5FPHA

The gtpase domains of the immunity-related irga6 dimerize in a parallel head-to-head fashion
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
399
structure length
395
Chain Sequence
b'DLPSSFTGYFKKFNTGEEIISQEILNLIELRMRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGVVEVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPNTYLEKMKFYEYDFFIIISATRFKKNDIDIAKAISMMKEEFYFVRTKVDSDITNEADGKPQTEKVLQDIRLNCVNTFRENGIAEPPIFLLSNKNVCHYDFPVLMDELISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQRIWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLARDWEIEVDQVEAMIKSPAVFKPTDETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVTEDAKTLLKEICLRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERFERON-INDUCIBLE GTPASE 1
publication title The Immunity-Related Gtpase Irga6 Dimerizes in a Parallel Head-to-Head Fashion.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 107
structure length 395
sequence length 399
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.6.5.-:
pdb deposition date 2015-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05049 IIGP Interferon-inducible GTPase (IIGP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fphA02
2VP2A 4CDGA 3QBVA 4MRVA 4BLSA 2FF7A 4PANA 3U44A 4R9UC 3EPKA 2O8DB 1UEJA 1E99A 2GRJA 4PO1A 1NG9A 2YZ2A 4M1OA 2QM8A 1SQ5A 2GZHA 2V55B 1OH5A 1G7RA 2WAYA 5C4GB 4OHXA 3LDAA 3QF7A 2GF9A 3CPHA 3RVBA 2FGJA 4PQRA 3K70D 2WWWA 2J87A 2JCSA 5AUPB 1KGDA 1RVDA 4MKGA 2PJRA 1IQPA 3LLMA 1XTRA 1R2QA 3QG5A 4NYJR 5IDVA 3X1YA 4IVPA 2GEUA 4OQXA 2J0QA 2C9YA 3SYKA 4RZ3A 1EGAA 2O0HA 1CJKC 1R5BA 2QN6A 2YWGA 4LHYA 4TL6A 5SZHB 3V4RA 5JS8A 2O8CA 3HU3A 2OE2A 3TNFA 2CEAA 1FX0B 1IHUA 1XD8A 4R2IA 4TLCA 3KB2A 3MWYW 4LYJA 1N5JA 5CJ2A 1CTQA 1E2FA 2J59A 1KSGA 5CLQA 3U5ZB 1KI7A 3HDTA 3JVUA 3FKQA 3K0SA 4BGDA 3QI2A 2UKDA 3FFBA 1GILA 5HKKD 1KMHB 3CLVA 2DPXA 2O52A 1R7RA 3CZPA 1G1MA 4NP6A 2G6BA 2NMVA 1D2NA 1US8B 1GKYA 4CF7A 1Z3IX 3UMFA 1G3UA 3MWKA 4Q1AA 4IVQA 4DWJA 1X8JA 3HR7A 4MYUA 1WE2A 5P21A 4B47A 2Q21A 2VEDA 1QHXA 4JBWA 4EJSB 4JLVA 2VP4A 3OE7D 2CLSA 4PSVA 1EWRA 2WPDD 3UWKA 1XZPA 3KQLA 1S1MA 3WRYC 3KKQA 2GJ9A 3KX2A 2D74A 3EXAA 3CRRA 4QJ3A 2JATA 1SVSA 4O2LA 1UKVY 4JBYA 1GL9B 2EFEB 3ZD7A 5DNYB 2K5UA 3EA5A 1HTWA 1U90A 3OEED 4II7A 4DSTA 1Z2AA 3PENA 1GDDA 3FWYA 2WJJA 1RZ3A 1N6LA 2BMEA 3HU2A 1NKSA 2QTHA 1J2JA 4RCYA 4F38A 2C5LA 1ZCBA 1JJVA 2W0MA 3EAQA 3NTUA 3KQHA 4ZKDA 4TL7A 3IO3A 1W4BA 4GOXA 4LK2A 5A0FA 2OAP1 4M53A 3SU8A 2ZI9A 2WSSD 3Q5DA 4MGKR 3AF3A 5FTNA 5FL3A 1W0KA 2Q9CA 3H1TA 2EQBA 3GEEA 1AQYA 2NPFA 4KCGA 4G3XA 1OH7A 2IXEA 3EZ7A 1N6RA 4B2PA 1VYVA 2B92A 3KB1A 1P6XA 1KMQA 1S1CA 2XNDA 3LBIA 1NJGA 2IS2A 1ESMA 1M7HA 1N6OA 4YMTA 2V3CC 3RRMA 4URXR 2NZ8A 4L9WA 2WJGA 4N1AA 5BYKA 1XRJA 2XJ9A 3HYRA 1E2IA 4Q00A 4XH9B 4HEJA 1E98A 1WA5A 4PXAA 4KU4A 2IEZA 3EWSA 3ADCA 1SXJA 2P5TB 3VR6A 4E09A 3ZLJA 2BOVA 1P73A 4NL4H 2VO1A 1IXRC 4MH0R 4OJKA 2WZQA 3I3SR 2C96A 3NKVA 1NMYA 1UEIA 3KKMA 2R6FA 3QPWA 3I8SA 1JAHA 2RH5A 2REOA 3MCAA 4NCKA 5DIFA 4UJ5A 1N6NA 3TUJC 4YLGA 2WKQA 2ZUBA 2C99A 3DZ8A 4R98A 3AKYA 5HCIA 3GPLA 1P9RA 2XSZD 1ZP6A 3EW9A 1TF7A 1YR9A 2FEOA 2RGXA 2CLDX 4U02A 1Y3AA 1N5KA 2WWYA 1Q20A 4IOKA 2C03A 2YC2C 3B9QA 1VDZA 1W2HA 4NYIR 4QRHA 4CIDA 3CF2A 4X8MA 2N46A 3W9YA 3IBGA 1GRQA 4OKSA 2OHFA 3MGCA 1J7KA 1RPZA 1RRPA 1Q1ZA 4IRUB 4BFYA 4U00A 3NHBA 3GLGE 5JJLA 3GJ3A 5UKDA 3UK6A 2J41A 2YYZA 3VR5A 2GHIA 3THXB 1MH1A 4B3FX 3B1XA 4DUGA 1QHHA 2C77A 2PL3A 3OZXA 5KOYA 5C46F 1ZIPA 1LW7A 3EZ6A 1G6OA 1XMSA 3AF2A 1OB2A 5EUQB 4XVRA 1KI2A 2B6HA 2R6AA 4O0MA 4TLBA 1N0UA 4V0NA 4D4KA 4DLXA 4FCWA 1P4SA 3T06B 1VG0B 2G9NA 5AJZA 4RFSA 2AKYA 4RD0A 3QKSA 4JT2A 4DLYA 2OCAA 4D80A 2ZS7A 3KZ1E 3REFA 1GG2A 2GXUA 3VQTA 2IYSA 3EZ9A 1GNQA 5DI9A 3ZZTA 4ESHA 5FOWA 3G82C 4D0LB 1M6NA 2ZE8A 5SZKB 1TMKA 1D2EA 4HAVA 1OSNA 3ADKA 2EWVA 3PEVA 1YZTA 5JHGB 4CEIA 4WVFA 1E32A 4JLMA 1IN4A 1KJWA 1L7VC 4NPHA 3IILA 5HZKA 3C5CA 3A1UA 4MYCA 4BZPA 3CR8A 1XEWY 2J0UB 5EP2A 1A2KC 2B21A 1DAKA 2MMGA 4DCTA 3VAAA 4RKEA 2XXAB 1YR8A 3BFKA 5FOXA 4KBFA 2ZUCA 3B82A 4D0NA 3KUCA 3RWOA 2O0JA 5HE8A 1NJFA 2CHQA 4C0LA 2PT7A 4B3CA 3IKJA 4JKYA 1DS6A 2CNWD 1G9XA 3H0KA 1ZM2A 3PQCA 4GDFA 1TL7C 1R5NA 1Q0UA 1YKSA 3PUWA 1UPTA 1E2JA 3R8FA 3C15C 3MMPA 4D81A 4DLVA 4A36A 3SC3A 2ANBA 1DOAA 2W00A 2J46A 5B58C 2FSGA 4ZI3A 1WDTA 2E9SA 2DWPA 2ZANA 4A9AA 4WA7A 2ODBA 3IPYA 4F92B 3UG7A 2HF8A 4HLCA 5L3QA 1GTVA 1TQ4A 1Z5ZA 2QP3A 5FPTA 4ZCLA 2H7VA 3N5CA 1U0LA 4V02A 1AZSC 4JSTA 3FHTA 1KDPA 2FZLA 4FMBB 1ZD9A 3EARA 1D9ZA 3SQWA 1TEVA 1Z6AA 1Z6YA 1E2PA 2P5SA 1OXSC 4GP7A 4L9SA 2JLVA 3AUXA 5CIWA 4ZV4A 2QP4A 1PLJA 3VR4A 1QHNA 3A8TA 2REBA 5CB8A 1GRRA 1ZUNB 1Z0KA 1KK2A 1FQJA 2DFTA 5FFMA 4CT5A 4TSFA 3IGFA 2QP9X 4OQLA 2E1RA 4XSHA 1SHKA 3T5GA 2ZSBA 3E70C 5FTJA 1SKYB 3ADDA 1HQYE 1Z0JA 4YMVA 2E87A 3VFDA 4LV6A 5CYPA 3OAAD 4AYTA 4HAWA 1ZVQA 1RRFA 4MQBA 5GJVC 4JL6A 4EPRA 2CE7A 3FTQA 2PEYA 2VIIA 3AF4A 4DSUA 4OHZA 1DAHA 2VSXA 1W7AA 3AGPA 1KI6B 5EZ6B 5AJYA 4OQNA 2OBLA 1R0XA 5B57C 2VP6A 1PJRA 1K6MA 4K8OA 4OI4A 5JRZA 4HDQB 4LPKA 3LVRE 3VX4A 2WMNB 1PVOA 3RAPR 1M2OB 4NBSA 3WBKA 4RZXA 1CLUA 1G16A 2FE4A 2WMOB 2ZU0C 1XD2B 4G5GA 4ASUA 1OIVA 2XTZA 4LBWA 2GXSA 5JWHA 1FFHA 3LA6A 2FWRA 3CX7A 2C9OA 5EXTA 2RHMA 3AP1A 3K9NA 3TK1A 3ADBA 4LJ5A 5FUYA 3RNLA 3LXXA 3F0TA 2R6GA 1L2TA 2SHKA 1J8MF 4LOAA 4LJYA 1G3RA 2YHSA 2V1UA 4G5SA 4XD7D 1CR4A 2GESA 3QVUA 2HXSA 4R2HA 4XWAA 4UQOA 3ASZA 5KSOA 1A7JA 2J7PD 1MO4A 4YMSA 1WXQA 3SI7A 1GAJA 4I99A 2GJAA 3IBYA 2DYKA 1FUKA 1XZQA 2ONKA 2Z4SA 1NVVR 4C0BA 2KBEA 3RWMB 2QL6A 1F3OA 5KHOC 4D82A 2VSOA 3QNUA 4JL8A 1KO8A 2FFQA 4LHVA 3DPUA 3WYFA 4DHEA 1QG4A 4DEYA 4OK3A 2IUSA 4BLTA 1PUJA 3P26A 5A5GA 4PC3A 1ZNYA 3ZVLA 2H92A 2ZJ8A 4QOSA 1M7BA 2MSDB 1CR0A 2QEQA 3VNVA 1W48A 3THYB 2IWRA 1OW3B 4WOPA 2XXAA 4POAA 3EWAA 3B78A 1NN1A 2P65A 1RJ9A 4XJXA 5F9FA 2HCJB 4M1SA 4QBHA 5FOSA 3BB4A 1GL7A 4HB3A 4KYUA 4WXPA 3CM0A 4DKXA 4Q66C 3GD7A 4ZCIA 1E2QA 1E6CA 1X6VA 2NPIA 4KFUA 1LVGA 2GCNA 4KITB 4C0JA 1ODFA 4XVQA 5IK2A 2REXB 4U5XA 2Q6TA 4ZI2A 3FHOA 1HA3A 4JVNA 4L15A 2JLSA 2WHXA 1BYIA 2ZJ5A 1GL6A 1GNPA 1WP9A 3BRWD 1HV8A 1YE8A 3LQQA 4X8HA 2RGEA 1ANKA 2QG6A 3IUYA 4TQAA 3MWJA 4W5WA 1DBSA 5KO2A 3KL4A 1KK1A 3BAFA 2ZRAA 4HUQB 1E2KA 4A6XA 2QAGB 1R4AA 5FOVA 3KTAB 4IW3B 5KYKA 2VP9A 1E0JA 3K53A 1KKMA 1N5LA 5SZIA 2AX4A 2O5VA 5EP4A 3PEUA 1T3LA 4TWZA 4P4SB 2V54A 3IHWA 3DMNA 3FPAA 4KODA 2BCGY 2RAPA 2GCOB 4NKRA 1G5RA 3W3AA 2ANCA 4OJQA 4C0AC 1FW6A 1ELOA 4EQ6B 4LYAA 4YMUA 5C4MA 4OI2A 3KJIA 2ZM5A 2VH5R 4A15A 1YHNA 5LPNA 1XEXB 3O8DA 3LQRA 1OIWA 1YR7A 4PSKA 3BBPA 1KOFA 4IOJA 3SJBA 4FN5A 1J70A 3NWJA 1KI6A 1NY6A 2A7QA 1E9AA 4RJLA 3T1VA 4ZDIA 4FXPA 4CGZA 2J0VA 2QE7A 2O0KA 3AKCA 1W0JD 1KO4A 2GILA 3K9HA 3CPJB 2P2LA 4DCSA 2ZRMA 3A4NA 4MYTA 2NO7A 3SN6A 4LJ9A 4XWOA 3K09C 5EE0A 4CEJB 2Q9BA 3U44B 4DXAA 5KTYA 1UKZA 1Z6XA 4NONA 2NOAA 2YOGA 1OH6A 2WJVA 2CCGA 1T0JB 2JLYA 1CJUC 3TR0A 4YONB 1COWD 1XEWX 1U0JA 4Q1FA 2RGGA 1YZUA 2ZI7A 4BZQA 4ZIRB 1CKEA 2IYRA 1CIPA 2Z5FA 4JLKA 1PV4A 4LJ6A 3H2YA 4S2EA 2CL7X 3EIHA 2C2HA 2CHVA 4M9ZA 3B7GA 3P4YA 5ANRB 2AR7A 1U81A 2YWFA 4BLQA 3I73A 2AWNA 4IKEA 1KI1A 3CONA 1ZD1A 4Z8XA 5AUNB 1KAGA 3QXXA 3A1TA 1CR1A 3NDBB 1O87A 2PLFA 1IXSB 3AVTA 3BB3A 2O8FA 2G0NA 1P62B 1EK0A 3W6OA 2YVUA 4J0QA 4IDQA 1D6JA 3P1JA 4UXIA 5EE3A 5EXXA 1D9XA 3QXCA 4C3ZA 2QU8A 1ZNWA 1YZLA 4US1R 5H68A 2FSIA 4PZZA 1NLZA 2XITA 1NVUQ 1OKKD 4PPFA 3W3ZB 3THYA 1E2HA 4FMCF 4Q1CA 4DLTA 3GLFA 1G3MA 2ZSFA 1GUAA 1VYUA 4N0DA 3NH9A 2GVDC 3KXIA 5GJWC 4ESVA 4Q4HA 5C18A 3GJ7A 1DAMA 3NVAA 5E95A 1KDRA 1T8TA 2ZSEA 3DZDA 4FINA 4QHYA 2FFHA 1WRBA 3KKOA 3K09A 1JALA 4NCIA 3X1WA 1ZM3A 2AD5A 1NNEA 4Q9HA 2V1XA 3U2QA 1JQJC 1DAFA 5DE3A 1Z29A 2A5DA 1DEKA 3EPJA 1KJYA 1NI3A 3QVVA 5JEDA 2HEIA 3OIYA 5J4YA 1I2DA 1KI3A 5E7IA 4B33A 3KKNA 2FA9A 4B44A 4HUQA 1SGWA 1EFRD 4NMMA 4BECA 3OESA 4GP6A 5K8IA 3KTAA 3LVQE 4G1UC 3EIQA 1JBKA 4Y0VA 4JLJA 4Q7KA 1NN3A 4EFMA 4HAUA 4KBGA 1RIFA 4PHHA 3IO5A 3GEHA 1BYUA 2IYXA 4TLAA 1Z83A 2JIZA 4OI1A 3L0OA 2JEOA 5G40A 1Q44A 3U3MA 2O8BA 3EC2A 2QGNA 1Z0IA 5L3VA 2GCOA 2IXGA 2W2TA 3CRQA 1T5LA 3GCGA 3L8ZA 2OFXA 4XTRA 3I5XA 4EQ6A 1GKUB 3W5JA 3K9LA 2GK7A 2GXQA 1Z07A 5J5CA 2JDID 4PO8A 4BEJA 1XEXA 3FMPB 3MD0A 3ZIAD 3AGQA 4B76A 4D0GA 4AD8A 2X8AA 1KSJA 3FYHA 4FCVA 2KJQA 4TQ9A 1H8EA 2GK6A 3ZYCA 2D3WA 1AIPA 2I1QA 2WOOA 2IUTA 3A4MA 1BOFA 3GEIA 3FKSA 2QPAA 4WBSA 4KFSA 3U6KA 2QQEA 3B2EA 1SXJB 3UMSA 1VCOA 1TF2A 1UJ2A 2I1VB 3TUIC 2F9LA 4TYWA 1TQ2A 1OXUA 2ODNA 1ZBDA 1ZUIA 3KJGA 4HLUC 4JLAA 4GI7A 4A8JB 5JI3E 2HYIC 2Q3HA 2ZPTX 5KSYA 1Z8FA 1TQ6A 2JJ2D 3MJRA 4UKDA 4DCVA 5IRCD 1QVAA 2F1HA 2ZRJA 1Z08A 1M1YE 3QG1A 3SJZA 3VR2A 3GJ8A 5CYOA 2DR3A 3SJCA 2F7SA 4K46A 1OIXA 3KJEA 3Q7QA 2ZVPX 3WHKA 4DIEA 2ORWA 1FP6A 2ZR9A 4Q19A 2W6IA 4D2IA 1LF5A 4AKIA 3LV8A 3QE0A 2GNOA 1AK2A 3AVOA 4JLPA 4LWZA 4HLQB 3MG9A 4RCZA 3T35A 3VKHA 1BMFD 1GOTA 2V7QD 1W36C 2PX0A 5JWRA 3MFYA 4PHTA 1NY5A 1KO5A 2GCPA 1OFUX 4FCTA 4ZIRA 2W2VA 3OEHA 2BMFA 3MRSA 1XF9A 2FH5B 2OILA 1QHSA 1E2GA 4TZ0A 2H17A 1EX7A 2BIFA 3LW8A 4YXWD 1EG7A 3I61A 2MSEB 2FX3A 2WM9B 1N5IA 4Q1DA 1LNZA 4BLOA 1MO6A 3V00A 2JJ8A 5C1BA 3GMTA 4Q21A 4URUR 3R7WA 3UG6A 2D62A 3NBYC 1W2GA 1OE0A 2HUPA 4B74A 5KSPA 4AK9A 3QKUA 1P2VA 2ZJZA 2ZSAA 4LYFA 1HUQA 3H4MA 3GLHE 4H9GA 2Q9AA 1MT0A 4PAQA 4M21A 4UJ3A 1P61B 2BEJA 1AGPA 2VL7A 3B1YA 3GJ4A 1QHHB 4LBYA 2F55A 1II8A 3ZVMA 4CEJA 2Y8EA 3B1WA 4BUJA 5CDFE 2A30A 4PPGA 4UNSA 2AHOA 1FZQA 3BK7A 1N6IA 1ZAKA 2GKSA 2HLDD 4HLUA 4BRUA 2QORA 4BFTA 4NHOA 4A1FA 4DSNA 1E1QD 4RFSB 4FMCB 5JECA 3CWQA 1V43A 1P9WA 1W49A 2VSFA 1SXJC 2F1RA 3BGWA 3AM1A 5A4JA 1W5SA 3QKSB 2BBWA 1XTIA 4MRSA 3AVVA 3OIUA 4I81A 4A8JC 1T0HB 1Q1QA 3C16C 3FOZA 4PPQA 4YDHB 4A2WA 2IA5A 1HH4A 4BASA 4MITA 1BKDR 1UKEA 2OM2A 5DYGA 4ERNA 4CEIB 2WICA 1GITA 2ZUDA 4Z1MA 2JLRA 2ASEA 4M1WA 4B2IA 4OHWA 1IAQA 3T1OA 5JZVA 2IS6A 2QTVB 3GLGB 2JJ1A 2B7CA 1FOEB 1TUIA 2GAOA 3VMFA 3CB4A 2PCLA 2LCFA 2BCJQ 2WWXA 1X1SA 4TN1A 2QZ4A 4LYHA 5DHFA 3SZRA 1FNNA 4XOIA 1T9HA 3MUFA 5CDFA 1NBMD 2OXCA 1XXHE 1JR3E 2QT0A 1WB9A 1VG8A 3B60A 1OLOA 5E4FA 4CRWB 2QROA 4TMVA 3Q5EA 1AN0A 4GPTA 1L4UA 2FFAA 4G5QA 5KNDA 2NQ2C 1ZU5A 2OXRA 2DHRA 3KQUA 1YR6A 5DHAA 4Q4JA 1PLLA 1TEXA 1G19A 1KNQA 2CDNA 3K9GA 4Z51A 4EPWA 3EPLA 2V9PA 1N0WA 3R9WA 5CM9C 4M4SA 4EFNA 2LWIA 5KNCA 5L3QB 2V6IA 2Z4RA 3I5YA 1UF9A 4XWKA 4DRZA 1N6KA 4DLSA 2BMJA 2CK3A 1PZNA 4A8JA 2JLZA 5DN6D 2RKOA 2QY9A 1U0HC 1E9FA 2BM0A 4AIIA 4QC2A 1QRAA 2VYFA 4DLZA 1NSFA 3D31A 2WKRA 4DZZA 3CRMA 4M0LA 4H1VA 1JEEA 4BQSA 5DYIA 1JNYA 2PZEA 2XB2A 2NO6A 2WIBA 1AA9A 3PV0A 3IIJA 1JR3A 1MR3F 5DLQC 2XNSA 5SZJA 2OEPA 5FOTA 1NIJA 1ETUA 1KY2A 3ETLA 1XPUA 2IYWA 2R62A 1V5WA 2J7KA 1DG1G 3U3KA 2F1JA 3TBKA 3WY9A 4AKEA 1H8HD 4JLDA 4LHZA 3LLUA 4ZPXA 2PCJA 4TLDA 1MO5A 2CCJA 5CLLA 4B3BA 4CW7A 4TYPA 5J4LA 5ELXA 3WNBA 1FPMA 4OQFA 1UBFA 2QMHA 3F3YA 4WW0A 3A6PC 4XSGA 1EFTA 1TPZA 2Z43A 5LB2A 4KLNA 2W6JD 2QSYA 5FL7D 1XJ0A 2FU5C 3RDPA 1MRSA 2FOLA 1QBKC 4C0QC 3ND8A 4TT3D 3B6EA 5JJKA 1E79D 2FGKA 2FN4A 2QUZA 5TXGA 4C0KA 4KLZA 2HT1A 3C4JA 3QPVA 4I1OA 1OT3A 2F3RA 2ZRDA 3NC0C 4PAOA 3A1SA 3GFPA 3QKTA 4D26A 2VQSA 4BFXA 5FUWA 4PHFA 4BFZA 1IN6A 1FUUA 3DOEA 2QPTA 3GJ0A 1Z47A 2QRZA 2C95A 4LBVA 2G77B 3I32A 1XJCA 2XOKD 4LRWA 4Q5IA 3DL0A 4R7ZA 3W90A 1KKLA 5LD2B 4O2RA 1K5GA 4EPVA 3FMIA 4M1KA 4LJ4A 5AJWA 1KAOA 1XB2A 2RGAA 2QQ0A 3JVVA 3OFNA 4KHZA 5KU1A 3SHFA 3K70C 3DKVA 3SDZA 2AK2A 2PT5A 1P9NA 2X2FA 2PZFA 3QJYA 1ZIOA 4C0SA 2XX3A 5FUVA 2ZE7A 2WAXA 2ZRLA 5GJBA 1T3SA 1IN7A 4OQMA 5JBQA 2VHJA 2GBLA 3GLGA 3REGA 1WBBA 621PA 4AKHA 1Y63A 1HEIA 2A5JA 4EFLA 1IXZA 3TLXA 1QDEA 3IIMA 2ZVQX 3EX7C 3VHXA 2OLJA 4JVMA 1NLYA 1CJTC 2P0EA 4OI0A 1RJ9B 1S9HA 1XU4A 2YWEA 3FDIA 2A9KA 3RC3A 3KQKA 2PLRA 1XP8A 3MLEA 3PG5A 3BB1A 2VF7A 4HAZA 2XTMA 3EPHA 5TDHA 4AY2A 4ABYA 3RANA 1HT1E 3CKLA 4A92A 3GLIE 2VHCA 2F9MA 3ECCA 1W4AA 3M6AA 1CBUA 1OHHD 4C4PA 1W5TA 4GL2A 3F5FA 3TW8B 1ESNA 1E1RD 1P75A 1VIAA 1HE8B 3BH7A 4GOKA 2AD1A 4HAYA 3CF0A 1QZXA 4DB2A 5AUOB 2IT1A 2ZR0A 1DELA 1L4YA 3FVQA 4PZLA 2W0SA 4NYJQ 2FNAA 2GA8A 4XTCS 3NXSA 2J45A 1F48A 1BS1A 2R6CA 3SE0A 3QXHA 4GRAA 4NYMQ 4DT1A 4KO8A 3DDCA 3U4QA 4ZKEA 2R44A 2QTFA 4QJ5A 2ONJA 3RS2A 1U98A 4I4LA 4URWR 5G53C 3VR3A 4A0RA 2JLUA 2ZU6A 3GQBA 3M0EA 4UXHA 5BQ5A 5L3SB 2P6UA 4Q01A 4E5UA 3JZAA 1R10A 3EG5A 4IDOA 4QBGB 4PFSA 1JI0A 5LD2C 2ZRKA 3A4LA 4P0TA 2F6RA 2ATXA 3P27A 1GM5A 1ZD8A 1CRQA 3SR0A 1VG1A 1XTSA 1KO1A 1IY1A 3CBQA 2WKPA 3VU9B 3BJIC 1VG9B 5D3QA 3HPQA 3GLIA 2IYYA 1OV4A 2ZROA 1XNJA 4OYHA 4I1SA 5HKKA 2BKUA 3TVTA 3UKDA 1NBME 3CWZA 4NTZA 1DPFA 1GIAA 3ZQJA 4MUBA 2DBYA 4JYCA 2J0SA 2QSZA 4TMTA 2JLQA 3U7FB 1LV7A 2NG1A 4GNKA 4URZR 3ZVRA 4HI0E 3W6PA 3D7MA 1SVWA 4QGFA 2RGBA 1VTKA 3LWNA 1CS4C 1G5PA 3E5HA 3K0FB 5JMTA 1Z0DA 2Q3FA 3OE7A 3ICQB 2WPDA 2IHYA 2X1VA 5JEEA 5F98A 1P72A 3UIEA 4PO9A 1WMSA 3VR1A 4LJ8A 1II9A 4BLRA 3WP1B 2RGCA 3KXKA 1Q57A 2RHDA 2ZS8A 2VLIA 4RD1A 3RABA 5J4HA 4UNPA 1AQUA 1T8UA 2GZAA 3OEEA 4E22A 3X1XA 5KPJA 1UADA 1LB1B 1Z6GA 3PUZA 2FEMA 3U3JA 1I4TD 2GVZC 5JRJA 4X8LA 3QSYA 5JSZB 1E0AA 1NP6A 2CL0X 5H70A 3GP8A 5FPHA 3D8BA 3IHLA 2ERXA 2WSSA 3CR7A 5AK0A 4BFSA 1J99A 4CEHB 2H18A 4D6PA 3LXRA 4HZUB 4A0HA 2O8FB 4LX0A 3PR1A 5F9HA 1P2SA 2HT6A 2P67A 1S2MA 1G8GA 1WF3A 2OFOA 2LKDA 2YC4C 1N3BA 4Q47A 1O3YA 2VP0A 3W6NA 1GFIA 2IYQA 4OK6A 2VRWA 2XEXA 3I8XA 1VPLA 1CR2A 3GLFB 1KO7A 2XAUA 3CX8A 5JFGA 1CP2A 4FMDB 3VTKA 2O8EA 1LY1A 4Q4HB 2ZETA 2AL7A 3DOFA 3EZ2A 3W5IA 5JLJA 3HPRA 3PUYA 1NIPA 3CRW1 3K1JA 3U60B 4V0LA 4B3GA 1ZU4A 4G5OA 1IN8A 4NE2A 3TGPA 4QHTA 1JQLB 4DDUA 1R0YA 2ODWA 3DHWC 5J4KA 3DMDA 4M9SA 1XMVA 2VF8A 1JPNA 1YRBA 1EFHA 3IEVA 2HF9A 4JKIA 4NYIQ 5G3YA 2FG5A 2WTUA 4A0GA 421PA 2XTNA 4L16A 5AR1A 2CBZA 1FL9A 2PX3A 4FIDA 1MKYA 2XSZA 4F4CA 4V03A 4MKHA 2C78A 3KFVA 1UDWA 2NO1A 5B64A 5LBIA 2QT1A 3CIOA 1KI8A 1N25A 5BWMA 2QMUA 1S4QA 1IN5A 5HPYB 1G3IA 5L3SA 4FD2A 3CH5A 1SHZA 4W7SA 2ZI5A 4P3YA 4IEIA 2O8BB 3W8RA 4C0HA 1MO3A 1GZSA 3GJ5A 4ZO4A 3WMEA 2QMEA 2YOHA 4B48A 2JGNA 1RRGA 2IF2A 5EE9A 1LTQA 5AJXA 1W4CA 5GADl 3BFXA 4IFEA 3U7HB 1A1VA 1DVRA 4QFMA 4DLRA 1R0ZA 4ARZA 2BM1A 2HYDA 3VU9A 5KDLA 5KUTA 3QF4A 3R8CA 1MOZA 3Q3JB 4L5BA 4RD2A 3V4FA 4RD4A 5EUMA 3QKRA 1OXTA 3TH5A 1TU4A 2JLXA 6Q21A 2CVHA 2EFDB 1IONA 1J90A 2IHBA 4BLPA 2VTKA 3KUDA 2X2EA 4V0ME 1EXMA 5GJCA 4IOMA 4Q1BA 5TVKA 3NIBA 4NCNA 3GFOA 5F2EA 2FV8A 1KYIA 3NC1C 1ZMXA 1ZW6A 5KNBA 1XEFA 2HJVA 3GJXC 3NDPA 3R20A 3CX6A 2NO0A 2GAAA 5K8UA 1XCMA 1II0A 2IYTA 3K0FA 3W8NA 3BFVA 2JASA 4LV8B 3BH6A 5K8LA 3H84A 3TVDA 3CUEF 1GKIA 4BFVA 3V9PA 4BE7B 3C5HA 4NU0A 4AI6A 1NL3A 3IQWA 4URYR 1A82A 1N2CE 4C2TA 2XZPA 3FGNA 4IHQA 1W0KD 2ZTSA 4FI3C 1XDBA 3EIEA 4QM7A 3J81k 3R9XA 2QPOA 1TQDA 1XBTA 5TARA 2XNDD 5JSZA 3QEJA 1Z28A 4EPTA 4PC6A 1NN5A 3U3RA 3DM9B 3ZZ0A 2KBFA 3R7WB 2GDJA 3AKEA 1TX4B 2IL1A 2A2ZA 2MMCA 5B2ZA 5JWOA 5KDOA 4CEHA 1D5CA 1X8LA 3A58B 3AF0A 1OXVA 4JIMA 3HJNA 1LS6A 3IEUA 4KSCA 3ZS9A 4HZIA 4HZUA 4ON9A 2CNWA 1SXJD 2VPPA 5EP3A 1MRNA 3KXLA 3N70A 1A5TA 2RGDA 1SKQA 5BN5A 1CJMA 2DB3A 1IJFA 1OXXK 3RRNA 1E0KA 4F93B 2MSCB 1QHYA 4LUCA 4B3XA 1JR6A 1II8B 2ZRPA 3QEOA 2OLKA 3B13B 3FFAA 2QRNA 3LBNA 5CK4A 2BBOA 2OUKA 2PJZA 1SVLA 2OBNA 4TMXA 1PLKA 1XCGB 1IBRA 1I4LD 4QHSA 2UZIR 1ZC3A 5FPYA 2WIAA 1S96A 2IS4A 1TU3A 4IXNA 2R65A 4MRRA 1AZTA 4QG7A 4YMWA 2ZE5A 1TF5A 1HQCA 3OHMA 3AEZA 4WIAA 3K0AA 2BV3A 3GJ6A 4AURA 2G88A 3TW4A 4KVAA 4RY2A 2KB0A 2ORVA 4FWTA 4TZ6A 1YZQA 1W36B 4LV5B 1S9DA 3MAAC 4LCBA 3X1ZA 4OL0A 3TUZC 3BERA 2AXNA 4DB4A 1Q12A 4W9MC 3BS4A 3A1WA 4H1UA 3WBJA 2YOFA 2BEKA 1F6BA 4P32A 3OAAA 5FI0B 5HCNA 3TIFA 2RGNC 2ZYUX 3TKLA 4YDSA 2RB4A 3ICEA 1ZINA 4D4MA 3LFUA 4TMWA 1G4UR 3PITA 3THWB 3TSZA 8OHMA 4DUGD 1F2TA 5DGXA 5FR1A 2Q0HA 3Q9LA 2Z83A 2P6RA 4TTQA 2I4IA 2NGRA 4LGMA 1NG1A 2PZGA 3NEJA 4NZYA 1ZCAA 2UZ3A 4PHGA 2C04A 1VHLA 3T1QA 1AS3A 4U7DA 4PR0A 4KFTA 4EJSC 1MABB 4A4DA 1Q3TA 5J4VA 2BMDA 3Q8XB 4PC2A 3SBDA 2VHTA 4Q4JB 5KDDA 1IY2A 2EFHB 3N2IA 1UM8A 1K8RA 2ZYVX 3IDQA 3WYGA 1VKJA 1YZKA 1AKYA 1E2LA 1U94A 4IEEA 1S3GA 3LD9A 4F4IA 3U61B 1OF1A 4XD7A 4LJ7A 1NF3A 2J7PA 1XCPA 2AXPA 3SOPA 2EYQA 1T6NA 2OT3B 1HY3A 1Q22A 2ZI4A 3RRZA 3C8UA 2ZXUA 2EWWA 3TR5A 1CRPA 4TYYA 1E96A 1YZNA 2R8RA 2ZRBA 2W58A 4KAXA 2ERYA 4NCJA 4QBFA 4E07A 4YQFA 1VMAA 1R8SA 4DDTA 3QENA 3VHLB 3MSXA 2JLWA 1Z6TA 1G6HA 2RGNA 1XXHB 1XX6A 2ZRIA 5EE1A 1A2BA 3CF6R 4NCHA 1U8ZA 4C7OA 1M74A 3PEWA 1D2MA 4TYNA 1RYFA 2I3BA 3DKPA 3SEAA 1QHGA 5D3MA 3B1ZA 1J8YF 2F43B 1HE1C 2CJWB 3X1DA 1TADA 4OHVA 3FMOB 3RS5A 521PA 3K0CA 3TRFA 1AM4D 4EJSA 1RRCA 2ZIAA 1AS2A 5FOUA 3WXMA 1E9EA 2ZAMA 4Q4LA 4B2LA 5JI2E 1EFCA 1VYTA 1UFQA 2A78A 4HAXA 2OAQ1 3RHFA 1OPXA 4Q4AB 4V0KA 4MGIR 1E2NA 4F91B 4ZCMA 5C2JB 1JEDA 4UXJA 4DCUA 3LO5A 4GBMA 4TQUS 1X8KA 1XTJA 2OZEA 2X77A 1KIMA 1KTVA 1GSIA 2IXFA 3PUVA 1E3MA 4NYMR 1SVMA 3PIRA 4PZYA 3U7GA 2BJVA 1ZM9A 3TAHA 4HUTA 4F4JA 4TSFD 4ZDWA 2GEDA 5EXPA 2QI9C 2CVFA 1G5TA 2ZYTX 3X2SA 1N6HA 1TTTA 1G4AE 5FBLB 2IYZA 3U7EB 5EJEA 5E7JA 5F3WB 4K81B 3WP0A 1GVNB 1VECA 2OG2A 4P31A 5TB5A 4HB2A 1B0UA 1YU9A 2N42A 2OCYC 2PMDA 4UNQA 4BEBA 1F2UB 4A6PA 2PMKA 3NG1A 4QNMA 3GLHA 5GVRA 4IDNA 1Q1BA 4MDFA 3B85A 3LNCA 3BXZA 1VIYA 1ZNXA 4MUAA 1ZJ6A 3AVPA 4M2LA 4ASUD 1KDOA 1NVWQ 2YV5A 3THWA 4JJKA 3AH8A 3HR8A 2ZJ2A 1G3QA 1SXJE 3D3QA 1VCNA 3IIKA 1DO2A 1P7CA 2HDNB 4MA4A 1W47A 2IW3A 2BWJA 1RC8A 1W0JA 5FTMA 5AWFC 4B75A 1LF0A 2EFCB 4QGAA 2JA1A 5K8TA 5DI3B 1GWNA 1TNDA 4MRNA 1QVRA 3I72A 2KI5A 5IT5A 1MABA 4UNRA 3I1FA 3RSOA 2KWIA 2DY1A 1Z06A 2GZDA 4PPNA 4DJTA 2R9VA 2HCBA 2OO7A 3CW2A 3P4XA 3WNCA 4DVGA 2ODEA 1PUIA 3H86A 4Z8YA 4BPBA 4DT1B 3UPUA 1BH2A 3SFZA 1COWA 3U4QB 3NH6A 2OV2A 4ITRC 4DBLC 4B35A 4IDPA 4CT4B 4PX9A 4MGYR 4S35A 5BN3A 3VNUA 4IXMA 4KI0A 3K70B 2QBYA 3AKDA 4W5JA 1FMJA 4Q9LA 1XD9A 3L0SA 4BZXA 4CZ2A 1JPJA 5IF9A 4JT4A 1G41A 1VCMA 1VCIA 3SS8A 1AJEA 1OYYA 1R5OA 1ONBA 1E9RA 2ZS9A 2Z6VA 3SYLA 1ZNZA 2Z0MA 4B71A 2LKCA 1XXHA 3BIFA 3HWSA 4HB4A 4ZDJA 1XPRA 1QF9A 1KY3A 3W34A 1XPOA 3A1VA 2XZOA 1E9CA 1G8HA 3GLIB 4JZKA 4L8GA 4TLEA 5CJPA 3S1AA 5CK5A 4XVUA 2V6JA 5IK2D 1SZPA 3CO5A 5EQTA 1OKKA 3NBFA 4C30A 4B73A 4Q18A 1IM2A 2GBLC 4RSGA 2CLCX 3PVSA 1NSTA 2F43A 1E2DA 1SULA 2WWGA 2CJWA 2O8DA 5BW8A 2V4ZA 2WJHA 2P3SA 3SHWA 4GFDA 4Q03A 3B5JA 1EWQA 5CM8B 2C9CA 4LDJA 2FPLA 4URVR 4IDHA 3BWDD 3BOSA 3ZZUA 3O8CA 1OH8A 3TQFA 1AKEA 4QBIA 4RFVA 2FJUA 1IJEA 2IX3A 1KZ7B 4Q4AA 4ACBA 3EZFA 4O25A 1CF4A 1U8AA 3ZQ6A 4EIWA 2FPMA 1CEEA 2XJ4A 2H16A 2OFWA 5FBRB 4F7WA 4JL5A 1Z63A 1Q1EA 4JMPA 4Q7MB 2AWOA 4JJZA 4RVCA 2IS1A 3AVXA 2QENA 1EFRA 1EFUA 1M34E 1YQTA 5G3ZA 2D7DA 4WAUA 1XWIA 3Q85A 1R6BX 2ZSDA 1H65A 1UKYA 2PEZA 1XTKA 1FX0A 1BO6A 4MYHA 2ZRHA 4HB0A 1E9BA 4LZZA 2ECKA 2HJGA 4QGHA 5L3RA 4A82A 2TMKA 4AG5A 2ZRFA 2B8WA 4MKIA 4RZ2A 3LBHA 1RKBA 3MJHA 3TSWA 2QM7A 1KMHA 1ZM4A 1DTSA 3PCRB 1Q21A 2EVWX 3QBTA 1G17A 2G1KA 1JB1A 1T91A 3BE4A 4GOJA 1S0UA 4CVNA 2GETA 4Q02A 1US8A 2BC9A 2JDIA 4B6EA 3AV0B 2ZYWX 3ZIAA 1S8FA 1F2UA 2QE7D 1I2MA 1DAIA 5KSZA 2AK3A 4OBEA 4JVLA 4FMDF 5H1YA 3PFIA 4AG6A 2G1JA 3RS4A 1C1YA 3NBZC 3ZDQA 2RCNA 2IF0A 2QA5A 2QGZA 4KV9A 4YC7A 2ZQ5A 3UWOA 1IOZA 1KK3A 3OIVA 5JS7A 3ND9A 4A2PA 2O8EB 2WWHA 2BKEA 2WVJA 3CH4B 2ZAOA 1XMIA 2YWHA 3NHAA 4EAQA 2DFLA 3C41J 2WJIA 1T4GA 3OIWA 2JJ2A 5DI3A 5BXQC 4EDHA 2J5XA 1E4YA 1FMLA 2G3YA 4X8OA 2QNRA 3FE2A 2R2AA 3CNLA 4P4TA 1UBGA 2ZITA 2J3EA 3P20A 1L8QA 5E7MA 2G0TA 3QPUA 3F8TA 5FPSA 1BIFA 4AWXA 1X86B 2F3TA 1BMFA 2GEVA 1XMJA 1G8FA 2VHQA 2V7QA 4NDZA 4V0OA 4WXRA 3PJRA 1UDXA 3RSLA 3TE6A 5FPKA 3ZS8A 2ZRCA 3PXGA 4KXFB 5FBWB 4KVGA 3AQ4A 2NIPA 4YXWA 2YKGA 1FNMA 3D6TB 4Q1EA 3RYTC 3DEFA 1JXOA 2R6DA 3R9IA 1U9IC 4D4JA 4JVSB 1EX6A 1W44A 5LDDC 2CCKA 3HP1A 3E2IA 3CNOA 1G7CA 3PUXA 4AC9A 1IY0A 5H8WA 4PAMA 2QAJA 1G291 3LW7A 1N6PA 4KYIB 2NO9A 4P33A 1F60A 4ARZB 4C9BA 5HE9A 4LC1A 1VHTA 3QQ5A 2H8KA 3QF4B 4IJMA 5JHHB 1E0SA 2IYVA 2NZJA 2DWOA 4LHXA 4KFRA 1KI4A 2YNMA 3NEYA 4D25A 3QKRB 2FMXA 4EUNA 2WSMA 2CHGA 4KSBA 2H57A 2IK8A 1HT2E 4HDCA 5LB4A 3M4YA 3AP3A 1NN0A 2HLDA 4LI0A 3L43A 3DVLA 1U8YA 1LFDB 4GSYA 1E1QA 2HV8A 3HU1A 2OESA 1ZUHA 1W4RA 2ORIA 5CB6A 5FH9A 3ZVNA 3IQXA 3CRVA 4BFWA 4LPSA 2IYLD 5AUQA 1X3SA 2QMOA 2FDCA 4GMXA 4RD3A 4QGGA 2ZJAA 1AGRA 3QXJA 4US0R 4Q9IA 5B30A 2YJTD 2JIZD 3RS7A 1OFTA 4HATA 2ZREA 1KSFX 2EW1A 2GTPA 3T5DA 4IOLA 4GT1A 1Q3HA 3UMRA 2OSBA 1U9IA 5FTKA 3KQNA 1UAAA 1QG2A 2JAQA 4DSOA 3SNHA 1NMZA 3THXA 3LY5A 3TMKA 2ZRNA 3I92A 3IPXA 1H8ED 3L2OB 5AJVB 1NBMA 3DM5A 2V8OA 3SYNA 4DDVA 3FHCB 4HYYA 4B34A 1NRJB 3FKSD 2DWQA 2ZJYA 4PQFA 5J40A 3RRYA 4M22A 4WZAE 5FR2A 2D4HA 1W1WA 2DFKB 3AP2A 4B43A 3RC8A 2H1LA 2VHUA 2IYUA 2FFBA 4WZ6A 4DLUA 4C2UA 1GNRA 2CXXA 4B6FA 5FUXA 1DE0A 3LX5A 4EPXA 1JAIA 4ACAA 3WRXC 4GZMA 4Q48A 3T15A 2OBMA 4A2QA 3VKGA 2P6NA 1KDTA 3FMFA 3SJAA 1AS0A 1CXZA 3RLFA 4MDEA 2W6ID 4IVRA 1W46A 1U99A 1YRAA 1K5DA 1KNXA 5TMPA 1A4RA 2AFIE 3P32A 4I1VA 5DN6A 2G83A 1RW4A 1G7TA 221PA 2W2XA 3K0AB 4M1MA 3OEHD 1I4DD 1FTSA 2J0UA 4WZBE 2ZRGA 5HTKA 3T34A 4M8NE 4RZUA 3WNDA 2IEYA 3VKWA 1ZYUA 2PBRA 4QNRA 3I62A 1G21E 2N1BA 1FP7A 5IHPA 1R0WA 2CL6X 1SKYE 2A5GA 4JS0A 4N0EA 4PSAA 3EA0A 4FWIB 1Z0AA 3EASA 2D7CA 2GWHA 1C4OA 4TTPA 5HZHA 4Z54A 1JJ7A 1NLFA 1YVDA 2AKAB 4OK5A 2ZJOA 1XFAA 1H8HA 3ZD6A 3KDSE 2XZLA 1E9DA 1F2TB 2WV9A 2XB4A 3GFTA 2VBCA 1G8YA 5HR5A 4NH0A 1DG3A 4LBZA 3LH5A 3O8RA 4DCNA 4OHYA 3N2EA 4MRPA 4AKGA 2W6JA 5FL7A 1SVIA 4QM6A 3WMFA 1TUEA 4GMDA 3K0EA 3L0PA 4JLOA 4LJAA 2ZR7A 1WBDA 4TT3A 3Q7PA 1HYQA 2FSHA 2PH1A 3KFXA 4GZLA 5DSZA 4G5RA 1E79A 2D06A 3WHLA 2RMKA 4XIGS 4CYMA 4EKDA 4ZDKA 4P4UA 1G20E 3TQCA 2H5EA 2L0XA 2BHRA 2GXAA 3AVYA 2WWIA 4RD6A 4UNNA 3VX3A 3KKPA 1DAEA 1E4VA 3LX8A 3K8YA 1KZGB 3BD9A 4QKQA 1D8TA 2A5FA 2WJYA 3G5UA 3AB3A 1G64A 2BVNA 1W36D 1M8PA 4G0NA 2YINC 3T12A 4DC9A 2XOKA 1P2TA 4FW9A 4M1TA 1R8QA 3M1IA 5DO9A 3A36A 1G18A 5JJIA 4QJ4A 4Z1MD 4BWYA 1DAGA 3BH0A 2J1LA 4HSEA 2A3RA 3QY0A 3ZH9B 3L8YA 2AFHE 2JJ1D 3U6BA 3JZMA 3B9PA 5CITA 1RE0A 4US2R 1YJ5A 721PA 5EE5B 5TV2A 2ZI6A 5TY0A 2GJSA 4TMKA 3AVWA 3NBXX 4A0FA 2ZE6A 2WOJA 4O3MA 4DLWA 1NVXQ 1T3HA 4HLDA 4G01B 4MGZR 2X19A 1JECA 1FQKA 4RKFA 4C7OB 3PEYA 1N0VC 3FB4A 1MV5A 3T1TA 3T61A 4TL9A 1ZC4A 1OFIA 1S3SA 1XD2A 3WMGA 1CULC 5D3MB 1OB5A 2OCPA 3L0IB 3GLFE 1HURA 1NMXA 3QXSA 1TAGA 5J47A 4DDWA 1OJLA 4PQYA 3AVUA 1XJQA 2IBMA 3L82B 2IC5A 5EZ5A 1GRNA 3THOA 1DADA 4V0MA 1KK0A 2GF0A 4Q9JA 4M1YA 2BBSA 1OHHA 4Q7JB 4LY6A 2EFGA 1CJVC 1E1RA 4BRWA 3B1VA 2CMKA 4JLNA 2J9RA 1Z22A 1XTQA 3BORA 1WCV1 2CK3D 3KJHA 2QAGC 1E2EA 4M9QA 3I4LA 3ZGXA 4PTLA 2C8VA 1KI9A 2EYUA 3ASYA 4JBXA 4JLBA 1P5ZB 3A37A 1YZGA 1FTNA 1F5NA 4TMZA 1UBEA 3QIAA 3EC1A 4B32A 1ZRHA 1SVOA 3TAUA 1M7GA 5FTLA 1SVKA 2O8CB 2W83A 5EP1A 1E2MA 2FZ4A 1JR3D 5G41A 4IFBA 2DFNA 2ZEJA 2ATVA 4N3NA 1QHIA 1C9KA 2B7BA 3C7KA 4DIDA 5EXSA 4JYBA 2IWHA 3BC1A 4B3DA 2GJ8A 4D4LA 5M04A 3UXMA 1E69A 1P3JA 5DH9A 1DARA 2WWFA 1B23P 2HXYA 2D2EA 1CU1A 1JXMA 2EU8A 4AYXA 5BYJA 4BFUA 4LC0A 2WBLC 4Q9KA 1RFLA 2VP5A 3WYAA 5FBVB 2NTYC 2BDTA 1NKTA 3GLHB 4ILEA 1T5IA 4TL8A 2FSFA 4TTRA 5JCPA 4L4UA 1KSHA 3UATA 3E1SA 3O8BA 2D2FA 5DISB 2Q3MA 4QXAA 3CZQA 4MKFA 3O47A 5L8VA 3C14C 3SQXA 1X1RA 1Z2CA 2AN9A 2ZJBA 4KJZA 5FBQB 2XGJA 3ONWA 4Q7LA 4W5HA 2QAGA 3CNNA 4QL3A 3K0CC 1LS1A 3LRPA 2DCUA 3DO6A 2BJWA 3RS0A 4JSYA 1ZM7A 2B8TA 4EPYA 3QOFA 821PA 1OYWA 2CE2X 3U3OA 3UANA 3OF5A 5E3HA 1NVVQ 3OFND 4P4SA 4E03A 3AF1A 1Z0FA 4LHWA 2FPKA 3RS3A 1WQ1R 1KHTA 2GJKA 4PC7A 4M9XA 1E94E 3SBEA 5JCZA 5KPDA 2F1IA 1E9SA 3MWLA 1EESA 3AUYA 4DEXA 4HDOB 5CIQA 5BN4A 2QBYB 4Y0AA 1G7SA 2VA8A 2BBTA 2OCBA 4I1UA 5FI1B 1OFHA 3Q72A 1DO0A 2UVQA 3CPEA 3TJZA 4AYWA 2KE5A 1G8PA 121PA 2ZI3A 1U2RA 2IUUA 1KJZA 3AVQA 3LAWA 3B8HA 1UBCA 1P2UA 1GP2A 5GVSA 3ZJYA 2C98A 3SFVA 1P60A 2A5YB 4R71A 4TYQA 4LSGA 4PC1A 3QUSA 1RYHA 3G0HA 3TSOA 3HYTA 3S1AB 2KSQA
chains in the Genus database with same CATH superfamily
3I52A 4GP9A 5LUAA 1P8JA 3CWCA 3R4VA 1IDN1 1ILWA 3BEDA 2GEJA 4BLSA 3H5OA 3C3CA 2B9EA 3PLRA 2IZ7A 4I4TB 1GGKA 2OO3A 1KE2A 3UWMA 1NJ1A 1Y9ZA 4HADA 4R9UC 1PJQA 3VNBA 3U44A 3ZDAA 4ZV9A 1V16B 2GRJA 4PO1A 1NG9A 2W8BA 4R8LA 1LCIA 4H0CA 3ZG6A 5F5XA 2GZHA 4EG3A 3RB8A 1G7RA 2V7TA 2WAYA 3FRIA 1XDGA 4I9FA 3LDAA 3E23A 4MS4A 3RSGA 6REQA 3LPNA 5C7YA 1ZY2A 3RVBA 3VR3D 4J2HA 1XVTA 4KWTA 4NK4A 2WWWA 3TQOA 8ATCA 2J87A 2JCSA 5AUPB 2Q62A 2B4AA 3OP4A 2JFGA 4ZI7F 2AOTB 2KMLA 1XTRA 1R2QA 1SUDA 3EZYA 4OM8A 4DMCA 4X90A 4ETWA 2NTNA 4ID3A 2GEUA 4FS8A 4A0QA 5MDHA 3E7WA 2C9YA 4EL5A 5HS6A 4MAAA 1GPMA 5IAGA 2H4HA 2QN6A 4TL6A 4E5YA 1H1LA 2O8CA 5A0VA 4Y30A 1P1CA 1QIDA 2YXLA 2Z09A 4D1YA 5C8XA 2B94A 3GPDG 4ZYTA 1X13A 1XD8A 5JJ5A 1CERA 4EG0A 1E2FA 2J59A 3OZSA 4ISBA 1KSGA 3U5ZB 2BHTA 3JVUA 3K0SA 3FKQA 3Q2IA 3R24A 5FNZA 2C5SA 3WKAA 1ESCA 3FFBA 3L18A 2X0EA 1BEZA 4L07A 4CG2A 3GMSA 1L4HA 3VU0A 2O52A 1RXWA 1RWMA 1BW9B 3NHZA 4S1OA 1Z2OX 1AK9A 4RHTA 4MMXB 2PHZA 1UMBB 3M6MD 3SSMA 4CF7A 3DEIA 6CHYA 1Z3IX 1H2BA 1RWKA 4WXHA 5BR8B 1RWXA 3D8TA 4XI9A 4HNAB 4IVQA 1Y6FA 2AOXA 1TU0A 4WVLA 3F6EX 3HR7A 3V8NA 3COZA 3KTFA 3CCFA 1ULAA 1BGWA 5BRNA 4MYUA 1N2GA 3O2SB 5P21A 3JALB 4S1TA 2VAMA 5DLEA 1DXOA 5I7RA 1GZ6A 2VP4A 1ZO8A 3LLVA 3OE7D 3ZEAA 3EIOA 4Q05A 1EWRA 1USVA 1V2GA 1XZPA 4MV1A 3HA5A 2ISCA 3VR4H 1S1MA 4ENSA 2C4MA 2WU4A 4EKYA 3BXEA 5JATA 3KKQA 2D74A 3EXAA 3V6MA 4U7PB 1U1FA 3KSRA 4D9FA 4EHAA 4TV8F 3A6KA 2ICAA 4RZIA 3LHIA 1UKVY 3HN2A 1HC7A 4Y6QA 4JBYA 1GL9B 2WA2A 5U1PA 3WLOA 1RKXA 4RADA 3ZD7A 5G1PA 3V8QA 1FSPA 2BGMA 1EI9A 1HTWA 1Y0BA 2FW8A 3FTCA 3TBHA 4DL9A 3OLXA 4Q9DA 3K6SB 2VDKB 2WJJA 5A9SA 1N6LA 4JCOA 1F51E 1RQ7A 2E89A 2ZPAA 1TDJA 3E8XA 3HU2A 4IH1A 5HX7A 1BN7A 1GGJA 3JARA 3WL4A 1UIRA 5EJ4A 2C31A 2X6QA 2JFZA 3VYTB 1GUDA 5J5VA 4BKRA 1W4BA 4ZAYA 4M53A 1DJLA 4NI5A 4BBPA 4W8GA 1U2TA 5LQUA 3AF3A 4TSKA 1YMUA 4J0DA 3AKZA 3W2TA 3H5VA 1AGNA 1W0KA 2L42A 3H1TA 2EQBA 1AQYA 1FTYA 1O7JA 2GK3A 4L57A 1EBBA 1YBVA 1U04A 2IXEA 5FAKA 3HK2A 2BJHA 4FW8A 1ZHFA 1P6XA 4OAQA 5DSTA 2RCYA 3C45A 3LBIA 2IS2A 4FPXA 3HLTA 4YLEA 5CAEA 3SLRA 5I7SA 1C7IA 1D7OA 2NZ8A 4L9WA 4N1AA 1SVNA 4W5QA 5AKZA 2JFVA 5EHGA 2PZAA 3G5MA 2PWPA 3I2HA 4HEJA 4Q00A 4PLFA 4ZCPA 1JGTA 1WA5A 4H1HA 2ESRA 4YN3A 1T35A 2FR0A 3ZLBA 3BBLA 2P5TB 1CUIA 1D8AA 1W9MA 4GX5A 3ZLJA 3PFKA 5IAKA 1RWOA 3VSDA 2XB6A 2IQIA 2LGJA 4EECA 1ZAYA 4UE3S 1SOAA 1E58A 1S2NA 1U9ZA 4NECA 1NMSA 2FX2A 2FR8C 1O8BA 2XECA 5EWJA 3UAZA 4GOND 4GI2A 2R00A 1FRFS 2R6FA 4MV8A 5CB4F 3DFIA 2WG2A 4NQRA 4NCKA 1V16A 4WN9B 1XG5A 4F6RB 2D5AA 3X3HA 4YLGA 3ZEIA 1L5ZA 3FA2A 3DZ8A 3FAKA 3O92A 1T43A 2GWRA 3AKYA 1KYYA 3DTVD 1V48A 3DVQX 1P9RA 4R98A 1TZCA 3IT1A 5CBKA 4YIHA 2ZYAA 2VPZA 3HBMA 3K2BA 5ER9A 1YR9A 2ZVJA 1YQ9A 1FX1A 5DKFA 1RWWA 2PAFA 2X13A 4FX2A 4QQ8A 5ICEA 4ZRMA 4NIMA 4RDHA 2HBRA 1N5KA 3ZHOA 4D3XA 1H05A 2C03A 2HNKA 2K4MA 4IOKA 3B9QA 2YV4A 4V3BA 4N12A 4G8BA 1QCDA 4P7BA 4CIDA 3TZBA 2AOTA 1MENA 3O93A 1XU7A 3CF2A 4X8MA 1DXHA 4OKSA 2G72A 1E3TA 1JEOA 2OHFA 1PCXA 2VNJA 3GFQA 5T4BA 2EQAA 2OCLA 2CJPA 3TW6A 1Q1ZA 4IRUB 4CLHA 1X42A 1PG2A 4HWTA 4PQGA 1Z4KA 3EXFB 2WZCA 1P5HA 2YYZA 5EIBC 4JU8A 3DZJA 2A9OA 4Y1FA 3NOXA 1MH1A 3LVBA 3B1XA 5AI4A 4DUGA 2E4UA 4RJTA 3STXA 5JDCA 1V0JA 4MV3A 3JQAB 1N75A 2BTOA 2OPBA 1LW7A 1JKFA 2W2NA 3GRZA 4I55B 5LFAA 1OB2A 1CYEA 2R7MA 1BW9A 3M82A 5EUQB 5B6PA 1JA0A 2QYSA 4TLBA 4MLZA 3PUIA 3SHVA 4M89A 3ANLA 4LNUB 4N7BA 3DGEC 4RHEA 3T06B 3WLTA 5C8DA 2Q6KA 4P7GA 1FRZA 3HJUA 3MUNA 4RL4A 3VZPA 4D9EA 2UYYA 4RFSA 4Q93A 3DUFB 3B8EA 2JBAA 3OKCA 2G5TA 4U6SA 3NGLA 3JALA 4E1BA 4JT2A 1L9KA 4DLYA 2FWBA 2XUHA 3KZ1E 5BNZA 1RI5A 4L28A 1E1NA 3D4LA 4RK5A 4KE9A 2OV1A 2PFGA 2FJ0A 2HPHA 4EQZA 4BO1A 1M6NA 5CVJA 3TM5A 4NBWA 5KYGA 4AG3A 1YZTA 3QEAZ 2EARA 4J29A 1IN4A 4NPHA 4PLTA 3NTRA 5HZKA 1M34A 2X76A 1MIHA 3AI1A 3KQSA 2VYCA 2FPPA 4INOA 4QELA 2H9AA 1POXA 2COUA 3A1UA 4J7AA 4WKPA 5TX7A 1V4NA 4TV8B 5C5EA 2WJ3A 2XTAA 1WZIA 1XEWY 4DCTA 4XWGA 3S2EA 1RC1A 3AV3A 4OM7A 4RKEA 4X85A 3VAAA 4RTOA 1FDUA 5DHTA 4E88A 4F1WA 2R6JA 5ECGC 1GQSA 2ZATA 2W2LA 1UDAA 3MHTA 3B82A 3RWOA 3E3OA 3GRRA 5AXCA 4BZWA 2A92A 3E4CA 2Q28A 4N5DA 4ZVNA 2YRFA 4NEHB 3UUEA 4BKUA 1G9XA 1RP7A 3NU1A 4HYTA 2FQQA 4GDFA 4WJKB 5AJUA 3VC7A 1Q0UA 3L9WA 3KUUA 4U7JA 4CNQA 2HBYA 3E1KA 4HNRA 2IH5A 3C15C 3FPBA 5KMGB 4D81A 1C5KA 1VJRA 2RGYA 4RW0A 3DDSA 1M83A 3T5AA 3SC3A 1FP1D 2JJMA 4LOLA 1DOAA 1XDDA 3EVNA 4MUMA 4EHLA 5I7EA 5IXSA 4LRTB 1DC7A 4EITA 4QQNA 3VZCA 2FSGA 4G07A 4BS9A 2E9SA 3MCVA 3IPYA 2XE8A 1UK8A 2A1UA 4P93A 2HF8A 2H65A 2QUBA 3CLTD 3UG7A 4A91A 4D7AA 4HCJA 3IDAA 1Z2NX 2EBUA 3WE7A 4GO1A 3K1TA 3O0TA 4NV3A 1M73E 3NIFB 3OFSA 5TQ2A 3SX2A 2WZDA 4DRXA 1F8UA 2FZLA 2F8MA 4I1RA 3FY4A 2WNHA 3GC6A 2NZYA 4GOOD 3RRFA 3TI7A 4BNJA 3DWGA 4L9SA 5E38A 2JLVA 3FLAA 5JC8A 4ICIA 4M9RA 4Q3CA 3A4YA 5AKEA 4ZV4A 1PLJA 3WKEA 1QHNA 2REBA 1FYVA 3W5IA 2NVBA 4WN9A 2IXAA 3Q3EA 4IQ8A 2II6A 3L8HA 2QX7A 5BSWA 4CT5A 2QW0X 2E1RA 1UZMA 2V65A 1UPFA 2PXXA 4JC4A 5CB4B 4CM4B 1F1BA 1A9OA 2O7SA 3OFJA 1OLUB 4BE9A 4LV6A 5C80A 3PX3A 4R2WA 4HAWA 4OXYA 1VB3A 3FLEA 1D4AA 4MQBA 5GJVC 5J1SB 4FHFA 1I0IA 2VIIA 4WCDA 4P3XA 5EJ8A 1J2TA 3MJCA 1YRHA 1M76A 4ZARA 1W7AA 1FNCA 3BMCB 2E21A 1RHKA 3IUNA 4LA4A 3OIFA 2GMWA 3A0RB 4L0QA 4D99A 5EZ6B 1Y1PA 1W34A 5FBHA 4OQNA 4WKOA 3RFVA 4BWGA 2OBLA 2NXWA 1R0XA 4RE6A 5H7XA 3WNVA 4WY2A 1H6DA 2UUAB 4OMDA 5P8WA 1HNZB 3LQKA 4IMRA 3VX4A 2WMNB 3ZGOA 4QECA 4YRJA 1M2OB 1P9LA 4B8ZA 3PX2A 1RSZA 3EXFA 1G16A 2FE4A 2JIMA 2OBFA 3IUJA 1XD2B 1KMMA 4O1HA 5JZBA 3FYDA 4BJ1A 3CBGA 3EW7A 2GXSA 2OBYA 4XQ0A 5JSYA 3EXIA 4QXPA 3QV2A 1DKQA 2R7LA 4OMUA 2RHMA 3AP1A 3JTMA 5EXTA 3JQAA 1V47A 3WDLA 3ADBA 5JNUA 2HMAA 3FTDA 3P9ZA 1EUYA 5HJ7A 4GRIA 1SO8A 4GKKB 2SHKA 3IUSA 3AWIA 4B7CA 3MS4A 4LOAA 3VBCA 3NORA 3THRA 4JK3A 3WWCA 4LNUA 2NLOA 5F3RA 1CSEE 3L7YA 4G4JA 1FQWA 4IDGA 4TWIA 2J7PD 3W8DA 3DUFA 3FR7A 2CMHA 1MOQA 2R8EA 3AEQB 4I99A 3RVDA 4B9EA 2QR2A 1Z5WA 1QR6A 2AFHB 2ZZMA 2Z57A 1U3UA 2ONKA 4KMSA 3FX2A 2I6UA 1AO0A 3SICE 2KBEA 2YH2A 3L7CA 1QUEA 4L85A 1XRMA 5DGTA 1P91A 4C0BA 3QNUA 3LUAA 5KHOC 1KO8A 1VE1A 1YF3A 1NBHA 3H1PA 3C3KA 4N5NA 4BMNA 1A9QA 1T2AA 3WYFA 1KH3A 4BP9A 4NBLA 2W11A 4G86A 5K0ZA 4M60A 4BLTA 4AUKA 4WFIA 4TZTA 1IXYA 4BN5A 3RVOA 3TPCA 1MTZA 1ETHA 1S2GA 1BU8A 2F48A 1VBMA 4EA9A 3VJKA 1ECGA 2MSDB 3M6LA 1IBLB 3BK1A 4C2BA 4IYJA 4QDXA 1W48A 5K3FB 4CM7A 2OB2A 2IWRA 1DKUA 4OHPA 1U4NA 3LY7A 4WOPA 3PFCA 1ODLA 1J56A 2QY6A 1NI4B 1RJ9A 3ECSA 1TD9A 4IBOA 1EX9A 1FYXA 4L76A 5TGZA 3RM3A 5SICE 3WGOA 1L1EA 4QYTA 3WNZA 5D5PA 2P27A 2O2IA 3DMGA 4M1SA 4QBHA 3VHQA 1Z34A 4HB3A 3AU8A 4WXPA 1VIMA 3RYIB 1E2QA 1OXMA 4QATA 4MW2A 4W63A 4B6SA 5DYYA 4KITB 3FYSA 1ODFA 4NOMA 4U5XA 5REQB 5LQAA 4ZI2A 3LRTA 1BYIA 4QSHA 3HKEB 4RSMA 1GL6A 3TIXB 1GNPA 3GMIA 5HA5A 1DHTA 1XZKA 1YE8A 5AVRA 1ANKA 4K5QA 3LCVB 2H00A 2VUTA 4KR0A 1UFRA 1XGKA 2YVAA 4N0QA 3RASA 1AVTA 2IV3A 1G60A 1KK1A 2I6XA 3AWDA 4HUQB 2O20A 4JU9A 4A6XA 2QAGB 4IDDA 1YKFA 3F7NA 1GTG1 5JQGB 3KTAB 3IQHX 5EMMA 4CUKA 1N8SA 2PVSA 4BNNA 2NVUA 4E4RA 5C4IA 2WVHA 1WVIA 2Y0EA 3K53A 4QOGA 3CJTA 1N5LA 4Y6PA 4KUHA 4AJOA 1L7QA 2BGRA 5FHQA 4E7PA 3N0WA 3PEUA 3N2LA 2BLNA 3WR5A 5KC8A 2AC7A 2V54A 2XKBA 2BFCB 3FPAA 4L6IA 1Y4DE 3AIMA 1PGOA 4NKRA 1J9EA 1G5RA 4HGYA 3UBMA 4MDYA 4DIOA 1ELOA 4R8KA 1ULZA 3C87A 4B81A 1XMOB 4BQQA 2ZM5A 2G80A 4UM9D 5LPNA 3IMEA 4OFWA 4PS0A 2HW8A 2HO5A 1JHDA 1HNWB 2I7CA 2NTEA 3DZKA 3M7IA 1OLUA 1TUGA 3JVDA 3UPDA 1PSZA 3UJNA 3BBPA 2ZWOA 1KOFA 5G1OA 4MV0A 4O2AF 4QICA 5HXAA 1R15A 4IOJA 4LQCA 4INJA 3GX1A 2RDMA 1M2HA 3BMCA 3VDMA 2FOIA 1EAYA 3CEJA 1NY6A 3SKXA 1E9AA 1LZKA 4RJLA 4GEKA 1I1QB 4MCIA 3T1VA 5KOHB 2QIOA 2EZ4A 2R8XA 4NFLA 2NM0A 3PQEA 2O0KA 4KNVA 1ONPA 2ZSJA 1CJCA 1A2QA 1KO4A 4N65A 3NPMA 3P0HA 1M2OA 3SIXA 2OP1A 4QEDA 4FYIA 1P19A 2NUBA 3GAAA 4XLZA 3SN6A 2L17A 3K4PA 4RH0A 5E6UB 3K09C 3Q7IA 2GTIA 1YKGA 4DXAA 4OF4A 2RE8A 5KTYA 1EB8A 1Z6XA 3MVEA 4IX1A 2NOAA 1WABA 2WJVA 4LKOA 3W9BA 3ED1A 4OY3A 3SQNA 4R9VA 4B6JA 1CVRA 1COWD 1GG9A 4UUMA 4Q1FA 2KYRA 2Q7DA 3MQ2A 1CKEA 2Z5FA 1CIPA 3E0QA 3PRHA 4N5MA 4WFQA 3SM9A 3H2YA 1NR7A 1YQGA 2QXUA 3M4ZA 3ZDFA 1OWNA 1FFCA 2FMHA 5IKXA 3A1EA 1TKRA 3C3EA 2CLIB 4QJIA 5CVVA 3B7GA 3P4YA 5ANRB 1A9XB 1YR2A 2AR7A 1U81A 1Z35A 2JFHA 4C3UA 3I73A 1YC5A 1KI1A 1KRXA 2P4QA 1ZD1A 4Z8XA 1H1TA 5AUNB 5F12A 2HV9A 3FGPA 1SHJA 1CEXA 1JLLA 4DNXA 1HTTA 3PIIA 2WF7A 3GEDA 4TKUB 3A9WA 3BB3A 3G8AA 3H9JA 1M2KA 3FYUB 3UMYA 3RSQA 4X64B 3LCMA 1A5AB 1ECBA 1RWNA 3QKWA 3OTHA 3PU6A 4IDQA 4YRSA 4XJVA 3H3JA 1NNI1 1PR1A 5EE3A 1A50B 1THMA 3QXCA 2Y68A 1S6YA 4IIGA 1ZNWA 1E63A 2AUMA 3TG2A 3O4RA 2FSIA 1NLZA 3O38A 5K3FA 5K0SA 5LYJA 1U28A 4GG1A 1HQDA 3GLFA 2GKGA 1KJ9A 2QVYX 3PXEA 2DHDA 5E1OA 2W2MA 1VYUA 4KPYA 1IVNA 2GVDC 5GJWC 4ZT2A 4FN4A 5DW0A 5C18A 1L5RA 3GJ7A 3NIWA 3L1JA 3SXJA 5FT9A 3BE5A 3NATA 5E4TA 1DCFA 1YR3A 1J8VA 3PGKA 4L4XA 4ZT5A 1ACMA 4CCWA 2ADOA 5EGNA 4CCAA 4LNAA 3W2IA 3PQ7A 3RYIA 3KKKA 1WXXA 3P9SA 3RC2A 3C74A 2DETA 3X1WA 2AN3A 5CP8A 2V1XA 3OECA 5EJGA 3ENKA 3L93A 4YYZA 1AN9A 4HXGA 1XLTC 4BX2A 1EWKA 5LR6A 1U1CA 1HDCA 2A5DA 2H0RA 2JANA 3KQPA 4JR2A 3VUEA 5L95A 1NI3A 2YHBA 3HKEA 3QVVA 1TCVA 3IERA 1Y8RB 1MB2A 5BUZA 3LCJA 3HRKA 3V4PB 3MYRA 5BSHA 2EAUA 3EQ9A 2C94A 3IBFA 4PFKA 1RWQA 1Y48E 1U8EA 2FW9A 2OCXA 1CP3A 4HUQA 4BECA 2FLVA 1ZRMA 3OESA 4RNDB 1O58A 2RG1A 1ZITA 3KTAA 1T29A 4ZC8A 1JBKA 4Y0VA 2EGHA 4Q7KA 5A62A 1CY0A 2BISA 4HAUA 4TTSA 2NU9B 4FE7A 3ZWKA 1Y7TA 5EVJA 3ORYA 1KYTA 1Y5IA 4WXMA 2X1MA 1Z83A 2R11A 5G40A 2K2WA 1A7AA 4KE7A 2XXBA 2BFCA 2QZJA 1ZCJA 3EC2A 1NE7A 3GFRA 4MUNA 4DM4A 3GCGA 1LI7A 3L8ZA 2QAIA 1JIIA 4CG3A 3EWNA 3H16A 2E2WA 2OORA 2IHUA 2BR4A 2GXQA 2JCVA 5AW5A 2QN3A 3ZHCA 1Q7EA 4Z7QB 3Q87B 3FF1A 3ZWOA 2HBZA 3AGQA 5KJFA 3I04M 3NXKA 2XYVA 2Z3VA 3DEKA 3CH6A 4M8IA 3N58A 1ORHA 1KSJA 4F12A 4KX3A 1H8EA 1F06A 4Z9FA 3EVGA 1S2LA 1WV1A 4B40A 1BWRA 3JZFA 1PZEA 4IEFB 4WZZA 5LQSA 5ERYA 2PKWA 1YDGA 1IUKA 4R01A 1YK1A 3C6MA 4TRJA 2WOOA 2Y99A 2IUTA 2ZIXA 2P3QA 1P3Y1 1ZVKA 1GG8A 3GEIA 3LDGA 2ZG6A 3PR3A 2CJYA 4UULA 5CR9A 4MTCA 1WCXA 5FV7A 1I3CA 3B2EA 4O2AB 4ALLA 4YJFA 1TF2A 1DBVO 2VUUA 3MN1A 2I1VB 5F73A 1DRUA 1PZFA 2F9LA 1TQ2A 5C5IA 1CJSA 1OXUA 1Z5PA 5FJJA 2Z3WA 4NPAA 1BQ3A 3KJGA 3BWEA 5EA2A 2QRVB 2ZT8A 4GI7A 4AWBA 5JI3E 4I14A 3UWPA 1DUIA 1LPMA 2ZPTX 4BQNA 1TQ6A 4MJXA 4UKDA 1QVAA 2FW1A 3PXAA 3F9CA 3BL5A 2YHAA 2GH1A 5A6SA 5GGYA 5CYOA 2HWWA 3F5MA 1UJ6A 2F7SA 3I4FA 1OIXA 2OMEA 3JU3A 3KJEA 3Q7QA 2Q8NA 2ORWA 4HFRA 4Q19A 2FB9A 2QT9A 4AKIA 1LF5A 1ZOPA 1VE9A 3LV8A 4EYKA 5LQMA 3AVOA 1RPJA 4JLPA 3RO7A 5BNTA 2AMJA 1BKSB 4S05A 1BXGA 2C9ZA 3R44A 4X94A 4GU5A 4CWAA 5IABA 1PSDA 4BAUA 3MFYA 1A76A 1HG1A 1LSOA 3S5UA 2GCPA 5JARA 1NVAA 3VR0A 2W2VA 2NAFA 2CLEB 1RM0A 2J6HA 3MMSA 5F1PA 3LW8A 2ZDGA 1CYDA 4QOIA 2D1QA 1LNZA 4DV0B 3ZD8A 1N7HA 5KVSA 4KGVA 5I9NA 1USIA 3G23A 3UG6A 3HJFA 1NUHA 3B2NA 4EF6A 1U65A 1QAMA 4OJYA 4WKCA 5F9MA 4I9NA 4H0FA 4LYFA 5ESRA 1BDHA 2WD7B 4WLUA 2QWXA 1U7PA 1IEVA 1MT0A 2H1OA 3B38A 2H2AA 3FYUA 3DAFA 4JOSA 2C3YA 4LHEA 1G98A 2VL7A 3GJ4A 4RZHA 1QHHB 4GPZA 1NVMB 2QSUA 1RXYA 3LYUA 3ORSA 3ZVMA 4CEJA 2C7VA 3DWIA 2BFEA 2ECPA 2WE8A 2Y8EA 3RIXA 1U6KA 4BUJA 2V5UA 1NKVA 1PVVA 1NI5A 2A30A 4WEQA 3IALA 2AHOA 1M8JA 1Y9JA 4MQ4A 4TS3A 2GKSA 2HLDD 2M1ZA 4B09A 4BFTA 4NHOA 2IDMA 1FB5A 3KKEA 3RREA 1MFZA 1E1QD 2XGGA 3OUUA 3VC1A 2WUEA 5IDQA 1P9WA 4HDSA 1SOMA 1W49A 1SXJC 3G0DA 3GVCA 4P2BA 1W2WB 3AM1A 3PJEA 2X86A 4YX9A 1XTIA 3G8DA 1KOJA 3ABZA 4KACA 4MRSA 2BEWA 4OAPA 2ZVDA 4EHKA 3ITDA 2VUHB 1X9GA 3NDRA 3OIUA 4I81A 4A8JC 2QTWB 1OAKA 1CC1S 1W6UA 1G59A 4YDHB 2FCAA 4BYGA 3RRJA 1WOMA 4MPPA 1BKDR 3CLHA 4C06A 1E3WB 1XPJA 1WY5A 2QJRA 2VT3A 4QOHA 2P3LA 3D7KA 2WICA 1GITA 1G8JA 2WHEA 2ZUDA 3WYEA 1SC3A 2G04A 2PRSA 4K7JA 2ZWMA 8GPBA 4M1WA 3HNRA 1WIWA 3RU2A 5FWXA 4OHWA 1IAQA 1DJMA 3PRYA 2JJ1A 2GAOA 1FOEB 1TUIA 1QZUA 2AOWA 2F90A 2Q2OA 1I4OA 4TUYF 4L6CA 2PCLA 3JQFC 3DZFA 4MWSA 5IZCA 3JD4A 4CJXA 5KYTA 2R8OA 4ZOLF 2G76A 4EFDA 1HZZC 1GNLA 2CDAA 2FPGB 3LRXA 3Q9SA 5DHFA 3RIYA 3SZRA 4B8YA 1QF6A 3PNSA 1LGYA 4N41A 3R40A 4KNWA 3KIPA 1NBMD 3BWBA 3N87A 4D5EA 1ZPDA 5E4FA 4J43A 4CRWB 2QROA 3AZQA 4G23A 5F5LA 3Q5EA 1BN6A 1IU9A 1L4UA 2I4LA 2C4TA 2HDHA 2O4CA 1FSSA 1SIBE 1ZU5A 2OXRA 4TTJA 4KQIA 5F4ZA 5FPPA 2VK8A 3KQUA 2P35A 3O90A 1E1MA 1PLLA 3AJRA 4NU5A 7REQA 5I3ZA 4BNUA 2VEOA 2CDNA 4MUIA 5LXTA 2JZCA 2TMGA 3PDHA 4Z51A 1Z6PA 2Y9PB 2PMEA 1NX9A 2EXXA 2W43A 3QX3A 1U4SA 4HWKA 3UJPA 5CM9C 5KS2A 4DV3B 1IN1A 2FY8A 1IQRA 2V6IA 1U0OC 1UBTS 4O3FA 5BNFA 1UF9A 3AF5A 3OFVA 1N6KA 2CYBA 1BX1A 4TVOA 1KPGA 1PZNA 2CK3A 2QRVA 2Q4TA 2JLZA 2RKOA 5K0BA 1AZLA 3NT2A 2BM0A 4NPCA 4AIIA 4LXTA 1AF4A 3H5TA 2V96A 5FX2A 2CYAA 4L4RA 1NSFA 4LE2A 4DZZA 2WKRA 3MTEA 1Q95A 2ZUVA 1SUWA 4M0LA 5DNWA 4H1VA 4CIXA 1ODJA 2XTJA 5DYIA 4BKMA 1JNYA 3E81A 3HBAA 4L78A 2AT1A 3WX0A 3ND5A 2VH1A 1Q1NA 5DOVA 2BE9A 5CA0B 3JD1A 2RHGB 4RKWA 1MR3F 4J1TA 3K8OE 2R79A 3S4YA 2OEPA 4RMHA 3T8YA 4MVJD 1KY2A 3G2HA 3M5DA 4MCHA 3TTWA 2I62A 3JWHA 4WNCA 1Q84A 3U3KA 3WY9A 4AKEA 1H8HD 3JQ7A 5YASA 3LLUA 3F98A 4IF4A 4MB2A 5B3JA 4GKJB 1MO5A 3F49S 1CQJA 4TYPA 4X1YB 1GTJ1 2HD4A 4WFKA 4C29A 5C81A 1RYNA 1SEVA 5F1KA 4Y9RA 3CURA 4OQFA 4N54A 5M29A 3A6PC 1RFGE 4ZQHA 5A03A 3LSTA 1EFTA 3C4QA 4KLNA 2WD7A 1SD5A 1VRWA 3H05A 4PQEA 4ITVA 4TWBA 1P33A 3W7BA 1Y80A 3MJDA 3LWDA 3QFFA 4A16A 4EBFA 2WJPA 1QBKC 4ZREA 3ND8A 3P2MA 4GX2A 3I9V6 1K6EA 4TT3D 1XNRB 3N75A 4U8GA 3B6EA 4DARA 4QA9A 5JJKA 1E79D 2QUZA 4KDRA 1GN9A 3K9WA 2CF5A 1FFXB 1J8FA 1S8AA 4L4ZA 3ZJTA 3C4JA 3OD5A 1EVZA 1OT3A 5K3OA 2VSNA 1ISFA 3L84A 1TVMA 1SG9A 1WW2A 2ONZA 3QKTA 4BQPA 1X7XB 4PHFA 1H23A 3U4IA 3GT4A 1KVTA 1JHYA 2QRZA 1V8OA 2C95A 3SDSA 2Q0XA 1VZ2A 1ZGCA 4TXMA 1GUBA 3DL0A 1OXKB 1ZGAA 1OLXB 1I9GA 1KKLA 3G9XA 2VXCA 4HEA1 2PBZA 5KYWB 1THTA 1BS9A 1DL5A 1F8YA 1IM8A 1GRVA 2C9MA 2RGAA 2YWXA 3IOYA 4BLUA 1IBKB 2CN1A 3DKVA 1MTOA 1CUVA 3E7XA 3OTWA 3M34A 1KFCB 1RKQA 1RAIA 2AYZA 3B20A 1E3WA 1X15A 3NJRA 4OGLA 3AHFA 4JBGA 2WAXA 4DA8A 2HMTA 2ZRLA 4IFTA 1HFEL 3ECAA 4E2XA 3HDQA 3L5OA 1IN7A 2WIFA 3HGTA 4OQMA 4U2DA 1JNXX 4ZAGA 4GC5A 2WW8A 3QSGA 2CDCA 3R6WA 1G63A 2GBPA 5EVCA 3Q9UA 5EXDA 1TT5A 2UZ1B 2H51A 2XR1A 4RWZA 621PA 5C9ZA 1WBBA 1VJCA 3VZDA 5IT0A 4G09A 4DR2B 4C7VA 2CMFA 4GGMX 1D1TA 1YRQA 1NDHA 4UREA 4OKIA 5TSDA 4CLRB 3G9TA 3VHXA 2OLJA 5HSGA 5KC9A 1NLYA 3A9RA 4R7GA 2P0EA 2NUTA 1FDVA 1S9HA 1XU4A 4TUYB 4R51A 1Z37A 1GRCA 4N8SA 1QGDA 3VAYA 1T36A 3MLEA 4HAZA 4EMBA 2F1KA 4Y1GA 4AY2A 2R7KA 3A6LA 3NHLA 3CKLA 4ZOLB 4BVAA 2IDJA 3NUQA 1W4AA 3M6AA 5ALPA 2HJ9A 3DC2A 2J0EA 4WZAB 4AROA 2D8MA 2R751 4ZT6A 1W6RA 1ESNA 5AIAA 2GPBA 5G0VA 1IG3A 5JASA 2B37A 3M2PA 3MJSA 1EGQA 4K03A 5AI8A 5ALXA 4EJ6A 3BGOS 2AD1A 1Z82A 2PDAA 2BI8A 1KJJA 3BL6A 3OKFA 1QZXA 4MR9A 1E64A 2MINB 5EN4A 1E6EA 4DB2A 1FZTA 2ZR0A 4MDFA 3HKCB 1Y3IA 1L4YA 1UMDB 1Z0UA 1UBNA 2Z9BA 2GYUA 3IBSA 3LC7O 2HWKA 4NYJQ 4XTCS 5K3SA 4YV0A 2J45A 3E0XA 1PTKA 2FUKA 4KYVA 3QXHA 4CL0A 4KO8A 2CMDA 1ZONA 4ZKEA 4QJ5A 1U2DA 1XZ8A 2PK3A 4P3KA 5G53C 4I4LA 3TQQA 1QE3A 4YCSA 1Y4ZA 4DA9A 1FMTA 3O83A 4N5LA 5BQ5A 3S1LA 4Q01A 3UT5B 1R10A 1SWWA 4IDOA 4NABA 3D2CA 3HXQA 2WSBA 4QBGB 3CVXA 5CUQA 2WTUA 3WK5A 4S24A 2GN2A 2FPRA 3B6ZA 4D9NA 3D0RA 4EJ0A 4MUGA 4ZGWA 3A4LA 2PKXA 2QM0A 2ATXA 3ANYB 1JZQA 3TSCA 4Y9UA 1T10A 1G21B 3NS7A 4OUDA 5CA0A 1WF6A 3SR0A 1DMRA 1L7RA 2PGJA 3DMTC 5FOQA 2FETA 2HR1A 3RQSA 2QX6A 3CBQA 3QVTA 2WKPA 2SBTA 1C8LA 4KXXA 3HPQA 5D3QA 1T9ZA 1B43A 2IYYA 4W7HA 1Z8HA 2D1RA 4KMRA 1A3CA 2A0UA 2Y1CA 3DLBA 5HKKA 1RLMA 2VT7A 1NBME 2OC4A 2YW9A 3CWZA 3O74A 4UZFA 1VB5A 1DPFA 1K5PA 3AIKA 4R41A 3ZQJA 5CCXA 3VPBA 2AZDA 3GRKA 2BFDA 4R0NA 3E9CA 5AOCA 4GNKA 3HUDA 4URZR 3V8VA 1QV6A 3SVTA 4HGPA 1JILA 3L7MA 1I14A 4GKVA 5D6OA 1RAFA 5BV0A 1SBQA 2H0QA 1J8DA 1FDOA 2IFTA 1JHUA 1J2EA 1G5PA 2Q4EA 3EVZA 3K0FB 2ZBRA 3DE0X 5JMTA 4CF5A 1U9CA 3SK0A 3KVVA 3ABIA 3D6AA 2X1VA 5FYDA 1BWQA 4OREX 4G0YA 5DCUA 4XUGB 3VR1A 1MU0A 1SPBS 1T5TA 2EQ5A 3A6JA 3DEHA 3KXKA 2VN8A 4OH1A 1FRQA 4MLPA 4RD1A 2W70A 3RABA 2DVMA 1PFQA 2CBGA 2YJGA 1O6ZA 1PFKA 4PIPA 4UNPA 5CHEA 4ASUD 5AM4A 4C3OB 2GAFA 1HRKA 2WYHA 4O4LA 3RF6A 2C2BA 2CV2A 3PUZA 3ER9A 1BJKA 3HXMA 5JRJA 4NE9A 4MI3A 5KYWA 4WJLA 5JSZB 2Y71A 2AYXA 4ZVQA 3K1AB 2GPTA 4X3OA 2BHLA 4F72A 1JG4A 3QLEA 3NTQA 4BFSA 1JHQA 4JI0B 3O8OB 3A26A 1U3VA 4MVJE 4NX2A 4Z86A 4QG3A 3TQHA 5I4KA 1HE5A 1YFZA 1CG6A 1RCFA 5ICFA 3WA6A 1U2EA 2WUFA 1P2SA 2YWJA 3DBHB 3QWHA 3COJA 2HDWA 2RJ3A 4II3A 2Q5FA 2YC4C 1N3BA 2BI4A 4Q47A 4E6EA 2HA5A 8LDHA 5GPBA 1GFIA 3ZHBA 5BRJA 5T4FA 1NVTA 1WSAA 2J33A 4PRLA 4YJ2F 1U11A 3G0OA 3GDOA 5HGXA 3BMQA 4WWHA 1CR2A 2XWJI 4AF8A 1W9HA 2WF8A 3PJFA 4N5HX 2Q07A 1RLJA 5JFGA 4JJFA 2J31A 1BWSA 4UAJA 1ISRA 2X0IA 3TL6A 4RQTA 2P7IA 3DOFA 4ER5A 4MJLA 5CFQA 3ODPA 3Q8MA 5DGDA 3CRW1 2X3UA 5HOQA 3V7NA 4V0LA 3BVPA 4MW9A 1GGNA 3RC7A 4BMDA 1L1QA 2G5CA 5A5DA 1M2JA 2YCLA 2BH2A 4KB5A 4UM8B 2ODWA 1T1GA 5BUQA 4KJXA 3S28A 1K4MA 3RUHA 5F4BA 2MINA 1JTEA 2WV7A 4NYIQ 1RXSA 5LC1A 4CTMA 3OZGA 2GBCA 4ZJUA 5AR1A 4AP6A 1FL9A 1KJIA 2E4AA 3GLQA 2JI8A 1K3TA 1MKYA 1WUJS 2XYHA 3M1AA 1JIQA 3R7FA 5IC4A 3ON5A 4ROTA 4XVHA 2HGZA 4Q9AA 2BTQB 3Q7TA 5KJ6A 3KP1A 3OZDA 1SC4A 3SQMA 2G4LA 1RQRA 3DJYA 5AK6A 1G3IA 4MV4A 1F3LA 1FNBA 1DX4A 3CH5A 4Y6RA 5IH7A 1MEJA 4GLFA 4NEGA 2ZI5A 4P3YA 1T13A 3AY3A 4C0HA 2LRHA 5IWCA 3GJ5A 4Q12A 3WMEA 1L1FA 2QMEA 2YOHA 4BNTA 4EY4A 3J81A 4B48A 2JGNA 3PZRA 4PM4A 5BO5A 2JJQA 2IF2A 2VZ8A 3L40A 5EE9A 3NC4A 1LTQA 5CT5A 1W4CA 3BFXA 3MB5A 4L5CA 3RBXA 3U7HB 1DVRA 2O14A 4HHEA 4QFMA 3EXHB 1RBMA 4UHBA 2XRZA 2EEPA 4ARZA 4OU5A 5EWLB 2FWIA 4K9OA 5KDLA 5KUTA 5GIOE 4FR5A 3E35A 4M7WA 2BGWA 3TZLA 1MB9A 3TIIA 1G42A 1SCJA 2Y1OA 3I6YA 2A58A 2J3DA 4OBBA 4Q3NA 5EUMA 1EXVA 3V1LA 1CUDA 1KYVA 2EFDB 1A7UA 3FTPA 4BLPA 4FHEA 3WFIA 4FLMA 3KUDA 5GJCA 3OX1A 4IOMA 5KREA 4QUEA 4NCNA 2WAMA 1Y3FE 6GPBA 1F7UA 3E7DA 1GDHA 1V4BA 1QGAA 1ZW6A 1XEFA 3M6XA 4CQJA 4WHMA 4EDFA 2WG1A 1VE7A 5I7OA 2HU5A 2HH9A 1XCMA 4HRYA 1II0A 3AIIA 3RTEA 1AQNA