2QXUA

Crystal structure analysis of the bacillus subtilis lipase crystallized at ph 5.0
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the remarkable stability of Bacillus subtilis lipase (Lip A) at low pH
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Lipase
total genus 65
structure length 179
sequence length 179
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qxuA00
2I3ZA 1AKNA 4X3CA 4H7FA 4BCCA 5ALGA 1BN6A 1AZWA 5JALA 3D2AA 4AMZA 4BRZA 3S8YA 3VXKA 2Z5GA 1UK9A 4LIPD 2HA0A 5K3DA 1G5FA 1VZ3A 1HKHA 1QIKA 5LZ2A 3FYUC 1ZI8A 1Q84A 2GZSA 3W2TA 3Q0TA 4WFJA 5AI0A 3KD2A 3WK5A 2AJDA 2PBLA 5AJHA 5AKXA 4QE3A 1CUBA 5JADA 4IQ4A 1XZEA 3WL7A 2YH2A 4J03A 3O4HA 4J7AA 3PF8A 4C4XA 1ODTC 1K8QA 2JBWA 4KR0A 1XZFA 3HJUA 1LPSA 3NWOA 2O2GA 4DTCA 1F6WA 3WK7A 2WIDA 5ALHA 2XMCA 5CBKA 5DJ5A 1FJ2A 5A71A 1DWQA 5AKGA 2HU5A 5C8VA 1L7RA 2ACEA 2ZYRA 2WM2A 3HABA 5EIHA 3VKFA 1MNAA 4CCYA 1T2NA 4JNCA 1I6WA 3O4JA 4FNGA 4CG3A 1E89A 4G4GA 4BCBA 3H17A 2AJLI 2O2IA 4JYMA 5J3JA 4YASA 1ZD2P 1C7IA 4KJXA 4Y2JA 3SC2A 1JU4A 4AN1A 4BZWA 1WHSA 1QTRA 5EI5A 2QVBA 4X91A 4BTVA 5EIAA 2WHPA 4W9RA 1FFDA 4K2AA 4PQEA 2HDWA 4EBBA 1IMJA 6YASA 4GW3A 2XUPA 3AIOA 5AIBA 1DQZA 2PSJA 4MWSA 4DMCA 1H2XA 1U65A 2ZSIA 3R40A 2XUAA 5AKYA 5CMLA 4UFPA 4O08A 4BP9A 3U0VA 1TCCA 2BFNA 5CXXA 4WDRA 3SK0A 4H0CA 1J07A 1VXRA 1H2ZA 3KSRA 4AZ3A 2BCEA 5LZ9A 5LYYA 1MNQA 5K3FA 2PSFA 5ALTA 5FPPA 5HZGA 2Y1KA 4MYSA 2BUAA 5AKKA 3X3HA 2Y2UA 5IVIA 4K5QA 1J2EA 1A8UA 1HL7A 3DKKA 5CH3A 3A6ZA 4H7HA 3O95A 3C5VA 2WUFA 4OU5A 4RE5A 4W1PA 3WWCA 4LXGA 1LZLA 3GBSA 5AK4A 4C4YA 5AHXA 5ALWA 2AJCA 1XQYA 2XUHA 3C8HA 4DMHA 1A7UA 4BYMA 1VKHA 1XLVA 4YK7A 2OG1A 1XQWA 1RYYA 5FPQA 5ALJA 3ZLVA 4NVRA 4KAFA 4H7JA 1CUWA 4C6HA 5AI6A 3G8YA 2PPLA 4FKBA 5KWIA 2RAUA 4PF1A 2JGFA 4AX4A 1LPMA 4N8EA 5E2IA 1NU8A 4Q34A 2CKMA 1EDEA 4Q3OA 3I1IA 5H3HA 2PM8A 5EHZA 4DNQA 4G1FA 1G42A 2UZ0A 1UXOA 1GPLA 1ZGCA 2WIGA 3KWFA 5EHQA 1VE6A 3CXUA 1PJAA 3VISA 2XUKA 1OXMA 1WB5A 4NZZA 4LYEA 5C8ZA 1UKAA 3D0KA 4DIUA 2VAXA 3I2GA 4EY6A 4X6XA 4F0JA 1E8MA 2PL5A 2PU5A 2LIPA 3FYUB 2QTBA 4YX9A 2V96A 3FOBA 4X92A 2PVSA 4WY8A 3VJMA 4C01A 3WK6A 1BCRA 2BGRA 1TK3A 1ZJ4A 5AM5A 4BB0A 4MWTA 4U2EA 3R41A 5CH8A 4E15A 4BVKA 1BS9A 1K4YA 3H18A 1BE0A 5AI9A 4NS4A 1GKKA 2IITA 2WHRA 1QIGA 5AM3A 1L7AA 1W4LA 5EFZA 3DKRA 4Y2SA 3A2MA 4EA6A 3T52A 3PFBA 2G63A 1PFQA 5D3KA 1SFRA 2HA6A 1QFSA 2X5XA 5ALZA 1Y37A 1QZ3A 2PU7A 4XX1A 4GEGA 3RKSA 3STVA 5IH7A 2C5FA 3A2LA 4XJVA 3ED1A 3I28A 2WKWA 5AI8A 5JANA 2OAEA 5CT6A 4WDQA 4X94A 5JAOA 2QMQA 3WL8A 3WYDA 3HSSA 3FVTA 3AIKA 4AMYA 4ZXFA 1EA5A 3F97A 4G5XA 4N8DA 4QLAA 2QR5A 1CUJA 1LGYA 2XUQA 4UBIA 1YCDA 4B0OA 1ZD5A 2HU8A 1JFRA 4CI9A 4HTAA 1YSCA 5LIPA 2WU3A 4U2FA 5JAPA 3A70A 5DNVA 2PSHA 4IH1A 1UFOA 4P08A 3M82A 4QDOA 1MU0A 3QZUA 2WUGA 3WYNA 4C87A 2WFLA 5ALQA 1VA4A 4ITVA 5JD6A 4H7EA 4WFKA 2VT7A 3ESCA 3DDUA 4GHWA 5T4FA 1VE7A 1JJIA 1CUAA 1MN6A 1XQVA 5ALOA 1F8UA 5EHNA 2VJBA 3WWOA 1THGA 1ORWA 1J1IA 2QOEA 5CW2A 2WHQA 3WKDA 4UPDA 1XZAA 1JMYA 1E3QA 1GGVA 2Z3WA 2GZRA 3H1BA 4ROTA 5JIBA 3VVMA 1MX1A 1ODSA 1ZI6A 4Q1VA 3WJ1A 5IVHA 4K6KA 1CUIA 2B61A 4ETWA 3L1IA 1CUDA 1YR2A 2J3DA 3C6ZA 5K3EA 4B9EA 1EINA 3QPCA 3E0XA 3FCXA 3BDVA 1FFEA 4QDUA 4BDTA 3N0TA 1QGED 4FNMA 3I2FA 1JI3A 1GPNA 2VTVA 4UHBA 1G4HA 5ALKA 2C4HA 3IVMA 3F8SA 4Q05A 2CZQA 3ANSA 1W75A 4FWBA 3I6YA 3PF9A 4GI1A 5CT4A 3CCBA 3LP5A 3G9ZA 4KE6A 3K9BA 5DWDA 1WPXA 3GZJA 1XKTA 1XZKA 3FSGD 4HVTA 5I7UA 4G8DA 3WL6A 1QIIA 3QMMA 4OB6A 5HF6A 2YASA 3EQ9A 4XWGA 5HQ3B 4B6GA 3PE6A 5I8PA 2QXUA 4LXIA 1VJ5A 5BOVA 1XZBA 2ZSHA 2QKYA 1MT3A 2OCGA 4BAGA 1OCEA 3IUJA 1UZAA 2QXTA 2XMZA 1GT6A 3G9XA 4E46A 4KAJA 3WLAA 1A88A 4EY7A 2EEPA 4AN0A 4UBLA 1XRMA 1TCBA 3BJMA 2G4LA 1S8OA 3O4GA 1MO2A 1U2EA 5LP1A 1K63A 4IO0A 5DYYA 7YASA 2HFJA 4N8SA 1LPBB 3D2CA 2HA4A 3V1MA 3ANTA 1B41A 1Y7IA 3C43A 4UBMA 2EDCA 2X8BA 3WA7A 2CB9A 2VA9A 4B0PA 4CG2A 3HLKA 3DD5A 1QO7A 3P2MA 1XZLA 4UUQA 1X2BA 3RARA 4KRXA 1CQWA 3UUEA 4QWWA 1XKLA 4F60A 1UK8A 3D5EA 5HKAA 3JYHA 4JEIA 4F21A 1U8EA 5CTAA 2WHPB 2PSEA 4WFIA 3G0GA 3ESDA 3H1AA 1QONA 2XMRA 3WZMA 1YASA 2J4CA 2WJ3A 4GXNA 2WFZA 3PUHA 1O6GA 3M81A 5FXMA 3I2KA 1UWCA 2ZYSA 4PSDA 5FLKA 5FP0A 2Z8XA 3K2IA 3F67A 2XMQA 4ZV7A 2RHWA 1W1IA 3UUFA 2V9ZA 5ALIA 5ALDA 2XMBA 2RI6A 3V1LA 4X95A 1EVQA 4Y2XA 4ZGBA 1XROA 3D3NA 3QITA 1EH5A 1UOPA 2XT0A 1CRLA 3N2ZB 4W1RA 3H2GA 2W22A 1ODCA 3V1KA 3QM1A 3FWHA 3HACA 4DMFA 1ZIXA 3GA7A 5AOCA 5FOQA 3SX4A 2B20A 3WKEA 4X71A 3DL4A 4UBKA 5FUMA 2JIDA 4TGLA 3STXA 1F0NA 5EHXA 2QS9A 3C5WP 3H2IA 3DEAA 4V2IA 3EQ7A 3JW8A 2WILA 2OXEA 3OOSA 3TGLA 2BGNA 1DX6A 4J3JA 5D7BA 2XQJA 3C6YA 4ZRDA 3WKCA 3ZWQA 3BF8A 1CUUA 3NGMA 4MEBA 4W1SA 5I9IA 1Y7HA 2FUKA 2P8SA 3SWWA 5BWCA 4AZ0A 5LZ5A 4J0DA 4FLEA 4PNZA 3VJKA 1E5TA 1IUOA 3IDAA 3W05A 3R3XA 5T4BA 1SC9A 1UKCA 4WJLA 1HPLA 2JEYA 2QUBA 4QDTA 4U2DA 1LBTA 3FYTA 1D07A 1GKLA 3HXKA 2B4KA 3STWA 1U4NA 2HA2A 4BC0A 3FLBA 1SOMA 4TVKA 5LLSA 2XE4A 4BVLA 2WIKA 1YAHA 1HBJA 2WG0A 4M0FA 2PUJA 2QM0A 4EZIA 4J0GA 1PV1A 4BBZA 2JGLA 4DSZA 1EVEA 4LHEA 4UHCA 1K5PA 3DYIA 1XFDA 1DT5A 2OQIA 1ETHA 4J0CA 2ZJ7A 2ACKA 4AO6A 3H04A 1QIFA 3STYA 3FLAA 4OB7A 4KRYA 1W52X 4XIIA 5AI4A 3BIXA 1W76A 3AFIA 4M0EA 4DNOA 3LLCA 1VA5A 4EY8A 3WA6A 1DINA 4GDMA 4N5HX 2R11A 4GECA 4H18A 2BUCA 3G7NA 4MJ3A 5EIEA 4B82A 3TJMA 2PSDA 3DCNA 4QEKA 4L9AA 4EB0A 4HXGA 3BWXA 3E4DA 4G4IA 3WWPA 2OCKA 3D4LA 1DWOA 2HM7A 1QOZA 2J3QA 3WL5A 4KYVA 2EDAA 4IHAA 5A7HA 2BUBA 4GLBA 5FDFA 1ACLA 4H7IA 5ALPA 4UBJA 2XQKA 1FFCA 1CV2A 1JMKC 1GXSA 1HLGA 5C7YA 2YYSA 3F98A 1IZ8A 5F4ZA 2VQ6A 1KU6A 3GUUA 3H2JA 4XVCA 4U2GA 3VVLA 1AURA 3UMJA 1LNSA 2IX9A 4UHHA 2QJWA 4FMPA 1CUCA 4RGYA 2OCLA 1JT2A 1X70A 1Q83A 2FJ0A 3WWEA 4CG1A 4B81A 3R3WA 2VF2A 1T4MA 4FFWA 3ZLUA 5K3BA 1W6RA 3G0BA 3R3ZA 1XZIA 5DTIA 3LCRA 5HKBA 2PX6A 3OC0A 4J0JA 4KAAA 4X6UA 3R3YA 2XUOA 2H7CA 3DJYA 3WKAA 3FVRA 4PSCA 1WB4A 2XQFA 4AO8A 1J06A 1XZCA 1XRPA 4E14A 3QH4A 4N5IX 4RE6A 5ALYA 4HXFB 2CEKA 3JWEA 1CUVA 4Y2RA 2OGSA 5JD5A 2WUDA 2C0QA 4AQDA 4UFOA 4UBNA 2GBIA 3IUQA 5CH5A 1MAHA 5CT9A 4Q3KA 1BEEA 2Y2VA 3ICWA 2GYUA 1ZICA 3KXPA 4L3WA 4G8BA 1R50A 3CN7A 4I3FA 4X00A 1R3DA 1BEZA 2W6CX 3DOIA 1UOQA 2RHTA 2DQZA 4MEAA 5LZ4A 3PICA 3STUA 1QIJA 4B80A 4DNFA 5A6VA 5ESRA 5ISMA 4G8CA 1WCYA 1TCAA 5AKZA 4OUKX 4AB1A 2JF0A 3AUKA 3D7RA 4Y2PA 2JGKA 4B84A 3BIWA 1CUFA 1EB9A 3WQHA 2WFLB 2D0DA 3H2KA 2B9VA 3QPAA 1RWQA 2WSLA 1ORVA 2HHAA 2JGEA 3IBTA 4HAIA 2WIFA 2H9YA 4H35A 4KE7A 2JGJA 1WB6A 1MX9A 2OLEA 1CVLA 2WG1A 4OCZA 3VDXA 1FFAA 1L7QA 4P93A 3QMVA 1C7JA 4X93A 3IB3A 5K5EA 1TIBA 4K6GA 5AIAA 2XDWA 4EY5A 4IH4A 3ESBA 3EQ8A 1SCQA 2X76A 5JZBA 4OPMA 1E66A 4FBMA 5IKXA 1N1MA 2HFKA 1XRLA 4X97A 3FSGA 4Y2UA 4A23A 3DLTA 1WPRA 4BE9A 3PDCA 3I2IA 4Z49A 4EHBA 1WHTA 1XZMA 1R9MA 5ALSA 4UHDA 5T4HA 1CIJA 2DQYA 3W9UA 5KBYA 4B7ZA 4ZI5A 1X2EA 3I1YA 5SYMA 4QNNA 2I3DA 3R3UA 2DHCA 4Y9SA 2R8BA 5AK3A 4FOLA 4A16A 3IUMA 2VSQA 5E4YA 3LIIA 4Y2QA 4QLOA 1YS2X 3F9CA 3B12A 4U2BA 4MYDA 4X7BA 1QIDA 1HQDA 2DSNA 3FBWA 3V9AA 3HYSA 3QVMA 3RK4A 5D6OA 2FJPA 1AMNA 1TKRA 2I03A 1LZKA 1VXOA 4OYLA 5CURA 3WK4A 2WQZA 1FSSA 1GQRA 3OG9A 1ZI9A 4H7DA 5ALMA 5DTJA 1YAJA 4LXHA 5AH0A 3O9VA 2OGTA 3AZPA 2ZVDA 5AICA 2HA5A 5LZ7A 1CUEA 1WOMA 4BZZA 4ZV9A 3OURA 3WWDA 5HF9A 4BC1A 2XUFA 3TEJA 3DL7A 2JEZA 1Q0RA 4PW0A 1DX4A 3WKBA 3V1NA 4BVJA 4DSAA 1LBSA 1CUGA 2QZPA 3F96A 1N8SA 5JATA 2DCMA 4UBOA 2OQVA 2PUHA 2C5GA 1CEXA 1NX9A 3QYJA 1DTEA 2ES4A 2Z8ZA 3L1JA 4ARAA 1SCIA 5ALNA 4DLNA 4DYHA 2DFPA 3BF7A 1EK2A 2WG2A 2XQIA 3DYVA 4CCWA 5BWBA 4AXBA 2H7YA 4C4ZA 4FBLA 2QRUA 1DWPA 3G0IA 5HF5A 1QIEA 3ZV7A 1R88A 5HK9A 3NOXA 5AKHA 5DNUA 1E8DA 1YA8A 1VZ2A 4X85A 2BKLA 2HA7A 2BAGA 1TAHA 2DHDA 3LIPA 4J0KA 4EY4A 3HI4A 4CIBA 1IVYA 1GQSA 2WJ6A 5KREA 3EF3A 1AUOA 3M83A 5AKJA 4QZVA 3C8DA 2HU7A 3E1GA 2O7RA 1R9NA 1EX9A 4OYYA 3GFFA 2ZYIA 1MAAA 4NMWA 2JGIA 3G9UA 3QMWA 4JYPA 3QPDA 4F5ZA 3BE8A 2G5PA 2HRRA 3W9BA 2WU4A 4DM7A 1P0PA 3WK8A 1ZGBA 1C4XA 5A2GA 4BCDA 5E4JA 5FRDA 2HIHA 4BRSA 3I2JA 1QO9A 5DYTA 1CUYA 5D3ZA 2VT6A 4G4JA 4A5SA 4AO7A 1HDEA 4UHFA 1B6GA 4OD0A 2ZJFA 3LS2A 2ROQA 5JARA 5JASA 2ORYA 4KE9A 1FFBA 4CCYB 3DOHA 4K6HA 5JZ9A 1EK1A 2Y6UA 3OTQA 2HA3A 1O6FA 4GWLA 3R0VA 1QIMA 2DHEA 2VJDA 1N5MA 1EXWA 4KEAA 2AJBA 1QJ4A 4QDXA 1CQZA 1UK6A 4LYDA 2QJRA 4W1QA 2RIPA 1ACJA 3HC7A 2WJ4A 4J0HA 3ZI7A 1E8NA 3IIIA 4BDSA 3IURA 5JAHA 5CT5A 3A2NA 3WI7A 5A62A 1SCKA 2O7VA 1OILA 1XRQA 4B85A 5ALRA 5AOAA 1UT6A 4HZGA 5A7GA 3NUZA 5HFNA 5AKIA 1QFMA 4INZA 1GPKA 2GBFA 3BJRA 2AXEA 3STTA 3KOOA 1XLWA 1A8SA 2GYWA 1XZGA 1AGYA 4I4CA 5AM1A 1NU6A 2XMDA 4WCVA 4FHZA 2VATA 3ICVA 1MJ5A 2Q0XA 3AINA 3H2HA 4PSUA 5A7FA 1H22A 2JGMA 3IUNA 3V48A 4B83A 3HEAA 3FCYA 1XZJA 1BROA 1RP1A 4Y2YA 1CUSA 5K3AA 3AJAA 2ECFA 3OPMA 3C70A 1GZ7A 3FNBA 3H0CA 5K3FB 1KEZA 1MX5A 3AZOA 3I6MA 3O9MA 1BRTA 1EB8A 2DR0A 3ESAA 4GBGA 3ZPXA 3GELA 3BXPA 3EBLA 2XQGA 2PKYX 3KDAA 4L0CA 5ALVA 1N5RA 1LPNA 4Q82A 3FAKA 3MUNA 4FDMA 3FLEA 5AK6A 4MQMA 1DT3A 1KU0A 4LKOA 1QIHA 1JJFA 3KWJA 1DQYA 5DLPA 3RM3A 2GYVA 2HRQA 3R3VA 5JAUA 3L1HA 2WIJA 4IH9A 2NW6A 2Y6VA 4FLFA 4BAZA 1YA4A 4YPVA 4C89A 2VJCA 4DMKA 2CUTA 3PFCA 4W63A 4BP8A 1YS1X 3C6BA 4L72A 4MXDA 2XMSA 5HQ3A 3ILSA 1G66A 3BDIA 1R1DA 1F0PA 2WTNA 5CT8A 2C7BA 5JYCA 1AX9A 1CUHA 2RGUA 5JZSA 1QE3A 4FTWA 4TPKA 1CR6A 4CIAA 2XB6A 2WFMA 4U2CA 3WK9A 2XLBA 5ALFA 3G9TA 3AILA 1H2YA 4PO3X 5HK8A 3AZQA 3IULA 1MPXA 2V98A 1XZDA 4HRXA 5C81A 4P9NA 5AP9A 4Q3LA 3IA2A 1ZIYA 2RONA 2H7XA 3BL8A 1A8QA 1ZJ5A 5AM2A 3I2HA 3OM8A 1XRNA 4G9GA 3C45A 4C88A 4HRYA 3WZLA 3DS8A 4G9EA 1H23A 1CPYA 4FLMA 2OPHA 5FV4A 5AI5A 1AC5A 2C0PA 4ARBA 1UKBA 1XLUA 1USWA 4Y2VA 5AOBA 3ZLTA 2GBGA 1BN7A 1MTZA 1XRRA 4RPCA 2I78A 3U1TA 1QTIA 1TRHA 4FFVA 5YASA 4S0XA 1P0MA 1VOTA 3O0DA 2VAVA 3FYUA 3T4UA 4OU4A 2OGZA 4H7KA 5AM4A 4ZWNA 4BATA 3C87A 5ALUA 2CBGA 5EGNA 3WIOA 4PV7A 1CLEA 3MUOA 3S2ZA 3RLIA 5SYNA 2E3JA 2K2QB 2Z3ZA 5K3CA 3WMRA 4OB8A 4DGQA 1Z68A 3WIBA 1ZD4A 5IVDA 1JKMA 2CJPA 5LZ8A 4BAUA 3EIOA 3B5EA 2J4FA 2HL6A 1CUXA 1CUZA 2ZJ6A 2OCIA 5ALEA 2XMGA 3DQZA 4QDZA 1VLQA 5E4TA 5CXUA 4KACA 5ALLA 1YB7A 1JJBA 3MGAA 1EI9A 1XZHA 2XUIA 1EDBA 1M33A 3TRDA 5HCUA 5HF8A 5C8XA 4H77A 4OSEA 1LPOA 2OAGA 1THTA 1DU4A 3WJ2A 4BE4A 1LPPA 3K6KA 1R4ZA 1H2WA 5KWJA 4QWMA 2D5LA 5FKJA 1TQHA 2O2HA 2BJHA 2C58A 5AKLA 3PI6A 1EDDA 2V97A 2WTMA 1AQLA 3C6XA 4QA9A 4D9JA 3E3AA 3M3DA 1QLWA 3AIMA 2WLSA 5HFAA 1UK7A 3H19A 1UOOA 1IZ7A 2WUEA 2YXPX 4MQLA 4HS9A 2VEOA 4WY5A 3CCCA 3G0CA 2G5TA 2ONCA 3CN9A 3G02A 4JUIA 5AK5A 3DNMA 1IUNA 1IUPA 4BTLA 3D59A 2CMFA 1EHYA 3O4IA 4B9AA 1LPAB 5JD4A 1WM1A 3VJLA 2HADA 2GBCA 2QUAA 4Y2TA 1JU3A 5DNWA 4HXEB 1ZD3A 4JH0A 5DYWA 3I6ZA 1XQXA 4EUSA 2XLCA 4RNCA 2XUDA 1Q0ZA 2ZYHA 4X6YA 2QT9A 2XUJA 4DNPA 1LLFA 3W04A 4P92A 3G0DA 4UHEA 3HZOA 1ISPA 2FX5A 3GROA 4KE8A 5T4EA 2IIVA 1BCSA 3W06A 3PUIA 4ZREA 3Q8WA 1P0IA 1ZOIA 5CRIA 1P0QA 5IVKA 5LKAA 2XUGA 1YB6A 3QBJA 3D2BA 4M0MA 5BV7A 1K6EA 2XI4A 3HRHA 5AKEA 5AO9A 2AJ8A 5LKRA 5AM0A 4CFSA 4Y7DA 3YASA 3B3QA 4J0IA 4E11A 1CFJA 3MVEA 5ALXA 4X90A 2H1IA 2VJAA 4I19A 1BU8A 4UFNA
chains in the Genus database with same CATH superfamily
1DELA 1QFYA 3OOYA 1DCFA 2I3ZA 3RRNA 4KC0A 1AA9A 1AKNA 2NUAA 3S7TA 3BXFA 2PR2A 5CNJA 2JCSA 4YRKA 1B23P 3U40A 3K2EA 2RK6A 2Z43A 3UHPA 2VAMA 2QAGB 4RV5A 2VDWA 4DCUA 1L7MA 4BCCA 1E3DA 3P97A 3HXOA 1NR5A 2QA5A 2PKCA 3LO8A 2LDBA 3HCCA 3K0FA 4JUFA 5ALGA 3W0LB 4J1NA 3FN4A 1AZWA 3CUEF 3CUTA 5JALA 2OORC 4TTAA 3TCNA 5JXGA 3DMGA 1X1TA 4RH1A 1TYBE 4N5NA 3A4TA 3UAOA 1LCIA 1CQIA 1KI1A 3QUAA 4EHJA 4C43A 1H2AS 3K1YA 3S8YA 4EY5A 3VXKA 3HDYA 2AWNA 1ONBA 5H68A 1TM2A 3GLRA 2J3IA 4L5BA 3KR9A 1GY8A 4WZ6A 4EDFA 2Q3LA 2HA0A 3B9BA 4TQAA 4U4AA 2FZWA 3FZYA 3M5CA 1L4HA 1OIWA 5LQNA 4NZNA 5LZ2A 1UAGA 4ZCRA 4UZSA 1HYHA 2UUOA 1THMA 3KHSA 3OZAA 3OQJA 4QGBA 5IJZA 1VKOA 2GZSA 1SIBE 1ORTA 4JBWA 2G6BA 5AHKA 3SHOA 4DA9A 5ADUS 1HH4A 1RNLA 2M9MA 2YY5A 3HXTA 3WK5A 3KPJA 4CMIB 2HH9A 1I2MA 2V58A 2X1LA 1XLTA 5AKXA 3ZZTA 3PWTA 2QTGA 3TLAA 2IP2A 1CUBA 4HYEA 5H59A 2IY8A 1BYIA 2WSMA 1MZVA 2W2LD 3UJAA 1W5FA 1W4RA 5ARCA 4ZCMA 1DJNA 3EOBI 1U5CA 4QVIA 4CV0A 1SUWA 4MRSA 1JVBA 4TUYB 1RIFA 2WF6A 1B0UA 1UBMS 3UM9A 4MW5A 2IHTA 4WCFA 3QWAA 1JG4A 5G4KB 1UXIA 2Y27A 3L0YA 1LPSA 1UEXC 1V7QA 2DPLA 1F1JA 3NWOA 3OC6A 4LI0A 2X1VA 1F6WA 4DFDA 4DTCA 2ILVA 1G0NA 3RWMB 5BVHA 3KAJA 5JYDA 2WINI 5EL0A 5FTLA 4CEHA 5DISB 3Q6MA 1F38A 2Q9UA 3DOUA 1N2GA 1PR4A 1SPBS 1STOA 1V2GA 2R751 1PZMA 4R1MA 4RH0A 1FJ2A 2YOHA 3OCCA 3UXYA 4BO4A 2FPRA 4JXXA 3PEUA 1H8HD 2A9QA 2FSUA 4X54A 4EPYA 2W37A 1O9HA 3I04M 4YA6A 1NT2A 5CGZA 1XOIA 1I24A 1MEEA 3GXBA 3G5MA 3PWSA 4LAFA 4OXRA 2LKCA 5JCXA 1K9VF 3LL4A 2IBTA 4OM8A 4O4JB 4O63O 3VKFA 3N74A 1ZRSA 3AONB 2DETA 3E53A 3DEYX 2B2CA 1KF0A 1HTWA 1E0SA 2ZREA 3D1LA 3QHQA 3U4IA 5DGDA 2WKPA 4JJ6A 4URFA 4YJ2B 4CVNA 1U99A 2FMTA 2AI1A 1Q92A 2BFCB 1UM8A 3AI3A 3PDIA 4MW7A 1QUFA 4F71A 1Z36A 2XVAA 2YJNA 3LUDA 4CG3A 2ZG6A 3NHBA 4G4GA 3LUPA 4PSAA 2CC2A 2SKEA 2AJLI 3C7TA 4MMYB 4R1QA 3WMEA 4RZ3A 5JR3A 5IWAB 4JYMA 1Q1GA 3B2EA 1HNXB 3DL2A 3H1TA 3NOVA 4Y2JA 1JXMA 5FOWA 2CMHA 4XM2A 3CUVA 5DBFA 1FSZA 2ZE8A 2VXOA 3BE4A 1EGQA 3UV3A 1POXA 1FQOA 4QXAA 2XWBF 3RS3A 3UUWA 2OGWA 1JU4A 3DNFA 4G9BA 2P9FA 2OV6A 4YPFA 1WHSA 1QTRA 3A4IA 3QE2A 3TMYA 2NVBA 2QLFA 3WNBA 2HJGA 2VJMA 4MAAA 3A6EA 3BMNB 5T41A 3CB4A 3TRKA 3D5TA 3D7LA 4G5FA 2XYVA 4OHWA 1T4DA 4PIPA 4RHCA 3W4KA 2FUNB 1QYCA 3SVTA 4PQEA 2HDWA 2QL5A 2WVGA 2ATXA 1AY0A 1EE1A 1WXIA 1MR3F 4Q24A 2ERCA 3DGFC 3UUGA 3QXHA 1D6JA 2XUPA 3Q9LA 1KDVA 1W1WA 3GEMA 3AIOA 4B4WA 1DV2A 3HLTA 4XB1A 2VSNA 1YKFA 3EDMA 2L42A 5AIBA 3UV6A 1Q21A 3HR4A 4G37A 2FQYA 4LHYA 4M1MA 4R40A 5K8JB 5DASA 1GZ6A 3N1UA 4PSKA 4AYTA 1XTUA 2XT9A 3UWOA 1F3OA 1EXNA 1M6YA 1W5TA 4HNGA 4URYR 2FFHA 4QSHA 5JJIA 1UC8A 3F5DA 4Q5IA 4I9HA 4C5AA 4MO2A 4DCPA 2MWMA 3UAXA 4YUZA 4FR5A 5D86A 5AKYA 4QM7A 2B8JA 4RWEA 3KQPA 3S28A 3N2GB 4LQ4A 1Q1AA 3L6EA 5EJ8A 5E6UA 4TSFD 2GKOA 2PSSA 3IUPA 3N6VA 3TTUA 4TXNA 4LHSA 3A58B 4FPXA 2HLDD 3SSAA 1H3EA 4BP9A 2WMOB 1K88A 5HZKA 1KTVA 4R5HA 1SU7A 2ZIXB 4X7MA 5HOQA 5L51A 3CQ9A 2J3KA 4PLYA 1IY1A 1DI0A 1T1SA 3AEXA 3CEJA 3ZS8A 5CXXA 5LP6A 3ZD6A 5EMHA 3NWPA 2V0CA 3BXOA 3IOMA 2BCEA 2ARKA 1USVA 2VZEA 3GZTB 3ZH9B 4FE4A 5LZ9A 1SHTX 2XGSA 2GVDC 1K6IA 3QKUA 1XTQA 3F2IA 4B09A 4IOMA 2XNSA 1RXYA 3GN1A 4KI7A 5CVCA 2W0SA 5AJTA 5KWVA 3DBHB 5ALTA 2D2IA 3ELBA 3DTVB 1Z2DA 5FOUA 3ZJUA 2Y1KA 3ZWPA 5KSOA 2HCBA 2X14A 2Y2UA 1J2EA 2BWJA 5KQSA 2NSHA 2X2OA 4YMSA 2GWHA 1Y34E 1GVNB 3KYBA 3ECSA 4LY3A 5H83A 3NBZC 3DKKA 3JARA 4GPBA 4TYMA 3T7SA 2FSSA 4D9BA 1QB7A 3U1VA 4H7HA 2QTVA 5KYKA 1FRFS 2WUFA 1MVOA 3O4VA 4XD2A 3VBEA 2IYTA 1KQ3A 1W85A 2CJFA 1XRJA 2B4AA 2Z57A 4RE5A 1RXEA 4IRXA 4W1PA 2NSDA 4CM4A 2IH2A 1J0EA 3AF1A 3UT0A 4DRXA 5EE1A 5BYJA 2WP8J 4PHGA 3VYRB 3A14A 1H9BA 1EX7A 1DFGA 1QFJA 2P4UA 4DCSA 4X64B 3PVCA 4A6DA 4DBVO 3CVOA 3EZ6A 4FYXA 1JHQA 1KI9A 5BYAA 2PR7A 2A9OA 3LBFA 1FTGA 4NAVA 4GKBA 1WJGA 4C4YA 1CE8A 4ID9A 3LBAA 3U4CA 5CIYA 2BGWA 4RA6A 4I50F 4MI6A 1Y6JA 3OFNA 4MI9A 4B35A 4CMCA 2XDAA 1A2BA 2HBRA 4BYMA 1OAKA 3DE4X 3OICA 1DLIA 1XJ5A 2HI0A 4OI2A 4MB6A 1VL6A 3C3YA 4HPXB 3PD7A 2BEJA 5JXJA 4LC0A 1Y9EA 4NBWA 3DQPA 1OXKB 2X8LA 3DHVA 1GXSB 3QHPA 5BV8A 5AXBA 4NYJQ 1E60A 4OHYA 4M0UA 5FPQA 4KQKA 1OPRA 3VA7A 1V48A 2WAAA 5CW1A 1M3SA 3AM5A 2GWRA 3AXTA 4KQEA 4ON9A 2WB2A 1AQIA 4WXRA 4H7JA 3PXGA 5C53B 3DD1A 3IIEA 3QPUA 2PPLA 4PYLA 5D3MA 4D4LA 4E3WA 4F2PA 4FGJA 5JCZA 4QUDA 3NTRA 5LIRA 2VIIA 2JGFA 2PEYA 1GYPA 2VQDA 3T3GA 2P9TA 3GOQA 4L4UA 2TSYB 2EAUA 4N8EA 4Q4AA 1EUDA 2GCGA 3K05A 1EVZA 1XPUA 3KXDA 1Z35A 3ILXA 2CKMA 1SOAA 1Q95A 3GLHA 1M0SA 1YCFA 4IP0A 2D13A 4NNJA 2QTHA 4CF7A 1RJ9B 2QMOA 2BSQA 4NBTA 4ZQEA 2PM8A 3I1JA 4UAJA 3LF2A 2PGLA 2GCIA 4MK4A 1KK3A 2VPZA 3GXOA 1C0LA 4G1FA 1SQSA 2EWMA 4JUAA 5JBIA 5FCDA 3G8AA 2DLNA 5F35A 3OCYA 4HRVA 4JGIA 1YRWA 4G0OA 4Q7EA 4D6YA 3OEWA 4EAAA 2OM6A 1X42A 1L4FA 3IMCA 4RESA 4BLOA 2WIGA 5EHQA 3QQ5A 3IBSA 2FG6C 3UO8B 1BS2A 3QSYA 1QF7A 2F48A 5CTJA 2WABA 2HJVA 3CXUA 2MR6A 4PGMA 4TWAA 1TI7A 2C5EA 4ERNA 1T5OA 4ZEVA 1L5HA 4CXMA 2N42A 4YRJA 2C8KA 1BX0A 3ON5A 4FFBB 3RODA 3L8CA 4NZZA 4BQNA 3PYXA 3TIVA 1XTKA 5ED0A 3D54D 2FEXA 4OHMA 3CW9A 5KVVA 1QGUA 1H3NA 4ZKDA 2GA9A 1V7ZA 2VAXA 2AMJA 2GHTA 5FA8A 2HYDA 5IRCD 5ICEA 4YHBA 5IM5A 3DOFA 3ZY3A 4BGEA 2AZTA 4EY6A 4B71A 1PFUA 5E2AA 2IV3A 1RZUA 3UT5B 1HNWB 1N5KA 5FWNA 4PX9A 5KTYA 1K2WA 3E18A 3H9QA 4WMLA 2PU5A 5EE3A 2FOIA 3AI7A 2RHBA 2CKDA 2OFXA 2H57A 4BFUA 3AR9A 2YVQA 2P9ZA 2A88A 3T7CA 3OEED 2YL2A 3V00A 2VHYA 3PNKA 2GAIA 1ZSVA 5GAJA 2Y1GA 4L3VA 2PVSA 4EHFA 1QTNA 3I76A 1HYBA 2MMCA 4C01A 1VMAA 3BSYA 3OJ0A 3SF0A 1GUZA 2X3FA 4L8YA 3EUEA 1AO0A 2P78A 1XMXA 4DZRA 3NM5A 4DB4A 2J9GA 4EFNA 5DHPA 4E15A 5KX5B 4KO1S 1TU0A 2ZUSA 1XL1A 3BAFA 3IUBA 4D99A 1B6RA 1J9ZA 3DBRA 4DREA 1BS9A 1K4YA 3VC7A 2H2FA 4I7EA 3DZIA 2WAMA 4B3RB 1F2UA 1I3CA 1ZN7A 1CIVA 1ZHHA 2GN1A 3N05A 1U8ZA 2WVHA 4NS4A 1YFJA 4E2YA 5BSEA 3K2BA 4BNIA 2HSWA 3LGSA 4OQPA 3RJ9A 1QIGA 2CNLA 1Q91A 5DXFA 1W4LA 3ZKWA 2B3DA 3DKRA 5AM3A 5CDSA 2H07A 4MDYA 5HCIA 3T52A 5D8DA 3PFBA 2GXAA 2VYVD 3MBKA 2G63A 1S01A 2WAYA 2CHQA 4JQOA 4NULA 3MINA 2HA6A 2XXBA 1QFSA 2POCA 3E2PA 3EIHA 1KYYA 1DTSA 2PX2A 5C5CA 1Y6QA 3HJCA 4JBLA 1KJNA 3Q1KA 3VU3A 3HJGA 1KWGA 5M29A 3PQDA 2PUCA 3OI7A 3ETHA 1Y37A 1P7ZA 4Y1RB 2VQ3A 2PU7A 3BXXA 3IXMA 1XAGA 3KQMA 1YCHA 1Q0PA 2JLRA 4GEGA 5DGXA 3A1VA 1TC2A 1T3TA 1BVUA 2ORED 1I4OA 1AD2A 4MVJE 5BP7A 4HLCA 4X7PA 4UTZA 2G76A 5E7IA 4DRYA 4DWOA 2D59A 4BL5A 3SFTA 1HRDA 4L7VA 4OJKA 1JWLA 1P3JA 3EVDA 3NBYC 3VPGA 3VR1A 2OZKA 2XSZA 4GOMD 4ZZ1A 1R0XA 4KHPB 2QGFA 4XEUA 4X94A 3S44A 1YGYA 5JAOA 2QTLA 1T2AA 4AWXA 3L7CA 1Z6QA 3DE0X 3HB4X 4FQ7A 4NCKA 3STHA 3HCOA 1AKUA 3CLVA 1NHGA 1PQWA 3AIKA 5KYXB 2R7KA 3S5JA 1SOVA 1VSBA 3T9AA 1SUBA 1P4RA 1S2NA 1EA5A 3FPLA 4II3A 4NOKA 1V1MB 1O1YA 4OAPA 3QEOA 4G1EB 5CB4F 2BJVA 4C7JA 1QHSA 1LJUA 3F97A 2A0UA 1GA4A 5K8LA 1ML3A 2QR5A 3W8EA 2OL4A 5JCPA 1LGYA 1OT3A 3DXYA 4RLHA 1CVIA 4W5WA 4BNLA 2QX6A 1JH8A 3HGQA 1OR8A 2ANBA 1HT3A 2GN9A 3BK2A 3Q6IA 1ZD5A 4QHSA 5B1EA 3BQ9A 2BDUA 3C3WA 3CO0S 4RKRA 4XPIB 1XA0A 2PQ6A 1JFRA 2CXPA 3LY7A 5G53C 4B8WA 1OJLA 3AR7A 1Z4LA 2BTQB 3EDCA 3ORSA 4HTAA 2XYRA 4QFMA 1ZHOA 2RARA 1CU1A 5LB2A 2E37A 2V7WA 1RYBA 1OFTA 2AD1A 1S02A 2OILA 1IDOA 1T2CA 1Z5ZA 2W2KA 3G2NA 1K8XB 3L4KA 5G4KA 1TD1A 1QPZA 2BM1A 1XDUA 4ZEXA 1L7OA 2GETA 2JJ1A 3VHXB 3FH0A 3VR6A 4NONA 5SY4A 1N0UA 2OV4A 3S40A 2HF7A 1QHNA 4WLNA 5K09A 1XVVA 1NG9A 3THYA 1VLJA 3LLUA 3SXJA 2FR8C 1R4MA 2ZVQX 3FDFA 3QZUA 5EKDA 1ULHA 3GFBA 1W4ZA 5CB4A 2GHIA 4C87A 3WYGA 3ZHSA 2X0KA 1QG2A 3L4BC 4MKGA 3GT7A 3LOPA 4FYIA 1NIJA 3CEHA 4M7OA 4B3BA 3KQKA 2PZGA 4KR9A 3H7AA 4ER0A 1AS2A 2UZ4A 4OXQA 3T0IA 4DDWA 3ESCA 5EGSA 1DTWB 1PFGA 3EOZA 8ADHA 1E9AA 3R8FA 3I9NA 3RROA 3I61A 3BICA 3DDUA 1A77A 1SM4A 1IPHA 1UP4A 2FF5A 3LXMA 4G5HA 3TLEA 5K45A 1T24A 4QGGA 1PYOA 1ZMRA 3AUXA 3IO5A 3HBNA 3JYQA 3WIUA 1YV9A 4AP5A 4J8PA 4LOJA 1E9BA 4RZIA 5EHNA 4C3ZA 4EEZA 1T0UA 1II8A 1G9SA 3SMQA 3FFTA 1SQGA 1WEKA 4IIYA 1UIRA 1ORWA 1J1IA 2QOEA 2K7ZA 2WF7A 2ZAYA 4MA5A 3AKYA 2R6JA 2X6RA 3FYCA 1EWTA 4NV0A 5CW2A 4TN5A 3RUPA 1L5SA 2O3SA 3H5OA 1P45A 4R8MA 3WKDA 1BHSA 3PX2A 3HKBA 3ANYB 4LYJA 4IIVA 2JFVA 4R5MA 5FBHA 4ESEA 1TZMA 4TL8A 2QXYA 1L6RA 1E3QA 1GGVA 3AVOA 1UZMA 4R0VA 4DR1B 3Q7RA 2R65A 2Z95A 3V1UA 4JI8B 4WFQA 1PS8A 4G2TA 1IJFA 2IZ6A 3ZX5A 1QP8A 4ROTA 4RVGA 4E0BA 1WETA 1XP8A 2YHBA 3DHYA 4A0SA 1JDNA 2JFYA 2FPSA 1Q50A 1VMDA 3GGGA 1AHNA 4G85A 3TZKA 1YVPA 4L4YA 2LP4Y 3LA8A 1OH5A 5KDDA 4HWSA 3I5XA 4RPGA 2C83A 1ATZA 3RYTC 1CF4A 5ENDA 5B1DA 2FRDC 2VYND 2B61A 2FPPA 5B6PA 3KXKA 3GNQA 3ADBA 3L1IA 3ESXA 3OJOA 1N6RA 3AR2A 3Q2OA 4DRXB 2VYVA 2W11A 3AY3A 3LAWA 2Z9BA 4HYTA 4N82A 5TS2A 3SHQA 3TLGA 4L7QA 3FY4A 3NHSA 3OZFA 1XNGA 1MO6A 4PLVA 4I36A 2J3DA 5EXPA 1XAJA 1XEXB 3C3EA 4OFXA 2P40A 3WTBA 1JDPA 1QQ7A 3C6ZA 1P4AA 3EXHC 4RZHA 1TTHA 2YJ5A 2PXAA 3AY0A 4F96A 4CV3A 2P1RA 3QPCA 2GQ0A 2IPMA 5F3WB 2J5KA 3W3AA 1M6NA 1FS4A 3ES9A 3W7AA 1A76A 3UPUA 1GILA 4Q12A 3X1DA 5IH3A 5EE0A 4OHRA 2H4YA 2VNAA 1GRVA 4LFCB 1R0KA 3DMFA 4UTPA 4GUDA 2ZPTX 1TYCA 1WSWA 3WV5A 2P6OA 4CKEB 2JHCA 2NZ8A 3RBZA 1K08A 3ZCSA 1PCXA 4O8CA 1ZO8A 4Z9FA 1VI6A 4NCJA 4DJEC 2OHIA 1YMVA 4TXLA 1CD5A 1LJLA 2VTVA 3E2MA 2OXTA 1R0ZA 2BELA 2C4HA 4V3BA 4QOHA 3TCXB 3HKDB 1Z08A 3WL4A 2R1ZA 3JVUA 1C8KA 4LPSA 5E38A 3RUEA 1IBMB 3PD0A 2QQ5A 4HWPA 1N9KA 1DBVO 1B0AA 5A3RA 1WA5A 4FWBA 3TG8A 1ZBQA 4RMGA 4RZSA 2A9VA 1OF1A 1V5FA 3HJBA 5FOTA 1T5TA 4JASB 2JK0A 5HGJA 2BR3A 4EFMA 4YAFA 4JENA 5F5NA 3TQOA 2XCRB 3MPOA 4O8ZA 3TTTA 1J0XO 4IJ5A 4HB4A 5LM3A 1YXMA 1FU4A 2E7ZA 3CCBA 2JFHA 3ZLJA 3GDGA 4XVHA 4L6AA 2XZPA 1T6NA 3NUGA 1MB3A 3K9BA 3T3OA 1O54A 2C04A 2Y4NA 2E2WA 4HQ0A 3BL5A 5FL7D 5E1OA 4AURA 4B6JA 1I0LA 1PSWA 1YI0A 2OC4A 4YTEA 3GQVA 2Q2OA 1UBEA 2V74B 1XZKA 4HBGA 1PJRA 4L8WB 1GP2A 2F62A 1JF8A 4S24A 1QR6A 4TVSA 2VL7A 3RUAA 5KTRA 4NL4H 3K30A 4LVNA 4HWKA 1QIIA 3ACCA 2FRVA 4OQQA 3QMMA 4FGUA 3U37A 5DYGA 4X44A 3TJRA 5F9HA 5HF6A 2YASA 3PUVA 5HQ3B 1WNTA 2C98A 2D7JA 5KAMA 4B6GA 5JNVA 2B1GA 4KXMA 2CNKA 5JCOC 2XKBA 3GGJA 4INPA 5I8PA 2QXUA 4LXIA 4HGZA 2WU8A 3RK1A 2FW8A 2ZSHA 1HOXA 2PLFA 3M70A 3CNNA 3UGJA 2PBRA 3ME5A 5TGTA 5GIPE 3AC0A 4IJMA 4QPDA 3CF4A 4XLZA 1MT3A 2VPTA 5CK4A 4GKJB 2ZFUA 2O3TA 2ZRQA 2OCGA 3NIWA 3QU4A 1EBFA 2GPJA 3JQAB 3E7WA 2Q41A 4LDNA 4WOJA 3THRA 1LY1A 5EZQA 3PD1A 3H8JA 3TMKA 1AUVA 4ZHQB 4NE7A 3GVPA 5BR8B 2EW1A 1ADFA 3W6ZA 5MF6A 4ZI7B 4FEGA 3R9KA 2ZCVA 2IYYA 3FROA 4B6OA 1HDGO 4F6CA 2QZJA 4Q00A 2NU9B 3WLAA 4F4CA 4NBNA 3N53A 4XUDA 4EY7A 1H1LA 4HNTA 3CLKA 4LV6A 4R8KA 1BOOA 4Q02A 1SK8A 1V2HE 2HMAA 4DJDC 5BUSA 2BGTA 1ZBDA 3MSCA 1W1UA 5I51A 2NLOA 1UPTA 2PD3A 4XFJA 2J9RA 2GERA 4YDHB 1HE3A 1L5ZA 1S4MA 3AJDA 3QWFA 1GZUA 2XAAA 4EKGA 2XOKA 4J2HA 2JFBA 2F3UA 3JYLA 3PEEA 1K63A 3QWIA 1YGPA 3HL0A 1NBOA 1W2HA 3NHJA 3I9MA 1PLKA 3DO6A 2QQEA 3DKIA 3AKDA 3HO1A 3DMTC 1NKSA 3FBTA 4HLQB 2HA4A 3V1MA 1N0VC 3ANTA 3LKZA 3CZ9A 2YICA 4HQLA 4QUBA 4Q6BA 4B4OA 5ITVA 2Q2NA 5IW8A 3AHHA 4W8GA 1JHMA 1Z0FA 1EGVB 2FSVC 2REQB 2YHIA 1A5SB 3WA7A 4OQ4A 5I6DA 5I7OA 2FF7A 3DMHA 1XA3A 1RAIA 4XIGS 1V43A 4ASUA 5DBIA 3R5HA 4OREX 4B0PA 4XX0B 4C7OB 1X7HA 1P9OA 3B7WA 2P9BA 4GNKA 2RK4A 2CYBA 2QPOA 3CMCO 1FVXA 1L8QA 2CLFB 2PLRA 3NJ4A 3P2MA 4IBOA 4IUDS 3TR5A 4HEA1 4LEIA 1R5BA 4D97A 5ICSA 3HEMA 4I99A 1EJBA 4YV0A 1UXKA 1Z0IA 4LMAA 4LOKA 1BNCA 1NI3A 2WE8A 1IK4A 4GMKA 2B1QA 2EG9A 4FC6A 1FYDA 3UUEA 1G60A 1TGYA 3FFWA 5IULC 1Z2OX 1XKLA 3QKSB 4IFTA 3VAZA 3H75A 3D5EA 1GRCA 3JV7A 4EDHA 2YKGA 4CM9D 2AFIA 5A6SB 1PFWA 1P4HA 3G6KA 4MW0A 4FGZA 4QO8A 2GILA 4JEIA 3U7RA 1U8EA 2H1HA 4EITA 1K7YA 1GEGA 1AKWA 2JD2A 3QSGA 5KJFA 3OSUA 1MVLA 3DO5A 5B3JC 2CVFA 4AJ4A 1RRPA 1NTOA 2ZRMA 1PL8A 3G0GA 1QE5A 4AY3A 1Z7GA 4NJEA 1GKUB 4DCCA 2B5VA 4UCQA 5BSWA 1RYEA 4OGLA 3IHTA 4Q9NA 4DLXA 3ACDA 4GXNA 5DTEA 3PUHA 3ZKAA 4H0NA 4W7IA 4AKGA 2BL4A 4ZU6X 3CKLA 5KIAA 1L1EA 1LDEA 1H66A 1SURA 2YYZA 3BGWA 4RCVA 4KUEA 1UWCA 1NLUA 2I4MA 1TM7E 2YWXA 3RLFA 3S99A 1AKTA 1ZIDA 5DM70 2V7QD 5ELLA 3Q87B 3V80A 5FLKA 2RK3A 2EYUA 1I4WA 2VWGA 4OK5A 1BDIA 2CZGA 4POAA 2GJKA 2Z8XA 5FP0A 2XB9A 3SD7A 4V0ME 3EVGA 6REQA 2JHAA 1OB5A 3IJEB 1VIAA 2AK2A 2XMQA 4BMZA 1PNQA 3I62A 4HO1X 4ZVPA 2QYOA 2R47A 1PAUA 2CFRA 4R84A 2PUVA 4O2BF 3PX7A 1JXAA 5ALIA 3EXEB 5JCJD 1JQ3A 3B7GA 3F6SA 3M5DA 3DT8A 2Q29A 1EVQA 5J43A 3EGDA 1OBFO 5K03A 3WISA 1SO8A 4KH1A 3QVUA 2P2CA 2QRVA 1A8PA 2P5UA 1G19A 3OQVA 1Z7YA 3D3NA 2ZOSA 1A27A 3GLUA 1FDWA 2R44A 3BKXA 2J9XB 3EVEA 4JVSB 4US0R 5EPOA 2C3UA 1TZ2A 4JP2A 5EOVA 3NOOA 1JEYB 2CMGA 3N2ZB 4W1RA 4YV2A 3NVDA 1ND6A 3AVPA 2PEZA 4CUZA 1JP7A 2C57A 3WB9A 3W79A 1IBLB 4CETA 2XADA 3PWKA 4B3MB 1A4UA 3ZU2A 2J6CA 3FCSB 1X80A 2R60A 2DFDA 3Q9NA 1ZIXA 2I3BA 2XD4A 5E6SA 4CKYA 4F46A 4O2AA 2HMWA 5A2QA 3ZDEA 4A0FA 1GO2A 3CJRA 1YULA 2YCLA 3MT0A 3TSWA 3UY4A 3GP8A 2RGDA 2QVGA 2GSWA 3F6EX 1ZL0A 1LK5A 2P67A 3BSSA 3KJXA 3LBIA 3B6ZA 1P5ZB 3QW4B 4G01B 4JJAA 3WKEA 2AC4A 5AFSA 1WZCA 1I2BA 4BJ5A 3IDZA 3CISA 4M8NE 1EIZA 1TQDA 2JRCA 2YMQA 4MYCA 3V8RA 4CN8A 3ZHUA 5IJ9B 5EHXA 3DDSA 2QS9A 3C5WP 4OP2A 4R2LA 4PC7A 3IA7A 4V2IA 1T8RA 1ZEJA 3LX6A 5DMXA 3MG9A 4BFWA 3NLLA 3WGMA 2DXIA 3WGIA 3VZRA 3OUTA 5DI3B 1KFJB 1SVIA 2XB4A 5IU6A 1ZINA 2V7PA 4D45A 5EUMA 1U7ZA 1JIJA 3IAAA 1A9RA 2C4VA 1ZRNA 1O96A 1W35A 3GLHB 3G1TA 2VZ0A 4M21A 2RFLA 1JXQA 3LJKA 1KSJA 3ORHA 2O0MA 3WKCA 3ZWQA 2A0KA 5L3QA 4RHYA 1QKIA 1V1RA 3KQHA 2I87A 1LNQA 1MB9A 4PZZA 5I9IA 1EVYA 1LRKA 2R48A 4B4KA 3AJ8A 3C15C 4YDRA 4HGOA 3KG2A 2NU9A 3K4HA 4QOGA 4YAIA 5KO2A 4C07A 1Q1ZA 2XVMA 4LYAA 3DE7X 3HP7A 3KJHA 4PNZA 3UXHA 2Q8PA 4HFRA 2IYQA 1JQEA 5EWMA 4KKXB 1ODKA 3OHSX 4B73A 1TOAA 1TO2E 2FY8A 3KPWA 3R3XA 3KDSE 1F4VA 2GUGA 4EO4A 3F7NA 1HPLA 4IYRA 1WCIA 3FDZB 2PZEA 3OUUA 5BQOA 3HZRA 1ZUIA 1NBEA 3INYA 2QUBA 3JQFC 4QEDA 1JILA 4CIVA 4TLEA 1REQB 1G3IA 4XQEA 4C6SA 2BF7A 3A3NA 3FD8A 4MB0A 2CYCA 2L2QA 3KOYA 1KEEB 4BO0A 4K9MA 3CUKA 4ROSA 3FOZA 4B5LA 3OHPA 1NI5A 1C9YA 5BSVA 3HWRA 2HD4A 5JW6A 5D1HA 2NNLD 4M2LA 4RVNA 4EPRA 2B4KA 1YZNA 5GOZA 1YJ5A 2CF5A 3AUTA 1B1CA 2XKJE 4TSFA 4DR6B 1IM5A 3KTAA 4MEJA 4U5XA 2EP7A 1SKYB 3JZDA 3TR6A 1I1OA 3FIJA 3FLBA 4LJSA 4A27A 4F72A 2X2PA 1GV0A 4JVOA 2BP7B 3RTBA 4CM5A 2Q6OA 3HBFA 2XRFA 1QVRA 2WIKA 3OTIA 2NZYA 3QEJA 2Q5IA 2ILTA 3ETNA 4XSHA 4YJ2F 2Z1MA 4FFNA 1EP9A 4RHUA 4OMCA 1L4UA 5CNKA 4YAKA 5K3SA 3N76A 4AZ0B 2BC9A 4JLJA 3OAAA 1Z47A 4OJMX 2QM0A 3KJZA 3TQTA 1YKSA 1Y4SA 2W6MA 1AB5A 1PWXA 1BG6A 2NV6A 2ZT7A 3DBLB 4TKMA 4YJHA 3TTYA 3BK7A 2JGLA 1QGZA 3E2IA 1EVEA 4LHEA 3W5BA 2EGUA 4UHCA 3ZU3A 5EAIA 3U7JA 1V3UA 1XFDA 1KPIA 2HSGA 3LECA 3BQMB 1ETHA 2Y1CA 3KBOA 1TW2A 2A1UA 5I4BA 2XRZA 2G82A 1MABB 5KPJA 1FTWA 1ID1A 3H05A 3SR3A 4H1UA 4HQNA 1TE2A 3REQB 3BHNA 4HSEA 5KCZA 5DZSA 2OCBA 1R00A 4UEOA 4ZV4A 4AO6A 2Z58A 1P81A 1FK8A 2QD4A 3ZE0B 1QIFA 4H16A 1CZHA 4TLCA 4MVCA 4F4HA 3DZ8A 4EJFA 1NVFA 1FFXB 2YUIA 1II8B 2ZSBA 4OHUA 4WX2B 3VVBA 3WYFA 3JQ8A 1U1GA 1NX6A 1ZVJA 4OA8A 4X7RA 2IV2X 4BLWA 5A9RA 1YB4A 3OJLA 3U17A 3BZUA 5K6AA 2JARA 2ZAMA 5FUQA 2VNSA 3PC3A 1F5NA 4RNDB 2HXSA 2QM8A 2HKIA 2NNWB 4YRMA 1L5NA 1IWBB 3GT4A 1BD4A 1DINA 1G8MA 1Q7BA 3BFKA 4XIYA 2BGKA 3PHHA 1B6SA 4GDMA 1O03A 4FMDF 1FMLA 5LJLA 1O77A 2R11A 1KETA 3MM4A 1V11A 2FH5B 1QZUA 1TO1E 1M5RA 3BKWA 1R12A 1VB3A 3MRXA 1OX4A 1AHIA 4OHCA 5EJMA 1E9VA 4BZPA 3G0OA 4DIFA 2FR0A 4PAQA 5E7QA 4XD7D 4URWR 2V1XA 1XYVA 4HNAB 3M4ZA 3AW8A 3NP9A 3WLTA 4DWVA 3IAUA 2PO5A 2RI0A 3F4BA 1WV1A 1ZD8A 3KLPX 3NDPA 3GNSA 4Z4CA 4KSBA 3TD2A 4WK0B 1SC6A 4GZMA 3E4DA 1IXRC 3TZEA 2UYCA 4E94A 1W0CA 3M1LA 2C4KA 3RADC 1EP3B 2WRZA 4Q9IA 4LFBB 5H5JA 4N47A 1NN0A 4BGUA 5HRUA 2Z5FA 1USKA 1X1RA 2NVOA 4M53A 3WGTA 1DWOA 1GLGA 3WL5A 3EZFA 4ECEA 4CQNA 2YVAA 1ZCAA 3UFBA 2YHIB 1VMEA 4DHWA 4MWBA 4QYTA 2RAVA 1FDSA 3A6JA 1U9ZA 2PNFA 5GONB 2V5VA 1TAUA 4XXHA 1IEWA 3OE7A 2LKDA 3UMVA 5JZOA 2VSXA 1M2VB 1Q1QA 2QY6A 4H7IA 1U8AA 2QYTA 3ZXUB 5ALPA 2B34A 3MS4A 4FFBA 1GTSA 1BFKA 1JMKC 1GXSA 2O1WA 3DB2A 1C9JA 4FIDA 4UU1A 4ZRMA 5E3HA 1I2CA 5C7YA 4IQ0A 2ORVA 2EC5A 1PEAA 4KWHA 3CWZA 2YYSA 4EB6A 3U7FB 2GM9A 4BKOA 3R9WA 1IY8A 4EI7A 3GLIB 3D31A 2X23A 1IZ8A 3PR1A 4RQTA 4B3HA 3PEFA 3GUUA 2ZU6A 2AK3A 2AUMA 1NMSA 2EKBA 4N7JA 4RMIA 5BXYA 1U7TA 2IX9A 3NX4A 3KEFA 1KYXA 2XE7A 3DR5A 3R1IA 4FUTA 4O2BB 3DLAA 4FMPA 2WYIA 5DSZA 5EZYF 3PUXA 5JCJA 4N48A 2OCLA 4N76A 3I4LA 3ILYA 4S1OA 1Q83A 1HI9A 2PT6A 3G2MA 3VPBA 1DKOA 3NKVA 1R15A 1EVKA 1UQRA 3TLMA 2PWZA 3FUWA 2FJUA 1V4NA 1OMOA 1IY2A 2ZI7A 4G0XA 4B47A 2M6SA 3OQHA 4JLVA 2X7JA 3IAEA 3ZLUA 5B3JA 1FOEB 3G0BA 5JSKA 3U49A 3KQYA 3CW8X 1BTOA 1XNRB 1JS1X 1UBHS 2YHSA 4J0JA 4X6UA 2C2XA 4IDBA 1GFWA 3PLNA 3PZBA 3UQZA 3AEZA 1X9GA 3VV2A 5KB3A 4S04A 2DQ4A 2JHGA 3IE0A 2JASA 4NC9A 3K5WA 2H7CA 1KQGA 1UKZA 1FYXA 4YP0A 3BTOA 4MHTA 4HDCA 1QKJA 3E5HA 1H4TA 1E1KA 3E48A 4JI4B 2RAFA 3EPLA 4U00A 4UZFA 5TXGA 4BZQA 1JRLA 3U4AA 2QLBA 5F7XA 1XRPA 2HHCA 2A6PA 4E14A 1QG6A 4XDYA 1EUZA 2QTFA 3P1JA 2WTAA 3GD5A 2IOYA 3B51X 4IEEA 1TEZA 1UKEA 2FFJA 4MVYA 1S8AA 2WT4A 2QENA 4GOXA 2GGSA 4TWJA 4WZAB 5DRYA 3WGQA 3HCWA 1M6EX 4NPHA 5AJUA 4KQHA 4TMFA 2I4OA 3RBVA 1EHIA 1T0JB 1FP2A 2VS1A 1LDBA 2D1SA 1GPWB 1MC4A 2HLHA 2I9PA 3FPSA 1ORDA 1IU9A 3KV1A 2G77B 1Q7EA 1YDGA 4Y1EA 4IDQA 4O4LB 2NU8B 4C0XA 4EF5A 2QN9A 2GPYA 1ORRA 2WBLC 1U3WA 4DPLA 4DQUA 2AR0A 3R0IA 1YR7A 3F6YA 3FMGA 2XYHA 2I2WA 4AQDA 5E3IA 3T3MB 3FTCA 1D2EA 3PUJA 4I1SA 1AK1A 4QXPA 2FKNA 3FFXA 3FRJA 3ETEA 4KV7A 3OETA 4ZICA 1Z2CA 1ZM3A 3V4FA 4BJ3A 5EWLA 2WIAA 2WSSA 1FBNA 3DYBA 4L28A 1ZICA 2PS3A 3A9UA 2EXXA 1IQPA 3MWGA 1I6MA 1SA0B 4D8YA 3K8YA 3FOAA 2C61A 4G8BA 4A6EA 2C20A 3I9OA 4YPOA 1U0FA 1VHWA 3BULA 2P0YA 2OBMA 5A3VA 2CJXA 1YWGO 4OY3A 4Z9BA 3OZCA 5GWXA 1Z5WA 5JMWA 3DOIA 4QGSA 4NCNA 3RUHA 4YP5A 2RHTA 1XJ0A 2DQZA 2PJDA 4TOIA 3JQDA 2CE7A 1C7FA 3RS2A 1QIJA 7REQA 5TJHA 4W5HA 1B3RA 1L1FA 4XLLA 1PWYE 1F2UB 4DNFA 5A6VA 3KYJB 3RFTA 1K7FB 4HLNA 3C16C 1J2RA 3EG9A 4OK3A 3KT8A 2W6JD 4OQYA 1W73A 4W9NA 1VL2A 2QMUA 3O8OB 4OUKX 1NQWA 2IDMA 5TT1A 3KJIA 4CUJA 1HFJA 1PLLA 2ZIFA 3SY8A 2CNOA 1LSJA 3VO8A 4BV3A 5BWLA 4YMHA 2J67A 1DOAA 3EVAA 1I10A 1X7YA 4NCBA 3GUVA 4OLAA 2JGKA 1SQFA 2B5OA 2BFDA 1W93A 3KP1A 4BFTA 2GZ1A 4JD5A 4QOFA 3VOAA 4XGRA 4RJTA 2CGEA 3V7UA 1CUFA 2YNMD 7MDHA 4B7XA 1J6UA 3F9RA 3U3ZA 4ZJUA 5HNKA 1K66A 2D0DA 4BP1A 1EWYA 1Q7TA 2WSLA 1NMQA 2ZBFA 4HAIA 1E6EA 3VSBA 5BW4A 4H35A 1G6HA 2HN9A 4NPAA 2OLEA 3TX2A 1FSPA 1UPAA 1LVHA 4LMRA 3ZHTA 3W8NA 5KTTA 3C6KA 5K0FA 5L4LA 2LNDA 5DWVA 3GGDA 1TLFA 5GONA 5B1HA 1I2AA 4DDHA 3VDXA 1L7QA 2V0GA 4RLSA 4BMVA 3QMVA 1N75A 4X93A 1NF9A 2HGZA 4DSNA 2ZJ1A 4C78A 1ZH4A 4GBJA 1TIBA 4K6GA 2OGUA 2X5JO 1N4DA 1Y1PA 2DY0A 5AIAA 3QFCA 5EWLB 4EHLA 3EDOA 2HPVA 2WTUA 1N2HA 4LJ6A 3BGOS 3EQ8A 2CNNA 2O07A 4TL9A 1EXVA 3TSYA 3CNQS 5JRJA 5JZBA 2BEVA 3K09C 1E66A 1G5RA 2C2BA 3E23A 1CF9A 3P2YA 4FBMA 2J0EA 3UGQA 4C04A 1J8VA 2D4AA 4CM8A 4LW8A 4J43A 3H6GA 4WOCA 4CMBA 3K8QA 1N1MA 2A4MA 3OPVA 1T1JA 2HF2A 4MHSA 4X97A 4OMFG 3N86A 1DPGA 2MHCA 4YB8A 5EXXA 4C0QC 1XDGA 1ZZGA 2JJ2D 5DWQA 1AB6A 4PPNA 4ZYWA 1XWFA 3PDCA 1L5QA 3M33A 1GR0A 3R7BA 3ROGA 3WADA 4D6PA 4YIKA 3O7WA 4JV5B 3NATA 2JKVA 2D5AA 3EGVA 3DG9A 3NETA 1RU3A 1WHTA 1JL3A 1T4CA 1C0IA 3LV8A 5CJPA 5B1IA 3W9UA 3DH0A 1W85B 1ZLYA 3FB4A 4ZI5A 1X2EA 6PFKA 3IDQA 5DVZA 1GV1A 1M1NB 1K06A 4QNNA 4ZP1A 1L7XA 2GFHA 1IPEA 2JS7A 1GIAA 3GJ4A 3IOCA 4K46A 3PPVA 5FA5A 3CH5A 1XKQA 2QEQA 4LISA 4DN6A 3H2YA 1ILEA 4R54A 4OBBA 1VHJA 4BQOA 5DHTA 2YZGA 4ZPXA 5E4YA 1JLRA 4AKHA 4G5QA 1SZJG 4Y2QA 1UIMA 5EP4A 4D92A 1YS2X 1KI2A 3F9CA 3THWA 2PX5A 1NN3A 2SKCA 3O8LA 4QBIA 1QIDA 2JCVA 1XXHE 3EIWA 2GJAA 1JPJA 3GWGA 1ST3A 3HYSA 3QVMA 5B6IA 1RQXA 3OBIA 1BMDA 2FJPA 3TDNA 3ZVLA 1BE6A 3KQTA 1WQ3A 1XI2A 4Z53A 5A0TA 1CY4A 3BWBA 1V8ZA 3FCOA 2VP3A 2Y1WA 2PGXA 1TKRA 1V1MA 1BMTA 2I03A 1LZKA 1OA0A 1WV0A 3IE2A 4OYLA 3WK4A 5DK6A 3PYLA 1T35A 5HOEA 3CPSA 5F33A 4Q4CA 2JPDA 3VRHA 4MGEA 1RBQA 1E79A 3M7IA 4CFZA 4S1PA 3VO1A 5BV2P 1ZOOA 3F8TA 1DRVA 2TMYA 1PV4A 5ALMA 3M6VA 2E5WA 2P2SA 3LUFA 3VDMA 4G67A 5E3JA 5ELXA 3RQSA 4KQJA 3ITNA 1RXIA 1EUDB 2Q1TA 4JB8A 5G02A 2UYYA 2CXQA 1KDRA 2Q5CA 5IT0A 1WU8A 1GTMA 2VQFB 5TMDA 5JS2A 1O96B 2BGGA 1ZG3A 3F71A 1AMOA 1BW9A 1CUEA 1WOMA 2FGJA 2XYPA 4OQNA 4P2GA 3WAKA 4BZZA 4FR0A 2AV6A 3PJFA 4CEJA 1TDJA 3DLHA 2C2HA 1XF9A 1VYTA 3NIFB 2R4QA 5KYTA 2YW2A 5KNBA 4TTPA 2PHZA 2BRUC 2UZAA 1DBWA 4BC1A 1WULS 4NYJR 3IL2A 4KITB 4N7RA 4UUAA 1JDZA 5K8IA 1QRRA 1UC5B 1ZMTA 1UZUA 2GN2A 1DX4A 4CGZA 4MWZA 1EM8B 3V1NA 3KHTA 2HV8A 3KX2A 3K9QO 5DEIA 4I5DA 2IYRA 2MCFA 4IIFA 1N3BA 2DCMA 2JAOA 1EU1A 2OQ2A 4UBOA 2KJQA 4JXKA 3CVYA 2XT6A 3N0WA 3JQGA 1R2QA 1CE8B 3ICOA 4FE7A 3OZSA 3L8DA 4FGKA 1KMHA 1AUQA 1YDFA 1WCV1 1B2LA 3FCAA 2CBXA 3L1JA 1SCIA 1D4OA 1C1XB 2VPPA 4D7AA 2F55A 1UKYA 2G4CA 2YFHA 4KZPA 1I7LA 3NFRA 5IMBA 4KOAA 2L69A 2JBHA 1J42A 5ESDA 5IDYA 1LC3A 3BN3A 4G84A 3T61A 4AXBA 4BGVA 4ESVA 3T12A 3CGWA 1DWPA 3NHFA 1E5QA 1QIEA 1SVUA 4LWQA 1N9GA 5HF5A 3ZV7A 1L5RA 4KO4S 4BX2A 3R3SA 3IDFA 1WEHA 4KLCA 4LZAA 4ZZ3A 1A5TA 3CUSA 3OF3A 5B2EA 2JA1A 1ONPA 4FDAA 3SKXA 1EGHA 2IDKA 4KHZA 5CXSA 3H1FA 1UJMA 3GL9A 4HEJA 4PZUA 1JDJA 4R2MA 1DUVG 1LQ2A 2HNAA 5TQ2A 4S2UA 3VPHA 4ALJA 4LF5B 4HGQA 1OLXA 3TI7A 1I2ZA 1U6KA 2C4NA 1XWIA 4BV8A 4F86A 1IVYA 5BRAA 4U0KA 3D8UA 2C2GA 2HQOA 1SKYE 4UVDA 5TMEA 1W5BA 4BXOB 2GLTA 1HETA 3FUXA 1OROA 2O54A 2WJ6A 3PXUA 1N77A 3QK7A 2KHZA 4IJVA 3HN6A 1T9GR 4ZTBA 4JA2A 4MQBA 2WT8A 3ZHCA 2C4WA 3C7DB 5AKJA 2ZUUA 1KO5A 4FFDA 1GSHA 3B53X 2HU7A 4RKYA 4GSYA 3ZH2A 3VZCA 4CYMA 4JELA 4ZZ0A 3T3DA 2FW9A 1JFFB 4HWOA 1E7QA 2Q2WA 1KXZA 1M66A 2A9KA 3DTVD 2O3QA 4CL8A 1PVOA 1VC2A 2FFRA 4LF6B 1SZDA 1AN0A 2D62A 2IZ5A 4R9NA 2KLBA 1RZRA 1FE8A 2AW3A 1B74A 1WD7A 4ONEA 1CWUA 3C3BA 3G9UA 3QMWA 1SC3A 4BNUA 3PKIA 3ZJ5A 3RUCA 3BE8A 3OM1A 4L1KA 1PDOA 3HM2A 4KOEC 3SJ7A 3GFPA 3JYPA 2VCHA 1P0PA 3N9IA 4V0KA 4MCIA 5TGDA 1GNLA 1ZGBA 4GQIA 1U0LA 1AZLA 1RXSA 1NDQA 2MSWA 1QH8A 1E6LA 4HDOB 4WEOA 3LPDA 1M0TA 1VJCA 2P2LA 2AMVA 1VGRA 3OE4A 2CMKA 2IT1A 5KHAA 3LPLA 3BILA 3AEUA 3I2JA 4ABTA 4H7PA 3F3MA 3SQMA 3SZRA 3U4HA 2X22A 2XCIA 4HVLA 5D3ZA 3QOYA 3VNQA 5KOIA 5KNLA 521PA 4CDMA 1DARA 4MAFA 5L6LB 3QWBA 1RJFA 1PG2A 1FYWA 2I6TA 4OD0A 2IU4A 4ZI7F 1MC1A 2ZJFA 4HLDA 1RP7A 2GCEA 4KN6A 2F43B 1SXGA 1UJ5A 2WD8A 2Y0EA 3JD4A 4TV8A 5DHUA 5JXWA 1RMQA 1NNEA 4OLHA 4KE9A 3A9RA 4DKJA 1FFBA 2B2XA 3WQRA 1T9DA 2W6NA 4KJZA 1V5WA 5MN4A 3TEFA 3IELA 1S3GA 2QRMA 3P0JA 1NQVA 4P36A 5WRFA 3OTQA 2C82A 5AW4A 2H9IA 3GAMA 3R0VA 3F78A 1N5MA 2H08A 3OT4A 5CCDA 3ESYA 2AJBA 3OU2A 3NP7A 3C41J 1AN9A 1QJ4A 4P98A 1DWUA 3EZLA 3EQ2A 2KPOA 4NDNE 4EA7A 2ONZA 4DJ5X 3B82A 3IQIX 3RVQA 4NH4A 2QT0A 2O2ZA 4JLMA 3PI7A 2HMTA 4FYPA 2ETXA 2XYQA 2IW3A 3TGWA 2Y1EA 5F64A 1OI3A 3LP6A 4W6ZA 4WJLA 3CLRC 5FI1B 1ZM9A 5C1PA 5H9WA 4YQYA 4ZI7A 3BB1A 1DFHA 1ZPDA 1HE4A 1TUBB 1VL0A 4R8VA 2VZ8A 5JAHA 4KK4A 1KJQA 3A2NA 5A62A 1SCKA 2BGUA 4V24A 3ZOZA 4DV3B 5JS1A 4G86A 3K8OE 1ZFNA 2H51A 4ZAZA 2VRCA 4AS2A 1XRQA 4M86A 5D5HA 1T1RA 2Q4OA 3V8NA 1E3MA 4HZGA 4GPD1 2F7SA 5A7GA 3NUZA 5AKIA 1QFMA 5JQGF 2QUIA 2YVUA 3O2QB 4KR7A 1NVUQ 2O5VA 2QRNA 4NBLA 3H2ZA 3LXUX 3BJRA 5DW3A 2WV7A 4PGGA 1U8YA 2ATIA 2J0VA 2XHEA 4J91A 4X1YA 1GQQA 1A8SA 1XZGA 1AGYA 4I4CA 1PWHA 3D3JA 1OX6A 4K9NA 1GAXA 4JU9A 1TA9A 2ZU0C 3ACBA 4WCVA 2IZOA 4ZU1X 1TAGA 2ENUA 5C5DA 1TKCA 2C5SA 3ENZA 3HDVA 3EY4A 2O23A 1HL3A 4DCMA 3FFBA 4YQFA 1CT9A 3AINA 1SXHA 2P2NA 1XG5A 2BFBA 1RWWA 3K72B 3PQ7A 1WZUA 4PSUA 4R41A 3WHPA 5A7FA 1H22A 5BN3B 4EVIA 5EJ7A 1G64A 1P4JA 2P9EA 2VC2B 1L5LA 3H5VA 1U2DA 4MUJA 4L2IB 4NJMB 1Z28A 4IHKA 3X1WA 1I3KA 1YQUA 1AOXA 1JE1A 1VE5A 4JI1B 3IODA 1P2GA 2WNSA 2IX3A 3BEOA 4Q37A 5ILQA 1S7GA 3MK31 5FOXA 3VU8A 1S6YA 4BQRA 3TNFA 1X7WA 1VYVA 2A0FA 3GRPA 4H1VA 9LDTA 3OPMA 3ZV3A 4D9KA 3QTBA 2HPZA 1ZM2A 4JL5A 3C70A 3CRZA 3H0CA 1IY0A 1KEZA 3NIGB 1R4MB 4LXYA 4P4TA 4ECAA 1JNYA 1U1IA 2DAPA 3A31A 3AZOA 5FUBA 5JE8A 3O9MA 3TL2A 5HMMA 1DB3A 1EB8A 2EJUA 4G0NA 5ED4A 4E31A 2EARA 4IZHA 2B7BA 4WK2B 1UDAA 1V16B 3BZWA 3GELA 3GIDA 3BXPA 4NMMA 4RADA 2YS6A 1ISIA 3ETGA 5D85A 2QX7A 3AHCA 3SYNA 3O03A 2PKYX 1U8UA 4JQZA 4JIGA 5ALVA 1AKYA 1NMEA 5EIBD 3I9V6 2HJWA 3OMLA 1M7GA 1WRBA 4F9EA 1QSGA 4AI6A 3FAKA 5HW0A 1O9BA 3ZXYA 3RVNA 3M5WA 3U7IA 4P0PB 5LMCA 1PDWA 1MUUA 1RBZA 4B75A 4MQMA 1QMGA 2QRHA 3EGIA 2QMEA 4FEYA 1L7EA 1YL6A 1ZUNA 5D6NA 2XXJA 3BRSA 2QZSA 2WHEA 3MXOA 3QVWA 3TG2A 1WWKA 2V03A 4ZVQA 1JJFA 4HAUA 4E22A 2HJSA 3RM3A 4RY9A 1U5AA 5ITWA 3UVEA 3PEYA 1CHDA 1DC3A 2GYVA 3L79A 4CIYA 4DCTA 3TWOA 1S2GA 4MHOA 3DHEA 5JAUA 3AQ4A 4OBWA 4XCXA 1TJNA 2IUYA 2VUUA 2BFDB 3L1HA 4RC9A 5CX1A 1KI8A 3V2GA 4JB3A 5C5EA 4FM9A 2MMGA 5DT2A 1YA4A 4YPVA 4TSKA 1RWOA 1UPUA 3LBYA 3OFSA 1E79D 3PQEA 1CRQA 1YQGA 1B6TA 3OBBA 1SVSA 2AG1A 2LXNA 3BXHA 4F1JA 1CULC 4R81A 2ZETA 4WV3A 5JMTA 1MHTA 2JJYA 1E5VA 1KO7A 1PUJA 3T4EA 1Y4DE 2Q6TA 2IHZA 2WIBA 4HAWA 4BWYA 4LC1A 5AOVA 4Q4DA 1ABFA 3PNQA 4HDAA 4NNPA 4UXIA 2A7QA 3R7DA 4UJ5A 4KFSA 4MXDA 5HQ3A 4KDEA 4MW4A 1T1GA 3BDIA 3WRYA 3UAYA 4OM7A 2DUMA 1ZGJA 3TFWA 1Y8CA 4ZALA 4BVBA 3SQDA 3SXPA 1WG8A 4S05A 1N7IA 5CT8A 2C7RA 1AX9A 3I52A 2RGUA 1CNEA 3C6MA 3PJRA 3HU5A 2HPAA 1R4NA 2C5HA 2OT3B 4QUJA 3ZQKA 5CAEA 1R0RE 1UPFA 2R00A 4NNOA 1C9MA 4NXNB 1SUCA 1FU7A 1JR4A 4J75A 1CR6A 5FFFA 2HEGA 1FUUA 3H0EA 3K70D 3BA6A 5KKNB 4CIAA 2YIVX 1IHOA 1X0XA 2XB6A 3K5PA 2J3JA 4WADA 2IY9A 4ND2A 4U2CA 5ALFA 5AWFC 3FGNA 3R9XB 1TMOA 1CY8A 2C9YA 3G9TA 3B7PA 3ZVMA 1Z2NX 2H54A 2PLNA 1A4IA 3JPWA 4PO3X 3L7AA 4UMVA 2BGJA 5GJBA 5JJKA 4HX9A 5KKAA 3U6BA 2NSLA 4X66B 2L82A 1J56A 2NIPA 2UVQA 4D3YA 3LL7A 5B58C 5TQVA 3WMWA 1HNNA 3ZWVA 4M3NA 3JD3A 4R1PA 4P9NA 3VNBA 3WHKA 1E2EA 1JR3E 3ZGVA 3VZQA 1LV8A 3OOJA 3ZU5A 1ZIYA 4EK9A 3EGOA 3KNZA 3JAKB 2PKXA 3KOWA 3T3PB 1OFUA 1T9AA 4IIJF 1QUEA 2RB5A 3E05A 1F20A 1G2QA 3I05A 3O7MA 1DDIA 2Y1FA 1XRNA 2IYEA 4L9RA 4MP3A 4Y1RA 3C45A 5K99A 1JXOA 3UYKA 3IXLA 4I8XA 3T1VA 2HMUA 2BISA 3PZRA 2RD2A 3W8DA 4CM3A 4URXR 2P6MA 3NUQA 4FJ0A 4M88A 5ANRB 4CTKA 1XCGB 5FR2A 3R3JA 3T7EA 3TPZA 1SR8A 1O95C 3AP1A 1PFKA 4J1QA 5C51B 1G21E 3ZUGA 3E8SA 1ZSYA 2GZ3A 2OPHA 5MFZA 1P6QA 1I94B 5MGNA 2PO7A 4WA8A 5BMOA 1QJCA 1JQLB 1EYZA 3U3KA 1PK7A 1VLHA 4FW9A 4MI3A 5HKLA 1QDUA 1UKBA 3ZE9A 4IIEA 2YV3A 5KYXA 5JPDA 1E2JA 1XSEA 1NQTA 4Z1OA 4OUDB 2AOTA 3ZLTA 3SGLA 3OKPA 4XVRA 3IHKA 5K0SA 4GVPA 1Z73A 3BHJA 3KL2A 3W9YA 5KOHB 2FPMA 1MTZA 3N3AC 4RPCA 5U9CA 2ID4A 5EIFA 4RKWA 3HVJA 5F5LA 2XH8A 2ZJ8A 2HRCA 2E87A 4DV6B 2I6FA 2COUA 3W5HA 4KFTA 2EGHA 5DX0A 3TQRA 1DC8A 1P0MA 1VOTA 3G8CA 1ML4A 2W70A 3T4UA 4PC2A 5CVDA 4OU4A 5DIZA 2GK6A 3BWMA 4R9SA 4YP1A 4UMEA 2MSCB 2O2EA 4QXQA 5CLJA 1ENZA 1N3IA 3AHFA 3E84A 4M0CA 5AM4A 3M4XA 1WUYA 3ND7A 1GU7A 1E7YA 1VGQA 4RD6A 3WLPA 4KQ9A 4Z4EA 2IS2A 3NRBA 2VDPB 3RK0A 4F2DA 2CBGA 4GO1A 5I9MA 5KNCH 1AKQA 1O95D 1J8FA 2UVPB 3OA2A 1FLDA 3MUOA 1A82A 4PV7A 4XQCA 3C3JA 2JFUA 3VX4A 1QCCA 3S2ZA 4YALA 2K2QB 2V7VA 4F3CA 3GDWA 1RYHA 2RBKA 4O4HF 4DGQA 3DBRB 1AXRA 1JKFA 3O8BA 2GJ4A 4K9RA 1J0AA 4JROA 2H0QA 3QE9Y 3KM0A 1DC5A 3EYAA 1V9CA 2PUWA 4MVXA 1ISGA 2NUTA 2YWRA 4Q9AA 2QV0A 3ESQA 1N6IA 1O87A 3AF0A 3ASVA 3UAGA 4Q7JB 2HDOA 3RC7A 1WKBA 4F85A 1Z3IX 4DMUB 2M6LA 1E3IA 2AR7A 1YB5A 3AYXB 5CA0F 2ZJ6A 1UQUA 3IX7A 2WSIA 4YRIA 2PH3A 2WR8A 4LGVA 4P4SB 3VV3A 1VCHA 4WN9B 1YQ9A 5E8JA 5HJ5A 4B2IA 3ZCPA 4RH3A 3DCJA 3PA6A 4LZZA 5E4TA 5CXUA 3KUUA 1ADGA 2PH5A 1QZTA 2E1RA 3ZCTA 3CNBA 2CL0X 5HFJA 1YB7A 2AF3C 2MYTA 3LQKA 4RV9A 5MHTA 2WV9A 2ZPUA 2H5IA 3DMPA 4NHEA 1CDDA 2R25B 2M32A 1PR5A 3D6HA 3HJAA 4GNRA 4HQFA 4M22A 3HDJA 1XZHA 2XNDA 3OZGA 2OA0A 4EPVA 1EDBA 1V4BA 2WA2A 4KPGA 2ATVA 3TRDA 1E9EA 2IYZA 4B87A 3IGFA 4HMQA 4DLKA 4OSEA 4CKBA 1RHKA 1XD9A 3SNHA 3KYCB 3RUFA 3LTEA 2R5NA 2CZCA 3AK4A 4MI1A 4MS1B 2GTPA 5DBHX 3TLBA 1C4KA 3WP0A 1VL8A 2ZROA 1THTA 4U7WA 4EZBA 3JRWA 2O3JA 3I8SA 5KAPA 1T9KA 3EXFB 3LPMA 3NWBA 4MW2A 1WF3A 2Y3IA 1BMFA 1R4ZA 3X1JA 4S0ZA 5KWJA 3AP3A 3BGVA 4QWMA 4F7DA 1RRMA 1Z39A 3ENQA 2D5LA 1RI1A 3BG5A 3JQAD 1AGRA 4S1TA 2A1UB 4GM4A 3N6XA 2VCYA 4MDFA 2O2HA 2BJHA 4B34A 1C7RA 5KNCA 1CY1A 1NP7A 2AXPA 2R87A 3G82C 3MB8A 4A0QA 3GO4A 1OH8A 2VHZA 3DUFA 3IO3A 2WTMA 1M1UA 4D8UA 1C8VB 3C6XA 2Q3FA 1A04A 4R8LA 1NRJB 1VIDA 3MSXA 4YBRA 4ZAXA 5TMBA 3ZWYA 1GN8A 4BVHA 3VMMA 3TUIC 2Z4RA 5KMGA 1VFPA 1QLWA 2YV5A 1VPVA 2OFOA 4JLUA 2WLSA 1PDVA 5CB8A 4MRAA 3NT5A 4G0YA 1YC5A 3FWZA 5H02A 1W2WB 1OGJA 3LX5A 1Q11A 2FRDA 2OOSA 2PS9A 4MQEA 1UOOA 2WUEA 1KAMA 4IXDA 2YXPX 4HS9A 1X38A 1RFLA 3E70C 4E6PA 2FVXA 3OA0A 4WY5A 3V42A 4F93B 4FYWA 2EEZA 3JWGA 4R8SA 1QK3A 1D6MA 4FYVA 2FMXA 1FUKA 3G02A 2GCNA 2XTZA 3F4KA 2UXBB 4RJJA 2QAJA 3VNSA 4DCOA 4URVR 3NHUA 3RIEA 4Q1CA 5K4HA 1M2JA 3W3ZB 3DNMA 3D8HA 3HV2A 3O1HB 5BN1A 3KZ1E 2ZBRA 1FXUA 1IUPA 4RTQA 1YJBA 3V6MA 2QN8A 5AVQA 1NFFA 2Q4BA 3ZHXA 5AJWA 5KX5A 4B9AA 3U4QB 1WXGA 3G0HA 4EA8A 1Z2PX 4I4LA 1XTPA 1GPJA 1RXCA 4GR4A 2ZRLA 4BZXA 1OFUX 1ZIPA 3V7NA 2XA9A 3HQ4O 3KL4A 4OYRA 4M8SA 4HXEB 4OUDA 1ZD3A 3EISA 3CEAA 3I6ZA 5DYWA 3ZHRA 4EUSA 3T38A 4WLUA 2EKLA 2P1DA 1GARA 1Q0SA 4HDRA 4X6YA 2DR3A 2AT1A 4US2R 3TBFA 1FY2A 3HYLA 3M6UA 4GPTA 2B1IA 3O3OB 4K8RB 1XNHA 4GYJA 3AFGA 4JX8A 3TQHA 1MV8A 3C5HA 3ND8A 4P92A 5GM1A 4JBXA 3JQ7A 4OQMA 1JZSA 3AFNA 2VZ9A 5BSFA 1L4YA 3PGMA 1K89A 1YO6A 1XJCA 2IIVA 3QBDA 4DSUA 1P0CA 3BB4A 1KRHA 3Q8WA 4GGPA 1P0IA 1ZUD1 4LE0A 4PTYA 3BGSA 3U7QA 3VC3A 1ZOIA 1YZFA 1G6KA 3KLBA 1UT5A 1DXHA 1AQUA 1F48A 1RD4A 4KIGA 1HDIA 4Q9HA 4DUGA 2UUBB 1Z18A 1VKRA 2VH2A 4GKAA 3CBQA 4P80A 4EPXA 2OBYA 3OCWA 1Y48E 5DNCA 3D43A 5LR6A 1YB6A 4MRPA 2QORA 2PLAA 3MPUA 3V34A 4ED9A 3MRSA 1G4UR 3MJCA 4A8HA 1GGFA 1ZUWA 4OGGA 4YR7A 2FW0A 2E85A 4M0MA 3I30X 3L93A 4GZ3A 2DFLA 2FZGA 4CZ2A 5BOSB 1J70A 3D7NA 4MVJP 2G0NA 3RPEA 1GOTA 1UBGA 1VHDA 2BKVA 2Y66A 3QU7A 2QSYA 2BJWA 3CRRA 4IR7A 3GLGB 3NBQA 3TZHA 2M1XA 4UOQA 1ZYUA 3HB0A 2P41A 4O59O 4RZUA 1XZPA 4YMUA 1WUKS 1ZJ6A 1H6DA 1I13A 5EINA 2O6HA 2BFCA 3MWJA 2ID8A 3NOQA 4KXQA 1ULSA 3TKLA 2BYTA 3BTUA 1D3AA 5C0OE 3Q3CA 5K20A 1DL5A 4N39A 2V6BA 4FEEA 4AJNA 2H9AA 4O3MA 3AUAA 1AV7A 1H0KA 1H8EA 4XR4A 4R1NA 1M2VA 3DZFA 3KPU