5FPHA

The gtpase domains of the immunity-related irga6 dimerize in a parallel head-to-head fashion
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
399
structure length
395
Chain Sequence
DLPSSFTGYFKKFNTGEEIISQEILNLIELRMRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGVVEVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPNTYLEKMKFYEYDFFIIISATRFKKNDIDIAKAISMMKEEFYFVRTKVDSDITNEADGKPQTEKVLQDIRLNCVNTFRENGIAEPPIFLLSNKNVCHYDFPVLMDELISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQRIWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLARDWEIEVDQVEAMIKSPAVFKPTDETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVTEDAKTLLKEICLRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Immunity-Related Gtpase Irga6 Dimerizes in a Parallel Head-to-Head Fashion.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords INTERFERON-INDUCIBLE GTPASE 1
total genus 107
structure length 395
sequence length 399
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.6.5.-:
pdb deposition date 2015-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05049 IIGP Interferon-inducible GTPase (IIGP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fphA02
1XTIA 4UJ3A 3V4FA 3GLHE 4QGGA 2Z83A 4AIIA 4MDFA 2DR3A 2J7PD 3K0SA 1SKQA 3NBXX 2FOLA 1KSJA 2V1UA 4O25A 4NKRA 5UKDA 4TL6A 3R7WB 4KCGA 4CF7A 2JIZD 1A2KC 2NGRA 1NBME 5E7JA 3NEYA 3MWYW 1S9HA 1S0UA 2IEYA 4HUTA 2W6JA 2JDIA 2GF0A 3CF6R 2ZR9A 4JLMA 5EZ5A 3VTKA 1N6IA 3KUCA 1G8HA 3I32A 5L3QA 5KDDA 4ZKDA 2BBSA 3EAQA 1IN7A 4N0DA 1Z3IX 3QF4B 4V03A 4B76A 4CT4B 221PA 2Z4SA 2O8EB 5LB2A 1AA9A 2IYVA 4A0RA 3TW4A 1T3SA 4X8LA 3K0AB 5KTYA 2HXSA 2K5UA 4BASA 1KI7A 1TMKA 1JAIA 1XTRA 3W6OA 4A8JC 2OXRA 3L0SA 4JBYA 3SDZA 5E3HA 1LW7A 1SZPA 4ESHA 4P4SB 1EG7A 2OFXA 4PZLA 1FTNA 4B71A 4KODA 2GDJA 2UZ3A 4JKYA 4IOLA 3N5CA 1E2FA 3U3KA 4OHYA 4TMKA 1NMYA 1OKKD 3WMFA 5EE1A 3TSWA 4ZIRA 4NCIA 5CB6A 2OBNA 3WNCA 3FOZA 3CR8A 4IOMA 4B2IA 2BVNA 3VHLB 1DTSA 4PHHA 3HP1A 1U8YA 1DAHA 1MO3A 3S1AB 4QL3A 1IJFA 1W49A 2ZIAA 4NP6A 3GEIA 4OQLA 2F1HA 1YZNA 2C78A 2QI9C 4G1UC 5ELXA 1G19A 1TL7C 1J2JA 2EW1A 1JB1A 1GP2A 3SJBA 1NNEA 1QHSA 3AUXA 3W5JA 3GJ0A 3BFXA 1SGWA 1Y3AA 4C9BA 4E09A 1XXHA 1KI1A 2QT1A 4OKSA 1N6NA 2QSYA 1JJ7A 1ZYUA 1TUEA 2WWXA 2J0VA 1Q1ZA 2OHFA 4F7WA 2ZRFA 1QF9A 1RIFA 1KDRA 1UEIA 2ATXA 2ZSDA 5FH9A 5GVRA 2MSCB 1SVWA 3CPEA 4B3XA 4OHXA 4A0FA 2G77B 1NMXA 2ZSEA 2QTFA 1UDWA 1JAHA 1II0A 3F8TA 2QP9X 1OKKA 1OJLA 2CNWD 2G83A 1W36B 4PPGA 3X1YA 1WBDA 1W36C 3K0FB 2DFLA 3D31A 2W0MA 4IJMA 2QAJA 2JLZA 1BMFD 2X2FA 3QXHA 5TB5A 2O0JA 2QM8A 4PAOA 3QENA 4KYIB 3OF5A 1QHHB 3EPHA 3WYGA 3THXB 3C15C 2P67A 2FSGA 1UM8A 2VL7A 4EJSB 3OEHA 5EP4A 4C0SA 2QMUA 1XD2A 2REXB 2NO1A 2OZEA 5CK4A 2NG1A 3WP0A 2GBLC 3FHOA 3TSOA 1YKSA 2DFTA 1MO5A 1M34E 4L4UA 1ZD1A 1GITA 3HDTA 5EE9A 2CJWA 5EQTA 3CRMA 1QVRA 2J59A 5FL3A 3A1TA 1UKEA 1Z0FA 1QVAA 1WB9A 2RGAA 3EA5A 3TBKA 1ZD9A 2NO7A 1E2KA 3LAWA 3O8DA 3RRMA 1YVDA 3ZIAD 621PA 4NL4H 1XEXB 3KTAB 3EPKA 2REBA 4HAZA 1GL7A 2ONKA 1KI6B 4PX9A 4TN1A 2P5SA 3PEVA 2BHRA 3K9HA 3SS8A 3I5YA 1K5DA 3PJRA 1JXMA 2GK6A 2IT1A 2J7PA 2RAPA 1Z06A 2BEJA 2LWIA 2RMKA 4KAXA 3KXKA 3RS5A 3T1VA 1XTSA 3GCGA 4EQ6A 5BN4A 4OK5A 2WWIA 2R65A 1NN0A 2VA8A 4QNRA 3T1OA 2H18A 5EP3A 4Q02A 3UXMA 4P32A 5J4YA 3H1TA 3HJNA 2ZRIA 2HDNB 4Q19A 4GT1A 5FFMA 2FSHA 4KITB 1U0JA 4XVQA 5KDLA 2NO0A 1TQ6A 4AURA 4Q1BA 1CJVC 5FTKA 5CK5A 2IYYA 2WHXA 3EIHA 5JLJA 2GCPA 2F9LA 3WHLA 5FOSA 1RYHA 4QBFA 1VDZA 4KBFA 1FMLA 5L3SB 2UKDA 3IO3A 2VHJA 4OI0A 2FH5B 3K53A 1ZC3A 2ODBA 4DLWA 3D8BA 3LH5A 1JNYA 2WPDD 1GRNA 2A7QA 2XSZA 5KSZA 2GEVA 2OLJA 3UPUA 1QHHA 1Q21A 1U8ZA 2XZPA 3K9NA 2OBLA 3NVAA 2JAQA 1M7GA 3OHMA 1T5IA 2BBOA 3A6PC 1HE8B 4DUGA 4C30A 1EFTA 1NG1A 4Q1DA 1AQUA 1GFIA 3BH6A 4LRWA 1UBCA 2DWQA 3Q72A 5JBQA 3NH9A 3T1TA 1E2PA 4DDWA 4BFXA 2IS4A 2ZJYA 1RRFA 2BDTA 3AKCA 4JSTA 2OILA 2VHTA 3K0CC 3PVSA 2G1JA 2GHIA 4M1WA 1XP8A 2B21A 2DCUA 3ZJYA 3LX5A 1JPNA 2J7KA 5CIWA 1ONBA 4BUJA 4UKDA 3U3RA 4K46A 3W6NA 4OHZA 3TUIC 3EZFA 4CDGA 3K70B 3GJ8A 4TTRA 2QQ0A 3FWYA 1OF1A 5K8IA 1ZNYA 2IYXA 2QSZA 2NQ2C 3CONA 6Q21A 3VNUA 2IX3A 4JVMA 3VMFA 4DSTA 2Q3HA 1T5LA 3TLXA 2FEMA 1OB5A 2VP0A 4AKHA 2GESA 3I73A 1S9DA 3IO5A 1XDBA 1SHZA 4JVLA 1HUQA 5FUWA 3F0TA 4N1AA 1DBSA 4KSCA 2WMOB 3AF3A 3KKPA 1ZINA 4OI4A 2CXXA 1RJ9B 1P72A 3PCRB 4LV6A 4Q9HA 2HCBA 3TAUA 3D7MA 3VX4A 3GD7A 1N2CE 4LJYA 1YZLA 3B2EA 4W7SA 2WOOA 5FI0B 3O8RA 4LV8B 4NONA 3QKRB 1IM2A 4FMDF 2ZRJA 2JLQA 1OXSC 1XEWX 1IY0A 1W0KD 1E2GA 3MG9A 4RJLA 4CYMA 2XSZD 2WWGA 3LNCA 2VIIA 4HZUB 2GTPA 5BN3A 4YMSA 3AVPA 2WJIA 3SYNA 1G7SA 4LJ6A 5F3WB 2J3EA 2VP9A 3L43A 1WA5A 2C2HA 4U7DA 3NHBA 3QKSA 4QFMA 1OLOA 3P4YA 1LNZA 4DDVA 4RKFA 1GDDA 1OHHD 4BZXA 2HCJB 4C0QC 3AF1A 4NYMQ 5J4VA 1K8RA 2YYZA 2D06A 4OBEA 4C0BA 5D3QA 3QKRA 3HWSA 3UMSA 1E2JA 3QF4A 1EX6A 4BLOA 2GXSA 2D62A 2O8CB 4D25A 3PITA 2EYQA 1EX7A 1US8A 4KFUA 1DAKA 4EJSC 2ZI4A 5IK2D 5K8TA 3BERA 3LRPA 1XTKA 4OJQA 1RZ3A 2RHDA 3CLVA 4WXPA 4DIDA 4BEBA 3CRQA 2ZRMA 3B7GA 1UBEA 1VG8A 1OSNA 1KMQA 2AX4A 1W2HA 2N46A 4LHYA 5CLLA 1F6BA 1I4LD 1W1WA 4G3XA 3SFZA 1KO8A 2JJ8A 1RFLA 4KLZA 4JLOA 2OT3B 4B3DA 1KOFA 1NY6A 3SHWA 4HDCA 5IDVA 2CHGA 4ERNA 4PC6A 5SZIA 1F2TA 1JR3A 4XWKA 3OEED 3B1VA 1N6PA 4D0LB 2V3CC 2HYIC 1NVVQ 3NWJA 3BOSA 3P27A 3QKTA 4TQ9A 2PX3A 1GNRA 1Z47A 2G3YA 1H8HA 1ZIPA 3GLHB 1BYIA 2CCKA 2ODEA 2QRNA 3ZVMA 5E4FA 3RVBA 1FX0A 1YZUA 3U3JA 1QG2A 1XXHB 1ZM9A 1MV5A 4IXMA 4YDSA 1NKSA 3TRFA 2FMXA 1GILA 3WMGA 2ANCA 2QUZA 3T1QA 4MRSA 4AYXA 1JQJC 5CDFA 2DWPA 2P5TB 5E7MA 1YHNA 4JZKA 4FCVA 1ZJ6A 4XSGA 3LDAA 1IONA 2ZE8A 1P75A 2ZRPA 3BXZA 2CEAA 3B13B 5JJKA 3LBIA 2NZ8A 2FZLA 2PCLA 3AKEA 3EG5A 3ZLJA 2WSMA 3W90A 1C9KA 2TMKA 3B6EA 2ZRAA 3AVUA 3KXLA 3THWA 1T9HA 2EWWA 5DYIA 2ZI7A 1CU1A 4PSVA 2RGXA 4RD1A 1M2OB 3FB4A 2RGNA 3J81k 4MYCA 1VPLA 2OSBA 1ZM7A 2IYSA 1NSTA 1XRJA 4TQUS 4L9SA 2IS1A 2O8CA 1NIJA 2ASEA 1SVLA 3QF7A 1KI4A 4AY2A 3KL4A 4O2RA 3TSZA 1KK3A 3KB2A 1R7RA 4XWAA 4M22A 2YOFA 1EFUA 1HT2E 1X86B 2C9YA 4KXFB 2Q3MA 4XD7D 1MABA 2OCPA 3U2QA 1ZIOA 3CUEF 2A30A 4RFSA 1P61B 3RC8A 2RB4A 4DLSA 4D80A 3U6BA 3CBQA 1HT1E 1KJYA 5DNYB 2JLYA 3KKQA 3FMOB 4A1FA 3R9WA 4G01B 1E9FA 4PZYA 5FPKA 2KWIA 2A5FA 2AFHE 4F93B 2X2EA 1Z6GA 1CRQA 4MRPA 3QXCA 3MAAC 2OLKA 2WBLC 1T0JB 4OQMA 1U99A 2UZIR 4TSFA 5FTJA 2ZUDA 2QM7A 2B7BA 4BLPA 5L3QB 3GLGA 3IIKA 3LD9A 3AVTA 1G3IA 5KO2A 4DLRA 4DCVA 1M8PA 2C99A 4L16A 4PTLA 4Q48A 1AGRA 3HU1A 3TIFA 1BOFA 3MMPA 5EXPA 5FPTA 3SZRA 1KSFX 4KHZA 1R0YA 1FOEB 1W0KA 2GEUA 3T61A 1FNNA 1XJCA 3UMFA 4BEJA 2ERXA 5C18A 2QE7A 1FP7A 3QXJA 3QIAA 3REGA 4LHXA 2EYUA 2LCFA 4CRWB 4KO8A 3LXRA 4V0MA 1ZNXA 4LYFA 1NLZA 1G5TA 1WP9A 4P4UA 5CJPA 2GJKA 4PO1A 5JS7A 1WE2A 1DG3A 3ZD6A 5L3RA 3IDQA 3KKNA 4IXNA 4TLDA 4DCTA 4LPSA 3LVQE 1B23P 1R0WA 4D4KA 1TEXA 4D4LA 3WBJA 4HSEA 4TTPA 3OE7A 4M9XA 2JLRA 3DZDA 3E1SA 3FKSD 2HT1A 4OQFA 4TMTA 1P9NA 4O0MA 4D0NA 3C5HA 4DCSA 2GCNA 5H68A 4L5BA 1X3SA 1DEKA 1R2QA 4PZZA 3VNVA 1IN5A 2NO9A 2ZE5A 4QJ4A 4YC7A 4RFSB 2ZVPX 4ZPXA 2MSEB 4KVAA 1OH6A 1N25A 2R6CA 5LBIA 2OE2A 2CCGA 2YJTD 2QP3A 4AC9A 4BLQA 4TZ6A 2ZRLA 4MGZR 4TLAA 2HJVA 1DE0A 2ZI9A 3IBGA 5FOTA 1JR3E 4DT1B 4NYJQ 2VHCA 3HU3A 4DLXA 2F7SA 2Q21A 4V02A 2NO6A 4PXAA 3DDCA 4HDOB 5JRJA 2FFHA 3AVYA 2H7VA 3TGPA 3R8CA 3RHFA 3ZVNA 3VQTA 2I4IA 3FMPB 2PZGA 2VH5R 4BZPA 3TKLA 5JRZA 4A0GA 2YVUA 3BB3A 4Q4AA 1KAGA 5KU1A 3GLIB 1T3LA 4NPHA 3OAAA 4Q18A 2D7CA 4JS0A 3GFTA 1YE8A 3CX8A 3WYAA 4JYBA 4A2WA 1FMJA 3PUZA 5DHFA 4IOJA 1II8B 1H8HD 3QEJA 3OESA 2IS6A 1BH2A 4YXWD 1YR6A 2V54A 3IILA 3EPJA 2O0HA 1TX4B 1NBMA 1FUUA 1U8AA 2QA5A 3L8ZA 4KJZA 5EE3A 1JR3D 2BWJA 3H2YA 4JIMA 4B43A 5JI2E 3PEUA 1EWRA 5FL7D 4TMVA 2D7DA 3VR1A 2JEOA 1YR9A 1D5CA 1XCGB 5FTNA 5F98A 1AQYA 2O8BA 3OIWA 2WKPA 3EIQA 5BWMA 2E87A 4JT2A 2J0UB 3PV0A 1G3QA 4NCJA 3T15A 2HUPA 2GILA 5FBRB 2CK3D 3ZZTA 2FWRA 1H8ED 4M2LA 1ZM2A 4MUAA 1XPOA 1SKYE 5IT5A 5FPYA 4DCUA 3THXA 4HATA 3UKDA 2CE2X 3LBNA 1R8QA 3GLFB 1A1VA 3QBVA 4MRVA 1RRPA 1PLLA 3NIBA 4JYCA 3U44B 2ZUCA 4J0QA 2GRJA 1T3HA 2PJZA 2XAUA 5EUQB 2ZTSA 3AVWA 1W5TA 1OHHA 2ZS9A 4KYUA 4W5JA 1U0LA 2C9OA 2WIAA 3ICEA 3B85A 4E07A 2ZE7A 2IXFA 2UVQA 2O8EA 2C98A 3L2OB 4I4LA 1CULC 4H1VA 3W8RA 2WJGA 2G0TA 3P1JA 4TTQA 4CT5A 4KVGA 1P2VA 4LC0A 1MH1A 1J90A 4LJ5A 3KKMA 2XEXA 1E2QA 3W34A 2Q9CA 1E0JA 4I1OA 3CF0A 4DLUA 1DAGA 1ZU5A 2ZI5A 4O3MA 4NMMA 1U2RA 2A5GA 1VYVA 5LDDC 3CB4A 4S35A 4XWOA 3ADDA 2DBYA 2IWHA 4X8HA 1OV4A 1KKMA 3TMKA 1GIAA 2QEQA 3FMIA 4OQXA 4IDPA 3I4LA 1IAQA 2WWWA 3CZPA 1W47A 4HLDA 1VYTA 2P3SA 1OPXA 3A37A 3CH4B 3IPYA 1OIWA 1YU9A 4NZYA 1VIAA 5TV2A 1RRCA 4QM6A 2IYRA 3H86A 4IDOA 3W9YA 4DZZA 4ZDJA 2ZRDA 2O8BB 1XFAA 3ASYA 3C14C 2GJ8A 1KO5A 4GI7A 1NG9A 1MO4A 3KZ1E 1CRPA 5LPNA 2XOKA 4A36A 3M4YA 1VG0B 4U00A 5D3MA 3PUVA 3EWSA 2ZUBA 3O8BA 4QGAA 2VYFA 4FN5A 4IEIA 4Z1MA 3I1FA 3X1XA 1UJ2A 4MYHA 5JWHA 2QAGB 4BQSA 2DYKA 3G0HA 2O0KA 1GUAA 4AYTA 4NTZA 2AR7A 3DEFA 3PXGA 1PVOA 1Z08A 2IUTA 1MABB 3GFPA 4Y0AA 2CE7A 3GJXC 4D6PA 3RS4A 4XTCS 4BFZA 5JJLA 1IN4A 1G8PA 2MSDB 4QKQA 1XMJA 1D9ZA 1Q1BA 3ZZ0A 3Q85A 1J8MF 4M0LA 4O2LA 4RKEA 1DO2A 2WICA 1YRBA 4CEJB 3QKUA 4RCYA 3PENA 3IBYA 4HAXA 2ORVA 4MKGA 1G8YA 4WW0A 2O8DB 2JJ2A 1Y63A 3EW9A 4V0LA 5DI9A 2B92A 1FNMA 5AJYA 4F4CA 1SXJE 1II9A 1KK0A 3L0OA 3CRW1 4LJ9A 3EZ9A 2GAAA 4P4TA 1EESA 2J87A 1C4OA 3RSOA 5SZHB 5J4KA 4V0ME 1M74A 3C4JA 4KSBA 1F2UA 3V9PA 3EZ7A 4KI0A 3PQCA 3CRVA 4A8JA 1G7CA 1NRJB 2JIZA 1G3MA 4GP6A 2RGNC 4ZDWA 3IQXA 2IF0A 1GL9B 3MD0A 1KAOA 3GFOA 2ZYUX 4OHWA 3WYFA 1DS6A 4GL2A 1CTQA 2VP2A 4FD2A 4R98A 1K6MA 2CLCX 3C5CA 1G18A 1DARA 3AF0A 1N6OA 3BD9A 3FPAA 4TMXA 3NXSA 5B2ZA 1ESMA 2HEIA 4TMWA 1XTJA 3CZQA 4NYJR 1ZAKA 2R8RA 1X1SA 3RANA 4PHFA 3SI7A 4BRWA 4TLBA 1S96A 2ZYVX 3M1IA 4OI2A 3T35A 2HT6A 3UG6A 1WBBA 3ZS8A 4C2UA 3PUYA 2P6RA 4B3FX 4ASUA 1HQYE 3DHWC 3WMEA 2PLFA 3K9LA 4TT3A 1EWQA 4PQRA 1SKYB 4GOJA 1ZVQA 5DISB 3VX3A 1DADA 3L0PA 1VMAA 2F9MA 3U5ZB 3AVOA 2F55A 3U7HB 3JVUA 3N2EA 4JKIA 5FBLB 1G17A 1G8GA 3LQRA 4ILEA 1W4RA 3LA6A 4DIEA 2ZJAA 3KDSE 2GK7A 4LJAA 4P3YA 5L3SA 1XPUA 4M1YA 4L9WA 4QRHA 2VSFA 3BS4A 4LOAA 3T12A 4B44A 4G5SA 4PSAA 3SJAA 4TMZA 1E9DA 2IC5A 3OEHD 4JBXA 2IYZA 1WMSA 1UADA 4B35A 3ZZUA 2C03A 2ZSBA 1E32A 2H92A 5DI3B 4KFRA 2BMDA 2PX0A 1RRGA 4Q7MB 2BBWA 3O8CA 3KQKA 5J40A 2DWOA 3MWLA 2WZQA 3IEUA 2HLDA 1TADA 4Q1CA 3UWOA 4FMCF 4NDZA 1W4AA 1Z8FA 5JZVA 2EFCB 3LX8A 1E3MA 4NYIQ 4DHEA 1CR1A 1V43A 5EP2A 2CVFA 3ZQJA 3UK6A 3THOA 1AZTA 3OEEA 1F2UB 1G3RA 3PUXA 3ADBA 1XEXA 1Z0IA 2GJAA 2GXUA 1JEEA 2CLDX 1E9AA 2GVDC 4I81A 2H16A 1P5ZB 1VIYA 4A9AA 5CDFE 1V5WA 1EXMA 1E99A 2V6JA 4TL7A 2YKGA 1Z2CA 1EFRD 4RFVA 4ZO4A 5L3VA 2FX3A 3CX6A 2GZDA 4FMCB 2QQEA 3VKWA 3NDBB 3GQBA 4R2HA 4PPFA 2XJ9A 1A7JA 1EFCA 2GCOA 5JMTA 1TPZA 2VF8A 1W36D 1TF2A 3VU9A 2ANBA 2PMDA 2OO7A 1COWA 5FOXA 4ZIRB 3BK7A 5H8WA 2F6RA 2H1LA 4W9MC 4BFYA 4OQNA 1YQTA 1SULA 1HE1C 2WSSA 1P60A 4XJXA 4Q4HA 2RH5A 1FPMA 4BECA 3S1AA 1Q1QA 1S8FA 4HB3A 3UIEA 2BJVA 3B60A 2JLUA 1KY3A 4URUR 4G5OA 1BO6A 3HR7A 4EDHA 2XZLA 2FU5C 2FG5A 3W3AA 1E1QD 3CR7A 4PC3A 4US0R 5AJZA 4GP7A 121PA 2W2XA 4KV9A 1OE0A 4TL8A 5FR2A 1W4BA 2NMVA 3AGPA 4LBYA 3I8SA 4MITA 3WRYC 5FBQB 3SQWA 3F5FA 1F2TB 4MGKR 4B33A 3IUYA 5CYOA 3DOEA 3BB4A 3AKYA 2ODWA 4NYIR 1AS2A 3WHKA 1QHIA 4P31A 1HY3A 4EAQA 5JWOA 2ZR7A 4QXAA 2XZOA 1I4TD 1Q3HA 3HYTA 5B58C 1SXJB 1EK0A 4QG7A 1P62B 1UKVY 3NTUA 5AR1A 1G20E 1IXZA 3TAHA 2WSSD 2I1VB 3WY9A 1G7RA 1QG4A 2W6JD 4D4JA 2CK3A 3SR0A 1UKYA 1L4YA 2ECKA 4BLRA 2XXAB 2ZM5A 1CP2A 4ITRC 2IUUA 4NCHA 3A4MA 3I3SR 1GKIA 5EE5B 421PA 1DG1G 2OV2A 3FGNA 2AK3A 4BE7B 2ZS7A 1Q57A 4Q9LA 2NOAA 2QRZA 2XNSA 3AP1A 2WKQA 1N6HA 4TQAA 2AFIE 2BEKA 2J5XA 2GVZC 5J47A 4B2PA 5DN6A 5DSZA 3DMNA 3SBEA 4FXPA 3B5JA 1JR6A 2J0SA 2F43B 4LJ7A 5DHAA 5HZKA 1SVOA 2HF9A 4Z8XA 3UWKA 1AN0A 1RE0A 4FWIB 3SE0A 2N1BA 3CIOA 1KI6A 3ETLA 2IYUA 3OIUA 4JLVA 1E0AA 1AIPA 3MRSA 3U44A 1KI2A 4AKGA 4MH0R 4PO8A 4QGFA 4EKDA 4OHVA 2J1LA 2CBZA 2C96A 3NKVA 4UXJA 3OFNA 4H1UA 5TVKA 5CB8A 3GEHA 2ZS8A 3QPVA 2H17A 3B1ZA 1KO4A 3WRXC 4ZV4A 2WOJA 4WA7A 5D3MB 1R5OA 5ANRB 3EIEA 2FF7A 1ZU4A 4Q47A 5EXSA 4UNPA 2BC9A 5DI3A 2ORWA 4W5WA 5TDHA 1E98A 3VR6A 1LS1A 2GKSA 4G5RA 4MRNA 1Z22A 1U90A 3DVLA 3RNLA 4HI0E 1VCOA 5SZJA 3K70C 4DSNA 3ZH9B 2WM9B 1OXXK 3IIMA 4PAMA 4F4JA 3X1ZA 3RS2A 3JZAA 5C46F 3D6TB 4C2TA 1SXJA 3AP2A 3AVVA 1ESNA 1WRBA 4XTRA 2XNDA 3SN6A 1J99A 2BOVA 3RSLA 2PH1A 1TQ2A 3SOPA 3AP3A 1KGDA 1TF7A 4TYQA 1AGPA 4BGDA 1KMHB 1NN1A 2IXEA 2YOGA 4ZI3A 4ESVA 4CEHB 4AD8A 5DH9A 3HYRA 1OYWA 3AEZA 3GLGE 3KQUA 2HYDA 4FINA 3UMRA 1G64A 2IXGA 2KJQA 2YC4C 4NU0A 2D4HA 4CVNA 2GBLA 2F1RA 2QY9A 3U3OA 2ZRBA 3KUDA 3K70D 1K5GA 2L0XA 2ZJOA 5HKKD 3K0AA 2X1VA 4HZUA 3VAAA 1JPJA 1NVUQ 1G41A 1ELOA 1JEDA 1L4UA 4Q66C 2QPAA 3VFDA 2JJ1D 4LYJA 1XU4A 4S2EA 1ZNWA 3QBTA 5K8UA 2OM2A 3K1JA 4TL9A 4Q9IA 1KO1A 2ZRKA 1IOZA 3R9XA 1E2NA 2PZFA 2FE4A 2RCNA 3AGQA 1GTVA 5HE8A 2QPTA 2R6GA 2EWVA 3RS0A 4LJ4A 4C0LA 1Z0KA 4JVSB 4A6XA 5KNDA 1Z83A 5DYGA 2ZU6A 1RYFA 1XZQA 5C2JB 1E2IA 3FHTA 2ZAOA 1Z6YA 3CO5A 2PZEA 3C8UA 2WJVA 2ZROA 3B8HA 4TSFD 4AK9A 1YZGA 4B6FA 4BFWA 2VSXA 1TF5A 1MOZA 4M1MA 4LHZA 2WIBA 4JMPA 4GZMA 4Z1MD 4CEIA 1QRAA 3QEOA 1IJEA 1NF3A 1LS6A 1N5JA 3DL0A 1T8TA 4IRUB 3GJ5A 2V1XA 3BBPA 5TXGA 4TYWA 1NVWQ 1NJFA 4DB4A 2QZ4A 2KE5A 3R9IA 1VKJA 3PUWA 4LWZA 1QHGA 4MA4A 4Q4JB 5CM8B 3VR3A 3AVXA 4HAUA 3AF2A 5FUYA 2IYLD 4M1KA 5DIFA 3ZQ6A 4V0NA 1ZC4A 4M1SA 2GZHA 1G291 4EJSA 5JJIA 1GM5A 3Q8XB 5CM9C 4XSHA 2ONJA 2QTVB 4M9ZA 1CS4C 1IXRC 4LHWA 1LTQA 3THYB 4WVFA 5FUVA 2ZYTX 1OH7A 3AM1A 3TJZA 4ZCMA 4DRZA 4IKEA 4GPTA 2C77A 1E2LA 4U5XA 5C4MA 4JLBA 1G6OA 3LLUA 3NH6A 4LUCA 4E5UA 1T6NA 3EASA 5IF9A 4LPKA 1PLJA 4JLJA 4Q9JA 1OFHA 4Z8YA 1Z29A 4LC1A 1HYQA 1BYUA 1AK2A 4H9GA 4JL5A 4C3ZA 4US2R 1NI3A 1E9SA 2A78A 2QMHA 4LYHA 1Q12A 4GOXA 4FW9A 4R71A 2ERYA 3H0KA 4JLKA 2XITA 2VP5A 1G7TA 1F5NA 4DEYA 1GL6A 2PJRA 1N0VC 1GRRA 2QP4A 3EARA 1E9BA 4Q7JB 1J7KA 1E69A 2PL3A 4JLDA 4BRUA 3GPLA 2V7QA 4LCBA 5B30A 2WTUA 4EPYA 2Q9AA 4GSYA 5FBVB 2AK2A 1CBUA 2O52A 2JJ1A 1QHYA 2ZYWX 3GJ7A 5LB4A 3QSYA 2Z6VA 2Z4RA 1WCV1 2CHQA 3KFVA 1D8TA 4TT3D 1AS0A 3ONWA 1H8EA 2AD5A 2Q6TA 3QG1A 3IEVA 2RKOA 3OIYA 3NEJA 4FWTA 4PO9A 3A1SA 5G53C 4TYNA 2IUSA 3LWNA 4Q1FA 1R8SA 4F91B 1CIPA 3RC3A 3GLGB 1XPRA 4PPQA 2J0UA 2ZJZA 3RLFA 1KK1A 1ZCBA 4YMUA 4MQBA 5JS8A 3C7KA 1KI9A 1NJGA 1MRSA 4JL6A 4ON9A 4A4DA 1N5KA 4TWZA 2E9SA 2VSOA 5AJXA 1GKUB 2O8FB 2C9CA 4QNMA 2ZSAA 1DPFA 5HCIA 2P2LA 1J70A 2W58A 4DKXA 3PEWA 4C0JA 4OK6A 2VP6A 4QBHA 4Y0VA 5FR1A 2FDCA 1OH5A 5FUXA 3SQXA 4LV5B 1QZXA 5HR5A 1UDXA 2W00A 2YWEA 2ZE6A 3BJIC 3ZVLA 4CIDA 1OFUX 4I1UA 3F3YA 1N5IA 3L82B 2V4ZA 1KZGB 1UPTA 2J46A 4A82A 1LVGA 2EU8A 1R10A 3CPJB 1AZSC 1KKLA 4DBLC 2F43A 3FKQA 1P6XA 3GLIA 1ZP6A 3EA0A 3NBZC 4D81A 2RGGA 3TR0A 4C0HA 1VTKA 3SU8A 2QU8A 2AWOA 3CNLA 1UBGA 1XJQA 5HTKA 4B3GA 2IA5A 5AWFC 2F1IA 1CJUC 1KI8A 5FPHA 3P32A 1G21E 1GAJA 3P20A 1WQ1R 1N0UA 4A2PA 3L0IB 3FDIA 1R5NA 1XD8A 3A8TA 3NC0C 2CCJA 1ZUIA 4IOKA 4MYTA 3X1WA 1UEJA 2R6FA 3RRNA 3SNHA 1TU4A 1VECA 821PA 3ZYCA 1ANKA 5KSOA 1P9WA 4CEJA 3WXMA 5IHPA 1D2NA 3I62A 1TQDA 1E2DA 2Q0HA 4PFSA 3N2IA 5FBWB 1KSGA 1N6KA 4Q4JA 2XOKD 4M4SA 3TUJC 1FFHA 3H84A 2EFHB 2GJSA 3RYTC 4E03A 1IY1A 3WNBA 1OH8A 4IEEA 1A82A 2RGEA 3HU2A 1XXHE 3N70A 4A2QA 3OE7D 3IIJA 1KJWA 3VHXA 1SVKA 1OXUA 2VHUA 3I8XA 1Q20A 3TE6A 2QPOA 1GNPA 1X6VA 4HZIA 1E1RD 3MGCA 4II7A 2DPXA 4IW3B 1KDOA 4R2IA 1XX6A 2VP4A 3QY0A 1NKTA 4EPTA 2BKUA 1ZBDA 2KB0A 5EP1A 5EUMA 5FTMA 5HCNA 4HLQB 3SBDA 1EFHA 4CEHA 4GMDA 1SQ5A 1OYYA 3TUZC 1XWIA 4R7ZA 1PUJA 2H8KA 2WJHA 5GJCA 3MUFA 2N42A 3B82A 1BS1A 2VLIA 1Z6TA 3DOFA 1R0XA 5L8VA 5H1YA 4C0KA 2QROA 2R44A 2WV9A 5EXTA 1C1YA 2Z0MA 3QXXA 5AJWA 1XBTA 1US8B 4D82A 2IS2A 1D6JA 1XD2B 3W5IA 4UJ5A 3CM0A 1N6LA 3MWJA 3QXSA 2OG2A 2JLWA 1RJ9A 1UAAA 1Z2AA 4BPBA 4JLNA 2FN4A 1H65A 1P73A 4G0NA 2ZJ8A 2OCYC 4B34A 2O8DA 3H4MA 4AG6A 3A58B 1R0ZA 3IHWA 4M53A 1RVDA 2ZQ5A 3W8NA 1DELA 3QPWA 2WMNB 1E1QA 3C41J 4Q21A 2XX3A 2ZETA 3VU9B 1G9XA 2FNAA 2E1RA 2QGNA 1ODFA 4KLNA 5B64A 1P7CA 1YZQA 3CW2A 3OIVA 4B2LA 4PC2A 3DKVA 1HA3A 3DPUA 4Q4AB 1W7AA 1SXJC 2A5JA 1FQJA 4AI6A 3RRYA 4U02A 3BH0A 2G6BA 2XB4A 4Q4LA 4B73A 4WZBE 1U81A 4XVRA 3EPLA 3VR4A 1U94A 2VQSA 1FW6A 3VR2A 3DM5A 2BBTA 4LGMA 5AUQA 2ODNA 4LBVA 2RGCA 1Q0UA 1P2UA 3K0EA 4UNQA 2W2TA 4ARZB 3ICQB 1OW3B 4URWR 5FL7A 1KZ7B 4IVRA 1MT0A 2W6IA 4FMDB 4MGIR 3UATA 1KI3A 1T8UA 1GWNA 4NCKA 5J4HA 4YXWA 2A9KA 2IW3A 1G4AE 1PZNA 1AKEA 1XMSA 3HR8A 4DSOA 3WNDA 1VHTA 4FCWA 2BM0A 2QENA 1M6NA 1WDTA 1IN6A 5KNCA 1S1MA 3R8FA 1DAFA 2GNOA 4LJ8A 1GKYA 2ZRCA 4EPWA 1CEEA 1HEIA 2C95A 3OAAD 5AJVB 2KBFA 4NHOA 3AKDA 2IL1A 2J9RA 1OT3A 3KQLA 3B78A 1DAEA 1ZRHA 3AV0B 1G8FA 3M0EA 2VTKA 4QM7A 3A1WA 2GA8A 4NYMR 3QKSB 3U60B 2CNWA 2D74A 3BFKA 4Q7KA 1XJ0A 3K0FA 2WKRA 4YONB 2W6ID 1F48A 4JL8A 1FX0B 3K09A 2CVHA 1LV7A 4HLUA 1HQCA 2OFOA 2WAXA 1WF3A 2IHYA 3LBHA 4A8JB 3UG7A 1U9IA 3G82C 4ASUD 4OI1A 2ZI6A 3DZ8A 4LBZA 3LV8A 1KO7A 3LO5A 3UANA 3HPQA 3RS3A 1PUIA 4WXRA 3QG5A 3IPXA 4BLSA 4A0HA 4NE2A 2G0NA 4A6PA 2G1KA 4GZLA 4ZDIA 1A5TA 5KNBA 4HB2A 3MFYA 3B1YA 1EGAA 1P3JA 1O87A 4QBGB 4X8OA 2IYTA 1UKZA 1QHXA 2PT7A 4RD3A 4EUNA 3MJRA 1DOAA 3BC1A 4N3NA 2J41A 2REOA 4RZUA 1KJZA 2VEDA 1LFDB 1GNQA 3LQQA 1G5RA 5K8LA 5EE0A 4QGHA 5BN5A 3O47A 1JECA 2BCGY 2ZITA 1Z0AA 2FSIA 2YZ2A 4FCTA 1I4DD 2EQBA 3GJ6A 3KJGA 4JLAA 4A15A 1NN5A 3ADCA 8OHMA 4WBSA 1TTTA 1XCPA 3B9PA 1Z63A 4CGZA 4I1VA 1E94E 1QDEA 3GLHA 1KY2A 4AKIA 4WZ6A 2IBMA 2H5EA 5FOWA 4ZKEA 5KPDA 2JJ2D 2IF2A 1X1RA 1XCMA 2YC2C 4RD0A 4YMTA 2QE7D 4DLZA 3QJYA 2OUKA 5HE9A 2DHRA 2QN6A 4B6EA 2XTNA 5HZHA 2FPKA 2Z5FA 1JBKA 1KMHA 4G5GA 2GETA 3DO6A 1LF0A 1CR4A 2WJYA 5JECA 3DM9B 2FZ4A 1VYUA 1PJRA 2ZR0A 2HV8A 1E2HA 3KXIA 4OJKA 4XH9B 4EFNA 5KSYA 1S3SA 2OAP1 2JLXA 2ZRNA 4IFEA 3LW7A 2JDID 4YLGA 3A1VA 4US1R 5FPSA 1Q3TA 2V6IA 2JA1A 4M21A 4EIWA 2CLSA 3W3ZB 1E4VA 4JSYA 4QJ3A 3E2IA 4HAYA 3BB1A 4KFSA 5AK0A 2YWHA 1AKYA 1S4QA 4B3CA 1YZTA 4X8MA 2AHOA 1N3BA 4AKEA 3QVUA 1XTQA 4MKIA 4UNRA 5LD2C 2XTMA 5G41A 2YNMA 2GCOB 721PA 4A92A 4DXAA 1UBFA 3SJCA 4NBSA 2B7CA 1NVXQ 3PFIA 4PSKA 5A0FA 1NP6A 4EQ6B 3KKOA 2OCAA 2QMEA 4QBIA 3B9QA 5GJVC 2Q9BA 2I1QA 1Z28A 4V0KA 2QGZA 2YWGA 2J45A 2ZANA 2GZAA 4HLCA 3NBFA 1GRQA 2SHKA 1SVIA 1Z6XA 3T5GA 3K09C 3RRZA 4RVCA 4DC9A 2WAYA 1ZMXA 1I2MA 2ZAMA 2XJ4A 1II8A 3K9GA 5BQ5A 4POAA 4B48A 5JHGB 1P2SA 3RS7A 2PT5A 4Z51A 5BXQC 2FPLA 4AYWA 1E9RA 3P26A 2YHSA 4BFTA 5BW8A 2V55B 1GZSA 5KHOC 2ZI3A 4Q03A 4WIAA 3R7WA 3RABA 1NLYA 4EFLA 5P21A 3U6KA 2A5DA 2AL7A 5KYKA 3AVQA 1NLFA 2WPDA 4K81B 1XZPA 3KJIA 2AXNA 4BZQA 3MWKA 1YZKA 5AUOB 4E22A 3OFND 2FJUA 4MDEA 1TU3A 3MLEA 4LY6A 3EXAA 4F4IA 3AB3A 5JFGA 3THWB 1E79D 4IDQA 1FL9A 1IXSB 3KJHA 1TUIA 4RZ3A 3U7FB 3I61A 1PV4A 2NTYC 3KX2A 5FOVA 2VBCA 3FHCB 5TY0A 2A5YB 2ATVA 4LZZA 4L8GA 4LYAA 4MYUA 4DDUA 4M9SA 2KI5A 1ZUHA 3QNUA 3SYLA 5G3YA 2BJWA 4FI3C 2ZU0C 1E4YA 2CL0X 4JJKA 5CITA 4N0EA 4RCZA 1E9EA 2AKAB 2DFKB 4P4SA 4BFSA 1U98A 4HUQB 4RD4A 3AQ4A 3TW8B 3BIFA 2KBEA 2X19A 1E96A 2MMCA 4TZ0A 521PA 4BWYA 5JSZA 4RD2A 2PCJA 4CW7A 4P0TA 1AM4D 2HXYA 2LKCA 4JVNA 1J8YF 2HJGA 2G88A 4Q01A 4XVUA 3TR5A 3ECCA 4YQFA 4CEIB 1XEFA 2GJ9A 2LKDA 3QQ5A 2CL7X 2Q3FA 3REFA 4BLTA 3ZIAA 3QUSA 2O8FA 2P6NA 1S1CA 3U7EB 3E5HA 4QHYA 1W2GA 2QG6A 4MGYR 3EC1A 2BIFA 2V7QD 4HEJA 4LBWA 1T91A 3FYHA 1NBMD 1Z6AA 1GVNB 3U3MA 1RC8A 4UNSA 5DGXA 4LX0A 4C7OA 5EZ6B 1AJEA 4KBGA 2ZEJA 4PAQA 2Y8EA 2CJWB 4WZAE 3U7GA 1CLUA 2DB3A 2C8VA 1UFQA 4EFMA 5A5GA 4XIGS 3NBYC 3TH5A 3IKJA 4MKHA 1VG9B 5CYPA 1JI0A 4BFUA 4DLVA 5CIQA 1PLKA 5JCZA 3CWQA 3E70C 1MRNA 1BMFA 4LHVA 2ZPTX 1S2MA 2WWHA 4LK2A 3TNFA 1IN8A 5TARA 3ZD7A 5M04A 3KFXA 2J0QA 2W2VA 4PPNA 5KDOA 1Q1EA 5H70A 1M7BA 1NIPA 4V0OA 1XMIA 1XNJA 4TYPA 2IHBA 3NC1C 1VCMA 1W48A 4HDQB 5J5CA 1N0WA 3HPRA 2FGKA 4M8NE 3VKGA 1ZCAA 4ZCLA 1CR0A 2OXCA 2WJJA 2BV3A 4IFBA 3V00A 4P33A 2PEYA 2BM1A 4JLPA 2BMEA 3CNOA 4B32A 1I2DA 3DKPA 1LB1B 1G3UA 5B57C 1VCNA 1E1RA 1RW4A 1COWD 4F38A 3GLIE 4RSGA 2NPIA 3TVDA 1N6RA 2V9PA 1L7VC 4LDJA 4DVGA 1ZNZA 2OESA 2RHMA 4MRRA 4DWJA 3U61B 1KIMA 2R6AA 1W4CA 4PQFA 4B74A 3ZGXA 2BMFA 2OEPA 2R9VA 1EFRA 1QBKC 1Z5ZA 2D2EA 3NDPA 4F92B 5JSZB 4B47A 2IEZA 3KQNA 1VG1A 2PMKA 5BYJA 3PEYA 1O3YA 4IDHA 4B75A 4TLEA 3D3QA 2RGBA 3EX7C 3FKSA 1CJTC 5E95A 3ADKA 2XB2A 4GFDA 4EPXA 5JHHB 4ACAA 3ZS9A 1ETUA 4DT1A 2P0EA 4YMWA 3LY5A 3MCAA 3CH5A 5JEDA 2GEDA 2BKEA 1HTWA 1XMVA 2HLDD 2I3BA 4NH0A 1KDTA 1W0JA 1ZM4A 1CJKC 2JCSA 4IDNA 3SC3A 4Q1EA 3OZXA 4RZ2A 4UNNA 5KUTA 4HAVA 3PG5A 3RWOA 1D9XA 1NSFA 1CF4A 4DEXA 1XEWY 3G5UA 5DO9A 2DY1A 4OYHA 3RDPA 2GXAA 3CX7A 1R6BX 2OBMA 3M6AA 4HLUC 3GLFE 2VPPA 1OFIA 1KNQA 4BFVA 3BRWD 4URZR 5FTLA 4RD6A 4HB4A 3CF2A 4GMXA 3B1WA 4ZDKA 5A4JA 4W5HA 2ZJ2A 2GF9A 3QI2A 1FP6A 3KQHA 4URXR 4OK3A 2JLVA 4K8OA 3T34A 2ZRHA 3X1DA 4PANA 5HKKA 2ZVQX 3Q5DA 3QE0A 5C4GB 4NCNA 3L8YA 4DB2A 5EXXA 1CR2A 1W44A 4OL0A 3PIRA 4HYYA 5BYKA 1TEVA 1JQLB 2VO1A 2EFGA 5TMPA 5IRCD 1FZQA 1X8KA 2YWFA 4JBWA 2OCBA 3NG1A 2F3TA 1LF5A 1F3OA 2P6UA 4Q00A 1YR7A 3CWZA 4TLCA 1P2TA 5SZKB 5EJEA 1OFTA 1X8JA 1S3GA 5HPYB 4XD7A 1OXTA 1RKBA 2MMGA 2GXQA 2FSFA 1HH4A 2EFDB 1XD9A 2QAGC 2XTZA 3Q3JB 1CXZA 2BCJQ 3FVQA 5CLQA 1NN3A 4YDHB 1KSHA 2DFNA 2XNDD 3EWAA 4PHGA 2EFEB 3GJ4A 4Q5IA 5AUPB 2QT0A 3IQWA 4KU4A 2OFWA 3LFUA 3A36A 1L8QA 1IHUA 1IY2A 4ZCIA 3SEAA 2QAGA 2QBYB 2YV5A 1CKEA 1P4SA 4KFTA 2AXPA 2X77A 2OAQ1 3BGWA 1IBRA 4TYYA 1KTVA 1BIFA 1SVSA 1TQ4A 2CL6X 2JASA 2WVJA 4MKFA 4FIDA 4LSGA 5J4LA 4PR0A 2W83A 1ZW6A 1FQKA 4JT4A 4ACBA 2IYWA 1MO6A 1ZM3A 4XOIA 4EPRA 1CJMA 1GSIA 4URYR 4HAWA 1UF9A 1W5SA 2NIPA 1OIXA 4QHSA 4CZ2A 5E7IA 3KJEA 1T4GA 2D2FA 3FE2A 2ZSFA 3GJ3A 2VHQA 1W0JD 4C0AC 2RGDA 1U0HC 3SFVA 1VCIA 5DE3A 2QL6A 1G4UR 2PEZA 3QVVA 5KOYA 3ZVRA 1WXQA 2GAOA 3LXXA 2H57A 4DLYA 3FMFA 2O5VA 2HF8A 3LLMA 1E2MA 4ARZA 2FEOA 4Q7LA 3JZMA 4G5QA 3BE4A 1D2EA 1U9IC 3AF4A 3SYKA 4D26A 3CKLA 2Z43A 3FFAA 3K0CA 4PHTA 5GJWC 1M7HA 1R4AA 4JJZA 1W46A 2FGJA 4PC7A 1OB2A 1MKYA 1XF9A 4IVQA 3WBKA 3Q7PA 1F60A 2P65A 3Q9LA 4LI0A 4IVPA 4GDFA 1G16A 2FPMA 5F9FA 2NZJA 3A4LA 2QNRA 1N5LA 1BKDR 3ZDQA 2R6DA 2FV8A 3JVVA 4MUBA 3WP1B 1NVVR 3GMTA 4RZXA 5CJ2A 1E9CA 1YR8A 4RY2A 5IK2A 3X2SA 4QC2A 4IHQA 1ZD8A 2AKYA 5G40A 2ORIA 4GOKA 3A1UA 4ABYA 4B3BA 4AG5A 2A2ZA 1DVRA 1MR3F 3AUYA 4D2IA 3RWMB 5JWRA 2FA9A 4AWXA 3T5DA 2QBYA 3V4RA 3TVTA 1GOTA 3FTQA 1GG2A 4Q9KA 1T0HB 2VF7A 3U4QB 2GWHA 1AS3A 1KYIA 3TQCA 3EZ2A 1E0KA 1X8LA 3ASZA 1KHTA 2AWNA 5G3ZA 3SJZA 2CMKA 3SHFA 4Z54A 2V8OA 3BH7A 1A4RA 2WWFA 3I72A 2W0SA 3IHLA 2R2AA 5F9HA 1NMZA 3CRRA 4UXHA 3GLFA 3GP8A 3PR1A 2R62A 4PQYA 2ZJ5A 2PLRA 3DMDA 3A4NA 5GVSA 2PBRA 2EVWX 3I92A 4C7OB 1DAIA 2ZXUA 3FFBA 4GRAA 1HURA 4M9QA 4ZI2A 4HB0A 3U4QA 2QTHA 1Z0JA 2WWYA 4QHTA 2B6HA 1A2BA 1DAMA 1G6HA 4DCNA 4URVR 1Q22A 3R20A 5DLQC 1KK2A 3IGFA 4M1TA 1YJ5A 1VHLA 2IK8A 4DLTA 1G5PA 2C5LA 3P4XA 4M1OA 3T06B 1LY1A 4PC1A 3ND8A 2XGJA 3VKHA 2CHVA 5F2EA 1DO0A 3Q5EA 4D0GA 1SVMA 2YINC 1QHNA 4GBMA 1R5BA 1NL3A 4WAUA 1FTSA 1ZUNB 2IWRA 3MSXA 3TQFA 3I5XA 1Z0DA 3NHAA 5FOUA 1Z07A 2CDNA 4GNKA 4Q4HB 4D4MA 4YMVA 2XXAA 5KSPA 3CPHA 1SXJD 4Q1AA 1B0UA 1HV8A 1E79A 3THYA 3Q7QA 1E6CA 2KSQA 1SHKA 3GEEA 1JJVA 2JGNA 1OXVA 1IQPA 5GADl 4I1SA 2FFBA 2BMJA 5LD2B 3ND9A 5JEEA 3CNNA 2FFQA 1XB2A 2AD1A 2NPFA 4DUGD 2IYQA 3BFVA 1P9RA 1JALA 1E2EA 2C04A 3EC2A 1FUKA 2QORA 2QMOA 1L2TA 3LVRE 4WOPA 1YRAA 3BAFA 5C1BA 2ZRGA 1KNXA 3BORA 4UXIA 3LW8A 1Q44A 4UQOA 3W6PA 1JXOA 1M1YE 1G1MA 4L15A 2G9NA 3VR5A 1E0SA 3C16C 3RAPR 5JI3E 4DSUA 3MJHA 4EPVA 2JLSA 3B1XA 2F3RA 5GJBA 4DJTA 2A3RA 1TNDA 2B8WA 2AN9A 5KPJA 1RPZA 1TAGA 3K8YA 1KDPA 4C4PA 4I99A 4QOSA 2X8AA 3QOFA 2D3WA 2ZREA 3KTAA 1D2MA 2YOHA 2B8TA 3TK1A 1NY5A 4QJ5A 3KB1A 2FFAA 1OIVA 3EZ6A 3AH8A 3QPUA 2F1JA 4R9UC 4DDTA 5AUNB 4HUQA 2ZJBA 4FMBB 5DN6D 5FI1B 5JCPA 2VRWA 3BWDD 2JATA
chains in the Genus database with same CATH superfamily
2HWXA 1DJPA 3GLHE 3E48A 1J20A 1NXVA 1L7PA 3GGCA 4YRJA 1Y4ZA 3DP7A 3L0ZA 4QUAA 5JDIA 4QLOA 2JBAA 2WUEA 1BE1A 2GZ1A 2YIMA 2Z98A 5K03A 4DA8A 3R7WB 5UKDA 4ENPA 4CF7A 1JYEA 1KAQA 4FZJA 1A2KC 2NGRA 2WK1A 3FCOA 4KCGA 2V7UA 5E7JA 3WICA 1FNSA 3DEJA 2RH8A 2OWEA 2WU0A 3WSVA 4DF3A 4DADA 4Q3BA 3RROA 1S9HA 2E4WA 1S0UA 2CFCA 1JDUA 4ROTA 2R87A 2JH3A 1ZITA 4JLMA 5EZ5A 1P2DA 3VTKA 1D2RA 4M7RA 5FF9A 4A8TA 3KUCA 1CQJB 1G8HA 4HDRA 4R3WA 3I32A 4D98A 1L4MA 1LWOA 4AKSA 3N3BC 1R6TA 3QX7A 5CM2Z 3M1AA 2NZVG 5H82A 2Q4EA 1I3NA 1IN7A 2LBPA 3KKZA 1ZGHA 3O0DA 4N0DA 3QF4B 4V03A 3AO0B 4G0MA 3EXIA 1I80A 3KU1A 1HRKA 3U81A 1QP0A 2O8EB 2X42A 4WZAB 3KQSA 3TW4A 1O6ZA 3CJTA 4X8LA 3BXOA 2FI1A 4PF1A 3OQVA 4I4TA 4CI9A 2XYVA 2WFZA 5JSHA 3SDZA 5E3HA 4ESHA 2K2QB 1EG7A 4X1KA 2PHZA 4JKYA 4RWEA 5ICEA 5B1SA 3UV3A 1W35A 3NCHA 2J6BA 1E2FA 2GEFA 1KJ9A 2M98A 3AZOA 4FYIA 4FT4A 4RXMA 3U16A 4OHYA 4TMKA 1WEHA 4TVKA 1A9XB 1JGTA 4FWBA 3JQFA 2AR9A 2GUWA 1MRZA 4G1FA 4NCIA 3MTGA 1CHNA 2X2PA 5AKGA 2INGX 4WESB 1JKJB 1Z35A 2GAIA 2RIRA 2X5JO 2BVNA 3BFPA 3RAJA 4E46A 3AC0A 2RI1A 3SE7A 3DLHA 1DAHA 1QFZA 2J3LA 2HIHA 1I6KA 4YIKA 3V80A 2ZIAA 2VQDA 1ZGBA 3ORHA 3QTBA 4N65A 4OQLA 2QSJA 1ISFA 5FA5A 1YZNA 4DTCA 3JAWA 3F5MA 2C78A 2ABWA 4HKTA 4G1UC 3HLKA 3MJTA 2EZ8A 2Q45A 2WJPA 4IWYA 4ZEVA 5KNBD 1JB1A 2C2BA 2BKXA 2IY8A 3PGXA 5HFNA 4D8UA 4GEGA 2Q2NA 4NMXB 2HRDA 2XA1A 5KNCH 3GJ0A 5D5HA 1SGWA 1JHXA 3GVHA 4NBVA 4R3NA 3HKBA 5A71A 4GW3A 1O57A 3ZDZB 4OKSA 3O8QB 3QOYA 1AV7A 4QULA 1CUJA 4WJKB 4CMJA 1WXEA 2AC4A 3AQIA 1CUFA 5C35A 1W5EA 4NX2A 3TDNA 4JJGA 5EUCA 4HEHA 1QF9A 1RIFA 4HH1A 1UEIA 4DM3A 1OCEA 1EM8A 3HKCB 3QEMB 4ZAGA 3JYPA 4OHXA 3DYIA 3NVDA 2G77B 1O97D 2VYVD 3FDXA 1A7AA 3OZIA 1D6MA 2QD3A 3PDCA 4JLUA 1GQQA 2FW8A 2OR3A 2PSDA 2CNWD 4AJ4A 1W36B 4PPGA 1W36C 4QEKA 3LDGA 3S68A 3NPMA 1U1GA 1MC4A 2CXSA 3HRKA 1WCIB 4X6XA 2X2FA 5FO0A 3F4KA 4IIHA 4DV3B 3OF5A 3EPHA 3MMNA 4HH4A 3DTYA 2LUOA 3S6JA 3UJ9A 3C15C 1GG5A 2DR0A 1RHJA 3HN6A 2FSGA 4FGJA 4ZU1X 4AY5A 2XE4A 4YJHB 3OEHA 1C30A 5EP4A 1T4CB 1C7ZA 1XD2A 3E4CA 2L42A 2CMFA 3TSOA 4YH1A 1YKSA 3QVOA 2P6PA 2IV3A 4R0MA 5JTTA 1E3JA 1MF7A 3ZE7A 1M34E 4UZSA 1ZD1A 3DDZX 3FYTA 4IJWA 4FJ0A 1QAQA 4A27A 1C3LA 3T4PA 2NXCA 4P9NA 5FL3A 1IAVA 3A1TA 5FEUA 1QTNA 1YFKA 2Q5LA 2C0PA 1U3FA 2I03A 1WB9A 1P1IA 4BJHB 3ZE0B 1SCBA 5HIKA 5IH3A 2P3LA 2R00C 2JVJA 3BCHA 3D0OA 3O8DA 5E3JA 1MVNA 1J56A 1XAJA 2C2OA 2VF4X 3FLBA 5EN4A 3YASA 5C1OA 1Y5IA 2Q50A 3PA8A 2REBA 5B5SA 3MUEA 4HAZA 1TGYA 3K94A 4TN1A 4REMA 4N40A 4QXRA 3I5YA 3FUCA 4LZWA 2G70A 3UJ8A 5AP9A 1SQGA 2BEJA 2LWIA 2OCKA 2RMKA 5ISMA 4JC4A 1L1QA 1I3OA 1KDVA 3U9SA 4BJ3A 3X43A 2OHOA 3GCGA 1BDBA 1J0DA 2HA2A 2WV7A 3CGGA 1T9BA 3SX4A 1CIVA 1QK4A 2WWIA 2Q3CA 5JMOA 2F2TA 5AOBA 5F3DA 3M4ZA 4FUQA 4HX2A 1MNAA 4MUYA 4OFBA 4ZOLF 5AKLA 2EL7A 4UARA 1PTKA 1QJCA 2XE6A 2PX8A 1Z7EA 2ZBPA 1PZMA 4FFMA 1GQSA 4GT1A 1SZCA 2IZ1A 16PKA 1U0JA 2YV2A 4XVQA 5KDLA 3ZC3A 4Q1BA 1CJVC 1BXRA 1YFJA 5T4EA 4GMFA 4BTEA 5I5GA 1AHPA 2BR5A 2GYUA 4W82A 4KBFA 5KAMA 1PZHA 1DDOA 1FMLA 3JAKB 5FX2A 4FN4A 4Z4CA 1MG5A 1JNYA 2E82A 1GRNA 3IPLA 1UOEA 3Q7SA 4YALA 4WOJA 1R12A 2XSZA 3ZBTA 2GEVA 2OLJA 3KL2A 4KXUA 5AVSA 1VQ1A 2GZMA 5IXYA 3C4QA 4MP6A 3Q3CA 2JAQA 3B20A 3GRUA 4QDOA 1GVHA 3VNAA 3FZYA 1HE8B 1WABA 3MFQA 3UVEA 3AR8A 4HNUA 2QGFA 4HXFB 4Q1DA 1JSXA 1AQUA 1L4LA 2XCIA 5DGDA 2W98A 3S40A 3V8EA 1UBCA 2DWQA 3JWPA 4ER6A 3NH9A 5BR8B 2R1TA 4DDWA 4LXIA 1XFDA 1F6DA 1L8OA 5AKZA 5A3VA 1L7BA 3O0TA 2R96A 2ONCA 4IUYA 2G4LA 5FBZA 2VHTA 4LXGA 2V7EA 3K0CC 1QH1B 2QRHA 3PHIA 2G1JA 4DYHA 5EINA 2WNSA 1Z9BA 1U9JA 4KR6A 1NBAA 1WVIA 2OLEA 1GCUA 4OXXA 3RJ5A 4AJEA 4EB0A 3DDOA 1IEXA 1RYEA 3ZJVA 3S70A 2V9ZA 3I45A 4NBRA 4EB8A 3Q9SA 2GPBA 3N0VA 4LJSA 3T3IA 3GJ8A 3K70B 2QQ0A 4IY1A 1ZNYA 4IIDA 4TLLB 1IH8A 3SLRA 2UUAB 4JVMA 5DTRA 3AFIA 3E84A 3FTPA 1T5LA 1QB8A 2BFFB 3F97A 4LA4A 4CM1A 5KVAA 4MVJH 5L4SA 5DM70 3ROEA 3U39A 1Z5UA 3DDHA 1Z75A 3EF3A 3L3BA 5EGNA 1XDBA 1SPBS 5EPOA 1XMOB 5FUWA 2ZTLA 4RELA 5B7NA 3W4JA 1RP1A 3R09A 3UGKA 3WE7A 1L7RA 1GSHA 3EDOA 2J5QA 1RJ9B 3N53A 2PWAA 4FFBB 4IFIA 1FYEA 4LRSB 1X13A 5C9ZA 3NT4A 4YJ3A 1N2CE 4WADA 2JHPA 1SURA 3V4SA 4N3AA 2OL4A 1RCFA 4BQQA 1BDHA 4I1YA 4CU2A 3GVPA 3KB6A 3U4GA 2WOOA 2VTVA 1Z82A 1IM2A 2GK3A 3ET5A 2ZRJA 4OH7A 1TTPB 1FFXB 2X40A 3EGXB 1FBNA 4DWVA 2VCYA 3C3YA 4X64B 2XYQA 2FMKA 2AOWA 2XSZD 2W2LA 1SQ6A 5BUZA 4AUKA 1U5BA 5CP8A 1VPWA 3IAM6 1FLVA 1OTHA 5COAA 5F3WB 1BN7A 2J3EA 3USCS 1L4KA 2VP9A 2P9YA 4I1RA 1JQ5A 2C2HA 4QFMA 2V7GA 1WQ4A 1RTTA 4NK5A 4YAEA 1SD5A 4YA6A 3ZDRA 4AX4A 3AXSA 1BG6A 4R31A 3SYMA 4F2PA 1M1XB 5J2TA 1JDBB 1RQPA 2HCJB 5T8KC 4NYMQ 5LWHA 1KYTA 2D06A 2MR6A 3O3CA 2SKDA 3GGSA 3PFHA 2VNHA 4QASA 5D3QA 5ER6A 1TVEA 5EMJA 4ZVKA 3TZCA 5K0ZA 2DLNA 2YRXA 1QTQA 1RKUA 1IL0A 1S02A 2A57A 2IXDA 2GXSA 2HRQA 3KT0A 2O8CB 1IB6A 2EYQA 1EX7A 4WASA 4R8RA 1MQ9A 1SCNE 5KU7A 3Q1KA 2ZJ6A 1Z2PX 4PLPA 1SG9A 3C3EA 5K8TA 1BE6A 3FGPA 4F3YA 1UJMA 5EYPB 3OPQA 3MWGA 1LSJA 4IHAA 4DIDA 5LQMA 2NTJA 1GTL1 2EX4A 3CRQA 2ZRMA 1XQVA 4GI1A 4GQIA 4R9VA 4BEBA 2VF5X 1NNSA 1NVDA 2NSDA 3TLYA 2VPTA 2N46A 2PMFA 5IAGA 3W4KA 3PXUA 1I4LD 4YCMA 2F55A 1S8NA 4KLZA 3F4BA 5A9RA 1EVKA 3F7TA 3OEYA 4CLRB 1G98A 3L9XA 4AJ9A 3VOTA 3QHAA 1Q2XA 3ZNOA 3VKHA 3ON5A 4H17A 4HDCA 1PZGA 2FPXA 3CJQA 4MV1A 1L9KA 3QPDA 5SZIA 1F2TA 4YP5A 2B5VA 2IBSA 5DGTA 1GKKA 4Z3DA 1N6PA 2V3CC 1CQIA 1CVLA 3TCXB 4P54A 3TW8A 1NI4A 1C3EA 3P27A 3QKTA 4DQUA 4O2AF 3AM3A 1GNRA 4ES6A 5EKDA 1AQNA 5E4FA 3EGIA 3DT6A 3OOEA 4GXTA 5KJ1A 3U3JA 1QG2A 1XXHB 4IXMA 5CAEA 1KMIY 3NBKA 1V11B 3D8RA 3FM9A 3TRFA 2FMXA 1GILA 5DBGA 4B6SA 2H4JA 2QUZA 3IV6A 2A7XA 4RHFA 3VO8A 1MZPA 2AJTA 4MRSA 4H1HA 4AYXA 3WLTA 1D6SA 4GSLA 1JFRA 5BSEA 3LLVA 2P5TB 5F23A 3RF7A 1YHNA 2F1OA 3LDAA 5JCXA 2XCQA 3JQPA 5AKYA 1OWLA 1IDN1 3O91A 3QOWA 4WHMA 3EVDA 3G0IA 2OBBA 1LNSA 4OBBA 3LBIA 4PO3X 5JJKA 5AKEA 2XDQB 5THKA 3I6BA 1O95D 2EKLA 3OFVA 2VYVA 4DA9A 2EWWA 2VJPA 5DYIA 1X1QA 4OOFA 1A9TA 5DXJA 3MS7A 1SUCA 1WETA 1IN1A 1P19A 2HU5A 4PG5A 1XRJA 1H6CA 4TQUS 4LZJA 1GZ5A 4LDAA 3IULA 3PNYA 1GZ4A 2CNOA 3CNQS 3QA9A 3QF7A 2OXFA 3H1BA 3RW9A 3HJFA 4Y67A 2NV6A 3P2OA 3PR3A 3AFHA 3KL4A 1JEQB 3R44A 3VTAA 4MR7B 3UHAA 5IDQA 1CZNA 1RPJA 3KB2A 4RGQA 3ZPXA 3ZTTA 2YOFA 1S01A 1WNFA 5M29A 1EFUA 1X86B 1DO8A 5ELMA 1I0ZA 1MEEA 3UC5A 3C6YA 2ERCA 1EEXB 3DTNA 1CK4A 4BKQA 2RB4A 4PN7A 1A9QA 1H1LB 4D80A 3M82A 2BGNA 3BM5A 3R9WA 1PTJC 1TT5A 3F1KA 1G5IA 4G01B 5AOVA 4L5IA 5A05A 4D0RA 3L6UA 5FPKA 2A9JA 2G6TA 2X2EA 3KKKA 3H3FA 1CRQA 2ZB3A 2AS0A 1NAHA 3GPCA 3R76A 1WL8A 3NEAA 4EG7A 5CDUA 2XRYA 2JCGA 1E6MA 3OLXA 2WBLC 4IIBA 3T5TA 3H5OA 1SUAA 3BXPA 4CIVA 4V0QA 5JXIA 5FNVA 2QM7A 4G67A 4BLPA 4C6SA 2GVNA 1GN9A 4LCEA 4Y98A 4ESOA 1H2ZA 4AF7A 2FN3A 1IBMB 1KBQA 4DLRA 4ZANA 1YOBA 1QJ4A 3E1GA 3N59A 3P45A 5AHRA 5IJXA 2DLCX 1TT7A 4N0QA 2IZ7A 3DZHA 2L69A 4WWHA 2WHPB 1EUQA 2BMAA 4IH4A 4AXBA 4HADA 2Q28A 2EFJA 1W0KA 4JN6B 4MR9A 1Q11A 4WTOA 3T61A 2Z8YM 5AVTA 2YVAA 1FNNA 3PD1A 2P2DA 5C18A 4FFLA 5AXAA 3QXJA 3DHNA 3KYBA 3QIAA 3AJAA 4BX3A 4DA6A 2BD0A 4M88A 4ZRNA 3LXRA 4WNAB 1TTQB 4AO6A 4GH5A 1SHUX 1FP4B 2O4UX 2AFIA 3LYAA 3LFHA 1ULUA 1RZVA 4P4UA 1TUGA 5CJPA 4Y2GA 2CJYA 3RUPA 5EWJB 2GJKA 3ST7A 5KCZA 4OLAA 1WE2A 3ILXA 2A58A 1DG3A 4IO0A 3IDQA 1OBVA 4TLDA 5IFKA 3GLVA 3QE2A 4OGLA 1B23P 1U1CA 4M1EA 3OKCA 4C6TB 4QO7A 2DPHA 4B9EA 4TTPA 4ZJYA 2XWPA 3OE7A 3T3EA 3K05A 4IRMA 1GKLA 3E1SA 1XA0A 4OQFA 5C3MA 1AQIA 3LY9A 1P9NA 2PTHA 4O0MA 3V8PA 2XMBA 3FG9A 1OU0A 4WKOA 1A5AB 3HLYA 4QELA 2IJGX 3BICA 5KYWB 4FFSA 3VNVA 2H3EA 3GRYA 2ZE5A 1MBZA 1MH9A 2EWMA 2X1LA 2XUQA 3TWOA 1CUWA 2ZVPX 3QI7A 4YY3B 1DRUA 3D3EA 4JB0A 4U39A 4ZQGA 4PZ9A 4RLFA 4DNQA 3WXBA 4CQLA 4MXDA 5GONB 2VCHA 1UMBA 3H9GA 4BO4A 3LPAA 5G0UA 4PS1A 1RI5A 5CA0F 1PS8A 4MGZR 2QU7A 4TLAA 4D8TA 2HI0A 5CMLA 3MK31 3KZNA 5CA0B 2A9PA 5KEIA 1ULHA 4BB0A 3IBGA 3IOBA 4NYJQ 1O0CA 1PQYA 4W6QA 1ZN7A 4V02A 1P0CA 2NO6A 4QDZA 1MAVA 2YCLA 2X8BA 1A4XA 1LI5A 2IYNA 4UHKA 2IDJA 3FSJX 3JZFA 2XIQA 3WO1A 1J24A 5KTMA 1G63A 1JG7A 1HETA 3Q2IA 2QLNA 5DLYA 3R8CA 2BTEA 2ZQZA 3ZVNA 2C54A 4J03A 4KAAA 2QRPA 5C5CA 1WXDA 3OMXA 4UD6A 5CTAA 1HI9A 3AY3A 3T7SA 3WQBA 4BKMA 3TKLA 5CVTA 3H3JA 3PBKA 3DKRA 4RKQA 3Q7IA 4A0GA 2EJBA 1KAGA 4Q4AA 4TGLA 4D9IA 4NPHA 4EKYA 1LWNA 3LL7A 2VDOB 4G4GA 3P9ZA 1BHJA 2WP8J 3IUNA 4H31A 4QU8A 4UVDA 2D7CA 2JCYA 2Q6VA 3NALA 4FYPA 2B2NA 3M34A 3MBIA 3PSHA 4JYBA 2FY8A 2QRKA 4XFDA 4A2WA 3PUZA 3S2UA 5B6JA 4AQYB 4RJIA 2I33A 5DHFA 5ICGA 3AXTA 2XYRA 2HD4A 2AZ4A 4G5HA 1PJTA 2QMYA 4XB2A 1QAMA 3QEJA 3K5WA 3TNDA 1P31A 3OCXA 1E64A 1C7FA 3NVMB 4PZ0A 4EUKA 3A2NA 1YR6A 2CUZA 5K3CA 1GPAA 1BRTA 2O0HA 3IEIA 1JHUA 2C2XA 2EKBA 3L8ZA 3KZCA 1JR3D 4JIMA 4P4GA 4B43A 2BGIA 1Y5MA 4M1QA 1EWRA 3TD2A 1ZJZA 2DMRA 2E48A 1DEAA 3JQCA 4UE3S 2D7DA 1YZHA 1D5CA 3GY0A 1I01A 3VPFA 2EHDA 3V2UA 2QW8A 4I19A 1HKHA 4XKJA 4RVDA 1AQYA 3ZXIA 3LOQA 3WV5A 4RLQA 2IIPA 1AF4A 4L07A 3OX4A 3L5KA 3PV0A 4EA7A 3ZJUA 1B2LA 2H1RA 4JP8A 1AGNA 1P5FA 5MN4A 2WPNA 3N0RA 2X0EA 3FVTA 2CK3D 3EXG2 3LU1A 1H8ED 3QBDA 4J0EA 1ZM2A 3QU5A 4MUAA 2P79A 2AYYA 4YUAA 5IT5A 4W5RA 1GEEA 1BS2A 4O4JA 2WY2D 1RM3A 1IDOA 3IOEA 4YAJA 4P1ZA 3LBNA 1R8QA 3GLFB 4LQ4A 4MRVA 1A1VA 1RRPA 2V59A 4JI3B 1XVTA 2AFHB 4IEFB 4CFZA 4JYCA 4ENSA 5ES4B 3U44B 5EY5B 2OC9A 5E1MA 4IGFA 2GRJA 2PJZA 2W4QA 4P3OA 4E2ZA 1T1EA 3BHMA 2VQ3A 1NZFA 3GWZA 5EUQB 1Q95A 1Z34A 3ZHCA 1D07A 1L1RA 1X7XB 2HAEA 4O4HF 4P3XA 3KPYA 5CW1A 5ELLA 1W5TA 1OHHA 4XR9A 2ZZKA 5TMBA 5JROA 2D59A 2OV3A 4E07A 3ENVA 1YS6A 3P9NA 2IXFA 3T41A 3JAMA 2UVQA 4JWKA 5EJ7A 2DTEA 2QJFA 3L2OB 3P96A 4IZHA 2B5OA 5JPDA 2Q46A 1CULC 4H1VA 2Z58A 4IZOA 4RE5A 5EMKA 2FLWA 3E6AA 3P1JA 4I2VA 5TPWA 3WGZA 1G0NA 1ESCA 2ECOA 2AT1A 5IVKA 4G1EB 4LC0A 4Q6WA 1MH1A 4PLTA 3GUVA 2BEVA 4DC0A 1U0RA 3B3QA 2EQAA 3BL6A 4Q12A 4RJKA 1XDUA 2JI7A 2Q9CA 5G0TA 2JGLA 5AVZA 1QFSA 2Q41A 3Q3EA 3TZBA 3HS3A 3I12A 4IV8A 1T9GR 1V5GA 1U2RA 2CXPA 1VYVA 4NMMA 5C31A 3SSOA 4MQ6A 2PD6A 3KUXA 3VKFA 1M2GA 2DBYA 2JFFA 2BYTA 4TWIA 4RDIA 3UK0A 2QEQA 1ACMA 3USES 1GD1O 3FUXA 4IDPA 4WCFC 4C1NA 2RHRA 4DXDA 4F86A 3ZGZA 6LDHA 2AFVA 2WWWA 1GNVA 1VYTA 2P3SA 2ZIVB 3UJ6A 3H04A 1OPXA 2KMLA 4REQB 3A37A 4U9HS 1X0XA 2ZP1A 4M83A 3RLIA 4NZYA 5IBPA 4ZARA 5TV2A 5K4GA 4LISA 1UAGA 3A6ZA 2QZPA 2IYRA 3R5KA 4I55B 4LHSA 3FLAA 3ESZA 3IQGX 4ZDJA 2QUAA 1ZVVA 2GEKA 2ACKA 3GEBA 2HDHA 4Y2RA 3C14C 2VUUA 1Z39A 2F8MA 3OU6A 3AJRA 4P7JA 1MA3A 1MORA 1UXOA 2G72A 2HFKA 3GHYA 2VC2B 1ENPA 2DUNA 5LQJA 3D7LA 1I1OA 1YL5A 1WHTB 1WUTA 3FPFA 2OUIA 2ZUBA 4ZMBA 3NHYA 5BYAA 3BEDA 3IQEA 4TKMA 2XUKA 3PFWO 5TSDA 1RMQA 1EZZA 1L5OA 1JQEA 1NFQA 2ZW9A 3Q3GE 3X1XA 4EY7A 5GTDA 3LKVA 4MYHA 3AVVA 1LTHR 1DCTA 1EWYA 1SOAA 1J0AA 5JWHA 4DEVA 3U80A 3QU2A 4ED9A 1GUAA 3M7IA 4AYTA 4C0XA 1J2EA 1PG0A 1QE3A 3EAGA 3C43A 3DEFA 3RH0A 3FUTA 4EYSA 4TMYA 4XLLA 1J2TA 2CE7A 1NXTA 1X0VA 4EITA 2O2DA 3GJXC 1KAHA 3RBZA 4XTCS 5H9VA 1Y34E 2ZDQA 2MSDB 4YYEA 3T8YA 1SCUB 5GINE 3T1YB 2CXQA 3K5HA 1OJ7A 2EW2A 1XO1A 3REQA 5T6BA 2QRMA 2YVKA 4DWOA 1RM5A 1WZEA 3QKUA 4N9QA 4RCYA 2ORVA 1YZ3A 3V1TC 4KEAA 2RONA 3AFNA 3N8HA 3A9UA 3BL5A 2I7XA 2R8EA 3CZ9A 4V0LA 5DI9A 3QVGA 1FNMA 1XI2A 5JD5A 3OIFA 2HQBA 3DLIA 3LHFA 4MRMB 1N8KA 3NO4A 4ZP1A 2O59A 5D8DA 3TKAA 2WJ3A 2QUJA 4OHFA 2B78A 2WAOA 5KJEA 4DKJA 2J87A 1SBQA 3CCBA 3IAEA 4KUGA 4F6RB 5J4KA 1F2UA 2JGRA 3OLQA 5EQDA 1QCYA 3EZ7A 5TEWA 4DR5B 1FX1A 5EIHA 2YQ4A 5HSGA 1GPDG 1NXXA 2JIZA 1QYVA 2O6LA 1G3MA 4JUAA 3NHLA 4E14A 1O9BA 1C9NA 2IF0A 3ABQB 3AK4A 1MN6A 5I9TA 5SV2A 3GFOA 3ZY4A 2ZYUX 4V2UA 4OHWA 3VPGA 4ZGWA 3R3WA 1Q74A 3CTMA 1CTQA 2XQKA 4R98A 1K6MA 3C5CA 2XGMA 3ZY2A 1PL0A 1DARA 2QX7A 2QXUA 3GMDA 3OPYA 3K6KA 5A9SB 1A8QA 4JKOA 5IBQA 3GH1A 2DE0X 3HY4A 4Q3OA 3L1VA 1K2WA 3V1KA 3HCDA 4NYJR 3W3AH 3WGJA 3ZOKA 2R8RA 1A9PA 4D7AA 4BRWA 2FR0A 4EARA 3H2ZA 2ZYRA 4C2UA 2FP4B 4OI2A 3ZS8A 5IT0A 2KPOA 3FHJA 3GT4A 5LZ7A 2P1ZA 3CZ4A 4ZREA 3PSAA 2FQYA 4X1YB 2QMQA 3PEFA 1KOJA 4GOJA 1VMKA 2I7VA 3VX3A 3STVA 3L0PA 3L5OA 5PNTA 2I9KA 3X1KA 2F9MA 1E0DA 3U7HB 3N2EA 4UBMA 2P91A 1M67A 3PT9A 5J2UA 4D3XA 1GU1A 2W93A 1G8GA 3L4EA 4AICA 4Z9FA 1P4HA 1L7OA 1KP9A 2O7SA 3LA6A 4MARA 4DIEA 4KW7A 4PYNA 2ZJAA 3KDSE 5HTOA 4P3YA 2JBAB 4GPZA 3HMQA 3LO8A 4DXHA 4M1YA 4L9WA 4YAGA 4QRHA 3FPSA 4LNAA 4O02B 2VSFA 2K7ZA 4WESA 4QFDA 1MNQA 3L0BA 2AJ8A 4G5SA 3SJAA 2QXTA 2IC5A 1M8KA 1P39A 3DUFB 4UUBA 3V8BA 3W2GA 3UHFA 1QNFA 3KPJA 3TMYA 2ZSBA 1OFVA 1EJBA 2AVDA 2ADFA 3MT0A 4KFRA 3AEKA 3OP4A 1EAMA 5I48A 1U2EA 3O8CA 4MI9A 1OPRA 1DCKA 4WN9A 3T4EA 1KVQA 1F0KA 2HLDA 1TADA 3UWOA 5E4JA 3WL4A 5C5EA 5IXSA 3KO8A 1QRTA 4H6WA 2DOKA 1Z4LA 1SNYA 4G4SP 5TE9A 1HPLA 1CZHA 2WA1A 3U40A 1CR1A 3WL6A 1E5LA 4EW2A 1V45E 3UK6A 3THOA 3WK5A 3OEEA 1PG2A 5CH8A 3LBAA 4UVHA 4F3RA 1KU0A 1XEXA 4ZJPA 4NG4A 1VMDA 2R1UA 2CLDX 3HCRA 1AY0A 1L5MA 1DQRA 1VE7A 5DHTA 1XN1A 5ALPA 3PNKA 3TOXA 1VHJA 4D92A 2DQYA 2H16A 3HKCA 3PCXA 3NLLA 1V5WA 1HGXA 4A9AA 5LQUA 5I3CA 4EY4A 1Z2CA 2Q5OA 3DKKA 4RFVA 4ZO4A 5C3UA 3IP8A 1SBYA 4ZQEA 5JT1A 3GV0A 2GZDA 3O1HB 4HXEB 3OFKA 4FLFA 2X6QA 3VKWA 4JU9A 4YRMA 4RTLA 3BZWA 3TNJA 1K3TA 3PJGA 1A7JA 2GCOA 4JQSA 4RHYA 1CCWA 1TPZA 1AUPA 3QZUA 2PGNA 3FSGA 3V46A 3U1TA 5B1HA 2FPSA 3MOGA 3M5PA 3WWZA 3WJAA 3WFZA 5L95A 1IM5A 1HC7A 1I2CA 3BK7A 3CMCO 5H8WA 4IVNA 4KI7A 5P8WA 1OZAA 1Z62A 2ZM6B 4BC1A 4BFYA 1F7UA 1JVNA 3GL9A 3Q8KA 1FPMA 2E49A 2J3MA 4LVUA 5ALOA 5FFNA 3H75A 3L79A 2XRFA 5EG5A 1S8FA 1JJAA 1AE1A 1O95C 2JLUA 1KY3A 1ML4A 3QY9A 1QBGA 5F78A 4KQ9A 4OB6A 9ABPA 1L5WA 5K0EA 2LV8A 5KCMA 3FFXA 1E1QD 1PR4A 4PC3A 1HDGO 3OUUA 4MJ7A 4TZKA 4OHPA 4GP7A 3TCKA 1WVMA 3LK6A 121PA 4I9GA 4XYEA 4RF5A 2JVKA 2W2XA 3W2EA 5KNLA 1G21A 1B6RA 1OE0A 4RZIA 3DE0X 4CLXA 3A3NA 3I58A 1YR1A 3PNLA 4WNCA 5A6SA 4K8RB 5TPZD 1YBVA 3I8SA 4QPDA 3SC4A 1JMVA 1GZDA 4BKPA 3GOHA 2DTDA 5TGTA 4F2DA 2C61A 3LQYA 2XBLA 3IT2A 4B7AA 4ZAFA 4B33A 3X44A 4YMHA 1UINA 1Z0SA 3DOEA 1NR7A 1YO6A 1HNNA 3NYIA 1U7XA 2XCOA 1TMOA 2ZVDA 4K1XA 4LQCA 5AM3A 1Y80A 4NYIR 3PC2A 1C3OA 4YCBA 2RFLA 4P31A 1HLGA 1HY3A 4OH1A 4BRZA 4DR6B 1H0HA 1N9GA 1MUUA 2RGWA 3MGBA 4QXAA 5A4KA 2XZOA 1N3LA 3U4CA 2X0NA 3E9EA 3HYTA 4D46A 2YV1A 5B58C 3U19A 1EK0A 5F1OA 2O8NA 2FSVC 1KEZA 1D03A 3O75A 1XTTA 2AN5A 1IXZA 3IEXA 3WYEA 2I9PA 2QRVA 1GPLA 1QG4A 3FCSB 2GN0A 2XY4A 3SR0A 4MVCA 3QMPA 4ZYYA 1C30B 2X22A 1UKYA 4ILKA 2FJ0A 3WLLA 1T1GA 2YHIA 2MWMA 2X7XA 5BNFA 1KFJB 4YT8A 5HBRA 1RXEA 5BO5A 4RTOA 1CP2A 4ER0A 3PVCA 3UWMA 4NCHA 3A4MA 2FOXA 1O54A 4ER3A 2OV2A 4UCXA 2AK3A 2PGAA 2XNSA 3AP1A 3HB0A 2NYRA 2WKQA 5I9NA 1C1DA 1YUNA 4DQDA 1O08A 3JAKA 2UYQA 3H2HA 4B2PA 4MYRA 5DSZA 3LWZA 3SBEA 3SCZA 4AP5A 4FXPA 1Y4AE 2P9TA 4RK7A 2XW6A 2X8LA 2R4QA 1SVOA 3ZE8A 1VIDA 2PH7A 1C9JA 1A5SB 1RE0A 1YIAA 4HNAA 2H48A 4FS8A 1E0AA 3QEMA 3V34A 5I01A 2ZIGA 5IJ9A 3G17A 5K09A 2MYUA 3ZLBA 1UUFA 2BI4A 3DVRX 3MRSA 4YJFB 3ZUGA 4AKGA 4NZZA 3Q4GA 1YV9A 1ADCA 1F0NA 3NKVA 1OY1A 1AKVA 4DV2B 2C0CA 3OFNA 1JBQA 4H1UA 1PWYE 1ADYA 3QMWA 5BURA 3AR7A 5REQA 3UK2A 4NOJA 4Y1RA 5CPFA 2H17A 2Z6QA 2R86A 5CT9A 5LQAA 5JAUA 1KO4A 1Z5NA 4FI3F 3WRXC 2O3SA 2C8JA 1VE9A 3PX2A 3ABSB 4AMBA 2LIPA 1R5OA 4JR2A 4JA2A 1PTJA 4OJTA 3K2QA 3M6XA 1VIMA 4JGGA 4Q47A 5EIFA 2ECFA 2P68A 1GLGA 3CEMA 1DMRA 2MCFA 5JS2A 3B7PA 4L3OA 2CYAA 1R0RE 4DSZA 1E98A 3VR6A 4BWVA 4BLWA 1ULTA 4X65B 3WKAA 1Z22A 3WDSA 3ZHTA 3DP9A 3WGUA 4HI0E 1VCOA 5SZJA 1R66A 4RPCA 5IZCA 2WM9B 4F4JA 1NPYA 2I5PO 3JZAA 1RQGA 4OHMA 3RS2A 1GU0A 2YS6A 4F45A 5C46F 1UQRA 1SXJA 1Y3CE 4YMLA 1IMJA 5F2KA 5JVDF 2FRXA 1LQTA 1RRKA 4PYIA 4TS3A 2UZ0A 1K8YB 3JWIA 4G8JA 2BOVA 1JW9B 1TZBA 1M1NA 3ZHUA 3DR5A 2EIHA 3ANYB 5CVEA 4MHOA 4EHAA 4BGDA 5M3BA 4E4YA 1NN1A 4W8HA 2YOGA 4CEHB 1D2AA 3QIVA 3HJBA 1F8YA 3KJZA 4PZDA 5DH9A 3HYRA 5I7AA 3WRVA 4DJ5X 2ACWA 3BSSA 3U1BA 1X7GA 3UMRA 2HB6A 1E18A 2R1TB 2D4HA 1QV7A 2GBLA 2BGWA 5KWJA 2QY9A 4TXHA 2H2FA 3G2PA 1K5GA 2L0XA 2BPOA 3PQ7A 4BNTA 4C5BA 4BVKA 4BO9A 2BH9A 2SCUB 1XK6A 1RYZA 2J0EA 4LQDA 4UHBA 4BNGA 1NVUQ 2PO7A 2QWXA 5I6DA 4JOQA 1IHOA 1L4UA 4JENA 1QIFA 3KIPA 1Y7IA 5FORA 2X2OA 4M8IA 2FLKA 2WF5A 3SR4A 2JJ1D 4BMSA 5KB3A 5L7TA 4HPXB 5JIBA 2WSYB 4QOFA 3UAYA 4S2EA 3W5CA 1FVHA 1R6AA 1SG0A 2HCTA 3B1FA 3K0HA 3CNEA 3F9RA 3QBTA 4I6EA 4ZPJA 2YDYA 3CLSD 3TTWA 4B6RA 1DU4A 2BFFA 4G1BA 4Q9IA 1HBJA 5JMPA 1KO1A 4EF6A 4CMAA 2ZRKA 1GFSA 1GPJA 5D5PA 3J81A 4YCSA 4U7GA 3DEYX 3KAJA 2RCNA 3KKEA 4H4DA 3RS0A 4HFNA 2BEUA 2W6ZA 4XE5A 3OBIA 4C0LA 5D6OA 3ICWA 1MC8A 3WGQA 5CB4A 5JNSA 4L78A 4A6XA 2YWCA 4ZVNA 2FR8C 1IVNA 2ZDGA 4IQ8A 2EF1A 3H0EA 3NBQA 4X5OA 5FLEX 1MTOA 3MINA 2VK1A 2ZU6A 5H02A 3BZBA 5HXAA 1JWAB 3HWWA 4YI3A 1XZQA 5TEVA 5KJCA 3FHTA 1BMQA 2RB5A 5EHGA 2AV6A 4MQFB 1HWYA 2QTNA 3C6MA 4YI5A 3MB5A 2GRAA 2VSXA 3DC7A 1NQTA 2WIBA 2GUGA 4GZMA 2D0DA 5DF1A 3ICCA 1N5JA 4IRUB 5LU9A 1WG8A 4LZNA 4X7RA 2V1XA 3BBPA 1NLMA 4BQNA 3KNZA 4YRZA 2AJLI 3OHPA 4ZOLA 4JT8A 5LN1A 2GSWA 3OQPA 4CT0A 3M5WA 4YHHB 4A23A 1NJFA 3AL3A 4L1KA 1IBSA 5DU2A 2NU7A 2GI4A 3H1GA 1JKFA 2QTBA 3PFCA 4H35A 5J43A 4K26A 3D3WA 3MINB 3PUWA 2QE6A 4LWZA 1QHGA 5CM8B 3SVTA 1NE2A 2EERA 3ER9A 1P81A 2P2SA 5KOHA 1T1IA 4DGSA 1UZMA 3MF4A 4NABA 2ZAIA 2D00A 3G8AA 5U1PA 4BB6A 3HCPA 4GPBA 1DWUA 3IA7A 3NS7A 5DTEA 2A4KA 1CE8B 2QN2A 2VRCD 1ZC4A 1X7ZA 4TRRA 4V0RA 3UK1A 4BN0A 4CIXA 2GZHA 4W99A 2HBRA 5LIRA 5CM9C 4OLBA 2QTVB 4M9ZA 5EFZA 2CJFA 4G0UA 3VJRA 4FYXA 4QDXA 4UMEA 1LTQA 2HO5A 5EIAA 5FUVA 2O23A 1OH7A 1SIWA 3AR6A 3OD5A 4QATA 1AQLA 2Q1UA 4HGYA 3RSCA 4E5UA 1ZL0A 3IE1A 3RYCA 2R68A 4J3FA 1RHRA 2CBXA 2LDBA 4HG2A 4LPKA 1RR6A 1PLJA 1DG9A 4EUFA 3AUTA 4X0EA 3WYGA 1BD3A 5JCJD 1AK2A 4C3ZA 2NTEA 4X66B 3KOYA 3V7UA 1CWUA 1U0TA 5LP6A 4B83A 5JQGF 3RVNA 3FIUA 1U5BB 2W6CX 3TL3A 1KJNA 2ERYA 5CFZA 3L6BA 3U7QB 2WJ4A 1U0EA 3ESXA 2VP5A 2C2KA 1JZTA 4PYKA 1F5NA 4HH3C 3VZDA 3PGKA 5BRAA 2GBCA 3S7TA 2PYIA 2DERA 2H0QA 3QJGA 4BRUA 1O97C 2PL3A 1UC4B 4JLDA 2PD3A 2V7QA 3PL1A 4AFNA 5B30A 2A9OA 5FBVB 2ZYWX 2JJ1A 2O52A 3GJ7A 4UCWA 1DC8A 2C57A 2FMHA 4BXOB 2Z6VA 4FP9A 2Q7XA 3L0CA 4FFDA 1XSEA 1D8TA 2BKAA 4CR7A 4DABA 2JAXA 4NU8X