5IZCC

Trypanosoma brucei ptr1 in complex with inhibitor f032
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
268
structure length
239
Chain Sequence
b'MEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
molecule tags Oxidoreductase
source organism Trypanosoma brucei brucei
publication title Exploiting the 2-Amino-1,3,4-thiadiazole Scaffold To Inhibit Trypanosoma brucei Pteridine Reductase in Support of Early-Stage Drug Discovery.
pubmed doi rcsb
total genus 89
structure length 239
sequence length 268
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2016-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5izcC00
1JKIA 3ZHXA 4IDCA 4OSPA 1IHXA 4NBUA 2DTEA 1O6ZA 4ND3A 1PJBA 3I6IA 1P1KA 1GD1O 2YJZA 1BMDA 5DULA 4E2XA 4J9VA 5F1KA 3SEFA 4DVJA 3UAGA 4PLTA 3D4OA 1DB3A 1UDBA 2I66A 2GSDA 3E8XA 4DLBA 4II3A 2YY7A 3RAJA 1DPGA 5A9SB 2ZKLA 5JDIC 1SPXA 4XR4A 2JL1A 2BLLA 4J2OA 1B8VA 2NWQA 1WWKA 4WEOA 3GPDG 3BMQB 2GRAA 1O94A 1V8BA 4P4GA 3S1LA 1C14A 3E1KA 3TSCA 1NQAO 3LC2O 3RUAA 2QRLA 1EUZA 3UF0A 2PGJA 1HEUA 2VYND 1GPJA 1M75A 1C0PA 3FI9A 3OJEA 4TZTA 4WNCA 3F4LA 4NDNE 5G0VA 3FD8A 1PL8A 4GLOA 1BHSA 4ZRNA 5IDXA 5KJCA 1MLDA 2D5AA 2TMGA 1LLUA 5LDHA 1YJ8A 1ADFA 1C0LA 4QUKA 2DT5A 4W6ZA 3ZWAA 1LUAA 4BO8A 4LN1A 2GERA 2Q1UA 5IFLA 1VKNA 3RUFA 4JROA 1KY4A 4CM9D 5DNAA 4K28A 2WDZA 3K30A 4M1QA 3ADPA 1H6AA 1B26A 4PLHA 4BMNA 5IDWA 3OJLA 3VAZA 4Z0TA 1K5HA 3DTYA 4RVHA 4KWHA 1E7SA 3CXRA 3L4BA 4IIVA 1HDGO 4ONEA 4E6PA 5G0SA 1XU9A 4JJGA 3K31A 3WQQA 1FMCA 1GQ2A 3UCXA 4BGEA 4D0SA 3WTBA 2VZ8A 1GYRA 1AE1A 3CTMA 1R4MB 3RBXA 3ZU3A 1ZJYA 1LRLA 4OXYA 4Z6KA 4WCDA 2FN7A 2YQ4A 5EMHA 3R6DA 3L6DA 4BKPA 5DCYA 2NQ8A 2VRCA 2OORA 2VRBA 4HFMA 4C4OA 5B12A 3WR5A 4NPCA 1PS9A 2VWHA 2PH5A 1OBFO 4I5FA 4OMUA 4TZKA 1HWYA 3GAFA 1YBAA 1M2WA 3GUYA 2WTBA 5JYEA 3FR7A 4XJSA 2I67A 5EERA 1R0KA 4B4OA 1VSUA 3ORFA 4XYEA 4A26A 1EE9A 1ZIDA 3KSDO 1QKIA 2JD1A 2Y05A 5FYDA 2X4GA 1KVTA 2F1KA 2CVOA 3FCOA 3KV3O 4QO8A 4CLRB 1GEGA 1HRDA 4XDZA 1I2CA 3EVNA 4YJGA 1NAIA 1HF3A 2PKQP 3F5QA 2AG8A 2X1HA 4KWIA 4XKJA 3N74A 4FN4A 1MG5A 2J6IA 4YJGB 1GZ3A 5BSFA 1E6EA 5ADHA 3IP3A 3M2PA 3UCEA 4EEZA 1YB5A 4RDHA 4DMMA 1UAGA 1U28A 3PVZA 3PEFA 1UH5A 3S2GA 2HMVA 1QORA 3ASUA 1HE2A 4Y8VA 1K0UA 1OOEA 4FGSA 3A06A 1U2GA 3NX4A 4NBVA 5FF9A 4FB5A 1TI7A 4YAJA 2C07A 5KOIA 2HMSA 2FRDA 1Q7GA 4G65A 1SCUA 3GMDA 4R5HA 3H9JA 3ZHYA 3GN1A 5HWSA 5ES3A 2BKAA 4IDEA 3GQVA 3GMSA 1O0SA 2UUOA 4FCCA 1PR3A 3X2FA 1ZO8A 1LLDA 1OMOA 1YO6A 3WG9A 3IKVA 1M6WA 3R0IA 3VH3A 3OFSA 1N7GA 1YONA 3VOSA 2ZYDA 1F17A 1PZGA 4B79A 4OAQA 2HMTA 1XELA 4OXNA 5TJHA 3WNQA 2BRUA 4N5MA 3OEWA 5ITVA 1HYGA 3RKRA 1ZJZA 1RM0A 2VUTA 3GGPA 4O63O 2EW8A 1XLTA 4LRSB 4JGBA 1E5QA 3VVBA 2AMFA 2WE8A 3C24A 3D0OA 4PRKA 3WLEA 3OQBA 1BXZA 3WMXA 1ENZA 3HSKA 2F00A 4TRMA 2PZMA 2GN4A 3PHLA 4XWYA 1ENPA 2V6BA 4D42A 5DOVA 3TZKA 4MKZA 4Q3AA 3EAGA 3TJRA 1YDEA 1D3AA 5K6AA 4AFNA 4YAGA 4PLCA 1AXEA 3ETEA 5CG2A 1JQBA 2DFDA 2EKLA 3GDGA 5G0WA 1ISIA 1NPDA 1SBYA 5JC8A 3WGTA 4UVIA 4I5EA 4MKXA 3L9WA 2CF5A 1U8XX 4DMLA 2PNFA 1GY8A 3QLJA 1T25A 3FTNA 2Q1SA 4S3MA 2FZWA 3D4NA 5DCWA 5EQFA 1GL3A 1N5DA 3BTSA 4CL8A 3JQBA 1YVEI 3UKOA 4CMAA 1A9YA 3T7CA 1XR3A 2Q99A 1NR1A 2GGSA 1T1RA 4YR9A 3OIDA 1MV8A 1J49A 5CEJA 1SOVA 1K6JA 3NDRA 3DMYA 4WLEA 3QVSA 3BTUA 1EDOA 4YQZA 5DCUA 4QFCA 3PZRA 1GQYA 4WJZA 3DMTA 1KY5A 5H83A 4E30A 1IPEA 4XRRA 1GADO 3JQFA 3DMTC 1T2FA 8LDHA 3JQDA 1GV0A 3EK2A 4XYBA 2IZ0A 1Z7EA 4WPGA 3L6OO 4BNUA 5FEUA 3DBRA 4D45A 1ENYA 1T1SA 3ZU5A 5DT9A 3ITKA 5JMPA 3GT0A 4WCFB 5JAIA 4DIFA 1N8KA 4BO2A 2AE2A 4I5GA 2CDAA 2O3RA 1IZ0A 5BNTA 2W2KB 4NJMA 4D3FA 1CJCA 1KVUA 1KBZA 3OQ6A 3Q9UA 4IS3A 4WLUA 3DOJA 4RVDA 3H7AA 2ZJ1A 1WDLA 3MJEA 2GN6A 2VYVA 3TN7A 3K8ZA 3IAHA 1CF2O 2GPTA 3JSAA 3Q0EA 4D44A 5A02A 2NTVA 1EBFA 1HSZA 2XXJA 4RF2A 2JFHA 3DZFA 4GVXA 4DQUA 2D59A 1ZSYA 1BXKA 1OC4A 2VHVA 3MTGA 5G0TA 2NUAA 1JVBA 3GZNB 1KIFA 5KTKA 3HUDA 1BTOA 3B1FA 3U62A 3PHHA 1PU2A 4J7XA 5AOVA 1EVYA 1KS9A 2O50A 1E1MA 1C1DA 1ZXBA 3U49A 2VUSA 3F47A 1E3WA 1F06A 4RLHA 1L7EA 1DOHA 3M1LA 1WLYA 4JNKA 3DAFA 5MDHA 3EZLA 1YQXA 1UJMA 3NKLA 4JXKA 4QXMA 5DP2A 4XGKA 8ADHA 4IM7A 3KYCB 4BB6A 4RPJA 5KWEA 3S55A 1LLCA 3EVTA 1Z82A 2PD6A 2NVWA 2QZZA 4IDBA 5JC1A 3WYCA 3WGGA 1PL6A 4YPOA 2Q2WA 2X5KO 5T67A 4HKTA 2X58A 4QQRA 4E5KA 4OIMA 1H9AA 3E48A 2WYWA 1PSDA 2VWPA 3R1IA 5T8KA 5KVQA 1E6UA 5AQ1A 3ONDA 4PFJA 2ZYAA 5T8KC 4AG3A 1N1EA 1ZXLA 4L0QA 3WWZA 3VZSA 4JBIA 2O3SA 1J6UA 4R1SA 3HADA 2GN8A 4IGFA 4XEHA 3ZV4A 4TROA 2C20A 1F8FA 1SMKA 3KSZO 5C7OO 4A10A 3HN2A 1YL6A 1JWAB 2JCYA 2B37A 1B8PA 4CV0A 5I7FA 3GEGA 4CL3A 4RF4A 3TZQA 4DGSA 3HQ4O 1R4NB 2AQIA 4CLXA 3W4KA 4DQVA 3L4BC 2EJVA 3OIFA 5J23A 3HZZA 3PHGA 4BO4A 3AUAA 4JBHA 4JX8A 3E9NA 3OJOA 3TNLA 3VTFA 3PRJA 1HLDA 4HFNA 4KUGA 2B0JA 1DHTA 2DBVO 2O3JA 1VM6A 3PQDA 2O2YA 3AU9A 1LNQA 5JE8A 1KEPA 1EVZA 1QLJA 2YQ5A 5ENDA 4D7AA 1GYPA 2G76A 4UVDA 3WXBA 4BNKA 4CUZA 4L76A 2Y99A 3D7LA 3Q2IA 4UUNA 4W7HA 2EW2A 5HBRA 2I65A 2QZ9A 3G17A 1LI4A 3ANNA 2DKNA 3SX2A 3QVWA 4R01A 2X23A 3EYWA 4J7CA 4IDDA 5A9SA 1PQWA 3DR3A 2NTNA 5KJFA 1N7HA 1CQIA 2A92A 3W6UA 3C7DB 4CMJA 2FZEA 4A2CA 4HUJA 1HZJA 1QMGA 4WLNA 4XQCA 1GR0A 3RASA 1BWSA 1UP4A 3PQEA 5A9TA 2FOIA 3IIEA 4TRRA 4J3FA 3WGIA 3F4BA 4GGPA 1LDGA 1X14A 1X7HA 2FSVA 1GQQA 4R4JA 2NU8A 1ONPA 3NJ4A 4RF3A 1WDKA 5JNLA 2VWQA 4E5MA 4F45A 3HFSA 4IDGA 2CNBA 1ONOA 3LSYA 4IUYA 3OM9A 5F5LA 2GCGA 4CM9A 2BMAA 2VTDA 3GOHA 3AY7A 5A4DA 2BH9A 4DL9A 4IDFA 1B14A 1SZJG 2X86A 3WICA 3N7UA 5EIOA 5JDIA 3NT4A 5IDYA 3U4DA 1UXGA 2D5CA 4J2HA 4J7UA 3PGXA 4NH4A 3EMKA 4I08A 1ISJA 3RUEA 4E5PA 1DEHA 4FD3A 3UXYA 3AUTA 2ZB7A 3A1NA 4BUCA 4HBGA 1N9GA 3GLQA 3JQ8B 1G0NA 4GQAA 2E49A 3WBFA 2G17A 3FPLA 3ICPA 4P4LA 5C7IO 4E13A 3ZWYA 3RSHA 2X9GA 3ZWPA 3ROKA 3EGOA 2B5VA 3KUXA 3PJFA 1U7TA 2NV6A 2IEDA 4M8SA 3KETA 3DZIA 4MVJD 4GX1A 5BNIA 2E48A 4J4HA 1W8DA 2PGLA 5ILOA 1K2WA 3I52A 2YV2A 4CLDA 4UUOA 4E4YA 4NBWA 3LZ6A 1QRRA 4GPD1 4O59O 3JQ9C 2YHUA 3EW7A 4NBTA 4H3VA 4KP7A 3V2UA 4LW8A 2HAEA 3VDRA 1VJ0A 5BSEA 3QV1A 3WGOA 4XYMA 3VZQA 3JYNA 1MP0A 4GKVA 3DBRB 1LDNA 4YJFB 2BELA 1WZIA 1KOLA 5HRUA 4IBOA 2EIHA 4EJMA 3VPFA 1PZFA 4KDEA 3WX0A 1KVQA 1V3UA 3GUCA 1Z73A 4CPDA 5DN9A 5TLSA 3LVFO 3AM4A 1LEHA 3VVCA 4MVJE 4FJ0A 1ZSVA 5FFFA 3JQEA 1RWBA 1HE3A 3I3OA 3LF2A 1A4UA 3H2SA 1HTBA 1NBOA 1MFZA 1DLJA 3L9XA 1Q7BA 1U7HA 3DOOA 5A3VA 1XA0A 3MZ0A 1ZMOA 3WYEA 1V35A 1YOVB 5DDIP 1QYDA 5TS3A 3WGHA 1FDTA 1CERA 4L4RA 4RVGA 2NVBA 3RVDA 4L4XA 1VKOA 2V6GA 1E1KA 3IQDB 1WMBA 5F3RA 3PP8A 3I9MA 2JCXA 4ALKA 3TF5A 2HKIA 3BIOA 4XZ3A 1DO8A 3QSGA 2E6UX 5BSGA 3GNSA 3KZVA 1UP6A 4PLYA 2P9EA 3A28A 5DF1A 4K26A 3BAZA 3OA0A 3OECA 3NRCA 4BO3A 1CQJA 1A71A 5TRTA 4RVFA 3PJEA 3G49A 4J1QA 1TA4A 1T2EA 2PKQO 2W90A 5CDSA 3ZU2A 4W4TA 3SLKA 4HNGA 1V3VA 3ZV3A 5A03A 4FFLA 1HYEA 2UDPA 2QW8A 2NM0A 3IC5A 4OKNA 3CEAA 4DIBA 1E5LA 3WWYA 4KTVE 1YKFA 1DC4A 4TVOA 4HWKA 1DDOA 3RJ5A 4II2A 2AA3A 1AXGA 1B8UA 2PD3A 3Q9NA 4J6FA 3WJAA 2X0RA 4TRNA 4NHEA 2AHRA 3DBLA 3PZBA 1V6AA 3WDSA 1A5ZA 1Y6JA 1DJQA 1C1XB 3FWNA 4BS9A 4DUPA 3RUHA 3I23A 3ZGYA 3ENKA 1DIHA 4QTZA 3A4VA 4YXFA 4P4NA 2FR0A 3WS7A 2P68A 3BTOA 1GCUA 1KYQA 3WGQA 5CHEA 3NDJA 5IAAA 1JU9A 2Q2QA 3HDJA 4NMHA 1LU9A 4FBGA 5ER6A 4D3SA 5IF3A 2BGMA 1C0IA 1ZW1A 4I1IA 4MO2A 2YV1A 5K0ZA 1RKXA 3H9EO 4U0JA 1PGNA 1DC6A 2DQ4A 5HTOA 4Q9NA 1ONNA 5CEEA 4WNIA 4ZQEA 1PJQA 2O3UA 2QYTA 3FNGA 3GFBA 5CP8A 1ISGA 3AOEC 4F6CA 1NFQA 5B37A 4CJXA 2FR1A 3DO5A 4YRAA 3WGYA 3ROMA 4O0LA 5JCJA 1XHLA 4BGVA 3L4SO 5L7TA 3KYDA 1GV1A 2GASA 1NP3A 1WPQA 2B4TO 1A27A 1HKUA 3RKUA 2W2LD 3U3XA 3WFJA 3IJRA 3QWHA 2SCUA 4NZ9A 1DAOA 4UREA 1CETA 3MOGA 2BFPA 4J1TA 5JPIA 2B4RO 1NFRA 3U4HA 4BNLA 4IZHA 5U4QA 4BNVA 3DQPA 4OYRA 4DQXA 1MXFA 2J3KA 3BHJA 1CDOA 4XJTA 1IOLA 4P8RA 4WLVA 4Z9YA 3ZWBA 4DPMA 5I7VA 3IKTA 3H8VA 3NTOA 2DVMA 5DP1A 3VKVA 1T26A 2O2SA 3ZNNA 4AJEA 4E2WA 4BOYA 4EGFA 2AQHA 3HNPA 4CMEA 3CZMA 4DPLA 2X5JO 4YRDA 2X0NA 2RAFA 4R1NA 5LC1A 3RIHA 3ZWNA 4U5QA 4NI5A 4OL9A 2HLPA 1ADGA 5ENVA 2HJSA 1E3IA 1PS0A 2D3TA 1ULSA 1AN9A 1O95A 1ML3A 3KB6A 3DDNA 2XOXA 2H5LA 3OICA 1G1AA 2CUKA 4CQLB 3MOIA 3OJ0A 4FFOA 3ETGA 1U5CA 1XYGA 4PVDA 3I5MA 1YS4A 4XD2A 4TVBA 3WGZA 2C82A 2FPGA 5IZ4A 4J16A 3U4CA 4E3ZA 1ZCJA 4KUHA 1BXGB 3PJGA 2Y68A 4WE3A 5BT9A 5BQFA 5L51A 2YW9A 3DAPA 5EINA 2I5PO 3KLMX 4QECA 4BO6A 3EUWA 1MX3A 1UDCA 2CY0A 1X7DA 2HQ1A 4O1MA 2C0CA 3BMOB 1UUFA 1EFKA 1ISFA 2WD7B 5IN4A 2VHZA 1QYWA 1Y8QB 4W9NA 3O9ZA 3E03A 3VC7A 2BFAA 3I6QA 1ZKMA 1FK8A 3FHLA 2ILTA 3CE6A 1J5PA 2YUTA 1UZNA 3RC9A 3U9LA 4G5HA 4LK3A 1OZAA 4HFJA 4IINA 5CDTA 4PLWA 1P0FA 2DLDA 2CVQA 2P91A 4N18A 3WTCA 1RPNA 3T4XA 3ITDA 2X0JA 2BFOA 4U8GA 2P4HX 3CMMA 3DTTA 1AHIA 1MXHA 4RLSA 1YB4A 1ORRA 3V5NA 4JJFA 4IQ0A 3G1UA 3PFFA 2HMUA 1P74A 3D64A 3V8BA 1U1IA 3AW9A 3OF2A 1I01A 4PG4A 1ENOA 3JQAB 1DAPA 3UCFA 4DBZA 3V1YA 1HDOA 4J9UE 2IYOA 3GR6A 4QSMA 4PGFA 2E82A 4CM8B 1I8TA 2R2GA 2FPIA 1NNUA 1R12A 3DB2A 4CMCA 4IGEA 4RQUA 1F0YA 1DRVA 1VPDA 3DBHB 5HS6A 3W6ZA 2CF6A 1BW9A 5BSHA 4YQYA 1HETA 3GVHA 3JQ7A 1X13A 5JAMA 5BNFA 4E32A 3GHHA 4BKOA 3H3JA 4JQCA 4R41A 3JQ7B 2HK7A 3VH1A 1EMDA 1YOVA 2J5KA 4EUFA 1UP7A 3D5QA 4XR9A 3DL2A 3OMLA 2DUWA 5U9CA 5T6BA 4CM4B 3RC7A 4HADA 1IE3A 1V9LA 3C1AA 1QG6A 3CIFA 3EY4A 3G1TA 2PK3A 2Q46A 1XDWA 4E21A 4LRTB 4AJ2A 4ZGWA 4GX2A 4K6FA 1IY8A 2DFVA 3INTA 2ZTMA 1ZK4A 1VSVA 3BMCA 3I4CA 3WIEA 3I4FA 4XB2A 3GAZA 2FR8A 2OXIA 2Q2VA 3F6YA 3JYOA 3QIVA 3UUWA 3NDIA 1UZLA 3WBBA 2NVUA 2PZKA 1Q7CA 4YAIA 1Q0LA 3GC6A 3V2HA 3TZCA 4HY3A 1AUPA 3JQ6A 2XAAA 2B83A 5CPFA 1DRWA 4K1LA 2O3TA 5F5NA 2Q1WA 4Y9DA 4GLLA 5CG1A 1B7GO 4YT4A 1VJTA 4K9DA 2HMWA 4AJHA 1QR6A 2HCTA 4IJWA 4AJOA 1QXSA 2PH3A 3C7CB 3I83A 1XQ6A 3QA9A 4DYDA 4YA6A 2GN9A 3D3EA 4XQGA 4Q3BA 3NJ8A 4EI2A 3ZV6A 2PA3A 3VTZA 1E7YA 4CMKA 3EHEA 3DZBA 4U7WA 3GGOA 4LSMA 1P77A 1YQDA 3L0DA 3MEQA 4LVUA 4ND2A 4CODB 1NX6A 4GX0A 5T57A 5AXDA 4INAA 4CR7A 4Z0PA 2EV9A 4YCAA 2O3QA 2GYYA 3C3XA 4J49A 4RPGA 4ZU3A 4RORA 3WQSB 4N5NA 4IQ8A 4R9SA 4G2NA 1F12A 4XGIA 1K6XA 3SLGA 4DC1A 2EP7A 5K9ZA 3QRWA 2NLOA 3AOGA 4MIEA 3UGKA 2VN8A 4FDAA 5TX7A 1PX0A 3AI3A 3AFNA 3HHPA 4ZD6A 3WSVA 2PV7A 1EBUA 2EHDA 3H9UA 1QV7A 3GPIA 3PDJA 3TZ6A 1O9BA 3JD3A 4GX5A 4A73A 3BA1A 4U6SA 4FFMA 3TOZA 2WD7A 4D79A 3DHEA 5I9MA 2BF7A 4PG6A 4TSKA 3FTPA 1DJNA 1CEQA 3E82A 3V2GA 4ZQFA 1VE9A 2OL4A 2VUUA 3HN7A 1B3RA 4IPTA 2YZ7A 3D1LA 4NNJA 3HDQA 3PQFA 4MVJI 3ZZNA 3IP1A 1PJLA 4B7CA 1EEHA 5CDYA 2C5AA 3K92A 4YAEA 1DC3A 1BVUA 3KYCA 2ZK7A 2DAPA 4B3HA 1XU7A 4Y6RA 1LTHR 5CAEA 3C1TA 3AM3A 4PRLA 4M49A 1YRLA 3KOUA 2VWGA 1JTVA 1UXKA 5GZ6A 3NTRA 4OXKA 1QSGA 2CD9A 4FS3A 4IXTA 3DFUA 2BI8A 4FOOA 1J0XO 4F3YA 4FJ1A 5KVVA 4FFPA 4TWRA 4MVJH 4PLFA 1DBVO 4PZEA 4FSHA 2H9IA 1CYDA 1PZEA 1XIVA 3KO8A 3MJCA 4ROSA 3VZPA 3AJRA 4TMFA 4BV9A 4C7JA 1C3VA 1PJTA 7ADHA 4LMRA 3O8QB 3H65A 2W98A 2X5OA 5EN4A 4RVUA 1NWHA 2Z95A 2YV3A 4WOJA 4EYEA 1UZMA 2RHCA 2O4UX 4FGWA 1I3LA 3K6JA 5EQDA 1ZEMA 4IMRA 4J0FA 1VI2A 3JQAD 3OQ1A 3DBVO 3WFIA 5F1PA 1JN0A 3ZI0A 1V0JA 2Y1GA 3D3WB 3PDUA 4ALIA 1XWFA 2ZQYA 4XRGA 1J4AA 2BGLA 2I3AA 4BQRA 1QYVA 5COBA 5FWNA 1YL7A 4CUKA 3W8EA 2HRZA 2R00C 3JV7A 2I99A 4AL4A 5ER9A 4AJIA 4QEDA 4ITUA 4PG8A 4DLAA 2R00A 1DIGA 4PLPA 4CM5A 3GN2A 5GMOA 1ZK2A 4UEJA 3IOYA 3VPHA 1YGYA 3AU8A 3RFXA 3RUDA 2WYUA 1BRMA 4BNXA 3DZHA 2YYYA 3Q2KA 3OEYA 4D43A 4CMIB 2GO1A 2ZTLA 5U1PA 3RROA 1B3BA 1Y8RB 4BKRA 3Q3CA 3UHAA 5JFOA 4E5YA 3JYLA 2VZ9A 4OM8A 2DU8A 4WCFA 1Y8RA 3WOHA 1YWGO 2C54A 5L7YA 3KVOA 3QW2A 2NTJA 4NQZA 1F14A 4IZIA 4FFNA 5T5QA 1LLQA 2RH8A 4B4UA 2EWMA 4BNTA 9LDBA 2NVUB 1LSOA 2W2KA 4NJMB 1P33A 3G79A 1Q1NA 1JKFA 2C7GA 1A7AA 1PZHA 3ZWXA 3RQSA 3BHMA 1U4OA 1NPTO 5JLAA 4Z9FA 1XEAA 4IJKA 4CM8A 1P1FA 1X0VA 2DBQA 4RDIA 4MIYA 1EUDA 4FPXA 2Q4EA 4LCJA 1U9JA 3GF4A 1DFGA 5KJ6A 1P45A 1NVTA 5KVSA 4EUHA 1WAMA 1BDBA 4TKLA 5MGBA 3B70A 5A06A 4AJPA 1RYDA 2VYVD 5IZCA 3E9QA 3L77A 3RFVA 4GKBA 1LDMA 4BKUA 3JYQA 1C1DB 1NVMB 2FWMX 5DBFA 5C7LO 5IZCC 2V7PA 2O4CA 1NXQA 3JQGA 4WLOA 4XYLA 1K6IA 1PWZA 3KYBA 1VRWA 3ZU4A 1IPFA 5CDUA 2JAPA 3W8FA 1P31A 1EVJA 2G82A 4EJ0A 1E77A 3JD2A 4B3JA 3LLSA 2Z1MA 3FRJA 4YWJA 5A9RA 4E12A 1EFLA 4N5LA 1VL8A 1NHWA 4QO7A 4R54A 2OFPA 4BO1A 1X7GA 4TQGA 3ZNOA 3KXDA 5AVOA 1LRKA 2EJWA 5C3MA 4LCEA 4MIOA 1T2AA 1FDVA 1KVRA 1H0KA 1PS8A 1I33A 5IG2A 4NG5A 1S6YA 3TL2A 5JYDA 4ZA2A 3NV9A 4CM6A 1PQPA 5EPOA 3ZDFA 3TFQA 3NT5A 2PR2A 2QG4A 2GDZA 1IZ9A 3ZHZA 1LRJA 3UH1A 1JKJA 1IYZA 1V3TA 3HG7A 1HT0A 5LDGA 3FNEA 3SC6A 3JQ9A 6ADHA 4HXYA 4Y67A 4A0SA 1JW9B 2JKVA 4R51A 2DPHA 1EDZA 4AICA 4IJVA 1LBEA 4S1VA 1WXDA 3D4PA 3FWZA 3ONFA 1NQOA 1GZ6A 2AQKA 2VHXA 1I2ZA 4BO0A 3OJFA 1I3NA 3QWAA 5JDCC 4CM1A 2VHWA 3AWDA 4GMGA 4OOEA 1T24A 3B20A 1H5QA 1BXGA 1DLIA 1GUYA 3MJSA 2IXBA 3NGXA 3SJ7A 3I9LA 5B4UA 3HB4X 1LX6A 3KHUA 4WOKA 2XXBA 3ZWVA 2IEBA 1HSOA 4FJ2A 3U09A 2VYNA 3IL2A 5KKCA 4R1UA 3GFGA 2EP5A 2OUIA 2RH4A 1DXYA 4E0BA 5EESA 3T7EA 4Z3KA 1R4MA 2W4QA 4ND1A 1YJQA 4NJOA 2X0IA 2NU7A 1M6HA 3D5TA 4BB5A 1KETA 3ZH2A 1U2DA 4FR5A 4OO3A 3RBVA 2PY6A 3LK7A 1P3DA 1BG6A 1ZNQO 1MG0A 2O7QA 1QYXA 5L45A 4MVJA 5ICSA 3MJTA 1YL5A 3A14A 1E3LA 4R3NA 5C5IA 4IJUA 2WWRA 3GZ4A 1SO8A 1LJ8A 1ZUD1 1TB4A 2A94A 2X8LA 3FPCA 4OQYA 4RPKA 4XCVA 5GZ3A 3QQPA 1I3KA 3ST7A 5IN5A 3OETA 5JAQA 4CV1A 4PLGA 3ZW8A 2BGKA 3H9QA 1TT7A 3LT0A 2P9CA 1FDUA 4BIIA 1Q0HA 3UFXA 2X7HA 3PI7A 4BQPA 4D46A 1KEVA 3F9IA 3VPGA 3ROPA 1DSSG 5G4KB 3S2IA 1OAAA 1SNYA 1MUUA 1WVGA 2C29D 3OP4A 4L73A 3JQFC 3MJVA 1X0XA 1PJ2A 2G1UA 4FW8A 4HFRA 1Z74A 4YACA 4BO9A 2RHRA 3DFZA 4HX5A 1I10A 2FMUA 3P5SA 2CDBA 5F1OA 1A4IA 4WK6A 3ULKA 5B4VA 4IY1A 1R0SA 1P1IA 3DBLB 1BVRA 4BHTA 1KEWA 3I9KA 1BDMA 4OOFA 2Q3EA 1E1NA 3AI2A 1HDRA 4KQWA 4JBGA 4RPLA 4CV2A 1W4ZA 4IQGA 3PIIA 1B16A 3TL3A 1ZH8A 4KTTE 2RCYA 2ZIZA 5TIIA 4EW6A 4YT2A 4BNJA 4CM3A 5IDQA 1KERA 2Y0DA 3PFWO 3DXFA 3PTZA 4M87A 1HDCA 2D1YA 2I3GA 4KMSA 3OBBA 4BL5A 4PN3A 3ONEA 4F46A 2UUPA 4A27A 4BNIA 2FPPA 4JN6B 4C7KA 4DC0A 5TF4A 5IJZA 1ADBA 1LSJA 2HO5A 3RD5A 1T2DA 5COAA 4B3IA 3BMQA 3RU7A 3H5AA 3QP9A 2OP1A 3X2EA 3H2ZA 3OIGA 2C7VA 3LYLA 3JQGB 5HA5A 2WEKA 1ZBQA 4DTIA 2NNLD 3NUGA 5G4KA 3LQFA 5I7EA 1O5IA 5THQA 3B1KA 1O89A 3PHJA 3FNHA 1E7QA 2R6JA 2YHIA 4B4WA 2YDXA 4BNNA 2FP4A 1U4SA 4B8ZA 4WGGA 2QIOA 1WP4A 3SBOA 1YE3A 1UXJA 2CZCA 2DM6A 3FF4A 4NR0A 2AW5A 4EDFA 1DRUA 3GNQA 5A04A 4XA8A 4J90A 2RBEA 1E6WA 3GH3A 1H94A 3INGA 5GZ1A 4J1NA 2B4QA 4M86A 4PLVA 3CKYA 3K9QO 4ALNA 3GDFA 1UXHA 4ZQBA 1H6DA 3WLFA 2HRBA 1DIAA 4CLOA 2IZZA 5KJ1A 2GR9A 3GG2A 1X15A 1R0LA 4M89A 1D7OA 1SAYA 1Y9EA 2ZJ0A 2Z5LA 5ITWA 4YJFA 2EGGA 3HJAA 4RO0A 4Q39A 3VKUA 4EUEA 1GEEA 2EXXA 5L4LA 3LF1A 4UVEA 3SJUA 1AHHA 2WE7A 1G6KA 2VZ0A 2LDXA 3BTVA 2FHSA 4PVCA 4Z0HO 4TRJA 4NIMA 2VT3A 1L1FA 3F1LA 4YAKA 5KIAA 5T64A 2JHGA 1H6CA 3HDYA 3F5SA 3DWFA 4ALLA 4GWGA 3VH4A 4Q3NA 1TVEA 3CMCO 2NSDA 3P19A 4MVJP 2H6EA 5A5FA 3GEMA 3LC1O 4O6VA 1KEUA 4R9RA 4GWKA 1E3SA 1I5RA 3TOXA 4YBZA 2QRJA 1NASA 4RVSA 4OH1A 4BV8A 1E3WB 5JAZA 5L7WA 1HDZA 3LLVA 1BGVA 4RF5A 5KNLA 4W99A 4AJLA 4E2ZA 2PLAA 3GVXA 3QE3A 5JY6A 1TLTA 4PIVA 3KEOA 1ID1A 1JA9A 1ZFNA 3BZUA 5FI5A 1U3VA 4Q3EA 3FR8A 3GZNA 3WJ7A 1PR9A 2QX7A 1NAHA 2J3IA 4MPDA 5IXSA 3W8DA 3AFMA 3JQCA 4WLFA 2WM3A 4UUPA 1IULA 1JAXA 1VLLA 1DC5A 3E5MA 5JXWA 2AQ8A 4YEDA 3JYPA 5I9NA 3IDSA 4Q3CA 3RC2A 5G4LA 4FQ8A 1OFGA 3G0OA 3T4EA 4WEQA 5AYVA 3LC7O 1LDBA 5KCZA 3O8QA 2IXAA 1LC3A 3F1KA 1PTJA 4EBFA 1NWCA 2QYSA 4Q3DA 5HM8A 1LA2A 3GK3A 4CLRA 1LSUA 1MC4A 4URFA 5TQVA 2NQTA 1XQ1A 3SXPA 2JD0A 4GGOA 4WECA 2G5CA 3DOCA 1T4DA 1DFIA 2IYPA 2NU6A 1HXHA 4B4VA 3D3WA 3AUUA 3U4IA 4BGUA 3MWDB 6LDHA 1SEVA 3IUPA 5CPBA 5KJEA 5KKAA 3RUCA 4JCOA 1YDWA 3COSA 1WDMA 3R3JA 3C8MA 1ADCA 2BD0A 3I9OA 4NU5A 3E6AA 3UVEA 4XIJA 3H5RA 1D4FA 1UR5A 1I0ZA 3JCZA 3R3SA 3WYBA 2Q50A 1U3WA 3LT1A 5ILGA 4AJNA 1B0AA 2DBRA 3MCVA 3QVOA 4XIYA 2VTEA 4Y98A 3ABIA 4L9RA 1N92A 3QVTA 4LSWA 4BO7A 4WASA 2VCYA 1VL6A 2Q4BA 1K89A 1ZEJA 1I30A 3RWBA 4BGIA 4DLLA 4DXHA 3M1AA 4L4SA 2C2YA 1H2HA 4A03A 1T2CA 3O4RA 4R68A 1D8AA 1MA0A 3RU9A 2HU2A 3TFOA 1NYTA 3VPXA 4FIZA 4MP8A 2IRWA 4DRYA 3E9MA 3Q6IA 1C1XA 1YH3A 1B2LA 5B1YA 2YFHA 3KEQA 5L40A 4NFSA 2W2LA 3C85A 2DTDA 3QVXA 3CUKA 3KTDA 4HP8A 1I32A 1H6BA 3STHA 3AK4A 4MDHA 1Z75A 1M66A 4H7PA 4R3WA 2C5EA 4RJTA 4J1SA 1A9ZA 5I8ZA 4CLOB 5JW6A 1N2SA 3RFTA 5I8WA 2GLXA 3ZWMA 1M76A 2D4AA 3ZNQA 1TXGA 1JVSA 5TT1A 4N54A 1MC5A 2P2SA 2VOEA 1P1JA 5CFZA 2UYYA 4UVGA 4KQXA 5F21A 1Y7TA 3GEDA 1LDYA 1WNTA 1JDJA 2TMDA 1ARZA 2W8ZA 1ZK1A 2OBYA 2Y66A 4ILKA 4CLHA 3JQ8A 2WJPA 1PWXA 3ENNA 3NAQA 5JBIA 2AE1A 1H93A 2A4KA 3GY0A 3TWOA 3I9JA 4ND4A 3UW3A 5L4SA 1GU7A 1GFSA 1NR7A 3EDMA 5A05A 5JO9A 2YHIB 1IHYA 3CINA 3DHYA 5GY7A 3VDQA 1YB1A 1LQTA 2EF1A 1UDAA 3NYWA 1LQUA 2ZB8A 2E37A 3PPIA 1RYEA 4J4TA 1KC1A 2PKRA 5TT0A 4CQLA 4UEOA 1PGQA 3I1JA 2EKPA 4QT0A 3K5PA 1SEPA 4ND5A 4MP3A 4I9HA 2JCVA 3KBOA 1D1SA 2FY8A 2H1SA 4J43A 4B7XA 1P1RA 3JD0A 4GL4A 3ADOA 2DPGA 1CIVA 1QV6A 4LVCA 4W82A 1Q2XA 5DBGA 3ZWCA 4JLWA 2Z1NA 4DPKA 4ZRMA 1LXCA 1NQTA 5HS4A 3K2EA 3PIDA 2WD8A 1TEHA 1E92A 5A3JA 3EZYA 1HDXA 2OBNA 2PTGA 3ANLA 3BHIA 3KRTA 4XDYA 3L07A 4J91A 4DYVA 1Y81A 2WYVA 4O5OA 1LC0A 1GPDG 1Z45A 1U3UA 2JHFA 4AJKA 2B35A 4IXWA 2ZQZA 5EJ2A 4BNZA 3O26A 2NADA 4XX0A 4MINA 4UVHA 5EL0A 3RJ9A 1QYCA 1IB6A 1WZEA 2YDYA 2V65A 2WSBA 1X1TA 4RV9A 4BNMA 3H6KA 4UUMA 4OKIA 5AXCA 4NBRA 2PZJA 3PLRA 2D8AA 2HUNA 1EQ2A 3RUIA 5H81A 1OI7A 4ALJA 4ZICA 1GUZA 3PYLA 2J3HA 3GG9A 2VRCD 1A72A 2X9VA 2Y93A 4ZQGA 4E2YA 2B5WA 3K2BA 2ZTUA 1I24A 3ZNPA 2X6TA 1XGKA 2QQ5A 3BMNA 4DBVO 5L3ZA 4Z9XA 4R5MA 3K73O 4QFDA 2IDZA 4I5DA 1R37A 2VHYA 4IIUA 3NEPX 4N7RA 5JDCA 4PCVA 4L75A 1R15A 3UOGA 4I8XA 3OH8A 3SVTA 1QP8A 1VC2A 2PGDA 3KSUA 1F8GA 4FC6A 4UAGA 3H3FA 4FFRA 1CWUA 4AVYA 5G2OA 4BNHA 1PEDA 1Y5MA 2YFQA 4NFHA 4QX6A 4BNFA 1Y9AA 4YTEA 1E1LA 2ZYGA 1Y5RA 2EERA 2OO5A 1PGPA 1NM5A 2I6TA 1DIRA 2D0IA 5L4NA 1O8CA 3OA2A 1P44A 1PJ4A 2J3JA 1N1GA 1MGOA 1B15A 4GSKA 2E4AA 4H16A 2JFFA 2HJRA 5ICMA 1ULUA 3GRKA 5TJ9A 4PG5A 2G0TA 1FF9A 4IMPA 2P9GA 2O48X 4DWVA 1IUKA 4KOAA 2ZCVA 3JQBC 2GUGA 2A9FA 2UAGA 3QJ5A 4LMPA 2PFGA 3QY9A 4RQTA 1WW8A 3B6ZA 4GSLA 4MVJM 1YXMA 4XYGA 1SB8A 3RBZA 2HK8A 2GZ1A 4BKQA 2UV8A 4MVJG 2ZCUA 4CV3A 3KLPX 5FI3A 5JS6A 2HDHA 3DZGA 3P2YA 4LISA 1R4NA 5L95A 4YT5A 4XQEA 4R69A 3ON5A 1AGNA 3B1JA 1ZK0A 2X22A 1C0KA 1UXIA 2DUUA 3BYZA 4NU6A 3WB9A 4CUJA 2B69A 1IL0A 3ICCA 4BVAA 2GZ2A 4GAEA 4ALMA 2O23A 1U5AA 4PZCA 4JK3A 4XQ9A 3IJPA 4YDRA 3KYDB 5H82A 4H15A 1PJSA 3GRPA 4CR6A 2B36A 4KUEA 4CM4A 3K96A 1W0CA 1SC6A 2PZLA 3PGJA 4NK5A 4I9UA 3FN4A 1DIBA 3GDOA 5A1TA 4E33A 3MWEB 2J8ZA 4A5OA 1JLLA 1NFFA 3PWZA 2EG9A 3QWIA 3FNFA 3FSRA 3O03A 3UICA 1T4BA 2J5QA 2UVDA 3U5TA 1PJ3A 3QWFA 4MP6A 5BR7A 4ZVVA 5C37A 3W4JA 4F6LA 4M54A 1YBVA 3PWKA 1Y8QA 2CSUA 1PGJA 4YJDA 5COQA 1Z6ZA 2QHXA 2O7SA 5I7SA 2HSDA 3HDHA 1KC3A 4W9NC 4U6QA 5AXBA 3DZJA 4CQMB 2XF8A 4MKRA 4NFYA 3DEYX 3DONA 1XSEA 1P0CA 1E3EA 4RCVA 4WKGA 2OGUA 1MFPA 1E3JA 4B7UA 4XGNA 3AI1A 4ZQHA 1PJCA 1ZMTA 3L6EA 5I9LA 4XB1A 3ZW9A 3S2FA 3V1UA 3W1VA 3TRIA 1GYQA 3VZRA 4CM7A 4CMHA 5A5EA 1ISMA 1NQ5A 1XKQA 4CQMD 2IODA 3PYXA 3AM5A 1P1HA 3JQAA 3O38A 3NT2A 4BMVA 4RPHA 2DC1A 1E7MA 2Y0EA 4UEKA 3AY3A 3H4VA 2Y1DA 4PZDA 3EC7A 4BNYA 3DC2A 4L74A 4EEXA 3INRA 3TDKA 2Q45A 1ISHA 1S7CA 1G0OA 2JD2A 3CZRA 3SC4A 2GNAA 5JCXA 3DAGA 1RJWA 3LDHA 1X1EA 1ZK3A 1OC2A 3NGLA 4GMFA 1N9GB 3TPCA 3ZHBA 1I2BA 2FSSA 3C1OA 1GZ4A 3GGGA 4MJLA 3G3EA 3H9GA 1JAYA 3HFGA 3BMOA 4BMSA 2V6MA 4CMGA 1L7DA 2AEMA 2JFGA 5JY1A 3A9WA 3HWRA 2AXQA 1DHRA 4UULA 1PL7A 3AUSA 1FDSA 4DA9A 4EJ6A 5IXYA 2VNAA 2OP0A 5G0UA 4CQMA 3BMNB 3WQRA 5TGDA 5K6AC 1GAEO 4ZHSA 3VPSA 3ETDA 3QWBA 3PK0A 3IUSA 4ESOA 3C7AA 4YT8A 2IZ1A 5AXAA 1GTMA 2GF2A 2Q49A 2PWZA 1NHGA 4GBJA 1UAYA 2J5RA 3H5NA 1HL3A 3GA0A 1ZSNA 2OZPA 2GZ3A 3P7MA 1ZZEA 3VHRA 3GNTA 3LT2A 3S8MA 1W6UA 4HV4A 4HNHA 4G81A 5CDGA 1JWBB 5TSDA 4R16A 3JD4A 1HLPA 2Y1FA 4RGBA 4I9NA 4CMEC 2P5YA 5DOZA 3Q1LA 4EZBA 1EUCA 1NPYA 3IS3A 1RM4A 1HYHA 3IMFA 4ZN6A 1YQGA 1SOWA 4CLEA 3ZWOA 7MDHA 3QHAA 3DBHA 4NK4A 4B8WA 5CEFA 4Y6PA 1DFHA 4J0EA 4JJIA 2EKQA 1HE5A 3DHNA 2P4QA 1A7KA 4LGVA 4WUVA 2WMDA 2AG5A 1WMAA 2XPCA 3GHYA 2I9PA 1EK5A 4ZJUA 3ANMA 1GUFA 3DZKA 2BFMA 1Z7BA 3PHIA 3VH2A 4IDAA 3W4IA 2EEZA 5DBIA 1HE4A 3AY6A 3TQHA 1GDHA 2JAHA 3RC1A 1XCBA 2VT2A 3OSUA 4MOWA 3BMCB 1QLHA 4OJNA 4OSOA 3E5RA 1R66A 4YYZA 1XG5A 2A35A 2VQ3A 1PQUA 1Y1PA 4GI2A 3S2EA 5JMWA 4CMIA 4IS2A 1NTOA 1EE2A 1H2BA 4AJ4A 2POQX 3GVIA 1U8FO 4PLZA 3RCBA 3I9NA 5KVCA 4D41A 2CFCA 3GVPA 4YJHB 2DTXA 4D3DA 3LU1A 4KZPA 1R16A 3OHSX 3TZHA 4CR8A 2ZATA 4YJHA 3ZWWA 3GVCA 3ROQA 4E5NA 3WSWA 1NVGA 3CH6A 4D0RA 4RZIA 1BW9B 1FXSA 4U0KA 3V1TC 5JSFA 2Y1EA 4TKMA 3PXXA 3ZN2A 5JO0A 1SB9A 2OMEA 1KVSA 2PD4A 2EGHA 3MTJA 1E7RA 1D1TA 1K3TA 3HB5X 4Y6SA 4KDFA 3U0BA 3PWSA 2BHLA 2CVZA 3CSDA 1U3TA 2IE0A 5JCJD 2LDBA 4DREA 1I3MA 3AOEA 4BNWA 4EITA 2ZB4A 1EVIA 4M55A 4YVFA 3FBGA 2D2IA 3M2TA 3UN1A 3KM0A 3ASVA 4E31A 1EK6A 1R6DA 1HDYA 4JP2A 4W7IA 4X54A 4GVLA 1EZ4A 1H9BA 1ZVMA 2P5UA 2BI7A 2X9NA 3N58A 1BSVA 4P38A 5DZSA 4FC7A 3PYMA 1W73A 2Y67A 2C59A 5LCXA 3BXXA 3P2OA 3LT4A 1VJ1A 1LSSA 4BNGA 2VOJA 5L53A 2OOSA 2ZB3A 1CRWG 2NACA 2Y1CA 3NTQA 1RM5A 4PG7A 2Q1TA 4K6CA 1M67A 2Y1OA 4J4BA 1PGOA 1VL0A 4ID9A 2HK9A 4DIOA 1E7WA 2H63A 4R1TA 4RL6A 2V6FA 3ZCXA 3CPSA 1E0DA 1TT5B 2ZTVA 5B4TA 4GH5A 2RIRA 4JP3A 3M6IA 2DBZA 4RZHA 1TT5A 3MJ4A 1PIWA 2QRKA 3PLNA 5L9AA 4BO5A 3JD1A 4WCFC 4OHUA 5TNXA 4L8VA 4FOSA 2CDCA 1HZZA 3E18A 1Q0QA 1LDEA 2Y0CA 2I76A 4P22A 4OQZA 4A7PA 2VNSA 3PJDA 1EQUA 2AEJA 2CMDA 4MVJF 3WIDA 2GD1O 3HE3A 1MB4A 2ET6A 3F3SA 4CMBA 1RM3A 3JTMA 2JJYA 4OGWA 1I36A 4Z3DA 1YBMA 2AEFA 3RI3A 4AJJA 1FDWA 3F46A 3WNVA 4YRBA 1FJHA 4YB8A 5THKA 3ZV5A 3FBTA 2NU9A 1GCOA 9LDTA 5TC4A 2C2XA 3WMWA 2OHXA 1P9LA 4AJ1A 3Q11A 4JIGA
chains in the Genus database with same CATH superfamily
3F9CA 3T1HB 3ID6C 1XKLA 2BFNA 2KYRA 4I46A 3ZHXA 4AY4A 1Q1AA 3NALA 3C3PA 3GT7A 4IDCA 1CIPA 4ABTA 2DTEA 4R8RA 1O6ZA 4ND3A 3MT7A 3FJYA 3NCTA 3R3ZA 3I6IA 4Z7OB 3RTCA 3TAXA 1EP1B 4E2XA 3AHFA 3RVKA 4BYMA 1RQNA 5F1KA 3RS4A 1QFYA 1Z4QA 4YMHA 2GT1A 3SBXA 3UAGA 3FUVA 3C4JA 4PLTA 2P1ZA 2AX4A 3F6BX 2YFKA 5LU8A 4DLBA 4II3A 4XVRA 3WL4A 3GARA 1MW9X 3T1NA 1XVVA 1SPXA 4ENQA 1AT1A 1WMEA 2VYCA 3M0EA 1E9CA 4J2OA 4MDFA 3INNA 1QGUB 2FTKE 3PC8C 1NBMD 5GJVC 1OREA 4W8HA 3DEJA 1LI7A 1V8BA 4P4GA 4C4ZA 1R5JA 3S1LA 3O8RA 2IXTA 1F6WA 2G88A 2Q5IA 3DQQA 2QMUA 3D3QA 3LUDA 4N3AA 3T61A 1EUZA 4N6OA 1CPYA 5SZKB 2PGIA 1TCCA 1ST3A 3HO8A 2UKDA 3UXEA 4AULA 1VCMA 1ZRHA 3AEUA 3EN0A 3LX8A 1C7EA 4TZTA 4WNCA 4EYQA 5GVSA 1G6OA 3GL9A 1EIWA 2SKEA 1R8XA 2FEMA 3GIDA 3F4LA 3RT9A 5D6OA 1H42A 3MPUA 2FK7A 4GYJA 4GLOA 3R74A 5LZ2A 5JEEA 2HRRA 1CUDA 1JLMA 3GRAA 4FYWA 4ZRNA 1N9ZA 1LLUA 2R1VA 1ADFA 1G6HA 3FOBA 5BN3A 4AP5A 4LZOA 3ZWAA 4BO8A 2XA2A 2C9YA 1H2ZA 4M3NA 2F8SA 1ODTC 3AZOA 4LV5B 1P81A 1O4VA 3RUFA 1JG2A 4JROA 1QRTA 1O03A 3UJDA 4BV3A 3H8SA 2R7MA 3WXMA 2P30A 4DUYB 2GOYA 2YWJA 1VL1A 4M1QA 3ADPA 1XJ5A 1KSHA 1SHKA 1QPZA 4NNPA 3QEOA 1QJCA 3CLHA 4JT4A 2CW5A 4YP9A 1LS6A 4RVHA 2ZSFA 4KWHA 1E7SA 2I1LA 3CXRA 2EDAA 1HDGO 4ONEA 1M2VA 4M22A 4Q66C 4XTCS 4E6PA 1GGVA 3UPUA 4Z1MD 3EA0A 4D4LA 4JJGA 1F2UB 1QCDA 3AP2A 2W6ZA 3LXRA 4CN9A 3K9NA 3GNLA 1GYRA 1XTIA 2IITA 2PL1A 3RBXA 4DE5A 1VBFA 5JD4A 3IMCA 4F93B 5EZSA 2QI9C 5EEHA 5SZJA 2O54A 3D4IA 1OZHA 3KUKA 1YQUA 2I2DA 3R6DA 1U9IA 4XE5A 1N8TA 1AGRA 2ZU6A 2NQ8A 1UBCA 4HFMA 4D8XA 3LUAA 4C4AA 4JYCA 2QT0A 5HK9A 4UD6A 2VWHA 2PH5A 1OBFO 1CXZA 1SC9A 3GRRA 5IFKA 3CBGA 4OMUA 1TZMA 2BV3A 1QHGA 1RRCA 1FP4B 1M2WA 4MITA 4HPJB 3GUYA 3EH2A 3RGWS 3KR0A 3EC1A 2QLBA 3CONA 4I0WB 2ON6A 4M0UA 5JYEA 1BDHA 1QH8A 3UWSA 1ZIDA 3PRYA 2VP3A 3KSDO 1H23A 1ZU5A 2H11A 1QKIA 5DHUA 4DUGD 5AUNB 5IS2A 1BDIA 5A71A 4EL5A 1KVTA 2F1KA 2CVOA 2GN1A 3FCOA 1FE8A 3OTIA 2P9BA 5I7RA 1N6IA 4NOJA 3WP1B 3ZXYA 4B81A 2ODBA 4RWZA 1Q83A 4F4UA 5C1PA 2QSJA 4U7TB 4KJXA 4RIFA 2XHEA 3SNHA 1NC1A 3GEBA 2VJYA 4PC6A 2AG8A 5HQ3A 1Z6YA 2IUTA 2ZJ5A 4YJGB 5ADHA 4KHZA 4FW9A 3IP3A 1UMDA 3G6WA 1ZGAA 2KX7A 2WJHA 3L18A 3PUKA 3BKXA 3EMBA 4FZJA 3GJ0A 3E1SA 4P4SB 1ZESA 3PVZA 4R1LA 5I3CA 3F2IA 2J67A 1Q21A 2Q1YA 2B9VA 2OC9A 1QORA 2IUFA 3PENA 4U2EA 4Y8VA 5CU7A 5BW8A 1N6NA 1OOEA 2QMEA 2PWPA 3HXLA 4WESB 1FFXA 4WSOA 4AT1A 3NX4A 1AA6A 1ORVA 1FUIA 1G21A 1TI7A 3FF1A 3A27A 2C07A 3ABZA 3IEUA 3LQ2A 4LOAA 2ZS7A 4F4DA 1QPBA 3UXHA 2CB9A 4G65A 2O2IA 1SCUA 3GMDA 3H97A 1WSWA 2NYVA 2NU6B 3DZCA 1GUBA 3M4ZA 3ZHYA 4Q3KA 2BKAA 1UMBB 3NAGA 3C8ZA 1O0SA 1ZHHA 2AD5A 1GKLA 2W5UA 1EJBA 3X2FA 5C18A 2VBIA 3KCNA 2AMLA 2LGJA 3HUEA 3RIMA 2QMZA 4RH1A 2ATEA 4TTPA 1M6WA 4FFBA 2ZYDA 1F17A 4JCCA 4WHMA 3SWWA 1PQYA 5IBRA 3FVVA 4KXQA 3L8FA 1EFUA 4B79A 2F8TA 4I50F 2C4NA 2HMTA 1XELA 4P53A 4XEUA 1RXVA 4Y2UA 4JP5A 2I4NA 3UK0A 4HLCA 2FZGA 3L0CA 5INTA 1ZJZA 3SC2B 5HJEA 2B3DA 2CWWA 2A7XA 1NNSA 2WT8A 2YHSA 4O63O 3N7AA 1I5EA 3U7EB 1E5QA 5EZQA 3VVBA 1JEQB 4K7JA 3K1YA 2B78A 5HHTA 4BE9A 1LW7A 5FNVB 4DTIA 2M1ZA 2PZMA 2XYGA 2R7NA 5EJAA 1ENPA 2V6BA 3K0CC 3TZKA 3ZUGA 1C7QA 2JI8A 2W6JA 4D9BA 1YDEA 2QQFA 1D3AA 2VA9A 3U7FB 2IIQA 1BXRB 1F5SA 4WNYA 3BD8A 5K6AA 1UC8A 1Y34E 1UODA 1CJBA 5JWRA 2VDKB 1QGZA 1PWHA 2DFDA 3N07A 1X3LA 4I2NA 5IF9A 1ISIA 4YRFA 3X1DA 5HCIA 3D7RA 5EQJB 3FA2A 1G66A 4MQEA 2B1JA 4B0PA 5E4YA 5JC8A 2K2WA 2WUVA 4UVIA 4F5EA 4MRNA 4I5EA 2C1ZA 2Q8QA 2DE0X 3QX8A 4WZ6A 2EFJA 2D2EA 2CF5A 3L9WA 2NW6A 4O4JB 2HFKA 1GY8A 1KI3A 4YREA 3MMNA 3FTNA 4MX8A 4I1YA 1YBFA 2PXHA 2WUWE 5JVDB 4L07A 4M7OA 1PFVA 1A7JA 1JYEA 5LYJA 1LW6E 1WHSA 3SS8A 1P7YA 3AR4A 3W5HA 4L6IA 2QTNA 1XTRA 2ZBUA 3T7CA 1U0OC 3AUJB 5CH3A 3VFDA 4JR2A 1EWKA 2EEPA 1DAIA 2BEKA 4EGQA 2PX3A 5DFAA 2AGVA 1MV8A 1J49A 2WNHA 1RWWA 2ZW9A 3FUWA 4RA6A 5BSWA 3NDRA 2J08A 2VL7A 4WLEA 1V2GA 2QW0X 3SZ3A 1EDOA 3SDSA 3GLGA 2VF2A 4TKZA 5DW0A 4WJZA 3K5WA 3ZW7A 2NP7A 1Z56C 1KY5A 2W2NA 4KSCA 4QLAA 1IH8A 1JPUA 1UOOA 1YDFA 2AOTB 4B4DA 4EABA 2J09A 1U8EA 5KQLA 3OPYB 2QTTA 3KZKA 5FPSA 3ZJUA 1PV2A 4N65A 3GXOA 3C3KA 3N8IA 3M3PA 4BMZA 2IZ0A 1Z7EA 2QTWB 3L6OO 1N0HA 1DTWA 1QGYA 3QPWA 4F8EA 2N75A 2VJBA 3HKEB 2UVQA 5H9WA 4M6WA 1T1SA 3B3QA 2YWEA 1EYZA 5DT9A 4CTJA 3CX6A 1EUDB 1VIMA 3A05A 3DPSA 3PVCA 1L1RA 1QCCA 4X3CA 3MT8A 4V0ME 3KLNA 2W37A 2G1PA 1LX7A 2IEAA 3WRXA 5JPCA 1XXHE 3FYUC 2JB9A 1H0RA 2W2KB 3IRUA 3E1GA 3T95A 1U94A 3K9WA 4I66A 4IS3A 4MQEB 3UW1A 5E4TA 5K3BA 3H7AA 1OYOA 2XH8A 2WTAA 2VPIA 3MJEA 3MELA 3RTBA 2XZTA 4A8HA 2J9FB 5A4IS 4TTTS 2Q4DA 3T5PA 3IAHA 1PNQA 7YASA 2DH5A 2GPTA 4D44A 2GF0A 4I6GA 2NTVA 4DA0A 1GL9B 1J9ZA 1EBFA 3CUWA 2NZWA 4LUCA 1Z2PX 2J0EA 4D4JA 1NI4A 2I2FA 4D9GA 1BXKA 2G9ZA 1OC4A 3A6KA 1IIRA 1IRXA 5IEBA 2BEWA 1NLUA 2NUAA 1RWVA 2W2OA 5G0TA 3K09C 1C9JA 1N5JA 2JLAA 5BN3B 3B1YA 3HUDA 1CVLA 5KINB 4WNAA 1G5QA 5DKFA 4E22A 1SHLA 5AOVA 5JAIA 4O1HA 3WRYA 4H7DA 3RNLA 2B7LA 3C3CA 4A8PA 4UXIA 4JKIA 5DEIA 1E1MA 4G37A 1C1DA 1EP2B 3R5XA 2I91A 2N1MA 2R11A 2X15A 3BFKA 4MPRA 3A2NA 1F06A 1Q19A 3R7LA 1J07A 1DOHA 2WJVA 3CNEA 3VSEA 4BN5A 1Y6RA 1A2QA 1ACJA 2O8FA 3A36A 1R0RE 2GXQA 1PVVA 4P54A 4GC9A 4I19A 1X9IA 3P0RA 1KJ9A 2C1XA 4LNHA 3S1AB 3EZLA 3EODA 9ATCA 4RIIA 4QXMA 3F2VA 1OI2A 4G89A 2A86A 4IM7A 1PFQA 1ZJJA 2X5XA 1RQ2A 4RPJA 1JZQA 1TKBA 4MUHA 1Z82A 3PPXA 3D8UA 4OQLA 2QJRA 1I51A 2ZI5A 3T5DA 2B1RA 1SBTA 4D4MA 4MHOA 3RTEA 4YPOA 4C0KA 3IQGX 2X5KO 3MFQA 4PX3A 1X8KA 2HO4A 4JP1A 4XQ0A 1RLTA 2X58A 3G8YA 1SKAA 3GUZA 2ZZNA 2A4MA 1H9AA 4OIMA 4WGFA 4P98A 3JXEA 4IRXA 1C1HA 2VWPA 3AEXA 4X62B 1O8BA 2ZUWA 4M0PA 5AQ1A 3I76A 4PRYA 1M3SA 2HA7A 5T8KC 2ZYAA 2VXCA 3H8WA 5BWOA 1KZYC 2ZCJA 4N12A 3U44A 3IEVA 1ZXLA 4RXUA 2Q5QA 3KP1A 1QO0D 3VA7A 3JWJA 3DM9B 2LTAA 4OREX 1XMSA 4DLWA 3HJBA 1LBHA 3KDAA 4OHFA 3I2HA 5K3FB 4EX7A 1G7SA 1DTSA 1HC7A 2E4XA 3AR2A 3D6FA 1C4KA 3MHTA 3HADA 3BXGA 2GN8A 2IDKA 2IYQA 4R81A 4TROA 2C20A 1F8FA 2KM1A 2VHEA 3RC1A 3TR6A 5CD9A 2CV2A 1TZ2A 2XKAA 4FZ3A 4BQOA 2PT6A 1NW4A 1IEVA 3HN2A 3N5CA 5PNTA 3OQVA 2V0GA 2B37A 4O4HB 4U63A 2NU8B 1R5NA 3FTEA 1UOEA 1G4HA 4X8LA 2AQIA 4JVMA 1SY7A 1KL7A 3BMXA 4IIBA 4U7GA 5J23A 2PSEA 2Y4OA 3G9XA 4BO4A 7GPBA 3K5HA 2C4UA 4IL5A 1XPUA 1XFAA 5KTRA 1FTQA 2ECPA 1X80A 2VI5A 4TT3D 1V71A 2HWXA 2XVZA 5LXTA 4MZDA 4HXFB 3VTFA 1WETA 2H2AA 1U9YA 5DM2A 2O05A 3SIXA 2DBVO 4JLSA 1GDTA 1SC4A 4IFTA 2JLZA 1ODIA 1LNQA 5DXJA 1KEPA 1EVZA 3HXMA 2YQ5A 2X42A 5HUQA 1XEXA 2WYOA 4CUZA 4BNKA 4JYZA 2MR6A 3QTBA 1C30B 4GYKA 3Q2IA 1D6NA 5DGTA 1OFUA 2ORYA 2XI4A 2JJ2D 3UEOA 2IOQA 1KHTA 3ESQA 4XVUA 4LOJA 1LI4A 1BCSA 3A9VA 1OKKD 2QNRA 1S2LA 4X84A 2YICA 1J1IA 5A9SA 3VKHA 3ZQ4A 3G0DA 3ZWDA 3DR3A 2NTNA 2PM8A 2AYZA 4XFDA 3BDAA 2Q7OE 4Z7JA 3WZ2A 4DCMA 1TM5E 2OENG 2ZLBA 2VJMB 2REXB 3FPHA 1JHAA 4GW3A 1NKTA 4XSVA 1YTUA 2QX8A 3JASA 2OQIA 3FYTA 4DLUA 4A15A 1ODFA 5EKDA 3VNUA 1RR6A 1GR0A 1WMSA 4XQCA 3RASA 4DNPA 1ZGJA 2FOIA 2C31A 3H17A 4J2TA 3IIEA 4B2PA 1W19A 1YASA 4X85A 4GGPA 3THYA 1GQQA 2QTMA 2VWQA 3BJEA 2A30A 2R8XA 3CRVA 3HFSA 3F0TA 4IDGA 5CH8A 2CNBA 4GOND 2GBPA 2AW3A 3H19A 3LSYA 4L5AA 5ESWA 4ESEA 1AKMA 2GCGA 5BOSB 3GLFA 3MXOA 5HZMA 2CNNA 3GOHA 5EP3A 3S8EA 5A4DA 1Q50A 4DL9A 4JEUA 2ZBVA 3O7WA 4DDTA 4IDFA 2ZVDA 3WICA 3FKSA 3HA2A 5EIOA 3BILA 4MB0A 3NT4A 3H0EA 5AUOB 4J7UA 4XGQA 1EX9A 1SBCA 2BT4A 2P79A 4D5EA 1WKCA 3L7KA 5FTLA 4I08A 4G1CA 1ISJA 1DEHA 1KPHA 1ORHA 4QG3A 1KKLA 1MQ8B 3AUTA 2ZB7A 3HCEA 2Q0XA 3ILSA 3MD0A 4L4YA 1LNSA 1M2KA 1BMQA 2E49A 4NABA 3GJYA 4EENA 2IYXA 3FPLA 3ICPA 5DU2A 5HTKA 5C7IO 1C30A 4KYTA 2WK1A 4K5QA 4M0MA 2YC2C 3ZWYA 1T9HA 1T35A 1EGVB 4WMLA 4ID3A 1L4NA 2ES4A 3ROKA 3MAJA 1YIOA 5G1NA 2B5VA 4BMDA 4ARZB 2GPJA 1L9XA 5AW6A 2NV6A 2IEDA 5BRNA 2CNWD 3DDSA 1Z7GA 1U5BB 5TPWB 3VQTA 5E1MA 5BNIA 1DKNA 4NV0A 1ZISA 2PGLA 1KMIY 2JATA 3HKBA 1K2WA 3I52A 3QQ5A 4GKAA 4WZBA 4UUOA 4JJ8A 1AO0A 5AJYA 3N0XA 1VE1A 5CT6A 1L9KA 1DAMA 3SZOA 1KMHB 4DXAA 4A2PA 4LZWA 4E11A 1AQLA 1GTL1 2XVXA 4H3VA 4DDKA 4YPVA 1P2VA 4YRSA 5CTJA 5F35A 4RYDA 2FVXA 1TAHA 4X1YB 2FQQA 1VJ0A 1YZTA 3Q3GE 1EP9A 4G56A 2HBZA 3UWDA 5HYVA 4YCCA 1V43A 1GJRA 4KXNA 3MMPA 4HBZA 3CF6R 1NJ2A 5EZYB 1LDNA 1C8VB 3NM6B 1VMIA 2JGEA 3BWCA 3PUYA 4YJFB 5ESDA 2EIHA 2EX0A 3D0RA 3VPFA 2I4RA 5LFAA 2PUDA 3AINA 3PNLA 3KZXA 5HMLA 2C5GA 2ZI4A 1V3UA 4BE7B 1Z73A 4US1R 5IC6A 5TVKA 5TLSA 3EQ8A 1LEHA 4PIPA 1M2HA 1Q1BA 2OLKA 1YVDA 2C5BA 3ANYB 4FJ0A 4MVJE 3V8VA 3VVCA 2P2YA 3JQEA 3IOEA 4EKYA 2ZIWB 4AIRA 4MVWA 3QEAZ 2P5SA 4HSEA 2RHBA 1SUFA 1SKYE 3H2SA 3OY7A 1HTBA 4R9VA 5KU1A 3ER6A 3L9XA 2ZAIA 2DUMA 3OZXA 1IRIA 1SD2A 2Y92A 1SXJB 3EA5A 4XPIA 4CDGA 4L72A 4QOHA 3LIIA 5H3HA 1ZMOA 3W6NA 2GK7A 3WYEA 1E62A 1YOVB 2BGRA 1RIFA 1UBKS 1W76A 2AUTA 2C9DA 1CERA 3PD0A 2VNJA 4L4RA 4RVGA 3EFOA 2XRFA 2BUCA 3HXPA 4DR5B 1L7NA 4JB3A 5K0CA 5E38A 1TF7A 4JP8A 1X8LA 3I6ZA 3CFYA 1UDWA 3HUFA 3QEMB 2JCXA 4MRMB 4ALKA 4CQJA 3C87A 4BY9E 1X8JA 3Q5GA 1GU1A 5A4KA 4Q34A 1KPGA 1CR1A 1UM9A 3SM9A 2RBKA 3BE6A 3GNSA 3KZVA 3OPMA 1A88A 2GHQA 3RYHA 4DXDA 3HB0A 2P9EA 4N5IX 4PINA 5JSKA 1Q92A 3OA0A 2NZ2A 4KACA 2DGDA 4YO8A 3NRCA 4BO3A 1WZ2A 1RC8A 4PPFA 4JH0A 2JVIA 1A71A 5F77A 1JHVA 4TRNA 4B44A 5CURA 2XVAA 4F12A 2W90A 5EJ8A 5K99A 3GT4A 1QHHA 5CDSA 3V4RA 4GZMA 1Q17A 5IJAA 5LD2B 4FSXA 1B41A 1SPBS 4REMA 3SF8B 1HYEA 4OKNA 2QW8A 3GFSA 3VR5D 4FOTA 4N76A 3KXKA 2HIHA 3KL4A 3RWOA 3HN6A 1XLUA 1E5LA 1JQLB 3LA8A 3EULA 4KTVE 5FI1B 1WV0A 5TMEA 1UF9A 1MR3F 1JF8A 5DK6A 1G7TA 3DF9A 5AM1A 4AY6A 2CBXA 3RJ5A 1MOSA 2XB9A 5DTQA 1P9WA 1AXGA 4DCCA 2W48A 2P90A 1MB0A 4FHEA 4Q12A 4QYSA 2P8SA 1BO6A 1QG4A 2VRNA 3I1YA 3LUFA 3ICEA 3PZBA 1SVWA 1Y6JA 1C1XB 3CY6A 4BS9A 3OUZA 4ARVA 4BFLA 2HCJB 2HSEA 2WJWA 2DRIA 4CCWA 2G4CA 1UFVA 2GJAA 4YXFA 4RFSB 4P33A 4JU9A 4ARIA 2WC1A 2AWOA 4IJQA 5JS1A 3GELA 2AG0A 2V7BA 3S44A 3VDMA 1JQEA 1SVNA 1T9ZA 3HDJA 4NMHA 4OU5A 5IF3A 1U99A 1GG8A 2G04A 5EKSA 3THWA 1C0IA 1ZW1A 3P2KA 2I3DA 2O5RA 5L6MB 4FQ7A 1D9ZA 4V1CA 5EJ9A 2W0MA 4AURA 1DC6A 2R62A 1VSTA 4EZEA 5BV0A 5I48A 1ONNA 3LLUA 1Y7PA 1XTQA 5CEEA 1TCAA 4WNIA 4PYMA 4ECEA 2QYTA 2ZXEA 4LWZA 5JWOA 1GRVA 1ISGA 1RHRA 2Z8YA 4QOIA 3RYTC 1UZUA 2XHZA 1V1RB 4F6CA 3RC8A 4INZA 4CJXA 4BQEA 1I5OA 2ZOSA 3NOOA 5EGSA 2I8CA 1FQKA 4DARA 4YRAA 4MQFA 3OZWA 3RRFA 3VOTA 3SEZA 4DT1A 4JLDA 2G1AA 4AZ3A 5JCJA 2ZRLA 5BN1A 3RS2A 4XUDA 3LQ4A 1GV1A 2QT9A 3P9YA 1DQNA 1NP3A 3FTDA 2A0FA 3FCEA 4X8HA 1B6TA 4Q47A 5CA0B 2PSSA 4QJIA 3WFJA 3QLVC 5FWYB 4Q18A 3CF0A 4D81A 1APBA 2ZYVX 1QU3A 1KYYA 1M6NA 2AN5A 3AETB 3QWHA 4IIYA 4MWDA 2QTCA 2B8TA 3D3JA 3NHZA 4J1TA 4UFOA 5F2OA 5AVKA 5JPIA 1F9AA 1YDMA 4XFKA 3TJMA 3U4HA 1PEKE 3ZE1B 5KBYA 4NU0A 5EIBC 3O90A 4NMMA 4BNVA 1Y89A 1JMKC 4OYRA 5LZ5A 4V0RA 4XJTA 5B58T 3BH7A 1X39A 2CNOA 1CQIB 1TD1A 1N3BA 4P8RA 4WLVA 1G6Q1 3AVYA 5CLQA 1N0VC 5CVJA 3P26A 1SXHA 2EX4A 5I7VA 1CUYA 1H4VB 1VG1A 2CVPA 3WLIA 4EGFA 3GJ5A 3UAYA 4OBBA 5ERYA 1O58A 2X5JO 3I42A 3EZ2A 4HJXA 4R1NA 4GI1A 4WN9B 5IARA 2RJNA 4MZXA 2Y76A 4NI5A 1OGYA 5AK3A 4HD8A 5TE9A 3GFVA 4WZAE 5BVGB 5ENVA 2J07A 2QM7A 3GDWA 2HJSA 2XZPA 3MS2A 3TKYA 1E99A 1JYSA 1Q91A 4LJKA 1O95A 3FX2A 3HA5A 3BA6A 3TB4A 3EGDA 2H5LA 2COKA 1G1AA 3UO8B 4ACAA 3ZXUB 4EY8A 3TQOA 3D6HA 1C50A 4A8JA 2NXEA 3FDIA 5LOVF 4XD7D 4FFOA 3ETGA 4Q1EA 2VJPA 1JEAA 4GXTA 1NMQA 4Q4AA 2DFLA 4L50A 3BRWA 2CLIB 1YS4A 3I5MA 2G07A 3V1LA 4TVBA 3PQ5A 4GOXA 2B2CA 3IQXA 1CD5A 2IU3A 1ZCJA 4BQQA 3RHFA 5IKPA 4FDMA 2H08A 5BQFA 1TTPB 1XTZA 3SR0A 5L51A 3ACDA 4NE2A 3W1EA 2CDRA 4LGYA 3REOA 3HLTA 2A67A 1IB0A 2JW5A 2ZYRA 3KLMX 4NCIA 4QECA 4RTSA 3EUWA 1MX3A 1N0WA 3S28A 1SHUX 1LB1B 1I3OA 1X7DA 2SCUB 4O1MA 2C0CA 1M1NB 5DB4A 1EA7A 4GBED 3P5BA 1X3SA 4X00A 1ISFA 1RFLA 4CKYA 5IN4A 4E5DA 3E5HA 3QUSA 5DHRA 1N1MA 3LFUA 4G1VA 3DYIA 3ND9A 3ZGNA 1XU4A 2QL9A 1W0KA 3Q8WA 2DPXA 4WXHA 3VC7A 4ENTA 3L4JA 4GYWA 3FBWA 3NWBA 2D7CA 5KYKA 1FK8A 2P27A 1IBSA 3W79A 5DX0A 3GP3A 1H85A 1DRJA 1OWPA 2YUTA 4KKVA 1UZNA 1XNJA 4JXJA 2NV0A 1VI6A 1YT5A 4YMGA 1O0BA 2RAPA 4LK3A 3IO5A 3IA2A 3ZWQA 4IINA 1Q7RA 2GARA 3R6LA 3IXQA 5EIAA 2P91A 4N18A 3WTCA 4F4JA 1J33A 1V7QA 2OPBA 3CZ4A 1DOZA 4KB5A 2QROA 3ZHOA 1E2EA 1X87A 4H1HA 1OFUX 2IX9A 3QG1A 4IVRA 1AKUA 4PCLA 2HTEA 1PR2A 3SOZA 4XLZA 4YYEA 4J76A 1JGTA 2P4SA 4JJFA 3G1UA 3OMWA 4EHJA 3RGGA 3LP8A 2IKQA 4HJRA 4YRKA 2ZIXA 1PUXA 3LKVA 3OEHA 2XXAA 3V8BA 1KZGB 1Z6XA 1P72A 1SC3A 3JARA 3OF2A 4EW1A 1ENOA 3JQAB 3JWIA 1H8HA 3UCFA 4YRGA 1SIBE 2QRZA 2YBEA 4J9UE 3V1YA 3KELA 1QK4A 3IAAA 2P9HA 1HGXA 3IBCA 4H1VA 4RJ2A 3P97A 2PRSA 4CMCA 4MR7B 5EE5B 4RQUA 1W36D 2Z3WA 2E0IA 3AIIA 1J99A 3T06B 2W22A 2ZM6B 3DBHB 3FHJA 3AB8A 3KVNA 4PPQA 5TDHA 5L3QB 3R9KA 3TBFA 4M46A 3DMPA 4YQYA 1HETA 3GVHA 2AZMA 1L5RA 1ATZA 1SOAA 1X13A 3BKWA 5BNFA 3SS7X 5LYJF 3R5JA 3BSYA 1NC3A 4MGYR 1OJLA 4BKOA 1KDZA 1ZWLA 2XTJA 3JQ7B 2HK7A 2NAPA 3VH1A 3HUTA 2J5KA 4D2IA 5JJKA 2YZMA 3C4QA 1GKKA 3OLWA 1R9JA 1VPLA 1Z2OX 4Q93A 4C0QC 5HMMA 5AOCA 1GQOA 2BWJA 1SZCA 5AHWA 4BECA 5EMJA 4RJJA 4ZOCA 3RC7A 1ISSA 2PGAA 4P4TA 1V9LA 1CUGA 3OQIA 1JJVA 3C1AA 1N6OA 1VBNA 2H07A 5IVKA 2I8AA 4I1RA 1NJ1A 1JHDA 3EY4A 4GR9A 2Q46A 2Z5VA 3JQRA 3S29A 4CTOA 2XTMA 2JF0A 2ZIVB 3H2KA 1KZ4A 2CDNA 3WIOA 3ER8A 3OHMA 3AT1A 4G67A 3JW8A 2DFVA 3INTA 2GWRA 4CXMA 2ZTMA 1ZK4A 1T91A 3BMCA 3I4CA 4G5GA 3WIEA 3WQHA 1U0EA 3GAZA 4AN4A 5BV7A 4QATA 2ATCA 3JYOA 3QIVA 4IQ4A 1F3OA 2YFYA 1EFVA 3O31A 3AJAA 4QPPA 3G0CA 4QHSA 1Q0LA 4OXQA 1OZ0A 1I94B 1AUPA 3JQ6A 2B83A 3OIUA 3SE0A 3FTFA 4N0DA 5F5NA 2O3TA 3TIVA 4A9AA 3ZCUA 3VZCA 1WHTA 3DFIA 1B7GO 1IUOA 2QUAA 3FE2A 3OQIB 1SCJA 1D04A 1NLMA 3EGIA 3OM0A 4F91B 2XA1A 3RRJA 5B2FA 2HCTA 2VA8A 1QXSA 2PH3A 3I83A 1AGYA 4DYDA 1HEYA 2FP4B 4QGBA 4YA6A 1QC5A 4Q3BA 1XFDA 1NQXA 3EQ7A 1MRZA 1SWWA 2RGXA 4HRVA 2G1JA 4MUXA 3SP1A 1SIWA 4J16C 3V2IA 5A6SB 4FILA 3SKYA 3SIRA 2FEAA 5LA6B 3MEQA 3D8RA 1UBFA 1YZKA 1LPNA 4GX0A 2CXOA 3F74A 3NVAA 2ZBRA 4INAA 3TLGA 2X5NA 4D25A 1OWMA 2QRVA 1CE8A 3LVBA 2O3QA 4N7BA 1OT3A 1TUGA 3ZJTA 4OMDA 2BFCB 3FNRA 3SYTA 2OVBA 1NG1A 4DJTA 4RETA 3BM5A 2OHHA 2O57A 2XE7A 3ZD9A 2Z1DA 2QUJA 4N5NA 4LYYA 5CGZA 1E6CA 1F12A 4YN3A 3SX4A 1SK9A 3F3KA 4IOKA 2XSZA 4REOA 1AKTA 2C5SA 3AOGA 4PS0A 2PKXA 5MFPA 1KI6B 3AI3A 4L8LA 3A4LA 1R00A 1YKSA 2P6OA 4HB3A 4BLPA 3GPIA 4GR4A 4HI0E 3W34A 4D8UA 4A73A 1HR0B 5ALPA 3CA8A 3HBJA 4U6SA 1A8IA 3DDUA 4MNTA 4D79A 3O75A 3Q40A 1G19A 5I9MA 4Q9LA 4PG6A 3SIWA 2A58A 3H05A 3NATA 2ZWMA 5ADUS 5AI0A 5KDOA 1NUUA 1VE9A 5IANA 2VUUA 3HN7A 5FOUA 1Q0SA 2ANBA 4WAUA 4Y9TA 3D1LA 4QJ3A 1DPFA 4XI9A 3HDQA 3PQFA 4OQXA 1SM4A 1HM5A 4EH1A 3F6EX 3VPBA 3IP1A 2UZ1A 1SHTX 4O4IA 4QEZA 5FFNA 5G1OA 2BHNA 1KI6A 5J3JA 4HUQA 4LE2A 2FZVA 1M8FA 3ED5A 1AZSC 1L3IA 3KYCA 4UNIA 2YVLA 4BJ6A 4DEYA 4ETIA 3ZBUA 1LTHR 4Q1AA 4LOIA 3R75A 2O2CA 2YIDA 1XV5A 3I01M 4J0QA 3ZH9B 4LS3A 3FCXA 5E3HA 5KOHA 3KXLA 4GPIB 2A88A 3R20A 4BQFA 5I9IA 2F3SA 3QTLA 1VPEA 1XEWX 4IJ6A 2X13A 2BI8A 4FOOA 1J0XO 4MI6A 2FPWA 3O2QB 4FJ1A 1Z5NA 3PB3A 4YJ3F 4KIJA 4TWRA 3SXUB 4PLFA 1DBVO 5CXUA 2GAOA 4JBXA 4ROSA 2D5BA 3AJRA 4TWBA 4LMRA 2FHPA 3BEOA 2VK1A 3BJIC 2AYYA 4EPTA 5EN4A 3TBHA 2X5OA 2IHNA 4OI2A 1UBNA 3PCRB 5AJHA 2VHJA 1XA4A 4IDPA 3MC1A 3T52A 2YV3A 3T7KA 4BAGA 4RDXA 3AXSA 3AV3A 2MOKA 5ETJA 5EQDA 5GJBA 3HFJA 4IMRA 2IK8A 3OQ1A 2V6IA 1WXFA 2XE6A 4X92A 4YUAA 1O08A 1JN0A 1W8IA 3TVTA 3LBAA 3RHZA 1JEYA 1V1MA 1TOAA 4YPFA 2BGLA 4G5OA 2I2XB 1S8FA 4HB2A 4JITA 1YL7A 1QQ5A 2GD0A 3FGZA 3E9YA 3ILXA 5J59A 2HCBA 3GCDA 2FPPB 3JV7A 2I99A 2RHLA 3BIJA 1A4RA 1P7PA 2L17A 3N05A 4FGKA 4LBVA 1YAJA 4ZI7B 4DJFC 3X44A 4DLAA 1NJ8A 2YRFA 3BBPA 1DIGA 2ZRJA 4CM5A 1JYFA 2WM8A 3GN2A 5AW2A 3Q72A 3PD7A 2DULA 3A0RB 2H54A 2CWDA 5EJFA 3VPHA 4B43A 5DHAA 3RFXA 3AESA 2QT1A 2JRCA 1EFDN 2PH1A 2R4UA 2XUPA 4IX9A 4RMGA 1AC5A 1OWLA 4TPKA 4AN1A 2A5JA 4DCTA 3C1UA 5IUJC 4MROA 1BRMA 3PEYA 3DZHA 1N0UA 3Q2KA 2C9CA 3OEYA 5PGMA 2WSSA 4AZTA 4CG2A 4EEKA 2VXYA 3R41A 4HWPA 4ZREA 5DWDA 4KKXB 3IKJA 5U1PA 2C3UA 2W6QA 1B3BA 1VLQA 3AR6A 4OQEA 1G42A 5EFOA 2QL7A 1OA0A 3DAHA 4BKRA 5JFOA 4NAVA 4ZEOA 2VK2A 3BF8A 3DFKA 3LP6A 1IVYA 3VOAA 2AJLI 2GFQA 2OK8A 2R6AA 3IVXA 2IYLD 3COPA 3W3AH 3KVOA 3W3AD 5J4KA 2PPVA 5D51S 4B4UA 1RYZA 4GOLD 4DG9A 3T3MB 2DQKA 4OHPA 2NVUB 1QNFA 3REFA 1LSOA 5C5CA 1OZGA 1PHRA 2W2KA 4TV8B 2J59A 1NF3A 3WAKA 3G79A 3O8OA 1KRXA 2CNLA 2WUGA 4UHFA 4JQOA 5EKXA 2L42A 3ZDAA 3PLAE 1A7AA 4YGXB 1FL9A 1PLJA 1G5HA 4HPWA 4YI5A 3U40A 2PE5A 1POXA 3OPYA 2QD4A 3PFIA 1SOMA 1FX0B 4PBSA 1JHYA 1KE2A 5JLAA 5JNUA 4UXHA 4Q9HA 4EZIA 4PQEA 1JP7A 1ZLXA 2IEYA 2PWAA 1BRTA 3F71A 3HKEA 4KL8S 3SJAA 3ZBTA 5JIBA 5JR3A 4WDQA 3RVBA 1EUDA 2ZUCA 1Z6TA 3EXIB 4JVNA 4LCJA 2W9XA 3HU2A 3IR5A 4MWOA 5T4EA 4LHWA 4Z99A 1DKUA 2R68A 4RSHA 1TPZA 1RYYA 4U7HA 2BBWA 3B70A 1C4XA 1YJ5A 4P3XA 3B9PA 3ZJVA 4X65B 1JH9A 3K4HA 1RLJA 3E9QA 3QTTA 3L77A 4RVNA 4GKBA 4CG1A 1ZP6A 3JQPA 1T9AA 3VR5A 1KOGA 2FWMX 4BZXA 1CR6A 3CZPA 5MN4A 3LBYA 4JA2A 1O1YA 1FPMA 4LX8A 4ZMRA 5JNSA 3I2KA 3O21A 2G28A 2VQEB 4JYAB 2YXEA 3D6JA 4AW9A 5CDUA 4TYWA 1XTJA 2BCGY 1W9HA 2G82A 2KQUA 2OAQ1 2V8BA 1E77A 2M6SA 3JD2A 5DK4A 4B3JA 4DRXB 5FLXA 2HHHB 2HHLA 1F2TB 1M2OB 1RCTE 2WNSA 4YS6A 1XDGA 4N5LA 2O7RA 4E12A 4WBNA 4RTOA 5AKLA 4R54A 4ETNA 3QBVA 5FPPA 4RPIA 3H5IA 2J6BA 2XITA 3KXDA 4HXEB 4R40A 1THZA 2DQZA 1TIBA 2IOHA 2RARA 3H1PA 4IOMA 5C3MA 4LCEA 2WKWA 4MIOA 5DHQA 1FDVA 3TRFA 4YAFA 2ISCA 3MRTA 3KOXA 1LZLA 1KYZA 1XDUA 1XYVA 4DV0B 1USVA 2UUBB 2PCLA 3WYGA 3I2IA 1ZH4A 1QP4A 1QRDA 3OZFA 4QLBA 5FJIA 2GDZA 5LVAA 1JFRA 4C4SA 3AJ9A 3IE2A 1CY7A 1GILA 3HR7A 4I99A 3EVBA 4M1SA 3UH1A 1XP5A 1IYZA 3ZZMA 3AC0A 3W5DA 3HG7A 2PMEA 2AN1A 3W2FA 2PWYA 1HT0A 4MIKA 3FNEA 4B2IA 3JQ9A 6ADHA 4HXYA 4ICIA 2I3BA 3EAQA 2H1RA 4YRIA 2V74B 1JW9B 1TJ4A 1X7ZA 2JKVA 2DPHA 3NOVA 5HXAA 2WJYA 1C8KA 4R2IA 1P7VA 5HFJA 5HSGA 3C3AA 2KMLA 3FLAA 3HVUA 4BO0A 3TBKA 3DV0A 3I6MA 3OJFA 3PC3A 2CV1A 2WA2A 3JWEA 4CM1A 3AWDA 2HGSA 2FK8A 3KT6A 4OOEA 5LBIA 1Y0BA 2QR2A 1EX1A 1GUYA 1PBNA 2JI7A 3BWDD 3ICVA 3NGXA 5LMCA 3SJ7A 1ADYA 1G55A 4FT4A 2A33A 4WOKA 2VK4A 2XXBA 4YV7A 4PR3A 2VAWA 3DS8A 1N9KA 3N6XA 3BB3A 1KIAA 2H9YA 3PXDA 3SG0A 2XGGA 5JALA 2OV6A 5LN1A 3U09A 4ZVMA 4EPWA 4R1UA 2QOEA 2OUIA 1M2GA 2CYBA 2RH4A 1FLVA 1H2YA 1SCUB 1U8AA 3BFVA 3E23A 1X94A 4Z3KA 4JV5B 3O4FA 2W4QA 5IUNC 1N3YA 1RI1A 1YJQA 3NWPA 4NJOA 3Q0TA 4ZZ0A 2X0IA 5BYAA 5LP1A 4RTQA 1EEXB 1M6HA 4EY3A 1RJFA 3D5TA 4JB8A 1IAVA 4LJYA 4NYJR 5H1YA 3ZH2A 1EFHA 1UJNA 1P9NA 1M5TA 2R4QA 4YAOA 3N1UA 4RD3A 1ZNQO 4N1AA 2HJ9A 1MG0A 4QD3A 3MJTA 1E3LA 1KNQA 4RK0A 3LH5A 4AUKA 4TV9B 5KSYA 1JBEA 4IJUA 2WWRA 1N34B 2COEA 3BQMB 2IOFA 2X8LA 4S1TA 1RZUA 3CV3A 3OF3A 4HAZA 5TY0A 5K5EA 2QTVA 5E1DA 1V6CA 1SKQA 4LBZA 1P0PA 5CHYA 1SVSA 2XDWA 5ESXA 3D8TA 4EFMA 1RKQA 4OL0A 4IEFB 5C34B 1UC9A 2HJWA 3GBSA 3K4QA 1TJ5A 3LT0A 1YZLA 3RARA 3VNSA 4BIIA 4EOGA 4TQ9A 5DSZA 4MUEA 3VPGA 3V1MA 4F3CA 3C45A 1HPLA 1MUUA 3BX1A 4G9BA 6ABPA 5BQ5A 4AWAA 4PFKA 1FS6A 3UUFA 4M76B 1X0XA 2FEPA 4YACA 1JDUA 4BO9A 2C4VA 2ZRQA 5HRUA 1E2IA 3DFZA 1Y9JA 3O82A 4HX5A 5T6MA 1VBKA 5ALRA 4A23A 3P5SA 5F1OA 2OQRA 2R4TA 3OCXA 4DWWA 1RNLA 2PLRA 3K8QA 2MMCA 2NO1A 1BVRA 5FJJA 1O97C 1RHUA 1KZ6A 3I9KA 1AZTA 1PAUA 5BURA 3U3MA 4KQWA 1HDRA 4QQNA 2BE9A 3WKCA 2QUZA 4PGMA 3L6RA 2PZEA 2V1XA 3GJ8A 1YV9A 2KSQA 3FPBA 4RK1A 5GONB 3DNPA 2CZQA 4EQ6B 1OR8A 1YS2X 1JSZA 1CJUC 4PY2A 5I7WA 5GIOE 1HDCA 1PTJC 4KMSA 1DC7A 3OBBA 4DNQA 3GJQA 4BL5A 1J7JA 5AUQA 4QTYA 4NOKA 4CIDA 3PTAA 1OI4A 1G21E 4LV8B 1ZOIA 2E3JA 3SSMA 2EKDA 5D00A 2CC2A 5BNWA 3PDIA 1IY1A 1QVRA 3K70C 4DC0A 1RRMA 1Z3CA 3KTFA 4NAUA 4L22A 1LSJA 3I32A 5DBEX 2AVNA 1N0IA 1T2DA