUWA 4TVOA 1ZFNA 4FFNA 1BW9A 5KOIA 3KLPX 3KSDO 5ADHA 5JE8A 2C5AA 4XQCA 4BNJA 2OZPA 3IC5A 3K5PA 1UH5A 3EZYA 3G49A 3ONDA 2HU2A 3OSUA 1W0CA 4H16A 4ZQGA 2Y1CA 3JD3A 1JAYA 2CVQA 4FIZA 4K1LA 3FPCA 4BO0A 4GLLA 4OL9A 2DQ4A 4LCEA 4BL5A 2C59A 4R1NA 1A7AA 3LVFO 2IDZA 4RZIA 1A4UA 4B7CA 2IE0A 2IYOA 4MVJI 1E7RA 3GZNA 3E9NA 3RUDA 2ZCVA 4UVEA 1JTVA 4BNXA 2X23A 4OSOA 4TZKA 4J90A 4R68A 4IY1A 5CEJA 4WPGA 5F1PA 3H3FA 2FZWA 3GDFA 4R16A 4J16A 4NK5A 3W8FA 3GUCA 1Z6ZA 2QQ5A 3JD4A 1DFIA 3R3SA 1XWFA 3PHJA 2OOSA 1WDMA 1CQJA 1EFKA 4Y9DA 3O8QB 4IM7A 5COAA 4WCFC 2CVOA 1QXSA 2FSVA 5JAMA 4CLXA 2I3AA 3CTMA 3GAFA 4NFSA 2C0CA 4J6FA 2BHLA 2W90A 3GLQA 1NFFA 5BNFA 1CF2O 2CDBA 5KJ6A 1B3RA 5LC1A 2P9EA 4UUNA 3VPGA 3F4LA 3MCVA 3TZQA 3GUYA 2IZ1A 5THKA 1HLPA 1EVIA 3RU9A 4GVXA 4DBZA 1SBYA 4X54A 4GWGA 3PXXA 3NGXA 3A28A 3DBHB 4RL6A 4ZA2A 4QQRA 1MC5A 4KDEA 3JQGA 1C0KA 3A14A 4FPXA 3DFUA 3TZCA 3RUAA 1M66A 4CM4A 4R1SA 1P31A 1EUZA 5A5FA 1Z75A 2VWGA 3H6KA 3JYOA 1LJ8A 2GGSA 3H5RA 3AU8A 5TX7A 3ROPA 2BFPA 3GEDA 3KSZO 2Q45A 2RHRA 1I30A 3ZI0A 4U0KA 4BS9A 5TT1A 4CMCA 2NADA 3NYWA 3I9MA 4ZN6A 3D3EA 4LGVA 4YJGB 4BKRA 4CMEC 3N74A 3KO8A 4AG3A 3JQ7B 1OBFO 2AE2A 3B70A 4HADA 2QRJA 4PLTA 5IDQA 2GF2A 3MJEA 1ADGA 3OJ0A 5A3VA 1K6JA 4BKPA 3C3XA 4XGKA 3BTUA 3H2SA 1E7MA 4CMHA 3GT0A 4RPKA 3PWSA 1UR5A 3TSCA 1ZK4A 4OSPA 2D1YA 2VWHA 3T7EA 1PQUA 2GPTA 1ISMA 1C1XA 1MGOA 4GI2A 4R3WA 1TT5A 3ZV6A 2BKAA 1RM0A 1XA0A 1ZK1A 2CDAA 5L3ZA 3ZWNA 2G76A 5IDWA 1ZXBA 2J3JA 3PHIA 5AVOA 5JO9A 4BO1A 3JQEA 4DREA 5TIIA 4ALKA 1ZMTA 4I9NA 1UDCA 2AG8A 4XGIA 2VRCA 3UICA 3O26A 2YDXA 3PGXA 4BO9A 3FNHA 3E1KA 3QW2A 2Q50A 4NG5A 2C2XA 4AJPA 4CM8B 3UCFA 4E32A 1LLUA 1MXFA 4YT2A 1PS8A 5IJZA 3SLGA 1Y8RA 3O4RA 3K92A 3ETDA 4I5DA 1GD1O 4ND2A 3I52A 3AOGA 5G0UA 5H83A 3X2EA 5DNAA 4B7UA 3U09A 1U3UA 3OHSX 3COSA 4J91A 4J9UE 5LDGA 4JNKA 2Y1EA 3PHLA 3SXPA 3KLMX 1E0DA 2I99A 4E5NA 1LA2A 3NTQA 4MIOA 1PZEA 1S6YA 3GG2A 3RIHA 3SVTA 4ALMA 1DDOA 3Q6IA 2HUNA 3GPIA 4FJ2A 5A4DA 3UUWA 3ZWXA 4YBZA 1U7TA 4TSKA 2TMGA 4Y67A 5HS6A 4ZICA 4GMGA 3I9KA 5C5IA 1PR3A 3D3WB 3U4HA 5JAZA 3WIDA 3NX4A 2PNFA 2EEZA 3AUAA 4QFCA 1J49A 4BGVA 2BH9A 1DLJA 1DIAA 3W4IA 3ZV3A 1ULSA 2D4AA 1P74A 4KUGA 4Z6KA 2RCYA 4FJ1A 2YFQA 2Q2WA 4JK3A 4KUEA 4RPHA 3VDRA 5IZCC 1GYQA 1F8FA 2J5KA 3E48A 4OGWA 4GSKA 3L07A 3WNVA 1O89A 5JBIA 1BGVA 4DLAA 2PD6A 3N58A 3W8DA 4CR7A 4DYVA 2O3UA 1E1LA 4D3DA 5I9NA 3HQ4O 3FTPA 4HFJA 4NJMA 4CLDA 1OAAA 3TNLA 5KVCA 2GCGA 4MVJM 3WGGA 3WNQA 1E6EA 3OA0A 4TVBA 1ONOA 3RROA 5I9MA 4PG4A 3QP9A 1HSZA 3QY9A 1YDEA 7MDHA 4IS2A 4HNGA 1SNYA 1DHRA 3DOJA 5KJ1A 3C1OA 1ENOA 1I3LA 1MV8A 3U62A 1XYGA 3ZH2A 4EW6A 3OBBA 1NASA 1EDOA 2VCYA 3K30A 2DBZA 2X0NA 3B6ZA 4FDAA 2X7HA 4DQUA 1H9BA 3V2UA 5AXBA 1LDNA 2VZ8A 2EERA 4O63O 4O1MA 4XYGA 4BV9A 2FY8A 1X1TA 3JQAB 1B26A 4OYRA 1TLTA 3F9IA 4J2OA 3BHMA 1KOLA 3NT4A 1RJWA 4UEOA 1AGNA 1Z7BA 3I9NA 1E3JA 1EK5A 3DZHA 2I5PO 3KZVA 5CHEA 1EE2A 1I33A 3LT2A 3AM3A 1Y9AA 2O3QA 4JGBA 4ITUA 1M67A 1B7GO 5A9SA 1LRKA 2C07A 3HNPA 4BGEA 4YRDA 1ADFA 1R16A 4YRBA 4GAEA 3RI3A 5GZ3A 3DZFA 2UV8A 2VWPA 4CM7A 4INAA 4PLGA 2QYSA 1HZJA 3H9JA 4IMRA 5B4VA 3TZ6A 1WDKA 2JHGA 2R2GA 3MJTA 4K26A 4PVDA 4ALNA 1FMCA 2O48X 1PJCA 3TL3A 1QMGA 2UAGA 4GPD1 4F6CA 1PJTA 4R01A 4WLNA 3UCXA 4XYMA 1E3EA 2CVZA 4HV4A 5ITWA 3NV9A 1G1AA 5F5LA 4GX2A 4XA8A 4BUCA 1HE2A 1UXGA 3QWFA 4IJVA 1CETA 4IZHA 4OXNA 3GK3A 5JDCA 1H6CA 1KY4A 4JBIA 3HB4X 2NLOA 3DTTA 4B4WA 4UUOA 5GZ1A 1GL3A 1PGQA 4J1TA 2V6GA 1N8KA 5KIAA 3B20A 4MVJA 5JC8A 4BNNA 1WP4A 2XAAA 4RVUA 1WPQA 4EJ0A 3D4PA 1WZIA 1YOVB 1CERA 2VYND 5K6AA 3IJPA 4FBGA 1P1JA 3QA9A 2EF1A 3R3JA 2GYYA 2Q49A 3PP8A 5ER9A 2DFDA 1DAOA 3BMOA 3I5MA 4DPLA 3HDHA 1SZJG 1EVZA 1NFRA 1NQAO 1JW9B 3ZHZA 3ICPA 3PRJA 3RBVA 1D1SA 3PYMA 4J4HA 1V0JA 5IFLA 1PJQA 2FOIA 4YT8A 1N9GA 3VPFA 4AJLA 4BNHA 3QRWA 3KYDB 1E6WA 1J5PA 4E6PA 3DBLB 4BNFA 3JQDA 3GHHA 1YQGA 3GVIA 1HDZA 4LK3A 2IZZA 1O8CA 2VYVA 1LTHR 1GU7A 2OXIA 2XF8A 1ZK0A 3WLEA 5HTOA 1BDMA 2BI8A 1YQXA 4KZPA 4AJNA 3L4BC 3V1TC 3GNQA 2DTXA 1U7HA 4AVYA 4BNVA 3BTSA 1MG0A 5KVVA 1E3LA 4BKUA 1HZZA 1QYWA 4WCDA 5KJEA 1LLDA 4GWKA 4UULA 1HDCA 5F1KA 2J3HA 3PJDA 1WLYA 4II2A 1ZW1A 3MJCA 3CKYA 3ETGA 3GN2A 3I4CA 4XZ3A 3ZNNA 4B7XA 1T24A 1Y81A 5EIOA 2ZTVA 4B3JA 3PWZA 1MA0A 4RJTA 1O9BA 4GQAA 1SC6A 4GX1A 5F5NA 5DCWA 4D3SA 3CUKA 4Y8VA 4D0RA 4FFPA 3OECA 1JAXA 3VH4A 2DT5A 3WFJA 3TL2A 4KTTE 1BVUA 1C1DB 3ADPA 2B0JA 3EK2A 3FNEA 3IMFA 3IUPA 3ZZNA 3EY4A 4WCFA 5T6BA 3WGHA 4DQVA 4CV3A 1ORRA 1YL5A 2E6UX 4J43A 5IZ4A 2FR8A 3ROMA 4MP6A 1F06A 4OH1A 3FHLA 1YONA 2OFPA 2EJVA 4M54A 4ALIA 2VT2A 3DBRA 1I0ZA 4XR4A 5B37A 3U3XA 4L9RA 4A26A 1I24A 1DFHA 3GDGA 1GV1A 5TJHA 3PZRA 1LQUA 3IQDB 4WEQA 1M6WA 4IMPA 1QYDA 3INRA 2BFMA 5BNTA 3AW9A 2LDBA 1GQ2A 2YY7A 3PLRA 1WZEA 2B36A 4ZU3A 5DBIA 1KY5A 4BGIA 4Z3KA 3VAZA 1JLLA 1HSOA 2ZTMA 3AFMA 2JCXA 4ILKA 2C54A 1LDBA 3PQDA 1HEUA 4WNIA 3BMCB 4YAGA 1U3TA 3PVZA 4E5YA 1YJ8A 4FJ0A 2Y93A 4MO2A 3AM4A 3ASVA 5EESA 4CMEA 1V3UA 1KVRA 4IQGA 2P68A 1KBZA 4W7HA 3OA2A 2XXBA 5IF3A 3KOUA 2PTGA 4TKLA 4J0FA 4IIUA 5F21A 4U6SA 4DBVO 3EDMA 2NQ8A 4AJEA 3A9WA 3RC9A 1C3VA 4BO6A 1BXGB 4JBHA 1QSGA 2J8ZA 2CFCA 1K89A 3AFNA 4NIMA 1NQTA 3WYBA 3QHAA 2Q99A 1DC3A 4RDHA 4R69A 4Q3DA 1Z82A 5KJFA 2AHRA 2AQHA 3GGOA 2HMSA 1P1RA 4I1IA 3KYBA 5ICSA 3P2OA 2QX7A 3ZGYA 3MWDB 2EGHA 2V65A 4L4XA 4P4LA 1GDHA 1DB3A 3WQRA 2DBQA 4J49A 2AXQA 4DMMA 3GN1A 1GCUA 1E7SA 3PHGA 5HM8A 5L7WA 1GADO 5DULA 2H9IA 2VUSA 3PGJA 4L76A 5L45A 4TKMA 4CV0A 4EUHA 1PJ3A 3AK4A 1RWBA 2HJRA 1NPTO 2X0JA 2Y68A 3DDNA 4JXKA 5KVQA 3UFXA 2WWRA 1IY8A 4XB2A 1LDGA 2NSDA 1Q0QA 2NTJA 3VPXA 2ZTUA 1RM4A 4RZHA 4CLHA 4GVLA 1Q1NA 1FDVA 3LZ6A 1H2BA 3LU1A 1PJSA 3ULKA 4AL4A 1Y1PA 3RQSA 1JDJA 2GERA 1KVTA 4G2NA 4JQCA 4ZGWA 1X7HA 1Z74A 1M2WA 3LLVA 1GQYA 5CAEA 1ISIA 3IDSA 3NAQA 3H7AA 1PL6A 4J7XA 3S8MA 4JP2A 2X9NA 3CZMA 1YJQA 3WSVA 4CPDA 3TRIA 2H1SA 1CRWG 3VHRA 4PLZA 5L51A 3TJRA 1GPJA 4UREA 4E21A 3CE6A 1JN0A 5LCXA 3K31A 1XGKA 3NJ4A 2GN9A 2PD4A 3EC7A 3DC2A 4XQEA 3OJLA 1N92A 2CDCA 3DOCA 4WNCA 4DMLA 4CUKA 5J23A 2VHZA 3ZU4A 3RC1A 3V2HA 1R66A 3ZN2A 3IAHA 2GASA 4E5MA 2GLXA 3JQFA 2GNAA 2D3TA 1BXGA 3GEGA 3D5QA 3ITKA 5A9TA 3WJAA 1LSSA 1U2DA 3E9MA 2B4RO 4HWKA 3B1KA 4JBGA 4XR9A 4TRRA 4DWVA 5IZCA 5TT0A 1R12A 3HADA 4D3FA 1UP4A 5KKCA 3GVXA 3WS7A 4YAIA 1U3VA 2BI7A 2DPGA 2NTVA 4FOOA 3OEWA 3OIGA 1SEVA 5BSGA 3ZDFA 1LXCA 2PH5A 1PS9A 5L9AA 1PJ2A 2B4QA 1M75A 1V8BA 1GQQA 4BNGA 5U9CA 1SMKA 4IJKA 1HE5A 3WGOA 2WSBA 3KHUA 1NHWA 4CMKA 1AE1A 3AUUA 2Y0EA 4O59O 4R41A 2WEKA 3GA0A 2X4GA 1BG6A 3HHPA 2PGDA 1LRLA 5H82A 4WE3A 6ADHA 2Q2QA 4NPCA 3D4OA 3O9ZA 3F46A 4OIMA 2ZJ0A 2X8LA 2BMAA 5F1OA 1C0LA 3QVOA 1NWCA 2EKQA 4N54A 4R9RA 4NNJA 1DHTA 8ADHA 1ID1A 1EK6A 3B1JA 1LX6A 3BA1A 1NWHA 1UP7A 3E5RA 5B12A 1NAHA 3PEFA 4R3NA 4FS3A 3KXDA 4A27A 1HKUA 4AICA 5DN9A 5EERA 3HN2A 3AOEC 3Q11A 2VNAA 4YEDA 3LT1A 4NQZA 4J1NA 4HP8A 4BO3A 4B3IA 4CJXA 4GLOA 5AQ1A 2GZ3A 4BNTA 3C24A 2XOXA 3H3JA 3P7MA 2FN7A 4UVGA 3H9QA 2ZYGA 3WYEA 1NAIA 3CXRA 4CL3A 2NU7A 3DAPA 1YQDA 4R1UA 4AJ4A 1WXDA 4D43A 1IZ9A 4ONEA 3FCOA 3GDOA 4A73A 2FP4A 1ISJA 3ZW8A 3LF2A 4BNIA 4TMFA 2CY0A 5JXWA 1MXHA 3ZWYA 5CDUA 5IXYA 4CLRB 3P5SA 3X2FA 2ZCUA 6LDHA 3NT5A 1Q0HA 3LSYA 3AWDA 4A0SA 3EYWA 2WD7A 1M6HA 4I5EA 3KETA 1YH3A 3U9LA 4ND1A 1CYDA 1UUFA 1DFGA 3WMXA 2XXJA 4U7WA 2FR1A 4FFLA 3G1TA 4IZIA 3ZV5A 4LMPA 5DF1A 4CLOB 4UEJA 5FYDA 1HWYA 4W7IA 1P45A 1XQ6A 1Y7TA 2UUPA 2GN8A 1MB4A 4UVHA 1R4NA 3BXXA 4D0SA 1OMOA 2NVUA 1F12A 2I67A 1U8FO 4BNWA 1UAGA 2J3IA 4C4OA 3WQSB 4RLHA 1DIHA 5CG1A 1BTOA 1PS0A 1LRJA 2Q1UA 4NBTA 1GY8A 3HB5X 1P44A 3AI3A 1PGJA 2JFGA 3RUIA 1DLIA 3I1JA 4U8GA 3NKLA 1C0IA 2OMEA 2VHXA 2YDYA 1DIGA 1XU7A 4H7PA 4TRJA 3GOHA 4CLEA 5CPBA 3F5SA 5CEFA 3JYPA 5IN5A 2QRLA 3JTMA 3WWZA 4E30A 2EP5A 3JYQA 4O5OA 3CEAA 4BQRA 1J4AA 3IOYA 4PLPA 5ER6A 1DSSG 1YDWA 3OQBA 4BNMA 4CMIA 3AI2A 3L4BA 4CQMD 5T57A 3JQCA 4NI5A 4BB6A 2AEJA 2IYPA 1X0VA 3VH2A 2UVDA 1GUYA 2HK8A 5CDTA 1DIRA 1KEWA 4IIVA 4YJHB 5CPFA 4BKQA 3W6ZA 2HK7A 5DOVA 4ZHSA 3QIVA 1NVTA 1EE9A 1PGNA 4GGOA 2DBRA 3T4EA 1PZGA 3U5TA 2WJPA 1AHIA 2QW8A 4MVJE 4MINA 1VC2A 4W6ZA 4KMSA 4IQ0A 2EIHA 3TZHA 5G2OA 2OHXA 4QT0A 5I8ZA 3L0DA 1CJCA 3GGPA 3TF5A 4M86A 4P38A 1ZJZA 4Y6RA 4PLYA 1P0FA 1QRRA 3UW3A 3VC7A 3H4VA 2FZEA 2HRZA 1LSUA 4AJ1A 2VQ3A 4D42A 5JYEA 4E3ZA 4WGGA 2ZB7A 3DTYA 3K2BA 4XRGA 3GQVA 4PRKA 1KVSA 2OL4A 1TB4A 3DEYX 5L4SA 4NK4A 1U8XX 1XSEA 2O2YA 3O03A 3D0OA 4EUFA 3TWOA 4E31A 3LYLA 4GBJA 2EHDA 3ANLA 3NTRA 3WXBA 4C7JA 1W4ZA 3O8QA 2C20A 2YJZA 1YWGO 2W8ZA 2EXXA 4HFNA 3QWHA 5ICMA 2ZATA 4CM5A 3GR6A 4EJ6A 2B5VA 3AM5A 3GC6A 4YTEA 1UZLA 4A7PA 3K9QO 1SOVA 1J0XO 3KV3O 1PJBA 1T4BA 3BZUA 2YZ7A 3STHA 2CSUA 2P4HX 2EWMA 2NU6A 4YPOA 4NU6A 2AMFA 1JQBA 1GYPA 4RF2A 3S1LA 4H3VA 3ZNOA 1E1MA 5I7FA 2GDZA 4WASA 2AQKA 1C0PA 1D7OA 3DBHA 1DEHA 1W6UA 1W8DA 1HDOA 3DZIA 1E77A 1UXHA 3TOXA 2I9PA 5G4KB 4K9DA 4FR5A 9LDBA 4IDAA 4P4GA 1T26A 2EGGA 4MKXA 3UCEA 5TQVA 4PG8A 2G17A 2FRDA 1ZEJA 1EZ4A 3FPLA 3RSHA 3HN7A 4JJIA 4PG6A 3BHIA 1KEVA 3IP1A 1A71A 2JFHA 4K28A 4YJGA 1N1EA 3TN7A 2DLDA 3BMQB 4JIGA 5JCJD 4WOJA 4A5OA 3FD8A 1P9LA 3JQ7A 4RVHA 4CUJA 1NNUA 5TJ9A 3ONEA 4DL9A 1HT0A 4RF4A 4IGFA 4RORA 1PQWA 3VZQA 2DTEA 3SJUA 3JQFC 1D1TA 4E13A 3RC7A 2E37A 3KEOA 5I9LA 3GH3A 1HDYA 5IXSA 3VTFA 4DIOA 2ZB4A 2GD1O 3EAGA 2EV9A 1WNTA 4ND4A 3H9GA 4YAEA 3WLFA 4EITA 1D8AA 4YRAA 3Q1LA 3FBTA 1QR6A 2A92A 5TF4A 2J6IA 1RKXA 1A4IA 2HMVA 2PGJA 1HDRA 2IRWA 3HDJA 1K3TA 1D3AA 4D46A 3C1TA 3G3EA 4P4NA 3H65A 2C7GA 4FC7A 4IDBA 2WE7A 2RIRA 5GZ6A 2VTEA 4XKJA 3RKRA 1V9LA 5KCZA 2PKRA 1XQ1A 3LT4A 3SC6A 4ZD6A 1PWZA 3W6UA 4O0LA 3TFOA 1I3MA 4ZRMA 1Q7GA 4K6FA 4CM8A 4AJOA 5TGDA 1NP3A 3MOGA 1K0UA 1A5ZA 5IN4A 3WGTA 3W8EA 4UVIA 1L7DA 4CMGA 1ZXLA 5A1TA 4MPDA 3UN1A 4QFDA 1FXSA 1XR3A 1YRLA 1V6AA 1PIWA 3NGLA 3L4SO 1U3WA 4OAQA 3TQHA 1U4SA 4XJSA 1T25A 1HDGO 4GGPA 4FCCA 1DRVA 1PZHA 2VRCD 5K9ZA 3K96A 3QWIA 4XQGA 1VM6A 4LMRA 2X58A 5C3MA 1PQPA 2WE8A 1VL6A 3Q2IA 4Q3CA 1I32A 1JU9A 3F5QA 4LRSB 3Q9NA 4CQLB 2X5OA 4WK6A 1WVGA 1XEAA 5L4LA 4E2XA 1VLLA 1B16A 3GNSA 3PTZA 4OXYA 5AXCA 1OOEA 2Y66A 4OKIA 2Q1SA 2IEBA 3DHNA 1E6UA 3QWBA 3FI9A 4KP7A 4IQ8A 2YHIB 3T4XA 2POQX 2O3SA 2QZZA 3V1UA 4PG5A 2DVMA 3DMTC 4FD3A 3D3WA 3RKUA 2P4QA 4CM9A 4LVUA 4DIBA 2PKQP 4BO7A 1I2BA 3S2GA 2CNBA 2YHUA 5BSFA 2RH8A 2DPHA 2YW9A 2B4TO 4W9NC 4R54A 2AG5A 4DVJA 1BDBA 4QO8A 1ZSNA 2PZLA 3SJ7A 1YO6A 3GFBA 5F3RA 1NQ5A 4EGFA 1NQOA 1T2DA 3OJFA 2NNLD 1UDBA 1GTMA 4QEDA 4I9HA 4G65A 2H6EA 3VPSA 3R1IA 2PZJA 4CM3A 1DJNA 4HY3A 4W4TA 1W73A 4D44A 4Z0TA 4U5QA 1QLHA 2OGUA 3H8VA 1EFLA 2EG9A 1GUFA 3PWKA 5JW6A 5DCUA 1LU9A 2GR9A 2JAPA 3HZZA 4PZEA 3R6DA 3EGOA 4R51A 5CFZA 2NU9A 1QV7A 4LSMA 5FFFA 1QORA 2Q2VA 2WYWA 2Y0DA 4J7UA 1V3VA 1I36A 3HE3A 1ENPA 3DB2A 1NVGA 3NDRA 2Z5LA 1TVEA 2ILTA 2Y99A 4RPGA 2AA3A 2O4CA 4A2CA 5G4LA 9LDTA 4FSHA 4LRTB 4EI2A 2C82A 2EKLA 4DRYA 4MVJH 2BELA 1KS9A 2O4UX 1T1SA 3AOEA 3GG9A 1A72A 1IPEA 5HRUA 1FDTA 1U28A 3RUEA 1OC4A 3KB6A 3PJEA 3OH8A 4IBOA 4XQ9A 4J9VA 4RVFA 5DBGA 1N2SA 5COBA 1PWXA 2GO1A 1B15A 1R37A 3ANNA 4UUPA 3JQAA 2D59A 3WDSA 1ENYA 4XGNA 4CQLA 3MTGA 3PYLA 1MX3A 3OEYA 4JX8A 4F3YA 3ZCXA 4KTVE 4GMFA 4FFMA 2PK3A 1YS4A 2W2LD 1KETA 3HFGA 3ITDA 7ADHA 2O23A 4XEHA 3S55A 3NJ8A 3SBOA 4LVCA 2W98A 2FPPA 3GMSA 3QVWA 3CIFA 4ND3A 1H94A 1UJMA 3I6QA 3TZKA 4YJFB 2HAEA 3H2ZA 1PL7A 1L7EA 1DC5A 4UUMA 4RPJA 3ZHBA 2FMUA 3MOIA 2X1HA 2J3KA 2C2YA 5I7SA 4ZQEA 3FRJA 3DR3A 4GL4A 2OP1A 5TS3A 2I6TA 4HNHA 5TNXA 2JFFA 4FW8A 2DM6A 2X5JO 2PWZA 3I83A 2E49A 5FI3A 5EQDA 1GUZA 4E2WA 3S2FA 4BKOA 5KTKA 1ZBQA 4FN4A 3BAZA 3ZU5A 5JY6A 5L7YA 5ILGA 4J4BA 4MDHA 1PZFA 4KOAA 4GH5A 1XELA 1B0AA 1MC4A 2W2KB 3JQBC 1FDSA 4IGEA 2NUAA 3ABIA 3WR5A 5JSFA 1PJ4A 1R15A 1JKIA 3HFSA 1HYEA 4IXTA 4BGUA 1DRUA 1X14A 3P19A 4NZ9A 2CD9A 2HO5A 4GX5A 3CMCO 3RFTA 4AFNA 4CR8A 1B8PA 1YOVA 4CM6A 2HRBA 4WOKA 3F1KA 3ZWBA 1WAMA 1KC1A 1Y8QB 4ALJA 3VZSA 5JPIA 1X15A 1P1KA 1E7YA 3RASA 1LLCA 1WW8A 4ZQBA 5EPOA 3VDQA 5A5EA 1LDMA 1IE3A 3I9LA 1YB1A 5B4UA 1P77A 1O5IA 1ZZEA 3KYDA 4IPTA 4MVJD 2B35A 3DBLA 4R9SA 1JKJA 3PI7A 4E0BA 4L4SA 3W4JA 4N5NA 2Y67A 4EEXA 4B3HA 3U4DA 3JQ8B 4Q3BA 4I5GA 3RCBA 1XIVA 3RUFA 3FTNA 4CMBA 3UHAA 2AEFA 3PIDA 3PZBA 1DAPA 1T2CA 3JQ6A 5DP2A 4ZQFA 5A03A 2QRKA 3FNGA 4MVJF 4BNYA 3ZU3A 2GSDA 1I2CA 3CSDA 4L73A 3LC7O 4Z9YA 4DQXA 1VKNA 4NJOA 4MKZA 4BO8A 1E1KA 2E82A 3UGKA 3QSGA 1VSVA 4IDFA 3WYCA 1E3SA 4QXMA 2G0TA 4PZCA 5DBFA 1GR0A 4MP8A 4NU5A 2BD0A 3PDJA 4JJGA 1IULA 1VL8A 2VYVD 1I3NA 3W1VA 1NFQA 3JSAA 4F45A 1GEGA 1HF3A 1YGYA 1T4DA 3JYLA 4ZQHA 4Y6SA 3GNTA 4YDRA 3WMWA 4ID9A 1C1DA 1HRDA 4G81A 3GPDG 4IDDA 4AJJA 1Y5MA 4DA9A 3HDYA 3VZPA 1LNQA 1EQ2A 4XDZA 1P1FA 1QYXA 1UDAA 4MVJP 1E3WB 1J6UA 1VJTA 4DC0A 4Q3AA 3BMNB 3QQPA 3HWRA 5T67A 2DU8A 2PZKA 1F14A 2EP7A 2I76A 2IXAA 3JD0A 1E5QA 1SB9A 4FQ8A 1ZO8A 2O50A 3ZWCA 1P0CA 1B3BA 2DUUA 4RVSA 3F3SA 3K8ZA 3H5AA 3O38A 2Y1OA 4BV8A 5THQA 4U6QA 5JDIC 3HUDA 5ES3A 4HXYA 5DP1A 4BMSA 2HJSA 2ZB8A 1GFSA 2HMTA 4CQMB 1AUPA 2A35A 1NYTA 1ZCJA 1GZ4A 4ROSA 3BMCA 5JMPA 4Q9NA 1O94A 1DRWA 4DXHA 4PCVA 3WBFA 1ADBA 2X86A 5HA5A 3FR8A 4RDIA 1R4MB 1GYRA 3K2EA 1U5AA 3OQ1A 2D5AA 2HMUA 5I7EA 3GVHA 4YT4A 1LC0A 1JWAB 1IYZA 2RAFA 3DWFA 1ARZA 1RPNA 2AE1A 3IKVA 1BW9B 1CIVA 1S7CA 1X7DA 3AI1A 3VKUA 2WTBA 1GAEO 3PQFA 2O2SA 3LLSA 3PPIA 3ZWAA 4R4JA 4J4TA 3UXYA 3CMMA 5A06A 2DBVO 3CPSA 1NBOA 1HLDA 1Q7BA 2VT3A 1EUCA 4E12A 4CR6A 4OOEA 3FWZA 4CV1A 5KNLA 1NXQA 1IL0A 3BYZA 2VRBA 5AOVA 2GN6A 3I3OA 3WSWA 2VTDA 3WWYA 5JAIA 3DHYA 3MTJA 3AUSA 1HETA 5IAAA 1JVBA 1SOWA 4J1SA 5K0ZA 2WDZA 1K6XA 4MIEA 4Z9FA 5C7OO 4OQYA 2VNSA 3VH1A 3VPHA 2OBNA 3IS3A 4R5MA 2X0IA 3F4BA 4WLFA 5AXDA 1AHHA 3S2EA 3WB9A 2GN4A 5EL0A 1V35A 2ZK7A 5A3JA 2PGLA 4AJKA 3F6YA 5JNLA 5FI5A 1ZUD1 3HG7A 1ML3A 3BMNA 1UXKA 4J2HA 3ROQA 2YYYA 3Q2KA 3L9XA 3ZWOA 2SCUA 4YAKA 2BGKA 3E18A 3ETEA 1Y6JA 4D79A 3RD5A 4NH4A 3HDQA 3K73O 4B8WA 1HL3A 2E48A 1N5DA 4GKVA 4C7KA 4EBFA 3KVOA 3DZGA 5EMHA 3LQFA 4TROA 1ISGA 3V8BA 1PTJA 4ND5A 4B79A 1YBAA 3G79A 1KERA 3QWAA 3ZHXA 4CV2A 2D8AA 2UUOA 3TFQA 1UZNA 3JQGB 5DZSA 2J5RA 3IUSA 1ADCA 4PGFA 1CWUA 4CM4B 3NTOA 4BMVA 1I5RA 1U1IA 8LDHA 4TQGA 3ENNA 3INTA 1MFPA 1VE9A 1SB8A 3DMTA 5EN4A 1A9ZA 4EZBA 1CEQA 1XLTA 2O7QA 4WLUA 1LEHA 2DTDA 2NVBA 4OMUA 4XRRA 4D41A 3BTVA 4BIIA 4PLFA 4WUVA 1R0LA 4U0JA 3LT0A 3GMDA 1CDOA 1UP6A 3BIOA 4W9NA 4YVFA 3QVXA 4FB5A 4XIJA 1IUKA 2R00C 2PFGA 3M1AA 3NDIA 4M49A 3TPCA 4FC6A 2AQIA 3AJRA 1QKIA 3GEMA 4TRNA 1GZ3A 3IKTA 4RF3A 4M8SA 2VHWA 3RJ5A 3VZRA 1VJ0A 3SEFA 1FJHA 1E7QA 3M1LA 3PDUA 3FR7A 4ESOA 5C37A 3A1NA 1KC3A 4II3A 3GFGA 3L6OO 5L4NA 1P1HA 3F47A 1TEHA 4I9UA 3RUCA 5AYVA 3ZHYA 2B69A 4JCOA 4W82A 3D64A 3NT2A 4R5HA 4XDYA 4Z0PA 5IG2A 1ISHA 2GZ1A 2Q4BA 4HFRA 1C1XB 1ONPA 1SEPA 4RGBA 4R1TA 4BO4A 3GY0A 4NBWA 3ZV4A 1TT5B 4L8VA 5JYDA 2AQ8A 1RM3A 1QYVA 2HQ1A 1H5QA 3BHJA 4PLHA 1ZSYA 1KVUA 3DOOA 4TZTA 2YQ5A 4Q3NA 1P33A 1QYCA 3H9UA 3KM0A 4CUZA 1T2FA 2FWMX 2PD3A 3ADOA 1XDWA 1RYEA 2FHSA 3MJSA 1XHLA 3VVBA 1EVYA 4XYBA 4ZVVA 4OQZA 4JP3A 3PJGA 1M76A 2YV1A 3DZJA 5G0VA 2TMDA 4FFOA 2PA3A 2DC1A 2X9GA 3VH3A 2BFOA 2P2SA 4NBVA 4YB8A 1QLJA 1Y8RB 2EJWA 1DBVO 3RU7A 5DDIP 1Y9EA 3NEPX 3I23A 3ZNPA 1LLQA 1ULUA 2ZIZA 3ON5A 2PV7A 5JCJA 2NU8A 3N7UA 2VZ9A 5TLSA 1VKOA 2IEDA 2BGLA 2D0IA 3RAJA 1HXHA 2JHFA 4B4VA 1B2LA 4I08A 4MP3A 1I8TA 4IS3A 1H93A 3JQ9C 4BQPA 3P2YA 4DLBA 4CLRA 3UOGA 2BF7A 2F00A 3ONFA 4M89A 3WOHA 1DO8A 1X0XA 3DZBA 2CF5A 1N7GA 3MJ4A 4WLEA 3RVDA 2WD8A 3V2GA 5FWNA 3FNFA 3EVNA 3DFZA 5BNIA 4IDGA 1BXZA 4J0EA 1IHXA 4BVAA 4BNUA 4IINA 4Z0HO 1B14A 1NPYA 2X9VA 3L6DA 4WEOA 4CLOA 4CL8A 2EKPA 3OQ6A 3LDHA 3JQBA 2Q3EA 2JKVA 4YJDA 4O6VA 3SLKA 5A9RA 4PLCA 2V7PA 4GX0A 4BB5A 1YB5A 4XD2A 4EEZA 2ZQYA 1IOLA 1DXYA 1ZSVA 2HKIA 4YAJA 4BNZA 4NMHA
chains in the Genus database with same CATH superfamily
1C3EA 2X22A 1AQLA 1PEAA 2DHCA 2GCOA 2OO5A 4EL5A 2ERYA 4EARA 5CK5A 1CJTC 4QD3A 1HFKA 4F2GA 2Z1NA 3GARA 2HO4A 2GX6A 1OROA 4JJ8A 1E99A 2XA1A 4YMUA 2OP0A 1CJUC 5KOHB 4CF4A 2PQMA 1NVVQ 4A6XA 4JUAA 1EGHA 3RG8A 2D2IA 3QKSB 4ARZA 2X13A 4R3UC 2FLKA 2CF6A 3HJRA 4XJVA 1RYMA 3OF2A 1RABA 5KB3A 2XTJA 4FYPA 2VQDA 2E6KA 5BN5A 3OAAA 1EX9A 4DCCA 1ADJA 2FFBA 4QYMA 1P5HA 1U2TA 4KYTA 3TS1A 5WRFA 3B13B 1F8GA 4GPZA 1LF5A 1L4GA 5ICCA 4WUTA 1JSZA 3MTBA 1MLDA 3V1YA 4GYKA 4UE2A 1U0HC 3EDRA 1MG5A 4HNQA 4Q1AA 1PNVA 1V3TA 1Y0BA 1A9SA 1D2AA 1BCRB 2PKQO 3KEQA 3OZGA 3WMRA 4B0PA 4R8SA 2ATXA 1PT8A 3OZVA 1IBKB 3DVSX 5AUNB 4MMZB 4X94A 2B61A 2LIPA 1KE1A 4I2VA 1ZVJA 1OR8A 2ZJ1A 5EJ7A 2IYLD 5IUKC 4EA7A 3R5KA 2PIAA 5LYYA 1L7XA 4PZUA 4YYZA 4A16A 1N2IA 4RCYA 1SG0A 4CNQA 3G0GA 4LHZA 2AK3A 3ENKA 1YGPA 3PUWA 1O7JA 2Y0PA 4HQOA 3ZBTA 2BHSA 4Z9BA 3RANA 3BS4A 4M6WB 3GJZA 1JHZA 1PUXA 1TYDE 3NFRA 5J63A 1J97A 5P21A 2C5HA 3WMFA 3KVNA 3ZH9B 4B6SA 5DNEA 2JASA 4QNRA 2XMCA 1IBCA 1OC2A 4Z3DA 3EW7A 2Z95A 3E03A 2F1JA 1BA3A 1MEOA 2DOKA 4I2NA 1U2GA 5HTKA 3KWJA 2BSQA 5E1DA 1H8ED 4HEJA 4DARA 1T9ZA 3CH4B 2BM1A 1W9HA 3E9QA 1LK7A 4I8XA 1N34B 1HT1E 1IVYA 3P0JA 1GRVA 2YV2A 2YUIA 3LWBA 1GM5A 3DUWA 1IZ8A 2FZVA 2IYUA 2P7HA 2VSYA 1YK1A 4B71A 3PGA1 4FILA 2RAVA 2FWIA 3KZNA 3DMFA 2R25B 4FX2A 5JRJA 4FLFA 5JS6A 3WL3A 4ZEVA 1E4YA 3PF8A 4I4TA 3VR2D 1JDTA 1YVDA 3N2NA 4JC8A 2Q0QA 1D6MA 1GHTA 2PO7A 6Q21A 2OFWA 3DYBA 2WYVA 2M2IA 1R5OA 2ESRA 3WDKA 3UK7A 1DIBA 2FVXA 4MMYB 3BXHA 1SIWA 4WH0A 5K2MA 3F6PA 3HO8A 4GBED 3W5HA 3H1BA 2IX9A 2QAGA 3H8JA 3H1TA 1QTQA 1A3CA 2A0WA 2M6LA 3ZG6A 1L8LA 5BSEA 1UT5A 4UW9A 5KJCA 3RVRA 1WHTB 3VOTA 3GAMA 5CTJA 1J7KA 2CBXA 2Z2KA 3D6VA 2E4ZA 3NBYC 4C4RA 1XDSA 4ZRDA 3OZBA 4F6LA 1E62A 1G5IA 4JA0A 3WGIA 3CRMA 3NWOA 4BFSA 4F38A 4DR4B 1G21A 2FRVA 1CJVC 5EXSA 1EU1A 2BLLA 5LMNB 3I39X 4QUGA 4HNTA 2W2LA 4MPRA 4D56A 5CDGA 2Y2UA 5AMXA 3VVLA 3MGGA 4C04A 1LBEA 4RGQA 3DO5A 5G0WA 1WMSA 1XVAA 2P9GA 1ZMOA 3IEVA 3KZXA 4MUIA 1RE0A 4DCSA 4KQGA 3BMQA 1O6FA 2Q2NA 1AK2A 2BEUA 2P1RA 1ATZA 2V6BA 4OUDB 5A0VA 4BE7B 1UQTA 4MQ4A 4FGSA 1V16A 2C04A 1PJZA 3M89A 3HVUA 3O8NA 5H0IA 4YDQA 2IYEA 2MSNA 4XJTA 3A36A 3ML1A 1OWLA 4YQYA 2P9FA 2VI5A 3P0RA 2BCGY 3QLUA 1U1GA 5MGBA 2H65A 1E3TA 1RQPA 2HHAA 3JY6A 3DO6A 2IUUA 1UBJS 5LXTF 2ORYA 1NNLA 2FR0A 3GBSA 2WVJA 1YZLA 5A4MS 1NBEA 5JZSA 1QOZA 2JBHA 4XB1A 3PRHA 1LSJA 2ZWMA 4MVXA 4RE6A 3MYRA 1GA4A 3AHDA 3MBKA 1B8VA 3WZLA 3SHQA 3VBCA 1GG9A 1QH9A 3W2GA 3UT6A 1PJLA 5AUQA 3NUZA 4ERNA 1X42A 2AZMA 1JHXA 3KTDA 3I5YA 1UPXA 4JCCA 3EQ2A 4HRVA 1MIHA 2B3DA 1XTZA 3LOPA 4LE0A 3GCGA 5K8UA 3RRXA 1RM5A 2G1UA 1R50A 3D7LA 4YRPA 5C51B 2JL1A 1M6YA 4ZZIA 2BFCB 1CQPA 4IKPA 3GP8A 1R6AA 3BSFA 3V8RA 2O20A 4KGZA 5KNBA 4WZ6A 3RIEA 3FIUA 3U37A 1E1RD 4WCFB 5COQA 3DQZA 5IDXA 5BSHA 3TL6A 3TLZA 1CS4C 1V41E 4ESHA 1YBHA 5TF0A 1J39A 1Z62A 2A94A 2JFUA 2O7SA 2XPCA 1MENA 3HJUA 1VHWA 4V0LA 4V38A 1BMDA 5AW9A 1QFMA 4OGLA 1J8DA 1VG9B 2I2FA 2I87A 4P3PA 4C7MA 4C9BA 2YICA 3AFOA 3D8BA 3MJVA 5LQUA 2PBLA 5BY2A 1Q16A 2V6MA 1AZLA 5B4TA 5DBHX 4QPJC 5G1NA 2FSPA 2PKYX 2FSVC 2JAHA 4KQ2A 2WTUA 4BTLA 4B3TB 1BD3A 1DZIA 2QD1A 3E9YA 3KXKA 4GZLA 3D1LA 2XDAA 4YC7A 5EJ2A 4AMBA 2LGJA 3GRFA 2Z6QA 1OZHA 1E2NA 1OFHA 1G5FA 1NKTA 2OAEA 2H1LA 3G59A 3UUGA 1CZLA 1EUDA 2HIHA 3OJXA 3VHXB 5J2TB 3UJ3X 1QS0B 1EBFA 2FSFA 5BQ3A 4D7AA 2F1KA 2BGGA 1AKMA 3A4VA 3BWYA 3L02A 3KUXA 3R0IA 3LX8A 3FCCA 4RK5A 5LQCA 3UXEA 2PX2A 4FEEA 2X8JA 2C5SA 3H86A 4KOEC 1RRKA 4M1KA 2EZ8A 2YHIA 1SPBS 2O2XA 3O2NA 3B3QA 2X7XA 4WECA 2PCJA 4BNLA 2Q7DA 4I4TF 5NULA 1DIOB 2UYYA 1BRMA 2ZWPA 3G0DA 3QVSA 3CSSA 1AXGA 2F3TA 1DG9A 1IHYA 1EJBA 3AKDA 4X7RA 2C1ZA 2BFWA 1SOUA 1JZQA 1ZQ1A 1D2RA 1SBCA 3NBQA 5KMGA 2XZPA 2GM4A 4G0WA 3WICA 3G7SA 3K09A 2VJCA 4IOLA 4B8ZA 4ZZ1A 3LPCA 2SKDA 4HR7A 4XWAA 3UF0A 5JU6A 1I6WA 3BBLA 1M5UA 1PGPA 5BPHA 1R6DA 3EZXA 3HU1A 5JO0A 3WKEA 2A9KA 5LD2C 3I5UA 3L9WA 1NUHA 1COZA 2VZ0A 1U3GA 3EQ7A 3REQB 4LOLA 1E9DA 2A88A 3FUCA 3QNMA 4Q66C 3GLRA 2EATA 3S81A 4N5IX 4NOJA 1UIMA 4B2YA 1RWMA 3TLGB 3QE3A 2VEOA 4N6OA 5BSUA 1EWYA 1V7ZA 4E5KA 4TS3A 3UMJA 2BKUA 3SXJA 1W36B 4EQZA 1WRBA 1LUAA 1S2OA 1MUUA 3KYCA 5EVCA 3L5OA 5ERXA 1Z5NA 1QVZA 1QBGA 2F1IA 3M2TA 3A6EA 1F2DA 4NDZA 4RQUA 1TQHA 3OZFA 2QRVA 5LLSA 3IBCA 4EA6A 4DR2B 4KUHA 2ABWA 1DC6A 1FP7A 1ZJ4A 3AGPA 4FHDA 1U7WA 3ZE9A 5BSTA 4IKEA 2BY4A 1XKLA 2LW7A 1YA8A 4B34A 1VE7A 2I4MA 2PXHA 3ICEA 2BTQA 5DFAA 4FK8A 1DJQA 2EW8A 5FF9A 1TT7A 3PE6A 4RX1A 5B64A 3KOYA 2G5PA 3ASYA 2Q8NA 3F6BX 3OE4A 4U02A 4YT5A 3ROKA 1IOWA 2DH6A 2IITA 3DOEA 2ZPUA 3BGOS 4GUAA 5IMSA 2ZUBA 3PC2A 5IBQA 2VHCA 3ZDDA 4RJJA 3GI1A 4N5LA 3ZDEA 3UFXB 3IA2A 4EEKA 1EB9A 3LE8A 1I3KA 3OJOA 3QPBA 1W2GA 1K9SA 4NWIA 4D02A 1WHSB 3BWDD 1GTL1 1P2DA 2QMZA 3H13A 4JUFA 5A6SA 4R2MA 5I9IA 1NMQA 4NC9A 1JU4A 1QIEA 3U4IA 3WWOA 5BMVB 1A8HA 4E14A 4B8YA 3LK7A 3CW9A 4KXFB 3LUBA 1WP9A 2B37A 3W6NA 3FUXA 3LI2A 4YWHA 3A6GA 1NR1A 5FA5A 3ZWMA 4US2R 3LF1A 4INJA 2CV0A 3LBYA 3MUOA 5EQTA 3KTAB 1GNTA 3VV3A 1BKDR 2Y1GA 3R76A 1RJ9A 5CJJA 1TAUA 1UDRA 2OHGA 2M6SA 3FWNA 4UHKA 5P8WA 4HYEA 5H81A 2CHUA 5IZ4A 2AOTB 3PA8A 3DUFB 1ORVA 4P5EA 1ENZA 1Y1LA 1THGA 5JG7A 5J5VA 5T64A 4W99A 2VK4A 3P96A 2NM0A 2FWNA 3AXSA 3SZ3A 4DCPA 5T5QA 3TNDA 5DSZA 4QDJA 5E1BA 1ZOLA 4HYTA 5LZ7A 3EGIA 4UBMA 3BK2A 3PEUA 4YACA 4DIFA 4F56A 1ESDA 2QVBA 4TVSA 5BVGA 2OBFA 1A7KA 3EEYA 2ZYDA 3QVGA 1A9PA 1KVQA 1BEEA 2R47A 3MA0A 5ECYA 4NOMA 4RLSA 2FDCA 1VECA 2P62A 1VHTA 1HE3A 2YN0A 2ZAOA 3FWYA 3NBFA 1P72A 3ESCA 2KBFA 1C7IA 4DPKA 2IBSA 1HURA 2ASVA 2XUPA 3RAEC 1BVRA 1WWKA 3C8MA 4PC1A 2G8NA 2J41A 1OYVA 1V4VA 3CUYA 3I01M 3IUQA 3JWHA 3L7CA 4FIDA 3TDMA 1P60A 3RK0A 3NIDB 2XCRB 1JEJA 3OOHA 1B6GA 2NO5A 5KYTA 1U9IA 1POWA 1WR8A 2YY6A 4LQCA 4LVNA 4DJJA 3HUUA 3DKVA 4EDFA 3IMEA 4YA6A 2P9JA 3FPAA 4V1CA 2WUWE 1NM5A 2IIQA 4GM4A 4ENTA 1X1BA 1Y8QA 2C2GA 3ANMA 4LW8A 4OOFA 1M2JA 3A04A 3B9RA 3DYIA 1KIFA 2C4HA 3Q3CA 3QUQA 3MTEA 3KWLA 4K6CA 5CLHA 1EUYA 3PKIA 5AHWA 3H2BA 1S1MA 3UHOA 3MJFA 2W4QA 1D2HA 4QYIB 3W2TA 1DEAA 3IR7A 1K06A 5DCYA 1Y7LA 2FMKA 3RVBA 4ZODA 1WCYA 3C3MA 3DONA 3I04A 3RTEA 3TDNA 3UO8B 2C7VA 3L6EA 4IIHA 2JGKA 2XF2A 3CIOA 5T8KA 1HE4A 3PK0A 3AHJA 3OEHD 4I50F 4G0ZA 1IY9A 4QUDA 3JQ8A 1YV9A 3ZYCA 1BHO1 1N2BA 3QLTA 4ZCRA 4EF4A 3W7BA 2QMHA 3N39C 4MI1A 5K8CA 3I34X 3I0NA 1MFZA 3LS2A 3GZJA 4LTDA 3ZHUA 1G6KA 4F91B 3UGQA 2GPBA 3URKA 1Y6RA 1ZICA 4H59A 2P8SA 2J33A 1O95A 3A9CA 3EF3A 1IB6A 3QPDA 5FEUA 1DX9A 1SWWA 2EC5A 2ZB3A 1Q0PA 1F8XA 1KDRA 4KSYA 4OYLA 3ZW7A 3OKCA 3SFVA 2COKA 4GO1A 1REQA 1YL7A 3DEFA 4UXJA 4DTIA 3GRKA 3S8YA 1HA3A 1PW5A 1ZS9A 2R87A 3I2JA 4B3RB 3BB3A 1A8SA 3G5MA 2ZYAA 4FW9A 2OLKA 2X0RA 4ZVLA 3UJNA 2EHJA 1YS1X 4C1BA 1RW4A 1XZMA 3PC6A 1XXLA 2EJCA 1XTQA 2F3UA 3S1AA 5BR7A 4DA8A 1VDZA 4DJTA 1EXVA 1UIRA 4KH0A 3ISTA 2GBGA 2Q21A 4ZIRA 5C7LO 3ZCTA 3SLRA 2B83A 1GSOA 3VU9A 1TO6A 4BBZA 1JGTA 2WD7B 3DZ8A 4TTIA 1KEUA 3R0ZA 5JAHA 3CBQA 1VBMA 3DNMA 4QUBA 4EW2A 2QYTA 4S04A 1S3IA 2C5LA 4KXLA 1L5YA 1L7NA 1N0UA 2RH4A 3GV0A 1QM5A 4J3FA 3VR6H 2H1FA 4BJ6A 3AVPA 3DAGA 4DE5A 2K2QB 3NKFA 3UVEA 4KKVA 5LBIA 1XPRA 4G37A 1PR9A 2BF4A 3EXG1 3L8MA 2NVUB 3SC4A 4AF6A 3TTVA 4AF8A 1RBMA 3TK1A 2ZWAA 3Q10A 2A9FA 2PMEA 4MI3A 4LDQA 1JDZA 1T2AA 1SKAA 2IP4A 3AEZA 4NOLA 2XRYA 1OIXA 4L74A 3TLBA 3ZWPA 4NXNB 3HJAA 2RHJA 1PDOA 1IK6A 1XZLA 1GEEA 2IGBA 3DV2A 5REQB 1OWMA 4IF4A 4HQKA 1PFUA 1OZFA 4DGSA 5CA1B 3A2NA 5AHXA 3FYUB 4O2AB 3BICA 5KNDA 4QE3A 1M33A 1SUEA 4TTSA 4G2TA 5ERGB 5F33A 5IDYA 2IOQA 5LYJB 1E79D 3H5IA 3R75A 4B4OA 4ER3A 5A4JA 5JOQA 5C5DA 1R74A 3T15A 4N9QA 1XEWX 1NY5A 4CN9A 1R4MA 1FDIA 5CP8A 5AM2A 1G64A 5BNWA 2VT7A 5ENZA 4CMAA 3IP6A 3TQRA 1AKVA 3NOXA 5FI0B 4PC6A 3V8VA 1ZY2A 5BORA 2Q46A 2D54A 1HC7A 1JHUA 3PFHA 4HB0A 3ZW9A 4YCMA 3E6AA 5FWXB 3VKVA 4CMIB 3QE4A 4TVOA 1ZFNA 3QG5A 4DS3A 3LZDA 4Z7QB 3KLPX 1OILA 4X6UA 1K86A 2ONZA 2WF5A 1Y8CA 4POAA 5I3CA 1I13A 2C5AA 4Y2SA 2HEGA 3CISA 1CZUA 1TL7C 3KHSA 3O92A 3B1VA 4OJTA 5FBHA 1XZBA 1WLSA 2VK1A 2DGDA 4H16A 4Q21A 5FUWA 2Y1CA 2ATIA 4WINA 1FFHA 2XGMA 3FOWA 3MQ2A 5BV7A 3M6UA 2Z0MA 3L6CA 3U40A 3ORRA 2DQ4A 3EQ9A 3R2JA 2IDMA 1T36A 3EODA 4C7VA 1A7AA 3LVFO 3SF8B 3C70A 3O91A 1ZOIA 2IDZA 4R2LA 5CYGA 1N9KA 1T9CA 3BWEA 1U04A 1Z12A 5I7OA 3ZS8A 4RHUA 4A8TA 4MVJI 4FNAA 3T3PB 4MH0R 3HKCB 3GEPA 1IM2A 2WA2A 1LTQA 2ZCVA 2PL5A 2AMVA 5FOXA 4MRMB 4C4ZA 1V1RA 3K0SA 1BQ4A 2X23A 4OSOA 4BE9A 2F8TA 2GD6A 3Q6MA 2IJGX 4M0CA 2A9OA 4NE2A 4R68A 4EOGA 4YQEA 1GLVA 3W5BA 3GDFA 4KLZA 1G5RA 1GZSA 4J16A 4NK5A 2GZMA 4LYHA 4MS4B 4UAJA 2BGIA 2YJ6A 1Z6ZA 4N5DA 1OXXK 4JI0B 4LWPA 1XWFA 3SG0A 4DQ0A 5DRYA 2EU8A 3DEIA 3NHKA 4J2TA 6REQA 8AT1A 1EFKA 2R8RA 4Y9DA 2B2NA 3D4LA 2V4ZA 5COAA 4YDHB 2BGNA 2NIPA 4LCBA 4DILA 3V8PA 1NVWQ 3L06A 3L8EA 4YX9A 2I3AA 3CTMA 2MSDB 3GAFA 2J6CA 2ERXA 5FTNA 2BHLA 4QULA 1NFFA 5IT9A 1CF2O 3BD9A 4H08A 4KCGA 1BFUA 4TMYA 4ZP1A 3CVVA 2GFQA 2RHOA 2P9EA 4BY9E 3VPGA 1NC3A 5TPZA 3CJTA 3B53X 3MSXA 1QQBA 1PZNA 2WG0A 3MYYA 1F1BA 4QU8A 5LP6A 4O0MA 5DHRA 2JH3A 5I7AA 5DM60 1ZRMA 4KN6A 4NATA 1GNQA 2JIQA 4F2DA 2PX0A 2VT6A 4RL6A 5HFJA 4QQRA 3EGEA 2XZLA 3H1PA 1BWRA 4KDEA 4XJXA 2OHJA 3LP8A 4CHGA 4FPXA 1WETA 3TPFA 4AY3A 1GCIA 1JPUA 3K4QA 2HPVA 3RRNA 2OHOA 1Z34A 1Z75A 3G23A 4MGIR 4DIEA 2P3LA 1RXIA 4ECAA 5BYAA 1CDDA 3IKMB 4ZT7A 3JYOA 4ZOLB 1EUQA 2RGRA 3QU4A 3HDTA 1EHCA 4Q7QA 2CMGA 3A10A 4I7EA 4L5YA 4LV5B 4S1NA 1O6BA 1N33B 4O4HA 2NPFA 3HVRA 4P9NA 4FMDB 4LYGA 1P17A 2E5WA 1VMAA 2O8VA 1ACMA 2ICAA 4QG7A 1J0BA 1NOJA 3E7WA 4MVCA 2NXEA 3ZI0A 3GFOA 4AWBA 4BS9A 1RS0A 2VNIA 1XHEA 4Q3OA 4EHLA 4ZN6A 3FCXA 5IP5A 4LGVA 1PG0A 3N74A 4CMEC 3IBYA 5F7ZA 3BT7A 5CTAA 3B52X 3TEMA 5ICEA 4G1EB 4V03A 2GK4A 3EPLA 2YJTD 3BC1A 1EFRA 1MOZA 1OBFO 2VS1A 3BXGA 3ONWA 3DAYA 1T9HA 4GECA 2CKDA 3D4IA 5SY6A 5EPUA 5K9ZA 1DUSA 1R00A 1V8FA 4WZBB 2HA3A 1K6JA 3CNLA 4XGKA 2F3RA 4P2BA 3MOSA 3BTUA 2FW7A 3EF0A 3SGLA 2PMDA 4KV9A 4N3AA 4BVLA 2ZRAA 4X6LA 2ADMA 2VAMA 2VWHA 1R27A 4M2LA 1PQUA 5K8JB 1ISMA 1C1XA 1CE8B 3CPEA 4GI2A 1FB5A 3S27A 4EVRA 3D0RA 1VI5A 4H6WA 4RM3A 3P9YA 2BKAA 3ORHA 3NM4A 1FS5A 1ZK1A 3QE2A 5LB4A 4AUMA 2HI0A 2X2PA 3AJDA 2YWCA 1LJUA 5EAIA 4RCZA 3S5UA 1ZXBA 1Y1KE 3MINA 5AVOA 4XSHA 5TIIA 3EAFA 5FOQA 2QM3A 5BV8A 1U9IC 3RADC 1U3DA 1AA6A 1UDCA 1ZH0A 1E6MA 1GILA 3SQXA 3VKGA 2HBQA 1TM7E 3O26A 4NJEB 1N25A 1NLYA 3AYXB 3NFYA 4HDMA 1DQYA 3MXOA 3NI2A 3EFHA 2C2XA 4HQNA 1IUNA 2E89A 3UCFA 1FBTA 4TL6A 1I51A 2A5FA 1MXFA 5HZGA 5LQMA 4Z3OA 1PS8A 4YAFA 5GQSA 3Q7EA 1Y8RA 4HCJA 1KJNA 1RC8A 1GPLA 4HLDA 4REMA 4ND2A 4CCAA 2QN8A 3AOGA 1CYEA 1WY5A 3DHWC 2VXYA 3T7RA 3N8GA 4JQSA 3X2EA 5BURA 2ZJ3A 5C8YB 4BUZA 4B7UA 3U09A 3R0XA 1IHOA 4AU1A 1SVOA 4JNKA 3DT6A 4TXJA 3PHLA 5TMEA 2JLRA 3OZRA 3BSWA 3SICE 1JFSA 4J0JA 3HJTA 1LV8A 4X41A 1MKYA 2B4YA 2CXNA 1NLUA 5LOVA 3TW8A 4AURA 2P2YA 1EFPA 1OZ0A 2VAXA 2QTVA 2DR0A 5DLDA 4TTTS 3X1KA 3SVTA 5G02A 3Q6IA 3N1UA 2HUNA 2VKTA 3RABA 3UUWA 3C87A 3H3XA 3P0HA 4UCFA 2Q0SA 2B34A 5G41A 4QJIA 4JKYA 1NTRA 2FLVA 5CNIA 2EX4A 5EWMB 1ZN9A 2C8VA 3C3PA 3TRJA 4TYNA 2B5OA 4ZDIA 3WYAA 5C5IA 2FZCA 1YQEA 3D7RA 4JGIA 3WYFA 2OCPA 4L8LA 4M9UA 5K0TA 3OKFA 4ABTA 5JAZA 2LRHA 1RAIA 4FGLA 1JEQB 2ZJ4A 4KGDA 2EEZA 3Q88A 5CH3A 2WC1A 4QFCA 1QIGA 2ZVJA 4BGVA 2CXUA 621PA 5FUQA 2D4AA 2RCYA 5BQ5A 5IFKA 2Q2WA 2SECE 4RFSB 1EZZA 5IZCC 1GYQA 1XRSB 2XB4A 3SEQA 3E48A 1XEXB 2B1RA 3AHIA 4GMXA 2ZBVA 1LPBB 1T4GA 4RV4A 1DT5A 2NYRA 3A9TA 3E27A 4HWSA 3UAXA 2VDUE 3JVIA 3OD5A 4I99A 5JMTA 4RPCA 3AETA 4UTPA 3NATA 3M6AA 3Q41A 1GGEA 1Z0FA 3GRCA 4HFJA 4LMAA 2ZAIA 1C9KA 4PC7A 3TNLA 2O8DB 3W04A 1HBJA 4JC5A 4MVJM 3UAVA 2B1IA 4IEIA 3OA0A 2YWBA 3AFHA 4JWTA 4O2BB 4JI1B 1L6RA 3MRXA 3IEMA 2OO7A 3I12A 4URUR 1ONOA 4OXIA 4OA8A 4YLYA 2RBKA 1JYEA 1SU4A 3NVDA 4PG4A 5FL3A 2KS6A 1KRHA 2CJWB 1RLMA 3QU9A 3JQRA 3C8DA 5IABA 1P2BA 2GEFA 5AW7A 3FPEA 1N3IA 3UWPA 2E87A 4V0RA 4RWEA 3C1OA 1ENOA 1N1DA 5GIPE 3FMGA 4BEJA 2GVZC 1UKVY 5CM9C 2R7LA 1Y3DE 3IMCA 2PSJA 1AKRA 1DMRA 3LWZA 3HCBA 4GC9A 4TMTA 1VPWA 2V0NA 3COPA 1DCFA 1MO2A 2FG7C 1G19A 4FDAA 4C6RA 2E5LB 3A2MA 4RD1A 2D1QA 3OY2A 3EIEA 2UUBB 4WXHA 2IHBA 4EX7A 3DZDA 3C6MA 3P2MA 5H9WA 3U31A 1DO2A 4OYYA 4Z7OB 4PC2A 1B26A 1X1RA 1NI5A 2PRZA 1QIIA 3O94A 4D9CA 3IQEA 3F9IA 3BHMA 3BXZA 1LBHA 4EI9A 4C6HA 1ZGHA 1XPUA 3ZE6A 3ZX4A 1ESCA 3SM3A 2G0NA 2C4UA 1P9WA 1Y9AA 2O3QA 2ZTSA 3G82C 4JGBA 1M67A 1B7GO 1Z5OA 2FPPB 1LRKA 2C07A 2L82A 2Y1WA 3GJ0A 3HNPA 4AMUA 1L8AA 3MAJA 4GAEA 1H5UA 1HQKA 3QFRA 5GZ3A 2D00A 4E94A 3E58A 3L1IA 2ISQA 3K9GA 2J4FA 4QXOA 5A4KA 1T8SA 5AVWA 4QPNA 1HZJA 3H9JA 1QTNA 1ODLA 1V1MB 2AW3A 2V58A 2R2GA 2RONA 1LWNA 2HWWA 3CGGA 4K26A 5HCUA 4ALNA 1TM1E 4A2QA 3K9HA 3L0IB 4DV3B 2PT7A 5IM4A 1QMGA 3QLVC 2H1IA 2H8GA 4RSRA 1PJTA 4R01A 4CRWB 2QUIA 3PL1A 3TI7A 3ZKWB 2YXNA 1MEEA 5AM4A 4FMCF 5E6RB 2X0KA 2CNWA 4L4UA 4N65A 4BLSA 4D5EA 1SUPA 4BMOB 4BUCA 3K70D 1HE2A 1XZCA 4UDYX 2CSXA 4OXNA 5FA6A 1RPTA 2FCRA 1KY4A 2INGX 3CRNA 1QGZA 1I6MA 2NLOA 4R6XA 3FROA 2CNLA 4OHOA 3MERA 4P3OA 1PGQA 4Q6WA 3TW0A 2PUAA 2R8PA 4I46A 2HNAA 5KIAA 3TLYA 1W0KA 3B20A 1BS2A 1IEVA 1T6BY 2B21A 2PL1A 3C4VA 1NDQA 2D0DA 2ZYUX 3AR7A 2YWJA 3OC6A 5JC8A 1A9RA 1WPQA 2B20A 5KYYA 2HHHB 4FCVA 2AL7A 1W85B 3CNQS 3VTKA 3WJ1A 1YOVB 3ZZMA 2NXCA 3YASA 1SBQA 3IJPA 4X1IB 1DL5A 1Z6TA 3O3NB 1JLRA 2GYYA 1UJBA 4K9RA 3CRW1 2DFDA 3I5MA 4QNNA 4DPLA 4KFTA 3BJMA 3PQ3A 4QEZA 1NQAO 1SGWA 3ZHZA 4OXXA 3ICPA 1AUXA 3CEPB 3PXCX 3UNXA 1NX9A 2EFCB 1D1SA 3WLAA 3ZDYB 4DV7B 2I55A 4MW6A 1DADA 2V9ZA 3RAPR 2I78A 4DLVA 5IFLA 2FOIA 3FGNA 1N9GA 5EJIA 3CU5A 4AJLA 3QRWA 3RYCA 4G1MB 1E6WA 3OCVA 2ECPA 4E6PA 4BNFA 1F3LA 2GAFA 1F7UA 3UB2A 4AN0A 1OBHA 2VP9A 1VCIA 1O8CA 3JZIA 1VDMA 2OGTA 4MV8A 4PICA 1LTHR 2C9BA 3ZVNA 2PBFA 2XF8A 2O5EA 3L4EA 2O54A 5HTOA 5KSYA 4ZAYA 2A9PA 1VG8A 4GPIB 4KXUA 3DCIA 4KZPA 3TX6A 1QG4A 4UFNA 3RLFA 3V1TC 1U2SA 1E2UA 2DTXA 1TZBA 1PK9A 2G83A 2PWBA 3QEJA 5LR6A 1K68A 1E5VA 4BFVA 1WIWA 1HT2E 4LEIA 1E3LA 4BKUA 4G6ZA 1QYWA 3EH2A 4UTRA 4YMIA 5K3EA 3ZVKA 4UULA 3K71B 4FEYA 3F5DA 4U2CA 1P61B 3F9RA 1RYNA 2YTZA 3ZNNA 2ZITA 3I4CA 3L49A 4XZ3A 3DNFA 4F3KA 1BDHA 2HT6A 2W8BB 5IYZB 3HLYA 3R9KA 1JDNA 5JFGA 4QM7A 2V5UA 2ZR7A 5BSRA 2WLTA 2RI1A 4CTKA 1MA0A 3BVPA 4OL0A 5DYIA 4E7PA 1X1CA 4GQAA 2C58A 5KNCH 5IC4A 1DZ3A 3GJQA 5F5NA 2WINI 4ENQA 1LX7A 4B3SB 2BE7A 2IXEA 1WXQA 3VH4A 1YHNA 4WOCA 1PJAA 1BVUA 2J7KA 2EP8A 3RRJA 2B1JA 2Z09A 4FOLA 3EQ6A 5BN4B 3ZZNA 2O5CA 2RG7A 3AQ4A 1TIPA 3WGHA 4DQVA 1TAHA 1L5HB 1M0SA 4J43A 3MC1A 3GJSA 3M6XA 4UNNA 3GROA 2CV2A 1WKCA 4E07A 2C2WA 4WBNA 3JWPA 2Q5JA 3O9VA 2VRNA 3FHLA 4OH1A 1T8TA 2EJVA 2OFPA 4IX9A 4ALIA 1GLGA 1AB5A 2H0AA 2UZAA 3U3XA 1MJFA 4BTVA 3R3VA 1JLKA 1DFHA 2PT6A 3L3BA 3GDGA 3BB1A 1VIYA 5DX0A 2Q1XA 3SD7A 1JFVA 1U7DA 1SHKA 3BRWA 3TXAA 3NS7A 4KI7A 3DE7X 3FZNA 2YWDA 4GBMA 2JFVA 3FUWA 4Q9AA 3NRBA 5E2AA 4CL0A 5HZHA 2H51A 5CB4B 1M6WA 1QYDA 4OFBA 2HDOA 1I5OA 2C83A 3MAGA 2LDBA 4JC4A 1H1LB 3UAOA 5DBIA 3WLIA 1KY5A 1OKKA 2ZU6A 3B82A 5ARCA 4AMVA 5L3SB 3KXLA 1RTKA 3JQPA 3EXEB 2IUSA 5IM4F 5CAEB 5CRIA 4QGBA 2AX4A 4QUHA 3RSGA 1LDBA 3KT3A 3PQDA 2PMKA 3FGPA 2J6BA 1UKCA 5M3BA 4KDCA 3L4KA 3AY0A 4FJ0A 4PSAA 1IPHA 2O2ZA 4Q9DA 3TNJA 1XVVA 2Y93A 4MO2A 1U0RA 4A8JA 3GJYA 2ANCA 2PJZA 2QLBA 2JIMA 4KN5A 1RRMA 3E9CA 2Z6AA 1HE1C 4PE5B 3MGCA 1K5DA 3GLGA 1GLNA 3HKBB 3OA2A 4F1WA 2RGNA 3N2IA 2XDQA 1U1DA 2WHYA 3FPBA 4J0FA 4UKDA 5F21A 1HH4A 3A37A 5B5SA 3ETJA 3EDMA 3CLUD 1CRLA 1ZMRA 1YRQA 2DQYA 2QUJA 3HXPA 2FEXA 3OZ7A 2ZU0C 2GJAA 3URMA 3U5ZB 4BO6A 2I8CA 5KTMA 3HDVA 1K88A 4JBHA 2HJGA 1QSGA 1U2PA 1F5NA 2QTAA 2G3YA 1K89A 1X70A 3TQCA 4C76A 4RDHA 2P5SA 1TRKA 2I29A 1Z82A 3TFWA 2CFOA 5IMBA 2AHRA 2AQHA 2OSVA 2HMSA 1USGA 3GIDA 3C8UA 4I1IA 4MR9B 1V6SA 3S3TA 4CKWB 2QD2A 1E9VA 3IAXA 5BVHB 3JPYA 1ONBA 2JAWA 1DQSA 4D6XA 1E4EB 2V65A 3FYSA 1GPBA 2FW6A 3LKBA 1DB3A 3P94A 3WQRA 1JIXA 4MJ3A 3TUJC 1YFZA 2QJOA 4U9HS 1S2GA 3GN1A 4IHAA 4NCNA 4PFSA 2OAGA 4RZUA 4L78A 3OZUA 4RBNA 3SMQA 3N8IA 1F38A 4R7GA 3T06B 5L7WA 4NCBA 3UT5B 2NAPA 1GADO 2YIJA 2H9IA 5A5VA 1ETUA 2NAFA 1VG0B 4W5QA 4LOJA 1N8SA 2PUBA 1KIAA 2DFTA 2OG1A 3ZTYA 4TKMA 1YZHA 4NFLA 4K05A 1X8LA 3CX8A 1EHIA 3F8SA 3G5TA 4BP8A 5HOQA 3WL8A 3B5JA 2X0JA 2Y68A 3DDNA 4BYMA 2BR4A 1SUSA 2IXDA 4F6RB 1KH2A 5EGSA 1LPPA 4GEGA 4QOJA 1J9GA 1WTCA 2GKSA 2W6ZA 2ZDGA 2ZTUA 3I5XA 1IJFA 4GVLA 4CLHA 1EFCA 2K7ZA 1YUMA 5INTA 1UM9B 3I6ZA 4OLHA 3KC2A 3KJNA 2QRPA 4AL4A 3RQSA 1JDJA 2OZVA 3IDFA 1KVTA 3WLMA 2G36A 4JQCA 5EYPA 3W1WA 1DWOA 2V55B 1PFKA 4AZWA 3LLVA 3L1VA 1NVBA 1AC5A 2ADFA 3N8DA 1ISIA 1SQSA 3IDSA 1TA0A 1KQGA 4AZ3B 2BUBA 1PL6A 3PDCA 4HPJB 1V7CA 3WRYC 4CPDA 2BFEA 3LVBA 2YJ5A 4LJ8A 5K1ZA 4AS3A 4DCUA 2H1SA 1CRWG 4U2BA 1Z83A 5JI2E 4PLZA 1K6EA 1WUTA 3T94A 4GM1A 4DSAA 4UREA 2Z9BA 3DTVB 3O8OB 3PCTA 3RYHB 1E2KA 5LCXA 3KQLA 1NOIA 1MJGM 4BZWA 5FOSA 2XGSA 2ETXA 1PG5A 1TK9A 3K1YA 2ES4A 3OJLA 4HJXA 2X3UA 5J23A 4D97A 1VXRA 1QIFA 2J0UB 2J30A 2V7UA 2Z3ZA 1G1MA 4DY4A 4E3WA 5LSAA 3V2HA 4HQ6A 4BU0A 1GT6A 3IAHA 4Q4JB 3PV0A 3SXUB 4DLTA 4E5MA 5EZYB 2GLXA 1E64A 3JQFA 4I1OA 2RAPA 5G1PA 2OQVA 1QOPB 3OT1A 4K9LA 4U6NA 2P27A 2QNIA 2MCFA 3UMFA 7ABPA 4G0VA 821PA 4XR9A 2ZJ2A 1DXOA 2ZSBA 4EHNA 2XYGA 1SD1A 3HADA 1UP4A 5KKCA 4OLBA 5TEVA 2RGYA 3FI0A 1NN3A 4QPPA 1U3VA 2BI7A 1H5NA 2NTVA 3AEYA 3VYTB 1UBCA 2P35A 3HM9A 3OIGA 3HXLA 3IH5A 2XD4A 4D0NA 1LXCA 4G63A 1U5BA 3RBAA 5L9AA 1PJ2A 2B4QA 1P5JA 1UBSB 1H22A 1SXQA 1UPAA 1PT6A 2I80A 3GD7A 1HE5A 3GEHA 2WSBA 4WXRA 1L7OA 4D6YA 3AUUA 5K3OA 2IH2A 3NKVA 4JVSB 5EJ5A 2YS6A 4IG4A 4TL8A 1TGYA 2WEKA 2Q7OE 3GA0A 4ZJZA 1G20A 2H2DA 2PUHA 5IASA 1SVWA 2CYAA 6ADHA 2Q2QA 3GCWA 5FUBA 2VA9A 1XQ9A 1FLDA 4ZANA 3D4OA 2GPJA 5LIPA 1JB9A 3OMXA 4BECA 4TV8F 1FUIA 1M2VA 4XVHA 2PRKA 3PR2B 2ZJ0A 4Q1CA 2JFYA 3JALA 1I1OA 2BMAA 4KRFA 3IHLA 1C0LA 5F1OA 1TZMA 4B81A 1OT3A 1T15A 1VMIA 2DPXA 3IQIX 1KP3A 4ENRA 1LX6A 1ZCBA 2ALJA 1UP7A 2GYVA 2I8AA 3BA1A 5A6VA 4FM9A 4YNBA 2PUDA 3PEFA 4L6CA 4LF6B 4IIJF 4EYQA 1DX6A 2FWAA 4Q18A 3O7WA 1ZI9A 4RNDB 4FS3A 1YQWA 2BFBB 4A27A 1JE1A 2G80A 5CB6A 3OZSA 2J3EA 4DM7A 2WQ6A 4PS0A 4AICA 4F06A 2A86A 3HN2A 4WK0B 3SDBA 2IS1A 3D31A 1Z0UA 2PEYA 3L8CA 4YEDA 4QYSA 4TV9B 1SFRA 1YRHA 3DGEC 4M7WA 4ES6A 4UMEA 4TM8A 3ELYA 4IAOA 3U4QA 2IKQA 4GE3A 1T9AA 3B5IA 2G72A 2NGRA 4G07A 3J7TA 1NAIA 5CFLA 3DAPA 3BCSA 3GLVA 1WXDA 1IZ9A 1VTKA 3SIWA 3HJFA 1F2VA 3N75A 3UA3A 1F2TB 4PAMA 5B1EA 3P9ZA 3ZW8A 4D80A 2QU8A 4EMSA 3P27A 2C2ZA 1USIA 2CY0A 2DWPA 3AW8A 4TMFA 3ZWYA 4ZO9A 5JXWA 4CLRB 3OPYB 4R0MA 3VZPA 3T5GA 3X2FA 3NIGB 3NNSA 2K4MA 1H1DA 3H5LA 1FXWA 5GOZA 4QC2A 5JD5A 3BHNA 4DJ5X 4MKHA 2NW6A 2WPNA 1M6HA 1QLWA 4LQDA 2W6NA 3E0XA 1J70A 1YR7A 3EVDA 4NAHA 1J2TA 3WNCA 2V1XA 1ULHA 2ACWA 3HY3A 1BIFA 2UZ1B 3KXIA 3C41J 2GPWA 4PQGA 2GRJA 3C3BA 3G1TA 3RLIA 1T9KA 2ZYSA 1IN5A 1JEAA 5JD3A 1HWYA 1U8UA 3GD5A 1RTTA 2UUPA 3FTDA 4PAOA 3WRVA 1MB4A 1QYRA 4UVHA 1LW7A 3VHLB 4CCSA 5EWLB 1GARA 3Q6NA 3SYMA 4D0SA 3ZZ0A 1YULA 3CA8A 4ZKEA 2R6HA 1ONSA 4BNWA 1EYZA 3IPAA 5AI5A 5AKXA 4C4OA 5IJWA 5ALQA 4LYJA 2CFSA 1OASA 3ZDQA 1PS0A 1S9DA 1QFXA 1TKRA 4P7FA 3G2HA 4NBTA 4Q9LA 3JXEA 1TM3E 4X64B 1DEXA 4B75A 4FXPA 16PKA 1PGJA 1L7BA 2XKKA 3VR5A 1DLIA 2GM5A 3EYAA 3I1JA 4H0NA 1W35A 2ZUSA 3FPHA 4NU0A 3HXMA 2I2CA 3BGWA 1G8PA 1C0IA 1W52X 2VHXA 4DQDA 3E9ZA 4I1YA 4LBVA 5LXTB 1U0LA 3CVUA 3GOHA 5CPBA 2C4NA 3F5SA 4ARZB 1GZ7A 3DPUA 1OBCA 4AKHA 2NZYA 3O75A 4QFMA 3KJFA 1OYOA 3X1WA 3JYQA 5BN5B 3ZHTA 4CL2A 5BYJA 3IUNA 4AT1A 3ESRA 3SF0A 1U6JA 4PLPA 1ZWLA 1H3EA 1CUZA 5ER6A 2XNDA 3E3NA 4RANA 3WV4A 3HR8A 4E6EA 3AI2A 2EFHB 2NP7A 1MDFA 4TTJA 5T57A 3KKZA