1VLHA

Crystal structure of phosphopantetheine adenylyltransferase (tm0741) from thermotoga maritima at 2.20 a resolution
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
157
structure length
157
Chain Sequence
MKAVYPGSFDPITLGHVDIIKRALSIFDELVVLVTENPRKKCMFTLEERKKLIEEVLSDLDGVKVDVHHGLLVDYLKKHGIKVLVRGLRAVTDYEYELQMALANKKLYSDLETVFLIASEKFSFISSSLVKEVALYGGDVTEWVPPEVARALNEKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopantetheine adenylyltransferase
publication title Crystal structure of Phosphopantetheine adenylyltransferase (TM0741) from Thermotoga maritima at 2.20 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 50
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1vlhA00
1BS2A 5H16A 1N77A 1PFWA 3MUEA 3IH5A 4NAHA 3RJZA 4ZT2A 3IVXA 1TYBE 5K0TA 3N05A 1WQ3A 2A1TR 2PFSA 1YUNA 3GUZA 3AG6A 2B7LA 2E89A 2JA2A 4DDHA 3PNVA 5FO0A 4AS1A 3AL0C 1N75A 1G59A 2WQ6A 2WQ7A 2H29A 4YBRA 4JFAA 1EE1A 3COZA 3MLAA 3TZLA 3PRHA 4GU5A 3SYTA 1NSYA 1MOPA 1U7XA 3COVA 1N2OA 4ND7A 1GAXA 4XFDA 1N3LA 1MAWA 4J75A 3FIUA 4OJMX 4OUDA 3C8ZA 1K4MA 1PFVA 4NAUA 1I6KA 2J08A 2AZXA 3FNRA 5H7XA 1JIIA 3UK2A 4MUJA 3A2KA 4MW6A 4XSVA 3A05A 3IVGA 1MB9A 1T9GR 3UMVA 2IP1A 4RUKA 1TYDE 1O96A 1WKBA 4MW5A 1PG2A 3CVXA 2WB2A 2ZP1A 1J1UA 2NZ2A 2YWBA 3DLAA 1ULHA 1QRSA 1RQGA 3IOCA 1O95C 2YY5A 2DLCX 1X8XA 5JBNA 2JAXA 1X6VA 3SEQA 1F7UA 4ZCPA 1O94C 4P2BA 2H2AA 3MLBA 2ZUEA 1QJCA 2BYTA 4QBTA 2BTEA 3FETA 3IOBA 1O97C 4U63A 2Z09A 3AFHA 3SDBA 1G8HA 1EFPB 1MBZA 3ISJA 3ZUGA 5HUJA 2PZBA 4EF6A 3ZXSA 1WJGA 4F3RA 2G36A 2QJOA 1J21A 4MVWA 1WZ2A 3ZGZA 2GKSA 2DERA 2QUJA 2PIDA 1KR2A 1UFVA 3HZRA 1JZQA 3QTBA 4HK4A 2E18A 4KPUA 2DPLA 3KT6A 1MC1A 4MAFA 3H99A 3RK0A 4A91A 1K4KA 1LI5A 4MWDA 2A1UB 4MWCA 2CT8A 1MRZA 3TNJA 1TEZA 2YXNA 1JHDA 1Q77A 3Q12A 1NI5A 1Q19A 4MW7A 3ZIUA 1HYBA 3H05A 1Y42X 2QUKA 4MLPA 3HL4A 1GPMA 4DDKA 2DR2A 1T6ZA 4KR7A 1O95D 3VU8A 1KKUA 4MQ6A 4JYZA 1I2DA 4HJXA 4KR9A 3A04A 3LOQA 2E0IA 1QTQA 3U1VA 1O94D 2RD2A 5AHWA 1O6BA 3TZEA 2O5RA 2X0KA 4EG7A 1R6TA 1O97D 5HUHA 3CVUA 4MUFA 1VBNA 2A7XA 2A84A 4MWBA 5TGTA 1N2HA 2EL7A 3HMQA 4MW9A 1JZSA 1U0BB 3UC5A 3NV7A 1EXDA 1NUQA 4MUNA 4WNYA 4E1AA 4K0RA 1K92A 3CVVA 3P0JA 4FZJA 3CA8A 1JEDA 1VBKA 3MMXA 4MUGA 2VXOA 4G6ZA 3IUEA 3PXUA 4Q16A 3JXEA 2R5WA 5J59A 1EFVB 3H9CA 4ARCA 3FI0A 4JZYA 4QREA 1J1ZA 2XRYA 3IVCA 3IMEA 2AG6A 1WXIA 4YP7A 3MXTA 1ZH0A 3DPIA 4NX2A 1KH1A 3UY4A 5IHXA 1ILEA 5J58A 2ZUFA 3SP1A 3OP1A 2D54A 3H97A 1WXHA 1H3EA 1VLHA 2Z3VA 4CDNA 1CT9A 2CV1A 3FWKA 2DXIA 4NDAA 2CYAA 3X1MA 3RFFA 4MVYA 2X1LA 3X1KA 5LFAA 4DE5A 4J76A 3E27A 4K03A 4MW4A 3TS1A 2AKEA 3ZJVA 3A4IA 3VGJA 3SZ3A 3CVYA 1IFXA 1U7DA 2VTBA 1PG0A 4R2MA 3X1JA 3KT0A 1N1DA 1O5TA 2CUZA 2EJCA 1IQUA 1F7VA 1KAQA 4MVXA 3IOEA 1T9GS 3INNA 2IELA 4ZT7A 3I05A 1QRTA 1G8FA 1JECA 1Q11A 3L92A 1WXFA 3CLSC 4Q93A 1ZJWA 1TYAE 1YI8A 1MAUA 3FG9A 1IQRA 1KQPA 1DNPA 1KQOA 3KT8A 1M8JA 4MUEA 1P7PA 1EUYA 3CLRC 4AQ7A 2V0GA 4CDMA 1H1TA 3Q4GA 1U3DA 2DETA 4ZT6A 1XNGA 1F9AA 3K9WA 5TS2A 4NZPA 4ZCRA 5KWVA 3FH0A 4KR6A 4PBTA 1LW7A 3DV2A 4MW2A 4YMIA 5LM3A 4L2IA 4KKVA 5HG0A 3D6VA 2XRZA 2J4DA 5DASA 4RPIA 1O96B 1OWPA 1QQTA 1YULA 2QUHA 1TFUA 1JIKA 3G6KA 2RE8A 4TS1A 5KHAA 1A8HA 2CV2A 1H3FA 1M83A 4MWEA 4EG3A 1I6MA 1JGTA 1OWMA 5J5AA 4MULA 1IHOA 1J70A 1GLNA 2QUIA 3ZJUA 4QRDA 4EG8A 1JILA 1YIAA 3IODA 5F23A 3FOCA 3LE8A 2QTRA 1N2IA 2JANA 4YP5A 1QNFA 1KH2A 4CT0A 4PBSA 3IMGA 4NATA 2CSXA 2PG3A 3KFLA 1OWLA 3HV0A 5FO1A 3PNYA 3FHJA 4ARIA 1I6LA 4MW0A 3CLSD 2WSIA 1F4LA 4R0NA 4EG6A 3UOWA 4X0EA 3HGMA 1OD6A 3RK1A 4MVCA 2X1MA 1SURA 1WQ4A 1TYCA 1MJHA 3CLRD 4HPWA 4KPUB 4EFKA 1JEEA 1NYLA 5DEOA 2E21A 2D5BA 4H3SA 1U3CA 2V0CA 1JMVA 2X3FA 2YWCA 4XFJA 2NSYA 1Q15A 4YP6A 1V47A 5DK4A 4DDMA 3OTWA 3P0IA 1KH3A 3COYA 1KP3A 4F4HA 2GM3A 3AG5A 4DLPA 3ZXIA 3RBAA 4ZT4A 1GZUA 2A88A 3AIIA 1NURA 3QTTA 4HJRA 1NZJA 1FYDA 1R6UA 4WSOA 2DEUA 1NUTA 2C5SA 2A1TS 3IMCA 5BNZA 1QU2A 1EFPA 3SZGA 1KORA 1EJ2A 3NBAA 4ND6A 1V8FA 1WXGA 3IDFA 1EUQA 3KT3A 1M1ZA 1O0CA 1GTSA 3TQIA 1WXEA 3SEZA 3S3TA 1NP7A 1T6YA 5DB4A 4I6EA 1M8FA 1TQ8A 3ILVA 1N2EA 5TEVA 1FFYA 3Q10A 3AKZA 2I1LA 3K32A 3ND6A 5K0SA 4S1OA 4EG5A 2HMAA 2QTNA 3TQOA 2A1UA 1K97A 1M8GA 3H9BA 5LLTA 1NUSA 1R6XA 4GRIA 1O0BA 1OBHA 2CV0A 1MB2A 1H3NA 2J5BA 1PFYA 4ZT3A 4I6JA 3F3MA 4JXZA 1YIDA 1NUPA 3VRHA 3PNBA 4CQNA 1N78A 3RHSA 3CLUD 4MUKA 3IUBA 2A86A 1WY5A 4ZCTA 1IRXA 1KP2A 4G5YA 1COZA 1OBCA 2HZ7A 4PBRA 3BL5A 3D6UA 4R2LA 4OUDB 4MUHA 1QRUA 2PZAA 1GTRA 1J09A 1KAMA 1GN8A 3NBKA 4PY2A 4I6GA 4BWVA 3CLTC 1N2JA 3M5WA 1OWNA 1OWOA 1IH8A 2GOYA 5EKDA 4DNXA 4UZEA 1VBMA 2O8VA 1G8GA 3COWA 4U7JA 1M8PA 2OQ2A 3G5AA 2QJTA 1N2BA 3FY4A 3GMIA 3P0HA 1NUUA 4MW1A 1N2GA 5FNZA 2PZ8A 4UZFA 3HFJA 2CFOA 4JXXA 2J07A 2CYBA 3P52A 1XJQA 2QJFA 1T6XA 3GLVA 1VL2A 3ELBA 1WOYA 4DJAA 4G5FA 2VTBB 3ND5A 3ND7A 5KCMA 1ZUNA 1XNJA 2D13A 3DO8A 3LCJA 1QU3A 1S4MA 3FDXA 4U8HA 1XNHA 2OV4A 1IQ0A 1J20A 3N2YA 3N8HA 1EFVA 2A4MA 1YUMA 5IJXA 3G59A 1ZH6A 4ZCQA 1KQNA 4EGAA 2QTMA 2DUMA 2PXHA 1IVSA 2TS1A 4MUIA 4EG1A 3CLUC 1PFUA 4ZCSA 2IJGX 1M8KA 4L2IB 3CVWA 1B6TA 5TEWA 3QE4A 3N9IA 4EG4A 2HGZA 1D2RA 2CYCA 3ZJTA 2Z08A 3CLTD 3L93A 2J09A 1JIJA 1LI7A 3CR8A 4ZT5A
chains in the Genus database with same CATH superfamily
4EGSA 5K6TA 2I6XA 3QV2A 3FFWA 5EUCA 2YHSA 3G7SA 1J5EB 4G5HA 4JDUA 3LUJA 4JKOA 4JL5A 3K9BA 5ALYA 2AQHA 16PKA 3TIVA 1FP7A 5C4GB 3R6DA 3VO2A 2X2PA 3VNAA 2E89A 2QYOA 1J8FA 3MQ4A 6REQA 4UDNA 3T9EA 2VDVE 4YASA 3UKJA 1N75A 3E9CA 3AW9A 1G59A 1Z45A 3AHEA 3E0QA 3EG9A 4XPIB 1HDIA 2JIOA 3COZA 4LRQA 1YOBA 3GRVA 3IAXA 2D7JA 2HSZA 4J7CA 3CRRA 2CNBA 4KXYA 3ZI0A 3W7BA 4XFDA 4BJ6A 3DAPA 5AK0A 1M5RA 3ZW7A 3LHFA 2UYYA 3AHJA 1W0KD 4KYTA 1FP6A 2G5GX 4HLCA 4R2JA 1RLMA 2Q6TA 4EW6A 3AVXA 2YNMA 3PWSA 4D56A 2YC4C 2O50A 3HBFA 2OZLA 1SU8A 4KC0A 4ZQIA 4XSVA 3WKCA 1XN1A 3IVGA 3NIDB 1I9GA 1SCBA 3Q88A 1N3BA 2QPOA 3GPCA 4NBUA 3CKMA 5BRJA 3T3GA 2YW9A 2AWNA 1E69A 2H5JA 2N75A 4RLSA 1MW9X 1PUJA 1DIBA 3T7CA 4R0VA 2Z0MA 1XVAA 4GKJB 3ANTA 4GPAA 3RVQA 2A59A 1SG0A 1JP7A 2DWUA 4FGLA 2JAXA 1N0HA 2L2QA 3CVJA 3HR8A 1LD3A 2YWGA 4BMZA 2JIBA 1SD2A 2JAOA 5LQKA 4RTJA 4ZTZB 3LIPA 2O3QA 2O2XA 3I30X 3MLBA 4D0GA 1ZXXA 3GJSA 1EGVB 3F6BX 4GLBA 4UQPA 3RYFA 2ZZKA 1VTKA 2AKYA 2AJDA 4FIDA 3IOBA 1TQHA 4BNZA 3GFRA 1AZWA 1FNNA 3FUTA 1E6EA 2PJZA 1CC1S 3OD1A 1GQFA 2QSYA 3T0FA 1MJFA 3WO0A 3ZEAA 5AICA 2G7ZA 1N5JA 4MXDA 5KSYA 2WAXA 2YFHA 3KXKA 3W90A 2AJ8A 4R2WA 1EFPB 5J2TA 3RS3A 2VJNA 3AZOA 2KWIA 2QYHA 3UFXB 3NAMA 4EA7A 3C2QA 4FYJA 4O4HB 1X13A 5SY9A 1V8BA 2WAMA 3E61A 4X1IA 2WJWA 4IGKA 2PIDA 4BKMA 4CI0B 5MGNA 1ISFA 1DARA 4B4UA 4P3XA 4H1VA 3CUTA 1X8LA 1FNDA 1I4WA 4OOFA 4B3HA 3G2NA 1W52X 4REMA 4U7WA 3SSAA 2NU7B 3PE4A 2ZWIA 4MWDA 2IZ6A 4UU8A 5JIBA 2X9VA 4LIPD 1L5LA 1B1CA 3KB6A 5FHRA 1X86B 4TVBA 4JI5B 5H9WA 5E0KB 1J1IA 1NI5A 1UCFA 2OCPA 1AMUA 2J9GA 3HB0A 4I50B 3PZRA 4II2A 1CUCA 4YO8A 3TSZA 1JF8A 3OZVA 2W6OA 4LE2A 4EJ0A 2FRXA 2PQ2A 4D2IA 3U17A 2IYLD 4L16A 3RG8A 1DRKA 3C3YA 3M1IA 2OB2A 2Q3BA 3TJMA 3IPCA 4FMDF 4FNOA 3MMPA 4IJWA 4RD4A 1V1RA 2GTHA 3BQNB 1YU6A 4JOBA 2D5CA 2O1EA 5A5FA 1AS0A 3VOTA 3M5CA 3INGA 4K9NA 5SYNA 4KR7A 4C78A 1NBMA 1XTVA 1DOHA 2QVBA 1O95D 3TBFA 2O2HA 2QT1A 3BK1A 3GB9A 2XLBA 4D26A 4UOQA 3EIWA 2VF2A 2B35A 1DKPA 2AUNA 5EEHA 4PICA 1ZN2A 3W2IA 5CNIA 2BKXA 3BWYA 1KARA 3IHWA 5DYWA 5BYKA 2Q4TA 5IABA 1G66A 1U5AA 4P54A 1OLUB 1WCWA 4FC6A 2QN7A 3P2IA 1YIOA 2O0KA 5FOTA 2VBFA 3B7WA 3CZRA 3L8ZA 1E64A 2N9UA 2PUTA 4GBMA 5KNLA 1JVNA 2FAXA 2H17A 2XKJE 1L7DA 3R9IA 5LA6A 1DX4A 3L0DA 3VR2D 4ZZIA 2WHEA 3LUPA 5F7ZA 1KE1A 3RV3A 2C2ZA 3L1IA 5TGTA 5KNBH 2F64A 2C54A 3LYHA 4YMTA 1YXMA 4M9SA 2ZI3A 1RCUA 3JQFC 3C6BA 4N54A 3F6RA 2FRVA 3BFVA 1JV2B 1PHRA 1X80A 1Q0QA 3DV0B 4IF6A 4MUNA 1VPDA 5D87A 3RVRA 1CKEA 4EATA 1A8IA 4Z6KA 3R8CA 1K92A 3LWZA 2HSWA 2YV4A 4AG3A 2UZ4A 2JHGA 2X0JA 3GAMA 5C53B 1RR6A 5CDGA 2GBFA 2B5VA 1JEDA 1N8KA 2SKEA 3AWIA 3OKCA 1G41A 4GSKA 1JEAA 3R7WB 5K0GA 4I4IA 1L5MA 4TKZA 2FQQA 1UC9A 2IPOA 4XSGA 1CUSA 2C4VA 2GFIA 5CXXA 5AJUA 1WP4A 4OQ4A 2RK6A 3WISA 2WJGA 2J3LA 3I8XA 3EPHA 3KVOA 4DLLA 2II6A 2R5WA 5HRUA 5DI3A 3KB2A 3OIFA 4I7EA 2OHXA 1Z18A 2VJAA 5DNEA 1PD1A 3K71B 2WWIA 3E9NA 1X7XA 4IMRA 2BF7A 5H80A 2PLWA 2RI0A 1A4XA 2RGAA 4FCWA 2WPNA 1ZD8A 5PGMA 1XVIA 3PT9A 3DFZA 4UBIA 2J5XA 1W36C 4BNTA 4C4AA 3RNOA 1NW8A 4F97A 1ZJYA 2LR0A 1GPYA 4C3VA 4URUR 3SP1A 3ACDA 4FZ5A 1NPYA 3ANSA 3F96A 3G1WA 3LGXA 1IUKA 4G0UA 5EXPA 3S4YA 4LVCA 3SZUA 4O4JA 4D3YA 4IUDS 5FXMA 3OECA 5IW8A 1K7SN 2GD2A 3HVIA 3AVUA 1EVIA 2YX1A 1DC3A 3QVWA 4ALJA 1KO5A 3STYA 3TD2A 1LSJA 1DEAA 4JAVC 5FJIA 4CXMA 3DUFB 5KAPA 2VR1A 4B44A 1OROA 3BE6A 5DDIP 4C22A 4FGWA 1U7DA 2R8OA 5BQ3A 3TXXA 1NY5A 4HXFB 1BQ3A 3T94A 3OQJA 4R8LA 2Q62A 1T9ZA 1UPAA 3Q7IA 4HN9A 3BGSA 1AX9A 1FBTA 1XEAA 1ZK4A 1H6DA 3P5SA 2Z4TA 1G8FA 2XWQA 4RJJA 5EKTA 3QXHA 4ZAWA 4CR6A 1C9KA 1N1EA 1E3LA 5PNTA 1GNQA 1E2IA 3HDHA 4B6FA 1SUPA 1IQRA 1QGUA 1WP9A 2BP7B 3QF7A 4NG4A 4AKEA 4GKAA 3IIIA 2G63A 4PX9A 3HU5A 4PQGA 1R4NB 4EELA 4D43A 2WR8A 2C1EA 4HLDA 4XDGA 4DBVO 2QQGA 4U00A 1HL7A 1LU9A 2YTZA 3T7DA 3VO1A 1ZWKA 4UOEA 4IOJA 1YR2A 2QM7A 2H9AA 4PPQA 3P2EA 4MLDA 5ENVA 1UKEA 4CEJB 2PRIA 3EGWA 3L9XA 4B7ZA 3OT1A 4G8DA 4X85A 3WIUA 2PGDA 3HO6A 2DMRA 4RZXA 1QTIA 2R87A 2X0NA 1YVUA 3QPWA 3THYB 1B14A 2E4VA 1JA9A 1BKSB 1E6LA 4MYCA 1OFUA 4LHSA 3KSAC 3DUWA 4CUKA 1ZGCA 4KE9A 3V2HA 4J7UA 4L57A 1A9RA 1Q1NA 4TS1A 3X1YA 1NA5A 2ZPTX 4CLEA 3P97A 1HNNA 3KYJB 4Z0NA 4LHEA 4FHCA 2XHEA 1EIWA 6ADHA 2Q5LA 3BVPA 4MULA 4OH7A 2VSNA 1OU4A 3DB2A 4UE6A 3U7IA 5AUNB 3TRFA 1EJ0A 4GGMX 1QVZA 2D8AA 2BFFB 2WJHA 3B51X 1Y5IA 4LY9A 3EXEA 1TKAA 1MZVA 3CURA 3WGYA 2FX5A 2EZ9A 1SKAA 3FOCA 1ZQ1A 3IVMA 4NENB 4FTWA 4PV7A 5JSKA 4NC9A 5T41A 4PQFA 2P7HA 3LYAA 4QFDA 5KBYA 3DO6A 3RAJA 2C94A 3OEED 1N36B 3IR6A 2C92A 2FR1A 1V8PA 2LBPA 3L02A 1I7QB 3SS7X 2C4WA 2ZIGA 3BH0A 1RPTA 4AY4A 5HZHA 1EHIA 3ODGA 3GHHA 4AQYB 4YT5A 2I6FA 3HR4A 4MW0A 2YQ5A 1F4LA 4FZRA 2HRBA 1FX0B 4RACA 3HGMA 4Y2YA 1U8UA 2ADFA 5CB4B 1JG1A 2QTHA 2RCNA 1M2OB 1RP1A 4OM7A 1DAMA 2VZ0A 1E2BA 1T1JA 5DM70 1YNSA 2A35A 2VRCD 2BMAA 3UPTA 4MS3B 3TIGA 5EJEA 3ZWOA 1XXHE 1N5KA 4IVRA 2WI8A 4BRUA 1ZM7A 1XZKA 4JI3B 3OI7A 2H1VA 1T6BY 1NPDA 4C4RA 3VU9B 3CNEA 1DC8A 3OLVA 4QYMA 4X1KB 4CIWA 1WMBA 1V47A 2RGEA 3PUVA 4RESA 3EWSA 1C3VA 1K7XB 1QGYA 3BGDA 4OP3A 5CG2A 2A3NA 2I4OA 1NMYA 4U02A 3PPWA 4OHXA 1RE0A 4X1OA 1JSLA 2KBFA 2ZRMA 1GZUA 1TIKA 2AOUA 1EAYA 2XOXA 4KYUA 4PGHA 1A2KC 3ZGYA 2TMGA 3Q8LA 3NTXA 3SR0A 4IYJA 5BNZA 2MYUA 3PPIA 2YV3A 1BDIA 2Q07A 3WC4A 1SVSA 4F5ZA 3TOXA 1LI4A 3E3NA 4H1HA 1W75A 4LS3A 4M0KA 3ZY3A 5KJ6A 3RHZA 1EFHA 2Y1OA 1M1ZA 3HDVA 1IN1A 2ID9A 4NG5A 4R9VA 2Y6VA 1NIJA 4DYHA 5TF0A 1SVUA 2NZUG 5HMMA 2XX3A 4QGSA 1LK7A 1OX5A 5EZ6B 1T6YA 5EEGA 1GKYA 3O73A 5HGXA 3BS4A 3PDHA 3SOZA 3UK7A 1M3SA 3VU1A 1ZRSA 2WZDA 4L07A 2ZRPA 4BB0A 3NGLA 4E7PA 3L7KA 4Q39A 1VJDA 1EU1A 3AW8A 4GP7A 1P5FA 1SVLA 3CMMA 3K1AA 3KOUA 1YB2A 4Q7KA 3A9CA 1CNMA 4CKYA 1LPAB 2HRRA 1T9DA 2DHDA 2PD6A 2B20A 1FS5A 4ZVKA 3K16A 2VHUA 2WTBA 4HQKA 3MW8A 4HDSB 4TKVA 1E4EB 3I5YA 4JDPA 4OHVA 4PVDA 4M1ZA 3CUUA 4FHGA 5KQRA 4LYAA 4R2KA 3UAZA 2X0RA 5AESA 2HR1A 1S1MA 1YB5A 4LJ4A 4WN9B 2C00A 2O7NA 4Q00A 5IXJA 5JVDF 4Z5XA 4HFMA 4ZARA 2IHVA 1N78A 1YDWA 3D3NA 2GILA 3G0BA 1ZVMA 1PW5A 1SHJA 2Z4RA 1Z2NX 1M6VB 1C41A 3C1AA 2RGRA 2QBYB 4UEWA 2A86A 4L8WB 1JIUA 1QR2A 3T61A 4XYMA 1IRXA 2BHRA 1XDSA 4G5YA 2VH2A 1AQUA 3L5OA 4PSVA 1XAHA 1IY0A 3N5KA 3HCPA 3A32A 3D8BA 3G7NA 4B3SB 2JLWA 4OUDB 2GF0A 4JT9A 2G08A 2WHQA 4GICA 3CZCA 5CGQB 1T5IA 1EJ6A 4PZPA 4AP6A 5ERXA 3O7WA 3KO8A 4X20A 1O94A 2ZYUX 2FJ0A 3IQWA 3T3EA 5DHTA 4ZQGA 3EZYA 3GFSA 5JUWA 3NDPA 1U6JA 1JQAA 2IBMA 4PXAA 1QHHB 4Q47A 4WLUA 1YC2A 2B8EA 2XZPA 2ZJFA 3P0FA 5NLLA 1K9VF 2BAGA 2P3SA 3W5VA 3KPYA 5GOTA 2JARA 1GTZA 1JTEA 2CVZA 1W88B 4LJ9A 5K45A 2YYSA 1AUQA 1Y4AE 3QP9A 2WWHA 4IFTA 3WE7A 3ZE9A 4L28A 4G9BA 2GFHA 3BZWA 3UBMA 1MB4A 4JITA 4IWXA 4ZU6X 3K31A 1G5TA 3U4HA 3UUGA 1ID1A 1KGSA 4YAOA 3JPYA 2WG0A 4KQ1A 4DWJA 3FMFA 4QBKA 2XR1A 4IFBA 4NYIR 1ORTA 2D0OB 2FSIA 4NNJA 2HW8A 1EFRA 4RTNA 1P5ZB 3ME5A 3EMVA 4AS3A 5GZ3A 4CF6A 3GQBB 3ZCSA 2OUKA 4BV9A 3DE0X 4NS1A 2E3JA 5BYBA 5B1EA 4J1QA 4B76A 3B48A 1F0KA 4BNLA 4MKFA 4BQRA 5B58C 1DV2A 2RJ3A 2CFSA 1XCPA 2R8PA 3LXUX 2WQZA 1GAQA 5BUCA 2E4ZA 4JBIA 3LBNA 1XYGA 4WMLA 1QGDA 1T2EA 2PKYX 3DEKA 3QFCA 3OY2A 1HYQA 4OQNA 4RIIA 1YASA 2E87A 4ETNA 2ZB8A 4ZOQI 4OL9A 2HFJA 1V71A 5FBVB 5DXAA 2ZAOA 4BMXA 4MZDA 3VDXA 3ITKA 1IK4A 3B8EA 4JIGA 4ZMBA 3P0RA 1ULBA 3DXFA 4M9ZA 2J6BA 3PGKA 3QQ5A 2GVNA 4K9MA 1GQYA 1Z0KA 2B4QA 3PFGA 4IRMA 3OCYA 2XMSA 2EAUA 2JI7A 4CLOB 3FRIA 1IEXA 1JA0A 4ECAA 1M1YB 5HBGA 4KX5A 2VYVA 3WRWA 1E61A 4QECA 3UG6A 4ZXPA 1JG2A 3ZJTA 2HQSA 1WLSA 1DIGA 2IV3A 4QICA 3I64A 3UN1A 4G0VA 1LI7A 4F06A 3A58B 1DAGA 1EUDA 1YGYA 2UZ0A 4TYMA 5H16A 3E5MA 4U6QA 1VMIA 2QTFA 4EBBA 1S8NA 1J8QA 3ACBA 3G2MA 3ENQA 4N0PA 4TKMA 4YLGA 2JRCA 3VVCA 3FB4A 4LDAA 4GWKA 1J33A 3DSRA 1J90A 1E62A 1CHNA 2BT4A 3EEBA 3FYSA 3P9KA 3RC9A 1FLVA 3I2KA 4NFHA 4M83A 4DSUA 2RAPA 1FSSA 4WCVA 3MN1A 3R0XA 1XRPA 3QLTA 5DRYA 5KX5A 4TLCA 1FLAA 1SCUB 3NB0A 1U80A 4G1VA 2X5OA 5JASA 5GY7A 3IAHA 3IBFA 3PRHA 2A5DA 2WSBA 1AGRA 5TVKA 4D3ZA 4JLWA 3U7QB 1KP9A 3ETCA 3HRIA 3N70A 4KSCA 1EI9A 2MHCA 4CW7A 2RIPA 5EHQA 4ARBA 4CGZA 1OKKD 3OOEA 4Y8VA 4TL9A 4OJMX 2AG5A 4D8WA 3AOEC 2VP0A 3FOAA 2C9BA 1UBTS 4OFWA 5G0SA 4QVIA 5ALZA 2DQZA 1FFBA 1SVIA 3G17A 3L8HA 4MW6A 1X77A 1T9GR 3FPFA 4YNBA 2IHJA 4BMCA 3T99A 1DBQA 3DTNA 3OX3A 4J2HA 5M04A 3FJYA 1C1DB 1NU6A 1IM5A 3HEMA 3IPXA 2X5KO 3G8DA 2ZOSA 3FW1A 3LWNA 2GBCA 4PNHA 1P1CA 5A05A 3RUDA 5ITZA 1H5NA 3TLYA 2OLEA 1XD9A 4AWXA 3FHTA 3E23A 2GYYA 5K3OA 4WT7A 4PXSA 4Z9XA 5TPWA 1WBJB 1GQOA 4ITRC 4KQEA 2YZNA 1F3LA 3AI1A 3FYUB 3JVEA 1PR2A 2OXTA 5A6SA 2ZTMA 4MVJP 2VBIA 1WPGA 3VR0A 3QWAA 4ITVA 1P4AA 2HQOA 2IDJA 3RE1A 3A06A 3C8DA 1CYDA 1ZD4A 4B79A 2ZR7A 1O97C 1CZHA 3TWOA 3L82B 3LK6A 1RMTA 1TZ2A 3AUTA 5IMBA 3UICA 3AFHA 3UTCA 1U0TA 2I2DA 4F3CA 2WIGA 2XZOA 3FVWA 1Q0TA 1Q0ZA 4W8OA 5EA2A 2BISA 1BO6A 2VS1A 2I54A 3OTQA 1DTSA 1VPLA 3HXOA 1QZZA 2Q7OE 4X92A 5DMHA 2VRBA 1XZHA 1DXYA 4KK4A 5TEWA 4NK4A 3RROA 3ZD7A 4KLAA 4BNNA 1XROA 3HVUA 4M0EA 4F3RA 1B41A 3OM0A 4MVWA 4R54A 1D4FA 4A0RA 2OFFA 4DC9A 1S96A 4I66A 2JGJA 1JZQA 3QTBA 2E18A 4FU0A 2PK3A 4PXYA 4NECA 1YZNA 3MAJA 1NW3A 3SAJA 9ATCA 3Q5EA 3SZRA 5FWXB 2IU3A 2JKVA 1Z6PA 4TTVA 3TNJA 3ZV4A 1MEJA 5IXSA 3KKLA 2F3TA 3LC7O 4C1BA 3M89A 4HEJA 1TOAA 1ESNA 1EGAA 2XOKA 4MW7A 5SICE 4ECEA 1NBIA 1P2SA 4WX2B 1U4NA 3R7BA 5G40A 4FGUA 1CLUA 2C2KA 5LXTF 2HN9A 2BV3A 5F5XA 3I04M 5CX1A 3VX3A 4BQIA 3HKDB 4UM5A 4ZEWA 3TFWA 1TTHA 2UUCB 4RY8A 3OMXA 4Q4JB 2G04A 3EEFA 3QLVC 5ALXA 3SLRA 1H0RA 1K2VN 2Q3DA 3NEYA 3H11B 1KKUA 4LJ5A 3VU8A 3NORA 3O90A 4PYIA 3ZTWA 1M2HA 3F6SA 4QE3A 2GZAA 3DZHA 2FPOA 1H8ED 3PR2B 1RDFA 3DOEA 2BLNA 3IMFA 3P27A 4ZGGA 4KDRA 3UB4A 2PL3A 4ZI7B 1HWYA 1W0JA 1U3GA 1JALA 3K0BA 2ZRNA 1KY2A 4C2TA 2FN7A 1T0JB 2K7ZA 2PVPA 4KQCA 4TZKA 5H83A 3SN6A 2OO3A 4P8RA 4N82A 3WWDA 2O8CA 3UHAA 1AGYA 1E1NA 1SKQA 2PJDA 4H60A 4MUFA 3GLFB 2FLVA 4ER5A 3QXSA 3ICQB 4D44A 4M3NA 1R0XA 4S0ZA 2QG4A 1RWQA 4HQ6A 2NQ2C 1NOJA 1A77A 1TCVA 3M1YA 5JSQA 3NC1C 4PZ9A 3ONWA 3PJDA 3KVYA 1U9ZA 2ET6A 3DBHA 1GPLA 5H02A 3RJ5A 3ZKWA 3KJHA 3L8GA 4KQKA 2XYGA 4KQWA 2P2CA 5J2UB 1YDGA 4ZVNA 1OLOA 1YDEA 3OQNA 2XITA 3GT4A 3T9CA 1Y1LA 2CCGA 2ASEA 1Y7PA 4G4SO 2XYVA 4KH1A 2FR8A 1MDBA 2IGTA 2R6JA 1NRIA 4JL8A 3W3AD 3LL7A 2AS0A 3SR3A 3TR0A 1DWQA 2XB4A 1W93A 2RGNA 1HDGO 2NO6A 3D8HA 4YA6A 5JWRA 2PUAA 4I5DA 5J59A 5I3ZA 3B5JA 2IX9A 3JATB 4EDFA 4YJ3F 1X7YA 3C70A 2H1WA 1V95A 5IC5A 3ZU3A 1H4VB 1R10A 2ZCVA 4QREA 3NUZA 3A6ZA 3TOVA 3UO8B 3LHSA 2EJVA 4W6QA 1N57A 4DSOA 2WSYB 4HRXA 3FMGA 2JNWA 4WNAA 1AKUA 3PLRA 1AHHA 2JL1A 1GP2A 4BBPA 4FHFA 2D54A 1PUXA 1GFIA 4RPKA 1A95A 1GPBA 1WXHA 5JVDA 1SG9A 3IAFA 3DP9A 1UFQA 2QE7D 1RSZA 1IY1A 1KKMA 2ZBGA 4O29A 3TEMA 3M6LA 3OJFA 4QGFA 5T4HA 1T4MA 2NACA 1K8RA 4NBTA 2JLRA 4GPTA 4OEHA 5CAEA 4J76A 1XEWY 1H9AA 1P7YA 1SWWA 2Q3EA 2R65A 2VL7A 4Q3BA 3DKPA 3TECE 3A4IA 1Z26A 3AJDA 2R4QA 4C20A 4K6HA 4FKBA 3X1JA 4DV7B 1LC0A 1ZLXA 3KUXA 4LNAA 4WZZA 5E9WA 1R74A 1J7JA 3DWGA 3L0OA 3VTZA 5FORA 1KMCA 2IELA 3VSAA 3OPXA 1A4UA 3PTLA 1T0IA 4YV7A 3G9TA 2ZULA 3AX6A 3DR5A 3N8IA 4ALNA 1F0NA 1EUCB 3VZDA 2EP5A 3OZCA 4DSAA 2I7TA 3K2EA 4FR5A 1BX3A 4JKYA 2DR0A 4XGKA 5K0BA 1FB5A 4WEOA 4XRRA 2BGIA 3R6WA 4CDMA 4B3FX 2NNLD 2XXAB 3OKPA 5MGBA 5CVUA 3R1IA 5EOVA 4DJJA 1GRCA 4J0GA 5FLEX 4IIHA 4GOMD 3R7NA 5KWVA 2IXTA 3OLYA 5JMOA 3ICEA 1HOXA 4KIWA 5FI3A 2P5YA 3ZCVA 3WGUA 1IWOA 1GNVA 3DV2A 1ZM9A 3N39C 2O2DA 4WGFA 3ZDRA 2CXXA 3NRJA 3W2TA 1IRIA 1M66A 1RZVA 3OTIA 3GJ5A 3N8GA 3THXA 2HA5A 4Y6GB 4AJ9A 2QUHA 3R7SA 2FA9A 3HQ4O 1S8OA 1ZD2P 1FFGA 5CD1A 1GPUA 3C3WA 1S2MA 1PEKE 2YCBA 3MCVA 3PQFA 4GC9A 4MJ7A 1VSUA 4OMFG 4Q5IA 5FV7A 3LCRA 3NEPX 4A2QA 4KL8S 4QO8A 2FNAA 3GHYA 1HI9A 2Y3IA 4BB9A 2PA0A 3T9DA 1JMYA 1UT5A 4HLUC 3WGVA 1J70A 1ZMBA 2BRUA 2V59A 2HSEA 2ZIEA 1XZIA 4LZZA 3A3PA 3L40A 1AHNA 4EIWA 2V0GA 1GPNA 4IJ5A 1BFUA 1YIAA 4B7CA 1UP4A 1FYWA 5EZ5A 3GDWA 4GC5A 1BXGA 4J3JA 3K53A 4G0MA 3IP5A 2XDYA 3JASB 1BD3A 4OQZA 5L4SA 1G7CA 3RWMB 3UENA 1Z4NA 1XLWA 2Z9CA 2WG2A 4QD3A 2GKOA 1W6RA 1KJQA 1XUOA 5EKXA 1P74A 3FHJA 3I83A 5AWFC 1U2GC 2XGJA 2NTEA 4JCCA 3QEBZ 1G7TA 4FYVA 4OK5A 3CLSD 3VHXB 2WSIA 1BCRA 2NG1A 5AJHA 1LK0A 1XRJA 1WVGA 4MGEA 3ZXXA 4B4VA 3I3OA 4AZ0A 3MIZA 1RYNA 5EQDA 4AYTA 1HRDA 2OVFA 2R1UA 3LWBA 4H16A 3GXBA 3NVMB 4LXTA 4TXHA 5M7EA 4R4JA 4D25A 4G0WA 1CS0B 3LM8A 4FDLA 4B3CA 5J3JA 2PBLA 1JFFB 4FFWA 1ZK3A 4DABA 1DBVO 3I9JA 1UR5A 1N2SA 4UMDA 2YWJA 2X23A 3ICOA 3QKSB 4DCNA 5JU6A 4FXOA 5EIOA 1JU3A 3WNDA 2CLOB 1US8B 1RC8A 2OAEA 2GVZC 3UJBA 3D64A 4GLLA 1V48A 3IA2A 2K7FA 1U5CA 4KGXA 2VJDA 3OPYB 1V8OA 4J0QA 1A5AB 1G0OA 4V0QA 2XTJA 4ID3A 1GOTA 3EW9A 4URXR 3D4IA 2WT4A 5JSYA 3B70A 1BMFD 3G6WA 2I1WA 3ICVA 1N8TA 2VPYA 2VA8A 1O54A 3PGA1 4TLEA 5B1HA 1V5GA 4H6VA 2WZBA 4IQGA 1RKXA 4OIFA 2WJ4A 5E8RA 3VMMA 2WFLA 4QYWA 1Z0UA 3VTAA 3N3AC 4OSPA 4MRSA 4ZU3A 3RH0A 1RHRA 5A0VA 4JLAA 1F6DA 1D6NA 2EHDA 3O8OA 1E9EA 1X15A 2D0DA 2YXBA 2ZDHA 2SKCA 3DKVA 4AJNA 3IERA 4D9BA 5B64A 4I6EA 3C8UA 1AKWA 1AUXA 1TPZA 2B2CA 2Z43A 3DWFA 2XA1A 4RAOA 2L69A 4WCDA 1A82A 2EJBA 3P2YA 4I3HA 2DU8A 4IZOA 1ZESA 1OXVA 1K88A 1MO4A 4JBXA 5EXTA 3CKKA 2F9FA 1QAMA 4DCTA 5K03A 3QWHA 4BVLA 2A1UA 4IFEA 4V3CA 2DTDA 1UIRA 4LCEA 1E3IA 1PVDA 1CVIA 1W1IA 5GJWC 3UJPA 4PZYA 2FWBA 3ULKA 2A5GA 4PG8A 3HFRA 1G42A 1T29A 1FS6A 4PEVA 1VQ1A 3H2SA 4HTAA 4GECA 3NIBA 3OVMA 5A3QA 4J49A 5KVAA 1YIDA 2DVMA 4PG7A 3BFJA 4UEKA 2PN1A 1KE2A 4BV3A 2BEVA 2CEAA 2PX6A 3A70A 4M21A 1E1QA 1QH1B 1XZDA 4P34A 1U94A 2R8XA 1M9NA 2F43A 2GK3A 2VJMB 3EYWA 3NALA 1OX4B 4O25A 1DLJA 2C2HA 1ZCJA 2Q3MA 3ZX4A 1JRLA 3ZU4A 3R7AA 5B7GA 3ZV5A 5D1HA 2MYNA 5TEVA 1VA4A 5T8KA 1VZ3A 3GJ4A 3PI6A 4BVAA 5LD2B 3AYZB 5L3SA 2GN6A 3PC4A 2Q5HA 1QK5A 4P3KA 3D8NA 5FOUA 2P2ZA 4PZ0A 3SBEA 5CFNA 5D3QA 3KPJA 1QG6A 2RB4A 4M98A 3A4YA 2Z04A 3T1TA 1CDDA 2MSCB 3C7AA 3BGIA 4C4ZA 3I5AA 4H6XA 1F2TB 1OXKB 3RSZA 2IHNA 3CLTC 2VPQA 1QO0A 2F2TA 2I3AA 3IJRA 2FK8A 3N8KA 3ICPA 3TPZA 5FEUA 3T4UA 3HBLA 5AKYA 2IV2X 4RY2A 4ALKA 5I4CA 5JARA 1OLXA 2WHYA 1MT3A 5EYPB 5JRJA 1U3TA 2AEJA 1VIAA 1B26A 1L2TA 1LC3A 4RPHA 1L1QA 1UM9B 3VHLB 4DBLC 5A4DA 1FMTA 3FOFC 1D2MA 1N2BA 2QLJA 3BIJA 1YJBA 2J5QA 3CEPB 4AF7A 1N2ZA 1E58A 1JXAA 2QVLA 3IDQA 4QUJA 1B93A 1YJCA 1KDOA 5FOVA 3SQNA 4LYGA 2C7BA 2IU6A 3GL9A 4E21A 1MF7A 4XWKA 2R6AA 2Q8NA 1AHPA 2EKZA 2FZEA 4OFBA 1JPVA 3CHYA 4N03A 5ISMA 4K0KB 1NYQA 3HCNA 4H0FA 5KYUB 1RT9A 1SU7A 4FLFA 4FP9A 2E5LB 1HM5A 1DZ3A 3KHTA 1B3RA 2QL6A 3L2OB 3RDPA 3V8BA 3VC1A 4E0BA 5JT1A 2VPWA 1I5EA 1XL1A 4CM8A 4DDVA 4PLGA 4WA7A 1VCOA 4IZHA 1A0OA 5DBIA 2NYVA 1IQ0A 4HGZA 5ELMA 3PZBA 2ZATA 5NULA 5AK4A 2BF4A 5JQWA 3LY5A 4IO1A 1U1CA 4KN9S 2H2DA 4NHOA 5CLIA 5ER6A 5I9TA 3TPCA 4JB8A 1DPFA 1OYVA 4LV8B 2WA1A 5TQVA 4C7XA 3IKTA 4JB3A 4BWYA 2ZCJA 1ARZA 2QTMA 1VSBA 1JFRA 3W5BA 5FFNA 2DUMA 2DUWA 3CKYA 5E95A 4KVGA 1ZGBA 3KFVA 3QE0A 4LSWA 2WUWE 3I2GA 3TLAA 4TMYA 1PFUA 4R5HA 4NCIA 4ZCSA 3N0VA 5C18A 4GPIB 3ML1A 1NVVR 5FRDA 1H0HA 3SXUA 4CE6A 1C3OB 1V0JA 2PM8A 3AXSA 4QDZA 2Q5IA 2YXPX 4R8KA 1SUCA 3WRVA 3A1DA 4KRFA 4KJZA 4X63A 4YJ3A 2EEPA 2G06A 2OHJA 4KQFA 3IJPA 2ZRIA 4OKNA 4U9IS 2A5FA 4XTCS 5HDQA 1AK1A 1NVKA 1F48A 4L76A 1WVMA 4DBZA 2JEYA 3MJEA 3MUEA 2IEBA 2W6JA 1WCV1 4D6PA 3L1KA 1G8KA 1AMNA 4LWPA 1TYBE 1DB3A 5JROA 1YCFA 5DTRA 5JQGF 2J46A 1H6CA 2DBRA 2FPGB 1A69A 3PDCA 4XGRA 4ZHSA 3A1EA 4G0NA 4GZ6A 1F8FA 2JVKA 5C5CA 1JWAB 5HMLA 4BP1A 3OQHA 3GP3A 4Z99A 1G8AA 4N76A 1T0BA 1KR5A 4YRGA 3MLAA 3WKBA 5TC4A 2BLLA 5A4FS 4WDQA 3X44A 4HNAB 4HX5A 4I2VA 5TGZA 4Y1FA 1DMSA 2P62A 4QJ5A 4EPWA 4KUHA 1X7WB 2QZZA 1KI2A 4J75A 3S2ZA 3DEIA 5KNCH 3A6PC 3AH8A 4IDBA 3K70C 1XGKA 1UKAA 2H92A 4MV3A 2RGUA 3IOMA 4R51A 1F5SA 3CUEF 1XDUA 2XDQB 5REQB 4F12A 2AEFA 5AM2A 1QCDA 1P75A 3MJTA 3OUZA 1UODA 4JMLA 1JFSA 2PY6A 3L79A 3V4PB 2ODNA 2G7MC 3KKZA 5EQJB 3R6LA 1QO7A 4MW5A 2VDPB 4DLTA 3QHAA 2XUDA 1CHDA 2VDRB 4KQMA 4CYMA 1U2EA 3MBIA 5B4UA 2FHSA 4WXHA 1ULHA 2I3BA 1A7AA 1W35A 3HJNA 4RDHA 4NJMA 4H7KA 4RBNA 2YY5A 1HEUA 1K8XB 1Z5WA 2I8CA 3VM6A 4Q18A 4B8YA 5AVJA 2NTYC 5JBNA 2QL9A 1NW6A 4GBJA 4L4XA 3GELA 3JALB 2UZ1B 4O02B 3EQZA 3V00A 3TJZA 2FMHA 1ZNXA 2D8MA 5ECYA 1CE8A 3NYWA 1XXHB 5I7SA 2AFRA 2EIHA 4K88A 1LDNA 2SCUB 3CR7A 3JQAB 4X3PA 1AU9A 3M49A 2JLAA 2GA9A 2VHCA 1PX0A 5EJ7A 4HZGA 4EYOA 4HDOB 4PYMA 4DUPA 4YXFA 2XAAA 2ZJ4A 5FL7D 5HR5A 3H19A 2CKDA 1OHHA 2LDBA 3FOBA 3HB7A 1XC7A 3ISJA 1R7RA 5FLYA 3DPUA 2JGNA 3VGPA 1NR7A 3EEYA 3FWPA 4E15A 4S35A 4NPAA 1L4UA 3H83A 5GGXA 1U6IA 4OD0A 3OM8A 4OYYA 4BFWA 2DTEA 4DNPA 5C46F 1A1VA 3MB8A 2H4FA 3NKVA 5B53A 4CNQA 1Y63A 4G01B 4DUYB 4UW9A 3N0RA 3ANLA 4D02A 2M1XA 1DHTA 3RRJA 1JLSA 2YINC 4MAFA 1I36A 3E35A 4F6RB 1PG5A 4JU8A 3ETHA 1GGFA 4CM1A 4CG0A 4JYBA 4YWHA 2FPMA 5HRAA 2ONZA 3MG9A 1DAOA 1BOFA 2B0CA 2BI7A 1GZ4A 4P3PA 3V1UA 1RMQA 3O93A 3PNMA 3TUZC 1KQ3A 4BCDA 1SD1A 1HTBA 2FW0A 2HA3A 2E49A 2OFWA 2PO7A 4N5IX 4Q6BA 4QELA 4QU8A 3N87A 3OJEA 4P38A 3C5CA 1B6GA 4MHTA 5TJ9A 1UF9A 4IAOA 2LXNA 4UUAA 4ZVVA 2EGUA 3JARB 1G55A 3MCTA 1GZ5A 4XYLA 1ZQ9A 2AJTA 1U8FO 3I1YA 3QK7A 4Q4AB 4KR3A 1YQ9A 4O2RA 1SZJG 3OZBA 2FWIA 2OQVA 2XZLA 4A1FA 4NBVA 5IBCA 3LTNC 2CFIA 3O3OB 1Q95A 2K87A 3ZDQA 1I1HA 2C7VA 5FUQA 1QTQA 1O94D 2ZFUA 2QG6A 4P0TA 2AH5A 5CK4A 3E9ZA 2WAYA 1GADO 1RLIA 1ESMA 4IW3B 4Q0MA 2HGSA 4HH0A 4EBFA 1XKXA 3L1VA 4MKRA 4EQ6B 2J87A 2FFAA 4ROTA 2YC2C 4FIZA 1C50A 5JH7B 4NCBA 1Z7WA 1KO8A 3ID6C 3NP9A 1YR3A 2AXNA 2PH3A 3LHDA 2W4QA 5DKFA 3EDQA 4MEJA 2F3RA 5C8ZA 1GAEO 2J9XB 3LDFA 3THRA 5DM60 1CJTC 1JDUA 1U9CA 2VTVA 3EE6A 3L5KA 3NBXX 1VIDA 2J7PA 4BRZA 5EMKA 5FBHA 5C5DA 4RO0A 1THZA 2BUBA 2IC5A 5AR1A 4G1UC 3WIDA 1GTL1 3F6PA 1ZI8A 3GWGA 1TDJA 1GJRA 4RHCA 3A4LA 3GP5A 1BWSA 4YFYA 2ZSEA 2BH9A 2GTIA 1KK2A 4K0RA 1G2QA 4M76B 1L4YA 2PO5A 2J3KA 1EFRD 3G68A 3ZDZB 2GXAA 4PC2A 4FI3F 1M2FA 4DY6A 5LD2C 1J9EA 5LB4A 1XTZA 4PIVA 1JKXA 4JP3A 4QLOA 1R12A 1SXJC 5KYTA 3K8ZA 4V0MA 1WSBA 2P3LA 4OHUA 3TTSA 3OFSA 5KYWB 5CD9A 2K2QB 5IT9A 3EY4A 1S2NA 2QT0A 4OHRA 1QPGA 4MQMA 5TQ0A 3AVTA 5BSVA 2R7MA 1H4SA 1V5WA 1L5VA 3W2EA 2DKFA 1POWA 2JCGA 3OOYA 5CFOA 1DEXA 2QXUA 5KVVA 4ARCA 5JPDA 3O26A 2B9VA 5IM4A 3GX1A 3IMEA 4B09A 1D1SA 2IYAA 3GFPA 4BFLA 2H11A 1UUFA 3RU2A 1ZH0A 3MJFA 5B58T 2E5WA 4MI3A 2DUUA 2NXWA 4EHLA 3PXGA 3U5TA 3CCFA 3FKSD 1B23P 4LF4B 1C8KA 4Y1RB 1Z47A 2VYVD 3L0PA 3NVDA 3PGVA 5JDCA 5LOVB 3REQA 3RSCA 2O6LA 3F9IA 3V42A 1IEWA 3GVPA 3ZCUA 2VK8A 3FWKA 3H2IA 3NCHA 2J32A 5CDHA 4Y0VA 2DFLA 1Q20A 2IE8A 1BDHA 1RW4A 4B84A 2WC1A 1E89A 4JSYA 2X1LA 4DQDA 3PTZA 3LT5A 3H5NA 4XH9B 2B4KA 4GOXA 5T7BA 2QN6A 3NASA 1DI0A 2CCJA 3VPCA 5C7LO 1OB2A 5BN1A 1TCAA 3CVYA 2NW6A 2OL4A 4O2AA 5G0TA 1HMYA 5C8YF 4EUHA 1O5TA 1BWRA 1C8BA 1UIMA 2OWEA 1QANA 1T0HB 2Y1CA 1MX3A 3A9RA 2A92A 3AESA 4IRXA 4JVMA 4MVXA 2E1PA 1NE7A 4OB8A 1K7EB 1W5AA 4FFNA 4HG2A 5JXHA 1NULA 3E7DA 2C2OA 2YH2A 4OVKA 6REQB 4XQCA 1UDCA 2N0SA 4UNQA 3THSA 1ACMA 1BN7A 3MQ2A 3RO7A 5LZ2A 4C08A 1AXEA 2R8ZA 1OFUX 2CE7A 1YRBA 2QAIA 1V1MA 2YBEA 3EG9B 2BFCA 1DQYA 1HY3A 2OKGA 4L5JA 3ZCTA 2QGFA 4ZIRB 4YT2A 3T5AA 5CA0F 3QOYA 3H6GA 3OBIA 3IHLA 2DM6A 2G83A 5DGHA 1JQEA 3LT2A 5A9RA 5JPIA 3TF5A 4ZJYA 3K5WA 2ZI6A 3H3XA 3DGEC 3SBOA 5JJCA 1NY6A 3I42A 3C6KA 3VKVA 2DTXA 5HJ5A 3O38A 3FZEA 4X9XA 3D43A 3P94A 4ZKEA 5GINE 3I32A 5JD6A 4YMIA 4BMDA 4E46A 4OJTA 1Y34E 1FP2A 1IPFA 2OZLB 2Z8ZA 3KR2A 2WE8A 3SM9A 5F9FA 1OYYA 2HHLA 2EF0A 3B1ZA 4YV0A 5CMLA 2FW7A 3B5IA 2ECFA 1SEPA 2V4UA 5L3RA 1QO9A 5KKCA 1XEFA 1P0IA 4JXJA 3IAS6 3WNCA 2QM3A 1P81A 1MC8A 4PHFA 2ZB7A 3NT5A 3TLXA 3WWEA 1D1TA 4ZVRA 3SU8A 1QZ3A 1WXDA 4IG4A 2QU7A 3DOFA 4X84A 4MCIA 1F0YA 1FVFA 4EF4A 1AY0A 2JFUA 4TTRA 3C3KA 1XQVA 2WICA 1YBAA 3OA2A 4YO7A 1GLNA 4KXWA 3RWBA 4F3TA 3KR1A 5DOVA 3RYFB 5MHTA 3K94A 2APJA 2VP3A 1Q7TA 2H16A 5I7AA 4BKUA 4BS9A 4CDRA 4Y2VA 1SC6A 3U3DA 4B40A 1EAMA 2FW8A 4EYGA 4F3NA 1LRLA 1P44A 1VMEA 3P9NA 4MSUA 1T6NA 2GK7A 4KRGA 4NATA 5DXFA 5J2TB 2QYSA 1LDYA 2AF3C 3KFLA 2HYDA 3WZLA 1ZDMA 1PTJC 1V26A 1P9WA 3D8TA 4FW9A 4G2NA 4K05A 3ROQA 1Z7EA 3OIUA 4C1NA 2EIXA 1PR6A 1ZZGA 2CWDA 3Q15C 1KK1A 4X1IB 2P5SA 1D2HA 4FJ1A 4S3MA 3W8FA 5CVEA 1DIHA 5JQGA 4YPVA 3WLIA 2IOFK 3LF2A 4ZV7A 2XDAA 4IXNA 2FOIA 2DB3A 3R0JA 3EULA 4YP1A 2EX0A 4CMIA 2HQ1A 4L73A 4I55F 2ZSBA 3OFNA 1Z83A 3FUCA 2ZBPA 1SXGA 1K06A 2R1VA 3CGGA 3SZMA 4U7DA 4G5OA 2XZDA 4LOJA 2NU9A 2VJCA 4MVJG 5CEFA 2AG1A 1NDQA 1D2GA 3NETA 4X66B 1YKGA 1SKYE 2HKIA 1W4CA 2FHPA 4MP3A 4NPCA 1GGMA 5K4HA 2C07A 5F1PA 4G4SP 2FMXA 4MQ5A 3D59A 3KLPX 5DH9A 4RM2A 1WCYA 2OK8A 2VATA 1PU2A 3TRDA 4QSHA 2ZJAA 3ABIA 4W5HA 1V1RB 1QYVA 5BV1A 2NIPA 1E1CA 1I33A 2PEZA 2QMEA 2ZJ8A 3E8XA 3V4ZA 3BTVA 2JAPA 4UUBA 2Y99A 4X1YA 1M75A 4LJLA 1GITA 2PBFA 1SVNA 3HA7A 3V9PA 3RBXA 1DC7A 1EVYA 4ER7A 3ELWA 1Z25A 5E3HA 3QY9A 4WLFA 3OLQA 2HCBA 1JXOA 5K0CA 3O84A 4IH4A 4E30A 1QRDA 1V5EA 3KKMA 2CDCA 2QRKA 3FUXA 4JJZA 5IXYA 1JHOA 2R86A 3WWPA 8MHTA 1WXEA 3QFTA 3UH0A 2R60A 3P26A 4QWMA 4WOCA 4WFIA 4PU0A 5DX8A 3FJ1A 1CQPA 4PZUA 1RRFA 3OLWA 2R85A 4J0KA 1KNQA 2FW6A 2ST1A 2Y1WA 5DM1A 1WDMA 3OX1A 5ALPA 4NQZA 5LA6B 3SDSA 4DGQA 4EO9A 2CXPA 1C0PA 4WXRA 4HOYA 3TQOA 4HEHA 3J7TA 3ZXUB 1B43A 1K97A 1O5IA 1Q1AA 1ODKA 1S9HA 1U0JA 1UK6A 3E7PA 2C97A 1X80B 3ESXA 2YHIA 3FMVA 4UBLA 4Z4IA 5FUMA 2XMQA 2YMLA 4NV0A 2LD4A 2Y4OA 4GGPA 4ESEA 4LPSA 5ADHA 3CO5A 2X9NA 4EUEA 5HA5A 2C78A 1KJYA 4IQFA 1B6SA 3CRW1 1WUHS 3AR9A 1NNSA 2AMFA 4UQOA 1U2TA 3EWAA 5C52B 5C31A 3O2JA 5K3SA 3GGDA 1NM5C 1SM4A 2BUCA 3T5TA 5TB5A 4YV2A 3EXHC 3LVBA 5K8LA 2FWAA 5DI3B 3VSEA 3GGJA 3BL5A 3D6UA 1W96A 4RY9A 2GB4A 1XYYA 1X7XB 5AIBA 4YMLA 1NXTA 5K51A 2V7EA 2ILVA 2V55B 4CV2A 3H1PA 3ZDAA 3I01A 4P5EA 4ZOEA 5BSMA 1BXRA 1FRVA 4XX1A 2PZLA 6PFKA 1MNAA 1SPXA 3ILSA 3OOSA 1IPEA 1KC3A 3RODA 4R8RA 1JIXA 4WASA 1XV5A 3PJFA 4O4JB 3M70A 4D9NA 3WJ2A 3ROPA 1P3JA 1WIWA 3JD2A 3HP1A 2PZ8A 1TB4A 1PWHA 4MR9A 5G0VA 3QPDA 4G1CA 3M4JA 4RIGA 3B2NA 2P7IA 3KZKA 1JQJC 1OOEA 1BKYA 3P52A 3UAYA 3GEPA 1NJ6A 5KINB 1K75A 2ZTSA 3BMXA 3L8FA 3IP7A 4GVLA 1M0WA 2GWHA 5EXEA 4I14A 5BO5A 2W7TA 2VH1A 3SFVA 3ND7A 1G5PA 3ZH9B 3N58A 3E3OA 1I7NA 1Q7GA 1ZUNA 2W22A 4N5MA 4AK9A 3GGGA 5I7HA 1P1JA 2FN9A 5K3DA 5JADA 3IKMB 3NVKI 3ZU6A 5EGSA 3HO1A 2OO5A 3ZHQA 4DNQA 2JC3A 1EK5A 2JCXA 1EFVA 4FXPA 4EFLA 5DWVA 5ALMA 1QGUB 2Q1WA 1MGPA 3BMOA 2BGMA 4PCAA 3O8BA 4PVCA 2NMVA 3LY7A 5FOXA 4UVHA 1O4VA 3MMSA 4CWAA 4Z1MD 4IHAA 3BAZA 3FKJA 1KFJB 2FPLA 4RHEA 2PVSA 1AXGA 1PX2A 3BQ9A 1XTTA 2NVUA 1T5TA 1RVV1 5BY2A 4KXFB 1XPJA 4FYWA 4LNUB 2PMKA 2XKAA 2NU6A 4PLYA 4GO1A 4QBHA 4L0CA 3U3ZA 4A8PA 3L7OA 3TX6A 1AKMA 3OT1B 2IJGX 1SHKA 2WTNA 3TZQA 2JW5A 1KZ1A 4IJKA 2M6SA 4CKZA 4PYRA 4S04A 4L0QA 1IVYA 3M6UA 1E6MA 3QVVA 5LMUB 3KOOA 1O77A 1VGVA 4BP8A 2LP4Y 3CXRA 3NONA 3E1GA 3SMVA 4RZSA 4UCFA 4G09A 4JY7A 4D81A 1M67A 3HK2A 2IUSA 1AKEA 3G8YA 3OCZA 2G4VA 1A88A 3DC7A 5TS3A 4N1AA 1LJ8A 3FTPA 4MWGA 4HWOA 4ZYZA 1Z9BA 4G2TA 3ROGA 4DIKA 4D3XA 4B3XA 1Q17A 2PFSA 4YRDA 2P69A 4I9UA 5DT9A 4JI0B 2F00A 3GGOA 4RYDA 4NULA 1EH5A 5C3UA 4YQEA 1DKNA 3PHCA 4MEBA 2J0UA 3EXEB 4IOLA 3HB1A 3HYRA 3ZR4B 3LX4A 3JWJA 1BW9A 2DFPA 2GZ2A 3HU1A 3SDZA 3U49A 4LOLA 4DZTA 5K0FA 4NMHA 2YNMC 1SUAA 5C81A 1HFEL 1MOPA 1U1IA 5C0OE 2XUHA 4CL0A 5ER9A 1JVSA 1MCZA 2NOAA 5KVQA 1SXIA 5CRIA 1QRRA 1CEQA 1I5OA 3RSLA 1KFEB 3AU9A 1BJKA 5C8YA 5JJKA 1CIJA 4XIYA 4BFYA 2X4DA 5IASA 3NWPA 3IBCA 1KY4A 2JVIA 3UCXA 1R6VA 3L0CA 3A2KA 3FUUA 2EBHX 2ZWPA 3TOZA 2XF2A 3T3IA 1I10A 1IZ9A 2CVHA 3D3KA 2V3WA 1H65A 3NR2A 4RAQA 1EQUA 1XMXA 4PPGA 4KE7A 3U4DA 4B0PA 3STHA 4D41A 3NHAA 5KWEA 4JUDX 5BXYA 3D6JA 1KI4A 1QRSA 1V43A 1NMSA 3KUKA 3N5CA 4JJIA 4WFJA 2UZAA 3LP8A 4KIFA 4DZZA 1RYEA 4YREA 4KDCA 3ORQA 4TWRA 1CY1A 1NHGA 1FRZA 5HX7A 5H81A 1RHJA 3OESA 4L7QA 3C6QA 2HK6A 2ZU0C 2H4YA 3ELUA 1B8VA 5AKKA 3EIHA 2I22A 5EIHA 1E2MA 1N92A 4JI2B 3JD0A 1X1TA 1KPIA 5CT6A 5C5EA 2AOUB 4BO6A 2OBMA 1BIFA 4QHTA 5KU7A 3KQWA 4R1OA 1YZKA 5ICMA 3MNFA 3RRFA 4GKKB 1Z6QA 4C2BA 5A4JA 3P9QA 4PPYA 4NCJA 1SIOA 4XD7D 4NWIA 4MGHA 3D0RA 3DF9A 5CM8B 2MSKA 1K6JA 4JH0A 5AVOA 2QTAA 4FHEA 3SM3A 3ZXSA 4B0OA 1ODFA 5DYGA 3IURA 2CXQA 2OWDA 3QUCA 4OB6A 5CU7A 2WWWA 4LDQA 3B13B 5CFLA 4GHWA 4NOJA 3R5FA 4HWSA 1BH2A 3X1XA 2ZTLA 4FS8A 3H9EO 3LUFA 2YL2A 1LI5A 1P9OA 2ZCUA 3K1AB 1MRZA 2F3PA 1EMDA 1GQ2A 1ZIXA 1XAIA 2VPXA 5FA5A 1J42A 2YN2A 3ZWMA 2H3EA 2WWFA 3U3OA 2QVYX 4TKVB 1E1QD 2JK0A 2GCOA 3FLMA 3PXAA 3BHJA 3ETLA 1C7IA 4QVGA 5ADUS 4DLSA 4IIEA 1IN6A 3SFTA 5K1ZA 3AR7A 3BTSA 1Q1EA 4H3HB 5TX7A 1NLZA 5IHPA 4R9RA 2O2JA 4KP7A 2MDTA 2O06A 3NBZC 1L5GB 4F92B 2W6ID 4I55A 3CSUA 1DXQA 4LRWA 2O0JA 4E6EA 5EJ6A 3AVQA 1JJIA 3KFXA 1BGWA 1QO0D 3HWWA 4R8SA 4EI8A 1WDKA 2AHRA 2VT6A 1Z62A 3M81A 3VAZA 4O4LF 1NFRA 1IBSA 1ZHOA 1ECPA 5ALRA 4FNGA 2GD1O 2QN9A 2JAQA 3W6NA 4DDUA 1Q3TA 1P2DA 2FSFA 1GGKA 2ZS8A 2XVAA 4GBGA 1E2JA 5DGIA 1U81A 4XCQA 2WVAA 1ZAKA 2A84A 2C5FA 3IV6A 4REOA 2BKEA 2NPOA 4FMDB 3RRMA 5AT1A 3PC8A 3DCNA 3WMXA 2OEPA 3DKKA 4TMZA 4NARA 1V6CA 2ZW9A 3O74A 4B6QA 1KVRA 3DCIA 2MSNA 3GMDA 3LPCA 1N32B 4V0ME 2CF6A 4CFYA 2DGDA 3DT6A 1G5HA 3OE7D 5TIIA 1K86A 4BLVA 2V7TA 1VYTA 2O48X 3IE2A 4L95C 5BOVA 3OO0A 3GGPA 2Z3ZA 4YX9A 1KI3A 2PU7A 2VK2A 1VBKA 4MS4A 1DQZA 1QXSA 3ZG6A 5FPKA 4BYMA 3K0SA 1TK9A 2X7JA 3MJSA 3ZCPA 4PLPA 4ISCA 1PNTA 1RQRA 4BU0A 3H5OA 4ZDKA 2F8MA 1UMBA 1CUXA 3N2IA 4ZO4A 4J8PA 3GNTA 4OTZA 1N9GA 1KMMA 1TM4E 2BBSA 3H3JA 2F8LA 3EWIA 4XQEA 4LYYA 2I55A 1EFDN 3AV0B 4H18A 4W9RA 2XF8A 3FI0A 1YZVA 1JQ3A 3KQQA 4D97A 4BBJA 3VZBA 1FJGB 1T0UA 4ZJPA 2C3OA 5JO9A 6CHYA 4BLOA 3C3XA 3HE3A 3QLUA 3LTEA 4M87A 3PD7A 1KH1A 5FA8A 2WUVA 4YUWA 1E0JA 1BDJA 2YJ3A 4RZ3A 3BN3A 4AJHA 3V4SA 3W4KA 3ZY5A 4P6VF 3QBDA 2RHWA 1WPXA 1XTUA 4F60A 3FPEA 3IQGX 1CT9A 1T8TA 2CV1A 2NXCA 4CT4B 3R77A 1H66A 1NVTA 1Q7CA 4QPJC 4FDUA 2J4FA 4MTLA 3IAAA 3UHOA 2BFAA 4B4OA 4BE9A 3DAGA 1XD8A 5TT1A 2W6JD 1NX9A 3DOJA 4PG6A 3TS1A 3V4LA 2B30A 4ZU1X 3VDQA 2C7QA 1X74A 2PJUA 4NESA 4QXAA 3SZ3A 4D4MA 3IC5A 2IS6A 5CM2Z 2V45A 1EUDB 2JGRA 5E8JA 4B80A 1XBTA 5M29A 2WYHA 3ETEA 4G63A 4KKXB 2QLFA 1TAHA 3IPLA 5JEDA 2FH5B 4LJYA 4UHCA 3C87A 1XQWA 1ZXLA 2PEYA 1IN7A 1ZXBA 1U0EA 2CLKB 1IHUA 3N74A 3ECAA 5IAKA 2XGMA 5DNUA 3WK8A 3VPSA 5LNK1 2WSLA 1ONBA 2XT6A 3RIEA 4DLAA 2YN4A 2Z6QA 4D4HA 4A0QA 1JHYA 4Y2SA 4QQKA 5KX5B 3CRNA 3M9XA 1YV9A 2Q21A 3OFKA 1KI1A 1ZGZA 2ILTA 3GLHA 1P1RA 3NHMA 1H1TA 5DBFA 2I2WA 2K6GA 1XJ5A 5UKDA 1L3IA 3ZDYB 1HNZB 4KWCA 4R98A 1TF2A 4RPLA 1AUPA 3CNQS 2DE0X 3K9WA 4H7PA 1VIMA 4PW0A 2IUYA 3NS7A 4N41A 4ZK2A 3G85A 1TQ2A 3B1YA 3HDJA 1AOXA 4GKBA 3RQIA 1C81A 3MOSA 1W5EA 1I3LA 4PYLA 1W1WA 4JQOA 1XALA 5GM2A 3IHKA 1ZNZA 4U2DA 5CLLA 1K5HA 5JD5A 1NTRA 3PC6A 2W98A 3A26A 3VJMA 4CMJA 2XRZA 1FTSA 5EHIA 1VE6A 1AS2A 2COEA 1DIOB 1CQXA 1QF7A 1KAEA 2XQIA 4PYNA 3MFQA 5CLGA 3TDMA 1XYVA 3DW1X 4C0SA 5DSTA 2QKYA 1HO3A 1Z2EA 1QVRA 1Z6AA 4US0R 1VL5A 5ITZB 1Y37A 3I9NA 1YB7A 3BXGA 4PCUA 4UMVA 3IAM6 5E4FA 4CEHA 2Y8EA 3V4RA 4PM4A 4Y6QA 4D0NA 3OETA 5TPWB 1Y1TA 2OKCA 2VN8A 1GV0A 3WTCA 5KYNA 1HXHA 3IILA 5A6SB 2OY0A 3VBCA 5HTOA 2JFBA 1GKLA 4KPGA 3RFTA 1BC5A 3VBEA 4NZOA 1CJKC 1P2VA 2ZBRA 3UMYA 1PT7A 3S5UA 3SK0A 4HXGA 3G5UA 1IBKB 4JUBA 4LE1A 2ZDQA 1CUGA 3LE8A 3DNPA 4QASA 2EC5A 2WM2A 1IAVA 4FCTA 3E22A 2RGDA 1NW5A 1RRVA 2OPHA 4Y6PA 4PHCA 1FQKA 5ARDA 3VX4A 1FZTA 4V0NA 1EP1B 3ONFA 1HZJA 2XCLA 4LSZA 5BSTA 3FSEA 3ZW8A 2CSXA 4MVJM 2ZJBA 2ZZMA 4FMBB 4R6XA 4KPFC 5CDYA 3O1IC 4IIGA 1RXYA 4K6OA 4ZAYA 4BVHA 1P4HA 1RYDA 1ECJA 1RWXA 1Q1ZA 1ZKMA 3RTGA 1ABFA 2N3ZA 3NHWA 1FTNA 1SURA 1T2FA 1DO2A 4XASA 2FZGA 1ATIA 4ZVPA 3RS4A 4KNVA 4IP0A 1N25A 3R3XA 3MJHA 3S81A 4I9FA 4N5DA 4TT3D 2D5BA 2BGGA 1MOZA 1ZM2A 4TRJA 3T1YB 1HLFA 3WDSA 2NQ8A 1LDBA 1BA3A 1ADYA 2FJPA 4YP6A 5FFMA 3ZNQA 5LJLA 1X7ZA 2EQ5A 5E2IA 1FK8A 3NBUA 4DCGA 1FQJA 2F3SA 1AKYA 2A0FA 3UV6A 2I6QA 8AT1A 4AF8A 3VUFA 5JNRA 3ORHA 4D4GA 2FFQA 1EVEA 2UUPA 4WL0A 2DUJA 4AWAA 1YCGA 3WJAA 5CX1B 1SWVA 3OE1A 4Z86A 1RU3A 4OXRA 3A7EA 3QX7A 4E5MA 1NURA 3VPBA 1ULSA 3FFAA 4FBGA 5BUSA 2ZR0A 5G41A 2ZJOA 5D6NA 4F5EA 2FUNB 3DMNA 1C7EA 3NP7A 1Z36A 4RIHA 4RVDA 4P7JA 1GSHA 4BBZA 2Y67A 2H65A 1RQ7A 4W1PA 3RKSA 1FRQA 3IDFA 3NGMA 1LNZA 3KT3A 3L8YA 4DA6A 4QJ3A 2IV7A 4YT4A 4LHYA 3IR5A 3NO4A 4MB0A 3F8WA 5G4KA 1Q3HA 2O8CB 2HMTA 4BN0A 3N2ZB 3G8AA 2WMYA 2BGLA 4UXIA 4K86A 4B6SA 2ZI4A 4X90A 3TO5A 2GFQA 2G1KA 5E4JA 2UXBB 4XW2A 2UVPA 2QRVA 2YJ4A 3G2HA 2P3QA 3Q3GE 5EL0A 3RTAA 2RHBA 4BVGA 1YA6A 3A6HA 3HGQA 4IDQA 2FFBA 2O1XA 4Q66C 3TLMA 3ZWYA 4UD6A 4LRXA 4MIKA 3RUIA 3DBHB 3ZKWB 3CQ9A 1IM2A 4RS4A 3MTAA 4HNVA 1C9JA 3F49S 5AW0A 1P9NA 4LNHA 2HTFA 5MFPA 3UBTA 3ZOZA 1GAXA 1A3CA 3GJ7A 3PNBA 4J3NA 2FN4A 2YXLA 4BNGA 2DWOA 3NBFA 4IICA 2YR0A 5ALFA 3TD6A 4B2PA 3CLUD 3CBQA 2A0WA 5F9MA 3IUBA 4ETWA 4YYEA 2AW5A 4WFKA 3CUVA 2VO1A 5IC4A 2MMGA 2O4CA 4RELA 1P4GA 2W2MA 3FWNA 3VC3A 4BB5A 1XVLA 5BRAA 3F78A 5CK5A 3QEKA 3ORSA 3ZHVA 1X7YB 1ZMOA 4GE3A 2HV9A 3QXGA 4EW2A 3ZV7A 5E2AA 5GV7A 4GMFA 1LUAA 1UBSB 3DL4A 1J09A 3BXZA 2FEPA 4U2EA 4LSMA 4WNAB 5FTWA 1G3RA 1NP6A 3EVTA 3ROEA 5KNBA 1U2ZA 3BIXA 2AOVA 3BFKA 1Z4LA 3R0ZA 4D3DA 2VP9A 3EC2A 1L7EA 3H5VA 1ECLA 5JVDB 3TSWA 3B8HA 4MCAA 2AI2A 3W9SA 4EVQA 1PSZA 3OPNA 3MM4A 1JJAA 2RHJA 1ZVQA 4HO1X 5HKLA 3O75A 4KXVA 1DRUA 1NUUA 1S3SA 4YJDA 4F72A 5FNZA 5CAEB 1K4YA 3EPKA 1ZICA 2ZWAA 1AMOA 4GP6A 4TTQA 2VEDA 3H5WA 2IZ7A 4HAXA 1QKIA 3SE7A 3N2EA 3HN2A 3PHIA 2AN9A 4JENA 2OYSA 5H8WA 3RS7A 3ND5A 1KZ4A 4RA9A 1V4NA 3ZWBA 3G0DA 1KFKB 5D1NA 1KI7A 2Q5FA 4O4LA 2VDJA 3K6JA 1EX7A 3TRHA 1Y48E 3BBPA 1LLFA 1RCTE 2XSZA 2HU7A 2ZTHA 4JVLA 2ONCA 3AEZA 4CV1A 4CKCA 1YR6A 3H2GA 4HHEA 4B9EA 1D6JA 1W47A 2X5NA 3INRA 5EP3A 1ESEA 3B9PA 4HUQA 1JH8A 4BZXA 3WICA 1FZQA 1RKQA 3FNBA 5CBKA 3S8EA 4QEDA 4CQLA 2YKGA 1EFLA 2NSLA 2PLNA 1NVXQ 4K9OA 2J6HA 4AN1A 2B5OA 3K5IA 3JWEA 4JEMA 3UATA 4DW8A 4JQZA 4M9XA 3RVJA 1GZHB 4IV5A 4U7TB 5E7MA 1GDDA 1CUAA 4BAUA 5FI0B 4N3BA 1AVTA 3V1YA 3V7WA 3W3ZB 3DEFA 4EG1A 1PJ3A 3D1JA 5CLJA 1P7VA 3OZGA 5BW5A 1ZGJA 3UF0A 4OK6A 4I36A 1L5HA 3THXB 3RJTA 4EG4A 1LEHA 1VRCA 4LY3A 2OCKA 3QW2A 1PWXA 3CF4A 4FYIA 3QA9A 3QIVA 2CZGA 2Z08A 4LXXA 3WDMA 1M76A 4CL3A 5FH9A 1Z39A 1D2CA 4FOSA 1Z4OA 3PEEA 3ZGNA 4CF3A 1NXOA 1OZAA 2WU8A 3HUTA 3IJEB 4HDQB 4OHBA 1XA4A 1L8AA 2P3OA 5ENDA 4EB6A 4X24A 3UIEA 5EE5B 5K2OA 3ZZUA 4HDKA 1V2HE 1FBNA 2FXVA 3N05A 3LU1A 5EZQA 1YE5A 1C8VB 1Z56C 4R3NA 4XX0A 4J6FA 1C7FA 5DULA 1TVCA 5F77A 5AKLA 2A9KA 3PNVA 4GLJA 1JEYA 4AS1A 1B00A 1FNCA 3D6HA 4TVSA 3I73A 4HEQA 2F3UA 4MARA 3UVEA 1FTWA 3C0KA 4EHJA 5TQJA 3S8MA 1BXGB 3BEOA 2IHUA 3EQ8A 5F64A 4Q1VA 4GU5A 3VZPA 2EGHA 5IJ0A 5FUVA 1U7XA 1V3VA 2OCAA 2ZIAA 3A6JA 3DT8A 3N7AA 4LOAA 3ZEIA 1VCIA 2VHYA 2BMFA 4IJVA 4FE4A 1QCCA 1T34A 4YIHA 1GCGA 1N6RA 5KPDA 2MSEB 2VBCA 4G4JA 4HFNA 4ONEA 5I7WA 4AKGA 5FADA 1PFVA 1JR3D 2CW5A 5CVJA 2YZGA 2WHPA 5HKBA 5K4GA 4LBVA 1BCRB 3WYCA 3WIBA 2QIOA 4LG1A 5BSGA 1P4JA 3OFND 4AZ0B 4ED9A 5ES3A 2XCTB 1MJGA 4XWOA 3CY6A 4JLNA 4AG6A 4BEWA 1Z3CA 1TYDE 4BPBA 2R11A 3ZWCA 3TLJA 4DWOA 4ZEOA 1LK5A 1YBHA 2HU2A 3DFFA 4HB0A 4PRKA 1OYOA 3TEFA 3MWJA 1IU9A 4KMSA 2FKAA 1S3FA 2NO7A 1SFRA 5E9JA 3KZ1E 5HZGA 4KU4A 4QSMA 3V1TC 2GTPA 4JHXA 1GV1A 4GWGA 3W2GA 1YVRA 3M83A 1OPRA 1X8XA 1XP8A 2W2VA 3GBVA 3TZBA 4ZCPA 1NUAA 4PZZA 2H2AA 2QR5A 3WR5A 3LUBA 4C07A 2FETA 2IL1A 1QJCA 1UXJA 1HDRA 2VDOB 4NBKA 3VXKA 3H4VA 2DBYA 2AXQA 4QBTA 3ZIAD 3D0QA 3KYDA 1ISIA 4AS2A 1TTTA 4BQOA 4S1NA 4M9CA 2JLZA 2R9VA 2OP0A 4MP8A 3K9NA 1SKYB 1LX7A 3PI7A 3QX9A 4YRTA 3W6ZA 1ODLA 3KVRA 1K0FA 4M1MA 5IKPA 3NLLA 3OQPA 2HO5A 1B16A 2IYRA 3H1GA 5E6SA 1G8HA 2WFLB 4RV5A 3IGFA 2C0PA 3LLMA 4ZOAA 4MYTA 4DNFA 3EZ9A 3BKWA 2ZUDA 1FU7A 4DIFA 1WETA 2AFVA 1WZ2A 3O8OB 1T5BA 3LQQA 4HNQA 2C29D 2VHXA 4B3RB 1ECFA 4URHA 1E1YA 3HPRA 4IZIA 3GG2A 4JASB 5HXAA 1VLMA 4AI6A 4C87A 2RJNA 3DWIA 3C45A 1XTSA 1ZNWA 5AM3A 5DTJA 2BR3A 2ESRA 2GK6A 3H16A 1JYSA 5CXSA 1BU5A 1QFZA 3UOGA 3M6IA 2QNRA 3FPCA 3VPXA 2G3YA 1VDZA 5GZ6A 5M2QA 4N3NA 2FPSA 1GQQA 1NXXA 3MGKA 2A1UB 4PCLA 3LBAA 1W48A 4EECA 1QIEA 2AFIA 3G88A 1XZEA 1I6WA 1R9NA 3KZMA 2VZ9A 1C7QA 1P0PA 4YMWA 3U37A 5KYYA 2W2LA 2YHBA 3ONEA 2JHCA 3T41A 1PSDA 5B2EA 1IHDA 4L4UA 2QUKA 4XE5A 2J0VA 1B73A 3H8VA 3FDZB 4ND2A 3M4ZA 4RM3A 2IYNA 2BEVB 5TJHA 3JQDA 4FLMA 1MU0A 2M1ZA 3RTDA 2DR2A 2F43B 1ORDA 4QU0A 1RQPA 2HEIA 2O8NA 4PNPA 2A0UA 3GCXA 2ZUSA 4BNDA 4BNXA 5EFOA 4E03A 1E9AA 1M2VA 1Y8AA 2BFOA 4NBWA 1XCOA 4A6PA 1UXKA 4AO7A 4FINA 3O3MB 5EJ9A 5IMSA 1UEIA 2WNHA 5L3SB 1YRQA 5FWYA 3Q2OA 1NR1A 3LRPA 4EGJA 4UEOA 1PL0A 2QRQA 1XE3A 5FCDA 3RVOA 3BUSA 3FOZA 4WNIA 2GEKA 3GZJA 3BXOA 4ZEXA 4XJTA 3RFCA 1OILA 3UYLA 1R6TA 2HLHA 2QD2A 3QWIA 1LV7A 4GPEA 5HUHA 1ZJ4A 2NUBA 2VBGA 4HATA 1ZC3A 2H4HA 3Q7RA 4Q7LA 3NJ4A 2FQYA 2IVFA 1JNXX 1OLXB 1TYZA 5CIQA 5CTJA 5BN4B 1UJMA 5FPQA 4UNRA 4GL2A 3FLAA 4L72A 3UC5A 3P96A 5DTMA 5IP5A 1HC7A 1BEEA 3HNRA 2YWFA 2RGNC 3H5RA 4PINA 3V97A 1QCZA 4BVJA 3CVVA 3OC6A 3UCFA 1NTOA 3L0IB 4PC7A 3L6OO 3NEAA 1QNLA 3M6MD 1JL3A 2R8BA 1W581 4G6ZA 2PZJA 3GNLA 4DC0A 5G2OA 3BILA 1UBRS 1DJOA 3DF7A 3E15A 4K6FA 5BPFA 4MH0R 4LGVA 4CM8B 2R00C 3B6KA 3UPUA 3I61A 5EPOA 3WGGA 1MLDA 1DBWA 1G1MA 1QX3A 1U2SA 2BKLA 3HCFA 3HGTA 3WY9A 3MT7A 2P67A 1WVIA 5AH0A 3NTLA 4P32A 2HDNB 2YJNA 3GDOA 2ZRKA 4YROA 5G3ZA 3RUPA 5A04A 3GARA 1W0CA 3CH4B 2AG6A 1HYGA 2ZBUA 2W2OA 3KJNA 4TS9A 4YP7A 3MJ4A 4DG5A 1PLJA 3BHMA 4E5PA 2LCFA 5K8UA 2A9PA 2Y0CA 1G5IA 2J31A 2QTGA 3HJHA 3RKUA 3BTOA 3QBTA 8OHMA 3NIGB 1BFDA 3HHEA 2R7KA 4UAVA 3W4JA 2DQSA 1VDMA 1JBKA 2CNOA 1DQNA 4I1IA 4RKWA 5B6PA 3UXYA 3UGKA 3X1MA 4DLXA 3B20A 3O9VA 4JL6A 5LP6C 2Q0SA 3SXUB 1NJ1A 2ZJ1A 2VDNB 1XSEA 4YJ3B 4F11A 4MPPA 3FF4A 2VJBA 4EPVA 3EIOA 3L9WA 3KUDA 4JB0A 1FXSA 2IHBA 3H9JA 1SH7A 4HCJA 1PG0A 4MKIA 3C4VA 1L6IA 1N1DA 2RAFA 3G13A 4NFYA 4TLDA 5ILGA 4A92A 4BLPA 1GGNA 5LQAA 4R81A 3TB4A 3BD9A 5B6JA 2IW3A 1Y0BA 2EF1A 3P9RA 3PRJA 3GLHE 4WY2A 4RDXA 2I76A 3D3QA 1ACLA 1E7MA 4EJMA 2QAJA 1JR6A 2FEOA 2GSWA 4HPJB 3L92A 5AUQA 2X8BA 3H13A 3OCJA 4NBSA 1NW9B 4AJKA 2VRWA 4NBNA 1CY7A 5L7TA 2D0IA 4H0CA 4BTVA 2B82A 3SX4A 4BEBA 3MWYW 2O7RA 4CQJA 4OQFA 4Y98A 2PWZA 2A7QA 1SZDA 2XVMA 4OYLA 5JE8A 3URKA 4ZTUB 4YRQA 1XNGA 2IIBA 3KKOA 2DETA 3QWFA 4A0GA 3TG2A 1A4RA 5FPSA 2HJSA 5AM0A 2IY9A 3U81A 3KBOA 2GKGA 4L85A 1G64A 3I2HA 3M7IA 1DDIA 1MNQA 2J4DA 3KSRA 1WB6A 1MX5A 1J0CA 5ALIA 2N46A 3MAGA 3T7SA 4B3TB 2EFCB 4L08A 4K9QA 2BRUC 2GM5A 4BJHB 2AN1A 3EIUA 4OMUA 3U62A 2IX3A 1K08A 3P9CA 2P90A 5BXQC 4BLUA 1XWIA 2A9JA 2IYFA 4NJMB 3MELA 2FZ5A 4IL5A 3HWSA 3FCYA 4YCCA 4PG5A 4QQ8A 1OVMA 4NYMQ 4GI3A 4L8VA 1CE8B 1T5HX 3B3JA 3KLNA 1MN6A 5EFZA 1U04A 3IT3A 2D1YA 3LLUA 5HNKA 2IS2A 1FRNA 4R40A 1JILA 4EKEA 2FF5A 1EZZA 2MIIA 5INTA 4XUCA 3EEQA 3D8RA 3KWMA 1QYIA 1GPKA 4R68A 3FM9A 3REOA 5JCOC 1AQNA 4G67A 4AUNA 3HVRA 1CP2A 1QNFA 2JFFA 2ZVQX 3BM5A 1RC1A 5ULLA 3KPWA 3IMGA 4QEKA 3HDQA 1OAAA 5JPCA 1ZEMA 2EJUA 3PFHA 4X6UA 3WO1A 3EXIA 3AEUB 1QLJA 3KOXA 2XVYA 3CT6A 5FR2A 5BQOA 3SGLA 1XTJA 2IYPA 3Q3VA 3ILXA 3ESQA 4X91A 5FA6A 3WLNA 3ZTTA 1CP3A 1Y9JA 4PFJA 5DNVA 1FQOA 3VKFA 3MBOA 1E3EA 4ZYWA 2BBTA 2F9MA 3O92A 3DR3A 3F67A 4X95A 4QBGB 1H0SA 2A94A 3NWJA 1UPTA 2ZYAA 3PPXA 5EUBA 4R16A 1GPJA 1VPVA 4MYDA 2MYPA 4WLOA 4JYPA 1YSCA 3MCAA 4RVOA 4UNSA 4BDSA 2EKLA 3NTVA 1JFVA 1F06A 3KQOA 1JR4A 1J8MF 4PC3A 1XKQA 5TF4A 1Q15A 1STOA 2QPLA 3KEFA 5DK4A 4QXPA 4TWJA 4ENWA 5BWLA 3IRVA 4BB6A 1WWKA 3V2UA 4G25A 4MVJH 3QUTA 3KPUA 3OCXA 1MD9A 2D3TA 1OC2A 2HF7A 3OWHA 4I4CA 4ZPXA 3FMPB 3DOIA 1Z8NA 4GPZA 4QARA 1NQWA 2O0MA 4TWIA 5B4VA 2GM3A 3O8LA 2VIIA 3C3AA 4HDNA 5TSDA 4L9SA 3OHSX 1R4AA 1PKEA 1VECA 5AVVA 2PR2A 3G0CA 3R5JA 1PV4A 3IB3A 3KB8A 4OXIA 1QU2A 1UPXA 4JJ7A 3RRBA 1NF9A 3ZN2A 1XR3A 2MMCA 3F1KA 3OG9A 4LJ7A 1L8QA 2X77A 3PC2A 1L7OA 4ND6A 2BP7A 4R01A 3RVKA 4Z3KA 3VHQA 1YBMA 1VKJA 1V8FA 1XRRA 4K7JA 1V7PC 2HWKA 1JJ7A 4EMUA 4URFA 2V3VA 1TLLA 4Q1AA 2C8VA 3Q7SA 1JKFA 3ETJA 2O14A 3N28A 3PUJA 3SI7A 3TQIA 3OIDA 5KHLB 1YGPA 1JFLA 1M8FA 1UJ6A 1GG2A 2AMYA 1T2CA 4EB8A 4KGVA 4ALIA 2YYYA 2AC7A 4WI1A 2C4HA 1NVGA 2I2AA 1FRFS 2Y4NA 3H84A 2COUA 3OLXA 1TT5A 1YCDA 2JFWA 2QTNA 4GUDA 4U9HS 5CNKA 2QHXA 1CRQA 4XWTA 121PA 2VWQA 3THYA 4GYJA 3V5NA 4LZJA 4M0DA 3UNXA 3K1JA 3DLCA 2EP8A 3B38A 3A11A 1ICEA 1MMFB 3C7TA 4DWVA 5IUJC 3TIXB 2LKCA 1CYEA 3AOEA 1VCHA 4YAJA 2BGTA 2XDWA 3P19A 4FEEA 3DD1A 2HHCA 3W6PA 2C61A 1JNYA