2QXUA

Crystal structure analysis of the bacillus subtilis lipase crystallized at ph 5.0
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipase
publication title Structural basis for the remarkable stability of Bacillus subtilis lipase (Lip A) at low pH
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 65
structure length 179
sequence length 179
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qxuA00
3HC7A 1VA5A 4K6HA 1I6WA 2PPLA 3QITA 2V97A 5FV4A 5JD4A 4B6GA 1YB7A 1GZ7A 2PBLA 1W52X 1CRLA 1VA4A 2XUHA 5AHXA 1H2XA 1ZGCA 4UHCA 2JGFA 2O2HA 2YYSA 1CUZA 1UZAA 1E8NA 1ORWA 4J0JA 4KE6A 5ALJA 1YAJA 4X92A 3ESDA 1W6RA 4J0HA 1QZ3A 3FBWA 4CCYB 1QIIA 5HFAA 1HL7A 2QRUA 3WL5A 2OCLA 2XMCA 3FCYA 3QVMA 4C4XA 1CFJA 3CCBA 1OCEA 2CMFA 1CUJA 3SC2A 4FBMA 3QM1A 1GKLA 3BJMA 2DSNA 1D07A 4B81A 1XZAA 2OCKA 2QT9A 5HF9A 4ZV7A 1ZJ5A 1AGYA 5AK3A 3SK0A 3MVEA 3D3NA 4EY8A 3W04A 1LGYA 4B0OA 5FP0A 2AJBA 3KDAA 4QZVA 1N8SA 1CEXA 1LZLA 4AN0A 1FJ2A 5ALDA 2B9VA 1K4YA 1TIBA 4L0CA 2QJRA 2PVSA 2XUOA 5SYMA 4DLNA 1R88A 5AH0A 3H2GA 2HA7A 3QMVA 4WY5A 1IMJA 1JMKC 1DWQA 5ALQA 1MJ5A 2ROQA 2CBGA 3R0VA 3O4IA 2WUEA 1UT6A 5CT8A 1BEZA 4N8SA 2Z8XA 4C4YA 3C8HA 1MNAA 2HFJA 1XLWA 4JH0A 2HA0A 1QGED 3KSRA 3A70A 3D5EA 2RIPA 1L7RA 4N8EA 4MQLA 3N2ZB 4G8CA 4G8DA 4BAGA 3GUUA 4KJXA 4Q34A 3CN9A 5HKBA 1L7AA 2HIHA 4ARBA 3M83A 4C4ZA 3WLAA 4A5SA 3BF8A 4KE7A 3AIOA 1XKTA 4W1QA 5A71A 2RHTA 2OGZA 5CXXA 4LXGA 3F9CA 2WSLA 1VLQA 4GDMA 5ALVA 1K63A 3GA7A 1GPLA 4PSUA 2CB9A 4H7EA 5EGNA 3WWDA 3G9XA 4QDZA 2WIKA 5FUMA 4PO3X 2HADA 2V98A 5ALRA 4GW3A 4UBJA 4WFIA 5JADA 2HM7A 1ZI8A 5D6OA 3WIBA 4HZGA 3R3WA 5AOAA 5J3JA 2Y6VA 2BKLA 3NWOA 3QH4A 2XLCA 5IVDA 5AI4A 4V2IA 3C43A 4J0IA 3P2MA 1DQYA 4BP8A 4BRZA 1R1DA 1WHSA 1CUAA 3PUHA 4EB0A 2GZRA 3R3UA 4JYMA 4BDSA 3D0KA 2ZYRA 4Y2UA 5ALIA 4J0KA 2YH2A 4LXHA 3H2IA 1E66A 5DLPA 3G0DA 1JU3A 1WB6A 2XUAA 2PSJA 2GBFA 4QNNA 4P92A 1TKRA 1XQYA 4MEBA 3LIPA 4M0EA 2WTNA 1VOTA 1F0PA 4C89A 1UFOA 3O4JA 4OSEA 4IH4A 4N8DA 2PSHA 2RHWA 5A2GA 1BN7A 1ZD4A 4BAZA 5BV7A 5JAUA 3FYUC 1ETHA 2LIPA 5KWJA 2J3DA 4BZZA 5CT6A 1WPRA 3LP5A 5HF5A 4ZI5A 2G5PA 3D2CA 3DQZA 3WK4A 3K9BA 2WIDA 2XUQA 2VAXA 3RARA 4EHBA 1XKLA 1UXOA 3O4GA 3G0GA 2B61A 4UFNA 3M81A 4FBLA 2XT0A 3PDCA 2H7YA 1GKKA 5FPQA 5AM4A 1ZD2P 3G9UA 3HEAA 5ESRA 1DT5A 1W4LA 1A88A 2C0QA 4UUQA 3R3XA 3IURA 4BZWA 3FCXA 3YASA 1KU6A 2I3ZA 4CI9A 3X3HA 4QE3A 5KWIA 3SWWA 1CLEA 1AX9A 4UBIA 4WY8A 5LZ9A 2BGNA 1UKAA 5E4TA 5DYTA 3NGMA 4Q3LA 2Y1KA 1BCSA 1VZ3A 4EY4A 1RYYA 3WJ1A 5EIAA 2W6CX 4DIUA 3FAKA 1N5RA 4FMPA 3DCNA 4FFWA 4IQ4A 3G0IA 5HQ3A 4KEAA 3R3YA 1AMNA 5CW2A 2ACEA 4HXGA 5HCUA 4L72A 3QMWA 1O6GA 3H1AA 4WDRA 2XUJA 3DYVA 5K3EA 4M0MA 4WDQA 1EB8A 1UK7A 4Y2JA 1DX4A 2BUBA 1UOQA 2FJPA 1LPOA 4J0CA 1JU4A 1GPKA 1QO9A 3MGAA 2BGRA 5AKJA 4GBGA 3E4DA 1P0PA 2HU8A 2XQJA 3FLAA 4ZV9A 4AZ0A 4AMZA 5CH3A 4TPKA 2QM0A 1AQLA 3HABA 3I2GA 3CN7A 2WG2A 2XUFA 2ZYHA 3D2AA 4CG3A 1BEEA 4FHZA 1XRNA 4H7IA 4AXBA 1F6WA 2PU7A 5JD5A 2GYUA 5ALNA 4RE5A 5DNUA 3IUNA 4K6GA 1EI9A 3AUKA 1THGA 1XZJA 2VATA 3W9BA 1XZIA 2UZ0A 3I6MA 3WK7A 1A8UA 4GEGA 5AKLA 2ZJFA 2FUKA 4B7ZA 5JANA 4Y2XA 1IUNA 5EHXA 1E8MA 2V9ZA 3K6KA 4QA9A 1MNQA 1CQZA 2OPHA 1XLUA 4E14A 2WTMA 1DTEA 3M82A 5AO9A 4BE9A 3I28A 4QWMA 5SYNA 3F97A 5E4JA 2K2QB 1ODTC 1WB4A 1R9MA 1NU6A 1ZI6A 4QDXA 2WG1A 1QIDA 1C7JA 3WA6A 1TCAA 1LPPA 1T4MA 4HXFB 5LIPA 1MX9A 3BWXA 3G9TA 1S8OA 3I1YA 3MUNA 4U2FA 1W1IA 4L9AA 1J1IA 1UKCA 2EEPA 1MN6A 2GYWA 5ALEA 1WOMA 3PI6A 1Q0RA 2PSFA 5K3FB 4QDTA 1ACLA 1Q84A 2H7CA 2PKYX 5JASA 1Y7IA 2X76A 3AIKA 4PV7A 5ALZA 3OURA 2WIFA 2WIGA 5DNVA 3AJAA 3UMJA 4X6UA 5KBYA 2QKYA 4IH9A 1EVQA 1UK8A 2GZSA 4HVTA 1HQDA 4OB7A 3S8YA 3PFCA 1M33A 3NUZA 5EHQA 3UUFA 3FWHA 2WHRA 1QE3A 1AUOA 1RP1A 4WFKA 5K5EA 1UOPA 4H7HA 4C01A 4G9EA 3VKFA 3VVMA 1P0MA 3ZPXA 2H1IA 1QJ4A 4BB0A 2OGSA 4J3JA 3RLIA 2H9YA 1QIGA 1Y7HA 2XE4A 5YASA 4X6YA 3VISA 2XDWA 1A8QA 4Q05A 3AZQA 4XX1A 1EB9A 4FNMA 3G0BA 4DNOA 5AI0A 1QFSA 1QOZA 3ESCA 1QLWA 1QO7A 3S2ZA 1E89A 4OYLA 4FTWA 1Q0ZA 3TRDA 3M3DA 1CUWA 4BTLA 4HAIA 3TEJA 5HQ3B 1QFMA 2WM2A 5CT4A 2DCMA 3DOHA 1ZOIA 5A7HA 2GYVA 2OG1A 1EH5A 4W63A 4YPVA 4AO8A 4KACA 3DLTA 2DR0A 5DYWA 4UBMA 5KREA 3C6BA 3SX4A 4M0FA 1LPMA 4MWTA 3EIOA 4OB8A 4BVJA 2ZVDA 5CH5A 2R8BA 2IIVA 3O0DA 2C58A 5LZ8A 3FLBA 4I19A 5DYYA 4A16A 2XUDA 2CZQA 2G5TA 1CUEA 4ZXFA 4G5XA 4DNFA 4X95A 3WK8A 1CUIA 2GBGA 3LCRA 3H1BA 5AM5A 2QS9A 3C87A 1H2YA 4Y2QA 3WWEA 3BIXA 5BOVA 2PM8A 3I2HA 3O4HA 4KE8A 4BE4A 5ALMA 1B6GA 4U2GA 3ILSA 1JJFA 5LKAA 4Q3OA 3IVMA 4GI1A 1YSCA 4X00A 3I2IA 4IHAA 3GZJA 4HXEB 2VT7A 1QTIA 4MYDA 4I4CA 2QZPA 2XMSA 4JEIA 4F60A 2GBIA 1TQHA 5JALA 5I7UA 1YAHA 3K2IA 2XLBA 2XQGA 4JNCA 2I03A 4OUKX 2QOEA 4G4JA 3C6XA 3WJ2A 2VT6A 3A2NA 3HJUA 2Z3WA 1Q83A 3IBTA 5AIAA 3FVTA 1EDDA 1B41A 3EQ9A 1F8UA 1XZKA 4QLAA 5ALFA 4MEAA 1FFEA 4FDMA 4BCCA 3PE6A 1CR6A 1TCCA 3H0CA 3AZOA 3PICA 4FLEA 2Z8ZA 3ICWA 5FKJA 5CT5A 2JBWA 4U2EA 3DL4A 1CUDA 4Q3KA 2HA5A 1JJIA 1MX1A 4MQMA 4EA6A 1MT3A 2DHEA 1XZBA 2YXPX 3AINA 4F21A 1MO2A 2HDWA 5K3AA 4LHEA 4XIIA 1H2ZA 4FOLA 4H7FA 2XMZA 3H17A 5AKZA 4BCDA 3L1JA 3T52A 3IUJA 1E8DA 4OD0A 1MU0A 4DNPA 5ALTA 1VE6A 2X8BA 2BFNA 3DYIA 5IVIA 5T4EA 4QLOA 4X85A 3WWCA 3JYHA 3QYJA 2WJ3A 4OCZA 1MTZA 4YK7A 2WUDA 2C7BA 1CUXA 4DNQA 1CUCA 1CUUA 3IA2A 4A23A 4ZGBA 1SCIA 3W2TA 2WFLA 4AX4A 3C5VA 2IX9A 4FFVA 5CBKA 1GGVA 5ALWA 4PSCA 3D2BA 4BC0A 3BE8A 4KRYA 3ZLUA 4ZWNA 1XFDA 3KXPA 4GXNA 2H7XA 2C0PA 3B3QA 3I2FA 2ORYA 1ZIXA 5AOCA 2XUPA 2QMQA 2ZYSA 4PW0A 3H2HA 3W05A 4LYEA 3PUIA 4G4GA 1P0QA 2RAUA 4DMCA 1XZMA 5A7FA 4N5IX 4RGYA 4AN1A 1K8QA 3FYUB 1ZGBA 5ALGA 5K3FA 2OCIA 4X94A 4D9JA 1U8EA 5AI8A 2HRRA 3OG9A 2ZSHA 2AJ8A 2VTVA 1VJ5A 2VJAA 6YASA 1QIJA 2YASA 4UFOA 2O7RA 3AILA 4C88A 2XUKA 5I8PA 3IB3A 3L1HA 1EA5A 4PSDA 3RM3A 1CUHA 4KR0A 4OB6A 4XVCA 1DWOA 1KU0A 5AKGA 2HHAA 1ZD3A 4XJVA 3CCCA 1CIJA 2E3JA 2JF0A 1CQWA 3BF7A 5EFZA 1R4ZA 3HXKA 3WWOA 1DT3A 2B20A 2JEZA 3WK5A 2DQYA 5AKKA 3LLCA 4H7DA 4UHEA 2XQIA 1IUOA 4BP9A 5DJ5A 2AJDA 2B4KA 5A7GA 4AQDA 1A7UA 1HLGA 1GPNA 5JAHA 1SCQA 4UHBA 3WKEA 1LNSA 4U2DA 3VJKA 2G63A 3IUMA 3H2KA 3E1GA 1EVEA 2AXEA 3HLKA 4P08A 4DGQA 1U65A 5AKYA 5JATA 1TCBA 4HTAA 1YASA 5LZ5A 4Y2RA 2Y2UA 4HRXA 4G8BA 4GHWA 3OPMA 3C6ZA 4DMHA 4BAUA 1CVLA 1YS2X 1JKMA 2C4HA 1J06A 3WWPA 3F67A 3N0TA 4BRSA 2RI6A 1UOOA 5JD6A 2WFMA 3ZLVA 4OU5A 1ZJ4A 1RWQA 3Q8WA 2WFZA 3QMMA 4GLBA 3ZLTA 2CKMA 4UHHA 4BATA 1LBTA 3STUA 2JGJA 3HYSA 2P8SA 5AM3A 1CUFA 5EHZA 4X91A 4H18A 3H18A 1YCDA 4E46A 3DD5A 3L1IA 3D4LA 2EDAA 3WQHA 1EDEA 2GBCA 1UK6A 4B84A 4NS4A 3QPDA 5ALHA 1K6EA 3AZPA 1VKHA 1Y37A 5AI5A 1C7IA 4BCBA 3TJMA 1AZWA 3W9UA 2HFKA 1LPNA 3PFBA 1BCRA 1XZGA 5AM2A 3KOOA 1EXWA 1WCYA 1H2WA 4DTCA 4QDOA 1ISPA 1E3QA 3MUOA 4KAAA 2WLSA 3DS8A 1CUYA 2VJDA 2WFLB 1N5MA 4AB1A 4U2BA 1FFBA 3R3VA 5EHNA 4JYPA 3BJRA 4LIPD 4C6HA 5ALUA 5H3HA 2HA4A 3ANTA 2O2GA 3V48A 3VXKA 3DJYA 3EF3A 4K5QA 1CUSA 2XQKA 5IH7A 3OOSA 4IH1A 3KWJA 2O2IA 4KYVA 3I6YA 4X7BA 1QIHA 1XROA 4Q1VA 4KAJA 3FOBA 2CEKA 4UFPA 4C87A 4DSZA 1ODCA 5AKIA 4B85A 2PL5A 3TGLA 5JARA 4MWSA 5LZ2A 2PUJA 1XRQA 4DMKA 2PSDA 2XB6A 3F98A 1MX5A 4XWGA 4H7JA 4QDUA 2BUCA 4BVLA 5CURA 3EQ8A 1FSSA 1EHYA 1X70A 2QTBA 4X3CA 4LXIA 4J7AA 2OAGA 1R9NA 3A2MA 3GROA 2BCEA 5AP9A 1JT2A 3KD2A 5FRDA 4X71A 5ALKA 4H0CA 3NOXA 4UBNA 4MYSA 3WL7A 1DWPA 4ZRDA 1ORVA 3HSSA 2QVBA 5C81A 2Y6UA 1ZICA 1BE0A 1X2BA 3IUQA 3C6YA 5DNWA 5CXUA 1JMYA 2PU5A 2IITA 4NZZA 4L3WA 3WMRA 3QBJA 1CUBA 3WK9A 2J3QA 1QIEA 2JIDA 1GQRA 1H23A 1NU8A 5K3BA 2DQZA 1AURA 4H35A 3PF9A 3D7RA 1C4XA 4CG2A 1BN6A 1BRTA 3AIMA 2VJCA 5AKXA 4ITVA 5AICA 3FYUA 4BDTA 5ALLA 1QONA 1OILA 4EY5A 2WKWA 3OTQA 1LPAB 2VJBA 1P0IA 1HKHA 4OU4A 1A8SA 3GELA 4UBLA 2WQZA 1SCKA 5E2IA 1XZFA 3FSGA 4ZREA 1G66A 1EX9A 3IULA 2OXEA 1LPSA 3GBSA 1ACJA 1GT6A 1BU8A 3STTA 5K3DA 1PFQA 4RNCA 3STVA 2HU5A 4FWBA 1HDEA 3ESBA 4H7KA 4MXDA 2JGLA 5A62A 5LLSA 3DKKA 5JAOA 4Y9SA 4CIAA 1UWCA 3HZOA 1BS9A 4E15A 3DEAA 4W1PA 2DFPA 5HZGA 5AM0A 3V1LA 4O08A 4AO7A 3I6ZA 4FKBA 3V1NA 1XRMA 3U1TA 4WCVA 2J4CA 1PJAA 3WYDA 1QIKA 2I78A 3E0XA 2XMBA 1N1MA 4CCWA 4OPMA 3JWEA 3BDIA 1FFDA 4F5ZA 4UBOA 4H77A 2WJ6A 5C8VA 3QZUA 4X93A 3VJMA 1IVYA 3IDAA 2PSEA 5D7BA 1ZI9A 4GWLA 4BYMA 1L7QA 5ALPA 1YA4A 2J4FA 3STWA 4Y2SA 4TVKA 5K3CA 5DWDA 5IVKA 1DINA 4TGLA 3V1KA 2NW6A 1WPXA 2WHPB 4S0XA 3WL8A 3DKRA 5HK9A 2V96A 3FSGD 2WUFA 1QIMA 3RK4A 2BAGA 2JGKA 3WKBA 1XZCA 2QUAA 3C45A 5LKRA 3O95A 2C5FA 4Q82A 1YR2A 1JI3A 2OQIA 1IZ8A 3VDXA 1XRLA 2D0DA 4EBBA 5C8ZA 4LYDA 2OLEA 3HACA 1XZHA 4W1RA 3R3ZA 1EDBA 1U2EA 3C5WP 3H19A 5ALXA 2QXUA 2Z3ZA 4LKOA 4RPCA 3KWFA 7YASA 1YB6A 1XZDA 4NMWA 2HU7A 1JJBA 2ZJ7A 2DHCA 3ESAA 3B12A 3VVLA 2PUHA 2HL6A 3QPCA 2Y2VA 5AM1A 5ISMA 3WIOA 1MAHA 5CH8A 5AKEA 2VEOA 5F4ZA 1LBSA 3G9ZA 2XMRA 3WKDA 4YX9A 3BL8A 5AK5A 4P9NA 2WIJA 2HA2A 4IO0A 2HA3A 3C8DA 4NVRA 1XRPA 3B5EA 5T4BA 1EK2A 1G4HA 3WI7A 4ROTA 1R3DA 2HA6A 2BJHA 5AKHA 5LZ7A 4B9EA 2C5GA 2ZJ6A 4EUSA 5JZ9A 2BUAA 5HK8A 4B83A 2PX6A 1F0NA 1JFRA 1SC9A 2I3DA 3I1IA 4DMFA 3EQ7A 3E3AA 3IIIA 3WYNA 5HFNA 3O9VA 2WG0A 4KRXA 5T4FA 4Y2VA 5IVHA 2JGEA 4EY6A 3ZWQA 2XI4A 1EINA 3BXPA 5CRIA 2FX5A 3HRHA 4JUIA 1CPYA 1DX6A 5LP1A 1TK3A 2HRQA 4UPDA 3FLEA 4X97A 5JIBA 4HRYA 2R11A 1XZLA 4CG1A 1QIFA 4QEKA 1R50A 2WU4A 5EIEA 3BDVA 1SFRA 4AZ3A 5CMLA 1XQVA 1AKNA 3ICVA 1CV2A 4UBKA 3FYTA 2VF2A 1CUVA 4DM7A 3R41A 4J0DA 1IZ7A 2WJ4A 5I9IA 1EK1A 4B0PA 5AI6A 2JGMA 3U0VA 5DTJA 4RE6A 1W76A 3PF8A 4OYYA 2D5LA 3ZV7A 4DYHA 2VQ6A 3OC0A 2O7VA 5C8XA 5T4HA 4WJLA 5FOQA 1DQZA 3G7NA 5JZSA 1IUPA 2OQVA 3VJLA 3ZI7A 4CIBA 1K5PA 2Q0XA 2RGUA 1VXOA 1Z68A 4W1SA 3BIWA 5ALYA 4AMYA 2CUTA 1XZEA 2FJ0A 3WKAA 3FVRA 5LYYA 4Y2TA 2CJPA 4B80A 3D59A 3F8SA 4PF1A 4U2CA 4FLMA 2WUGA 4F0JA 5JZBA 3EBLA 4E11A 3ED1A 3WZLA 1QTRA 5FXMA 3H2JA 3DNMA 1UK9A 3H04A 4CCYA 1YS1X 4DSAA 1XQXA 4KAFA 3DOIA 5AI9A 5BWBA 3W06A 2G4LA 2XQFA 4QWWA 2OAEA 4BVKA 2DHDA 4AO6A 4EZIA 3T4UA 5HKAA 2XUGA 1ZD5A 4MJ3A 4J0GA 1J2EA 3R40A 1UKBA 4UHFA 4BC1A 1VZ2A 1E5TA 1LZKA 3I2KA 5C7YA 4P93A 3WA7A 4Y2YA 2VSQA 1G42A 1CUGA 3G0CA 2XMGA 1USWA 1W75A 5JAPA 4BTVA 3LS2A 4EY7A 3G02A 4K2AA 2JGIA 4ETWA 4WFJA 3STYA 2QUBA 3WKCA 4N5HX 1VE7A 2AJCA 4FLFA 1ODSA 5D3ZA 3ANSA 3QPAA 4B9AA 2XMDA 4K6KA 2AJLI 4Y2PA 4INZA 2XUIA 1WHTA 4G4IA 1J07A 3A2LA 4UHDA 1XRRA 3WZMA 4FNGA 1VXRA 3UUEA 1H22A 5JYCA 1DU4A 5CTAA 1MAAA 5FPPA 5AOBA 2ONCA 2JEYA 4HS9A 4GECA 4YASA 2X5XA 3G8YA 3RKSA 3FNBA 2WILA 1LPBB 3HI4A 2ZSIA 2WU3A 1XLVA 5FDFA 1FFAA 1NX9A 2VA9A 1AC5A 4X6XA 3AFIA 4J03A 2W22A 1G5FA 4CFSA 3LIIA 3DDUA 3I2JA 3V1MA 4PQEA 3WK6A 1ZIYA 1OXMA 2WHPA 1WB5A 2XMQA 4Y7DA 1GXSA 5LZ4A 2ES4A 1YA8A 3Q0TA 1XQWA 5AK6A 4I3FA 5BWCA 1HBJA 4B82A 5IKXA 1KEZA 2ZYIA 1TAHA 3A6ZA 2EDCA 3O9MA 1GQSA 1TRHA 1PV1A 1BROA 5E4YA 1O6FA 3DL7A 1SOMA 3F96A 2WHQA 5D3KA 2QXTA 1WM1A 1X2EA 1U4NA 2VAVA 5HF8A 4G9GA 5EI5A 3OM8A 4X90A 5HF6A 1FFCA 1THTA 5DTIA 3WL6A 2ECFA 4PNZA 1LLFA 4W9RA 2QJWA 2Z5GA 4ARAA 5CT9A 2QR5A 5EIHA 5FLKA 3JW8A 2OCGA 2OGTA 4G1FA 5ALSA 4KE9A 2ACKA 5A6VA 3STXA 5AIBA 5AJHA 4Z49A 5AK4A 3V9AA 1T2NA 1HPLA 3CXUA 1MPXA 5ALOA 4BBZA 2RONA 3GFFA 3C70A
chains in the Genus database with same CATH superfamily
3HC7A 3Q2KA 1EJBA 4YCSA 2FR8C 4ZEMA 5I6DA 2F3QA 1T5HX 1ZK4A 4LXXA 3T3IA 1N2ZA 3E84A 5A9SA 4PCUA 3ETCA 2JFFA 3QBVA 4H4EA 2PPLA 3WYEA 2DFTA 3CKMA 5FV4A 3GPIA 3OPQA 5JD4A 4I4TA 4E5PA 1U3WA 1W52X 2PBLA 3H16A 1PS9A 1QF7A 1J1ZA 2OEPA 5JCOA 1DBIA 3UHPA 1JHOA 1ZW6A 1JIVA 3BE5A 4GVPA 2X13A 3LY5A 3CX3A 3NHUA 1VA4A 3AI7A 3KLMX 4S1TA 2O8FB 3DZDA 1TF7A 3AEYA 3EDMA 4C20A 1BC5A 1H2XA 1JQ3A 1RM5A 4KGVA 4JLVA 1DGQA 5KNCH 2RGYA 3HDVA 4YIKA 1JSRA 2CVOA 4BNFA 1HH4A 4XDYA 1SBQA 5KYXA 4UTXA 1VHDA 4AT1A 1I0LA 2WSIA 4PZEA 2YYSA 4M8KA 2FZWA 1ML4A 2FRDC 4OK3A 2I2FA 5EZYB 5EP3A 4MDFA 5EFZA 1AZSC 3BHMA 2VP3A 1Y1QA 4EA9A 1CRQA 3EGIA 4Q3DA 3DDHA 5ALJA 3U7FB 2PGDA 2IBMA 3KJHA 2GCOB 2JAHA 2WRZA 3BD7A 3OZBA 2IUEA 4JUAA 4X92A 2Q5CA 4J0HA 4C5BA 3JD3A 5I48A 1DBRA 4MX8A 1TAQA 3GUYA 4DQVA 3U37A 2A7QA 1IM5A 2V5AA 4MVJG 1ZH8A 3ND5A 4BY9E 4CCYB 1VPWA 2Y76A 1A8HA 1FSGA 1NFFA 2PIAA 8ADHA 2OR3A 3A1FA 4KGZA 5JSQA 1ZUNB 3IV9A 3LBYA 4A0RA 2H92A 4OH1A 5FA8A 1LDGA 4N9WA 2MSNA 1OFVA 2OCLA 3MUFA 3RYIA 5HRAA 4Y2GA 4J3FA 3K0CA 5LL6P 2AN1A 4KB5A 1EBBA 1Z6AA 2DR3A 1V5FA 3ENQA 2W42A 2XMCA 4Z4CA 4FCCA 3RIMA 5I7FA 3KOMA 1HY3A 3KQSA 1MA3A 5IUNC 1CFJA 3GR6A 4QUJA 3CCBA 2IX3A 1FNMA 2ZJ8A 2ANBA 1CUJA 3UAGA 1OROA 2VK2A 3HU3A 3SC2A 2J0QA 3V55A 1H3NA 1OBHA 2JLAA 4AZ0B 4RFSB 5HKLA 5JRJA 4PFJA 3GFTA 3RU7A 1Y98A 1QAQA 5AW5A 3W3AH 4B81A 2EV9A 4EYEA 1N32B 3KL4A 4HTFA 1AM4D 16PKA 4EUFA 4JLBA 3HV2A 3QFHA 3O1HB 5BRNA 5BR7A 2R6FA 4AY2A 4G5FA 4ZDIA 4GRDA 4G36A 4KO2S 4DWWA 4NJEA 1ZU5A 3PFNA 1NQXA 2HT1A 4ZV7A 4D2IA 1AGYA 5G1PA 2VWHA 3SK0A 1A50B 2GEDA 3PL5A 1RKVA 4M1EA 1JLSA 4D8VA 1KZ9A 2YFYA 4QC2A 4EY8A 9LDBA 3W04A 4XGKA 3HL0A 1EFKA 1MCZA 3BIJA 4AS1A 4QZVA 5F64A 4BMSA 4DIMA 3OSZA 4EA8A 3RS8A 4EG4A 4GR5A 1LZLA 4OHKA 3VDQA 4LVNA 5EQTA 4LDZA 3KPVA 1FJ2A 4MPTA 2B9VA 1JZSA 2EARA 1J70A 3AX6A 4MJLA 2QE7D 3QHPA 4UASA 3FZEA 4UEKA 5TF4A 1OB2A 4FZ5A 4JGGA 2NSDA 2PBRA 4YR7A 3ISVA 2Q29A 5EIOA 4ZN6A 2ZIXA 3V8RA 2XUOA 3VSDA 4D5GA 3N28A 1UDAA 3QI7A 3E5RA 3KZNA 1TK9A 2NT4A 4L02A 3P45A 4LDPA 3WJAA 4JJKA 4ZJUA 3FRIA 1RHJA 4TX1A 1QZXA 1AGNA 4BIIA 1H6DA 1PZHA 1Y4UA 2B6HA 1IOZA 3H1TA 4RY2A 2FMHA 3E15A 1DWQA 2PZFA 2HOQA 5JY1A 4MUBA 5LQRA 2IS2A 1Z38A 1G6OA 3DSRA 1MJ5A 5D84A 3RS4A 2ROQA 1OGIA 4IUDS 3QENA 3EPHA 3E7WA 5CGQB 5FV7A 2B4TO 5CT8A 4KPYA 4QGBA 4D6PA 2I9PA 4URXR 1TM3E 1BEZA 3JYLA 8ATCA 4RPGA 5BWNA 5C1BA 2ZFUA 3D8BA 1J8VA 4PCLA 3GLKA 5I9LA 1W2GA 1ID8A 4LYYA 1XLWA 1Y1KE 4KQ9A 3LLUA 1NBAA 3J7AC 5I7RA 3IDQA 1J2UA 4XDHA 3A70A 3D5EA 2BEUB 3OQHA 4LHYA 3KVRA 4MWOA 4L9WA 1NRWA 2J33A 3R0XA 3NVAA 3LBFA 5LCXA 4AFNA 3OCCA 4ZD6A 4A0FA 3VRHA 1PWZA 1BS2A 2ONKA 5IS2A 2IZ7A 3R6TA 4G8CA 1N2SA 4PY2A 2YN2A 3NV7A 1ATZA 3IT1A 1TYZA 1S2GA 4KJXA 1IY8A 4Q34A 4QHTA 3CN9A 1UUFA 1FDIA 2IF2A 4EX6A 3TJZA 1KY3A 2P2GA 1M2VB 5EJ8A 1ZJYA 3TL2A 3ZEIA 1QB8A 3TXXA 4HAVA 3IAUA 1RZRD 3V8MA 3K6SA 1KR2A 1OI2A 3I5YA 3T95A 3HFSA 3GGJA 2DY0A 2JC3A 3M83A 5C7LO 4Q21A 3DXZA 3WP0A 3RBVA 3KPYA 4JK3A 4OVKA 4WJKB 3E18A 5GJWC 4UNPA 5I8WA 4NFHA 2G9NA 3V4FA 1AGPA 3BF8A 4BX3A 3AIOA 1Q7EA 1XCBA 3RJMA 4W1QA 5EA2A 2QTVB 2IPXA 4FFDA 5ED0A 3LUPA 5GWXA 4Q3NA 3HCAA 3NXKA 1JPJA 2VRCD 1N5JA 1ULHA 4P3XA 2DUMA 1R12A 1TLLA 2AF4C 2VZ0A 1OX4A 1KXJA 3A6DA 3SHVA 1RFLA 1B6TA 1P60A 1VLQA 2VDWA 3QV2A 4YYZA 4EHLA 1K63A 3W8FA 3GN1A 2GAIA 3M49A 1U0HC 2Q1TA 1PK7A 3UF0A 4H4CA 5EGNA 2CMDA 3WWDA 2EKQA 5JS7A 5DWQA 4U0JA 2WIKA 2EGUA 5KHOC 1IBRA 2TMKA 1KAQA 5LBIA 4B3BA 2Q8NA 4GW3A 1FJXA 3SIWA 1FVOA 2XTZA 2P7HA 4MRAA 4CMAA 4FE7A 1V11B 3ACDA 1CRPA 4WFIA 4CLEA 5JADA 1ODFA 2R85A 1JGTA 3TZEA 3CTMA 2YWFA 4A0HA 3H13A 2J5KA 2PSSA 1YRBA 3C1AA 3KQMA 3WIBA 2P9HA 3U44A 4AWXA 3CU5A 2GNPA 2HQSA 3T61A 3E48A 5JBNA 1GL3A 3QE2A 2ERCA 3GYGA 1PCXA 4YQYA 2I6TA 1L4GA 3R3SA 5JDCA 1BWPA 2NZXA 2RCYA 1RFGE 3MTBA 4JIGA 4RTOA 5AVVA 4ACAA 2HSEA 4GMFA 1IQUA 4ALLA 2ZR9A 1QRRA 2J0VA 4FUTA 1GYPA 3M6UA 3KEGA 1ZRMA 5DP1A 2BFDA 2YICA 3L6RA 4GPBA 1DXYA 4I9GA 3ZY6A 1QRUA 1DHTA 1WNTA 3JWJA 3P2MA 1W0KA 2PZAA 2CJYA 1VE5A 3W1EA 3UMFA 3K9LA 1G7SA 4U9HS 2QD1A 4BRZA 1WHSA 2NSHA 3OZEA 2X0KA 1FNNA 3H11A 3VZCA 4ESVA 4JYMA 3ETJA 2QPTA 2QYTA 1JQDA 1Z56C 2WSSA 2ZAGA 4I4TB 4BDSA 3EFHA 4M1KA 2J5RA 1W48A 3LP8A 4MV3A 3ZQ4A 1HMPA 2Q3DA 3ICCA 4J0KA 4MAFA 4CFYA 2G36A 4V38A 1X19A 1TIKA 3THYA 4UCWA 3FN4A 3G0DA 5A02A 3U9LA 2GAOA 5CG1A 1P31A 5K0EA 1U1FA 3COJA 5I7VA 1D5CA 1Y3IA 4TQUS 2XUAA 4XASA 5FPYA 1OUMA 4UMDA 2PSJA 4DYDA 3DZ8A 2HPZA 1EUCA 3LCJA 4FZRA 2I2AA 1C7EA 5E7IA 2IK8A 4MEBA 4NMXB 2QM8A 3HNOA 3VNVA 1F0PA 5E1OA 4OQDA 2DG2A 4B33A 2HXGA 5GAJA 4PIMA 2VYFA 3FVWA 3HJGA 1Y3CE 3DCYA 5BV7A 1SUIA 5EPEA 5JCOC 1QDUA 1UDCA 1WMEA 3EDRA 4ES6A 5KQGA 1KIAA 1NV8A 3L0CA 4G85A 5F3WB 1W4RA 4NOJA 2QN2A 2FSGA 5CLJA 3ZBUA 1I3MA 4DADA 3W79A 3I5MA 2AOVA 5F3RA 3KU4A 1QYXA 2C9CA 3DM5A 4KKVA 5L6MB 4DV0B 4BBAA 1B1CA 1WUJS 4DUGA 3EHDA 2VYVA 1YVEI 2RB5A 1WPRA 2P4UA 2G70A 5HF5A 2IGTA 3H1GA 4TM7A 2FN4A 3BGIA 1KY2A 5AW7A 1G20A 4EFKA 5GIOE 2GEJA 2VAXA 3KKMA 4Y9TA 2OD2A 4UQOA 5BVHA 2XWBF 2A35A 3ZWXA 2B1RA 2OHXA 1XKLA 3MOGA 4TS3A 3VR4H 3JQGB 4U5QA 4NAUA 5SZIA 2ZANA 1XA0A 3MELA 2C5HA 4WOKA 1JUDA 4AZVA 2OXCA 2WD8A 2WDZA 3V1UA 3ZQKA 4Q02A 4ZAFA 2CY0A 4UFNA 3ER9A 3X44A 3ZHZA 2WYOA 4JP8A 1RJEA 3AV0B 2WAXA 4MZXA 1ZZGA 2FZVA 1IY1A 4FDVA 4PIPA 2B8EA 4YCLA 2G67A 2H7YA 4HH0A 1GKKA 5FPQA 2X1HA 4YP9A 3IVCA 3TL3A 1VGVA 2VL7A 3L93A 3DW3X 1LX7A 1O5IA 1U9IC 4OJMX 3TIGA 4YQFA 3G9UA 1N3IA 2GZ3A 4LDJA 1FFXB 4ZYTA 3VNBA 3EZNA 4JBIA 4XZ3A 3V3TA 3HBFA 1A88A 4YMVA 3DNFA 4L57A 4EB6B 2J45A 2CXOA 4KIGA 5LLDA 1WPQA 4BZWA 3PE4A 1YRWA 1W44A 3FCXA 3EEYA 5FQNA 4F1WA 3CLSD 2G9UA 5IT0A 3PT5A 1EFCA 2I55A 2LRHA 4DBLC 1HA3A 3HCOA 3JTMA 2I3ZA 2HMWA 1LC0A 1V16B 4QE3A 2BZ1A 2ZZNA 2WQ7A 4M87A 3V7NA 5D5PA 4BO6A 4QVIA 1NLUA 3ORSA 3IBFA 3ZVNA 4KNYA 1AX9A 4UBIA 3W5SA 1VKNA 3NEPX 2FMIA 3UKOA 3OT5A 1JAIA 3IE2A 3IGFA 5E0OA 3WE7A 1C9KA 2X3YA 3CJQA 4J2TA 4I50B 5KNCD 5EOVA 5IM4F 3K32A 2OGWA 3PQCA 3BL5A 2ZIXB 4LHWA 2QRLA 4MRMA 2GSDA 2MTBA 4MV0A 5E4TA 1GTVA 3WRXC 4CWAA 4DOMA 4DMUB 5E8JA 3ODGA 4X8OA 2PQ6A 2Y1KA 3P5SA 3ZYZA 1NOIA 1D9ZA 5AWFC 1G2OA 2J0UB 1T3SA 5ERYA 4EY4A 5JYDA 1V7QA 1OHHD 4LJ6A 1DO0A 5FBRB 2JJYA 4X7PA 2DUWA 3L4EA 2W6CX 4KPFC 3QW2A 1C30B 2DPMA 2QD4A 2GRAA 4MWCA 4UMFA 5AVSA 3UJNA 2CNLA 4OKNA 3UB4A 3AR5A 1LLDA 1L8AA 1ZVMA 3DCNA 3HVUA 4OHUA 4WX2B 5E9WA 1TF2A 4MLCA 3JWPA 4LSGA 4KEAA 3UV3A 4AROA 5HQ3A 1NI3A 4FJ1A 2IIPA 1TYBE 2C61A 1GL6A 3R9IA 1UPAA 5H83A 1OFUX 2HWYA 3ESXA 2BMAA 4HXGA 1RPTA 4C04A 3VZPA 3P9PA 1DOHA 3F6CA 1SVMA 3TLEA 3K9GA 1G41A 3QMWA 3AW8A 5CX1A 3PSHA 2XUJA 1RADA 5K3EA 4GSYA 1Q21A 1E3SA 2NO6A 2ONZA 2OZEA 2VAWA 3PNBA 4P3NA 4RYDA 3KZOA 3SD7A 3HLYA 1U8AA 3A1VA 3EQ2A 3JVIA 1BDJA 3PHJA 3EBOA 5BNZA 2Q2VA 3GJRA 2QLNA 2O7QA 3L7MA 3GLUA 3VV3A 1BFDA 5C4GB 3RE1A 1COWA 1GPUA 4BMOB 5CCXA 1H65A 1JEDA 3W3AD 1QKIA 2FJPA 3ZK7A 3BWEA 4V1CI 3MRSA 1JU4A 3CIFA 4PCVA 3URKA 2GX6A 2XYGA 3PENA 5LQJA 1GPKA 3GT4A 3ENZA 4JBYA 4KK4A 3PEEA 5KTOA 4YP6A 1QO9A 3L5OA 4XWOA 1PTJA 4FYMA 3FB4A 4GBGA 3E4DA 1P0PA 1XB2A 3FLAA 2REBA 3QXCA 2CKDA 3B1FA 1SXJD 2L19A 5IM4A 4L0MA 4V0SA 3HKBA 2XBUA 1Y5IA 4DV6B 2QTTA 1BGXT 2OXFA 1VE3A 3O4FA 1WG8A 1DARA 1J8MF 3JPYA 2QENA 3I2GA 2HBZA 3KHKA 1G7CA 1N7HA 4QQ8A 1R64A 2WG2A 5TC4A 4JL8A 4WBNA 1ZNYA 4FHZA 2QGNA 3BRWA 1I2BA 1X80A 4JI0B 4H7IA 3O2NA 1EGQA 4OL9A 5T3UA 2VRNA 3U7HB 3VZSA 2VDWB 4M8NE 5M34A 3UMYA 2QN6A 1XCLA 3HVRA 1I10A 1ZCFA 4JZKA 1QFZA 2DZDA 5K1ZA 4K6GA 1F1BA 3EA5A 2P0AA 2QORA 1BXGA 4NF2A 1F3LA 1ZX1A 2XXBA 1AO3A 4HDNB 4K0KB 1JF8A 2CEAA 2C3UA 4O6VA 2PJDA 1RQLA 3M6LA 4ND1A 4Q1DA 2D2VA 2F00A 3MWKA 1E6WA 4LNUA 5EJAA 1QDLB 5BW8A 3IIEA 3QTTA 4OMDA 5AMXA 2OQ2A 4OP2A 4GEGA 5AKLA 4BFLA 1TUBA 1CZOA 1Z0FA 3JR3A 1KE2A 1OAOA 1V1RA 2D2IA 5EMJA 1EX7A 9ABPA 1E1DA 1J0CA 1D2RA 3D3QA 2MMGA 5L3ZA 3U44B 3ILXA 2QJTA 4LQCA 2DPXA 2G08A 3PRHA 2ZWAA 4Y2XA 3CNEA 2VXBA 2UZ3A 3AEUB 2B8NA 2COUA 1IUNA 2W2KA 1MFZA 3I39X 3QQPA 1OU0A 4INPA 4L5BA 4RGQA 3ZHBA 1BZYA 1E8MA 1U81A 4IW3B 4REOA 3ZI4A 2O3QA 1U2DA 4LY6A 5BW4A 3T34A 3M7IA 4QA9A 4OLJA 1J33A 2AUTA 4PN7A 1K6MA 4XWWA 3EW9A 1XLUA 1VL5A 2DH6A 3PUJA 1Z74A 3QFSA 3AGPA 5E8RA 4BASA 3PXBA 3VO1A 4BE9A 3ZDDA 3ZKWA 4DBLE 5C18A 1G8KA 4DQXA 4GZ5A 5B5SA 4QATA 2PUEA 1T2AA 3H11B 2DRIA 5KOHB 2QE6A 1C29B 3KZKA 4HNHA 5KQSA 2J87A 3IUSA 3KBBA 4ZT6A 1Z7YA 3P8ZA 4PWYA 4QDXA 4BV9A 1FBTA 2PH5A 4NEGA 1K7XB 1QIDA 2AXQA 1DDGA 1JHDA 1DG9A 1P33A 1O4VA 4YJ3F 2X42A 5JDCC 3JZDA 4AIRA 2WWFA 4PO9A 4BKRA 4NATA 4B6QA 2EP5A 2VBGA 1FNCA 4KXMA 4HXFB 5F7JA 3KQHA 2Z5FA 3G9TA 2FSIA 1DLJA 1Z2NX 3L0OA 4COOA 3CUUA 1EUCB 3L7DA 4UVEA 1NR7A 2FP3A 4K1XA 5AUOB 2XWPA 1G8HA 4TSRA 3HFGA 3J7TA 4MVJM 5FI3A 2FPGB 4U2FA 4JGBA 1DLIA 4WK2B 5IJZA 5CB4F 2PRSA 1NPYA 2H2WA 4UCFA 5DM60 1FSPA 2GYWA 4ZVLA 2P2YA 4RK7A 1L7MA 2IYSA 3PI6A 1L6IA 2PSFA 3V4SA 1IYZA 1JYSA 4OQFA 3ANNA 2BR5A 3UOAB 3U62A 1A98A 5LC1A 4C78A 5JAQA 2J3IA 1W5FA 4YP7A 1XFAA 3M6WA 1QKKA 3BHNA 3LQYA 4XQ9A 2YWEA 4HNQA 1QOQB 3A6LA 4BO1A 3KVYA 3PCXA 3AP2A 1KAHA 4HADA 4U00A 5AVTA 5IT4A 1L1EA 5KX5F 1Y1PA 1H8HD 2CD7A 3DMFA 3DOJA 5ALZA 1X1QA 3OURA 4L95C 5IKEA 1X87A 3PL1A 4Q1FA 1XVIA 2CWWA 3C7DB 4N0EA 5F2KA 5KDOA 5AQEA 3LW8A 4ZC1A 5LP6F 1G20B 3RW9A 3D8TA 2H8KA 3Q0EA 2Z58A 4WESA 3LKBA 3LUBA 2AMJA 3IQXA 2CLFB 2C5EA 1RCTE 2P1ZA 1RQPA 1UK8A 2GZSA 1SUBA 1C8VB 3OZFA 2OYSA 3E2IA 3SEFA 3HU5A 1SC6A 1GWNA 3DXXA 5H7XA 3DBOB 1M33A 1T4DA 5A06A 1UMBA 2V6GA 4R3UC 2Q2OA 1DS6A 3Q4GA 4JBNA 3I2YX 4E6PA 1QHHA 4NBNA 3FWHA 5LUAA 1XALA 4M37A 1QHXA 3FCEA 3QW4B 4NG4A 1OFHA 3OE7A 3GJ5A 1KY4A 1AUOA 2GM5A 4YCMA 4NMMA 1KK0A 4YJ3A 4WFKA 1LDBA 1UOPA 4E5VA 4RVCA 3V33A 5DXFA 4BLVA 1N3YA 1RPJA 1JEOA 4ZPXA 1VIVA 1W8DA 3IQFA 4JBHA 1VG1A 1P0MA 2NZYA 2CYCA 1QJ4A 3FROA 5ITWA 1M1ZA 4ASUA 1V8FA 1WLSA 2JFZA 1K8YB 2E1PA 2I54A 2OGSA 3H5TA 2R1VA 4J1TA 1R66A 5F2EA 3U4GA 3VFDA 5K8LA 1Q1EA 3HWRA 4KREA 3A9TA 3LCVB 4R83A 3E9MA 3RLIA 3TAUA 4Q9DA 5ERXA 3H3XA 3MSCA 3CYFA 4MUEA 2TMGA 4R2LA 2AR0A 3L7AA 3PPIA 4JOBA 4DA6A 2AOXA 1UKEA 4Q05A 2FMUA 3Q8KA 4EHDA 4E2WA 5EKUA 4C7KA 4P38A 2A86A 2BMVA 3DAPA 3F46A 1FXSA 5TMDA 3EXIA 3ONDA 4PG7A 1JHAA 4FNMA 1H2HA 1KK2A 3IUPA 4KN9S 1QFJA 3ONFA 4KN5A 4NXNB 3AKYA 1KJQA 4KDEA 4R1OA 5F35A 5HKKD 5HPYB 2UU9B 1XCPA 1FP4A 3PJDA 4JJ4A 4YV1A 3GPDG 2OECA 1S9DA 4P7JA 5T7BA 1QFSA 4NV0A 3FMIA 1Z12A 1QO7A 1UBOS 1EWTA 1WXIA 3S2ZA 2XRYA 1RVV1 5LP6A 5J43A 3IQIX 1JV2B 3UC9A 4A6DA 4YP5A 3FMGA 3GCZA 3VC3A 1CJBA 2JJ1A 2QW8A 2GILA 3AXSA 4P5DA 3TRDA 4DC9A 1M2WA 2V4MA 3P7MA 4Q4AA 3TN7A 4ZZIA 4O25A 3PRYA 2CC2A 4UEWA 4P4GA 3SQOA 1PJZA 3F71A 4RWEA 3TEJA 4EW6A 5HQ3B 1MO3A 3T1QA 3TW8B 3GXBA 5IRCD 1ZL0A 5L6LB 1ISSA 3F6PA 5JFTA 1URPA 3MBIA 3PIIA 4MW4A 4PYMA 4MGZR 1X8KA 2BFWA 1AKUA 1VHJA 1EH5A 2CYBA 3GFSA 1X1BA 2ORVA 3DBIA 4Q9KA 3QU4A 4KU4A 2VPZA 3V2HA 1I33A 5KYKA 3VR4D 1M2HA 4U7PB 1P1RA 4C0AC 2R7KA 3A4VA 2AZTA 1BAPA 1MB3A 4GPAA 4CLRA 2GBPA 2P91A 2ZVQX 5DYWA 1YIAA 2IYYA 1Q77A 3JQDA 3H7IA 3S1AB 3ZWNA 3A10A 3BD6A 4MWTA 5EMNA 3PUKA 1C81A 2VUTA 3ZJYA 2H5JA 5DH9A 2FRVA 4NABA 3AY0A 1Y63A 4XCQA 3C3DA 1HEUA 5CU7A 1JXOA 3VNSA 3QE9Y 2G09A 4LSMA 3A3YA 2KE5A 3LLSA 3R7SA 1RRFA 1U5BB 2G72A 1QX4A 3B60A 2X8LA 3KG2A 3LUJA 3NHPA 1NVKA 3O0DA 3ZWYA 3FLBA 3L6BA 4GOMD 1H2AS 5TT1A 1PT5A 3CQ9A 4A16A 3K0AB 2CZQA 4LDAA 2G5TA 1CUEA 2IYEA 3JAKB 5TPZA 2D1QA 2C82A 1CRWG 4RANA 2PT7A 1GN8A 4HPWA 2XB4A 4ABYA 3GLSA 4KIJA 3U3DA 5LYJF 3P1JA 1LWNA 1O6BA 3B7GA 4DNFA 2OBFA 1W2WB 4IGFA 3RRXA 1SZPA 4I9UA 2PZJA 3PEUA 3EXHB 4OMCA 4XAQA 5EMKA 3IYLW 4A8PA 1ECLA 3T1VA 4J16A 2AI3A 4Y9UA 4XPIA 1T5IA 3SYLA 4DDWA 1AQJA 4OXXA 1DKMA 1S8FA 2AHRA 3C87A 1SUSA 2CLIB 3LCUA 1OTXA 1PT8A 1ADFA 2JH9A 3WWEA 1ZEMA 3GPCA 2CWDA 4NCIA 4GAEA 1JDPA 3UAOA 4R2JA 4ZJPA 1JXAA 1YBFA 3BH6A 4O2AB 1M2NA 1PTJC 4H1UA 2OHJA 4X7MA 1BXGB 1DKLA 5CK4A 1QS0B 1VFPA 1B6GA 2CNBA 3R5SA 1CCWA 2O5VA 3UMGA 2PYDA 5JNVA 1ULAA 1EUYA 4F5WA 5BYKA 3ILSA 1E2QA 3NRCA 1J23A 1GAJA 2WF6A 4GPTA 3CLUC 3HMKA 1V4VA 4LQLA 2XF2A 3EF0A 5TXGA 2BVNA 2P2LA 3AW9A 3MJDA 4JCCA 4FILA 1S7GA 4M9ZA 4BQPA 4GI1A 1YSCA 2WY2D 1R0YA 3TPFA 1NBIA 3E03A 3HJHA 4UQPA 9MHTA 1R7RA 3SGLA 2WJVA 1OSNA 3GZJA 3K5PA 3UHOA 1EZ1A 4UU0A 5AR1A 4KO3S 4OA5A 4R40A 1HKUA 1T2CA 5EINA 5IBRA 4YUVA 3RU9A 3B3JA 3SJAA 3ZHCA 4QM6A 1B8PA 4JENA 1HDYA 4G41A 3NHKA 3R7DA 4I4CA 3ZXSA 4OEHA 2I4OA 3IQEA 3WNVA 1XDBA 1U28C 2X2FA 3E5NA 3OT1A 1K75A 2ZB2A 5B53A 3CIOA 3RGWS 4BMPB 1JN0A 1Y0BA 4JEIA 3Q3JB 4MV6A 1KI3A 5B7NA 5JNSA 5JNLA 1GT91 1TQHA 4XR4A 3K2IA 3IV7A 3KJIA 3JZIA 3IAS1 3ZKWB 1BMDA 2GBLA 1G8JA 3GGCA 4RK5A 5BOSB 4NCAA 1GCOA 5AD1A 5JECA 2I03A 1EFHA 2AQHA 2V6IA 4QRIA 2WYUA 5HDBB 1OAOC 1GG9A 2HHCA 4CDRA 3C6XA 3IIMA 3LQ1A 4CKEB 5ETJA 2VT6A 3A2NA 3CLTC 2AG8A 4UDXX 5FULA 3UJCA 5LN1A 3CPSA 4O8CA 5IUKC 1QVVA 3E4CA 4UU8A 5J5AA 3DG9A 2E7ZA 4A10A 4QUKA 3UYKA 3WLOA 1HNXB 1AY0A 1DTWA 4NU6A 1EJ0A 1RVDA 4PXSA 3TPCA 3AF5A 1EDDA 2ODTX 1VJTA 1QO0D 3TZ6A 2VOJA 5I7AA 2C00A 3SAJA 4V03A 4CUKA 3S68A 1F8UA 5HIJA 3BE6A 2CXTA 3RPEA 1SG0A 4GP7A 1PJCA 1X1RA 1XOIA 1Z6XA 2VG8A 2G0TA 4IDEA 4BB5A 2V55B 3RBXA 2A9QA 2IPMA 4LC9A 4GFDA 4JP3A 4IWXA 2OCBA 1Z4NA 4UZFA 2IBTA 4OXYA 5DN6D 1UMDB 2UYOA 3FPSA 4J4TA 3WC4A 4CMKA 5JOQA 1F6DA 3HCRA 3GIWA 2HGSA 3AZOA 3PC7A 2ODNA 4TLMB 4R98A 2X7JA 3ICWA 3V46A 3ZDYB 4M7PA 1FLNA 3CE6A 5DK6A 4U2EA 3SBOA 3RJTA 1N0WA 2IYWA 3DL4A 1U6JA 4YFYA 2IY8A 5DHSA 4E1VA 5BQXA 1ZSVA 2JFVA 2HA5A 3MGCA 4K3VA 2YNMC 4NS1A 1OLSA 4Q9LA 2JB9A 1M76A 3NM4A 5HM6A 2YXPX 3SS8A 2B8TA 2WPNA 4LCJA 2F7SA 1VSQA 4LNHA 1T9GS 4PPYA 3ICOA 3EVTA 1YK0A 4TXHA 4DDUA 3VC2A 3EULA 2VWGA 2ETVA 2Q62A 1OI4A 4XIIA 3UIEA 2JDIA 4FOLA 4H7FA 1U80A 3PWKA 4YAUA 3GLGE 1XF9A 4JU8A 1I2CA 1WMSA 3NJ8A 3A9WA 2V1XA 5EUMA 3FPLA 4BCDA 3TIXB 1XYVA 1Z28A 3ELUA 3DOUA 1G3QA 2PLWA 2XAUA 3TMAA 1H6CA 2IS6A 3HB4X 2NSYA 4KWEA 3ZLBA 1Y9EA 2CZCA 1DJOA 2VXYA 4EATA 1E8DA 1MU0A 3AU9A 4KTVE 1UMBB 4WLNA 4DNPA 9ATCA 1GG5A 3DE7X 3OZCA 4OQNA 1U2GA 2AEJA 4I3HA 1FF9A 3RYCA 1JEEA 3CF0A 3TZCA 2ZB8A 5EJ6A 1RBMA 2DJ5A 2MSDB 4BO8A 2P9BA 4QLOA 3JYHA 3AUTA 2DYKA 3ZY5A 5KINB 1FQJA 3QOFA 5HRCA 1P6QA 2VBIA 2WUDA 4BECA 2R1VB 3OM9A 5HJ5A 3GAMA 1DKRA 3VOBA 5D1HA 1F17A 2DOKA 1LJ8A 3NH6A 4D3XA 4JYZA 4KGXA 1CUUA 2BPOA 5CB4B 4A23A 3C7KA 2GJ9A 1ZH0A 4EHIA 2ZWOA 4D82A 1ZRSA 2WFLA 3G2LA 1ECBA 1XXHE 3GEDA 3N75A 3JCZA 3R8XA 4BMCA 3ET4A 1EFVB 4I1RA 1GGVA 3LKVA 3R5JA 1H8ED 2WUWE 1KEEA 4YJ2F 2G0AA 3BE8A 3QELA 5IN5A 1TD1A 3GV0A 2AXPA 4FMDB 5CUQA 3JQRA 3ZLUA 1L4UA 1OIXA 5AT1A 2EGGA 4CIDA 2HK6A 3L8DA 2DULA 3KXPA 2ZKIA 2BE9A 3CUSA 2H7XA 3CISA 3MWLA 4GXNA 5HM8A 1R6TA 1JDVA 3DOFA 4BLQA 1PEAA 1BGVA 2EQAA 4EB8A 4LF6B 1DCTA 5KX5B 4NESA 2XUPA 2YUIA 1HEIA 1BE1A 1YL6A 4J1TC 4KGDA 5INTA 2Q2QA 1VBKA 2ZYSA 4CUZA 1T6XA 4PW0A 1NDUA 3NOQA 5LFAA 5LP6B 3MMSA 3PITA 2Q3FA 4LYEA 2R6HA 1UANA 1IJFA 4C0SA 1A71A 2VK4A 4Q01A 2I6SA 3KTFA 4D8XA 1ARZA 1N7JA 4XI9A 2RAUA 2P5YA 1HDCA 1TD9A 3AJDA 3TZKA 1E1CA 1NUTA 4U7JA 1Z26A 2XVMA 1FXWF 4LWPA 1KH1A 1UPXA 3LPDA 4EG3A 3NAGA 3A2KA 4L0DA 2H0AA 4O4JF 2G3YA 3DJFA 3ZHQA 3FYUB 3MJEA 5ALGA 5FPSA 1C3LA 1Z5GA 3W6ZA 3A4TA 4JCOA 4ARSA 4LRUA 3LY9A 4AZWA 2EZ8A 1QQ7A 2G25A 1OH6A 1YT5A 1NAHA 5JS8A 3CG4A 3ANXA 2PX0A 4YAWA 3TTYA 5LNK1 1PGNA 5EN4A 2VTVA 1GQYA 4FOOA 5CCBA 1TC2A 3KCNA 1GTL1 4IKOA 6YASA 5A0TA 2YHIA 2HF8A 3M5DA 4UAGA 5KYVA 2PWAA 1JBEA 3QEMB 3G7UA 3PQ8A 1GU7A 4WK0B 4IX1A 2O7RA 1R0WA 3GB9A 4S24A 1PL6A 5JAMA 3OJFA 3FH0A 4QECA 2AMYA 1ZKMA 3AG5A 4EJSA 2Z5LA 3IB3A 1ID1A 5KB3A 2XNKA 2ZBGA 1EA5A 1HURA 4HEA1 4MK4A 5K0SA 2RBGA 1HE4A 3NM5A 3IDFA 1TXGA 4UC0A 4JJ7A 3EK2A 1YO6A 4J76A 3NALA 1KI1A 5ADHA 5L3QB 1WCXA 3JV7A 5H16A 4F6RB 2J30A 4D9NA 1ZD3A 3KJQA 4B43A 4M83A 4XJVA 3CCCA 5DLQC 3U9TA 1IB0A 2BDTA 1UJCA 1UXKA 2C3OA 1VGRA 1J7KA 2JAQA 3F47A 4RTLA 4XWKA 1BFKA 1YD7A 1CIJA 2E3JA 2GF2A 2JF0A 3ZN2A 4EG0A 5G4LA 4O4LA 3Q7RA 1CQWA 3QY9A 3HXKA 4IUYA 4DLWA 1NKVA 1GG2A 4D45A 4B7UA 2UUBB 4NARA 3EPKA 1X7YA 2DQYA 2KBFA 1E61A 2W98A 1RZRA 3R09A 4U63A 2FRXA 3RIGA 3TFOA 2ACWA 3ESZA 1OT5A 4GPIB 4QXMA 1QBKC 1WA5A 2C2GA 1FXWA 3AUJB 3LK6A 1E1YA 1R6BX 3F5DA 3FI9A 3CT6A 2EFCB 4O4JA 4D6YA 1ZUIA 4CLXA 2TMDA 3H4VA 1Y42X 3OPYA 4YFVA 3S2FA 1DC5A 3VTKA 1O1YA 3W5HA 4AQDA 4DDMA 1EM6A 1LEHA 1FRNA 2DTXA 2QD2A 3AKDA 4OYRA 2VPTA 3EGOA 3FFBA 1GPNA 3O9ZA 1X74A 4A1FA 2CNKA 3OBIA 1JQ5A 4YT5A 2ZBQA 4YMTA 3AHCA 1P61B 5CR9A 3ZGOA 3OOJA 2BEJA 4J16C 4ZVVA 1LNSA 1XJ5A 1J25A 4FS8A 4WBSA 1YFJA 1PWXA 2HRDA 2CL0X 5AUQA 1WP4A 3H87A 3IUMA 2V9PA 3H2KA 3MQFA 4UNIA 3OZAA 2VUHB 2QAGB 4JP2A 1QVRA 1SK8A 3DAGA 1ECCA 5IXJA 3OT1B 2F4VB 2AXEA 2C9BA 3K1TA 3O3CA 2IPOA 1FBNA 1AN0A 3ITEA 3JQAD 3TRHA 2YW9A 3HZZA 2DT5A 1W7AA 5KU7A 3C7TA 4LMBA 1NQOA 3DHVA 1W94A 3CUWA 4HAOA 4UPVA 4XGNA 5JVDA 1MB0A 5MDHA 2MYUA 1Z8FA 4JWKA 1EEXB 3SCZA 4DKXA 4M9QA 4WXMA 4RMJA 3DHWC 3WR5A 1T6YA 2I87A 3H5OA 4CYMA 3FI0A 2PRYA 4EPYA 1KDRA 4HDRA 2ZRAA 3ZW9A 3ZUPA 5LYJB 1GZVA 4D4MA 2OTCA 4B79A 1SVWA 3VZBA 4G8BA 3NYWA 1CERA 1AXEA 1A8IA 3BZUA 4US1R 821PA 3PGXA 3C6ZA 5IWCA 3K1YA 4DG9A 1J6UA 3O2JA 1GM5A 1JKMA 2KBEA 1I6KA 3OIUA 2FH5B 3GVXA 4PE5B 3EC2A 4R5HA 3WWPA 2IVZA 4ALJA 3PNYA 1Y6ZA 2AN9A 2NWQA 3A1CA 3MINA 4HB3A 4BRSA 2KJQA 1KMIY 1PK8A 4M8LA 1CZKA 2UYGA 1NHGA 1P5ZB 4GWKA 3NNDA 4ILEA 2QYHA 1GYRA 4G2NA 1EUDA 2WFMA 2GBLC 5JD6A 2MSWA 1ZJ4A 1JZTA 2PL1A 3QLUC 1RWQA 3ENNA 1P9NA 4AU1A 2PMBA 2BM9A 2IUTA 3P0JA 2Y93A 1ZMXA 3ZLTA 2CKMA 4UHHA 1IVSA 2XOXA 3LNTA 1JEQA 5H3CA 3BRSA 1LBTA 4HFRA 5JSFA 4FX5A 4MOWA 4MVJH 3FETA 3SYKA 3R6WA 3RWOA 5ARBA 2ABWA 4ZAYA 4ZQBA 1J0DA 4F3RA 1YZFA 3IAFA 3CSUA 3V7FA 1QG6A 1YNOA 4PC3A 1OLSB 4ZOCA 3H18A 2IEIA 3PC2A 4RZXA 3ONNA 4E46A 1B0ZA 1SUCA 5K0GA 4L75A 4ZQIA 3OEHD 3D4LA 4KLNA 3B51X 2EDAA 3REQB 3UXMA 3H3JA 3C7AA 1HE8B 4UKDA 3WQHA 1H3EA 4U3JA 3E9DA 2HRBA 3AY3A 2RJNA 1N0HA 4C7XA 2JAWA 3DQQA 3IAM1 3CZQA 4UDNA 4XH9B 5ALHA 3TQOA 3UATA 1DAGA 2ZCJA 1KJ8A 7GPBA 4Y0VA 2GD0A 1V48A 3VYUB 1W29A 2Q7XA 3EIUA 6NULA 4AF7A 2PUBA 4GE0A 2HH9A 1AV7A 5G0TA 3ZZ1A 4ER3A 4JI4B 2A5YB 3P2JA 4X20B 4YUYA 1QCYA 1JQLB 1KZHA 3WGTA 3AL0C 4MA5A 1GVHA 1XT6A 2HFKA 1Q0LA 5ITZB 3HN6A 2NUPA 4UMVA 3Q7TA 2XDQA 5DT2A 1XZGA 3VI4B 5AM2A 3DEYX 3UANA 2A0YA 3QA3E 4YGXB 1BMTA 4ZHSA 1H4SA 3DT6A 2WKSA 4YPFA 1NW5A 3DD1A 3QVGA 4YCBA 4DTCA 2JFNA 5ILGA 1ZO8A 5C53B 2FG6C 1ISPA 2JL1A 1BX1A 2QTAA 3MUOA 4KVAA 4N5LA 3AVWA 1TA0A 4F38A 2Q2WA 2WLSA 3AR3A 1KKLA 4FFSA 2PKQP 4FWIB 1J0XO 4G0OA 2VJDA 2WFLB 1NVTA 2P6UA 4TXJA 1QH0A 4AB1A 4CT4B 4U2BA 5JNUA 3EE6A 3SZOA 4RTMA 4DAEA 2CNWA 1G3UA 2AN5A 4MCIA 4JYPA 3UYLA 1KEEB 2XITA 3I76A 4WIAA 1U2GC 3NC1C 2OV8A 4LXQA 1SOUA 1SUAA 3QELB 4W5RA 2Q7OE 1L4NA 1XC7A 4YMIA 3TSWA 4HDMB 2I1WA 3GFRA 5ALUA 1AMUA 4P7BA 1MIOB 1D04A 1XEFA 4RJIA 5DHQA 2H31A 3T9CA 4BVGA 4C0LA 3V4OA 4AF8A 5L40A 5TIIA 4C3VA 5M29A 5JRDS 3OTOB 3C0KA 3MB8A 4HWTA 4OH7A 3T3OA 4C0QC 1JHXA 4QPCA 3NVDA 1YKSA 3ZXYA 3RVSA 1OZHA 2JFGA 521PA 3DJYA 3EF3A 3VXKA 1KEKA 4N3AA 2NU6B 4NBUA 3UWDA 5D7NA 1CUSA 1C50A 1I01A 2ECOA 2XQKA 4ZVPA 1IJEA 1Y5MA 2A7XA 2ZE5A 4IH1A 4KVGA 3BQMB 2C99A 4RD1A 4WEOA 1O58A 2CXNA 3CNLA 3G88A 1LLUA 1QIHA 2WMNB 1NQAO 4X7BA 3SZRA 2ZU0C 1B76A 1NJ2A 1SUWA 3FXAA 2FXIA 2HNAA 2LDXA 3WQSB 4CBVA 3GJ0A 1DJMA 3TAHA 2O1EA 2ZBPA 4KAJA 1Y8CA 5IJ9A 5BWLA 3C3MA 3VOAA 1PE0A 2Y99A 2IYOA 2ZS8A 1E1QA 3ZVLA 3ZW8A 1EWVA 2OFPA 3HU2A 4DDVA 4ZDJA 5B58C 1VPEA 3ABOB 4S1PA 4RZ3A 3IERA 4OI2A 1RWXA 1OA0A 2BFBA 4GL4A 1JA0A 1U6IA 4GMGA 4XE5A 4BFWA 4DSZA 1KQ3A 4R0MA 4Q4DA 3IKTA 4ZVKA 5B7QA 3F78A 1VM6A 3HDQA 2AYXA 4B85A 4LV6A 3NHRA 3GARA 2BD0A 5FTKA 3IEUA 4WECA 3TQSA 2W2PA 4FYKA 2GN8A 4BX8A 1PUIA 2FEKA 2V65A 2C4VA 1U0GA 2DBZA 4WBXC 4EK9A 1GD1O 5A0FA 4EJSB 1MX5A 2Y0EA 1Z33A 2VZ9A 2AKYA 4ZEXA 4D8YA 2J07A 4CMHA 4CNQA 3D4BA 4QIHA 3UTDA 2QL9A 5JRZA 4KMMA 5KPJA 2W48A 1F8FA 4YJ2B 4BVLA 3B7WA 4G0YA 5TMPA 3O83A 1BVUA 1EZ4A 1T9ZA 4RH1A 4Q7KA 4DF3A 3ABRB 4AECA 5JY6A 5BY2A 2Y0BA 4XYBA 3LXRA 1O5OA 2X8WA 3HYLA 1U2RA 3A2MA 4TXMA 3A58B 4U7FA 3KZXA 1OBFO 3KD2A 3LHDA 1R4NA 1J9ZA 1CJVC 2GN9A 4TZ0A 1WEHA 2LBPA 3TLCA 4EKGA 3WGMA 1YL7A 1AV6A 4Z4EA 3JRWA 1HORA 1S4MA 2AFIB 2ZYAA 3LYAA 4QXOA 4CKBA 3HS3A 3WL7A 5MN4A 2PX3A 5J4HA 2HSJA 4EFNA 2RGEA 3U5TA 5C8YF 4JFAA 2R7AA 3HSSA 1E9BA 4QBHA 5LLTA 3UPTA 2YS7A 1YIOA 3EEFA 1BE0A 4OF4A 5KCMA 3SSAA 1JVSA 3MLBA 3F6YA 1X3SA 4G24A 2FWPA 1JMYA 2B83A 1RSZA 2PU5A 3DP9A 3PHBE 4X1KA 4DPLA 4RTSA 3TEMA 1X38A 3LQ2A 1VMAA 3VNQA 2XHZA 4L3WA 4S3MA 4KBGA 3WMRA 3HCBA 2BFOA 3QBJA 3PHIA 4M6WA 3W2GA 2BJVA 1DIAA 1O89A 4RXUA 3VPXA 1RBQA 3AESA 5CA0A 1N9KA 4HYEA 3VH3A 2G88A 4BEBA 2C3PA 2DBYA 3BMNB 3AM3A 1LI5A 1SZCA 2Q28A 2WDPA 2QRGA 4X1YB 5ELMA 2SBTA 3DC7A 3WY9A 1RABA 4Z3KA 4NCHA 5JXJA 4YDHB 3HK2A 2VVTA 2JGAA 3SIXA 4TSFA 1T1RA 3NWEA 4PR3A 3PT9A 4QJ4A 2PMFA 1PI3A 1GZUA 1QF9A 3G2MA 3ANMA 3G5TA 3UENA 4EHBA 3CVWA 1QG0A 1DFIA 5KTKA 621PA 3GQVA 4REMA 3E5HA 3PFKA 3LGSA 4CG2A 2X23A 1OI7A 2ZAOA 3NS7A 4E70A 4TTVA 2HI0A 3LY7A 3NTLA 4RTPA 1CB7A 4ITVA 2DM6A 1BE8A 1GNTA 3PUXA 3SJBA 3BS4A 5LQKA 3ZCRA 1WIWA 3K7EA 4AIIA 1BVRA 1TPYA 5EE1A 2FQ1A 1W4BA 3HXOA 4EY5A 1IRIA 1P0IA 4TTQA 2ZUVA 1NNI1 2ZREA 3AU8A 3D3JA 2ASEA 3JS5A 4ZAXA 1A8SA 4F2WA 2J41A 3M4ZA 3S2GA 5K0JA 4L4RA 3WGIA 4D26A 4UBLA 1OW3B 2C07A 2ZAYA 1MDBA 1DAMA 1PYOA 3WOVA 2WQZA 1EUDB 1SCKA 5E2IA 2IS4A 1YQTA 1E2IA 1K06A 2HZ7A 3NDPA 4ONEA 4N1AA 1IONA 3T3DA 1ZNXA 4BEVA 2GPSA 4HNRA 5DTEA 5EJFA 3NB0A 1FLDA 2ZBUA 3U3JA 4PSVA 2V5UA 4MZDA 3U17A 3AQIA 4KOEC 4FYHA 4QGSA 2NVWA 4KL8S 1EP9A 2ST1A 5FBQB 3SR0A 5LOVF 2VNIA 1GPH1 2C57A 3GDWA 1SUEA 2OXEA 1A76A 1ZGAA 4YRCA 3SSNA 1AJEA 1LPSA 5CFRA 3OFND 3UK7A 2C7QA 3LUHA 2ZM5A 5IK2A 4R1TA 1U1IA 2EF0A 3AEQA 3TAXA 2XKAA 5JCPA 3EMDA 3ZI0A 5JH7B 2VK8A 3MWEB 4GVXA 5IEJA 1LTHR 1W5BA 4GPD1 5K3DA 1R5BA 3C41J 5G53C 4MB0A 5DW3A 2RK6A 2WA2A 4FWBA 1HDEA 4B1FA 2YC4C 2ZE7A 4OQZA 3ON5A 1X7WA 1U9JA 3BB1A 4FWTA 4OUDB 4HNAB 5G0WA 1U4SA 2I4TA 2IYZA 1HV8A 2OSVA 3HXTA 3S1SA 2CD9A 5L3QA 3KLNA 3DZHA 5LLSA 4ETIA 1OWNA 2XGSA 1A2KC 1W88A 4MWZA 4PLYA 1Y6QA 4Y9SA 4BFUA 4CIAA 4MUKA 3CX4A 3U13A 5JXWA 1L8OA 3BBPA 3NDJA 4DJEC 5B7GA 2YCBA 1IQRA 3KJEA 3ZX4A 5IASA 4QU8A 3MJ4A 1RZ3A 1PW7A 5AM0A 3PX7A 4PEVA 3FX2A 2XDQB 2NQTA 1EAMA 3IMGA 2ATCA 5KOYA 3OC6A 4IILA 4FKBA 3X1MA 3V1NA 5K8UA 1XZ8A 1E3MA 4XTCS 2GUWA 5F5NA 2J4CA 5SY4A 4FDAA 4EQZA 1X7GA 3SMVA 4DPKA 3LUAA 4KR3A 1PJAA 4ENTA 3A6KA 2RAVA 1MEJA 3ROKA 1YMQA 3BSWA 2FTKE 3WYDA 1U6KA 3FKSD 3ZE8A 1GZSA 4TKLA 4RIHA 3EGCA 1VCMA 2OHIA 4QT4A 2IXFA 3GJ6A 4CCWA 3M6FA 3SLKA 3TBKA 1HYGA 2DAPA 3JWEA 2XVYA 4W5HA 5BNIA 2A5JA 1KWKA 1TJYA 1A82A 2GTPA 5LD2B 3ZBTA 5LB2A 2O14A 3NG1A 2IL1A 3T9BA 5C8DA 4Q93A 1XELA 5J4YA 1DC6A 5T8KA 1N2CA 4JWTA 4X93A 5A3VA 3VJMA 3EIWA 4CM9A 2YXNA 3KZMA 1KPIA 3L3BA 4DIEA 2BGMA 4EEXA 1TYDE 3KKEA 5JLJA 3A6PC 1HGXA 3WV5A 1XD9A 1XCJA 1N5LA 5HNKA 1W9MA 3U3ZA 3A6EA 3BXZA 1GSOA 4M38A 3E7DA 3CVXA 3Q9LA 2K6GA 3CRVA 2AF3C 2E4UA 4JUCA 5LIRA 2OV4A 1WXXA 5LXTF 4KN6A 1ZI9A 1QZUA 2Q3LA 1HLFA 1JFLA 2E4XA 4MVJD 4XLZA 5ABPA 1L7QA 2VHUA 2VR1A 3L8YA 1SPBS 2G8LA 5B3JA 3K1AB 4I6EA 1Q74A 2BWJA 4Y2SA 5C35A 2QQFA 2DHQA 2IODA 2P0EA 1YR7A 3BC1A 1YDFA 2NTEA 2P2NA 1TTPB 3H2BA 1IBCA 5DWDA 4BWGA 1WCV1 1CG6A 2F43B 3KSDO 4LXTA 5IVKA 3TSCA 3ENKA 4ICIA 1DINA 1XHFA 3UM9A 3V1KA 3OZGA 1C4KA 1T36B 2OAP1 1JQKA 4S0XA 5AHWA 5ENZA 3TQQA 2QPOA 2V96A 1PT6A 4HUJA 1D6MA 3A7EA 4LRQA 2WUFA 4PONA 1M5RA 721PA 4M9RA 2ORED 1K92A 3D81A 3I8XA 3QLEA 1GOTA 1UMCA 3PLRA 2H00A 4LRSB 4OBXA 4W82A 4D9HA 4J91A 2R8OA 4XX0B 4EL0A 1AMOA 2XVZA 3GG9A 5CVEA 1N78A 4QVKA 3T4PA 3GRRA 3DTNA 2VTEA 1CNFA 4RC9A 4XD7D 1TDJA 1QU2A 4Q82A 3A32A 2CLOB 1OI3A 1CC1S 1WMFA 2FSFA 3ZV5A 3REFA 5KJEA 3SSOA 2JZNA 4FPXA 4M49A 1JI3A 3VVBA 4CM8A 4C0HA 1XRLA 2FP4B 4YO8A 2WMYA 3RRFA 5C8ZA 1M6NA 1XYGA 3AKEA 1OWMA 2OLEA 3DHEA 3MBKA 4FHEA 5B1EA 5K0NA 1E2JA 4HB2A 1IBSA 3QU2A 3R3ZA 3KYDB 3NV9A 1FS4A 3IEXA 4RL4A 1GA1A 3C5WP 4RM2A 3GAAA 3S5JA 3H19A 2IF0A 3TVDA 4R6WA 5E9QA 2YJ3A 5LMCA 7YASA 2P9QA 2CJWB 1XZDA 4NMWA 1UPUA 1ZA1A 3LO8A 3PFGA 3B82A 1VG0B 4KMOA 1P9RA 3OEED 2PRJA 3LYHA 1JBKA 2ON6A 5JI3E 4POOA 4WZAA 4NSNA 4IIFA 4XVRA 4ND8A 3IOCA 2NX2A 5CA0F 4L3OA 3QPCA 3U7IA 4O59O 5AM1A 1QH8A 2IYXA 5LMUB 2EKBA 1ANKA 1ACMA 5K8TA 5TGZA 3ZIDA 4Z4IA 2IZZA 5GTDA 5KQPA 2JIZA 5A05A 1CP3A 1YIDA 3MCVA 5AKEA 2W2VA 4GWGA 4HYTA 4ODIA 3QIAA 1EWRA 3KT6A 3OJ0A 3G1TA 4JX8A 2OFXA 4OM7A 3RKRA 4A2CA 4CTJA 3OUZA 2HUNA 2Y1LA 3BL8A 1OIWA 1P5JA 3I5UA 2IP2A 3N6RA 4OYHA 4Q1BA 5AK5A 5KYWA 2WIJA 1XK7A 4TT3A 1PZEA 4TSKA 4KR7A 4A36A 3D1LA 4PX3A 4YMUA 4IO0A 4JASB 2AG0A 2HA3A 3K9WA 4MAMA 1Z0JA 1KQGA 2FX3A 1VSVA 2W00A 2XYQA 4QJIA 1K2VN 4GLOA 3TIFA 3KT0A 3KOZA 1G4HA 1KKUA 2QU8A 4RU1A 1NBHA 1XTBA 1YJCA 1EE2A 4AYWA 4P34A 2BEKA 2B9EA 1LK0A 3DB1A 4ROTA 4IXNA 1G3MA 1E2MA 1NVGA 4ZAVA 5AKHA 1P91A 4JL5A 2KS6A 1ABEA 1X1AA 2C5GA 4HNUA 2KSQA 3DH0A 5HYVA 3D7SA 2NAFA 2X8AA 5HK8A 3GFOA 2EF1A 2O9JA 2PX6A 1UXJA 2BSAA 3EDYA 4K9SA 4L28A 1YMVA 3VR5A 4OGGA 1HDRA 3LSTA 4ML3A 5BQ5A 5IKMA 1AGRA 1VTKA 1YBMA 2F3UA 3E3AA 2Q4EA 3CW9A 3RJZA 4ZHQF 3BGVA 1M34B 2WEKA 3DVQX 3O3OB 5E1DA 4ZT7A 3WBKA 1BD4A 5HJ7A 2IQIA 3C6KA 3IEKA 2ZRKA 4RA6A 5T4FA 2ZJAA 2BEWB 1WS6A 3IIJA 4KCGA 1SOAA 4DB4A 1RJDA 5IKOA 4GUDA 1S8NA 2R47A 1E7WA 1QPBA 5C8YB 3ZWQA 4ZAGA 2Z2XA 4DCJA 4B3SB 3JQQA 4DEYA 5D5QA 2YJ4A 1EINA 2QT1A 3DAFA 1WUHS 4IJVA 1PG0A 4QGFA 5ERGB 1XTTA 3FGPA 1FEZA 2VJYA 1FQOA 1MOZA 1D2MA 1LRLA 1VHLA 2FX5A 1B8NA 4QL3A 3TD2A 5L3SA 2JLCA 2RH4A 4E5NA 1UEJA 2Y4NA 3MLAA 1CB0A 3D7LA 4Y1RB 3FHJA 3ZH9B 1CPYA 3V5NA 5LP1A 4Y6PA 4UM7A 3WADA 1YQQA 1JILA 2C97A 2N1BA 3DAYA 3GGDA 1JH8A 2QAIA 3BWBA 4KFRA 3KT3A 4XSGA 3G17A 4E0BA 1Q92A 1Z6YA 5JFOA 5IULC 4NV3A 1HMYA 5B3AA 1H66A 4DCVA 3H84A 4QEKA 1IRXA 3CJRA 3QVUA 1VIDA 4CG0A 2R3SA 1DCFA 2SICE 2ALJA 3DW1X 3HBJA 4J1SA 4L7VA 4HDAA 5CM8B 2FFAA 5FTLA 2YZ7A 4FT2A 4EABA 5G02A 4EITA 3KYCA 5EIEA 2HYIC 5DMXA 4AZ3A 2QUJA 3IHKA 1SURA 1MGOA 2G1KA 3M34A 1AKNA 3O3NB 4FZJA 1U9ZA 1I7PA 1PQWA 2XMPA 3OSUA 4GKBA 4ND6A 2PNFA 4RMGA 5FBZA 2WT9A 4ON9A 3CF4A 4NKRA 2Y0PA 4UBKA 3JVUA 4COKA 2VF2A 3BWVA 3UFXB 5D01A 4QXQA 2GEFA 2PT9A 3BK2A 1XF1A 1CKEA 1TFRA 4I46A 2A78A 4HG2A 1S1CA 4C7JA 4J0DA 2WJ4A 1A0OA 2J5QA 1SGWA 1TAGA 5EZ5A 1F2UB 1ZH6A 2DKFA 1UQUA 1EK1A 1UWLA 4M1WA 4Y6SA 1I8TA 4DJ5X 3U0VA 5JS1A 2WNIA 1I6MA 5E3HA 3VH4A 1V6SA 4EW2A 2PJUA 1BU5A 1DI0A 2OCPA 1SNYA 1V1MB 1X6VA 4P35A 5A5EA 1N5KA 1R9JA 2RG1A 4RTQA 1EVIA 3MNFA 4TKZA 2GEVA 3TS1A 3GJ7A 5EZ6B 3ZGYA 2I8LA 3NO4A 1ONBA 3P52A 1JVNA 2A0WA 3MTGA 1F5NA 1O3YA 4G0ZA 1JDTA 3P0EA 4YRJA 1HZJA 1JJ7A 5CIWA 4KHPB 4QHSA 1A4IA 3G7NA 3B2EA 3RD5A 4TMXA 4AK9A 3GFBA 3NEAA 3X2EA 2I6UA 2RGUA 1Z8HA 1YZQA 4XA8A 1NI4A 3IKVA 3RVQA 3DPSA 3PHHA 5AXBA 4EYSA 3MMXA 4EECA 2Q9BA 1Z4JA 1RYZA 3MRVA 1FW8A 1S4QA 1MGPA 4YGYA 3IB6A 1I1NA 4HYQA 4QLBA 1FZQA 1N2CB 1UJ4A 3E2PA 5FTMA 3AETB 3WIDA 1U31A 2V7BA 4UEQA 5L4LA 3EG9B 3RCBA 3DEZA 4U39A 2VJPA 4B80A 3OQPA 5FWYA 1DAOA 3AEZA 5L3VA 1QFYA 2JJ8A 1Z73A 4JHLA 4OLAA 1G6HA 1NQWA 4H15A 1ONSA 2J09A 3FKQA 5EMHA 1UODA 2FUEA 2P68A 4KPUB 3K71B 3AVYA 4UDYX 3UOWA 3EBLA 4UD6A 2WF8A 2H08A 4WK4B 2V0GA 1NW7A 3MQ4A 1VCIA 3USES 3EVGA 2PCLA 1Z4LA 1V1JA 1S2IA 3OFKA 4EFDA 2AQ8A 1BKDR 4NX2A 3EQ6A 4L4ZA 2P41A 3P94A 5AVOA 2VWPA 1K2WA 1YCHA 4ITRC 1KO1A 5JR3A 5ILOA 3O8QA 1IQPA 3OY2A 5EP1A 5JCZA 1QVZA 1XPUA 3D6MA 1SZJG 1X7ZA 3GQBA 1V2HE 1ZGJA 2Q99A 2JFPA 1O96B 1YS1X 3F90A 1XQXA 3RASA 5K05A 4N47A 3NDBB 3DOIA 4FW8A 1P2FA 4YRQA 2YZMA 4R54A 3H75A 1N1DA 5BWBA 2F8LA 2QN9A 2OAEA 3DPIA 3GCDA 3C3EA 3ZWAA 3IEIA 1T10A 1TI7A 1XEWY 4EZIA 1ECGA 2OOSA 1M73E 5LOVA 2XWJI 3D6VA 4XSVA 2ZYTX 4FQ7A 3ZE1B 2AFRA 4RTNA 5HKAA 2XIQA 3JQBA 4X8MA 5DM70 1YA6A 4MHTA 1P72A 10MHA 3L40A 2JI6A 1NWHA 1PJ3A 1MW9X 4NG5A 1J2EA 2SCUB 2E85A 2AG6A 5B3JC 1C0EA 1NF3A 4WGGA 4XKJA 1KFCB 1UAYA 3MERA 3MRXA 4NYIQ 4Y1FA 4DLKA 4WNAA 5KVAA 4KK3A 2PUFA 1DIRA 3IMFA 2W6ZA 3NHAA 1RQNA 1JDUA 2QV0A 3Q5EA 4HLDA 4QAQA 4UTZA 3T4XA 4LOLA 1CQIA 2X7XA 4R6XA 3TZLA 4ZI3A 2C95A 2BI4A 4BVBA 4NCNA 2QHXA 1PLJA 3FRJA 3UWPA 1F60A 5TMBA 1YVRA 3E22B 4A2QA 1LI7A 4WNYA 3AG6A 5IMSA 3IESA 1LH0A 1CUGA 1JU9A 3TOVA 3ZTYA 3DUFA 4BKUA 2XMGA 2R79A 2PK3A 2QTWB 1W75A 4L74A 5TLSA 2QP3A 2B69A 4XRGA 2OBNA 2QTZA 4AM8A 4MLPA 4F9GA 3I30X 3N8GA 3OIWA 4M7OA 4EY7A 4K2AA 4MJXA 1GN9A 2SNIE 4YWJA 5FFFA 2BKAA 2CW5A 3WJ7A 5LXTB 2Z9CA 5K99A 1C3VA 1GGFA 1NDHA 3JZFA 3PNVA 2QUBA 3IFSA 4YBRA 2XVXA 3B8EA 5EAIA 3HCDA 1NQ5A 4N5HX 4WZAB 2AJCA 5B1SA 5B1YA 2XCTB 1B2RA 1CYDA 4QOHA 3DZBA 4FLFA 1UJ5A 1YDEA 4RHTA 1DBWA 1EFRD 1QH1A 1SVSA 2Q4RA 4MVWA 4PZCA 2NUAA 2CSUA 3HO8A 4URWR 4I36A 4EDFA 3ANSA 3QPAA 1O8CA 4ZOLF 3UMSA 1SD5A 2B4YA 1F51E 3BXXA 4K6KA 4H3SA 1KMQA 2B34A 4FCVA 4NZOA 5C4MA 5C80A 4INZA 4BLUA 1NW3A 2PXXA 1WHTA 3KXKA 3OWHA 3UT6A 1CR1A 1JG7A 4DV5B 1H69A 5EP2A 1Q44A 2CDNA 3OKAA 5GONF 1QQ6A 1XRRA 4UHDA 1R9GA 1H4VB 1VXRA 1XJWA 2REQB 1YH3A 3QOXA 4H08A 1X3LA 4MR8B 1T8UA 4RF3A 3DP7A 3QWHA 3K05A 4XIYA 3VBCA 2NMVA 4G37A 1DU4A 4IOJA 1NZFA 1MAAA 1T5TA 4HDKA 4AKHA 2ONCA 4TQGA 3M2TA 3PTZA 4ZO9A 3SC3A 2F2TA 3NP9A 3U1BA 3DBHA 1J2TA 2P9EA 4GECA 3T7SA 1F7VA 1Y8QA 2X5XA 2BFEB 4Z9AA 1RS0A 1H42A 2YV3A 2ET6A 3BKXA 2WILA 3FHOA 4O4HA 1SOWA 1LPBB 1FB5A 4PG5A 2ZSIA 3HP4A 4P1ZA 4ZQEA 2WT4A 1XLVA 3OTWA 3C14C 4QELA 3EIEA 1NX9A 2MU1A 2XRFA 3TBHA 4TKMA 5FR1A 3AFIA 1GGJA 3UHAA 2AYYA 1G5FA 1O7JA 3ZK9A 3TRKA 2VHVA 1CY6A 4BO4A 3NBZC 2WNHA 3F5MA 4GLLA 4AW9A 3VR2A 3IAS6 4KDRA 4PQEA 1F4PA 2H5IA 1R74A 1BMFA 1ZIYA 2IU6A 4FN4A 2QZSA 3BTVA 4G0PA 4UTRA 3SXUB 2JKVA 3QEOA 1WW3A 3HWX1 4I8DA 2XMQA 4M46A 5HILA 1Q6YA 4YAIA 1F8GA 2NQ8A 4WT7A 1JJVA 3VPHA 1A2BA 1VC2A 2X1VA 1G63A 3Q0TA 4MUNA 5E9JA 3TZHA 3TG8A 3N7UA 1MRNA 4KIWA 1XQWA 2AR9A 4JR2A 1CF2O 4JSTA 4B5KA 5BWCA 3HY6A 5JLAA 2BP7A 5CA0B 5L3SB 2VEDA 1II8B 5T67A 2RC5A 3EJWA 2ZYIA 3MYYA 5KU1A 1IG0A 1OJLA 2RBEA 4ZOLA 4YJHA 3OMWA 3ZD7A 4FD2A 4U6QA 1YR8A 1FUUA 3CUTA 3R5KA 5J59A 3TLBA 1Z45A 5BW5A 2XTJA 1SXGA 1TVKB 3AM5A 4D3ZA 1XU7A 4IOKA 5JPDA 2A0KA 1M2EA 3EISA