5IZCC

Trypanosoma brucei ptr1 in complex with inhibitor f032
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
268
structure length
239
Chain Sequence
MEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
publication title Exploiting the 2-Amino-1,3,4-thiadiazole Scaffold To Inhibit Trypanosoma brucei Pteridine Reductase in Support of Early-Stage Drug Discovery.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 89
structure length 239
sequence length 268
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2016-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5izcC00
2ZTMA 3AI1A 3GAFA 3HUDA 2B0JA 4MDHA 4EBFA 3Q3CA 3DOJA 4HP8A 4MVJM 4AJIA 4RPKA 2OHXA 1H6BA 1PX0A 4MP6A 3GLQA 3WIDA 5I8WA 1R6DA 4E2XA 3WQRA 1NHWA 3PIDA 3CPSA 1VJTA 4NJMB 5IZCA 3TZHA 4BUCA 1DC6A 3H65A 3I5MA 2UYYA 3QJ5A 1Q1NA 3JQAB 3MJ4A 3WYEA 2EKPA 5F5LA 4CM9A 2VYND 2NTNA 1HEUA 3DL2A 2AEFA 1OMOA 1ZK3A 3HDYA 5ER9A 2GN8A 5JS6A 4Q3EA 3L0DA 3ZWCA 1H9BA 3RIHA 5F5NA 5A04A 1XR3A 2Y0CA 5ICMA 5JDCA 3VPXA 4E6PA 3CMMA 4CL3A 1IUKA 2W98A 4DRYA 2BGMA 4RGBA 2O3TA 1H93A 1XDWA 3NTQA 2PKRA 3KSZO 4B4OA 1V8BA 5FEUA 1QORA 2FPIA 4JBHA 2X22A 3OIDA 3AUAA 3NGXA 1LI4A 3WJ7A 1EQUA 4AFNA 5EL0A 1GV0A 3FNGA 1I3NA 1JW9B 2GZ3A 3CINA 4Q3AA 1Y6JA 3TNLA 1P77A 1CEQA 1GCOA 1E1KA 1DFIA 5BNTA 1H6AA 3GVIA 4GKVA 5HBRA 3BIOA 3VTFA 3VHRA 4UUOA 3GGOA 3RC9A 4L8VA 2E6UX 2IZZA 2PLAA 3FWNA 1FDWA 1PJSA 5G0VA 3ZHBA 1LDMA 3VKVA 2QYSA 1PS0A 2OP1A 3WQSB 2WD7B 4XIJA 1U7HA 5IJZA 3CMCO 2QIOA 3ADPA 1GZ6A 3VZQA 5EESA 4FFRA 2BKAA 3UH1A 5EINA 3UICA 4IXWA 3ZWWA 1XQ1A 3IP3A 1I5RA 4I5GA 1E3WA 5EQFA 5JC8A 3V2UA 4B4VA 3AI2A 3U09A 3JYOA 4I9HA 5L40A 3VC7A 1YBMA 1E3EA 1QSGA 4AICA 4BB5A 1H0KA 5CAEA 1RM5A 3G1UA 3GNSA 3OBBA 3R3SA 4PN3A 2P9EA 1HE5A 2H9IA 3RVDA 3IDSA 2H6EA 3PJFA 1NFQA 2FSVA 2CVQA 4Z9XA 5FWNA 3FRJA 4CQLB 1GEGA 4YB8A 1GYPA 4KTTE 2O7QA 5JSFA 2WSBA 3PLRA 2CF5A 3JQ8A 4NJMA 1W4ZA 3LU1A 4R5MA 4IPTA 3HN2A 3ROMA 3JQAA 3VZSA 3WFJA 2ILTA 3K31A 1ISFA 4KWIA 4QSMA 4AJEA 1KVQA 4LCEA 4A27A 4MPDA 4EUHA 1SEVA 3JQ6A 3MJVA 4L4XA 4B7XA 1QYCA 3OH8A 4JLWA 1RYDA 5I8ZA 4GMFA 1AXEA 1TI7A 2A35A 5EPOA 3ZN2A 4J2HA 1WLYA 4CLDA 4IJKA 1U1IA 3H3FA 1P0CA 4WLNA 2I67A 3GZNA 3KHUA 5JO9A 4IZIA 4NBTA 1HDZA 2IYOA 3QVOA 3KOUA 4XIYA 3PQDA 5JCJD 3GNQA 4UEOA 2J3KA 3GPDG 3F5SA 4YJGB 2P2SA 3VPHA 3GFGA 1UAYA 2UUPA 3KM0A 2X7HA 2I3AA 1ISJA 2O3RA 3R3JA 4L74A 1BHSA 1FF9A 2BFOA 5F21A 1EUDA 1Q0HA 4URFA 5EN4A 2C5AA 2X5OA 4TQGA 3LT1A 1IZ0A 3DXFA 2Q1SA 2G1UA 2Q3EA 2X0RA 4R1UA 4RLSA 4LCJA 2YV1A 3AJRA 3D3EA 4FFPA 1HDGO 3FTNA 2ZB4A 1NR7A 4PLZA 4ZRMA 1RWBA 1ENYA 1VRWA 1HDOA 2Q45A 1PGJA 4TRRA 2WYUA 3ANMA 1H94A 4NHEA 1KEPA 3SX2A 4BO7A 2PY6A 4BMSA 9LDTA 3WYCA 3AFNA 3KYCB 3NT4A 3CUKA 5A1TA 3ZV4A 4FDAA 3AM5A 4NMHA 3LC2O 1GDHA 1SCUA 4OXNA 4N5LA 4ZA2A 2WM3A 1VKNA 1JQBA 3FSRA 3E9MA 2FR8A 4F45A 3FBTA 3GDOA 2JAHA 4NBUA 4XQCA 1UZLA 4ZQHA 4CQLA 4YT4A 3FNHA 2HQ1A 1C1XB 3VPFA 1KYQA 1U2GA 1MFPA 2B69A 2X1HA 3GHYA 3DMTC 4RCVA 1X7GA 3WGHA 4F46A 4I1IA 5GMOA 5HS4A 2VWHA 4TROA 4J1TA 2FZEA 2D59A 3PK0A 4OQYA 4J49A 1U5CA 2EKLA 3COSA 3GAZA 4BKQA 4IXTA 4BNIA 5CG1A 1UUFA 4YJFB 5GZ1A 2J5RA 1KIFA 5JMPA 1ZEJA 3LQFA 1RPNA 3NX4A 4J43A 4XB1A 1XKQA 2NWQA 3TRIA 1BW9A 2EP5A 1HDYA 2X86A 5DDIP 1D7OA 2W2KA 2DBVO 4BNGA 1NTOA 1LEHA 3GH3A 1I2BA 1Z6ZA 3ZU2A 5IXSA 1YL7A 2HDHA 3F1KA 1DIRA 1HF3A 2WEKA 4XCVA 3JQFA 4BO9A 3EZLA 2WJPA 1VL0A 2VWGA 4RDIA 3KYBA 2C29D 5DN9A 4Z9FA 5A4DA 5HTOA 2R00C 1WMAA 4M8SA 4W9NA 4NNJA 2PZMA 1A71A 1DFGA 1VE9A 2I6TA 4DXHA 2C5EA 4CM5A 4D43A 1HZZA 2B4QA 3KBOA 4AJPA 3TF5A 1T1SA 2YFQA 1ZCJA 2I99A 2W8ZA 1WW8A 4ROSA 1E1NA 4NJOA 1I36A 3GVCA 2ZCUA 5JDIC 3JQEA 4WLUA 2AXQA 2V6BA 3G79A 3M1AA 3ROPA 2B36A 1NFRA 1H9AA 4YVFA 2TMGA 1KEWA 4K28A 2PZKA 2ZYGA 1P3DA 2RH4A 3WG9A 2X5JO 3N7UA 4JP2A 1YVEI 2W2LD 1PJTA 1X14A 4IY1A 2Y1CA 5IDWA 3CEAA 4E5MA 3EZYA 4GSKA 4AL4A 4IDGA 3AUSA 5KJ6A 1BXZA 1VI2A 4WE3A 3KLMX 1K2WA 2HLPA 1GY8A 4OOFA 3EAGA 5JFOA 3HJAA 3H9UA 3DOOA 4RVSA 4Z0HO 3WWYA 4L4RA 5L7WA 2HMWA 3HFSA 1N8KA 2PR2A 1F0YA 4XZ3A 2FY8A 3C85A 1HL3A 4B7UA 3KVOA 1C1XA 4RPHA 3AY6A 3RD5A 1Y9EA 4QX6A 1LX6A 5FF9A 5I7EA 4RZIA 1ONOA 2FPGA 3IOYA 3PYLA 3OICA 4IDBA 4JJFA 4EW6A 4PLGA 1AN9A 4UULA 4EZBA 2DUWA 1P45A 3V8BA 4TZKA 1PWZA 1Z7BA 2HKIA 1RM3A 2YJZA 4WCFB 4OMUA 4YAGA 4P38A 3UCEA 4NG5A 4RF5A 4DQUA 5IF3A 3D5TA 2R2GA 4AJHA 1VM6A 4QFCA 1EK5A 1IOLA 4R9SA 4R16A 4FSHA 2VHZA 1KERA 1U7TA 4CV1A 3RUCA 1WDKA 4O0LA 3TL3A 4RVHA 3A06A 5THKA 3HN7A 3H5AA 5AXAA 4CL8A 3GOHA 3IC5A 2QRJA 5JLAA 1A72A 1NQ5A 1ISMA 1M6HA 3ICPA 1Z75A 4DPKA 4CR8A 2VHXA 1V3VA 1PS9A 1V6AA 4B8WA 1A9YA 1PIWA 1LRJA 1I01A 1PJ2A 1P1KA 3AM4A 5L9AA 1Q7GA 1ULSA 3F47A 4CQMB 5H83A 4E30A 2JAPA 2ZJ0A 2PD4A 3I9JA 1HRDA 2A9FA 2YYYA 3VVBA 2DT5A 2CVOA 1R37A 4IDDA 3AM3A 1VL6A 2G5CA 2Q2WA 3W4JA 2XAAA 1X15A 2D3TA 2JD1A 1R0LA 3FTPA 4GVLA 1M2WA 3IQDB 3PQEA 1MLDA 3F6YA 1FXSA 1GUFA 1OC2A 4GAEA 5HS6A 5JXWA 1DLIA 2JFHA 3OP4A 3DQPA 1EDZA 1JKFA 2O7SA 3ROKA 4ZJUA 1OZAA 1BG6A 1P1RA 3WBFA 4G2NA 2HUNA 1U9JA 3JQ7B 1G0OA 2Q2QA 3DHEA 3FNFA 3RJ9A 3UHAA 2EEZA 3GPIA 3ICCA 3WGOA 1LDNA 1U5AA 3WGTA 3OJEA 3Q0EA 4UVIA 1CWUA 1E5LA 1H2HA 1LDBA 4IDFA 1IHXA 2VRCD 4RF4A 5C3MA 3GK3A 2EJVA 2OUIA 2OP0A 1DO8A 2AQKA 1DAPA 1DPGA 1IPEA 1WP4A 1ZK4A 3JV7A 1DBVO 5DBGA 4BKUA 4GX2A 3OA2A 1C0PA 1PTJA 3ZU3A 1JU9A 1TEHA 3BMOA 5DF1A 3EK2A 4WEQA 2CF6A 3FR7A 1ZJZA 4HNHA 4CMHA 3GT0A 5FYDA 3ZNPA 4BO8A 4WOKA 1Z45A 1KVRA 1R4MB 2GERA 4PG4A 3I23A 3T4XA 2EW8A 2XOXA 3F3SA 3E5MA 4INAA 4BKPA 1PZGA 3SLKA 3F46A 2D4AA 3KXDA 3S55A 1LA2A 1T4DA 1L7EA 4OM8A 2YUTA 4E21A 4DQXA 8ADHA 1ISHA 2VT3A 2B5VA 3LT0A 3ONEA 4FFMA 2JFGA 2XXBA 3QHAA 1F17A 2EF1A 3INGA 4P8RA 2D0IA 4MVJG 3WWZA 4CR6A 3K96A 3GDFA 2AEJA 1JN0A 3DONA 2DVMA 4QTZA 4DIOA 3GFBA 3OJ0A 3DTYA 4QECA 2PV7A 3FPCA 4ESOA 4FN4A 2NNLD 3R1IA 3M2PA 1BXKA 3MZ0A 3AUUA 1C1DB 2PD6A 3U4DA 3ST7A 1WVGA 1LC3A 3P2OA 2DPGA 3E9QA 3PDUA 1ML3A 3H9JA 1OFGA 4I5EA 3UN1A 4E4YA 4EUFA 2ET6A 5ILOA 3KETA 1P0FA 2UAGA 3Q9UA 4NU6A 4Z6KA 3GRKA 5CPFA 1MC5A 4YRAA 4HWKA 2H1SA 1EVJA 1YE3A 3V5NA 1CYDA 1L7DA 1KY5A 3N74A 3WGGA 2VNAA 4GX5A 3JQ7A 4EUEA 4BO1A 2GSDA 4KZPA 4RVFA 5AXBA 3G17A 1MG0A 1E6UA 3T4EA 1YOVA 1LQUA 4LVUA 3KEQA 3SJUA 5B4TA 5CDGA 1UZNA 4WPGA 5CPBA 2GASA 3RUIA 3H9EO 5I9MA 1MB4A 3E82A 1BDBA 3JD2A 1FMCA 2BELA 2EG9A 3ZWXA 1NHGA 2DFDA 1LBEA 5TSDA 4DC1A 1H6DA 5EQDA 1ZNQO 4PZCA 1HDCA 4AJOA 4BO3A 2QYTA 4CV2A 3TZ6A 1P31A 1ZFNA 4IMRA 3H9QA 4DUPA 3A4VA 4Z9YA 1CETA 4XX0A 2OXIA 1BXGB 3OMLA 4NR0A 3GGPA 5KNLA 2A4KA 3DMYA 3IJRA 3JQ9A 4CM7A 3FHLA 1G0NA 1Y5RA 1NM5A 3EW7A 2DLDA 4OXYA 1M75A 1P1FA 1M66A 3H5NA 3I1JA 3PHIA 1E7QA 2D8AA 1TXGA 5TS3A 4HX5A 3JD1A 1M67A 1Z73A 2AG8A 3WXBA 3JD3A 4CV0A 2Y68A 5COAA 3MOGA 3ZW9A 5L53A 1HE4A 3L6EA 1DB3A 1EBUA 4IINA 4B4UA 1Y8QB 4YRDA 3PYMA 3SEFA 1UP4A 1KETA 4D3FA 5B4VA 2IDZA 1WAMA 4U5QA 3RAJA 2UV8A 4BNYA 3WGYA 1HT0A 1NX6A 2HCTA 4WGGA 3G3EA 4KQWA 4JN6B 2J3IA 2VUUA 2JL1A 5H82A 2CVZA 4Y6SA 5JYDA 2GYYA 3LT4A 2PKQP 3PIIA 1HE3A 2AEMA 3TWOA 5JYEA 2RCYA 4BO0A 4R1SA 2AE2A 4UVGA 4BB6A 2FN7A 3JYNA 4BIIA 4CM3A 4QEDA 4TKLA 3A9WA 4HXYA 1O6ZA 3D4OA 2HRZA 4IMPA 1E3LA 3L9WA 5I7FA 4J4BA 1PJQA 3LZ6A 3OQBA 4GWKA 3S1LA 5EJ2A 4EI2A 1Z74A 1Y9AA 1E6WA 2NLOA 4UEJA 5F3RA 4CPDA 4YT2A 3KRTA 3DZGA 4U8GA 4GBJA 2C7VA 9LDBA 4M89A 3DBLA 2HRBA 4KUHA 1I0ZA 4MIYA 3NAQA 4J7XA 5FFFA 1HETA 1DJQA 2NTVA 4KUGA 4MKZA 1LDYA 2Q50A 3PHLA 1PJBA 3IJPA 5BSGA 4ND1A 4ITUA 5IDXA 1V3TA 1U4SA 4J6FA 1N7GA 4YJDA 3ONDA 4NH4A 3BHIA 4GQAA 1Z82A 3TZCA 4B4WA 1GU7A 3GG9A 2FSSA 1F8FA 1TT5B 2VYNA 5TRTA 3RBZA 4W82A 5EERA 4HKTA 3UCFA 2J5KA 4M86A 3U49A 2Q1UA 1I3LA 1IHYA 1DXYA 4MVJH 5HRUA 1ARZA 4JP3A 4E3ZA 3S2FA 1K89A 1B3BA 1KEUA 3F1LA 4XD2A 1BWSA 2GN4A 4MVJF 2GUGA 1UDAA 1JAXA 1GTMA 2E48A 4OH1A 5ENDA 1YS4A 3PWSA 3ZI0A 4BNXA 4IDCA 5IN4A 5KCZA 3V1UA 4RF3A 3TN7A 2O48X 1QYDA 3IKTA 3I6IA 1TB4A 5A02A 1SPXA 3WSWA 3UXYA 4RPJA 2DFVA 3FI9A 2VZ8A 5BR7A 4CM4B 1O89A 4KUEA 5ER6A 3JSAA 3VZPA 3NDIA 3JQ8B 3AOEC 3ZHZA 1NXQA 4BNVA 3RSHA 2FOIA 4FBGA 3PEFA 1NFFA 1WZEA 4R01A 4PCVA 4YQZA 1UR5A 3H9GA 4A03A 4CMEC 2ZB7A 1WDMA 2AHRA 1H2BA 4OAQA 1CDOA 5TT1A 4GKBA 3OQ1A 1FJHA 4NFHA 1LUAA 2Y1EA 3QVTA 5THQA 3GZNB 1XELA 3BTOA 3MTJA 2GR9A 1EE2A 1B3RA 3D4NA 1DLJA 1YBVA 1GYRA 5T67A 4WNCA 5A3VA 1K6JA 4PGFA 1D4FA 4QT0A 5A3JA 2JCVA 3D1LA 1MXHA 2TMDA 2W4QA 4J16A 1DIHA 4RQTA 4AJ2A 2ZYAA 4DGSA 4LMPA 1HLPA 1NAIA 2C82A 3O8QB 4BNFA 3E6AA 1ZEMA 2A92A 2P4QA 1DIBA 4J1NA 2VCYA 4XEHA 1I3KA 3GNTA 5TJHA 1TT5A 2J3HA 1LLUA 3O9ZA 1PQUA 2RH8A 5K6AC 3MJCA 4XRGA 4FD3A 2PNFA 4XYMA 1KY4A 2Z5LA 1RM4A 4UVHA 3EMKA 2X5KO 4W7HA 3O38A 2SCUA 5GZ3A 1PQWA 4GX0A 4A7PA 1UP7A 4JNKA 1Q0LA 2QX7A 5DP1A 2ZYDA 2RAFA 2HJSA 1O95A 3GGGA 4RL6A 2EJWA 3GHHA 3EYWA 5JCJA 4CMIB 2Q4EA 3I3OA 3HSKA 2GO1A 3SLGA 1T26A 2OGUA 4BS9A 3KZVA 3RI3A 4CM4A 2C20A 4J1QA 1ZSVA 1TVEA 4MVJE 1GEEA 3L77A 3QVXA 3WMWA 4NQZA 2CSUA 5BSEA 1K3TA 5IZCC 1OI7A 3GEDA 1TLTA 3QLJA 3BZUA 3T7CA 2X58A 2GPTA 4RZHA 3QWAA 3W8FA 5BT9A 2QRLA 3ZNQA 3QV1A 5MGBA 5I7SA 1BW9B 1SB8A 4W7IA 1UZMA 3DMTA 4YR9A 3KV3O 4ZVVA 2ZQZA 4LSWA 2W2KB 5JY1A 5JDCC 3DFZA 4XR4A 1XQ6A 2I76A 1M76A 1UXJA 1NQTA 3PHGA 4IJUA 3WB9A 1RKXA 2RHCA 3DBRB 4B79A 1ZJYA 1B26A 1EUCA 2FRDA 3GMDA 3VAZA 5KOIA 3NT2A 4J4TA 1GQ2A 4FR5A 4RVGA 1GFSA 5ITVA 2DBRA 1R16A 3LLVA 4S3MA 3TQHA 2ZJ1A 4CLOB 2V6GA 3MCVA 1X7HA 2VT2A 3O8QA 4DIFA 4XJSA 4C7KA 1GZ4A 3HB4X 4YJHA 1ISIA 2ZCVA 3A1NA 3ON5A 2V7PA 2GF2A 3PXXA 5BNIA 1K6IA 1UXHA 2HO5A 2UDPA 3RUHA 2VWQA 4TRJA 2NVWA 4BNWA 3RUFA 2P9GA 4HFNA 3QY9A 2HU2A 3NV9A 1V0JA 4ND3A 3I83A 4U0JA 5BNFA 2HK7A 3LYLA 2Y1DA 3FNEA 2ZATA 2X8LA 5JDIA 4FOSA 4RORA 1YL5A 1YRLA 3CZMA 4AJNA 5G0SA 4CMIA 1ADCA 1GYQA 3GA0A 4UVEA 4CLHA 3MWEB 4TVOA 1VKOA 3QRWA 4IZHA 1JDJA 3BMQA 3GN2A 2B4TO 1VPDA 1HYEA 3BA1A 3ZWBA 5CDUA 4BKOA 1U4OA 3KTDA 5DULA 3QVSA 1E6EA 2O2YA 2FR0A 4Y98A 5JAMA 2DTDA 2BMAA 4IQ8A 1VSUA 1Y7TA 3EUWA 3QSGA 3ZWMA 1MC4A 3CZRA 4AJ1A 4Y9DA 3RU7A 3RUEA 3MJTA 1NBOA 2O2SA 1LSOA 4ALKA 1JLLA 1MP0A 1E77A 1EK6A 3D4PA 3D64A 5G4KB 5JO0A 2OFPA 2P4HX 1U3TA 3ZWVA 4JBIA 1DHTA 2W2LA 3UOGA 4YWJA 4H7PA 3BYZA 1SNYA 3ADOA 3STHA 3DBVO 1A9ZA 4PZDA 2PH3A 2J6IA 3M1LA 4H3VA 4HADA 1K6XA 1KVSA 4ALIA 4YXFA 1LRLA 2JCYA 3DBRA 3I4FA 4YQYA 4CM6A 4RVDA 1E7YA 1UXGA 4J2OA 1I30A 3A14A 1L1FA 1UJMA 2O23A 1YQXA 4XYLA 1Q7CA 2EV9A 2X6TA 3C1AA 4YACA 4IUYA 3PGXA 4I5DA 5IZ4A 3LK7A 2E4AA 1NPTO 5HWSA 4MVJD 4CLOA 5CG2A 1E7WA 2GDZA 3ZU4A 4E2YA 1FDSA 1LTHR 3E9NA 3I9OA 2ZTUA 2EW2A 2YV2A 4GX1A 3ZV5A 3SJ7A 4TRNA 2HJRA 3IIEA 4UAGA 4ILKA 1U3UA 1LRKA 1B8UA 1EFLA 1KC1A 4MINA 5JAZA 4Z3KA 4FFOA 2B83A 1CIVA 1FDTA 3GVPA 5L45A 1QYWA 3V2GA 1MFZA 3W1VA 4Y6RA 1IY8A 1DC5A 5AYVA 2FZWA 4II3A 3AU9A 1W73A 4WKGA 2NU7A 4YAEA 3QWIA 1JVSA 5TC4A 2Q2VA 5JE8A 4H15A 3W6UA 3NJ8A 3ETEA 2E37A 3PHHA 3WR5A 3TOXA 2PTGA 3NEPX 1SOVA 3UCXA 3LC7O 4OO3A 2CFCA 1IPFA 4D79A 3O26A 3ZV6A 2FR1A 3WTCA 1B7GO 1XSEA 2GZ2A 3OIGA 1R66A 4R5HA 5TJ9A 1ZXBA 2PZJA 3FCOA 1D3AA 1XYGA 2QG4A 3BMOB 3LDHA 1YO6A 1HDXA 1ZVMA 3KEOA 3B1FA 1UXKA 2V6FA 2WYWA 4IGEA 4QQRA 1E3JA 5G4KA 3OQ6A 2H63A 3GY0A 2JJYA 2EKQA 3ZCXA 5BSHA 3P19A 4J0FA 1CQJA 2OORA 3E18A 2WTBA 3E8XA 5KVSA 1C0KA 3OFSA 3QVWA 4XQ9A 5AOVA 3JQGB 3SVTA 2CZCA 4K9DA 3X2FA 2LDBA 3DC2A 2Q99A 2P5UA 4UUMA 4ZN6A 5JAIA 1F14A 1HSOA 4WLFA 2QW8A 5DOVA 1PR9A 4PLVA 4CM8B 2VRCA 1SAYA 3QWHA 3RU9A 3WFIA 3BMNA 3C3XA 3WNQA 2PKQO 1PEDA 5A9TA 1F12A 2V6MA 3Q2IA 5KJCA 5COBA 2IZ0A 3H4VA 4DLAA 4W9NC 1EFKA 3GR6A 3MJSA 3PJEA 2Z1NA 4LK3A 3PJDA 3ETGA 5U4QA 3KO8A 1YJQA 4ZHSA 3FWZA 3WQQA 1GL3A 1HLDA 4F6LA 4YAKA 4PLCA 3HZZA 5JY6A 4AJ4A 3P2YA 3PFWO 3RJ5A 3W6ZA 3PJGA 4IDEA 2ZB3A 5A5EA 4DWVA 2CUKA 1E1MA 2OOSA 4A73A 1SBYA 4F6CA 4GLLA 1NVGA 4FCCA 3JQBC 4O63O 4RV9A 4WOJA 4E12A 3BHMA 3K2BA 1CJCA 1Q7BA 3OEWA 4XGKA 1Y5MA 2FMUA 1XLTA 2BFAA 3LVFO 4PIVA 2IE0A 1KOLA 1A5ZA 1YGYA 2PFGA 3BXXA 4W4TA 3TJRA 5B12A 1C0LA 3VPGA 5AXCA 1VL8A 1YOVB 2D2IA 3OJOA 4CM1A 4LRSB 4UUNA 4A10A 5ES3A 4GGPA 1E3SA 1A7AA 5ITWA 3GG2A 4DYVA 2OBYA 1EMDA 3L4BC 4JK3A 5L4LA 4R1NA 5DZSA 3DAPA 5G4LA 2IXBA 3DOCA 1N92A 2IXAA 1MG5A 3ZNOA 3HG7A 3WSVA 4WCDA 4D0SA 3Q2KA 3TL2A 3ORFA 4NDNE 3AK4A 3OA0A 4XQEA 4NU5A 4J1SA 2JD2A 3HB5X 2VZ0A 3NDJA 1B8VA 4BQRA 3ZH2A 4XRRA 1DHRA 1VSVA 3EY4A 4FS3A 4YT5A 5H81A 1YJ8A 3IAHA 4WLVA 5T6BA 4CMGA 3RBVA 4RDHA 3JQGA 2JHFA 3OETA 4MOWA 4KMSA 4KQXA 4I9NA 1W6UA 3K9QO 4BGVA 1D8AA 4TZTA 2NQTA 4Q39A 3JQCA 4YTEA 4MVJP 4L76A 4N7RA 4CM8A 5IAAA 2YDXA 2X0IA 4OYRA 1ID1A 2WDZA 3JQDA 4KDEA 1ZXLA 1KEVA 2PA3A 1HYHA 1XIVA 5JC1A 4XKJA 4PLTA 1KVTA 3R6DA 2QZZA 1I3MA 4EJ6A 5JCXA 1S6YA 2Y99A 2UVDA 2CMDA 1WDLA 3LF2A 4YAIA 5KIAA 3OSUA 1OOEA 4XGIA 1T4BA 5I9NA 1V35A 1E92A 4YAJA 1HWYA 1YQGA 4YBZA 3C1OA 4DBZA 2DBQA 4HNGA 5F1OA 3JYLA 2DBZA 2LDXA 3F9IA 4M54A 1YWGO 5KJ1A 4JIGA 5I9LA 5T8KA 2G0TA 1Z7EA 4E31A 1HXHA 1RYEA 3ZGYA 4DYDA 2H5LA 1ZK2A 1E5QA 1ENPA 2IEDA 4XJTA 1KC3A 2AA3A 4J4HA 4LW8A 5JAQA 4JGBA 5A9SB 3PQFA 4WECA 3NT5A 1FK8A 5CFZA 1DOHA 4U0KA 3SC4A 2BH9A 3DBLB 4XYBA 5KTKA 2X0JA 1LQTA 3SXPA 1ONNA 3QW2A 3FPLA 1B14A 1A4IA 1YONA 4GVXA 4HV4A 2J3JA 4J90A 4BNZA 1GQYA 4LGVA 4N54A 2C2XA 1I8TA 2P9CA 5DOZA 3WMXA 2PH5A 3K5PA 2O50A 5TLSA 3PTZA 2BHLA 4B3JA 1QG6A 3ONFA 4GI2A 1NPDA 5TNXA 4IGFA 5L4NA 3CIFA 4I5FA 4DLBA 1I24A 3ZWOA 2I5PO 2AQIA 4Q3CA 4WCFC 3RBXA 3GZ4A 4NK5A 2VHVA 4GLOA 2VHWA 2VNSA 2WWRA 1AUPA 2BLLA 2GRAA 3DHYA 1QXSA 3K2EA 4PG5A 4Y8VA 3U3XA 1E1LA 1QV6A 4GSLA 4JXKA 5AVOA 4ZQEA 2Y66A 1R12A 1UDBA 3QP9A 4BNLA 1PJLA 4DBVO 1YB1A 4P22A 1QV7A 1B2LA 2QZ9A 2YY7A 3S2GA 1QYXA 2E49A 2GN9A 3JD4A 4PRKA 3TFOA 2VRBA 3L07A 1ADFA 4IIUA 1Y8RB 2VN8A 3DO5A 3WLEA 1U8FO 1PGOA 1GPDG 1PZFA 3GEMA 4BQPA 2YFHA 3NUGA 1NPYA 5GY7A 3BAZA 3ITKA 3GUYA 2BGLA 4DLLA 3U4CA 5B1YA 1JVBA 1HKUA 2DUUA 5F1KA 3IL2A 3GVHA 2Y67A 1JA9A 3DAFA 3WGZA 1ZUD1 1H5QA 2V65A 1HDRA 3WNVA 1R4NB 3D7LA 1X1EA 1HZJA 4RPLA 3K6JA 2Q1WA 1D1SA 5BQFA 3NGLA 1XCBA 1T24A 3WOHA 4BV8A 4HUJA 4TRMA 3C7CB 2Y1OA 3VKUA 2C07A 4PLYA 5AQ1A 2X4GA 3CSDA 3HQ4O 1LNQA 5KVQA 3S2EA 1I2ZA 4L73A 2GN6A 1IL0A 1GUYA 1XWFA 2BF7A 1I33A 1RM0A 4TKMA 5L95A 4OQZA 2PGLA 3PP8A 3GC6A 3G1TA 4R68A 2HSDA 3HFGA 1YB5A 5A9SA 3ZWYA 5DBIA 1BSVA 3H8VA 2O4CA 4CLRA 4CMAA 1PGQA 3B70A 3M2TA 4KWHA 1EVYA 4BMVA 1X0XA 4L0QA 1NYTA 2IEBA 1CQIA 1O8CA 5IDYA 4NFSA 4JJGA 4K1LA 1HSZA 3SBOA 3TZQA 1LLQA 4I08A 4FW8A 2BFMA 3TFQA 2VHYA 5EIOA 3UKOA 4DC0A 1PZEA 1U3WA 3CE6A 4CMJA 3HWRA 2Y93A 3WDSA 4YRBA 4ZD6A 4OHUA 5A9RA 1LSJA 2Z95A 4E2WA 1EUZA 3AI3A 4A2CA 1T1RA 4BO2A 2PD3A 1ADGA 2Q49A 4Z3DA 2EHDA 3SC6A 1T2FA 3PYXA 3VPSA 2VYVD 1J5PA 2OBNA 1LSSA 3FR8A 1O94A 3U5TA 3DZKA 3WX0A 3PRJA 4TSKA 3C8MA 1JKJA 3BHJA 4CJXA 1DC4A 3FN4A 4IS3A 3RKUA 1Y8RA 5K6AA 1JAYA 1QLHA 5CDYA 4J91A 1EDOA 1JWAB 4O5OA 3H5RA 5L3ZA 4O6VA 1T2EA 1PSDA 2Y1FA 4MIOA 2O3JA 3NYWA 2J5QA 1A7KA 4B3IA 1W8DA 4MJLA 1ONPA 1H6CA 1R4NA 3DWFA 1OBFO 1M6WA 4PFJA 1HE2A 3N58A 5JMWA 5CEFA 3VZRA 2NU6A 1MGOA 1C3VA 2QQ5A 3H2ZA 2X9VA 1YXMA 4X54A 4TMFA 3TOZA 3CXRA 4XA8A 2JCXA 1J0XO 4FJ0A 2YZ7A 2F1KA 3Q6IA 4DA9A 4FB5A 5JBIA 1GZ3A 4IQ0A 3ZWNA 5L51A 1LDEA 4ZGWA 5U9CA 4KTVE 4I9UA 1ADBA 1P9LA 5DCUA 4L4SA 5HM8A 3TSCA 3VH1A 3NRCA 3OM9A 3EC7A 4AJLA 1PJ3A 3ASUA 2Q4BA 2DTEA 5K9ZA 3QE3A 1E0DA 5CDSA 3QIVA 3INRA 1J49A 1I2CA 2WYVA 4BL5A 2IODA 4PG8A 3H6KA 4JX8A 1QYVA 1GQQA 5HA5A 4DL9A 2YHUA 3RFVA 2CY0A 4EDFA 1G6KA 4YJHB 1VJ0A 3ZW8A 2EWMA 2BFPA 4RPGA 4AG3A 5L4SA 2ZIZA 1I32A 4RF2A 2Q46A 1PR3A 1CERA 1QKIA 2AQHA 3GDGA 5T64A 4ZICA 1T2CA 2JFFA 2NVUA 5C7IO 3ROQA 4XQGA 2YV3A 4QUKA 4GGOA 1C0IA 4DREA 3D0OA 3WGQA 2GZ1A 4CLEA 4E5YA 1WWKA 2XPCA 1NNUA 5KKAA 2DTXA 1R0KA 5LC1A 1D1TA 1E3IA 4PVDA 4MP3A 4CM9D 4E2ZA 8LDHA 4A5OA 3H7AA 4B7CA 4MP8A 3I6QA 5F1PA 4DVJA 4R1TA 3BMQB 4Q3BA 5KJFA 1DRVA 4PG6A 3I9NA 2WMDA 3VH4A 4WASA 2D1YA 4J9UE 1PL6A 4JBGA 1K0UA 1P33A 2EP7A 4MVJI 1B15A 2BGKA 1Q2XA 3HDJA 3ZZNA 4D42A 1NVMB 3TDKA 5L7TA 2EERA 4BGEA 3AUTA 4AJKA 2JD0A 4BO4A 3GVXA 4TVBA 4EEXA 3H3JA 4CR7A 3AY7A 2C0CA 3RFTA 5ICSA 3QA9A 4YPOA 3E5RA 3IMFA 1B8PA 3VTZA 1DDOA 3L6OO 1LSUA 4H16A 4ALNA 5KJEA 4CODB 4FOOA 1S7CA 4JCOA 2C7GA 1E7MA 3ABIA 3ANNA 2VZ9A 2DAPA 3W8EA 1JTVA 3GQVA 2DPHA 4M87A 4Y6PA 2I65A 2FP4A 4FC7A 2R6JA 3K92A 1FDUA 5GZ6A 2X0NA 4BHTA 4E32A 2FHSA 5LDHA 1ZSNA 1UAGA 1V3UA 2QRKA 3DZIA 3PWKA 1DIAA 3BTUA 2G76A 3OJLA 1IULA 3VDQA 3JYPA 4RVUA 4KP7A 1PL8A 3WICA 4WNIA 2D5CA 3U4IA 2Y0DA 1GUZA 2AE1A 3ASVA 1G1AA 3B6ZA 1T2DA 2QHXA 4PRLA 4GH5A 1JKIA 3ITDA 4K26A 5CEEA 1A4UA 5A05A 4LMRA 2R00A 1DIGA 4J0EA 2OL4A 4IQGA 3GRPA 1F8GA 5G0UA 4U6QA 3K30A 4UREA 4Z0TA 3RROA 4AJJA 4EITA 4YYZA 1PS8A 1EVIA 4OSOA 1SB9A 4G81A 4EYEA 3W8DA 1DEHA 2YDYA 4ZU3A 2VUTA 4YCAA 1ENZA 3F5QA 2X23A 5FI5A 2B37A 3JQAD 3ENNA 3WLFA 2EGGA 1GAEO 1KS9A 3AFMA 3LF1A 3RUDA 3TPCA 1VC2A 3EGOA 1PGNA 2X9NA 3WIEA 2WD7A 1YDWA 4OGWA 1WXDA 2P68A 2YQ4A 3C1TA 3DBHB 4FGSA 3O03A 4K6CA 4RO0A 4U7WA 2NU8A 3VH2A 4MVJA 4WUVA 4YT8A 1QRRA 1LJ8A 2EIHA 4UUPA 1F06A 2RHRA 4CLXA 3HDQA 3EVNA 4NBRA 4Y67A 1ZW1A 4KOAA 5G0TA 5J23A 5C5IA 4HBGA 1UDCA 1P1IA 4R51A 4ID9A 2Q1TA 3UGKA 4QO7A 3UUWA 3Q9NA 5L7YA 1UH5A 1BRMA 3FF4A 4QFDA 4FIZA 1XA0A 4S1VA 1RJWA 2E82A 5A06A 3IUPA 5ADHA 4BV9A 3WJAA 4GMGA 3RCBA 2ZK7A 1NWCA 1ISGA 1UXIA 1Y81A 2DQ4A 4L75A 5KVVA 3VOSA 5B4UA 3ZV3A 5BSFA 3RASA 3ENKA 4ZQFA 1E7RA 2F00A 4BNNA 5IFLA 4E13A 4N5MA 1XU9A 2HMSA 3BMNB 1BVUA 3E1KA 4MIEA 3IS3A 4B8ZA 2BI7A 2B35A 4Z0PA 4Q3NA 2Y05A 2PZLA 2I3GA 3AY3A 3ANLA 1XG5A 2XXJA 3LC1O 1N7HA 3F4BA 1B0AA 4XYGA 1MA0A 3RUAA 4BNMA 2NSDA 5JNLA 1N1GA 1U3VA 4YJGA 2G17A 3DZHA 3P5SA 4J9VA 3F4LA 3ZWPA 3BMCB 3DEYX 4WK6A 3NDRA 3HNPA 2PGJA 4OIMA 3PHJA 4OSPA 3MEQA 3WYBA 1ZKMA 3L6DA 3B1KA 4M55A 3DHNA 4YA6A 2FPPA 5TF4A 4UEKA 5TQVA 2CDAA 4M1QA 4R69A 4FJ2A 4PG7A 2A94A 1ZMTA 1WNTA 1BMDA 2D5AA 3U9LA 3JQBA 1NAHA 3DBHA 2G82A 4EJ0A 5AXDA 3WBBA 5B37A 1O5IA 4DTIA 1NWHA 3FBGA 4EJMA 4NPCA 3WS7A 4Q3DA 2WE8A 3AWDA 3L9XA 3R0IA 4FFLA 2HAEA 1I10A 4IDAA 4P4GA 3ZHXA 1MUUA 3C7DB 3CKYA 4HY3A 4WEOA 5DBFA 2UUOA 4ZQGA 1EQ2A 4RQUA 1NQAO 3KYCA 1BDMA 3HHPA 4NI5A 3JCZA 2NACA 3JYQA 1GPJA 3PZRA 2CDCA 2NV6A 1ORRA 4BNKA 3L4BA 4CQMD 6ADHA 7MDHA 1N1EA 3EDMA 4R54A 4XWYA 3CH6A 1LLDA 4RJTA 3A28A 2I66A 3I9MA 4BNHA 3NTRA 2EGHA 2VOEA 1PL7A 2VWPA 3H2SA 3M6IA 1TA4A 5U1PA 1SC6A 3C7AA 2B4RO 4DMLA 3JQFC 4YJFA 4DMMA 4G5HA 4IBOA 1XHLA 2POQX 4BMNA 1XEAA 2C54A 2NVBA 6LDHA 1YKFA 3VDRA 3DZJA 1P74A 4FPXA 3E03A 2VOJA 1R15A 4HFRA 2HK8A 4II2A 4E5PA 1MV8A 5TT0A 4M49A 4PZEA 3T7EA 4CMKA 3DFUA 4C4OA 4R41A 4LRTB 4CV3A 5DCWA 1EE9A 4OL9A 3MJEA 4PLHA 2X9GA 4IS2A 4JROA 1Y1PA 3Q11A 3ZDFA 1N9GB 4BNJA 4K6FA 2IRWA 3BMCA 1ZIDA 3HDHA 3I9KA 4ND5A 2GCGA 4TWRA 4NBWA 5DCYA 1EVZA 1NQOA 1X7DA 1N5DA 4G65A 1QP8A 3EVTA 2VUSA 4D46A 4NFYA 3OIFA 4B3HA 1DRWA 4PLWA 4DPLA 1AHHA 5C7LO 4CMBA 3GUCA 4D3DA 4R9RA 4XDZA 2YW9A 4RLHA 1IB6A 1YB4A 1LLCA 2BI8A 1J4AA 4WLEA 5FI3A 1BTOA 5DNAA 3PDJA 1AXGA 5MDHA 2HMTA 5G0WA 1R0SA 3MTGA 3PLNA 2NTJA 3PI7A 5CDTA 4MO2A 2HMUA 3V1TC 1ZBQA 2CDBA 3PGJA 4ONEA 5CHEA 3UF0A 4LSMA 5TIIA 1NR1A 1SMKA 5A5FA 3QWFA 5C7OO 4BNTA 4BOYA 1JWBB 1DJNA 5C37A 5TX7A 4IJVA 3B20A 4HFMA 3PWZA 4BO5A 1VJ1A 2JKVA 1WZIA 4D41A 3KB6A 1J6UA 1PJ4A 3DDNA 3OECA 3PFFA 5TGDA 3UVEA 4BGUA 2Z1MA 4KDFA 3U62A 2BRUA 3QWBA 2DC1A 3Q1LA 3PVZA 1A27A 2P5YA 3D5QA 2Y0EA 3V2HA 3ZNNA 1ULUA 4NIMA 1ZH8A 3IKVA 1KBZA 1T25A 2ZB8A 4ND2A 1X0VA 3PZBA 4NBVA 1HYGA 3ULKA 5CEJA 3EHEA 4WCFA 3X2EA 1ZSYA 1YDEA 4FQ8A 1PU2A 3ZWAA 3INTA 2PGDA 4HFJA 3RC2A 5I7VA 4E5NA 4R3NA 1OC4A 4QO8A 2ZTVA 4IIVA 4IJWA 4AVYA 4OXKA 2NUAA 3P7MA 3IUSA 2WE7A 2CNBA 3B1JA 3IP1A 4CMCA 4L9RA 3OF2A 3AW9A 4ZRNA 1LU9A 2DKNA 3NJ4A 4FJ1A 5LCXA 2BD0A 3RWBA 1O9BA 4OOEA 3OHSX 1N9GA 3KLPX 3K73O 4WJZA 3K8ZA 4W6ZA 1EBFA 1YQDA 2GD1O 5IN5A 4XYEA 3WTBA 3MOIA 4CQMA 4ZQBA 4Q9NA 2ZQYA 3D3WB 3I4CA 4LISA 1X13A 3S8MA 2YQ5A 1U2DA 1GR0A 5DP2A 2O3SA 3BTSA 5IG2A 2IYPA 1K5HA 4CLRB 2RIRA 1VLLA 1IE3A 3JTMA 3OJFA 1SEPA 2DU8A 4D45A 1SZJG 1ENOA 4GPD1 2J8ZA 3HE3A 4BNUA 1SO8A 2AQ8A 2Y1GA 1DRUA 5A03A 2I9PA 1YH3A 4BVAA 4C7JA 3QQPA 5JW6A 2EXXA 2HMVA 3VVCA 1GD1O 4FC6A 1BVRA 4OJNA 1B16A 1E7SA 1PQPA 2C59A 2OO5A 4N5NA 3U4HA 4CUZA 1U28A 3UAGA 3GMSA 3GEGA 4NZ9A 5T5QA 2O3QA 5IDQA 3UW3A 2OMEA 1QR6A 2HK9A 3DZBA 1FDVA 5EMHA 3NKLA 1ZZEA 4DIBA 4EEZA 4BKRA 3U0BA 2ZTLA 3VH3A 4A26A 4ALLA 7ADHA 1PJCA 3KSUA 1XU7A 4D0RA 3G0OA 4LVCA 5KVCA 4BO6A 1CF2O 4U6SA 5DT9A 2O4UX 4D7AA 2C2YA 1X1TA 3RQSA 3DR3A 3W4KA 3RFXA 1NVTA 1R4MA 2YHIB 4R4JA 3KYDB 1OAAA 2DM6A 4PLFA 3I9LA 1W0CA 2W90A 2CD9A 4YEDA 4UVDA 4ALJA 4EGFA 1DAOA 2GNAA 1AE1A 1YBAA 1TT7A 3GF4A 1Q0QA 1LDGA 2P91A 1PZHA 1GCUA 2VQ3A 4P4NA 5ILGA 2WD8A 3O4RA 2GGSA 3BTVA 3RC7A 4QXMA 2NQ8A 1ZK1A 1EZ4A 3KUXA 4JJIA 4D3SA 1AGNA 3AU8A 1PGPA 1GADO 3V1YA 4J7CA 5CP8A 4BGIA 4E33A 3L4SO 4GWGA 3LLSA 5T8KC 1LXCA 4P4LA 1AHIA 1T2AA 3D3WA 3JD0A 4XDYA 2VYVA 4GL4A 5G2OA 4E0BA 4NK4A 1C1DA 1NASA 5ENVA 2ZKLA 3AOEA 4XR9A 4W99A 1IZ9A 1WMBA 2VTEA 3DAGA 5LDGA 1CRWG 3AOGA 4XB2A 3ZHYA 2VTDA 2AG5A 2O3UA 4E5KA 3HADA 2GLXA 1KVUA 4J7UA 3I52A 1N2SA 3S2IA 2RBEA 4ALMA 4CMEA 4DQVA 4D44A 4DPMA 4JQCA 3G49A 3RKRA 1U8XX 3GN1A 1YL6A 4O59O 2PWZA 1NP3A 4FGWA 4MKXA 3CTMA 4R3WA 1MXFA 1EEHA 3MWDB 3PPIA 5KKCA 3C24A 4MKRA 5KWEA 2AW5A 1ZMOA 2FWMX 1DC3A 4CUKA 1IYZA 3JQ9C 4XGNA 1P1JA 4YDRA 1WPQA 2NVUB 1DSSG 2B5WA 2JHGA 1GV1A 3LSYA 3TZKA 2PK3A 3UFXA 3DB2A 2NM0A 1LC0A 3LT2A 5IXYA 1HTBA 3RC1A 2XF8A 4IM7A 4O1MA 1BXGA 1PWXA 4CUJA 5COQA 1ZO8A 4PVCA 4I8XA 4LN1A 2OZPA 4F3YA 1P44A 5K0ZA 2YHIA 1QMGA 4OKIA 3KYDA 1UP6A 1C14A 5T57A 1MX3A 3DTTA 1BGVA 3KSDO 3NTOA 1V9LA 3OEYA 3FD8A 3W4IA 1ZK0A 4A0SA 2NU9A 1SOWA 4PLPA 4J3FA 1O0SA 3DZFA 2IZ1A 3ETDA 4ND4A 2NADA 4FFNA 1P1HA 2AMFA 1Y8QA 3E48A 4OKNA 3WGIA 1DFHA 1E3WB 1QLJA 1XGKA 5JPIA 3ZU5A 4N18A 4WLOA
chains in the Genus database with same CATH superfamily
2CLSA 3VI4B 3O3NB 1RYFA 3HUDA 1XHEA 4D57A 4JXXA 2DR2A 1I7SB 4KIWA 3QPAA 4EBFA 4HP8A 4R9VA 4RPKA 5EAIA 4Z7NB 5LQNA 1IJKA 1H6BA 4ZV7A 3WGLA 2GD2A 1NJ8A 1USWA 4JKIA 3AHFA 1SCQA 3WIDA 3AV0B 3LJKA 3EZNA 3LBYA 4L22A 4MHSA 5E9AA 3E3LA 2OENG 3I53A 3WAKA 2XSZA 3UBTA 2FWNA 5HCIA 5HCUA 3QJ5A 4ZCPA 2EKPA 4LX8A 3E15A 4PAOA 1DKMA 2FP4B 3RS5A 2NTNA 2AFHB 3TMKA 3ZXSA 4AUMA 4JNCA 1XZGA 3FUXA 3E9YA 4QJIA 2I78A 1X80A 1V6SA 1H9BA 3GDHA 5F5NA 5A04A 1GM5A 1FU7A 1XR3A 2XUIA 4Y1GA 2Y0CA 3WOVA 1CUFA 3VR2D 3DE2X 1Q95A 3ZYCA 4DRYA 4YAFA 4B31A 4OB7A 3T7IA 3HY4A 3PDCA 4MX8A 2JGIA 3CUUA 4LDPA 3MBKA 3NTQA 4LJ7A 3CXUA 5C9ZA 4B43A 4GE0A 3VYVA 3E53A 1S3IA 2FPIA 4OUDA 3Q8XB 3NGXA 5CLGA 3EIWA 3WJ7A 1KBQA 3NKVA 4G4SO 4JB2A 3C3KA 1CG6A 4H1TA 1I3NA 1X7XB 4KFTA 4EX6A 1JW9B 2GZ3A 3CINA 5C1PA 2WUEA 5DXFA 1BGWA 5IHXA 3N86A 3CNHA 5CX1A 1BDJA 2C3YA 3GVIA 3MW8A 4RHCA 2D2XA 2HO4A 3B5IA 4IIEA 5A3QA 5ITZA 3RC9A 2GXSA 2GJ8A 2WHQA 3FOBA 3DHWC 3TG8A 5SICE 4CGZA 3FWNA 2BP7A 4EO4A 3K70D 3O0DA 4HSGA 1ZONA 2OZEA 2RJOA 3RC3A 1NC1A 5SV2A 5K6RA 3RB8A 4I1PA 4YR7A 1T4GA 1TCUA 1PS0A 1Q21A 2WD7B 3CMCO 1JUDA 2HMYB 1XAGA 1KKLA 2XVYA 2IW1A 2WI8A 3ADPA 3I5UA 4GMXA 3WHIA 3ZK9A 1HQDA 2XA2A 4QFBA 4FFRA 4V0MA 1VRVA 1OLSA 2OZKA 3RS8A 3WMFA 4IXWA 3SQOA 1KA9H 2D2FA 4TL7A 3JAKA 1YFKA 3NHJA 5JVDB 4I5GA 1E3WA 3AXTA 3OD1A 3N6RA 3BD8A 2G3YA 5BV0A 3KT3A 1GR1A 3AI2A 3U09A 3UIEA 3KBBA 1Q77A 3LUFA 1SR8A 4I9HA 5AH0A 1MORA 3VC7A 4FOPA 1AKVA 1ODJA 3TPZA 1DDIA 1Q22A 1PG5A 4GSYA 1H0KA 4PZPA 3GNSA 3G1UA 2HCBA 3ND9A 3OBBA 4RJIA 4HLQB 4PN3A 2H9IA 4DJEC 2YIDA 4LYFA 4UPDA 2BDUA 4WFKA 2H6EA 5EPUA 5TGTA 1BQ4A 5BXYA 1YQEA 2FSVA 3O9MA 1OIVA 5FWNA 1ZOOA 4KNWA 2F3TA 1VYTA 2DY1A 6ABPA 3WWCA 4G36A 4YB8A 1C3EA 2A30A 5JNWA 2HXGA 3OVMA 3L1IA 3EVCA 3LU1A 4IPTA 5AM1A 3D1VA 4UM7A 5SZKB 5L3RA 5AKHA 1E5TA 4EI9A 1WG8A 4KNVA 4UMEA 4KQIA 3MRSA 4RMJA 1GRCA 1T4CB 2RGRA 4E5VA 4KWIA 1SJ9A 3F96A 4C43A 1RT9A 2WKPA 4G0PA 1X7ZB 1GZSA 3JQ6A 4DCOA 4J75A 1C2TA 1W6RA 3A9RA 3SYLA 1TI7A 5EPOA 4LHSA 4GECA 2XMRA 2X0EA 2Q6IA 4O8ZA 4HGQA 4J16C 5TQJA 4YJ2A 3PI6A 1U1IA 3B8EA 3IT0A 3QOXA 1P0CA 4WLNA 4DIUA 3OEHA 4TTIA 4EW3A 3GZNA 4AB1A 2XT6A 1ELOA 1PV4A 5E3HA 2IYOA 5ES4B 1BA3A 2EEPA 2O8DA 3N59A 1RACA 3UWDA 5KUTA 4KIJA 3B9RA 3FFBA 3PQDA 4K5QA 5DWVA 5JCJD 5EIXA 3RYHB 2PUGA 2BLNA 3F5SA 3GPDG 4YJGB 3Q6NA 1BCRB 4X85A 2NPOA 5HQ3B 3KM0A 1X2EA 2DF8A 3SQDA 1ZVKA 5E1BA 3ZBPA 1M34B 3JASA 4MPTA 2LP4Y 5EP4A 5KU7A 4PAWA 3BDIA 4BVGA 5F21A 5H3LA 2XR1A 3WDMA 3F5FA 1PT5A 2F1OA 3KOYA 1NJ1A 4JI0B 4FK8A 2KE5A 3IT1A 5EN4A 5BNZA 3IDZA 1ZLXA 3LXUX 4R8SA 5GP1A 3ORYA 3V9PA 5JJKA 4AKHA 2H1FA 1V39A 4IH4A 4QUJA 2Q1SA 2X0RA 4BQQA 4MDEA 5FR2A 3KZ1E 2LV8A 2O0JA 1ZS9A 1RRKA 2YWHA 3NXSA 4LCJA 3VPAA 3D3EA 2H9AA 1HDGO 1QUEA 2ZB4A 4MR7B 4OLJA 1NR7A 3V34A 5REQA 1PLLA 1YZVA 4A36A 3CX6A 1RWBA 5E0OA 1MOSA 1FNBA 3RJTA 3W5UA 4MQFA 4A23A 3W5CA 1HDOA 4OJMX 4MGYR 2H4JA 2AT1A 4XIGS 2PA0A 2SKDA 2ONJA 2XMGA 3FLAA 2WYUA 3ANMA 1OGIA 3QLVA 4TV8A 2OBXA 3DR5A 1T10A 3CX8A 1KH3A 5KYKA 3MLEA 3GT4A 4V1CB 3FROA 4MRRA 4QBHA 4MR9B 4X41A 1HMYA 4HQ0A 4M53A 1I94B 5A1TA 1VPEA 2P8JA 3G7NA 1A9XA 1TF5A 3OZXA 3SKVA 4G56A 5KYVA 5AKZA 3EC1A 3ZV4A 2C5HA 3LC2O 1SA0B 1SCUA 2P0YA 4OXNA 4C5AA 1SXQA 2WM3A 1JQBA 4LJLA 4Z4GA 1PYDA 5AW4A 4K46A 1U98A 4F45A 2NXEA 4NBUA 4CQLA 1DWPA 2F43B 1PFQA 3OLWA 4RULA 2E4UA 1YZHA 4EKEA 1J33A 3VPFA 3NWOA 4HLUC 1G66A 2B69A 2X1HA 3GHYA 3DMTC 4D81A 5DPMA 3AHCA 1KDTA 4Y1RB 3SJAA 4YP5A 3RVJA 4TROA 2FZEA 2PUVA 2H2HA 1V43A 1YZ3A 5TQ0B 1U5CA 2EKLA 3R6TA 4YJFB 5DNEA 4YRJA 5GZ1A 2J5RA 4BBAA 3GJYA 2FRDC 3WNZA 5HQJA 2C2MA 3NAZA 3NX4A 4EB8A 3GB9A 1AVTA 1QC5B 3JAWB 1W49A 3Q9SA 1ST3A 2C4KA 1H2WA 1NW8A 1VQ1A 1BW9A 2FYTA 2NWQA 4HMQA 1SPBS 2FSUA 2K87A 3RV3A 1K5GA 5J5CA 1HDYA 4BN5A 3S1SA 3MINA 1TKBA 1XD2B 1G64A 2DBVO 2A33A 2IOFK 2W2KA 3LUGA 5KQGA 3UHPA 2GK7A 2NO6A 1Z6ZA 5EG5A 3DE1X 2WAYA 3BGVA 3K72B 3F1KA 2M6LA 4Z9AA 4AK9A 2BHRA 3JQFA 2X2FA 1TQ8A 2FCRA 4IH1A 4KE9A 1QZ3A 2Q3CA 2QD2A 1Z5ZA 2VAPA 3KYBA 3UUGA 3WRXA 1QG0A 2WLSA 1TAUA 3KJEA 4B7ZA 1QIIA 5A4DA 1UBEA 1BX1A 3WKEA 3DDHA 4YDQA 2BGGA 1WMAA 2VQEB 1WOMA 3LDGA 4M8SA 4W9NA 5DJ5A 3UG6A 5K8JB 5KTOA 2AMLA 3F7TA 3HWSA 5IF9A 2QNRA 3LXXA 5AUPB 3UAZA 4ZT5A 3QBEA 2HZ7A 4CM5A 2Q4OA 2JIZA 4G01B 1QHHA 1SN7A 1KAOA 3VZDA 1UMCA 4ROSA 3S68A 1E1NA 1WXIA 2P2NA 1YR9A 4I3HA 5JD5A 2Z1DA 1VPTA 3GVCA 1HDEA 1JXQA 1PT9A 3JQEA 1AXRA 1U7XA 2AFIB 4O5AA 1TJPB 2AXQA 3ID6C 3T0FA 3KDPA 4HDOB 4NOJA 2ZJ5A 1G38A 2TMGA 2REQA 3N75A 3KPYA 2H7CA 1XTUA 2RH4A 2X5JO 2XCSB 4ENRA 1PJTA 1X14A 4MMXB 2AOUA 4OGLA 1YUMA 1FRFS 3FYCA 3R0QA 2K2WA 2Z6UA 4OHWA 4YMUA 1OFUX 1CX9B 1GG2A 1NZJA 4CBVA 2B2CA 4MQ6A 1P9OA 1Y9ZA 4LHZA 4WE3A 4D9EA 2HLPA 1GY8A 2WOJA 3JWHA 4OOFA 3Q8MA 2J59A 4AD8A 4Z0HO 4RVSA 4R0NA 1B41A 3MSXA 1FLVA 3IAM1 2GN2A 3IBTA 2B6NA 3PC6A 3W3AD 4I8IA 4OHOA 1I6WA 4OSEA 4CIYA 3FBWA 4QXAA 2QQ0A 2FY8A 4IDPA 4Z49A 4LDRA 3G5TA 5F76A 2IP4A 2V7TA 1Y7HA 2O2JA 3F4KA 1WPXA 1LPBB 3FGNA 4MXDA 2F2TA 3VV3A 5CITA 4F4CA 1SK9A 4QX6A 2MSWA 3X1MA 3OLQA 3PRYA 4RZIA 2FPGA 4PNPA 4BQSA 2QUKA 1YOBA 3ODPA 4EVRA 1EB9A 2WG0A 4EQZA 2RARA 3ITEA 2H3EA 3HXPA 1BYUA 3O4VA 3V8BA 4PZZA 1RM3A 3V8QA 4YAGA 3TIIA 1I7LA 1UBLS 2J41A 2QTAA 4ZXFA 4DQUA 5IF3A 5I6DA 3QFSA 1QIHA 4G5QA 5DI3A 1MC8A 3I8OA 3FPSA 5JAPA 3P97A 2P9TA 1NJFA 1UEXC 1IOLA 4DW8A 2PMEA 2ZUUA 5JATA 4FSHA 5C1IA 4XDHA 2DWUA 3TZEA 5AKEA 1XVAA 3KHTA 5NULA 1DJPA 1WF6A 4CV1A 2JGMA 2AW3A 4QRHA 5JSHA 1EP1B 3UATA 4MS4B 4LDZA 4IX1A 4O0LA 4OLFA 3EZ7A 3A06A 2O1EA 2EFGA 3ZWKA 3HN7A 4K0KB 3A6ZA 3TLYA 1GUAA 4MWCA 1RWMA 1NQ5A 2G25A 3D0QA 1ISMA 4ZEXA 4B81A 1Z75A 3V4FA 5JV5A 2XA9A 1V8OA 3SNHA 1JHOA 4TMKA 3CHYA 1V3VA 1PS9A 1V6AA 2F1RA 3OHMA 1A9YA 5BN5B 5CXUA 4RESA 2O6LA 5JYBA 2V98A 4YMVA 2CC2A 2QTCA 3MTIA 4B6JA 1XNQB 2JAPA 3I9JA 1GNQA 1HRDA 3GMTA 2A9FA 1A2BA 4ARUA 1ECCA 1KI7A 2RGNA 1TM7E 1E9BA 3AM3A 3K0BA 1TD9A 5LMNB 4HZUA 3ME5A 1PN3A 1L8QA 3T5PA 3EDRA 1E18A 4GVLA 3IQDB 3IDQA 1WCIB 4Q6WA 2VUHB 4P82A 5KAPA 1QCZA 2CXPA 1YB7A 1C30A 3Q72A 4YREA 3PNPA 4ARZB 5KO2A 2V0GA 1DLIA 5DHPA 5TMDA 2IJGX 2JFHA 3OP4A 3IR7A 4H1WA 3ROKA 3EXFB 1OZAA 2WT9A 1BG6A 1P1RA 1U0GA 3GFRA 1VCHA 2Y2UA 3R5JA 4R3UC 4XUGB 3K9FC 2WUGA 2WHPA 4WTOA 1D2HA 1U9JA 1QH0A 2O2ZA 5KKNB 1JG6A 4NLLA 1U5AA 1LV7A 1XZQA 2ATCA 2VI5A 1XX6A 1E2HA 2AXEA 2P9YA 1CWUA 1M6EX 1E5LA 2NPIA 2XIJA 2PMFA 2XQKA 4W8GA 4IDFA 1FJGB 1XF9A 1WPGA 1ZRHA 2VRCD 3FFWA 4L9WA 4KXFB 2R1TA 5I45A 4IXNA 4BB0A 5C8XA 2OUIA 1TO2E 5J4LA 2YZKA 1NG9A 2W6OA 4Q9LA 5PGMA 5J2TB 3EMDA 1E3MA 1XZIA 4BKUA 1RZRA 1YIOA 1IAQA 4BMCA 2VJMA 4OQMA 4J29A 2VZLA 2GM3A 5LZ4A 4YLGA 5ADVA 2SHKA 1TA0A 4RWZA 3CGWA 4B35A 4K9NA 5DF1A 2EF0A 3EK2A 1W5BA 1QHGA 3A70A 2CF6A 2J3DA 3NHWA 5DLEA 4A0RA 4BTLA 3VKHA 4YV7A 1BU8A 1K8XB 2Y1LA 4HNHA 4GRAA 3ZE2B 5LB4A 4WOKA 4I4NA 1KVRA 2ZJ4A 4CF3A 4EKDA 3T4XA 3TNJA 1TTHA 3O0TA 1KAMA 2I22A 1XQ9A 2XOXA 4DBLC 3DMGA 1T9ZA 4NNPA 5FUVA 4HTAA 3AB7A 4INAA 4BKPA 5DV9A 2P41A 3EDQA 3KXDA 4B3SB 3S55A 1LA2A 1T5IA 4MQ4A 4OM8A 3DTVB 1U2EA 4FYPA 1Y4AE 8ADHA 4AF6A 1VGQA 2NZXA 1CY1A 5EJFA 4TSFA 4EY7A 2YJ4A 4N01A 4L0DA 4ZVSA 4Q7QA 1EFRA 2AZMA 3LLCA 5FTWA 3LH5A 5C35A 1YGPA 2WP8J 2ZIEA 4KZKA 4PC1A 3MGCA 3I32A 4JWTA 3GDFA 1KKUA 1MDBA 1JIIA 2YXLA 1JN0A 4HZIA 4JI1B 4C4SA 2CXHA 2DVMA 1TW2A 3VVMA 5KQMA 1CJSA 2X1VA 2QTHA 2WJAA 1R50A 2A0KA 2PV7A 1JA1A 1YR3A 4FN4A 2NNLD 5C31A 3M2PA 3NFRA 3MZ0A 3KFLA 1DXQA 1AK2A 2HNKA 1XDGA 3N6XA 3BSFA 3PDUA 5H0IA 1ML3A 3ZQKA 3UN1A 2ODQA 5ILOA 1A98A 4NV3A 5AUNB 1E9SA 1ZGJA 2YOHA 2H06A 2TYSB 5I4KA 2QUJA 3GRKA 3VV2A 2A2ZA 2L17A 2SKEA 4D4IA 1NUSA 3CWCA 4CIBA 2H1SA 1LVHA 1IY9A 5JWOA 4E22A 4P1ZA 2C0PA 4C7OA 1I7NA 1I4WA 3V5NA 1C8KA 1KY5A 1GL7A 2FN4A 3PA8A 3KKMA 4NG4A 2AGVA 3JQ7A 3NAGA 4I50B 5ARBA 2PUEA 1IDN1 4LZOA 4OREX 4D74A 3A3PA 4FXPA 1QJ4A 4RVFA 4IIJF 3B6MA 3G17A 5AXBA 3T99A 5A62A 4D98A 5EKTA 2QYHA 5CURA 5CBPB 4KXWA 1ZUNA 5CDGA 5IABA 3MRTA 1O9HA 2HBYA 1FMCA 3JD2A 4PR0A 2BELA 2EG9A 3ILXA 4DQDA 3U4QA 2GZAA 4DC1A 1EM8B 2HBZA 2NZ2A 4QYWA 2H00A 1LKZA 1Y5IA 3D54D 3O94A 4C6RA 5LD2B 4LOHA 4DTCA 4D9JA 4LJ5A 1R0XA 3K09A 4ECEA 3A4VA 5M04A 1KARA 3TVTA 2G6TA 4NR0A 4ML3A 1X1SA 3CPJB 2W5UA 3AEYA 3IJRA 3VO9A 4EP1A 4BC0A 1ZM7A 5K1ZA 3FHLA 4X3OA 4OX9Y 3IXQA 4OXYA 1YU6A 4CFSA 1BE0A 3HEAA 4EW2A 3HR8A 5FV4A 1QE3A 4JR2A 2REBA 1AS0A 1M66A 3I58A 4NBLA 4NBSA 1E7QA 4HYYA 3ZDEA 4E1AA 4BMPB 4ENVA 3TUIC 1TKCA 1BIFA 2CMKA 2QSUA 2VDQB 3KKQA 2AG8A 4KIUA 4UZEA 4TTJA 3WXBA 2DHDA 4ZCMA 5B7PA 2Y68A 3ZW9A 4MS1B 1VIAA 1UCFA 3QVGB 1XPOA 3O4HA 1OYOA 2VSYA 3IRVA 1AKWA 3L6EA 4YRDA 4B4UA 3H86A 1ZNWA 3SJCA 3DVSX 2JKZA 1KETA 3DE0X 4WH0A 4I0WB 1IRXA 3K6RA 4KQEA 2ICAA 2Q07A 3RAJA 1VA5A 1V4NA 5AVVA 5TMEA 3I62A 2SBTA 2J3IA 4PFQA 2G9QA 1S5PA 2WWIA 2P1DA 3GL9A 1TYZA 4UHDA 3TLXA 4Y6SA 8GPBA 4O33A 1TC1A 3QI7A 5C4IA 5JALA 5GWXA 3LT4A 2EYUA 3AL0C 1K5PA 4WRRA 3R9IA 4Q6BA 1XP5A 3EASA 3QY0A 5HP4A 4BO0A 1OX4B 4R1SA 4BCBA 5I7HA 4D2IA 2AE2A 1RE1A 2Y9PB 1E5XA 3OWHA 3K1ZA 5FBRB 3AEQB 3LQ2A 2ALJA 1C1YA 2CNWA 4HQ6A 3EB9A 5JZOA 3GJXC 3WRYC 4OK6A 2YW2A 1J70A 1J09A 4PM4A 2DQZA 4F5ZA 1L7VC 5JMOA 3PQ7A 2WIJA 2O0KA 1QMPA 5D3KA 4TTSA 4HDSA 4BP9A 1PJQA 3LZ6A 3ORQA 2X2EA 4N03A 1VL5A 2C99A 3IKLA 3OQBA 4B3CA 1NW5A 4N41A 2JGKA 1ZH0A 3HBLA 3RANA 3S1LA 4F96A 1Z74A 5CDFE 3FYHA 2X1MA 2GK4A 1WUYA 2NLOA 2BHNA 4FYXA 2GRJA 3H4MA 4V0SA 2G4VA 1RP7A 4YALA 3TQQA 1JXOA 3W6NA 1GAJA 1UT6A 4IICA 4M89A 2IYFA 5CT6A 3V9AA 2OXCA 4J7XA 4DMCA 1HETA 1DJQA 2ENUA 2GD6A 2NTVA 3QFHA 4MKZA 4TWAA 3TLGA 3V97A 3WK7A 1PK7A 1LDYA 1PNRA 4YK7A 3PEYA 1QLWA 1XMVA 3ESQA 3VR4H 5IDXA 3S8YA 5KU1A 1E99A 3TLJA 1S8OA 3M4YA 3ONDA 4NH4A 5HGJA 1EK0A 4YJKA 5D5HA 4D9MA 5KTMA 3MA0A 3EF1A 3OCZA 4B4WA 3GG9A 1BO6A 2CWDA 4HAXA 1ZH4A 1ULAA 1J2JA 4ZT7A 1SUEA 4HVCA 4HKTA 5AHWA 4AWAA 1PSZA 3LCCA 3RSFA 3CR8A 3RO7A 3N3BC 1F2UB 4NMLA 4QHYA 4TMTA 3UC5A 4U1RA 4JP3A 2SCUB 3FXAA 2H1LA 4G1EB 5T4EA 4ZIRA 2LW7A 3B7PA 1BWSA 5LNK6 3DV2A 4DHWA 2GUGA 2WU0A 3NBMA 4CKEA 1FFHA 3CX7A 4MYUA 1JAXA 4OH1A 5D5PA 5ENDA 3C97A 1YS4A 3TK1A 1I0IA 3R23A 4CKCA 5HOEA 1XZLA 2EL9A 5KNCH 2XQVA 1NRXA 3HPQA 1S3SA 3UMFA 3B2NA 1NOKA 4B71A 1H42A 1RRPA 2MINB 2XWBF 2W2QA 4UUAA 1M5RA 1E79D 3OFKA 1LPOA 4GMDA 2UXDB 3FUUA 5EUCA 1LPMA 3T1QA 4CM4B 5BR7A 1NN0A 4YV2A 1O89A 3IVXA 3I92A 1WD7A 4RTKA 1L5VA 4PCLA 3JSAA 5EJ8A 3GPLA 1VOTA 3VZPA 2J0QA 3NDIA 4ENTA 3FGOA 1RTKA 1KJJA 3R0JA 4XE5A 5K0SA 1I3OA 4QAJA 4LWZA 4R8MA 3VR6A 1L4FA 2XRZA 3PEFA 4YMIA 1CUSA 4R01A 4NPHA 4PCVA 2C2HA 4CMEC 4Q9HA 2OFOA 3QUAA 2E55A 1ECJA 3CLTC 4P84A 1SHLA 2AHRA 4PZUA 1OFHA 1P19A 1Q1ZA 2IYVA 2HQBA 2JGAA 2WJ6A 3BKXA 5TPWA 4IOMA 3P20A 1NF8A 4LPKA 1F0KA 2YXDA 2Z8XA 2Y1EA 1RYYA 3QVTA 3R24A 1NUUA 3A4LA 4RXTA 3BTOA 1EE2A 1HL7A 4AAYA 2UVPB 4YMTA 2VK1A 1TU4A 4WNCA 1EUCB 1SRRA 4MUKA 3EFOB 3F2VA 5CR9A 2IUUA 5JZ9A 1YB6A 2A0YA 1VB5A 1K6JA 1NMYA 2OHGA 3O95A 5CTJA 1JHDA 1S2OA 1D4FA 1P4SA 3G0GA 3GJRA 2R97A 3KJQA 5ALWA 2F8MA 1XWIA 2GK6A 3L0CA 1JYFA 4ECAA 2W00A 3MFQA 3NP9A 1UJNA 4XLTA 5D3MB 3RGWS 4F3CA 1NUQA 1QGED 2WVHA 1RYZA 1U81A 1ZEMA 3QBDA 3ZUPA 2J67A 1HGXA 2R86A 1IH8A 2A92A 1DIBA 1LNSA 4ARVA 2CEAA 3U7EB 3NBZC 4JCCA 3LQQA 3VR3D 3SN6A 1LLUA 3SR4A 5LLTA 1JWLA 1PQUA 5CFNA 2RH8A 5K6AC 1V71A 5SY6A 1QQ6A 1KI6B 4DUGA 2DQKA 2HF9A 2VP4A 1HE1C 3LFUA 2ZSBA 2XWJI 2YY5A 1RYMA 2Z5LA 4ZAYA 1DG3A 1GCGA 3KSAC 1NXSA 4DSUA 2WTXA 4W7HA 1NF3A 1K7SN 2NW6A 1SVOA 3A2MA 3O38A 4WK4B 1G18A 4GFDA 5BVHA 4QFMA 1O96B 1QFJA 2VNIA 2YFKA 4X7MA 3P9NA 2JZOA 5E7MA 2X5NA 1UBUS 3ANSA 4GX0A 3T1VA 4C08A 2ZYDA 2RAFA 3FOEC 2F9FA 2PRSA 4JBXA 4RL6A 2WPNA 1H8EA 3HFJA 1XDUA 1T9KA 2FEWB 4ZC1A 1RMQA 5GV8A 1F60A 2NUBA 2W6IA 3N07A 3CVVA 3I3OA 3DM9B 4MQ5A 5JSZA 2B1QA 3N2EA 4INPA 1BC5A 1RI2A 1VHJA 1T26A 4FN5A 4QNMA 3RE1A 5IJ9A 1K6MA 1U0NA 5ED0A 3PT5A 3KE8A 2ES4A 3T94A 1UKCA 3BC1A 5FNVA 1N5IA 2DPLA 5DX0A 3QG5A 5K2OA 1P6XA 3MJDA 5C1BA 4P9NA 4A16A 4NMWA 5IZCC 1OI7A 2PKWA 4NARA 3BZUA 1RQRA 2WU8A 2ZJ3A 5LR6A 2QDXA 4S1TA 5CXXA 2BFDB 3B78A 3RADC 1FU4A 1X74A 3PGA1 6YASA 2O8FA 5BW4A 2PQMA 1JA0A 4WVFA 5I7SA 3PEVA 3UXMA 2X6QA 1B6RA 4W7IA 3T3OA 2ZU0C 1M2HA 4L5YA 3ZHOA 5JY1A 4TS1A 2J9FB 4IIBA 1KQPA 3MQ2A 3V4PB 6AT1A 3QVVA 1E4YA 5ICCA 3N8IA 2ZE5A 3C1UA 4H6WA 1JJFA 2VZEA 3WB9A 1NY6A 1M6VA 4BFUA 2XKKA 1M1NA 4OB8A 4PHTA 3DBRB 3BCRA 1EJ2A 4B79A 2R8XA 5FAKA 4FR2A 1JDTA 3GMDA 3OUUA 3UWOA 4RMNA 5HZGA 2ZS8A 3AT1A 4LNUA 5C8YF 3NT2A 4V3CA 1SVKA 4J4TA 3MYRA 2EAUA 3RPEA 4MW2A 5LNK1 3CQ9A 5TXGA 4X91A 1IN6A 1GNSA 1R16A 1EA7A 1YR1A 4I8DA 4L8YA 4S3MA 3LC0A 3O8QA 2VT2A 2JCSA 3UA4A 3N2NA 4DIFA 1QP7A 4XJSA 1GZ4A 1U4NA 3ERCA 2FF5A 1CNFA 3ON5A 5HMLA 4MQUA 3MMZA 4IUCS 3BFVA 4QUHA 4Y2HA 2Q5CA 1FP7A 2A9PA 4JB3A 2PL3A 1GWNA 2HU8A 2VWQA 3HB0A 1EDDA 4UOQA 1XTZA 3HB9A 2HA4A 2FV8A 3V4ZA 4E4RA 1WZ2A 3NV9A 4MYCA 5IARA 4ND3A 3O4IA 3VKGA 1PDWA 1A7UA 1N32B 3BS4A 3JSXA 2CLEB 4OXQA 4JYAB 2DPYA 5TGZA 3PUYA 3QTLA 1RWNA 3RSLA 3N8NA 2WTEA 4AQ7A 1E94E 1NVUQ 1JGTA 4UCQA 5AK0A 4LCBA 1OLXB 1LPPA 1VYUA 3GA0A 5JQGA 4WL0A 3QRWA 3BMQA 3OZ7A 3RRBA 3GN2A 2B4TO 5T4HA 1GGJA 4M1ZA 3DPUA 3DT6A 3NC0C 3OLYA 3ROTA 3WQHA 1Z6TA 2BMAA 4IQ8A 5CVTA 2R60A 3GLRA 3RIYA 4XVHA 1YS6A 4Q4HA 1MC4A 3K0HA 4AJ1A 4UBOA 3EPJA 3HRIA 5JG7A 4B48A 3RU7A 1KDRA 3ZTTA 3D2AA 3ZD8A 2H5EA 4QGFA 1XCLA 4OHKA 1FSZA 4R2LA 3VC2A 4OA8A 4ALKA 3MYYA 2B5OA 3VNVA 4X1KA 5JFTA 5G4KB 3RHFA 3REFA 4DM4A 3IOEA 1U1FA 2W2LA 1O5OA 5IRCD 4ZOQI 4GE3A 2HIAA 1D2CA 1V4BA 3I8XA 3AEUB 3LA8A 1G8JA 4G07A 3WWEA 4LIPD 3BYZA 4UPVA 1SNYA 5JWRA 3ADOA 4OAOA 1NIPA 3DBVO 1A9ZA 1N8SA 4PZDA 2WF6A 2PH3A 3II6X 3M1LA 4H3VA 2DYKA 1KVSA 2JHCA 3SK0A 1V4VA 3D7NA 4AO6A 3MT7A 1G7SA 3PSHA 4HVTA 3IXMA 1XVLA 3GFFA 4AF7A 1E7YA 3OZIA 4D4GA 1JEEA 5C8VA 1CUZA 4J2OA 3H1PA 4RTSA 1JKXA 3AUJB 3FCAA 1JIVA 4LHVA 4IG9A 1YQXA 3GAMA 4XYLA 3H1FA 3C1AA 4YACA 4N6NA 1GGMA 2YYAA 3F74A 4I5DA 1N2CB 3LK7A 4JYMA 4UBMA 2J3MA 2L82A 3QU9A 4L02A 4DBLE 1E7WA 1THTA 3N0TA 4P32A 4C14A 1FDSA 4E2YA 1KMHA 2FWRA 4L1KA 2ZTUA 6NULA 2LWIA 1WHTB 1R64A 4JHXA 4YNBA 3URKA 2VBCA 4GX1A 4MDFA 2JFWA 4AO7A 4B3BA 4TRNA 3WL3A 5D85A 1CLEA 4UAGA 5CYOA 1Z8HA 2PXAA 4LJ6A 1U3UA 1E0KA 2GPNA 4BBJA 1B8UA 1JECA 4F60A 3E58A 1JEQB 1EKXA 3CURA 2ODNA 3HSYA 3UGQA 4EARA 3RS4A 3KPVA 3BWBA 2W8BB 5FBZA 1GG8A 2O0HA 3GVPA 5EUMA 3BT7A 1DUSA 1HFWA 3EODA 3UK1A 2D00A 2I4LA 5EJEA 4ZZ0A 5EJ4A 2OHVA 3W1VA 4NXNB 2AZXA 3ICVA 1IY8A 4GRIA 3Q0IA 3FOAA 5JJBA 2I4MA 4ZODA 4KQJA 2LIVA 1KYXA 4Z86A 5DEOA 4CEHA 1XO1A 4YLEA 3JZIA 3EVFA 2WWTA 1OWLA 4WFQA 4N76A 2FPLA 2IEIA 1CY2A 2Y3IA 3A0RB 1X1BA 2Q2VA 1B6TA 2WRZA 4JEUA 3EIQA 3NJ8A 4OTZA 1XXHE 1FDIA 3ETEA 1CT9A 3PHHA 1WHSB 4RKWA 3TDMA 3WR5A 3GP8A 2PTGA 4ARBA 4I66A 4QXPA 1G2IA 4ZQCB 5ESDA 2IP1A 3UCXA 1Y7PA 2BEJA 4FOLA 5AW5A 4BQFA 3O7MA 3SD7A 4L5JA 1GAQA 1F5NA 1U8TA 1XSEA 2V74B 4UTZA 1FEZA 1SOAA 1RKUA 1ST2A 1ZXBA 2IELA 8ABPA 1U2GC 2EJBA 3PITA 1D3AA 1XYGA 3BMOB 3D6TB 3FHOA 1KO1A 5ALSA 3KEOA 2AJLI 2WYWA 3SIPA 3UXHA 5EHGA 3LBIA 3FZGA 3OPNA 3F7NA 3L6CA 3QIAA 1BVHA 3OQ6A 1T3TA 3NIDB 1T0UA 3GY0A 2JJYA 3SP1A 3RR2A 3H2JA 1IK6A 1U9IC 2BFWA 3NI2A 3WLMA 2A88A 2OORA 2WTBA 3E18A 4Q05A 1YJXA 5F35A 5K0JA 4NL4H 4FE4A 1BN7A 2Z0MA 3EOBI 4GKAA 5AOVA 3V8PA 4GPAA 2CZCA 1DT3A 4QHSA 4TL6A 3TECE 2QUBA 5ECWA 5IBQA 3I9V1 2QU8A 3TX6A 5JAIA 4EO9A 3KR9A 4WLFA 2QW8A 1JQ3A 5BN1A 5LQAA 1VBKA 3RJMA 4BB5A 2N47A 4WKCA 4CM8B 5HK9A 2HFJA 2PXCA 3BMNA 4AXBA 3U4MA 2C3OA 1PEDA 1GXSA 2PKQO 2V6MA 3Q2IA 5CFPA 1OYWA 3FETA 2I4RA 1TTPB 3IJEB 5COBA 5T6MA 1YBFA 1L8LA 2TSYB 2GAAA 3HJHA 3GR6A 2BMDA 3O8BA 3MJSA 1R27A 3PJEA 4LK3A 2GEJA 4RMGA 2PX8A 4M1YA 3U7QB 2J5XA 3KO8A 4HS4A 4DILA 4XM1A 3WQQA 5I8PA 3QUQA 5DSTA 4YAKA 4PLCA 5FEMA 5KOYA 4WN3A 3S2UA 3NASA 4AJ4A 3P2YA 3PFWO 3RJ5A 1ZOLA 3FRHA 5FL7A 4IDEA 1O03A 2OV3A 1NDHA 1P3Y1 2OT3B 4FXOA 3TDNA 4H7FA 5HF8A 4OK3A 2MT9A 2MSDB 1W5FA 3E23A 5H59A 2PUJA 1P0QA 1OTXA 4RV9A 3VQTA 2HR1A 3SU8A 1CJCA 4XGKA 2P27A 2FFBA 2ZZNA 4KHPB 3T7TA 3DLIA 4PIVA 4EKYA 3M3HA 3LUBA 2IE0A 4GXRA 2R2AA 2Q6KA 4XPZA 1X7WB 4MEJA 3BXXA 1XMQB 1LBIA 5KTYA 3TJRA 1HKHA 1QVAA 3GYGA 1M0TA 1M0WA 4Y2XA 1GGNA 3QKRA 2D2IA 3OJOA 5TDHA 4LRSB 4RXUA 2EBWA 3WJ1A 4YMSA 3R7WA 3WLJA 4CM1A 1R0YA 3BIFA 1M83A 1A7AA 3SR3A 1OA1A 2MYNA 2OBYA 2G9RA 1GLVA 3HABA 3PUHA 4JK3A 2FK7A 4FWTA 2WJHA 3DLPX 5CLLA 1JFFB 2IXBA 5G4LA 5BSMA 1N92A 1O57A 1MG5A 1QAOA 3BREA 3N6VA 3P96A 4I3FA 4IFEA 3HG7A 1TGYA 5I7AA 2GD0A 3U3ZA 4LBYA 4O4LF 2RH5A 1C41A 1D6MA 3HCPA 3V4LA 4HCJA 4YROA 1SC3A 3N2YA 2BFEB 2FGJA 3DD5A 2M1XA 4C29A 1AG9A 2J9YB 3HB5X 3P2KA 3HO1A 4I4CA 2VZ0A 5IYZB 2OAP1 2YZMA 3Q85A 3ZH2A 2G07A 1KTIA 4G8BA 1DHRA 3KSMA 4XRRA 4ZZ2A 4DQKA 1WXHA 4CTMA 1AUXA 4UBJA 5AHRA 1NKSA 3W2FA 3GLFA 5DE3A 3TIVA 4D92A 1QP0A 3CEPB 4OP1A 2J09A 2JHFA 3GWGA 3JQGA 3OETA 4KMSA 4MOWA 2GYVA 2B21A 1R6UA 1TTTA 5BV1A 1D8AA 1FDRA 4TZTA 3JQCA 3F9CA 1G5IA 5DTRA 4Y2PA 3PX7A 2V8BA 1D2RA 2X3YA 2FN3A 4H17A 4N7RA 4YTEA 3VOAA 5HNKA 1IJBA 2X0IA 4CF6A 5KNBH 4OQLA 3DT8A 1S2MA 1SKYE 1CS0B 2PS9A 4OYRA 4RPIA 2GCNA 3QPDA 4KDEA 1V1JA 1FS5A 3N3AC 1MHPA 4J76A 4MRVA 2IYNA 4K86A 2WV9A 2ZCJA 1KEVA 1RADA 4LE0A 5FFNA 2PA3A 5JXIA 1HYHA 1UQTA 1YS7A 1XIVA 3G89A 5K8TA 1DAIA 1BEEA 1F7VA 4BRWA 1IQUA 1IMJA 3AR2A 3QG1A 1CP3A 2OAQ1 2QTTA 2VYQA 5EWMB 1L5WA 2UVDA 4YN3A 2A5JA 2CMDA 1X7YB 2JATA 3N05A 2ZAIA 3W34A 3PQ8A 4QVGA 2ACWA 4G6ZA 4PS1A 2WPDD 3HCEA 3C1OA 4JZKA 4QM7A 1YWGO 4U02A 5EHXA 1XN4A 1RHMA 5I9LA 1OA0A 3KZKA 2P3SA 1QTIA 3A6EA 3FSGD 1O0BA 4O08A 3NEYA 1NBEA 3NM5A 4FR0A 4MWTA 3T4UA 2G1KA 2KWIA 1G5PA 1JEOA 2O2XA 3N0XA 2C77A 2H5LA 3OEEA 4ENSA 1ENPA 1U5BA 4XLZA 4F2GA 1ISRA 2I54A 3BILA 3DULA 3E5HA 3IO5A 4JGBA 4DR1B 4WECA 3KV1A 5F2KA 1E0SA 4U0KA 3SC4A 4RTOA 1XP8A 2BH9A 2C9BA 3E27A 1CRZA 4XYBA 2FUNB 5KTKA 3TB6A 4CIVA 1SVLA 4E7PA 4OLAA 4JENA 3SFTA 2O8EB 4HV4A 2HI0A 4JUIA 4J90A 5K8IA 2R47A 4C04A 2C2XA 1PTJC 3WMXA 2PH5A 5IT5A 3K5PA 2O50A 3QX9A 2CL7X 4KXUA 1LTQA 3I04A 3BUSA 4P35A 3E1SA 1NXPA 3H6HA 1QG6A 3LTNC 1HQKA 4CEJA 1NXOA 1UM9A 1WSDA 2BONA 2IHZA 4Q7JB 4DLBA 5E38A 4JLVA 3G2MA 2AQIA 1XRLA 1MB3A 1CF4A 2OQVA 2ZBEA 4M7WA 2VPPA 3RBXA 1P4HA 2R79A 3NHLA 2QT9A 4Z53A 4GLOA 2VNSA 2WWRA 3DHYA 2BLLA 2GRAA 2NVOA 2NYUA 1O87A 1QXSA 2ECFA 3T38A 3U3XA 3W2HA 2VKQA 2H57A 2PDAA 1QF9A 2Z9DA 4J0KA 4JXKA 4BZPA 4KSYA 1UDBA 2HYIC 4O4JF 2BTQB 3TEMA 3WA7A 2IIVA 4P22A 2JK1A 3MMNA 4N8SA 3FDZA 1IXSB 4RBNA 1QV7A 1L5SA 4HDNA 4WZAE 3S2YA 3VKFA 1QYXA 1ZGAA 3TFOA 2IKQA 3L07A 4BEJA 2EBUA 2HIGA 4XUDA 4BLRA 3UT5B 5ALKA 3C3PA 1PZFA 4NRDA 3GQBA 4KVAA 4BWFB 3D9QX 2VXYA 3MS7A 1NPYA 4PSDA 3ER8A 3KOOA 2WJGA 3GUYA 1J8YF 1QO0A 2ZG6A 3HU3A 3DE3X 3HYRA 4FBLA 4IL5A 3SI7A 1LWNA 1QG2A 3GVHA 5F1KA 3BJMA 2BAGA 1ECGA 3FDFA 1BAPA 1DQZA 5AJUA 5JYCA 1U3FA 3WGZA 2C84A 4QNRA 3ZXXA 1EXVA 1G5TA 2CYAA 2NZYA 4RPLA 2KBFA 2O5RA 2Q1WA 2QTVB 1MU0A 221PA 4RE6A 3OWOA 1PE0A 2MMGA 4LZPA 1IHUA 2NXNA 2WJZB 1LB1B 1T0BA 4FTWA 5A71A 2M6KA 1Z6AA 3DE4X 4PLYA 3RIXA 2C1XA 5UKDA 1FUEA 5F12A 5GAJA 1JQAA 2RHJA 3A1EA 1PP4A 5KVQA 5HXAA 2VYCA 3GCWA 3ENQA 4B9EA 5JRZA 2BBOA 4R1QA 3ENWA 3L1HA 1I33A 1K88A 1PT7A 2NZVG 2W48A 4TKMA 2WTAA 3PRHA 3PP8A 1KQ3A 4TUYB 2OCKA 1V47A 3TUJC 4BU1A 4DLXA 3CH5A 3ORSA 3IQZA 3P8ZA 5IK2D 4HNAA 5DBIA 3H8VA 4JUCA 3UPTA 1ZXXA 1RXUA 1UBGA 4YP9A 3B70A 2FN8A 1U28C 3VYTB 3GLUA 1VKHA 5B58T 1ND5A 1NBMD 4Y2UA 4L27A 4GYJA 3RTAA 1KH1A 2UKDA 3IE1A 4WNAA 5B2FA 3T34A 1OX6A 2OD9A 3EAQA 2CUZA 4OQEA 1A69A 1RQXA 3I6ZA 1E2DA 3Q98A 4Q16A 1FSPA 2MSEB 2VSQA 1A1VA 2GWHA 2K5UA 2Q5EA 1EQAA 4I08A 2BUBA 2PXHA 4RMIA 2BFMA 4UBLA 5BVGA 5LQKA