5FPHA

The gtpase domains of the immunity-related irga6 dimerize in a parallel head-to-head fashion
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
399
structure length
395
Chain Sequence
DLPSSFTGYFKKFNTGEEIISQEILNLIELRMRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGVVEVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPNTYLEKMKFYEYDFFIIISATRFKKNDIDIAKAISMMKEEFYFVRTKVDSDITNEADGKPQTEKVLQDIRLNCVNTFRENGIAEPPIFLLSNKNVCHYDFPVLMDELISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQRIWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLARDWEIEVDQVEAMIKSPAVFKPTDETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVTEDAKTLLKEICLRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERFERON-INDUCIBLE GTPASE 1
publication title The Immunity-Related Gtpase Irga6 Dimerizes in a Parallel Head-to-Head Fashion.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 107
structure length 395
sequence length 399
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.6.5.-:
pdb deposition date 2015-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05049 IIGP Interferon-inducible GTPase (IIGP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fphA02
5E7IA 3TMKA 1SKYE 2ZSBA 4X8OA 1EFUA 4TLBA 3LW7A 3LO5A 1AZSC 5L3SB 4XVUA 4JLAA 4PO1A 4JLJA 3VMFA 4DCSA 2FF7A 4DDWA 1TAGA 4US2R 2X77A 4M21A 5M04A 2J41A 1G6HA 4M9SA 2RGBA 3KKQA 2GXQA 4M8NE 3R8CA 4IXNA 4C7OB 2OE2A 2ZRGA 3IHLA 1COWA 3MCAA 1OYYA 4QHSA 5GJVC 3DZDA 3GFTA 1NBMD 1E0JA 2ZI3A 3TH5A 1DARA 4LDJA 2GCOB 3QVUA 5KYKA 1W4BA 3AH8A 1JNYA 2X1VA 2IK8A 3NBFA 4B44A 5H8WA 3VHLB 1MO4A 2QY9A 1OJLA 4RZUA 5AJXA 1LW7A 2DWPA 5GJBA 3NBXX 1FTSA 3GLHB 1YZQA 4QXAA 4GT1A 5B64A 3BH7A 2JEOA 4FXPA 4TN1A 1ZCAA 1QHIA 4DLXA 2D2EA 2B8TA 3E5HA 4BEBA 5TV2A 4PHFA 3LD9A 2VF8A 3A4MA 4E22A 3ND9A 1OLOA 1IN8A 5GVRA 1P2TA 4Z51A 3RC8A 4G5QA 1EWQA 3AVVA 4A82A 1N5IA 4D2IA 2VLIA 5SZKB 3SYNA 5BN4A 1J70A 1QG2A 4IDPA 3FVQA 2ZS8A 1AS3A 1G64A 1LS1A 5D3MA 2QORA 4M0LA 3QXCA 4BFSA 2GA8A 2K5UA 1XPOA 3EPKA 5H68A 1DEKA 1CS4C 3TNFA 3C15C 3U2QA 3REFA 3C7KA 2VPPA 1G7SA 1FP7A 3LA6A 2P6NA 3EPLA 2A3RA 4HAYA 4IVRA 4IDHA 2F55A 4Q01A 1VHLA 1NN5A 2KI5A 1YU9A 2A5JA 4PC1A 4RD6A 1SHZA 1KKMA 1Z07A 3VR2A 2MSDB 5L3RA 3FWYA 4LBVA 1G4UR 2GKSA 4ILEA 4JBXA 3RSLA 4D4JA 2R2AA 1TTTA 2NGRA 2WPDD 5DGXA 1UM8A 1CXZA 2OBMA 2ZRPA 3RS3A 1N6OA 4YMVA 2IYRA 3BH6A 4ZDJA 1NJGA 4HB4A 1N5KA 4RKFA 4URZR 1W36D 1KZ7B 1NI3A 1HT2E 2WJGA 4C3ZA 2J45A 3M1IA 2FFBA 3ETLA 4KFRA 2BEJA 5G3YA 3SJCA 2H92A 2O8DB 4CDGA 1W48A 1JJ7A 1U98A 1J2JA 1R6BX 3NG1A 3RLFA 1MABB 2P3SA 4G0NA 4M1KA 5GJCA 2NPFA 4MUAA 3U6KA 2O8BA 2QTVB 3NBYC 1TEVA 1II0A 3U61B 3AQ4A 1DPFA 2OILA 3CNOA 4JL8A 3AVXA 2GEDA 2GNOA 4M53A 4QOSA 2DWQA 4A8JC 3NTUA 4S2EA 5FTJA 5JEEA 1KK1A 2ZI6A 2W00A 3FDIA 2G83A 1EGAA 3U4QB 3QKRB 5L3QB 1E9FA 1E1RD 4TL7A 4NL4H 4TLCA 3FKSD 4DLWA 4TT3A 3QXJA 5J4YA 1EK0A 2IS1A 2YKGA 1TU4A 4MRVA 2ONJA 1QZXA 3T1OA 4DSNA 1DAIA 3QI2A 1NRJB 1AKEA 1FNNA 1SXJE 2W0MA 3QOFA 5EZ6B 4B35A 3T35A 1M8PA 4LY6A 4FMCF 2GDJA 1XX6A 3L82B 4GL2A 1IN5A 5K8UA 1E96A 3H4MA 4NYIR 2F9LA 4I1SA 3U3OA 4O25A 5J4HA 4L9WA 2Z6VA 4Q00A 3TUIC 5HE9A 2VO1A 2ZS9A 3NIBA 1XB2A 4JSTA 4KHZA 4ON9A 1TF7A 2O8EA 1DAGA 1WA5A 2D4HA 3DL0A 3O8CA 3BGWA 5DI3B 4PHGA 4Q19A 1G20E 3I92A 3U3RA 4HEJA 4MGKR 1XTJA 3GJ0A 2CCKA 1OB2A 3LRPA 2QUZA 4NMMA 2EFEB 6Q21A 2J0SA 2ZYUX 1B23P 5KNCA 5J40A 3VFDA 4P4SA 1VYVA 1US8B 5KUTA 4ITRC 2C99A 2BC9A 4MRSA 4OQMA 4WIAA 5JJKA 2CLCX 4HUQB 4LJ5A 1TL7C 1H8EA 1CR2A 1O87A 3B78A 4AYWA 3FOZA 1V43A 5JHGB 2Q9CA 3L0OA 3EIEA 3QY0A 4HB3A 3JZAA 1G8HA 1Q1EA 1ZM3A 3H86A 4HDOB 5HR5A 1G8YA 3F8TA 1Q57A 1H8HD 3QXSA 5JFGA 1M2OB 5CM9C 1KNQA 3LQQA 3QPVA 5AWFC 1R7RA 4RD0A 4QJ5A 1HE1C 4C9BA 2DBYA 5G41A 4FCTA 1CJUC 5LD2C 3ZD6A 3TKLA 2P65A 4A8JB 2OFOA 3K09C 1SVSA 4LBYA 4CEHA 1GL6A 3WMGA 2Z0MA 3E1SA 2EFHB 4EPYA 4BGDA 4B6FA 2PBRA 3FHOA 1BOFA 1TQDA 3RSOA 1IAQA 3JZMA 2C2HA 4DZZA 3B6EA 2A5GA 2YINC 3FHTA 1SVOA 1GKUB 4WBSA 2J59A 3ZLJA 2PH1A 2F3RA 1JR3D 5TY0A 2IEYA 4FINA 2J1LA 3MJRA 4GBMA 1B0UA 4JS0A 2IS6A 3QQ5A 4IVPA 1E98A 1TUEA 3LY5A 2GRJA 2V7QA 1E32A 1DO0A 4LJ4A 5JRZA 4LK2A 3NVAA 1KSFX 1P6XA 1FL9A 5HKKD 4JVNA 4Z1MD 4RD4A 3QF4B 4TMVA 1E9SA 3N2EA 1E9RA 2A78A 1IXZA 4I1VA 2ZRBA 3GLIB 1GDDA 3B1XA 1G3RA 2JJ8A 1R5OA 4IOJA 3LVQE 1XTIA 1AA9A 1G1MA 4YONB 4F7WA 4CF7A 1WMSA 3MWJA 1VYUA 5BW8A 1GWNA 4ZIRB 1Q1QA 5FUYA 5G3ZA 4BLQA 2EWWA 1Q3HA 1P7CA 3RYTC 5DN6A 2NIPA 4JVLA 4AIIA 2RB4A 1E79A 1G7RA 1XEXB 1FOEB 4MYTA 4D26A 1KI6A 2HLDD 2IX3A 1YJ5A 2QQ0A 3X1ZA 3SU8A 3WYAA 2JIZD 1Z2AA 4YC7A 1KJWA 3MJHA 2GZDA 3WNCA 2ZEJA 4OHZA 3K70C 2QL6A 2P5TB 3EX7C 5LD2B 3FTQA 4EJSC 1IONA 2YOFA 4XVRA 1SVWA 2ODEA 3Q72A 4IFBA 1J8YF 4ZDKA 5BYKA 4B73A 2R62A 1LY1A 1WE2A 2IL1A 2ZQ5A 2C5LA 2V3CC 2W6JA 4M1SA 3PCRB 1P2SA 3K53A 2ZSFA 2OESA 3CWQA 1OH6A 4HZIA 1XD9A 1KI3A 3TR5A 2CDNA 2VEDA 4Q4JB 3A58B 2GESA 1JAHA 4L4UA 2OUKA 5ELXA 1BYIA 1JPNA 2J7PD 1E2HA 4XTRA 1Z0AA 5IF9A 3AEZA 2UZ3A 5AUQA 3WNDA 2VHCA 4CGZA 2W0SA 1G17A 1GL9B 3H2YA 3GFPA 4XJXA 4ESVA 1BMFA 2IUUA 5HPYB 4AC9A 1E9DA 3ZS9A 1Z0IA 2AL7A 4UJ3A 3B82A 2YVUA 3QNUA 5J47A 4NCNA 1NG9A 4RD3A 4LC0A 1G9XA 3U3MA 2O8FB 3HPQA 1G5RA 1KO1A 1EG7A 1XMJA 3U60B 1AQYA 1CP2A 1KY3A 4IVQA 4PQFA 2YHSA 4MRNA 3AB3A 1YZKA 2BBTA 3CF2A 4ARZB 2GJAA 3T61A 1YQTA 1E1QA 1SKQA 2XITA 5TVKA 2AXNA 3A1TA 3QG1A 1EESA 1OSNA 4RY2A 3WYFA 2CBZA 4P4TA 4PO9A 3K0FB 5JWRA 4J0QA 1S1MA 3THXA 1JEEA 5CYPA 1BH2A 2AWNA 3EIQA 1XTRA 2OCBA 1HTWA 2WWHA 3T1VA 3K70B 4B71A 4V0KA 2ZIAA 3AUXA 1OXUA 4EJSB 2XNDD 4A15A 3AF0A 4DWJA 4OK6A 1UEIA 1KK3A 5SZJA 4LJ6A 1NSTA 4KFSA 3T1TA 1TF2A 2XZOA 3AVWA 4CRWB 1GIAA 3VR6A 2OEPA 5FFMA 3ZYCA 2AFHE 4FD2A 3SZRA 3VR1A 4ASUA 4A6XA 3O47A 3LAWA 3EA0A 1FW6A 1SVLA 2O0JA 2YC2C 1KAGA 1OXTA 3ADCA 4DJTA 2HXYA 4JLOA 4TL8A 1C9KA 3VKWA 2PMDA 4NBSA 1G3MA 2XTNA 4O2LA 3OIVA 4WZ6A 4NCHA 2ZRCA 4HAZA 1OKKD 5IT5A 3QKSA 5TARA 1NKSA 1A7JA 4R2HA 2HJVA 4GP6A 3SN6A 5C18A 4EUNA 4AKIA 3ZIAD 2MMGA 3GJ8A 1G291 2ZU6A 1XNJA 2VF7A 1RRFA 1MO6A 2NOAA 1N2CE 2ATXA 3PUZA 1KAOA 3EPHA 1EX6A 2CK3A 5FL7A 1D9ZA 3A1SA 1J7KA 4ZDIA 2XXAB 1TNDA 4A36A 3BK7A 1KK0A 1U0HC 1VCIA 5FUWA 1DBSA 4N0DA 4DXAA 3W90A 2QBYB 2YNMA 5KU1A 4OL0A 3TW8B 3K9HA 621PA 5EE3A 4ESHA 5JCPA 1C1YA 2QPAA 2QTFA 1TX4B 2VSFA 3KUDA 1KMHB 4LJYA 3WXMA 4BZPA 3U7HB 4B6EA 3LX5A 4FI3C 2Q3MA 4E07A 3EWSA 3OEHD 4M9ZA 4Q4HA 3IDQA 2WWXA 4PC6A 1R2QA 4YXWA 5FPHA 1F2UB 3AF1A 4KLZA 2IW3A 3A36A 1NNEA 1E0AA 4IDOA 5KSZA 3ONWA 1ZD9A 4HAVA 4F4JA 3OAAD 1C4OA 3MD0A 3B13B 4TSFA 1Q22A 2CL0X 3BFKA 1NN1A 1YRBA 2RH5A 2NZJA 1WF3A 2IYQA 1OV4A 1AS0A 2VSOA 1JBKA 3WMFA 4OHYA 2ZRDA 4OQFA 2XGJA 1E2JA 2GK7A 3WP1B 1T3LA 4BASA 4FCVA 2ANCA 3TRFA 4IDNA 2OXRA 4A0GA 4HDCA 1OXXK 4G5RA 1U90A 1VTKA 1LFDB 1XTQA 2F6RA 2BVNA 1AJEA 4HLUC 4NDZA 4Q9HA 3LDAA 2KBEA 3B85A 4GSYA 4Q02A 2BBOA 4MYHA 2R6CA 4FWTA 1XTSA 2RGNA 3BXZA 4DT1A 5JBQA 2ORVA 1K5GA 3CNLA 1NVUQ 5FPYA 1EWRA 5F2EA 2QE7A 2WAYA 4N0EA 421PA 1MRNA 2F1JA 2VP9A 2P6RA 1T9HA 1CULC 1LB1B 1QVAA 3X1DA 1VDZA 4PZZA 2GXAA 3B5JA 3KKNA 2BBSA 1DAEA 3V9PA 1QHHB 1P61B 1Z06A 1AGRA 2ZAOA 5FBWB 1U9IA 1R5BA 4H9GA 4F4IA 4AWXA 3B1YA 4XSHA 1TQ4A 2WKQA 3R8FA 2ZUBA 5KNBA 3WBJA 4MKGA 3DMNA 5DH9A 1ZCBA 3ZD7A 1WDTA 3ASZA 2FZ4A 2HT1A 1RW4A 3VR3A 1F2TA 1YR9A 3PVSA 3NKVA 3AKDA 2AN9A 3P4XA 1TADA 3HWSA 4QJ4A 3TJZA 4XSGA 3EG5A 121PA 4QBFA 2E9SA 4A2PA 5B30A 3Q5DA 3TQCA 4AD8A 1S3GA 2BM0A 1GNQA 1XWIA 4G3XA 2JLXA 2ZJ8A 3HU3A 1KJYA 1Z0KA 2OT3B 3QKUA 1P75A 4BFVA 4IKEA 2GF9A 1NVXQ 2RHDA 1T91A 1XXHB 4JBYA 2J9RA 1R8SA 2OCYC 2ZI5A 3M0EA 2FPLA 2J87A 2RCNA 2OLKA 1VG0B 5JJIA 4IFEA 4NU0A 2WBLC 4WAUA 1GNPA 3NEJA 4F93B 5K8IA 4M2LA 1GZSA 1SXJA 2OCPA 3TGPA 3EXAA 4UJ5A 2ZSEA 2ODBA 3RRMA 3BD9A 3ZVLA 5HCIA 2IXFA 4B2PA 2BMDA 4LJ8A 1DTSA 1R10A 3FGNA 3SFVA 4LJAA 1G3QA 2D7DA 2WOJA 4JBWA 5IDVA 1R0XA 2LCFA 3B1WA 4JIMA 4EPRA 4GOKA 2IYLD 2FNAA 4B3BA 2FGKA 1E2NA 1WCV1 3E2IA 4K81B 3KKOA 3DZ8A 3MMPA 4Y0AA 1XMVA 3CR8A 4DB4A 5KTYA 1BKDR 5GVSA 1QHSA 1K5DA 2GTPA 3GJXC 2XSZA 2P0EA 4JKYA 3I1FA 2IYSA 1II8B 1N3BA 1P73A 1QVRA 4JJKA 1AK2A 5A4JA 1GUAA 1AKYA 2B7BA 5FI0B 3BORA 4CIDA 3D8BA 2WWYA 1XEFA 3ZDQA 2NO7A 2XZLA 2ZSDA 3QIAA 3MWYW 4H1UA 2GJKA 1YZUA 2NMVA 1DG1G 4KO8A 4AI6A 5FOWA 4MRPA 4B3XA 3GLGA 3BAFA 1OFHA 4JLDA 4V02A 1T3SA 4PSKA 4URUR 2X8AA 1CRPA 2J0UB 3VTKA 4DEYA 1MT0A 1W0JA 4Q66C 3PENA 4YDHB 5FPTA 3U7EB 1W2HA 4FMBB 1NJFA 4HZUA 2Q3FA 4BZQA 3KTAB 3UATA 3CRW1 5H70A 5EUMA 2ZE5A 4A0RA 1QF9A 4V0OA 2CHGA 4DDUA 1MV5A 1ZP6A 2RHMA 4XIGS 3VX3A 5KHOC 1SVMA 4QNRA 1KY2A 1W44A 4IEIA 1UPTA 2IS4A 3W3ZB 5F9FA 5L3SA 1YZGA 4WZAE 2CE2X 1E4VA 4O0MA 2FFAA 3BIFA 1GRQA 4QGGA 3QKTA 4NHOA 4BFYA 2BIFA 2G9NA 1T8UA 2AHOA 4BLRA 2NO1A 3CRQA 4CZ2A 1G8PA 1N6LA 3ZJYA 1A4RA 1TQ6A 4C7OA 4TMTA 3I3SR 2PLRA 1VIAA 4KBGA 2EYUA 4Q5IA 4F92B 1N5LA 2FX3A 4CT4B 4KYIB 2F1RA 2Y8EA 4MGIR 2CCGA 2GCOA 4P32A 5EP3A 2CL7X 4X8LA 4C0SA 1ZU5A 2VRWA 3CIOA 2XOKD 1E2KA 4A6PA 1S0UA 1OFTA 2R6GA 3BS4A 4KBFA 1G8FA 2REOA 1OB5A 1MO5A 4Q4LA 2BM1A 5DISB 3KZ1E 3IQXA 3UMSA 3W5JA 2WSSA 2ZRKA 4JLPA 1P2UA 1A2BA 3QF7A 4PAOA 3EARA 1IN4A 2A2ZA 4URWR 5CB6A 2OBLA 4JJZA 4TL6A 3CKLA 4RSGA 4RVCA 4GZMA 2XZPA 3N2IA 4LUCA 3CF6R 4R71A 4C0HA 2VP0A 5KOYA 3S1AB 4BFUA 2G1JA 5E95A 1ZNYA 1EFRA 1DG3A 3DHWC 4PHHA 1VCOA 1ZUNB 2HDNB 2ZE8A 1XU4A 3K0SA 4DEXA 3MRSA 3CB4A 5KSOA 4P3YA 3V4RA 1P9WA 2P6UA 3EAQA 2QTHA 4PSVA 2OAP1 2VQSA 3TAHA 5IK2D 4V03A 5D3MB 4S35A 2WKPA 2FOLA 1H8HA 1DAHA 3EA5A 4KSCA 4A9AA 1G8GA 1KI8A 2BV3A 3I73A 3W9YA 2JLUA 1JJVA 4NP6A 2WWIA 1VECA 1X86B 1Z6YA 2A5FA 1W0KD 3B1VA 5C1BA 1ZM4A 4MQBA 1WB9A 1ZVQA 3B9PA 2J7KA 4LPKA 2QMUA 3VR5A 1ZYUA 1OH5A 4RCYA 5FUXA 2O8DA 2JDID 3P4YA 4B76A 1KNXA 3UMFA 1H65A 3K9NA 3PV0A 4II7A 4RFSA 4XWKA 1Z0FA 2R9VA 3SYKA 5JECA 5JI3E 1W2GA 2QRNA 3ND8A 4JLMA 1MABA 2ZE6A 1N6PA 4KITB 1KK2A 4UNQA 2OLJA 2F1IA 3TSOA 1W5TA 4B47A 2REXB 4UKDA 2FV8A 2B92A 4PZLA 2BDTA 3QXHA 3ZQJA 2XB2A 4Q7LA 5JZVA 2VHJA 4LZZA 1NBME 4BLSA 2O8CB 4EPWA 1OHHA 4B74A 3I5XA 3QKRA 3U4QA 1OIVA 2IF2A 4PTLA 2O8BB 1KIMA 1XMIA 2FA9A 5EQTA 4RJLA 1X3SA 2GK6A 5KSYA 1L7VC 2DFKB 1CR0A 2ZJ2A 2BMEA 1WXQA 1XJ0A 4NYJQ 1CR1A 2FSIA 2QT0A 1VKJA 1XEWX 1AQUA 3PITA 4PX9A 1GL7A 5JEDA 1VG1A 1ZNXA 2W6IA 2ZTSA 2ZVQX 1COWD 5E7JA 4LBZA 4M9QA 3SI7A 2QGNA 1HT1E 2GEVA 5CK5A 1F48A 4YMSA 3SEAA 1E2QA 4BRUA 1FUKA 4EPVA 2YWFA 1QHGA 2ZRFA 5FTLA 2PJZA 3FMPB 1G4AE 4LI0A 3B2EA 5KNDA 1FX0A 2FU5C 2OV2A 4C0AC 4JLVA 3THWB 1Y63A 2B6HA 2HLDA 3PQCA 3VU9B 2CCJA 1FQKA 4PPQA 1PLJA 4I4LA 3FHCB 2XNSA 3RS7A 2O52A 3HP1A 2QMEA 4KFTA 4PANA 2MSCB 2D62A 3MUFA 2MMCA 1NVVQ 2IBMA 4C0BA 2HEIA 3AVTA 4IRUB 2WWWA 4RCZA 3K0AB 2OHFA 4HUQA 2X2EA 4BUJA 4TTQA 4A0FA 3U5ZB 2VP4A 3QSYA 2RMKA 3CO5A 3R7WB 1CF4A 3RC3A 1YKSA 1E69A 1OXVA 3HPRA 4Y0VA 3GLGE 1G41A 2J0QA 5G53C 3SC3A 5KSPA 3CUEF 2HXSA 2AX4A 2V1UA 1OFIA 3KXLA 4KCGA 3K9GA 1P9RA 1G21E 5FOSA 4QGFA 4XH9B 1E2PA 3VNVA 1N25A 1U8AA 1YZTA 3CR7A 3OIYA 4TMKA 5FOTA 2QG6A 3HYRA 4LYHA 3PR1A 2FGJA 3DEFA 4A8JA 1IJEA 1S4QA 1AGPA 3DMDA 4W5HA 4EFNA 1KSGA 3Q8XB 3IO5A 4YLGA 1UBGA 4NKRA 3BJIC 4OJQA 2BKUA 4UNPA 5B58C 1YVDA 3FFBA 1R0YA 3M4YA 1EX7A 1NN3A 1HY3A 4U02A 2ZANA 3EZ7A 3V4FA 4I1OA 4FWIB 3AV0B 1XPRA 4OQLA 1Z22A 2GETA 1FZQA 2GXUA 5HZKA 2JJ1D 4LYFA 4XVQA 3I8XA 4DHEA 2PT7A 2VBCA 2RGAA 3CH4B 4GMXA 1ODFA 2V6JA 5G40A 521PA 3CRMA 3KDSE 4PQYA 4EFLA 1P3JA 1CJKC 4QHTA 1LF5A 3QF4A 4AURA 4PPGA 3QEOA 2WJVA 3JVVA 4GOXA 3GLIA 4C0KA 4QRHA 4QNMA 3MFYA 3PUYA 2CLDX 4CEJA 2O5VA 3MSXA 2JA1A 1RKBA 1RZ3A 3KB2A 4P4UA 2Z83A 2ECKA 2ERXA 4ZDWA 2ZRMA 5EE1A 1NSFA 3CZPA 4LHVA 4QFMA 3CNNA 3DM5A 4DLYA 4ZIRA 2CE7A 4U7DA 4CEIB 2WIBA 3AKCA 4W9MC 2RGXA 4DRZA 1ZNZA 4L15A 4WXRA 1RRGA 3IBGA 4HI0E 1N6IA 2I3BA 1XEXA 2OO7A 5J5CA 2A5YB 2QM7A 4B3DA 4C30A 1IJFA 1G3UA 5P21A 1ESNA 4MYCA 4JLNA 1VMAA 2RGDA 1Z6XA 2HCJB 4TZ0A 2AK2A 3TBKA 1ZIPA 2GJ8A 2XEXA 3I4LA 4QGAA 1UBFA 5H1YA 1CJMA 5FTKA 3ZQ6A 4PPNA 5DYGA 3K09A 5KDLA 5JS7A 5EE0A 3U44A 1OKKA 4CW7A 1O3YA 2VP6A 4UNSA 3PEWA 4HAUA 3CM0A 4MKIA 2FMXA 5JMTA 2ZRHA 2I1QA 3C16C 4NH0A 1E2DA 4Q4JA 1H8ED 2RKOA 2BCJQ 2OFXA 3MWKA 4V0MA 3ICQB 1AM4D 3Q3JB 4TMZA 4A2QA 4AKEA 5EE5B 3WHKA 4PXAA 4Q4AA 4EPXA 3LBIA 1NG1A 2IUTA 4IOMA 4RZXA 3EPJA 3VKHA 2F43A 2OM2A 2D7CA 1TF5A 4M1OA 2WV9A 2GZAA 4F38A 1WP9A 2A7QA 4DDTA 3THOA 4C0LA 4D0LB 4NYMQ 4B2LA 2FN4A 1PLLA 2E87A 2W2VA 1PZNA 1CR4A 2BHRA 1ZJ6A 4TLEA 2O8FA 1UKVY 1XJQA 3IEVA 2EYQA 4DCNA 2GZHA 3OEHA 2RGCA 2EFCB 1J90A 1PJRA 4PC7A 1N0UA 2QN6A 1ETUA 1IBRA 1R0ZA 2FSGA 1OH8A 1S3SA 2IXEA 2YZ2A 1K6MA 3RVBA 3T12A 3CW2A 2OG2A 2WICA 2GF0A 3R9IA 3WBKA 1GKYA 1G19A 2FWRA 4M1WA 1RE0A 3OZXA 2FFHA 1A82A 4YDSA 4TMWA 5DIFA 2CHVA 3W5IA 4AKHA 1I2MA 1N6KA 2VHQA 4BFZA 1QG4A 4CT5A 2IA5A 2PJRA 3OAAA 4GPTA 3QG5A 1NMXA 2V7QD 2Z4RA 2ZREA 3B60A 4DIEA 3IILA 5F9HA 1KDTA 3SFZA 1XF9A 3KB1A 5AUNB 4EJSA 4DB2A 1MH1A 1XPUA 3CX8A 2ZJBA 4IJMA 1KDPA 2YWEA 3O8DA 1RFLA 4XOIA 5GADl 2ATVA 2BOVA 2JJ2A 3BB4A 3K0CA 3K9LA 3THXB 2QA5A 1KSJA 2HCBA 1BIFA 1ZINA 2GAAA 4JLBA 4C4PA 2VHTA 1XCMA 5AK0A 1W49A 4TLDA 3U3KA 2WTUA 1TU3A 4IDQA 2Q21A 5TXGA 1Z83A 1A1VA 2OXCA 3L8ZA 4Q18A 2WVJA 3EASA 3HU2A 4PR0A 2F3TA 3DO6A 1U2RA 4LHZA 1T4GA 3BRWD 2PX0A 5DN6D 1FPMA 1MOZA 2PCJA 5FL3A 4F91B 4BLTA 3OFND 3L0SA 2N1BA 4TTPA 3KQNA 4TMXA 1F3OA 1PVOA 1SULA 4Q1CA 4JYCA 3UWOA 2C9CA 2UZIR 2AR7A 3QXXA 3IQWA 4WXPA 4B48A 1GTVA 2XAUA 3KFXA 4Z54A 1IY2A 4MA4A 2W58A 3IGFA 3SHWA 1L4UA 3EZ2A 3GLFB 3TIFA 5E7MA 1ZM9A 3EZ6A 1S9DA 2W6JD 2AD5A 1R0WA 3H84A 4MH0R 3MWLA 3OIUA 5BQ5A 1E2EA 5UKDA 4B32A 4CVNA 2XXAA 3FFAA 3QENA 2Q3HA 5EXXA 3HYTA 2O0HA 1MO3A 3C8UA 3T1QA 1M6NA 4QBHA 2QBYA 1JXMA 3A4NA 3KQLA 4TWZA 4D4KA 1MKYA 3LLMA 4PZYA 1G5TA 3VR4A 1JPJA 1KO4A 1KMHA 2ZVPX 4QC2A 1N0WA 1JR6A 5AJWA 2FPKA 2ZUDA 2G6BA 3W6OA 4ACAA 1VCNA 4DSTA 1NMZA 1BYUA 3J81k 3AVYA 2CLSA 3DKVA 3R9WA 1NVVR 4Q1EA 4JLKA 5FR2A 4AG6A 2ZRLA 2C04A 2H57A 4MITA 4D4MA 3GLIE 3OE7A 1KSHA 3N5CA 1CJTC 2BBWA 1SVKA 4Q4HB 1RYHA 2DCUA 3LVRE 1SHKA 2PX3A 4JSYA 2QP9X 2GVZC 1D9XA 1PUIA 2FDCA 2FZLA 1CKEA 2KJQA 3DVLA 1E1QD 3BH0A 1SKYB 2W83A 4RD2A 2WSMA 4M1TA 1I4DD 2NO6A 3KKPA 1WBBA 3TUJC 1EFCA 2ZETA 3QJYA 5EXPA 1UKZA 3CX6A 3IIMA 1BS1A 2GWHA 3HR8A 3GJ3A 3REGA 2EFGA 1U8YA 5A5GA 2QI9C 3KQKA 2WAXA 4URYR 1TQ2A 3ZH9B 1RJ9A 1Z6AA 4G01B 2QAGA 3TQFA 3FE2A 5E4FA 5EE9A 2C9YA 2QM8A 2GAOA 2IYVA 3UG6A 2IHBA 3AVPA 1TPZA 3WMEA 1E94E 4HAWA 4OHXA 4GFDA 3HU1A 2VA8A 5JS8A 2GBLC 4M1YA 3BFXA 3WHLA 1Z63A 1ZM7A 2D3WA 3GCGA 4ASUD 3DOFA 3UXMA 4UQOA 1GVNB 4AYXA 3PUVA 2JLSA 4NZYA 2IEZA 4R98A 4V0ME 4G5OA 4UXHA 1ZU4A 4EQ6B 3KL4A 2A30A 1M7BA 2IYXA 4ZPXA 3C5HA 2G77B 3L0IB 1DOAA 2YV5A 3OEED 1II9A 3GD7A 1SXJC 1SZPA 4DT1B 1ZW6A 1AN0A 2HT6A 2XJ4A 5D3QA 3TAUA 3LBNA 1QBKC 2CNWA 4ERNA 1QHHA 4F4CA 4YMUA 1CLUA 4TYWA 4PC3A 1M7GA 1YZNA 3QUSA 5CLQA 4B43A 5KDDA 2QMHA 2FSHA 4US0R 3SJZA 3NDPA 1T6NA 1P2VA 3THYA 4X8HA 1HUQA 2QP4A 2JAQA 5FH9A 2CK3D 5FL7D 3L0PA 3CRVA 3C14C 4QG7A 2WJHA 1KMQA 2QAJA 3LFUA 4HUTA 1UKEA 1G6OA 4EPTA 1JEDA 4BQSA 1DELA 1YR8A 1OH7A 3SR0A 3Q85A 4LV8B 1X8LA 1IOZA 2ZJZA 1WQ1R 1RYFA 1LVGA 1F2TB 4M1MA 1P60A 1UADA 1HQCA 5K8TA 3W6NA 5DO9A 1N0VC 5FI1B 1UBCA 1M34E 1W4AA 2WJIA 2WWGA 4NCKA 1JI0A 4Q03A 3LNCA 3BBPA 1XXHA 3EIHA 1ZD8A 1E0KA 5FR1A 1NBMA 3IHWA 2H18A 2XB4A 2VP2A 4TYQA 1UFQA 3KFVA 4HLUA 1F5NA 2C9OA 2QP3A 2YWHA 3ADDA 1XP8A 3A1VA 4Q1DA 4KV9A 3CPHA 1ELOA 2QSYA 4I99A 4YQFA 2IYTA 4TSFD 3QPUA 2D06A 3UK6A 4A2WA 1D2NA 3ZS8A 2YWGA 3VKGA 3IO3A 4AK9A 4POAA 2Q9AA 1TEXA 4FMDB 2Z4SA 4B75A 1PV4A 5JSZB 4Q9KA 3NDBB 1SXJB 2R6FA 3BC1A 3K1JA 5CIWA 1ZIOA 2OFWA 4KI0A 3KQHA 5HE8A 3WNBA 4L8GA 4IOKA 2JLVA 5EXSA 3M6AA 3O8BA 4UXJA 5DHFA 4HATA 3D3QA 2X19A 1ANKA 2DYKA 4LHYA 4XD7D 3I61A 1G16A 5JI2E 4GRAA 1U81A 2ONKA 2QGZA 3RAPR 2CEAA 1E99A 4LHXA 1Z8FA 4KSBA 3TR0A 1F60A 2QNRA 2ZYWX 1ESMA 4D0NA 5TMPA 4MKFA 3SS8A 5LB4A 4Q47A 1T0JB 4RZ2A 3FMOB 3TVDA 2EWVA 3RWMB 2DY1A 3X1YA 1LF0A 4LGMA 4YMWA 2KWIA 2WPDA 5CM8B 1A5TA 2OZEA 3CF0A 8OHMA 5SZHB 2J0VA 4QKQA 1KI4A 2C78A 2H17A 3AVUA 2NQ2C 4MUBA 1W0KA 4WOPA 3QVVA 1JQJC 4LJ9A 3T06B 3TE6A 1UAAA 2NZ8A 3U7GA 2G1KA 4OBEA 1Q21A 5K8LA 3MLEA 3GFOA 2D74A 1CRQA 3P26A 4ZCMA 2I1VB 2CJWB 2HYIC 2AKAB 2KB0A 1J99A 1GRNA 2IHYA 3ZZUA 3AF3A 1XFAA 4EDHA 4QGHA 2BWJA 1Z0DA 2LKCA 1XD2B 1E9AA 4K46A 4MGYR 4DLTA 3IPYA 5L3VA 1CIPA 1E1RA 3B9QA 1DE0A 5AR1A 3FKSA 1DADA 5FOVA 1N6RA 1PUJA 4ZKDA 4LJ7A 4ZKEA 4HB2A 4V0LA 5C4MA 4M22A 721PA 4JT4A 1E6CA 3TSWA 3ZVNA 2CVFA 1U0LA 4ZCIA 1U99A 3IIJA 1Q1BA 1ZAKA 1NVWQ 2ZR9A 2A9KA 3KXIA 1TUIA 4DCTA 3MGCA 5BWMA 1P72A 3GLHA 5BYJA 5DNYB 3RNLA 4AKGA 4AYTA 3L8YA 3KQUA 4C2TA 4FN5A 2WIAA 3OIWA 3PJRA 5BN5A 3ZGXA 4KXFB 3CPEA 4TTRA 1IQPA 2PCLA 3SDZA 4QHYA 4P31A 4B3CA 2VL7A 3EZ9A 2IXGA 2EVWX 1CU1A 1SXJD 1P5ZB 2QZ4A 1DAMA 1HE8B 3NHAA 1PLKA 1I4LD 4KU4A 4TYPA 3V00A 5JHHB 2CXXA 4HAXA 1ZBDA 3AGPA 4W7SA 3LXXA 4E5UA 1UKYA 5KPJA 3VNUA 3KJHA 1UDWA 4BEJA 5CB8A 3BE4A 3AM1A 1E3MA 3S1AA 1LV7A 3IIKA 4BFTA 1BO6A 1KDRA 3LWNA 2ZJYA 1E2LA 3LXRA 4DDVA 3QE0A 2CL6X 3E70C 2W2XA 1NLZA 2ZR0A 3T34A 5IHPA 5L8VA 5AJZA 2UKDA 4NCIA 3CRRA 3SQXA 1S9HA 2XSZD 3LQRA 3SJBA 1VHTA 4GDFA 1T5IA 4RFVA 1NF3A 3EW9A 1DAKA 1MR3F 3OF5A 2NTYC 2V9PA 3RS4A 2QEQA 4E03A 1N5JA 3R9XA 5C2JB 1IY0A 3LX8A 5CDFA 3PEVA 5DI9A 3ZVMA 1KHTA 4WA7A 4C2UA 1Z3IX 2FFQA 4O2RA 1NL3A 4OI1A 4Q9LA 4DKXA 3W34A 2B21A 2H8KA 3A4LA 2I4IA 3MG9A 4DUGD 4QM7A 1NN0A 3TK1A 3WY9A 4B2IA 3DOEA 2OAQ1 1W0JD 3AVQA 2V54A 2V4ZA 3O8RA 1JR3A 1UDXA 2WMOB 1OW3B 3EC1A 2ZPTX 2Q6TA 4G1UC 1XXHE 3CZQA 3RRYA 4TZ6A 4Q1FA 2R6AA 1YZLA 1IY1A 2ZS7A 2R6DA 2WJYA 3B1ZA 4LYAA 3RS2A 4DSUA 2DFTA 2ERYA 1KZGB 2JJ1A 3BB3A 5L3QA 4RFSB 2GXSA 2LKDA 2V6IA 4UXIA 2O8CA 1W1WA 1ZC3A 1YE8A 1HH4A 3P32A 3BOSA 5HKKA 1LTQA 3U3JA 4Z1MA 5J4LA 4FMDF 3NBZC 1CTQA 3A8TA 3L2OB 1XBTA 3RABA 1E9EA 3AUYA 4OJKA 2WMNB 3DPUA 2ZAMA 4BZXA 4GP7A 4D82A 4LRWA 5EXTA 3T5GA 1K8RA 2GCPA 5C46F 2DPXA 4ABYA 2ZXUA 2AD1A 2ZROA 2J5XA 3NC1C 1ZD1A 4A4DA 2IC5A 3A37A 4PAMA 4RKEA 1CBUA 5DI3A 2V55B 2HV8A 3SYLA 1NKTA 1UBEA 2PEZA 2YOHA 4NE2A 5AJVB 3CX7A 3UIEA 3THWA 2Q9BA 2JIZA 5HTKA 1M74A 2ZYTX 3VU9A 4IXMA 3G5UA 4GOJA 3GEIA 1US8A 3CPJB 2O8EB 2OSBA 2OCAA 1ZUIA 2C77A 3UMRA 2WSSD 1J8MF 3IUYA 5HZHA 2YC4C 5EP2A 3A1WA 3PFIA 1KJZA 1FX0B 2X2FA 3K0AA 4A92A 2VP5A 4DBLC 1EXMA 3DDCA 2QU8A 3R7WA 4KAXA 5SZIA 3TSZA 2J3EA 4IOLA 4JZKA 2C98A 1SGWA 4P4SB 4B3GA 1JALA 1GG2A 1W5SA 4OHVA 5AUOB 2ANBA 4QJ3A 5BXQC 1VG8A 5IRCD 5ANRB 3Q5EA 4WZBE 1NIJA 1T0HB 2IYYA 1EFRD 2J7PA 2R8RA 3U6BA 1Y3AA 5FPKA 4LSGA 4NTZA 1FMLA 3QBTA 4KLNA 3BB1A 1KKLA 2F7SA 2ZUCA 4OI2A 3TLXA 5AUPB 4R2IA 4TQAA 2PL3A 1RVDA 2IYWA 3AF2A 2ORIA 5KPDA 4I1UA 3BERA 3VAAA 2AXPA 2P5SA 2NO9A 2WZQA 4D25A 2L0XA 1LS6A 2ZJAA 2V1XA 5EUQB 2P2LA 4BFWA 3JVUA 2NG1A 4PFSA 4DVGA 3I5YA 4CEHB 2PZFA 1DVRA 4MKHA 3CLVA 2PMKA 2B8WA 5LPNA 2QROA 1IXSB 5JWHA 4BE7B 3CWZA 4Q21A 3BFVA 4FCWA 2H7VA 4ZV4A 4RZ3A 2WWFA 5DE3A 1P4SA 1N6NA 1Z08A 3N70A 2JLQA 3B8HA 1OIXA 3ZVRA 4EAQA 2GVDC 2FE4A 1ZRHA 1W7AA 3GLHE 1ZNWA 2EFDB 5LB2A 4NONA 1T5LA 3HR7A 1X8KA 2IS2A 4OKSA 1JB1A 4HLDA 4QL3A 2KSQA 1UF9A 2NO0A 5FTMA 1OHHD 4TT3D 3KUCA 2VIIA 1OPXA 5EZ5A 3PXGA 4M9XA 4XWAA 2XNDA 1RRPA 2JCSA 1U0JA 4ZI3A 3UPUA 1AS2A 1Z28A 5EP1A 4PC2A 1Z0JA 1KI7A 2ZRNA 4CEIA 1YR6A 3C4JA 4HLQB 2C03A 4L9SA 2H1LA 4O3MA 1JECA 2RGGA 3AKEA 5B2ZA 3AP3A 2CMKA 1VYTA 5CK4A 4LV6A 2W6ID 4CEJB 1HEIA 1XEWY 2QT1A 4DLVA 3VHXA 4TQ9A 4L16A 3SQWA 2EW1A 2DB3A 2QRZA 2ZM5A 1D2MA 4Q48A 4V0NA 4EFMA 2D2FA 1QDEA 2Z5FA 3G0HA 1KI6B 3DKPA 4GMDA 2EQBA 1FMJA 3K0EA 3NH6A 1Q3TA 3FKQA 3OFNA 1Z29A 1F6BA 2DR3A 2DWOA 4LOAA 2HF9A 1JXOA 3RRZA 3GJ4A 1JAIA 3ZIAA 1Q20A 1FNMA 4JL5A 2JLWA 1KI1A 2H16A 2WKRA 2ZRJA 1R8QA 3TW4A 1G7CA 5CDFE 4AY2A 1DO2A 3GP8A 2WHXA 1N6HA 1Z6GA 1IHUA 4LYJA 4PPFA 1IM2A 2EU8A 3AKYA 2GJ9A 3RS5A 3U44B 3GJ5A 1NMYA 1NLYA 2ASEA 5FBRB 5FTNA 4DIDA 3TUZC 3Q7QA 2QPOA 3K0CC 2WJJA 3KJEA 2FEOA 2ODWA 4P33A 1IN6A 1Q44A 5TB5A 2CHQA 4QBIA 1JR3E 4Z8YA 3UWKA 3ZZ0A 1OYWA 1P62B 2G88A 3R20A 2ZI9A 2ZI7A 2AWOA 1X1RA 3IBYA 1OIWA 1Q1ZA 1RC8A 4QM6A 4ZO4A 1OXSC 5JLJA 4Q4AB 2XTMA 1WBDA 2F43B 4NPHA 4Q7MB 1QHNA 2C96A 2IF0A 4HYYA 5FBQB 3X1XA 4BRWA 3ADBA 2IWRA 4K8OA 4KVGA 2CVHA 3GJ6A 4ACBA 4ARZA 2V8OA 5JWOA 3AVOA 2UVQA 3AF4A 4Q9IA 4D81A 3ASYA 4QBGB 4ZI2A 1GNRA 5FBVB 1KO5A 821PA 4KYUA 1AZTA 2GILA 3NHBA 4LWZA 1X6VA 1E0SA 4ZCLA 3K0FA 5HCNA 5C4GB 5DHAA 1HV8A 1XD8A 2DFLA 1XCGB 1XMSA 1W4CA 2KBFA 2ZJOA 3PEUA 4GZLA 3OESA 2VH5R 1HQYE 3RANA 2ODNA 1YRAA 3IEUA 5EP4A 1RPZA 2Z43A 2GEUA 4WW0A 3WRYC 4U5XA 4B3FX 1FTNA 1OF1A 2OBNA 2QMOA 2O0KA 3LH5A 4IEEA 4LPSA 3LV8A 3WP0A 1UEJA 1G7TA 1M7HA 4P0TA 4DLSA 5J4VA 2PEYA 3UKDA 3C5CA 2XJ9A 4BPBA 4Q9JA 2FSFA 1V5WA 3RS0A 3W8NA 1QHXA 2BCGY 3NWJA 1HA3A 1MRSA 2F1HA 3HJNA 2BMFA 2JLYA 4OK3A 1E79D 2RAPA 3FB4A 3KJIA 4HB0A 3W8RA 1XCPA 3C41J 1XZQA 2JASA 2IUSA 1W4RA 1IXRC 1GFIA 3SHFA 4W5JA 1EFTA 1G3IA 5FOXA 1S2MA 2YYZA 3I32A 4LC1A 5LBIA 4JVSB 1Q0UA 2F9MA 3X2SA 4PSAA 2N42A 1Z2CA 3W3AA 2ZJ5A 3QKSB 5FBLB 4NYJR 3AGQA 3OEEA 3GLFA 3FMIA 1IN7A 2RGEA 3EWAA 4JKIA 1FUUA 1NY6A 1YHNA 2BKEA 2QPTA 1Z5ZA 4IW3B 3LBHA 3OHMA 2VHUA 3RWOA 3X1WA 2ZR7A 3H1TA 4Z8XA 1DS6A 1KGDA 5EJEA 2QAGC 1KI2A 3FPAA 3RDPA 4BLOA 5F3WB 1G5PA 4D0GA 1DAFA 1GP2A 1L2TA 5JJLA 1M1YE 2RGNC 4JL6A 2NPIA 1GM5A 3WYGA 1S96A 4D6PA 1S1CA 1D8TA 1E4YA 1ONBA 3F5FA 3H0KA 4PAQA 1BMFD 2WOOA 1Z47A 3F0TA 3FMFA 1WRBA 1XJCA 1W47A 3CONA 4R7ZA 1GITA 1F2UA 3WRXC 4US1R 4URVR 4HDQB 2WM9B 1P9NA 2W2TA 1EFHA 3TVTA 1NLFA 3GMTA 5GJWC 4DLUA 4DC9A 1GOTA 1GSIA 4KJZA 2MSEB 3PEYA 1E2MA 4MDFA 2ZE7A 4Q7JB 2YOGA 2QQEA 1U9IC 5JCZA 4OK5A 1KTVA 1E2FA 4BECA 3RRNA 1KYIA 3UANA 3NC0C 4UNRA 1SVIA 4TL9A 2KE5A 3PUXA 4JVMA 3FYHA 4KODA 4D4LA 5LDDC 4Q1BA 3VQTA 4LCBA 1KO8A 4D80A 3IPXA 221PA 1D2EA 4BWYA 2PLFA 2BEKA 4YMTA 2GCNA 3Q7PA 4OQXA 1D6JA 1E2GA 2JLRA 4U00A 2TMKA 3Q9LA 3ADKA 3SE0A 2XX3A 3K70D 2JLZA 2YJTD 3P20A 4DCUA 1KI9A 2C8VA 4EKDA 2P67A 4DCVA 3SOPA 1E9CA 3PIRA 1CJVC 2ZI4A 4Q1AA 1U94A 3A1UA 2HF8A 2JJ2D 3I72A 3GPLA 3QBVA 3KKMA 2AK3A 5TDHA 3D6TB 1W46A 3D7MA 2VTKA 1U8ZA 5CIQA 4DLRA 3NH9A 1RJ9B 3D31A 5E3HA 2QAGB 3SBDA 2FPMA 4XD7A 2FH5B 4EQ6A 4CYMA 2BJWA 2BJVA 1S8FA 4OQNA 2AFIE 4LBWA 4N3NA 1SQ5A 4B34A 2ZRIA 5CJ2A 5DLQC 1ZM2A 2ZYVX 4LV5B 3I62A 4TYNA 5FPSA 3KXKA 5DSZA 1QRAA 2ZITA 2REBA 2J46A 2HJGA 4G5SA 2IWHA 3T5DA 4JT2A 4B33A 1HYQA 1X1SA 2ZRAA 1L4YA 1NIPA 1UJ2A 2PZEA 3SBEA 1GAJA 1XDBA 2QSZA 1RRCA 4OHWA 2C95A 2FG5A 2DFNA 2H5EA 1RIFA 1OT3A 4X8MA 4NYIQ 2R65A 5FOUA 1NP6A 2R44A 2IT1A 3NEYA 3ICEA 3ZZTA 4AG5A 3L43A 1ZMXA 5FUVA 2VSXA 4MRRA 1E2IA 3AP1A 1QHYA 2IYZA 4HSEA 1Z6TA 3UG7A 4WVFA 2QENA 3PUWA 4A0HA 1FQJA 1L8QA 4YXWD 3QPWA 4DLZA 3P1JA 4GI7A 3BWDD 1XRJA 5CITA 2XTZA 3T15A 4FIDA 2A5DA 2JGNA 4W5WA 1ZUHA 4LX0A 3KX2A 4N1AA 5AJYA 4MDEA 1A2KC 2GHIA 3GQBA 3OE7D 2GJSA 2XOKA 1W36C 2PT5A 2HYDA 2GBLA 1LNZA 1NY5A 4H1VA 1HURA 3KJGA 3GEEA 4L5BA 2FJUA 1T3HA 1KO7A 1R4AA 1X8JA 3P27A 3I8SA 3VX4A 4C0JA 4OI0A 3K8YA 4MGZR 2FEMA 2E1RA 4G5GA 4NYMR 4R9UC 4PQRA 1T8TA 2ZU0C 4XTCS 4KFUA 4BLPA 5KDOA 2HUPA 4XWOA 1XZPA 5JSZA 3G82C 4FW9A 1KDOA 1OE0A 5KO2A 2G0TA 1VPLA 1GKIA 5CYOA 3LW8A 4BFXA 3EC2A 2B7CA 3AP2A 5A0FA 2IYUA 2ZSAA 1II8A 3GLFE 4UNNA 4OI4A 4JYBA 4FMCB 2SHKA 3F3YA 2G0NA 1CEEA 2ORWA 2G3YA 1AIPA 3CH5A 4PHTA 5BN3A 5J4KA 3A6PC 4HLCA 4I81A 5IK2A 4URXR 1FP6A 4TYYA 1YR7A 3W6PA 2QE7D 5JRJA 3IKJA 3RHFA 4LHWA 3EZFA 3CBQA 5DYIA 3THYB 1D5CA 4IHQA 5CLLA 1FFHA 2J0UA 4C0QC 4E09A 1G18A 2N46A 4M4SA 1GILA 2AKYA 2JATA 1OFUX 3NXSA 3KTAA 4OYHA 5CJPA 5F98A 1I2DA 2Q0HA 3GEHA 3HDTA 1ZC4A 2CNWD 3SJAA 3GLGB 4TQUS 4A1FA 1VCMA 2JDIA 1VG9B 3GJ7A 5B57C 2PZGA 3B7GA 4EIWA 4DUGA 2VYFA 1XTKA 3QEJA 4KVAA 4NCJA 3PG5A 2CJWA 1KOFA 3LLUA 4HZUB 1Q12A 4JMPA 1GRRA 3MAAC 1TMKA 3SNHA 3DM9B 2DHRA 4PO8A 1E9BA 3U7FB 1W36B 1R5NA 3ECCA 4TLAA 4MYUA 1JQLB 4GNKA 4RD1A 1I4TD 1XD2A 2LWIA 4DSOA 4Q7KA 1VIYA 2BMJA
chains in the Genus database with same CATH superfamily
5C5CA 3EODA 2VPWA 4GX1A 2XUZA 3VI3B 1JDTA 1BE1A 3GAAA 4U0KA 1U3WA 1GPH1 5D5QA 2SCUA 3GRKA 3LW7A 3LO5A 3OSUA 1YDHA 1GNSA 3JU3A 4UM5A 4AQ7A 3T5BA 3ZV3A 1FUYB 4DDWA 2FF7A 1H9BA 5ADHA 2MYTA 2J41A 1UBTS 1HDGO 3AZPA 2PSSA 1UZAA 2RGBA 2G4VA 3RIHA 3KKQA 2GXQA 1X9HA 5CVEA 3SHTA 3HKBB 4F3KA 1W52X 4R51A 3IDZA 4YEDA 2ZBEA 2EFYA 2DT5A 2OQRA 5GJVC 5EPUA 4J0JA 4E7PA 1T9BA 1REQA 4D74A 1WVIA 4B3IA 1IIRA 1QE3A 4D3SA 5KYKA 3T1HB 1L3BA 3N8KA 3B6MA 3WDSA 1UBOS 2IK8A 3TZHA 3WGTA 3I0ZA 4MCJA 2XYVA 1QO7A 3HFRA 5KX5B 3FNIA 3WGHA 3AU9A 3NBXX 2WK1A 3OJFA 2PGAA 4O02B 4GU5A 4XLZA 5B64A 4KREA 3VOSA 4FXPA 4O4IB 2VRCA 3ML1A 3OT1B 2BT4A 4BNNA 5K0SA 1VKZA 1L7RA 3E5HA 3QYAA 3ZUPA 1DL5A 4YR9A 4PHFA 4B35A 5K45A 2H3EA 4WOCA 3A4MA 4UTXA 3SF8B 2VXBA 4XI9A 5AW5A 3VKVA 3ER9A 1YS1X 4E22A 3N07A 5A9SB 4I2NA 2W7TA 3GG9A 2Y1EA 4KUGA 3ICOA 5CCDA 4M8SA 3ZE7A 4A82A 2KHZA 5ICEA 3AVVA 5J2TF 4ZT2A 1OGJA 1DKOA 4FI3F 5BN4A 4BXOA 3DOJA 1TDJA 1IEWA 1LS1A 2XA1A 4R0NA 5HKLA 2DZDA 2HLHA 3VKUA 4X85A 4BFSA 2Y1FA 4F4DA 2GA8A 4YCNA 1BA2A 2DBRA 2UYHA 3SBOA 2QW8A 5AVZA 5EFOA 1CS4C 1V8FA 1FY2A 3QYJA 4EY4A 1R4MB 3REFA 4I4TF 3G9ZA 2INGX 1CY2A 3LA6A 4C06A 1QYVA 2VCYA 4F12A 1AKWA 2FY8A 4FVTA 4K40A 3EPLA 2A3RA 4HAYA 2HK9A 1C8BA 3Q6IA 4AJEA 1QC5B 1VHLA 1RZVA 4HL6A 4ISBA 1E2BA 1DXHA 2KI5A 3H7AA 4ER6A 2OKGA 1YQQA 1SHZA 1KKMA 4PC1A 1P7PA 2G9ZA 2KW5A 4LBVA 4Z0PA 1CQZA 5LJLA 2R66A 3X2EA 4FZVA 1G4UR 2GKSA 1DQYA 1F0PA 5MN4A 3PKIA 1NHGA 2OBMA 1Z5VA 2ZT7A 3DULA 4UCWA 2W4MA 3RS3A 4BCDA 1HNWB 3O8QA 1TZBA 3ZHCA 1Z45A 4ZDJA 2VR1A 4BAGA 1N5KA 4E5PA 1TAQA 3DE3X 1W36D 1KZ7B 2I2WA 3OZFA 1RBZA 4Q3LA 3VZBA 1ZVVA 2FFBA 3ETLA 5G3YA 2BEJA 2PNFA 3O1LA 1KR5A 3PPXA 1ZX1A 1WIWA 3PR2B 4Y1GA 4CDGA 1UWCA 3T3GA 5KWSA 4V3CA 2ZIZA 3ISJA 4GC9A 2JVJA 2X40A 4P92A 4G0NA 2NPFA 4MUAA 4RIHA 5EZYB 3RTEA 1TEVA 3IR6A 3VSBA 3PE6A 3AVXA 2B5OA 2GEDA 3CN7A 3C4VA 2DWQA 3DO8A 3H3FA 1NOIA 1G2PA 4B17A 4CN9A 3DDOA 3MCVA 4DA4A 2PWZA 2PKYX 4PS0A 1SC6A 3LE8A 2J85A 5DCLA 1E9FA 2C3YA 4ZI7A 3UC9A 1U4SA 4NL4H 1JLRA 4PLYA 2LPMA 4DLWA 1EK0A 1ID8A 1OXKB 2YKGA 4MRVA 2ONJA 3SSMA 4DSNA 2O2IA 4GR9A 5GZ3A 3OJOA 4Y0NA 1FDIA 3RKUA 3JXEA 5D51S 1TVEA 1M8PA 3WWZA 4BQQA 2FUEA 3HCBA 2VTEA 4WXYB 4FYHA 1U0NA 2I6QA 4L0DA 3L82B 4LDNA 1VSBA 1JMKC 4GL2A 1IN5A 5K8UA 3H4MA 2Z2IA 4RVGA 2F9LA 4DQDA 2PXAA 3AHJA 4KRXA 3C85A 4IINA 1FRZA 3TQSA 3GT0A 3D2CA 4KHZA 5ALZA 2AYZA 4ON9A 4R6WA 1DZ3A 1TTHA 1W5FA 1WG8A 5IU6A 2VKTA 2A84A 3KOUA 5F2NA 3BGWA 2H65A 5DI3B 4Y6RA 1XNGA 1E5TA 4IYJA 4HEJA 2QWXA 3AEYA 3DFZA 5KCZA 4L73A 4YB8A 2QUZA 4YQEA 2BGWA 2ZYUX 3IVXA 1TPYA 2FZGA 1XRLA 2V0CA 3CUSA 4P4SA 3VFDA 5KNCA 4M0PA 4NDNE 3G9UA 4GG1A 3KQTA 1LSSA 5KUTA 1VLJA 4MRSA 5JC8A 4KH1A 2CLCX 4IWNA 1RWWA 2P9YA 1TL7C 4NARA 1V5IA 1D03A 2MSLA 3DMRA 3SNHA 4YMIA 1MDFA 4AYWA 4F46A 1V43A 1K7YA 1ZWKA 4PQEA 3W1VA 3W2EA 9LDBA 3RUFA 1AVTA 2XMGA 3O8OA 4HB3A 4HGNA 3EXG1 1G8HA 1Q1EA 1ZM3A 3B1KA 3K7EA 4HDOB 1RYDA 4HDAA 4OPMA 5HR5A 1G8YA 3F8TA 2P75A 1H8HD 2R1VA 5JFGA 3EF0A 2HK6A 2XTJA 1UMDA 1VGRA 3LQQA 2L19A 3FY4A 3QPVA 4MTLA 4LY9A 1R7RA 1R9GA 4Y2GA 4BVEA 4DZTA 3RT1A 2VWGA 3R8FA 3N58A 4FCTA 4FSHA 1JJIA 1V45E 2IH5A 3ZD6A 4BB5A 2Y67A 2LIVA 3TKLA 2OFOA 4HEQA 1D6SA 1JMVA 2C0PA 3JQGB 1WABA 3EG9A 3N53A 1J9ZA 1GHTA 1ODTC 1UC4B 2EFHB 3E1SA 3H5LA 4RY8A 2NWQA 1KYYA 4ROTA 3JSAA 1I9GA 5BSKA 3JZMA 5KTOA 2C2HA 4CLDA 2QY6A 2PDAA 1Z4PX 3B6EA 2YINC 1QNLA 3BTUA 3NONA 2HQSA 4UE3S 4X60A 1SUCA 5KOIA 1RQ2A 2Q0SA 2IOFA 3C39A 2MYUA 3FHTA 1C9DB 3LMKA 3T41A 1G8MA 1CPYA 1QVVA 4JJFA 3VM6A 4DG5A 5EAIA 5FYQA 3E7DA 3DOOA 3H2KA 4CNQA 1KWKA 2B4AA 2HA6A 3DHVA 3FCAA 2DBZA 1M6EX 3LM8A 3HWRA 4Q82A 5AKHA 4EHIA 1TUEA 1L4HA 4AF6A 2GO7A 2V7QA 1AF4A 3CLKA 4PXSA 5JRZA 1M1NB 1JDZA 2DTEA 4PCUA 3CXUA 4ESOA 4KO1S 3TRKA 2GK4A 3QQPA 3DJYA 3VJKA 3QKWA 5IKXA 4RD4A 4MB6A 5D2CA 1E9SA 4JYPA 3HCFA 5F2KA 4M87A 4RVNA 1USVA 4RADA 3QMPA 4FBMA 1JKJB 3CX3A 2Z08A 4UPEA 2V9CA 3GFVA 4IOJA 4IO1A 3K9FC 1WUJS 2YZNA 1C9NA 1SZCA 1G1MA 5EWMA 3AUSA 3LQKA 1T1SA 4CF7A 1YRHA 1VYUA 1DCKA 4K3VA 1N9GA 3OCJA 1NVTA 4ZIRB 5LBUA 2BE9A 3BRWA 1Q3HA 1SEPA 4U7JA 2NIPA 4S1TA 2PU7A 4JVLA 1DRJA 1E79A 2RB4A 4V0SA 5T4BA 1E58A 4LF4B 1FOEB 1Q7TA 2NX2A 1KI6A 1O58A 3C6YA 5JH7B 2FSPA 4LF9B 4JZYA 3DPSA 1WXGA 1GAWA 4X1KA 3MT0A 4NVRA 4RPKA 4RF3A 1Z2PX 4FFWA 3KXPA 5IYZF 1KJWA 3MJHA 2GZDA 1HC7A 2ZAGA 4JJ7A 1NVKA 4DJDC 5J5AA 3L7NA 2QL6A 2P5TB 1J1ZA 4K6KA 2HMUA 1S2IA 5I5EA 1ISFA 2YOFA 3EVEA 3Q72A 4IFBA 4NCXA 4ZDKA 4B73A 2ZYDA 4OAPA 2R62A 7REQB 1XVTA 3MJEA 4K28A 1C8KA 5IM4F 3AR9A 4C6SA 2PR2A 2ZQ5A 2DPLA 3TCNA 1P4GA 4E08A 2V3CC 1SBIA 1PRYA 3JQAB 2W6JA 4DZRA 1M1UA 4M1SA 3SWWA 4ARVA 4YROA 1QRSA 3K53A 4TS1A 3OOYA 3FBWA 4H59A 4HH4A 2F3QA 3ZNOA 2CDNA 2VEDA 4Q4JB 3C98A 3I04M 4KN5A 5LDGA 2JGLA 3KPYA 4ALKA 2OUKA 2YJ5A 4EA6A 4NMXB 1E2HA 3OJLA 2D2XA 1Z0AA 4XTRA 5HUJA 5IF9A 2GYUA 1NBOA 1JIXA 2YZGA 3QEMA 2VC2B 1RQNA 2D5LA 1BVUA 1W88A 3KNZA 4ESVA 1ZHHA 1A50B 1EPUA 4KKXB 4O29A 2IUUA 1IB6A 3PFBA 4D0RA 1V1JA 1LXCA 3CY6A 1Y34E 4B45A 3N2KA 1D7AA 3DBRB 2TRSB 3S27A 4KAJA 5INTA 3A32A 1NG9A 3IDSA 1WOYA 2O8FB 4MVYA 4ZO9A 1BXRA 3ESQA 5DK6A 3HPQA 2QVCA 1DC5A 5BWBA 2PUEA 1JWBB 1KO1A 4OSPA 1SM4A 3T9BA 2C5SA 1CIJA 3RIEA 4G41A 3LL4A 3B53X 2WDZA 4FJ1A 3R3WA 4IVQA 1OJ7A 2QSJA 3KYDA 4PQFA 3AB3A 4U4AA 3ELYA 5TJ9A 5A1TA 2CSXA 4ARZB 2GJAA 4F3CA 4X1YA 3U4CA 5KWVA 1ARZA 2AXNA 4RHCA 1QH8B 1V2GA 3K6JA 4NE9A 2WA1A 1EESA 4JODA 4L8WB 1A9OA 5IAGA 1A77A 1VB5A 3OU2A 2X0RA 1LX6A 1E1NA 1SU8A 3K0FB 3PQ4A 5JWRA 2VBGA 1N75A 1RQLA 2OBXA 4J0QA 3THXA 1X1BA 3RS9A 1WEHA 2JRLA 3IEMA 1SCUA 5DOZA 4B4KA 2WWHA 1HTWA 2R3SA 1H2YA 3JQPA 4DL9A 5B2EA 3KPWA 3Q98A 3DR5A 4EG4A 1JFFB 1OXUA 1S8AA 3AUXA 1YI0A 4OVKA 4EJSB 5E0KB 4TKLA 4OK6A 3V2GA 1BEEA 1UEIA 3L06A 4MXDA 5SZJA 5C32A 4RULA 1PR5A 3OKCA 5FOQA 3R0QA 2B8EA 1S2OA 5JLAA 1O94D 3KDAA 3VR6A 1ECFA 3BPSA 1VE9A 2ZWOA 5BQPA 2AS0A 4KI7A 4H7KA 2AN3A 1Z3CA 4KQHA 1WNTA 1X19A 3O47A 3G85A 4S12A 3OBBA 1A97A 1XIVA 4JB3A 3L79A 4K9DA 5GZ1A 4NFHA 2HXYA 2PRYA 1RACA 3DP9A 3L77A 4FDAA 1MQ9A 2AVNA 3HKDA 5C4IA 2ZTLA 3HDYA 1K8QA 4NBSA 4WZZA 5DV9A 4WZ6A 4U7FA 1AZLA 1Z18A 2ZRCA 3R5FA 1FRQA 1DQZA 3QKSA 1EEXB 4N6NA 3E5RA 4PBRA 2Q46A 3O9ZA 3EZYA 4ZVLA 3TSAA 4TV8A 5AOCA 2HCFA 4MW6A 4XCQA 4KTTE 3SN6A 4Z53A 2QN9A 4QAJA 1G291 1SU6A 2JJMA 2PZMA 3K2EA 1XNJA 1OOEA 4HH0A 1RRFA 1GG9A 5FADA 3IQZA 4GXQA 2ATXA 4MCAA 4ZT7A 1KAOA 2FPPA 2I80A 2BH2A 3TMYA 1KEVA 4NHEA 1U3TA 2ZDGA 2C1EA 2CK3A 1D9ZA 5T4EA 4KRFA 1ADCA 2XHZA 2JGIA 4KQCA 3F1KA 4GECA 3UGKA 4A36A 2EOAA 4Z2AA 3I2YX 5B1IA 3SR3A 5KYXA 1YCDA 3STVA 5J43A 5C52B 1WV1A 1TYBE 1VJTA 3PNSA 1JG2A 2QJOA 5FEUA 4CKWA 4ESHA 2XOEA 2QTFA 1T2AA 2NU7A 4HDNA 4EB6A 1KMHB 3WGOA 1Q95A 3IPAA 4LJYA 4OLBA 2XVXA 4H0CA 1T2EA 1T6ZA 2XF8A 2FMHA 2F48A 3K0KA 4FUTA 5IJ9A 5JXWA 3EWSA 2WD9A 5JMPA 5D1NA 4P81A 3GRAA 4L5IA 5IXSA 4Q05A 4B80A 5FPHA 3H9GA 4R01A 2HWXA 4POOA 2Q5FA 1BDBA 4KLZA 2JBAA 4ZC8A 3VV3A 4W9NC 5CHYA 4YAOA 4P5DA 4S1PA 4EY7A 2IOYA 2YYYA 4IDOA 2WIGA 4CLOB 5KSZA 1ULAA 2JRCA 3ONWA 1RPJA 4IRXA 1K5PA 4GWLA 4HAVA 4QPJC 4F4JA 3TPFA 2HGZA 4N76A 3MOSA 2Z8YM 5HFJA 1UC5B 2CL0X 2FSUA 2R1TA 1YRBA 1W8DA 4JJIA 3H2BA 1E4EB 1WF3A 2H4ZA 3ZW7A 4E88A 4B82A 1AS0A 4R2JA 4GXRA 3BCRA 2FB9A 4WEOA 5I9SA 1PWEA 5BYAA 1Z0SA 1K8XB 3FDXA 1QF7A 4OHYA 4P2GA 1E2JA 3WC4A 3WMXA 2GK7A 3PUJA 3U5TA 1A88A 1GUDA 3DV2A 2RI0A 4EJMA 3KPVA 3D54D 3H16A 4BASA 5J3JA 1JHZA 5JDIC 4J43A 3TRFA 4YO7A 4J0IA 4IDNA 5THKA 4A0GA 2YIDA 4HDCA 5H7XA 4WNAA 1BQEA 3F73A 3QVSA 1U90A 1KYWA 1XYGA 1XTQA 5ILOA 3WA7A 2OMKA 3R3UA 4NDZA 4Q9HA 5AW1A 3SCZA 4Q02A 2BBOA 2VNAA 3HDQA 2E37A 4FWTA 2RGNA 1V8DA 5LM3A 1WLYA 1R0BA 3BMXA 4MAMA 2R00C 3UJ8A 4Z4QA 2HDOA 3CNLA 3QVGA 2JIRA 2FE1A 1XAJA 2HGSA 1XQ1A 3NHUA 1IN1A 4N0EA 3ELUA 421PA 2VQFB 5BPFA 4F3RA 4CFSA 3CVUA 2FRDC 3C5WP 2QB5A 4EUFA 2VP9A 5IAKA 1T9HA 2ZZNA 1ORDA 1QVAA 2D1RA 3K8ZA 4PLCA 2GZ3A 3BCUA 3KKEA 4R2XA 2GXAA 3ASUA 3EBOA 5ESXA 3MZ0A 4RX1A 1GTSA 1P61B 3OTWA 1U3UA 2ZAOA 2C9MA 3TL6A 5FBWB 1NI5A 3MWGA 1KARA 1U9IA 2CYCA 2BKVA 5F76A 1DJLA 1EVYA 4H9GA 3IAXA 4Z8XA 4EG5A 3OQNA 2WZDA 3ZOZA 4F4IA 3CLHA 4I4TB 3JWEA 2D1SA 3I39X 1L8AA 2ZUBA 4BTVA 5KNBA 1M5UA 4R9NA 3WBJA 1IBCA 3NYWA 4KR6A 5DH9A 2BLLA 3MPOA 1UWVA 1WDTA 5HJ2A 5BT8A 4QXOA 1T5HX 4AJNA 3PVSA 16PKA 3NKVA 4OUDA 5AP9A 2AN9A 2J8ZA 4CLXA 3P4XA 3NV7A 2O07A 3HWSA 4YP5A 4AUKA 4CT0A 4QJ4A 2WSLA 3TJZA 3ORRA 2GR9A 1EXDA 2E9SA 3DOUA 1F1BA 1VJ1A 5IULC 4RK6A 4U9IS 2AN4A 5FWXA 2ZYGA 4C87A 3P9CA 4OHRA 1X1EA 5A4MS 1BFUA 1RQPA 4E14A 3CLRD 4K6GA 1NKVA 4H31A 4AD8A 5BMVA 4PLVA 4PZEA 6GPBA 2ID7A 2D1QA 2J3DA 3MSCA 4P5PA 2ZJ8A 1KJYA 3K31A 5BNWA 4IKEA 3OMXA 2HUNA 3S44A 1NVXQ 3C3CA 3QU5A 3PUHA 1PFGA 3G9TA 4UFPA 2XNJA 1ORTA 3JQBA 2J9RA 1S2DA 4WASA 1T36A 1UKAA 2OCYC 3STHA 5KYWB 2EZUA 1Q5PA 1V7CA 2OGWA 2ONYA 2RK4A 1OYOA 5A3SA 1JDVA 2VWHA 2XNCA 1B3RA 3R44A 2AOUA 4FFSA 4JJAA 1A8QA 2JIDA 3AEUB 3AR6A 2OZLB 3K1AA 4DCJA 2WHEA 4M2LA 1RQ7A 2V03A 4LZNA 2IXFA 2BMDA 3KE9A 4HF7A 1JE0A 3B2QA 1R10A 3SFVA 2X8JA 1G3QA 3KOZA 4KEAA 2R60A 2HBQA 4HSGA 3T4PA 4WBNA 2WOJA 4JBWA 1AMOA 4HJRA 1HYHA 3KYIB 1DJOA 1GGFA 2C0QA 1O97C 2WF9A 2XECA 5IDVA 5KCMA 5JMWA 3V8EA 3M82A 1I8TA 1Y4AE 3LC7O 5J63A 4EPRA 4GOKA 3O4RA 2BY4A 4G0YA 4KWHA 1I10A 5A06A 2FNAA 2IUEA 3OZGA 3E2IA 4K81B 4Y0AA 5JS6A 3KKOA 3MMPA 3GVPA 3WJAA 4DMRA 4DB4A 1OH8A 1XU9A 5KTYA 1BKDR 2XVMA 3LKBA 1HQKA 1LU9A 2B1IA 1G20A 4AULA 3TECE 1QHSA 4W4TA 4RJTA 3OZCA 1HKHA 5J59A 3ZDAA 2PFSA 2IYSA 2EBHX 1TQ8A 1BFDA 1OLXA 2RAUA 4ZVMA 1PVVA 2VS1A 2LV8A 1N3BA 2EP7A 2WFMA 3MS4A 4IH4A 4JJKA 4Z7NB 5A4JA 2GBIA 5FI0B 1YGYA 3D8BA 1WKVA 3PB3A 1UPCA 4RTJA 4OKIA 3ZHUA 1QRUA 3QIAA 1SPBS 5JYDA 1ZD3A 3OM9A 2NMVA 3HCDA 3UMVA 4MRPA 1WSAA 4R1TA 4F1WA 2RKBA 3WDMA 4URUR 1CRPA 1PV2A 3NWBA 1WCYA 4FMBB 5GIPE 3W5UA 4F5ZA 2VTBA 4BZQA 4WZBB 3V1UA 2RGUA 1LRJA 3UHOA 3KTAB 4GYJA 1MD9A 3H1EA 3UATA 3TLGB 1ZITA 5ALKA 3KT8A 4H7DA 1QF9A 2GRUA 3GGJA 3ZE0B 2DQ4A 3ESRA 2CHGA 2OGUA 1ZP6A 3IESA 2Q8NA 2FSVA 1P6UA 3HI4A 5ALIA 1LRKA 4Q6WA 3S29A 3VX3A 5KS2A 2Q50A 5EI5A 1DXOA 2PG3A 5TNXA 2HPAA 4I5EA 1VPWA 3ZLVA 5GY7A 1W44A 1U0EA 3AU8A 2IS4A 1V8BA 4UMDA 1YZGA 4REOA 5M29A 5GV8A 4QYMA 1ODLA 1E4VA 4QGGA 4OQEA 3QKTA 3D6MA 1K5HA 2CKDA 3IVAA 1U3CA 3CCCA 2AHOA 4CTJA 2NO1A 4LWQA 4BJ3A 1G8PA 3PFFA 4C4YA 3ZJYA 4D45A 3IC5A 3CWCA 3DLPX 4XPIB 4CL0A 2L2QA 2Y1XA 5DULA 3VPHA 2B5VA 4AMUA 4U39A 4JROA 2EARA 4F92B 3GGSA 2O2JA 3NEAA 3D3KA 3ENQA 4MGIR 3W6ZA 2CCGA 2G17A 2Y77A 3GVXA 4EVIA 2BFWA 1GKKA 1CNMA 2CL7X 4YIHA 5LNK6 4M88A 1JAZA 1K6XA 4J3NA 3EGDA 3MTDA 4MWBA 3C74A 3IEIA 3PHBE 1OFTA 1RPAA 1GUFA 3BS4A 3CW8X 4KBFA 3B5EA 3FDJA 3O26A 1NE2A 4YJ3F 3RU3A 3R4VA 5AVUA 1W85A 3H8WA 1HKUA 5DISB 1RM3A 4WWHA 1XZMA 2IVFA 3M6FA 1XCBA 2ZRKA 3W5JA 1A2BA 4Y2RA 5BO5A 3ZBQA 4FGWA 3CX4A 1MB9A 4OATA 2JLCA 1DKUA 4YCAA 1I7DA 2A2ZA 1Z4MA 1BS9A 2WNHA 3RTDA 2EJWA 1XDSA 2OBLA 1X9GA 3VRHA 5CB6A 4FP9A 1U9CA 5TEWA 4TL6A 4LJSA 1VI6A 4Q9NA 2O7RA 4YIKA 3ROTA 5I7SA 5KHAA 5AW3A 1H93A 3KOOA 4RSGA 2BFOA 2YBDA 4N5NA 2FEAA 2I1LA 3D5TA 3DSRA 4TKUA 3WGVA 1MOSA 4R71A 5IUKC 4C0HA 4ZQEA 2CXSA 2VP0A 4CMHA 1SBCA 5KOJA 3OOJA 5KOYA 2EW8A 4N40A 3CUVA 4INJA 5ESDA 4E21A 4F2GA 2KX7A 2PWAA 3TCKA 3NWPA 4CIBA 2R4QA 3IP5A 5ENVA 3MRSA 5LLTA 1T25A 3CB4A 3JATA 5JO0A 3V4RA 3GEDA 3KBBA 4I19A 4IVNA 1OC2A 1VRWA 1ZGJA 3VBEA 2DUUA 2JEZA 2V7GA 1IBSA 4HFNA 5IYZB 4FCCA 2ATCA 3AHDA 3I0MA 3ODGA 1UFOA 1ECPA 2ZBRA 2A4MA 4JENA 1SQSA 3ZN2A 1DAHA 2OR3A 3EA5A 4KSCA 4ZXFA 4GAEA 3UA4A 1XJ5A 4L5CA 1FTWA 3R5TA 3PNLA 3DTYA 4K6OA 4N3AA 2A5FA 2R68A 3PZBA 4RA6A 1WB9A 5C8VA 3IIIA 1IE3A 3HEBA 5B7NA 2YIJA 3ZZNA 3B9PA 1DIRA 1E63A 2KPOA 5JU6A 1U5CA 4RCYA 1CHDA 2BJHA 2CV0A 1FU8A 1LI4A 2VFAA 3P45A 5LA6A 3P4YA 4C7JA 2G4CA 3B7PA 3WJ2A 3K9NA 3PV0A 5AW9A 4EQZA 5JI3E 1J2TA 2R9VA 3CT6A 2WD7A 4IWXA 3SYKA 2NT3A 3ND8A 1NBIA 1YKGA 3D43A 4UCXA 5A3VA 4CMEA 3WLAA 4UNQA 2OLJA 1W5TA 4TM7A 4UKDA 1U5BA 4PZLA 4LZOA 2BDTA 3SQOA 3ZQJA 3JARA 3AFOA 3HU5A 3F6PA 3C6QA 2VHJA 4MWEA 1ZY2A 4L5AA 2GTHA 3D7KA 3WGMA 4HTFB 4EPWA 1YCHA 3D0RA 4YAIA 3QKRA 2O8CB 3EUAA 3L01A 2DLNA 4PTLA 1V1RA 2EL7A 2G5CA 3LQ4A 4YT2A 1L5FA 4ZO6A 4CL2A 2O8BB 1QX4A 2QV0A 2D5AA 5IANA 3HA3A 1X3SA 5FBZA 5LP6A 2W37A 1LPMA 2E4AA 2YRFA 4N3GA 5ELMA 3S2IA 4UOZA 2ZJ2A 4BNLA 1KXJA 2VEOA 3DKKA 3NTOA 1KETA 2HRBA 1VKJA 2R97A 4PX9A 4QFCA 4ZI5A 3LLCA 2JFPA 1K88A 2C4UA 3OZDA 4WN3A 3LNTA 5HP4A 2W6IA 2PN1A 3SI7A 4LBZA 4PTZA 5ALNA 1SXPA 1E2QA 2PWYA 3SGLA 1NPYA 4KN9S 2YWFA 2AH5A 1MIOB 3C87A 4IJKA 4E3WA 5MN6A 2QRJA 3FMPB 2HKIA 4MGHA 4CLEA 1PZGA 2QZ9A 5HUQA 3OZWA 5KNDA 1YB5A 2NP6A 4C0AC 3TWOA 1VMIA 4CTNA 4IJWA 4JLVA 4P22A 3A0RB 4QPDA 3LY7A 4OB8A 3WAKA 2HLDA 1M83A 3PQCA 3GROA 3VU9B 3MOIA 2CCJA 1FQKA 1XQWA 4PPQA 4UHJA 3NVKI 2PQ0A 1UMCA 1OMOA 3FHCB 1AK1A 3H5OA 4E1VA 2QMEA 3KHKA 4F2DA 2H1OA 4HTAA 3N6VA 3HEAA 3G8AA 1EVJA 2D62A 1V1MA 1NVVQ 4NECA 3VH1A 5B1EA 3FYUB 4IRUB 3AVTA 3GDHA 4RCZA 3IUJA 4FE7A 1RKUA 4A0FA 1PS0A 3K9BA 1NF9A 4RM3A 2I7XA 3R7WB 1YKSA 1Z5GA 2YVKA 1OXVA 1UH5A 3HPRA 5E3IA 5FPQA 2CZCA 1JHYA 2XUFA 4HAOA 5CMLA 4UCFA 3FSRA 5DHRA 1OFIA 1ZGGA 1IYZA 3KXLA 3K9GA 4XRRA 5BUZA 1M6VA 3DDHA 3V3KA 4F9EA 3VNVA 1N25A 3OIYA 4X3OA 5JADA 2XB9A 1DRVA 2FPIA 2Q62A 4LYHA 4CQLA 5DM70 4C2BA 1ISJA 1ECCA 5IWAB 1HE3A 2PYZA 2Q5CA 5GWXA 1U2DC 4ALMA 3EXEA 4A8JA 3I3OA 1IJEA 2E5WA 2PWBA 3A2KA 1RXEA 1AGPA 4B5LA 5E4YA 1E66A 1KSGA 1EE2A 2PMEA 3BL6A 4AO6A 1FS4A 2JZNA 5FI3A 5IH7A 2G67A 2O8VA 4K0RA 4MUJA 3BK2A 3EXFA 3EMDA 2X22A 2NU9A 2O9JA 3PQDA 1WXFA 3NP9A 3QFCA 5D00A 4DRXA 4OXQA 2PUHA 4G86A 5TC4A 4DIBA 3DNPA 4FS8A 1H6AA 2PT9A 3BQMB 1GCAA 1HZJA 2X4DA 1NQ5A 3VTAA 4G07A 1IVNA 3DEJA 4LYFA 3I8XA 2RDMA 4C0XA 2H54A 4OLFA 1BN6A 4HNHA 3FGPA 3MGKA 2GPAA 2ZIEA 2ZPAA 2OHJA 2JL1A 3KBOA 5EL0A 5KEIA 2CXPA 1XL0A 2G63A 3KDSE 4PQYA 2JD2A 1RYZA 2I1WA 4QYTA 5EG5A 1V6AA 4LEIA 1SN7A 4FW8A 5EUCA 2RHCA 1NUTA 1GTL1 1Z35A 4JFAA 3RC2A 2P4UA 4DA8A 2ACWA 2XVYA 4CDNA 5K3AA 2XYGA 2P30A 3QEOA 2WU1A 3JVVA 3JALB 3RVNA 3S2SA 4QNMA 3WL8A 4C0KA 2BEUB 5DX0A 4DKJA 3ZDXB 2CLDX 4YA6A 4NZNA 1JVSA 3ESAA 2JA1A 1RKBA 3ZKWA 2A9JA 3I58A 2C3UA 4HRAA 1QLWA 3ZDBA 5ITZA 4UMFA 2A33A 5LQJA 2PRJA 3CNNA 3LX4A 2BI8A 4XOUA 3AKCA 5AI5A 4IHJA 3ZW8A 1ZNZA 4L15A 3AXTA 2PANA 4DRZA 4QU9A 3IBGA 4WJLA 2I3BA 1PJSA 2QM7A 2B82A 4RH3A 1E3WB 3MCUA 4U2FA 2NYUA 3A1CA 1G3UA 1OBVA 2YJ4A 5EIBD 3WMWA 4DYDA 4RS4A 4EKYA 1ZL2A 4JLNA 3TL2A 3TG8A 1AURA 3TBKA 4Y9DA 2GJ8A 4PR3A 1L4GA 5HQ3B 1RZRA 5H1YA 3LOUA 1YC2A 3B1JA 2YWCA 4QOFA 5DTEA 3PIIA 4PPNA 1NWHA 5KDLA 3IEXA 4MGEA 1UM9A 5ARCA 1X1QA 1J0XO 1EA7A 3BWEA 1Y6RA 2VP6A 4CLHA 1SBTA 2X2OA 4V2IA 2DPYA 4UNSA 5I7FA 2GO1A 4EG8A 1N57A 1U04A 3AJ9A 1P0IA 3GB9A 5JMTA 3IQGX 2H2GA 2ZRHA 3IMFA 1PKXA 4NH0A 2UYQA 3SDBA 1M2VB 2B25A 1ZJJA 1H0HA 4TWRA 1WETA 4MS3B 1TT7A 2JVKA 3NIGB 1FFWA 5DW0A 4L9RA 1I33A 2BCJQ 4IIJB 3MWKA 2BDEA 4V0MA 4YRTA 3ZWWA 2DCMA 2IHVA 1XLUA 2Y4NA 5EE5B 4C5AA 3KUXA 4PXAA 4Q4AA 3ILSA 3LBIA 3HZRA 1OQAA 4RZXA 3EPJA 1AHNA 1DKNA 2AYXA 3NHFA 5AVOA 3MIIA 2GM9A 2FZKA 4M1OA 5MGBA 5BWOA 1YMVA 3E9NA 4F38A 5TPWA 4RH1A 1ULTA 4JAVC 5A2GA 1I0ZA 5BVHB 1HF3A 2A7QA 3UAWA 5JZMA 1IBKB 3PKJA 4H7EA 4P1ZA 4IS2A 4CR8A 3RYCB 1CJSA 2QNBA 1A71A 3O0DA 4IGEA 3HP4A 3Q3CA 1PZNA 3TTTA 1L9XA 4V0RA 4BGVA 1W5BA 1XJQA 3IEVA 2GZHA 2GERA 3OEHA 4CCAA 5BSEA 1YGPA 1B14A 2RGCA 2V5UA 1JT9A 3WTBA 2J3LA 3C6XA 4H4CA 4PC7A 3RRFA 1UPFA 1E3DA 2YMMA 4ZVOA 4TUYF 3JD4A 2YZ2A 3T12A 2HO4A 3R9IA 2GF0A 3EISA 1GA4A 4REQA 3OZXA 4G8DA 2LZ0A 4O1HA 2FFHA 4KXYA 4YDSA 2QVLA 4PZAA 1WZNA 5DIFA 2IYAA 3KPJA 1DP4A 2FUG1 1N6KA 2JGDB 2XD9A 3MINB 2NV2B 2A1IA 1QG4A 5ITVA 3PNKA 1XZGA 3OAAA 1KDZA 3AEQA 4NOLA 2RHTA 4ZVVA 2Z4RA 3B60A 1M34A 4DV0B 5F9HA 1KDTA 3I6YA 3CLRC 1IZ7A 2A0UA 3N2LA 1S02A 1VSQA 1X7DA 2G06A 2N3ZA 2Q7DA 1MH1A 1ZGCA 1TW3A 2H00A 2P2DA 3F4LA 2ZJBA 1CDOA 5AOBA 4GKKB 1FJHA 2C5HA 1DG9A 3DE7X 3O8DA 3Q2KA 3RC7A 3TTXA 4YMHA 5K3FB 4WKBA 3KYCA 2ORYA 3NANA 4RQTA 1RWOA 1Y9DA 4MWSA 1IBMB 5K3EA 1THZA 3HVKA 2EHJA 4OP2A 4TLDA 3SVLA 2A6PA 4W82A 4WK2B 5DCUA 3RRJA 5CA1F 1Z83A 4MV6A 3OQJA 1YB1A 2CUTA 3AETB 1WHSA 3KQMA 1KH3A 2AV6A 1QH1B 4JQYA 4HNQA 4LHZA 4C05A 3CTMA 1CEQA 1ODKA 5DN6D 4RZHA 4CGYA 5LQUA 2MCFA 4BLTA 4CF6A 2N1BA 1OX5A 4OXIA 1E6KA 4TMXA 3CR3C 1F3OA 1XQYA 1MTZA 4YGXB 1K63A 3HACA 3DLBA 5L6MB 2UZIR 3D6JA 1ZXXA 3IQWA 3MLAA 4P7BA 4WXPA 5AK6A 4R1MA 3TZLA 4B48A 4J7CA 3OFVA 4JUBA 4MA4A 1CFZA 2YXNA 3NHWA 1ODIA 4WOJA 3UENA 1A5SB 2VDOB 2XODA 1JT2A 5AVYA 4AO8A 2X1MA 3HB9A 4ZK2A 3TIFA 5KZMB 2VQDA 1PEAA 1ZM9A 3AR5A 3PXAA 4YUZA 2KM1A 1S9DA 2RHOA 4C08A 4RVSA 3UAXA 3VV2A 3EWNA 2HWKA 1IQ0A 4QUAA 1P1KA 1X0XA 1PGPA 1YJCA 3OT4A 3QENA 5H9VA 1CJCA 2J0EA 3HYTA 2O0HA 3IUBA 5FNVF 3T0FA 3T1QA 4N8EA 1DKMA 1JXMA 1S2LA 1PJ3A 4L51A 2QVXX 3CVWA 2YUTA 3CRZA 3ZDFA 1G5TA 1H0KA 1NI4B 3E82A 1KO4A 4R3NA 1J1IA 3WSWA 1AO0A 4W6QA 3GU3A 5TPZD 3E3AA 1YONA 1JR6A 2QD2A 2FEXA 4B4UA 3O4VA 5HIAA 1LBEA 3HB7A 3WKCA 3W6OA 3EXIA 1Z33A 1EGMB 3C24A 3OJCA 4V0QA 1C0LA 2CLSA 3LWBA 2BR4A 3JVEA 3O0TA 1MVNA 1TOAA 5IM5A 3VNSA 1JSZA 1ZSVA 2WG1A 4QDOA 3I9KA 2EJVA 4YAJA 4AG6A 2FCAA 4FNGA 4RK0A 4FGZA 3TOSA 4B6OA 1DQSA 4CUKA 1KSHA 1F1JA 1LZLA 2GAIA 3PUIA 5EMNA 5ADVA 1GGJA 4Q4HB 4XX0B 2Z2ZA 2WIKA 2VQ6A 4R81A 1FFCA 2DJ5A 3F6EX 4LSWA 4ME6A 5JYBA 4X62B 2B99A 2QP9X 3AJ8A 1E77A 1WX1A 2CHUA 3H42B 2OM6A 4F3NA 1J56A 2YQ5A 2FDCA 2FZLA 1CKEA 2JKYA 2KJQA 4RIFA 4C7BA 9MHTA 1KDYA 3T95A 2R6ZA 1Y1TA 3BH0A 3RFTA 3VC7A 2W2NA 3QX8A 1GYRA 3ZGNA 4YAGA 2FN9A 4NESA 3SDSA 3WHPA 1EFCA 2ZETA 4D57A 5BVGB 4KZKA 2HU7A 5JAZA 4YV0A 2BGGA 1WQ3A 4N65A 4PLPA 3FVRA 4TSKA 4BO4A 1I32A 1PD1A 1S4MA 1U8YA 2X3UA 3D7SA 5LQKA 2ZB4A 4M98A 1PWYE 1RJ9A 3OZBA 5TE9A 1KVTA 2QAGA 3PVZA 3FE2A 4AZ3B 4NRDA 2JIQA 4Z99A 1SUEA 3K5PA 1CZRA 5GINE 2QM8A 2IYVA 4H7FA 4JOSA 4XKJA 4R5HA 3MPUA 1EUZA 4G1MB 1MMFB 2JB9A 4OHXA 4GFDA 2CJFA 3UXEA 2J9YB 1Z63A 3BFXA 4C3OB 3LYUA 4Q0MA 4CG0A 3FJ1A 1ZM7A 4YJ3B 4QOHA 3GCGA 2O54A 1E3SA 2AZ4A 3H8SA 5HRUA 1CVLA 2L17A 3CZMA 3ZE9A 3R09A 1EJ0A 1ZRNA