5FPHA

The gtpase domains of the immunity-related irga6 dimerize in a parallel head-to-head fashion
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
399
structure length
395
Chain Sequence
DLPSSFTGYFKKFNTGEEIISQEILNLIELRMRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGVVEVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPNTYLEKMKFYEYDFFIIISATRFKKNDIDIAKAISMMKEEFYFVRTKVDSDITNEADGKPQTEKVLQDIRLNCVNTFRENGIAEPPIFLLSNKNVCHYDFPVLMDELISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQRIWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLARDWEIEVDQVEAMIKSPAVFKPTDETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVTEDAKTLLKEICLRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords INTERFERON-INDUCIBLE GTPASE 1
publication title The Immunity-Related Gtpase Irga6 Dimerizes in a Parallel Head-to-Head Fashion.
pubmed doi rcsb
source organism Mus musculus
total genus 107
structure length 395
sequence length 399
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.6.5.-:
pdb deposition date 2015-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05049 IIGP Interferon-inducible GTPase (IIGP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fphA02
1VECA 4EUNA 4JVLA 4HATA 4DLUA 5EE3A 3TUJC 5E7MA 5BYKA 3EX7C 4JJZA 1JQJC 3PG5A 3PCRB 4I99A 4NCIA 1ZCAA 1CULC 1P2TA 4M8NE 3AGQA 3SI7A 2NO7A 1HUQA 3AUXA 4Q4JB 1MRNA 1TTTA 1K8RA 4X8HA 2QMEA 2Z6VA 1GDDA 3UMFA 4Q4HB 2MMGA 1IQPA 3R7WB 2JIZD 2VL7A 4U00A 4A92A 1KO4A 2ASEA 1E1QD 1TF7A 1P3JA 2OG2A 2WBLC 4Q1FA 3LLMA 1JI0A 2FFAA 3EXAA 2ZJOA 1ZNZA 2PZGA 2JLRA 3R9WA 4NCHA 5KYKA 5GJBA 1A1VA 1E1RD 1ESNA 1N5JA 4DCNA 5JECA 1NSTA 1IN5A 2QMUA 1XCPA 2XNSA 5DNYB 3EPHA 4BGDA 1W7AA 5JJKA 2OLJA 2JLZA 1N6KA 4UXIA 2VP0A 5JRJA 1I2DA 2J0QA 1LF0A 4D4LA 1ZIOA 5L3QB 4F4CA 5LD2C 3P27A 3C5CA 3CX6A 4ILEA 2QNRA 1KMQA 4JL5A 4Q7MB 2Q3MA 2P2LA 5KSZA 1QZXA 3KKPA 4HEJA 4BRUA 2ZVQX 4OKSA 2K5UA 4DCVA 4BFSA 3Q5EA 5J4HA 1IN8A 1E2NA 2NZJA 2V6IA 2NG1A 1Z0FA 3FDIA 4B3DA 1S96A 3N5CA 1ZM7A 2X2FA 4JSTA 4LJ6A 1GNPA 1UBGA 1LFDB 5FBWB 1VDZA 2B8TA 4ZIRB 4OK3A 2FSFA 3QKSB 1VG1A 1DTSA 1OJLA 2QAJA 4A0GA 1G18A 2BKUA 2F1RA 2VHUA 4AG5A 3I32A 5LB2A 4A0HA 1AN0A 4XD7A 1W0JA 3FYHA 4GMXA 1F60A 3EAQA 1KO8A 1R8SA 1U81A 3X1WA 2IYWA 3B1XA 1N3BA 1UADA 1IOZA 4YMVA 5AJXA 5JJLA 1IJFA 3C16C 3MWJA 1GITA 1XMIA 3AF0A 3B1VA 4BWYA 1GZSA 4MYCA 2PEZA 4Q7JB 2RGDA 3DPUA 1CLUA 1Z83A 2AK2A 4FXPA 1KAOA 4NYJR 1R0WA 4NZYA 4OI2A 4QBGB 4LBZA 1Q1ZA 3LBIA 3W6OA 2CVHA 3OFND 1G6HA 4HLUA 4Q00A 4IDPA 4P4SA 4DUGD 3PEYA 1D5CA 1XPOA 2QQ0A 1L4UA 4PFSA 2H17A 3IHLA 1KDTA 4CEIB 2F55A 3BH6A 3OESA 4LHYA 1GOTA 4E03A 4KI0A 2EQBA 2Q0HA 4V0OA 3A4NA 4BFUA 2QP9X 1XJQA 5CJPA 2BBWA 1Z2CA 1SVLA 3FMPB 4LJ5A 2KBEA 4RKFA 3UWOA 3LXXA 5FOSA 5HZKA 1OV4A 4NYJQ 5FPYA 1LF5A 1Z0KA 3NXSA 5L3SB 4EJSB 4CEJB 4OHXA 4YMWA 2Q9AA 1KI7A 3CWQA 3OEED 3OE7D 2PMDA 4Q1CA 2FU5C 1ZUIA 1U2RA 3C41J 3ZZUA 4CEHB 2QE7A 2F9LA 1Q3TA 1K6MA 1LY1A 1YZLA 2UZIR 1KMHB 4JT4A 4AURA 4IEEA 2GKSA 1XTKA 4RCZA 1DAHA 1TL7C 4KBGA 2Q3FA 2FMXA 1R8QA 1T4GA 1W4AA 3K0CA 1I4TD 1G7RA 2J9RA 2WJYA 2FN4A 2OCYC 4XSGA 1X86B 2HJGA 1P5ZB 3ADKA 2ZI3A 4LX0A 5KO2A 1YZNA 2D3WA 1R0YA 4PXAA 4LV6A 3QUSA 2ZE6A 3B7GA 3THYA 2W2XA 2ZYWX 2REOA 3DDCA 2ORVA 3B6EA 4RFSA 3SFZA 4Q18A 1NMZA 2D62A 5A0FA 2BBOA 2DWOA 2V4ZA 1L8QA 2O0JA 5DE3A 3QKTA 1US8A 4TQAA 5CB6A 3NHAA 1I2MA 5C2JB 2YJTD 2GTPA 4LPKA 4A0FA 3GPLA 2D4HA 3THXA 2RAPA 1Q3HA 4TTQA 2VP9A 2QG6A 2WWGA 2AR7A 2H16A 4M21A 1X8JA 4IVPA 1UBEA 3NH9A 4D0NA 1EFRA 3KTAB 5K8TA 5AJYA 3H84A 1OIXA 4NCNA 5H8WA 2JLVA 3EZ9A 3LAWA 3ZH9B 2PZFA 1LW7A 1RZ3A 1E2MA 4BPBA 3CM0A 1BOFA 1UEJA 3BK7A 5TB5A 1NL3A 3MFYA 2KB0A 4I1SA 4I4LA 2GVZC 4JMPA 4JBXA 4A6XA 5HE9A 5KPJA 1E2FA 5AUQA 1RIFA 3CZQA 5EE1A 1OFHA 2OCBA 4EFLA 5FPHA 3ZVLA 1JXOA 3CRVA 4F4JA 1E9AA 4LC0A 1E98A 1T8TA 2HXYA 4ZCMA 4C2TA 1G291 3CF6R 4GSYA 1J70A 4HI0E 1JQLB 3EZ7A 2QN6A 2NPFA 2PJRA 3SR0A 2WWIA 1ZD9A 3Q5DA 4AK9A 1G3RA 3QJYA 4V0LA 2C77A 2GRJA 2VBCA 1OXVA 4B6FA 4QM6A 1O3YA 3T1QA 4TL9A 3CR7A 4AC9A 1RC8A 1DADA 1OH6A 2DWQA 3TVTA 5JRZA 1YZGA 2CJWA 2GNOA 4UNPA 1Z8FA 2ZE5A 4WOPA 1XCMA 3GEHA 2HUPA 1NP6A 2HT6A 3ZGXA 4ASUA 3SEAA 1YKSA 2RGEA 2ZJ5A 5C4GB 4ABYA 2V8OA 3FGNA 1QHGA 3O47A 2IYSA 3JZAA 2P65A 4DSUA 4RCYA 4EDHA 4HYYA 2A5GA 2GF0A 3UPUA 5DO9A 5JWRA 2AN9A 4FWIB 5ELXA 4WIAA 2F43B 4DDWA 4J0QA 1DPFA 4ZDJA 4WAUA 3FHTA 2FZ4A 5IHPA 2JLWA 2W6JD 5K8UA 2AHOA 3QG5A 3LFUA 1U8ZA 3G5UA 5FL3A 5F9HA 5FTMA 3HYTA 2JDID 3EW9A 3U7GA 1JJ7A 3HJNA 2IWRA 1W1WA 1PLKA 5KSPA 3LQRA 2ZI9A 4RZ2A 5CDFE 5EE5B 3TSZA 2FZLA 3GFTA 2OCPA 4ON9A 3P1JA 3K9LA 1N0WA 3RC8A 5CLLA 4JLAA 2W58A 4Q4AA 1FMJA 1NF3A 4DHEA 1T5LA 1D2MA 4PHTA 2DFKB 2W00A 5H1YA 4O2RA 1TF2A 4O25A 1EFTA 2BDTA 1T0HB 5CYPA 1VYVA 1X8LA 1G8FA 1G3QA 1HY3A 2H92A 3TH5A 4C0BA 4P32A 2AD1A 4A82A 4CRWB 2XNDA 3FKQA 2AK3A 3MJHA 3S1AA 2GCOA 2OFWA 4GZMA 2BMFA 4DC9A 5BYJA 5M04A 2FFBA 4QRHA 2V1UA 3SE0A 4DB2A 2W2TA 1ZU4A 4LYAA 2ZI5A 3QKUA 2Q6TA 2ZVPX 4AKGA 4BLPA 5CYOA 2J7PA 2AWNA 1GAJA 4QOSA 2EVWX 4A1FA 4UJ5A 5HKKD 2A5YB 1E2GA 1S2MA 3I73A 2QBYA 3GJ8A 3NDBB 5KDDA 2MMCA 3BAFA 1P7CA 3T06B 5E3HA 2WSSA 4D4KA 2JLXA 2OZEA 1Z0JA 2YOFA 1KKMA 5CDFA 1L7VC 4IHQA 4PANA 1W36B 4TMTA 4PQFA 4DCSA 2WPDD 3R20A 3KXKA 1DELA 2GEVA 2QPOA 3PUZA 1YR7A 4HUQA 4BLQA 5JI3E 1E2HA 3MAAC 1KKLA 2J1LA 3PFIA 4NHOA 2C9OA 3T35A 4D82A 4HLDA 4PAOA 3BOSA 1KO1A 1PZNA 4GRAA 1OLOA 2F3TA 2ZJYA 3U44B 1BS1A 4ZPXA 1OXXK 2PJZA 1ONBA 4P0TA 1G41A 2J45A 4C0AC 1XJ0A 4B6EA 4A8JB 2OAP1 1SXJC 2JASA 1QHNA 2KI5A 1H8ED 1Z6AA 2DY1A 3RS0A 1AIPA 3H1TA 1TUEA 3I92A 1CRPA 1XTJA 1VG9B 3KUDA 1UJ2A 4GP7A 721PA 5F98A 5BN4A 2AX4A 4JIMA 1SGWA 5FTKA 5G41A 4BRWA 4H9GA 1KOFA 4XOIA 4IFEA 4GOKA 4Z51A 2ZM5A 4LSGA 3L8ZA 3ZIAA 4LWZA 2A30A 2Z0MA 3QKRA 3BB3A 2PMKA 4B43A 1TAGA 4MRVA 4D0LB 1LS6A 3A36A 1NN3A 4DDTA 3SHWA 1XXHA 1PLJA 2OXCA 1MABA 2CK3A 1Z29A 3IPYA 3NBZC 1N6OA 3GJ6A 4GNKA 1AA9A 1Q0UA 3RDPA 4LYFA 2NO0A 5DI3A 1QDEA 3A37A 5FTJA 1MOZA 2GILA 3LBHA 1SXJE 1DBSA 1JEEA 1ZU5A 3DZ8A 4HAZA 1E4VA 3TIFA 1YRBA 2ZU6A 1CIPA 3T1VA 3W8NA 2IEZA 3NBYC 5JS8A 1J99A 2VF8A 1W5SA 2VP6A 2RH5A 4BFVA 1R0XA 1KZGB 4XH9B 1E69A 1FW6A 2HT1A 2ZSEA 3CBQA 3NKVA 4N0EA 1RFLA 1MH1A 2VQSA 2XITA 4HAYA 4TSFA 4E5UA 4DDUA 1RPZA 2C78A 4E22A 4PZYA 2O8BB 1LVGA 4B3FX 1E2QA 3BH7A 3ND8A 4IVRA 4PAQA 4EAQA 3C5HA 4QNRA 1HYQA 3AVYA 3U4QB 3ZVNA 2GJAA 1ZVQA 4YXWA 2ZXUA 4MGIR 4QBHA 2BWJA 4US2R 4GOJA 1SKQA 4Y0VA 2FGKA 3FOZA 4EQ6A 3LDAA 4DLXA 1RVDA 2IYVA 3T15A 5FTLA 1PUIA 2JATA 4V0KA 1TQ4A 3ADDA 1RE0A 4BUJA 5CB8A 4B3CA 4S35A 1RYHA 4F91B 3GMTA 4A6PA 5SZHB 1AGPA 1WP9A 4Z8XA 1SVKA 4KSCA 3WNCA 4F92B 2P5TB 3QBTA 1QVAA 2JCSA 2ZRHA 4EIWA 1I4DD 3PQCA 2CDNA 1G16A 1YZTA 4IDOA 1ZP6A 2V7QA 3UATA 3BE4A 1SVIA 1OFUX 3MRSA 3M4YA 5LDDC 2FSIA 1KSJA 1FX0A 3T34A 4G5RA 3IPXA 2D7CA 4Q66C 5FOXA 4FN5A 1CF4A 1XTSA 2WICA 3BH0A 4DZZA 4BEJA 1G7TA 2PT7A 4U7DA 1XJCA 1WE2A 2ZSFA 4B3BA 1CU1A 4HAWA 3M1IA 1NVWQ 1XEXA 4JLBA 1TNDA 3LA6A 5B2ZA 1M1YE 3B5JA 4B33A 4RD2A 1E3MA 1JALA 2WZQA 5AUNB 4XJXA 1OSNA 4NL4H 1E9RA 1OHHD 1GFIA 1QHYA 1EFCA 2DFTA 3SU8A 4L5BA 1FP6A 3IDQA 3LVQE 1CKEA 2F1HA 3AP1A 1E9BA 4LBYA 3EASA 2JLYA 3TQFA 2AD5A 2XOKD 2RGGA 3B85A 1W49A 1ESMA 4ZDWA 1EFHA 5H70A 4DLVA 1YQTA 4ZV4A 1U0JA 2PEYA 2PT5A 3FHOA 3SZRA 1JPNA 3TNFA 2BVNA 1OXSC 1AS2A 1VTKA 1T9HA 3KJHA 4G5GA 2KSQA 3REGA 3PXGA 2ZUCA 3KKMA 4US1R 3AUYA 1P73A 1WB9A 4JS0A 1COWA 2ZI6A 2WOJA 1EWQA 1XD9A 4TYWA 2R65A 3MLEA 5CM8B 4D25A 3UANA 2QENA 1OF1A 1Q57A 2F7SA 3WP1B 4MA4A 1G8GA 3GJ7A 4ZCLA 3RSLA 2HLDD 4Y0AA 2DB3A 3GLFA 1J7KA 4M1MA 3KFVA 1DEKA 2XEXA 3TSWA 4ZDKA 2OBLA 3AVQA 3GJ4A 3H4MA 1OIWA 2GZAA 2OUKA 4KU4A 5JWHA 4FWTA 4M1KA 4ZI2A 4KFSA 2O5VA 4HB3A 4IKEA 4WZ6A 4V0ME 4RFSB 2CCKA 1VG8A 2G1KA 2XJ9A 4Q9HA 2YC2C 5JSZB 2DR3A 3R8CA 4Z8YA 4ACBA 4QBIA 4LI0A 1DAMA 5EP3A 5HR5A 3A8TA 3THXB 3P4XA 3BGWA 2IUSA 1Q44A 3NVAA 4RD4A 2W6ID 2ZJ2A 5AWFC 2NO1A 1E2EA 4RVCA 1G20E 4RZXA 5FTNA 4LY6A 4TLEA 1TQDA 2ZJ8A 2NOAA 4OQFA 3DHWC 2G0NA 2B92A 2W83A 2IXFA 3FTQA 2ZSBA 2RGNC 3SC3A 1YVDA 2VO1A 4JLJA 3KJIA 4G5SA 3AM1A 5DSZA 3EG5A 1T3HA 1CTQA 3IEVA 3CRMA 5F2EA 4XVQA 4ITRC 4C3ZA 2ZREA 3ZVRA 4NH0A 3I61A 5FL7A 3KUCA 3FB4A 3ZD6A 3I8XA 1G3IA 1IJEA 5KTYA 1GTVA 5J40A 4KAXA 1H65A 2LCFA 3CPEA 4W5JA 4TWZA 3UG7A 3B9PA 3UMRA 2CLCX 4B3GA 2G6BA 2GAOA 3CF0A 1DE0A 1XNJA 3ZS9A 1FQKA 1ODFA 2EW1A 2EU8A 3RRZA 1FP7A 1CP2A 1ZBDA 5EE0A 3GFPA 4YQFA 1ZNXA 5HZHA 4OHZA 3T61A 2CJWB 4XWKA 2QROA 3Q85A 2GJSA 4EPXA 4DSTA 4QKQA 1W36D 3M0EA 2CXXA 3A1SA 3QE0A 4OHVA 2FPLA 4AY2A 2VHCA 1T3LA 2G1JA 4LUCA 4JBWA 2ZRIA 3K0EA 4Z1MD 3GFOA 1KSGA 1VCIA 1VCMA 4TN1A 3RANA 1P4SA 1PUJA 2AKYA 2BHRA 1MRSA 1J90A 4BLTA 4AD8A 2ZI4A 3JVVA 4DJTA 4H1UA 3O8BA 3H86A 3GLGE 1JEDA 3REFA 3AVWA 3E1SA 1DG3A 3KL4A 3RWOA 3TQCA 5DN6D 5E4FA 3K0FA 3B1WA 5JLJA 1C4OA 1GP2A 2G0TA 3IQXA 4RD6A 3G0HA 4DLTA 1RW4A 3FMOB 1JNYA 1HQYE 1JR3A 3EPLA 2DHRA 4HDOB 3VHXA 1CJVC 2IYTA 2OILA 4PC7A 1CR4A 1KTVA 2IHYA 5FPSA 2HV8A 4BE7B 1YR8A 2IF0A 3Q7PA 1P2VA 2OM2A 1RKBA 2CL6X 3WMEA 5BWMA 5BXQC 5JCZA 4URVR 2OAQ1 2GWHA 4OHWA 4X8OA 1BH2A 2GESA 1U9IC 2QTHA 1HE1C 4LBWA 3WHLA 1YHNA 4I1UA 2Q3HA 2V6JA 4OI0A 4NONA 2GF9A 3GLIA 5TXGA 4PQRA 1FTSA 4M4SA 2IA5A 3H2YA 1E9FA 2VP4A 1BKDR 4I1VA 4BQSA 3E2IA 3WNBA 4NBSA 1M7HA 2Z83A 2HEIA 2RGNA 3S1AB 4AIIA 2GCOB 4BFXA 1VYUA 1EX7A 3IQWA 1SKYE 3CRQA 3WMGA 3V4FA 4QGGA 3A1UA 4MDEA 4Q21A 3FKSA 2ZSAA 4B35A 3T1TA 3OEHA 2O8DA 2BV3A 2QAGA 5SZJA 1TPZA 4OI4A 3CB4A 4OBEA 4DLZA 1Z47A 3BIFA 5GJVC 2X19A 2ZEJA 4HZUB 3PR1A 3TJZA 1IXZA 3B1YA 1YZKA 1YRAA 1OH7A 4LJ4A 2D74A 1B0UA 2VYFA 1E2PA 2O52A 1KK1A 3R9XA 4Q47A 2BCJQ 4XTCS 4AKEA 5GADl 4DLRA 3AGPA 3J81k 2NO6A 2ZS8A 4A15A 1A4RA 1J2JA 4QGFA 3ZYCA 5L3VA 1G64A 1S4QA 2Q21A 2RHDA 2F9MA 3U3MA 4LJ8A 4FD2A 2CNWA 1KSHA 3IEUA 3LW7A 1AGRA 4DT1A 1GRQA 1GM5A 1W0KA 3HPRA 3QXHA 4KFTA 5KPDA 4HUQB 1MKYA 3IUYA 2H5EA 1TF5A 4DCTA 1XZQA 3U3KA 2PBRA 2DBYA 2FSGA 1S9DA 1XTQA 2P0EA 4NPHA 2XXAA 2NIPA 2ZRCA 8OHMA 5KDLA 2KJQA 1NVVR 3QXSA 3TGPA 2P6NA 2ZUDA 1KY3A 4OJQA 3WBKA 4TZ6A 3N2IA 3LV8A 1OE0A 4EKDA 2RGXA 3KQUA 4XD7D 1RJ9A 1W0JD 3CONA 2WWFA 1KZ7B 1TEXA 1F5NA 1CR2A 4W5HA 2DPXA 3OEHD 3ZQ6A 5GVSA 5C1BA 2QSZA 1E0KA 4BZXA 3DOEA 4CT5A 4E07A 1NIPA 2CMKA 4LV5B 1NMYA 3EZ6A 4YMUA 2Z43A 4QFMA 2ANCA 2AWOA 4MKFA 3RNLA 4OQXA 1NVVQ 2A2ZA 2ZRJA 4KHZA 1N0UA 1AZSC 1N6NA 2J41A 3CNNA 3QPVA 5FR1A 4DLYA 3NEYA 3ICQB 3NC1C 4PPQA 3W3AA 5DYGA 4D26A 1G21E 4OI1A 5A5GA 1P9NA 3AB3A 3MUFA 1CR0A 1W46A 2V55B 3LNCA 1N5LA 2PLRA 2WIBA 1XXHB 3AF4A 5JZVA 1W0KD 3WYFA 3ICEA 1VHTA 2N42A 3AV0B 2V54A 4NDZA 4JKIA 4JLOA 5FOVA 5L8VA 5DI3B 5TVKA 2FV8A 4C0HA 4LHXA 3VR6A 4DKXA 2XTNA 4URWR 4RKEA 4Q1BA 4F93B 3VX3A 4F4IA 1XRJA 1R7RA 4M2LA 2ZR9A 4GBMA 3U7EB 2C99A 4JT2A 5DHFA 5K8IA 5D3MB 2OFOA 2CE7A 4BFZA 1XX6A 2IS6A 1QRAA 1G8PA 1KNQA 2WWXA 1AZTA 2WAYA 3LD9A 4CZ2A 2YKGA 1NKSA 4HLQB 2RGCA 2QE7D 2J3EA 5C18A 1XDBA 3EWAA 121PA 3I62A 1MR3F 3TE6A 3TAHA 3QF4B 5J47A 3AVPA 1JPJA 2FX3A 4L9WA 3ZZTA 5JS7A 3Q7QA 2QI9C 2BOVA 3HU1A 4HDCA 4R2HA 4YLGA 1KO5A 2YYZA 2XTMA 1OKKA 4LDJA 4Q9JA 1A82A 4ACAA 3TW4A 2B7CA 1IY0A 4LRWA 1R2QA 5JEEA 3GLHB 1R5OA 2ZYUX 4TLDA 2PCJA 4Q48A 2C9CA 1UFQA 4LV8B 5JHGB 1QHHA 1FQJA 1H8HA 4R98A 3VNUA 1VG0B 2ORIA 2GBLC 1WRBA 3DEFA 2ATXA 3AEZA 4B47A 1EWRA 2IYRA 3WNDA 3M6AA 2FH5B 2QRNA 2X1VA 1N6HA 5AJZA 2P6RA 1EFRD 4JZKA 3DKPA 3QNUA 3DKVA 2QTFA 1S0UA 1VYTA 2GXUA 2FF7A 4DSOA 3FFAA 5FUYA 3VFDA 1ZCBA 1KI6A 3LY5A 4TLBA 3WHKA 1E0AA 2O8CA 4D4JA 4G3XA 1E0JA 2D06A 3W5JA 1OB2A 2FOLA 3SDZA 3QOFA 2OFXA 5JJIA 1Z06A 1XEXB 2EFHB 5JBQA 3HPQA 2H8KA 2YZ2A 1VIAA 3CLVA 5HCNA 2WVJA 2ODNA 2VH5R 3LWNA 3QBVA 5DHAA 2XSZA 4KLZA 5IDVA 1MO3A 3CX8A 1OH8A 4URUR 3N70A 3PEUA 1BIFA 5GVRA 1WMSA 4G01B 2OO7A 4K81B 3PITA 2C2HA 1N6PA 4JSYA 4Q4HA 4LGMA 4EJSC 1XWIA 1KJZA 4Q1EA 2O8FB 1T8UA 1SVOA 4A2QA 1Z07A 5ANRB 2ATVA 4Q19A 4L15A 1IY1A 2H57A 4GZLA 1AJEA 1EFUA 1GL6A 4GT1A 1EESA 1G5RA 5KSYA 3L0IB 3O8DA 4AG6A 1BMFA 2IT1A 3IBGA 3K09C 4M53A 4ASUD 3I5YA 2IXEA 5F9FA 4L8GA 2EFGA 4QHSA 5AR1A 4UNQA 1KI9A 4KBFA 2VSXA 3DMDA 3F0TA 1TMKA 1E0SA 4KCGA 2Q9CA 1ZM3A 4Q1DA 3GLFB 2MSEB 5FPKA 3LX8A 2HF8A 1VCOA 1ZYUA 2G9NA 1WXQA 1DS6A 3BFVA 4XWAA 1P6XA 4NYMR 4TYPA 2PL3A 4TQ9A 2EFDB 1GWNA 2XSZD 2CVFA 3CPJB 4UQOA 2QPTA 4JVNA 2JGNA 3SYKA 2FJUA 3C15C 3W5IA 1M7GA 4M1WA 3TSOA 4ZIRA 3QENA 2ZRDA 4RY2A 3QSYA 1WF3A 4TLCA 3U61B 1XPUA 1G9XA 3A1VA 2PZEA 4LC1A 5EZ6B 3ND9A 3SJZA 3K0AA 3EIEA 1KO7A 1TQ6A 3WBJA 3E5HA 3U6BA 2EFCB 2CCGA 1HEIA 4XVUA 1E9EA 4NYMQ 2ZRGA 2J0UA 3U60B 1QG2A 3MCAA 4JBYA 5EP1A 1UKYA 3EIQA 3KQHA 4G0NA 5HE8A 5JFGA 5CM9C 2XNDD 5DYIA 4PQYA 3MG9A 4M1OA 1CJUC 1F2UA 2ZJBA 5EXXA 3R9IA 2CBZA 1KDOA 1GSIA 1PV4A 4MRSA 2JEOA 2QY9A 2R6CA 4PAMA 4HLCA 3QEOA 3P32A 2GJ9A 4UXHA 1Z6XA 2GCNA 2VA8A 2J46A 2ONJA 4JL6A 3U3OA 2FWRA 3QY0A 1U8AA 2GJKA 1O87A 1ZNYA 2BJWA 2R2AA 4BLOA 3FE2A 3NC0C 1N2CE 1P72A 4Q7LA 1D8TA 2J7PD 2IS2A 4URXR 4N3NA 2ZJZA 2OSBA 3K70B 4P4TA 2YINC 2ZRPA 3SJAA 3TAUA 2BEJA 3MGCA 2BEKA 4CEJA 4BFWA 2RGBA 2OHFA 3IBYA 3VQTA 1TUIA 5JI2E 1E79A 3PVSA 1AKYA 2GJ8A 3ASYA 3NG1A 4DBLC 2WSSD 1NBME 2EWVA 1SQ5A 1YZQA 4UKDA 4WBSA 1AQYA 4DB4A 4GP6A 1P60A 3SQWA 1EG7A 3QQ5A 2IC5A 2ZE7A 2JA1A 5KU1A 1OFTA 4MYUA 4IXNA 2BM0A 4BEBA 1G7CA 1UPTA 2ZTSA 3W6PA 3WYAA 3FFBA 3RS2A 2G88A 3G82C 1MO5A 3WMFA 4MUBA 3O8CA 5KUTA 4L4UA 1F48A 4TQUS 2GVDC 2ZU0C 3ASZA 4CW7A 4CYMA 4B73A 5C46F 4NE2A 1DO0A 2OBMA 3NWJA 4HAXA 3K0FB 2YV5A 4M1YA 4OK6A 5DLQC 3D7MA 3W6NA 5FBQB 1E9SA 3ZDQA 3KXIA 1E6CA 3EA0A 2V9PA 4N1AA 2GDJA 3RAPR 2C98A 1W44A 1U94A 3EIHA 1NKTA 2NO9A 4PSVA 2C96A 1KGDA 3VHLB 2WOOA 1AM4D 2BMJA 1E4YA 1P2SA 2WM9B 2WSMA 3IIJA 4R2IA 2W0SA 1FPMA 4MRNA 3T5GA 3ZIAD 4NTZA 4CIDA 4IRUB 4DLWA 4NU0A 1E79D 3UMSA 3IHWA 5EE9A 1WBBA 1Z0IA 4Q9IA 3I4LA 3KTAA 2WJHA 5BN5A 3ZS8A 1VKJA 3CO5A 3TBKA 1U90A 3GLIB 3RS3A 4LPSA 2CK3D 2UZ3A 1V5WA 1NBMA 4AYTA 4C0KA 1KAGA 4B2LA 1NG9A 1WDTA 5TY0A 2A78A 3QXCA 3CRW1 2UKDA 5TDHA 3L0PA 3ZQJA 4BZQA 1DAKA 1GRNA 2YOHA 5BQ5A 2JLSA 3OAAA 4LBVA 5CK5A 2X77A 1SVSA 2G3YA 2OCAA 2I4IA 4C7OA 3TKLA 1UEIA 3W90A 2REXB 4C0SA 1ZM9A 1K5DA 4TYYA 1NNEA 4PHGA 2DFLA 1SXJA 2XAUA 4NYIR 1P2UA 3K1JA 2NMVA 1QF9A 2O8DB 2QAGB 4TMWA 1W4CA 1M34E 1E2LA 2RMKA 1IXSB 3BWDD 3CUEF 6Q21A 4TT3A 2J0VA 2AFHE 3QPWA 4TSFD 4Q9LA 2C04A 5BW8A 1W5TA 1DO2A 1DVRA 5FUWA 5K8LA 2QU8A 2PLFA 1OYWA 2J59A 4ZKDA 1QHSA 4PTLA 3SYLA 1W36C 4JLNA 1N0VC 3WY9A 3BS4A 3P26A 2GEDA 3PUYA 3T12A 4YXWD 2ODBA 1Z22A 4P4SB 1W2GA 2RKOA 4NYIQ 1X1RA 2ZRMA 1ZM2A 3DM9B 3PV0A 3RYTC 5EZ5A 3PUVA 3Q72A 1II8A 3VX4A 4DT1B 4DVGA 1ZINA 2A3RA 3PEWA 2J87A 4EPWA 2Q9BA 3EZFA 3AKDA 3R8FA 1WCV1 3MMPA 2IBMA 4A8JC 3ETLA 3PUWA 1NY6A 2JJ1A 4X8MA 4B71A 2P6UA 3HU2A 4G5QA 2OLKA 3AF1A 3VKWA 3AVUA 2F43A 1ZAKA 2O8EA 2C5LA 1U99A 2YVUA 1MO6A 2VSOA 2VF7A 4CF7A 3SN6A 2ZUBA 3IIMA 3AH8A 4FCTA 3U5ZB 4QJ4A 1OYYA 1G3UA 1RJ9B 2ONKA 4TYQA 5J4VA 4GI7A 4KFUA 1W47A 3C8UA 5E7IA 3UKDA 3VAAA 4PHFA 1WBDA 1XMJA 4OQMA 1ZUHA 2C95A 2GZDA 2V7QD 2YWHA 3HR8A 4DEYA 2DYKA 4RSGA 1HE8B 1R5BA 5JMTA 4JVSB 4FIDA 5DGXA 1NY5A 2C8VA 3V4RA 3IO3A 3KKOA 1Z0DA 2R44A 3LQQA 4DWJA 3NBFA 4NMMA 4EPRA 2IYQA 4FMBB 2R6DA 4GL2A 1X1SA 4MH0R 4JKYA 1NN1A 3KJEA 4QJ3A 5LD2B 4PZZA 2JJ2A 4JLMA 1RYFA 3SYNA 1LS1A 3THYB 1ZD8A 1IN6A 1Z6TA 2BMEA 1XCGB 2ZE8A 3U7HB 3SJCA 4LYJA 2JLUA 4IOJA 2ERYA 3VR5A 4WXPA 1HV8A 4NP6A 3RS7A 221PA 4GFDA 1US8B 4JLDA 5L3RA 4LOAA 1ZNWA 2F6RA 3ZD7A 2DFNA 1D6JA 2ZQ5A 4NCJA 2R6FA 1S8FA 3OHMA 3KZ1E 3LH5A 2X2EA 1CXZA 3IIKA 3OIUA 4PX9A 4URZR 3LO5A 3MJRA 2OT3B 5G40A 5GJWC 2HYDA 4FCVA 4IJMA 4MYHA 3IO5A 3B2EA 4HDQB 4PO9A 5EXSA 1UDXA 1DG1G 3BBPA 3PUXA 1COWD 2C9YA 5IK2A 1BO6A 3AP2A 1L2TA 3C7KA 5EQTA 3CIOA 2QGZA 4RJLA 3A1WA 3CRRA 2ZYVX 2ZRNA 2PCLA 2ZPTX 1Y3AA 3SOPA 3QXJA 2MSCB 1EGAA 4MKGA 1CBUA 2D7DA 1N5KA 2V1XA 3IKJA 3MSXA 3THWA 4B75A 3BORA 2AFIE 2ECKA 3V9PA 1A2BA 3RSOA 1OW3B 2B8WA 1J8YF 1NVUQ 1D2NA 2F1IA 3AF2A 1TEVA 3AKCA 2KE5A 4KVGA 1IXRC 1HURA 4G1UC 2GXSA 1FTNA 2ZR7A 5EXTA 3U44A 1CR1A 1XU4A 1QG4A 1XPRA 2DCUA 4HB4A 2G77B 4OYHA 2GCPA 4A8JA 1E1QA 2I1VB 3DL0A 4OL0A 4XVRA 3V00A 4TZ0A 4V0MA 3QI2A 5KDOA 5FI1B 2QSYA 4UNRA 4GOXA 4A36A 2OEPA 1MT0A 1NG1A 2ZAMA 3BC1A 4ZKEA 4LJ7A 4Q7KA 4HAVA 1NN0A 4F7WA 3RLFA 1KK3A 1ZD1A 4FMDB 3VTKA 1JR6A 1S9HA 1XD8A 4TL6A 4TYNA 1R6BX 1SHKA 1XD2A 4PC6A 4KYIB 3TUZC 1KSFX 4JLPA 2ZYTX 3KB1A 1FUUA 5AJVB 2O8CB 4IVQA 3UXMA 3BD9A 3BJIC 4HLUC 5FUXA 5IF9A 3B1ZA 3K0SA 4FMDF 2OBNA 4TTPA 2CHQA 3SBEA 4WZAE 4ARZA 1I4LD 1N6RA 3QVVA 2WMNB 3QG1A 4IOKA 4O0MA 4PSAA 2QT1A 4YDSA 4MKHA 1VPLA 2Z4RA 3C4JA 4GPTA 5FL7D 1NVXQ 1CRQA 1Q21A 1XEWX 2ZJAA 3U7FB 2LKDA 3L2OB 1ETUA 3CWZA 3A4MA 2DWPA 4OK5A 1G5PA 1FOEB 2AXNA 3LW8A 3K70D 3W9YA 3AF3A 3W34A 1W4BA 3IILA 3WRXC 1LTQA 1TADA 1D2EA 2BIFA 3A4LA 3B82A 1DAEA 4Q4AB 1OB5A 4MGKR 2NPIA 3KX2A 4P4UA 4US0R 4EFNA 4JLKA 4B3XA 1VHLA 2CL0X 5AUOB 4D2IA 3ONWA 2HJVA 3NEJA 2NQ2C 1AK2A 3TUIC 3ZZ0A 1LNZA 4DDVA 1XTRA 1T5IA 1N6IA 4ESVA 2O8BA 3K0CC 4LHZA 1UBFA 4FMCB 5TMPA 4JLVA 4TL8A 3EARA 1IN7A 1IN4A 2N1BA 3U4QA 4CVNA 2IYXA 1XB2A 5AJWA 3OFNA 2X8AA 3I1FA 4LCBA 4O2LA 1ZIPA 4TTRA 5J4YA 1E2IA 2CCJA 4DUGA 1HH4A 1KYIA 5FUVA 1PVOA 2WWWA 3X1XA 3FPAA 1OXUA 4TMKA 4FMCF 3WP0A 3GLGA 2LWIA 3HDTA 4BFYA 2HCJB 1JR3D 3L0SA 2Y8EA 4Z54A 1P62B 3EPJA 1ZUNB 1G8HA 3K9NA 3L43A 1IM2A 1CS4C 4QC2A 2QBYB 2FNAA 3F8TA 1U0HC 2IUTA 4HAUA 3K0AB 3OE7A 3OEEA 3CPHA 3E70C 3UG6A 2HXSA 1NLZA 1F3OA 1S3GA 1YE8A 2AXPA 2VLIA 4YMTA 1E9CA 3VU9A 1Z6GA 3AVTA 5HTKA 1KI8A 3QIAA 5CITA 5DH9A 3JZMA 2J0UB 1KDRA 2QP4A 3GJXC 2IK8A 3ADBA 1XF9A 2GXQA 4DXAA 1G6OA 4BLRA 1DAGA 4RD1A 1F2UB 1G19A 2ZRKA 3AVVA 3CH4B 3FWYA 4XTRA 4L9SA 3Q3JB 1WA5A 3CR8A 4M1TA 1M2OB 2XTZA 1KDPA 1UF9A 2C03A 4OJKA 1G5TA 3IGFA 5F3WB 3ECCA 3FKSD 2IYLD 2RHMA 2IX3A 4M9QA 4HB0A 2XGJA 3I3SR 2IF2A 3VKGA 2GK6A 2WIAA 1II9A 4C0QC 4KYUA 1M74A 1FZQA 2IW3A 4LJYA 3BB4A 4UNSA 3L0OA 3VMFA 1FNMA 1YU9A 1GVNB 1KI3A 5E95A 3PENA 4B76A 1XEFA 2ZS7A 3QKRB 1V43A 2ZI7A 5IRCD 1U9IA 4PPFA 1F2TA 2OV2A 5TARA 2CNWD 3EWSA 1GUAA 3L82B 1ZW6A 3TR0A 1MABB 1NIJA 1S1CA 3KQKA 3HR7A 3OIVA 1UAAA 4B74A 3C14C 4RD3A 4PC1A 4A2PA 4LHWA 3EPKA 1OT3A 4QM7A 2FG5A 2Z4SA 4FCWA 1ZJ6A 4ZI3A 3OZXA 1CEEA 4XIGS 1YJ5A 4C30A 1JJVA 5LPNA 4W9MC 3NTUA 5J4LA 5KSOA 4W7SA 1ZM4A 4CT4B 1G1MA 1ZRHA 5CJ2A 1HTWA 2AKAB 3DOFA 5JSZA 1KI2A 1RRCA 3N2EA 2QMOA 4F38A 1E96A 1II0A 2WKPA 3X2SA 2E9SA 3QVUA 1AS0A 2BMDA 4P3YA 1GL7A 1VMAA 4DEXA 5LB4A 2O0HA 2ZRAA 3FVQA 1IONA 2QRZA 4KLNA 1P75A 3DO6A 4QJ5A 4XWOA 3B9QA 5B64A 3VR3A 2A7QA 1NMXA 4YMSA 1XEWY 1ZC3A 3MWKA 2JLQA 1HT1E 5G3YA 4PC3A 1F6BA 3KDSE 4EQ6B 1OXTA 1G4UR 2PX3A 1T6NA 3K9GA 4TMZA 4WA7A 1D9XA 3DMNA 3AVXA 4U02A 1N25A 4LHVA 3X1YA 1G7SA 1E32A 1AKEA 521PA 1JECA 3GD7A 5KNDA 1Z3IX 2P5SA 4A2WA 3KFXA 3GP8A 4Q4LA 4C7OB 3W3ZB 4AYXA 2W6JA 4GMDA 1GILA 5D3QA 2J7KA 4M0LA 3D8BA 1SXJB 1U0LA 2BJVA 3UK6A 1GL9B 2IYZA 4JJKA 2JDIA 4TLAA 5G53C 1GKYA 2WJGA 2GAAA 2FGJA 3I5XA 1K5GA 2QZ4A 1SVWA 3BFKA 1FX0B 1GRRA 1Z6YA 3O8RA 4GDFA 4KO8A 4B48A 5BN3A 2XB4A 4WXRA 3A6PC 1XFAA 1Z28A 3TW8B 4B34A 1S3SA 1UKZA 2HF9A 3SJBA 4M9ZA 3OIWA 5AK0A 1E2KA 2P67A 1OKKD 4EPYA 1ANKA 1II8B 2BBSA 4M9XA 5EJEA 3BRWD 3I72A 4KV9A 4KSBA 4D0GA 1M7BA 2VP2A 4OQNA 4Q4JA 4BLSA 3ADCA 3DZDA 3R7WA 1FFHA 2WWHA 5FR2A 1M8PA 3GEEA 2FEOA 3LVRE 3LBNA 4ZCIA 1HT2E 4C2UA 1KHTA 4B2PA 1H8HD 3TMKA 1SULA 2O8EB 3TK1A 3RS5A 2BCGY 2HDNB 3Q8XB 4PR0A 4LYHA 3TR5A 2UVQA 5KHOC 4QGHA 2ZROA 2GA8A 1MV5A 1PJRA 4V03A 3RWMB 4ZDIA 1XBTA 4ESHA 5HKKA 4D6PA 4FW9A 2WMOB 3FMFA 2IUUA 3CH5A 1Q22A 4LZZA 2D2EA 4PHHA 4I1OA 4YDHB 4KITB 5J5CA 1TQ2A 1DAIA 3AQ4A 5SZIA 5L3QA 1LB1B 3QF7A 2CE2X 3CF2A 1IY2A 3GJ3A 4QXAA 3TLXA 4G5OA 2WPDA 4EFMA 2LKCA 2WJJA 1C9KA 4DIEA 4HZIA 2R62A 4MYTA 1GIAA 3X1DA 4PZLA 3F5FA 5EP2A 4IEIA 4A0RA 3GEIA 4JL8A 2QT0A 3U3RA 1Q1BA 5J4KA 3F3YA 5FBLB 2GETA 3GQBA 2VRWA 1CJMA 2A5DA 3DM5A 4EPTA 1KIMA 2CEAA 3QKSA 4PPNA 2QMHA 1MO4A 4UNNA 1T3SA 1IHUA 4Q02A 1W48A 2B6HA 4B32A 1OH5A 1H8EA 4OHYA 2QP3A 2F1JA 3JVUA 2ZIAA 4KODA 1Z63A 3NBXX 1UM8A 3PJRA 2GBLA 3FHCB 4O3MA 4LK2A 3QXXA 4QGAA 3DVLA 2R8RA 2NGRA 2QM7A 5CK4A 4C0LA 2EYUA 1PLLA 1CJKC 4HZUA 3K9HA 4R9UC 2VHQA 4E09A 2XB2A 1BMFD 1QBKC 2BBTA 2ERXA 4B2IA 4HB2A 4L16A 3SHFA 1KI4A 2W2VA 2CLSA 1XTIA 1Q1EA 3KXLA 3WXMA 4V0NA 5FFMA 1XXHE 4I81A 2QM8A 3THWB 2RGAA 2GEUA 2WJIA 4HSEA 2FFHA 2VEDA 3HU3A 2E87A 5FH9A 1N5IA 3BXZA 2O0KA 4JYBA 4D81A 1WQ1R 3GCGA 4TL7A 5P21A 2YHSA 3AKEA 4CEIA 1C1YA 1XP8A 3EC2A 4IDNA 5EUMA 2P3SA 1HA3A 3VR1A 1D9ZA 1LV7A 4NKRA 4WW0A 1Z2AA 3B13B 3HYRA 5G3ZA 2ZANA 3AVOA 4DLSA 5JEDA 5A4JA 3GJ0A 3RRMA 2JAQA 2WJVA 4P33A 2IS4A 3GJ5A 4P31A 1YZUA 2HCBA 5L3SA 2SHKA 4EJSA 2FA9A 3D6TB 4YC7A 3SBDA 2G83A 2CHGA 1AQUA 5CIWA 4BFTA 1NJGA 5UKDA 2QGNA 4EPVA 4IW3B 3VR4A 4CEHA 4CGZA 2J0SA 2I1QA 2AL7A 4UJ3A 1IBRA 1KMHA 2IEYA 1Z08A 2XJ4A 2YWFA 3LRPA 4Q03A 2FSHA 1XD2B 2D2FA 4BECA 3MD0A 4R7ZA 2WV9A 3K8YA 2VIIA 3K09A 4Q9KA 3H0KA 1RRGA 1UKVY 3PIRA 2GK7A 1SZPA 2IHBA 1TX4B 1OFIA 5AUPB 1XMSA 3GLHE 4MKIA 4QL3A 2B7BA 4FI3C 2QPAA 2ZAOA 4W5WA 4QG7A 1XZPA 2R6GA 3SFVA 1ELOA 1E2DA 1P9WA 2ANBA 3ZJYA 4ARZB 3HP1A 1DARA 1NLYA 2IYUA 1GNRA 1W4RA 4KXFB 3T1OA 3VR2A 4DSNA 621PA 3FMIA 5KOYA 1E9DA 1KI1A 2OE2A 4IOMA 4LJ9A 4M22A 5FBVB 3I8SA 3WYGA 5E7JA 1B23P 1R4AA 5EP4A 5H68A 1Q20A 3HWSA 1RRFA 4K46A 4MUAA 2QEQA 3ZLJA 3K53A 4Q01A 5B30A 1TU3A 1R0ZA 1NN5A 3RABA 3LLUA 4II7A 4A4DA 4PPGA 1YR6A 5DIFA 1SHZA 2BC9A 4MGZR 5SZKB 5D3MA 2V3CC 2GHIA 4C0JA 3KQLA 2EWWA 3KB2A 5HCIA 2FE4A 5IT5A 1XMVA 2PH1A 3D31A 4QNMA 5EUQB 1KNXA 4KJZA 3THOA 4AWXA 3NIBA 1X3SA 4IDHA 2W0MA 1L4YA 1NI3A 1GKUB 1Q12A 3VNVA 3QF4A 1J8MF 2ZSDA 2VHJA 5B57C 2RCNA 3UWKA 5DI9A 2YNMA 4AYWA 3VKHA 3B60A 1JAIA 2YWGA 1GNQA 1G17A 2OXRA 2B21A 1A2KC 3RRNA 1OHHA 2VP5A 3U6KA 4WZBE 2ZITA 1R10A 3GLHA 1GKIA 4RZ3A 421PA 2WKRA 3ZVMA 2XOKA 3KKQA 1A7JA 3GLGB 1EX6A 1P9RA 1AS3A 1KK0A 2JJ8A 3B78A 3EC1A 5LBIA 4AKIA 2HYIC 1FUKA 2VSFA 3P20A 5C4MA 1FL9A 5JWOA 2KWIA 3SS8A 1Z5ZA 2YWEA 5FOTA 2VTKA 3TRFA 2OESA 821PA 1GG2A 5FOWA 2ZS9A 4M1SA 4DRZA 2Z5FA 1U8YA 1SVMA 2ZR0A 4BZPA 3CNLA 1RRPA 2CLDX 2ZRFA 1Z0AA 4Q1AA 4B44A 3LXRA 4PSKA 4URYR 3VU9B 2ZRBA 3GLFE 1QHIA 1JAHA 3D3QA 2IWHA 3W8RA 4M9SA 2F3RA 4KVAA 1EXMA 2WKQA 3P4YA 1NBMD 1QVRA 1W2HA 4AKHA 2HLDA 2XXAB 3OIYA 4S2EA 5TV2A 4D4MA 3SNHA 2MSDB 4BASA 2I3BA 2E1RA 1T91A 2ZRLA 2FPMA 1E2JA 3OAAD 4JVMA 3RVBA 1U98A 1KK2A 2RB4A 4AI6A 3NH6A 5CLQA 2L0XA 2GZHA 3BB1A 4DCUA 4QHYA 1BYIA 4XSHA 2XZPA 1TU4A 1Y63A 1R5NA 1SXJD 4PO8A 2WWYA 3A1TA 3K70C 2J5XA 2FEMA 1T0JB 1UDWA 2TMKA 4RD0A 1SKYB 1UKEA 2WTUA 4TT3D 3RHFA 4A9AA 3RS4A 1X8KA 3X1ZA 2H1LA 2GXAA 5EXPA 2O8FA 2XZOA 1G3MA 2H18A 4UXJA 2IYYA 1Q1QA 4R71A 3Q9LA 3MWYW 2W6IA 3CW2A 3QEJA 4ERNA 2H7VA 1OIVA 2FFQA 4MQBA 4IDQA 1NLFA 4FINA 4K8OA 4C9BA 1F2TB 2ODEA 3U3JA 2NTYC 1G8YA 2WHXA 4V02A 4TMVA 1NRJB 2QORA 5FPTA 2ORWA 4MRRA 2YC4C 2R6AA 1OPXA 3RC3A 1A5TA 2PX0A 5CIQA 3CKLA 3T5DA 1N6LA 4MDFA 2JJ1D 2FDCA 2N46A 3AKYA 4KFRA 1DAFA 1ZMXA 5JCPA 4MITA 3CNOA 2QUZA 1CJTC 1JXMA 2QQEA 4NCKA 4X8LA 4IFBA 2BM1A 4N0DA 5B58C 2IS1A 4YONB 2QL6A 4TMXA 4WVFA 4LJAA 1HQCA 1E99A 5FBRB 1KY2A 4PC2A 1NSFA 2WAXA 3EA5A 1FMLA 1E94E 2XZLA 2EYQA 2VHTA 1EK0A 2A5JA 2ODWA 2CHVA 1ZC4A 4CDGA 3AP3A 3MWLA 4QHTA 3QPUA 1DOAA 1IAQA 4MRPA 4QBFA 4PO1A 4U5XA 1VCNA 4H1VA 5GJCA 3CZPA 2IXGA 2JJ2D 3CX7A 1P61B 4Z1MA 3U2QA 1NJFA 1X6VA 5KNBA 4IXMA 1JBKA 4OQLA 1M6NA 4ZO4A 2EFEB 2KBFA 2JIZA 1QHHB 4RFVA 4HUTA 2BKEA 2VPPA 1BYUA 4IOLA 4JYCA 3KQNA 4D80A 5DN6A 1JR3E 2CL7X 1QHXA 2QA5A 5HPYB 3KKNA 1YR9A 2QAGC 2QTVB 4DIDA 1S1MA 2REBA 3BFXA 4RZUA 1UBCA 1E1RA 2R9VA 1G4AE 4Q5IA 1KJWA 1FNNA 3PEVA 3WRYC 3NHBA 3NDPA 3BERA 3EZ2A 1KJYA 4MGYR 5KNCA 3UIEA 2FPKA 5IK2D 3KJGA 2A5FA 2NZ8A 3B8HA 5FI0B 1KI6B 2XX3A 1JB1A 5JHHB 1VIYA 2A9KA 3TVDA 3LX5A 3GLIE 2ZETA 2YOGA 3A58B 5DISB 3RRYA 3SQXA 4POAA 4C4PA 5FOUA 3L8YA 3OF5A 2IL1A
chains in the Genus database with same CATH superfamily
3DZFA 4EUNA 4JVLA 5FCDA 5I7RA 3NTLA 4R8RA 5EE3A 5KQGA 3TUJC 5BYKA 3OE4A 3S55A 4X94A 1DGQA 2IPNA 1C3XA 1EHCA 1NC1A 5GONF 2A0KA 1ZCAA 4OXQA 2B98A 4M8NE 2YY6A 4P92A 5DHQA 3ONFA 2FPSA 1Q19A 2NO7A 2XE6A 1C8BA 3F2IA 5T8KC 1TTTA 4AN4A 7MDHA 4V2IA 1T36B 4YT4A 2C4WA 4H35A 5MN6A 3AETB 4K9OA 4A92A 5EKTA 1E1QD 1B0AA 1RWPA 4Q1FA 4BNMA 1JI0A 1JHRA 2IELA 1ORRA 5F1YA 3QX3A 4PG7A 5TC4A 1NVDA 3EIXA 3LCUA 4ETIA 2J48A 2SCUB 2VWHA 5JCOC 5JT1A 4KLAA 5GJBA 3BA1A 1SD5A 3QVJA 1WHTB 1B8PA 1QR2A 1L5SA 2JCGA 3Q12A 4CKEB 1PQYA 4IYJA 3FNRA 4L28A 1XRQA 2AEFA 4ND2A 1MPXA 2QMUA 3PGLA 4GI5A 3QE9Y 2COUA 2Y1WA 2DUMA 2PXHA 5E9QA 3QX9A 1DV1A 1VSBA 2W48A 3G9QA 3IXLA 1I2DA 1ZH4A 4D4LA 1ZIOA 4L4YA 5F21A 4F4CA 2F8LA 3R7NA 3D0OA 4F85A 2V58A 5BUQA 5B12A 3CX6A 5AOCA 2J5RA 4CM6A 4ILEA 3UAOA 1R50A 1Y9AA 2OGWA 1W96A 3AR9A 3PNSA 4Q7MB 3V4VB 3W78A 2QSUA 4CI0B 1TM3E 5BOSA 3HXLA 1R0SA 6REQA 7ADHA 2V7VA 3RT9A 1O4VA 2DQSA 4QYXA 4BFSA 3Q5EA 2WMYA 1JQKA 2OXIA 2NZJA 4IG4A 1JLMA 4KO1S 4WZAA 4IJ6A 3AUJB 1S96A 4D8UA 5I7OA 2HA6A 4R40A 1NFRA 1FP2A 1CQZA 1GNPA 1YUBA 4H0CA 1LFDB 3HVRA 1VDZA 2B8TA 1ZCJA 3AONB 2XKJE 4OK3A 1DJLA 3CXRA 2IV7A 3QKSB 3T38A 2QAJA 2DU8A 2VYCA 2BY4A 3LT5A 3CR3C 2XNHA 3FM9A 3NR2A 5I5EA 3JQAB 1SCKA 1W0JA 4S12A 4XD7A 3ZIUA 4G0UA 4GMXA 3VDQA 1OTHA 5KJCA 1BEEA 4LQ4A 1V9CA 3B1XA 4K9RA 1TVEA 1JA9A 1SR8A 3N2LA 4ND5A 5EG5A 4BYGA 3JAKB 2DECA 1UADA 4E13A 4YMVA 5AJXA 2V9ZA 1ZIDA 2YJGA 3C16C 1TRHA 4UVGA 1WULS 1NBIA 1XMIA 3UO8B 4H7PA 1FP4A 1MC1A 3O4GA 5EFOA 2PEZA 4Q7JB 4WOKA 1W73A 4F3RA 1Z83A 1T9AA 2AK2A 4GAEA 4TKUA 1R0WA 4NZYA 4KN8A 4LBZA 2R7MA 4B7CA 2GUGA 1C5KA 2QW0X 4HXGA 5DX0A 4P4SA 3H2HA 3U40A 3VTZA 5ITZB 1NASA 4G56A 4MULA 1XPOA 1NZFA 2FAXA 3N05A 4DG8A 1T9BA 1JT9A 2JJMA 3MTAA 1DX9A 1BDHA 2H17A 3IHLA 4DM7A 1DO8A 2V7WA 5BSUA 4P80A 5TEWA 1ADYA 2A8YA 3CZRA 4HRXA 4X45A 3GZNA 4AJLA 4KXYA 2XMSA 2I7CA 1QPBA 2EQBA 2Q0HA 3FHLA 3OP4A 1IB6A 1SOMA 4V0OA 5DBHX 4BFUA 4F21A 5CJPA 3UBTA 3DD1A 1H94A 1NKVA 2ALJA 2O50A 2RD2A 1NJSA 4M0FA 2QJFA 3LXXA 5MN4A 2VNJA 2YIMA 3Q4GA 1LF5A 1KFJB 4UBMA 5JVDA 3RAGA 2P3OA 4NZZA 4YMWA 1DWOA 1U1IA 4D79A 1RFGE 3DYBA 1LSOA 4XIIA 3CWQA 1I30A 1K2WA 1JLHA 2BM9A 2CLEB 2C88A 1ZUIA 3MD9A 3ZZUA 3MQ4A 4CEHB 1K7CA 4FYHA 1AOXA 1LBSA 3MTQA 4ENQA 5LIRA 1LY1A 1YZLA 2NYVA 2UZIR 1J06A 4BP9A 1QQAA 2VQDA 1PTJC 1XP5A 1HLFA 2GKSA 3MUNA 1R0CA 4IO0A 3DLBA 4RCZA 16PKA 2G70A 1TUBB 2N1MA 2Q3FA 1PG2A 3H9CA 3U31A 1T4GA 4XQGA 2RSLA 4CL8A 3CE9A 4BO6A 2V0NA 5BNTA 1QPZA 3RVSA 1PU2A 3N2ZB 1UJMA 3BD6A 4ARBA 5B3JC 1GSHA 4RHEA 2A1UB 1PWEA 1JIKA 3EQ2A 2IOQA 1I5OA 2JANA 3AZQA 2ZE6A 1W76A 3W3AH 3PU6A 2ILTA 2X8LA 1RAHA 4JI3B 1JFRA 4QWWA 3PXXA 4RFSA 2VAWA 3HGQA 1CUXA 2G67A 4RF3A 5J23A 3MJ4A 4Q9DA 3C24A 1PK9A 3AM4A 2EEZA 1VB5A 4FGLA 4J0FA 5A0FA 1L8QA 2CFTA 2FY8A 2O0JA 3H8VA 4RX1A 5HMMA 4ZHQA 2Y4NA 5CB4A 1ZJ4A 4IS3A 1US8A 1PS0A 2FPXA 4YCJA 3NHAA 2P0YA 3WMWA 1L5FA 5DW3A 3PDUA 5CB6A 2YJTD 4YCDA 1ISJA 5DXFA 2XVMA 5HQ3B 2CLHB 4B6SA 5BV0A 3Q8LA 2RAPA 2FR1A 3BE5A 1Q3HA 4MUFA 3OWOA 4D8VA 4TSRA 2AR7A 2H16A 2WF7A 4ZRDA 4ARSA 4D0NA 1N9GB 4B4VA 4M6WB 1QONA 1XZIA 2ZIXB 1WZEA 4B3MB 3SOZA 2H1HA 4NCNA 4P4GA 4DJAA 2VK4A 1DLJA 2C5EA 3EZ9A 3LAWA 2PPVA 3LOPA 4RTQA 2G9QA 3QUTA 3EMBA 1TVKA 3VV3A 1YRQA 4YRJA 5IVHA 3A70A 3I9FA 3JQCA 3ZXXA 2B78A 2KB0A 2IOFK 1FDUA 3MFYA 4XFJA 4RH0A 2PRKA 5AUQA 2IEAA 3WLQA 3DVRX 1HTTA 3SXUA 3ZE0B 2BHLA 3O6VA 1VKHA 3HJBA 2FWIA 1I4OA 4ZODA 3RFUA 2JBWA 3CRVA 2KS6A 1E9AA 3TNLA 4LWPA 4U6NA 1V11B 4U8GA 1EFLA 3DZHA 2QTGA 3ZIDA 5AW6A 3WL4A 3MB8A 2YY7A 4OA5A 4GNRA 4GEGA 5B1HA 5H0IA 3QHAA 3N07A 4X97A 3EE6A 4J1QA 3ZXYA 2XADA 1J70A 3L4BC 4DYDA 2NUTA 4DWVA 4Z6KA 1ZAYA 2PJRA 1YHYA 3OCCA 4OTZA 2NPFA 3SR0A 2WWIA 2GFQA 3PWSA 3G9XA 1S7GA 4P82A 3RIEA 3UUEA 4AK9A 4AO8A 1G3RA 3KHTA 2GN8A 4H27A 4DLBA 2VBCA 4B6FA 4QM6A 1Z4OA 2P4EA 2Z6AA 3CR7A 4GO1A 5TQ0B 2DWQA 5JRZA 3K2QA 1YZGA 2GNOA 2WHPB 3P9NA 4LJSA 4LN1A 4ND3A 3TL2A 4CQNA 2I1LA 5E1MA 4HXFB 4R51A 2A9PA 4MYSA 1I1NA 3O1HB 2HT6A 3KWFA 1N2SA 4XFKA 5ICCA 1O0BA 2Z4TA 3H11A 1QVWA 1GPH1 5L7YA 1LGYA 2RGEA 1L5VA 3KPWA 4PN3A 1QHGA 3O47A 1JG6A 1IFXA 1M73E 1XQ1A 2P65A 3F1LA 3GJZA 1GY8A 3NTXA 4ZQCB 5EJAA 3SMQA 3J7AC 3TLGA 2Q62A 4EEKA 2CNOA 3RIHA 1AGYA 3GDGA 1AQ6A 3FMGA 3DULA 4FWIB 2O0MA 2F43B 1DPFA 5KNDD 4WAUA 1ETHA 1PJBA 3AU9A 4KH0A 1ODLA 3GLFE 4FFBB 5KX5B 4HDMA 5K8UA 3G2KA 3QLJA 3FD8A 1NNUA 4OJNA 4ENUA 2K87A 1Q15A 1U8ZA 1L4NA 3G5UA 4CM4A 1SQSA 4I08A 1SC3A 4N5DA 1JHUA 1I6KA 3GPDG 5AKEA 4B85A 5F9HA 1E3LA 1WDLA 1A5BB 4OM8A 1RQXA 2W6MA 3H7IA 4FUTA 4KE7A 1C7RA 1IJKA 3DL4A 3IQIX 4MZDA 5KSPA 4D3SA 4R3NA 3GFTA 3SXPA 1NQUA 3L8HA 2BMWA 2OKCA 1TW3A 4JJAA 1K88A 4QTZA 3V8QA 1QCYA 4U3JB 1G5IA 1FMJA 1TM7E 1IJBA 2ZUEA 2EQAA 3LL4A 5C8ZA 4P83A 4FMPA 5K45A 4GQIA 4E5YA 2DWUA 2OB1A 2BDTA 3O31A 2J3KA 4JYPA 1VYVA 3REQB 2MDTA 1G8FA 1VMDA 1HY3A 1MD9A 2H92A 3KYCB 4OHCA 5HJ2A 1WUKS 1WZNA 2VUSA 3TSYA 3KAQA 5ALTA 4A82A 9ABPA 2QAIA 1RYBA 4F0JA 3FKQA 2HA0A 1RABA 2AK3A 3D6MA 1TI7A 3S68A 3U80A 4ER6A 1K3FA 1P7VA 1AK1A 3E22A 5AI0A 4L6CA 3S1AA 3LJKA 3TLAA 1JW9B 4RKWA 1B42A 1H0SA 2I8CA 2ZCUA 2CLIB 3B9BA 2BMFA 1Y33E 5BW6B 3K71B 5GTDA 1WM1A 1Z5GA 2W4IA 5BYJA 2XLCA 3IB6A 1F0PA 1KMIY 2FFBA 3DYVA 4B79A 3EGWA 3ETJA 2V1UA 1TE2A 4DB2A 4MPDA 2COKA 2HJHA 4LAFA 5CTJA 1KEEA 3QYFA 3OQPA 4YRIA 4AJEA 2A0XA 1H2BA 1T2NA 3G59A 5CYOA 5EIBD 2X4DA 3OI7A 3B48A 4QOSA 1EP1B 2IIVA 2EP5A 2WTMA 1IZ8A 4KR0A 4TVSA 2AJLI 3DZJA 4QVGA 4MVJA 1VRCA 1PTKA 3E9ZA 3QFSA 4E32A 5AM4A 1M8FA 3WQSB 4NDAA 2KLBA 3I73A 5LQKA 4HMOA 3N6RA 3T41A 3QSGA 4GHWA 5KDDA 1E8NA 2ZQZA 3T06B 1ESCA 2R6JA 1N2ZA 1Z0JA 5FNVB 1IMOA 3EVDA 2QRGA 4YACA 5L7WA 1E92A 2Q2QA 4DPMA 1OOEA 4A16A 5B5SA 4FS3A 4GX5A 2NVBA 1QC5B 2WPDD 3H8SA 1M1NB 2GEVA 5DM4A 1F8UA 4BLQA 4BU0A 4E88A 3OT5A 4OREX 5AVTA 2WT9A 2J1LA 2FI1A 3K8QA 3C3KA 3P2YA 3C7DB 3JQ6A 1T4CA 4OIFA 3WIBA 1WSWA 1NVAA 1SIBE 3ENKA 4GRAA 5C80A 4DGSA 3SBOA 5MF6A 4BDSA 1HL3A 2M6SA 3PVZA 4YWHA 2CYCA 3PLNA 4Y6OA 4CCYB 5FNVF 3D6NB 4L08A 3QWIA 3H9QA 3TXXA 1BJKA 4OGGA 4DNPA 2WYUA 4YP1A 1PD0A 3OT4A 3DTVA 5LYJF 2JAOA 1SXJC 2JASA 1QHNA 2PRIA 2WU0A 3COWA 3JXEA 4KX5A 3UCFA 3EGXB 4N54A 2RKBA 1AIPA 1JJIA 1TUEA 3CEPB 3G2IA 3QVTA 1QRSA 4I6JA 3JALA 5A7FA 5JQGA 2ZTUA 4MTLA 5KTSA 1UJ2A 3JQFA 1CRPA 2HQBA 5F51A 3URMA 5BN4A 4CCAA 5HFJA 4ZVNA 2JCVA 4BRWA 3FJ1A 3E3AA 1W85A 1F17A 1EVEA 3C98A 4D3YA 4GMKA 1KOFA 2BMAA 1U5BA 3PQ6A 4MGHA 3LQYA 5DNVA 3FJOA 5ALQA 5HS6A 3ABSB 3EXIB 4UM9D 1Y8QB 1M0WA 3HA3A 4QBTA 4BO4A 2BH9A 2JS7A 5DZSA 1GQOA 2BKXA 3GFGA 4IMPA 4M0MA 4XR9A 1TAGA 4IMIB 5HUHA 4D0LB 2RH9B 3A36A 4LXXA 2ZWAA 5FNZA 3JQ7A 2JJQA 3NIDB 5ELLA 3QVGA 3IPYA 3ZWBA 2CK3A 1TM5E 1DUIA 2NV2B 1IG0A 3UCXA 1TEHA 3GJ6A 4GNKA 2C2WA 5CLJA 2ZUSA 2OP1A 3SC6A 5DBOA 1O95A 1XLWA 3A37A 3HYSA 3IJRA 1MOZA 1MOPA 2GILA 3IUNA 2I71A 4RE6A 4JWKA 1ZU5A 4ZT4A 3RGGA 5I4IA 3HVHA 4D74A 4B6QA 3I9OA 3ZKAA 2ZU6A 3T1VA 5J3JA 1S5PA 1WD7A 3M9XA 4TX1A 5JS8A 1E3EA 4EUSA 3HYNA 2FPUA 2XGOA 4CPDA 1R16A 4W5QA 3MBIA 4M7PA 4B45A 2B5WA 5BRAA 1H05A 2PZMA 1R0XA 1XI2A 2TMYA 4BLWA 2A86A 2WHRA 3CBQA 3HO8A 4GYJA 2BFEB 3ZI4A 2VQSA 1MH1A 3ZGYA 1IEVA 1K8QA 4YFYA 2ZIUB 2GRAA 3L07A 2POCA 4IIDA 4OHMA 5DGIA 4AY4A 4DDUA 5FO0A 2O8BB 1LVGA 2Q41A 3ZEIA 1J2EA 4B3FX 3BH7A 3I39X 1MA0A 3H1PA 4WSOA 5FA5A 5AW9A 1FFXB 3SD7A 4EAQA 2X4IA 1VCHA 3C5HA 4GX2A 4PTZA 4P7BA 2P9GA 4ECAA 4IG9A 4EVQA 3KAPA 4PZ9A 2PFGA 4YXWA 3VH4A 1EUDB 1XKLA 4QDZA 2V5AA 2H7CA 4MGIR 3UK1A 2ZXUA 1FSPA 3BF8A 4V1CI 2QUBA 3PICA 4A27A 4D1YA 3LDAA 3F3MA 1SB9A 4G81A 5EEGA 3VR2D 4Z3OA 3USCS 5EINA 2HCFA 3T15A 4D9HA 3ZZ1A 2FKAA 1AB5A 3HL0A 3NONA 1K3UB 4UEQA 3N86A 5A4FS 1RE0A 1DKQA 1SIUA 1AU9A 4K3VA 1HOTA 4HPJB 4R2XA 1XRNA 3OQIA 1KZ4A 4B3CA 3OLQA 4S35A 1X1TA 3T6KA 4F91B 1WL8A 2IVZA 5SZHB 2D8MA 2IHJA 4PLPA 4G67A 1WPGA 2JB9A 5LQMA 4EKNB 1SVKA 1QVAA 1YS9A 4DBVO 4EIWA 1OR8A 3FIUA 4HQ0A 3GFVA 4XLTA 2CDNA 4XUDA 4IDOA 3VSEA 5KBYA 1NZDA 3C5VA 2J4CA 4J4TA 3RKRA 3U3XA 1LJ8A 3OHSX 1KSJA 2GEJA 3T34A 1ZMRA 4LCJA 5EXDA 5ALYA 3T7JA 2WICA 3BH0A 4PZDA 4FBLA 4MIOA 2PT7A 3WOVA 5FO1A 3OQ6A 1CU1A 2PSDA 2P6MA 5ICSA 3H5WA 1NVWQ 3OJWA 3PLRA 2FK8A 1O2DA 3RIGA 1JDZA 1K8YB 3FPJA 3VPBA 1ZH6A 5BVHA 2QR2A 3S5UA 2YNMD 1JALA 1I2BA 1UJCA 3BEDA 4Y9TA 5K1ZA 1XL1A 2EOAA 5K4GA 2FCAA 4LWOA 3QI7A 4P7KA 1OSNA 1X9IA 2OSVA 1EH5A 2P2CA 3FG9A 3BYZA 5DK4A 3TKYA 3DBLB 1QHYA 1EFCA 2GMWA 1H9AA 2P30A 4OEHA 1C7IA 3IIEA 3F6SA 4LBYA 4V0QA 1CKEA 4TTVA 3GOHA 4QEKA 1EWYA 2RGGA 4ER7A 1J00A 2EDAA 1W49A 3LOQA 4RTPA 3I2HA 4ZDWA 5MN5A 1WETA 1PL7A 1YB6A 1B0ZA 2VEOA 5E2IA 1DRKA 1U0JA 5BSHA 1MAAA 1JPNA 4U5QA 3BXGA 3KRTA 4ENRA 3EVEA 3REGA 1JLRA 3R3HA 2Q1WA 1XU9A 3FTDA 4LXQA 2CT8A 1P73A 4JI8B 4KOAA 2OVFA 1WB9A 4CFYA 3HCCA 4J3FA 4BMVA 3T3NA 2R65A 1N5OX 3GAZA 4J7XA 3DV2A 4MWBA 1Y6GA 6NULA 4TKLA 1GXSA 1S8OA 4EHKA 4D3XA 2OQIA 1ZMBA 5GZ1A 3NS7A 3SP1A 4BZWA 4MA4A 4R9RA 1QE0A 2GHRA 4DGQA 1GZUA 2YS7A 3RSLA 2HLDD 4GYWA 4HWRA 3PR3A 1ILEA 1GZ3A 3W5VA 1SD2A 3AY6A 3KT3A 4F2GA 3FBWA 1F4LA 3NYQA 1DEKA 2HFJA 2XEXA 4CMIA 4ZDKA 3NIGB 2PGNA 3AVQA 3BMNB 3GJ4A 3KT6A 4Q37A 3PWTA 4X3OA 3ZQ4A 3K8OE 5BUSA 4E14A 3CIFA 4RESA 4ZAWA 5KVQA 3Q2OA 4KU4A 5CAEA 1CEXA 5JWHA 3TX2A 1J9EA 3W4JA 4ZI2A 4FWTA 1JIQA 1V7ZA 1PR1A 1U2TA 3QJGA 5D84A 1P33A 5D5HA 2YC2C 4LTNA 1EIWA 3ZUGA 4TKVB 2DR3A 2X0IA 3WLJA 3JV7A 4WJLA 4OV6B 2J4FA 1DAMA 2QOEA 2MHCA 4X6XA 4ZV7A 5B6IA 3HCBA 1RYYA 5JAHA 3BGWA 2A9RA 4ZAGA 2ZJ2A 3MJCA 1E7QA 1VGRA 2GCIA 9MHTA 4EHLA 5EGNA 4TLEA 2AG5A 2NOAA 3QE4A 5ALJA 4OQFA 4RGYA 1IN1A 2G0NA 5CLHA 1G0OA 2OC9A 1QO9A 5AI5A 1M2EA 2Q50A 3MHPA 5TMDA 4EJMA 4EHFA 1GYPA 3ED1A 4J7AA 3SC3A 3LIPA 4JLJA 1RD4A 2P2DA 3KJIA 3PDJA 2GZ1A 1KC3A 5DSZA 1NRIA 3AM1A 2AUMA 3E48A 3L92A 2NUAA 4YQEA 1YJXA 1L1QA 4O4IB 2XHZA 3IEVA 1IUNA 1ZRNA 3KNZA 3UJNA 1LRJA 4ITRC 4XVQA 1CYDA 2ZREA 3BE6A 4O8CA 1RS0A 1Q7GA 2FWNA 4ZTBA 3I8XA 3ZD6A 2JH8A 4OAOA 1UKAA 3SDSA 1IJEA 5T4EA 1JFLA 1ZWLA 2OL4A 2WYWA 3ULKA 5KTYA 1RYDA 1TJPB 2HRRA 3AOEA 1JIVA 2ZATA 4KAXA 4G23A 4YRMA 1V1RA 3NJRA 3CPEA 4FIZA 2DE0X 3UG7A 6AT1A 1FNSA 3B9PA 1T5HX 4PIPA 5BMVB 6YASA 1MDBA 2G6BA 2EDCA 3WAJA 1DE0A 3ZS9A 2Q1YA 2APJA 4O4IF 2H51A 3SMVA 3VDXA 5KNBH 2FG6C 4DV5B 2EU8A 3A14A 4U2CA 3SQMA 4ZVVA 4KR6A 3TLKA 1DRWA 1K86A 2Z98A 4RORA 3W79A 3SAJA 2C2OA 4CIBA 4RTJA 1IWOA 1KWKA 5A62A 2GNPA 4DJFC 1QOPB 3VR0A 1OZAA 2CJWB 5HRCA 2HLHA 1F0YA 4YUYA 4HX9A 1MJGA 4G4SO 5LDDC 1W36D 5BMVF 1BDJA 2WJWA 2E4UA 2WM2A 3A1SA 3M9WA 4FD3A 4CIYA 1UL1X 3B8EA 2ZW9A 3I0ZA 3PKIA 4TUYF 1PJSA 2QX6A 4IV0A 5EIFA 5LQSA 2VHCA 1DWPA 1E6WA 1XALA 4WERA 4AY2A 4X71A 4UU1A 3BMCA 1GL3A 1X9GA 4Z1MD 1X3LA 1VCIA 1VCMA 4OHKA 3PQEA 3RANA 2FCRA 3OD1A 2IOFA 2KQUA 1MRSA 5LQNA 4BLTA 2E55A 4AD8A 1GDTA 3Q0IA 3G1WA 4H1UA 3H86A 2G9VA 2QW1A 3QW4B 4EHHA 3AVWA 3E1SA 1DG3A 1GRVA 2GN1A 2ZYSA 3V33A 5DN6D 1BU8A 4KAFA 3D59A 1BWSA 1TJ5A 1KMCA 1CUBA 3KAKA 4YNBA 2WFMA 5M3BA 5JLJA 1AHHA 5FYDA 2MU1A 4QELA 3DZIA 3N2KB 3LWBA 1A9ZA 10MHA 1Z7BA 1IXKA 4YAJA 4DRXB 2Y1XA 4F6CA 1JHOA 1X80A 3DOJA 3R3ZA 4ARUA 3C1OA 1ITZA 4BMNA 2OILA 3FLEA 3QGMA 3UY4A 1CR4A 1KTVA 2IHYA 4ZEOA 2J8ZA 4ZYLA 1P2VA 4RW0A 5AKJA 5BXQC 3W2GA 4OHWA 2GESA 3AI3A 2E6KA 1L7RA 2QTHA 3VH1A 2UXBB 4ZQGA 4GKBA 4UOQA 3I37X 3HN7A 3TQOA 4YUAA 5JFTA 2UYHA 4P0PB 3ROKA 1WKCA 4BO8A 1UBRS 2Q3HA 4A8PA 4FP9A 4CNQA 4FPXA 1Q95A 1HDZA 2VKQA 3OP1A 3Q2KA 4NONA 1H5QA 3RD5A 3GROA 4ALMA 1U6KA 1F3LA 2X3YA 4OI0A 5BUZA 4WHMA 1MXFA 1QQ5A 1J0DA 4IIVA 5G4KA 3V2IA 3A04A 3AEKB 2O2JA 3E2IA 4C2AA 3H0CA 4NBSA 3DL7A 4ZRMA 1M7HA 3ZU6A 1IZZA 3T3GA 3IAHA 2GCOB 1VYUA 1QRRA 4PYLA 5D5PA 5AKKA 1NXOA 2AZDA 3WQQA 1EMDA 1X19A 3CRQA 1I80A 4ITUA 4QPNA 3WMGA 4YJ2F 1QS0A 3WSWA 1SBTA 3A1UA 3ABZA 3OZRA 4JU9A 4EVIA 2ZSAA 2HPAA 3OEHA 4C20A 3QU7A 1EVQA 4RH1A 5EJMA 2ARKA 3OF5A 4OI4A 4HVTA 3KYIB 5JDCA 1F5SA 1VHJA 5IABA 4DLZA 1V8BA 2WYIA 2NP6A 1IXZA 4TOIA 2C1XA 1Z4NA 2PLNA 4QTTB 4ZD6A 2VYFA 1WTAA 3UA3A 1M0EA 1E2PA 2O52A 4MQMA 2DKFA 2Q5JA 3C4QA 1J24A 2BEWB 4DCJA 3AGPA 4DCCA 4HN9A 2XR1A 4A15A 2WIGA 1DKLA 3EVAA 3AFOA 1V3TA 3GVPA 1I3MA 1MEEA 1FXWA 3G0CA 4LTMA 5BQPA 2UDPA 2LZ0A 3M7IA 4FD2A 2CNWA 4W8HA 1KSHA 1BVRA 2JFZA 3IEUA 4OBWA 2Z58A 1AGRA 3WGHA 4ADSG 4DT1A 5KJ6A 1GM5A 1W0KA 5KPDA 3EGCA 2ZJFA 5K5EA 3HSKA 3U9TA 2DLCX 1GPUA 1GN8A 2DBYA 2E85A 4INOA 1ISSA 4YV2A 2FSGA 2P0EA 2RK3A 2M6KA 4DEVA 4YT2A 2C8KA 4BMPB 3QXSA 1KRHA 2UZ1B 1KY3A 3I0MA 1GKLA 5HWSA 4GLJA 3WBKA 5FQOA 3KDAA 4WKOA 3EXEB 1A27A 4TQGA 2B1GA 5CPFA 4N7BA 1OE0A 3NNDA 4UE3S 1Z73A 4Q3LA 2I4RA 4JK3A 1QGZA 4X1YA 5I7VA 3GCWA 4B1FA 2DPXA 3OEHD 3OQHA 5GVSA 1ZEJA 4E6PA 2PTGA 3TF5A 1RXEA 2QSZA 2B94A 1V7CA 1ISHA 1MB2A 3DOEA 3L1KA 3ZY6A 4E07A 2RGRA 3UCEA 4ZREA 5HM6A 4DPKA 3OZFA 4Z4GA 1O58A 1I2ZA 4QFMA 3H5LA 3LCRA 4MKFA 3RNLA 3OECA 4OQXA 1W581 2QTZA 4AZ0A 2WLTA 2ZRJA 2B30A 4R8MA 1AZSC 3X2FA 3BHMA 3DO8A 5CDYA 2R84A 4EKEA 1H2RS 2YVLA 4R8SA 5H81A 5JAPA 5HKAA 3U4GA 4D26A 4MS1A 3WGKA 1J09A 2BZSA 3A4VA 3L4SO 1P9NA 3OO0A 1H5NA 5K3FA 3JSAA 5A5GA 5K0FA 2ZUUA 3OZCA 2FK7A 2DY0A 4MQFA 3UHJA 5JZVA 5LXTA 1W0KD 2B82A 3ICEA 4KQGA 2X0DA 1H23A 1WO8A 2IEDA 3ABIA 3JQDA 4BNWA 1IBSA 3X1MA 1BFDA 3LQ4A 5TVKA 4LHXA 4DF3A 2IEGA 7MHTA 3PZBA 2Z57A 1LVHA 1JG1A 1B6TA 3PI6A 5HEKA 2X14A 2X1LA 1DRJA 4JFRA 2KMLA 4KQ1A 2WD8A 3ESQA 5CLGA 1N36B 3K32A 4O6VA 1FSFA 2QRKA 3VX3A 2WFLA 5KKAA 1R7RA 1J20A 2NXWA 4ES6A 1IBKB 2Q5QA 4W9NC 5K6AA 2VT2A 3G5MA 4IDEA 2O3SA 4KXQA 1D4FA 3A6ZA 3WLOA 5DHFA 5K8IA 1GEEA 2OFOA 1O94A 3S28A 3PEFA 3DLCA 1W8DA 1XX6A 5K6TA 2Y0DA 1QRAA 3JYOA 4HWSA 4QECA 1EFVA 1AZTA 2WWXA 2YKGA 1C3OB 3RKUA 2HBQA 4P58A 1FFDA 5DM0A 2JK0A 2P1ZA 1VKRA 2PQMA 1Z2OX 121PA 3BHJA 3EWAA 4RM3A 1AO0A 3OF3A 4I4NA 3LBAA 4YX9A 4EUKA 5LLSA 3EQZA 4BX3A 3ZDAA 2FVYA 2NZUG 5J47A 1T3GA 3DVQX 4WFJA 2FX3A 4L9WA 4HGRA 4H1TA 5JS7A 4R2HA 4HDCA 3JTMA 3Q3VA 4KWCA 2XDYA 1RHKA 2FX2A 5I4KA 1IL0A 3RSQA 3ZD9A 2VJMB 1A82A 1TZBA 1OI4A 1P8JA 4ZEWA 4ACAA 5JO9A 5IULC 1AH2A 1RI4A 1OXKB 5JEEA 2Z5LA 5D85A 1ID8A 4B8YA 5JIBA 5L4SA 1TLFA 5CM2Z 2ONCA 4A6DA 2C9CA 1UFQA 4MVCA 2GF2A 5HIJA 3X44A 1FQJA 3UXEA 4R9VA 1VL6A 3OFSA 4QJBA 4WBNA 3BWXA 3R5TA 3VNUA 2A3NA 4N40A 1RP1A 4BVHA 2ONZA 5IG2A 5LZ9A 4P4NA 4YT5A 3KHUA 2ATXA 4K6CA 2IYRA 2J9ZB 3SQLA 3UMGA 4OHRA 2ZBQA 3ESRA 1M8JA 2X1VA 4A8HA 1IY9A 3EG9A 4YUXA 1N5RA 3P9XA 5BPHA 1EXWA 3RUDA 5CXQA 1QAQA 3DKVA 5DM1A 1UODA 1JMYA 3VH2A 2PUGA 3V3KA 2FF7A 2RE8A 2H3EA 3I09A 3KOZA 1CUVA 3LY5A 4XRGA 3NAGA 1Q7EA 1ZK1A 4TWJA 2O8CA 1KIFA 1A3CA 2GPTA 2EKDA 2C3PA 3BJEA 3N1UA 2D06A 1J4AA 5FDFA 1OB2A 4MS3B 2R7NA 2OXFA 3QOFA 2OFXA 1UBJS 1Q0HA 5JJIA 1XEXB 2EFHB 2ET6A 2I34A 2YV2A 4IP0A 5ITWA 3EGVA 3L7KA 2YZ2A 3QPCA 2ADMA 2LD4A 4MQEB 3QBVA 4MQ4A 3SZLA 2DBRA 4PEVA 4M8IA 3CX8A 4ZO9A 4HEA1 4CXMA 1SB8A 1N8NA 1XFDA 4FDMA 3N70A 4URUR 2XMPA 3PEUA 3OCYA 5EYPB 1BIFA 1WMSA 4K81B 5AM1A 3S4YA 2V7XA 1KC1A 3TD6A 4R83A 3D2AA 3VJLA 4WZBB 4OCZA 2ISCA 2JD1A 5HFAA 3P19A 2RBKA 1T8UA 2JFPA 3S44A 1BE8A 3TIGA 3ZE1B 1Y0BA 1Z07A 4DJDC 2FQWA 4BMYA 3KKLA 4L15A 4PR3A 4QXMA 3AR8A 1V1MA 3V48A 5KWEA 1EFUA 1GL6A 5I3CA 1T6YA 3ELUA 2JAWA 5KSYA 4PFJA 2VQ3A 3O8DA 3BTUA 2GLUA 4YCLA 1NW7A 2I3GA 3N75A 1F38A 1C29B 4LECA 3MTDA 3LDHA 3TRKA 2RIRA 4KBFA 1PJ8A 2VSXA 3ROQA 4EZIA 1L7MA 2FHPA 3MS7A 1GZ4A 1U8TA 4KCGA 2SKEA 1YMUA 3KWJA 1ZM3A 2AYZA 2I6SA 1K6JA 1O6FA 1AGNA 1SOUA 1J23A 1ZISA 2PXCA 4PX5A 3RYHA 4MW4A 1OLSB 3LX8A 5KKCA 4BV8A 4P7JA 4U1RA 1PHPA 2G9NA 1TZMA 4LDRA 2O8NA 1YACA 4XWAA 1P6XA 4KQFA 2C3YA 5GM1A 3C6YA 4YVFA 2BM8A 3DLAA 3UICA 4YS6A 3CVYA 1EE2A 4UQOA 2QPTA 3SYKA 4JBNA 3W5IA 4BKUA 2PSFA 1TQ8A 3STXA 5SY9A 2CZQA 1CS0A 3C3PA 3QENA 1P4GA 2NPOA 4L76A 2YJ6A 1C4WA 3F9IA 3I12A 3CLRC 4HGQA 4TLCA 1G9XA 1ZQ1A 3A1VA 5EZ6B 3K0AA 3UMBA 4M88A 4QNNA 1IUPA 3QTTA 2WAAA 5JNUA 2GPWA 2QX7A 1PR9A 3LS2A 3U60B 1SN7A 1UKYA 1A9TA 2PKQP 2QV7A 2YZGA 3EIQA 3GGOA 4H3VA 4YASA 4ZVQA 3OETA 4MW9A 5C5EA 3E5MA 4DN6A 3VJKA 2XNDD 4ONEA 4PQYA 3MG9A 4M1OA 3ZJVA 2ZJBA 3KT0A 3R9IA 3BMQA 2QX8A 4N12A 1SCBA 1CZUA 4NMLA 2ZQYA 2JEOA 3FCAA 4MW5A 4PAMA 4RK0A 4XJVA 4HLCA 1FYWA 2P79A 1LH0A 3C3BA 2YJZA 4R8LA 4RVOA 4YP6A 1Z6XA 3AUUA 1EPUA 1SBYA 2GCNA 2Q1XA 1GQRA 2YUTA 3JQPA 3ESZA 4C7KA 2J46A 1V3VA 2BONA 2R7KA 1Y3BE 3QY0A 4Q15A 4GWLA 4JROA 3ZY5A 2UYYA 2C8LA 3FUWA 2AMLA 1ZNYA 2BJWA 4N9QA 4KE6A 4PS0A 5DLYA 1L7NA 3IT0A 1PRYA 4Q7LA 1P72A 1ZA2A 2JIBA 1D8TA 3D5EA 1QMPA 3FVRA 3KU4A 1SUPA 4IM7A 3ZLVA 4N3NA 4ZVTA 1KVRA 3RJ9A 3RB8A 4KQ9A 4B7AA 3DBVO 2FP4B 1JILA 4RPCA 4WX2B 4BN0A 2RI1A 4GYYA 2J5BA 3IBYA 1K4MA 1TUIA 5FEMA 3VQTA 5C1OA 3NG1A 4DBLC 1YV9A 1NBME 2EWVA 3ZDCA 3EVFA 3TNDA 1UM9B 1YZQA 4XB2A 2P40A 2JI6A 2ZULA 1KQOA 3NAQA 4TTAA 3EVNA 1BXZA 1X7WB 4PCLA 3B38A 3TECE 3T1HB 2IC5A 1FRQA 2ZE7A 1XLTA 4LXIA 4N0MA 1U63A 1B8VA 5K4AA 4W99A 5CX1A 1U28C 2X2PA 4G9EA 2AE2A 5KYXB 5JYDA 2B4YA 1G7CA 1UPTA 1ZK3A 5EHNA 3DDZX 3OZSA 1OZGA 3LYUA 3RS2A 3WMFA 4XM2A 2A4KA 4L4UA 4UCFA 4NV1A 1F48A 3VPDA 3TGLA 4TQUS 4YRAA 2HK7A 1YDFA 3LQ2A 5ALWA 4CG1A 4J4HA 1YI1A 3E18A 5CA0A 4EO7A 5EVJA 3QJ5A 1K7XB 2LIVA 2GO7A 5DLQC 2AF3C 3AWIA 1RXIA 3AJDA 5FBQB 3A2KA 3KXIA 1T5BA 4WLFA 4R0VA 2PT9A 4HFRA 1D0SA 2C7GA 1W44A 5K6RA 3EIHA 1TFUA 2XUJA 1NKTA 1F12A 1H5UA 5ALKA 2DERA 2IZOA 2QIPA 1YD7A 2C96A 2QN2A 3MM4A 1Z7YA 4OHBA 3EUAA 1H22A 1HDIA 4JB8A 4L3WA 4NNJA 3KVVA 1LPNA 1MQ9A 4KO4S 4KTVE 3FGZA 4R2IA 1FPMA 4BO0A 4C4RA 3Q7SA 5DX8A 5IWCA 3O1JC 2C59A 1X7ZB 3T7TA 3RK1A 1ECJA 3DWEX 3AF6A 4N39A 3FTNA 3VNRA 4Q9IA 3W5AA 2WJHA 2FJPA 1SBZA 4E5PA 4LX8A 3FKJA 3VTAA 1PDWA 1PF7E 4CN8A 3RS3A 2NXCA 1V5WA 1NBMA 2JKVA 3M6MD 4J49A 3NKFA 3U13A 2RI0A 3UHAA 1MDFA 1WDTA 5TY0A 4CIWA 1C1HA 1JYSA 2DF8A 2DLDA 3QXCA 5F12A 2R4QA 5DP1A 3L0ZA 1PJLA 4FB4A 3Q1KA 1DAKA 4UVIA 3TAUA 2W2NA 4RV5A 5CK5A 1SVSA 2VYNA 2I4IA 2VHZA 3RODA 4GOMD 4IIGA 1ULUA 2G5PA 1K5DA 4RC9A 1NNEA 4PHGA 3U37A 2DFLA 2XAUA 3LY8A 4NYIR 1P2UA 1RRMA 2EWMA 3PGXA 3ZY3A 4AWAA 1QF9A 5G0WA 2ATCA 2E1PA 2VQ6A 2QAGB 1R27A 4H3KB 4L22A 1M34E 5FBKA 1E2LA 2O8DB 2GBGA 3BWDD 3OOSA 3CUWA 4HUJA 3GUVA 4JJ6A 4KAJA 3T9DA 3VHRA 3G79A