2QXUA

Crystal structure analysis of the bacillus subtilis lipase crystallized at ph 5.0
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the remarkable stability of Bacillus subtilis lipase (Lip A) at low pH
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Lipase
total genus 65
structure length 179
sequence length 179
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qxuA00
1GZ7A 4E14A 3OOSA 3ANTA 1BCSA 4I4CA 4FDMA 4ZV9A 5AKGA 2VJBA 1YSCA 4UHEA 3FSGA 3F67A 4G4IA 2VT7A 5JD5A 4DGQA 1UOOA 1SOMA 3T4UA 4X92A 2X76A 3G9XA 2OLEA 3I2IA 4H7IA 5JAHA 2WHRA 4J7AA 2WU4A 4C6HA 4WFIA 1QIIA 2OGTA 1ODSA 3LIIA 5FP0A 4ETWA 2XI4A 4BP9A 3WL8A 2WUGA 4G8DA 2GBCA 2HRQA 5C8ZA 4N8DA 1G4HA 2C0QA 2BAGA 5AI9A 2O2GA 2ZYHA 1W76A 2ACKA 1YCDA 5CXXA 1OILA 2V9ZA 3IULA 4MYDA 4AXBA 5AK3A 2QUAA 5JAPA 4KE7A 2OQVA 2VATA 5CW2A 2WIFA 3C6YA 3OC0A 1BRTA 4G9GA 1WHSA 2C7BA 4INZA 1U4NA 2QS9A 5IVDA 2J3QA 3DYVA 2XLCA 3A2NA 1IUNA 3PF9A 4OYYA 3R3WA 4KE6A 3D4LA 2QOEA 4BAZA 1K5PA 3W04A 4TVKA 1YA8A 4LIPD 3QPAA 4Y2PA 5IH7A 5IKXA 2GBGA 3I2HA 4OPMA 2QM0A 3GELA 1MAHA 3BDIA 2AJDA 5C8XA 3WKDA 3GUUA 4G4JA 1QE3A 4HVTA 2FJPA 3AIKA 5DWDA 4NZZA 3FLEA 5EHNA 2WUDA 4PSUA 4X3CA 3ZI7A 5FRDA 3WYDA 1KEZA 2WG1A 4FFWA 2YYSA 1H2WA 3AJAA 5FDFA 1NX9A 2EEPA 4E11A 1RWQA 4FOLA 5AM1A 3LLCA 1A88A 1XZAA 3SC2A 5CH8A 4DMCA 3M3DA 3V1NA 3HABA 5LZ8A 3B3QA 1QJ4A 3D2CA 1HBJA 2XMRA 2QXUA 5ALWA 1FJ2A 3I2JA 4HS9A 3MVEA 4H77A 4C4YA 3G0CA 4DTCA 1F0NA 5KWIA 1EX9A 2FX5A 4H18A 1VE7A 3F9CA 1IMJA 1CUZA 1R4ZA 4C01A 2XMGA 3CN7A 3ILSA 2IITA 3STXA 4ZV7A 3DOHA 4PV7A 1E89A 2OXEA 2DFPA 1CVLA 4B80A 1XLWA 2VA9A 3WI7A 4LHEA 3KXPA 2H7YA 5DYTA 1BN7A 1JMKC 4A5SA 5E2IA 5ALQA 2WFZA 5ALFA 3BIXA 1LPSA 1CUYA 1JU4A 4ZI5A 2C5FA 3P2MA 1UK9A 3ESAA 1YS1X 4U2BA 3AZPA 4IHAA 2RIPA 3JYHA 2G63A 1CUXA 2Y1KA 1K8QA 4B83A 4C4ZA 1ZI6A 4W1PA 1WB5A 3HEAA 1ORVA 2XUPA 1JU3A 1UKAA 1XZGA 3M83A 1CUIA 5JANA 1XZJA 2PU7A 4W63A 1SCKA 4Q3KA 1CUGA 1VE6A 3R3YA 4C87A 2WJ3A 2H9YA 1ETHA 1GPLA 3FBWA 1XROA 3C8HA 2OCIA 5AM0A 1EH5A 5CT9A 4DNQA 1TIBA 1RP1A 5AKLA 3X3HA 2XMQA 2OGSA 4M0FA 4QDOA 5AI5A 1XLVA 3QMMA 4P08A 3WZMA 2RI6A 2DHDA 5K5EA 3H2JA 4YK7A 3VXKA 1ZGBA 2OAEA 3KWFA 1CRLA 1FFCA 2B9VA 1BROA 1QIHA 4BZZA 5T4FA 5A71A 4KR0A 5ALOA 4XVCA 3LCRA 3QPDA 1S8OA 1EI9A 2CBGA 1E5TA 2WHQA 2WFLB 2PUJA 5EHZA 1F8UA 4AB1A 3NGMA 4QE3A 3PFBA 2Y2VA 3BIWA 1XZCA 2Q0XA 4ZRDA 5IVHA 1ACLA 1DQZA 1JJFA 1K63A 2BKLA 2PSEA 4LYEA 1CEXA 4IH9A 1SCQA 4EBBA 2I03A 2X8BA 3C5WP 4Q82A 3FYTA 1CQZA 1W52X 3H1BA 1X2BA 3LS2A 2ZSHA 3O4GA 3FOBA 2C58A 4HXGA 4J0KA 4C88A 5ALMA 5AI0A 4O08A 4G9EA 1QIJA 2CUTA 4AZ0A 3MGAA 4OCZA 5CBKA 1XZBA 3GA7A 5C7YA 4X6XA 4AO7A 2WIDA 2YXPX 1CUWA 1Y7IA 4H0CA 3WL6A 1AMNA 5LLSA 4BC0A 1EB8A 2Z3ZA 3IUQA 4UBLA 2XLBA 3VKFA 2G5PA 5E4YA 1XRRA 4UFOA 1DX4A 3RKSA 1E8DA 5LZ9A 2J3DA 3TRDA 1H23A 1DU4A 2ORYA 3M81A 4OU5A 4Y9SA 2H7CA 1O6FA 3S8YA 5A7FA 4BCCA 1H22A 3FAKA 4EHBA 2XQKA 2WHPA 5HKAA 2HA6A 4BBZA 3C6BA 3WKCA 3PICA 1CUHA 4F21A 3DOIA 4E15A 5ALKA 3SWWA 5DLPA 2J4CA 5JAUA 3C6ZA 1EDDA 1F6WA 4MWTA 3CXUA 4QLOA 5ESRA 3FVRA 5ALGA 3EQ9A 1Q84A 4UFPA 5ALTA 3F8SA 2XMCA 4U2FA 2BCEA 3STUA 1R9MA 4ZGBA 3AUKA 3WWEA 1ZI9A 1MPXA 5ALYA 5I7UA 2XMSA 5ALSA 2G4LA 4B9AA 5AKEA 4RPCA 1A8UA 4FNGA 3D0KA 4AO6A 2V97A 4KE9A 3STYA 4RE5A 3QH4A 4F5ZA 5CH5A 2JGJA 1MX9A 3RK4A 1P0MA 5FKJA 4OUKX 4Y2JA 3W2TA 5K3AA 4J0DA 2PBLA 4JEIA 3G0BA 4RGYA 1L7AA 1R50A 3W05A 2P8SA 1HLGA 5AP9A 3S2ZA 5I9IA 3UUFA 1Z68A 1TCCA 4UBMA 5JATA 1XRLA 1A8SA 2W22A 4U2CA 4B85A 5D3ZA 2QZPA 4C4XA 5DNWA 2OAGA 1EK1A 2HA2A 1XZKA 4Y2TA 5JD6A 1AX9A 1XKLA 3H04A 3PUIA 7YASA 4AZ3A 2DHEA 3U1TA 5HF9A 4XX1A 2QJWA 5AKYA 4W9RA 2HA0A 2XE4A 1B6GA 1CUBA 4L0CA 1E8NA 2PVSA 3KWJA 3W9UA 3TEJA 2XUGA 5DNVA 3DKKA 4QDTA 2JGLA 4H7EA 3FYUC 4I3FA 3C70A 1WOMA 5CRIA 1U2EA 3IB3A 4Y2UA 1CUDA 4NMWA 1OCEA 4LKOA 3BWXA 1HL7A 3H2GA 4UBNA 3WKAA 1P0IA 1YB7A 4BZWA 3G0DA 1G66A 1EB9A 3E4DA 5KBYA 1UOQA 1WPRA 4ITVA 4W1QA 1PFQA 5H3HA 4M0MA 1VA4A 1UXOA 5FPPA 5HF6A 3ESDA 4Y2YA 5ALDA 2CKMA 5AK5A 4TGLA 4BVJA 3HRHA 3V1MA 5HCUA 4JYPA 2QTBA 5ALXA 3FWHA 3T52A 1AC5A 2FUKA 1ORWA 1GPKA 1HQDA 2QVBA 2XT0A 3EF3A 5JZ9A 3KD2A 1EHYA 1MN6A 4MEAA 4MWSA 2NW6A 2WFLA 4X94A 1ZD3A 1QONA 1QLWA 3KDAA 2WIKA 3ZWQA 2ECFA 2XB6A 1VLQA 3I6MA 2WU3A 5SYNA 4AX4A 1W1IA 5AOCA 1CV2A 5C81A 2QRUA 5A6VA 4FNMA 4K6GA 1MTZA 4CG2A 4WDRA 2D0DA 3DNMA 4FLEA 4E46A 5AI6A 2XQFA 4HAIA 4A23A 4GXNA 4FTWA 2ACEA 1GXSA 3C5VA 3D7RA 1THGA 2QKYA 4ROTA 3HC7A 4FLMA 5CH3A 2Y2UA 1FFDA 2JGIA 3WMRA 2B61A 3C87A 1XZLA 4PF1A 2JBWA 4CG1A 3AIMA 3DQZA 2AJCA 4B7ZA 5FXMA 1WB6A 4QDZA 2HL6A 4H35A 5CT8A 3H2HA 4IQ4A 4KACA 3R41A 2BUCA 3VDXA 2AXEA 1XZDA 5A2GA 2XUHA 1XFDA 2IX9A 5E4JA 2C0PA 1QTRA 4KRXA 3K9BA 3WZLA 2G5TA 4BTVA 2JGMA 4U2EA 1UK6A 3DYIA 1Q83A 4DNPA 4EY4A 1EA5A 4WFKA 4C89A 2WILA 3WL7A 4PNZA 4Q05A 1X2EA 1LPNA 3IDAA 3O4IA 4J0JA 3MUNA 5AHXA 1A7UA 4QDXA 3KSRA 1JKMA 1LPMA 4EZIA 1VXOA 3HJUA 3OURA 4GW3A 3QM1A 3ICWA 5JARA 2WLSA 4EY8A 3DCNA 4FBLA 4GLBA 1CUJA 4X91A 2B20A 1N1MA 2XUOA 3C6XA 3R40A 3WK9A 3VJLA 1AUOA 1YR2A 1HPLA 3WWCA 1ZGCA 4H7HA 4IH1A 3C45A 5AM5A 4OYLA 3V1KA 2DR0A 4ARBA 2BGRA 4CIAA 2WUFA 5AJHA 2OG1A 5EIAA 1TKRA 2RONA 4ARAA 1ZJ5A 4AQDA 1ISPA 4PSCA 4DSZA 1BS9A 5A62A 3HZOA 5CTAA 4EY5A 4WCVA 5ALPA 5K3BA 4P92A 5ISMA 3WK6A 2CJPA 2HA7A 1CFJA 4MQLA 2WTNA 4DMKA 2XQIA 3STVA 5ALUA 5CURA 1EINA 2HA3A 4CI9A 4RE6A 5LZ7A 4D9JA 1GKLA 3WWPA 3H18A 3Q8WA 5FLKA 3IA2A 5HFNA 2PUHA 1QO7A 1ACJA 5DJ5A 4V2IA 2ONCA 4BAUA 2XUDA 5D7BA 3L1IA 3I2FA 5HK9A 2O7RA 5BOVA 3L1JA 3AIOA 2BFNA 1YB6A 4W1SA 4KRYA 3RARA 5HQ3A 5AKXA 1WCYA 2PL5A 2RGUA 4UHBA 3WKBA 4FMPA 2QR5A 3IUJA 4DSAA 3CCBA 5LKAA 1OXMA 4LXGA 3K2IA 5KREA 1HDEA 1TK3A 2Z3WA 4QWWA 2VJDA 1QIFA 1H2YA 2H7XA 3DD5A 3DL4A 2XMBA 1VA5A 3O4JA 2VJCA 4LYDA 4J0HA 2UZ0A 5EIEA 3U0VA 1VJ5A 3PFCA 1ZICA 3SX4A 1XZEA 1Y37A 4FBMA 3I6ZA 3BJMA 4BRSA 3FNBA 1Q0ZA 4DNFA 3A70A 4EUSA 2WKWA 3FCXA 2WIJA 2VF2A 2BGNA 2DCMA 1AQLA 2JGKA 1CUFA 2VAVA 3E0XA 5AKHA 4XJVA 4BATA 4CCYA 3I1IA 4Y2RA 1MX1A 4Q1VA 2XMZA 4HXEB 2PKYX 4GBGA 5DYYA 5SYMA 2PSJA 1Q0RA 2O2IA 1H2ZA 2XUKA 1HKHA 4KYVA 1U8EA 5KWJA 2V98A 2BUBA 4X95A 5JASA 2WG0A 3H2KA 4UFNA 3STTA 1DT3A 4HXFB 5DTIA 1EVQA 2VQ6A 4K6KA 3WJ1A 4AN1A 5AK4A 1A8QA 2DQZA 2XUJA 3CCCA 4HZGA 1R1DA 2PSDA 1AURA 5F4ZA 1FFEA 4X7BA 2BJHA 1QIKA 3EIOA 4K2AA 3G9TA 4OSEA 2WTMA 5AKKA 2HU7A 3B5EA 4UHCA 2HA5A 1O6GA 5AOAA 1P0QA 3KOOA 4WFJA 5LKRA 4AN0A 1Y7HA 1JMYA 5JZBA 1VKHA 3IBTA 4WY5A 3R3ZA 1T4MA 3W06A 5ALIA 2XQGA 1PV1A 1LZKA 2GYUA 1FSSA 1XQXA 1LBTA 2HFJA 5ALLA 2D5LA 2VTVA 1YASA 4PSDA 1IUOA 2JEZA 1YAHA 4J3JA 4KAAA 4CFSA 5FV4A 3AILA 3LIPA 1CIJA 3YASA 3N0TA 1QFSA 3AFIA 1IZ7A 4X97A 1TQHA 3FSGD 2ZYIA 4X6UA 2PSFA 4X93A 4UHHA 2CZQA 3C43A 1ZIXA 4UPDA 5AI4A 4CG3A 1EXWA 4Q3LA 1DINA 3ESCA 2B4KA 4DNOA 3G9UA 1R9NA 1JI3A 4MJ3A 1EDEA 5K3CA 1WHTA 3VVLA 2E3JA 4JH0A 4UBOA 3BE8A 5JADA 5ALJA 4Z49A 1TCBA 3EBLA 3FCYA 1QIDA 5K3FA 1GGVA 5AM3A 1H2XA 2HU5A 5D3KA 1E8MA 1XKTA 4OD0A 5K3EA 1F0PA 4OB6A 3ZLUA 4BCBA 1J1IA 3BF7A 3FYUB 3PUHA 1LPOA 3NWOA 1N8SA 1EK2A 1ZD4A 4AO8A 4KEAA 2IIVA 5CT4A 1YA4A 2OQIA 3D5EA 4H7KA 1QIMA 3G02A 5AIAA 2PSHA 4F60A 3F96A 5HF5A 1DTEA 2O2HA 4BP8A 1KU6A 3RLIA 3QYJA 3ICVA 5AH0A 3B12A 4QNNA 3IUMA 4BE4A 4GI1A 1VOTA 4PW0A 1C4XA 1G5FA 3STWA 4XIIA 5EHXA 1M33A 4KAJA 1R3DA 4X71A 5DTJA 3F98A 4Y2SA 3HXKA 1W4LA 3WJ2A 3G9ZA 3DKRA 5AK6A 4K6HA 4WY8A 4L3WA 5BWCA 5T4HA 4H7FA 2OCLA 1XRQA 1VZ2A 3Q0TA 1CLEA 1QOZA 3FLAA 3M82A 1XRNA 5IVIA 3HYSA 3VISA 4B0OA 1CPYA 4B84A 2V96A 4G8CA 4UHDA 1ZD5A 4N5IX 5AKIA 1BN6A 1WM1A 1QIEA 4BDTA 2XQJA 1B41A 3AINA 2WFMA 3IUNA 2I78A 1QO9A 2WM2A 5JYCA 1UFOA 1MJ5A 5CXUA 4CCYB 4UBKA 3WK4A 1USWA 2K2QB 5AO9A 2Z8XA 2DHCA 3VJMA 1MAAA 2WUEA 5IVKA 5ALVA 1J06A 3O9MA 1XQWA 1E66A 1X70A 4ZREA 4DMHA 2AJBA 1W6RA 1XZMA 1N5RA 3UMJA 4IO0A 1LNSA 1IZ8A 1MNQA 2HM7A 5YASA 3V1LA 2VAXA 1TRHA 4HRYA 1MO2A 3O0DA 2WJ6A 3BF8A 5AI8A 4YPVA 3GZJA 4A16A 3O9VA 3FYUA 1BCRA 1LPAB 2Y6VA 4J0IA 1UZAA 4JYMA 4AMZA 3W9BA 1D07A 5EFZA 2JIDA 3JWEA 4J0CA 3BL8A 4DM7A 2CEKA 4J0GA 5FPQA 3FVTA 2WJ4A 2HU8A 3O4HA 1JFRA 3IIIA 4NVRA 2QMQA 4EA6A 2QJRA 4GEGA 5AKZA 5BV7A 2WQZA 3CN9A 3WA7A 2EDCA 3MUOA 1XQVA 1SCIA 2RHWA 4RNCA 4PQEA 3GBSA 2ZYRA 1UOPA 2JGFA 3H1AA 2ZJ7A 2HIHA 2GYWA 4OU4A 2DSNA 2RAUA 2OCKA 4MQMA 4YX9A 4M0EA 2HADA 3LP5A 4UBJA 3WK8A 4X00A 4EY7A 4GWLA 2I3DA 1CQWA 2PM8A 4BCDA 2O7VA 4WDQA 1XRMA 5D6OA 1DWOA 2Y6UA 4X85A 4TPKA 4JNCA 2XMDA 1GT6A 3I1YA 3EQ8A 5ALZA 4B81A 5CT6A 4DLNA 3WQHA 2RHTA 1DQYA 3ESBA 1CUAA 5T4EA 2GYVA 3GROA 4U2DA 4B0PA 5CT5A 4NS4A 5E4TA 1BEEA 4HTAA 3BJRA 2ZSIA 4XWGA 3V9AA 1ZOIA 4H7DA 4G8BA 1XRPA 3NOXA 3HI4A 4QZVA 5AM4A 1JT2A 5I8PA 4EB0A 5EIHA 5JAOA 4DIUA 1MX5A 1FFAA 1K4YA 1TAHA 1RYYA 4QEKA 3VVMA 4OB8A 4WJLA 1VXRA 1MT3A 4BAGA 1AKNA 2JEYA 2YASA 1P0PA 1VZ3A 2AJ8A 1FFBA 2ZYSA 1JJIA 4BTLA 3EQ7A 3ZPXA 2HDWA 4N8EA 5ALNA 1U65A 2XUQA 2AJLI 2OCGA 5EHQA 2XDWA 1C7IA 4N5HX 5FUMA 2DQYA 1LZLA 1GKKA 1YS2X 1LPBB 5HKBA 1LGYA 3DL7A 3G7NA 5AM2A 3G0GA 1NU8A 1AZWA 3N2ZB 3WYNA 5LZ2A 3I28A 4Q3OA 2XUIA 4BVKA 4L72A 5EI5A 3A2MA 3WL5A 5LP1A 4P93A 1CUVA 3WKEA 1THTA 4GECA 5HQ3B 1ODCA 2OGZA 2ES4A 3WIBA 1BU8A 3R3VA 4BB0A 3H19A 4MXDA 4QDUA 3G0IA 1QGED 3JW8A 1ODTC 3IURA 1GQRA 3IVMA 3NUZA 3AZOA 3E1GA 4GDMA 3H17A 4BYMA 4KE8A 4Y2VA 2PU5A 2YH2A 5LZ5A 1IVYA 3OTQA 5FOQA 3DLTA 5AICA 3D3NA 2GZSA 3WK5A 2R11A 5ALEA 1L7QA 4UBIA 2Z5GA 4B6GA 6YASA 1N5MA 1DT5A 3TJMA 3ED1A 1XZFA 4LXHA 5HFAA 1J2EA 3QBJA 1YAJA 4JUIA 1CUUA 4X6YA 4YASA 1AGYA 2QT9A 3ZLTA 2Z8ZA 4B82A 3QMWA 5AKJA 3ZV7A 3ANSA 1CR6A 2VEOA 4MEBA 5AOBA 3QZUA 3DJYA 4H7JA 3ZLVA 2HRRA 4FHZA 1CUEA 5DYWA 1NU6A 5JZSA 1LBSA 1UT6A 2J4FA 1ZJ4A 3R3UA 4OB7A 1EVEA 2CB9A 3O95A 1QZ3A 4CCWA 2ROQA 3A2LA 1UKCA 1EDBA 1UWCA 3DS8A 1BE0A 4UUQA 3D59A 2I3ZA 2H1IA 5JD4A 4J03A 2VJAA 4BC1A 3RM3A 1MNAA 1QIGA 3K6KA 4X90A 1I6WA 4W1RA 2HA4A 1ZI8A 2GBIA 2JGEA 2PPLA 1LLFA 3G8YA 1T2NA 2QXTA 2HHAA 4CIBA 1SFRA 4LXIA 2HFKA 2XUAA 2WG2A 4FKBA 4ZWNA 4QA9A 4K5QA 5ALHA 1XLUA 1DWPA 3H0CA 3R3XA 1QTIA 2EDAA 2C4HA 1WB4A 4ZXFA 5JIBA 2ZVDA 1ZD2P 5T4BA 3QPCA 2GZRA 5EGNA 5A7HA 3QMVA 1IUPA 1L7RA 1UK7A 3SK0A 1BEZA 1UKBA 4G5XA 2WIGA 3TGLA 1R88A 3GFFA 2GBFA 5K3DA 3OPMA 3HACA 2R8BA 5AIBA 4Y2XA 1WPXA 1W75A 3WLAA 4G4GA 4Q34A 4FFVA 3OM8A 3WWDA 3AZQA 3L1HA 4HRXA 2FJ0A 3I2GA 3PE6A 3D2BA 3PI6A 2ZJFA 5A7GA 4DYHA 3HSSA 5ALRA 4EY6A 3QVMA 5J3JA 2LIPA 3PDCA 4S0XA 1KU0A 2BUAA 2QUBA 5K3FB 5LZ4A 2ZJ6A 4G1FA 1CUCA 2XUFA 3R0VA 5C8VA 1GPNA 5HZGA 4GHWA 3D2AA 4PO3X 4BDSA 4FWBA 4Y7DA 1XQYA 4UHFA 1J07A 1TCAA 4L9AA 3WIOA 1LPPA 1E3QA 1QFMA 2C5GA 3UUEA 4MYSA 3QITA 2PX6A 3WK7A 1DWQA 2JF0A 5LYYA 2WHPB 1ZIYA 1UK8A 3I2KA 3HLKA 1XZIA 1K6EA 4BE9A 5JALA 3PF8A 1PJAA 4BVLA 2W6CX 3DDUA 4AMYA 4F0JA 3WWOA 3V48A 4FLFA 5HF8A 3VJKA 2VT6A 4BRZA 3H2IA 2CMFA 4QLAA 3DEAA 4U2GA 1XZHA 3BXPA 1SC9A 1G42A 2OPHA 3I6YA 4DMFA 3FLBA 4QWMA 1C7JA 5CMLA 3OG9A 3F97A 1MU0A 5BWBA 4KJXA 2X5XA 4KAFA 5DNUA 4Y2QA 3WA6A 1DX6A 3C8DA 3E3AA 1CUSA 4P9NA 2WSLA 5LIPA 3A6ZA 4N8SA 1GQSA 1JJBA 4B9EA 2VSQA 4I19A 4IH4A 5HK8A 3BDVA
chains in the Genus database with same CATH superfamily
3NNSA 4E14A 1SXJC 4LYHA 1I33A 3VYSB 4L27A 1II8B 1C7FA 2ATIA 4HDNB 5L3SB 4HXYA 3RVNA 4M1ZA 3Q1LA 1GV1A 3GOQA 3RUIA 4J3NA 3UHAA 2IUSA 3Q87B 5L95A 1E7RA 4G0UA 4RIFA 1RPTA 2ZI6A 3CR3C 3M6MD 3ZW8A 3L0OA 4LZWA 3NI2A 3QJYA 3VU1A 1CIVA 3EGCA 3F67A 3NC0C 2WJGA 3PWTA 2VT7A 4IMJB 1ZHOA 5FOTA 4EUKA 3GFOA 5H68A 3LUJA 1JSRA 4YCSA 4Q6WA 3KFXA 3L4SO 4C3ZA 4FR0A 2OC9A 4DCNA 1OD6A 5BPFA 2QLJA 2RKOA 3OQHA 2JAUA 3PBKA 2B8TA 4MS1A 1XA4A 1NM5C 1XDSA 2X76A 2ZBDA 3G9XA 1YZLA 3KCQA 5THQA 1M34E 3FIUA 2BBSA 3L6EA 3NTUA 3TZEA 5KQGA 4OX9B 4WKBA 1NNUA 3I2IA 4H7IA 1QC5B 4Z7QB 3G13A 5BNTA 5JAHA 1AGNA 5JRJA 4BFLA 2FMTA 1KEEB 1HFJA 1JTFA 1A95A 1NBMA 2ZB7A 3BZUA 2NNLD 4AWXA 3ZIAA 4C5AA 1TFRA 4V03A 821PA 2Y68A 1EVKA 1A5SB 1TK9A 3CUSA 3OWHA 2AOTB 4D4HA 3IAM6 4WFIA 1QIIA 3L04A 1Y6RA 2XOKA 1NFFA 2AUTA 2V7QD 3DHWC 1E9DA 5FP0A 5JFGA 1C9DB 1SOVA 4LNUB 4UZSA 1Y89A 1RHRA 1A5TA 3WL8A 5C5DA 1JDJA 3C8ZA 1KYTA 3ZYCA 2HNAA 2O50A 2XVXA 4I8XA 1WKBA 4DJFC 2AZXA 5MGNA 1W8DA 3VZRA 5D3MA 4MI9A 4Q9JA 5AI9A 5KVAA 1YFLA 3OZBA 5H83A 2XV1A 4RA9A 1ZL0A 4UXHA 4ZCPA 1ODJA 3QJ5A 4BJ1A 1REQB 2JANA 3FN4A 4HLUA 5J23A 1GNLA 1UDRA 4UASA 4V0ME 3RIMA 1A76A 4MYDA 3OAAA 5EN4A 1B8VA 1T4CB 4MRVA 5AK3A 3CVWA 3K0KA 2JGNA 4DM4A 1XXHB 1X94A 5LFAA 4KE7A 2OQVA 2YHBA 2G25A 3ANNA 4BJ6A 4PG8A 4OA5A 5CW2A 3EYWA 1BA3A 4XEUA 2QUIA 3JZAA 4Z9XA 1TO2E 3FTFA 3RRZA 3OC0A 4G9GA 1RYNA 2FE1A 3FNRA 4E08A 1FXWA 4ZFNA 4EHAA 2FRDA 2QS9A 3CONA 5IVDA 1UC8A 1QF6A 3MWDA 4MP3A 2ZULA 4EKDA 1JWLA 4BNVA 4E07A 3UJDA 2RHJA 1IUNA 3ACDA 2PLAA 4CL2A 1ILEA 5KTPA 2HBQA 2EBWA 1WDLA 3TZQA 4XYMA 3FFBA 3KKLA 3UWDA 2JPDA 1NR1A 1PNVA 3WZ2A 1XCPA 2EWWA 4R0NA 4P3OA 1OYVA 3ABQB 4LRSB 4E5NA 3QKSA 3LBFA 4IOKA 1SUBA 4JITA 5L3RA 1CFZA 3VDMA 1ZVJA 2DQKA 3FOEC 3SM3A 4WKOA 3EEYA 4BMZA 2BC9A 3NT4A 4HGOA 4J8PA 2H2FA 3DBRB 4KO4S 1QLHA 4BQEA 1SKUA 2HF9A 1DHTA 1SUEA 3H5WA 3ZEAA 1Y5RA 2O6LA 5ILOA 3RS2A 1EAMA 2Q4TA 3KWMA 4MUHA 3UMVA 1Z5NA 2D2IA 2X8JB 3KOUA 5KVSA 1FK8A 3PPIA 4L8WB 5IKXA 4I6GA 2O7QA 4DUZB 4JXKA 4Q6BA 1AK2A 2IZZA 5BN3A 1U0EA 1WUTA 4HQRA 1OAAA 3Q4GA 3GNQA 2GXUA 2X2EA 3GELA 2Z98A 4OPMA 2IU0A 4DSTA 1XI2A 4O4HB 1R8XA 1Q91A 4EQ6B 3WKDA 5H3CA 1U2SA 3RASA 4Q4HA 2D4HA 3O8CA 3FUCA 4S2EA 1E2GA 1C8LA 1Y7PA 1Z17A 1PT7A 2CXXA 1KZ9A 3A6GA 3AIKA 4HNGA 4Q9NA 4D9EA 2BTQB 1TUEA 2IS2A 1HMPA 5A04A 3T38A 1G5QA 5CCEA 3ZI7A 3Q2OA 3ND6A 1GZVA 1XCOA 2B8EA 3H65A 4ZHQA 3B6EA 2JVJA 3D1LA 4A15A 5CIWA 3UF0A 3WYDA 1T34A 4AI6A 1VKRA 3Q5GA 2AX3A 3HYLA 4HQLA 1N2SA 1UFQA 2P5YA 4PPFA 5K3SA 5BXYA 1CR2A 4IFTA 2XXAA 2YYSA 1H2WA 3AJAA 1SQGA 4KL8S 4WXHA 4IVRA 4CLRA 5JVDA 4E11A 4MVJH 1IN1A 3LLCA 3S2FA 3JZIA 2A5LA 1KMIY 1K6XA 1JDNA 3TCNA 4IUDS 1JLLA 3PEFA 1VCNA 2W98A 4JJKA 4OXXA 4ML3A 1U4SA 1WCIB 5CNIA 2VTBB 3LXUX 3NEPX 4ZMSA 1N3YA 2HJVA 3HJFA 4R1LA 2PSSA 1YBFA 3A1TA 3P2EA 4IS2A 3SSOA 1IRXA 1IL0A 3HABA 2HSJA 1I7NA 1UCFA 5LZ8A 4BGUA 3R6WA 2R6JA 4MS4B 2EL7A 2XMRA 3IERA 4BO9A 3O03A 4HWSA 2D62A 3ABIA 4CLRB 1FJ2A 1Y63A 4EA9A 2UYCA 2FXVA 4HS9A 1N4AA 2XRYA 2D2VA 4GE3A 4JVMA 5IANA 4UE6A 2JG3A 4OY3A 4BOYA 4DRXA 3MCWA 2K7ZA 2FX5A 4U9HS 1GGMA 4IAOA 3K92A 1L4LA 4H18A 4C5CA 1FVFA 2BZ1A 1NXQA 2FWJA 2KSQA 3PP8A 4U8HA 1JLMA 1QYVA 1Q0LA 4HAOA 3PHHA 1R64A 3P0IA 3JYOA 1R4ZA 4HH4A 1RJFA 4GZLA 4C01A 2RI0A 4LE2A 3G5TA 3CN7A 2IYPA 2JJ2A 4Z9FA 3HZZA 1KNQA 1H3NA 4C08A 1D1TA 1X77A 4MV6A 3STXA 2JLVA 3O4RA 1VMKA 3JQ9C 3O38A 1C9MA 2B37A 4IJUA 4D5GA 2O8BA 3M9LA 2QR3A 4NBTA 3TK1A 2OXEA 3C8MA 3EFBA 1NONA 5LXTB 3MD0A 2FE4A 3W3AH 2VA9A 3W34A 2BEJA 3KSZO 3EW9A 4NNPA 1R0BA 3PVCA 5G4LA 3T5BA 2X8JA 3K9NA 3N2IA 4QO7A 2IH2A 2JS7A 4XCVA 1WXHA 4RK5A 3WL4A 4EAQA 3FI9A 3V4OA 2UXCB 1JPVA 3EXIA 3B9QA 3V55A 3ZE2B 3HRIA 1Q0SA 2C9MA 2WABA 3NO4A 3ROXA 1RAEA 2WT4A 1DELA 1KOLA 4I3HA 4OH7A 2PGNA 3HVIA 5HUJA 1U0GA 4P86A 4QSHA 3VR2D 2X4DA 1B3RA 1GSAA 2RAPA 5CAEB 4BLTA 3RVMA 2C5FA 2QX6A 3NDJA 1N3IA 1UK9A 3GLHE 4AMVA 4QUJA 1NM5A 4MAMA 4NG4A 5FTWA 1YS1X 3JZDA 4Z7JA 5K2MA 3SKVA 5AXAA 1E79D 3EVEA 3F9RA 3JYQA 4ZT6A 3U0BA 3F4KA 4PYLA 4C7OA 5LMZA 5MN4A 1X9HA 1OZFA 1QGUB 2RIPA 1P7ZA 1CUXA 3SFVA 1LVGA 1K8QA 3L9XA 3SYTA 4CT5A 5CD9A 4LY0A 2ZRDA 4Z0PA 2F6RA 3HEAA 3AM5A 1XN1A 3OPNA 1RAGA 1MJHA 1U1IA 2C2MA 3TSCA 2G1PA 4XX0B 2L2QA 2X0FA 2ODNA 4X7PA 2PU7A 5HIMA 1DP4A 6CHYA 3B6JA 1OYYA 2O3JA 4MPTA 3Q2KA 1CUGA 4EZBA 1I3OA 1K27A 1VE6A 4R8SA 5AMXA 2NUAB 4QGSA 3ACBA 3ADPA 4ROSA 5LQSA 2Q3CA 1RVV1 2UYYA 2ZKIA 4IJMA 1KKUA 3DB2A 3JPYA 5J4YA 3FBWA 1AQ6A 3ENNA 1D8TA 3VHRA 1H2HA 3C8HA 4NBSA 1CIPA 1H8EA 4JLDA 5A4KA 4I9NA 9GPBA 3K70D 1TIBA 4B3MB 1DQSA 5FADA 3KTDA 4QYIB 1U9IA 3RIHA 2GVZC 2V4MA 2ZRPA 4M0FA 2QQGA 4C22A 4FFMA 2AL7A 5D3MB 2QPAA 1H85A 3URMA 1TKBA 1XLVA 3JQDA 4BV3A 1O87A 1ADJA 3QMMA 2X6QA 3WZMA 1IPEA 1ECBA 1ZHFA 3AGPA 4JC4A 4HVCA 1J39A 1Q74A 2RB5A 2QTCA 1FY2A 3OTIA 4EGCB 1N7IA 4PPQA 3QOYA 1VHTA 1YZNA 2ZBFA 1KMMA 3EA5A 4UVDA 3GRAA 4LF7B 3H2JA 4KQMA 4Y6PA 4HF7A 4YK7A 2NG1A 5K0LA 4RQUA 2R8XA 5CX1B 1KXZA 1MO4A 1ZGBA 4G5GA 5CK5A 1UUFA 3DH0A 1CRLA 1YMVA 1QANA 4YLEA 3Q6MA 1AKVA 1TLFA 2E4ZA 1BHO1 5ALOA 3F73A 2ATVA 4U6QA 1UZNA 1YR6A 2QUZA 4YIHA 1EI9A 2QMEA 4XQCA 4O2RA 4R6XA 4EW2A 1E5TA 2JJYA 2ZANA 4G2NA 3T7JA 1CQJB 1T9GS 2WFLB 1SOAA 1Y1LA 3A6PC 1MV8A 3LOPA 4DRYA 5IRCD 4UVEA 1N8KA 1F8UA 2FOLA 3NGMA 1E9FA 3P20A 4QE3A 3V8RA 4AB1A 1R15A 3PFBA 4PAQA 4DY4A 2RGEA 1MRSA 2YJTD 5A3QA 3DWIA 1UMDA 4MUNA 1N2BA 1JDUA 3N8IA 4UM9B 1PWXA 4G5QA 3RSCA 1U6KA 1QH8B 1G8YA 4ZRDA 2FLVA 5IVHA 3IBYA 5E1OA 4A8JC 4BN0A 1AS2A 3NEYA 4N18A 5JMTA 1C3XA 3FHCB 3HUUA 4DMMA 5BYBA 1JAIA 1P81A 1MAWA 1HNXB 3BTSA 1F48A 1GRQA 1VM6A 3AQIA 3VO9A 4IG9A 1CJKC 4Z8YA 4CWAA 1CEXA 1II8A 5L3SA 1H2BA 2A3NA 1GTG1 2PGDA 3ESYA 1FFXB 2NXJA 3FUWA 4KN9S 5F23A 3WGYA 3FKSD 2EFCB 5HWSA 3DAFA 2X8BA 2AOVA 4Q82A 2OCBA 4HY3A 1POXA 3GK3A 5IBRA 3G5UA 4ZTBA 1LH0A 3M33A 1X2BA 4FFLA 3LS2A 3O4GA 3E9ZA 3FOBA 3NORA 5FTMA 4MW0A 1E98A 3ER9A 2MOKA 3IA7A 1EA7A 1U2GA 3DO8A 2YV2A 3MMPA 1KK0A 1H69A 3GUVA 5ALMA 2AEJA 5JECA 2F3QA 5AI0A 2Q2VA 2QYHA 2ZB2A 4O08A 5GZ6A 3HKBB 2JIOA 2CUTA 2QD3A 2OSBA 3OPYA 4IFBA 3RW9A 1SZJG 2GILA 5KB3A 2BD0A 3W4IA 3HUFA 3TLZA 1X7ZA 1PS9A 2FK7A 3BIOA 3IAS6 3PHBE 5CBKA 1FC0A 1DXOA 3TEFA 1TCUA 5C7YA 4AO7A 4QC2A 2IWRA 1RIIA 3I4CA 5P21A 1AMUA 4RHFA 3TE6A 2O1WA 2ERYA 2FW0A 2IY7A 2RH5A 2VO1A 4RPHA 3PL5A 4U00A 4UM9D 1Y7IA 1C0EA 4QFMA 4QRDA 1W581 3UK7A 5C3MA 5E1DA 1PJBA 3JATB 2GJKA 3NAZA 3RPEA 2QDXA 5LA6F 2PFGA 3HJHA 5MF6A 4Z9BA 5JCPA 1JNYA 3L7JA 5F73A 1L7MA 3FTCA 5EJMA 4YPFA 4EPWA 1RC1A 1NL3A 1XFAA 4IKOA 2XXAB 3NTLA 3GI1A 1QNLA 1UPBA 3BH7A 4N65A 3UC9A 4AJKA 4EHFA 1P1HA 1XEXB 3P9YA 4OL0A 2J41A 4R1SA 3RVSA 4PC2A 1AJEA 3B1JA 2OT3B 3AUYA 4UFOA 4B3IA 1KO8A 2FMIA 2HK9A 2EJCA 2G09A 4XFJA 3RKSA 2CV0A 3TRDA 4YAUA 3JU3A 2P6UA 2EJVA 3GGSA 1M2WA 1W2WB 4RZ3A 5JYBA 4RTKA 2EEZA 4Y9SA 5J2UF 4LCEA 1Z08A 1JXAA 1C8BA 2CJXA 1E99A 1Z2NX 3M4JA 2BP7B 2XDQA 1RI3A 3DC2A 1N2CA 3WYEA 1OBOA 5EMNA 4HOYA 3L0CA 3Q9UA 4A5OA 1SBIA 2DZDA 4E70A 1K5GA 2QBYB 4OI4A 2NTVA 1YB2A 1P4SA 4HEA1 4P2GA 4FFNA 5CXQA 3MJTA 1CJTC 4ED9A 4BB6A 2D5AA 1MKYA 4QGFA 2BLNA 1FP7A 2XQKA 1ZKMA 4GDFA 4KTVE 1XN4A 3K5WA 3V3KA 4BBZA 4RH3A 2GKOA 1XTKA 3PENA 3TQQA 3VBEA 3NBXX 1P3DA 3ITDA 1CUHA 4NC9A 3O7MA 2GZHA 2Y1DA 4Q24A 4ARSA 2NMVA 1J8VA 4NEQA 1EFDN 2V0NA 5BVGA 3NUQA 4O59O 2OWDA 2I7XA 3DOIA 3E7DA 2ATEA 4E15A 2FDCA 3SWWA 1XP8A 4ND4A 5DLPA 2FFBA 3LKDA 4WGGA 3RK0A 4HWTA 2X0JA 5I7RA 2Q1YA 1GZ6A 3H7IA 2NPFA 1EDDA 3SIRA 1AOXA 3K4HA 4JUFA 2GBLA 3ZKWB 4QLOA 4IO1A 1U3FA 1UBOS 5CU7A 4LF6B 4AMBA 2CB0A 4CEHB 1JVNA 3W5BA 1ZNYA 3EVDA 3NPAA 2JLBA 4ARZA 3C85A 2Q7XA 1I7LA 1QFXA 3GQBB 4HO1X 2W6JA 3G6WA 3KG2A 2BGKA 4ZAZA 1JDPA 1DXYA 2PANA 2WU8A 2XX3A 3FG9A 1MV5A 1V71A 4AP5A 1TMYA 4R3WA 5J63A 1R9MA 4BJ5A 2QYOA 1UPTA 4DLXA 1Q20A 2W5UA 5IZCC 1XEFA 5ALYA 2LVBA 4CGYA 2C78A 5FUXA 4WBNB 2B25A 5IMBA 2G4LA 3VPXA 3F4LA 1HDZA 1O57A 4V3CA 3K1YA 2ZG6A 3DTNA 2P4HX 1M6VA 2BGMA 3FBGA 3QUSA 4NR0A 5JJIA 1HOXA 1DFIA 4R7ZA 4YREA 2GH1A 4FN5A 5CH5A 4F7DA 3ND5A 1U5BA 1MX9A 3ZVLA 5I7FA 1RXVA 1JKJA 4NENB 4UOQA 1Q11A 2GUWA 3AHIA 1ZIPA 4U8GA 4A2PA 4AZVA 1KO5A 3SEQA 4HEHA 3D31A 1RWKA 1ANKA 1U2RA 4NBLA 4XM2A 3RIYA 1JHRA 1T2UA 3BRQA 3A8TA 3D8HA 5K3AA 4B76A 3E27A 3IEXA 4M0CA 4RTQA 1E2PA 2GCOB 2P11A 2NVBA 4HYYA 1G3MA 3AY0A 1P1BA 4IXMA 3LDHA 2NU9B 1UFKA 1Q1ZA 4Y9TA 1VL5A 5CXSA 2HQOA 4RGYA 4FSXA 4ER5A 4WBNA 3KQOA 1DAHA 2C4KA 3EASA 3DLCA 3NFRA 4MVJF 4US0R 4F97A 2Z57A 4M21A 3G85A 4MJXA 1OIWA 3GDFA 3NBUA 3S2ZA 1KEEA 2HHHB 3P9XA 4X20B 3AW8A 3OTGA 4ON9A 2DPMA 2C83A 1UZMA 3ACCA 3F4BA 3CIOA 3H1EA 4NF2A 1TCCA 2D1RA 4PAMA 4UBMA 5CJJA 3ZWVA 4I3GA 3EB9A 5AVVA 1B6RA 2CCGA 3QXCA 3PJEA 2UVPB 1Y5MA 3L82B 2Y0CA 4K0KB 2W22A 5ENDA 1ORTA 1YK0A 4B85A 1BW9A 1J9GA 2J0UA 4O2LA 4DCSA 5HXAA 1PNRA 4EQZA 2QZPA 3TX6A 2CD9A 5GY7A 4RL4A 3VZCA 2QV0A 3NIWA 4G24A 2OAGA 1LKZA 5K0BA 2J9FB 1T1RA 1TM2A 3WDMA 4CT4B 3DV2A 1EK1A 3A7DA 1P77A 1N6NA 2PXCA 2HA2A 3KIPA 4LY3A 1EXVA 3L77A 4RLFA 5IK2A 2EKBA 2IUTA 1E1NA 1E3WB 4QU8A 3PUIA 5BW6B 3RADC 5KIAA 2NO1A 2ORED 4JI6B 2H1OA 1MR3F 3H83A 5BWNA 2YXNA 5KJFA 1AD2A 3JQ9A 3TL2A 2QJWA 1QYCA 1WVMA 4O1MA 4HNRA 4OLFA 5D86A 5BR4A 4B71A 5DBEX 1B6GA 4N03A 5FI0B 1JYSA 2OYRA 1QWOA 4PN3A 2C2YA 3OWOA 4RULA 1RHQA 2P9YA 3GLSA 3Q41A 4L8LA 3VPHA 3WQBA 2A9PA 6LDHA 2XUGA 4W8OA 5DNVA 3BL5A 1ZDMA 2HK7A 1TT5A 2XNDA 3DKKA 3H87A 3HCRA 2B4YA 1E2MA 3PDHA 4NZNA 4QDTA 4JKIA 5D01A 5DGTA 5JCOA 1O7JA 1WXGA 2JGLA 4G37A 3LA8A 4H7EA 3E3OA 4RSMA 2FQXA 3FYUC 2IP2A 3CEJA 4MUXA 5EP4A 1C7RA 3T3MB 4MYRA 1Z0JA 3SKYA 5BUZA 3BCSA 2DF8A 2PD6A 3A37A 4IR7A 2PWAA 4I2NA 3KYCB 4TLBA 5A5GA 4PG4A 3SQDA 3FFWA 3IEKA 3V8EA 2FWIA 2AEFA 5COQA 3N6XA 4PFSA 4WVFA 4Y2UA 5K99A 1YOBA 1THMA 2IH5A 1B00A 1L5HB 3F8TA 3LF2A 4LGMA 5B30A 4TMYA 3WGVA 4NLLA 3T4EA 1L4KA 1DAIA 1V8ZA 2ZIVB 2P2SA 2QE6A 1DLJA 1L4NA 1PZNA 2ODPA 4HWKA 5FNVA 3E0QA 3I62A 2X58A 1LBHA 3ABZA 3JSAA 4YLYA 2Z6UA 1QHHB 3BWXA 4UBNA 4FX5A 3WKAA 1P0IA 1U8ZA 2JC3A 2P2DA 1G66A 3T5DA 3ZC3A 1YULA 2YQZA 3PG5A 2XTAA 2AOUA 2B8JA 2PKEA 4BUJA 3N28A 4RD2A 4J90A 3ICEA 4XH9B 1NYLA 3ET5A 4N3GA 1ZRMA 1THZA 4M0MA 2C9YA 3S2UA 4XASA 5JC1A 2OSVA 1WG8A 3W4JA 5JFTA 5C37A 5HF6A 4Q37A 1V8OA 1KFEB 1JVSA 1AMOA 1M34B 4KU4A 2OZVA 3LECA 4FZRA 3BSFA 4Q9HA 1RBZA 5ALDA 1T2VA 2PL3A 5AK5A 4BVJA 1CDZA 1XV5A 1EEHA 3ROMA 5EOVA 1QSGA 5FA8A 5LWHA 5J2UB 1QCZA 1SBQA 4X24A 2H29A 2IGBA 4GR9A 1XZ8A 4AZ3B 2OENG 4GSLA 5AKHA 1P8JA 2FUG1 3FWHA 2ZRHA 2CLIB 3I9V1 4BMVA 4LAFA 2GKSA 1AC5A 2I1VB 5DNEA 3UO8B 3D6HA 5A2QA 3FZNA 2FUKA 1LS1A 1JA9A 3QEBZ 2O5VA 4BU0A 5AVXA 4G1BA 4BMSA 1GPKA 4W5QA 1OFIA 3LL7A 1ZK4A 3I05A 4GOMD 3KKKA 4TMKA 2Q3LA 1IDN1 2R2AA 2G83A 3C6QA 3LPDA 3VR5A 1ZPDA 1YU6A 4YRZA 1OUMA 2E87A 1JBEA 1RAHA 4OATA 3DQQA 1ZONA 4GEKA 4RENA 1RRKA 2PG3A 5CDFE 2ORVA 1A96A 3EF3A 1SQSA 1EHYA 4R2HA 3OIGA 4KVZA 2DULA 4MWSA 4PBSA 4I4NA 3ZQ4A 4C7BA 4DF3A 1VYUA 3CNNA 3U4QA 1B14A 1XTUA 2QRHA 4RFVA 1P1JA 1MRNA 2WFLA 3CW8X 4PLVA 4RVFA 2BELA 2E4XA 4LJ9A 5BW8A 4ZEXA 1LLQA 2QUKA 3KDAA 4RD6A 3ZWQA 5B5SA 1ODKA 4G0QA 4HCJA 1TJNA 2WV9A 4JP5A 3VNSA 4AN4A 2GN2A 5H8WA 2HMAA 2XH8A 4HMPA 1J70A 1HE8B 1E1MA 4G1CA 2DE0X 3G79A 2WJIA 3FPLA 1VHWA 2ZT5A 2V7PA 4PCVA 3TW0A 1TYCA 3UK6A 4CIWA 2ZBPA 1CYEA 4JBNA 1PG2A 5T5QA 1VCHA 3ASZA 2VNKA 2ABWA 3BMQB 2KB0A 1SOUA 4CQMA 1GQOA 2I4NA 3CINA 2W0SA 3JZMA 3KU1A 4JNKA 5THXA 5EIWA 2D0DA 5DEOA 4J2OA 3TIFA 5K6AC 5AI6A 2GD2A 1MX3A 2OE2A 2XQFA 1JDZA 3A14A 4GXNA 5CUQA 5FFMA 4FTWA 1NVWQ 2ACEA 1THGA 4BVGA 1ZM4A 2QKYA 2ZTSA 4XD7A 1IPFA 1NKTA 3ODPA 3TAHA 2LZ0A 1G0OA 5CH3A 4NZOA 3UBMA 1NAIA 5KPDA 3DEZA 1FFDA 1RP7A 3IC5A 2Z8YA 4IMRA 2XYRA 4UTOA 1XZLA 1SXJB 3D8UA 1W5SA 3PIDA 5GWXA 1T6XA 3ZGOA 4D9GA 2XCTB 5F9FA 2L17A 1TGVA 1WB6A 2V6IA 3A1CA 3DDHA 3ND9A 1E2BA 4R8LA 4GGPA 3G7UA 1G6Q1 1JV2B 4JOSA 1OI2A 3B8EA 5E9AA 3T7DA 2FW8A 2W6JD 3IEMA 3H2HA 1AHNA 2V6JA 5F3RA 2V74B 4IQFA 5BWLA 2CV2A 3R41A 1KSGA 5KX5B 4JC8A 2VWHA 3KELA 3FFTA 4Q1AA 4ACAA 4EELA 4QM6A 1W88A 2DPGA 1DUVG 1OAOC 4TV9A 2CLCX 4PANA 2WJZB 3L5OA 2AKEA 1N6IA 1NTOA 2FR1A 3CUEF 3VYRB 5BVHB 1G8FA 1N2JA 5A2GA 1E1RA 1QVAA 4B75A 5B2ZA 1XFDA 5E4JA 4Z3KA 2IF2A 3PQ6A 1VTKA 5LQCA 4CKBB 2A9JA 2G5TA 3EULA 1R10A 1P74A 1T3HA 3LKBA 1ZBQA 3AF4A 3DULA 3SC3A 4RY9A 4U2EA 1E1CA 1UK6A 4EH1A 3DYIA 4EY4A 2FV8A 5ADVA 4WFKA 3F78A 3TTWA 3N8GA 2WILA 2H48A 5ERXA 5IJXA 1E5DA 2DTDA 1OBHA 1PI3A 1O96B 1RHKA 3Q3VA 1OI7A 2OHXA 4A03A 2ERCA 4HP8A 3ZK8A 1S96A 1XCMA 3MPUA 2IBMA 3MUNA 4YI5A 3IEIA 3S2SA 2ZWVA 1Y6ZA 1S02A 3KSRA 3LPLA 3MT9A 4Y8VA 1Y3HA 1ENZA 3KR2A 1ONNA 2W6NA 4EZIA 3G8AA 5LIRA 3OEHA 5T8KA 4Z4GA 3TVYA 4U7JA 3TI7A 5IFLA 2YOHA 3QM1A 5BP7A 2H06A 2C0CA 1PR1A 2C4VA 4KFUA 3LPMA 4KK3A 2W37A 3RVLA 4F3YA 2O8BB 1ULBA 4HK4A 4ZPJA 2CSUA 2P3QA 3NHFA 4EYKA 2X0EA 1ISRA 1E1DA 1L4UA 1PG5A 1RVDA 1Z0FA 2EFJA 3QVXA 1ZGJA 3LCVB 4JK3A 3HXQA 4EY8A 3DCNA 5TE9A 1I2AA 1YR1A 3EARA 2XXJA 2K6GA 2Y67A 4UDYX 1ZNWA 1M67A 1XXLA 2B20A 2CDAA 3E18A 4DDHA 1HURA 5FAKA 4KKVA 2VDQB 4BNUA 1X8LA 3C6XA 4RJ2A 2EFGA 2HZ7A 3SZLA 3VJLA 3WK9A 5CYOA 2P9CA 5JYEA 1H4VB 2JHGA 1HT0A 4FGKA 1WU8A 2UZAA 3NALA 2QRVB 2ZJ3A 4FYHA 1GUDA 4P81A 2WT9A 4BFCA 3L79A 1NMYA 4BKUA 4MS4A 2P3SA 2RH8A 2AFIA 1BQEA 1TXGA 1ZGCA 3EH1A 5CCXA 1MC5A 1NVVQ 5EXEA 5KNDD 3DXYA 3B36A 1U5AA 2CMHA 2IPNA 2NPIA 3GP5A 3GT7A 4OYLA 3HP7A 4MW1A 3TR5A 4WLOA 3DF7A 1JKIA 3OX1A 4B6PA 3TLJA 1P8AA 2PKQP 4MROA 3AHJA 5D5QA 3TZBA 1JIXA 1PT9A 1MAVA 3EXG1 4Z0TA 2R87A 1YF3A 2QW1A 3QVJA 1NVAA 4CIAA 4BECA 2ZXFA 5AJHA 1FFSA 1W8IA 4CM6A 3QX3A 3R9WA 2X9LA 4MV4A 2ECKA 3O8NA 3ZU2A 5E3JA 2RONA 1GA1A 2BVNA 1ZJ5A 4QOHA 2BEUA 1RQLA 1RBQA 2MJLA 1LB1B 3SHTA 2LD4A 4PSCA 1IOWA 5HKKD 5A62A 4RFSB 3A1EA 1G3QA 2BFBB 5KYYB 2QLTA 4YRIA 3N8KA 5ALPA 4IXWA 4TSFA 5DNYB 2VYQA 3IKVA 1X86B 3OZXA 3EFOA 3VHXA 3WK6A 1DRKA 1JNXX 2A1TS 4YO7A 2WTNA 1IN5A 4H6XA 5TS3A 4FK8A 2BDEA 1G2OA 3V2UA 3V80A 3N87A 3QF7A 4BLUA 4DAOA 1ABFA 1WABA 4EEXA 1TD1A 4EDHA 4RE6A 2J3MA 4KSCA 1XELA 4KWTA 3D0RA 2GO7A 5LZ7A 4D9JA 3ZV6A 4RHUA 4PX9A 4TRRA 5K09A 1GFZA 1NQ5A 5I3CA 1UXHA 2A14A 3SZRA 1F2DA 2AHOA 1OZAA 2E4YA 2NNWB 3AEUB 3U4AA 3LX4A 4CMGA 1GCGA 4RMHA 2JKZA 1O3YA 1L5ZA 2EAUA 1K97A 4OXYA 5DJ5A 3EPRA 5DNDA 4C78A 3PUJA 1DC8A 1NRXA 2VUIB 2XZDA 4M53A 2XYGA 2WAMA 3WOHA 1NI3A 5D7BA 3ZV5A 3SQXA 3OY2A 1J9EA 2XGMA 1NYRA 3RU3A 4DKXA 1C8KA 2HZBA 3NIDB 1B2RA 2HK6A 5AJUA 3ADDA 4GOOD 1XBTA 4ZHSA 3ET4A 2JI4A 5HK9A 2O7RA 4LMRA 1DTWA 2YOFA 3H84A 3ZDDA 5NLLA 3SBDA 4DCPA 4R8VA 3SZMA 1YB6A 3EAFA 5H4GA 4KRYA 2IUYA 2NZXA 2XUZA 4IV0A 5HQ3A 3PL1A 4WWHA 2RGUA 2I6XA 3OPXA 3AJ9A 3Q2IA 2GJ4A 1E5QA 1JQ5A 4FMPA 5H59A 3S7TA 2A6PA 1F38A 2C29D 4GICA 3UB2A 5CB6A 1R2QA 3IQXA 3IUJA 4DSAA 3HWSA 4YUAA 3CCBA 3F6PA 1O4WA 5FF9A 4F04A 4FCCA 2I0FA 4R2WA 4TUYF 3K2IA 4TKUA 3KPJA 3QFFA 2ST1A 3AKCA 3PXAA 4BKRA 4F3KA 3GLKA 1UBNA 3CV3A 2NTJA 2RDMA 1QIFA 3K35A 4E33A 4HV4A 3DD5A 2DWUA 4BN5A 2BJVA 2WTBA 4ZOQI 6AT1A 1P2UA 1DCMA 1KAGA 1M1NB 1TUBB 3AHGA 5IC6A 4CVNA 1NDHA 3DDCA 4EOGA 1VA5A 6REQB 5F9HA 4NJOA 2HCJB 1QF9A 3FE2A 5JG7A 5IM4A 4KQHA 4F5YA 5JU6A 1OHHD 1UP6A 1W30A 3U0VA 3IP6A 4NZ9A 4BS9A 2MSLA 3SBOA 3PC3A 5G4KB 1VJ5A 1VBKA 4MSUA 4B1FA 1GTSA 4E5VA 3GJ8A 3VH2A 2F3TA 1KS9A 1ODFA 3H3JA 3DBHA 5KINB 1KZ4A 4GO1A 5F1OA 1Y37A 2DAPA 2F8MA 3C6MA 3MGCA 1LTHR 1RPNA 1ZZEA 2D1YA 3BJMA 4F3NA 3GDOA 3FNBA 1Q0ZA 4HTFA 4GBJA 4RTJA 5EZSA 3MJCA 1QVVA 1AQYA 2WKWA 3AOEA 1K75A 3FCXA 3RK1A 3THOA 3ZIAD 2QPLA 3OCZA 4L16A 5DCWA 1B1AA 1TJ4A 3LT0A 1ORDA 1Q1QA 1U8XX 2NT3A 3L40A 3TL3A 3FNIA 5CM2Z 2NUTA 4HNAB 2FUNB 3S28A 1R6DA 4QPZA 1U0HC 3T61A 5T7BA 5EFOA 1EUDB 1WSDA 3E0XA 3O1IC 3QIAA 4LJSA 1WBJB 4O5AA 1K2WA 1Q1AA 4YAGA 3UFXB 3I1IA 2JCYA 4MGYR 1Y8ZA 1TVKB 4ESVA 1GLGA 3E2IA 1S1CA 1X7GA 1F0KA 1MX1A 1P75A 2BBOA 3E7FA 3IBCA 4Q1VA 3KQPA 5IAAA 2CFSA 3VSCA 1HDGO 3HB9A 3BD6A 3JALA 4C0QC 1HY3A 3R9KA 5JXIA 1FYVA 5IH3A 1PYDA 1XU4A 1BMTA 2JK1A 3V1YA 4QRIA 3ZNNA 3SYRA 1RZUA 4WK0B 2AX4A 1EE9A 2IEBA 4MQEB 3ILVA 2VTEA 4URHA 5DHTA 1XKXA 4OQLA 3VR3A 4ESHA 4FB4A 1U8EA 1XIVA 5K0NA 5KWJA 3HTXA 3MD9A 2WB4A 1X80A 2OG2A 3EIXA 3HSYA 4WE3A 2J3JA 3TLGA 1RKBA 4PLPA 4UFNA 1TM3E 5BURA 1EVIA 4O29A 4Z53A 3IP7A 4QHTA 2WIBA 3HE3A 3KBBA 4QUKA 2ZSKA 4CUZA 4DG9A 2F1JA 5DTIA 1EVQA 1BYUA 3W2IA 4K6KA 5FBKA 3UA4A 1DQRA 1Z0AA 4P7JA 5EWMA 2VKTA 4ZIRA 3GD7A 4DB2A 2A9VA 1BNCA 1NVEA 1XZPA 2DQZA 3W9YA 3CCCA 3HXMA 3OOEA 1EFAA 1W48A 1ESCA 1M6VB 1QHFA 1QGDA 2PGJA 2AFHA 1A2QA 2ZU6A 2Y1WA 5FQOA 5A4JA 5CDSA 1IONA 4YXFA 4NU0A 2OXFA 3DOUA 5KNCA 3PFWO 3T3NA 2TMKA 3P9NA 2M6RA 1NT4A 3GPDG 3EIOA 3VKHA 1NFRA 4K2AA 4KGZA 3AR8A 4UJ3A 1E64A 4B7XA 3DMRA 1NG1A 4OSEA 4ECEA 2JLUA 4H59A 3PCRB 1FDIA 2IOFA 2ODBA 4HAVA 5ETJA 3EEOA 3AL3A 4D4KA 2HU7A 2NOAA 4ZO9A 1LBIA 3FFAA 5K8JB 2G6BA 2NGRA 4Q00A 3Q7RA 5AOAA 3IDZA 3KSAC 1P0QA 5AESA 5ICCA 4N6GA 1YB4A 2FUCA 2F00A 2CFRA 3SHFA 4H3VA 2PD4A 3U3XA 5B7PA 4ZA2A 4W9NC 3AC0A 2QAGB 2XCOA 4GQAA 5J5VA 4K87A 5JXWA 5LQUA 1K7XB 4LJKA 2J5RA 3HY4A 3TLCA 1E32A 4Z9AA 3UW1A 1Z16A 3W06A 2PZFA 1CULC 4BWGA 5I9LA 1SKYE 4I5FA 1YZ3A 4J7UA 2F7SA 3AERB 1W2GA 3C41J 1FXSA 4V0KA 2ALJA 1F12A 4GYJA 4LWOA 3C5EA 3DOFA 3UUGA 1C0PA 4NOKA 5HGJA 5KCMA 2I2XB 3PJRA 1OLUA 1YC5A 4NDNE 2QVZX 3T5CA 3OCJA 2IOQA 1IUOA 3RSQA 4BNJA 4LMAA 2DY1A 3K4PA 1Y6GA 3Q7TA 1P60A 3D4IA 1RRPA 4IHJF 1W5FA 1DDIA 3NRBA 4OBBA 1Y3FE 1S2LA 3LIPA 3C7CB 3MTJA 3HWWA 1M10A 3NBMA 3M49A 3JYPA 4CM9D 3COSA 4JJEA 4PPYA 5K8VA 1GCOA 1LSOA 4RMJA 3WFJA 4X97A 4ZVVA 3WGIA 2H4XA 4KI7A 3CZ4A 4L2IB 1XAHA 2NO5A 2Q7OE 5F3WB 2Y1OA 3FSGD 1NIPA 3EXHA 4ZU6X 2ZYIA 3ZHRA 4L0DA 1GWNA 3FHOA 3L46A 5FUVA 2PKWA 4EENA 1DL5A 1ZIXA 3CX6A 1Y8QA 1M6NA 1ZW1A 3IAAA 3HCAA 3A6KA 3HCOA 1D04A 1Y9DA 3ILXA 3PA6A 2I76A 5G0TA 4I9GA 3BB1A 4UMEA 2FETA 1XT6A 3RJ9A 1EDEA 2IXTA 2PMDA 2E3JA 1QQ6A 4F96A 4ZO6A 5H7XA 1L3CA 4P22A 2WR8A 1YZHA 2DMRA 1HRDA 2DWPA 3LA6A 1PJ3A 3LDAA 2XOXA 3KUCA 3WL3A 2EZ9A 2J9XB 2ZRKA 4B33A 4ZCMA 5JMWA 2O7SA 1EU1A 2JH9A 1NNLA 1RADA 1UMCA 4IQGA 4IX1A 4O1IA 3RIEA 4CQNA 5ALJA 2ZITA 3HKCB 4PC1A 2R1TA 1SVKA 1DARA 2A4MA 3PC6A 3ZYZA 4FWIB 4HG2A 1ZKDA 2Q28A 1H6AA 3EVCA 4RXMA 1O95C 3FCYA 5IARA 4EPVA 3OJOA 2QX4A 3DTVB 2Q4EA 1GGVA 2P2CA 3KSMA 1NT2A 3FTQA 3USCS 1BX1A 4BJHB 4TLMB 1SVUA 2CXPA 1YZGA 3EGXB 1AVTA 1C4WA 1NJ6A 2YS7A 1SD1A 1WVGA 3OIFA 1TK2A 5JLJA 1X74A 1YH3A 4B3RB 1VMDA 1RRGA 5DISB 3ZGYA 2WWYA 2R86A 1NZFA 2P2YA 4AYWA 4IHKA 1DKPA 2ONKA 2P9ZA 2A30A 2WA2A 2QVXX 1F0PA 3BS4A 3KYDA 4CTNA 1SIBE 2XGJA 1J1IA 3BF7A 5AJTA 2V7UA 4DV6B 1H4SA 1M2VA 2SHKA 2OILA 4WFQA 1E2EA 3BGOS 1UEIA 4IZIA 5JMPA 4ENTA 2AFHB 5JBQA 4KEAA 4HQNA 4PLZA 2Y66A 1TIPA 2IIVA 1LLCA 2LKCA 3I9V6 4LN1A 3ROFA 4RO0A 4BLVA 2BH9A 3L6UA 2ZUWA 4R1OA 4MZXA 2OQIA 3DZ8A 1OXBB 1U99A 3GEIA 1WKCA 2QY6A 1QIMA 3EAQA 1GPDG 1PDWA 2DM6A 2AG8A 3M3PA 1FTQA 3KE9A 5AIAA 4MDFA 1LQUA 3KEGA 1LFAA 4Z0NA 1R74A 1UWVA 2VL7A 3V4ZA 1DTEA 5KQMA 3VNQA 1KU6A 2JHAA 4HDSB 3TQCA 5A1TA 3TWOA 2OR3A 2MSCB 4WZ6A 1RXWA 1OWPA 3PC2A 3QK7A 1PGNA 1XYGA 3GMTA 4NCAA 3JASB 1GAJA 1RQNA 3LRTA 4LJ6A 1I0ZA 2VPQA 1NNSA 4YCBA 5EL0A 5FLXA 4G8JA 1K8ZB 1ZK2A 5I8ZA 2H4JA 1KJ9A 1UMDB 3AP2A 3IUMA 4JVLA 3FMIA 4BE4A 3LGXA 1QP4A 1Z6QA 1W49A 3S8MA 3W3AD 1SJ9A 1C2TA 1KQOA 1MOSA 1M1YA 5LDGA 4X62B 1P61B 1SZPA 5EXTA 2R79A 5AK0A 2GSWA 3B7WA 2GNPA 2HEGA 4JT9A 5HBRA 5CA1A 5DHPA 1SHUX 4R98A 3ZY6A 3TAUA 1QGAA 2XCSB 1R3DA 5GIPE 3ES9A 1PLLA 4H9GA 4HSEA 4HUQB 4KMRA 4OREX 4D99A 5BVHA 5EEGA 4D42A 4U63A 3R7BA 3ZLJA 3HXKA 2HXYA 1ISGA 5DB4A 3MMZA 2MWMA 1XF1A 5EINA 1W4LA 2X7HA 4TV9B 2IE8A 4JLMA 3OO0A 2PO7A 3DGEC 3M6IA 3G9ZA 1R00A 3MTBA 4XQ9A 7ADHA 1GM5A 2D1SA 3ZDYB 4DVGA 3IJEB 3KJXA 4YTEA 4OMDA 5DCUA 3AR6A 4YP6A 3X1YA 3CVXA 2CE2X 2JGRA 2B2NA 4L3WA 2VEDA 5T4HA 1RLIA 3SSNA 4H7FA 1GNPA 3W5HA 2AN9A 3F5DA 1CLEA 4URXR 2IE0A 3H99A 3W5DA 1IOLA 3A28A 4B6EA 5BSHA 5K6TA 3WGUA 2ISSD 2RE8A 2YDYA 3PT9A 4RNDB 3TUIC 4NMHA 2QTFA 2WMYA 1XHFA 2Q8PA 4JWKA 4EVSA 4B84A 2R7AA 3HJNA 3Q88A 3VTZA 1MEEA 3VAZA 3T3HA 1TADA 1E6KA 3U7HB 4FCWA 4RKRA 4G01B 4WNAA 5AKIA 1WM1A 1F4PA 2B9EA 4WVLA 1IN7A 2ZYDA 4DLBA 2MR5A 1Z4OA 2JHFA 1JFFB 1NW8A 1Z4IA 2F48A 4LE0A 4RORA 4RZQA 5EXDA 4LF8B 4IGIA 2W2NA 4RPIA 2BZGA 1SH7A 3MILA 3HV0A 1HLFA 3I53A 4BVFA 1OH6A 4C7JA 4N0DA 1V25A 1ZMTA 1K68A 3BB4A 4XX0A 3EPHA 3AI3A 3ABRB 5SZHB 1QO9A 2XQVA 3KB1A 4B46A 3VVBA 1BVUA 3CVJA 3BXEA 4JEMA 1OB5A 4CMEC 4Y2HA 1QB7A 1VLLA 1XU9A 4LQ4A 2WM2A 2POCA 4MEJA 2HCTA 4LQDA 4PRZA 2HMVA 2HO5A 4MO9A 3ISTA 3QE2A 4C4PA 5BRJA 4DR5B 2NO6A 1NRIA 3UMRA 2JHCA 3L06A 4CCYB 1KI8A 1SMKA 3CNQS 3OEED 3WSVA 4KOAA 4BU1A 4D43A 2FSGA 2L69A 3IUEA 5AO9A 4MJLA 4ZVLA 2AR9A 1FLNA 1E7WA 2H65A 4IZHA 3WQQA 4X66B 2OHHA 4WBXC 3GGJA 1KC1A 1Z83A 3N2EA 3O9MA 3IUSA 1BVYF 1SQ0A 1E61A 2R5FA 3QX7A 4N5MA 4WH0A 4YVFA 3LHFA 3OF3A 1M1YE 3I5AA 1UBHS 3OOHA 3KXKA 4TMXA 4UDNA 1I4WA 2GT1A 4PYQA 3ZWWA 5HZMA 2OZKA 1DADA 3B13B 1JEOA 5C1PA 4DMHA 4U7DA 3TUZC 1T9CA 3K1ZA 1GSIA 2DJIA 2REXB 3LHDA 3QVGB 1XZMA 1N5RA 4E0BA 2ECQA 3UMJA 5FWXA 1NPTO 4LYFA 5IT0A 3AI7A 3LWBA 1KFJB 4DAEA 5JQWA 1PGJA 4FYXA 1PE0A 2VDNB 4P54A 1EYZA 4EJSC 2DH6A 1IZ8A 1NR5A 3F90A 4UZFA 4MQBA 1MNQA 3TIVA 4F4UA 2HM7A 5YASA 3OZVA 1SVSA 1VECA 2PH7A 2XGOA 1WW3A 4GGMX 4ZC1A 5ICSA 1TRHA 1MO2A 3UB4A 3ZCXA 2C84A 1JXMA 1OREA 2GGSA 3LY9A 3O0DA 3PGVA 4ZRMA 4C5BA 1V4NA 3N6VA 2WJ6A 2QN7A 3BF8A 2EJTA 3CHYA 4HLQB 4REQB 3VUFA 1LJLA 4YPVA 4OBEA 1L8AA 3ETDA 1U0TA 3O9VA 3FYUA 1XTZA 2Y3IA 1LPAB 1D4OA 2Y6VA 2O05A 4K81B 4II3A 1PD0A 2NWQA 5G1NA 5LUBA 5HYVA 1WA5A 1JIIA 2WUVA 3CYFA 3QE3A 1N1GA 4AMZA 5L6MB 1D07A 2WTAA 2AI1A 5EFZA 2ZJ8A 4P6VF 3HS3A 3UB3A 1BH2A 1VJCA 4M99A 4DLTA 5C1BA 1V5WA 3PZBA 1BKYA 2DGDA 2QHXA 3DSRA 3U49A 5C4MA 4ND3A 5FPQA 1R6AA 2YYYA 1DC6A 2EBUA 1K5DA 2V59A 4RPLA 2F4VB 1Y82A 2WJ4A 2OYCA 4HR7A 2P0AA 5A4IS 4S0ZA 4FR5A 5FNVB 1A9ZA 1M8GA 2E7ZA 5FAXA 2BFEA 4DJDC 4EPYA 1JFRA 2JI9A 2EQBA 2IYZA 5AVKA 1T8RA 2QJRA 3H0KA 4D6YA 1FDRA 2R2GA 3AKYA 3EAGA 3OLYA 4RK1A 3Q6NA 2VRCA 5BV7A 1E6LA 4MR7A 4ZEMA 4I50F 1N6LA 2AH5A 4FYIA 2EDCA 3BBPA 4LFBB 2E37A 2DG2A 3JR3A 3FVWA 1D0VA 1J7JA 1XKQA 1N9GA 2Y77A 3I6BA 3NG1A 4B6FA 2J6HA 1KK3A 4MUKA 3VPSA 4EKGA 3FNFA 1JDVA 4OSOA 2ZYRA 1XMQB 4O8ZA 5BUCA 2I67A 3B60A 3NYQA 3FZGA 3LC2O 2VJKA 1A4RA 3N8NA 4WQMA 3PNVA 4UNNA 3H1AA 1JR2A 3BK1A 3C4VA 4D7AA 4DDMA 3FCCA 1DBWA 4C7OB 3C7KA 4TZKA 3NDPA 5B57C 3FPAA 2P9HA 3B9BA 4ZEOA 2XNJA 3MTIA 2WHXA 3O8QB 2DSNA 2B1RA 2TMYA 3D0OA 3DNPA 3FWPA 4YJHA 4DQLA 1BS1A 2RAUA 5AW3A 1BD4A 1LVHA 2IYFA 2JVIA 4X3PA 4A3SA 2QNBA 2XR1A 4B8ZA 1KVTA 2FSIA 3NYRA 3M89A 1JHDA 1QU2A 1FVOA 1N7GA 3FJOA 3JQAA 4D8VA 3D5QA 2ZUFA 2HRZA 5GONF 3P0FA 1CQWA 1P2FA 2JD2A 2WE8A 2YRWA 3GNSA 3OE5A 3WNCA 2YNMD 4WK4B 5TS2A 4M86A 4XFDA 1CETA 4X85A 3ZHUA 4GM0A 3HA5A 1XXHE 3R5FA 4XCQA 4AYXA 4QDKA 3GJ4A 2P8JA 3I1YA 2IZOA 1Z5ZA 4NBUA 5L51A 1UPFA 4X5OA 2XITA 1WUHS 2VP6A 5TT1A 2IPOA 1C3LA 2NO0A 3EMVA 4DLNA 1E5LA 3F7TA 3WQHA 1DQYA 3PNMA 1CY6A 4KWCA 3LHKA 1O58A 3SZ3A 3FVQA 1ZNQO 4KWEA 3LQYA 2YBDA 3GROA 1KMHB 5KYTA 4FD3A 4TXHA 3HCCA 4NS4A 1Z0KA 1VJDA 3X2EA 4PS1A 4WIAA 1FBTA 4YLGA 3ZU5A 3BJRA 4D80A 2P2ZA 1OZHA 2YIDA 3A1NA 4MPPA 5JR3A 1XGKA 1QG6A 3EF0A 3LQ4A 4YYEA 2X1HA 3RBVA 4CL0A 1QRUA 2XJ9A 1XXHA 2VZ8A 3B53X 3ROKA 4LKRA 3EJ6A 4G8BA 1A1SA 1WMFA 5T6MA 2Q6KA 3L92A 3RUAA 3NOXA 3ORRA 4NE9A 1PZFA 4ER3A 1BE1A 3BHNA 3RSSA 2XNHA 3ZK9A 1E6UA 2WSSA 1JAYA 3RR2A 4OQ4A 5I8PA 5JAOA 5EIHA 3ZWDA 2JIRA 1LI7A 3A9CA 1V45E 4L7QA 4R2JA 3V8PA 1NUHA 1Z22A 1B43A 3FDZB 1MDBA 3LXMA 2R8OA 3V4RA 1IZYA 1K4YA 2JKVA 2IDZA 5DM0A 5TVGA 2QVYX 1U5BB 4AWBA 3TXYA 1PDVA 1AO0A 2AIRA 3N2KB 4IGEA 4CXMA 4E5DA 2I6SA 2I6TA 3OJCA 3PX3A 4WJLA 5A02A 1YD7A 1O6CA 2ORWA 1A9SA 2PUTA 3GZTB 1YTUA 1MT3A 2YINC 5T57A 3TOVA 4HGQA 4DIBA 1N0VC 1CHNA 3P9IA 1U3WA 1JBKA 3MC1A 4MINA 1PQYA 2BM8A 2AOTA 2YASA 3GRPA 4JR0A 4MQFA 3LVRE 5CJPA 4C2AA 2I22A 1P0PA 5AW1A 1D4ZA 1VZ3A 4ERXA 4P34A 2O2SA 2AJ8A 4IFEA 2JRCA 4Y6SA 1FFBA 2OBMA 4N12A 1U3CA 4RQAA 2A8YA 4WESB 1KMNA 3PQ5A 4LECA 2C97A 4KIGA 1X8XA 1E2UA 1NKSA 4WA7A 3TGWA 1YOVA 1L8QA 3K72B 4XPIA 1NXPA 1OPRA 1PBNA 1UT8A 2FRXA 3P9RA 4FFOA 4JROA 4KNWA 1CBUA 3ZU6A 5BWMA 1L5OA 2XUQA 2ECPA 2AJLI 4CT0A 2CK3A 1DKNA 2OCGA 3ELUA 4I9UA 3BE6A 4K28A 1C7IA 3CG0A 3KE8A 4N5HX 5KNCH 5FUMA 5TARA 1CQIA 2VDWB 2GNOA 3GJ5A 4OVKA 5TPZD 3DAHA 3E9CA 2QPTA 1Z2OX 4CV0A 1IAQA 3S5UA 3VTAA 4E5MA 3CA8A 2G1AA 4AJHA 1UJ5A 3NGLA 3EMDA 1LGYA 1FZQA 2UAGA 1JLRA 2HHLA 4HNQA 4R7GA 1QQAA 3DL7A 4UCXA 3QU7A 2BGGA 4OL9A 1JB1A 1GNQA 4B7CA 5EAIA 2LP4Y 2ENUA 4NAUA 5CLQA 5AM2A 2ZUDA 1QF7A 3MK31 5SY6A 1C0IA 1NU8A 2W6MA 4RA6A 3R8CA 3WO0A 4KITB 5IJWA 4CM4B 4R9VA 3VX4A 4YRFA 5FBQB 1AZWA 3AR4A 5F77A 3N2ZB 5HNKA 5EUBA 4D9MA 3I28A 3R3JA 3AYXB 4IHJA 4PX3A 1ZM7A 2GZ2A 3D54D 4BFSA 1MQAA 2YYAA 4Y2GA 1HR0B 3AY3A 2P35A 1Z34A 1XAJA 3PYMA 2P6PA 2HNBA 3HDHA 4KQWA 4RKQA 2DT8A 2GTIA 3KZVA 2H5IA 3UOGA 3CEPB 1SIUA 4L72A 5T3UA 3RABA 3T9BA 3U13A 2PHZA 2O8EA 5EQDA 3SHWA 5G0WA 3NFYA 1ISMA 2CDBA 3ZHCA 2FN9A 4Z51A 4KZKA 1CUVA 8ADHA 1CY8A 1PTJA 1ODCA 4FP9A 2I3BA 1IXRC 4GPZA 1AKTA 1E3TA 3H1PA 2QRNA 3B1WA 2RHRA 5KQLA 1E3DA 2J45A 3LAWA 4Q4JA 1AV6A 1ES9A 4H6WA 3X1ZA 3GRYA 1NW9B 1WB9A 3H19A 4D82A 2DC1A 2GRUA 4D3XA 5G3YA 5KOJB 1D1SA 1VLHA 1OC2A 1K0UA 3JW8A 1QGED 4QVGA 3V6LA 1GYPA 1MW9X 4YQEA 3LOQA 3VR0A 3U5ZB 1Z56C 2ETXA 1SUDA 1IB6A 3PX7A 1VBMA 5A3SA 4FNOA 1GQRA 3D1VA 4GRDA 1L7PA 3IVMA 3ENKA 2QYTA 4B43A 3M4ZA 3QX9A 4NX2A 4TXNA 2IPAB 1GKIA 4YQZA 4CV3A 4N0MA 1QCYA 1SNYA 3PQEA 3CT6A 3LCCA 3M8KA 1XJ5A 5L40A 1X7ZB 1YXMA 1TA0A 1JF8A 4ZU1X 3DMDA 1GL7A 1ORIA 1QV6A 2A5JA 4L74A 4OHCA 1E3EA 1E2HA 1PFGA 3FHLA 4TOIA 4RSRA 5LBUA 4C7VA 1X7WB 1QGYA 4DJTA 5CFNA 2VHVA 3FPFA 2YH2A 1WR8A 4NH4A 3ZZMA 4F3CA 2D8MA 4FHCA 1A9XB 1SHJA 3TTSA 3UQZA 5AICA 1PSZA 4RIGA 1KZGB 3D3NA 4C0JA 4YMTA 2LUOA 2PLFA 3DR5A 5E6UA 3KKOA 3WK5A 3GC6A 2INGX 4RZ2A 1WZNA 3LG2A 7REQB 3Q3CA 5C2JB 2VHJA 1TPZA 1YRAA 1VBFA 4G5RA 1J2TA 2WYWA 4LBVA 4RS3A 4B6GA 1ZUWA 1LA2A 3A3KA 4HN9A 4V0OA 3NCHA 1VPLA 4HN4B 4WW0A 4H27A 1MIHA 3ED1A 3HZRA 2HU2A 5E1BA 1WSAA 3H16A 4WCFC 1Z82A 5DSTA 3GCGA 2VS1A 3AUSA 2ISQA 1G21E 3RC3A 4EIWA 3N76A 2RK6A 3NOQA 5CNJA 3OLWA 1JSCA 4PXAA 1NSFA 1P9OA 1RNLA 3LWNA 1EEXB 2ZE6A 1BW9B 3M6FA 2VF7A 3TD2A 4OHPA 1QRAA 2EKLA 3FPBA 1TF2A 3CRZA 3L1UA 3NWBA 1QBKC 1CJVC 1U9JA 4M8IA 5DTMA 2UV8A 3OX2A 1QRRA 5ADWA 1U3VA 5A5VA 4RCYA 3ZV7A 4N76A 3C7TA 3L6CA 4PG7A 3NM4A 4NZPA 4KX5A 1M0SA 4MEBA 5KOJA 4IJVA 1E9EA 3QZUA 1KGSA 3DJYA 3WB0A 5KQRA 4WHMA 1JWBB 1EFUA 1Q1EA 2MSEB 3LUPA 4RYDA 1HT2E 2BIFA 5IDYA 3LWZA 3IQWA 3TBFA 3MJFA 4FGZA 4JLUA 4PVDA 4GUAA 4IYJA 3B5IA 3QU4A 4GC9A 2FVYA 2PNJA 1BWPA 1YB1A 3QVSA 2CLLB 1KTIA 1T8SA 3WLPA 3LYUA 5JDIA 3JVUA 1O95D 4X65B 5AXBA 1PYGA 4OJYA 2JLRA 1DJNA 5KQPA 1XMIA 1FNCA 1D0IA 5DPMA 1OX6A 1TYBE 4BNHA 1TT7A 2JJ1A 4CCWA 2ROQA 2Q4BA 1NASA 1JHPA 1QX3A 4MKXA 5KDLA 4YV2A 2AVNA 5E1MA 5C4GB 1QORA 2EQAA 1H3FA 3HVJA 1P18A 4FR2A 5DSZA 2CGEA 2JCVA 1UWCA 1GJRA 3MQFA 3PNYA 3RO7A 5F5NA 1RYHA 1MP0A 1S8NA 2AMVA 3RQIA 1E9BA 4TKMA 3V4LA 3S81A 1IY1A 3VR3D 3D4BA 4UUQA 5KOYA 2FX3A 3CISA 1Y6QA 2RCYA 3TX2A 4F2HA 1N25A 4AC9A 1ABEA 4TXJA 4CGZA 1XDWA 3AF6A 3ANXA 3R0XA 2WVHA 4DCJA 4WKGA 1SRQA 2VC2B 4KBFA 2HA4A 3ICPA 1F1BA 2RKWA 4P80A 1NBWB 4ND1A 4PSVA 1IJKA 4PTYA 3TSWA 1AKWA 3DD1A 3V00A 5IUNC 1LK5A 1LWOA 2C5SA 4MQ5A 2AG6A 2CWDA 2IHYA 2PS0A 3QKIA 2HQ1A 3ZXYA 3UV3A 4F1WA 1P6UA 1QP7A 1AHHA 5EJ7A 4K1LA 5FR1A 5IN5A 3NC1C 2GD1O 2GXSA 1SFRA 2JHPA 3IKTA 4DUPA 2PZKA 1KAHA 2XECA 2XUAA 2ZCVA 3ZKWA 1CZUA 5MFPA 1FTYA 2PS9A 4ZWNA 3T7EA 1SHTX 3MIZA 2B1GA 2ZTMA 2H5LA 4DREA 5HOQA 1KOFA 1U94A 4AZWA 2XKJE 1Z73A 1M5TA 2Q5OA 4FZVA 2IYOA 2CBXA 4F4FA 2AOWA 1SBNE 2YHIB 3H0CA 2QTWB 3F74A 3R3XA 5L7YA 1OIVA 1PLJA 4UEOA 3UWOA 2GM5A 1J8FA 4IQ0A 4PNHA 5KJEA 1TZ2A 4QU0A 5TGDA 5DN6D 5LQMA 3IQGX 2O0JA 1DG9A 1LLUA 1P62B 2A1IA 4HGYA 4X41A 2F43B 1E9VA 1MO6A 3MRXA 4O4LA 5COBA 1FP6A 5T4BA 3QPCA 4BB5A 2GZRA 5IWAB 2Q1TA 3PHCA 3I01A 2I4IA 5A7HA 4ZHQF 2IEIA 1L7RA 1T9HA 4AP9A 4CBVA 1C4OA 2R00A 3LW7A 4RVHA 2WIGA 2OMKA 2P0YA 1CX9B 1RHJA 2DBZA 3TGLA 3SICE 2GBFA 2LNDA 3DE2X 3OD5A 2QBYA 1WULS 2XHZA 4EHDA 5J1TB 1GKYA 3F46A 3CKLA 4B44A 2BMAA 1KI7A 3TJZA 1RFLA 1WBBA 2NZUG 3ENZA 5BV0A 2Y9MB 3U4HA 3K96A 3NVMB 3GJTA 1KFKB 3V8QA 3B2QA 4HB2A 3WFIA 1WPXA 3DOCA 4FN4A 1X1EA 4L76A 4R2XA 5IASA 3AZQA 1EK0A 4MQ4A 1S3FA 3UXHA 1FQWA 3U7QA 1FUUA 2FEAA 1L9KA 1SXHA 3D2BA 3CKKA 6ABPA 2IDJA 1MQ8B 2ZJFA 1FLAA 4YT8A 1N32B 3PWSA 2ONJA 1BTOA 2NU7B 5A1JA 5JMOA 5A7GA 2J3HA 2PJRA 2Z1NA 4IHQA 3ZD8A 5U9CA 3I9FA 1Z6YA 4DTIA 2I29A 1T10A 2LIPA 3PDCA 4I4LA 3Q8XB 3NKLA 1BX3A 1SBCA 3BBLA 1BGVA 1C1DB 4W99A 5HUQA 2CJWA 2AFVA 2B3DA 2MYTA 1KU0A 3DZKA 4LRQA 5IF3A 4DA6A 1TMGE 2O20A 2XWSA 2K2WA 3DL2A 3O1LA 3R0VA 2L0XA 4MVJP 2B8WA 1HE4A 3GCZA 4X64B 3D2AA 5EKDA 1TE2A 4FWBA 3MLAA 4KN5A 4CLDA 1V8FA 3TSZA 5JSQA 2ZTUA 4UHFA 3WIEA 3OPYB 1T1EA 2H4ZA 4RD4A 1J07A 1TCAA 2YRXA 1QDLB 3IE2A 4BFVA 4E1AA 4B4DA 4OTZA 3WIOA 3DZJA 4P3NA 3Q9NA 4CZ2A 3GUYA 2C5GA 3UUEA 4TQUS 1DO0A 3P32A 3DR3A 3E70C 4MYSA 2GAAA 2HUNA 2XVZA 1RWNA 1M0TA 4B3FX 2FQQA 1O77A 2VXOA 2CMKA 3QVUA 5LYYA 4X8MA 3ABSB 4KFCA 3PXUA 1ZXLA 4TS4A 2Y1FA 1P4GA 4R5HA 4XWTA 1Z33A 3MN1A 4ILEA 1BOOA 1MVLA 2RK4A 4D8XA 2X3YA 3DW1X 5CTJA 4DADA 3LUBA 5GZ1A 3WBBA 5M29A 2AG5A 1UK8A 2QD2A 3PE4A 1XZIA 3H9CA 4GLJA 4BE9A 5A5FA 5JALA 3SF0A 5FWNA 3PF8A 2CC2A 1JIKA 2BMJA 3CZMA 3DXFA 3E84A 3OZRA 2C1XA 1KGDA 3HBLA 5BN3B 2RIRA 2YCLA 3ELWA 1PJAA 3S7ZA 4E6PA 5HRCA 4BVLA 1IBMB 3PWKA 4QM7A 1Q5PA 4L4YA 3SZUA 3MUEA 3U2QA 4F0JA 2ARKA 1XALA 1T5TA 3Q0EA 1VFNA 3LUFA 4XKJA 3SR0A 3V48A 1YQTA 1HV8A 2NZVG 3VJKA 5A6SA 4TLAA 3SGLA 1GZ5A 4G1UC 2HAEA 5IBPA 4CM5A 4E22A 3JQAD 5ULLA 1U98A 1P31A 2JZCA 1Z18A 3LT1A 4EFLA 3LTEA 3PGLA 4E12A 3BAFA 2QN9A 4PCAA 3UJBA 2Q99A 2JLCA 4P0PB 4BQQA 1EGMB 1SC9A 3WDSA 3ONDA 1UKEA 5B58C 4FCTA 3R7WA 3LRXA 3QWHA 2O52A 2FW9A 1G18A 4JYBA 4Q18A 2A1UB 5DNCA 4IEEA 1W1UA 1MFPA 2BR5A 2EYQA 2ZREA 4LHSA 4G0OA 4ITUA 1G98A 2OV3A 4P7KA 3GFVA 4Z9YA 3TE7A 1YQD