5IZCC

Trypanosoma brucei ptr1 in complex with inhibitor f032
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
268
structure length
239
Chain Sequence
MEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploiting the 2-Amino-1,3,4-thiadiazole Scaffold To Inhibit Trypanosoma brucei Pteridine Reductase in Support of Early-Stage Drug Discovery.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords Pteridine reductase
total genus 89
structure length 239
sequence length 268
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2016-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5izcC00
4XJTA 4MVJE 2Y93A 4F6CA 1ORRA 3M1LA 1GQQA 4YT4A 4DTIA 1FXSA 1Z7BA 3JD1A 3JCZA 4RVDA 5TX7A 3WFJA 2VRBA 1J4AA 3SJ7A 4WCFC 1PJLA 3ZNQA 3OJOA 4GWKA 1UAYA 2Z1MA 3INGA 4LGVA 3DC2A 5BT9A 5ITVA 5L53A 1R4MB 1RPNA 2Y1FA 1DRVA 4ZN6A 2DPHA 4IMPA 3BIOA 4IY1A 4D3DA 3K2BA 4XB1A 1GZ4A 1QORA 3Q9UA 3EVNA 2Y99A 4NU6A 3RKRA 4CMEC 1DJNA 1MFZA 1VKOA 2ZCVA 4QO8A 3WR5A 3JQ6A 1GADO 3B1KA 1EBFA 2HMVA 2IXAA 4RPGA 1SEVA 3FCOA 2DVMA 1LNQA 4RF5A 3K30A 1ULSA 4N5MA 4OSPA 1NASA 5L4NA 4P4NA 4IDEA 4YCAA 2NTVA 2X4GA 4K1LA 4CM5A 3NEPX 2ZYDA 3Q0EA 3V5NA 3JQ8A 4CQMB 4NFHA 4I1IA 4RPKA 2V6GA 3DR3A 5EIOA 3OJ0A 3WIDA 2J3KA 3TOXA 5GZ6A 3ZNOA 3F3SA 5B37A 3KVOA 5JSFA 2UV8A 1F8FA 4E5MA 3S2EA 3GC6A 3VZSA 3ZNPA 3KYCB 5TJHA 2QYTA 1CYDA 1KEPA 4PG7A 4UAGA 2X7HA 5JDIA 4A03A 2JKVA 2NADA 5BSGA 1XQ1A 2ZB4A 3JQCA 2NU7A 3U09A 3R1IA 1VKNA 2ZKLA 2I65A 2CUKA 2VHXA 4R9SA 2OP0A 3KLMX 4O6VA 4AJNA 3RC2A 2Y0CA 1Q7GA 3DBLA 2C82A 1Q0LA 3KOUA 3L77A 2HKIA 2YYYA 3PQFA 4Y67A 1YO6A 2FHSA 1DHTA 3TZHA 3QSGA 4XR4A 4XRRA 4HV4A 1X7DA 4IXWA 2YHUA 4ZQGA 4QXMA 1NAHA 3JQ9C 1XYGA 3L4BA 5F1KA 4FW8A 1R16A 1W8DA 1ZK4A 1PX0A 3TZQA 4RL6A 5F5NA 4FFMA 3VZRA 4WASA 1OAAA 4HP8A 5AOVA 4II3A 2VQ3A 3ITDA 1F0YA 5CEEA 1ZVMA 3D4PA 2WDZA 4ROSA 3WS7A 4CMEA 2PKRA 1FDTA 3ULKA 3L6OO 3N74A 5L4LA 3PGXA 4YAKA 3LT4A 1E6UA 4W9NC 1VJTA 3W6ZA 1PGQA 3SJUA 4BMVA 4BO2A 1JKJA 4CM8A 4H15A 1UH5A 5JAQA 2WSBA 3JQGA 4IXTA 4QEDA 3WICA 4C7KA 4LISA 3JD3A 5CHEA 5G0UA 3GAFA 3VH2A 3F5SA 1L1FA 3GUCA 1PGPA 2GN9A 1JA9A 4IJKA 4MVJG 4I9HA 5U4QA 1U3WA 1YQXA 1X0VA 1Z7EA 3VH3A 4CUKA 2B37A 4H7PA 5A3JA 2CSUA 3RWBA 1G1AA 3AFMA 4I8XA 4RDIA 4J1SA 2FN7A 4E5KA 1CF2O 1DPGA 1B3BA 3H9QA 4ZD6A 5JMWA 4CLOB 1YBMA 3O4RA 1T1SA 1U5AA 3GGOA 3GLQA 3KXDA 4UUPA 2YV3A 1UDAA 5LCXA 4PLZA 5A5FA 5JDIC 4HFRA 3SLKA 3T4EA 1HTBA 3I9OA 1UDBA 2JFHA 4GLLA 4QO7A 5TS3A 3U62A 3GVPA 3WIEA 4DBZA 1C1XA 3F47A 5GZ3A 1S7CA 4J7UA 3KZVA 4DIFA 4IIUA 3ETDA 2B4QA 3MJVA 4CLDA 2D8AA 5A5EA 1PJBA 1LDYA 4DYDA 1K2WA 3WTBA 3FSRA 3KLPX 3BHJA 3RU7A 4FGWA 4L8VA 5CDUA 3KTDA 2BKAA 3BHMA 1JN0A 4DLLA 3U5TA 3L9XA 2A92A 4LRSB 4TRNA 1TA4A 3GGPA 1DXYA 3KV3O 4CR7A 1JQBA 2C59A 2J3IA 4AJEA 4R5MA 4ALIA 5A03A 2I3AA 4BO9A 4JQCA 1BVRA 3AUUA 4FFLA 2W2KA 1C1XB 1CDOA 3SXPA 3UCEA 1E7SA 4BNHA 2NLOA 4J4TA 3D3EA 1NVMB 1ID1A 1JAXA 3KSZO 4TKLA 1NR7A 1X15A 4DLBA 4DWVA 1MXHA 1KY4A 5IDWA 2O3UA 1ZJYA 4HNHA 4MIYA 3VH1A 4Z6KA 1GUFA 2VHZA 2HMTA 4WKGA 5ILGA 1OI7A 1QYCA 2OXIA 4EW6A 4YPOA 1ONOA 3I3OA 3QVSA 4IDCA 4RCVA 1N1EA 3JYPA 3JQDA 1FF9A 2QW8A 3RUAA 1YVEI 2CVOA 3CMCO 4WNIA 5C37A 3WOHA 5IZCA 1SEPA 4H3VA 3RC1A 3DTYA 1YJ8A 3JSAA 1KIFA 2O7SA 4I5FA 4Q3AA 3WGTA 3ETGA 4LN1A 1NXQA 3E5MA 6LDHA 4BNYA 5I9NA 1O6ZA 2IZ1A 4ZGWA 3FPLA 1PJQA 3FBGA 1U2GA 4XYMA 3KSDO 3NRCA 2P4HX 1C0PA 3NTRA 4RLSA 1PJSA 2YFQA 4PLCA 3SC6A 3AU9A 4HADA 2PKQO 2GZ1A 3NDIA 4L75A 4NQZA 3ZHXA 2QZ9A 4IDDA 5L4SA 3PHJA 4KDEA 5THKA 5C5IA 1MLDA 4PG6A 4E31A 4CMJA 2NU9A 2BHLA 1NQ5A 3TN7A 1NFFA 1WDMA 2Q49A 4QTZA 1SPXA 4W7HA 2GUGA 4WE3A 3ANNA 3JYLA 4U0JA 1TT7A 3LF2A 4J0EA 5ER6A 2NVBA 1R37A 2Q1WA 4J91A 3CSDA 3E9QA 4FN4A 1K6IA 4HUJA 1NWHA 3JYOA 4E0BA 1A4IA 3KEQA 3ZGYA 1T26A 3EAGA 5L9AA 2IE0A 3PYMA 4S1VA 1WMAA 2A94A 3HWRA 4RVSA 1H6CA 3S2FA 1T2AA 3F6YA 1FJHA 3DZFA 4RVUA 3IKTA 1E3JA 4J2OA 4KUGA 1RKXA 4W4TA 4OMUA 3TOZA 2B0JA 4TRJA 4YT2A 2EKLA 1B3RA 2BD0A 4R3NA 4PLYA 3LT2A 3FR8A 4A27A 5FYDA 1EVIA 2NUAA 4TQGA 4YAEA 4XQGA 1H6AA 1P45A 4PRLA 5B4UA 4K9DA 1LXCA 3NTQA 3FPCA 4GPD1 1EQ2A 3BXXA 4QX6A 5MDHA 1JVBA 2TMDA 4CM7A 2EHDA 1LSOA 2FOIA 2VNAA 3JQ8B 5K6AA 3RUCA 3JQAB 3KSUA 5KKAA 4E32A 3ZCXA 3H6KA 5AQ1A 1B8UA 4Z3DA 5T8KC 5IDYA 1F8GA 1HE2A 3JQFC 3HNPA 4L4XA 4WLNA 1KVTA 3EC7A 3WJ7A 3WYCA 3MJ4A 4BNIA 3WGOA 3DBVO 3H5RA 4N5NA 1PEDA 5G4KA 5JMPA 2YQ5A 1SAYA 5DDIP 2V6MA 2AE2A 1DJQA 3U49A 3PJFA 2X23A 1BXGB 5H83A 1CRWG 4PCVA 1U3VA 3GVHA 3AI2A 3K5PA 4IMRA 5DBFA 1E3WA 3ADPA 3HJAA 3DMTC 1XWFA 5KVVA 4B3IA 1N8KA 3IKVA 4UULA 5JY1A 4YRDA 3RU9A 4UVIA 2HAEA 3QY9A 3CPSA 3OJLA 1XA0A 2E82A 1Y5MA 3D3WA 1PGOA 3EUWA 3GGGA 5TQVA 4E13A 5T5QA 2VNSA 2HQ1A 4CLEA 5IZ4A 1GQYA 2V6BA 4FGSA 2X22A 2NACA 3W4IA 3H2ZA 4MVJM 5DN9A 4LVCA 1ZCJA 1QYWA 3DWFA 1X14A 3NTOA 1FDUA 2IRWA 2B4RO 4PIVA 2J5RA 3S2GA 2X1HA 3BMNA 2GYYA 4TROA 5AXBA 4BOYA 4BNLA 1NX6A 4MJLA 2OL4A 3ZWXA 3G1TA 2PNFA 4FC7A 4C4OA 3OM9A 4YXFA 4MKXA 2B35A 4J4BA 1N5DA 5COAA 4BKRA 4ONEA 4BO3A 3GAZA 1SMKA 4ALNA 1I36A 1VM6A 5DF1A 1LRLA 3I9JA 1ADBA 2VWQA 3HFSA 4YB8A 2H6EA 5L51A 2C20A 3E5RA 4IINA 4BKOA 3ZDFA 3JQFA 3RJ5A 4I9NA 1NVGA 3BA1A 3BMQB 4GGOA 4HKTA 4CMKA 5HS6A 4ZRNA 1T1RA 3UW3A 3EHEA 1UXKA 2RIRA 2A9FA 1MUUA 3D7LA 5LDGA 1K6XA 3B6ZA 1JLLA 5KVCA 4EDFA 2ZATA 1NQOA 1Q0QA 3AM4A 4L73A 4U6SA 4D45A 4IQ0A 5I9MA 4QT0A 3INTA 1ENZA 1ZJZA 3VPHA 5KJEA 5AXDA 4CM4B 4JROA 3IQDB 1JVSA 3UOGA 4NJMA 3AI3A 4FFPA 4X54A 1I3NA 2G17A 3BMNB 1DO8A 1MV8A 1EFLA 4OOFA 4CR8A 3VDRA 4DLAA 3X2EA 3TWOA 4BGVA 3D64A 4PZDA 4EJ6A 2NVUA 4XYLA 5EJ2A 2ZK7A 3WFIA 2Q1SA 2FZWA 1LSUA 4CUZA 1G6KA 1U7HA 3OEWA 2CNBA 5T8KA 1PL8A 3EMKA 3GDFA 4GI2A 4KUEA 2BI7A 4B8ZA 4ZICA 7MDHA 1W4ZA 1P77A 5CEJA 4F46A 4U8GA 2QG4A 1PL6A 4R9RA 2BGLA 1PZGA 5CDGA 4BKQA 4NHEA 1IB6A 4UVGA 1VL8A 1GFSA 2LDBA 3I4FA 4I5DA 3ON5A 4GVXA 1GPDG 2AHRA 2FMUA 4XYGA 2DTXA 1ZSYA 3QHAA 4EI2A 5I7FA 4TMFA 4F3YA 4NPCA 1A4UA 1PGNA 4QSMA 3U4IA 1B0AA 1GY8A 1PS8A 3UICA 5IAAA 4CR6A 4DMLA 3DHNA 3RUEA 3LDHA 3IC5A 1BGVA 3GK3A 4JK3A 4DGSA 1KVSA 1WDLA 4NIMA 3VZQA 3HB4X 5A9SB 2PGDA 4NR0A 3DHYA 3EZYA 1DFHA 2BELA 2P91A 3BMOB 3H9UA 3DZGA 1ISHA 3SEFA 3Q1LA 3ONEA 1ZK1A 3PLRA 1YL5A 2DLDA 3C3XA 2IDZA 3NYWA 1PQUA 3OJEA 5JCJA 1SBYA 2D2IA 1GV0A 3I9KA 4NI5A 1QXSA 4JJGA 3NJ8A 4HNGA 1KERA 1DIAA 4UUOA 4LVUA 2UDPA 1HYGA 2R00A 4YQYA 5F5LA 2A4KA 2Z1NA 3UVEA 2JCVA 2YZ7A 4G2NA 5LDHA 4BUCA 2NQTA 2VN8A 2X0NA 1DDOA 3GHHA 3GUYA 2O4CA 3OBBA 5G0VA 2JAPA 5CEFA 1LI4A 3CMMA 2Q1UA 4RJTA 4Z9FA 1TB4A 3ADOA 1P1IA 3E48A 2JD1A 3Q3CA 4OL9A 4JXKA 5F1PA 4M55A 4IDAA 1HF3A 1C1DB 3JYQA 4NFSA 1P31A 4FR5A 2R2GA 2EERA 1HDYA 1V35A 4BKUA 3E9NA 3HN2A 1KYQA 3AY3A 3RAJA 4KDFA 3TPCA 3C8MA 5FF9A 1UZLA 2H1SA 2I5PO 4OQZA 1J0XO 4K6FA 3B1JA 3OEYA 2HUNA 4P8RA 4D0RA 5IFLA 1LDEA 1HSOA 1PL7A 2X0IA 3PYLA 5TRTA 3ROQA 3WYBA 1V3VA 4LMPA 3ZWMA 3R3SA 4U0KA 4ZRMA 4CQMD 1P0CA 4M8SA 3D3WB 1HLPA 3JQ7B 3JQ9A 4IJVA 1E1KA 4KOAA 2D5CA 3I83A 3ITKA 4GVLA 4PZEA 3DOCA 4GGPA 1YL6A 1T2FA 4IJUA 2E49A 3LSYA 1I01A 5TT0A 2VRCD 4Q9NA 2VUUA 2XOXA 1HEUA 2X0JA 1GUYA 4QQRA 2Y0DA 1ISIA 2PGLA 3PFFA 2DC1A 4MVJP 1P74A 3QVTA 4E2XA 4MKRA 2VZ9A 4K28A 5G4KB 3D5TA 4IGEA 1DC6A 1HDOA 3QJ5A 2R00C 4UREA 1X1TA 4M89A 3ICPA 4AJPA 3DBRB 3OIDA 2CDCA 3AJRA 1WLYA 1E3EA 1D8AA 4DBVO 4UUNA 4PG8A 3AY6A 3IL2A 1U9JA 4XIJA 1AN9A 5DCUA 1UXGA 4JBHA 4P38A 3PJEA 4MIEA 1IOLA 3H65A 4EGFA 6ADHA 3OQ1A 1HZZA 3KBOA 3RCBA 5TJ9A 1HE3A 2EEZA 1PR9A 3B70A 4HXYA 3I6QA 4NJOA 4BVAA 5ER9A 3JQ7A 1V0JA 4R54A 4XQEA 4XR9A 4HWKA 4E12A 3NDJA 3ZZNA 4BKPA 1YL7A 2BH9A 1W6UA 1QSGA 2OO5A 2IZ0A 2X9NA 2YDYA 1X1EA 4XZ3A 5JDCA 3WGHA 2GCGA 5I8WA 1JKIA 4ID9A 4WEQA 4XB2A 3VPFA 3EW7A 2EIHA 4A2CA 1H2HA 4FBGA 5JAIA 3QRWA 4BO5A 1CIVA 1R15A 3FNHA 2EKPA 4L9RA 1VC2A 3E8XA 2P9CA 3PHLA 3QVWA 3WGIA 1KBZA 4AICA 3E1KA 4QFCA 5A1TA 3ROPA 3BTVA 1VSUA 3K96A 1B16A 3GRPA 1C14A 4P4GA 2CVQA 5KTKA 1ZXLA 1LSSA 4DRYA 4BO1A 3VOSA 4B7UA 1PZFA 2RH8A 1CQJA 3KYDA 1E5QA 3NAQA 1P1RA 4RDHA 1F12A 4IM7A 5U9CA 4J1NA 3V1YA 4E2ZA 4XGKA 4ND5A 4NBVA 1BDBA 4QFDA 3GG9A 4UVDA 2PZLA 4OM8A 1YH3A 2P2SA 3WSVA 2EG9A 5EN4A 1N1GA 3ROKA 2O2SA 3LC2O 3LVFO 4OH1A 4CQLB 4WGGA 4YRBA 5TF4A 1A9ZA 5L40A 5TLSA 2OBYA 3TJRA 3CIFA 2VT3A 4BS9A 4LW8A 4BMNA 3PEFA 1CERA 3PDJA 4E2YA 1GR0A 1M66A 4MKZA 4D3FA 2DBRA 5L45A 1EUZA 2NTJA 4AJLA 1OC4A 1YB4A 2FP4A 4B7CA 1DHRA 4YJGB 2FRDA 2BF7A 1U7TA 4BNTA 1AE1A 1ZEJA 5L3ZA 3VKVA 3W4JA 4DMMA 4MVJF 1W0CA 3GDGA 1A27A 4L0QA 3GMDA 3PZRA 4WCDA 3RBVA 1B8PA 3S2IA 3FWZA 2YV1A 1EK5A 1XU9A 1I0ZA 4PRKA 5JDCC 3AUTA 4WCFA 4YEDA 2FPIA 3DZIA 3Q9NA 4CMHA 1B14A 2HMUA 1E5LA 1NPYA 4BNFA 3VTFA 2OORA 1HE5A 3ENKA 5F1OA 2GNAA 4JLWA 1BMDA 4E33A 3JQAD 1DIBA 4WLOA 1WWKA 1I3MA 4XRGA 3IJPA 1ZK0A 4YJFB 2W2LA 4XEHA 5JCJD 1BVUA 1C0LA 4QUKA 1ULUA 1O95A 2DM6A 3GPIA 4B4VA 2GD1O 4JCOA 4L4RA 4OOEA 1F17A 3DONA 4IJWA 4OXKA 2P5UA 5IJZA 1RM0A 3E82A 3FD8A 1R6DA 4IS2A 3RUFA 2VYVD 3MTGA 4TRMA 4JGBA 4XIYA 5ITWA 3NUGA 5I7VA 1KC3A 2PZKA 5FWNA 1I3LA 3QWIA 4ND1A 5TT1A 3ZV4A 4CL8A 4CQMA 4YRAA 2O7QA 2QRLA 3I52A 4KP7A 4M49A 4B4WA 1M2WA 1V3UA 3WWZA 1SCUA 5TC4A 5K9ZA 1E7YA 3EK2A 5DULA 1ADFA 1R66A 5IF3A 1ONNA 1EBUA 1BXKA 3AOEC 3SC4A 1YDEA 4K6CA 1OBFO 4BNXA 1X7GA 4EJMA 1NFRA 4ZQFA 3ONFA 4FS3A 2DBZA 1VL6A 3PTZA 3X2FA 5IXSA 3GHYA 1IZ9A 1LDBA 2AQHA 2VUSA 2DT5A 3GH3A 4E21A 1IUKA 2HCTA 1ZMTA 3WLEA 3GR6A 3O38A 3EY4A 2JHFA 2D1YA 2HRBA 4JP3A 3OHSX 3PYXA 3G3EA 2FPPA 3N7UA 3HDQA 1A9YA 1PIWA 5C7OO 1I3KA 5JBIA 1L7DA 4RQTA 1ZBQA 4MP8A 1GPJA 1I5RA 3MJEA 3JQGB 2AW5A 1R0LA 3HQ4O 4JN6B 5I9LA 3GOHA 4CM8B 2WD8A 4BB6A 4B3JA 4IZIA 3FBTA 3HG7A 1OC2A 1YGYA 3SX2A 3BYZA 1I30A 4DC1A 1DLIA 2YW9A 3FHLA 4GAEA 2B5VA 5JO0A 4YA6A 4I5GA 3GMSA 1E7WA 4KQWA 2OZPA 2XPCA 3QP9A 3EYWA 4AG3A 3DB2A 1U5CA 2PD3A 3RSHA 4CMBA 1I2CA 1SB9A 1C1DA 3WX0A 4WLVA 3IP3A 1EDZA 2PA3A 1H2BA 3KETA 2VRCA 2X86A 4ALLA 3UGKA 5ADHA 2QQ5A 2JAHA 1R0SA 2FSVA 4BO0A 3GG2A 3SBOA 4Z3KA 5GMOA 4CLRA 2BFMA 2E6UX 1KVQA 3IAHA 1GEEA 2GZ3A 1VJ0A 5L95A 3GFGA 4Y9DA 3DZKA 4M1QA 1PQWA 2ZTVA 4YR9A 3H3JA 4GMGA 5TIIA 1QV7A 4FFNA 1D7OA 5A4DA 3V2UA 2TMGA 3ASUA 1SO8A 1FDVA 3WTCA 2AEFA 2EGHA 5J23A 1G0OA 3OSUA 1Y5RA 2YJZA 5JFOA 3P19A 2GGSA 1HXHA 3KO8A 3QWHA 4AJJA 3WMXA 3RFXA 1T2DA 3JQAA 3NV9A 4GX5A 5EQFA 1JTVA 5DCWA 1P1HA 4EUHA 2G1UA 3RFVA 1DAPA 1GUZA 2WE8A 2C7VA 3MJTA 1AHHA 4OKNA 5EERA 3RBZA 1WAMA 4GKBA 3G1UA 1EEHA 2ET6A 4J49A 1XR3A 1Y81A 3CH6A 1QG6A 3HDJA 3JD0A 3RFTA 2Z5LA 4Q3EA 1AHIA 2P9EA 3GY0A 4MINA 4E2WA 1ISGA 2NU6A 1E7QA 1SZJG 2Y1CA 2F00A 1LJ8A 9LDTA 1Z6ZA 3ZWWA 1P44A 1ZNQO 2FY8A 3VC7A 2O3JA 1YQDA 1IY8A 2J5KA 1A7KA 1HWYA 2HK8A 2P4QA 2CMDA 4Q39A 2DAPA 3EVTA 4GX0A 3VPXA 2NU8A 5I7SA 1EDOA 4GWGA 1ZFNA 2JFGA 2PK3A 4ILKA 2C7GA 1GZ6A 1B15A 2PD4A 4NK4A 3FTNA 5KIAA 4XYBA 1WP4A 2AE1A 2YDXA 3RC7A 2WD7A 1K6JA 3MZ0A 5DP2A 3WYEA 1LA2A 4EEZA 3WBFA 3P5SA 2IXBA 4JP2A 2NVUB 3GNQA 2LDXA 1Y9EA 1P9LA 3ASVA 3HFGA 3L9WA 2EW8A 4MVJH 5COBA 3DOJA 4WJZA 2Q3EA 1H9AA 2Y1GA 4Q3CA 1GCOA 2DPGA 7ADHA 5EPOA 4EZBA 2CDAA 4B7XA 2GO1A 5A9RA 2JCXA 4W7IA 4WLFA 1U1IA 4DQUA 1BG6A 3PFWO 1DSSG 1T2EA 2AEJA 3VAZA 3C7CB 5HS4A 1Z74A 3NKLA 3TF5A 3PQDA 3QIVA 1ISMA 1ENPA 4DL9A 1NFQA 4XCVA 1BW9B 4BNZA 1GAEO 1XG5A 2H63A 2ZTLA 2ZQZA 1N92A 4TVOA 3L4BC 1LU9A 3ZWAA 3OP4A 4RV9A 1LDMA 3H2SA 1D4FA 1ZZEA 3AM5A 3VPGA 5IXYA 1VJ1A 1MB4A 4J7XA 3V1TC 4Z0PA 1BTOA 1GYRA 1FK8A 3TZ6A 1TEHA 1RYEA 5KWEA 3PPIA 1PS9A 2PY6A 1P1KA 4P4LA 5C3MA 4GBJA 4JX8A 1YBVA 2DTEA 1OMOA 1VPDA 1TI7A 3DZBA 3F4BA 3TL3A 2E4AA 2I67A 1UP7A 3VVBA 5AXAA 4BL5A 2FSSA 1RYDA 4NBTA 4CM1A 3I23A 3CZRA 1PJCA 3UHAA 1DRUA 1KEUA 2C5AA 5G0SA 1NTOA 1LC3A 3D5QA 2HK7A 2FWMX 3MWEB 2JD2A 1R4NB 1UR5A 1T2CA 1CJCA 3AU8A 4FOSA 3JTMA 1ZIDA 3HZZA 1Y6JA 2BFAA 2ZB3A 4XDYA 2J5QA 3TFQA 1E1LA 3LT1A 2PKQP 3H8VA 1K0UA 5FFFA 2V6FA 3H7AA 5BNIA 1NPDA 3A06A 5BNTA 4PLWA 3NT4A 1N9GB 2NQ8A 3JD2A 2B36A 2ZB7A 3F9IA 3WBBA 2XF8A 2GF2A 4ZQHA 3K2EA 3RKUA 1DC4A 1PJTA 3H9EO 1YOVB 3PP8A 4GL4A 2Y68A 1MG5A 1IHYA 2PFGA 8ADHA 2VCYA 1CQIA 2JD0A 1M6HA 3LQFA 3I6IA 2X5OA 5CAEA 1HKUA 4YTEA 1DRWA 2X5JO 2JL1A 3M2TA 4R01A 3F4LA 1HSZA 4BGEA 2O3SA 4YAJA 2G76A 3FF4A 4CM9A 5JNLA 3U4CA 3B20A 1NVTA 2FPGA 5ENDA 3QVOA 1KVUA 3DMTA 3GZ4A 3PGJA 1A72A 4NK5A 2GR9A 2NV6A 3DAGA 3DO5A 3GRKA 1Z75A 2POQX 3CINA 3BTSA 5A05A 4CQLA 1WXDA 5TNXA 2Q4BA 3C1AA 3TRIA 2J3JA 2AXQA 3GEDA 4W99A 4CUJA 2BGKA 2WWRA 1Q2XA 2H5LA 1GDHA 1VI2A 1BHSA 1SOWA 4RPJA 1ZK3A 4J43A 2BFPA 1NQTA 4CMIB 3B1FA 1Z73A 4WEOA 4GSLA 1HDRA 3Q11A 1RM3A 4ALJA 4AJ1A 1GL3A 1QLHA 1FDSA 3RUHA 1UZNA 4MVJD 4JIGA 2I66A 5LC1A 3ZN2A 3DAPA 4TZTA 4OXYA 1DLJA 1YONA 4M54A 4JBIA 3RD5A 4BO6A 1B2LA 2JFFA 1ENOA 1O94A 3I4CA 4XQCA 1H93A 1ZUD1 2EF1A 3ZWCA 3UCXA 4PVCA 1EK6A 4BQPA 1RWBA 4OKIA 2ZB8A 2PZJA 4PLFA 1DB3A 3PIDA 5T64A 4CMIA 5JC1A 1H6DA 1TXGA 3C7DB 4FD3A 4J90A 4JNKA 3RUIA 3E6AA 5DZSA 2VHWA 3H9GA 4BO7A 4NG5A 2Q2WA 3TNLA 4FCCA 1C0IA 5G0TA 2VYNA 2B83A 1PWXA 4J16A 1NM5A 3HE3A 4HY3A 3GA0A 3H3FA 1X0XA 3I9NA 4ALMA 4ZA2A 2RBEA 1JAYA 4YACA 4F45A 1DC5A 3FTPA 1LDGA 3MCVA 5DOVA 4PG5A 3VKUA 5A3VA 3DFUA 4WK6A 1XGKA 4M86A 2VTEA 4O59O 3LF1A 3ZH2A 1LUAA 2HU2A 3IP1A 2DFDA 5JAMA 5HM8A 4IGFA 2JHGA 1N2SA 3NGLA 5HWSA 5A02A 4LSWA 1D1SA 1BRMA 2O3TA 1PS0A 1IHXA 1ZK2A 5BNFA 2UAGA 1CWUA 5FEUA 4PG4A 4XX0A 4OAQA 4RPLA 2HRZA 3PWKA 3NX4A 1V9LA 1KY5A 2NSDA 2UVDA 3BZUA 3WDSA 1YB1A 3UCFA 4ZQBA 3WQQA 1I24A 3S8MA 3W6UA 1DFIA 1GTMA 3ZW8A 5IDXA 1DAOA 3ZWNA 4R3WA 1DIRA 4HFMA 1HDZA 3WJAA 4L4SA 1NNUA 3WGQA 2VOJA 4OHUA 5BSEA 1UP6A 1LX6A 1VRWA 3KUXA 5K6AC 1M75A 4CMGA 3COSA 4DQXA 1UDCA 4FJ2A 2X8LA 3UXYA 1ISJA 2JJYA 1YQGA 3F5QA 2NM0A 1Q7BA 3QWAA 5JO9A 1ADCA 1E3SA 1DOHA 4DPKA 4FFOA 1QP8A 4FQ8A 2IEDA 1R0KA 1T4DA 3VHRA 4BO4A 4C7JA 5KJ6A 4CV2A 1PJ4A 4XJSA 4FPXA 2PD6A 4O63O 4PLTA 2ZCUA 3K31A 3OECA 1TT5A 1U28A 1A7AA 2O23A 1PJ3A 1FMCA 4CPDA 2IODA 3ZU2A 2W98A 4CM4A 5ILOA 5L7WA 4A7PA 2A35A 1GV1A 1LQTA 1AXEA 4FFRA 1E92A 1WW8A 4XD2A 3Q2IA 3D0OA 1ZMOA 1KS9A 3WG9A 3W4KA 2OHXA 3AOEA 1P3DA 1M6WA 1HRDA 2RHCA 4BHTA 2PV7A 2WYWA 4Q3BA 5JS6A 3WNVA 4BNMA 1XKQA 4DIBA 4RVFA 4WOJA 1VL0A 3PIIA 1DIHA 1T25A 2NNLD 4GLOA 3D4NA 2WYVA 3UN1A 3QQPA 2VWPA 3FI9A 4GX2A 3O8QB 4ND4A 3DEYX 2AG8A 1LLUA 3GZNA 3N58A 1BW9A 1OOEA 3A9WA 1ZSNA 4IDFA 2EWMA 4O1MA 2Z95A 2WMDA 5JE8A 4DVJA 2HDHA 3M6IA 4LRTB 2BRUA 3ZHYA 2WM3A 1XU7A 4DIOA 1K3TA 1NHGA 4B4OA 2I3GA 3DOOA 3BHIA 3NT5A 5I8ZA 5A04A 1LC0A 1K89A 1RM5A 1E3IA 1P1JA 1XEAA 1MGOA 3KRTA 3QLJA 1R12A 3RASA 4ESOA 4D3SA 4PVDA 1EMDA 1Y8RB 1PTJA 3ZNNA 1LLDA 2VZ0A 4Y6PA 5A9SA 1U4SA 3JYNA 2BMAA 5EMHA 3WGGA 4OYRA 2NVWA 3JQBC 3K92A 4J9UE 4Y6SA 1MX3A 2Y1EA 3IOYA 2VZ8A 4F6LA 2RAFA 4TZKA 4AJOA 3A4VA 1HDCA 2PLAA 1YOVA 4UEJA 1KETA 1E6WA 2CVZA 2OP1A 3GVIA 4ZU3A 3OA0A 1Y1PA 3DHEA 3CZMA 1QR6A 1Z45A 5KJ1A 1E3WB 5L7YA 1SB8A 2YQ4A 2EP7A 2YHIA 4RPHA 3D4OA 2NTNA 1SC6A 3IUSA 3HDYA 2G5CA 1ONPA 3OA2A 1M67A 3FRJA 3AWDA 4D41A 3DDNA 1IL0A 1UZMA 1WVGA 1NPTO 2WTBA 4GKVA 2BLLA 2EJWA 5EESA 1ZH8A 4Z9XA 3V2GA 4CM9D 1XQ6A 4DQVA 2Q1TA 1H94A 1YBAA 2IZZA 2DQ4A 3G0OA 4KMSA 2C29D 3IUPA 2PTGA 1KOLA 2PH3A 2HK9A 3DZJA 4LSMA 4NJMB 2Q45A 3TL2A 4KWHA 1ZSVA 3VTZA 4DA9A 5HRUA 1EE9A 2VWGA 4LCJA 1JU9A 1OZAA 4YJHB 4J3FA 3JD4A 3OQ6A 4MVJI 2C5EA 2Y66A 2X0RA 1H6BA 1T24A 3INRA 1E1MA 5HBRA 3RQSA 3JQEA 5TSDA 5MGBA 1WMBA 4MPDA 1UXIA 1JKFA 1WZIA 1NP3A 4CMCA 5JAZA 3IS3A 4DXHA 1UJMA 3GN1A 3ENNA 3NDRA 4RVHA 2QRJA 2HJSA 3KM0A 4EITA 5JYDA 4Y98A 3K8ZA 4BO8A 1UXJA 2GRAA 2DUWA 4BNKA 4XDZA 1UUFA 2ZJ1A 3LT0A 2EV9A 4YAGA 2I6TA 4D43A 1I2BA 1O0SA 3GN2A 1GU7A 3HDHA 2YUTA 2BGMA 1DFGA 1XHLA 4O0LA 3OH8A 4ZHSA 3NJ4A 1EE2A 4KTVE 3DMYA 1MA0A 3EDMA 3OF2A 2D4AA 2X9VA 1I2ZA 4A73A 5G2OA 3PLNA 4AJHA 1YB5A 3G49A 1PWZA 4RLHA 1O8CA 4NBWA 4YT5A 5B4VA 1PZHA 1Q0HA 2NWQA 4D0SA 1IYZA 5JLAA 2HSDA 1MP0A 3RROA 5KNLA 3MWDB 3K73O 3L07A 1MC5A 4U6QA 4PLHA 4A0SA 2CY0A 1CEQA 4E30A 3JQBA 3HADA 3U3XA 3H4VA 4O5OA 2QZZA 3KEOA 3LC7O 4ZJUA 1LQUA 4D46A 2D3TA 4EEXA 5U1PA 2QYSA 2W8ZA 4CV3A 1ZXBA 3PXXA 4CJXA 4P22A 4NBRA 5TGDA 3CKYA 1V6AA 3O03A 4U7WA 2HJRA 4OSOA 3G79A 1E7RA 4XWYA 2Q46A 3ORFA 3L6DA 1RM4A 1BXGA 1B8VA 3ZWPA 2J8ZA 4WOKA 4I5EA 4J0FA 3HB5X 1GZ3A 3PQEA 4JJFA 1HE4A 3D1LA 3RJ9A 3E03A 3ETEA 1ZKMA 3WLFA 4EUFA 1Z82A 5A9TA 9LDBA 2WYUA 1G0NA 5COQA 1LDNA 1A71A 4GMFA 4R16A 1WZEA 4PLVA 1LTHR 1CETA 2W2KB 3GQVA 1YE3A 3CTMA 4IBOA 4NNJA 5DP1A 1HETA 3DBHB 1NWCA 4J2HA 3PJGA 2HMSA 1B7GO 5ES3A 3P2YA 4A26A 3AK4A 4J7CA 3LU1A 1X7HA 3LLSA 3ICCA 3AM3A 2O48X 3K9QO 1YS4A 3GF4A 4D7AA 4Y6RA 1Q1NA 3PRJA 4R1NA 3CUKA 3QV1A 3ZWVA 5BQFA 2PWZA 5ICSA 1JW9B 3VDQA 4OIMA 4L74A 2Y0EA 4UVEA 5H82A 3SLGA 4K26A 1V3TA 5IN5A 2D5AA 3PHGA 2ZTMA 4NMHA 3ZHZA 3ZHBA 2PR2A 3U0BA 4OGWA 1HYHA 1Q7CA 3TQHA 2YHIB 4D44A 1XCBA 1I33A 1YXMA 2I9PA 5JCXA 2EP5A 4GQAA 5KKCA 2IYOA 4Z9YA 1KEVA 4CV1A 4CLRB 1I10A 3IDSA 3O26A 1U2DA 1J6UA 3PZBA 5C7IO 4TKMA 2BFOA 2GN8A 3L0DA 2E37A 3HHPA 1H5QA 5CDYA 4RQUA 2FR8A 1ZO8A 3L4SO 3H9JA 4Q3DA 4NU5A 1D1TA 5KVQA 3WWYA 4N54A 4R1TA 5CDTA 4FSHA 4FJ1A 4FIZA 1XLTA 1IZ0A 2WJPA 3ZV3A 4EBFA 4E5YA 1PZEA 4KZPA 3WGZA 1MFPA 4GX1A 5JYEA 1O89A 2O2YA 3VVCA 1AGNA 3VPSA 2Q50A 4J4HA 3U4DA 3ZV5A 4DPLA 4IQGA 2PH5A 2X9GA 1JDJA 1K5HA 2VT2A 2EW2A 3WQRA 2QHXA 4YJDA 3IMFA 5CFZA 1EVYA 4Q3NA 4AJKA 3CEAA 1IULA 3GZNB 2GERA 2O4UX 4R1UA 3O8QA 2I76A 2HMWA 2YY7A 3Q2KA 3ZI0A 4OXNA 3TZKA 2EKQA 1GEGA 4KWIA 1JWBB 3I9LA 1GCUA 3K6JA 3QWFA 2GSDA 2RHRA 2DU8A 2R6JA 2VWHA 3DAFA 4J1TA 3DXFA 3FN4A 3T7CA 5T57A 5FI5A 5T67A 4FJ0A 2JCYA 1UXHA 3CXRA 3DQPA 4UVHA 4WUVA 3C85A 2P68A 3LYLA 1TVEA 4LK3A 5A06A 4XKJA 1EQUA 4ND2A 2UUPA 4FOOA 1OFGA 1NQAO 1Y9AA 4UEKA 4WECA 4YJHA 3WB9A 3TSCA 2F1KA 3FNFA 1TT5B 4ZQEA 1DEHA 4DUPA 1YKFA 3JV7A 1L7EA 4L76A 3MJCA 3PWZA 1QMGA 4INAA 3AI1A 4U5QA 4YDRA 3PI7A 4YVFA 3H5AA 2Y67A 4UUMA 5FI3A 3S55A 3KYCA 4BQRA 3BMCB 3OICA 3WGYA 4GH5A 5DBGA 3F46A 3BTUA 1NHWA 2HLPA 3AY7A 3GVXA 4IIVA 4R51A 3U9LA 2WEKA 4W9NA 3UKOA 2C2YA 4YJFA 3PK0A 4TSKA 5L7TA 1ARZA 1D3AA 4R4JA 3KHUA 3ABIA 1VSVA 4IQ8A 4BNNA 2QX7A 4TRRA 2OBNA 4WNCA 1XIVA 2C54A 3DBRA 3AOGA 1Y8QA 2AMFA 3AW9A 4RZIA 4WCFB 1F14A 2W2LD 3E9MA 4IZHA 1E6EA 1UP4A 4Z0TA 4NFYA 3AFNA 2RH4A 2XXJA 3MJSA 4BV9A 1H9BA 2VHYA 5EINA 4CLOA 5G0WA 2EJVA 2VYND 3QWBA 1GD1O 4RORA 3P7MA 1U4OA 4G81A 2Q2VA 2DBQA 3H5NA 3SVTA 4YJGA 1Y8RA 2J3HA 4CODB 2VHVA 4RF4A 1YJQA 1J5PA 3T4XA 3RC9A 4RF3A 4AL4A 1XELA 4XA8A 2BI8A 3WSWA 1YWGO 3S1LA 4BV8A 3ZU5A 1R4MA 1PSDA 4ALKA 1GQ2A 2DUUA 2Y1DA 4E6PA 5C7LO 4RZHA 3GVCA 5G4LA 4RVGA 1LSJA 3ZWYA 5I7EA 5H81A 4R41A 2ZQYA 4E3ZA 3C24A 3R0IA 5JPIA 4A10A 3GT0A 4URFA 1WDKA 1I32A 2D0IA 3NGXA 1EZ4A 1IE3A 2YFHA 2Q99A 4XGNA 3OFSA 4BIIA 1C3VA 5B4TA 1SNYA 4BNWA 1AXGA 2ZYAA 1V8BA 2HO5A 3KYDB 4I08A 4N5LA 3ONDA 2DTDA 2ILTA 2GN6A 3LK7A 3UUWA 3FNGA 3MOIA 5JY6A 1E1NA 4ZVVA 4D42A 1EVJA 3DFZA 2CFCA 4R68A 5DBIA 5IDQA 2Q4EA 4ITUA 3RBXA 3DBLB 5B12A 4E4YA 1E0DA 2CF6A 3V2HA 4YBZA 1C0KA 4B8WA 1F06A 1TLTA 4MP3A 4NH4A 4AJIA 1LBEA 2OUIA 2CF5A 3FWNA 3M2PA 1LLCA 3AUSA 2AQKA 1FDWA 3DZHA 3GPDG 4JBGA 1ENYA 3BTOA 3RIHA 3FNEA 2FR0A 1LRKA 1PJ2A 3GNTA 4D79A 3LC1O 3T7EA 2VUTA 4AVYA 2AEMA 1PGJA 4FC6A 3R6DA 1DBVO 2XXBA 1E7MA 5IZCC 2GPTA 2ZTUA 4BMSA 1IPEA 4TWRA 1BSVA 3DBHA 4J6FA 2GN4A 3BMOA 3OJFA 1YDWA 3PVZA 4BNGA 3LZ6A 3F1KA 3BAZA 3UAGA 3OMLA 4A5OA 3ZWBA 2C0CA 4AJ4A 1HL3A 2GLXA 5CDSA 1GYQA 1MC4A 1NAIA 4YWJA 1HYEA 1XDWA 1XSEA 5CPFA 3KYBA 1NBOA 1Y8QB 4KTTE 1U3TA 1U8XX 2P9GA 1ML3A 2OMEA 3DL2A 3PDUA 4DC0A 4EJ0A 2CD9A 2DFVA 3RUDA 3A14A 3ZWOA 4PZCA 3VZPA 4OQYA 4IPTA 4MP6A 2X6TA 3STHA 4CM3A 5IN4A 1QLJA 3IIEA 3GFBA 3W8EA 1KVRA 1QYXA 4RF2A 2C07A 5K0ZA 4WLUA 5KJFA 1E77A 3AUAA 3A28A 4OO3A 1HZJA 2AA3A 4BB5A 4MDHA 1ADGA 1O5IA 2FR1A 3BMCA 4RO0A 5JW6A 3TZCA 3W8FA 3ANLA 2PGJA 1MXFA 3W8DA 5BSHA 2OFPA 3ZV6A 1PU2A 1I8TA 5AXCA 4NBUA 4CLXA 3C1TA 3WXBA 3TFOA 4KQXA 2Y1OA 3IJRA 1VE9A 2OOSA 1IPFA 3VH4A 3HUDA 3GEMA 2UYYA 2W90A 1S6YA 2Y05A 4RGBA 4II2A 4BNUA 2B4TO 4BNVA 1DC3A 3DTTA 5JXWA 3M1AA 2B69A 3O9ZA 2ZIZA 1ZW1A 1MG0A 2PZMA 1QYDA 2AQ8A 4I9UA 3OETA 2DKNA 5THQA 4GSKA 4B3HA 2P5YA 4TVBA 1GYPA 5CG1A 3L6EA 1QRRA 3Q6IA 1BWSA 1RJWA 3V1UA 1B26A 4XYEA 3OQBA 4CMAA 1UAGA 4YAIA 2G82A 4BGUA 2W4QA 4DPMA 2C2XA 3BMQA 5F21A 4WLEA 2VYVA 1SOVA 3A1NA 1U8FO 4CLHA 5KVSA 4R69A 5ICMA 2AQIA 5HTOA 2GASA 4IDGA 3EGOA 1AUPA 3GDOA 3UF0A 3W1VA 2O3RA 1A5ZA 1O9BA 4J9VA 5DNAA 1P1FA 4DYVA 3ZU4A 3E18A 5KJCA 3ZU3A 4B4UA 1Y7TA 3MOGA 4MO2A 1WPQA 5AYVA 4EYEA 1HLDA 4CV0A 3WNQA 3QW2A 3P2OA 2V7PA 4BGIA 4EUEA 3R3JA 1W73A 1M76A 5CP8A 2QIOA 3MEQA 3PHHA 3QVXA 1DIGA 3V8BA 4IDBA 4IS3A 3PJDA 4DREA 3ANMA 5DCYA 2VTDA 2WD7B 4PFJA 2YV2A 1EUCA 3TDKA 5T6BA 4G65A 5BSFA 2X5KO 5EL0A 4OJNA 3KB6A 3QA9A 1HT0A 1LLQA 2IYPA 4HX5A 5CG2A 1KEWA 2D59A 4M87A 5HA5A 3I9MA 2Q2QA 1HDGO 4LCEA 4PGFA 1N9GA 1PR3A 4R1SA 1BDMA 3GEGA 2VOEA 2QRKA 1BXZA 2RCYA 4YT8A 1QKIA 2OGUA 2G0TA 5KCZA 3PHIA 3OIGA 3I5MA 4N18A 3OIFA 4E5PA 1H0KA 4NZ9A 4MOWA 1R4NA 4PLPA 1NYTA 1HDXA 1JWAB 4MIOA 4R5HA 5DOZA 2EXXA 2H9IA 3ST7A 3U4HA 4W6ZA 1T4BA 5JC8A 4UEOA 4WPGA 3WQSB 5B1YA 5KOIA 1P0FA 4BNJA 2GZ2A 3F1LA 4W82A 4FB5A 4E5NA 2CZCA 5GZ1A 4G5HA 1EFKA 1YRLA 1LRJA 5F3RA 4CM6A 1U3UA 2I99A 2XAAA 4H16A 5DT9A 4AJ2A 4CL3A 1KC1A 1NR1A 3G17A 3I1JA 3HN7A 1E3LA 4IUYA 1QYVA 5CPBA 1EUDA 2IEBA 3RI3A 3C1OA 4KUHA 1EVZA 3QE3A 4HBGA 2B5WA 8LDHA 3UH1A 1WNTA 4XQ9A 4PLGA 5AVOA 3EZLA 3HSKA 4PN3A 1LEHA 2V65A 3PWSA 4B79A 2O3QA 1J49A 3LLVA 4AFNA 1PQPA 3RVDA 1ISFA 2E48A 4MVJA 1ZEMA 2DBVO 2ZYGA 3MTJA 1VLLA 2FZEA 2GDZA 2EGGA 3FR7A 4FDAA 4NDNE 4Z0HO 3GNSA 4YYZA 3CE6A 3WMWA 1P33A 2X58A 4Y8VA 5GY7A 4ND3A 4YQZA 1QV6A 3UFXA 5BR7A 4HFJA 4XGIA 2O50A 3ZW9A 5IG2A 2UUOA 4J1QA 4LMRA 4N7RA 1N7GA 1N7HA 2AG5A 2ZJ0A 1X13A 2CDBA 2J6IA 4HFNA 2WE7A 4JJIA 4S3MA 5EQDA 2SCUA 4QECA 3NT2A 5ENVA 3C7AA 3ROMA
chains in the Genus database with same CATH superfamily
1WXHA 4J07A 4UEQA 1U7DA 4FOLA 5H16A 3VO1A 2FMTA 1UBNA 1WB6A 1H4TA 4L0CA 1T6BY 5REQB 3JCZA 3GRUA 4RVDA 1Y7HA 5TX7A 3MLAA 1V48A 3TSAA 3OZIA 2WYIA 2A78A 3WK8A 2NPOA 1WZNA 5FBWB 1PJLA 1EEXB 2ZR9A 3NI2A 4H1TA 5K1ZA 2Z1MA 3DC2A 3CNBA 4INOA 1T5TA 1EJ0A 2QTFA 3FFTA 3PFCA 1QRSA 4YDQA 4ARCA 2Y1FA 2PRYA 4ZN6A 5HIKA 4P1ZA 5JJBA 4PYMA 4TWBA 2C2GA 5BW5A 3RVPA 3ACDA 2QVLA 3K2BA 1Z35A 2AOVA 2R1VB 2OHOA 2CEKA 1PSZA 1Q12A 1QORA 4Q3OA 3UEOA 2RI6A 3D5EA 1KAHA 3L18A 4L5CA 1VYTA 2NT3A 3EVNA 2FDXA 4XWAA 2Y99A 3ESZA 4EUKA 4JBLA 4ZZ2A 1G7RA 3RKRA 4Y0AA 4CMEC 5CLQA 2VEOA 2GPAA 3QFRA 2PMWB 4IUBS 4KLNA 4X1YA 4A8TA 2BBOA 2IS4A 4CF7A 1JL3A 3DKKA 2BTQA 1R8QA 1Y33E 2E4YA 4I4CA 4P3XA 1EBFA 2HMVA 2IXAA 3L02A 4BMXA 3KL4A 1NM5C 1QJ4A 4DXAA 8GPBA 4KVGA 4P4NA 4YCAA 3SX0A 2X4GA 2A9RA 4L3VA 1IPHA 1CV2A 2ZYDA 2P6UA 2PYDA 1N2GA 4JAVC 4EHJA 1IC6A 1ZL0A 1FP4B 2EW1A 1SC3A 2J6HA 4KXWA 4O1IA 3UMGA 4CQMB 1EHYA 2FYTA 4RPKA 1D2EA 3OJ0A 1XJWA 3VRHA 3QX3A 3TOXA 4EPRA 1RC8A 2VXYA 4FGZA 5TVGA 4ENWA 2LCFA 5AOBA 4Y9RA 1NXWA 3CN7A 1A7JA 5JSFA 2AFHE 3VX4A 2CLOB 1YSCA 3C3EA 2INGX 3AETA 2UV8A 3MILA 4L6CA 2B4KA 1NU8A 3S2EA 3VZSA 1GTL1 2NO4A 3ZNPA 2EL7A 3IESA 3TBFA 2V0GA 4HDKA 3KOZA 1POWA 3BE6A 2WAYA 4IIYA 4PG7A 1KEPA 3K9NA 3MUNA 4LE2A 1QGUB 4F8EA 3R5SA 1F7VA 2JBWA 2YZMA 2ZRHA 3P9ZA 4LQLA 4QG7A 4YO7A 4D1YA 3RH0A 4AO6A 1JE0A 1XNHA 3DDSA 3K0KA 1YUNA 2ZB4A 1KZ4A 3JQCA 2NU7A 2QTRA 3GCWA 3IDQA 3R1IA 4LV5B 3RVSA 5FTLA 2CUKA 4R9SA 3KLMX 2B7CA 2WMYA 2DG2A 2G4VA 2QNBA 2Y0CA 1KAMA 2EFJA 3C16C 1LBQA 3DBLA 3EEYA 3L77A 2O19A 3BFJA 4OQDA 4Y67A 2ZIXB 1Q21A 4U9HS 4NE9A 3D4IA 5KNDH 1DHTA 1G1MA 1TTTA 4EVIA 4OHYA 2XLBA 4XR4A 3WA6A 4HV4A 2AD1A 3R3YA 1TRHA 5C4MA 2YHUA 1BDIA 4UCFA 1IJKA 4ZQGA 4OA8A 3ENWA 4QDTA 5EE1A 5F35A 5B1DA 2JJ2D 5F1KA 2E9SA 5AUOB 4FW8A 3Q0IA 3TZQA 1J21A 4PE5B 3GJYA 2QPTA 4MI9A 1Y98A 4WASA 4E5DA 3VR4D 3D6JA 4IWXA 2VQ3A 2R44A 4X41A 5FWXB 1JNYA 4TLCA 3PX7A 3KL2A 4KK4A 4MS4A 4MSUA 2WDZA 3L8CA 4ROSA 5J5VA 3WRYA 1JEQB 1L5MA 1QNLA 3DBOB 4N0EA 4QTUB 1QZ3A 4ZREA 1XZDA 3U9SA 5JNRA 3T3HA 1UMDB 2ERXA 3AXTA 2CNNA 5F4BA 3W6ZA 1Z22A 5KTTA 2F67A 2I4NA 3LBYA 3MMZA 4UE2A 1SK8A 4V3BA 5EHNA 4CM8A 2E4XA 1CVLA 4QRIA 4RUKA 5JAQA 5H9WA 5LFAA 1NXSA 1WKCA 4IXTA 1XP5A 4EPXA 5CA1F 3WICA 3CG0A 3JD3A 1XD8A 1JXOA 1UMBB 2KBFA 3R5JA 4FQ5A 5CHEA 5G0UA 4EGJA 1WEKA 3PF8A 4V1CA 2WTXA 4DBLC 2O8EB 4F84A 1C30B 4O4LA 2CBXA 1MQSA 4MQBA 1JWLA 1GTSA 3JWEA 4DF3A 4DQ0A 2IPXA 1C9NA 4YQFA 1E69A 3NM6B 3OZXA 3KU1A 1YQXA 2ZUEA 3VH3A 2B37A 2VF5X 1C8KA 1TUEA 3JATA 4H7PA 2RGRA 2J48A 1M2OB 2KX7A 3AFMA 2ILVA 2GD6A 3HLTA 3NJRA 2FN7A 2F2TA 4RDIA 1DPGA 1Y42X 4WA7A 2Q6VA 2VBCA 1QDLB 1YBMA 3BWDD 3H99A 4LRWA 3KXDA 1IJBA 2QQFA 2YV3A 4C4YA 1HE1C 2IU4A 4MI1A 3EQ9A 1RYYA 1Z0JA 2FSFA 5KPDA 4B80A 4H7KA 2JFXA 4XDGA 3I9OA 1BWQA 1SIUA 2X4IA 3AG5A 1UC9A 3PHCA 4JH0A 4QO7A 1STOA 3QXXA 1NF9A 1C1XA 3F47A 4PXAA 5GZ3A 1OLUB 4Q3LA 1S7CA 3OQIA 3QFFA 4DDVA 4NV0A 3M9WA 1Q3KA 5DXJA 5K20A 4KODA 1PEKE 4M46A 1OB2A 5HQJA 3MWGA 3ETDA 4JENA 2ECKA 3OPMA 2B4QA 4HLDA 4P31A 4ZKEA 1SUCA 2Z2JA 3CNQS 4ID3A 2AX4A 3ZLTA 1UWVA 4DYDA 5TMDA 2JGLA 3FSRA 3KLPX 2DWPA 3RU7A 2HYIC 4DJJA 4FGWA 4EHKA 3C3BA 4JLOA 1VLMA 3KTDA 1JLRA 4P82A 4W5WA 3MRVA 4N3NA 4BYGA 1QOZA 2A92A 3L9XA 1UBHS 4LRSB 4TRNA 5SV2A 4IIDA 5LOVB 4GRAA 1O97C 2VJAA 4TTIA 2QLJA 3VR6D 4UTZA 1QRDA 3CVUA 1JFSA 3A4IA 4ALIA 5DGCA 4OQLA 2MINB 2I3AA 4JQCA 4O4JF 4JOQA 4PO3X 5BXQC 2H18A 1CDOA 3UCEA 4CWAA 4F5WA 1NVMB 3FAKA 1QG4A 2G6TA 4TKLA 2XUFA 5IDWA 2W6ID 1XV5A 2QLNA 4MIYA 1XCOA 1NVWQ 3HB0A 1ZI8A 4BQSA 3UWMA 4M53A 4DANA 2XKBA 2VHZA 3DE7X 3RO7A 4BQQA 2XUIA 1XROA 2XR1A 2QTVA 3BG5A 1OI7A 1R6BX 2H2DA 2VTKA 1SVSA 2F1OA 3EXAA 3HKDA 1ONOA 3I3OA 3OVMA 3QVSA 4IDCA 5A0FA 4EW6A 3GFRA 3ZR4B 3ZH9B 1CYEA 4RCVA 1A8HA 3TSWA 4B3GA 4JT9A 1YJBA 3H11A 3JQDA 4N65A 5KWJA 5DM70 2QW8A 3SR4A 1YVEI 2JIRA 2VHTA 3CMCO 5CNJA 3TVTA 5EJ6A 2ZGVA 3Q7IA 1SEPA 5FNVA 3HUEA 1JDBC 1CUWA 2OG1A 3JSAA 2B25A 1KIFA 4HEA1 2PS1A 4I5FA 4AZWA 4Q3AA 3WGTA 3WL6A 3SSMA 3E5MA 4BNYA 1NIPA 1TCVA 2IP2A 4GEKA 3Q3VA 2IZ1A 4UBLA 4M6WA 5EJFA 1ZJ5A 4A1FA 4ZGWA 2AF4C 1RCUA 5KYKA 2IWHA 1OH7A 2AJTA 1CY1A 2HHJA 2CHGA 2EFCB 4QSHA 1M7HA 5JALA 2P65A 4UKDA 3NUZA 4RW0A 3NRCA 2P4HX 4G85A 4ZQCB 3SXUB 3SZGA 2WVHA 3Q10A 5HRCA 1RTTA 4RKWA 3GUUA 2PUBA 1NF8A 3MUOA 4QBIA 2IQIA 1CQPA 2WJ4A 3ZHXA 2C3OA 2QZ9A 2DUMA 2G40A 3PHJA 3PQ4A 4FLEA 4G5QA 3ZLJA 4NG4A 1UM9B 1MLDA 5IX8A 5FYQA 4CMJA 1WMDA 1S89A 1VJCA 5A7HA 3C43A 2AKAB 3TXAA 3B82A 4U0JA 3TW8B 2BBWA 4WZBB 4MUIA 1O58A 4X8OA 2XIQA 3SYLA 4FN4A 1A82A 3C48A 5CTJA 2R1TB 1DKUA 1Z8NA 4M22A 4E0BA 3V3KA 3KEQA 3MWLA 1T26A 3CX6A 3PYMA 3I58A 1WMAA 3HWRA 2FVYA 3S2FA 1USKA 1OJ7A 1T2AA 4NPAA 4DCOA 3ERCA 1FJHA 2VA9A 2JJ2A 4FK8A 4RVUA 3IKTA 5BUCA 4BBAA 1WTCA 4CTMA 2WT4A 3SWWA 2QZ4A 3NC1C 1RXSA 2EZ4A 5LBUA 2YWBA 3KKZA 1B3RA 3TTTA 1VMEA 3R3ZA 4R3NA 3QKRB 1H5NA 1JT9A 4YAEA 5LNK6 4QRDA 4G07A 1I6LA 4XQGA 4HWRA 3SQMA 4BFSA 4B3RB 2AF3C 1KAGA 1P45A 4LKRA 3E9YA 2IOYA 3UV3A 3RDPA 4GZLA 3MPUA 3Q72A 4MS3B 3RJMA 3ADBA 2G9NA 4RS4A 2YNMA 5MDHA 4PX5A 2TMDA 3EXIA 4GOJA 2PL3A 4ERXA 4YUWA 4IZOA 2FUCA 3FPFA 2LE0A 1COWA 2VNAA 4M8NE 1LV7A 1VRCA 3JQAB 2ACEA 2XUQA 1HR0B 2QUAA 4E32A 2XJ9A 3H6KA 3RU3A 3W5HA 1G8AA 2ZE5A 3G2MA 1L7NA 1OA1A 2RJNA 5T8KC 5IDYA 4WBNB 3GXBA 1PD0A 2XMDA 1YBHA 2C7PA 1KVTA 3EC7A 4IYRA 4BNIA 3L8YA 2GFQA 2CHEA 5TQ0B 2OGWA 3DBVO 4MR8A 1AMNA 2IS2A 5LYYA 1PEDA 5JMPA 3JAKB 4UBMA 4GBGA 3ZGOA 4AD8A 3U60B 4H0CA 3T06B 2BFFA 2OO5C 2AE2A 2V6MA 2IPAB 1XTJA 4QOIA 3R8XA 3TMYA 3QEAZ 2P1RA 5H83A 1LBTA 1CRWG 1PUXA 5CR9A 3AI2A 1AS3A 4IMRA 5CX4A 4G24A 2YRWA 3A9UA 1CY4A 3GEEA 4BXOB 3ZJVA 5AM2A 1TTQB 3RS0A 5ALKA 1XPRA 1QAOA 3GCDA 1X1BA 3DZDA 4OFBA 1TIKA 3KPYA 1QQAA 2GETA 4UVIA 1MEJA 5GJWC 4BJ3A 1QYIA 2HAEA 2Q4OA 2PX0A 5TQVA 1E2UA 2XSZA 4OFWA 5T5QA 5DISB 3KHTA 2FEOA 2X22A 5ANRB 2NACA 2XA2A 4J0HA 3H2ZA 4IUDS 3GLHE 4QUJA 4ICIA 1ZIPA 2Z30A 3FJYA 3NBZC 4D5EA 2OZLB 3UV7A 4B82A 1QK5A 1BWRA 2OBLA 1KIAA 2XRYA 1TVCA 4PIVA 4CT4B 4WBSA 2J5RA 2JJQA 3S2GA 1F6WA 2J31A 3NNSA 1DRKA 1UF9A 3JWHA 3PICA 3PNBA 4KI0A 1W35A 3D6UA 4Y6OA 3PDIA 4EO7A 3K0SA 3I0MA 3ZWXA 4GLJA 2B9EA 4FC7A 4C4OA 4YXFA 1ELOA 3PNLA 4ZOQI 3TRHA 5I5GA 4J4BA 3ROTA 1N5DA 5HFNA 4BKRA 4KXYA 4ONEA 4BO3A 3TMAA 1QANA 1SMKA 3LV8A 4ALNA 5DHRA 3H5IA 5EIEA 4KFUA 4OP3A 4ABYA 4TSFD 2I8AA 5JWOA 3E5RA 4IINA 2CMFA 2QX4A 2OMKA 5JCOA 3ZE9A 3CRVA 3RJ5A 1NVGA 5HHTA 1R10A 3IEIA 2GBLA 5CNKA 2D5LA 5BXYA 3AL0C 4RLFA 2PEYA 4WJKB 4D4JA 5K9ZA 4EMBA 4ZV4A 3ETHA 4HZUB 4C2UA 4X7BA 1ZA1A 2A9FA 3JZIA 4DDHA 4KQGA 1FYFA 2ODPA 3HP4A 1JLLA 3AHHA 4MB6A 5KVCA 5G3YA 5JSZA 3QPAA 5EGSA 1Q0QA 2A5YB 3L3BA 3AM4A 5JNVA 3AY0A 1A2QA 4IRUB 3WLLA 4BPRA 3VNAA 2XVMA 3EIOA 4JGIA 3VPHA 1JQJC 1Z5UA 3R9KA 1ZI9A 1GCIA 4CM4B 5LWQA 1CTQA 3C8ZA 5AKGA 1D9ZA 4JROA 4UNSA 2HRDA 2QRUA 3IQDB 4V0RA 1JVSA 2YXNA 4YECA 3UOGA 1U8YA 4DC9A 4X54A 1GILA 1I3NA 3BMNB 2WYOA 1MV8A 4HZIA 2Q3FA 5FEMA 2QM3A 1IN4A 2MHCA 3X2EA 4DDWA 3PUVA 4F8YA 1ZS9A 4Q9LA 4XYLA 3IAS6 2Q1SA 2FZWA 1LSUA 4JUFA 4PTZA 1G6KA 5AKZA 3WFIA 4QBGB 1KU0A 2XE4A 3GDFA 3EMKA 2GPYA 4MDYA 1JQ3A 2PQMA 1U9CA 2C9YA 4HAZA 2QG4A 3Q7SA 1PG2A 1RLOA 1E0JA 2A84A 4RTOA 2QNIA 2BGLA 4KO4S 4KPUB 1IB0A 3WP0A 1JXAA 1JGTA 1G41A 1VL8A 2C4WA 1ABFA 1L9XA 2OB2A 3AEUB 5E4YA 4YS6A 5FOUA 3SR3A 3ON5A 4GVXA 2AHRA 1EX9A 2QX8A 3HO8A 2GO7A 3RRMA 1ZSYA 3QHAA 3EXG1 3N8KA 3HY4A 1U0HC 5JQGA 4JJEA 2JLCA 3AEUA 4EGAA 2HV9A 3M4JA 5IAAA 4CR6A 3A10A 4DMLA 1J2RA 1Q19A 1TK2A 4TVKA 2IV7A 1Q7EA 1GFZA 1JI0A 1BGVA 2QPLA 4M98A 4PSUA 3BICA 3KDSE 1KVSA 1GNPA 1ZUHA 3V6LA 5KVAA 4NIMA 4BEVA 5AJVB 1T5LA 1RPAA 1V47A 4QWMA 2HPVA 4YIKA 2PGDA 2OAGA 3EZYA 1Z5VA 1DFHA 4ZOLA 2ERCA 3LL4A 5EEGA 2BELA 3VKGA 2ZRJA 3BMOB 4AO8A 3PLRA 2II6A 3LMKA 3VYSB 4Z54A 1KZ9A 2B1RA 3IYLW 5DE3A 1JNXX 1YRWA 3T4UA 4AXXA 1OKKD 3UKDA 3OIYA 4JFRA 5JCJA 3FOBA 3R09A 4F93B 5DI3B 5DM2A 1RHJA 1YI0A 3GL9A 3TE7A 1RYMA 1GV0A 4DSOA 4QAQA 2DPYA 1QXSA 1XZGA 5JCZA 4HNGA 2D5BA 3CPHA 2XDYA 3S5JA 3HXKA 1TM1E 2IZ7A 2QMHA 2GVDC 4CG1A 5EKSA 2RJOA 2R00A 3ZZTA 3ABZA 3FWHA 3SHOA 5F5LA 5HUJA 2C4KA 1GL7A 2Z1NA 5D8DA 1L3CA 4G1EB 4HS9A 5LDHA 1XRRA 1SN7A 4BUCA 4D8XA 2OFXA 2VN8A 2X0NA 1OI2A 3OBBA 3OLYA 4IAOA 3ZX4A 3KFLA 1YCDA 2KM1A 5KQPA 3KK0A 4FCWA 3FLMA 2ZRMA 5AI9A 3IT3A 3V9PA 3O4FA 1JYEA 3DLBA 1AHNA 3SFZA 4Z9FA 5ILQA 3F96A 1TB4A 1KEEA 2FE4A 3W3AH 3KZMA 1IWBB 1FX0A 1QQ6A 4OL9A 4JXKA 1FTNA 2QQGA 1EYZA 4FZ3A 4NFSA 4X6LA 3WE7A 1MJHA 2QQ0A 3T3GA 2EERA 1OU4A 2GT1A 3K09C 1U3FA 4OB8A 1SHJA 4QOFA 5TY0A 4KDFA 3SS7X 3TPCA 2VA8A 3MRXA 1US8B 3GPCA 4G5YA 5BNWA 2I5PO 3D0KA 4MTCA 4B2LA 13PKA 4OQZA 1J0XO 4K6FA 1JMVA 5I3ZA 3MG9A 1F3OA 1O57A 4EOGA 2I8CA 3M33A 2HUNA 4FOPA 3BCUA 3EBLA 2GD0A 2W2QA 1LDEA 3EGWA 3LUGA 4K9OA 3WISA 3ZJ5A 1ZKDA 2YX1A 4L7QA 4ODIA 5TRTA 3ROQA 3KELA 5KNCA 4KL8S 1S01A 3QPDA 4QYIA 1IN5A 1VZ3A 4QDZA 1Z17A 4CT0A 3IEXA 2Q4RA 1YUBA 4KOAA 3IERA 1XTRA 3RF6A 4N7MA 1U1FA 1JPVA 4Q7QA 2ROQA 1T2FA 4DKXA 4HLQB 5JAUA 1F7UA 3RSGA 1O9HA 2ZT5A 3ZHQA 4D3YA 3DMNA 3VO2A 1NW5A 4LC0A 3QKIA 1W48A 1DDIA 4MVJP 3RVMA 1WU8A 2BFFB 4I36A 4YP7A 4D0NA 2DWQA 3NW9A 1MVNA 4XIFA 3TB4A 2X8JB 3BWBA 1DC6A 5IFKA 1HFJA 3QJ5A 3TZEA 2HLDA 4YV0A 3IUEA 1DARA 4P54A 4PBSA 4AJPA 4DB2A 1YKGA 2GQ0A 2AYXA 5B7QA 3AJRA 1E3EA 1ESMA 4CL0A 5AI8A 4UUNA 3ZDCA 1M8JA 1O6BA 4EKYA 3OZFA 1AN9A 4A0FA 1SUSA 1UXGA 4PS0A 4JBHA 4WKPA 4MIEA 3EPKA 2FTKE 2AMYA 4INJA 1IOLA 4DV3B 2DERA 2IQ5A 3EODA 1F0KA 4O4HA 4DCSA 1RS0A 2FNAA 4TMVA 1GTJ1 5BWMA 1XN1A 1Y1QA 3IHLA 4F56A 1IG0A 1PKXA 5EWMB 5CLFA 4NJOA 4PFKA 1QK4A 1RQNA 4EW1A 5KEIA 1MAVA 2JAXA 3MA0A 5JXJA 3B6KA 3PEUA 4HWKA 5M5BA 4OYHA 2ZJ2A 4V24A 1ZNWA 4YCSA 4GLFA 1R9JA 4E12A 3W5AA 1RKBA 1X3LA 3L7CA 2VK1A 2OO5A 2BDEA 2X9NA 2YDYA 2BTOA 5JDCA 4M0KA 1KTVA 1W2WB 3BJEA 2MT9A 3F90A 4TXNA 1RAEA 4JUAA 5AOCA 3RHTA 2A1TR 1B76A 3R9WA 1LK0A 2AFHB 4JEIA 4YCBA 4F91B 4I50F 4N5HX 3EGEA 2PO5A 4JOSA 1V16B 2V3CC 4FMDB 1CIVA 1W88B 1TM5E 1RABA 2YVUA 2ISCA 3FNHA 4GIBA 1Q14A 2EKPA 2VP3A 3F8TA 4NP6A 1E1QA 2EKBA 4J29A 4BNDB 4C3ZA 4H0NA 1M2HA 1B00A 3E1KA 4WW0A 1LTKA 5E7QA 3UXHA 5A1TA 3K96A 3CS3A 3SYKA 3GRPA 1C14A 1Y0BA 2CVQA 1ZXLA 4KQCA 2YYAA 5G1OA 4DRYA 4BO1A 4MW9A 2JLSA 1N5MA 3V34A 2GBPA 3WO0A 1L6RA 4AB1A 4B6SA 1K7YA 4FFBA 2B1QA 1G5FA 1F12A 1W5EA 5I47A 1G8MA 3NB0A 3AP1A 3ILHA 1RP7A 3NOVA 3QE4A 1BNCA 4W1PA 3V1YA 4YMVA 5K5EA 3MOSA 4ND5A 2CK3A 1BDBA 4LQ4A 3VR5A 2PX2A 5KWVA 1QGDA 2Z2IA 2NNWB 1PV2A 3O83A 1IIBA 2PL5A 2PZLA 4UVDA 2P2SA 3WSVA 1ZRHA 4MPPA 5EN4A 3QLTA 1NQUA 4PZAA 4UBJA 3LC2O 1YZQA 2R85A 4I2NA 4OH1A 2V7XA 4J0JA 4WGGA 2OYRA 2VPQA 3VNSA 4EB6B 5FWDA 1CJMA 1A9ZA 5TLSA 1A9PA 4EJFA 1GXSB 1XHEA 3K6SB 4X61A 5FNVB 3PEFA 3PSAA 3GLIA 4RHUA 4XFJA 1PUJA 2AYZA 1J42A 1L5OA 1M1XB 4MKZA 4MQ5A 4QJIA 3K4QA 2C4TA 1U8TA 3AONB 5L45A 5JDIC 4CLEA 2RAPA 3ZYZA 2GZHA 4B7CA 1ZNYA 3DULA 2YN4A 2YJNA 3LBHA 4RETA 5I7HA 2GM4A 1G291 1ZEJA 5L3ZA 2C96A 3RQIA 4ZQIA 5AHWA 1A27A 4LF5B 3GMDA 3PZRA 4WCDA 3FWZA 2YV1A 1CR2A 5CJ2A 1I0ZA 1O0BA 2OGTA 3AUTA 4WCFA 3N2IA 3TNJA 2FPIA 2J07A 1SC9A 1CUIA 4J7AA 5LB2A 1E5LA 2PM8A 4CMHA 4E03A 2OORA 3LE8A 4UOQA 5T7BA 5AI0A 3PQ8A 4MWEA 1B6SA 5F1OA 1W9MA 3T7IA 2WI8A 3Q5EA 1XX6A 1GGNA 2AUNA 3P94A 4I4TF 2MR5A 2YWGA 1N2IA 3QFSA 3ABQB 3ZQUA 3AESB 3C7KA 3IJPA 5B64A 4GM4A 4YJFB 2BBSA 3LDGA 4C0HA 1UKBA 1YFZA 2BL4A 2ZB2A 3MQFA 4PZ9A 3SFTA 5IT5A 3H84A 1ULUA 3W5UA 4O08A 1TA0A 2IHUA 2WU8A 3ZDYB 4B4VA 2YOHA 1H3EA 1F17A 2WIAA 3DONA 4IJWA 1ZXXA 2P5UA 4BAZA 4F7DA 1PW7A 5BR8B 2OCAA 5KDOA 1KSHA 1Z68A 3LCRA 4IS2A 5DWVA 5DV9A 4F3NA 4TRMA 4YRZA 4FGLA 3BRCA 5ITWA 2EBFX 2ZAGA 3NUGA 2IF0A 4F92B 1V6CA 1RYBA 1IEQA 2PZKA 3I01M 4XCXA 4ZT3A 3VDMA 4F2GA 4JV5B 1QVWA 5DX0A 5GINE 3DF7A 4JZKA 4P3KA 2A9KA 5TT1A 1M6EX 1WVIA 1XRMA 1ZD4A 3B53X 2I1WA 2QRLA 4YRAA 1AMUA 4LV8B 4K40A 3JVVA 1X7WB 3PEYA 5C3UA 1RKQA 1V3UA 4QUAA 3SS9X 3WWZA 2WLSA 3SP1A 4AKGA 4C43A 4X1IA 1MIHA 1G59A 4QKQA 3EK2A 5ALUA 2CFOA 4CI9A 3RNOA 5IF3A 1AQYA 4C7OB 5BURA 1EBUA 1BMQA 1PT9A 4IFTA 4C1NA 4ZDJA 1OBFO 1E8NA 2O2IA 3CF4A 2AT1A 1RDFA 1WS6A 3E1GA 5FV4A 1MKYA 3RF7A 1WBBA 4ZQFA 1EVQA 1WXQA 2B4YA 1GRNA 3ZWQA 1SBQA 4JLPA 3U4AA 5K4HA 2PPLA 1LDBA 2AQHA 3GH3A 2DT5A 4CI0B 2JEZA 2HCTA 4LDPA 1JR3A 2GN2A 4DSAA 3TW6A 1MBZA 1FDIA 1EFCA 4A8PA 3L93A 2BF4A 4KPGA 4G25A 4JP3A 1WMFA 4GNKA 4K5QA 2Q2NA 3CN9A 3HL0A 3QHQA 2BR4A 4MHTA 1I3KA 4HL6A 5FLEX 3PUHA 1TTHA 3G02A 2FMXA 2XWBF 3WGKA 2IHNA 4FYXA 1ZBQA 2NZUG 4GG1A 3J80A 3DDZX 3CUWA 2Q2OA 2HIHA 3PC7A 3DCIA 3EB9A 3T3OA 5KNDA 3HQ4O 4RHXA 3H19A 1YRBA 4CM8B 1QVVA 3ETNA 4B3JA 2Y27A 1MIOA 5CNMA 3FBTA 2VTBB 3TLGB 1JSZA 1YGYA 3FUUA 3SX2A 4H3KB 1OLXA 4IICA 5FT9A 3NH9A 4F5ZA 3T5AA 1DLIA 1LJUA 2YW9A 2C4VA 1LPNA 1OLXB 4BE9A 4I5GA 4P34A 3GMSA 1E7WA 4KQWA 2JI8A 2MU1A 3EOAI 4LJAA 4Q4AA 4HAXA 3WK9A 4DLYA 1W2HA 4UUAA 1XJ5A 2JA1A 3ILXA 3P71T 3A6FA 3ZBUA 3BPSA 4ILEA 5CW2A 1C1DA 1U0FA 1EDZA 1O94C 2OQRA 1DP4A 2XQIA 4EELA 3Q40A 1QHHB 3HXPA 1KZ6A 2PT6A 4J0QA 5JI3E 2GB4A 3KP1A 2R6HA 2W2PA 2GLUA 2JAHA 2QW1A 1N6NA 2IU3A 3L4JA 3JX9A 1ZUNA 2A1UB 3KKLA 3GG2A 2NZVG 3A36A 4JELA 2EVWX 3R4CA 2BFMA 4C30A 1KVQA 3RVRA 3UUFA 3WO1A 1GEEA 2ZWPA 1Y3CE 2FKNA 2PMKA 3NHSA 2NU7B 1V5WA 4Y9DA 1PBNA 5GONF 3U1VA 4GMGA 3DOHA 3WLPA 4B84A 5CH5A 3JPYA 3LLUA 1W9HA 1EU1A 2AJLI 1OUMA 1D7OA 4HC4A 4RD6A 1E98A 2XUDA 1SO8A 3ASUA 3EVZA 4JI0B 2AEFA 2XNHA 4C7OA 4O29A 5FB3A 1QPZA 5BVGB 1G4AE 3QMWA 2LCQA 2I2WA 3SEQA 4D9GA 3WMXA 3H1BA 3SEAA 3D81A 4MH0R 3UT5A 3K35A 1G66A 2F64A 4M9RA 4ZO8A 1XKTA 5FAXA 2AXNA 2HIMA 2O2DA 1FP4A 2GN0A 3FUCA 1NJ2A 3RFVA 1DAPA 1GUZA 2WE8A 2C7VA 3JU3A 4Q93A 1U0RA 3MJTA 4OKNA 3RBZA 5EERA 4BX8A 3NRJA 3G1UA 4GKBA 1H5UA 3AR4A 3GJSA 4C3OB 3KBBA 3DFIA 1L7XA 1Y81A 3FSGA 1BEUB 1QG6A 4F2WA 5CX1B 5EJMA 3QEBZ 5AIBA 3O0TA 3DPIA 3JD0A 1FQWA 4CKXA 4MINA 1KJIA 4FDMA 2FMFA 1CZKA 2H16A 2NU6A 2F00A 3O8DA 1KZGB 3T3NA 4DV1B 1ZNQO 3VC7A 2C5BA 2O3JA 3AG6A 3E7WA 1IY8A 3FCSB 2XKJE 5DSZA 1L5GB 4GR4A 1SH7A 5D3KA 4MLPA 1OTXA 4ZO7A 1FUKA 2GVZC 2FEXA 2P4QA 2CMDA 3FPAA 2DAPA 3D6AA 1Q11A 4HH0A 4P7FA 2AWOA 4WDRA 4JD5A 3HP7A 2FK7A 4MHSA 4PONA 1EDOA 5I7SA 4X8LA 1PD1A 2EWVA 1J7JA 4HZGA 4AY5A 1DAIA 1X8KA 1FRZA 3C8UA 1ZFNA 1KFCB 2PK3A 1D07A 4O0MA 3AZQA 4G5SA 2PD4A 2QN2A 3KJEA 4MUNA 3C97A 4XYBA 3HHEA 2AE1A 3D8SA 3R7SA 3RABA 3VSDA 2GNPA 2BKVA 1Z4KA 2APJA 2DFLA 2G9QA 2AFIE 4MW0A 3V4FA 5DYGA 3P5SA 4EEZA 2B7BA 2FMIA 2Z9DA 2LDXA 3DVSX 1F9AA 3K5HA 3HFGA 3T9CA 1RQPA 4MVJH 2IPLA 2QMUA 2GFIA 4JR0A 5AJXA 1G5IA 1H9AA 4H7JA 4WV3A 1RWPA 2XCOA 1CY8A 4K8RB 1GCOA 3PA8A 4KDCA 5EPOA 2OCPA 5KNCD 4H6PA 3LK6A 3WNCA 2GO1A 1M54A 4BRSA 3FZQA 1TZKA 3M4ZA 4WLFA 1QMPA 2P8SA 4DLUA 1BG6A 4YALA 4Z2YA 4Q12A 3WLHA 4EB6A 1DSSG 5A6SA 1VPLA 3KSMA 1WXEA 4GBED 1FP1D 3RK1A 1E2PA 1TJNA 2CW5A 4PYNA 5J43A 2B8WA 3OG9A 4JLMA 2QVCA 5J2UA 2DR3A 2O0HA 2VHJA 4MGIR 3PQDA 3S40A 2CL5A 1ISMA 3FETA 3L7NA 1NFQA 4IQFA 1BW9B 4CDNA 4ZHQB 5AW0A 1NNSA 1G9XA 1GSHA 4LZOA 3ZXXA 1RRGA 2H63A 1DWOA 4HNVA 2JLWA 1G6OA 4TVOA 4RTNA 1W30A 1KJNA 3ZWAA 3DXXA 4FI3C 4RV9A 1WB9A 3ZUPA 5BN3B 4TUYB 1D4FA 1NKVA 2PX8A 3CE9A 1ECJA 3AM5A 3ED5A 1VHJA 2CDRA 3N8IA 3LWZA 4G56A 2UZ0A 2HU7A 1BTOA 2J3LA 1FK8A 2VJLA 2CNOA 1K97A 3BRQA 3W2FA 3DMPA 3DWGA 4BFWA 1QOPB 3PPIA 5C0OE 3X44A 2W4MA 5KWEA 2OD9A 4P4LA 4ZWNA 5C3MA 5FHRA 2CLFB 4TV8F 4OEHA 3TCXB 1AK1A 3COVA 2BKXA 1VPDA 4L8LA 1A50B 1TI7A 1CB0A 4BP1A 2YIMA 3F4BA 2GXUA 5E7JA 4C76A 4MCIA 4N9WA 4URXR 3BSWA 1XTKA 4GSYA 1KDTA 3UAVA 4N4AA 3H6GA 3T34A 4EPTA 2EAUA 1GDDA 1S5PA 3KEGA 3VVBA 4BL5A 3ZDQA 1JI3A 1YZHA 3R24A 1TIBA 5EP4A 2IHBA 3UQZA 3ZDBA 2WABA 1HG1A 4PF1A 3RS2A 1RACA 1MQAA 1IDOA 1EWYA 1EIZA 1JHMA 1D8TA 2PMDA 4G97A 5KNBA 4QU0A 1RI4A 1NTOA 3OKAA 3PEEA 4M7PA 1G4UR 1BE6A 1CS0B 2GAIA 2VK2A 3FWKA 1BA3A 1HOTA 2B78A 3CO0S 3CRQA 4Q9KA 1XZIA 3C3KA 3QELA 4RD1A 3WMFA 4IVPA 3I72A 4OI2A 1CJCA 1F6DA 3AU8A 4FOSA 2OPHA 3F3YA 3JTMA 4TTPA 3HU5A 3GZJA 2BFAA 3V6MA 4FE7A 4LYAA 3T7JA 3LT1A 3IAS1 3FMVA 3H8VA 5FFFA 5BNIA 4F0JA 1P2VA 5JS8A 4GOMD 4MUXA 5KX5F 1N9GB 3DCYA 5KWIA 2FQQA 1AKNA 3JD2A 4E51A 2FSUA 3F9IA 5AP9A 4N5DA 4TS9A 2QL5A 3R44A 1Y9ZA 3IVMA 4ZQHA 2NOAA 1PJTA 2OFOA 2YJ5A 4I50B 4FGKA 4BLQA 2Y68A 3FX2A 1MG5A 1JT2A 1E20A 2PFGA 2RHLA 3ZCUA 5FPYA 4M83A 2P9ZA 1RC0A 1AKYA 1OLOA 3RVKA 1M6HA 3IGFA 1NW7A 4C9BA 3B6IA 2X5OA 4ZEOA 3UPDA 1HKUA 4B35A 3BREA 4UDOA 1GQOA 1NMYA 3P1JA 1ZR4A 3OX4A 1UOOA 4PAMA 3MRSA 3D8NA 2O3SA 4DHEA 4UFPA 3IXLA 2CDNA 1W75A 2XDQB 1U0EA 3PI6A 3U4CA 1RLMA 5ABPA 1A8IA 1NVTA 3CJQA 3A6GA 2VAPA 2X1MA 2ZU6A 2OZEA 1THTA 5ED4A 4M8KA 1L7PA 3B1WA 5HIMA 1BVYF 3GZ4A 4F8JA 1UXOA 5HIIA 4DBLE 3AVXA 5KAPA 2GR9A 3DAGA 4BAUA 5LBTA 4QVIA 2AOXA 1Z75A 2I7VA 5JZBA 1E0KA 3OZCA 2NUAB 1NA5A 2SBTA 2W00A 1EP9A 3C1AA 4IOJA 2P0AA 4G5GA 2PSJA 1PQ4A 3O3OB 4WT7A 2J9FB 1UT8A 4UXHA 1G20E 5E9JA 4W99A 4A6XA 2BGKA 2WWRA 3TOCA 5CFLA 2H5LA 5DHPA 2XGGA 3U7IA 1BHSA 3HA5A 1G8HA 1SOWA 2HBZA 3NWPA 1RJEA 1IK4A 4RKRA 1ZK3A 1CJUC 4HXEB 2SKDA 3AP2A 2BFPA 3B5EA 2BT4A 4G0ZA 4OK3A 3UATA 4BTEA 1C4KA 4WEOA 5JISA 1HDRA 3Q11A 5EXXA 3RC3A 3AGPA 3C2QA 1AQLA 3RTAA 2C5FA 2G72A 3OLQA 4UHHA 5LC1A 3WRXC 2I66A 3IHKA 4F60A 3DAPA 2EQ5A 4YMLA 3AIKA 4POOA 1DLJA 4V38A 4E22A 4JBIA 1NC1A 4MGEA 4W5RA 4TTSA 4XQCA 1CUZA 1UM8A 2Q6TA 3EG9B 3IDAA 2N1BA 5C1IA 1H93A 1YR1A 1ZL2A 5AM4A 2V7EA 4OL0A 1ZUD1 4PU0A 4ZXFA 2G8LA 1J9ZA 3ZWCA 5FOQA 3AXSA 3F5MA 4I1VA 2HQSA 2GPJA 5A0VA 1C3EA 3D43A 1IONA 5K4AA 5JC1A 1AKVA 1X8JA 2DCUA 4JKIA 1N2CE 2D1QA 1KH1A 2LZ0A 3LKDA 3LVQE 3N1UA 4Q7EA 2J45A 5DZSA 2VHWA 1BFKA 3DVQX 2HMAA 3NEJA 4BIMA 3IE1A 3GQBA 4PAQA 5AHOA 3SI7A 3TNLA 4CTKA 6AT1A 1DMRA 1PV1A 1XXHA 2VYNA 5FADA 2DFPA 3B7PA 4NH0A 3R75A 3M6FA 2F3UA 4YUAA 3H3FA 4HWPA 4ZA2A 1KFKB 5AVUA 4MYSA 4G5RA 1T3SA 1XMVA 4LPSA 1DC5A 1T29A 3KOYA 3DGEC 4ZEWA 1DQRA 1U28C 4OHOA 5ELMA 3VR3A 4EA9A 5SZIA 4PXSA 5A3SA 3GJ3A 2NXWA 1ZIXA 4ARBA 1Q0ZA 1V45E 2FW1A 2XDQA 1KAQA 3WLSA 3EHDA 3L8DA 3R5HA 5EMJA 4DA7A 5HM8A 2JHGA 2JJMA 4MS1A 5CYFA 2I4IA 4OATA 3ZE8A 4KR6A 1OPXA 3H5VA 4MGHA 4GE0A 1K27A 2COUA 3SD7A 1N5RA 2PSFA 3K0HA 2CJWB 3LRTA 1TU0A 1KSGA 3DTVD 1PS0A 1ZK2A 2BFEB 3O31A 2UAGA 5FEUA 3RADC 4GRDA 4PG4A 3CBGA 4HEQA 3VQTA 4RPLA 4F3TA 3DEKA 7REQA 1XZPA 4CW7A 3PWKA 3NX4A 4OQQA 5KQMA 4B2PA 2LD4A 4YCMA 1SVLA 1MZVA 4M1TA 3WRVA 1UEIA 1ZNXA 3MC1A 5F73A 1CQZA 3QHPA 4XVUA 4ZQBA 4OBEA 2H29A 3UMVA 1G2PA 1JQLB 4IKPA 3FKQA 4G8DA 3S28A 4WNAA 1RI1A 1RQ2A 1N6PA 3QEOA 2X2PA 1GTMA 5IDXA 1ZH6A 2CGEA 1EHIA 2HRCA 3A70A 3QK7A 4HFMA 1O6GA 1HDZA 1Y3FE 4TWAA 5HSGA 1P2BA 3EZXA 4L9WA 1GRRA 4F71A 4JUIA 2BZ1A 2I2AA 2P1ZA 2VOJA 4OHUA 4P4UA 3GZTB 3LCCA 2Y4OA 4DLTA 4FJ2A 4R0MA 3RHZA 3U56A 1YQGA 3QWAA 1NL3A 4LVNA 3DEZA 1ADCA 5D85A 3CR3C 3W7VA 1DOHA 3O47A 3AL3A 2O59A 3ER6A 3VHRA 5KJ6A 4PCLA 1A69A 1CB7A 3OKPA 5SY6A 3PQ7A 5HQ3B 1JEJA 4NCIA 4DR6B 1DELA 3FPJA 3TW0A 5E8RA 4PLTA 3DBIA 4KE6A 3IEPA 3K31A 1XTVA 2E5LB 1U28A 1ESDA 1FMCA 2OECA 2IODA 3CPEA 1RJ9A 2W98A 5AW1A 1WSWA 4CM4A 5ILOA 1FFAA 3CLRC 1X80B 2XT0A 4RD3A 2EFYA 2FFQA 1H1LA 2H2FA 5T3YA 4MIKA 3T5MA 5K3FB 5M2QA 3OQNA 1AXEA 2ZG6A 1FYVA 5CFQA 1OZFA 4PZZA 5AKYA 2IH4A 3EDYA 4UDYX 4B6RA 1IRIA 3UGQA 4ITVA 1IQRA 2EJBA 2OHXA 1QCDA 2OT3B 4PC3A 1YDHA 5IVDA 4AW9A 2WAOA 1YS6A 3Q3IA 5DXFA 3D59A 3WNVA 1ZH2A 4BNMA 2PBLA 2CC2A 3IOEA 4TYQA 2YJGA 3S68A 3O8OA 4DIBA 1NQXA 1DIHA 2NNLD 4MZXA 3UN1A 1RWOA 1H2AS 2IW1A 2FU5C 3K1JA 5E1BA 2VWPA 4CIVA 3V4RA 1R5BA 3O8QB 3LD9A 1HG0A 2YV5A 3GZNA 2ZBUA 3N58A 4Q9DA 5IC6A 1H2EA 1BW9A 1OOEA 4Q1AA 1LH0A 4HWTA 1R2QA 1XMOB 2EWMA 1UBRS 2RGAA