5IZCC

Trypanosoma brucei ptr1 in complex with inhibitor f032
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
268
structure length
239
Chain Sequence
MEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
publication title Exploiting the 2-Amino-1,3,4-thiadiazole Scaffold To Inhibit Trypanosoma brucei Pteridine Reductase in Support of Early-Stage Drug Discovery.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 89
structure length 239
sequence length 268
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2016-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5izcC00
2PKQO 5A1TA 1LDNA 4E32A 3VPXA 1ENOA 4NI5A 1Y8RA 3D4PA 1XKQA 2XOXA 2CF6A 3ENNA 1PZHA 1ISGA 5F1OA 5I7FA 1E6UA 1JVBA 3PYMA 3ZH2A 3VHRA 3BMOA 4XIYA 1QYDA 4CMHA 2DM6A 3DFZA 4CJXA 1VL0A 1JWBB 1ZJYA 2JFFA 3FTNA 3F1LA 3MTJA 3HN7A 4YAJA 4WEOA 4DLBA 4PRLA 4MPDA 1DRUA 2WYWA 4B7XA 3UHAA 5ER9A 1NQAO 2NTJA 5FI3A 4TMFA 4ALLA 3DAGA 1RPNA 4CLHA 4CMIA 3WGIA 2X9VA 3AFNA 5G4KB 2NTVA 4I08A 2FN7A 2IDZA 3HHPA 1CWUA 4L0QA 1RYEA 1U5CA 3IIEA 2GN9A 1IB6A 4IMPA 2P68A 2HUNA 3LLSA 4EJ0A 3DAPA 1MUUA 5TLSA 2CVZA 5LC1A 5FI5A 4PLVA 4IGEA 4HNHA 4J90A 3ZV6A 1TXGA 2ZTMA 4AJKA 3W4KA 3OIDA 1VM6A 3FNFA 3RD5A 3R1IA 2CDCA 1N7GA 1YBVA 2HMWA 1DBVO 3KOUA 2YUTA 1ARZA 5B4UA 1NX6A 4EJ6A 3NDRA 3M2PA 3H5NA 2GERA 1T2AA 1P45A 1XU9A 1ZNQO 2OUIA 1E3SA 4AVYA 4GGOA 4KUEA 3WOHA 2HMVA 3U4DA 2DTDA 3OICA 3AK4A 1ZXLA 2A94A 2Y67A 3VH3A 5IN5A 4ZHSA 1GQ2A 3PXXA 3ZV5A 3ZWWA 3WNVA 3NYWA 5IAAA 2D1YA 4P38A 1LDGA 3WG9A 2VT3A 4RORA 3I4FA 4CL3A 1P1HA 1QYCA 5JDCA 3KM0A 1U1IA 4ALKA 4I5EA 1UDAA 4I9HA 5I8WA 4DPLA 4GSLA 3KYDB 3SC6A 2EEZA 4CL8A 1CF2O 2VHXA 3JQGA 4NFSA 2BI8A 3IAHA 3FPCA 2VWHA 1I2ZA 3BTSA 5EESA 1E1MA 1AUPA 1C0PA 2O23A 1EK6A 4R4JA 4CM4A 5KJ6A 1BGVA 1NFRA 4O5OA 1LLDA 5CDSA 4BNTA 2YYYA 5L40A 2PTGA 1ENYA 1E1LA 2Y99A 4ZRMA 4CV3A 4DIBA 3JQAB 4HBGA 4OM8A 2JCVA 2EF1A 1L7DA 3O38A 4EEZA 1E6WA 2GN4A 3DMTC 1KY4A 4NG5A 1KVSA 3CH6A 2Y1OA 5JAIA 1I36A 4ROSA 1ADFA 5MGBA 2NVUB 4BIIA 1KVUA 3D0OA 1P9LA 5JSFA 3I52A 3Q2KA 4RZHA 3ZZNA 2OBYA 2PD3A 4CQMB 4GGPA 4BO2A 4FSHA 2GASA 1X0VA 2CD9A 5HM8A 3HFGA 1NNUA 1QKIA 3FHLA 4BMVA 3W6UA 3KZVA 1Z82A 4OHUA 4ND4A 3TSCA 1M76A 4EDFA 5C7LO 5AOVA 1EUDA 3GN1A 3RU9A 3RU7A 4E4YA 3OQ1A 1FJHA 1PJQA 4BNZA 1UZNA 1VI2A 1F0YA 3C7CB 3TPCA 3HDYA 4AJ1A 3KHUA 4GLLA 1PEDA 1ISIA 2NWQA 4J1QA 1J0XO 2JAHA 2DT5A 4N7RA 2VUSA 2HLPA 3GK3A 4WCFC 3G79A 3RBZA 1I2BA 4KUGA 5B4VA 1UXHA 4IJVA 1IPEA 1U3VA 2PNFA 1ONOA 4A2CA 1WVGA 2DLDA 2ZIZA 5F1KA 5I7VA 4FFLA 1ZK1A 1A7AA 1NASA 2CNBA 2WJPA 3IJRA 4XX0A 4YJFA 4E2YA 1HRDA 3G1UA 5IZCA 2BGMA 3Q3CA 3OEWA 4OOEA 5KJ1A 1IY8A 4D44A 1IE3A 5B37A 4D3FA 1E5LA 3DDNA 4U5QA 4WCFB 2WD7B 5KVCA 4BKRA 5BNTA 2GZ2A 1PJCA 4XDZA 1KEPA 4J6FA 3ZWAA 5AXAA 3QW2A 3INGA 4PLCA 4A0SA 1UP4A 4W7HA 3WYCA 2A4KA 3K2BA 4CM8B 4F46A 2X22A 2Q50A 2EV9A 4CR7A 5C7OO 5EQFA 2IEBA 4EZBA 3W8DA 1M67A 3FWNA 2JCYA 3BXXA 3ADOA 3ZHZA 5CDYA 3GDGA 5I9MA 4Y6SA 1QLHA 3WGYA 1ZJZA 4CMCA 4IZIA 4M89A 5FFFA 2I76A 1AGNA 2VZ9A 2D59A 2UUOA 3WIDA 4OXYA 5EJ2A 5G0UA 2DVMA 2HCTA 2PK3A 2GNAA 1IHXA 4HY3A 4EBFA 2P5YA 4RPJA 5KIAA 3PJFA 2ILTA 2X7HA 4MVJF 4PLWA 5EL0A 1E1NA 3WTBA 4NU5A 4O0LA 2DTXA 3IP3A 3NV9A 3ENKA 3PHLA 4GAEA 4IDGA 5IZ4A 2AEMA 2X5JO 1KBZA 2VYND 2VCYA 2EWMA 3N7UA 1KC1A 1OC4A 2OP1A 3AI1A 3IL2A 3H5AA 5F5LA 3PLRA 5KJCA 3JYLA 3DZGA 2DFVA 5I9LA 3SLKA 3ABIA 4DYDA 1DHTA 1HDRA 1UXJA 4ALMA 3PIDA 5BNFA 5IDYA 4YAIA 3L07A 1DXYA 4BQPA 4GH5A 2FZEA 5HS6A 2B36A 3E8XA 1OC2A 3GG9A 2YZ7A 2X6TA 1LI4A 4R01A 3RC9A 2EGHA 1I5RA 2TMGA 4Z0PA 1YQDA 1EFLA 4YRDA 3UCEA 2AMFA 4BL5A 4LGVA 2Q2VA 5KVSA 2VYNA 2B4QA 1NM5A 2DPGA 3F3SA 1PWXA 4L74A 4IDDA 3UVEA 1C3VA 4EI2A 2UUPA 4DVJA 1PJSA 1H94A 1ZZEA 3U49A 3EVNA 1T1SA 3U4CA 3BTOA 4BV9A 1ADBA 2JFHA 1X7HA 3GMDA 3PQFA 1PJ4A 1O6ZA 3CINA 3HFSA 4WLFA 3T7EA 4XYGA 4E3ZA 1HDXA 2O2SA 4RF5A 5ILOA 1N9GB 4IPTA 5L7YA 4ZQGA 4TRMA 4DLAA 1J4AA 5GMOA 5TGDA 3SX2A 4TKMA 1UZLA 3B1JA 3OA0A 4QTZA 4MOWA 3ON5A 5K6AC 4BNFA 1CYDA 2GGSA 3D3WA 2NADA 4R1TA 3AI2A 4NBTA 1C14A 1CETA 4QO8A 2X86A 2AEJA 4FQ8A 5EQDA 1Z7BA 4CV0A 1YB5A 4WLVA 4XD2A 4Y6PA 2JL1A 2VZ0A 3L6OO 3FWZA 3TQHA 3R3JA 3PI7A 1UUFA 3S8MA 4WNIA 2PLAA 2WSBA 1HDCA 3LT4A 2HKIA 2RH4A 4PZDA 2VUUA 4IDAA 4YAGA 3WICA 4M86A 3DTYA 1TI7A 1J49A 3KLPX 2C7GA 2FWMX 4M87A 3DOCA 2EJWA 4CLRA 4BGUA 3HADA 3PYLA 4YJHA 2R00C 5B12A 1V3VA 2I65A 3UFXA 3H65A 3ZV4A 1GYRA 4CR8A 3KV3O 1A9ZA 1B14A 3GQVA 3P5SA 2Q2QA 1HYEA 3E5MA 1SBYA 4MVJA 1IYZA 4FDAA 4W9NC 3DHNA 1HTBA 4QX6A 3TFQA 4NBRA 4DXHA 2HK7A 1D7OA 4NK5A 5KVVA 4K6FA 4QUKA 2PZKA 1AXGA 4NH4A 1BHSA 4GKBA 3PJEA 4B7UA 1P74A 1Y1PA 1DO8A 2X5OA 3M2TA 4ND2A 2Y0EA 5IDWA 5L4NA 2OFPA 5DP1A 3PJDA 2HRZA 1HKUA 3KYCA 1LQUA 2Y1FA 3BHIA 5GZ6A 2P9CA 5HS4A 3OEYA 2W90A 2YQ4A 2Y68A 4PFJA 1DJQA 1GADO 1KVRA 3BMCB 3UN1A 1XEAA 4P8RA 4A7PA 4TWRA 1YL5A 2Y66A 3KB6A 2JKVA 2DKNA 4JGBA 3ZNQA 3RI3A 4ALJA 1CIVA 4WASA 4BS9A 3CZMA 2AE1A 1EUCA 4GMGA 3DZJA 1PIWA 1Y5MA 3TWOA 1C1DA 1RKXA 3AM5A 4TVBA 3ZU2A 4BO0A 1Z75A 1RWBA 1BDBA 4F6CA 5CDGA 3DZKA 1BXKA 3K96A 2X1HA 2ZQYA 1KVQA 3VPSA 5TIIA 5A02A 3AI3A 1MV8A 3H3JA 1P1RA 3TZHA 2VZ8A 4IS3A 3PP8A 3TJRA 4LSWA 4YAKA 5JAMA 5CG2A 4PG6A 4Z0TA 1VL6A 4E5PA 4PLZA 4FIZA 3LC1O 5H81A 1XELA 1Q0QA 4CR6A 4QECA 4DQVA 1NTOA 1QSGA 3LDHA 5ITWA 1W6UA 2GUGA 2O7QA 5L45A 2FSSA 2PH3A 3RFXA 4JP2A 1FMCA 3H3FA 3BTUA 4MVJG 3RUEA 1MP0A 1AHHA 4RPLA 1W8DA 3OQ6A 2HMSA 3WBFA 4MKZA 1HSZA 1BTOA 4OO3A 5U1PA 4TQGA 1FDVA 3JQ6A 1P31A 1GZ3A 4MVJP 4XWYA 1XYGA 5DOVA 3WQSB 4GVXA 3F6YA 2D8AA 4D42A 2GD1O 4WGGA 4NFHA 2OXIA 1ZVMA 4D45A 1R15A 2E6UX 4LVUA 3T4EA 3TDKA 1N5DA 1KYQA 2A9FA 4KQWA 3HNPA 2FPPA 2X58A 4YEDA 2HJSA 5T6BA 3DTTA 3LU1A 3LF2A 3TZ6A 2BRUA 5U9CA 4CQLB 4B4OA 3DHYA 1U9JA 4CM5A 3WFIA 3I23A 1HZJA 4IIUA 2YDXA 4A73A 3HQ4O 1F17A 2EERA 4B7CA 3ETEA 3MTGA 2I99A 3O8QA 2PFGA 3B1KA 2HK9A 4CLEA 3ROKA 5CEEA 4XR4A 3GUYA 1LSJA 1BW9A 2R2GA 1DFIA 1E3JA 1HL3A 3OJOA 1VKNA 1RYDA 2BH9A 5I7SA 4YJGA 1NAHA 2CDAA 3UF0A 3M6IA 3PVZA 3VH4A 2GDZA 1UXKA 3OETA 2PY6A 3WTCA 2PGDA 2QX7A 4CLOA 3A06A 4FOOA 3KTDA 3FPLA 3DBHA 3K92A 2V6FA 4RGBA 2EG9A 3KRTA 3D7LA 4LRTB 3WSWA 1H6AA 1M66A 3KXDA 3TL2A 4PG8A 5A9RA 1PL7A 1LQTA 3HJAA 5JDIA 2XXBA 1ENPA 4PGFA 2X9NA 4D3DA 4EUHA 5T57A 4R9RA 4FJ0A 3F4LA 4GWGA 1BXZA 4AJ2A 8LDHA 3TFOA 1N8KA 1HEUA 4MINA 3AWDA 4FOSA 4IJWA 2VHZA 3ZHBA 4CM1A 1R16A 3BMQB 3IUSA 4ID9A 3G0OA 2AQ8A 1G0NA 3RSHA 4PVCA 4EW6A 4BO6A 2FZWA 4YT5A 3S2GA 1XWFA 4QT0A 2AEFA 2FR0A 3I4CA 3ZWVA 2IODA 3R0IA 4XCVA 2ZTVA 5A4DA 3AJRA 3O03A 4P4NA 1DIRA 1LC0A 4UEKA 5TT1A 2G17A 5GY7A 2NTNA 2EW8A 3FR8A 4NJOA 5G0SA 3EW7A 4MVJI 3QWIA 3T7CA 1D1TA 3GEDA 2YDYA 1VL8A 2VTEA 4IY1A 1PJBA 4DREA 1P77A 2J3KA 2D5CA 5JYDA 4KMSA 1DIHA 2EGGA 3L9WA 1I10A 3CSDA 1UJMA 4OSPA 4PN3A 3OMLA 2NSDA 1GL3A 2WE7A 2IZ0A 3GR6A 2Q4EA 4L4XA 1N2SA 3JYNA 5BT9A 1W73A 1NQTA 1V8BA 3FSRA 3BA1A 4UVDA 4MJLA 3NDIA 3DMYA 2V7PA 4RVHA 4IQ0A 2JJYA 1ZUD1 3LC2O 4WLOA 1L1FA 1H0KA 5A5FA 3IQDB 2AE2A 3TNLA 3P2YA 2GLXA 3TOZA 3ZWCA 5T64A 1QORA 4ZU3A 5DF1A 4LVCA 4DGSA 1ISMA 1EUZA 1LSUA 3ZGYA 5G0TA 3F1KA 4IJKA 1D3AA 3V8BA 3U09A 4CMEA 1BW9B 5JMPA 1ZSYA 5LCXA 5CPFA 2OL4A 3HUDA 1E0DA 2ZCUA 1B8UA 4XQGA 3ZHYA 1YB4A 2XXJA 3DHEA 4FD3A 3C7AA 3O26A 5IXYA 3VTFA 1O89A 5DZSA 3QP9A 5F3RA 5THQA 2Q45A 4NDNE 4HKTA 5A03A 2RBEA 3QWFA 4MIYA 4E5KA 4OQYA 5L4LA 3CXRA 5F5NA 5HBRA 4YXFA 5L51A 2HMUA 1LUAA 4E5YA 4HWKA 3X2FA 3VVBA 1BG6A 1YOVA 3DBHB 3G17A 1UXIA 4D79A 4JROA 1FXSA 4Z0HO 4FS3A 3GT0A 3JQFA 1CERA 4B4WA 4DWVA 1GV0A 1PS8A 1V35A 3COSA 2OHXA 3D5TA 4G65A 2AG8A 5AXDA 1Y9EA 3SC4A 1X15A 2G1UA 2JD1A 3K8ZA 3LQFA 4DLLA 1ZIDA 1ZK4A 1CEQA 3PZBA 1P1FA 1U3UA 4NBUA 4BB6A 4BNHA 2QRKA 3K30A 3F9IA 3MJTA 1B26A 3L0DA 4ZA2A 4HP8A 4EITA 2QZ9A 2A92A 1U8FO 3WGGA 4W6ZA 3HB4X 3VKVA 1PR3A 3MCVA 1P0CA 5ENDA 4XEHA 1WZEA 2IRWA 3V2GA 2C59A 1BWSA 4BGVA 5TC4A 3RCBA 3JYPA 1A7KA 1NYTA 2HDHA 3G3EA 1KIFA 2NU7A 4MVJE 4YDRA 3VH1A 1P3DA 2FR8A 5U4QA 2AG5A 4RF2A 3VZQA 1LX6A 4P4LA 5COAA 4LSMA 1DRWA 1G0OA 3PGJA 1R0SA 3ZN2A 5KCZA 5TSDA 4OMUA 3WLEA 3VDQA 2V6GA 4OYRA 4QXMA 4Q3DA 3UUWA 2EKPA 4E13A 4XGNA 4NMHA 3LK7A 3WJAA 4N5MA 5J23A 4XR9A 1H6BA 4R69A 5IDQA 5JMWA 4GL4A 3PIIA 4BB5A 3ZU4A 4IXWA 3JD3A 3GNQA 4FC6A 2DBVO 2PH5A 1ENZA 1D4FA 3D3EA 4R54A 3RUDA 2BFAA 4J43A 5EMHA 4MIOA 3STHA 3DZFA 2IYPA 1TT7A 3WYBA 1GV1A 4I9NA 2X9GA 4OL9A 3A28A 4J9VA 4D0SA 1EE2A 3LT1A 3Q11A 2C5EA 3QWHA 1PZGA 4PZCA 4UUOA 5DCYA 3C8MA 4JBHA 5CAEA 4OOFA 3KEQA 2C82A 3EDMA 3GVIA 4KQXA 5ADHA 3VDRA 1YO6A 1CQJA 4XJSA 4I5FA 4KTTE 1U7HA 2EXXA 2CDBA 3H7AA 2RH8A 2W2KB 4AICA 4PVDA 3JQFC 1QMGA 2QG4A 3ASUA 1GEGA 2FR1A 4ZICA 2E48A 2DBQA 1BXGA 2PKQP 1MXHA 1JKIA 4YWJA 4HV4A 1GCOA 2VHWA 4B8WA 2CUKA 4YPOA 1YOVB 5TJ9A 2ZB4A 4NR0A 3GAFA 2VT2A 1CRWG 1EE9A 1PSDA 3KVOA 3UH1A 1EEHA 9LDTA 5JW6A 4U6QA 4CM9D 4HFNA 3ICPA 3TZCA 4JQCA 5C3MA 2NNLD 1PJ2A 4MIEA 2Y0DA 1Y8RB 2PD4A 1DLJA 3K6JA 3PDJA 5G0WA 2PZMA 3TZKA 4U0KA 3GLQA 3L6DA 1OOEA 1XU7A 3U0BA 4R51A 1DAOA 2PWZA 3BMOB 1ADGA 3AFMA 2YV2A 3NJ8A 4RPGA 3LYLA 4BKPA 1GU7A 7MDHA 4MDHA 1D1SA 4Q39A 1A4UA 1I33A 2GYYA 2P4HX 3PWZA 4XQ9A 1KOLA 1B8VA 1F8FA 1JDJA 1Q7GA 2O3JA 3WS7A 4CUJA 1NQOA 5DCWA 2CF5A 3LT2A 2BF7A 2Q3EA 4CM9A 3P19A 1SAYA 5ES3A 4NBWA 4NIMA 1Y81A 1MLDA 2CY0A 4CMIB 4RLHA 2J3HA 2QYTA 3WWYA 4UUMA 3F5SA 3INTA 4CMBA 2GRAA 4CODB 3GUCA 2EW2A 3H9GA 4IGFA 4U7WA 3ZW8A 2Q99A 3GMSA 1VLLA 2Y05A 1EFKA 1BVUA 3DEYX 2BLLA 1ISJA 1SO8A 4CMAA 1YL6A 5IN4A 2JD0A 1Z7EA 3BMNA 4ND1A 2NU8A 3GRPA 3NTQA 1GCUA 2O50A 5L4SA 2QIOA 5FWNA 1T2FA 1XIVA 2V6BA 3AW9A 1XCBA 4ESOA 1EDZA 1R37A 2O3UA 4J9UE 2NQTA 1VJ0A 4JBGA 4RVFA 4URFA 2ZYAA 5JDCC 3TZQA 1OFGA 3AOEA 3PHGA 4DMMA 4GX1A 3K5PA 3W4JA 2Q1SA 1I2CA 4BNYA 3CE6A 3DOOA 2C20A 3FCOA 3MJ4A 4R16A 3W4IA 2AA3A 5AYVA 1H9BA 2H5LA 2J5QA 5ITVA 1YQXA 1QXSA 1WDKA 5JLAA 1K0UA 2BFMA 3JYQA 2XF8A 3FR7A 4KWIA 4S1VA 2IXBA 2W98A 4OKNA 4PG5A 4UAGA 3JQGB 5L3ZA 2B4TO 2HU2A 4LMRA 3K73O 4XYLA 3CMCO 4E30A 3MEQA 1NBOA 5COBA 1X0XA 4OGWA 1UZMA 2LDBA 2HSDA 2O2YA 4CM4B 1VJTA 4Z9XA 5TT0A 1R4MA 1HDOA 4L4SA 1R6DA 1MB4A 3Q9NA 1YB1A 2WD8A 3GVPA 3GVHA 3WIEA 1NWCA 3DR3A 3O4RA 3EMKA 2AQHA 4IINA 2RHRA 3NRCA 3DBLA 3IJPA 3C1AA 1B3BA 1HZZA 3QIVA 1X13A 1Z45A 1HWYA 5T5QA 4MO2A 3ZCXA 1QYXA 1BDMA 4WOKA 3NGXA 3QVXA 3SVTA 4BO7A 4M49A 3N74A 1LSOA 2H9IA 1M2WA 2BD0A 2SCUA 1LSSA 3WSVA 1IPFA 3INRA 4E33A 4Y8VA 3JQ8A 2QRLA 1RM3A 3VC7A 1TT5A 3V2HA 5KJFA 1T24A 1HYGA 4LISA 1HE3A 1R12A 3JD4A 1U2DA 3JQ9A 5JO0A 4Z3DA 2Q4BA 3DFUA 4TVOA 4BGIA 4OH1A 1T25A 1B3RA 1UP6A 5JPIA 4Q3AA 1TVEA 5COQA 3ANLA 1Z6ZA 3I6QA 3RWBA 3I9LA 1PGOA 2J3JA 1R0KA 5IZCC 4TRJA 4XA8A 3RFVA 4GX5A 4R1NA 1GQYA 4AJEA 3FD8A 4EUFA 4FJ1A 4D0RA 2CFCA 1PGPA 4L73A 2EP7A 2I3AA 2X8LA 1VRWA 4UEOA 4E5NA 3IS3A 5AVOA 4YYZA 4AJOA 1YE3A 2GCGA 2FY8A 1FF9A 2VWPA 4BMSA 2Q1WA 3OJ0A 4JCOA 4YJFB 4PG4A 1H6DA 1NPDA 3JQBA 3VAZA 4BVAA 4DC1A 3VTZA 1BRMA 1G1AA 4RPHA 1OBFO 1XG5A 2J6IA 1Q0LA 1UH5A 1VE9A 3ZWYA 2ZYGA 2P91A 1ID1A 3C1OA 3N58A 3VOSA 5BSGA 5KOIA 2CVQA 1E5QA 4IXTA 3EUWA 3AU9A 1F12A 3SLGA 1QYVA 3ZU5A 4YRBA 1RJWA 2Z95A 4IMRA 1SZJG 1GEEA 8ADHA 4B8ZA 3ITKA 1ADCA 1U5AA 4MVJD 1ZW1A 4DIOA 3MJSA 9LDBA 1U4SA 1ZBQA 3ETGA 2X0NA 4MP3A 1DEHA 1EQ2A 3OJFA 3EVTA 3RAJA 1HE2A 4DQXA 3ANMA 2FRDA 3QWAA 5DN9A 4RVDA 1DIGA 5CPBA 2YHIA 1EQUA 1ZXBA 3LSYA 4O59O 3GEGA 4WK6A 2VNAA 1MC5A 4LCEA 3S2FA 4O6VA 1MC4A 1MXFA 1ONPA 2YY7A 3KUXA 4FGSA 5T8KA 1WW8A 2DBRA 5KWEA 2B83A 3V1TC 3ONEA 3IP1A 4BO4A 2XPCA 4NQZA 3RJ9A 4K9DA 4Q3EA 4FFPA 1LEHA 4LK3A 3TL3A 2BGKA 5FYDA 1A27A 2ZTLA 2OZPA 4QQRA 1ML3A 4OIMA 4I5GA 4NJMA 4RF3A 1U4OA 1SCUA 4R3WA 1N1EA 3M1AA 4JJIA 1NR1A 1ULSA 1PR9A 2G5CA 4H3VA 5L9AA 1U3WA 4CPDA 1LDEA 1OAAA 4PLPA 2DBZA 2C07A 4M8SA 3Q6IA 5IJZA 1NXQA 3ROMA 3NX4A 3GG2A 3ZW9A 4E12A 1YS4A 1F8GA 1Q1NA 2Y93A 3FNEA 4DL9A 2D2IA 3H5RA 3NTOA 1LU9A 1PQWA 4BGEA 2VQ3A 2X0RA 1DDOA 1GUFA 3WNQA 1ZEMA 3PEFA 4XZ3A 3NT4A 2CMDA 2QRJA 5BSEA 1LDBA 2UVDA 5DBFA 1C1XA 2IE0A 3E1KA 3HN2A 1V9LA 3PK0A 2VOEA 1B15A 5BSHA 4CMGA 2NQ8A 4ND5A 1F06A 5TX7A 3VZPA 3DBRA 1IZ0A 1PQUA 3S2IA 5HRUA 4GX0A 4R5MA 2DUWA 1YJ8A 4UVEA 3FBTA 5CG1A 2F1KA 6ADHA 4J91A 1PTJA 5ICMA 1H6CA 2NVBA 3D3WB 3IC5A 1JWAB 4OJNA 4DYVA 2P4QA 2AQKA 3PHIA 1Y8QA 3U3XA 3H9UA 3UOGA 4D43A 4XRGA 5L7WA 1O5IA 3GPIA 4NBVA 4EGFA 4WECA 3UW3A 5L53A 4JNKA 2FPIA 5KVQA 4L75A 3KSDO 1LLQA 4ILKA 4MKXA 3D4OA 1VSUA 3ST7A 5KKCA 2VTDA 2PKRA 1E7SA 2NACA 3I3OA 3D5QA 3EY4A 4Y98A 1YDWA 4JXKA 4YAEA 4BNMA 4PLGA 1CJCA 3R3SA 4G81A 1IUKA 1XR3A 4DTIA 4PLHA 1ONNA 3AU8A 3PFFA 2NU6A 3GEMA 4GBJA 4XJTA 2C2XA 3RROA 1KERA 2B35A 4FW8A 4J1NA 4CLRB 1UP7A 4YJHB 1QLJA 2EJVA 4IQ8A 1NPTO 4BNVA 3GOHA 1VC2A 3GZNA 1BMDA 1YH3A 4PRKA 2PZJA 2ZK7A 5FEUA 4J7CA 4U8GA 3JYOA 1HDYA 1XSEA 4KUHA 1Y6JA 5JAQA 1R4NA 3I9KA 4JP3A 1U2GA 5GZ1A 1XQ1A 4ZN6A 1DFHA 1PWZA 2AHRA 4NJMB 1JKJA 1I0ZA 3AUAA 4BQRA 4II2A 2AQIA 2IXAA 4PLTA 4J0EA 2DC1A 2OO5A 3OH8A 3KYCB 4C7KA 3RBXA 3FN4A 1Q2XA 2G82A 3VKUA 4YQZA 1SOVA 1BVRA 4AL4A 3ZWNA 4CUKA 1O0SA 4M1QA 5G0VA 5ENVA 4PLFA 4KDEA 4JX8A 2W2LD 4J1TA 3ZNPA 5A9SA 1KY5A 1C1DB 2UDPA 4K28A 3HDJA 4ND3A 2TMDA 4C7JA 3K31A 5B4TA 5JS6A 4R9SA 3E03A 4J2OA 1E3IA 1YDEA 3MWDB 3HG7A 1DC6A 5JC1A 3A4VA 2I9PA 3KO8A 1SB9A 3F5QA 3RC7A 3H9QA 3GDOA 5A06A 1NR7A 5I8ZA 4AG3A 5IDXA 1MFPA 1ZK3A 1NVMB 2WE8A 2W2LA 2QZZA 4UVGA 1LLCA 3Q9UA 4MP6A 4PZEA 1VPDA 1GZ4A 1H2BA 3I9NA 2HRBA 1E3WA 3NEPX 4RJTA 3UKOA 4F6LA 1GZ6A 2WYUA 5DNAA 4U0JA 5L95A 4K26A 1ZSNA 3ZWOA 3RUCA 2BKAA 1B2LA 2YFQA 1GR0A 5K0ZA 1X1EA 3E82A 1JAYA 4D7AA 2XAAA 2ZATA 2P2SA 3CUKA 3H6KA 3AUUA 5HA5A 5ILGA 1HE5A 5TNXA 3TRIA 2DPHA 2PZLA 1ULUA 4OXNA 3AM4A 1I3LA 1RM4A 2VWQA 1J6UA 3Q2IA 1WNTA 4WLNA 3GH3A 4GVLA 3KETA 1PL8A 1X14A 1K6JA 4CV2A 4KWHA 2BI7A 5DCUA 4RZIA 5G4KA 4BMNA 3DONA 4GWKA 3CEAA 2OP0A 3GZNB 1YL7A 3UICA 4GLOA 3OECA 3WB9A 3BZUA 2NU9A 4BV8A 1JQBA 3GRKA 1R4NB 1EVZA 2DU8A 1ISFA 4J2HA 4NU6A 3W8EA 1FDWA 1MFZA 4W99A 2B69A 2PD6A 3GA0A 3O8QB 3U4IA 3K9QO 3HSKA 2A35A 2ZYDA 5TF4A 1PGQA 5BNIA 4YT4A 3DB2A 3PYXA 3QQPA 5IF3A 3GY0A 1LRJA 1Q7CA 5DULA 3ADPA 4YJGB 3U9LA 1AE1A 2Z5LA 3ANNA 3PTZA 4RQTA 4N5NA 1LBEA 4M54A 1C0IA 4RVUA 2VNSA 3WX0A 3CZRA 3JV7A 5JDIC 4BO5A 2VRBA 4CM3A 4CLOB 3G1TA 5A5EA 4L9RA 1HETA 3I83A 4RVSA 4R68A 1Q0HA 2D4AA 4C4OA 3KYBA 3OBBA 1NVGA 4D41A 2E37A 5H83A 3NT2A 2Z1NA 3IKVA 4XRRA 5EIOA 5JO9A 5C5IA 3IUPA 4RF4A 4UREA 3TF5A 1UAGA 4LMPA 1U3TA 4EUEA 1XQ6A 2O4UX 3HE3A 3RUFA 3AM3A 3TOXA 2HJRA 1P44A 3FNGA 3JQAD 2B5WA 3GPDG 1I3MA 5TRTA 3SJ7A 2NVWA 2ZB3A 3KYDA 3MOIA 4DBZA 1P0FA 1O94A 4Y9DA 4AJPA 1GD1O 1YWGO 1HDGO 1Z73A 2O3SA 3OHSX 1GUZA 4G2NA 2O48X 1EBUA 1ZK2A 4UVIA 2YW9A 4IIVA 1KETA 3EC7A 3UCFA 4BNUA 4CQMD 3WDSA 1DIBA 2ZJ0A 3ONFA 4QFCA 1UR5A 1Y7TA 3VPHA 1I32A 3EAGA 3KLMX 1TLTA 2GSDA 4J4BA 3NTRA 3OF2A 3JQAA 5A05A 5CFZA 1K2WA 2OGUA 1E6EA 2C29D 5DT9A 4E6PA 1KC3A 2O4CA 2FPGA 2NVUA 2NV6A 1LNQA 1OI7A 3VH2A 3UAGA 3VPFA 3RUHA 3WGZA 1PJLA 4CQMA 2ZCVA 4WJZA 1JA9A 2D3TA 1HXHA 2X23A 2BFPA 4MKRA 2X0JA 4E31A 2YFHA 3PRJA 2V65A 3NKLA 3DMTA 4NFYA 4BOYA 1U28A 2Y1EA 1WXDA 1NWHA 3U62A 4LRSB 4WOJA 3QVOA 4CMEC 3DZIA 2GPTA 2WMDA 1NHGA 1WMBA 2PGLA 3PZRA 4KDFA 4NZ9A 3KSUA 5H82A 3MJCA 2HO5A 3OQBA 3PPIA 1IULA 1FDTA 4P22A 3X2EA 4CM6A 2H6EA 1WMAA 4JJGA 1CQIA 4A27A 2VHVA 2VRCD 4MP8A 4AJLA 4B3HA 1ORRA 3WLFA 1I30A 5JFOA 5EPOA 4WPGA 1MA0A 5C7IO 3WFJA 2GR9A 1T2EA 5DDIP 1ZSVA 2BFOA 5DBGA 3RC1A 3D1LA 4FJ2A 3VZRA 1ZMTA 3L4SO 1X7DA 4W4TA 5ER6A 4UUPA 3OIFA 1DIAA 1ZEJA 3LF1A 4WCFA 5CHEA 2WD7A 3L9XA 4DPMA 1E7MA 3QHAA 1DB3A 3HDHA 4XQCA 2AXQA 1I3NA 4D46A 2VRCA 3F46A 4XKJA 4D3SA 3HWRA 4CM8A 1PJ3A 3RIHA 3FI9A 4HFJA 5A04A 3M1LA 1GUYA 2YHUA 1X7GA 3JQEA 4RDIA 1R66A 4J16A 3RC2A 1WP4A 3QE3A 4INAA 2ET6A 2JAPA 1LA2A 4BKQA 2HMTA 1W4ZA 3ZNOA 3RUIA 3E9QA 5CDTA 5EERA 2PA3A 1PJTA 3E48A 4TZKA 2YV3A 2C2YA 3IDSA 3HDQA 2F00A 4F3YA 3LC7O 2CSUA 3GZ4A 2FOIA 1H2HA 1ZH8A 2GF2A 1TEHA 4Y67A 4DBVO 5IFLA 1A4IA 1Z74A 5TJHA 3RJ5A 4DUPA 1JW9B 2WTBA 4IDBA 1DRVA 5TQVA 1QRRA 2ZKLA 4HFRA 4BKOA 1T2DA 1E3LA 3EHEA 1EVYA 3KBOA 1HF3A 3G49A 3H8VA 4HXYA 5AXBA 2ZTUA 5I9NA 3B6ZA 4X54A 2IZ1A 3E9MA 4L76A 3B1FA 1PU2A 4WNCA 3JTMA 4Y6RA 3GVCA 3SXPA 1JTVA 2RHCA 1DLIA 1RM0A 1DC3A 1JKFA 3DC2A 1ZCJA 1IZ9A 3JD1A 1EZ4A 2YV1A 1HT0A 4RCVA 4CLDA 1JLLA 1LC3A 3PHHA 4RQUA 3I9JA 4EYEA 4TKLA 4XIJA 4Z3KA 5L7TA 1ISHA 3ASVA 1XLTA 1M6WA 4AJJA 2C7VA 5G4LA 4H16A 3V2UA 5EN4A 4YRAA 1FDSA 4N54A 2CZCA 2GO1A 1JN0A 1JVSA 2X4GA 1IOLA 4BO3A 3KSZO 1WDMA 1GYPA 3C24A 4CUZA 1YRLA 4KP7A 4UUNA 2VUTA 3FTPA 4CM7A 3PQEA 1X1TA 1H5QA 1Y5RA 4J7XA 3E5RA 3ZDFA 2R6JA 3H9EO 1RM5A 2JD2A 4BNKA 4YT2A 5BQFA 3C7DB 1C0KA 1AN9A 1IHYA 4ZVVA 4BNNA 1DHRA 1GYQA 1MG5A 2Y1GA 1SC6A 4UEJA 4BNGA 4BNJA 1I01A 4Q3NA 3JSAA 4R41A 1YVEI 4CLXA 1AXEA 5THKA 2YJZA 1N1GA 4KZPA 1B16A 3I1JA 4AJNA 4XQEA 3ZWMA 1BXGB 1N9GA 1U8XX 3GGGA 4ZQBA 3WQRA 3ZU3A 3V5NA 3H2ZA 3T4XA 3ROPA 1E77A 3AY3A 1QV7A 3MZ0A 4BO9A 1I8TA 3WWZA 3JQ7A 2DUUA 3EGOA 1DFGA 2Q1UA 5LDHA 4GPD1 2BGLA 1P1KA 3MOGA 4UULA 3OSUA 4RL6A 3UCXA 4J0FA 4IDFA 4B3JA 4CV1A 1K89A 2WWRA 2Q1TA 3I9MA 4FN4A 2J5RA 2EKQA 3NGLA 4JK3A 5CP8A 1GPJA 3H4VA 1YQGA 5K6AA 3WBBA 1T4DA 1NFFA 4FFNA 4HNGA 1CDOA 3L77A 3IMFA 3GFBA 4FFMA 3EZYA 4XYEA 2RIRA 5F1PA 4GX2A 2OOSA 3SEFA 5JBIA 2BELA 3PGXA 1M75A 1GY8A 3CIFA 4R5HA 1KEUA 2P9EA 1T4BA 4W7IA 3JQDA 1YONA 3I9OA 3Q1LA 4IS2A 4ALIA 2C5AA 4MVJM 4E21A 1PX0A 1UXGA 3L6EA 3LT0A 2J3IA 3UGKA 2WDZA 5K9ZA 5GZ3A 3GGPA 3PLNA 4G5HA 4OAQA 2LDXA 3ONDA 3R6DA 4HFMA 1GAEO 5JYEA 4WLUA 3WGHA 4L4RA 2D5AA 5KNLA 4ZGWA 4YQYA 2R00A 3AOEC 3PWSA 4BHTA 1W0CA 1OMOA 2UYYA 2DTEA 3VPGA 3U5TA 3CMMA 1V3UA 3BMNB 3WMWA 4ZQHA 4Z9YA 3ZHXA 3IKTA 3QRWA 4W9NA 1H9AA 4LN1A 3QJ5A 3E9NA 3FBGA 1LRKA 1B7GO 3DOJA 4J49A 1EVJA 1XHLA 1FDUA 4BNIA 4TROA 1F14A 2QYSA 1V3TA 2H1SA 3JQCA 3DO5A 4CMKA 1B0AA 4J7UA 3BMCA 4WKGA 4XB1A 2I5PO 1UAYA 2YQ5A 1HE4A 3NDJA 4IDCA 3WXBA 3EYWA 2I66A 4R1UA 5JY6A 2POQX 4K1LA 4AFNA 4YA6A 4F45A 1J5PA 4IUYA 4LW8A 1PQPA 4OQZA 3OJEA 1V0JA 3SBOA 2RAFA 2VOJA 4FBGA 3S2EA 3CPSA 1HYHA 4ONEA 4N18A 5ICSA 4E5MA 5JXWA 3D64A 3OA2A 1SEPA 1R0LA 4J1SA 1DJNA 3WGOA 3JQ7B 3DXFA 3DZBA 4B4UA 3JD0A 3QLJA 1DC5A 3L4BA 1R4MB 3ZV3A 4YJDA 1O9BA 2RCYA 3U4HA 5JC8A 2PV7A 1SMKA 1E7WA 5DOZA 2Y1DA 4Z6KA 4OXKA 2B4RO 2W4QA 3DBLB 2JHFA 7ADHA 2OBNA 3B70A 3ZNNA 1SNYA 4LCJA 3AY6A 2EIHA 3JQ9C 4PIVA 4JBIA 3MJEA 2O3QA 4MVJH 2G76A 1ZO8A 1E7QA 2GZ1A 1WLYA 4FCCA 4YB8A 5HTOA 1T26A 4XGIA 3W1VA 3DAFA 3JQ8B 4KTVE 1E7RA 2OMEA 1VJ1A 1JAXA 1VSVA 3DQPA 1TT5B 1YJQA 2J8ZA 3H9JA 3ZWBA 1UDBA 3GAZA 4I8XA 3QV1A 4WCDA 2I6TA 2QHXA 2UV8A 2Y0CA 3QA9A 5F21A 3GF4A 3WGQA 1I3KA 4S3MA 4XB2A 1A71A 1GQQA 1O8CA 1QR6A 1EVIA 2W8ZA 3ITDA 4ITUA 1QG6A 4J4HA 2QW8A 1NAIA 4CQLA 3LZ6A 2E49A 4ZD6A 3NUGA 3VZSA 5A3JA 2C54A 4UVHA 4NNJA 1AHIA 2E82A 3JQBC 4Q9NA 3RQSA 1XDWA 4WUVA 2HAEA 1WZIA 5B1YA 1IL0A 1K6IA 3P7MA 2NUAA 4JIGA 4RV9A 3VVCA 3ETDA 3S1LA 1YBAA 4U6SA 5TS3A 3V1YA 3QVWA 1DSSG 5BR7A 5JCJD 1YGYA 1EDOA 3QSGA 2FHSA 3LLVA 2ZJ1A 5JCXA 1A9YA 3H2SA 1U7TA 3C3XA 3GNTA 4ALNA 5EINA 1UDCA 2AW5A 4N5LA 1HLDA 4TZTA 1LDMA 3GHYA 1PGNA 1L7EA 2E4AA 2WYVA 1YBMA 5G2OA 3ZI0A 4L8VA 1NPYA 1PS9A 4RVGA 3FRJA 4Z9FA 4YTEA 2WEKA 3CKYA 4NHEA 3ORFA 1HLPA 4B79A 5JCJA 3BAZA 4AJ4A 4XYBA 1YXMA 4FB5A 4RO0A 3L4BC 2EHDA 1MGOA 3DWFA 3AY7A 2G0TA 4GSKA 5HWSA 2ZB7A 2JCXA 4CMJA 2VWGA 4YACA 2Z1MA 3GN2A 1LDYA 1QV6A 3BMQA 1TA4A 3RKRA 3OJLA 1EMDA 5T8KC 1A72A 3A1NA 2DFDA 3A14A 3AUTA 4FC7A 5CEFA 2X5KO 4OSOA 5AQ1A 1NVTA 2FP4A 3MWEB 4ZQFA 1LTHR 2B5VA 3OIGA 3Q0EA 3GC6A 2YHIB 2J5KA 1P1JA 1A5ZA 3FF4A 2P9GA 2BMAA 2O7SA 1SPXA 4DC0A 3BYZA 3ZWPA 1SEVA 1DC4A 2CVOA 2NLOA 4BO8A 1ZKMA 2EP5A 3GGOA 4XDYA 5CEJA 4WLEA 4YVFA 2NM0A 4NK4A 1E1KA 1P1IA 2DAPA 2B37A 3DL2A 2IZZA 3I5MA 4A26A 3KEOA 5DBIA 3JD2A 1E3EA 3F47A 3PWKA 4GMFA 3ROQA 4QO7A 1K6XA 1GFSA 4AJHA 4DRYA 4NPCA 4JN6B 4HX5A 1KVTA 4JLWA 4WE3A 2HK8A 2V6MA 4IBOA 4TRNA 4E2WA 3RKUA 3IOYA 5BSFA 3BIOA 4PCVA 4I1IA 1H93A 3WMXA 4DQUA 4OKIA 1GTMA 4A5OA 3NAQA 1NP3A 5CDUA 2UAGA 2Y1CA 4K6CA 1HSOA 2O3RA 4EJMA 2VYVD 4GI2A 2VN8A 2PR2A 1DPGA 2JHGA 3PJGA 3RFTA 4IM7A 2ZQZA 3WGTA 6LDHA 3DBVO 3PFWO 3QVSA 1Q7BA 2GN8A 3E18A 3HZZA 3I6IA 4O1MA 1C1XB 2HQ1A 4HADA 4XGKA 1B8PA 4YCAA 4I5DA 4P4GA 4RPKA 1G6KA 3DBRB 1N7HA 2FSVA 3MJVA 4PG7A 1ZFNA 4FPXA 4JJFA 1O95A 3B20A 2VYVA 1LJ8A 4TRRA 4BNWA 5JAZA 4RLSA 1ZMOA 1T2CA 4DIFA 1WAMA 3F4BA 3PQDA 1K5HA 2I3GA 3S55A 3AUSA 4A03A 1LLUA 2B0JA 2Q46A 2VHYA 4FGWA 1Y8QB 4H15A 3SJUA 5KJEA 3NJ4A 3WYEA 3ICCA 5A3VA 1M6HA 3GHHA 1PL6A 1PZFA 2BHLA 4O63O 2GZ3A 3NT5A 2I67A 1MG0A 1NFQA 1XGKA 3PHJA 3AOGA 1GPDG 4H7PA 4Q3BA 1E7YA 1EK5A 4FR5A 3BHMA 3RBVA 4BNLA 1N92A 2QQ5A 3CTMA 4DA9A 3QY9A 4DMLA 3RVDA 1BSVA 2WM3A 1MX3A 1QYWA 3EK2A 4A10A 4AJIA 4E2ZA 5C37A 4FFRA 3P2OA 3W8FA 1S7CA 2Q2WA 5A9TA 1ZK0A 1NHWA 3GDFA 3ZWXA 4ZJUA 5FF9A 3V1UA 1WWKA 2EKLA 1NQ5A 4YBZA 5KKAA 4BUCA 2GN6A 3D4NA 3DZHA 3GNSA 4B3IA 4BKUA 4EEXA 4E2XA 2H63A 1S6YA 3OFSA 2FMUA 4IZHA 2ZB8A 4ZQEA 4IJUA 5T67A 4TSKA 3OP4A 3ULKA 4PLYA 5JNLA 4KOAA 4I9UA 4DPKA 2P5UA 1KEWA 1VKOA 1HDZA 2X0IA 3TN7A 3HB5X 2JFGA 4BO1A 5MDHA 3A9WA 4M55A 1DOHA 1TB4A 1PS0A 3FNHA 1LRLA 4IDEA 3EZLA 3WR5A 5I7EA 4R3NA 4II3A 1C0LA 4B4VA 4QEDA 4QFDA 3JCZA 3QVTA 3W6ZA 5IXSA 5DP2A 1KS9A 3UXYA 1I24A 4XYMA 3PDUA 4Q3CA 1FK8A 1XA0A 4GQAA 2Q49A 3QWBA 1D8AA 1V6AA 3RASA 2DQ4A 1DAPA 1JU9A 1T1RA 3C1TA 3O9ZA 5A9SB 3K2EA 4YR9A 2D0IA 1K3TA 4HUJA 5IG2A 3OM9A 1GDHA 3BTVA 4J4TA 3RUAA 3E6AA 3GVXA 1OZAA 5JE8A 3C85A 2W2KA 4FFOA 1YKFA 2O3TA 1EBFA 4IQGA 5LDGA 4W82A 1Y9AA 1PZEA 4YT8A 4ZRNA 1SB8A 2OORA 4E0BA 1KEVA 2PGJA 3BHJA 1E92A 1WPQA 4QSMA 5JY1A 3GFGA 3LVFO 4WEQA 1LXCA 1P33A 1QP8A 3WJ7A 4R1SA 2IEDA 1SOWA 4J3FA 4BNXA 1PGJA 1WDLA 5AXCA 2IYOA 2C0CA 3WQQA 4RDHA 1E3WB 5KTKA 4GKVA
chains in the Genus database with same CATH superfamily
4DNQA 1E2IA 4E32A 3D4PA 3ENNA 4YASA 1I7DA 1PZHA 1XVAA 4DEVA 1OFHA 3LVBA 5HILA 2IYTA 5F1OA 5FFMA 5I7FA 1R50A 2ZUVA 4Q82A 5AM1A 3H97A 3PYMA 2XUOA 2OFFA 5KX5F 4V2UA 4ARBA 1G1MA 4N3NA 4BLWA 5IU6A 1Q6YA 4UDYX 2HJGA 2V0NA 1WO8A 1YUNA 3SSAA 4BFWA 2AMVA 2ECOA 4E15A 4L5IA 1NXOA 1P4HA 1CDDA 4FHEA 4NZYA 5FI1B 4P2GA 1GKKA 2QRVB 2BFBA 4WEOA 3KB2A 4PRLA 2R6GA 4FHDA 5F7JA 3W9BA 3UQZA 3UHAA 5L51A 1DAFA 1W44A 3LLUA 3ZGXA 4ALLA 3WGIA 1RPNA 4V0SA 4CMIA 4KQJA 2X9VA 3PQ7A 4JI3B 1D9XA 2CMFA 2ZRKA 3UJDA 2PL1A 1X7YA 3V48A 4AF7A 4L0QA 4P3KA 1KSHA 2YH2A 2GBFA 3BGVA 4EA9A 2QF7A 1Q92A 2P68A 3E2IA 5MFZA 4WKPA 4EJ0A 1FJGB 1P29A 1PZMA 2YOFA 1JQJC 1MUUA 3IVAA 2NU9B 2FZGA 4Q9JA 3D7NA 4IGEA 3MIIA 1ZN8A 2Q6VA 2O57A 2EZ4A 4HNHA 2IPOA 1DJOA 1DT5A 1VM6A 2CB0A 2Y1LA 3L1VA 3R1IA 4CT0A 1JQLB 3RT1A 1N7GA 2BR3A 5AHOA 1YBVA 1JYFA 1NW8A 1DBVO 1G9SA 1IUPA 2YUTA 1NBAA 4JYCA 4NZMA 3A4IA 2HU5A 3ID6C 2UZ1A 1KFKB 5JU6A 1I14A 1GPBA 3IMCA 5HP4A 3FHTA 2P67A 5IS2A 1E3SA 2ZXEA 5F2OA 1AG9A 4PSDA 4D99A 4KUEA 4WBSA 2VR1A 1KARA 4YI5A 2DTDA 1TVMA 3G59A 4JFRA 3OICA 4L28A 1ZXLA 3OUUA 3VH3A 5IN5A 3K9BA 1GQ2A 2HLHA 2NYUA 4I4LA 5ED0A 2GCEA 3RFCA 3SFZA 3V8EA 1DQSA 4QATA 4LE1A 5A5VA 1G9XA 3K71B 5LIRA 1DCTA 2G4VA 4P38A 3DL4A 1C8VB 2BDTA 2QTLA 2VT3A 2MYPA 3I4FA 2P9FA 1DV2A 3SF8A 4CL3A 4RHEA 3A6LA 1VPEA 2HCBA 4HUQB 3UA4A 4D9NA 1GO2A 5LQUA 1NC1A 5DLYA 1QIDA 4G24A 1T5OA 2G04A 1ZX1A 5CIWA 4CCYB 2N42A 2OYRA 1CDEA 2EEZA 2WPDD 3E84A 4UUAA 3SFTA 4C05A 5FV4A 1CF2O 1J90A 4JEUA 3IAHA 1YZTA 3CRW1 1G3QA 2ZS8A 1UIMA 4E94A 4QXQA 2XI4A 1I2ZA 3BTSA 4TT3A 5G53C 5EESA 1D03A 2IBSA 2C8VA 4MKIA 2V7GA 3O93A 5IBPA 1C0PA 4FOLA 3TR5A 5KJ6A 3M6AA 3B60A 3FPJA 4E3WA 3ZBTA 5CDSA 3A6PC 4FGZA 5HK9A 5L40A 1ENYA 1P2BA 2HF7A 2PTGA 2Y99A 4M1ZA 2OFXA 4DIBA 1W46A 2C5LA 3HKEA 4OK5A 3JQAB 4XB6B 5TXGA 1XNJA 4DKXA 4C4YA 4EEZA 4CGZA 2GN4A 1KY4A 4UXJA 5JJLA 2A88A 2CUTA 1R88A 4XVHA 1ADFA 2JI4A 3Q3EA 5IHPA 3GO4A 1R27A 4EKIA 2LR0A 5JSFA 2ATVA 4RZHA 2GD0A 3L1IA 1JH9A 4D9BA 2WTUA 2OBYA 2PD3A 4CQMB 1L4LA 4GGPA 4F11A 1NF9A 4BO2A 1N6RA 1MX1A 1SUSA 1U0SY 2GASA 4G0XA 3GWZA 1A7JA 1CPYA 3SKVA 2G1PA 1EJ0A 2CD9A 1QKIA 5IXJA 4AJ9A 5JHGB 2GD6A 3KZVA 4BFZA 3SDSA 1GWNA 4OHUA 3KXPA 4KKXB 5ESXA 1L4YA 3TSCA 5C7LO 4EDFA 3OQIB 1YMUA 3RU9A 4CTNA 4E4YA 4B76A 1FJHA 4BNZA 2WUDA 1E1CB 2JVKA 4LF7B 1YB7A 1IN4A 3EIHA 3AX6A 2FFJA 3X1XA 3IEVA 2XCUA 1QX3A 1WMDA 1PJAA 2W48A 4GLLA 3WLJA 2BI4A 4WY5A 1A8QA 1ISIA 2NWQA 3IHKA 2YZKA 5EE1A 4Q47A 3DXXA 4N7RA 1J56A 2IH5A 1XXHB 1NUUA 4X6LA 2I2CA 4YGXB 5JJCA 3I01M 3VR3D 3DV2A 4HDAA 1QF9A 1I2BA 1VSBA 4KUGA 3TO5A 3ZE6A 5CM2Z 5B4VA 1UXHA 4NXNB 5D3MA 2QD4A 3S7ZA 3CNQS 1GILA 1ZK1A 3VI3B 1JA1A 4E2YA 2WJPA 1PLLA 2BFNA 4XX0A 3UJ3X 3BF7A 2BGMA 3Q3CA 1E60A 2PZAA 4C2TA 5KJ1A 1CIJA 2A9KA 1IE3A 4K3VA 1N0WA 4NBKA 1QQAA 2IS4A 5KVCA 4U5QA 4HJXA 4ZZ1A 5BNTA 2GZ2A 5CH3A 3ECSA 1BDHA 4XDZA 1KEPA 4AN4A 4J6FA 4IILA 2O2DA 4MQLA 4IX1A 5J1TB 1Y4SA 3QW2A 4JB2A 4AZWA 3INGA 1UP4A 4F46A 1NV9A 4RMNA 3ZE7A 2Q50A 2EV9A 3QYFA 2BFEA 5C7OO 3EFBA 1VG1A 2C88A 4UOQA 3T5CA 3EPLA 1K68A 4MWTA 5IVKA 4HEA6 2FEOA 1E1QA 3OY7A 4XM2A 3ADOA 4OQDA 4QNMA 5CDYA 4DIUA 5LLTA 1Q91A 4DAOA 2YZMA 1QLHA 5AJXA 2I0FA 1EVKA 4OHYA 1W36C 3AHCA 1CXZA 4B6EA 4M89A 4XLLA 1XROA 1TAUA 1Z4JA 2D59A 2UUOA 2VVTA 3QEKA 4FYVA 4UBOA 4URZR 3NEAA 4EHDA 1KZ7B 4DDWA 3CZAA 1N3IA 2PX5A 2A14A 2PK3A 2GNAA 3O95A 1FS6A 4HY3A 2P5YA 2ODNA 1T2NA 3AHEA 4ZAWA 2IEGA 4RELA 3O82A 2A5YB 3OZAA 2ODBA 4KSYA 4ZARA 5REQA 1W36B 2CD7A 3J81A 1N2ZA 3EIOA 5HXAA 3GARA 3IQXA 4BLPA 2VF5X 3N8NA 4O0LA 1G7RA 4YQEA 3NV9A 1GG8A 4X3PA 4GAEA 1TCAA 1TVKB 2FZCA 2AEMA 4LV5B 1KBZA 3OEED 4G0QA 1I51A 3SYTA 4EGJA 1QK5A 1IFXA 4OGKA 1JLLB 4NYIQ 3H5AA 4Q4HA 1IOZA 1RE0A 1XTPA 4ED9A 2ZR7A 2FDCA 5K2MA 2QNIA 8GPBA 4B3GA 4TYWA 2DFVA 5I9LA 2V8BA 1D8TA 4M88A 4X8OA 5KREA 1RXIA 4DYDA 4BMCA 1UXJA 1YC5A 1TNDA 1HYBA 1C7QA 1JLMA 3NIFB 3PIDA 5BNFA 4HNTA 1BA3A 2BFDA 2G4LA 4IIFA 1TFUA 1UOOA 2G7ZA 2NN3C 1Z37A 3EIFA 3N9IA 4ZYTA 4XWOA 3UJHA 4B84A 1AU9A 1RW4A 3BL6A 3U0VA 1UJCA 2YRXA 2YZ7A 3QUCA 4G41A 3RC9A 4ETWA 5JRJA 4CW7A 2TMGA 2QJRA 2J6CA 3QENA 4LXHA 4EWLA 4BL5A 4LGVA 1Z15A 1GTZA 1DBSA 1KYTA 2DPGA 2CCKA 1DAHA 3F3MA 2Y1WA 1U1CA 3P9QA 2UUPA 4JLKA 4B40A 1H94A 3H2YA 3EVNA 3A9TA 3CZ5A 2FX3A 3GWGA 3RFUA 5LNK6 2V8OA 1K9VF 3EVFA 2L82A 4U2GA 5AHXA 1AS2A 2X0FA 1X7HA 1XNRB 3K1TA 5JSQA 4MWDA 3UC5A 1XMXA 1UDWA 4JJ4A 4KKVA 4PSAA 4XYGA 4EPRA 1HDXA 5GIOE 3IAAA 4WNYA 1SU4A 2INGX 2RGAA 1RPJA 4G85A 4RH0A 3OT4A 1N9GB 4ZQGA 3GCWA 4CG1A 4DLAA 1JEQA 2A5LA 3ZCRA 2RG7A 1HKHA 4AYXA 2JEOA 1NN5A 4TKMA 3VR2A 4CKZA 2I6GA 1H69A 4QTZA 3KKQA 5AI9A 5EUBA 3A1DA 4R1TA 2YS6A 4MQ6A 2QVLA 4IF6A 1ZGCA 3EGDB 6Q21A 1BXRA 4AWXA 5KNCD 1C14A 3AP2A 1S9DA 1LTKA 3OHMA 5EWJB 2X86A 2XE4A 3F6PA 3P2EA 4KQ9A 3BIXA 5F2EA 3SR3A 4H77A 4CV0A 4XD2A 4EB6B 2JJ8A 2W4IA 2JL1A 2QI9C 1JDNA 1MO2A 1LS6A 3LKVA 1ZS9A 2IUFA 3EWSA 3NVDA 2O59A 5TGTA 4OGGA 1XQXA 3SZMA 3GJ4A 3KPUA 2H59A 2C5FA 2GHIA 4Q1EA 3VDXA 4AF6A 3U5ZB 4EAAA 4WNIA 2XDYA 1HDCA 2H29A 1A5BB 3LJKA 3NHUA 4DR2B 1SWVA 3LT4A 4IFIA 4DXDA 4DQLA 3LXUX 2WQ7A 4PZDA 4IDAA 1CP3A 1GQOA 4MITA 1H4TA 3R5JA 1JTEA 4HDSB 4M86A 3DTYA 3WICA 1TI7A 2R68A 3R7BA 2KB0A 1K4KA 3IB6A 3FYTA 4M1MA 2ZM6B 3L3BA 4P08A 1KDTA 2MSWA 2YC2C 2H08A 2EJWA 4CLRA 3K4HA 4QBFA 5HYVA 4PEVA 2LTAA 3IUEA 4TXHA 1ZGBA 5TMEA 5B3KA 3UFXA 1PK7A 2XVMA 3HK2A 3KV3O 5TQ2B 5GONF 3EH2A 1B14A 3AUYA 3LHIA 4MVJA 4AURA 2JGDB 2V5UA 4PYLA 3V8MA 1KORA 2BE9A 3EE6A 1HTBA 3LV8A 3QI2A 2CXUA 4QX6A 5HCIA 5DM0A 1WB9A 4EHFA 1MQ9A 1D7OA 2JLBA 4FR0A 5G1PA 2QX4A 5GINE 1E1DA 1YR6A 3BBPA 1A9OA 2ISQA 4JB8A 4OGLA 4EHJA 2GXQA 2VLBA 4EW3A 1Q3HA 1NLMA 4OLBA 3HNRA 5L4NA 1SCAA 3U9TA 1VCMA 2G9ZA 3SLRA 1P5RA 2WM2A 4JQZA 4QYSA 3F71A 3U3MA 1H2EA 3EOAI 2QP4A 1XZPA 2HHJA 4P2BA 4ZCRA 3IUYA 5K09A 1LQUA 2FJ0A 4ECEA 2YXDA 3OM0A 1AUOA 2B7BA 2Y68A 4IMIB 5E2AA 4JKIA 5J4VA 1CY4A 2PN1A 1ATIA 1DJQA 1WB4A 3JW8A 3G5MA 4GOJA 4N7MA 5FR2A 4EI9A 1CNEA 3UN1A 3Q5EA 1J8FA 3SS9X 3ZXUB 2RK6A 1YHYA 2J46A 1S2MA 4L02A 2AOVA 1OIXA 2P3OA 3HZRA 3GRVA 3QFSA 4JSTA 4MV8A 3ZNQA 4Q1CA 4WASA 4BS9A 2XMCA 3ZDCA 4IIHA 1XMVA 3CZMA 2Q3CA 3FDJA 3N5CA 4QDTA 4JXXA 4AP6A 4GMGA 4F2HA 3DZJA 4KRGA 4MWOA 2JRLA 4U7FA 2J0VA 4XIFA 1RWBA 1KJ8A 1CJSA 1BDBA 5IAEA 3U4QA 3PF9A 3CZ9A 3DTVA 4U00A 5D1HA 1V39A 1MGPA 1Z6PA 3KQHA 1QGDA 1JILA 2GNOA 4N1AA 5AJVB 1LBIA 2F2TA 4KMMA 4D9GA 3NV7A 4FFBB 2X41A 1KVQA 1E5DA 1T6XA 3ND7A 1BROA 1SUDA 4K87A 5K1ZA 3H3JA 5IUNC 1C3OB 3I1FA 3TZHA 1EK1A 2PT9A 3TJRA 4URHA 4YAKA 3C1UA 3T7TA 4RMGA 3VR5D 1KI3A 4YMLA 1USWA 2IYNA 4IICA 3A9UA 3EXIA 3TJMA 5H81A 1PZNA 1ZNZA 2HV9A 3QXXA 3W2HA 1F6BA 1XZEA 2WIJA 1DX4A 2QTAA 3OJXA 5H7XA 1Q0QA 4CR6A 4XD7A 1A5SB 3N2GB 1W6UA 3C39A 3I6YA 4U7JA 2W6JD 1Z5UA 1OFIA 1P4RA 1YACA 2O2ZA 4I7EA 2XMGA 4RZSA 4ENRA 3A1WA 4J76A 3MSXA 2HO4A 2GKGA 1OV4A 5JG7A 3RG2A 3V80A 3W5JA 4ENWA 5K8CA 1S3IA 4MKZA 4BMOB 2CC2A 2Z43A 1BTOA 5K0LA 4BP1A 2ZTSA 2CLKB 1Y89A 4OK3A 5U1PA 4CVNA 3EZNA 1FFYA 1ZOLA 4MVJP 3WGKA 2ZE8A 2QN3A 3E05A 3RABA 4BRZA 4WGGA 5DJ5A 2R8PA 3LFHA 5LSAA 1ZVMA 1CJBA 1R15A 1IB0A 2E6UX 3DF7A 4C21A 5A62A 4LVUA 4GMHA 2QUZA 3AR7A 4OHOA 1L4KA 3K72B 3TDKA 3UPTA 1UPCA 2IWRA 1B8NA 2ZJAA 3RWMB 1KEEB 4LYHA 4R1QA 3VO8A 2C83A 1W93A 1JZSA 4HDMA 4PYNA 3M4XA 1JIJA 1HMPA 4GW3A 2BRUA 4QOIA 5JPCA 1Z08A 3FZEA 1IWPB 4B4OA 3Q6NA 4FZ3A 4UE2A 4Z0NA 4NEHB 2Q27A 3DOIA 1IZ7A 1PUXA 4LGYA 4D5GA 4J0CA 3H0EA 5DO9A 3RPEA 3Q8KA 3RIMA 5DNYB 4UJ3A 4FYMA 3ZDQA 3HQ4O 3SS8A 2NT3A 4WV3A 4B7CA 2BMWA 5JXHA 5L3VA 2HK9A 4F45A 4YRPA 5CEEA 3O8OB 3GUYA 4XR4A 4EVQA 1RHQA 2WVGA 3GNLA 4Y2RA 1ZI9A 3TGWA 4HMOA 4LRWA 1HL3A 1XDSA 1OH5A 2Y2UA 1J9GA 1C9EA 1OX6A 5BUZA 1FVXA 2QY6A 2CDAA 2ZSAA 3Q7IA 4M22A 4UTRA 4KNYA 3H4TA 2NOAA 1T6BY 1Z2AA 5EXEA 3UFBA 1KYWA 3JASB 3NATA 1NVWQ 4CLOA 4QLOA 5ECDA 2QUHA 3HDVA 5F52A 1MDFA 1YZNA 5F7ZA 4R2LA 4M0FA 3W7AA 2AKYA 2Y1XA 2FA9A 1JI0A 3ZWKA 2J0UB 5KSZA 1F0NA 4Y9TA 1GTSA 5LUBA 4QQNA 5DHFA 1W0KD 5EJEA 3SU8A 2O06A 3CH5A 4LQDA 4J0JA 3KRTA 4Z4QA 1L4HA 1EA5A 3TL2A 3KXDA 4R9VA 3UXMA 1HLFA 1PL7A 3W6NA 3Q3IA 5JDIA 1KMMA 3BK7A 1ID8A 1IIBA 4PGFA 2OCAA 3D1VA 3OU2A 2CNNA 5TVGA 4OP2A 4EUHA 2FMFA 4TGLA 1BXZA 2CL6X 10MHA 1E2KA 4KXQA 3ZXIA 1IHPA 1WD5A 3EXG1 3HKDA 4MINA 2G88A 2VHZA 4X3CA 1G5RA 4M7WA 2OFWA 4EMTA 5C34B 1R16A 3T4UA 1XRLA 3SQLA 2XX3A 5LZ7A 3LTEA 1XNHA 2FZWA 4TWBA 3HBLA 4QTTB 1FQWA 4C04A 3ZWVA 2IODA 2FP4B 2ZTVA 1SELA 3AJRA 3ADBA 3BQMB 2JDID 4P4NA 5TT1A 4B3RB 2G17A 4M1KA 3UAWA 5GY7A 2Y6UA 2EW8A 3FR8A 3IPXA 5DXJA 4MVJI 2G3YA 3QWIA 4HVTA 2M2IA 2JA2A 1KO1A 3WWPA 3WLQA 3GUHA 1ICEA 5BUSA 1YE5A 4M46A 4DLPA 4M1YA 5DI3B 5J63A 2XTMA 4DJTA 4P58A 3V8NA 5EIEA 3T9FA 5JYDA 2EGGA 4U39A 3DEIA 1GZ7A 3QPAA 2PL5A 1PNQA 1UT5A 5CT5A 2WY2D 4CTJA 2QTHA 3BVPA 4CDGA 4DS3A 3ABQB 3O47A 1KTVA 5FX2A 4Z53A 2NSDA 3TW4A 1FNNA 3A4TA 4YN3A 3ZEAA 1WF3A 2WE7A 4S0XA 2Q4EA 4L4XA 3JYNA 3SD7A 4OY3A 4QWWA 5BT9A 5ALEA 5DYGA 3HNOA 3OZ7A 3HU3A 2CV2A 3AILA 1U9YA 4I0WB 1SBIA 3ICVA 1MBZA 2Q2OA 1USGA 2IU3A 2V7PA 3HXMA 3R3UA 1XB2A 2JJYA 3WGLA 4BAZA 4RA9A 1DAKA 1GKYA 3K8OE 2AE2A 2H1HA 3TNLA 3S4YA 3P2YA 1NF8A 3R9WA 3TRJA 1SIOA 4DAEA 1QORA 4O4JF 3WLTA 1JIVA 1NQUA 3QHQA 1KR2A 4ZU3A 4YRJA 4DSAA 3BERA 2RI1A 3NDPA 1ISMA 3FOBA 3FXAA 5CDFA 4PC6A 1LSUA 1L1QA 2FSVC 1GNSA 1J00A 2LE0A 2YN4A 3CSSA 3GFPA 1CLUA 5G0TA 3U09A 5FOQA 2ZZMA 2GFIA 3W5UA 2O0HA 1AV6A 3CF0A 3RFFA 1FNDA 2IKSA 2ZCUA 4XQGA 4F9FA 1YB4A 2JKYA 3MRVA 4PAOA 2O05A 3WKCA 3C7AA 4Q01A 4AZSA 2SECE 3PG5A 1RC8A 2NZXA 3VTFA 1KKUA 1U1GA 2Q45A 1UDRA 5K6TA 2RH5A 3HHEA 4LVOA 3SZGA 4MIYA 3A4NA 1MJGA 2WIBA 2ZRJA 4OQYA 1KAGA 3CXRA 4P92A 1Y1SA 2JATA 4YRCA 5EWLB 5HBRA 4YXFA 1PV1A 5IVIA 4ABTA 1N6KA 2IW1A 1COWD 3PQ4A 1T3SA 1QNFA 4G8JA 1E2BA 3EWIA 4URXR 4AQ7A 4O2LA 4QXPA 4D79A 3AETA 3EPPA 1WP9A 3KXLA 2B4KA 3AUFA 4FS3A 4HT3B 3RHZA 1CERA 3IUMA 5DMXA 4B4WA 4EEKA 5BSRA 3F5DA 1ZUIA 5F51A 5LBTA 1FS5A 2VSFA 1Q0ZA 2W71A 1QS0A 1AHPA 5EP1A 1M5RA 2XDQA 2WABA 4RA6A 4M0LA 1KI6A 3LQFA 4DLLA 2VIIA 1R5BA 1T8SA 5DGTA 1FU7A 1I7PA 3PZBA 1C4XA 1SQSA 4BNHA 1P2UA 2VP5A 3F9IA 3FWYA 3K30A 3L0DA 3MJTA 4HP8A 4HRVA 4AG6A 4BVLA 4EITA 4OBBA 3VDMA 3ZCPA 2X42A 1CDZA 4I3FA 3VU0A 5MGNA 3WQBA 1IHDA 2QJOA 1RBYA 1JHUA 4UM7A 4CIDA 1D4ZA 4NOLA 2IRWA 3GV0A 4BKMA 3BJEA 3RCBA 3VSBA 4CHGA 5HQTA 2ZIFA 3U37A 5CBKA 3KNZA 3VO1A 1A7KA 3OE5A 1NYTA 4C3OB 1T3ZA 5HDQA 4O4IF 4IF4A 2WM9B 1BDJA 1JSRA 4OAOA 2FR8A 4UNNA 5U4QA 4QDXA 4P4LA 1KKLA 2HXYA 1H2AS 2C4KA 2FW9A 4OFWA 1KJJA 4LSMA 4ZZ2A 2CV1A 1NQWA 3N2NA 2ZKIA 1G0OA 3OZBA 3TXYA 1XTUA 5ALKA 3OZUA 1SULA 5GV7A 4BQSA 2A5JA 3ZN2A 2AR0A 4U1RA 1MJNA 4LF6B 4OMUA 2V6GA 1T13A 4Q3DA 4EPYA 4JXJA 3VSDA 3SVLA 1VB5A 4XGNA 3R23A 5J23A 2PX6A 1P39A 4WNAB 2BKVA 1KXJA 2YRFA 4QXAA 2Z9DA 2X4DA 3G8BA 3I2GA 4QBHA 5CXSA 2A1TR 4MGEA 4MV9A 5JMWA 3GP8A 3EBLA 3NOOA 3LSTA 2YVAA 4BN0A 4R71A 2F3TA 3P9KA 3GNQA 4Y9UA 3GLRA 3OTWA 4IXNA 3LIIA 4NF2A 2BFAA 4J43A 3STHA 4DCTA 3DZFA 5EHXA 1D2CA 4QJIA 2YFKA 3D0KA 3AJ8A 3EGIA 2X9GA 3LPDA 2NZVG 1MR3F 5M34A 5IM4A 5CW2A 4ZQHA 1C50A 4LRYA 3WDKA 3DT6A 4MGHA 1IUOA 3EG9A 2C82A 5K20A 1TEZA 2IDJA 1O8BA 3PD1A 4BFXA 1Y4UA 4DWOA 3ETHA 3UPDA 4XJSA 3FDZA 4I5FA 4UTVA 3CVUA 4ZREA 2XUJA 2G9NA 4NJEB 3AR5A 1H8HD 3ACBA 3K3PA 4M6WB 5BMVF 2B1JA 3ASUA 3FVRA 3NOXA 4QUBA 1DO0A 2AZ4A 2QTRA 3TPZA 2E48A 4ZICA 2DBQA 1BXGA 3CPJB 4UQPA 4UTXA 1QZZA 1JKIA 4N0EA 4YWJA 2Q0XA 4NMMA 1ZR2A 5A0FA 2BBTA 2PIAA 3WLOA 4B8WA 2XLCA 4YPOA 4BFVA 4ADSG 2PV0A 3C70A 1JJVA 3UH1A 1E4YA 1YOBA 2LCQA 1ZL0A 3CISA 4KIGA 5DXFA 4DG5A 1Z7WA 4LOKA 4DT1A 2DKFA 2FFRA 1JHQA 2WUWE 5TPZD 5J40A 5E9QA 3OCUA 1NBME 2BHTA 3TZCA 3WOVA 2NNLD 1JG1A 1JA0A 1R5JA 2A0KA 3K16A 4B44A 3NI2A 2IGBA 2QJTA 1GRVA 3PDJA 4UNPA 2PZMA 3TZKA 1WSWA 4P3XA 1ES9A 3VM6A 2VJQA 3SYNA 1OX5A 3O4VA 3HYRA 3P32A 4R51A 1PKEA 1BKYA 2BVNA 4Q5IA 2XCTB 1ADGA 1ISPA 1H2WA 1Y6ZA 2P9TA 3TIFA 2G5TA 1WZUA 2GF0A 1TUBA 1FQJA 5ECGC 1J7JA 3CWZA 3NC4A 3V6LA 3HCFA 1BE8A 1OWLA 3OAAD 4MDHA 1KOLA 1I33A 2CT8A 3G9TA 5HR5A 4CEHA 2P90A 4MUEA 3ZVKA 1TIPA 1UOPA 2BFBB 2WJGA 1IXKA 2OWEA 3LT2A 1RYZA 2CVHA 2HI0A 2Q3EA 5AKEA 5ALYA 4ZVSA 2GVDC 1XWIA 3B85A 1Z6GA 2PRKA 3AQIA 4Q24A 4HYTA 5ES3A 3ZBPA 1HURA 1QWOA 4CMIB 4KYIB 5K3OA 4RXTA 3PGLA 3SZUA 2QYTA 1Y33E 2HYDA 1X7YB 4CMBA 4CODB 1NYRA 2AXNA 1ZD8A 1VHDA 4DIEA 3HH8A 4HDKB 2JJ1D 4WGFA 4XGRA 5KO2A 2IXFA 2V7WA 2QV7A 1AC5A 1L8AA 5KTRA 1D6NA 1EFKA 1PG2A 3DEYX 2H4YA 3FSJX 5AD1A 3MWGA 5SICE 4FNMA 4B4DA 2DQKA 1SO8A 1TZBA 5HRAA 1B6SA 4LZLA 5HKOA 2W8BA 2BISA 1N0VC 1NUQA 3FOWA 3WWDA 2P5TB 1WUHS 1G38A 1MPXA 3PDWA 5KSWB 2WQ6A 2B34A 5CD9A 3T95A 3TR0A 2NU8A 4RMIA 2MCFA 5J1SB 2O50A 1J09A 4FX2A 1E2PA 4CG3A 1YRAA 2UZ1B 2XKBA 1YS7A 3TRFA 2CLHB 1P62B 3AW9A 4GPBA 2O3UA 2XUKA 4NPAA 4URFA 1VJ0A 2ZYAA 4OV6B 2P77A 3UUFA 2XZOA 2RGRA 4Q1AA 2G4CA 3RSGA 3PHGA 3LO8A 3GJSA 1XK7A 2RKOA 1FJXA 5L6MB 1IAVA 3KZOA 4B3BA 4HH4A 1N7IA 4R16A 3MJ4A 1KZ9A 1M7GA 1MAHA 3NH6A 1RI4A 4JP8A 1JZQA 4R2XA 4KQ2A 3HFRA 1DOAA 2PX4A 3SF8B 1EHCA 3JSXA 3V1LA 2LD4A 4AIIA 5ITVA 2OHGA 1A97A 4BBJA 4Z7QB 2QL9A 2V9ZA 2ZYHA 2WVAA 3AM1A 1OV6A 3HXQA 3DEAA 2XJ4A 2AFRA 1Q95A 2AUTA 2JIZD 5F33A 3QUBA 1E2JA 4GZLA 3G2HA 2IXBA 2W98A 2XZPA 3LPMA 4UASA 3V55A 1AKWA 5L3ZA 2B4TO 2FN3A 2HU2A 3ELUA 3OM1A 2P7IA 4P5EA 1GFZA 1A98A 5H9WA 3NHLA 2R60A 4HYQA 3ZE1B 3LD9A 2NUBA 3LKDA 1H8ED 1M83A 2QP9X 2F90A 5ICEA 2P0YA 3FCAA 2MWMA 3TQIA 1LQ2A 2VYFA 3ESYA 4Z9XA 3ZCSA 5KEIA 3LUAA 5CXXA 3K15A 2NUPA 1R6DA 1MB4A 4R7GA 5IK2D 5T7BA 2W42A 1NWCA 4N0MA 2AQHA 1YB2A 3HKEB 4B6FA 2D5IA 2RHRA 3NRCA 4LHWA 1B3BA 1HZZA 3RAFC 3MMSA 2M9MA 1V95A 2ZJ3A 3B3QA 4JVSB 5FP0A 3IE2A 1HWYA 4IJQA 3FFXA 3VPAA 1OBOA 4LY6A 5FLEX 3X1MA 1BDMA 1TUEA 2AJCA 3CUWA 4WOKA 2QD1A 3BSSA 3QVXA 2ZSJA 1SVUA 4M49A 3AIMA 4PWYA 1MH1A 1LSOA 5TF0A 2W2MA 1CQPA 2EBHX 1LSSA 5EE0A 3MXOA 5JVDF 1IPFA 3INRA 1CRLA 3AJEA 4Y8VA 3JQ8A 4ITVA 2QRLA 3I42A 1U1DA 4R2WA 2FZLA 1FZQA 3BM5A 1F7UA 1H3FA 4CU5A 1TT5A 1WMFA 2ECPA 4H08A 1YV9A 4FSDA 1U7UA 3KJXA 5KJFA 4BY9E 1ZC4A 4PR3A 2Q3LA 1XZLA 2WKRA 5H4GA 1XD9A 3L6RA 3AKCA 3DFUA 4PYMA 4INPA 1NATA 1JKMA 4BGIA 3UANA 3VJMA 4OH1A 1B3RA 1UP6A 2JAWA 1J2TA 5D01A 5TPWA 3UA3A 1B6RA 3ANLA 1Z6ZA 3CU5A 4D9KA 5BMOA 3P0FA 3G8AA 3RVKA 3REFA 3C6MA 2FEPA 5C8ZA 2WTNA 1PGOA 1ZOPA 1G291 2GPWA 4C4AA 2ZUEA 4MPTA 3GRYA 4EUFA 2Y92A 3L6UA 4OP1A 3GPLA 4FJ1A 1K27A 3I8XA 5DYNA 5BXQC 1M7BA 2PMFA 2QTBA 3S6JA 3ZJYA 4E5NA 5KNDH 2FGJA 2PBZA 2FI1A 4LVNA 1MENA 2NZUG 1LKZA 3F6SA 4MYRA 5AVOA 4YYZA 2XZLA 5D3MB 1YE3A 4AKGA 1M2VA 1VHLA 2VSOA 1GCAA 2ZJ8A 5D84A 1N75A 1JIXA 1XFDA 2Q1WA 4OFXA 3Q9LA 3TLXA 3JAMA 1RXVA 4HR7A 2G25A 2IHZA 3KR0A 3CYFA 4KXMA 1L5QA 4RAQA 4DC1A 5LWQA 1KFEB 2C7RA 1C8KA 3T1OA 1BQEA 1OBFO 1XG5A 1T6ZA 2J87A 1VE9A 4V24A 3AEUA 4Q48A 5CB4A 3U4GA 1NJSA 3E9DA 1JALA 1ID1A 1UFRA 1A04A 1KU0A 3VOSA 2OYCA 1ZAYA 1UBSB 1JR3E 1PFVA 3DE7X 3EY9A 5JBNA 2PQ0A 3TNFA 4D57A 5I01A 1ZQ1A 2OV3A 2BFEB 3FVTA 3H9CA 3IRUA 3EUWA 1EWVA 2O2EA 4FINA 1F12A 3KKMA 3SLGA 1QQ7A 1LPBB 1TU3A 3CH4B 4CL0A 1V2GA 1MN6A 1P9NA 3RM3A 5KQMA 1DAGA 4S24A 2W4MA 3ITKA 1ADCA 2GF9A 1JAHA 4LA4A 4LYGA 3WA6A 2QE6A 3MUOA 3WAKA 1OAKA 1ZM9A 4DV4B 3WK9A 3GJXC 1DEHA 2X19A 3G82C 4C0AC 1UT8A 2EW1A 3N59A 4R0NA 4DQXA 4P7JA 5TE9A 3ITNA 4GM1A 5IUJC 2HDOA 2Y9PB 1DIGA 4RVDA 3IUNA 5CMLA 5DN9A 2X0EA 3ZGVA 1UDXA 3OMXA 3HVHA 5REQB 2I2WA 2YJ6A 4E6EA 4EM6A 5KQRA 1MC4A 2YY7A 3KUXA 4FGSA 1E62A 2REBA 5T8KA 1VPWA 4IDPA 2C84A 1HQYE 3LGSA 3FZYA 1FRVA 4WADA 3PHCA 2QLTA 2B83A 3IP1A 4FNAA 4YMUA 2HHHB 2ZT8A 1CUGA 2PFKA 4JJ6A 1NW3A 4DA7A 3L0CA 5CGZA 1ESMA 2VPTA 4F3TA 3N3BC 4I50A 4IW3B 4DM7A 3EH1A 4Q4HB 3A10A 2FSFA 1W52X 3AVOA 3U7EB 2F9LA 1NZJA 5DI9A 3RTGA 4OIMA 5C46F 5J43A 3LBIA 1YRHA 4RF3A 5E9WA 3E23A 4ZTZB 2UZ0A 1VP3A 1JXOA 1N1EA 2BFDB 4I6JA 3SZRA 1SUFA 1ULSA 2G5CA 1OZGA 4QU5A 4X6UA 3USES 3B8EA 1P91A 3DT9A 2IOFK 4H3VA 1LDEA 4IR7A 1Z39A 2G28A 4KVAA 3TXAA 2C07A 4FYPA 3AERA 1XCJA 1H2XA 2LKCA 3N2KA 1AZSC 5EUCA 1T9DA 4GPAA 1NXQA 5AQEA 3NX4A 3C43A 3GG2A 4E12A 2FPWA 2Z9CA 1F51E 1L7RA 4C89A 1E9VA 1K8XB 1XXLA 1GARA 2FWRA 3UHOA 5B58C 3HYSA 2WB4A 2HIAA 3QHPA 4NABA 1W29A 4CKXA 1Q1GA 1XEFA 1PQWA 3TI7A 2VQ3A 4BGEA 1GUFA 1WV1A 2PMDA 1PT6A 5FWDA 3K0BA 1W5SA 4Q0MA 4XZ3A 2CHFA 1KYIA 1KF0A 2QRJA 2N9UA 5FCDA 4FFSA 1QG0A 4QLBA 5CA0F 3RRFA 5CT8A 3WNDA 2L18A 2VOEA 3BWMA 3DEHA 3DMFA 1GKUB 3TAXA 2ZRGA 3B2EA 4FMBB 2NQ8A 1NNSA 1HBJA 2FP3A 5TX7A 1JEQB 1N2EA 1ZNYA 3VC1A 1I2AA 1T4GA 2DUWA 3HUTA 4HZGA 4MMYB 4M7RA 4EJFA 1RMQA 1UWKA 4MAFA 5AJWA 4KPYA 3KHKA 5ICMA 2AX3A 2NVBA 4OG2A 5FPQA 2ZI3A 3OLZA 3D6AA 1W4CA 2G1JA 2GQ0A 3P26A 4DYVA 3PHIA 2NO7A 1Y8QA 1BXRB 2A4MA 2BE7A 4LXXA 3Q3GE 4G4JA 3E58A 3C6QA 4TWJA 4L8LA 1T2VA 3HEBA 4BE7B 3CN9A 3HBNA 4AY5A 1V4NA 4WECA 1NBMA 1SXJD 2FPIA 5KVQA 2V55B 3QVJA 4RDCA 3E7PA 3P4UA 3KSDO 2VJMA 1ZVKA 1L5SA 1O96A 2QD5A 3KJGA 3LCUA 4HQKA 4Z4GA 4KFUA 4YP7A 3N75A 4IQFA 3D7MA 1N8NA 2NACA 3I3OA 2BKLA 3KDPA 521PA 1V5FA 4B2IA 4BZWA 4DGQA 4YAEA 2XMSA 4PLGA 4OQQA 3VR5H 1P3JA 1YFJA 3HM2A 3R3SA 5G02A 1B0UA 1XTRA 1EK2A 4O0MA 2GESA 3AU8A 3PFFA 4UNIA 4L0MA 3RROA 2HEGA 4CLRB 4FW8A 3NG1A 5JZOA 4KXFB 3EMDA 5A0VA 3V33A 1Z4LA 1I94B 4BNVA 3UFXB 4GRIA 3GOHA 4WK0B 1VC2A 2DPMA 5FEUA 2ZK7A 2J33A 1DWOA 4U8GA 1ACJA 3JYOA 3WBKA 5AW7A 2RBKA 1YK1A 2JAQA 1KOGA 4GF5A 3ACDA 4FDTA 3ZIUA 1WPRA 2A1UA 2HNBA 4AN0A 1Y6JA 3MCAA 3HJBA 3ND9A 4V2IA 4KXLA 1XTQA 2VJKA 3DDZX 3LY7A 2KBEA 1VL2A 2CKDA 2C4HA 3RTEA 4BQRA 1QRSA 3KR1A 4Q7QA 1IUNA 4II2A 2XKJE 2XMQA 2B8EA 2YNMD 3RS2A 3TLCA 3CKMA 4PLTA 1EJBA 4J0EA 4Y3UA 1J8VA 4MUXA 4WQMA 3P0RA 4GR5A 4MS4A 3RBXA 4QM7A 1KA9H 4F8EA 1Q2XA 2W2QA 5B7NA 5C3UA 5TVKA 4YQZA 1BS1A 1DBWA 4HDNA 4X84A 1B93A 1BVRA 4GWLA 3QOXA 3X1KA 3AKDA 1WKCA 1YQWA 4CUKA 1O0SA 2HN9A 3Q7PA 4M1QA 2P69A 5G0VA 1G8FA 4MWGA 6REQA 1W8IA 1G3RA 3NHKA 4NAVA 3SC3A 3BH7A 4AQDA 1D0SA 5ENVA 4COKA 2QM7A 2WSSA 3CO0S 4QYIB 2GLTA 2WWXA 3D3KA 1L5HA 4CGYA 5J4HA 1S2NA 1RI3A 1Z6AA 3SR0A 2YXLA 1CUAA 3BFXA 1KDOA 2HWXA 4S1WA 3EQ8A 1JLRA 2C5HA 3LP8A 1KY5A 1E6MA 2NYAA 4PRZA 5MHTA 1BC5A 3AKYA 1E9FA 4OHXA 2PAAA 2TMDA 4C7JA 3U4QB 3VVMA 3DTVB 4ARCA 1VKRA 2QYOA 3AIOA 3RS4A 3AIKA 4R9SA 1TQ6A 3ZLTA 1INLA 3O2QB 1DC6A 3CVXA 1BE0A 2XGJA 3W04A 1FP2A 4KO2S 2I9PA 4FHFA 3MS2A 5AVZA 4GMKA 4HOYA 3RV4A 3L8ZA 4QOSA 4OX9Y 1NR7A 5LYYA 3FKSA 2WG2A 5CNIA 5IDXA 4UU7A 4WVFA 2WE8A 1JFVA 1L6IA 3EXIB 2W2LA 4P3YA 2QZZA 3AHDA 4UVGA 3RRNA 2PUDA 4MP6A 4PZEA 4BATA 2IOYA 5B2FA 3I9NA 1SG0A 3V00A 3V1UA 1GR1A 1SY7A 2P2NA 3Q41A 3TRHA 4NTZA 1WBJB 4FDVA 2WICA 2XT9A 5DNAA 4JZYA 3U7JA 5GP1A 3C16C 2F3PA 2G9UA 2ENWA 5L95A 4K26A 2I33A 2CYBA 4E4RA 2YY5A 2XNSA 1Q19A 2ZDQA 4KLAA 4Y2UA 2XTJA 1B2LA 1L5VA 2FEWB 2B61A 2YFQA 3FCCA 3H6GA 4HGPA 3T38A 3W7VA 4AY3A 3I8OA 4F4FA 5JROA 3D0QA 2OQIA 5IAOA 4H1HA 3CLVA 1B2RA 2JHAA 1DTWA 1U6IA 2PZLA 2Z1DA 2BRUC 3CB4A 3GX1A 5CYFA 3VYUB 4E03A 2VWQA 1J6UA 2D8MA 3B2QA 3KS9A 4UJ5A 3GH3A 2P5SA 4F4DA 3F90A 3MBOA 1PZXA 4GC9A 5JMOA 1ULZA 1Y6RA 1PT9A 2E85A 1BIFA 2I87A 2V58A 2EEPA 1QHNA 2WDPA 3PXBA 5G4KA 4BB0A 1L6RA 1YJAA 3DONA 4G5XA 2OHIA 3X1JA 4DV0B 4RK1A 3I30X 3QOFA 3GZNB 4HDMB 4LC9A 3UICA 1YMVA 4NYJR 1VMIA 3W34A 3U7GA 1XU4A 4YP6A 5AVQA 2ZYUX 2UXCB 3WWEA 2ZSFA 5HIMA 2EKZA 2O1SA 3K0SA 3PFCA 4CWAA 3CX6A 3GRKA 5AOAA 1L4BA 4GECA 1M6VA 2DU8A 1A0OA 4B43A 4JQYA 4ZAVA 1FDWA 2O1WA 4HCJA 1GP2A 3U4IA 2AFIA 3K9QO 2ZSIA 3FFTA 1TM3E 3OCZA 3HSKA 2H1IA 2ZYDA 4FQ5A 1PGQA 4Q18A 3IP7A 4RZXA 5TF4A 4X92A 4YT4A 3T1HB 2HIHA 1GPLA 3QQPA 4U6NA 4EF5A 1LRJA 2FKAA 1CC1S 1Q7CA 1ZUWA 2B21A 1XQVA