2QXUA

Crystal structure analysis of the bacillus subtilis lipase crystallized at ph 5.0
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Lipase
publication title Structural basis for the remarkable stability of Bacillus subtilis lipase (Lip A) at low pH
pubmed doi rcsb
source organism Bacillus subtilis
total genus 65
structure length 179
sequence length 179
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qxuA00
2QUBA 5EIHA 3OPMA 4F21A 1MU0A 1PV1A 4GI1A 5CTAA 3LP5A 5LKRA 3R40A 1JJIA 1P0MA 1DX4A 3DD5A 3I28A 1MAHA 4LYEA 3ZLTA 1P0QA 1THGA 1IMJA 4BYMA 5JD4A 1Q0RA 3ICVA 3FCYA 1YB6A 1AZWA 3VKFA 4FOLA 4ROTA 1X70A 3R41A 1JI3A 4B82A 2I3DA 5D3ZA 1K8QA 1C7JA 3W04A 5JAUA 1XZAA 3BDIA 4WY5A 5AP9A 4DNPA 3FOBA 1QIDA 4FWBA 1H2YA 2OCIA 1R9NA 4BP9A 3PI6A 1PJAA 4GECA 2GZSA 3WQHA 2XQKA 1EHYA 3HABA 4H7FA 3G0IA 1D07A 4H7IA 3FLEA 5ALNA 5AKKA 2WIJA 4D9JA 2WG0A 3LIPA 3N2ZB 3U1TA 4CI9A 1BN6A 1QO9A 1CUBA 4X90A 3R3WA 3WA7A 5D3KA 4H0CA 4B0PA 1G42A 4GHWA 5HFAA 1ZJ5A 1RWQA 3OTQA 1HDEA 3O95A 4DTCA 4HRXA 1HLGA 1FJ2A 2C5FA 4B85A 1AX9A 3F96A 5ALFA 2WUDA 2XMDA 3QPCA 1QFMA 3RARA 5JZSA 2HRQA 4EZIA 3WL5A 4UBLA 4OCZA 3FCXA 3QMWA 2FUKA 3KOOA 1IVYA 4Y2SA 4JYPA 2ZYRA 4O08A 2J3QA 3FSGD 5AK6A 4FKBA 4PSUA 3QPAA 1MT3A 1XQVA 4QE3A 5DWDA 4UHDA 1LPOA 5DLPA 1H2XA 3BJMA 4N8EA 2VA9A 4HTAA 1IZ7A 3TGLA 2XMQA 1XZCA 1DQYA 5AJHA 1UOQA 3CCCA 4CG2A 2XUJA 2WHQA 3FYTA 4FNMA 4C4YA 2PL5A 4EB0A 4GWLA 1XLVA 4KRXA 4UUQA 1KEZA 3D2AA 5JD5A 5ALIA 2WU4A 4UBIA 1MNQA 3WIOA 1K63A 2BUCA 3PFBA 3S8YA 5JASA 2BJHA 4CCWA 2PSHA 3BDVA 5JADA 3WL6A 5FRDA 4PV7A 3ZV7A 2BKLA 5HQ3A 1MX1A 2PPLA 5CT5A 1ACJA 1K6EA 5AKHA 2WQZA 2PSJA 3WK4A 3ESCA 2XLBA 1R9MA 3DYVA 4UBOA 3E1GA 2IX9A 4QDUA 1G66A 2HHAA 5AM2A 5HF6A 3WMRA 1JU4A 1YB7A 3QVMA 4Y2JA 2XQGA 3ESBA 2WFLB 3WI7A 5AICA 5T4BA 3WJ1A 1XZMA 4KR0A 2NW6A 4DYHA 1CUEA 5K3BA 4BDTA 4NVRA 1F0NA 5AKJA 3R0VA 2R8BA 4IH1A 4DSAA 3AIMA 3A2MA 1E89A 3G7NA 1U4NA 1WCYA 4I19A 4UBJA 5EHXA 5I9IA 4Y2XA 3A70A 2WIGA 2DHDA 3AFIA 4XVCA 1GKKA 4L9AA 1BCRA 4MXDA 1CRLA 1BRTA 3IUQA 3LS2A 4OB6A 2XUKA 2AJDA 1WHSA 2XMRA 2PBLA 4KJXA 1WM1A 3NUZA 1B6GA 2LIPA 4OUKX 4K6KA 2JGKA 4B83A 3FVRA 3O9VA 2XUPA 1GGVA 1QIEA 3ICWA 3FNBA 5A6VA 2YH2A 3V1LA 1WPRA 4BZZA 2QJRA 2GBFA 5DNVA 1VZ2A 3O4JA 4WDRA 3IIIA 2GBIA 3NGMA 3ZLUA 5KBYA 1CQZA 5H3HA 1DWQA 4KAFA 1XZGA 2WFZA 3VXKA 2QS9A 4LYDA 4I3FA 4A23A 1QIJA 4J0HA 4BP8A 5HZGA 5JAOA 3GBSA 3DKRA 3IDAA 3WK5A 1YSCA 4YPVA 5E4JA 3IULA 2VEOA 2G63A 4G1FA 3IA2A 1WHTA 4HS9A 3V1NA 5E4YA 1A8UA 3W9UA 1A88A 3UUEA 1X2BA 4W1SA 4U2CA 3IBTA 3H2KA 3CXUA 5CT9A 4C87A 1DINA 2B61A 2QR5A 3GZJA 1XZFA 1ZGBA 5J3JA 4G5XA 2AJ8A 3WIBA 4DMHA 4Y2VA 1JJFA 2DQZA 1ZGCA 3HEAA 1T2NA 2WFLA 4UBMA 4DMCA 1YAHA 1LBTA 1L7QA 3WK8A 2XUDA 2QM0A 3WK7A 5FUMA 1AKNA 5AKLA 4PQEA 2C5GA 3V1MA 2HU5A 2OGZA 2IITA 3K6KA 1YA4A 2AXEA 1W76A 3DCNA 3A2NA 4B9EA 1GXSA 5BWBA 2DHEA 4BATA 3H18A 5E2IA 1ZI9A 3AIOA 4QNNA 4RPCA 4GW3A 1XRRA 1VA5A 5AK5A 2QKYA 4RE5A 5FV4A 3I2IA 2ZSIA 5CRIA 1IZ8A 2OGSA 3C70A 5CT4A 1CEXA 1Y7IA 2WIFA 1P0PA 2YXPX 1QIIA 2V9ZA 5AKEA 3QMMA 3R3VA 4P93A 2O2GA 4G4IA 3HLKA 2DCMA 4C6HA 3WWEA 4C01A 1F6WA 1UFOA 1VXRA 5AO9A 2XUQA 5JD6A 5HK9A 5AKXA 2WUGA 3I1YA 1CUFA 3EF3A 4HXEB 3L1HA 4WJLA 4TVKA 1OILA 5FKJA 5JAPA 2WUFA 1KU0A 3U0VA 2V97A 3R3UA 5A7FA 1EDEA 4BTVA 4F60A 1XRQA 1E66A 3TRDA 4AO8A 5K3CA 5ALWA 5EFZA 1XZEA 1LPBB 5LKAA 4CIAA 1LPAB 4MJ3A 5K3DA 2GYWA 4V2IA 3SWWA 3AIKA 1MAAA 2CJPA 4G9EA 1ZIYA 5LZ9A 2EDAA 4BE9A 4MQLA 1XQXA 1E8MA 3OURA 1SCQA 3JW8A 1MJ5A 2Z5GA 4WDQA 3KSRA 4QWMA 2I03A 4IH4A 4A16A 4B7ZA 4UHBA 2WTMA 2CUTA 2HA2A 3SK0A 4QZVA 4LXGA 4L72A 5T4FA 4UHEA 5JARA 4GLBA 4L3WA 1ODTC 1JKMA 5AKYA 2CBGA 5DTJA 3RM3A 1CUAA 5YASA 3RKSA 2JGJA 4MYSA 4FHZA 3V48A 4PF1A 4AMYA 4OU5A 2EDCA 3EBLA 4KACA 3H2HA 3OM8A 4Q82A 4U2GA 1WB4A 4J0JA 1E8DA 2XUGA 4NMWA 4X97A 3QMVA 3RLIA 1CUSA 1EK2A 3DL7A 1ODCA 5IVDA 1UZAA 4BAUA 1R3DA 1BU8A 5EHQA 1XLWA 2QXTA 2I3ZA 2ROQA 5EI5A 4BC1A 2VJAA 1J2EA 5HCUA 4W1PA 1VOTA 2CEKA 1VZ3A 2DQYA 2IIVA 3E4DA 3DDUA 4J0DA 1EDBA 5JYCA 1QTRA 3SX4A 2WTNA 3H0CA 2C0PA 2HDWA 2Z3WA 3QITA 2P8SA 4JEIA 1DWOA 3C87A 4X85A 2PVSA 2RIPA 2JGMA 4EY6A 3YASA 4CCYA 5LYYA 4DLNA 2O7RA 2JGFA 3DOHA 3CN9A 4ZV9A 2QXUA 3FBWA 3NOXA 2QTBA 4F5ZA 4FLFA 4OPMA 1IUNA 4DIUA 4LXIA 2WLSA 2C58A 2PU7A 4KE7A 3QBJA 5CH8A 4JYMA 3HZOA 3QPDA 1CPYA 2B9VA 5A2GA 2E3JA 4U2EA 2Y2UA 1AQLA 3R3YA 1U8EA 1H2WA 1EINA 3DL4A 3EQ8A 4M0EA 3D0KA 4EY8A 1WPXA 4E14A 2HRRA 3WKCA 1DU4A 4AZ0A 3D2CA 4G8DA 5ALQA 5JAHA 4BAZA 3ZPXA 3QZUA 1MN6A 4CG3A 5DYWA 1N8SA 1YAJA 5CH5A 3D5EA 4X91A 2HIHA 5ALEA 4C4ZA 2H7YA 4G9GA 2QUAA 3MVEA 1LBSA 4KE8A 4WFJA 2C7BA 2J4FA 2XE4A 1X2EA 1WB5A 3IUNA 3QH4A 3WKBA 4W9RA 3B5EA 4J0KA 2RONA 5AIBA 4Y7DA 4HXGA 1A8SA 2HA0A 3HI4A 4B9AA 2ZYSA 1ORVA 5T4HA 4XIIA 4AB1A 1P0IA 2PM8A 2WIDA 4QDZA 5AI5A 1AMNA 1CLEA 4K6GA 5AI6A 2DSNA 3HYSA 4BVJA 5IVKA 4W1RA 4DNOA 4BAGA 1R4ZA 4AN0A 1HPLA 2JGLA 1JU3A 3ZWQA 3ZLVA 1XRPA 4FTWA 2QJWA 5ALYA 2PU5A 4AN1A 3IUMA 5FLKA 4FNGA 1WOMA 2DFPA 1GPLA 4A5SA 1TIBA 5AI9A 4BE4A 1ZD5A 3NWOA 5EIAA 4NZZA 1AUOA 1U2EA 4F0JA 2HM7A 3ANTA 1LNSA 1LPNA 3WWPA 4H18A 1MX9A 1TCBA 4BVLA 2FX5A 1OCEA 2WILA 2ZJFA 5FOQA 2VT7A 4UFNA 4Y2PA 4OB7A 4MWTA 1EB8A 4GDMA 3VJMA 5ALRA 4AO7A 4XWGA 1UWCA 4G8CA 2OAEA 1EH5A 4E11A 4X6UA 4AMZA 1Q83A 1XKTA 2XMSA 3K2IA 5K3AA 1CFJA 4QDTA 5JIBA 4K6HA 4KAJA 3L1IA 3AINA 3BJRA 3C6ZA 4EBBA 4MWSA 1BE0A 3FYUB 4Z49A 1GZ7A 2ZJ6A 5FXMA 4H7DA 1VJ5A 4MQMA 1QFSA 1XZKA 5EGNA 4PSDA 1CUHA 5C8VA 3PFCA 1EA5A 7YASA 5K3EA 5LZ2A 1XRMA 3FAKA 1EDDA 3T52A 5AK3A 5AM4A 1W6RA 4INZA 1LLFA 1MX5A 2C4HA 1QOZA 4Y2TA 4C89A 2X8BA 2OGTA 2ECFA 2WG2A 3N0TA 5EHZA 4U2DA 2WJ6A 2UZ0A 3FSGA 2XUAA 4DNQA 1A7UA 3G02A 4PW0A 3WWDA 5AI8A 2H9YA 2W22A 1PFQA 3DNMA 2HA6A 3PUHA 4GEGA 4JNCA 4AO6A 3A2LA 5FP0A 1GQRA 2JF0A 1ZD3A 1QONA 5C7YA 5AI0A 4CG1A 3OC0A 3MUNA 5ALPA 3WZMA 4KAAA 4BCCA 1OXMA 3BL8A 1JT2A 4G8BA 1ZJ4A 4N5HX 4IQ4A 4X93A 1N1MA 1XRNA 5CBKA 3VJKA 3H2GA 1XZLA 4X94A 4WY8A 2J4CA 2OCLA 1MTZA 2XUFA 4RE6A 3D7RA 2H7XA 3B12A 3LCRA 3O4GA 1E5TA 2PSFA 4DMFA 5DYTA 4OU4A 2OG1A 2WKWA 3STWA 4QLOA 5CW2A 2XDWA 4AX4A 3C6BA 1EX9A 1E3QA 4X3CA 2JEZA 3BE8A 2OQVA 1CUIA 1U65A 3G9XA 3WKAA 4E46A 3PUIA 2VJDA 1LPSA 1JJBA 1YA8A 1DWPA 4J3JA 3STXA 2BAGA 3HACA 4GXNA 2ZSHA 3L1JA 2XLCA 1ODSA 1XQYA 4X00A 2X76A 1IUPA 1UKBA 3KWFA 3MGAA 3QM1A 4P9NA 1ZD2P 4MEAA 3HC7A 1QLWA 4MYDA 2Z8XA 3C8DA 3OOSA 5DJ5A 3HSSA 5ALVA 5ALSA 4K2AA 4OYYA 2VJBA 4ARBA 4FBMA 5AM3A 4KE9A 5HKAA 1G5FA 1CV2A 1W4LA 2HA4A 2WSLA 4X95A 3VISA 3M82A 2ES4A 3QYJA 1W75A 3C43A 1VLQA 2WUEA 3JWEA 1J07A 5ALGA 3AJAA 2GZRA 3ANSA 3VVLA 2K2QB 1CUUA 3BF7A 1W1IA 5SYNA 4DSZA 4DM7A 4GBGA 2AJLI 3ILSA 1QJ4A 4X6XA 4LXHA 3V9AA 1XRLA 3ESDA 3ED1A 3TJMA 4Q3KA 2HU8A 5C8ZA 3G0DA 1I6WA 5D7BA 5ALLA 3G9UA 3C5WP 2OCKA 3AUKA 4Q05A 3CCBA 3PE6A 4ZWNA 1XKLA 2ZVDA 5BWCA 3G9ZA 4BVKA 1YCDA 3OG9A 3KD2A 1J1IA 2W6CX 1TCCA 2ACKA 1RP1A 4XJVA 5ALDA 1EB9A 1THTA 4M0MA 2RI6A 4Y2RA 1CUVA 3C6YA 3BIWA 5LZ5A 4L0CA 3O4IA 3V1KA 5CH3A 3DJYA 1SCKA 4Q3LA 3H1BA 2WIKA 4K5QA 1N5MA 1EVQA 5A71A 2H7CA 2B20A 4HRYA 3G0GA 4HZGA 4EY5A 3M81A 1VE6A 3UUFA 1T4MA 1JMYA 3D3NA 4P08A 1GT6A 4Y9SA 2HFKA 4J03A 3WA6A 5CT8A 3SC2A 1YR2A 3O0DA 2XUHA 2QOEA 1Q0ZA 2Y1KA 2HA5A 5AM0A 3FVTA 3GROA 2FJPA 2FJ0A 1F0PA 2RAUA 1NU6A 2WM2A 1QGED 4CIBA 1DT3A 3FYUC 1DQZA 3I2GA 2HFJA 5HF9A 1BEZA 5HFNA 1ZI6A 4UHHA 5AOCA 1CVLA 3EQ9A 1IUOA 1CUJA 1QO7A 3JYHA 4WFIA 5ALHA 4ETWA 5I8PA 2O7VA 5FDFA 1TRHA 4QA9A 3WJ2A 3WKDA 3HJUA 1S8OA 4ZREA 2RGUA 4I4CA 4HAIA 5JATA 2Y6UA 3BIXA 5AKIA 3VVMA 2HADA 2G5TA 2Y2VA 5AOBA 4H7KA 1ORWA 2HA7A 3AZPA 4ZGBA 2BGRA 3E0XA 3KXPA 1CUYA 1VXOA 3I2FA 4UBNA 1XFDA 1LGYA 2OLEA 3WLAA 4QEKA 1UK6A 4UFPA 1FFDA 3BWXA 4Q1VA 4X71A 4UFOA 4KYVA 4H7JA 1EK1A 1GQSA 1QIGA 3D2BA 1BEEA 1YS1X 5LIPA 3FLAA 1SFRA 3I2JA 1QZ3A 1L7RA 4X92A 5ALJA 1HL7A 1CUDA 5K3FB 2QT9A 4BTLA 1CQWA 3C8HA 2AJBA 4X7BA 4NS4A 4Y2QA 2YYSA 5IVHA 5BV7A 2WG1A 4N8SA 2OAGA 5KREA 2JGIA 4BB0A 3IURA 2VT6A 3WL8A 3W05A 5EHNA 4BCDA 4OYLA 3PDCA 3WL7A 4WCVA 4OB8A 4H77A 4FMPA 1NX9A 1CR6A 4UHFA 1QIFA 1UK9A 4Q3OA 5LLSA 3HXKA 1KU6A 2QVBA 1H23A 1VKHA 2JEYA 3AZQA 5EIEA 2CMFA 3MUOA 3STTA 3I6YA 4AXBA 3DOIA 1B41A 2Z8ZA 3W06A 2XMGA 2D0DA 4DGQA 3C5VA 4RGYA 3I6MA 4W1QA 3M83A 1R50A 4QWWA 3W9BA 1GPNA 1WB6A 5KWJA 4QDOA 4PNZA 5ALXA 4TPKA 5D6OA 3D4LA 3F67A 1VE7A 3DLTA 2GYUA 5C81A 3HRHA 4BDSA 5HQ3B 3CN7A 3DS8A 3FWHA 5AH0A 1ACLA 4H7EA 3WWOA 5IH7A 4KE6A 2V98A 5DNUA 2WFMA 2ZJ7A 3STYA 1BS9A 4OSEA 5F4ZA 1MPXA 2ZYIA 4XX1A 1CUWA 3P2MA 2XUIA 4LHEA 3H17A 2Q0XA 3E3AA 5A7HA 6YASA 5K3FA 5HKBA 2PKYX 1CUCA 4B0OA 4DMKA 1UK7A 3G9TA 4MEBA 4J7AA 3PF9A 1LPMA 2VSQA 2Z3ZA 2XMZA 3DKKA 2OQIA 2XMCA 5AKGA 2VAVA 1QTIA 2I78A 4ZI5A 4PSCA 3ESAA 1DTEA 2BUBA 2XT0A 3BF8A 3F9CA 2QZPA 3AZOA 4ZXFA 3WWCA 1MNAA 1YASA 2HU7A 4B80A 5CURA 2PSEA 2GYVA 1Y37A 4BZWA 1LZLA 2WHPB 4HXFB 3B3QA 3DEAA 1XZDA 2D5LA 4S0XA 5LZ7A 3WK9A 2OXEA 4N5IX 5DNWA 4P92A 5BOVA 5C8XA 4Y2YA 2GBCA 2JGEA 4EY7A 2XQJA 1XROA 2GBGA 1FFBA 2PUJA 4E15A 1H22A 4UPDA 5HF5A 1XZIA 1HKHA 3VDXA 3H1AA 5E4TA 3DQZA 1TCAA 1ZOIA 4DNFA 5AM5A 3Q8WA 1FFAA 1TQHA 2PSDA 1NU8A 2G4LA 4UBKA 4QLAA 2BFNA 1QIHA 4U2FA 3A6ZA 2O2HA 1GKLA 1N5RA 5CMLA 5JALA 4LKOA 3F8SA 2VQ6A 4ARAA 2OCGA 5SYMA 5A7GA 1QIMA 1ISPA 2ZYHA 2J3DA 3W2TA 5ALKA 3X3HA 4Q34A 1Q84A 4EUSA 3D59A 3I2KA 4BBZA 1F8UA 2ACEA 2PUHA 3EIOA 4IO0A 3BXPA 2CB9A 2BUAA 4OD0A 2HL6A 1UKCA 1DX6A 5JZBA 3Q0TA 1O6GA 5CXUA 4UHCA 2X5XA 2Y6VA 1QE3A 3FYUA 4KEAA 2CZQA 5A62A 1SOMA 1LZKA 1QIKA 2WHPA 3IB3A 2EEPA 2JBWA 3C45A 3GFFA 4ITVA 2ONCA 3S2ZA 2C0QA 1O6FA 2QMQA 3G8YA 1R88A 4PO3X 5IKXA 2XQIA 2WJ4A 5ESRA 1A8QA 1SC9A 5HF8A 5ALOA 1Z68A 1UOOA 3R3XA 3F97A 5AM1A 2JIDA 1FSSA 1Y7HA 2YASA 5DYYA 4B81A 2V96A 4EA6A 3IUJA 5ALZA 4EY4A 2VTVA 5ALMA 2BCEA 1HQDA 1LPPA 1TK3A 2G5PA 1BCSA 2BGNA 5AHXA 4ZV7A 2CKMA 4AQDA 1BN7A 4WFKA 3G0BA 3KDAA 3KWJA 4BC0A 3I6ZA 5IVIA 5JZ9A 3O4HA 4YX9A 2QRUA 5K5EA 1L7AA 1MO2A 3UMJA 1FFCA 3H19A 2B4KA 1R1DA 1ZICA 2VJCA 3H2JA 1CUZA 1SCIA 1XZHA 4U2BA 3M3DA 2H1IA 4J0GA 1W52X 1AURA 4RNCA 5HK8A 1FFEA 1K5PA 1UXOA 1G4HA 1J06A 2ORYA 3WZLA 2XUOA 1XQWA 3C6XA 4C88A 5ALTA 5LP1A 5KWIA 1EI9A 5FPPA 3LIIA 3GELA 4M0FA 2DHCA 2RHWA 4IHAA 4H35A 3TEJA 1UK8A 4CFSA 3IVMA 1UT6A 1EVEA 2XMBA 1CUGA 2XB6A 3H04A 1ZI8A 3GA7A 1BROA 4B6GA 1JFRA 1XZBA 4AZ3A 4FDMA 1JMKC 1ETHA 2DR0A 3WK6A 1CUXA 4YK7A 5JANA 5CXXA 1CIJA 2WHRA 3STVA 4X6YA 5AOAA 2VAXA 3AILA 5FPQA 4QDXA 4H7HA 4KRYA 4CCYB 3R3ZA 5ALUA 3H2IA 2VF2A 4TGLA 1C7IA 3I2HA 1XZJA 1AGYA 3DYIA 3T4UA 4YASA 1UKAA 3K9BA 1ZD4A 1RYYA 3LLCA 4JUIA 1TKRA 1C4XA 1K4YA 1AC5A 5I7UA 5LZ4A 1EXWA 1ZIXA 3STUA 3PF8A 3WKEA 1XLUA 1E8NA 1USWA 4B84A 1M33A 5ISMA 4BCBA 4EHBA 2HA3A 4HVTA 2WU3A 1YS2X 1GPKA 3RK4A 4J0IA 4LIPD 3F98A 4ZRDA 2O2IA 3O9MA 4BRSA 1DT5A 4W63A 4FLEA 3GUUA 4BRZA 1UOPA 3G0CA 4FBLA 4N8DA 4JH0A 3WYNA 3PICA 3ZI7A 4FFVA 4G4JA 5AK4A 1HBJA 1VA4A 5AI4A 2RHTA 4C4XA 5LZ8A 2PX6A 2AJCA 2XI4A 4IH9A 2VATA 2OPHA 1H2ZA 3EQ7A 5CT6A 5T4EA 4FLMA 3WYDA 4G4GA 1TAHA 4J0CA 3FLBA 5DTIA 2XQFA 3I1IA 4Y2UA 2WJ3A 3VJLA 5AIAA 2R11A 4FFWA 5AKZA
chains in the Genus database with same CATH superfamily
3AEUA 4EJFA 2JIQA 4GL2A 4UEWA 3IAS6 1D5WA 4PBSA 4TYNA 3GUYA 2QUBA 4GIBA 1HV8A 2DAPA 5H80A 3NFYA 3BZBA 3SKYA 4CF4A 1TT5A 2HHLA 3ONEA 3OPMA 1PO7A 4GP6A 5EIHA 4DSNA 5C1PA 1ZL0A 2HLDD 1A8IA 1MU0A 1F60A 1PV1A 1QAOA 1QH1B 2FNAA 4KLNA 4MH0R 4NZNA 4UATA 4WK4B 5GGYA 5HMMA 3A1SA 2JASA 1XP8A 4JWTA 4BWYA 1ZA1A 1NZFA 3RV3A 5LKRA 3R40A 3DEHA 1P0MA 3I28A 4B48A 4W5QA 1M6WA 4LHYA 2GTHA 2IOQA 1PV2A 1C50A 1FS5A 3IP6A 5HVNA 3IV6A 2A1UB 5AUOB 3HXPA 3CZRA 1PZNA 1G6HA 2UUOA 3BD7A 1NF8A 3N53A 2RH8A 2RMKA 2FP4B 2DWPA 1YB6A 2EHJA 2X4DA 4G0VA 3UK7A 3VKFA 521PA 5BW8A 3C3YA 4Z9FA 2EJBA 2RK4A 1JR3E 2V03A 5EUQB 4C4SA 5IKOA 4ROTA 2F17A 1NI3A 3P2JA 3WG9A 5KYUB 3UBTA 1JI3A 1YV9A 2I3DA 1RLOA 4JJAA 4UZFA 4X45A 4E5SA 2CNNA 3P0RA 3HL0A 3W04A 4FFOA 2PRSA 4BNWA 5B6JA 4V0QA 3AP1A 5EPUA 5BSMA 2SKCA 2EERA 4DNPA 2CC2A 1FA9A 2PRYA 5F7ZA 1GQOA 1QIDA 4FWBA 3SOPA 2HWKA 3HMQA 3OFNA 3SXUB 3WRVA 4ZCTA 1R9NA 3F3KA 4BP9A 2ODNA 1XXHE 5CJ2A 4DAOA 2JFPA 1KAGA 5I7VA 1V3QE 2FPLA 3K0CA 2BR5A 3Q7EA 5BQPA 4LF6B 4YMGA 1PJAA 2O07A 3FI0A 3C3PA 3I9FA 3LCJA 3OZUA 4QYIA 1U2DC 1DX9A 1O94C 1C3JA 3KJIA 1U7XA 2UVPB 3DKIA 2GZSA 4AY3A 2XQKA 2NQ8A 2RJNA 4FINA 3BREA 3G0IA 5KVCA 2VUIB 3NIFB 4MWZA 5I9MA 1IM8A 1RHQA 1HDRA 5ALNA 3QJGA 1NUTA 1QP7A 2WJGA 3OLZA 2FXVA 4JQSA 1XPRA 5GONA 3QA3E 5DW0A 3VR2A 1Q17A 1Z4KA 2QTAA 3MIIA 1YE8A 1QP0A 3U1TA 2DFVA 2IK8A 3HR4A 4BLQA 4CKYA 1D1PA 3BWBA 4A8PA 1HNXB 1DBPA 3ACDA 4TV8B 2J8ZA 4F4CA 3QOFA 4QUAA 1MCZA 4X90A 3R3WA 3C3DA 3RD5A 5AVVA 4QHSA 2P9JA 2DPXA 4R2JA 4H0CA 2R4QA 1NMQA 1PG0A 4HFRA 4LZPA 5D3KA 5HFAA 1M2KA 4M83A 4B0PA 3DXYA 5KJCA 3HCNA 1IH8A 3JQ8A 1KMQA 1RWQA 2D2VA 2ZI7A 3P9IA 4N18A 2OFWA 2ZUVA 3AP2A 4LWPA 1S2DA 1I2AA 1T1SA 2CD9A 2IF0A 4FSXA 2AYXA 5FR1A 2I62A 2JLXA 1VSTA 1Z12A 2RGNC 1T0HB 2C5FA 1HXHA 2J09A 3FSJX 3ABQB 4M98A 3JD1A 1CK4A 3JAWB 4RK4A 4CEIB 2HLDA 1C9MA 3Q3EA 1U0JA 2WUDA 2QU7A 1KFCB 2GPTA 2YHBA 3L04A 2Z2IA 1ZR2A 4YCMA 2ZUUA 4EYEA 4CF3A 1J09A 3GLFE 1IBMB 2HRQA 5EYPA 3WL5A 2DU8A 2IXFA 3IE0A 3T1VA 4CLOA 4B73A 1LA2A 2FUKA 1J0XO 4Y2SA 5K51A 5LOVA 1WXGA 1ZC3A 3I83A 4L8WB 5IFLA 1U0TA 3RUCA 2YV2A 1Z08A 1V1MB 3HVHA 3PLNA 1IRIA 1CD5A 1LK0A 2NUTB 5EESA 3FM9A 4XGIA 5LMUB 1J8MF 2G28A 1NNUA 4DLUA 1KDPA 1MEOA 1PHPA 3CRNA 3G23A 3IO5A 4JB3A 4MK4A 4D96A 2BMFA 5KTYA 3EVEA 5KTKA 1PV4A 1C7RA 1H2XA 3AUUA 4YP1A 4N8EA 5IT0A 3ZVNA 1KO1A 4OA8A 2RHLA 1IZ7A 1E79D 2I9PA 2VDQB 3KB8A 3KBBA 1KMHB 1YVUA 2AOTB 4U7FA 4WZAE 5BXYA 1IG0A 3MBIA 4PC1A 1R6VA 2Q3BA 1YULA 4Q1BA 1CJBA 1V39A 1WW8A 3U7GA 1ZJYA 3ZU5A 3GUCA 1J2UA 1U8ZA 1ZIPA 1BHO1 2EQ5A 3IT2A 2BSAA 4BX9A 5AJHA 4TXNA 3CCCA 3JYQA 2H8KA 1TADA 2H9AA 4KH0A 3KE9A 1B8UA 4UE3S 1KKMA 3N2KB 3TIXB 3FYTA 2BMWA 1NQ5A 1F51E 2WJHA 2PUWA 1XVUA 2PL5A 1G16A 1C81A 1OA1A 3DDZX 2B1JA 4JKIA 1RLIA 2A94A 1RHMA 1XLVA 3O3OB 4KWHA 5GP1A 3GFSA 1RYMA 3TIVA 3OLQA 3LZ6A 4Z5XA 1KEZA 1LSSA 5EJ5A 3FTDA 3JWJA 3PL1A 3T35A 4N9QA 1PR3A 4F11A 4OKNA 4U8HA 3HJBA 4RW0A 1MNQA 2LCFA 2R4UA 4MQFB 4YGXB 3WIOA 4C3OB 1CF4A 1PAUA 5HCNA 2O8BB 1NBIA 3GDWA 3V2GA 1NYTA 4MR8B 4D45A 1TGVA 2WM8A 3G8DA 2G1KA 1MB9A 4RJKA 1XKQA 5IUKC 4Q7LA 3LQQA 4HZIA 4LYGA 3JZFA 1P7YA 4MWEA 4AECA 5JADA 3BRWA 4HGYA 5CM9C 4LVCA 3WL6A 2J6BA 3U4QB 3U9SA 4O4LB 2W6PA 1G5RA 2WI8A 4QFBA 1JECA 3ACCA 3EEQA 3ZV7A 3KXKA 1UAYA 4HBZA 2C8JA 3LY7A 3QKSB 4K9NA 4YP5A 3VYTB 1GFWA 2WSMA 3IUSA 4L5YA 1ZH8A 2LKDA 3HZZA 5CT5A 5EPEA 3PFHA 1BXZA 1LX6A 3IVXA 3NR2A 5AKHA 1GUBA 5EUBA 3GA0A 2OOKA 4P35A 1K3FA 1K66A 1TL7C 3BB3A 3ZCXA 1ZHOA 3OM1A 2XLBA 3VI3B 1DUVG 2X6RA 3K1AA 4UTZA 1CYDA 1TFRA 2WINI 4K9RA 2BDUA 4AKSA 2JGNA 4DS3A 2F1KA 3TDKA 4E5MA 3N2LA 4H7PA 4BQQA 4PGGA 4MDFA 5CFOA 3ZHTA 4R8MA 2AV6A 3ZIAD 1MVOA 1UXKA 5CLJA 4KQ2A 2ZULA 4RQAA 3Q0EA 2Q6IA 5HF6A 3HP1A 4AW9A 3T5MA 2FPIB 4KXXA 4DT1B 5CA1F 4FFDA 4JXXA 4GXRA 5EKUA 1P4HA 3KSDO 3F7MA 3PQCA 2OFFA 1G5QA 2WFLB 4NFSA 4G0XA 1HC7A 3JSAA 1U0SY 2O9JA 1BQEA 2CHQA 5AICA 5JC1A 3S0JA 1P33A 1XZMA 5A3RA 3PNYA 1H69A 4KV9A 3L4BC 3HBFA 1RCTE 3PNQA 2NW6A 3MT7A 1UJNA 1BD3A 4W7IA 5K2OA 3QEAZ 1QZZA 4BDTA 1P75A 3KEQA 2ZATA 4NVRA 2X6QA 1RMTA 4NPAA 5LJIA 2YV1A 2Z2JA 3BSSA 4OHKA 5IABA 1K92A 2SCUA 2WE7A 5HQTA 4IH1A 1A5SB 3A2MA 1E89A 5EHXA 4JLSA 5I9IA 3KKLA 1JHDA 2IZ7A 2I4IA 1VI6A 3KFLA 4UOZA 1T1JA 3A70A 1EFCA 2WIGA 2XB2A 3ETHA 4WXMA 1Q14A 4EFDA 1NLUA 3EGDA 3ZDEA 5IT4A 1VL2A 4RCVA 3ICPA 5HEKA 5TF4A 1OHHA 1HR0B 2CVFA 3CR3C 4JVOA 1H0HA 2IVZA 1PWYE 4IGFA 2YWXA 5A3SA 5K8TA 5MDHA 1KQ3A 4NXNB 4MXDA 4GVPA 5JXWA 3ZK9A 1BRTA 4LI0A 1PR1A 3LS2A 1Q15A 2PGDA 3ZWAA 4OHUA 1O87A 1UIRA 4D99A 4LX8A 3LYUA 4OXYA 5FUQA 1PEYA 2YJGA 1QS0A 4MV5A 5ECWA 3I0MA 3TZ6A 2FRDC 3HVIA 3ZGXA 5TMBA 1EIWA 1FLNA 3HPQA 4OUKX 5CAEB 4K6KA 3WNBA 1I4EB 2G8NA 3JV7A 4B83A 3QKWA 1GQYA 1LNQA 2H65A 2VNAA 3QSGA 3H5IA 3V1LA 1WPRA 2R5WA 3PD1A 1J8DA 2GBFA 3TTYA 2FRXA 4MMXB 3I62A 3BC1A 3MBOA 4MKHA 4XQ9A 4MR9B 3T7KA 3NGMA 3KQLA 2QVYX 2X0KA 1OAAA 1FUIA 5EKDA 1CQZA 3FPFA 3IP8A 3X1XA 1NVTA 4CV3A 3THXB 1KAOA 4LK3A 3MRTA 4WE3A 3CJTA 3UB2A 4MYTA 4P4SB 4GX5A 4WLOA 3WGYA 3T9CA 4L3OA 2V6MA 4XIYA 3HG7A 3ZZMA 5CB4B 3FKJA 1U8UA 3LOPA 1D0IA 1RIFA 2IYLD 3HZRA 4L2IB 4M53A 1A9QA 3IAXA 4I8DA 1H6CA 1QE5A 3CW8X 4QBTA 5D01A 2V5UA 2XEXA 5M29A 2O4UX 3MG9A 1ND5A 3MTQA 3VO1A 2VEOA 3ZIAA 3PYMA 1NWCA 2IEZA 4I1YA 4RIEA 1NVBA 3GHYA 2OBMA 4OGGA 1TM3E 5FB3A 3SC3A 3L8GA 5D5HA 3MFQA 1N4AA 3SHVA 5E4YA 3HE3A 3M33A 4XB6B 4NCHA 4BYGA 1OFUX 3NATA 3W9UA 1C30A 2BONA 2OLKA 2REBA 2Q1XA 3HDJA 1BGWA 2X5KO 3RYHA 3VDNB 3ZXIA 5FOVA 1SN7A 2B99A 4WTOA 4HAXA 4CF5A 4DIOA 3NVAA 5A05A 4WBXC 3H2KA 3NHFA 4F1JA 1GRVA 4P6VF 3ZY2A 5IS2A 1DINA 3U7JA 2YX1A 1W30A 2QR5A 1SVOA 3GZJA 4FMDB 4PYKA 2ZTSA 3W5JA 2W58A 4KFRA 3HP7A 3HYCA 5CNMA 5NULA 2VK8A 4G5XA 4L5AA 2WHEA 2ZWPA 4Y0VA 4CHGA 1G3QA 4XCQA 2B78A 2KHZA 3HEAA 2OSVA 5BR8B 3VNAA 1YAHA 3WK8A 1QKIA 4ZO8A 1ECPA 2XUDA 2QM0A 4UCFA 4LYFA 1K5GA 4ISCA 3HM9A 1AKNA 5AKLA 1T3GA 3UJ9A 1KTIA 4KODA 4B7CA 5ES4B 4FQ8A 5IC5A 1SHTX 1ZSNA 2HU5A 1FLDA 2OXTA 4UTNA 1C3OA 3P9QA 3RUIA 2YWFA 4HADA 3S44A 3OJWA 1ZZGA 5K4HA 3TGPA 1FP4B 2XW6A 1RI2A 1R6XA 3QXXA 4FHGA 3ZJ4A 4EHFA 5J2TB 1PD1A 1TF7A 3BJEA 5FV7A 4YWHA 3RVDA 2CFTA 2C42A 1GXSA 1KPHA 3GOQA 3SG0A 3ZW7A 5BN4B 3LD9A 4MO2A 1FW6A 1BRMA 2WIAA 1CRWG 1WU8A 4BATA 3H18A 1DRUA 3P9CA 4ZAZA 3S1AB 3E1KA 4O2BB 5E2IA 5CG2A 4K3VA 1GUZA 2VF8A 1N2JA 4QNNA 1YL6A 4G0OA 4HO1X 4M0UA 4M7OA 3EDQA 1PBTA 1QAQA 1VA5A 4WOKA 2QKYA 5FV4A 2ZSIA 3B6JA 3GDGA 4MA5A 3W8FA 2HT6A 4WZBA 1IZ8A 1SU4A 5IEBA 1N5DA 3QF7A 3OOHA 1DAFA 3OE7D 4ZA2A 4IJUA 4QOEA 3GNLA 3W8NA 2I4TA 2HJGA 4HLDA 4KXNA 1P7CA 4HNVA 2WIFA 1JX6A 1AK2A 2UU9B 1M7GA 1P0PA 2RSLA 1ECJA 2FWJA 3A11A 2GD2A 4R31A 1QIIA 4XB1A 1KYVA 2PX0A 4GX1A 1DP4A 1R0YA 1F6DA 1LNZA 2J41A 2F90A 2KLHA 2NV2B 2VJMB 3AR5A 3R3VA 4PFQA 3PJGA 2VCHA 3AUXA 4HLUC 3OT5A 4G4IA 3E15A 4O5OA 4ER0A 1NMSA 3SDZA 4C6HA 2CEAA 3FZYA 3WWEA 1HYQA 3SZRA 1DFIA 2GBLA 2FFQA 2GLXA 4NJEA 4Y6GB 5EMHA 5I7EA 5FUVA 4BMYA 4FMCF 1ZGHA 4OM8A 4B31A 3G2JA 4IAOA 4DVJA 4WNAB 3ZYCA 1VMDA 1Y6FA 2FG5A 4XD7D 5HK9A 1EJBA 1V7PC 4GLJA 4CKEB 5IAAA 3QVOA 1GCIA 1EP2B 3JWHA 1JLLA 3JQDA 2RGYA 4PAGA 4PFSA 3WAKA 3DNPA 1WRBA 4RD1A 2PH7A 4YAOA 3NM6B 3T1NA 4TVKA 4TSFD 1P4SA 2FQYA 3THRA 4D4LA 2GKSA 2QQGA 4WOPA 5F1YA 4IQFA 3CVXA 1GTZA 1I3MA 3JAKA 3B1JA 2QNBA 3U0VA 3V42A 3R3UA 3OQBA 1W35A 3VPSA 4CUKA 5A7FA 3OECA 1GDTA 4JHLA 2O3SA 4P0PB 1MO4A 1GUDA 3AJ8A 2AI2A 2AFIB 3QX9A 3SHFA 2I6QA 3B7PA 2FFBA 3TRDA 4KFUA 4AO8A 4P54A 4CM9A 2BT4A 2NTYC 4NNOA 1OSNA 1DIAA 1R8YA 2DYKA 1JJAA 2HEIA 3ZBPA 1RZRA 3MIZA 1GPUA 3UJ3X 5I7FA 4FI3F 2ZIZA 2GI4A 1B8VA 4B4KA 1EP3B 2DHRA 2WM3A 5KYGA 2J30A 3VU8A 1W94A 3OX2A 1YZUA 5AVYA 2H2FA 8ADHA 3ET5A 4G37A 4YMLA 4MJ3A 4QRDA 1GGEA 4R8SA 5K3DA 2GYWA 1IB6A 2NGRA 4K1XA 1CEQA 2ZT8A 2G09A 3NG1A 3BXGA 4LA4A 5FL3A 3SF8A 3ZBQA 1KYZA 2KBEA 4J9VA 5DEOA 1DAPA 2VYVD 1ISGA 1FS4A 3IP1A 3MYYA 4HAZA 3UANA 3AI3A 4UKDA 5GPBA 3UMSA 4F6RA 2XZLA 4LRSB 6AT1A 1LCIA 2WTEA 3WLNA 4B4WA 2HK8A 1CS0A 5F3RA 1REQB 4IIDA 2EDAA 5KZMB 4RTQA 1XQXA 2J6HA 5GVSA 5K8CA 5I9BA 5J9FA 2Q3JA 3OURA 4WESB 2ZP1A 3RVNA 3KWMA 2HMSA 3W2HA 3PQ4A 3Q12A 4ECEA 3ZCTA 5FFFA 2TSYB 3ADPA 1MIOB 4IO1A 4V38A 3S1LA 5AW8A 2HZ7A 5JSZB 2A86A 2I03A 1ZVJA 4X7PA 1DBSA 5JW6A 4IEIA 1Q0TA 4B7ZA 5B53A 4PG4A 3SK0A 2V7GA 4QECA 3CWQA 4IGIA 4GL4A 2I91A 4QRHA 4C0KA 3UXHA 5T4FA 3X1ZA 3CFYA 1NQTA 3DC7A 3OZSA 4UNQA 3VDRA 4BQOA 5BSVA 2IYTA 3CVUA 3BRCA 2BGMA 3HNOA 5CIWA 3VKUA 4I50F 4E30A 5AKYA 3ZCVA 5K0TA 3Q9UA 3TZCA 1WXQA 1W88A 1HF3A 4NKRA 4TL7A 1DRWA 2X5JO 4INAA 4KX5A 4V0OA 4XARA 3RFVA 5YASA 3I6QA 2PKXA 2EL9A 3LH5A 1ARZA 4TM7A 5C35A 1SZCA 1IG3A 4J90A 1WP9A 2QTWB 4LMPA 4WXYB 4OVKA 5E2BA 1ZXBA 4FHZA 3V48A 1G8AA 3B1ZA 3CKYA 4OU5A 3CLTC 2IHNA 2EDCA 3EBLA 4URVR 3H2HA 2IVFA 1JFFB 3OM8A 4L02A 2UUPA 1W0JA 4V0RA 4LGMA 3RNLA 4BVHA 3TG2A 1YBMA 1K08A 1UC9A 1WB4A 2EJVA 4J0JA 1QBGA 2XUGA 1WXWA 3BMQA 3HB0A 3P52A 2I2AA 2BTQA 4IGAA 4ZYTA 1CUSA 5BRJA 4FWIB 4EQ6A 2DJIA 5EJ8A 1PQYA 2CDBA 4XEHA 1NBHA 1DAEA 5H68A 3U2QA 4C7BA 4IDPA 3NALA 4A1FA 2VT3A 1EWQA 1NQAO 4QVIA 2BD0A 5K99A 2NSYA 1R3DA 5J2UF 1I2BA 4UAJA 1BU8A 4AP5A 2IGTA 3W7AA 3UA3A 1XLWA 2QXTA 4K40A 4XFJA 5EI5A 3V80A 1OOEA 5L3QA 1QC5B 4QEDA 1NBMD 2DUWA 1K7FB 4DBLE 1YQTA 1S96A 4BJ3A 1IOVA 3CF2A 1J2EA 5EMLA 4M9UA 4I6JA 1ZYUA 1PCXA 4IS2A 3DC2A 4M0KA 2WNSA 9ABPA 1VIDA 4CDNA 3RIYA 3PYXA 4ARSA 3GBVA 1PFGA 2DQYA 4PQRA 1L4FA 4LJ6A 3R74A 1QFXA 5ICGA 1EFVA 1PFWA 4MV1A 3CKKA 3OFKA 3P9XA 1Z4QA 3VPAA 2RI0A 3H5TA 3KEMA 3UIEA 1D2RA 4C3UA 1GGMA 2H3HA 4BRUA 2HXYA 2FB9A 2C5LA 1QYIA 1TVCA 3K73O 5JYCA 2DLNA 1TTPB 3LHIA 1QTRA 1P81A 4YQZA 1OTHA 1H66A 3BB4A 3E2IA 4NC9A 4AZWA 1VMKA 3NTUA 3AXTA 4R01A 1K98A 3KKKA 2Z3WA 2W2LD 2VNIA 3KKNA 2YWEA 3LI2A 3MJSA 3DBVO 1FYWA 4MB6A 1T26A 4P84A 5IDWA 2OT3B 2FHSA 4RTPA 5IYZA 2I7XA 1G38A 4W5JA 2WR8A 5AVZA 4D4HA 2YZ2A 5IKPA 3KOMA 4HX9A 3RVRA 2PVSA 3GARA 1R12A 4LXUA 2RIPA 2JGMA 3BSWA 4RF4A 2K6GA 2OO3A 4KVGA 2VTBB 1HGXA 3HDVA 4DLNA 2H1LA 4FXOA 2ZTUA 4CHTA 2Y0EA 2IHYA 5ESDA 3OIWA 4RIHA 2FHPA 4DLVA 1NY6A 1HFKA 1FIUA 3IBYA 1T13A 4YS6A 3AQ4A 2QXUA 3FBWA 1T4DA 2JFZA 4TKLA 3CB4A 2G1JA 4PNPA 3HO1A 1OXSC 4S35A 5ERYA 3BHMA 3RKRA 1O2DA 1XZQA 5HP4A 1N33B 1H65A 4BNXA 4XYMA 5GJCA 5JS6A 3VR5D 1Y8RB 3HU3A 4TZ0A 3AHFA 1NVDA 3UA4A 4YCDA 2C58A 1NBOA 3CLKA 3F4KA 1X14A 2FR0A 1OXUA 4DPKA 1VLHA 1FPMA 2BRUA 3Q3VA 4AFNA 1KL7A 3GEDA 1GITA 3K3PA 3QPDA 2V3CC 1AHIA 2DT8A 3AERA 2BEWA 3R76A 2BMVA 3HUTA 2I4RA 1TJ5A 2M32A 4FOPA 3L8DA 2LTAA 3T0IA 5A5GA 1GNTA 2H0RA 3PQFA 2E3JA 3ZTWA 4DC0A 1S6YA 1Y6ZA 4U2EA 3JASA 2VPZA 4J1TA 5J59A 4CTMA 3LC1O 2JFVA 1CJUC 2PH1A 3NAMA 3ZN2A 1EINA 2IJGX 1T36A 2AW5A 3UJNA 3GMTA 2NU6A 1Q2UA 3DL0A 1HKUA 1PFUA 3FWPA 3QKTA 1M8JA 2PLRA 4I08A 2WPNA 4RPKA 3T1OA 4WERA 3WGOA 4DDMA 2D0PB 4OHPA 1O08A 2QDXA 1PGNA 1YF3A 4OMUA 1G55A 4S1VA 4CIDA 1AV6A 4I1PA 4XZ3A 3D2CA 3KHKA 5FUBA 3WHKA 4RHCA 4L15A 4C7XA 4X1KA 1C1YA 1CR2A 2JD1A 3QZUA 1WUTA 2P6UA 4M1TA 1YBAA 4QQFA 1E2JA 4F2GA 4N40A 2X4LA 1N8SA 1LRKA 1UWVA 3WBKA 3OZTA 4L7VA 4Q4AB 4TV9F 1U0NA 2J6CA 4LC1A 4R71A 1DQRA 1UKYA 2BI7A 2HIHA 2Z8YM 3BWVA 1PZGA 3BMCA 3BBLA 1LBSA 2ZJZA 4BJ5A 4LKRA 2C7BA 1LDEA 3KLNA 1GR0A 2J4FA 2UYOA 4NZMA 2OA0A 1JAZA 2WKQA 4MQ6A 1L5RA 1ULAA 4Q4JA 1ZHFA 1WB5A 1ZVVA 5TJHA 2HREA 2Q3FA 1XYVA 4MYRA 4TUYA 5G4LA 1QO0A 5L7TA 2ORWA 1USVA 1RZRD 5HKKA 3S29A 2Z04A 2I3AA 3TXXA 1KMMA 5L9AA 2V9PA 1QNFA 4Y7DA 4B75A 1IWPB 1NC1A 4TM8A 1WETA 5KSWB 2PBZA 5AHRA 3E5MA 3R6DA 4DGSA 2OCDA 4B9AA 2TYSB 3CMMA 5ERXA 4OSOA 4Z7OB 4QICA 5EJ6A 3OZAA 2OKCA 3IILA 1E2PA 4HPWA 2VCYA 5H4GA 4LJKA 3FTEA 1N7HA 3B1VA 3DMTC 1Z5VA 4EIWA 2QRVB 4XIIA 1E3WA 2D3WA 4PZ9A 4FOOA 5PGMA 1LEHA 4G1CA 4XLLA 1L3BA 3OEHA 4K8RB 1PWXA 4FJ0A 1LVUA 1EDZA 3H6GA 4NEGA 8LDHA 1E2LA 1BH6A 1Q0UA 2Q8PA 1WZEA 2HNKA 3CZCA 3CURA 4OX9B 3J81A 2UYCA 3I64A 3NTXA 5AI6A 2DSNA 3HYSA 4BVJA 4W1RA 4MW2A 1NFQA 3I9OA 3W9YA 1SO8A 4HX5A 3KJQA 1R4ZA 3QPVA 2Y1DA 2D5IA 4MV7A 4FBGA 1ZJJA 1DVRA 3BE4A 5EQJB 1HE1C 3LQ2A 8OHMA 1JU3A 3TKLA 4PLFA 5DM60 2OXIA 1FXWF 4FTWA 4RZIA 2QJWA 3URKA 1QYRA 4B3BA 1M7HA 3WGJA 1UP4A 1YOVA 3AEQA 4TZTA 5AQEA 4CM7A 1HE4A 4ZRNA 3X2FA 3AKYA 1E99A 3T06B 4DJFC 3ZD9A 4D6XA 3H1PA 1GPLA 4X61A 3FKQA 5AI9A 1C9JA 1TAQA 1ZD5A 4LXYA 3L05A 1AXGA 3HGMA 4G5RA 2FEMA 1G8MA 4BO7A 5ED4A 4HB0A 1XRJA 3SU8A 4L4SA 1OWOA 1LNSA 1I7LA 3PR3A 2CJXA 4N5DA 5CPFA 5TC4A 1U3DA 2YZGA 1LPNA 2L0XA 2DFDA 2QN1A 3KR0A 4JZYA 1T29A 4L50A 4B7AA 3GX1A 1PLJA 4HTFA 1GUFA 3EPLA 2GRJA 2AG8A 1TCBA 1X7XA 2C8KA 5KNDD 2G6BA 2FX5A 4P2GA 3UEOA 1T9HA 1P1RA 5ETJA 3ZDCA 1Y4ZA 2G77B 4CU5A 3OLCX 5FOQA 2HJVA 2VT7A 2ZRDA 2ZUSA 1FMLA 1OWLA 2Q5CA 4JC8A 3C1TA 4OHZA 2QRMA 1OIWA 4AWBA 4P2BA 4GOND 1SA0A 1T5IA 1YZTA 3IKJA 3RFXA 1KH2A 1YR7A 2PL3A 3F71A 3GP3A 2R9VA 2IHUA 3ORYA 2BISA 1N0VC 4B1FA 4B71A 3SIPA 1K97A 3U40A 3JWIA 3K2IA 1RXSA 3C48A 4MVJE 2XNDD 5H9VA 5K3AA 4LF9B 1CFJA 2JIZA 4P0QB 4ZDKA 3WRYA 5K0CA 5EVCA 4LNUB 1V7ZA 3C6ZA 1E7QA 4M0PA 2Q2OA 4IKOA 1EXNA 1AY0A 4R7GA 5LDDC 3V1YA 5CVTA 3EXHA 3TSCA 4EP1A 1D7OA 3UGTA 1KSJA 1MLDA 4R8LA 3RLFA 5M04A 2E1PA 5EKXA 5FXMA 3EVFA 2DTDA 4H7DA 1VJ5A 1M34A 4K87A 5A5FA 2OAP1 2VPQA 4O4JF 2CLCX 3OEWA 1XZKA 5KQGA 1B93A 5EGNA 3S1SA 2F59A 2ZJ3A 3O38A 4NQRA 3H4MA 4DDTA 1SNYA 5K01A 2DXIA 1EBUA 2GK3A 1V96A 2JDID 2WPDA 4IXTA 5LZ2A 3FROA 1XA4A 4AWAA 1RRGA 4HDSA 3R5FA 3WP0A 3FAKA 2HO5A 2A88A 3PA6A 2Q0QA 3PIIA 1ZKDA 1SBQA 2HJRA 1OYYA 2H4ZA 4JBNA 3LVFO 4JR1A 4UU7A 5KWEA 1ELOA 1FBTA 3GQBA 1L4BA 4UNSA 1FNBA 3AONB 5AK3A 4A6EA 3LA6A 1HTTA 4X1OA 5CNJA 2G7MC 3MTGA 1YJ8A 1MX5A 1RYEA 1KHTA 1VSQA 3ZU4A 2C4HA 1QOZA 4EJSA 4Y2TA 6CHYA 1YT5A 4UD2A 3QU2A 3R5HA 4CI0B 4EM6A 3A2KA 2VG8A 3ZI4A 3K4HA 4FIZA 1ZUNA 4HDCA 4QOGA 4A0GA 3TF5A 4IZHA 1WBDA 4R2HA 4XD2A 3B3AA 4CMBA 3KJZA 4YN3A 5A1JA 4X0EA 3NT5A 1O97C 1RI5A 4GOXA 2ZBFA 4TMFA 1VYUA 5BXQC 1YJAA 1BKSB 1QHYA 1TZ2A 3G02A 4M9RA 5JPCA 4M9ZA 5LQNA 2C4NA 1ZBDA 4R2XA 3H7AA 3K0HA 3BICA 4DA4A 2N3ZA 4E03A 4HNSA 5EXDA 4C20A 3LL7A 1ZMBA 4RK6A 3VPGA 3WWDA 4NX2A 1I9CA 3L6DA 3DOOA 4IGEA 3O8QB 3ZV5A 4MLZA 2JJ2D 2J7PD 2RKBA 4BWVA 1A50B 1Q50A 1NLZA 4K9SA 4Q7EA 2VLIA 3K71B 2QTFA 2BKEA 3GT4A 2I7CA 2ODEA 4MUIA 3J80A 2IHBA 4DDHA 1GTSA 1DCFA 1J33A 1GQRA 3PNKA 1J0EA 1ZD3A 4KGXA 2XA9A 3ZY4A 3KQWA 4QUDA 1ECGA 4DBVO 3NTQA 2NU8A 3T7AA 3UWMA 4ZIRA 3GJYA 4NXMB 2ASVA 2BY4A 1YONA 4HNAB 4C0SA 3NVMB 1Z0ZA 5AVWA 4HQNA 3QE3A 4TLCA 2FPPA 2ODBA 1DC6A 3TTTA 3WSWA 3IDFA 2GD6A 2QN7A 4ZQIA 2PMDA 2ZR9A 3DAGA 4IJVA 2IYQA 3PRJA 4M1ZA 5A9RA 2PKRA 2D00A 3IPXA 3ND9A 2OFXA 3GFPA 1N57A 4KGZA 3SVZA 4CW7A 4G26A 4OH7A 5I48A 4BCCA 1WIWA 4CEHB 4DMRA 1JT2A 1MO5A 1IFXA 1VFPA 2LWIA 2Y1WA 4F9EA 4BV3A 2ONJA 2GM9A 1PZFA 1X80A 2IODA 2JIOA 4JP8A 4QFDA 3ADBA 2HO4A 4K9LA 3VYUB 3ZU6A 3UKJA 4L07A 3KZVA 3QVGA 3EJWA 5JD3A 3NXSA 1I7QB 2J4CA 2QQFA 3ROPA 2D1TA 3JQGA 2Q6LA 4C0WA 1NONA 2ADMA 2OCLA 3W5SA 4TYYA 5LWQA 1IMOA 4YRRA 4NDZA 4RE6A 1PTJA 1YIDA 3HUDA 4ID9A 5C34B 3D7RA 2VQSA 4XX0B 4S1OA 5C1OA 1DIHA 2EKLA 1IQRA 5EY5B 1BDMA 1UQRA 6PFKA 3A3YA 4EF6A 1RWBA 2JNWA 2EFGA 1RBZA 2DJ5A 3SE0A 1NVAA 1T6YA 2W98A 3ORQA 4CV1A 1KAEA 1II9A 1US8B 1T4CA 3O4GA 3HA7A 5BP7A 4AYWA 2DY1A 2PSFA 3MWDB 4FNOA 2VP9A 4QU9A 5D00A 1JWLA 2RKOA 2WKWA 2J0EA 4GQBA 3I09A 3P2OA 5BVGB 4C6RA 1HYHA 5FBQB 1SBTA 4BMOB 3M6AA 4ZVSA 2OVBA 3FPSA 3H8WA 5DB4A 4JX8A 1CZKA 1Y5IA 4HCJA 4QLOA 3N76A 3ZE8A 3VUFA 4AX4A 3IYLW 4CTNA 4F3NA 1S2LA 1XDSA 4IXNA 4LSGA 1WEHA 4LZOA 5KYNA 3EXAA 1TLFA 4HH4A 3TZBA 3V34A 3H2SA 1C3LA 1A82A 1C4OA 1XMOB 4GYKA 3RVKA 2JGDB 1ZW1A 1V95A 4IZIA 4AJIA 5KIAA 4F4JA 1Z4NA 4G0YA 4IIXA 5EJ9A 4HMPA 1WO8A 5KOHB 2OQVA 5EP2A 1Z16A 5IT9A 3N8DA 2WD7A 3M34A 4P4NA 2WZQA 3A9UA 5CA0B 2CKDA 1T43A 3IKLA 3CMCO 4C43A 1T9DA 4EX7A 2X40A 3IT0A 1L3CA 4EG1A 1UBUS 2BI8A 4H3KB 3LBNA 2YKGA 4K9QA 4XPZA 3TM4A 3RFUA 2L82A 3OJXA 4IDHA 3LSTA 3NYIA 4EUEA 3GBPA 3H2YA 2F43A 4YRLA 4EKIA 3M4NA 1XJQA 3K72B 3ROKA 2B82A 1JJBA 3C7DB 1J0CA 4GOKA 1GNVA 3ST7A 1WB9A 4OM7A 2HF8A 3E9CA 3DTVA 1DEKA 3FPCA 1YZQA 4GXNA 4E1VA 4Z4QA 1F2DA 4J0FA 4NONA 1ODSA 3HCFA 1OT3A 4ZVMA 2VJQA 3MYRA 4CMCA 4RK0A 2OWEA 4ZT2A 1FPQA 3VJRA 2NLOA 3IP7A 1VI5A 4M1WA 2ATCA 5KAPA 2BR4A 3NAZA 1SH7A 3MGAA 3P5BA 4P9NA 4RDCA 4HGOA 1H0SA 2IU0A 3S55A 2D59A 5IMSA 1V25A 4NJMB 4HEJA 3GJ8A 3HC7A 5HM8A 5GAJA 4H6PA 2R25B 1ZWLA 2Z8XA 3IJPA 3Q40A 2FPXA 1XJCA 1LFDB 2XA1A 4ARZA 4M8LA 4Q1AA 3ZHUA 4JQCA 1NURA 3HUUA 1NASA 4K2AA 3LNTA 4TTPA 3CONA 2OCBA 2RHHA 3IESA 4I55F 2VDNB 3IR6A 2CJWA 2W8BB 1ABEA 3SX2A 3VVCA 1AA6A 3KTAB 5TXGA 5AM3A 2P9GA 1G5FA 1I5RA 1Z7WA 1JQEA 1ST2A 1U0HC 1NQVA 1V11A 2LIVA 2YYZA 3RK1A 4MVYA 1ZK3A 1DAHA 2HA4A 2TMDA 3HI6A 3Q8XB 4RO0A 3RIXA 4MKRA 1O8CA 1UEXC 2ES4A 4RELA 3L1VA 2IE8A 4RY9A 4QFMA 2GPWA 3PFWO 1BDIA 4TLLB 4D9EA 3PHHA 5BYAA 4GICA 5IZ4A 1W75A 2X7HA 2V54A 3GJ6A 4FFBB 2IPMA 4KO4S 4YR7A 4E1AA 3L07A 2Q4BA 3BIFA 3ETNA 4RJ2A 2DZDA 5EKTA 2WUEA 3JWEA 5HE8A 2A58A 2FEOA 4B44A 3JALB 5L7WA 1TUBB 4D79A 5EJFA 3UFXB 5FWDA 2GZRA 3ANSA 3PCXA 3WO1A 4AMUA 1Z63A 4LC9A 3DEKA 3VVLA 2K2QB 1LF5A 1CUUA 2HTFA 3IHKA 3LTNC 3ZH9B 1XPUA 1OBHA 1MFPA 4NECA 1JVBA 3WLJA 4UNRA 4ON9A 4ARUA 4NCNA 1W1IA 3ANMA 2BFEA 2Z30A 3W4KA 4DEYA 4XLTA 2R4TA 4DM7A 4DSZA 4RL4A 3PVSA 1VKOA 4BO1A 2WYHA 1DZIA 4GBGA 4KQ6A 5K0BA 5L45A 1XYGA 1Y5RA 1SBYA 1QJ4A 3GHHA 5J40A 3T1TA 4KIGA 3KKQA 3O2JA 1XTSA 4X6XA 4EGQA 4LXHA 1N32B 5JSHA 1QFJA 4DL9A 1KP2A 4B6JA 4N3BA 1JLKA 3B78A 1Y8QB 4F12A 1FYEA 2OHJA 3ESDA 3UJBA 4JELA 5MHTA 5EWLA 2JL1A 5CW1A 5FA6A 2I6TA 1PVDA 4Z53A 5FAXA 4YPFA 2NX2A 5FLXA 3KSAC 2QPOA 3SZOA 4XASA 4AM8A 4KXMA 1NJ2A 2FE4A 2WU8A 3VR0A 3UC5A 1F3LA 4LXTA 3G9UA 1Z82A 1MOQA 1M6NA 1MIHA 2JHGA 2OCKA 3C5WP 3AUKA 1A0OA 2PLFA 5JQGA 4Q05A 4AY2A 3IMEA 4L9SA 3PB3A 1VCIA 3ADCA 5DWVA 5BSUA 1HDOA 1JE1A 4ALIA 1II8B 4LFCB 1J23A 5F1OA 4ISBA 3FLMA 5E7IA 1U0EA 2FWPA 2VBIA 4HN4B 4JROA 4KP7A 3LZDA 1J1IA 3Q3HA 2W6CX 3LGAA 2QTGA 3BCRA 4UUMA 3B1KA 3QBTA 4HL6A 3L79A 5DT9A 1ZVKA 3OCCA 1QNLA 2ZDGA 4URZR 5ALDA 2MSNA 1EB9A 3CRQA 3H1FA 4B79A 1DOAA 2VDWB 2CCKA 2FCRA 3SHOA 1I7SB 5EMMA 3EPHA 5LZ5A 4PX9A 5GTDA 1VYVA 1FMCA 3OZRA 1SVLA 4JJEA 5CH3A 3E7XA 5SY9A 3SR0A 4B3HA 5KX5F 2V7VA 4Q3LA 3RIHA 3GPLA 4B35A 4AG3A 3QGMA 121PA 4G81A 1O5TA 2E7ZA 4TWRA 4EAQA 1SBNE 3GZNB 4OJKA 3FPLA 4R81A 1EVQA 3NWJA 5A71A 3VDQA 5FEMA 2PUDA 1XTUA 3IHTA 4OMCA 2QVGA 2WV7A 4IVQA 3DR5A 5BQ5A 3EY4A 3V8MA 2XE7A 5BR1A 3DJFA 3FR7A 1JIJA 1TLLA 1AV7A 1YL7A 1YHZA 3CRMA 5DOVA 4Q19A 1JMYA 2G5GX 1SQFA 4QPDA 1D04A 3PNLA 4PAMA 3T3PB 3CS3A 4OFBA 1V5FA 3REQA 1H1LA 3MLEA 4HDMB 4NATA 3PHIA 1S3SA 1QGAA 3F5DA 2JGAA 4Q1CA 3JRNA 1A4RA 4J03A 5CM8B 5DASA 3SC2A 2I4NA 4YIHA 4JLOA 5I7OA 1COWA 5CB8A 3NAQA 4JA0A 1GKUB 3I5AA 4MVJH 2NNWB 3MFYA 4WECA 2XUHA 2R85A 4NZYA 1LBHA 2QOEA 4U63A 2J0QA 1DXYA 4M4SA 1Z6GA 2P1DA 1MJNA 2OORC 1VSBA 1EUCB 4YRSA 2C97A 2ZYDA 3QELA 1XEWY 2PRZA 3JQAA 3WLFA 1KGDA 3GROA 4ES6A 3L49A 4PG5A 3UMCA 1JZQA 2VBGA 1EP1B 2PV0A 3K15A 1H8ED 3E35A 1SGWA 4BIIA 5GIPE 4J4HA 4OP2A 1O9BA 2CZGA 1XQ6A 2FPGA 3A31A 3C7TA 5K8UA 1FB5A 3CNBA 4RD6A 2W2TA 3HU2A 2ST1A 3NOOA 2GZAA 2OZKA 3LXUX 1O4VA 5FI3A 2X9GA 1E4VA 3EFOA 3EGXB 3JR3A 3PXUA 4OH1A 3EDMA 3BTVA 3QXCA 2HFJA 4GWKA 5EXSA 7GPBA 2ZPAA 2ZUDA 4U1RA 1AKQA 5BNFA 1HETA 5IN4A 4WLVA 1WCWA 4R9RA 3U6KA 3EQ9A 3JQ9A 2JB9A 2JZOA 2BF7A 3DF9A 1JLMA 3QTLA 1Z5UA 2CL7X 3BM5A 3KYBA 1ESZA 1CUJA 3QVTA 2I4OA 2B98A 3RHTA 3H16A 2H5JA 2VDJA 3JYHA 5LBTA 2FQQA 4DV3B 4NPCA 5M2QA 4PLHA 2V7UA 5FDFA 4NAUA 1N2CA 2V7WA 3UTCA 3WKDA 4JC4A 3AH8A 5TQVA 1T0UA 2XTNA 5U9CA 4PTYA 2VOEA 2I1WA 4Y8VA 1Y1PA 3ENZA 5FF9A 3TI7A 3ZHSA 4FE3A 4RJTA 4DR7B 4YBZA 1YRQA 4GI2A 1I33A 4LJAA 4NDNE 5AKIA 3UMRA 2G5TA 2JCGA 4PVDA 5AOBA 1F48A 1JG3A 1MT0A 2PRIA 3EDCA 2GCNA 4H7KA 4MYUA 4W8HA 1VYTA 3DE3X 8ABPA 4IRUB 1Y7TA 4YBRA 1AOXA 1G21A 4ZGBA 5F2NA 2DUMA 3E0XA 3KXPA 4UBNA 1EK5A 3ZGLA 1LJLA 2P2CA 4IXWA 1XFDA 1NXPA 3TL6A 3W3AH 3SR4A 1YH3A 1SD5A 3P4XA 5BV2P 3NTLA 2EW1A 3MJFA 3NRCA 5MGNA 4UFPA 5FOSA 1SWVA 2JCSA 4KPUA 1U9ZA 3M8KA 4BU1A 3B8HA 2NXEA 1ONNA 1Z45A 3A3KA 4RWEA 5DGDA 1WMBA 4YCNA 4IUYA 4A6PA 3T3EA 2C2YA 4KYVA 4H7JA 1TO2E 3AUYA 1P2TA 4IOMA 4UDOA 3OIFA 4G1UC 1LVHA 1XMQB 5C5CA 4FYWA 4EHJA 1YGPA 4LWZA 1I4DD 2Y1XA 4ENUA 1SZPA 2P4QA 3ZZTA 2RIRA 3DHEA 5K0FA 5J4YA 4XVQA 1L7RA 4KXFB 3MM4A 2Z98A 3UXYA 5TGDA 2Q2QA 4C0AC 1KPIA 2QMHA 4YCBA 1G20E 1QV7A 4BEJA 4Z7NB 4BTLA 1ZNZA 1TGYA 3IUEA 4ZU3A 2IUFA 4ZJYA 5FTMA 4N3NA 4TQAA 4YALA 2PWPA 3RSZA 3MD9A 1RP7A 2AJBA 2V6JA 2VYFA 1ZN7A 2PX2A 3BB1A 1GKIA 3O8DA 3TCXB 4NS4A 4EFKA 3QJ5A 1DEAA 4BLTA 2D5CA 3LP8A 2F8MA 4GR4A 1GL6A 1R0LA 3HH8A 5P21A 4M0LA 8ATCA 5HX7A 3T7JA 3LDFA 2V4MA 1IY0A 2WG1A 4J91A 4MS1B 5K45A 4LSZA 4DLXA 1ABBA 1B42A 2P5TB 1A04A 2HMAA 3AMVA 2PLNA 3GU3A 2OAGA 4AF8A 1R9GA 2UZ3A 3LC2O 4P58A 4IJMA 4CIVA 3K0BA 2MSDB 2JGIA 5KREA 3ZDFA 4CMHA 2NNLD 1OIXA 4MRRA 3W2FA 3ESRA 1U8XX 1H4VB 1UP7A 3IURA 4GI5A 1N6HA 4JVSB 4MYHA 2AMFA 1EVIA 3FNEA 2JJ1A 4KQEA 5DXAA 4OYLA 2P9FA 4BCDA 2PFGA 5BQXA 3PDCA 3VM6A 3N3AC 1NXQA 2WKRA 4B2LA 5BUQA 1P1HA 4PYOA 1KY4A 4ZHQB 5J4HA 3ESYA 2ZE8A 4F4FA 4UM5A 3AHGA 4H77A 2QMYA 1XWIA 4FMPA 2FF5A 1YE3A 4P36A 4DR6B 1P4GA 4EZBA 4Q7KA 2PVPA 3DEJA 2ZIAA 3EVGA 3GVPA 3KPYA 5AHWA 3TI9A 4HG2A 5SZHB 5C2JB 1P39A 4UHFA 3LFHA 5EIXA 3ZDDA 4OTZA 1U7TA 5CR9A 3FPHA 3GRCA 1I3LA 1OGYA 2QVBA 4XA8A 1K1EA 1UADA 1ZM3A 1E5LA 3RB8A 1VKHA 1XD8A 3LXMA 3M5PA 1K7CA 2RGGA 4BVKA 4Q3DA 4X3OA 3DD1A 4HFMA 4OQDA 2VZLA 4JP2A 4IUBS 3SYMA 1E0DA 3L7IA 3NRJA 2V1UA 3DWIA 4NE9A 5E6RA 3TECE 4OQ4A 3SVTA 2IC5A 2C4TA 4AXBA 4JLNA 3DOIA 1JR3A 5DIFA 1B41A 3W5VA 4HSGA 3E7WA 4DCMA 1JPUA 2X23A 2P1RA 5CK5A 1Q57A 1AZTA 4FCCA 3C5VA 2C4MA 3MUFA 4WACA 4CFYA 1MA3A 2XE8A 1XHEA 4M8SA 4MLDA 4NCXA 4RGYA 3V8NA 1U3GA 2QK4A 3H75A 3KX2A 5THKA 2PEYA 4PIMA 4QWWA 3WB0A 4NE7A 1VHDA 2JBHA 2ZSDA 1GPNA 3PPIA 2M6LA 1GTRA 2H4HA 2G7ZA 1R0XA 3MBKA 4TPKA 3DKVA 1XXHA 2C9DA 4LQLA 1RRFA 2WHXA 4GBED 1U6IA 3O74A 5ED0A 1SWWA 1VE7A 1BH2A 1WUHS 1WDMA 3D0QA 3DLTA 3NWPA 5ICFA 4TL6A 4AIRA 1T1GA 2GYUA 4E5KA 4ZJZA 1A4UA 3THWA 4BDSA 4TV8F 2YJNA 3IIEA 5IUNC 1P5RA 1RM3A 1X8XA 2BZSA 2P6NA 2WWTA 3CN7A 4L9RA 5FAKA 2C7GA 3FWHA 1WTCA 5ILQA 1H1TA 3LUDA 5JQWA 2XVXA 2Y0DA 3O3NB 3OPYI 3K9GA 4QHTA 5B12A 3L5KA 1KO7A 3BS4A 3GEHA 4IYJA 1Q3HA 2FLVA 5A6SB 2Q9CA 1WXHA 2IYOA 2WFMA 2VN8A 3AOEA 3H3JA 4D0NA 1ZD8A 4RCZA 1VCHA 4HAWA 4OYHA 4BMVA 5F78A 2QTMA 5FL7D 1KI3A 2YMMA 5I01A 3HJRA 3H4IA 1Q91A 3P2MA 2XUIA 3OP1A 3QNMA 1Y7PA 3RAPR 4URHA 1ZA2A 4CLHA 3BIJA 3QFRA 1X8LA 6YASA 2FN7A 2WMNB 4FW8A 2VF7A 2UAGA 4AJKA 1NM5C 3B85A 2UV8A 5IJWA 3ZC3A 1JSRA 4JJ6A 4CLDA 1A9OA 1KDRA 1KI6A 4HV4A 3SS7X 5L3SB 4DEXA 3MRSA 1UK7A 4E3ZA 2JEOA 2J9RA 3QFHA 3MTEA 3Q3IA 4MEBA 1RQRA 3PF9A 3ECCA 2B5WA 5HRAA 3L1UA 2Z3ZA 1XTRA 2QF7A 2FSVC 4YO8A 4BEWA 1OC4A 1OH6A 2OHOA 1OF1A 4TTRA 3NS7A 3L6RA 4P4LA 3V9PA 1U2TA 1GA6A 4IKEA 4PYQA 1MJHA 1LSUA 4COKA 1JG2A 1M5TA 2O7NA 2PZGA 3L7AA 2HJWA 3HWRA 1S1MA 1O95C 2OQIA 4JU8A 4OG2A 1QVZA 2CLKB 2GEDA 4ND1A 5E6SA 2H51A 2LNDA 1H9AA 2VDUE 4Z9YA 5KJEA 5JNRA 3BKWA 5JXHA 1NSFA 4KWEA 1JEYB 1T8RA 3FOZA 3GLFA 3Q2IA 2XMCA 4IQ8A 5BOSA 4LDJA 4H1HA 3G2KA 4HN9A 1N6OA 3BDAA 1XLTA 1D4FA 4N0DA 2OYRA 3VGPA 1RWOA 3WDLA 1VG0B 4PSCA 4DCOA 1DTEA 3CA8A 2BUBA 3OT1A 4HWPA 4LRXA 4QG7A 4I1OA 4ND7A 3D1VA 4TMTA 4QNMA 4PX5A 2QZPA 4X24A 1GTVA 3NXKA 1BCRB 3AZOA 4D02A 4EH1A 1HNWB 4ZXFA 4HUTA 5CDUA 1YJ5A 1BXGB 2QG6A 2NTNA 4E2FA 2FFHA 1U5BA 1YASA 2HU7A 1I3NA 2BH9A 4E12A 4XRGA 5BNTA 3BWMA 3K70D 3RJZA 5L51A 4OLBA 2BDEA 4O59O 4CZ2A 4EELA 3L7KA 5E7JA 5JVDB 1Y37A 4OJYA 1KO4A 5H70A 4F85A 1DOZA 1JQAA 3B9QA 4WZAA 5AJXA 1TQ2A 4F3CA 1OBCA 1UH5A 4HGZA 2OGWA 3O94A 2C7VA 3VU9B 1QK3A 4G1BA 2PX8A 1F2UB 4RV9A 1KZ4A 4XKJA 4EG8A 2FWNA 1T5SA 3BE5A 4NOJA 1FZTA 4R0VA 3FZQA 3OM9A 2PKEA 3G0HA 4GMFA 2O23A 3DLCA 4IDQA 2IBMA 4S0XA 5AW9A 4TLDA 1JQ3A 1UKZA 2YY6A 1S7CA 3D7SA 5L7YA 1DKQA 4JOCA 2OXEA 5F33A 3KYDA 3WV5A 1D2GA 1ZGJA 6REQA 2GAAA 4LOHA 5DNWA 4EFLA 3E81A 5C8XA 1T8SA 3IB6A 4Y2YA 5IANA 3GLIA 3AF1A 2JGEA 3P26A 3AEKB 3D6AA 3EAGA 3DBRB 3E9ZA 1WLSA 2ZPTX 2F6RA 3EH2A 1KP3A 3FWYA 3AF6A 1N6LA 3D5QA 2G9UA 4Q00A 3RT9A 5AW6A 3GT3A 2N9UA 3ZWNA 4JBLA 4OHCA 1JYEA 3CLTD 4MKFA 2ZUWA 3DDOA 4KN8A 4WBNF 1M1YE 4FDVA 5KHAA 2HHCA 4Q1FA 1I5OA 5TQ0B 1QYVA 5CYPA 2Q41A 4MROA 2J6IA 3HVRA 1WHTB 2X6TA 1BMQA 1NMXA 1JB1A 1R0ZA 3T7RA 3UV7A 1TYAE 1IIRA 3SWWA 3DGEC 3EEFA 5B2EA 3PKJA 2FGKA 1ZOIA 3DHNA 4NARA 4TSKA 1FTYA 2R68A 2ZUEA 2CL5A 2HUPA 4IIEA 3IAM1 2WP8J 3EYWA 2WJJA 1KOFA 4R2WA 1TQHA 2H2GA 3PITA 1NU8A 2G4LA 4NI5A 4UBKA 3QBDA 3WWYA 4XJSA 4BOYA 3RUFA 1DADA 2O2HA 3N2GB 1T9AA 1GKLA 2C2MA 2Q2NA 2Y76A 3E9NA 3PV0A 3Q10A 2YOGA 4ND8A 3T5CA 1U1DA 4FEEA 4NBUA 4KQXA 2CWDA 2QAIA 4PS1A 1VLZA 5FNVA 5B37A 4XSGA 4DJAA 4EO9A 1TZMA 1UODA 4LDQA 4RIFA 2C88A 4ARAA 1BDBA 1XAJA 2W0SA 3FTCA 1GZVA 5SYMA 4B45A 4OJQA 4R1QA 3FGNA 1BSVA 1QIMA 4DQVA 3T4EA 2QW8A 3L6CA 4PPFA 4QUKA 3SIWA 1ISPA 3GEBA 4MULA 3S2FA 2NU9A 2R6CA 3HKDA 4GE0A 1FTSA 4X20B 4F2DA 1JFVA 1JIVA 3RQIA 1HQCA 3A3PA 4DWJA 4IFBA 2PJUA 5ALKA 1YWGO 4YHHB 3MXOA 4BNYA 1W4BA 1T6ZA 1V3TA 4YXWA 3DB1A 3RS4A 3DLHA 1GN9A 5FA5A 1TA4A 3CUKA 3HKCA 4LCEA 3BMOA 4RABA 1W29A 2PZJA 3NIBA 2ACEA 4R40A 2OV2A 4MGIR 1U28C 4D3ZA 3CLVA 5KYXB 5LIRA 1N6PA 2H2HA 3RS5A 1QF9A 2FUEA 5JWOA 1B7GO 5CEJA 1G8GA 2BUAA 2O14A 2R00A 1J5XA 1VFNA 1WY5A 3BKXA 3C8ZA 5EERA 1UKCA 1SC4A 1RZVA 1DX6A 2P9HA 4YUAA 3HHPA 3ROMA 4D9IA 1KEEA 2G67A 2Q1WA 3C7AA 2QP9X 4ME6A 5BT9A 3VSDA 4CV0A 2JGRA 4V03A 4BBJA 3QP9A 3GJ3A 3H6KA 4LQ4A 2EX1A 3D43A 2HHHB 2VBFA 1PK9A 1SB9A 1OROA 1ZIOA 2JZNA 2QTRA 3FYUA 4HQFA 4K03A 4TMZA 4AZTA 2X1MA 2CZQA 2X4IA 2A9RA 5TS3A 3GLHE 1U0OC 4Z8YA 3V8RA 2BBSA 5A62A 1HE8B 2WHPA 4HDKB 3PDUA 4YT5A 2XJ9A 4QBFA 2EEPA 3AG5A 2EBHX 3JD3A 2FG6C 3V7YA 3EPKA 2OMKA 4DLWA 1Q21A 1SIOA 3S2ZA 3M6VA 5HBRA 1HQYE 2F1HA 5MF6A 2PUTA 1VYHA 2Y1OA 4WXEA 4ZGGA 2C1ZA 3R77A 5IFKA 4E21A 3AI1A 1FNNA 1H4TA 3GJ4A 3NI2A 2YHAA 1CY2A 3QOXA 2VP3A 5IWCA 2WJ4A 1RDFA 1Z2DA 4KI7A 1E6LA 4K2HA 1JEQB 1Y3AA 5FOTA 3U1BA 3LX8A 5ALOA 4MUGA 3SEFA 3KQYA 3KYCB 2F8LA 4EGCB 3R3XA 2BHTA 1QJCA 2QTVB 2YV3A 3F5SA 4BMNA 1A9XB 3ZWOA 4X1YA 3DVQX 1KRHA 4PX3A 4HBGA 2DBQA 1H2EA 3SN6A 2VQEB 4C6SA 2AVNA 4V0LA 2IEGA 2OZEA 1AQIA 2O6HA 3M5WA 2QTHA 1C29B 1L7OA 3QOWA 5C8VA 3PUYA 2JI4A 3DEYX 2JH3A 3ZDYB 1E3EA 3EWSA 3K0AB 1EVLA 2HMTA 3A1FA 3F6BX 3K6SB 2N42A 4FMDF 2JATA 3A1DA 3P97A 4QOHA 4YMTA 2OZVA 4N0QA 3IUJA 3PC8A 3G6KA 3TTVA 4XXHA 3W0LB 2CK3D 1OLUA 2P1ZA 4DDKA 1M2OA 3RT7A 3WGQA 2XD4A 2ZUBA 3OIDA 4QVGA 4BFZA 4ZEVA 1BYIA 4ZQEA 3UW3A 1VGRA 1XMPA 3LOUA 1DKNA 1DQSA 5T6BA 4EYKA 4KU4A 4PHGA 5AHXA 3PUJA 3O31A 2PKQP 3ND5A 5SY4A 4F04A 4G84A 4F8EA 4IJKA 3RU2A 1MD9A 2QLTA 4AQDA 5J4KA 1JIIA 5TE9A 4BO5A 2YR0A 1DBIA 2I1QA 3PNVA 1Q1QA 5E6UA 4BC0A 4EITA 5CIYA 1G5HA 1UWKA 2AEEA 2JS7A 3FX2A 2ZSEA 5H4HA 3WGVA 2ATIA 3V3KA 3P96A 2Z57A 3G7SA 3D8NA 2WF5A 3KQNA 3WB1A 2PPVA 2QRUA 5K5EA 1KS2A 1MO2A 1TYBE 2V6BA 3UMJA 4YMUA 5BN3A 1I10A 5FYDA 5EKSA 1KXZA 3PQ5A 4OL9A 3H19A 1N1EA 5EN4A 3CH4B 4Z7JA 1JFLA 3H9BA 4IDEA 4O2BF 4FYJA 2L17A 4ASUD 4D9CA 2DC1A 4P33A 1F9EA 1YMVA 4EGJA 1BMTA 1TKCA 4HC4A 3T1HB 4V02A 3ZJVA 4UTPA 1U2GA 3EW7A 4MWBA 3LQFA 3L7CA 3C1UA 2CF6A 5KWVA 1P31A 1IVNA 1MG5A 4HAOA 1KOLA 3M3DA 4EF4A 1MW8X 2HYIC 4ENVA 1Y1KE 3AR4A 2EIXA 5JNVA 1W52X 3F2IA 1DFHA 2XOKD 4J0GA 2FK7A 4JFRA 4EUFA 1K5PA 2Z95A 4MW9A 1RXEA 2OQ2A 2A5JA 3NJ4A 3IQXA 3ZGZA 1QZXA 4NBRA 3GMSA 3OM0A 2VJPA 3WYFA 2OENG 2IELA 5JCJA 5JCXA 3RTEA 2Q5JA 1P7VA 1QHIA 1VKZA 1YOBA 2PWZA 3BXXA 3KQTA 3QQ5A 4L6CA 3UTDA 3IE1A 4XQCA 5DCYA 3RREA 2CE2X 1E9SA 1NPDA 1EI9A 1SBZA 1W6UA 2JFBA 3K1TA 5CXQA 1I7PA 4BB5A 1YR6A 2O8EA 3HDQA 3FJYA 3IL2A 2QIPA 1Z5NA 3PEVA 1P72A 3EZNA 1KSFX 4PQYA 3ZHYA 2IH5A 2HSJA 1S8NA 3UHAA 4M7RA 1QQTA 3HJNA 3RSLA 1I0ZA 2QAJA 1QVWA 1GRNA 3H6HA 3R9WA 3EZGA 3RBXA 3TEJA 2W2PA 4FX5A 4O2AF 1IBRA 4QXMA 5G0UA 3IVMA 5F1KA 4EUHA 4RULA 3H5RA 4PM4A 5A3JA 2UUAB 4URWR 1CUGA 2QN8A 3SD7A 1PFVA 2QVXX 5BV1A 1COZA 4N12A 4BRWA 2D3TA 3H04A 3O8NA 2JANA 4OFWA 2HB6A 3HYTA 1A5AB 1PT5A 3NETA 4J16A 4UOEA 3CVOA 3WGLA 1KH3A 1M1NB 3RO7A 1GAXA 3NKLA 5K8JB 4YRQA 4E2WA 3H11B 4D3FA 4TS9A 4IV5A 2ORVA 1CZOA 4S1WA 3VC2A 4B6GA 2G9QA 2VQ3A 2YHIB 2VUSA 4CF7A 3ROQA 2W93A 1PFKA 1YQGA 4AZ3A 1JMKC 2ZYVX 4CTKA 1ETHA 1O96B 2DR0A 5DIZA 2HR1A 4I9NA 3OUUA 5KKNB 1OZFA 2I2FA 3EK2A 1NNSA 2HQRA 1FFXA 5EMNA 4MICA 3L0IB 3PDWA 2ECOA 3BMNA 3MCAA 4X8HA 4YK7A 2FPKA 1Y1TA 3THSA 5T5QA 4A4DA 1XR3A 2Z4SA 4BO0A 4BWFB 5F9MA 3MRXA 2YMLA 4DF3A 4CIWA 4X8MA 2E4AA 5FTNA 2ZBDA 4KPFC 3RRNA 1E98A 3AILA 4ARCA 5FPQA 4QBGB 1YIAA 5BMVB 1XGKA 4B33A 2P75A 1J8QA 1XCLA 2FGJA 3TRIA 1PS8A 5BV0A 1BMFD 1WDWB 3R3ZA 3ZY3A 4NAHA 5FPKA 3LQYA 4ERXA 2RGRA 1BW9A 5HIIA 4JCCA 4GMXA 1C7IA 3DZFA 5IBPA 3WLPA 4BJ1A 5TMPA 4CM8B 3DHVA 1M6VB 3TLMA 5JSFA 2HDOA 1WVGA 3ZLBA 4AF6A 3EIHA 3N2NA 2XXAA 3K9BA 1AH2A 4RDHA 1ZD4A 2H3EA 3DPSA 4D42A 1ZR4A 2G88A 3L4SO 1YJXA 3KAJA 5FPSA 3LLCA 5GGXA 2VUUA 3IAFA 3K4QA 1TT5B 3PDJA 4Z6KA 1UJ4A 2IH2A 3VNVA 3OX1A 3HFJA 4AL4A 1F38A 9GPBA 3IPLA 2RGCA 1CE8A 1Y4SA 1TJNA 5EVJA 1ZG3A 2VP4A 1BC5A 3CSUA 3FH0A 1L6IA 3TLJA 4B76A 2IEIA 5LZ4A 4AJ9A 3T15A 2ZYTX 1X38A 4KJZA 4RFVA 1ZIXA 4WNYA 5LP6A 4YRBA 2ZJ8A 2DKFA 2QZSA 2ZBEA 2R5FA 1GRCA 2R97A 2WKPA 4ZCMA 5BSEA 5IK2A 3DNFA 4GO1A 3M3HA 3NX4A 3OD5A 3WGUA 4CQMA 3E8MA 2FEKA 4XDYA 2PHZA 1Z0KA 1E8NA 4PYMA 5BQOA 1Z2OX 4ZQFA 2ZZNA 4HJRA 2IYPA 1KSGA 4CMAA 2CLEB 2VC2B 3RODA 4YI3A 3RYFA 4XLZA 2X4GA 4WNIA 1H4QA 1OX5A 2Z6AA 5IM4F 4O4HB 2H2IA 2PGLA 2PMEA 2R0QC 1M33A 1N7GA 3UMBA 4CM3A 1E94E 2RHDA 1QH8A 3ODGA 3HKBB 4D8XA 4MR7A 4TKUB 3GUHA 1J2JA 2JHAA 1AE1A 1NVUQ 1XCGB 2AFIE 2R47A 4HVTA 4QD3A 1DO2A 5E0KB 2FZKA 2WU3A 4KK3A 1G5TA 1UM9B 3ECAA 3BH6A 4CMEA 2VWHA 5EJEA 3PP8A 3W5BA 1NW5A 2RKWA 3GJQA 2XZDA 2OV6A 4P22A 1AGPA 4WIAA 5HG0A 4XWKA 1TZCA 2I87A 2PLAA 3D0OA 1U04A 3K31A 1JQBA 2QA5A 4GGOA 4HNGA 3TNLA 1GG9A 2GHQA 1SCUA 1Y33E 3IDQA 5FX2A 4FYKA 1IY9A 3LUFA 3DMNA 5HPYB 4ZCIA 1NAIA 3R7FA