1VLHA

Crystal structure of phosphopantetheine adenylyltransferase (tm0741) from thermotoga maritima at 2.20 a resolution
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
157
structure length
157
Chain Sequence
MKAVYPGSFDPITLGHVDIIKRALSIFDELVVLVTENPRKKCMFTLEERKKLIEEVLSDLDGVKVDVHHGLLVDYLKKHGIKVLVRGLRAVTDYEYELQMALANKKLYSDLETVFLIASEKFSFISSSLVKEVALYGGDVTEWVPPEVARALNEKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phosphopantetheine adenylyltransferase
publication title Crystal structure of Phosphopantetheine adenylyltransferase (TM0741) from Thermotoga maritima at 2.20 A resolution
rcsb
source organism Thermotoga maritima
total genus 50
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1vlhA00
2E89A 1G8GA 1NI5A 1N2EA 1EFVA 3ND7A 4NZPA 2A1TR 2PZAA 4J75A 1YUNA 2A1TS 2DPLA 4GRIA 1H3EA 4NAHA 3P52A 1N77A 4I6JA 5J59A 1KQNA 3IOBA 5F23A 4NDAA 1QTQA 1MJHA 1X6VA 3QE4A 2A1UA 1KH3A 3TQOA 3MLBA 3GUZA 3D6UA 3FG9A 2EJCA 1G8FA 3AIIA 3A4IA 2CYBA 4OJMX 1OWPA 3MLAA 1N1DA 3D6VA 3IMEA 3N05A 3CVYA 3GLVA 2YWCA 1QRSA 3KFLA 1LW7A 3RK1A 3IOCA 1LI5A 1O94D 3N8HA 4DJAA 1FYDA 1EE1A 1T9GS 1COZA 4ND7A 4AQ7A 4MW4A 1QRUA 3MUEA 4MLPA 3HGMA 3VRHA 2O5RA 1DNPA 1TYCA 5DASA 1G8HA 2X1LA 1XNJA 1M1ZA 1EFPB 3AG6A 1P7PA 4PBSA 4MW7A 3SEQA 3FH0A 5IHXA 1WJGA 1IRXA 4X0EA 3X1MA 4DE5A 2J4DA 1K92A 3N2YA 1PFUA 3M5WA 2DLCX 4MQ6A 1GZUA 5HUHA 3FNRA 4UZFA 1GN8A 3VGJA 1TEZA 4F4HA 1YIDA 5H16A 2J07A 3CVUA 1XJQA 1N3LA 3IUEA 1BS2A 3L93A 1QU3A 3ZJVA 4P2BA 3Q4GA 1U3DA 2PG3A 1QJCA 2I1LA 1O95C 2QJOA 4RPIA 2IP1A 1OWLA 4MW1A 4PY2A 1N75A 1I6LA 1WXFA 1EUQA 1KORA 3HMQA 1F7UA 4WSOA 2CV1A 2OV4A 3BL5A 5HG0A 4ZCPA 3HV0A 4KPUA 4HK4A 2YY5A 4JFAA 4ZT2A 1TYBE 1WXHA 3IMGA 5DEOA 3ISJA 2DXIA 4PBRA 3SP1A 1SURA 1EFVB 1YUMA 3QTTA 3AL0C 2NSYA 1ZUNA 4MUFA 4UZEA 4I6EA 2QUKA 4MAFA 3FWKA 4XFJA 4QBTA 4MWCA 1WOYA 3CLUC 3CVVA 4DLPA 3P0IA 1N2HA 3CVXA 1VBMA 1WKBA 3ZIUA 1WXEA 2A1UB 2A88A 4MW9A 2JAXA 2D54A 3NV7A 1O94C 3SDBA 5J5AA 2DERA 1UFVA 2BTEA 3MMXA 3KT8A 4K03A 4A91A 2O8VA 3A2KA 3LE8A 4R2MA 5KWVA 1JZQA 2JA2A 4CDMA 1NUQA 1I2DA 2AZXA 1QNFA 4OUDA 2HZ7A 1QU2A 1WXIA 3ZGZA 1M8GA 2D13A 4DNXA 1JEDA 2J08A 2NZ2A 3FOCA 5TEWA 3LCJA 4WNYA 1JIJA 1OWOA 3K9WA 3DPIA 2EL7A 1YI8A 5J58A 2CSXA 1IHOA 3DV2A 5TEVA 2RE8A 1EXDA 2A84A 3RFFA 4MWBA 1ULHA 1F7VA 3AKZA 3FY4A 1WQ4A 4JYZA 3H05A 3P0JA 1IFXA 4YP5A 3SYTA 2DEUA 2J09A 4MVCA 2PFSA 3MXTA 3ND6A 5H7XA 1PG2A 5BNZA 3ZJTA 3C8ZA 2WB2A 3ZXIA 1Q15A 4ZCRA 2PIDA 1J21A 2QUIA 2CV0A 1J70A 1J09A 1Q11A 1NUTA 3IMCA 1YIAA 3FETA 2E21A 4F3RA 2Z08A 1N2OA 2CFOA 3CLSD 3UY4A 1MB2A 3LOQA 1OWMA 3ELBA 3ZJUA 1OBCA 4KR6A 4EG1A 2IJGX 1CT9A 3PNBA 2A86A 3P0HA 2IELA 1JEEA 3NBAA 3H9CA 1VBNA 3CVWA 4HPWA 1QRTA 2ZUFA 4EG8A 1IVSA 2E0IA 3HZRA 1H1TA 1NUPA 4NAUA 3S3TA 4EFKA 2X0KA 1MOPA 3HFJA 3GMIA 5KCMA 2YWBA 4ZT6A 1NP7A 4QREA 1NURA 1FFYA 1WY5A 1TFUA 2XRYA 2YXNA 1N2GA 4HJXA 1V8FA 4EGAA 4PBTA 4MUGA 1XNGA 4KKVA 3IOEA 4YP6A 4MULA 2AKEA 1MAWA 2ZP1A 3FI0A 1I6KA 4AS1A 1K4MA 2QUHA 3KT6A 4I6GA 4YBRA 1Q77A 4EG5A 4ZT3A 3SEZA 4JXXA 3KT0A 1OD6A 1ZH0A 3CLRD 4Q93A 1NZJA 3AFHA 1IQUA 4MVWA 2PXHA 1O0CA 2GM3A 2B7LA 1O5TA 4L2IA 3TS1A 1EJ2A 2BYTA 2GKSA 3X1KA 4ARCA 1X8XA 2D5BA 3FDXA 3IH5A 4DDMA 1PFYA 1R6UA 2V0CA 1H3FA 3OP1A 2HMAA 1KQPA 3PXUA 4R0NA 1N78A 5DK4A 4RUKA 1MB9A 4S1OA 4E1AA 2H2AA 1WZ2A 1R6XA 3FIUA 1N2JA 1T6XA 3IUBA 4ARIA 5LLTA 3UOWA 4U8HA 4MW0A 3AG5A 2CYCA 2RD2A 1TYDE 5FO0A 3UMVA 4DDKA 2VTBA 4MW6A 3CLSC 2Z09A 4G5YA 2A7XA 3IVCA 1JHDA 2GOYA 4MVYA 3COVA 4FZJA 1MC1A 1T6YA 5KHAA 1JMVA 4G5FA 1M8PA 5HUJA 2PZBA 4ZCQA 1NYLA 2QUJA 5LFAA 1M8FA 2QTNA 3PNVA 3RJZA 3KT3A 4NX2A 3RBAA 5K0TA 1J1UA 3VU8A 2R5WA 1KP2A 4MWEA 5EKDA 3TZEA 4YP7A 1QQTA 1Q19A 1HYBA 4EG7A 2WQ7A 1RQGA 1JIKA 1VL2A 1O6BA 1R6TA 2TS1A 3H99A 3G6KA 3ILVA 1M83A 4MUNA 3PNYA 3H97A 4MUKA 4MW5A 2DR2A 3CA8A 2XRZA 1M8JA 5FNZA 1O96A 2ZUEA 3JXEA 1J20A 1M8KA 1N2IA 1OWNA 3H9BA 1PFVA 4MW2A 4KR9A 1LI7A 3K32A 1NSYA 1VLHA 4JZYA 4MUJA 1U0BB 1IH8A 3UK2A 1K4KA 4XSVA 1PG0A 4JXZA 1H3NA 4ZCSA 1O97D 3UC5A 1KH1A 2QTRA 1TQ8A 3IVGA 3CLRC 2CT8A 1JZSA 1K97A 1KAQA 3Q12A 2E18A 3IVXA 3CLUD 4MUEA 4H3SA 4QRDA 2X1MA 4CQNA 1GPMA 1VBKA 5IJXA 1TYAE 4R2LA 1KP3A 2X3FA 1KR2A 4KPUB 1T9GR 3CR8A 2Z3VA 3CLTD 5DB4A 1A8HA 1KAMA 3TZLA 1D2RA 5TGTA 1MRZA 3A04A 5TS2A 1MBZA 2J5BA 1OBHA 1ZH6A 3ND5A 1J1ZA 2WQ6A 3E27A 4L2IB 2QTMA 1IQRA 4ZT5A 3ZUGA 1NUUA 2H29A 3HL4A 4ZCTA 3DLAA 5K0SA 1KQOA 1U3CA 4ZT4A 3RK0A 1U7XA 4NATA 4XFDA 5JBNA 4KR7A 1EUYA 1PFWA 2A4MA 1IQ0A 3RHSA 4EG3A 1B6TA 3L92A 4ZT7A 4MWDA 1JIIA 1KH2A 1NUSA 2AG6A 1T6ZA 2VXOA 4MVXA 3X1JA 2CV2A 1O0BA 1N2BA 1U7DA 2VTBB 4EG6A 4OUDB 1WXGA 3G5AA 1F4LA 4U63A 2OQ2A 5LM3A 3Q10A 1EFPA 4U7JA 2HGZA 2WSIA 2CUZA 4ND6A 3FHJA 1JECA 3A05A 1V47A 3F3MA 1JILA 3I05A 3IODA 1YULA 1JGTA 5AHWA 4MUHA 3COYA 1XNHA 1KKUA 3N9IA 3INNA 1ILEA 1ZJWA 1GLNA 2C5SA 2JANA 1WQ3A 4J76A 2CYAA 4CDNA 2QJTA 2DETA 3G59A 1GAXA 1S4MA 3QTBA 1MAUA 1O97C 3PRHA 3DO8A 3SZ3A 4CT0A 1O96B 3IDFA 4GU5A 2DUMA 4K0RA 3COZA 2QJFA 3TQIA 4BWVA 4TS1A 4EG4A 1G59A 3NBKA 3ZXSA 4Q16A 4DDHA 2G36A 2PZ8A 4EF6A 3COWA 1GTRA 3CLTC 4YMIA 3U1VA 3SZGA 2V0GA 1F9AA 4G6ZA 1O95D 1I6MA 4MUIA 1Y42X 1GTSA 5FO1A 3TNJA 4HJRA 3OTWA
chains in the Genus database with same CATH superfamily
2PANA 3GG9A 1XEWY 2W6IA 3IR7A 2LTAA 4PAWA 5DGIA 1A4XA 2ZSEA 3VZPA 1DBRA 4KWEA 4B6FA 3H6GA 4YRMA 1YGPA 2ZXUA 2DY1A 1LJ8A 2G1PA 1N3IA 4B3CA 4L72A 3CZ9A 2PT7A 4W7HA 1T1GA 2OO5C 3CO0S 3Q1KA 3IP1A 1Q7CA 5IYZF 5NLLA 4TRNA 4BN0A 1CY6A 1PNTA 2I7CA 2Q6OA 1GCGA 1ABFA 2CVFA 3GEEA 3F5FA 4HEHA 4LMRA 2RHTA 5EJ9A 4XEUA 2XUPA 5AKKA 3N2KA 1QGUA 4LTNA 2N46A 1EWTA 3QX3A 3FTEA 3JQBC 4Q4JA 4DLWA 4Y9TA 4ZEMA 3U44B 2CHQA 1V11B 2W2LA 5FLYA 2I33A 2CYBA 3REOA 1FTNA 2FY8A 1X9IA 1A5SB 5FOVA 1MHPA 1QHHB 1QYCA 3F1KA 4XSHA 3FZNA 3M6IA 3OZUA 3K9CA 3OQJA 5FP0A 3W5IA 1OA1A 3CVYA 2WWYA 1L5QA 5IVPA 2WG2A 4EPXA 3KFLA 2Q5IA 2WNSA 4BRZA 2VDNB 4AJLA 4F8YA 3A36A 4QYMA 1MQAA 2DWOA 3AEUA 2K5UA 4F45A 1B23P 2EWMA 4WDRA 5JAIA 2JHFA 2X8JB 5IFLA 1EE1A 2COUA 1COZA 2HF9A 4AQ7A 3HA5A 3HJHA 4ZYZA 1JAXA 1ZSVA 2DM6A 4MV8A 2NU9A 4UDNA 1OI7A 4GPBA 5A3SA 4COOA 1PJ4A 2FW9A 3LTEA 5ITWA 4ZOAA 2EQ5A 3EUFA 4ZO4A 2P2CA 4BPBA 5GZ1A 3OQBA 2OXIA 4WKOA 4QPDA 1AGYA 1G0NA 1M0TA 3EZNA 2YTZA 2V55B 3FVTA 4LJ8A 5EYPA 4YCSA 2ECOA 3SEQA 2WYIA 2ZJOA 1K66A 3F74A 4QULA 5AHRA 4F2DA 3SC2A 1NQTA 4KDCA 2O5CA 2BFFB 1RCFA 3M5WA 3LRXA 1FFBA 2RGWA 1OFIA 3UYLA 2FUCA 2NQ2C 4KB5A 5JCXA 4GR5A 1NT4A 1U6IA 1E9FA 4NE7A 1T34A 3R0XA 2DT8A 4UFNA 1FXUA 1O8BA 4ZOLB 1A3CA 1BN6A 2A7QA 2W98A 3IV6A 4UCXA 4YFYA 4JB2A 5LQSA 4ENTA 1AJEA 4TXLA 2PSHA 1UPAA 2V4ZA 3E22A 3KYCB 5CVEA 5K2MA 2X4IA 16PKA 4KXFB 1T1JA 5KWJA 1BMDA 1O95C 1RHUA 4FQ5A 4A27A 5JC1A 2C04A 4MW1A 1YFZA 1U8FO 3EVNA 3ZLTA 4R0MA 3I2KA 4PHHA 1B6SA 1MR3F 2GK4A 1U7WA 1N75A 3IDSA 3OCVA 3TL3A 4JEIA 5G40A 2E1PA 4YT8A 1BHJA 2R7KA 1Y89A 3TLXA 4AZWA 2JK0A 3G9QA 4NXMB 3TAHA 5ALNA 4OLAA 5HRAA 3PR2B 1NV9A 2DUJA 2GLTA 3DP7A 3UWPA 3WLPA 3ZHZA 3VC3A 2WFLA 2WB4A 2B99A 5DM1A 5J2TA 4D96A 2CL5A 1SXJB 2LBPA 3ZJ5A 4B31A 1FMTA 1NXVA 5E2AA 5F5NA 3ZNPA 5BQ5A 4BWFB 3EDYA 4P2GA 4EVSA 3CWCA 5KTKA 3D9QX 2BBOA 1K2WA 1UOOA 4WCFC 5C1IA 1EMDA 3QF4B 3UCFA 4KQXA 5DEOA 2NACA 3NM4A 3QEAZ 1G64A 1XBTA 3ISJA 4LZAA 2DU8A 4QUBA 2JGNA 4NVRA 5FA8A 1ZOOA 3LQFA 4CF7A 1SOMA 2GFHA 3GUCA 3NALA 3H9JA 5JAHA 1W0CA 3AUKA 4FUQA 4CEJA 4RH3A 3UMSA 4M53A 4HQFA 1YL6A 2P4UA 4RVSA 3E3AA 2FWNA 5JSUA 4CWAA 2C07A 3CH4B 4DV6B 2R00C 3FWKA 1IB0A 3BBLA 3PWTA 4XFJA 3I9V6 1RI4A 3JYOA 4DLPA 1MDBA 4L73A 5BR8B 5FBKA 3CVXA 5B4TA 4H0FA 1TUGA 3ZD8A 3ZIUA 4WH0A 2A1UB 4A8JC 3DR5A 5K05A 4BEBA 1O94C 3REQB 3WYDA 5I51A 4MGEA 1Y6QA 5IEJA 2Z0MA 3GLIA 2EGGA 1TCAA 3EXHB 3INTA 4FYWA 4EPWA 4OD0A 3SIPA 1GA1A 3H13A 3C87A 4E5DA 5JMPA 1QGYA 3R4CA 4PLWA 3LW7A 1LJLA 2BFBA 2ZETA 4BRUA 4E5YA 3HZZA 1I2DA 1Y63A 3PHCA 2PZGA 3KQUA 1RWXA 5FI5A 3WWZA 4MIEA 1SH7A 2C77A 4G26A 3KQMA 1F2TA 5FRDA 4NC9A 5BSMA 2H4YA 5IDXA 2GSWA 3GEHA 4KC0A 2PWPA 4NE2A 1M8GA 2IYRA 3DGFC 4TN5A 3H04A 1KQFA 4J29A 1MIOB 1VPDA 3L6DA 4GBMA 1EP2B 4O2AA 5JG7A 1GZSA 1WB6A 2RK6A 5CVUA 1JIJA 2GARA 3JD3A 3ZW8A 2HDNB 4EYSA 4E6EA 4JP2A 1F9EA 2QS9A 1ECLA 4OLFA 5CIWA 5IVKA 5CPBA 1DRWA 2IU4A 6CHYA 4U7DA 3K09A 5T6MA 2CSXA 5DPMA 5U1PA 1IHOA 1P4HA 2BDTA 2IEIA 1WCIB 1GPH1 2VNHA 3DV2A 1BJRE 1NATA 3K96A 4J2OA 2QORA 5EVJA 2D0DA 5BOSA 2C4NA 4HFNA 4JI6B 1X8JA 1J0CA 1J8FA 3QKSA 2QQEA 3AKDA 5THQA 3VXKA 5AVVA 1F7VA 3QPVA 4JYZA 1E3TA 1PS8A 4OYHA 1W8DA 1WNTA 2PSDA 3Q8XB 1WCXA 4DGSA 1NW8A 3SYTA 5AQ1A 3GLIE 3LZ6A 3OT1A 2PFSA 4L22A 1EP9A 1XDBA 1R2QA 3EHDA 1GEEA 4R31A 3OPMA 1QH1A 5D5QA 4HGPA 3HJFA 2I76A 2GTIA 5HTOA 2BFEB 2NT4A 2RJNA 1L5LA 5AHOA 4C7JA 1QRRA 4IZHA 4R9NA 2R6CA 3GZJA 4FPXA 3L5KA 2EBFX 1D6SA 2O4UX 4IHQA 3TIGA 3WLNA 3G0OA 5KEIA 4EJSB 1VE5A 3ROGA 2WF6A 2PH5A 2VDLB 1GKYA 3LJKA 1DZIA 4PX5A 4TL6A 3DOFA 3B6EA 4YMWA 1IZ9A 2UV8A 3V00A 3R3UA 5JXGA 3HJUA 5I4CA 1BROA 3RFCA 1BX1A 1MB2A 3SYNA 1I1QB 4JOQA 5IJ9A 3DJFA 4X92A 1SB9A 1QIFA 3ZQ4A 4Z4CA 3ZWOA 1W9HA 2GR9A 4ESEA 1GAXA 4TYNA 2A86A 1EQAA 4DTIA 1Z3IX 3JU3A 1JWAB 1JYSA 1XIVA 3VOTA 5DISB 3ZGVA 3ZWVA 2EFEB 1RXVA 3L0DA 5JS7A 2NO9A 1NBHA 1MTOA 3CVWA 3RAGA 1U9JA 1MENA 4HPJB 2WU1A 2E0IA 7ABPA 3AR6A 5EWLB 1T35A 5IASA 5JQGB 2VHUA 1WHTB 5FWAA 4E51A 3GK3A 3HFJA 2Q6VA 5G02A 5B7QA 4C01A 2BZSA 2FDCA 4D9BA 3R8XA 1SU4A 3OP4A 4IDFA 4EHLA 1V5FA 3QFHA 2PIAA 4FE7A 4WWHA 5KVVA 3FHCB 1ESCA 1QTIA 2I03A 2DH5A 3FKSD 4FMDF 4BBJA 4KFUA 2CK3A 1S96A 1OX5A 2JHAA 3F78A 5E6SB 3S2GA 3ABQB 4ZI3A 2ZP1A 5KPJA 5AXBA 4AP9A 1E2LA 1RWQA 3NGMA 5ESXA 1XTSA 5JJCA 3PC6A 2H0AA 2N42A 2C9OA 3GQBB 4JITA 2ZS7A 1XTJA 3AFNA 3EC7A 5JSQA 3JWEA 1UJNA 4DCNA 1CHDA 1KZ6A 4JX9A 2H54A 3K20A 5CDGA 4Q5IA 3WWOA 2NV2B 3IB3A 1GPDG 2ILVA 1NVBA 1KZHA 4WRRA 1SCBA 2PXHA 3LF1A 1SUWA 1JDNA 4Q7JB 1IY2A 1U3GA 1L7XA 2AG1A 4LXHA 1LI4A 2WJAA 3NM5A 1YE5A 3HE3A 5IBRA 3RTCA 5I3CA 5JPIA 1J6UA 4CMHA 1PUJA 5BXQC 2P5UA 1QQBA 1QYDA 1T8YA 5I7UA 1POXA 1RQPA 2P0YA 1SHZA 4I55B 1QFJA 2WE7A 3RANA 3SXUA 2FNAA 2LPMA 1K6XA 5D7NA 5E2IA 3VGPA 5KSYA 5EL0A 1N2JA 1ONBA 2PBRA 4HOYA 4HRAA 4LV8B 4O63O 2IEDA 2IQ5A 3E3NA 2ZVQX 1Y8AA 3TGPA 1ZZGA 2W6MA 2WJGA 2XX3A 1OJLA 1CZUA 2C59A 3O0DA 3LLVA 2H6EA 4JHLA 2EKDA 3ITEA 3U61B 4LAFA 3IHLA 3UJBA 1MB4A 3C3KA 3AERB 3AMVA 2GZMA 4DV5B 4XUGB 4N8EA 3GT4A 3UMVA 4AQDA 4F8EA 4XPZA 1OOEA 2OG1A 4HKTA 4R9SA 4D8XA 3T3DA 1KWGA 3A4TA 4YEDA 5D51S 5D3QA 1QQ5A 4KWHA 1IZ7A 1NKVA 4Y6PA 4DZRA 4E1VA 3S2YA 3WX0A 5F5LA 5KSWB 1EDZA 3MB5A 1JNYA 3DAYA 3AF2A 5FQNA 4E21A 4YA6A 4ZQCB 3KK0A 3BFJA 3J81A 1MJ5A 4KWCA 3RC8A 1TJ3A 2XKAA 4JLPA 4K3UA 5JXHA 4GKJB 2P0AA 1KP2A 3WK8A 721PA 2WF9A 2VP4A 1Q3TA 3PX7A 4OJKA 2VDVE 2H1OA 3BZBA 1SIUA 2Q49A 1A0OA 3GEDA 1QONA 3UGQA 3KQYA 1E32A 4LF5B 1WZIA 4MUNA 4RA9B 3V1KA 3JYNA 1YL7A 4MYTA 3CE6A 3UVEA 1MH9A 5FNZA 3V7YA 3N2GB 2AJBA 3LO8A 3THWB 3C3EA 1NN3A 2B1IA 3BD8A 2B4QA 1UDAA 4MW2A 1MV8A 4POAA 1ZUHA 1VIDA 2QXTA 2R6R1 1SOAA 2WJ4A 2WUDA 1IH8A 3AB7A 3AEYA 4J4TA 3U7EB 4JJKA 1ECFA 3G7SA 3G89A 4GS5A 1VE6A 5AKYA 1SAYA 1RYDA 1X7YA 3QKRA 2ERXA 2ZUSA 2CVOA 2ZVDA 3U39A 3W34A 3ETNA 1K0UA 1W2WB 3IHTA 4TSKA 4QQKA 3GJ4A 4DIUA 2EX4A 3QBDA 1QC5B 4J0DA 4ZAYA 1AZWA 1AQLA 1LRLA 1F2VA 2JGEA 3IT3A 3LL7A 4H3SA 1PI3A 2I4MA 4IF6A 2HWXA 3UB2A 3ZV5A 2X1MA 4E14A 4CQNA 3FUXA 3IULA 3NW9A 4R1LA 1QNLA 4ZEWA 5LDGA 2EBHX 1KR2A 2OHVA 4BP9A 5LVAA 4KPUB 1KI7A 5AJXA 1H0RA 4W8OA 3Q5DA 2YZNA 4GSKA 2IBSA 1C1HA 8ATCA 1QK4A 3W05A 1D2RA 4B7XA 1Z0IA 5GGXA 1JV2B 3VZBA 4JUDX 3W6UA 5HK9A 2IYYA 3WK5A 1VP9A 2ICAA 1HR0B 4H0NA 1YASA 3G2IA 3ND5A 1PZHA 5F9MA 4JIGA 4WKBA 5A9RA 1ONPA 2XSZD 5LMNB 3VJLA 3T5AA 1DV1A 2X0DA 4JV5B 4Q05A 3LYLA 2R8RA 3JWJA 3KZOA 3LP6A 3OY7A 4RGQA 3O31A 5TVGA 2QNIA 3T61A 3UFXA 3G0HA 4ID3A 1ZGZA 3U4HA 1E2FA 1GG5A 4Q9IA 4C9BA 1W75A 1P0QA 1WHSB 2I3GA 3DL7A 3FJYA 3WZ2A 4BVHA 2Y27A 3HXPA 3DE2X 1WUHS 3GCWA 1PVVA 2XQJA 3L7IA 4MQBA 4D0SA 1CUYA 3EXAA 5DXFA 2CB0A 3B13B 1PR5A 4MA4A 3FPHA 4BZQA 4ZT7A 1MFZA 3Q41A 3OKCA 1PW7A 3HN2A 3VNAA 1YQXA 2AG6A 2G83A 2VXOA 3ZKWA 1LX7A 2CV2A 2DHQA 2PSEA 2VJOA 1QYXA 1SUIA 4RADA 5EN4A 5AW4A 2PX0A 2G7ZA 3D3EA 3D6MA 3PFCA 4FN4A 1Z0UA 2DRIA 1ZMBA 3NBQA 5GV8A 3IKTA 2OWDA 4CF5A 5FTJA 1EFPA 2CD7A 2J3MA 4BNGA 4UU8A 3OIYA 3MCTA 2CUZA 1Y1SA 5TQ2B 4C4RA 4ZMRA 3RLFA 3UENA 5CMLA 1SXGA 4GZ6A 4UDOA 1USIA 2CNWD 3ECSA 4B9AA 3I05A 2OHFA 2IXAA 3PFNA 1GPYA 1FFDA 3CCBA 3PEYA 1KARA 3B38A 2FV8A 3DMFA 2HRRA 3NGXA 1IDOA 2HA5A 3JWGA 3PIDA 4J7UA 4CLRB 4E1BA 1ILEA 2DHCA 1QS0B 1YE3A 2AXPA 1YDGA 4QXAA 5JLAA 3UMCA 4E2WA 4Q7EA 2GEUA 1RPAA 1E7WA 1V7CA 2G9ZA 5J9FA 5TNXA 4Q4HA 4N03A 3CC8A 4IBOA 5CYPA 5CD9A 3K09C 4HZUA 5JALA 2PUHA 3D3JA 4JASB 1P2SA 4E4RA 5C5CA 4EUKA 3FNFA 4CUZA 1ZH8A 3EA0A 5JVDA 4RBNA 1UJBA 5B2FA 1P44A 3CGGA 1VZ2A 1A1VA 2CGEA 3TQCA 4EUEA 3L7MA 3KVYA 2P3LA 2VCYA 2VBFA 3AR9A 4REMA 3GHHA 4D0LB 1R10A 5J3JA 2HFJA 4K6GA 3K9HA 5EE5B 4KAJA 4J0JA 4WVFA 2X0EA 1L6IA 2V0GA 3VV2A 4NMHA 2VQFB 4G6ZA 4M86A 4Q9AA 4EVQA 3HUTA 2JA1A 3V4FA 4YN3A 4UCFA 2CBXA 4UAVA 1T9AA 1PWEA 3BVPA 4YC7A 4HJRA 3GIWA 3I0NA 1Z6GA 1WB9A 5DSTA 3E7XA 5F2EA 4FCTA 2D2IA 4RZQA 4YDHB 3HR7A 4CXMA 4LPKA 4N54A 1WEHA 2VNSA 2HNBA 3NONA 4GRIA 4ND8B 3K1JA 1LPAB 5C4IA 1HZJA 4BAZA 4Y2HA 2VHEA 2VPWA 3F6BX 5FL7D 1GITA 4XOUA 1N77A 1ZVVA 1H93A 2G07A 4DCMA 3HCEA 4DG5A 5F23A 4TL8A 1P4AA 2X5XA 1SU7A 2Y9MB 3NHBA 1HDEA 2XCTB 2ODBA 2H63A 5C0OE 1LTQA 1DAEA 3H5TA 4OXNA 5CLHA 2WAAA 4FDTA 4U2BA 1XRLA 2C2GA 4JBIA 5AT1A 4ND3A 3WBJA 2JCVA 3KR0A 5DI9A 4US0R 3H1TA 4X00A 1XZEA 2HF8A 1SVOA 4URFA 2UXCB 1U31A 2C1EA 2ZIXA 1E60A 4FYJA 1QGDA 4NP6A 2BFPA 2EGUA 3DTVB 2OGZA 3IMEA 4M8IA 3ZDAA 2HUPA 3TH5A 1KMHA 2YWCA 2AHOA 5TR9A 1XAHA 4Q9HA 3A1WA 4MYRA 2PM8A 2QRZA 2ZSBA 3AGPA 5CD1A 2Q3JA 2HYDA 3GYGA 2Z9CA 4FHEA 1VI2A 2FFHA 4RKEA 5AUPB 1Z0SA 5B2ZA 3B9QA 2O5RA 4TWRA 3KJQA 4WFJA 3Q3JB 5HTKA 3U19A 1PRYA 1QHGA 1Z2OX 1SA0B 3CF4A 4YK7A 2JHPA 3ZDYB 4REOA 4KHPB 4QL3A 4E3ZA 1KA9H 3MPOA 4GZ5A 1DC3A 1Q1ZA 4KQ1A 5H9WA 3FCUB 5KCZA 3GT7A 1RQ7A 2Z2ZA 4GR9A 1K7EB 5EZ5A 1VPEA 1P72A 5T4HA 2D1TA 4FR2A 3VAAA 1GNSA 4XYLA 1IRXA 5EIOA 2FPOA 2X42A 3FBTA 3GJ8A 3P2OA 1GA4A 2R8OA 5F33A 4GZ3A 1KRXA 3UXYA 3KEOA 2NU7A 1HQDA 3D2AA 3H5VA 3M7IA 3NTQA 3SFVA 4P0PB 3HXQA 3OX1A 3FNRA 5FPPA 3FFWA 4U3JB 4WGFA 2OV2A 2WWFA 3HB7A 3P4YA 3PG5A 2WP8J 3H8JA 4GE3A 3W6ZA 2WZQA 3FLAA 3A1FA 4YIKA 1KJ9A 4EAAA 2YWFA 1F60A 3JRNA 4C0AC 3I1FA 3C98A 5EC8A 3Q72A 1RJEA 3ZD6A 2ZFUA 3C6MA 2FKNA 5GOZA 4X93A 2Y1LA 1JJBA 3C3WA 1ZOLA 1X1EA 2ZTLA 5A9SB 4JSRA 4G23A 3EIFA 3N28A 1NNLA 4PR3A 4TMFA 1I6LA 4PC2A 1U80A 4RW0A 1U7PA 4PLGA 1ARZA 5H68A 4BXOB 2PGAA 4GMHA 3BIWA 1XWIA 4RORA 4MGKR 3JALA 3C3PA 3L9XA 2CDCA 3JW8A 2X3YA 3L0PA 1P4GA 3L7AA 4RMHA 5TVKA 4PN3A 5CA1B 3RT1A 3FSGA 4YRQA 1E5LA 1L3CA 3ZDZB 4CDGA 3HGTA 5D1HA 4IIFA 2EV9A 2JD2A 3MGBA 4AWBA 3M4JA 2UZ4A 3G8YA 1RQNA 5KWSA 5JS8A 4XQ9A 3TVYA 3KQKA 5KYUB 3I3OA 1OMOA 5CVDA 5CX4A 5B1YA 5AVOA 2B9VA 3FF4A 5FQOA 1I30A 2GCPA 3AQ4A 1ZUNA 3HS3A 1ZJ6A 4FCWA 5DNWA 3PRJA 5K8LA 3L84A 1G1MA 4BLUA 3LQKA 4DUGA 1BH2A 4L4UA 1O89A 3ANMA 2WPDA 4WEQA 5FBLB 3MD0A 2FPMA 4B4OA 1E7YA 3EH2A 2Z2XA 4QPJC 3GJXC 3KR9A 4HLUC 3ETCA 4NG5A 4JWTA 4X1KB 2OQIA 1XA0A 1E2NA 2GZAA 3KS9A 4BCDA 3TSWA 4FZ3A 5JANA 5LDDC 2HIHA 2GZDA 2IH2A 1K4YA 3FFBA 3GWZA 5IU6A 1KYTA 2XMRA 3OIFA 5LQUA 1G18A 3OSZA 3QXHA 5HZKA 5ECWA 4Z1MD 4NE9A 1ZWLA 5CGZA 1KHTA 1C4OA 4NYMQ 2AK2A 3PGKA 3DNPA 4R71A 4G1FA 4N49A 2E37A 1JU3A 4FT2A 4IXNA 4Y6LA 2Z6UA 2HEIA 3N3AC 2XYQA 4L8VA 1NP6A 2HZ7A 1UQRA 3RUDA 2B37A 5DBOA 1JIUA 1NJ5A 3C3DA 4TSFD 1QU2A 1ORHA 3TRKA 1IY8A 4RZ3A 1KBZA 5LL6P 4B09A 1FA9A 1RLJA 2D13A 3CKMA 4XWYA 1NN5A 4ZOBA 2Z5LA 4LY6A 1CUGA 5ALEA 2XADA 2ID9A 2A33A 1UXJA 3IFSA 3DDNA 3RS3A 2PGNA 4C5BA 4N3BA 1ZLXA 1MN6A 2P7IA 1S4QA 1V71A 4WBSA 3RR2A 4ZYWA 4KMOA 5K45A 2O7VA 5EMNA 4ZI5A 3G82C 1KDTA 5AM5A 1D4FA 2DHEA 4EQZA 3F4KA 5BN5B 1SBIA 3HMKA 3TE6A 5KTMA 2NP6A 3V2UA 2RE8A 4L7QA 4FB5A 1EXDA 1ORDA 1H8EA 4TTIA 1TTHA 2J85A 1FEZA 2QN8A 1AH2A 1EDBA 2HIMA 3GRZA 1XGKA 2OV6A 3P0JA 4NV3A 5DU2A 3S2ZA 1DKMA 3EOAI 1YZUA 4X66B 4I2NA 2G09A 2PUCA 5LYJB 5KQRA 5K4HA 2J9XB 3MUNA 1U3FA 2LXNA 2P9JA 1U8CB 3K5PA 2P5YA 4UBLA 1SCIA 2RIPA 2IQIA 5DK6A 4DLVA 4OB8A 1W9MA 1TADA 4G89A 4KKXB 3UQZA 4LJSA 3RSLA 3OPYA 1LPOA 1NDUA 1ODCA 1F8YA 3BFXA 4GICA 4RSHA 4E2XA 1LFAA 5BN4B 1FLDA 1DG3A 3EAFA 2D4AA 4E4TA 3AL3A 1QZZA 2G5TA 3GLHA 1GFWA 4JODA 1L7MA 2BGMA 1E5XA 3K0CA 1CPYA 4UVGA 2IDJA 4Q66C 2V1XA 4Y2QA 1NBAA 2GUWA 3AY6A 1R6VA 4ZPXA 4UHEA 3IKJA 2VRWA 4IJWA 2GXUA 2QN6A 2QB5A 2GASA 3GNTA 4JBGA 5JHGB 1G41A 1HORA 2NO1A 2PY6A 2ORWA 3LVRE 3OCWA 1XL1A 4LQLA 4R8MA 4V0RA 2O6LA 1XZ8A 2Q8QA 1HRDA 5KVQA 4EJ2A 3FDZA 1QRTA 2BSAA 2Q3BA 4Z9YA 1JN0A 1J2RA 5J43A 1NUPA 2BFCB 1YIOA 2R44A 4BUJA 4GR4A 3UHFA 5I8WA 3NATA 4KP7A 5KCMA 2OGSA 5J4HA 3A4NA 4OGKA 4Q7MB 4YGXB 3BB4A 5TXGA 1JLLA 2FPIA 1H0SA 3I01M 2X2PA 2ZR7A 2POQX 4IIUA 1CTQA 2BGIA 3MTAA 1TFUA 3L1UA 3FYCA 1N2GA 3Q2OA 2PMDA 3QYJA 4MTLA 4Y0VA 5KTNA 3ADBA 3FIJA 4JL5A 1Y7HA 2O2CA 4KN9S 4RF4A 3WYBA 4KSBA 4B82A 4CV3A 2XGJA 2JLZA 1AG9A 4AS1A 4OHZA 3IAAA 4TYWA 5DSZA 1ZSNA 2RHHA 4IXDA 2ADOA 3GLHE 2A5LA 4OHCA 5DIZA 4MINA 2B1GA 2ODEA 3M4NA 4OYLA 4DUZB 2W0SA 4TQGA 1J33A 2OE2A 5SZJA 2C8JA 4FSDA 4EMTA 3H2YA 2BF7A 2AWOA 3EDOA 3TSYA 3EFOB 3H9QA 3HHEA 3RASA 2Y92A 1WDLA 2ECQA 4RJJA 1NW7A 3KSZO 1S5PA 4LRWA 2WIKA 4JUCA 1X13A 4QU8A 4I9HA 2B7LA 4FP9A 3SLRA 2W22A 1B0AA 4L2IA 3KIPA 1H2YA 4AG5A 1QYWA 1GZ5A 2IPLA 3THOA 1Z28A 4KQIA 2Q28A 4MHTA 1EPUA 3CEJA 4JLWA 5LOVA 1KMQA 3D1VA 1RZVA 3EB9A 1RRCA 1W36C 4GPZA 3UNXA 4R0NA 3PXUA 3AY7A 1KIAA 2PR7A 3B3JA 4ISCA 1GZDA 2YVLA 4IJ6A 3O1JC 3P71T 1CY4A 1ZINA 2ADFA 4KR2A 4F71A 5I6DA 4GYYA 4H7FA 2VUSA 2YHIA 2J7KA 4MS4B 1SG9A 3DKIA 4MW0A 4XKJA 5E3IA 1X38A 2J5XA 1ZM7A 2CXRA 2LKCA 2YJZA 4U6QA 3WLOA 3SKVA 5KVSA 1LBIA 2PLAA 3EFEA 2ZWIA 4UTZA 2WPNA 1DKQA 4WZAB 3SYMA 4Z9FA 3NHLA 5ARCA 3RKSA 1WY7A 3G2NA 1KE1A 3RSSA 4BMDA 4FYKA 4IDDA 2WT4A 3IVCA 1JHDA 4MP8A 2WA1A 4MS1A 1AZLA 4LRSB 4KK3A 2D1SA 2VYCA 3B5IA 3NANA 5KHAA 4EFNA 5F2NA 4NBRA 2B1QA 1G2QA 2B4RO 2P30A 4GZMA 3K1ZA 1UH5A 1R0RE 2R9VA 4JJEA 1NMZA 2IITA 2ODWA 4YAEA 2CL7X 4NNOA 5F9FA 3JYHA 4YJGA 2XWBF 3IXLA 1GM5A 1E9AA 1ETUA 1P9WA 1XMVA 3PNOA 5C31A 1DAHA 4GP9A 1F17A 1QIIA 1XEFA 3CR3C 2GPNA 4WJZA 4BMCA 5G0TA 4II3A 4BB6A 3NOOA 4XGIA 4I4LA 5GMOA 1EE2A 2PUFA 2EF0A 5ELXA 2B21A 2DWPA 1I1HA 3A6KA 1A82A 3KAKA 2O2JA 3H4VA 3OJFA 5DVZA 4BGIA 2AS0A 4X62B 1SVNA 2XRZA 4ZHQA 2AV6A 4Y9DA 2GTPA 3TB4A 4C5CA 4RGVA 2ZUEA 3KO8A 1V4VA 5DBFA 1XG5A 5ITZA 2QYTA 4KPYA 4JT4A 3ZZ0A 1HEUA 4XJSA 4PEVA 3CX3A 3NZEA 1OI4A 4KR9A 5FF9A 2HEGA 4OHFA 4OK3A 2J32A 5DN6D 4XSVA 1LV8A 3SI7A 4WKNA 3UPTA 1AGRA 4M1EA 4O4LB 4Z4EA 3PUVA 3G0BA 1E8DA 2FMFA 3ANSA 4QPPA 5GV7A 3WJ7A 5JATA 2A1IA 1Y82A 4XH9B 1YU9A 4HQRA 4NYIQ 3DE6X 3GXBA 1B6RA 1OFGA 1RSZA 3QYFA 3SNHA 4C7KA 1KAQA 2FZWA 4OKIA 4A1OA 2C4MA 3O8RA 3QV1A 2ZUDA 1KKMA 2XCIA 1WNFA 1TEHA 2X2FA 4CKCB 5IKXA 3G7UA 2JC3A 3CISA 1GPMA 5LP6B 1CUJA 1OXSC 3HB4X 1U3TA 3V8QA 4ZVRA 3LM8A 3M8KA 4PTLA 1ES9A 1GTL1 1PL6A 4KNVA 2EX1A 1I0IA 1O9BA 3SQMA 3K0FB 4BFTA 1SWWA 1KJZA 4Y0AA 4KFRA 3LC7O 1ZU5A 1MO2A 3KKLA 3GWGA 3NTUA 4MKHA 1P8AA 4MRPA 2HW8A 3FPCA 5IN4A 3M4ZA 2WP0A 5L53A 1Z73A 1E58A 2Z8XA 3MILA 1VMDA 4Y18A 4AJOA 3S1LA 3F1LA 4FYXA 1TAQA 2BRUA 1YQ9A 4RJLA 1NRJB 3TYXA 3U44A 4IQ0A 1ZBDA 1MPTA 2GPWA 2WVJA 3BERA 4JOBA 5F4BA 1U8EA 1QHHA 1OTHA 4BX3A 2PL3A 3EF0A 4YAIA 1PFWA 2A3RA 5EZSA 2HADA 3EEYA 2MSDB 4HN2A 4KIWA 3R5XA 2VOJA 4C1NA 1I6WA 1YJCA 5KNLA 3BSFA 1WUIS 3VR1A 1G4HA 2X8JA 3KJHA 3G79A 1N25A 4UASA 2F67A 3LCVB 4QPZA 1FX0B 1UBFA 2Q4DA 1LSUA 1X80B 5J2TF 3ZWKA 1A72A 3BGIA 3ZOZA 3I04M 4K87A 1F3LA 4LHXA 4M0MA 4EYKA 2UVPA 3LXRA 3WLTA 2PS9A 4M2LA 5FBQB 1Q2XA 4DA7A 4Y2RA 1Z8HA 4LA4A 3BWVA 4N82A 1MJFA 1RYNA 1OXUA 1MB0A 1FNDA 2AI1A 2V7QA 3DBLA 2Y76A 3TKLA 4LZPA 4BFCA 3UWSA 4ZAFA 3WGZA 4TWAA 2BFFA 2P67A 3GELA 1IHUA 4J1SA 4MV6A 1PG5A 1X9HA 3LK7A 1U4SA 4XIGS 3C3CA 4ZOLA 2B36A 3ROQA 1BDIA 3LHIA 5BWNA 4WY2A 3EF1A 4C4AA 1XD2B 2V6IA 3ILXA 1BDBA 2QRJA 2IUSA 3A4YA 3ETGA 2WIDA 3AB3A 5IXJA 2IEGA 3HLKA 2E85A 3WIVA 3IO3A 4I5EA 3O4VA 4FDLA 4JI1B 4OXXA 5IJAA 3GI1A 3HJCA 4R40A 3CW9A 2QENA 2V6BA 4KQJA 4R1PA 4Y1RB 2YDXA 1KI8A 1NUAA 1DO2A 4FC6A 1RVV1 3IE0A 4AZSA 3D3NA 4AS3A 1MC5A 2RHOA 1GTRA 4NV0A 3CLTC 3O84A 2ZUVA 4QRIA 3MRTA 3L02A 1SXJA 2Q2WA 1O95D 2KLBA 5CUQA 1Q12A 3KR1A 1F12A 4CG3A 4MQEA 4H6PA 4PZ9A 3QF4A 2F3RA 5FO1A 3STVA 3OE7A 2EVWX 5LQNA 5MHTA 4JNCA 5IG2A 1OC4A 1UBEA 5DW0A 4BB9A 1QHIA 1PU2A 1FFWA 1QR2A 3ICOA 4B6PA 3K0CC 4KYUA 1I2MA 2VZEA 4A10A 2HV9A 2ZT7A 4ERNA 1JVNA 1M3SA 1RLOA 3OZGA 4IO0A 2A5YB 3DZJA 3U3ZA 5BW4A 1FRFS 2SBTA 7YASA 1AQUA 5EIHA 1PZFA 3QRWA 1KQNA 2FW7A 4R1OA 2BGJA 4U00A 5FA6A 1JB1A 2MYUA 4QQRA 1HC7A 3EZ6A 1IY9A 1QTQA 1Y9EA 4XD7D 4QBGB 2A1UA 2CNBA 7REQB 1KAGA 1A9XA 1XJ5A 1OAAA 3PGVA 1GXSB 1KSGA 3REQA 3WAJA 1VE3A 2HRBA 5I7HA 4BO1A 1FK8A 4NS4A 3ZR4B 2OKGA 1VSBA 2D4HA 2AQIA 2F17A 2WLSA 3AIIA 3D5QA 4HFMA 5LB4A 4C43A 5AVWA 3I5YA 2JLBA 3MLAA 4PZUA 4AG3A 3D6VA 2WFAA 3SLGA 2IX3A 5BWCA 1SXJE 2WTAA 5E1MA 3W5CA 3RK1A 2IC5A 1Z4OA 3DAOA 3PE3A 3G1TA 5BQOA 5IT4A 1NNUA 1VFNA 1YTLA 1H0KA 1SVSA 1NJ6A 3FNIA 4EMUA 1O94D 1LJUA 3EZ7A 5A5FA 4M4SA 3U62A 3ZHYA 4F86A 1YJAA 2QX4A 5CG1A 3V46A 3ZX4A 4P31A 1S2IA 1G5QA 5LXTB 1Q7GA 2WKRA 4U7TB 5CTJA 3ILYA 3L46A 1A9RA 3PFIA 2HOQA 3IALA 4MVJG 3IPCA 5FD8A 4QXRA 2Q9CA 1JH8A 1E9BA 3ASVA 3OOHA 4B5LA 4D8VA 5KNCH 4F93B 2ZJ7A 4XD2A 3UWDA 1MOSA 2OTCA 2LP4Y 3K1TA 2VAPA 1C7QA 3KVRA 4MB2A 5FNVB 3SHFA 3M6VA 4QJ4A 1F06A 3TEFA 2QP3A 1BU8A 1OB5A 2ATXA 2F62A 1UZUA 3ANXA 1XVTA 3K9BA 3GGJA 1JHRA 3JPWA 4GOKA 5A71A 3CIOA 1APBA 4GOXA 3UW1A 1L4EA 2FZLA 5H16A 3R5HA 4I4TF 4CG0A 4AJ4A 1UANA 2ZUTA 1H2ZA 3DLPX 3SMQA 1QIGA 1ZGGA 2BFEA 4RC9A 3F5SA 3S55A 1CQIB 5BORA 2B83A 2HMTA 1UK8A 2G9UA 2W6JD 5B3AA 4EJSA 3P5SA 4BJ3A 4IRMA 1YGYA 1VIVA 2NYVA 4Q1FA 1TJ4A 4FBLA 1DX4A 4NARA 4Z8XA 3B48A 3VH1A 3Q1LA 2MHCA 4EGQA 1EUQA 3ACCA 1R9MA 3AILA 3U9LA 1UOQA 2PRIA 3HMQA 4NBVA 5DYGA 4BPRA 1SBYA 1W5AA 4EEZA 1G2IA 3GO4A 2O19A 1EB8A 1JHPA 2JCYA 2X0RA 3UA4A 2O8CB 4PTZA 1A50B 3DMDA 3WJ1A 1TM2A 2DTDA 2G1KA 1GZHB 2JPDA 1IUKA 2L2QA 1G38A 2BFNA 1AKRA 1THZA 5F4ZA 3OWHA 1LSSA 5D84A 5JQGA 3FOEC 5EWLA 5EE0A 3PHJA 2ZIWB 4GGPA 4A92A 1WHTA 1NVEA 3WRXC 2YJTD 3PLNA 4YQEA 1E1KA 1SNYA 1CWUA 3SP1A 1TE2A 3WYCA 3K1YA 4JYCA 3GLKA 1M2FA 2DCMA 1UOPA 1QCDA 1BYUA 3O2SB 2CFCA 1OLSB 2XD4A 3IQXA 3KM0A 2PS0A 2QGZA 1LGYA 1M2HA 1OLUA 3F6SA 3ISVA 3JYLA 3GBVA 1EFAA 4YRDA 3OQ6A 2XLBA 3KUUA 1CLEA 1IHPA 1KMCA 1T3LA 2K6GA 1B8NA 3T3MB 4D92A 4NCAA 3P0IA 3WQRA 3N5CA 4B85A 5F2OA 5BSGA 4C21A 3KZMA 1JSCA 2HBYA 2YZGA 3AUUA 3QJYA 5JAQA 5IVIA 3RSFA 3TL2A 1AA9A 2JAXA 1QHYA 4LYDA 2D54A 1U2EA 1SM4A 4B6QA 4C4TA 2Y4NA 2HWKA 4P5DA 4O08A 1Z22A 1S7GA 3MMXA 4NEQA 2ES4A 2DQYA 2R86A 4OI4A 4LXYA 1L8XA 3CSSA 2QUZA 4PICA 3F7MA 1YV9A 3IUMA 1PQPA 1KEKA 2P9TA 3LA6A 2C1ZA 4GQAA 1R16A 2B94A 5ALHA 1SC4A 4NBTA 3W5AA 2X7HA 1E6MA 4F6CA 1RR6A 1RYFA 2V58A 1FP6A 1HTWA 4OXKA 5E4YA 1I3MA 3L49A 4TUYB 4R7GA 4F5EA 2HF2A 3KKKA 2XUGA 4BIMA 4H6WA 2GESA 2XQVA 2C5BA 4Q3AA 1SKQA 3DXZA 1RS0A 3AHIA 2R4UA 4FYMA 3P2MA 4V0LA 3U48A 3FLMA 1P1CA 3IBSA 3KLBA 3Q9LA 4TS3A 5EZYF 4I55A 3VMFA 1N2SA 5JY1A 4YAJA 1IUPA 4TZ0A 2WFMA 1FRNA 4FSHA 2CE7A 3BN3A 4YCJA 1L8AA 2CLOB 5BWMA 2ZRJA 1PR6A 1PWXA 1DBQA 4M1WA 3U80A 3ZCSA 2FQ1A 1O77A 2QX8A 2ZGVA 3GN1A 4B8WA 4EJFA 2R8BA 4OHKA 4R05A 3DEFA 3PZBA 1DIHA 1XZIA 4GOLD 1I7DA 5K8UA 1B0PA 3O8BA 5FTKA 4MCIA 4OQFA 2W6ID 3SFZA 4ZVVA 3AERA 4EG0A 3JVEA 3VR0A 4QECA 4P7FA 3KDSE 2QR5A 2BRUC 1P62B 1RWKA 3MXTA 2JRLA 3ZJTA 4K9KA 4R3WA 1G9SA 2ZR9A 3SE7A 2JFZA 3HU3A 1NVVQ 4ECEA 2ZS9A 3E6AA 5EIXA 1GQYA 2R3SA 2MJLA 3VVBA 4DR3B 3UXEA 2ORVA 1U0JA 4QZVA 5ALQA 3V1YA 2GFIA 2HX1A 3DBOB 3M1LA 3K70B 2JAWA 4QU5A 2VXBA 1CR4A 1Z4JA 1GTZA 4NCBA 2FPKA 4E09A 3K9LA 2W2LD 4FUTA 1IULA 2ORYA 3DA8A 3GEMA 1GKIA 3M1YA 3BTVA 1AZTA 1IOVA 4O8ZA 4UPVA 5TY0A 5UKDA 4CW7A 1E6WA 2HSGA 3MCVA 1AN9A 2BJWA 2IELA 4ERXA 4ENSA 3BAFA 3EH1A 4BOYA 1KE2A 2XQGA 4WNAB 1QPGA 2RBKA 4FD3A 3N2GA 4UMFA 1JAYA 1H05A 1C7RA 4BAGA 4H1WA 1FJ2A 1V8ZA 1PK9A 2X0KA 2PCJA 3H2ZA 3RTAA 3T7JA 2NNLD 4DIDA 4XFKA 4F1KA 2OWEA 3UWMA 3CT6A 2TECE 4BU0A 4K6OA 1B26A 3T38A 3TLAA 4IEIA 4EBBA 5BWBA 1CEYA 1JLMA 3ER9A 1KO7A 2VDRB 1WV0A 3P9ZA 2GZSA 4R8VA 2JGIA 2H0RA 3LBYA 3BXZA 4GPTA 4EA9A 5ELMA 5K8JB 3JASB 5E6UA 5K51A 4EGAA 3LUPA 2PX4A 3PITA 1CK4A 2FWBA 3Q87B 4ZU6X 1QC5A 4J0IA 3WDKA 3F5QA 2EBWA 4GPIB 4B4UA 3LBHA 3UKOA 2HMUA 1U8ZA 4EGJA 4TV8B 2RBGA 2WG0A 3VVCA 3NORA 4Z4GA 2ZXEA 4MKGA 1OVGA 4I1SA 4URUR 4Z7QB 3S2UA 2EW1A 2PUTA 1HG1A 4PZLA 5JNRA 3RSCA 4HP8A 1VKRA 1DRUA 2MSEB 4NICA 2IU0A 1ZC3A 5JJLA 1EBUA 1TT7A 2OO3A 3JATA 1KFKB 4MI1A 1T4CB 4MRVA 5DX8A 4D74A 3HY6A 2C7VA 1SXJC 4M1QA 5AI8A 4Y98A 5JQWA 3EC2A 1CZKA 4BEWA 3CO5A 3PGA1 4UHFA 4Q47A 2QR2A 1E0JA 2QYHA 2H2HA 3B70A 3N0XA 2ZM5A 4CQLB 1G8SA 2GKSA 2P5TB 2W8BA 3O3OB 3FDXA 3QJGA 3L8YA 5KDOA 3S28A 5L7WA 2AN4A 3ML1A 4HDMB 2CBGA 5ALVA 2W2KB 1WHSA 2C3YA 1ISMA 3GH1A 5L51A 1KC1A 3ZE7A 1YBVA 3JQCA 2ZRDA 4HR7A 2VTBA 2PVCA 4F3KA 4B43A 3O4HA 5LJIA 5EKTA 4X60A 4RWEA 3W9UA 2IKSA 5KX5A 4ARIA 1LV7A 1WSDA 1G7RA 3UOWA 3N0WA 4PC3A 3VNVA 4KUEA 4GIBA 1RWVA 1TW2A 4HI0E 5C7IO 1VKOA 3AG5A 3JZDA 2P1ZA 5HX7A 2OPHA 3D0KA 5FO0A 3VTFA 4L4YA 1L5WA 1VLMA 2B0JA 2I2DA 2O7QA 2CLIB 1N5KA 2V74B 5IABA 3EXHC 4V1CI 5HXAA 1N6NA 3H8SA 2C4TA 4MQFB 4OHVA 4WL0A 3U4CA 3A9SA 3KUKA 1Z8FA 1I36A 4EKYA 4FJ0A 5TQ2A 1XRPA 2HK6A 2Z8YM 3LL4A 4RHEA 4RHUA 4ZV4A 1MEJA 2BP7A 5AM4A 1X9GA 3TPFA 3RTGA 4PW0A 3NHUA 3PXCX 1BWQA 2QRUA 4TM7A 2E7ZA 2QAIA 3SLKA 3SYKA 1L0BA 4BQEA 1TO1E 3SWWA 5GQSA 3AUXA 3K0EA 4X6XA 2ZTUA 3AWIA 1KXJA 2ZUUA 3R0VA 3OBIA 4G8JA 4YP7A 1Q19A 1QS0A 3PJGA 3SEAA 1K68A 3VU3A 1NL3A 1K98A 5DM0A 5A06A 1BX0A 1W1WA 3H99A 2FQYA 1RM4A 2Z4TA 3D54D 2CEAA 1P0FA 5T57A 2UU9B 2NXWA 2WF5A 3MF4A 4JYAB 2P90A 2PZMA 3PEFA 4J0KA 1IDN1 2UYHA 2ZBVA 3EASA 3EMKA 1EVIA 1F8FA 1HK7A 2EJBA 3IIIA 3X2FA 1J20A 1DKOA 2VF4X 1QG2A 3E9YA 4CKEB 4U9HS 4Z9BA 3C5VA 4L95C 4Q9KA 5HRUA 4ZJPA 3GJZA 1ACLA 4G86A 3W9SA 2EZ8A 1T9BA 4N7RA 3LBAA 2YIJA 4ESHA 4JXZA 1H3NA 2FHSA 1V6SA 1VKHA 3AF4A 2DPGA 4X8LA 1KH1A 3LXMA 5CPFA 3TZCA 3W5JA 4Z7NB 1TQ8A 1YFLA 1V4BA 3USCS 3VO1A 1Z38A 1A7JA 3WLJA 4YDSA 3VKFA 3MRXA 3M2PA 1JFLA 2R751 3OZFA 1Z39A 5CU7A 3S1AB 3TW0A 4OB6A 3U16A 4C0BA 2RK3A 4EJSC 4Y7CA 3WVNA 1R74A 3MJCA 1MC8A 5AOCA 5BRAA 4ZQHA 4R83A 1IPEA 4LRUA 3AR3A 3A6JA 3IIJA 3QVKA 5CR9A 4ON9A 1YZQA 4JT9A 4BLOA 3PL5A 4ND8A 1U02A 4RFSA 3VHLB 3DTTA 2M98A 5K0GA 4L27A 4WKCA 4KLRA 4PO9A 4U2CA 4ZZ2A 2KBFA 3UWOA 1N32B 5SZIA 3D0QA 2XQKA 2C84A 4DA6A 1G20B 5C1PA 4C05A 3RW9A 3BBPA 5L6MB 1P9NA 5JO9A 1EFKA 3D6JA 3OMXA 4A8TA 1R00A 4PE5B 3RWMB 2IIBA 4LK3A 3HBJA 3TKYA 2IYOA 2FMIA 4FFNA 4TRRA 4ZT5A 3SS7X 5I3ZA 2PH3A 1UC9A 2YMPA 3FHLA 3DHWC 4OKSA 8GPBA 5HYVA 2D62A 3D4PA 4MTCA 4RO0A 3PUHA 4MVJM 2ST1A 2B98A 1Z17A 3PS9A 2V03A 1A7UA 4V0OA 1EUYA 1E3WA 4G0QA 4IGIA 4BQNA 2W2PA 2E3JA 5FOSA 1TUIA 2DUUA 3NIDB 1L6RA 3I6BA 3RRNA 4L8YA 3FTNA 2C9MA 2HSDA 4IP0A 1TMYA 2ZT8A 4FBGA 2XE8A 1YVDA 4XCVA 3UICA 3AESB 1BE0A 1BRTA 3X1JA 2CDRA 3QOYA 3W9YA 1AUOA 1SA0A 1WXGA 1NJ1A 5DTMA 4JSTA 1N1EA 2MSWA 4DIFA 2P8JA 4DMLA 1C3OB 1Z5GA 2F64A 3RS7A 4UUNA 3QOFA 1P6XA 2FJPA 2CK3D 1BFDA 3MJ4A 4LNHA 1RPJA 5BO5A 1HNWB 1VKNA 2RGNA 1NTOA 4LDJA 4JBHA 1CF4A 4INAA 3MOIA 3WLAA 4AG6A 1CUUA 3HCCA 4CV1A 3EQ2A 2DB3A 1GPUA 4LSWA 3ETJA 1XHLA 3IODA 3I5MA 4N01A 4MRSA 3ZQJA 4BP8A 4BNMA 1WR8A 2ZVJA 3PDUA 3HBMA 4NHEA 1MA3A 2W2MA 4DJEC 3H1BA 3N9IA 3NIBA 2PTHA 4U3JA 5JHHB 3D8SA 3KETA 4DLLA 2JANA 1LBQA 3ZTWA 4JL8A 3QM1A 5JPCA 3KBOA 1QO9A 4JDUA 4L6IA 1XEWX 1PDOA 3W2FA 5LQCA 3T06B 3USES 3N2LA 1ZJJA 2ZJ4A 1PTJA 4FDVA 3ZE1B 3AETB 5AJZA 4GE0A 1DMRA 2HK7A 4Q4AB 3UJ6A 3UHAA 4EITA 5CT5A 5G0WA 4WA8A 1T6NA 5ALRA 3UKJA 5A9SA 2WYHA 3TRHA 3FSEA 4BTVA 1Y9ZA 1CW2B 1YMQA 2NYAA 2QJFA 3TQIA 3OFJA 4Q9LA 5J5CA 1AUVA 4RHCA 3WNBA 3EGEA 4BXOA 1QG4A 1XCBA 2I6XA 1GPJA 4WUVA 3T9DA 1ISJA 5CA1A 4MJ7A 1JLHA 1NXQA 3T6KA 4I8DA 5A0TA 2XA2A 2Q0XA 3BAZA 4IFBA 4YMIA 5BN1A 1XK6A 4CIBA 5KSZA 3D7MA 5JI3E 4ZK6A 2V6MA 3PPIA 4G5XA 1MX3A 4S0ZA 4IIEA 2BM1A 2WA2A 2ZBQA 1NR5A 3LTNC 1TF2A 1OFVA 3OPNA 3DL4A 4K1XA 4M7RA 4PLVA 4E2ZA 5A02A 2SHKA 3QVLA 4TVOA 2F4VB 2O3SA 1M2GA 1NI5A 4GVPA 3CW8X 4LK2A 4NCKA 1PV2A 3ZHRA 4K6MA 2Y66A 2YXDA 1QVVA 4PG5A 4KXXA 4J75A 2IWRA 4P4LA 1UUFA 5EFZA 1HF3A 1OI3A 1TZBA 4L5AA 4PAOA 1ZCBA 3AEKB 3D64A 1U81A 2QVXX 2J6IA 3GMTA 1B0ZA 3CIFA 1YRWA 1Y3FE 4YAGA 3AVWA 4IVNA 3AP3A 3PQ2A 4M22A 4C0QC 2RGBA 3IQIX 3L8DA 4AD8A 2E4XA 4X1KA 4HT3B 6YASA 1PR1A 1T5OA 1C7EA 1C8VB 4LE0A 4RKQA 3IAFA 4GX1A 4ZODA 3RSZA 3TXXA 4B6SA 2G7MC 2PO7A 4QSHA 2Q0QA 1JHZA 3L40A 3F2VA 3UHPA 4ZALA 4B3RB 5IWAB 1NE2A 2XUFA 1V95A 3EZ9A 1RI2A 4UM7A 5CFZA 3INGA 1DQZA 4PYMA 1RADA 3MQ4A 4AZVA 2D2FA 1AK2A 1QRSA 2HR1A 3CZRA 4W5JA 2DFLA 1A76A 4AAYA 3FD8A 1DBSA 2WR8A 1MO4A 1CETA 3PX3A 4G8BA 1Y3IA 4PSCA 2CKMA 4W1SA 1Y3CE 5EXTA 2BEVB 2M6RA 1J39A 3NIFB 2PS1A 3OZRA 1W46A 4RA6A 3V8EA 1EG2A 2DQKA 2JBAB 2GI4A 1YFJA 1UCFA 2WWXA 3EVFA 2V3CC 2NYRA 2QU8A 5F78A 1L5MA 3FUCA 3TFWA 4KQGA 4EECA 4EABA 3VNRA 1HURA 1BXRA 3DYBA 1SBTA 3W7AA 5BN5A 3L07A 3DT6A 5A2GA 4WNCA 2SICE 1ESNA 1E1CB 3GR6A 4ZGWA 3DZKA 2VBGA 5I9TA 3O2JA 2CHGA 2WYUA 4BNVA 1VG9B 4IHJF 5CURA 4W8GA 2LWIA 2IF0A 1DDIA 4GP7A 5CFNA 5TRTA 2X8BA 2JFUA 3A7DA 3SKXA 1UMKA 1XAIA 2Z9BA 3LZCA 4MQ6A 4RDXA 5LYJA 4Q9JA 2QXYA 3BJRA 2WV9A 2IX9A 4BB5A 1RJGA 1TK9A 2RAFA 3DW1X 3IUEA 4KSYA 5AIBA 2R25B 3LNTA 4G4SP 3AIMA 3VAYA 4C87A 3TM4A 4POOA 1XYVA 2J59A 1BYIA 1YZVA 2G72A 3NCHA 3IQDB 5KPDA 4EUSA 4PYKA 1T2EA 3EARA 3MWEA 1I14A 1PLJA 5FI3A 3R0QA 1XXHA 4CUJA 2GAIA 3I6ZA 3H5IA 2PZFA 3LX4A 3BGVA 4X44A 5EJAA 5FTLA 4WSOA 3KUXA 1IM5A 1U65A 3DBRA 5FLEX 4EW3A 2ACKA 3KQNA 2J0VA 1FTGA 5IKOA 4FW8A 2XCLA 3ELYA 3QA3E 3W4IA 2JI7A 4V39A 5HJ2A 4ETMA 5LOVF 1HE4A 2R1TB 2VQDA 3V55A 2BFCA 2R4TA 3EVTA 3C3JA 3KTAB 4EY6A 3DDHA 3KOWA 1WUTA 2DXIA 1U4OA 3QLEA 5CW1A 2ZR8A 2QSYA 4U2DA 5G41A 1JFTA 1GZ4A 2QZ4A 3MW8A 3QTTA 3QUCA 4KQFA 4QBFA 3AVXA 2O5VA 4D9FA 4TTPA 5I5GA 2Z3WA 4H3HB 5K0EA 2J5RA 4KLZA 4JI7B 1C50A 3OURA 2JLQA 1QGAA 2WAMA 5IXSA 3RYIB 2EJVA 4QBTA 3OX2A 4QUAA 1I10A 2Z2IA 3PSAA 4LSMA 4PVDA 3G2MA 1PN3A 3GROA 1LZKA 2QRHA 2F3SA 3WHLA 1BWRA 2XNSA 1IM8A 2BEKA 1XXHE 4J4HA 5AVQA 3SDBA 1Q0TA 4GX5A 2R48A 1THMA 2GYVA 3E5HA 2HLDA 1XTVA 3R3JA 3RS8A 5DTEA 1ZGAA 4W1QA 2MOKA 4ZA2A 3WL5A 1UBGA 5MFZA 3KKEA 3NJ8A 3ORFA 3TW8B 4DA8A 4X3CA 1HM5A 5CDYA 3VU9B 3WSTA 2VO1A 2FPWA 1N5MA 1XJ0A 2RI1A 3UK1A 3UCXA 4XZ3A 3U4IA 5JH7B 2YBDA 3DZCA 4DANA 2CFIA 3LQ1A 4WNYA 3KSAC 4ZHQF 2I1WA 2QN7A 4BECA 1YZ3A 2I5PO 2G0NA 4E12A 4ZHSA 4UBKA 1B42A 3EZXA 3KRTA 3LY5A 1W1UA 5EWMA 3Q7PA 4CM3A 4MV7A 2RJOA 1LPMA 2DR0A 2B5OA 3DOJA 3QKIA 4DIEA 2ZUBA 3ICCA 2ACEA 2G28A 3W3ZB 1ONOA 1O8CA 2OCGA 2WWWA 2GWRA 3EW9A 4MS4A 4JXJA 1XZJA 4HQOA 1QHSA 5IP5A 3C3XA 4QFBA 3PXGA 5K8CA 3E2IA 4PAQA 2XBMA 4WZAA 5K6TA 1GR0A 2OBYA 1ZEJA 1PE0A 3AVPA 3QEMB 4ZC1A 3R7DA 1YBAA 4ZREA 5BVGB 5C1OA 3G02A 4Z4HA 1W36D 1W4RA 2FTKE 5F1OA 3RBZA 1YRAA 5HIAA 3RS9A 1NOJA 1RLMA 1E59A 1RLUA 2W2OA 1EBFA 2HN9A 5A3VA 4HQ0A 4Z86A 2BT4A 1QG0A 2G25A 1Q92A 3QY9A 1GGFA 3D8RA 2HPAA 4K6FA 3BD7A 1BXKA 4UOQA 5REQA 3ZWDA 5DM70 1MOQA 1GP2A 3AP2A 3RS4A 1VI5A 3LCCA 2C7QA 4Q21A 4IMPA 3CG0A 7AT1A 1FVFA 2ZI5A 2PGDA 3AEZA 3HPQA 4TMXA 3WQQA 2OV3A 3UG7A 4HZIA 2EZ9A 1CNMA 3GRPA 4P3YA 4E08A 5JOQA 4Q3LA 2AHRA 3U9SA 5EUQB 1NLMA 3KU4A 4FCVA 5B58C 1G8JA 2QYOA 2E49A 4J9VA 1P31A 3WMWA 2AA3A 4UOEA 3U26A 3VTAA 2EW2A 3LGSA 3WLQA 2RC6A 4TS9A 2JCXA 1XPJA 3JRXA 4IIXA 4Z7OB 4XGQA 1AQNA 1TM7E 1HDIA 5D3MB 1YRQA 3PEEA 5HSGA 3Q98A 1H1TA 3L7YA 2RGNC 2XI4A 3SJ7A 1RM0A 1TX4B 3KSRA 1CNFA 1Q1GA 1S9HA 3F71A 1SCAA 4KAXA 4WZAE 1ZI9A 1Q16A 4F4JA 1RQRA 4ALMA 3CT4A 2Q5FA 4KN8A 4ZTZB 1W88B 1WZ2A 5A7HA 1NV8A 2Q8NA 4YAUA 4IXWA 2B2CA 4L57A 3EG5A 2J30A 4ZDWA 3ZUPA 1XZHA 2FZCA 1NXSA 5EJIA 3GJQA 3ZZUA 2PFKA 3LBNA 1C3LA 1PTJC 2XMSA 4C76A 5JCZA 3K53A 4O2RA 3WNDA 3ZW7A 1NULA 4MRRA 4CKCA 1NNI1 5JS2A 3I0ZA 3N75A 4KLCA 1XU9A 3PUJA 4LHSA 3FTDA 5LP6A 2D7CA 3PIIA 1YC5A 2JF0A 1E0SA 4INPA 1E2EA 1R0XA 1W4LA 4JXKA 4ARZA 3IUQA 1Z82A 1V3VA 4HXFB 1VTKA 2BR5A 3HB9A 4XUCA 3KT0A 2JGMA 1JMYA 2LNDA 4L15A 4JVSB 4OCZA 3OZIA 1U3UA 2WUEA 4Q93A 3F97A 5J63A 4UTOA 2PH7A 3N07A 3P0EA 2BCEA 1XP8A 1MO3A 3DDOA 1JYFA 4BEVA 1SGWA 4ZOLF 2XWSA 4N76A 4HGRA 3NHRA 4LBVA 1TZ2A 3L5OA 1OTXA 3P2KA 4LDNA 2Q3EA 4OP2A 2BYTA 1O6ZA 1JU9A 3AC0A 5E0OA 3QNMA 3UAXA 4CMKA 5L6LB 1M0WA 1Q2UA 1N6PA 1PFYA 4YJDA 4Z51A 3RRXA 2OORA 3FCXA 3VDNB 1E6LA 2YWXA 3OP1A 2BFOA 3OZ7A 3M0EA 4EY8A 3GGSA 4GOOD 2XMQA 3D31A 3FSGD 4C6HA 1Y1LA 1GPNA 3IBFA 3NETA 1MUUA 2J5QA 2XUAA 4CMIA 1AQJA 3P2JA 5AW8A 1MZVA 1KYXA 2H1WA 2E9SA 4FCCA 4IV0A 4RL4A 5FADA 3NOQA 3AINA 8AT1A 1Z68A 4U8HA 1NTRA 5LIPA 1KNQA 1OXXK 1S8FA 2PUJA 1JSRA 4P0QB 1FX0A 1KEVA 2RD2A 1X80A 2XF2A 2M2IA 5AXCA 1Z0JA 1EFDN 1VLLA 1E2QA 1UT6A 3MJDA 4LYEA 1U1DA 1EWQA 2EFCB 3BJMA 3COVA 3L77A 4LQCA 1IZZA 4FZJA 4DUGD 4UQLA 3HCPA 2WPDD 1TMOA 1MX1A 2A6PA 1CIJA 3VOBA 3I9OA 5KOJB 4KN6A 1ZMTA 2GF9A 2EKBA 3HYNA 4UMVA 3AF1A 1WBDA 1ESEA 2IZZA 1PR4A 4ZO9A 3RUPA 3KT3A 5GONF 2HZBA 3COPA 4K5QA 2JVJA 1RKBA 1CIVA 5ADUS 4HQLA 2VVTA 4PQGA 4ZZ3A 5JZBA 4I5DA 5AOBA 3NKFA 3NWJA 4MWEA 3ORSA 3V1UA 2HA6A 1G5TA 2JK1A 4QX6A 3Q7TA 1NMYA 3OFVA 3H5WA 1OI2A 4NJEB 3K0SA 3MHTA 1VJ5A 1KK1A 3WB9A 1RQLA 3U7QB 1PD1A 2IHYA 1Y34E 1PUIA 1D1PA 1DVRA 2AOTB 3ONEA 4XLLA 3TM5A 3STHA 3WB2A 4A6DA 3ZCRA 1DIOB 4ZCLA 4KR3A 1QORA 3I39X 1M6WA 1ZK4A 1HGXA 3TD9A 4YRAA 4FIDA 1N2IA 3B3QA 2P2NA 3I32A 4LJLA 3UMYA 3DT8A 2ZIUB 2GAOA 3K32A 3FPKA 1J00A 4HF7A 1YDMA 3OFKA 4F6RB 4DQDA 4TV9F 2QIOA 3P9IA 5AKGA 1JVSA 4GFDA 1Y1RA 1QDUA 1GGJA 1HLPA 2IYAA 2VK8A 3OZEA 3WRVA 3Q3EA 3DVSX 1UM9B 1XQ9A 3V6LA 3CLRC 2QRQA 3LMKA 5JROA 1YC2A 3IDQA 4X91A 4IDAA 4B3IA 1H8ED 4WV3A 3IPRA 2J3DA 3Q12A 3SFTA 5A5GA 3AT1A 3GT0A 3NPMA 3VDMA 3TZQA 1SEVA 2ACVA 3AR7A 4MYUA 4GKKB 4DCSA 1K7SN 4LFAB 1VBKA 3KVOA 1G19A 3MYRA 4DWOA 4IIBA 3AW9A 1ZIPA 1YRLA 2X3FA 4OLHA 2BBSA 3VSEA 1OY1A 1GGVA 3ZWBA 1T9GR 2DT5A 3CLTD 5G0SA 4W5NA 3TBFA 5GM2A 1F2DA 1RKVA 2X0JA 3MGCA 1JHUA 2J5BA 2JIZA 1WMDA 5JD3A 2VSOA 1ZH6A 3D5EA 2RGXA 3TZ6A 1NN1A 4C0SA 7REQA 1Y7PA 3ADKA 3L43A 2J0QA 1GXSA 3W7VA 4A0RA 2H5IA 3H5RA 1ORVA 3AVOA 2AQHA 2PZEA 4QDKA 5CLFA 3E9ZA 1TK3A 1E61A 1C14A 4RKWA 2AXEA 3HB0A 4WTOA 1P61B 2CLEB 3B1ZA 5ALKA 5F52A 3T7AA 4E94A 4P3OA 3VTKA 5BXYA 5DLPA 5H70A 2EXXA 3S8EA 1M6VB 2BSXA 3R23A 3HCNA 4HEA1 1QP7A 4H31A 2H4FA 3GJ3A 3QVXA 5WRFA 2O8FB 1U99A 2OSBA 2ZTSA 1Y8ZA 1LTKA 1Q1AA 1RBZA 4AYTA 3AOEA 1II8A 3EVEA 4MSUA 4X7PA 5SV2A 5CFOA 5LXTA 1H69A 4OB7A 2O2XA 4XQCA 2QZJA 3UJ7A 3K05A 2BKXA 4JBYA 1U2SA 1EWRA 4OUDB 4LQDA 1YQWA 2ZSDA 1XZCA 3KDPA 3IEIA 4CLEA 2WABA 3ROKA 4G5GA 3IV7A 4J9UE 1IN1A 4B45A 2H5LA 3VPXA 3VKUA 4P5EA 1B00A 1WMFA 4I81A 5FNVA 2FZGA 3AZOA 3D43A 2IUYA 3GPBA 1R4AA 2FU5C 1GA6A 4Q1EA 3RS0A 2OILA 4YRIA 1FDWA 3GL9A 4LRTB 4HNAB 5IKPA 4KDRA 2WOJA 1XSEA 1NI3A 1LLFA 4UHHA 5A2QA 2NQ8A 1USKA 4QJIA 4MUHA 3X1WA 2Z3ZA 2N0SA 2OUIA 1WX1A 2CVHA 3DE5X 3G7NA 4B4KA 3MAGA 2PBLA 4HC4A 4D4LA 4F2WA 1HL7A 5JMWA 4MDEA 2YWJA 1NG1A 3HDYA 1QOQB 3NVKI 2JFQA 3KYBA 3X1YA 1O97C 1CQIA 1V25A 3RPEA 4AI6A 4LDZA 2XOEA 1XK7A 3G5UA 3K8QA 1Z88A 3Q88A 2XTZA 1TAUA 5BWLA 3QUAA 4G5QA 5I9BA 3IDFA 3FTFA 1P0MA 4YJ3A 4LGVA 4GU5A 2QRLA 2RH4A 4YP0A 1PBTA 3WFZA 4NJMB 1X8LA 2H2FA 2OA0A 3WL3A 4MV1A 5G4LA 1JSXA 1IJBA 3IUNA 4AFNA 3ZLUA 5EXDA 3IIMA 4MB6A 2VT3A 4PQRA 3DW3X 4MJXA 3DEIA 4BLTA 1Y8QB 1JXOA 3PGLA 1AUQA 1WZCA 1D6NA 2YOGA 3ONDA 2TMDA 3VO2A 3WGOA 2P2SA 1L8LA 3D4NA 3PXEA 3WHPA 3OZXA 2GQ0A 4I55F 4BN5A 4S35A 3KKQA 2PKRA 4X85A 2CHVA 2Y99A 3FM9A 3SZUA 1ZJ5A 4E5NA 1GZ7A 4E7OA 4HB3A 5EE3A 2P65A 2YVKA 3E0QA 4KNWA 5DYYA 5HVNA 4C2UA 1KFBB 3GAAA 4UM9B 2PU7A 4WOCA 3B36A 3DKVA 2WHRA 3OIWA 1YCFA 1MEOA 4I14A 2X14A 4WOBA 3REGA 5CB8A 1TA9A 1E3JA 2HQ1A 3VO9A 4YMSA 1MP0A 1KSHA 3MWLA 1BAPA 1JS1X 2PAFA 5A4DA 2ZRCA 3R7NA 1TJ5A 3FPEA 2HUNA 4L3WA 2RHBA 4MP3A 1FXSA 3FJOA 4Z0HO 1J1IA 1WDTA 2JJ8A 4AKIA 4K6HA 2VG8A 2XF8A 4QGFA 2QOEA 4QUDA 5D8DA 1CFZA 4G63A 1XTIA 4MCHA 3R5TA 1T3HA 1D8AA 3R1IA 4QBKA 3UMRA 1GZVA 5KQLA 3HADA 3OF2A 2FEWB 4UM8B 1K5PA 1UAGA 3RVRA 2IP4A 3GY0A 3NAGA 1EGAA 1TD9A 3IOCA 2FR8A 2XNHA 4PPYA 2W70A 4RK4A 1WOMA 2O3QA 3KSDO 4Q00A 4TUYA 4AKEA 2BKUA 4DLYA 3HZHA 1TZMA 2X22A 4DC1A 1JR4A 3FNEA 1XCJA 4PRYA 1GILA 1H6DA 3IHWA 3ODPA 3OJXA 5BSRA 5LP6C 1FMJA 3DFZA 4WDQA 2P75A 4CM8B 2HM7A 4DLZA 1YRYE 5ADHA 5FUQA 2BMDA 2AUMA 3UK7A 1XXLA 4BYGA 2E4YA 4K9LA 2QDXA 2E2WA 3DWGA 3F73A 2DKFA 4EA7A 3IBCA 3TINA 4YB8A 3F8TA 4FLEA 1QB7A 3FMGA 1I3OA 2A0WA 2DCUA 3LKVA 2UUAB 4FZRA 5AJUA 4D81A 1J42A 5G2OA 2IU6A 4MYDA 3C8DA 4KR0A 3EIQA 4NBSA 1BFUA 4LCBA 3HI6A 4RMJA 2FQWA 1J49A 2PSFA 4LMBA 3S27A 1U2GA 2FI1A 3GVCA 5EMMA 3UQYS 3CVUA 1AHHA 2OORC 2Y68A 1QO7A 1SCJA 4OK5A 4Q3KA 1UIRA 1LXCA 4ZVKA 5LKAA 4QHYA 1QE3A 4WJKB 5KTRA 3WMFA 5K09A 5KYGA 6ABPA 3Q4GA 2NZYA 1GO2A 1CJVC 3FKQA 4WFQA 3FN4A 4E07A 4ZQFA 3BL6A 2BMJA 3T7CA 3LBIA 4D9IA 3H1GA 2RH8A 4L9WA 2DF8A 1KAOA 1YOVB 3JTMA 3LHDA 2QMUA 1FZQA 2Z04A 3WA7A 5DOZA 4J0GA 4Y1FA 1KDRA 3TZKA 1YZGA 2ZYGA 3QXSA 1GPAA 4ZCPA 1GDDA 1DQRA 3AV0B 2W9XA 2ZQZA 1JKJB 2H51A 4OG2A 2ZRMA 1TRHA 4WNAA 4BBAA 3O8NA 2JGDB 4I3GA 2UUCB 3URKA 4ZT2A 2EQAA 1XCLA 1ZSYA 2WD9A 1SVUA 2OHXA 4AL4A 1CD5A 1KK0A 4MVJI 5FJJA 4ETWA 3FW1A 3E70C 2JGRA 5LD2B 2Z83A 4KQWA 3B78A 3KJZA 2JI8A 2Q5JA 2ORIA 1ZITA 2QLJA 5FORA 3TR0A 2AIRA 5ESDA 4BIIA 5DP2A 5KX5F 5FUBA 1D7AA 3AL0C 4BQQA 4RH0A 4I6EA 2C7RA 3P9QA 4JLUA 3NHSA 3LI2A 5HF5A 5IF9A 5EP1A 4RV9A 1CEEA 1WA5A 3JASA 2I3BA 2AC4A 5JNUA 1ZD5A 3GUUA 3BGDA 3IIKA 2ZANA 2HA4A 2V7QD 5C46F 1JSZA 1KI3A 3BRSA 3ZHBA 4UM5A 3HU5A 1WXEA 2XY4A 1UDCA 1NDQA 3SPXA 3CS3A 1I3LA 1GAWA 1Z6PA 3DFIA 1S6YA 3EQ6A 1FUKA 5J5AA 4IGKA 2BPOA 1J5EB 4JOSA 1R8JA 3MJTA 1XI2A 1FY2A 4KQEA 4RQTA 5KWVA 4AXBA 2F8SA 3MWDB 2YYAA 3QMPA 3VHRA 2I3AA 4CDMA 3BSYA 4EJMA 5T4BA 3WQBA 3UT0A 1DJMA 1T4CA 2VT7A 2O2ZA 3GP5A 3NWPA 4GI2A 4RL6A 5G3ZA 3K31A 3PC2A 3MPUA 4YASA 2HSWA 3EPRA 2FG5A 3RVLA 4YWHA 1T3TA 3E81A 4R54A 1BWSA 1FSSA 4RABA 4H0CA 5A0VA 2GPTA 3I2GA 1D04A 2C5GA 2HMYB 3CUKA 3A1NA 3F67A 4JU9A 4KI7A 2VYNA 3DCYA 4HDMA 1CRQA 2W2KA 4NV1A 1L4YA 1YI8A 3OJ0A 3KXPA 1SQ0A 3ZZMA 2XHZA 3KEQA 2QGFA 3PKZA 1SXJD 4D8YA 3AXSA 4YIHA 3CUWA 4E2YA 4GZLA 2R7NA 1S9DA 3LT4A 3ST7A 1E1RA 1DOZA 4J94A 4XYGA 3VR6A 8MHTA 5K3SA 4RVUA 1H2HA 1OSNA 1SVKA 3OE7D 1IUNA 4I2VA 4MKIA 5EQJB 5T3UA 4IWYA 1S8AA 2G82A 4N3NA 5E7QA 1M9NA 4AZ3B 5CX1B 2DEUA 3TTSA 1R0ZA 2YOHA 2L82A 2ZRKA 5IDWA 5A62A 3I37X 5FFFA 1KNXA 4ZVSA 4CM5A 1P9OA 4C20A 3S2IA 5K8IA 1VDMA 1PZXA 4QIHA 3BILA 1E4OA 1ECGA 1T9ZA 1GNPA 1H5NA 2CHUA 3IURA 4OU5A 4PQEA 3QG1A 3MFYA 2RCNA 4JK3A 1HLFA 1UK6A 3RF7A 3A6PC 4QVKA 2LDBA 3IMCA 3NCTA 3KZKA 3HBFA 4NFYA 2AGVA 1T8RA 3GGOA 3I8OA 4GM0A 5JTTA 3AONB 5ABPA 1XQ6A 4BMPB 4RIEA 5CA0A 1NW9B 3AOEC 2IYXA 1UFOA 2BJVA 3LDHA 1ZA2A 4HGQA 4KVAA 5D6OA 1X86B 2DTEA 2I29A 3H5NA 2FRXA 4R1TA 3RB8A 2HWYA 5IEBA 2EJWA 4KQCA 2JJMA 4IRXA 1I5EA 3E15A 4KXQA 1NXWA 2C78A 1BEEA 5B7PA 1OFTA 1VBNA 2CF5A 2VH1A 5K0BA 3QWBA 1VMIA 2NQTA 3JWHA 5DYIA 2VC2B 1GCAA 3C0KA 4G2NA 4RHFA 5LZ8A 3K6RA 4CKEA 3S3TA 4EA6A 4LBZA 3KKPA 5LUAA 3W5DA 2FFAA 3JZIA 3DZ8A 3VNUA 5DHAA 3Q8MA 3GARA 4U02A 2ISCA 1XRMA 4WN9B 3NJ4A 2QA5A 4DVGA 3H0CA 1L7PA 2I62A 3RSHA 2B25A 5IAAA 5AVXA 1NAIA 4HJXA 2YXNA 3TD2A 2QE7A 3I1IA 1PT5A 5L7YA 3TJMA 1WVGA 1XZKA 3PKIA 5DHPA 1U5AA 1AZSC 5D3ZA 2D5AA 1M74A 1P7ZA 3S1AA 1QAMA 2ZYWX 1Y7TA 3Q7EA 4CM6A 4YROA 3TJRA 5B3LA 1D2HA 3PEVA 4PG7A 1C8BA 3HKCB 1VJTA 4KPFC 3QU7A 3SVTA 3VZSA 4YBRA 2R96A 3FZGA 2P35A 4EG5A 3NT2A 1GDHA 3T9AA 3QVSA 3TLMA 3DE4X 1P2VA 3QVWA 1ZX1A 3TWOA 5KOHB 421PA 1JQDA 1P81A 3GFPA 4KE8A 5EIWA 1G20A 2ZDHA 2DFKB 3A9CA 3HU1A 4QXQA 4TN1A 3U6BA 1JG7A 2ASVA 5EJ2A 3KSBC 3ZE0B 3I64A 4TL9A 4X71A 2GJKA 1XPOA 1QK5A 4D3ZA 1CRLA 1W581 2X7JA 3G3EA 3WKCA 1AKWA 2XZPA 3ZHTA 3E8SA 2FXIA 3C41J 3O8LA 4Y9UA 3RS2A 1GL6A 1WZEA 4GG1A 4UAJA 3PFFA 2Q3HA 4JENA 4EM6A 3I2JA 1XD9A 2QTTA 2UYYA 3Q7SA 4RPJA 1Z2EA 5JWOA 5KBYA 3ABZA 1E8MA 3DLTA 4BCCA 1EJ6A 2OBXA 1FNCA 1MB9A 3ISTA 3OH8A 3Q6NA 1U0NA 2HSEA 1RQXA 4OEHA 1DEKA 4OMDA 2QR3A 5CK5A 3W3AA 3UT5A 2IZ6A 2X9NA 1SBCA 2W83A 1KY4A 3A58B 2Q5QA 1CZNA 5CA1F 3A8TA 3R7AA 2IHBA 2A9VA 1FDUA 3CN7A 4TYMA 2QAGB 1IN5A 4Z0TA 3AESA 2QY9A 2QRMA 5AI4A 1V1RB 3TW4A 3W2GA 4YUXA 3I34X 4R8RA 3QITA 4X95A 5HBGA 4MGZR 1VG1A 3PC3A 3ZTTA 1RCUA 2CCJA 3CLSC 2EFGA 4G5YA 4PGGA 4QOGA 3BTOA 1L5OA 1C3OA 1C9DB 2R6DA 2WQZA 3INYA 1VCHA 4TS4A 3HXMA 1DTEA 4JQZA 2YRWA 5JZVA 2PRKA 3DV0B 4JC4A 2HIAA 1G20E 1M8PA 3OZVA 5IDVA 2RHCA 3TQRA 4Z9AA 2HA7A 1LEHA 3GZNB 5JD6A 2AXNA 2FR8C 4AY5A 1Z16A 3HR8A 3I53A 2QTNA 3ZCXA 1LFDB 2Y6UA 5C9ZA 2K2WA 3HM2A 4FI3C 3W7BA 2VPIA 3KV1A 3SC4A 4JELA 2IDKA 1J25A 2IYWA 4C6TA 1YONA 2RHJA 1RQGA 3CSDA 1Z6QA 2H92A 1RE1A 1PDWA 4D8TA 3AOGA 5TLSA 4KE7A 3I0MA 4ZRNA 2RH5A 4C7OB 3GRYA 2H1CA 3B9BA 4JYMA 4OLBA 3QHAA 1M8JA 1MT0A 3AETA 3VVMA 1DC5A 3N8KA 1BJKA 1DX6A 2DWUA 4FHGA 4IWNA 4Q4AA 4ZJZA 1MGOA 3ZK8A 3JXEA 4GKBA 1V35A 2CMKA 3WICA 1DRKA 3MTDA 1DTWB 1NW6A 2F2TA 3B2NA 2C3OA 1PJRA 5BMVF 1WDMA 2FG6C 4MLCA 3AWDA 2A30A 3UJ3X 4CKYA 5DKFA 4X7RA 3DVQX 4IILA 4ZAWA 5T7BA 1JA9A 3FOAA 3S99A 4B8ZA 5C81A 3EIWA 4CR6A 1SB8A 2R68A 3HXOA 4HB2A