5IZCC

Trypanosoma brucei ptr1 in complex with inhibitor f032
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
268
structure length
239
Chain Sequence
MEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Pteridine reductase
publication title Exploiting the 2-Amino-1,3,4-thiadiazole Scaffold To Inhibit Trypanosoma brucei Pteridine Reductase in Support of Early-Stage Drug Discovery.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
total genus 89
structure length 239
sequence length 268
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2016-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5izcC00
1M6WA 1GQYA 4ND4A 4RDHA 3GT0A 2LDXA 1IY8A 3INRA 3KB6A 3SLKA 1ZK0A 2FR0A 4JX8A 4E6PA 1Y81A 3LVFO 1OZAA 5G4KB 4RF3A 3TL3A 4GKBA 5BNFA 4FB5A 3DOJA 3QV1A 3ZWVA 1FK8A 4J1QA 3WGGA 4CQLB 2TMDA 2GPTA 3W6UA 3GG9A 4GX1A 4PVCA 1I2ZA 5I8ZA 4YQYA 5L53A 5TJ9A 3ZWBA 4BGUA 1EFLA 3ZDFA 3RFVA 2Q3EA 1A4IA 2PGDA 3E9QA 2VN8A 3I9NA 3ZHXA 1VLLA 5A9RA 3JD2A 3H65A 1NHWA 1W73A 4BNZA 3K31A 2PNFA 4M89A 1LX6A 4LISA 4HFRA 4YJFB 2JAPA 1E6UA 1C0PA 1EQUA 3AY6A 2QG4A 4R9SA 5FI3A 4FGWA 4MVJF 3S55A 4CMAA 2QRLA 3O26A 3PFWO 4CV3A 3TOXA 5L95A 3EVNA 3DZFA 4CM4B 4NQZA 3V2HA 1Q7BA 1YBVA 5B4VA 3QW2A 3AY7A 1ZNQO 3DB2A 2X0NA 4OXYA 4HV4A 2DPHA 4EUEA 4AJEA 4U6QA 4B3IA 2V65A 3TSCA 5BSEA 3JQFA 4U8GA 2DFVA 4XA8A 1WPQA 5JSFA 1QYXA 5K9ZA 1EBUA 1IHXA 1UH5A 5G4KA 3AW9A 3GNQA 4XYEA 1B0AA 3DZKA 5JNLA 2C07A 3DBHB 1L1FA 4BIIA 3EDMA 2VTEA 2HK8A 4BO1A 2EHDA 4CM6A 5K6AA 1EUZA 1PJTA 4KTVE 1GZ3A 2DUUA 4K9DA 1YBAA 2UUOA 2CVOA 3QRWA 4L73A 3ZV6A 4CMIA 5AXAA 1N8KA 4M55A 3TWOA 3CSDA 5CDSA 4ND1A 4BNVA 4I5FA 4BQPA 1NQ5A 2FRDA 1H2BA 1ZFNA 2Q49A 1UR5A 1HYHA 4Q3AA 4PCVA 2HLPA 1LDBA 1YQXA 3E8XA 1NAIA 3IJPA 3TNLA 3ANLA 4ZGWA 1Q7GA 3NRCA 2DBRA 2Q1TA 3ROQA 4J4BA 3H6KA 3ANMA 4RPGA 3F5QA 2X8LA 3CMMA 3KYCB 4OO3A 2OGUA 4IM7A 4DLBA 3ZU3A 4E12A 3JQAD 1XQ6A 2NVWA 4CUZA 4D46A 1DRWA 2GERA 6LDHA 5IN5A 1E1KA 1QYWA 1R0KA 3NTOA 4DQUA 4BNFA 1V3UA 2YZ7A 1KEVA 3RC7A 1ZEJA 4CMHA 1H93A 4NK5A 3ENNA 1AGNA 3Q6IA 4DLAA 2CVZA 5AXBA 1DRUA 2ZATA 4N5LA 4KQWA 4ZQEA 2EEZA 5TLSA 1RPNA 1DJQA 4M8SA 5JAZA 4H16A 1GUZA 3V1UA 2I66A 1NASA 1YJ8A 3FBTA 1YH3A 3WQQA 2JCYA 1ENPA 3JQBA 1UAGA 1TLTA 3GVCA 4J43A 4RV9A 1FDUA 3U62A 3KOUA 1UJMA 2P5YA 4YRAA 4BL5A 1BDMA 3GEGA 4KZPA 1PTJA 3PLNA 5FYDA 1PWZA 4FS3A 5JS6A 3I5MA 2ZJ1A 3NT5A 1EE2A 1KYQA 4BGVA 4QO8A 1UP4A 3H9JA 1EUDA 1YRLA 3AUTA 4TRNA 1RM0A 1EK6A 4NI5A 5BNIA 4BO0A 1MV8A 4ND2A 5THQA 4TZTA 3GVXA 3PYLA 3K30A 4OIMA 4EEXA 3SX2A 1RM5A 2CF5A 4IDCA 4XEHA 4CUKA 4LK3A 8LDHA 4ZJUA 5L40A 3F47A 2NTNA 3KM0A 1EVIA 1Q7CA 4MIEA 3LZ6A 3GZNA 1XHLA 4J7XA 5KJ6A 4UREA 2NU9A 2J8ZA 4C7JA 3NGXA 3TZQA 1LSJA 1Y1PA 4II3A 3PGXA 1R0LA 3WFJA 3HUDA 4DIBA 1H6AA 1ORRA 3AM4A 2HMWA 4ALNA 4PG4A 4CR7A 1R4MA 1YQDA 1MLDA 2HU2A 4UULA 4PLWA 3O9ZA 4XIJA 1YKFA 3MJSA 3LQFA 4OGWA 4E21A 4FFOA 5KJ1A 3AU9A 1BG6A 2HDHA 2VHWA 1IZ0A 3HE3A 2WSBA 4FFPA 1ZJYA 3MTJA 2YDXA 1I10A 4QFCA 3L07A 5IDYA 3PQFA 1JVSA 2D2IA 3BMOB 3VKVA 1ZMOA 4AJNA 3DZIA 3F1LA 1WWKA 5T57A 1JTVA 5F3RA 3DOOA 4PZEA 3LLVA 4CPDA 2O3RA 2HMUA 1E3SA 2UAGA 1WP4A 4YJGA 3UW3A 1A7KA 1U3VA 1I32A 2X0IA 1Z73A 2X0RA 5C3MA 4UVEA 1HDCA 1LRLA 3FTPA 5A06A 3O03A 4U0JA 1P74A 5K0ZA 3FR8A 2Q50A 3D3WA 2R6JA 4FJ1A 3H2SA 1UDCA 4JP3A 5ER9A 4YT8A 3RBVA 1JLLA 2W2LD 1K89A 4PFJA 2X0JA 2RH4A 1NQAO 1OAAA 3VTZA 5I9MA 1UXGA 5IDWA 1RWBA 4BNHA 4FSHA 3PYMA 1WAMA 4W4TA 3ZNPA 2C2YA 4IGFA 1I36A 1M6HA 1KVSA 3ABIA 3KEQA 1YOVB 2O3JA 3BMOA 1DIGA 1LQUA 3RFXA 2C5AA 5U1PA 3T4EA 1BXZA 4MO2A 5G0WA 3ZNQA 1ZK1A 4KWIA 4ZU3A 1U8FO 1SO8A 1NAHA 2W2KB 1SEVA 2FWMX 2JFGA 3GY0A 2XXJA 3P5SA 3QQPA 5CPFA 3ZWPA 1N92A 4UVGA 2I9PA 5JPIA 3RBXA 4QEDA 2JFFA 5F1OA 4M87A 5IXYA 5G0TA 5KWEA 4NHEA 1BW9B 3W8FA 3CZRA 4BO6A 1GCUA 1OBFO 4MKXA 3MWEB 4JQCA 3UN1A 3D3EA 1WDKA 2DVMA 2HQ1A 4JCOA 4NJMA 1NNUA 3GGGA 3NT4A 4XRGA 4IJWA 2XPCA 4L0QA 4DWVA 2GZ2A 5T5QA 3PJDA 3I4FA 2DT5A 1S7CA 3SBOA 4N18A 1LNQA 5ICSA 5JCJA 3RASA 1LSSA 2Y1GA 2V6GA 4R1NA 2J3HA 4LRSB 1ZK3A 2VZ0A 4AJPA 1Y8QB 1YOVA 4I1IA 3U9LA 4ITUA 4IY1A 1Q0LA 2VWGA 4AJOA 1IULA 4XYLA 1H2HA 4TZKA 1FJHA 3U4CA 2PTGA 1DC5A 1LLUA 1X15A 3L4BC 4YAIA 4IS3A 1TI7A 3DONA 2QIOA 3GPIA 1HDOA 3SJUA 3HDQA 5THKA 1E1LA 1HYGA 4Y8VA 3VH3A 2CD9A 1PU2A 1BW9A 1K6JA 2OZPA 4F3YA 1U3UA 3VDQA 2OBNA 3OFSA 4QFDA 4BO9A 4A27A 2HKIA 3RC1A 3QIVA 4D79A 2C29D 1VKOA 4L9RA 3IMFA 3AFNA 1GAEO 3NJ8A 5DCWA 2QW8A 2DPGA 5JW6A 2CY0A 1HE2A 1K6IA 5I7VA 4IS2A 5DP1A 2OP0A 4WLVA 2WE8A 1BRMA 2ZYGA 3KTDA 4HX5A 5B4UA 6ADHA 1Z82A 1CERA 3DMTC 3BMNB 4I8XA 2EKQA 1DEHA 1RJWA 5GZ3A 1R4NB 2GO1A 2RIRA 3VH1A 2ZTLA 2C7VA 2EERA 3A4VA 2VHVA 2NADA 3PFFA 4R54A 1DIRA 3G79A 3EAGA 2C0CA 3DAPA 5FI5A 5BR7A 1JN0A 4Z0HO 2JD1A 2VWQA 2D5CA 3JD4A 2FPGA 4CLHA 3E6AA 1RM3A 3C7CB 3OP4A 5ICMA 3I23A 4I5GA 1ZKMA 1DXYA 2B83A 2GN9A 4R5MA 2NU6A 1A4UA 4YEDA 1T4BA 4PG7A 3HB5X 4IQ0A 2H9IA 2ZB7A 3Q9UA 1PJ3A 5EESA 2Q1UA 2I3GA 2A92A 5L51A 3VTFA 4II2A 2GN4A 2AQHA 3HQ4O 3QVTA 4BB6A 2X5OA 3DDNA 1UP7A 4CM8A 3PZBA 3ZWCA 3BXXA 3LC2O 4TKLA 1A7AA 3DFUA 3D7LA 4RVUA 4K1LA 3ULKA 4A2CA 5JY6A 4YPOA 5ILOA 5KNLA 3G1UA 1VJ0A 1ZW1A 1DIAA 3FF4A 1I33A 5B37A 4WE3A 3AU8A 3KXDA 4W99A 2QQ5A 3GA0A 4PLHA 3IS3A 1YJQA 3I4CA 1EQ2A 4J90A 3VPGA 4CV2A 1RM4A 4NPCA 4Y98A 4IQ8A 1EMDA 1M67A 1QV6A 4PRLA 3OECA 4IDDA 4J4HA 1Z6ZA 5F5LA 5MDHA 1ZBQA 1UP6A 5A3VA 1DHRA 3ZW9A 5JC8A 3EVTA 2HMSA 4NFYA 3DBLB 3GVHA 4YRBA 4WLUA 4CLEA 1PL8A 4YDRA 2BFOA 4J49A 4DMLA 3FD8A 2IODA 5JC1A 2FMUA 1N7GA 3FWZA 4H7PA 4R9RA 5T64A 1ONNA 3UCFA 2VZ9A 3RSHA 2PZKA 4H3VA 3DOCA 2CDAA 1PGNA 3FPCA 5L7TA 2AG5A 1N5DA 3WGYA 4JNKA 5IZCC 2IXAA 2A35A 5HA5A 2EKPA 4YACA 3GMSA 1TEHA 4F45A 3TZCA 3D5TA 1DAOA 1K0UA 3LT1A 4BS9A 1NM5A 1HSZA 3WBFA 5G0VA 2B35A 4HNGA 4S1VA 1PJQA 1ENYA 5EIOA 3DXFA 5T8KC 2PLAA 2PZJA 3PEFA 5CDTA 4E2WA 2X6TA 3NAQA 5A03A 3PJGA 3PWSA 5JY1A 4GGPA 4UEJA 1A71A 2ZCVA 1AHHA 2P5UA 1DFIA 4M54A 2WEKA 4CLOB 4W9NC 2VWPA 3GOHA 4NNJA 4FFNA 4PLZA 3F5SA 3N74A 1YB5A 3JQ9C 3QVSA 5BSHA 3ICCA 1N1GA 3C8MA 1WW8A 4BV8A 3C24A 1JA9A 1MP0A 3WYCA 1XLTA 4MOWA 1PS8A 4YT2A 2VZ8A 5HBRA 2BELA 3TDKA 2EJWA 2GASA 4Z3KA 1WXDA 4RVDA 2Y1FA 3DMYA 1LXCA 4UUNA 4XB2A 4B3HA 3TL2A 4P4LA 2IEBA 5LCXA 2A4KA 3H5NA 5FEUA 5HM8A 1WZEA 1G0NA 4BO4A 1XDWA 4GLOA 3OJLA 5TT1A 3H5AA 2P4QA 1YXMA 1V3VA 5DBGA 3HJAA 1RKXA 1E3WB 3FRJA 4O1MA 1EVJA 5LDGA 4EJ6A 1GY8A 2GYYA 3PZRA 2YY7A 4LMRA 4N54A 4RPJA 4B8WA 2ZTMA 3AY3A 3B70A 3JQGB 1VC2A 4ILKA 4QUKA 1LDMA 3DZGA 1E7SA 1DSSG 4A7PA 3K92A 1U2DA 4E33A 4AL4A 4D0SA 3MJCA 1T26A 2ZTUA 3DWFA 3RC9A 4BKOA 2XF8A 3RBZA 4YWJA 2D3TA 4LSMA 5B1YA 4EGFA 3ZCXA 3ADOA 4XB1A 5LC1A 4QXMA 5DF1A 1WDMA 3FI9A 3DEYX 3FR7A 2G1UA 5IJZA 3MWDB 4NBWA 3JQ8B 2EP5A 4RZHA 3VH2A 5TGDA 1PR3A 3R6DA 2EW2A 3JCZA 1I5RA 1ZEMA 4OSPA 5JO0A 3LLSA 4J7UA 5IDQA 1LQTA 4IDAA 1BVUA 3E48A 4JROA 2G82A 3ROKA 3JSAA 5A3JA 1IPFA 3HDHA 4C4OA 2O3SA 5DULA 4PLFA 1K6XA 4Z9XA 3EHEA 3WNVA 4BMVA 1HT0A 3F46A 1ML3A 4Q3BA 2UDPA 1ULUA 2BI8A 5G0UA 1E3WA 1BSVA 3QLJA 4YVFA 3PHIA 2VYNA 4Q9NA 3ZN2A 5KVVA 1AUPA 3V2GA 4IJUA 4FD3A 5A9SB 4CV1A 4B4UA 4UUMA 4Q3EA 5EJ2A 3QVXA 1PGQA 5KJCA 2FHSA 3AOEA 2PZMA 2PK3A 3DZBA 2GDZA 4IJVA 3JQ8A 3D0OA 3ZHZA 4CL3A 2NACA 3ZU4A 1ULSA 3IKVA 4W7IA 3C3XA 5BNTA 3QHAA 4E2ZA 3UICA 5JE8A 4BGEA 4CM1A 3CXRA 4FOSA 1TVEA 4DPKA 2VT2A 4E5NA 4ZD6A 1M2WA 3OICA 1PSDA 4XX0A 3QWFA 3I3OA 2PH5A 3EW7A 3W4JA 3BMCB 3FSRA 2IDZA 3T7CA 4D44A 4KUGA 4OXNA 1UDBA 4RO0A 1NFRA 4ZQFA 3VVCA 5L4SA 3OM9A 3DL2A 2YUTA 2VHYA 3OSUA 3SC4A 5DCYA 4BNWA 4WJZA 4XZ3A 2UV8A 1GEGA 1G1AA 1T2EA 4RZIA 1ISFA 2NVUB 3ONEA 4G5HA 2QYTA 1Y5RA 4G65A 2QZZA 3ETDA 2J5RA 3FPLA 5JMPA 1AE1A 1HDXA 1IL0A 2WD7B 5TX7A 3W8EA 4YYZA 4IDFA 3RCBA 2O2YA 4BOYA 1P0FA 4P38A 1KEUA 2VRCA 3HDJA 1E92A 4MVJM 3R1IA 3OA0A 5ES3A 3JD3A 3MEQA 3KO8A 4MVJP 4FR5A 5DOVA 3Q11A 2OL4A 3OMLA 4BO8A 4NIMA 4UVHA 1LLCA 3G0OA 1UXKA 5AXDA 1X0VA 1DBVO 1U2GA 2QRJA 3AUAA 4DL9A 1IHYA 5KVQA 3NUGA 2OP1A 1NVMB 1ONPA 2DLDA 4MVJA 4ZRMA 3WGQA 2JHGA 1VPDA 2PD4A 3DZJA 4XWYA 3M6IA 4YAJA 1VRWA 1U3WA 3ONDA 4B7CA 2BGMA 4B8ZA 5A02A 5I7EA 1WZIA 2GF2A 4U5QA 1PJLA 1UDAA 3WQRA 5JYEA 3OHSX 3OBBA 4WECA 5T67A 3LF2A 4HWKA 3S2GA 4BNLA 1NPDA 3IL2A 3RD5A 1JAYA 2YV3A 3D64A 2WD7A 3WX0A 2VCYA 3BIOA 4CQLA 2X23A 3OH8A 4JK3A 3K8ZA 2CVQA 4YB8A 5CAEA 4XJSA 3ROMA 1ZXLA 2OO5A 4EBFA 2AE2A 4M86A 3I6QA 4NG5A 1V8BA 3FNHA 4DMMA 3WMXA 1MUUA 4XGIA 3S2IA 2O2SA 2DTDA 3DZHA 1Z74A 2O4UX 4YTEA 4AJJA 5JAMA 3ENKA 2X1HA 2WE7A 4UVIA 2YV1A 1CEQA 1P1HA 2G5CA 1ENZA 3AOEC 4FFLA 3WLFA 4B7XA 5ITWA 4YJFA 1ISIA 1PJ2A 3TZKA 1E6EA 4A73A 4AJ4A 4JBGA 1NR7A 3IAHA 4CM4A 1OOEA 3NDRA 4MIOA 3V2UA 2PH3A 3NJ4A 1I3MA 3CEAA 3ZU2A 1DAPA 4A10A 5COBA 7MDHA 2RCYA 3WOHA 2BFAA 1JU9A 2NNLD 4NU5A 3PGJA 4GVXA 1N9GB 1YBMA 3DBHA 3E9MA 2OORA 4OMUA 3GDOA 1TA4A 4R41A 3ZH2A 1I2BA 3VZQA 4TRMA 3U09A 4WCFB 3Q1LA 1DHTA 1ZXBA 1EZ4A 4MP6A 4Z3DA 4JXKA 2C54A 1QSGA 1X7DA 4FC6A 2O7QA 3QWBA 5DCUA 3PQDA 3TOZA 1JW9B 2VYND 3RROA 2VQ3A 1ADGA 3U3XA 4FGSA 1R37A 1ZUD1 3O8QB 4I08A 4XCVA 3JD0A 1H0KA 1L7DA 1GYPA 2ILTA 4TSKA 3N7UA 2X22A 1E7QA 3MZ0A 3PVZA 2Y0DA 4OHUA 3H2ZA 3KEOA 3OIFA 1BMDA 3KYCA 1DFHA 1C3VA 3CINA 1EE9A 1QV7A 4NZ9A 3PIDA 1P1IA 4MKZA 3LF1A 2ET6A 3CH6A 4DVJA 2JHFA 3BA1A 3KBOA 2Y93A 4L4RA 4ROSA 5DBFA 5JCXA 4CQMD 1XIVA 2XOXA 2YHIB 4KWHA 4Z0PA 3PP8A 1BVRA 4RGBA 1N9GA 2C82A 3IIEA 2BD0A 2G17A 2ZQYA 5ENDA 2QHXA 2WWRA 4QT0A 1H9AA 1TT5B 4WCFA 2CDBA 3JQDA 3UAGA 1R16A 2D8AA 2JD0A 2ZIZA 4IDBA 4IXTA 4BNGA 4XQ9A 4AJHA 2IYPA 4R1SA 3OQBA 2CDCA 4P8RA 3L4BA 5CEEA 4EZBA 3C85A 3P2YA 4FIZA 4Q3DA 1NPTO 4IIVA 1O5IA 4I9UA 4MJLA 4YJDA 1NBOA 1Z75A 3GRKA 1VM6A 4TRJA 1E5QA 4Z0TA 1F06A 3VZPA 3BMQB 9LDTA 1GEEA 2EGGA 2IZZA 1QYVA 5CDGA 3NV9A 2HMVA 4N5MA 3KYBA 5ADHA 4D42A 1FXSA 1JWBB 2Y1DA 3RWBA 3QWHA 1WMBA 3JYPA 3ADPA 3L6EA 3TF5A 1WMAA 4EEZA 5I9LA 2HRZA 1DB3A 1EUCA 1I01A 3DFZA 3BTUA 3IJRA 3ZU5A 2O3UA 3SVTA 4J6FA 3ETGA 1M76A 1ZJZA 1C0IA 3W4KA 5C7IO 4DTIA 3TFQA 1E1NA 2DTEA 2NLOA 3ONFA 3MCVA 3K9QO 2Z1NA 3KSUA 3KYDB 4RLHA 1V35A 3OJOA 1B2LA 3W1VA 4K28A 4MVJD 1P77A 2HRBA 1XG5A 3DMTA 3O38A 3WDSA 3ANNA 2X5JO 4WPGA 1QORA 2DKNA 1OC2A 5JMWA 2AQKA 1T1SA 4UEKA 1I8TA 1X14A 4LVUA 3HFGA 4IGEA 4DIFA 2Q1WA 3GDFA 1W4ZA 5BT9A 1OFGA 2AQ8A 4OM8A 1GD1O 4YQZA 4A26A 4TMFA 3BTVA 1B7GO 1J49A 2HJSA 3IDSA 4ZA2A 3F1KA 7ADHA 1YONA 3L6OO 1CYDA 2V6MA 3EC7A 4O63O 5EQFA 5HTOA 4XQGA 3OEWA 1ARZA 1VE9A 3OA2A 4ZVVA 1Y6JA 1QLJA 1BXKA 2Q46A 4NDNE 3WG9A 1MXFA 1HZJA 1IPEA 4EYEA 2BFPA 2FSVA 3DAFA 3WTCA 3JQ7B 2DU8A 5JDCC 1HDGO 4RVHA 4WK6A 2C5EA 4ID9A 3ZHYA 2JAHA 5JBIA 3D5QA 4WLFA 1GFSA 2VHZA 3BAZA 3GHHA 3HZZA 2H63A 4ZN6A 4BO3A 2NV6A 1LSOA 2FPIA 5F1PA 3GEDA 4ZRNA 1AXEA 2XXBA 4W6ZA 1DC3A 3AJRA 5EERA 4AJLA 3WWZA 1U3TA 1Z45A 1MB4A 3R3SA 5KKAA 5TC4A 3U0BA 3S8MA 2BHLA 2J3KA 1KEWA 2DFDA 3NEPX 4WCFC 3F4LA 3C7DB 1PZEA 3VPSA 1GV0A 2TMGA 3T4XA 2C7GA 3WIEA 4BMNA 3C1TA 3JQEA 2W2KA 4KOAA 1SC6A 4BNTA 3OETA 3D4PA 1ZIDA 2R2GA 3F9IA 3FCOA 3GC6A 1DC4A 4TVBA 5TF4A 4OXKA 3GUCA 3H3JA 4DUPA 4Z9FA 1LTHR 4MINA 2ZJ0A 3UCEA 3E5MA 1KY4A 3BHJA 4CMEC 3C1AA 1BHSA 3OJ0A 5DOZA 2H1SA 2Y1OA 1C1DB 4LRTB 4XQEA 3ICPA 4JJGA 3COSA 5IZCA 1A9ZA 4IIUA 1PX0A 1MG0A 4LW8A 4L4SA 4CMGA 2H6EA 4J2OA 2O23A 1HL3A 2W98A 1LC3A 1XEAA 4M1QA 2DBVO 4LCEA 4F6CA 3EYWA 8ADHA 3OF2A 4NBUA 4AFNA 1LLQA 3I9OA 4H15A 5FFFA 1PQWA 3U4HA 1GPDG 1XU7A 5T8KA 2I65A 1VJTA 5G2OA 2J5KA 3WTBA 4ND3A 1YB4A 3K6JA 4CUJA 1CQJA 1NFFA 3E03A 4DPLA 1Y8QA 3GQVA 2CZCA 1T2AA 4LN1A 2Y68A 3GZ4A 4BNUA 1GZ6A 4IQGA 5C7LO 2EWMA 4W9NA 1A9YA 4DGSA 5AOVA 5CDYA 3JQ9A 2FZWA 9LDBA 1E7MA 4IZHA 4XGKA 4CR8A 1HDYA 2DBQA 1B15A 1SBYA 2B4RO 2PD6A 1PS9A 4WLNA 2NSDA 3H9UA 2C2XA 3I9LA 1R0SA 1U1IA 1LU9A 1W0CA 1Q2XA 1KEPA 2DBZA 1DLJA 3DHYA 4R69A 4AICA 1HEUA 1W8DA 2AEFA 3A28A 4BNIA 1NWHA 3ON5A 3PK0A 3DBRB 4DA9A 2X86A 3PHLA 1E7RA 1YQGA 4ZQGA 3VHRA 4NBTA 5IFLA 4BQRA 4RPHA 1WVGA 1X7HA 2CMDA 1GTMA 4ONEA 1P1JA 1KC1A 2X9GA 2NQTA 4I5DA 3UHAA 4YAEA 3VPFA 3KVOA 2B4QA 3Q2IA 2BLLA 1AN9A 1I3KA 2I3AA 4MVJH 2E49A 4TQGA 4BO2A 4YXFA 3WLEA 2GN6A 3BMNA 3L9WA 1R4NA 1HETA 1X7GA 5L7YA 2P9EA 4OQZA 4RDIA 2EJVA 2IEDA 4D43A 4AG3A 1VL8A 5KIAA 3DTTA 3RUDA 1UAYA 1LLDA 4J1TA 5I9NA 3N58A 1YDWA 4GWKA 2Y0CA 2RHRA 3RUAA 4R3WA 3AI3A 4MPDA 4O59O 5L3ZA 2J5QA 3VOSA 1MGOA 3PTZA 2GSDA 4B4WA 4J4TA 2YDYA 1DC6A 1CJCA 1H6BA 1GCOA 3FNEA 3VAZA 4HNHA 2Q2WA 1Y8RB 1O9BA 1XELA 3PRJA 3V1TC 3K2EA 3IQDB 1H6DA 2J3JA 2J3IA 4OSOA 3WXBA 1DOHA 4MP3A 4BMSA 2AA3A 1YO6A 3SLGA 3RUHA 1U4OA 4GSKA 1PJBA 2CF6A 1O8CA 4IUYA 2ZQZA 4IBOA 4ZHSA 3TRIA 2AQIA 3Q2KA 4EJMA 3MTGA 3PDJA 1QMGA 1VI2A 2HK9A 3PJFA 3EUWA 2PFGA 1B3RA 4WEQA 3VZSA 3SJ7A 4NH4A 3B6ZA 2FN7A 2YW9A 1HSOA 1BTOA 2PR2A 3DO5A 1XYGA 4PGFA 1EBFA 5IXSA 4G2NA 2Q2VA 5JCJD 2C59A 3SEFA 5DZSA 4HY3A 3QSGA 5KVCA 5EPOA 3TQHA 2FR1A 3DBLA 4E32A 4FFMA 2EW8A 3I52A 4XD2A 4IDGA 3RC2A 3R3JA 5KTKA 1T2CA 4QTZA 3A9WA 3Q9NA 5IDXA 3GRPA 3DQPA 5BQFA 5CFZA 3D4OA 2CFCA 2ZCUA 5EINA 1YGYA 3RKUA 4L4XA 4RLSA 4KMSA 5JDIC 1H94A 1Y7TA 4D3SA 3WSVA 1SPXA 4CMKA 3NGLA 4PLGA 1WNTA 2QRKA 1U5CA 2OMEA 4IDEA 5L4NA 3TJRA 1KVQA 1DRVA 1XQ1A 1LDNA 4ALKA 4R4JA 3GLQA 4MDHA 4RF5A 1EFKA 2WTBA 1NR1A 3GAFA 1PEDA 3WICA 3JQCA 4Z6KA 3JQAB 3PXXA 2LDBA 2YFQA 4YR9A 3KLPX 2FR8A 5EL0A 3WGOA 4N5NA 1U28A 4CLOA 4XIYA 4I9NA 5CG1A 3WGZA 1U4SA 4AJKA 3L4SO 3M1AA 4IMPA 3FHLA 1TB4A 1X1EA 1GPJA 3JYQA 3R0IA 3T7EA 1T2DA 2JCVA 4C7KA 1U7TA 3F3SA 3UF0A 4R3NA 4AJ1A 4PLTA 2NM0A 3HHPA 4M49A 1KY5A 2X5KO 2OBYA 4JBIA 1NQOA 2I67A 3TZ6A 4BO7A 3V5NA 1NYTA 2BGKA 4LCJA 5HS6A 3VVBA 4LMPA 5COQA 2PY6A 1PGJA 1XSEA 2NU8A 3WQSB 2PGJA 4E13A 2O3TA 3I83A 1NVTA 4L76A 3PPIA 5JYDA 4BGIA 3NTRA 2P2SA 3MJEA 4PZCA 1E77A 2GD1O 3DBVO 3VZRA 4JJIA 3NX4A 4JIGA 3BYZA 1E1MA 3I9KA 1YVEI 1I0ZA 4BKPA 1Q1NA 3U5TA 4FC7A 4CM9A 1D1TA 1J6UA 3JQGA 5KKCA 1J5PA 3E5RA 4J7CA 4OQYA 3TN7A 3V8BA 1D8AA 3CIFA 5IN4A 2YHUA 2FSSA 1N2SA 1B8PA 2W4QA 4E30A 4DQXA 3PHGA 4RF4A 4NU6A 4PLPA 4J9UE 4E0BA 4OOFA 1P1KA 4QECA 2BKAA 1SOWA 3RUFA 3H4VA 1JAXA 2ZTVA 4IJKA 2NU7A 1BWSA 3PDUA 1IYZA 2IYOA 1KVRA 5DN9A 4GVLA 2B5VA 3DHNA 3K5PA 3ZWYA 4RCVA 2WYVA 4JBHA 1TT7A 1ISGA 2VNSA 5F1KA 4AJ2A 3OJEA 5TS3A 1VL6A 4L74A 1H6CA 4HP8A 4MVJI 2IXBA 2Q99A 4A03A 1XCBA 2D0IA 4XGNA 3ZWXA 1YS4A 3RU9A 1K3TA 2Y1CA 4PRKA 4NMHA 3AM5A 5CEFA 4YA6A 3D1LA 4KDEA 4O5OA 3MOIA 2EIHA 3WSWA 4E5KA 3OQ6A 2Y1EA 1J0XO 1M66A 1PGPA 2YV2A 3EZLA 4EW6A 4YAKA 2B4TO 5A9SA 4CMBA 5CG2A 1FDTA 2O7SA 3PI7A 4E5YA 5CEJA 1F12A 2PZLA 4D0RA 3WIDA 2HAEA 4PIVA 2FPPA 4CR6A 1B3BA 1LI4A 1HXHA 3WB9A 3H5RA 1F8FA 4DYVA 1KC3A 1P0CA 3JYOA 3KSZO 3AWDA 3PHHA 4GX0A 5LDHA 3UKOA 2D5AA 5DBIA 3ZGYA 1V9LA 3JTMA 3B1KA 5TRTA 2Z1MA 2GZ1A 5GZ6A 4GLLA 2BF7A 3RVDA 1JKJA 2OFPA 4ESOA 2CNBA 3H9QA 4N7RA 3BMCA 4J0EA 4DXHA 1HF3A 3GVIA 1ZSYA 5L45A 1JKFA 1ZK4A 4MIYA 2O4CA 4PG6A 1DIHA 1GZ4A 1YB1A 4MVJG 2PWZA 1MX3A 2POQX 2ZB3A 4CLDA 1LRJA 2Z95A 3ZNNA 2WYWA 5A04A 3W4IA 1LBEA 1ADCA 1LUAA 2R00C 4J0FA 3HSKA 1SEPA 2FY8A 1D4FA 2PV7A 4ALIA 2NVUA 4CMIB 5J23A 4DPMA 4X54A 2NTJA 3LT4A 4XR4A 2RHCA 4GMGA 3ZWAA 1ID1A 4XDZA 1E7YA 4LVCA 1EDZA 1C1XB 1OC4A 2W2LA 2CSUA 4XDYA 3HB4X 3ZV3A 3GFBA 5FF9A 4QQRA 3NKLA 3CMCO 4U0KA 2F00A 1V0JA 1GADO 4IPTA 3WBBA 1LDYA 2YFHA 2PD3A 2AE1A 3JYLA 3RKRA 1DLIA 2VOJA 2UUPA 3RJ9A 3UCXA 3WGHA 4TWRA 4NK4A 4RVFA 1PL6A 1D3AA 4O6VA 3UGKA 5I7SA 3AUUA 2ZYAA 3RUEA 2D59A 5H81A 2GR9A 5F5NA 4ALLA 3GUYA 3IUSA 2A94A 2B36A 2FZEA 1PIWA 4J16A 2Y66A 2WD8A 1P1FA 4ZQBA 3NTQA 4S3MA 4R68A 2GCGA 2EKLA 1ISHA 3WR5A 2W8ZA 3GDGA 1LJ8A 1UXJA 2W90A 5CHEA 1E6WA 3FTNA 1U7HA 3GEMA 2HJRA 4FCCA 1UZNA 2GN8A 4KP7A 1C1XA 4BO5A 2AXQA 4BB5A 5C5IA 3ZHBA 5ITVA 4GSLA 4JP2A 3VC7A 3E18A 1LSUA 1PZHA 3L9XA 1T24A 1PGOA 1HLDA 4OL9A 1PR9A 3SC6A 3UVEA 1EK5A 1N7HA 1ZCJA 3G3EA 5I7FA 4CM9D 4GQAA 1UZLA 5AXCA 1I3NA 3WWYA 3ST7A 5CPBA 1PJCA 1KIFA 2GGSA 1GUYA 5TSDA 5IF3A 3F6YA 2OXIA 3S2EA 4RPKA 5KCZA 1EVYA 3LU1A 1P31A 3GZNB 5A5EA 5L4LA 2YQ4A 1R6DA 1SB9A 2E37A 3G17A 1E5LA 1F17A 3GAZA 3L6DA 2BGLA 1MC5A 5C37A 4F46A 5JDCA 3Q3CA 5F21A 4WKGA 3JYNA 3SXPA 3O4RA 1KS9A 3E82A 2D4AA 1SCUA 1R4MB 4LSWA 1HRDA 1Y9EA 4E31A 3B1JA 4G81A 1ZH8A 3AI2A 4YJHB 1K2WA 4P4GA 2B0JA 1H5QA 1ONOA 2VUTA 1I24A 5DT9A 3FNFA 4URFA 2BRUA 4NFSA 2PGLA 3ZWNA 2C20A 1XA0A 4Y6PA 2A9FA 4GWGA 2PKQO 4D45A 1NHGA 2VT3A 2ZYDA 3EK2A 3ZWOA 4E3ZA 3H9EO 2I99A 5GZ1A 4GH5A 1DDOA 4BNNA 5ENVA 2WMDA 4WNCA 1DFGA 1ADBA 3O8QA 5G0SA 4WCDA 4YJGB 4F6LA 5GY7A 1ISMA 4KDFA 4GPD1 1DIBA 3K96A 2V7PA 3CE6A 1RYDA 4CMEA 5B12A 4RORA 2X58A 4PN3A 1GV1A 2AEMA 1R66A 3D3WB 2B37A 2VRCD 4PVDA 4DYDA 2Y67A 3JQFC 5B4TA 4CLRB 1P33A 1Q0HA 3WYBA 2E4AA 2YHIA 3UFXA 3QWAA 2Q4EA 5JFOA 4YJHA 1W6UA 4CV0A 1E3JA 2BMAA 4D41A 4GAEA 4RVSA 3RUCA 3U4IA 3F4BA 2ZB8A 4B3JA 1B26A 4AJIA 1TT5A 2OUIA 2VYVA 3ZV4A 5K6AC 3HG7A 2NUAA 2P9CA 3EZYA 3DHEA 1PQUA 2VUSA 1FDSA 4DBVO 1X13A 2EG9A 4DBZA 5KJFA 3ITKA 1P45A 1B8UA 1PS0A 2RBEA 3UXYA 4J9VA 4BNMA 2NTVA 3DAGA 4TKMA 1WDLA 4XYGA 4PG5A 1N1EA 1ZSNA 2JCXA 2CUKA 1SNYA 1ZMTA 3HN7A 4PLVA 1MFZA 2RAFA 3BMQA 4EJ0A 4GGOA 1R12A 4WOKA 1AHIA 1SAYA 5JO9A 1EDOA 4ZICA 1B8VA 3WGIA 1M75A 4R5HA 1G0OA 3CPSA 3I9MA 4J1NA 4WOJA 1A27A 1VSUA 3AFMA 4NJMB 1PZFA 1AXGA 2D1YA 4DC1A 2SCUA 5BSGA 4DC0A 4E5PA 4CLRA 3CTMA 3GNSA 4E4YA 4J1SA 2UYYA 1RYEA 1UZMA 5TT0A 3ZZNA 3GN1A 3Q0EA 3QVOA 3AI1A 1F8GA 4RF2A 4XYMA 1O95A 3OIDA 1FDVA 3KUXA 4UEOA 3KYDA 4BKRA 3C7AA 5FWNA 4R1TA 4AVYA 2WM3A 1UUFA 4J2HA 2JJYA 2NVBA 2WDZA 1NTOA 2GLXA 1OMOA 1CF2O 3JQBC 3KHUA 3HN2A 3AOGA 4RQUA 4WUVA 3WJ7A 1PQPA 2O3QA 4IMRA 4GX5A 3MJTA 4EUHA 3MJ4A 2EV9A 4B4VA 3AK4A 1JKIA 3H9GA 2Q45A 4Q3CA 1HKUA 1V3TA 3TZHA 1IOLA 4RQTA 5KVSA 1H9BA 3HFSA 4BUCA 4Q39A 2HMTA 2GRAA 3NDIA 3B1FA 3AM3A 2VRBA 3S1LA 1ENOA 1HLPA 2VHXA 4FDAA 4K26A 3RAJA 3UUWA 2JFHA 3RI3A 4NJOA 1MG5A 5MGBA 4XQCA 3GFGA 1T2FA 4L75A 2Q2QA 4PZDA 4XR9A 1P44A 4KUEA 3QVWA 3GHYA 1YL5A 3QWIA 3WFIA 4HUJA 1VL0A 1IB6A 1HTBA 1BDBA 4E5MA 2B69A 5JAIA 3TFOA 2WJPA 3AUSA 3JQ7A 1S6YA 1WLYA 3P19A 3B20A 3RFTA 2IRWA 1T4DA 2IZ1A 3H7AA 4BKQA 3ITDA 4E2YA 1DJNA 4O0LA 1VKNA 1NPYA 2V6FA 5JLAA 1E0DA 2OHXA 2Y99A 3OIGA 1CIVA 3GN2A 1CDOA 3L0DA 1BXGB 4YBZA 3K73O 1PJ4A 4B79A 1FDWA 3PJEA 5TNXA 2VNAA 2X7HA 1GR0A 4KTTE 1U9JA 2EP7A 5EN4A 3LK7A 3PWZA 4YRDA 3HADA 1SOVA 2EXXA 4YAGA 3ZWMA 3VKUA 5I8WA 2HK7A 1Z7BA 1P1RA 4IINA 2YQ5A 4DREA 4BV9A 4BKUA 4KQXA 4CM5A 4EI2A 3STHA 4OAQA 1MXHA 5AVOA 1CWUA 1YE3A 2F1KA 4JJFA 3TPCA 3VH4A 2P91A 4W82A 3IP3A 4OJNA 3A06A 4WASA 4YT5A 2HUNA 1MA0A 1KVTA 4XKJA 1P3DA 4BHTA 3RUIA 1ZO8A 4CM8B 1C1DA 1PJSA 5JDIA 3P7MA 4QX6A 2E82A 1JQBA 2Q1SA 3ZI0A 1CETA 4HFNA 4I9HA 3VPXA 1NX6A 1J4AA 1VSVA 2HO5A 4EDFA 4XYBA 3CZMA 1BXGA 3LDHA 4FPXA 4GI2A 4Y9DA 3RU7A 3S2FA 1XGKA 1F14A 5CP8A 2ZB4A 1HZZA 1JVBA 4WNIA 1MFPA 1LC0A 4WLEA 5TIIA 4GBJA 4CODB 2VOEA 4NBVA 2QYSA 3IP1A 4WEOA 1GUFA 5COAA 1V6AA 1SMKA 1UXIA 4JN6B 4PG8A 3I9JA 4UUPA 4OOEA 4IXWA 1O89A 3GG2A 2QX7A 3WNQA 1NVGA 2VYVD 1LDEA 4D3DA 1U5AA 4WLOA 1YWGO 1YL6A 2VWHA 1EVZA 3X2FA 2P4HX 4B4OA 4DLLA 1DO8A 2WYUA 1B14A 1PL7A 4BVAA 4INAA 4QO7A 2HCTA 4OYRA 3C1OA 2X9NA 1IUKA 1HWYA 2DM6A 2DTXA 3G1TA 1CQIA 3OQ1A 2NQ8A 5HRUA 3DBRA 3INGA 1G6KA 3E9NA 4EUFA 2GUGA 4DRYA 1O0SA 1D7OA 4J3FA 2ZKLA 2Y0EA 3E1KA 4ALJA 1Z7EA 5A9TA 3X2EA 2YYYA 4E2XA 1LA2A 3BZUA 3P2OA 3DTYA 3JD1A 4RVGA 2BFMA 2I6TA 4HFJA 3EMKA 4TVOA 1PZGA 1QP8A 2VUUA 3IOYA 1NWCA 1QXSA 5A1TA 4FOOA 4L8VA 3RQSA 4ALMA 3BTOA 3VPHA 4XRRA 3W8DA 3GK3A 1C0KA 3IKTA 2NWQA 5ER6A 2JD2A 2VTDA 1XR3A 5IZ4A 2G0TA 4CL8A 2I5PO 1T1RA 4R51A 1Y9AA 4RPLA 1PWXA 4FBGA 3BHIA 3WMWA 3INTA 5JXWA 1NXQA 3JV7A 2FOIA 1FF9A 1IZ9A 4YCAA 4ZQHA 2JKVA 4DIOA 1KERA 3G49A 5L7WA 1ZSVA 2O48X 2G76A 3QP9A 4HKTA 1U8XX 2X4GA 1I30A 3I1JA 2PA3A 4BNKA 1JWAB 3VDRA 3ASUA 4HBGA 4NR0A 3QE3A 4NBRA 5JAQA 4CM3A 4D7AA 1IE3A 5AQ1A 4U6SA 3CKYA 1Y8RA 4OKIA 3EY4A 2BH9A 3LYLA 1D1SA 5TQVA 1A72A 4OH1A 2E48A 4IZIA 3LC1O 3PLRA 5CDUA 3CUKA 3DR3A 4Y67A 5IG2A 1CRWG 1L7EA 1TXGA 4DQVA 1XU9A 4P4NA 1GU7A 3KLMX 4CMJA 3L77A 3LC7O 3KV3O 3D4NA 4QSMA 3ZV5A 1HYEA 3OEYA 1GQQA 3WGTA 2FP4A 1SB8A 1XWFA 2XAAA 3KSDO 3HDYA 2RH8A 5GMOA 4B7UA 4K6FA 1NFQA 4TRRA 2PKQP 2Q4BA 2UVDA 5EQDA 2AHRA 3EGOA 3PQEA 3V1YA 1QG6A 2DUWA 2O50A 1EEHA 1VJ1A 2B5WA 2BI7A 1E3EA 3IC5A 4MKRA 2ZK7A 1ISJA 5G4LA 4KUHA 4FQ8A 1DPGA 5KOIA 1HE5A 5U4QA 2EGHA 3M1LA 1BGVA 5HWSA 1GYQA 4D3FA 1HDRA 1B16A 1XKQA 2AW5A 2H5LA 3M2TA 2GZ3A 4HADA 4JGBA 2AMFA 2DAPA 3GNTA 3ZW8A 5U9CA 1LRKA 2I76A 1GQ2A 1I2CA 3GH3A 3BHMA 3FBGA 1GL3A 2PKRA 1KBZA 4WGGA 2Z5LA 1Y5MA 4R1UA 4Z9YA 3A14A 4RJTA 4EITA 5A4DA 2E6UX 2J6IA 1OI7A 5DNAA 1JDJA 3GVPA 1E7WA 2QZ9A 3K2BA 5H82A 3FN4A 4JLWA 3KRTA 1F0YA 3NDJA 4FW8A 4BNYA 2R00A 5TJHA 1QYDA 5HS4A 3LT2A 3IUPA 4FN4A 4PLCA 1Q0QA 2V6BA 3PHJA 3UOGA 4W7HA 3H8VA 4CM7A 4GL4A 4ND5A 1HE4A 2EF1A 3ORFA 4Y6SA 1QYCA 5EMHA 4FJ2A 1O94A 1ZVMA 1K5HA 2DQ4A 3ZNOA 3QA9A 4FJ0A 3U4DA 1QLHA 3OJFA 2DC1A 4Y6RA 3JQAA 4PLYA 5IAAA 1KOLA 5C7OO 2YJZA 2OOSA 3I6IA 4FFRA 3QY9A 1X1TA 1X0XA 4CQMB 3LT0A 1HE3A 3ZWWA 1ADFA 1KVUA 1HDZA 4CLXA 4MVJE 5DDIP 4GX2A 1LDGA 3MJVA 3KETA 5H83A 3JQ6A 3MOGA 3QJ5A 1P9LA 2P9GA 3GF4A 5KJEA 2GNAA 2AG8A 1GDHA 4GKVA 4CMCA 3FWNA 3NYWA 4A0SA 3UH1A 3HNPA 3U49A 2Y05A 2HSDA 4CJXA 3GMDA 1LEHA 3ASVA 5AYVA 1FMCA 5ILGA 1ZZEA 1I3LA 3ETEA 3PYXA 4J91A 1R15A 1C14A 1YL7A 3LSYA 3GGOA 4YT4A 4RL6A 3PIIA 4UAGA 2JL1A 3ROPA 3WS7A 1QR6A 3A1NA 2AEJA 4HFMA 1UXHA 4K6CA 3WJAA 3GR6A 4HXYA 3W6ZA 1GYRA 5A05A 1A5ZA 1QKIA 4P22A 4BNJA 4OKNA 1MC4A 1KETA 3DC2A 5L9AA 4GMFA 4U7WA 4R16A 2IE0A 3RIHA 3H3FA 1T25A 3HWRA 1E3LA 5BSFA 1QRRA 1SZJG 2P68A 2IZ0A 1C0LA 4CQMA 3FNGA 3NT2A 4XJTA 4MP8A 1YDEA 1NQTA 3PWKA 4Q3NA 4BNXA 4NFHA 2X9VA 3BTSA 3GPDG 1E3IA 4UUOA 5DP2A 4I5EA 3KZVA 3WYEA 1NP3A 5A5FA 1ZK2A 4TROA 4A5OA 3RJ5A 5T6BA 4R01A 4LGVA 3GGPA 3M2PA 4UVDA 1O6ZA
chains in the Genus database with same CATH superfamily
1M6WA 1TK3A 2H08A 1P2SA 2ZYHA 4R2XA 4A3SA 3WY9A 2I91A 4YHHB 2QVGA 4FDTA 3GT0A 1JB9A 3HO6A 4UPDA 3TTWA 4DJFC 1IY8A 2I6FA 3INRA 4HSEA 1CZKA 3K2QA 4JFAA 1XV5A 5TF0A 4JX8A 4PZLA 3N5KA 4B47A 3LGAA 4BMDA 1QPBA 2ZIWB 1P4AA 4EMUA 2Q41A 4ZVOA 5AD1A 4CQLB 1RAAA 2HPHA 4Q6BA 3IQFA 1JG6A 5G53C 1XRNA 3R44A 1F4VA 5KC9A 4RK1A 4KB5A 4YAWA 1QG0A 3F7NA 4OK5A 4YQYA 3VSEA 2OD2A 5K8TA 3ZDFA 5L53A 4EFDA 1SA0A 4DV3B 4IG9A 4B80A 3CKMA 1WMSA 4X95A 3FRIA 1I6WA 1G3IA 1A4IA 1U2DC 1OU0A 1RXSA 3DH0A 1H4QA 5A9RA 2YWGA 2PL1A 2OY0A 5ALWA 1RWWA 4HDNB 1JTFA 4TN5A 1QJ4A 1NHWA 1W73A 3GXOA 4MR7B 3KQNA 3PKZA 2J59A 3LX5A 3RRMA 3FPAA 1HNZB 3L0IB 5FI3A 3SQDA 3ZCTA 1E6UA 1C0PA 1EQUA 1TKCA 2QG4A 3R3XA 4MVJF 2D1QA 2H0QA 5EUBA 4MHSA 3TOXA 1V9CA 3R5KA 3A6GA 3DZFA 4NQZA 1A2KC 1R0CA 3NM4A 1D6JA 3DB2A 4FLEA 4WXMA 2RGGA 5AW5A 2WAOA 4NBLA 3TRDA 4C08A 1DAEA 4RJKA 4B3IA 5BSEA 3RS8A 2B8EA 1OPRA 3D1JA 2L17A 3OJXA 4QXPA 4XA8A 1T9GR 2R96A 1ST3A 5JSFA 2R6DA 2WT4A 1IHXA 1UH5A 1DT5A 1JEOA 4H08A 4MWEA 1XZQA 2P2GA 1PJAA 3AW9A 5G4KA 3S7TA 3GPLA 3K5IA 1OI3A 4N3GA 1FNSA 1N2CB 1Q20A 2C07A 1GRVA 1L0BA 4BIIA 2OCGA 2OPHA 2FVYA 5E7MA 3H99A 2FZGA 2VTEA 4PYRA 1XCMA 2JLAA 3MNFA 1CS4C 3MS2A 3RT1A 5DLYA 1JZQA 3GDWA 2QMOA 3OF3A 4N0PA 3ZTTA 4C6TA 4IDQA 1PG5A 3QRWA 1AUVA 4L73A 5H7XA 3ZVRA 5HCUA 4ERXA 1N8KA 4M55A 4RZ3A 3CSDA 3O4JA 3TWOA 1QHGA 4F2PA 5CDSA 1CQWA 1QZUA 4C4ZA 2X7JA 4NCXA 2A5DA 2O8DB 2REQB 1ATZA 1SCIA 2FEPA 2C58A 4DMRA 1LDBA 1GLNA 1YQXA 2VNKA 2W0SA 3IJPA 2H31A 5H80A 3ANLA 1MH9A 3QXHA 4ZGWA 2ZIFA 2LD4A 3ROQA 3TVTA 1XRMA 2Z2KA 4J4BA 1HURA 4ZO8A 4GBMA 2YYSA 4GHWA 3F5QA 5FTMA 1EUDB 4LYYA 1AKQA 4JXZA 5BURA 1YB7A 5IVPA 3BJEA 4QJ3A 4OO3A 5JH7A 2ZULA 4DDUA 3JQAD 1XQ6A 1M5UA 2OENG 3TX6A 2GERA 5IN5A 4DTCA 4Y2GA 1V5GA 2XR1A 1XQWA 4UEQA 4BTEA 3GQBB 4BNFA 1CZOA 1KEVA 3F3MA 5IEBA 2OYRA 5B7QA 1YQQA 1AGNA 4BVBA 3IUQA 4RQAA 4IJ5A 1QIKA 3H87A 3LVRE 1GTSA 4LJRA 4X1IB 2ZATA 1M5RA 4G1UC 4KQWA 1PLKA 2EEZA 4DCUA 4R7ZA 1TMYA 5C1IA 1KDOA 4H16A 4J0GA 1Y98A 4MWSA 5E9WA 3RPEA 1SBQA 2RSLA 1NASA 2V59A 2X0EA 3MGCA 1I6KA 3H7IA 3FBTA 1MOQA 1S2GA 4WZBE 2ZR0A 4WTOA 1A9RA 1CEEA 1NX9A 1T8UA 1TLTA 1UAGA 2OSVA 2ODWA 1UT6A 2XADA 1KNXA 3BRWA 4M8NE 4QVGA 1RPZA 2AUNA 3T3NA 1UJMA 5C1BA 4CTMA 1LCIA 3HWWA 2OCYC 1QUEA 2R4QA 4GI7A 5KWVA 4MR9A 2DCMA 2W6MA 4FS3A 4AM8A 4DR2B 1EE2A 1KYQA 4REQA 3NS7A 3ZHUA 1LBTA 4OXQA 3GU3A 3H9JA 2F9MA 4MXDA 3W2FA 4XM0A 2C3PA 4Q4DA 4NI5A 2O8EB 4JT4A 3S8EA 2O06A 1X3LA 4NDAA 4O4HA 1TJ3A 2JVJA 2VTKA 3GVXA 4TZTA 3ZI7A 5JZOA 2YVLA 2YVAA 3PYLA 2WC1A 1U94A 4OIMA 3KJHA 1RWPA 3HVUA 2BBWA 4II7A 1RM5A 1JHMA 1T3TA 2BSAA 2CF5A 1U2GC 2GCIA 4LCBA 4NBNA 1NF3A 5IBPA 3D3QA 2ATVA 2WIDA 1EU1A 1FP7A 1II9A 2HJ9A 3KR9A 1KDZA 3RRJA 4PYJA 1EVIA 1Q7CA 4F5EA 2C4VA 1M1NB 1SIOA 3EE6A 1CUIA 1TU4A 3GZNA 4J7XA 2HPVA 4TM7A 1OW3B 3VSDA 2R68A 4IXDA 5JMTA 3NGXA 1KQOA 4MI9A 5KOHA 1SQ6A 4BNDA 4UQLA 1NSYA 3AM4A 3D43A 1K5PA 1BE0A 4RIIA 1TJNA 1R4MA 1B4DA 1JEAA 1JNYA 1W85A 4UULA 1G8FA 5CYGA 2V0GA 4F3CA 1RPAA 4DMFA 4PPNA 3EIXA 2H2GA 5L3QA 3O75A 2CHEA 3GDHA 5AHOA 1ZX1A 5JD4A 1FTGA 3ZGZA 1ZHHA 4E21A 1JXMA 1ZVKA 3AU9A 3UG7A 1T5IA 3WIVA 3ZCQA 3GJ3A 4QTUB 2HDHA 3VGPA 4AYXA 1HQYE 4X7PA 2X8AA 1EP2B 5HVNA 2CWWA 3ESRA 3UGQA 3GFRA 1FU8A 3E9YA 4IJ6A 2B7CA 1Z12A 3CXUA 3AUKA 3LX8A 4HT3B 8MHTA 3QVGA 3Q3IA 1ZMOA 3OT4A 4AJNA 4D9CA 1M0WA 1WV1A 2ZRBA 3ESZA 3F1LA 3HJRA 5DTJA 5T57A 5HF9A 4ARSA 3G5LA 5ALLA 3AHJA 1LS6A 3ET4A 1B6GA 4QOFA 4RSHA 4LF7B 3LLVA 4CPDA 4EUSA 2G6TA 2AUMA 2AXPA 3QM1A 2QLBA 1HFKA 2FW9A 4YCCA 1A7KA 1Y1TA 1PD1A 1VLJA 3ITNA 4JJEA 5HF5A 2NAPA 2WTEA 1YNSA 3G2LA 3C8HA 3D2CA 1C9JA 4UVEA 3Q3VA 1JU4A 2B3TA 1U7DA 2EQ5A 3UMSA 5A06A 5K0ZA 3FR8A 1B0PA 2Q50A 3LDUA 3CFYA 1E5TA 3AVUA 3BJMA 1UDCA 4JP3A 5ER9A 4B3FX 4YT8A 1JLLA 2W2LD 4F86A 4A5SA 1Z7GA 2E87A 2EAUA 1NQAO 2YWJA 3KT3A 1JT2A 1YUBA 2XOEA 3PNSA 4O33A 2ZYTX 3LGXA 1L7BA 4HTFB 4F5ZA 1B1CA 3ROXA 3BWCA 1YC5A 1RWBA 4BNHA 3H4MA 1R0ZA 1SELA 2XUKA 3H2BA 4JOSA 3UUGA 1MAVA 2C2YA 4IGFA 2OORC 1I36A 3E1GA 1M6HA 2XB8A 4KQ1A 4QPZA 3VR2A 2P9YA 4A92A 1W7AA 2XNDD 10MHA 4YAOA 2IY9A 4JLPA 1Y82A 2A9KA 2PMKA 4X20A 4RTNA 3I5YA 1Z38A 1TQ6A 1JJBA 1SXIA 1YT5A 4UPEA 4MUNA 2WFLB 2JFZA 3VYTB 4PHFA 1T36A 2PXAA 3KQPA 1GNLA 2EKDA 3IULA 4UHBA 3W2HA 1ZK1A 4ZU3A 2VCEA 4PSKA 4C0BA 2FWJA 2R6ZA 3GY0A 3RSLA 2H59A 3W2GA 2OTCA 2ORED 3ITEA 1WPRA 4J8PA 1ZNXA 1N92A 1X1BA 2XZDA 2Z57A 4V0NA 4UVGA 2XB9A 4O4JA 4JLJA 2EU8A 1K9VF 3D7MA 4M87A 1NC1A 4FNGA 5IXYA 4MWBA 2CLKB 4FZJA 1WW3A 5FPHA 3UY4A 5DNWA 5GGYA 1L1RA 3W8FA 4BO6A 3RHSA 5C8DA 4WK0B 3THWA 2QN1A 4DNFA 5BNWA 3G23A 3OM8A 3K6SB 1ZJ6A 3UN1A 4EGSA 2DVMA 3FLMA 1M7GA 3WKDA 3PXAA 4XRGA 5JI2E 1Z0FA 1BZYA 4QYMA 1D9XA 3ECAA 2FRVA 3CPEA 1XB2A 2JFOA 4GEKA 3QE9Y 3VSBA 4EG8A 2GZ2A 4RU1A 3PJDA 4P92A 2P9HA 3C4JA 3QENA 2H1CA 1YFZA 3TXYA 4HNVA 4V0SA 5ICSA 2D4HA 2FA9A 3B1ZA 4I3GA 3RASA 3RRZA 2J3HA 4G0PA 4OP2A 4JKOA 1IRXA 1NVBA 1OWNA 1TJYA 3I9V1 1D1PA 1KSFX 3NKVA 1VLHA 2LVBA 4I7EA 1IWBB 4ES6A 4BFTA 1XRRA 3OP1A 1MABA 1Q0LA 1UBCA 2VAVA 4NV1A 2JJQA 3MUOA 1AZTA 4TZKA 5JD5A 2XUOA 3AQIA 2GTHA 5FUXA 1X15A 4JYBA 3L4BC 1TCAA 1TI7A 2CLSA 2RAUA 5HKKD 1MOSA 2VF8A 1XNRB 3KQQA 4NY1A 2B8WA 2BEVB 3UAZA 4CKBA 3Q3HA 3NYQA 1HYGA 2AJBA 2DX7A 3SYKA 4D98A 4F3YA 4KFTA 2J5BA 3MG9A 3VDQA 4JVSB 4AF6A 4QUHA 2VP6A 1JHQA 1NURA 4C0QC 1V6SA 4MGYR 4BO9A 2KYRA 3FHJA 1ZGAA 3H4IA 4HGPA 5HIAA 3KPWA 3LL7A 1OTXA 3QIVA 4DDKA 2ONYA 1QV9A 4X6YA 3I9FA 4K8OA 1ZIOA 3E4CA 2DKOA 1VKOA 3FFTA 2ZBFA 3HCFA 3Q87B 3IMFA 3L0BA 1QE0A 3NJ8A 5DHFA 5A71A 4F3NA 5HYVA 2QTTA 3DV2A 1SG9A 1NG1A 3JRXA 4NEQA 4XM2A 2VQFB 1H2AS 1HE2A 2QR3A 2AN4A 2QPOA 1Z0AA 5DP1A 1UANA 4Y7DA 3T38A 1T29A 1BRMA 1HQCA 5A6SA 2O8CB 3RSFA 4UBMA 3S1AA 2Q21A 1CERA 1CVIA 2A33A 2A6PA 3UW1A 1BA2A 1UT5A 2ECFA 1O6FA 3BMNB 4RWEA 4JR0A 3I1YA 1KSJA 1NW7A 1R4NB 1RJWA 2GO1A 3HXPA 4YGYA 1FP4A 1MVLA 5LLDA 4EAAA 1R5NA 1B23P 3V7WA 1JDVA 2JKZA 4GE0A 2ZJ4A 5TGTA 4EA9A 5CDHA 5BR7A 5IF9A 2JD1A 2ZJZA 1BHJA 4M9CA 1UZAA 5TQJA 2HIHA 4FDUA 3HBLA 1ZI8A 2B8TA 4Q12A 4YRFA 1W88A 5KBYA 3TNJA 1H2ZA 4NJEB 4ZAFA 1LK0A 3AHEA 1PHPA 3BJZA 3G82C 3I23A 4FFVA 4MKHA 4UXIA 4ZOBA 5D3MB 5E1MA 5I4KA 3HJFA 4AI6A 4E08A 2NU6A 2NZVG 4EKYA 3I53A 5AO9A 2YMQA 5EAIA 2O8FA 1UKEA 1RXEA 5A7GA 1B42A 4W5QA 2VBIA 3MWLA 2H9IA 3IVMA 4HJRA 1FW8A 5EESA 2XHZA 1F7VA 3V1MA 1U81A 1IG0A 2P9FA 2VYFA 4W8HA 4P36A 4UZEA 4M9ZA 2VJMB 2Y1LA 2AQHA 3D31A 4MX8A 1PUIA 5IH3A 2CCJA 5L3RA 3G9QA 3K0EA 1UP7A 2QUAA 3WHKA 4LPKA 3N0XA 4DLPA 4CM8A 1K3FA 3FDFA 3U5ZB 1IWPB 2HQOA 1YBFA 1MT3A 3E3LA 4MRMA 1KH3A 1U8UA 1DKNA 1JR4A 3O73A 3WZLA 1KI7A 2QF7A 3ULKA 2FFBA 3NHUA 1TVKB 4LKOA 4Y2XA 5BSRA 4ED9A 3RLIA 5K0BA 5ILOA 2HRCA 1VJ0A 3FF4A 3IT0A 4RX1A 4RK4A 3ZKWA 3MHPA 4FXPA 3AU8A 3EASA 4C6HA 4EAQA 4EYOA 1PZNA 3EVDA 3RVNA 3VNVA 2BFCB 1P18A 2J3LA 4EENA 2WWHA 1XMJA 4FR0A 3TQSA 4CV2A 3DPIA 2EX4A 5ABPA 4M1SA 4QOEA 4RLFA 3BD9A 2B2NA 3JU3A 2IF2A 1M67A 4MPPA 1BN7A 3DV0B 4J4HA 1O95D 2WFAA 1DAGA 2YXLA 2C2GA 2H9YA 3ZW9A 5JC8A 1L5SA 4RK7A 1DE0A 4CLEA 3D8TA 5LZ8A 3QF4A 4G89A 1JYSA 1PO7A 4DMLA 2NUPB 4R84A 5C80A 5AVUA 4E88A 3AGQA 3FAZA 4PHHA 3RYIB 4ZK2A 2YNMA 4JVMA 2YMLA 3FWZA 2ACEA 4H7PA 4C2AA 5K8JB 1Z0JA 1JJ7A 1T13A 4U2GA 1OX4B 2WICA 1I0LA 1ZU4A 3UCFA 4F85A 4F9EA 1K7CA 1WKBA 3FYUA 3SSOA 2PZKA 4RPCA 4H3VA 4X3OA 5JZ9A 4PPYA 1V2GA 1PGNA 4IH1A 2AG5A 2AOUA 4W5WA 1EXDA 1U80A 4GMXA 4FR2A 1L8XA 1G4HA 4Z9BA 2A35A 1VSQA 2C77A 4G0YA 4YACA 1KMHB 1TEHA 1YJXA 4F45A 4WACA 1E0KA 3TZCA 5CB4A 3ECCA 1J23A 2PV0A 1BAPA 2XYRA 4G4SO 2AFIB 4KE7A 1EWRA 5G0VA 4S1VA 4JUCA 3N9IA 3NUZA 2AJ8A 4WV3A 4DW8A 3UHFA 4E09A 2YWDA 1Z34A 4J0QA 2ZT6A 1SHJA 2NYVA 4RTQA 3WWCA 5CDTA 1FNMA 1L5KA 3LZCA 2I2BA 3UT6A 3VYRB 5HW0A 3WYFA 1XF9A 1H2RS 2LZ0A 1ZN2A 3PKIA 4LRQA 2CWDA 3T9BA 5BWBA 1Y8CA 2BFEB 4M6WB 1SZPA 1DFIA 2TECE 3P8ZA 3GLUA 2B1JA 2A0WA 2VWPA 1OJLA 4NNJA 4W9NC 4FFNA 3F5SA 1KZHA 3JQ9C 2R97A 4RJLA 3QELA 2KQUA 4O1HA 4AT1A 5BSHA 1MD9A 2HFKA 1LQ2A 4XW2A 1C9DB 3FWKA 3M5WA 4MOWA 4WOPA 4EABA 3N86A 2BELA 3AG6A 3GYBA 5SYMA 3TVDA 3ACBA 4CT0A 2LV8A 4DJTA 2PCJA 2HSWA 1S0UA 4UZFA 4Y1RA 3DMYA 3FVTA 4RPIA 4FMBB 1J5XA 1V45E 3K70D 4HGOA 4ZI5A 2MINA 1GQSA 3MMZA 3QLVA 3WJ2A 1SBZA 3K20A 4DCTA 5FEUA 5JECA 2Y0PA 2AH5A 2HWUA 3KQHA 3E35A 3OOWA 3L4JA 5C53B 2HSZA 5FI0B 4HRYA 4EY3A 3CNEA 3HYCA 1RDFA 1V3VA 3ND6A 1A50B 5DBGA 1RKXA 1DQRA 2FEKA 2F64A 3F90A 1EVJA 4YCJA 1QHHB 2GYYA 3SJAA 3I34X 1HX7A 4B8WA 3TQCA 4KACA 5CXUA 1SXJC 2HHAA 1JBKA 4CHTA 3P9CA 4UM7A 9ATCA 3F5MA 3QYFA 1TYAE 2OHVA 2ZVPX 4UBIA 3GJYA 1E9FA 2QN8A 3F3YA 4A7PA 3PC4A 3FTQA 1G21B 4AL4A 1T26A 3I2KA 4LTDA 1P0IA 3RT9A 3RBZA 4HQLA 4DNXA 3TTUA 1NUUA 1QNFA 1P7PA 1K8ZB 3WMRA 3X43A 3ZCXA 4CT5A 5BT8A 5KYGA 1L5QA 2DYKA 4WN3A 3FCXA 5LC1A 3VMMA 3M5CA 3FI9A 2QRVA 5HRAA 3EYAA 5ARBA 1G3UA 4ESEA 5JNVA 3JQ8B 1YTLA 4RZHA 3VH2A 4QDTA 1PR3A 5GJVC 4RAOA 4WKCA 2IHZA 2IYFA 3LY9A 2QVZX 4OSPA 4QFMA 1W2WB 2GJAA 2IY7A 3MERA 2ZRQA 1ZD8A 4J7UA 4PFKA 2V8BA 1IJEA 2G82A 3L0SA 3MGGA 4JROA 3VPBA 4ARUA 3FB4A 1XKXA 1WX1A 3BULA 4RVCA 3QYAA 2L2QA 2H2HA 2O3SA 4AY5A 4C4OA 5JCOC 1K98A 1SU6A 1BD3A 1QE3A 4JJ4A 3X1KA 2OZEA 3D02A 3AEXA 5K8LA 2OVFA 2VA8A 4BMVA 3F46A 1DU4A 3EXFB 4XDGA 5F7ZA 2BZGA 2AG1A 5BQFA 4ARBA 1QWOA 3QLJA 2PVSA 4PSUA 2IWHA 3RK0A 4E3WA 1W36C 2UUBB 1KMIY 2CFIA 4Q9NA 3ZN2A 3HEBA 1ZGBA 2AWOA 2RHBA 4QHYA 3SM3A 4DT1A 5EJMA 2H2IA 1IDN1 1P72A 4EG7A 1ZGGA 4FD3A 1PR6A 4YR7A 4QUGA 4UUMA 1E4YA 4Q3EA 2GB4A 5KJCA 5KOYA 5FBZA 1J70A 2QS9A 1E5VA 3HUTA 2PK3A 4G8DA 3DZBA 4WESA 4XWAA 2P4EA 3AVTA 2Q28A 1O08A 2FPPB 2OEPA 3HVIA 5TVKA 4YUYA 4H17A 3FMGA 4Y1FA 2NACA 3WBJA 4I4LA 3ZHZA 4X93A 3AL0C 3IKVA 2PE5A 4UKDA 2GHRA 5BNTA 5ARDA 3HU3A 3QHAA 4E2ZA 5KWJA 5MN6A 1K8RA 2HT6A 4JOQA 2N75A 1P7YA 2FDCA 3D7NA 3IA7A 2QYOA 4F2GA 1F60A 5LP6A 3RRBA 2JIOA 1PTKA 3N6XA 2ROQA 3UHOA 5ALPA 1CUGA 2Q3MA 2APJA 2X2PA 2YRFA 2IH4A 1C9YA 3VAAA 1P75A 4CIYA 3T1HB 2AJTA 1IOVA 3HKCB 4DB4A 3T1YB 4M7RA 1XZ8A 2Y8EA 2JB9A 4ZQFA 4M0DA 5K3FB 4EY8A 3SVLA 4PZZA 1OFVA 4F8YA 2OAGA 4YY3B 3ED5A 3JVDA 4F1KA 2YNMD 2IH2A 7REQA 4N3CA 3ZE1B 1N0UA 4HRVA 3MPUA 5CMLA 1E4EA 5EJGA 2IX9A 2ZJBA 2GARA 4RZIA 4EGQA 4N9WA 5IABA 1Y5RA 4MW2A 1BJKA 2J5RA 3D59A 2UVPA 4XUEA 3FPLA 4AROA 2QL6A 1AE1A 5TX7A 3RK4A 2HREA 4B7AA 4GQBA 4IDFA 3WL6A 3RCBA 4YYZA 3U19A 1Q21A 4YI5A 3V4OA 1K4YA 2IU6A 1E92A 2H48A 3QW4B 1RRMA 1U2SA 1GSAA 2AX3A 3M6WA 4YRQA 7AT1A 5D3ZA 4WZAA 5KNBA 1T9GS 4CEIA 1N6RA 1ZLYA 4D8VA 1OUMA 5ES3A 3JD3A 3OPNA 4RZUA 4FR5A 5DOVA 2CV1A 2OL4A 3OOHA 1FOEB 1UJCA 1RXVA 3GFQA 4UVHA 4N03A 1LLCA 5A4KA 2B0CA 2VXBA 4DQLA 1E62A 4LQ4A 2QRJA 2B2XA 3AUAA 3FB1A 5EE3A 4PE5B 3PXGA 3W78A 1A76A 3H05A 4NVRA 1IHYA 1RWMA 1YRHA 1TQ2A 1VCHA 1NVMB 2HV9A 2OP1A 1AOXA 3FVWA 5J47A 3LQRA 1YUMA 3HU1A 4HSGA 5CLQA 2J33A 4DGQA 5EJ9A 3P9NA 5IMSA 2H1HA 3G89A 1XDBA 4L2IB 4UNNA 1N0HA 1UFVA 3VR6D 5BPFA 5JNRA 2BGMA 2IITA 2P8SA 3BGOS 5I7EA 4UOEA 2GF2A 2BDUA 4Q9AA 5LU9A 3NRJA 2JARA 2B9EA 3OHSX 1KKMA 4TXHA 3VDNB 3VPDA 2F8MA 4F1JA 5CM8B 1BOOA 2Y6VA 1JAYA 2YV3A 5KSZA 2WD7A 2YTZA 2XBMA 1LK5A 4JK3A 2XQGA 5CVJA 5EMJA 4YB8A 5BPHA 1XNJA 4LJ5A 5CAEA 5IKEA 4XJSA 4LZJA 3UPDA 3L1JA 4C7OA 1DBRA 4PXYA 1WHTA 3E0QA 4AKSA 3CEHA 4NG5A 1H1DA 2XW6A 3EQ7A 3FNHA 1COZA 4D5EA 2W2PA 1MUUA 4XGIA 3TMAA 1F2UB 4DMMA 2DTDA 3FETA 1Z74A 2YIJA 3PR1A 4PQGA 4YTEA 1C4KA 4OA8A 5DASA 4AJJA 4YQFA 4AMVA 5KYWB 4JYAB 4L95C 5D6OA 4EG3A 3KWMA 2YV1A 3TLAA 2G5CA 1NLUA 2NT3A 3DQZA 2DZDA 4FFLA 3WLFA 4B7XA 4A8TA 1OLXA 1LY1A 5DI3B 5CITA 3PX3A 2AB0A 4YJFA 3LTNC 4GNKA 4RMIA 4A73A 3D3KA 1E9VA 4K3UA 1KQ3A 2RI1A 3GT7A 1FFGA 4JBGA 5KDLA 2YOFA 2O0KA 2J3QA 2OSBA 3ESCA 1K8YB 1QIHA 2FDRA 1EX6A 3TLGA 1P6XA 4O4LF 3NDRA 4WXEA 3K72B 3OCJA 2B4AA 4Q9DA 1QX4A 3K8QA 3OJCA 3WVNA 4TKVB 4PV7A 1WNFA 1DAPA 3R4CA 1TGVA 1KZ7B 1V4NA 2IZ6A 1SVKA 3L1VA 1BMQA 1T3LA 3PX2A 3WLRA 1L6IA 2OBXA 4JZKA 2QMHA 1U2ZA 3B3FA 4NL4H 4EELA 3DKRA 4TQAA 2PWBA 2X8WA 1CLEA 2BFAA 2NNLD 2J6CA 4R8LA 2D1SA 3V9PA 5CLLA 1JQJC 4NU5A 5EHQA 2A0YA 1MOZA 2A4MA 4ZZ2A 4DEVA 4MAAA 5ALVA 4RE6A 5BWMA 3DBHA 4AIIA 1I2AA 2V7UA 3C48A 1Z15A 3E9MA 4MKGA 2XQIA 1NF2A 4JXJA 4FTWA 4MS1A 1KJ8A 4LMAA 1O58A 4G63A 1QSGA 1X7DA 4GXNA 1RQRA 3QWBA 2CN1A 4JR2A 3PQDA 5DCUA 5DB4A 4B6JA 4N5DA 2AXEA 1JW9B 3RROA 5JXGA 2P2CA 3KQOA 3IAUA 3L7YA 5E9AA 4FGSA 4EA6A 5AICA 1AG9A 3O8QB 3RYCA 2NO1A 2BISA 2A3NA 1H0KA 3PQ7A 3Q8WA 2RARA 1ZQ1A 1FTQA 3FUWA 3TE7A 2ILTA 5FOUA 4F9TA 3N7UA 1B6RA 3ZZTA 3CH4B 2Y0DA 3H2ZA 1YI0A 2R5NA 1DAFA 2X8BA 1ONBA 1GL9B 1R0WA 2XUIA 5CFPA 1DFHA 1VI5A 1KRHA 3ZIAD 2Q8QA 4NZ9A 5AIAA 2NO9A 2EFYA 5EE5B 3FHTA 4DVJA 5I7RA 5B7NA 1B93A 2DF8A 2RGNC 4A8JC 4E94A 1FCJA 3VNQA 4ABTA 1XIVA 4B73A 1II8A 4KWHA 4M9UA 4PX9A 3AP1A 3TUJC 2Z58A 2C82A 5DXAA 3OD5A 1KDVA 3O0DA 3QBDA 2BKXA 4XCQA 3SR0A 2WWRA 5ECWA 1GCIA 1M0EA 3I2JA 3OIUA 4QT0A 1EGAA 4CQNA 3HP7A 3WZ2A 4BWFB 3I05A 2CDBA 3JQDA 4NAVA 1P2FA 3UAGA 1R16A 1O5TA 1QH8A 2JD0A 4TYQA 3A3PA 1T3HA 1JVNA 5AOBA 1CZHA 1L7RA 3DE1X 3O92A 5ECDA 4BNGA 4EK9A 2RHLA 2KSQA 5EFZA 1JQKA 1KFKB 1U2TA 2IYPA 4UUQA 3S29A 4AJHA 3OQBA 3BD6A 2CDCA 2NT4A 2HHJA 3CG0A 2WI8A 1Q50A 4Y0AA 3V97A 4QLBA 1M2JA 3REQB 1ST2A 1XA3A 4QQKA 4AP6A 4FIZA 3P2YA 5CB0A 1T6BY 4ZZIA 4IIVA 3I5XA 4P1ZA 4MHTA 1T6ZA 2I2XB 2QR2A 3AFOA 3TEMA 2C1XA 1G3MA 3GFSA 4TRJA 5CHYA 4E5DA 3NBMA 2VJYA 4PRYA 1GEEA 1E6KA 3C74A 2IZZA 1MZVA 2P1RA 4BRSA 3EGWA 1I4DD 3Q7IA 1NBWB 4N5MA 5F73A 5CT5A 3VDXA 3SF8B 1NF9A 1AMOA 1J24A 1XLWA 5IJWA 1KY3A 3SJBA 1JQAA 1QKKA 1RCUA 1YJCA 1TA9A 3TF5A 1SIBE 2RKWA 5KNBD 4N82A 5I9LA 1JDBC 3N6VA 2P67A 2WKPA 3V3TA 1I01A 3I2IA 3UK7A 3NAZA 1D6MA 2Q9CA 4D8YA 4CWAA 2CLDX 1KOJA 2O3UA 3SVTA 2AUTA 1HV8A 4J6FA 1ZJZA 2IOYA 3C6QA 4IIHA 3BXFA 1MJ5A 3QXXA 1E1NA 2NLOA 3L79A 4LDRA 4OHMA 4TL9A 5CFNA 3R6TA 4CCWA 3SSNA 1K3UB 4LJLA 1R9JA 3OJOA 3UMRA 5BR4A 5C18A 2Z3VA 2IIPA 3O4VA 4K28A 1N1DA 1I51A 2CMKA 1VMIA 1EPUA 1XG5A 4RCZA 1L7VC 3DMTA 2BGNA 4ZO4A 5DX8A 4GQIA 3AV0B 2C31A 5D01A 4O8CA 2WLTA 4BVFA 3O38A 3DTVD 3S40A 2F9FA 1NSFA 1R74A 2DKNA 3ZD6A 5CU7A 2RH9B 5IM5A 5JMWA 1EGMB 4MYDA 1I8TA 1X14A 5SY9A 2OQVA 3HFGA 1G60A 2Y77A 3GJ4A 4IGEA 3V8VA 4GT1A 5K1ZA 1KXJA 2FMIA 4DIFA 3C8UA 3BFKA 3GDFA 1OR8A 1Z9BA 4YRNA 3MWYW 2AQ8A 3LXRA 4KGVA 4YQZA 3R76A 4UTZA 1X8JA 1GGJA 1X7YB 2Z9DA 7ADHA 3S28A 1YONA 4AZ3B 1SC4A 4XVCA 1CYDA 3EC7A 3I8OA 5HTOA 1R5OA 1CF4A 1PK9A 5ALFA 2O52A 5EHXA 3SWWA 1H05A 2VJAA 5A3RA 4A0QA 4CYMA 2FW7A 3SQMA 5BR1A 1Y6JA 1M6VB 4NOLA 3QOFA 1BXKA 3UANA 2Q46A 4NDNE 4YREA 3WK7A 1WKVA 3MGBA 1HZJA 3R7FA 4ZQCB 3T5MA 4EYEA 4ER6A 2FSVA 3WTCA 1ZM7A 2C9DA 4KN9S 1CR2A 2H4JA 3JQ7B 2DU8A 5JDCC 4EB6A 2HLNA 1DJPA 4RVHA 1IRIA 4WK6A 1VE3A 1MF7A 2JAHA 5JBIA 3A6LA 3QI7A 4WLFA 1Q44A 4CG1A 4DV6B 1H0RA 1RTTA 2C92A 3ANYB 3D7SA 4UDOA 2NV6A 1ZRNA 2ZITA 3KB2A 1LSOA 2YY6A 3ZGLA 2AG0A 1VA4A 2VNJA 3UGTA 4RD6A 1DC3A 4W6ZA 4BP9A 3SZ3A 1K92A 1JBEA 3CPHA 3R6WA 1Z45A 5KKAA 4BFLA 1B73A 3U0BA 4DQ0A 4U7GA 2G1KA 621PA 1E8NA 2J3KA 1JHAA 3K1JA 4QIHA 3CB4A 1X38A 3TBKA 4BRUA 5K0TA 2BZ0A 4JU8A 4BFXA 3WIEA 4C4PA 3PHBE 2C7GA 4BMNA 1PEAA 2IOFK 3AHHA 3V7UA 2J0UA 1HH4A 3C3MA 1F3LA 2W2KA 4NYIR 1SC6A 3RYHA 4BNTA 5KYYA 3TGWA 4WOBA 4JLAA 3UOAB 3GC6A 1CJSA 2FSFA 3CSSA 4JLNA 5CGZA 5DWQA 1LTHR 4K46A 5JHGB 4LC9A 5CK4A 1Q77A 2W2OA 2ZJ0A 4L22A 1RU3A 3HVKA 5AKZA 3C6MA 1AKNA 1I1OA 1MNQA 3QEOA 1QVAA 3O8OB 1BHSA 2YC4C 5DOZA 1TM1E 3Q98A 3I8SA 3JYHA 3MGAA 4M46A 1DX9A 3EODA 4XQEA 3TYXA 5BYAA 3MWEA 1OZFA 4HD8A 2Y4NA 2QL9A 3DJYA 4JJGA 5IZCA 2BGUA 4L07A 4IIUA 1GGFA 3SHFA 4B6QA 1XZBA 4L4SA 4LW8A 4RTOA 1DKRA 2O23A 5H0IA 2FWRA 1TZMA 1FX0A 4YP1A 4TYMA 1QC5A 2DJIA 2IEGA 3L7BA 4H15A 5FFFA 4HEQA 4HK4A 1ZOSA 1X74A 4I1YA 1VJTA 4ND3A 3M9LA 2RKOA 2PZGA 4UUBA 4CUJA 1USUA 1UC5B 2JFYA 3D7KA 2JLRA 5EJAA 2O1WA 2IYUA 3SJCA 1JSZA 1PVVA 2BJWA 3CU5A 5FFNA 4RS4A 3PNVA 3L0CA 5FTWA 3QI2A 3T3EA 3UYKA 4IQGA 4BNUA 1PR4A 5F5XA 5CBPB 4DGSA 4U7JA 3P26A 5CDYA 4B3XA 4DSTA 2X3FA 3Q88A 2W7TA 3B3AA 3HJGA 4HUTA 1CVRA 1P2VA 1E7MA 3AKDA 5FWYB 4CR8A 2C2WA 4XGKA 1HDYA 1PS9A 2I0FA 3H9UA 2JRCA 5AVTA 4OHBA 1G6OA 1W0CA 3RLFA 3LW7A 5ANRB 4B6PA 1LK7A 2AEFA 3A1VA 3D4BA 3PUZA 3IEKA 2WHYA 3K1TA 4OFZA 1FQKA 1KMQA 3IODA 3PC8C 3ON5A 3EH2A 2GJKA 4R83A 1Q19A 2GD0A 2VNHA 4ZQGA 2QROA 2JG3A 2FAXA 5KNBH 3DE3X 5IBRA 4NV3A 4R1QA 5KTRA 4TV9F 3WDLA 1BWRA 1LTKA 1VIMA 2CMDA 5GV7A 3IAFA 4HF7A 3IQGX 5EP3A 1GTMA 1P1JA 2JBAA 1XK7A 2GBLC 2PJRA 3DEIA 2XVXA 2J0EA 4QU9A 1KE2A 3DEJA 4NENB 1U65A 3HU2A 2B4QA 3MWFA 4LNAA 4OKSA 4ZKDA 3Q2IA 4BGDA 3THXB 1N6IA 5DM70 1AN9A 3EIOA 3KXKA 1PWEA 2E49A 3T5BA 1VMDA 3FUXA 2O0JA 4QYXA 3AO0B 4FW9A 4O2RA 4HDMB 5ETJA 1TDJA 2ZI6A 3A4IA 3WAGA 1X7GA 5L7YA 3JARA 1YIAA 3EVFA 1B74A 3EGDB 3GRYA 2IEDA 4ZP1A 4D43A 3RAEC 2WUVA 4AG3A 1EGQA 1HO3A 5HKLA 5BYKA 1MIOB 3DTTA 4Z5XA 3BGIA 2CLMB 4JUBA 4JHLA 1KI6B 4OXIA 5DTRA 5I9NA 4GWKA 1WOMA 3RUAA 1CDZA 2QI9F 2BP7B 4MPDA 2DXIA 2OXFA 4YMLA 3PTZA 4H7IA 1TVMA 3JAWA 1RSZA 2WSLA 4KBYA 4NBKA 4J4TA 2YDYA 5AVSA 3G88A 3MK31 3QIAA 3T7AA 2ZAIA 2QKYA 1DC6A 2XUDA 3CISA 1CUXA 4X60A 5GONF 1P3Y1 1P2BA 5ENZA 4EJSA 3L8FA 3B1YA 3H2KA 4HNHA 1XEWX 1Y8RB 3PHCA 3FTCA 2RK3A 3PCRB 2HLDA 3PNPA 3PRJA 3F6RA 2J31A 4P3PA 2SNIE 1H6DA 2J3JA 5CRIA 3PPXA 2P7IA 4U2FA 1M1UA 1OZHA 3QUBA 1IQUA 1QIDA 1R4ZA 1U3CA 3T7RA 2WU4A 2CEAA 3DOFA 4KQKA 2VBGA 1PJBA 3ICQB 3EIUA 4A6EA 1PW5A 4TTAA 1P62B 3P9PA 2IXFA 1MO5A 4EJMA 3VO8A 1E61A 3PDJA 4HB0A 1VI2A 2ZRKA 3CVXA 4XVQA 3B78A 1HUQA 2WUFA 4WSOA 4NYMR 2PMEA 1QR2A 1KGSA 3DVAB 4NH4A 2I6QA 1TQ4A 4ZOLA 1H8HD 4XASA 2ORYA 2PR2A 3M81A 3DO5A 1WUHS 4IP0A 5BQOA 4GI5A 1RIFA 2DR2A 1EBFA 3UK0A 1UPUA 5IXSA 3BWXA 2CL6X 5AI6A 5ALMA 4HY3A 1N2OA 3EPRA 2EJCA 4ZALA 2FR1A 3DBLA 4CEJB 4E32A 4FFMA 3U0VA 3UT5B 4CCSA 5I6DA 2WYHA 1P7ZA 2X8JA 2A1UB 3V8QA 2GN1A 1JS1X 4QPCA 1P6QA 3EW9A 3ZYZA 3BL8A 2W6ZA 2B61A 1I4LD 3X1ZA 3G2JA 3HV0A 2ZCUA 3OUZA 3MB8A 4GRDA 3KFVA 4P2BA 5ERGB 4Q66C 4C20A 3N2GB 1C7QA 3Q9LA 4UFNA 5JDIC 4DSAA 2OESA 2IYRA 3OZDA 4D3SA 2Z0MA 1AQ6A 3NGLA 3WSTA 4HNTA 2ZRPA 1UBEA 3U3OA 1ZIXA 3EOZA 4FFDA 4TSFD 4U2KA 2WTUA 2YH2A 3C3KA 4R0NA 2E1RA 2A84A 1C30A 2V7TA 2QMZA 1HEYA 1RZVA 2OAEA 3C6BA 2HB6A 3Q72A 2JZOA 1L5GB 4P4SA 4Q9KA 4Q9LA 3TIIA 4Y6OA 5ALSA 4R4JA 2IDJA 4H7DA 4KGXA 4CCYB 2WTBA 1NR1A 4XOIA 2VDMB 1BDHA 3DM9B 1PEDA 1KO4A 1KBQA 4OAOA 3JQCA 4CTNA 4M1OA 3QKRA 4GVPA 5T4HA 4Z6KA 1TM2A 3JQAB 4UQPA 3JZAA 5JI3E 2ZSDA 4QXRA 5DK4A 1ILWA 2ENUA 4CKWA 4XIYA 4I9NA 2PZAA 1XZAA 4LPSA 4AJKA 2C99A 2E5WA 2QYHA 1U0HC 1K7EB 4KGZA 1P9RA 4WX2B 5F1YA 1Z18A 1Z5PA 2KBFA 1FXWF 3JYQA 3LY8A 3R0IA 5TB5A 4LNHA 1GU1A 4W1PA 1T2DA 4MW5A 1HNWB 1E0SA 4LFCB 3F3SA 3W77A 5JS1A 2FF5A 3FPJA 4OQ4A 2EYUA 4IHJA 4LOHA 4R3NA 4RY2A 1W59A 3JWJA 4M49A 3I04A 2VF7A 4O2BF 1U11A 2VZLA 2OBYA 2WKRA 3AKYA 3V5NA 3K9HA 3U3KA 1XCGB 3WLOA 1EFHA 4LCJA 4R9NA 5E6RA 5HS6A 4LMPA 3MILA 3VVBA 2MSKA 1G8GA 4OMDA 1RLTA 1VDZA 1XSEA 4JVOA 4AMBA 3PG5A 1KPHA 1V11B 2X19A 2GF9A 1JPUA 3I83A 3B7PA 3B82A 3NOVA 4L76A 1M2OA 1EWKA 3A1EA 3MJEA 4PZCA 4RC9A 2IS4A 4CKCA 2E5FA 1WABA 1QWSA 4R7TA 3DE4X 3DBVO 3VZRA 4YUVA 2IBMA 3Q2OA 3KQLA 3EWSA 3NX4A 1RQPA 3BYZA 3C6ZA 3U48A 1KAMA 4DY6A 1T9KA 1YVEI 1U8TA 2C7BA 2FLVA 5KKCA 3ISJA 2G04A 2AC7A 4OHRA 4EX7A 4J7CA 1ZM9A 2ZU0C 2XT6A 3TN7A 1U0TA 3IKJA 4JH0A 5FOVA 2REOA 4YP9A 2YHUA 3AP3A 3PE4A 2FSSA 1CVLA 1B8PA 5K4HA 5E1DA 4E30A 4DQXA 2XMPA 1QQ7A 3BB3A 5JVDB 1QVZA 2FU5C 2V6JA 3PUXA 1D2HA 5F64A 4HQFA 4E7PA 2XDQB 1ZM3A 2NXNA 2BM8A 1AZLA 2PX6A 4HDKB 1P1KA 3EUEA 4LE2A 3ICVA 4OBEA 3KVRA 1JJVA 3TRKA 3TRFA 2QZSA 5DHTA 1WCV1 4X41A 4TYNA 3H5LA