1VLHA

Crystal structure of phosphopantetheine adenylyltransferase (tm0741) from thermotoga maritima at 2.20 a resolution
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
157
structure length
157
Chain Sequence
MKAVYPGSFDPITLGHVDIIKRALSIFDELVVLVTENPRKKCMFTLEERKKLIEEVLSDLDGVKVDVHHGLLVDYLKKHGIKVLVRGLRAVTDYEYELQMALANKKLYSDLETVFLIASEKFSFISSSLVKEVALYGGDVTEWVPPEVARALNEKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopantetheine adenylyltransferase
publication title Crystal structure of Phosphopantetheine adenylyltransferase (TM0741) from Thermotoga maritima at 2.20 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 50
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1vlhA00
1M8PA 4XFDA 4BWVA 4DLPA 5BNZA 3S3TA 1TYBE 1VBMA 2J5BA 4F4HA 3HL4A 3IVGA 2RD2A 4MW9A 4ZCRA 4L2IA 1U7XA 4MVXA 4DDHA 3ND6A 1GZUA 1J09A 4MWBA 1M83A 4HK4A 2QUHA 1YUNA 5DASA 5IJXA 3CLUD 1O0CA 4I6EA 4OUDA 1JEEA 1S4MA 3E27A 4MVWA 1X8XA 2A4MA 1YUMA 3FH0A 1OBCA 1JEDA 3UK2A 2Z09A 2BYTA 4HJRA 1J21A 1OWOA 4K03A 4PBSA 1WKBA 1M8JA 3FETA 3FG9A 3IH5A 3VGJA 5JBNA 3D6VA 1J1UA 4MWEA 2E0IA 4MUJA 1ZUNA 1JIIA 1NURA 3UY4A 4G6ZA 1B6TA 2DLCX 4QBTA 2X3FA 1N2JA 1HYBA 1MC1A 2HGZA 4MUIA 1VBNA 3ELBA 4KPUA 1NUPA 1JZSA 1XNJA 1GAXA 2WQ6A 1CT9A 3CVUA 3Q4GA 1WZ2A 1K4MA 4ARCA 1O96B 1O97C 2H29A 1OWMA 2CYAA 1LI7A 2YWBA 2D13A 4E1AA 4JXXA 2YXNA 4KR9A 4UZEA 4EFKA 4MW5A 1KQOA 2QTMA 1DNPA 1GLNA 3OP1A 2DPLA 3X1KA 1T6XA 1OWPA 1YIDA 1EJ2A 4DDKA 5DK4A 4DE5A 2ZUFA 2HZ7A 1K97A 3CLTC 4NZPA 1N2EA 3HV0A 1FFYA 1OWLA 1O95D 1WXHA 2DETA 3IVCA 3P52A 1M8GA 3AKZA 1NI5A 1ZH0A 4YMIA 3GMIA 3KT3A 4EG1A 4JXZA 4MUGA 1K4KA 1IRXA 4OJMX 3IUBA 5DB4A 1WXFA 4G5FA 3TQOA 2PFSA 4KR7A 1YULA 2X1LA 1EXDA 1GTSA 3H9CA 1EE1A 1N1DA 1XNGA 2PZAA 1LI5A 1TFUA 2QTNA 3LOQA 3ZIUA 1KQPA 5AHWA 4EG7A 1NUUA 1YIAA 4MVCA 4PY2A 3FIUA 1G8FA 4QRDA 1D2RA 1T9GR 2VTBB 3FWKA 4MW7A 2B7LA 1EFPB 4J76A 4YP5A 3OTWA 1WXEA 4JYZA 2CV2A 1ZH6A 3A04A 1O94D 2E89A 3L93A 2G36A 2PIDA 2J09A 4QREA 5LLTA 1QRSA 3F3MA 3QE4A 2E21A 3Q10A 4YBRA 3Q12A 3HFJA 3QTBA 1I2DA 3ZJVA 3P0HA 2WB2A 1OBHA 1H3FA 3VRHA 3ND5A 1O6BA 3CLRD 3SYTA 1U3CA 4MWDA 3RK1A 5KHAA 4R2MA 3CR8A 2E18A 4Q93A 5FO0A 2QJTA 1X6VA 3SEZA 3HGMA 4YP6A 2NSYA 4TS1A 1JIKA 4MLPA 1JIJA 3PRHA 4JFAA 2JANA 3GLVA 1Q77A 3FI0A 4KKVA 1V8FA 3KT8A 3MXTA 5FO1A 5J5AA 1TEZA 4ZT2A 2J07A 4MW0A 4YP7A 1J70A 3A4IA 3IMEA 1QJCA 3H9BA 4GU5A 3MMXA 2IP1A 1ZJWA 4ZT3A 2H2AA 3FHJA 3RHSA 5EKDA 2IJGX 2PXHA 3HZRA 2V0CA 3ZJUA 3I05A 4EG3A 3RJZA 3RK0A 4ZCTA 1GPMA 2CSXA 5IHXA 1MJHA 1F7UA 1H3EA 2TS1A 1WJGA 1N78A 1LW7A 2XRYA 1OD6A 2CYCA 1XNHA 3COWA 1BS2A 3TZEA 2DUMA 2A88A 3COZA 1MRZA 5TS2A 1RQGA 4FZJA 3CVYA 1N77A 1G8HA 3SP1A 1I6LA 2Z3VA 2CYBA 4KPUB 3INNA 4MUKA 5HUJA 3H05A 3ISJA 1IQ0A 4RUKA 3N05A 3CLSD 1N2BA 2J4DA 3SZGA 1KAQA 1UFVA 2EJCA 3K32A 2X1MA 2GOYA 3N2YA 1T6YA 2CFOA 3UMVA 3UOWA 3ZXIA 3IMCA 1KP3A 1NZJA 1MAUA 4ZT7A 3ZJTA 3H97A 4MW6A 4X0EA 4DDMA 3SEQA 4WSOA 4G5YA 1P7PA 3D6UA 1N2IA 3NBAA 2QUJA 3LE8A 2WSIA 3FY4A 4GRIA 1OWNA 1WXIA 3AG5A 4U8HA 2C5SA 4CT0A 4J75A 3A2KA 1XJQA 3G5AA 1O97D 3TS1A 2ZP1A 1IH8A 3L92A 1KORA 4EG4A 1COZA 2A1TS 3ILVA 5K0SA 1JGTA 2X0KA 4PBRA 2CT8A 2CV0A 1EUQA 1JZQA 4P2BA 1EFVA 1NYLA 1N75A 3DV2A 1KAMA 3IMGA 4DNXA 3X1JA 1M8KA 5K0TA 4ND7A 4ZT5A 3CLTD 4XSVA 3RBAA 3DO8A 1PFYA 3IDFA 4ARIA 1ILEA 3ZGZA 2EL7A 3C8ZA 4EG6A 4MAFA 1JHDA 3VU8A 1KKUA 4MQ6A 2YWCA 4CDNA 2QUIA 3PNVA 4MWCA 1TYCA 3BL5A 1WQ4A 4HPWA 2A7XA 3UC5A 4F3RA 1IQRA 1TYAE 1J20A 2A1UB 2CUZA 1MOPA 3KFLA 3ND7A 5H16A 2IELA 2VTBA 2CV1A 2BTEA 1WQ3A 3AG6A 3CLRC 1F9AA 2GKSA 2O5RA 3X1MA 1IVSA 1ULHA 1QRTA 4MW2A 4EG8A 2AKEA 2YY5A 3MUEA 2DEUA 1QU3A 1A8HA 1NUSA 2HMAA 5TGTA 3ZUGA 1F7VA 4ZCQA 3M5WA 1M1ZA 2DERA 5HUHA 4MUHA 3FOCA 3DLAA 1PG0A 1VL2A 2OV4A 3COVA 3LCJA 3HMQA 3CLUC 2QJFA 1Y42X 1JILA 5HG0A 4KR6A 1G59A 4L2IB 2PZBA 4U63A 2DXIA 5J58A 4I6GA 1YI8A 2VXOA 4ZCPA 3MLAA 1T9GS 4NAHA 4Q16A 4ZCSA 4U7JA 4OUDB 1VBKA 1H1TA 1IHOA 4K0RA 3TNJA 2AG6A 4H3SA 1TQ8A 3N9IA 1KH1A 1KQNA 3TQIA 2RE8A 3CVVA 4MUFA 4CDMA 5LFAA 1I6KA 1J1ZA 3CLSC 4ZT4A 5H7XA 3AIIA 2QUKA 3IOBA 3TZLA 4JZYA 1PFUA 4NATA 1N3LA 3IODA 1PFVA 4EGAA 1IQUA 2A1TR 2A84A 1QNFA 4ND6A 3DPIA 4PBTA 5TEWA 3U1VA 4DJAA 1MBZA 3G59A 1KP2A 4HJXA 2AZXA 3G6KA 3CVXA 1T6ZA 1H3NA 1O95C 5TEVA 4I6JA 5KCMA 2OQ2A 2WQ7A 1O96A 2QTRA 2JAXA 1QU2A 4NDAA 1F4LA 1VLHA 1N2GA 3P0JA 1MB9A 3QTTA 1N2OA 1NP7A 1FYDA 3PNBA 5J59A 1R6XA 3IUEA 4R2LA 1MB2A 1R6UA 5LM3A 2I1LA 3KT0A 3P0IA 3IOEA 2Z08A 4MUEA 5FNZA 3K9WA 1K92A 1WXGA 4EG5A 2DR2A 4R0NA 3RFFA 4MW4A 2QJOA 2D5BA 2NZ2A 2PG3A 3H99A 1EFVB 3N8HA 1NUQA 3FDXA 2D54A 4MW1A 4NAUA 1PFWA 1QQTA 1SURA 3MLBA 1O94C 1Q15A 1O5TA 1JECA 1KR2A 1R6TA 3FNRA 1JMVA 1KH2A 3PNYA 1PG2A 1N2HA 2GM3A 4EF6A 1NSYA 1GN8A 2ZUEA 4CQNA 3JXEA 3CA8A 1M8FA 4A91A 1EFPA 4AQ7A 3ZXSA 3COYA 1O0BA 4WNYA 1WOYA 4S1OA 5KWVA 3A05A 4NX2A 1G8GA 1Q11A 1MAWA 1EUYA 3AL0C 1KH3A 4AS1A 4MUNA 1QRUA 3AFHA 3PXUA 2A1UA 3SZ3A 2PZ8A 5F23A 3IVXA 2J08A 1GTRA 1QTQA 2V0GA 1NUTA 1TYDE 1U7DA 1V47A 1U3DA 1WY5A 4RPIA 1Q19A 2XRZA 4MULA 4ZT6A 3KT6A 3CVWA 1IFXA 3GUZA 1U0BB 3IOCA 4XFJA 4MVYA 2R5WA 4UZFA 3NBKA 3SDBA 3NV7A 2JA2A 1I6MA 5DEOA 2O8VA 2A86A
chains in the Genus database with same CATH superfamily
4OGFA 2D00A 3F8WA 3F97A 1YDGA 3JQ9C 3QUTA 4Q9DA 3GGGA 5JWHA 3WYAA 2FEPA 2OBBA 4KW7A 4E22A 4F46A 4JT2A 2VQFB 1EE9A 4BFWA 2ZR9A 4R1NA 2BP7B 2PS1A 1M0TA 4UOQA 1E6MA 4L2IA 2WIFA 1WRBA 3A70A 3L79A 2FFJA 5G0UA 3EZ7A 5K4AA 4RTSA 4E7OA 2FX5A 4BRWA 4MWBA 4ZOLA 3HQ4O 2Y1WA 4OGLA 1V4NA 1FX1A 1YE3A 2GF9A 4EITA 2P9ZA 2QQFA 2VXBA 4A2PA 2X5XA 1YC2A 3ESCA 4YFVA 1AZWA 3Q1LA 3LVFO 2A4MA 3C3PA 2BBTA 1Y5LA 4KOEC 3MYRA 4K03A 2G40A 3DBHB 1B2RA 2OFWA 1D9ZA 3H5NA 2COKA 3OO0A 3RRYA 1U1DA 3GJ7A 1M5TA 5C1OA 4ZN6A 5AI5A 4MKIA 2DF8A 3MK31 2NVUB 2PRKA 3AYZB 4M4SA 3B2NA 3UJAA 3WSWA 2A5GA 4LPSA 2C9YA 2D0DA 5C1IA 1N2JA 3TTXA 2R1TA 2AQIA 2X6RA 1KVRA 1STOA 4S2EA 5KNDH 1B8VA 2C3PA 1FSGA 2WSMA 2WZQA 4FMPA 4B7ZA 3FKJA 1LNSA 3H19A 3LT4A 4TVKA 3ZYCA 1WB4A 3OCXA 4LBYA 1KZ1A 4KUEA 2I8CA 2KLBA 3C3BA 3GQBB 5LP6A 5ALPA 4BBPA 2OEPA 2H5EA 3WLHA 2JIDA 2CNOA 3QBVA 5EJIA 5BT8A 4M54A 4FHFA 2QL5A 3OM1A 2VT2A 4D43A 5B5SA 1BXRA 1SKAA 3F71A 1TI7A 1U9YA 2X42A 4ZC1A 3C6XA 4EFKA 1KFKB 1YU9A 2WMNB 2XE4A 4QIHA 1JHZA 3H1TA 4IDPA 4RC9A 3IHWA 1EDZA 2PPVA 4QUAA 2NV2B 1GT6A 3MIZA 2H5IA 2QNIA 5MGNA 3F46A 1WU7A 1M2GA 2IODA 2IXBA 3CB4A 4KPGA 2VAWA 4HEJA 3PGXA 4RAQA 5ARCA 4EW3A 5LXTA 3B48A 5EEHA 4BN4A 5EFOA 5KX5B 5A9SA 4LZPA 1R5JA 3N39C 4RD6A 2ZRMA 4HWSA 4PNPA 4H4DA 3WKEA 1DJQA 5FOVA 2WAYA 2WM8A 3GMIA 4ZAVA 1DLIA 4JXZA 2P2DA 4PV7A 2OVFA 1E20A 4QXOA 3AEZA 2BGRA 2D2EA 3C8UA 4Q7KA 3WK9A 4R0MA 1L4NA 2O2IA 4DVGA 2X1LA 2PMCA 1LNZA 1TW3A 4EB6A 1WSBA 3KZOA 4PQEA 4OAQA 4M36A 2WHYA 2OT3B 3I5AA 2IIPA 1T3ZA 1O5IA 1YVDA 1Z2NX 4NESA 2D5IA 5JZ9A 3FZYA 1XB2A 2P3SA 2HBRA 2FR0A 2R47A 4P4LA 4YPFA 4GLOA 3TQFA 1YIAA 4GDFA 3FIUA 4FFLA 4UAVA 4ZEOA 4OX9B 3HYNA 1QH8B 2ZSJA 4Q7EA 2B4QA 2Q6IA 2XMSA 2QRNA 3KZCA 3O7MA 2L82A 2OOSA 4WECA 5FTKA 1BCRA 1G8PA 3NTQA 1T9GR 3TNDA 1NW4A 1G8KA 1RCFA 4FGZA 1GCIA 1XZHA 2BC9A 2PO5A 3EMDA 3LL7A 3NHWA 3OJWA 1PL6A 2JLCA 5JANA 1OPRA 2RH4A 2Y1KA 2XSZA 3JQEA 3PT5A 2REQA 4URHA 5J4VA 1HPLA 2HJ9A 3FPCA 1OX4A 3ABRB 5FTJA 1AO3A 1E6UA 2OENG 1RD4A 4G0VA 1JR3D 1Y5IA 2XQVA 1XZGA 1WW2A 1GARA 1JR4A 1QB7A 5FBWB 4AD8A 4KJZA 5HFAA 4DZZA 4HVLA 1UWLA 3IEIA 2Z6UA 3PNSA 3Q12A 4BMOB 4XRGA 1PT6A 3OFJA 3R3HA 4MZDA 2R11A 5TDHA 4QBKA 2WHPB 4TV8F 3RIEA 2X19A 2DBYA 5HJ7A 5L7WA 2ZW9A 1H3FA 4TLCA 3THSA 1QZXA 4TMZA 1QYIA 4TTAA 2PLWA 4OVKA 3RV4A 5I6DA 1BXGA 2X14A 3L40A 1SCUB 2XBLA 1Y7TA 1KEWA 3JQAB 4HHEA 1XRSB 3E8SA 4EZEA 3R9XB 3AUKA 1R5NA 3H42B 3RHTA 4R1OA 4BMZA 2QM7A 2BZ1A 4TTJA 4ARZA 1GZHB 5ESXA 1RR6A 4JELA 4W8HA 1FFBA 2I03A 4AWAA 5KNBH 4XVUA 3FZQA 2C4NA 4FFBB 1YB4A 4Z9BA 2DUWA 1EEXB 3IALA 4QICA 3K72B 2V98A 1YI1A 3TDNA 4BO5A 1S02A 3CEJA 2XZPA 2A0XA 5K3DA 3TK1A 4YWJA 2WZBA 4D0RA 5HKKD 4Q12A 3A6FA 3L18A 2AZ4A 1ARZA 4QUBA 3CUKA 1J90A 3SE7A 3TE7A 5C81A 1Z8FA 4J1TA 4N8SA 3L0PA 4IIUA 3RIMA 2P4HX 2GRUA 3PDHA 4KQFA 4TXHA 3HBMA 4EIWA 1HE5A 3RJ5A 3S2SA 4I99A 2WF7A 4I3GA 2CSXA 1HGXA 1AURA 4XQGA 3QHAA 2OMEA 4MRVA 3THXB 5F2KA 1KJNA 1VZ2A 1KGSA 4P7JA 4TXLA 1BQEA 3VR3A 4N5LA 4E2WA 3QBJA 2PZMA 4J3NA 3HYRA 1PIWA 3KE8A 5JXIA 2FEXA 3PUVA 3T4UA 5TV2A 4XYLA 2ZTUA 2ZUVA 2G3YA 1JEAA 1P81A 1PDOA 1X1SA 3O4RA 1O03A 4GP7A 1JMYA 2HQ1A 1BMQA 5JD3A 4B5KA 2Q6OA 4RQBA 4W5WA 2HXGA 5F5NA 5HIMA 4QVIA 2QWXA 1XAHA 2LUOA 3BSSA 5JS1A 1R0LA 1QQ7A 1FVOA 2D2IA 4NNOA 5I7RA 5I9TA 3EFEA 1JHUA 1JA9A 3CLSD 3QX9A 4R1TA 4J16A 1RYNA 4JEMA 2ROQA 3EGXA 3FNEA 2IHVA 4CMIB 2RIPA 3IE1A 4JB8A 3R6GA 2AFHB 1R1DA 2W6ZA 4S0XA 3CGGA 2JFYA 2FWNA 2DMRA 1JW9B 1QIHA 4LYJA 5HJ2A 3PJEA 3C74A 2F3QA 2XUPA 2GYVA 3ZJTA 1R00A 4BP8A 4Q15A 4YEDA 4LRYA 5AQEA 2ODQA 1C50A 3CF2A 4MV8A 5K8JB 1AT1A 1AUQA 2WKSA 3FCUB 1UPUA 2QUJA 2WI8A 4OCZA 3ESQA 4ZI7B 5F1KA 5I51A 3NVKI 4XDHA 1HYEA 4Z7NB 3SXJA 4XIGS 3R77A 1MFPA 4GKKB 3PWZA 4ZWNA 2MYNA 2V7PA 3RREA 3F0TA 4NE7A 3DNFA 1IH8A 3UW1A 3V1TC 2WLSA 1OIVA 3RT1A 5A6SB 3B1KA 2PANA 3GJ0A 4F8YA 2CT8A 3MCUA 3M6VA 2X0KA 2WPDD 3LPLA 2JAPA 3I9FA 2AXNA 3FPLA 1EFRA 1CRLA 1EFVA 3C7AA 4DCGA 4YAWA 3LRPA 3QTLA 4NNPA 4RELA 5HKBA 5LNK6 3OZSA 1BVHA 2RH8A 4IJWA 3BRSA 1M8KA 4H6WA 3ZQUA 1WPQA 1W0JA 3CNNA 5LUAA 1QJ4A 1WV1A 3BE6A 3CSUA 3G1WA 5AUQA 1KK0A 2XVMA 3OWXA 3R6DA 1OXMA 3N6XA 4UJ5A 5EJ2A 2OQVA 3VUFA 3AJEA 3ZWPA 4ZK6A 3D3WA 4KJXA 4YROA 1PZEA 1MVNA 3FFWA 2MCFA 4WEOA 4ETMA 2VJOA 4J0CA 2O5CA 1N4AA 5GIOE 1CVIA 2AN9A 5DW0A 5TJHA 4BKQA 1RBMA 3E05A 3H0CA 3QW4B 3VXKA 5A3SA 5BQFA 5KWVA 5F33A 3LLUA 5LBIA 3TZHA 3MWYW 1H2ZA 4LFBB 2HBZA 1IC6A 4K81B 3HTXA 3TI9A 4LXTA 3RUCA 2IHNA 5ES4B 1MOPA 4NPAA 4MP6A 3CX6A 1GA1A 3TLKA 2E48A 3BK1A 5IM4A 2Z2YA 4R7TA 2AJLI 2C2HA 2ZRIA 3K31A 4IEIA 2QN7A 1GL9B 4AJLA 2AQHA 2EEZA 2QV7A 2YXPX 2ZRFA 4KAJA 3D81A 2G5GX 2GQ0A 3HUDA 4RK4A 3AY7A 4E94A 4Q1DA 3K4PA 1NOIA 1M2OB 1XDUA 1UK9A 1RHKA 3EUAA 4OFWA 5CYPA 5DT2A 1D2NA 3H75A 4BJ6A 2XOKD 1JG1A 4JP2A 4RESA 1ZJ6A 4KH1A 3CC8A 1KFBB 1T1SA 5L51A 1NZDA 2MR6A 4WLNA 1G5TA 4H7FA 3MWEB 4CIAA 3DLAA 2Z9BA 3SIRA 1EGQA 1Z3IX 4FS8A 1U8ZA 1QGZA 2XUDA 4KV9A 4ZXPA 2PNJA 3TCXB 1ZNYA 2RGAA 4NU5A 4UTNA 3FOFC 1H2WA 1ZUIA 3L0IB 4AO7A 3CLUC 2XTMA 3DAYA 3U60B 3EGWA 1QKIA 4RK0A 4TLDA 4KE8A 4MPPA 4Z4FA 5C46F 1PR2A 3QWFA 1I5EA 5KVAA 3ZWMA 4OMFG 4CQMD 1QPZA 1U63A 2FJUA 1ZOIA 2IKSA 3O3CA 1PD0A 1QV6A 1T35A 1FP6A 2IEIA 3OCUA 5IT9A 1II8A 5A5VA 2VAXA 2WE7A 2YW2A 4ZRNA 3CH7A 3AP1A 2RHJA 5AJUA 1AGRA 2C8VA 5B53A 1XMSA 2AN5A 3DL7A 4XI9A 3AI1A 4ZCPA 2CVQA 2VJAA 1AO0A 5GY7A 4O4HA 4TYPA 1B6RA 5L7YA 1TZMA 4Q3KA 1OCEA 3UFBA 1Z4IA 3WBFA 5ICSA 4UDOA 1UEXC 4UQPA 1WM1A 1CY0A 1HO3A 1S0UA 2GBPA 2QL9A 5EMKA 4QZVA 4L15A 4EOGA 1ZM7A 1P5HA 1T8UA 4AZ3A 2P6NA 2XWJI 3K1AA 4EO4A 2O4CA 2AC7A 4HDMB 3NG1A 3ZD8A 1S3IA 4EUNA 1MZVA 2C92A 5G3ZA 5AM4A 1CB0A 1LBEA 1PL0A 3HO8A 3TW4A 2IZOA 1RVV1 1PYOA 1N6PA 5CTJA 3KKEA 3PD7A 4UD6A 4AUNA 3BGDA 2D0OB 2ALJA 1NXSA 2L0XA 3ECAA 3M0EA 3EBLA 4L4ZA 2FHPA 4MA4A 3B5EA 2GD0A 5AOVA 3NOXA 3SQLA 5I01A 5KJFA 2FUEA 3RT7A 1XCMA 2GO7A 2EL9A 2HEIA 3HFGA 1LWOA 1RIIA 2A84A 3IE2A 3DPIA 3SVZA 3U26A 4PBTA 2MYPA 5C5EA 4F5WA 1BIFA 2FP3A 4TOIA 4XPIA 4RGVA 2C7RA 3SBXA 1PG5A 5TMPA 3CVXA 3IVMA 4MWSA 4ZRMA 1YZQA 2BSAA 5A0FA 1C9MA 5DULA 1ZZEA 3VZRA 4EHHA 2NSDA 3T61A 1WMEA 2RHMA 3QJ5A 1UIMA 4XLTA 5C80A 4KWCA 3E8MA 5KDOA 4U7DA 3AETA 2HMVA 4RMNA 1N32B 1V11B 4P2GA 3UCFA 3N74A 2VTKA 1GAQA 4HDNA 4I4LA 3E3OA 3GVHA 3PQ3A 4I4CA 5FI0B 1CYEA 1QSGA 1KJIA 4G36A 1D2GA 1JHYA 1PJSA 1D03A 4LNHA 2ZYWX 4O33A 3FFTA 3G1UA 3BRCA 3D7SA 2YQ5A 4HH3C 3WY9A 4WNCA 2JIQA 5JNWA 4IIVA 1V3VA 1CIPA 4KQJA 1E3MA 4JHLA 2JFFA 3BN3A 4CIVA 2FWJA 3QENA 2P2SA 1CQJA 4BX0A 3C1UA 1L6IA 2COUA 3J7TA 4GDMA 1QX4A 4MX8A 3IRUA 3ITNA 4EG5A 4LE1A 1GU7A 1UXGA 3LSTA 2XNDD 1KS9A 1I3LA 2I6GA 3BHMA 3T1HB 5AW8A 4FKMA 3LIIA 1AS3A 1JR3A 4HUTA 1I6WA 1MTZA 1E98A 2BFPA 4RW0A 1CZOA 1H2HA 4XR9A 3LQYA 2GJKA 5HTOA 2MYTA 1C9DB 4NAUA 1Y80A 3Q3HA 2OB2A 4ND1A 4ZA2A 1L4MA 1F2UA 1BN7A 1U0NA 1PNOA 5HZKA 3ORSA 1OIWA 2OD2A 4XTCS 2BR3A 5KX5F 2BGNA 2IY8A 2Z1NA 2GLXA 3AESA 3GV0A 1G3QA 4UQOA 5F4BA 3IQEA 2ZXFA 1NXOA 1VECA 2IYVA 2PL3A 1X92A 3RS3A 4A1OA 5JRZA 4M1ZA 2VBFA 2CNLA 3PIIA 3SHOA 1WMAA 5BSRA 3UT5B 4S1NA 3B1JA 4G2NA 5KOHA 3OIVA 3HDTA 5D5PA 3BQNB 1UBSB 2ACKA 1LPBB 2R6GA 4RVSA 5A2GA 3FZNA 3KK0A 1E9FA 1CZNA 2ZIGA 3OZRA 3RC1A 3TM4A 5IJ9A 1CZUA 3DBLB 3M6AA 5DYIA 3OPYB 5FTMA 4A9AA 4OGWA 1CY1A 5HKKA 5K6RA 4MHTA 2XHZA 3NRBA 5FI1B 2AIRA 1YCGA 2HUNA 2RHBA 1E59A 3SZ3A 4KHZA 5F23A 1D2MA 2NUBA 3H3JA 2FJ0A 1GTRA 3L05A 3K0AB 1POXA 4CM7A 5C2JB 5GADl 3MCAA 2OCLA 3QNWA 3QYPA 2BGKA 1X1RA 3TSAA 5GP1A 5KTOA 2HQOA 1P72A 3CCCA 3HADA 1H2EA 2XRFA 2H0AA 2Z43A 5JFGA 3PX7A 3X1DA 3EAFA 1PKEA 2BLNA 1G5FA 2J4FA 5FD8A 4C0LA 4KIWA 4RQAA 3W5CA 2CFIA 3NBKA 4R2WA 4M7RA 1JXMA 1QGOA 3EJWA 3HU2A 4GI3A 2JA2A 4IJ6A 1MXHA 3FPHA 5EZQA 1ZOOA 1ULBA 2BFDA 4EGJA 4C6SA 3S7TA 2BW0A 2AA3A 1G7SA 3ASZA 1TLTA 2HCTA 2O2GA 5LQUA 2VHYA 1Y9ZA 2ZWOA 4QTTB 5DGHA 5JXGA 3FJOA 2C99A 2FMTA 3QH4A 1U5BA 5H3HA 1KI1A 2YBDA 3WO1A 1C7RA 4FE3A 1ADBA 1NQXA 5FRDA 3RWMB 5JISA 5LU9A 4B33A 4Y2QA 5IUKC 1UUFA 2H9AA 3SMVA 4DPMA 1OZ0A 1P7YA 1FNDA 2PZEA 3GOQA 1DOAA 5L3RA 2OFFA 3B2QA 1JKFA 4OUDA 4A73A 5AVWA 4GE3A 3E27A 3RVLA 4QVGA 2QTTA 1X8XA 5JNUA 1MV5A 1V1RA 1Z6AA 4NCJA 1DC3A 4RV9A 3R5XA 5I47A 1M6VB 3HWRA 2Z09A 3OEYA 4MGZR 3PR2B 3FPBA 1XQYA 2EW8A 1IXKA 2SKCA 3HP4A 1M2JA 4Y0VA 1J9GA 3ZK8A 2O8DA 2O7SA 2WTMA 2NSJA 3G7UA 2AXPA 2VNJA 3GLIE 3MBIA 1I2CA 5CDHA 1ZU5A 4GZ6A 4NONA 5FJIA 4HX5A 2AJ8A 4LMBA 1QGUB 1XIVA 3UK7A 3KQTA 3OOEA 4JYBA 3TBHA 4B8YA 2PX4A 5FJJA 3B1FA 1FUKA 2IOFK 2WUGA 1Z6XA 1HTTA 2INGX 1E2UA 5KYYA 4JGBA 4BZXA 4NBNA 3MHPA 4F9EA 1YWGO 4H7JA 3JAWB 2WPDA 1Q57A 4YRFA 5IKEA 5JOQA 2HNKA 1E3IA 3GWZA 1GOTA 1X2BA 4ZI5A 4CEJB 2V7WA 4L27A 5HKAA 4CHTA 4ZP1A 1LI7A 1VKHA 2AXQA 4F5DA 4WV3A 5T57A 2LDXA 4KR9A 3S1SA 5HW0A 4F91B 3Q5GA 3HM2A 4LYHA 3T7IA 4JITA 1KQOA 1OQAA 2QTMA 2NQ8A 2XADA 4RF5A 4DEVA 4F96A 2VC2B 4HC4A 2RMKA 1YIDA 5JHGB 3HZOA 3DBOB 2RI1A 1VSTA 2ZUFA 4MKZA 5J2TA 1HSOA 1QHIA 2RBEA 2BEJA 1RHUA 1C1DA 4KL8S 5J4KA 1OF1A 1DRUA 3RABA 4DZTA 3AKZA 3RSZA 3K6RA 2FQ1A 5FBRB 4EG1A 4P53A 3GVIA 3V8BA 2O3JA 5FBZA 2RG7A 3LT1A 3D4NA 4NOJA 4F7WA 1N7IA 4RULA 1IRXA 4ZQEA 4DA4A 1WXFA 4G5FA 2R8ZA 3BJMA 2PH7A 2ZS8A 3J7AC 2VJLA 5B3JA 1WB6A 2XMQA 2PVCA 4EECA 4GYYA 4AW9A 1FPQA 1V9CA 1G19A 1ZXXA 2B99A 4L57A 4L4UA 4ZI7F 5ARBA 4IX9A 5CMLA 2ZPUA 4O08A 3ED1A 5C53B 1LU9A 2QBYB 2WILA 3MCVA 1USWA 3VPFA 2W0SA 3HWSA 4URYR 4M0DA 2XOKA 2VAPA 1G3MA 3WLPA 4AMVA 5CA1F 2JHGA 3PC2A 4C1BA 2C58A 4D96A 1VA5A 2V9PA 2ZBVA 2G8NA 2YVAA 1C41A 3BCUA 3LBFA 4GIBA 4PLPA 4UU8A 5FWAA 1R10A 3ABSB 4FOPA 4IGIA 2RGNA 3CPSA 3HKEB 3UNXA 3NMUF 4YDSA 1SIWA 5JJCA 5L3QB 3OZBA 4J76A 3I1YA 3T3OA 3NQ41 1Y5RA 4UM5A 3HN2A 1E99A 2WYWA 4Y2RA 3OTWA 4CQMA 2VF4X 5E7JA 3KL4A 3KYDA 4BYGA 1A9PA 2ID4A 1ADCA 3DEJA 1FBNA 5CXUA 7GPBA 1M0SA 4DLYA 4ZC8A 2WJGA 1P7ZA 1XTQA 3HY4A 4GLFA 2ZCVA 4IDQA 4J0IA 3ZHOA 4EG3A 5KKAA 5CEJA 2Y0EA 3D7RA 2CHVA 1UOOA 3DHNA 1NBAA 1GPWB 3QTBA 3HFJA 4BCDA 5ADUS 3R6TA 4GICA 3RVJA 4CPDA 4MS3B 5AVZA 4RTMA 4B79A 3EIEA 4PQGA 3R0ZA 2HT6A 3PUIA 4UVGA 3FNFA 5KTRA 5CIYA 3BWMA 2QN6A 1EGMB 1N6IA 3OIFA 4B45A 4PXAA 4YY3B 2UUAB 1NC3A 4EX7A 5ITWA 1C1YA 3RUFA 3UATA 1X6VA 4ZV9A 3GRKA 4ND2A 3FTDA 4W7SA 4J1SA 4LMAA 1IUNA 3MTJA 3LKBA 3S2UA 4KKVA 3O92A 4OQMA 4DEXA 5LWQA 1XI2A 5FO1A 3SK0A 2XNJA 1Y63A 2C98A 4ISCA 3TNYA 3MMZA 5ITZA 3G0CA 4MTLA 3VR4H 2ZWIA 1J70A 5CP8A 5K09A 3RD5A 4YRSA 2GYWA 2JRLA 3TL6A 1U28A 4NOMA 3TPFA 1CDDA 3CZPA 4YR7A 2VF2A 1CW2B 1PNTA 4ZVTA 1LTKA 4NBUA 2UZ3A 1BH2A 2IJGX 3VPXA 2DPMA 1RVDA 1YDEA 5DIFA 3TFQA 2F64A 4YJ2B 1CUWA 2RJOA 4ID9A 3TN7A 3HBAA 2HPAA 1U2GC 4DG9A 4FYVA 5JATA 4D0SA 1Z36A 3CY6A 3WL3A 1G5RA 1FDUA 3EEQA 1WJGA 1ABEA 3EFOB 2QMUA 1Q12A 3H3XA 1YQTA 2C2MA 5EC8A 1RWNA 3KXLA 2GNPA 4Q00A 4HNRA 3KQMA 4R3NA 1J0XO 2H8KA 1HF3A 2VYQA 3OEED 1ULSA 4K1XA 2RHGB 4P58A 1UDAA 1H0SA 1JQAA 1XDDA 4A8JA 1G4UR 6NULA 1CS4C 4LJ8A 2UZAA 5IF3A 3QRWA 2OL4A 3GJXC 1U0SY 2PH1A 3ADBA 4LRXA 2CF5A 2JW5A 4QHTA 3NALA 2RHOA 1T0HB 5EL0A 4ESOA 2QAGC 1H5UA 1YV9A 5IXYA 4WN3A 1GU1A 3AF1A 4FR5A 2XNDA 2EJCA 2H1WA 2QORA 1J97A 1RAEA 3L4BA 4UPEA 1IIRA 2RAUA 5GPBA 1SPBS 4BJ3A 1QK3A 2X1MA 3U7QA 5FV7A 2Z1DA 1RTTA 3SXPA 5DXFA 1XPJA 3S1AB 2Q2VA 4U4AA 1DKLA 3WIBA 4JI6B 2R00C 4BKUA 1GSHA 3KV3O 4ZT7A 4WCFC 3VVLA 4ZCLA 3EIFA 2RG1A 2IS1A 3TCKA 4JVMA 3E5NA 1VDMA 3TX2A 2I2XB 4Q3LA 4MVJI 5CLIA 3UXEA 4WXHA 5AW4A 4U2EA 5AKXA 2M32A 1VIMA 2FWAA 4TMYA 2BBWA 3HCRA 3JZMA 4KGVA 4TWJA 5JNTA 4S04A 4ZQGA 1RMYA 1ZH4A 3UVEA 3S99A 4CT0A 1VE6A 2PVPA 1JNXX 4MUBA 3ZS8A 2AMJA 1WKCA 4N8EA 4B7AA 1I4EB 4F56A 2AQ8A 1DDGA 2W83A 4ZVUA 1TGYA 3HU1A 4LZZA 2OG2A 2OYRA 3Q7SA 1Y6RA 3ORQA 1GGJA 4CTKA 3IJEB 3PXBA 1EHIA 4REMA 1GFSA 3O4VA 1R88A 1KVTA 1JKJA 4IUCS 1BE1A 3DC7A 3UYKA 2PTHA 2ODTX 3AXSA 1S1MA 4RSHA 4EVIA 1GFWA 1IEXA 1NPDA 1TTTA 4GXRA 1UC5B 4C08A 4QAQA 2WFZA 2XCSB 3FBWA 4ESEA 1QTNA 2JCSA 1WUKS 1MAHA 3G5UA 4TVOA 5LQSA 4HQKA 2V7UA 2LKDA 2P2CA 2HY7A 3LK6A 4U6QA 4XA8A 2CBGA 4ZDJA 2VHUA 2YVUA 1ZVJA 2FA9A 4D02A 5IBQA 3VU8A 5MFPA 2Q45A 2RIRA 4K6OA 4KIFA 4OGKA 1Y8CA 1KIFA 1P1JA 1SM4A 3HWX1 2QF7A 3I2JA 3EC2A 2DR0A 3IRVA 3PKIA 1A5BB 1CY2A 1V5WA 4MWCA 4CKYA 3B9RA 3LAWA 4NV0A 4U2FA 3K0BA 2PGXA 3MW8A 5F35A 3GLHA 3KFLA 1Z7WA 2GAAA 1K2VN 2JH8A 2QTVB 3SICE 2UZIR 4YJHB 4GBED 4U2KA 4G0ZA 2ET6A 4WZAE 3MAGA 1T1EA 4GT1A 4ABTA 3WP1B 2PRYA 4C0QC 4JBYA 2V3CC 1GL7A 3WWYA 5C18A 4OHYA 3CZAA 3FYUB 1M6WA 3IPRA 3UAYA 2HA0A 1U04A 1UDWA 4NYJR 2O3TA 1NUSA 2JIBA 3HEAA 4PC2A 4RLFA 4BZPA 2ZWAA 5TGTA 5JH7A 2Q1WA 2IYWA 4LSGA 3TQHA 3YASA 2W71A 4OXQA 1RZ3A 1CQIB 4O02B 4YAGA 4CCAA 4FLMA 4CF3A 4ECEA 3BE8A 1YKGA 1PVVA 1DRVA 2F1IA 4J9VA 4L8GA 1U90A 4RHUA 4UNNA 1WETA 4H9GA 3ND9A 3O95A 1KY2A 1NQVA 1A5TA 4M1YA 3PQ4A 1YR2A 3VNBA 1KAHA 1WBJB 4IVQA 4LRUA 4NKRA 4JI5B 1L5HB 2PZBA 2HGSA 4G09A 3ELUA 4XCVA 4OKNA 2Q29A 1N6HA 3OMWA 4JBGA 2ADOA 4DSNA 2O7QA 4DUPA 2D7DA 3GVPA 2J9YB 1ISJA 3Q7EA 4TV9B 2CLEB 3H86A 2G09A 1V6AA 1H93A 1ETUA 4PRLA 2OGUA 2ZRHA 4JUBA 1QYCA 1VM6A 3DR3A 5JI3E 3W34A 1GL6A 2O8CA 1TAGA 3LRXA 5K2OA 3V42A 4TUYA 4G1BA 1DB3A 1FS5A 5U4XA 1UK8A 2AYZA 4MS4A 4ZQHA 2PZGA 1HQKA 2C9BA 2F3UA 3SC3A 5TLSA 1PHPA 4XQCA 1Z73A 3P19A 4HAUA 3H9QA 3RS2A 4MUFA 4MQFB 1HNWB 1OVGA 5JEEA 1QV9A 2JCGA 1NJ6A 5BVGA 3FRIA 1BOOA 3Q2IA 5JZBA 1N6LA 4IG4A 1D6SA 2UVPB 2Z9CA 4REQA 3BWYA 1GSAA 1MKYA 2Q9AA 2ZAOA 1DWQA 1ZJ4A 4NATA 3WNDA 4CRWB 1RHMA 1YRYE 4OUKX 1IEWA 5JDIC 2J9GA 4RKWA 3G6WA 3RTGA 2VQEB 1UKYA 1ZUWA 1W581 4ND6A 1VJTA 3BULA 3M6XA 3CIFA 2ZS9A 4JROA 4NXMB 1PNRA 1JU9A 1AKUA 1Q50A 4C0SA 4UMEA 4DJAA 1Z82A 3BXFA 3KDAA 1RPTA 1F6BA 4LV5B 2NNLD 4YC7A 1PQUA 2FNAA 2DRIA 2MWMA 2NSLA 2B1JA 3R7NA 4LFCB 3SJBA 4C4OA 1KMNA 4B3IA 2ONYA 4M53A 3QSGA 3QXJA 1OV6A 4RVUA 4DCNA 3O4JA 3EQ9A 1OYVA 4CKZA 2X8WA 3LS2A 3OEHD 2FW7A 3MAJA 3C6QA 5BYJA 5AK0A 2AC4A 1U2SA 4J94A 5IH7A 4FJ2A 3P20A 3R7AA 1YVEI 3PNBA 2ZRGA 4LPKA 1I4WA 3OJEA 4M7PA 4TL7A 4R2LA 4ETWA 1X8KA 1E0KA 4JLNA 3VZDA 4B7UA 4PYIA 5EIHA 4KDCA 3PNOA 3TR5A 4E5VA 4PR3A 3CEAA 1SVLA 2ZROA 3PEFA 2WWYA 5KQRA 4Y3UA 1NDQA 1ORTA 4X1IA 2IX9A 4UDXX 4DIOA 1K92A 3D64A 2QD4A 4TPKA 4QYMA 1R4AA 2VLBA 2YQZA 1UJBA 3G2KA 4RVFA 3S28A 2K2QB 5AM0A 1ESMA 2NZ2A 5TPWB 2GR9A 2HADA 5C9ZA 3TVTA 4P3NA 1ZD4A 1NRXA 2QRQA 3AEUA 1JUDA 1Q20A 5C31A 2BKLA 2VXYA 3OLVA 2W5UA 1VHLA 1Y1PA 1ZBDA 1CF2O 2R66A 2ZEJA 3OIWA 3AR8A 1E7QA 3JVEA 4P86A 5TPZD 4OY3A 3K30A 4Q19A 5FPPA 2PKXA 4M1WA 1M74A 1Y8RA 3V8VA 4BMVA 2BFBA 1J22A 3NYRA 1MMFB 2H6EA 5ILGA 2WJIA 4U6SA 4JBLA 1X7YA 2XDWA 4PO9A 4BFYA 2JVJA 2XWSA 1T0JB 2ZULA 2VUHB 1OXXK 3KVNA 2QG6A 3GH1A 1CE8A 2I65A 1ESZA 4WOCA 2X7XA 5KYWB 3EXHA 4D9FA 1KYTA 5B2EA 4RCZA 1TVCA 3A05A 2X86A 2KMLA 1YE8A 2QY9A 4GOOD 1Q3KA 4KITB 4XQ9A 2F1JA 1M1YA 1GKKA 3TDKA 4P83A 1ORWA 4FBGA 4ND8B 1Y1SA 1X94A 3PFIA 4UE6A 1M76A 3L4SO 4CYMA 4DQ0A 2E5LB 2PCLA 4K9OA 4Q4CA 3ZDDA 2J0UB 2Q3HA 3NHMA 4LVCA 1CUEA 5GGXA 4BVBA 2OXIA 4ABYA 1PTJC 2IIVA 2ZB8A 3M49A 1SUEA 3IC5A 1VHTA 3RF7A 3T3DA 1F0YA 2EWVA 2ZUWA 1VL8A 3LOPA 2RH9B 5SZJA 1MGPA 2OAQ1 1FVHA 1QKJA 3C7DB 3O2JA 4Z0TA 3RS0A 5DV9A 5FADA 2JLSA 5T8KA 1K4YA 1ACJA 1Y3AA 1SBZA 3EIQA 4DT1B 4DMRA 3B9BA 5EWJA 4MCHA 3LDAA 2R5WA 4BP1A 3C5EA 3S55A 3GZNB 3ESZA 1H23A 1ZRNA 3OEEA 4S35A 2WJYA 2X8LA 1DC4A 3SFTA 2IOQA 3EGIA 3MVEA 4S1PA 3JVIA 1M5UA 4F4UA 2C9DA 5ALSA 4QYSA 2OPHA 4XJVA 1KFJB 2OYSA 3EG9A 2JLQA 1K9SA 3JYPA 1SCQA 4JT4A 3UYLA 3DAPA 3N3AC 1PJQA 1VBMA 3AEXA 5KPDA 5FA6A 2BUAA 4KFSA 2WV9A 5H80A 4B34A 1I9GA 1T2AA 2WWIA 5JSFA 1IBKB 3WRVA 5E4YA 3ANLA 4KXUA 4EUKA 2OHGA 2HU8A 3IPXA 2I1VB 4TMFA 4YV7A 3ND6A 4IIGA 2IL1A 4F9TA 3OC0A 4MS1A 3FTEA 3OE1A 1YC5A 4ZQIA 2J7KA 2X23A 3AHJA 1S2DA 1T9KA 2ECKA 2P5SA 2QN9A 3PSHA 1LNQA 3S8MA 3IEKA 1FTGA 3NHBA 4RCVA 4CKBA 1C0LA 1TMYA 1WPRA 4GPBA 4F3TA 1P2VA 3AF3A 3OUUA 4CR6A 2AMFA 2VFAA 3FDZB 3PVZA 1U8TA 4FYXA 5IUJC 1LV7A 3P9ZA 3LP5A 2O8CB 1T0PA 3RRJA 2XNSA 3W90A 3VMMA 2EATA 4E32A 1YGYA 1Q0PA 1IPHA 1F2TA 4D9BA 1Y7HA 1M8JA 1FMCA 1USIA 4DAEA 1W44A 2ISCA 4FHEA 3G7NA 3NWOA 4K3UA 4KMOA 1DQRA 3FFXA 3RRBA 1ZBQA 5ER6A 5EG5A 5IJWA 5K3OA 1DO2A 4RIGA 5A1JA 3P27A 1U0EA 3ZDFA 2XCOA 4JUFA 3U4HA 4HWKA 3WGYA 4TXMA 4KPUA 2FEKA 3OZCA 2QSYA 1NUPA 3CGWA 4BPBA 1TO1E 2FXVA 1AKTA 4MGHA 5JUWA 1GAXA 3OZDA 2C2BA 3CYFA 3ILXA 4DQKA 4O3MA 2QD1A 3I37X 1NHGA 2ZRAA 4L4YA 4PLWA 2VJBA 4XOIA 2O8FB 4D9KA 4NYJQ 4E1AA 3GJRA 1DCKA 3KUDA 3Q9SA 4HZUA 3RIXA 4YO8A 5K0LA 1HSZA 4FWBA 3VKGA 1GLNA 2VWHA 1SXHA 2PSHA 5LIPA 3B1WA 1LTHR 4YT2A 1L7RA 1O6GA 2OYCA 4JJAA 1N1GA 1A7UA 3LT2A 4G5HA 1NMEA 2PEYA 5ADHA 4G0NA 4OO3A 2VDWB 1FDSA 4J0DA 2R7LA 1Z08A 2FZCA 3HV0A 3LECA 4N7RA 4NZPA 1NYRA 1LSJA 2RC6A 1XDGA 3DMPA 4Q6BA 3SKVA 3UENA 4N6GA 4EHDA 3OQMA 4YMIA 4PAGA 1FK8A 2VJCA 3CV3A 2IF0A 5E6UB 3REGA 5J4LA 4PG7A 5U4QA 4QUJA 5L8VA 4ID3A 3AJ9A 4YS6A 4YALA 3TIFA 4R31A 4KR7A 3PR3A 1P1KA 2QNRA 4TQAA 4C0HA 2CFCA 5KC9A 4DCTA 1QG4A 2J3EA 3FYHA 2DUNA 1JFVA 3ESRA 3M6UA 2C78A 3EPKA 4LYFA 2BI7A 1KRWA 1S5PA 2ZWVA 4ENRA 1C80A 1EVKA 1G55A 1OLUA 2O07A 2YZMA 3LT5A 4JLUA 1RE1A 2F3SA 3DWGA 3O3MB 4QRDA 4GF5A 3RSGA 5JQWA 4H17A 5FYQA 1WUJS 4W5JA 2ZJ7A 1AN9A 2VUTA 3ZY4A 1G20A 1ESEA 3SNKA 1R8QA 1B7GO 1UFQA 1L4HA 2UXBB 2JAHA 3OCJA 1Q0SA 2KB0A 4RJ2A 4V0ME 3L8ZA 4URWR 1Z63A 1GDDA 2XTAA 2I1QA 1J56A 1JHAA 3K0SA 2GS9A 5CLJA 2CJWB 3KKQA 2UYCA 3NBYC 5PGMA 3F3MA 4ARCA 1ZW1A 3SSAA 5E6SA 2B20A 2PS9A 2E21A 3G17A 3QE4A 3R41A 4LRWA 2SNIE 4MHOA 3DE4X 1X38A 3FMVA 2ZT5A 3OQPA 3PHCA 2H1SA 4IDCA 1YJ5A 2BDUA 1CR6A 3FGZA 3F5FA 2IZ7A 3H5OA 1X1CA 3S8EA 1QVAA 4R2MA 5CCDA 4KN5A 4KACA 1A9QA 2Z2JA 4JQSA 2AG1A 3AVYA 4DIFA 1PZFA 4MRMB 1JIKA 1T10A 1AVTA 1M10A 2H2HA 2WFMA 4DMKA 2UUOA 4ZYVA 4DCUA 1FFCA 4R8MA 2GPNA 3MINB 1HFJA 1ML3A 3DFMA 3LYUA 3RVKA 2WFLB 2RARA 4ZT2A 5AI8A 2OGTA 4FJ0A 1NN1A 4NHOA 4YP0A 3EEIA 4DIKA 4WACA 2ADMA 5LYYA 5REQB 4GZLA 4IRMA 4F21A 4YRGA 4L73A 4Z8XA 3TXYA 3VR6D 2G72A 3MMXA 2IH4A 2H17A 2XWQA 3AUSA 5KCZA 3M6MD 3IPLA 4KVAA 5JD5A 2AR9A 3TOXA 1TYEB 2VZ8A 3NBUA 3P9KA 3BSFA 1P4RA 1TD9A 2YN0A 5NLLA 3SG0A 4BY9E 2HNBA 2ZAGA 4WY2A 4LF5B 1RI3A 3CB2A 5HRCA 1GYPA 5FUBA 4P3KA 5BN4B 5CLLA 1YA6A 5DPMA 3OTGA 3OEHA 4EELA 3LUAA 2ZXUA 4F97A 3COPA 3AUFA 5FQOA 2Z4SA 2XE7A 2WJZB 4ENPA 4IKPA 3W5DA 4NU0A 5E95A 1OJ7A 3T8YA 4B4KA 1XD2B 1A9RA 7REQA 3HDHA 2ZU6A 3U4CA 1J2TA 4HLUC 1G8HA 4YJGA 2NZJA 1EGAA 3WQBA 1V16B 5AHKA 4PYQA 4TRMA 4AMZA 4G5GA 2V9ZA 4FFVA 1SO8A 1NBIA 2A9OA 1P18A 2PSEA 3O73A 4PANA 4RUKA 5CTAA 5BN3B 1C4XA 2N75A 4J4TA 4X00A 4ZZ3A 3ZHCA 2N42A 3NOQA 1ZAYA 3TQRA 3RAEC 1P2GA 3P96A 1DFHA 1P8JA 2MYUA 3F7OA 3TINA 1LK5A 1ORVA 3HABA 2FN4A 4JEUA 4DRZA 1CLUA 2Y1CA 4NU8X 3Q9LA 2FPPA 4O29A 4DYDA 5KNCH 3H97A 4HV4A 4PZPA 4XUGB 4PC7A 3DSRA 1ECCA 3M5CA 5TPZA 4OB7A 1DAPA 3D6UA 3LX8A 3L5KA 1TVKA 1O77A 3LE8A 3PSAA 1CY7A 3M34A 2WTXA 4Q01A 2PU5A 2REBA 3JQ8B 3FTPA 3AUTA 4RZ2A 1C3EA 5KYTA 1JEYA 1RABA 1OFUA 1T9CA 1VTKA 1Z2DA 4TQ9A 4LOLA 2I76A 4I3HA 2PFKA 2PQ0A 1DTWB 3O7WA 2XGGA 1TU0A 1OIXA 1T24A 4IWYA 2J6IA 3GP5A 1OROA 4RTJA 1YBAA 1EUQA 3UCEA 4D56A 4B6SA 3ONEA 3FW1A 3G8YA 4EL5A 1R8SA 1E5VA 1OH8A 2UZ1A 2VATA 3R7WA 4QC2A 3UWPA 2GN1A 2HT1A 5K0TA 3WIOA 1Z6YA 1G7RA 2ZPAA 3EVBA 4Y9DA 1AF7A 2E4WA 1SEVA 1Z0DA 4FYHA 4GQAA 4AJOA 3UMMA 4TYMA 1ZESA 3CLHA 5ED4A 4DUYB 2BZGA 1ESCA 3EOAI 1Z33A 3JTMA 3V4ZA 1KU0A 3OIYA 5B7GA 1YB1A 3AFMA 4MLCA 1P5FA 5DM70 3CWZA 1X80A 2O7VA 4X8HA 5FPKA 1W7AA 1DT5A 1W48A 4AY3A 1E7MA 1VC2A 2ZKLA 2BEVA 1JT9A 3CRQA 3GT7A 2NAPA 1SBNE 3TOCA 4RS4A 1MLDA 4B6GA 4IXDA 3CG4A 1KMCA 3LKDA 5ALUA 3IP3A 5MN6A 2FZEA 2YVQA 1CXZA 4GLLA 5T4BA 4WZBE 1FP4B 3R3UA 1N57A 3THWA 1XCGB 4H27A 1KYXA 1WULS 2CL5A 4MCJA 2HX1A 2DH5A 5DP2A 2HDWA 4HAOA 1TF7A 2CKMA 3NM6B 2AN4A 4OI1A 4JJIA 5C1PA 1K7SN 4EMBA 4QKQA 3AL2A 3BCSA 4ZALA 3WWOA 2G9QA 2CJPA 2P2GA 3R5FA 3AERA 1YBHA 4JLBA 2GUWA 5G4KB 4CMJA 1KA9H 2X13A 4HFNA 1IB6A 1X1BA 1C3VA 3NPAA 4O2LA 1PRYA 1DTEA 5T3YA 2NYVA 1DX9A 2DQZA 2I66A 3GA7A 3MM4A 3QEAZ 4WESA 5BMOA 1YHYA 3AVOA 4Y18A 2ZS7A 1XVTA 1N2ZA 3GPIA 4CJXA 3GP8A 2WE8A 2YWJA 4CLDA 5K6AA 3HDVA 1VE1A 5KYWA 1BEUB 2TYSB 3CUUA 3T0FA 2GI4A 3A36A 3IQGX 4IGFA 4TLMB 4K28A 3SVTA 1JILA 1XRQA 3H8JA 4RANA 3RS4A 1PL8A 4ZMBA 3DL2A 4KR6A 2H5JA 1XLTA 3HGTA 1IZ9A 4QHSA 4N5MA 4TT3D 3ZWNA 1N9KA 1HFWA 4IYJA 1U3VA 4WJLA 4CGYA 4CEHA 2V4ZA 4UEKA 1SUFA 3WC4A 2MINB 4NAHA 2UYOA 1ONSA 4KTTE 1MN6A 2B4KA 2V97A 2ZUUA 4P4TA 2J8ZA 2VRBA 4IQFA 4K9SA 1IHOA 2WKRA 3Q98A 4WERA 1IOVA 1DEAA 2OHXA 4JJ6A 3TB4A 3UJ7A 1JAYA 5IXSA 5LKRA 5K8IA 3DUFA 5AK3A 1OBVA 4ZJZA 4A8HA 4ZMSA 3HJHA 1FJXA 5CNJA 1KH1A 4L28A 5KO2A 1UAAA 5CYGA 1U2PA 3Q5DA 3ENZA 5B1YA 3G2HA 5GVRA 3WLOA 1RMTA 3F2IA 1RXIA 4ND3A 1QB8A 3NKLA 1MTOA 5AXBA 3U2QA 4NS1A 5K6TA 1X7ZB 5DHUA 3QE9Y 2NAFA 1BDMA 3SR0A 4PN3A 4PF1A 1R0WA 1CPYA 1THGA 2P1ZA 2A0YA 4QT4A 2GXSA 2D1FA 3ETLA 1C30B 4L75A 1T43A 3QMMA 4F4CA 3E4CA 1DMSA 1QF6A 3A31A 2X8JA 3DNPA 3ZCVA 4KLRA 2R4UA 3PGVA 3LVQE 1FFEA 2BE9A 3FPAA 1GUBA 1K7YA 1OI4A 4N0EA 1KP2A 3EISA 3IO3A 3CZRA 1NNEA 4X20A 1L7MA 3KLMX 4GX0A 1EKXA 3H2GA 3O2QB 2Y77A 2AV6A 3A2NA 5KCMA 5L3SA 1RI2A 4N6NA 3W06A 1KWKA 3HSKA 2HM7A 4JR0A 4JI8B 3W8NA 1GTG1 1HMYA 5C8ZA 4GR5A 1WBBA 1S9HA 3PUWA 1UXHA 5AWFC 1QAMA 2CK3D 1W4RA 3F1LA 4Q03A 4PSKA 4ZEMA 1U7UA 4IHJF 2JI9A 2BCEA 5CFPA 2AX3A 3GG9A 2IXAA 4NZOA 2XCLA 4U7HA 4FE7A 2JGJA 3KCNA 3DV0A 5HGJA 2Q3JA 4RA6A 2VDQB 2NUPA 3LYHA 4DCJA 1RYDA 3ODPA 2ZYAA 4OI4A 1J07A 2L17A 3T0GA 4JK3A 3WWZA 5J1SB 3DE0X 1LB1B 1WG8A 2XE8A 5EUBA 2QTZA 3I6BA 4C3OB 1SD1A 4F5YA 3TIXB 1SBTA 2B92A 3D6TB 2PV7A 3H9EO 2FX2A 5KS2A 2DHRA 3K0HA 3MLBA 3QMPA 3R40A 1KSJA 4JS0A 2VJYA 4X3PA 5IC6A 1CLEA 5EPOA 5IAGA 1BH6A 4AF7A 1W75A 4IY1A 4Z9YA 1KF0A 3H5IA 3JR3A 1DI0A 2O2SA 3T9AA 3LOUA 1N5OX 5ALNA 5LMUB 2D3TA 3RKSA 1AG9A 3QQ5A 1XQ6A 1L3CA 1TW2A 2OHOA 5FUYA 1LQUA 1WBDA 3SFVA 1LBIA 3E35A 4YCAA 3GAZA 4D9EA 2ZRNA 4E3ZA 1EWQA 2CXHA 4XW2A 5K5EA 4KPFC 2EJVA 1N34B 1N6OA 1YBMA 3V4VB 3LUJA 2QMEA 1XTBA 3A10A 4KN6A 5KYNA 1YDFA 3TFOA 4LOHA 1EIWA 2Q5FA 3SPXA 2UZ0A 4P3XA 4LJKA 2GF2A 2W8ZA 3SJCA 3EA5A 2VK2A 4D9NA 1XMJA 3VR6A 1IONA 4PE5B 1VHWA 2UVDA 1GO2A 3OKPA 3OZ7A 3TQQA 3PGMA 3N7AA 4L78A 3H4TA 4PYJA 1V6CA 3ZV7A 3GD5A 4IDDA 5FXMA 1KL7A 3WOVA 2P30A 3FWYA 3TD6A 1QIGA 4HP8A 3UA4A 1JG7A 4JBWA 4LYGA 2ODAA 5F77A 3L06A 4W5OA 3T7EA 2LV8A 1JG2A 3GDHA 5JSZA 1PEKE 2IEYA 3DFUA 3NJ8A 4OKSA 3VVMA 4DA7A 1IFXA 4RTLA 4GEKA 4HOYA 1PLJA 1KJJA 3GRZA 3OOYA 4IJUA 4N49A 1UODA 3F67A 4YCDA 3UMJA 3VSBA 3R24A 1MG0A 3KVYA 1RKUA 1C9JA 3DZHA 3HDQA 3LX4A 3Q0IA 4KGDA 3OLYA 5K3BA 1DQSA 5DYNA 3S2GA 1WZCA 2YJZA 1EP2B 1Z17A 4DLVA 1P44A 4LMRA 4PSDA 4F86A 5CB4B 5MHTA 4HH4A 3O74A 4W1QA 1R6DA 1V39A 1L9KA 2H0RA 2QXTA 2VP2A 3CJTA 4XFDA 5EXSA 5A1TA 2JA1A 4DABA 4JDUA 2DKNA 2Z56A 1NUHA 3Q3IA 2GZHA 2OKCA 3AR6A 1NDHA 3KD3A 2CMHA 4IJVA 3RANA 3WGVA 2FPXA 3ELYA 1G9TA 3D3JA 4L3WA 3RIHA 4JN6B 4CL3A 4DDHA 1GZUA 4M1EA 4N0QA 4GUDA 3LK7A 1IDOA 3HYLA 1E1MA 1JAZA 3N07A 2O1EA 4W1PA 3FCAA 1RC8A 1BHQ1 4GXTA 1XZBA 1YD7A 3BKXA 3GCDA 4MCIA 3ZI0A 2CVOA 4AUKA 4BFUA 1S4MA 4KGZA 1AUOA 5C7OO 5EIFA 2J9FA 4M6WB 4Y0NA 5A3JA 5IP5A 5LZ2A 1JMKC 1T2FA 1E2IA 3JVVA 4B9EA 1CDEA 1W87A 3FH0A 2C5HA 4HLNA 5ETJA 3UK2A 1X70A 4B2PA 1YXMA 5B1HA 4DIBA 1OWOA 1DAFA 4X45A 4A10A 2F17A 2CN1A 1VE5A 2F2TA 3VDMA 3QX3A 2QY6A 3K8QA 2VAMA 4QTUB 3ER6A 1YMUA 4MUJA 5DLPA 3QA3E 1P1CA 3VTFA 1I13A 4RCYA 2QVXX 4BJHB 4MJLA 2AOUA 1Y7IA 2EKBA 1XYGA 2YYAA 3M5PA 1R27A 4BOYA 5HF5A 1I94B 1DAEA 2BFFA 2JFGA 2A9VA 4PW0A 1WPXA 3PYXA 3D7KA 5FFMA 1KDYA 4BNFA 2Z3WA 5B30A 3H2BA 3N2GA 2XX3A 4YRZA 2P68A 3CVUA 5K4HA 2WPNA 3G68A 3NHYA 1Y4ZA 1O6CA 4OLJA 5K0NA 4WINA 5BNIA 2B94A 4ITVA 3IQDB 4BAUA 3B3AA 4ZOEA 2E4UA 2OC9A 3R0VA 3OHPA 4FXPA 4PO8A 3S1LA 4LF7B 1V8DA 5HCIA 1QRDA 4BQQA 1LVHA 3DTTA 3KQQA 3RAJA 4CCYB 1P62B 4K9PA 2HYIC 3K09A 1OXVA 4LK3A 4E5SA 3N0XA 1HQDA 4PG8A 1QP4A 1MVLA 2VCHA 4ZHQA 3LM8A 4PPNA 2J0SA 1BHSA 3HBNA 3GH3A 3FPJA 5HIJA 4R3WA 3T7AA 1SBIA 2I87A 1P77A 4QDUA 1EJ0A 1N2EA 5JJKA 1QYRA 2A35A 1BKSB 1R0YA 2CZGA 3U9TA 2VSFA 4O4JF 3WISA 3P52A 4Z6KA 4M60A 4MYDA 3DWEX 4Y8VA 1O6FA 2ON6A 4MDYA 4YAUA 1E2QA 1FQJA 1XZIA 3JD1A 3QELB 4MUGA 1XNQB 4IQGA 4CV0A 2YYSA 5DB4A 4C7OA 3O84A 2CLCX 1M2VA 2G82A 3WKCA 3RG2A 5MN5A 3HEBA 3TRKA 2Y76A 1T15A 3A1NA 3G9QA 5AM1A 1Z74A 2FETA 2C8LA 3ZXUB 3OMLA 4A0GA 1XNGA 2DBQA 1O7JA 2ERYA 4C76A 2AC2A 4OX9Y 3KB2A 4CNQA 5HXAA 1EQ2A 1U2DA 4A5SA 4X64B 2WAAA 3GEIA 3PENA 1IY8A 3WG9A 3ZUPA 1YQUA 1PGPA 1SHJA 3BXOA 5M34A 1G8FA 4V03A 5SV2A 5DNYB 4ROSA 3EZXA 3U61B 2VJDA 1XD8A 1KZ9A 4R54A 2VP4A 3NYIA 5JAQA 2EX0A 2GESA 2M6RA 2ZSKA 5GV7A 3TW6A 1JDBC 2CGEA 4AURA 1QYDA 1US8B 3PKZA 5B58C 4BB9A 5D84A 5JY6A 2JJMA 2Q9CA 6ADHA 3HM9A 2OUIA 4TT3A 4BRZA 3H16A 4XX1A 4KFCA 4Q4JA 3GPDG 4P92A 3MD0A 3TLJA 2R8BA 3ULKA 4ZGBA 4MJ7A 4LGVA 1ZL2A 2R8RA 4R6WA 1FJHA 4WBNF 3HXQA 2QRVB 3EQ2A 1A4RA 1MOSA 4IHKA 2KWIA 3NAQA 2IC5A 2E55A 2PMKA 4BX9A 4UHFA 2ZSEA 1E2FA 4XCXA 3WB9A 2QQ0A 3M82A 4HLCA 3PPWA 1C3OA 2VDJA 3CLRD 3LWBA 4M0LA 2NO6A 4UHBA 1YFZA 4EFNA 3ZNPA 1OH6A 4F2PA 2OK7A 4BGDA 5ALZA 2B8JA 1PT8A 1UP7A 1Z68A 2QQ5A 2WDPA 4OPMA 1E6WA 3Q8LA 4GKJB 3PE4A 1B16A 2IYOA 4HGPA 10MHA 3IKLA 5JJLA 2J5RA 1PZNA 4HWPA 4JFAA 4HDSB 3PPIA 1J0BA 4L8VA 1E63A 1Q77A 2DPXA 2GPYA 4R8SA 4TSRA 3WK8A 3B3GA 1J2UA 3KT8A 4FKZA 4TKUB 4I2VA 2OHVA 2GKOA 2LP4Y 4CEIA 4LHYA 5GM2A 1Y6QA 4FWTA 2R1ZA 4MAMA 1GQFA 1U3TA 3LBHA 4W5RA 4MR8B 2B35A 2PWZA 4JJZA 3MZ0A 1QQAA 3MJRA 2AG5A 4ZT3A 2W00A 1XLVA 1ILWA 4BLPA 2XNCA 4B4VA 2FSVA 2ZZNA 1E5QA 5AJWA 1NJFA 1HTBA 1KTIA 1S8NA 2A57A 2M2IA 3WAGA 1G0NA 4I19A 3DJYA 5KJCA 2Y4OA 3FMIA 5IJ0B 2EJBA 2FZGA 4PHGA 4TS3A 5BW4A 1MJHA 4L74A 4HTFB 1UKCA 5L7TA 3HB5X 3VKUA 3P9RA 4XB6B 5FWYA 5HUQA 1UFKA 2YRFA 2ZYTX 4H18A 2CK3A 3DZIA 5LDHA 3AZPA 4G65A 4NV1A 1E3WA 1NSFA 3A3KA 5JNLA 3COWA 7YASA 2JAUA 2QKYA 4D42A 4IQ0A 3IJ5A 2BLLA 3O9ZA 2X9NA 2V74B 2JASA 1NLZA 2XMCA 3DDSA 3CONA 1RQPA 3PUHA 5HZGA 4TXNA 2FQYA 3PU6A 3WLQA 5GVSA 1QP0A 1CF4A 5E2IA 1IBLB 1I6LA 1QLJA 1JYSA 2WWWA 3OQHA 4F5EA 3RKRA 1BGXT 4GBGA 4OREX 5L40A 1CR0A 2WUFA 1U2ZA 1FXUA 1SG0A 1YZFA 2E49A 5EMLA 3WLKX 5AMXA 1VPEA 4R1PA 2OCBA 1J2EA 1VKJA 2GBIA 2ZDGA 3G9UA 5IAAA 4PLYA 3ZNNA 3R5KA 3HVRA 1XTSA 4MB6A 5AKIA 3P9CA 3FCYA 3C3WA 3S2FA 3ZKWA 3SR4A 3DDOA 1PDVA 1QGDA 1Y4SA 1M7GA 1OFIA 4AP5A 4FI3F 2ZBEA 1DKQA 2NUAA 2WIDA 3BMCB 4BS9A 4LZWA 5TRTA 2GZRA 2HJSA 4KGXA 4QPNA 2AI1A 3HJAA 2R4QA 2ZQZA 4X41A 3FY4A 2M1XA 4XJXA 4YQFA 1I7DA 3SYNA 5EYPB 5CBPA 1HQCA 4MICA 3S29A 2JIMA 3MYYA 2PR7A 4OQPA 5EJ9A 1U0OC 4L9WA 1W36B 3SJAA 2JLWA 3W2GA 3V6MA 4DA6A 5I5EA 3SZMA 1XJQA 3C8MA 5CU7A 3FCSB 5IAEA 4U3JB 2ZP1A 3ADDA 1P1FA 3U3XA 2Q4OA 1KORA 1W29A 4NRDA 4Q9JA 1HYQA 1N2CE 4OLHA 4PBRA 4OH7A 2P9YA 2KLHA 2RAVA 4RORA 5EMHA 3KOZA 2AEEA 2JKYA 3AINA 1N92A 4DNXA 2VDMB 4RH3A 5EIEA 5JDCC 1Z22A 1J5PA 1W6UA 2H11A 3BE5A 1CEYA 1SC3A 3C48A 2ZJBA 1N5LA 1F4PA 3B9PA 3RBAA 4JHXA 3QG5A 3RRZA 3U0VA 4GFDA 2YWGA 3VO9A 3IDFA 4LG1A 2Q28A 3BEOA 3VKHA 1L4LA 4AJ9A 4DGSA 4R1LA 4Z99A 4H16A 4IFTA 3EWIA 4I1VA 4I4IA 1E7RA 3ADOA 3HCWA 2FR8C 5LSAA 3KD2A 1ZD5A 3USZA 3ROXA 3VR2D 4NWIA 4HNAA 4DJ5X 2PUHA 4KKXB 1A8IA 2NXCA 2GTIA 2VPIA 3BL5A 2WU3A 3E7PA 4RKEA 1XOIA 2ZE7A 3N76A 4JLOA 1MXFA 1RC1A 3W9UA 3UF0A 3PRYA 3Q6NA 3PITA 1QDLB 3JQFA 4DHEA 1H6AA 2ZTVA 3AR7A 3VMFA 3CF0A 5K51A 2O57A 1BCSA 3DCIA 2ZBRA 1IVNA 3I52A 2TMYA 4O0LA 5TQJA 3IAAA 5IT5A 2YY5A 3OJOA 5AKKA 2DEUA 3KKOA 1P7CA 2X9QA 2H1HA 4FD2A 5IAOA 4MV5A 5FOTA 3IT1A 4LQLA 2BCJQ 3T3IA 1ODSA 3WGLA 3L0CA 5HRUA 3OAAD 3IR6A 3RRFA 2WOJA 3U49A 3VR5D 3C2QA 2JFOA 4LI0A 3ENVA 1BS9A 2FE1A 4U39A 1LF5A 5DKFA 4JJGA 1ZSNA 4GWKA 4WFKA 2R84A 1C8BA 3OY7A 2NN3C 1Z4MA 1U1CA 4LX8A 3ZZ1A 2LKCA 3GEGA 2J3JA 4KU4A 4OXXA 4QBIA 5F2OA 1E2EA 3TGPA 4Q4HB 4V0MA 3BYZA 4IZOA 4CLOA 1KQ3A 3H9JA 3P2MA 4JP8A 1AIPA 3KHTA 3S81A 1T2DA 4KPYA 3R8FA 5CLFA 3T41A 3ZNOA 5CJPA 1M73E 5HEKA 2FPGB 2BAGA 2JI7A 3Q7RA 3GNLA 4Q7LA 1EXVA 4H59A 3QPUA 3CEMA 4MIEA 3X1YA 2VTEA 1SKUA 1KDTA 1J06A 2SKEA 1FYWA 2BP7A 3NTOA 1VSBA 3VAYA 3QSYA 4L0MA 4L6CA 2D2XA 5K0EA 3WLFA 3WLJA 1IMJA 2KQUA 4PPYA 4BO8A 1W96A 2OGZA 4BLQA 2NUTA 9LDBA 2BM9A 1XC7A 3BQ9A 1KO8A 3L7JA 4UW9A 2PO7A 3FWZA 2V1UA 1YTUA 5ICGA 2QRZA 3UTDA 4LJRA 3A4VA 2FDCA 2C9ZA 3H04A 4JC0A 4JL6A 1IOLA 1CTQA 2YZGA 2Z83A 3DBHA 1FTYA 3I8XA 2VSNA 2W6CX 3EWNA 3KOWA 3EVAA 2NZUG 3KAPA 2IEAA 3R5TA 2XD9A 1KDZA 3W5HA 1ZI8A 4ALKA 2BFMA 3E22B 5KTNA 4TLEA 3QY0A 3BDVA 3W1VA 2TMGA 2NVUA 3G5LA 4FI3C 1Z2EA 2IHUA 4O2RA 3LCRA 2FR1A 1Q1EA 3B2EA 2X77A 3GC6A 4ER3A 5LA6B 1TU4A 1U3WA 1JYFA 2G6TA 2R8OA 3TOVA 3TG8A 5DNCA 3SYLA 5ES3A 3G6KA 5HJ5A 3D59A 4IV0A 3IPCA 3QBEA 4CTNA 1CFZA 3CZ5A 5HCUA 1D6MA 3GVXA 2PX8A 4KODA 2UYHA 3TW8A 4KXNA 3KHKA 1OSNA 3NATA 2C4HA 5TGZA 2WTUA 4BCBA 4CG0A 2JARA 1MB9A 2NTEA 3MERA 2B7CA 2N1MA 4Q34A 2X22A 2ZT7A 4DCPA 1RP1A 3FUUA 1BQ3A 1T0UA 3KJHA 3B5JA 3ASUA 2NYAA 4A2WA 3BFXA 4Z1MD 3CVOA 1V2GA 3AOGA 4ZYTA 2AWNA 2PA3A 1MNQA 1S8AA 5HK8A 3N2ZB 2FRDC 3KT0A 4KQCA 4EJMA 1F60A 1Q17A 5ALYA 2QXYA 4LZNA 5JEDA 4MUXA 4Y2XA 3CZQA 5BOSB 2XLCA 4MI6A 5KX5A 4GGOA 2FEOA 1TEHA 1MU0A 1A7JA 3ENWA 5BYBA 1BE6A 4PFSA 3ENNA 1JKMA 4QSHA 1XHFA 3C7KA 1EX9A 1ZK0A 3D6NB 1E2HA 3G2MA 3D8NA 3ANTA 3EMBA 4FS3A 3F4BA 1YFKA 3BF8A 4RVNA 1GZ7A 3H2JA 3HYSA 5FNVB 4LCEA 4Q1BA 2LD4A 3A7EA 3O8LA 2D54A 1ZHFA 3A14A 3BA6A 4WGFA 3L3BA 3BILA 3PL5A 4YWHA 3QPBA 2YXDA 1Y4UA 3B82A 3CURA 3BGWA 1MABA 2D1QA 3PI7A 4MQLA 2PPLA 3VISA 1GV0A 1FNMA 3JAKA 3LKZA 4DM7A 1JECA 1HDCA 3IDZA 1KC1A 3DZCA 5DMXA 2H92A 5A9SB 5E7QA 2Q2NA 3NEJA 1FLDA 5LXTF 1NSYA 3QLJA 1GN8A 1NQUA 4CQNA 3JXEA 1QH8A 1K5HA 3I9LA 4UM9B 4YLYA 1PJTA 1ODIA 5BUZA 3AHIA 3CA8A 5J3JA 2WWGA 1CR4A 3CPEA 1U7ZA 4HATA 1J0AA 4KXFB 3UMYA 1Z35A 4JUCA 4BLSA 1KNQA 1WOYA 2ZE5A 5IDYA 2R60A 2WUVA 5KVSA 2IXEA 3ANXA 3OF2A 1TOAA 1WSAA 3SIXA 3H6KA 4HDKB 1N5KA 2MOKA 2BRUA 1HUQA 3M1AA 2WSLA 1SJ9A 4E70A 2A92A 4AROA 2IXTA 4DBLC 1MT0A 5LN1A 5LNK1 1U99A 2JI4A 3MG9A 1VL6A 4C1NA 3NXKA 1SBCA 3C14C 3KEGA 3Q88A 1AKWA 2HQBA 2MT9A 2X5OA 2WHPA 3H6GA 1AUVA 1JFFB 1XDBA 5FUXA 3U44B 2FE4A 1XQWA 5IDXA 2Y67A 3CRVA 3TAXA 3PHIA 1H4TA 2YIVX 1HX7A 4UHKA 1IXRC 4PNZA 4XZ3A 1SCUA 1NM5A 3P9YA 4BV9A 5CDYA 1K6IA 5FLEX 2GJAA 4UZFA 3IULA 5GIPE 3BE4A 1PF7E 3UH0A 4XVHA 4C0BA 3R9XA 4NMWA 4I81A 3U17A 5H59A 1E7SA 1SCDA 2O8VA 4WZBA 1FZTA 4UASA 4FYWA 3AFIA 1TC1A 3CKLA 1SOVA 2IPLA 3DKVA 4ZO9A 4G85A 3FTFA 4CM8A 4FFBA 1WNTA 2C2ZA 4IS2A 1FFHA 1PFKA 1Y1TA 2PIAA 3DB1A 4B1FA 2HBQA 3HN6A 3C0KA 3WGJA 4HAWA 1XZ8A 4R3UC 3M1LA 1PZMA 3KOYA 2I2BA 2X9VA 3H13A 5BNFA 2LCFA 3WXMA 2E6KA 2BEKA 3CRZA 2QUHA 3VH1A 1GZ3A 3FYCA 3RBZA 1RPAA 2H65A 1XMXA 3AHCA 2ORYA 1JAHA 1FNCA 1ZIXA 2I3DA 2Q5LA 2W6ID 1MCZA 3EH1A 4CW7A 5BVHB 3THXA 1EUDB 3RU7A 1L5RA 3F6RA 3PNMA 2I71A 3V9PA 4UNQA 1JIXA 3G2PA 5CCEA 4RJTA 3DD1A 4ZZIA 2W2NA 4MV9A 4QPDA 4BJ5A 5I3CA 1OLXA 3JQQA 1TKBA 5CYOA 1J1UA 4QYWA 1Z6QA 5GJBA 1GR0A 2YC2C 3CTMA 3H84A 1P60A 4F71A 1P1RA 4F6CA 4PSCA 4P3PA 4UBOA 1JH8A 4BZQA 4CL0A 2C7PA 4YMUA 1CQZA 3INTA 3HBLA 5DLDA 1YAJA 1N0VC 1JG3A 3R0IA 4G9BA 2CMDA 1XCJA 3PYLA 1GG2A 3OSZA 2B6NA 1UMCB 4BATA 1EVQA 4AJPA 1JDVA 4C89A 4ERNA 1K4MA 4C7MA 5LU8A 4UTPA 1SCIA 3FHCB 5MF6A 5B12A 1YFLA 2AFHA 3K9CA 5IN5A 2AB0A 4PX3A 3RRNA 3WHKA 3RYTC 3WS7A 2C00A 2ODPA 2YWBA 1AQIA 2VH1A 3K4HA 4IG9A 2ZZMA 2ZJYA 2WMDA 4UE2A 3FVQA 1BRMA 3PZBA 2EIXA 2WSSD 5LP6C 1F9EA 4WMLA 1Z38A 2DFDA 1DNPA 1YTLA 4U8GA 5LUBA 1T9BA 3L8DA 5GAJA 1YZLA 5A7HA 2ZSAA 2FMUA 1EJ2A 4ZI7A 4MV3A 1YJBA 2ZJ6A 4Q39A 2BFNA 3E03A 2ZBPA 2YV5A 3GRCA 4TN1A 3VR2A 4LJ4A 3RSQA 5C7IO 2C5GA 4CT4B 4BFSA 2QR5A 4MPJA 1RRVA 1UK7A 5CA1A 3EUWA 3UHJA 4DJDC 2YHSA 4M83A 1PV2A 2V4MA 3A9VA 1N0IA 3CISA 5CITA 4AY6A 2BZSA 4F6RA 2IF2A 4IQ8A 5DTEA 3KKKA 2J30A 3QPAA 3EDCA 1ADFA 1ZIYA 4AN0A 3N86A 4GOLD 4QELA 2FF5A 3DOUA 2RHRA 4X5OA 3FMPB 4WKGA 2B9VA 3D2BA 4ZO6A 1HNNA 1KAEA 1RW4A 3GZTB 1I2ZA 4JWTA 4C4RA 3U7GA 4HNHA 4INZA 3J81k 3QUAA 4K6HA 2P77A 3D3KA 3I9V6 4EYGA 5IEJA 3OAAA 1GNQA 3VR5A 2Q4DA 2ZBUA 3MA0A 4QODA 1SELA 1F8GA 1VJRA 1I1NA 1MHTA 3FHTA 1D2RA 3RV3A 4Q48A 3HXMA 3BVPA 1W49A 1P2DA 4D9IA 1U9CA 2CVHA 3NC0C 2VTBB 4AY2A 3FWKA 5CFNA 3MTDA 5KQGA 2CUKA 4OXYA 1F2VA 1MDFA 1L5MA 2ZCJA 1SZCA 2Q6VA 1AMOA 5H4GA 4JYZA 1EG7A 3K8OE 3CWCA 3AY6A 2HW8A 3IHTA 1IM8A 4RZQA 5CB6A 3X3HA 4EPYA 5IX8A 5AI0A 2QZ9A 4TYQA 3UJPA 1J6UA 5JS2A 1Z4PX 1GQYA 2H2FA 4NAVA 4PZEA 5BUSA 4C78A 4CMEA 1OXKB 4DLRA 1E2PA 1QCYA 3KWJA 1FQKA 3LMKA 5KU7A 4KXMA 3T1YB 4BEWA 2OO5A 5CUQA 1V3QE 2FVXA 1QC5B 1VGRA 1KYZA 3EE6A 5G0WA 1K6MA 1PSWA 4US1R 1TO6A 3C8HA 4B43A 3P4XA 4RY2A 1CJUC 4YUZA 2PH3A 4MWDA 3M4JA 3PPXA 4C7KA 2E18A 2DGDA 1YZ3A 2QMYA 1UM9A 5FO0A 4X95A 4N9WA 1BE8A 4P35A 1UZLA 4DCSA 2JIOA 1PQ4A 2PDAA 4EHJA 1PGOA 4UTRA 4IXWA 5IJZA 2WT4A 3PQ8A 4YCBA 4Y6RA 1ZKMA 3OZVA 3MD9A 4UEOA 5IM4F 2ZOSA 1XF1A 1Z2AA 2FDXA 2HDOA 2OGSA 5ESDA 4PO3X 4I1YA 1LZLA 3GJTA 1ID1A 2A94A 3KO8A 1RXUA 1OB2A 1WD5A 1Z16A 5TIIA 4KH0A 2DWOA 2VQ6A 2YDXA 4E5DA 3RVOA 4CMGA 4EGQA 1TYZA 1ZD2P 3ESBA 1I4OA 1PR5A 3ZXXA 5JWRA 3RI3A 3DMGA 4B73A 2Z57A 4TL6A 4DBZA 1ZVVA 3VSCA 1ORHA 4L8FA 4PWYA 1LF0A 1DAHA 2VN8A 3GNQA 4P7FA 1M1NB 4I3FA 3V1LA 1W8IA 1WF6A 3F6SA 4JGIA 4H7PA 4RFSA 1PYDA 1DAGA 3D5QA 1P3JA 2ATIA 3K9QO 1BAPA 3GEHA 1JV2B 2O2XA 2O5VA 3ACCA 3L2OB 2Q1YA 4NCIA 2FOLA 3D6JA 4F1JA 2BTQB 1DBIA 4J1TC 5AJYA 4X65B 1AH2A 3N3BC 4UBNA 1Y6GA 1G2IA 1F8FA 3I6QA 2V55B 5BO5A 2X0FA 4BC1A 2NT4A 4I50F 3ZU4A 1CIJA 2X0IA 1TA4A 1XNHA 2Y71A 4HX9A 2Z5LA 4XWYA 4EA7A 5LLDA 1JHXA 1GITA 4Z1MA 4KDEA 4CIDA 4F4IA 2CY0A 1OTHA 1Y6JA 3A7DA 1V4VA 3BMOB 3DBIA 3UMFA 4GGMX 3GJZA 4AMUA 3EEYA 4OP2A 3ENQA 4J0JA 4HRVA 4CLEA 2WLTA 5PNTA 1JKXA 2BHTA 4MUKA 3H05A 2YHBA 3P9XA 3NM4A 1JPUA 1ZOLA 1IPFA 2JGLA 1L5NA 3G2IA 3K35A 2QROA 3ANSA 3MIIA 4YMTA 4OXRA 4J03A 2RHCA 2QPOA 3FLEA 4P7KA 3QVMA 1JXQA 1T6YA 4RXMA 2LR0A 1ZR2A 2YTZA 1M6NA 4P0TA 4EGSA 3WGNA 1X7WB 4FZRA 3VH2A 2P6RA 2Q4EA 1NZJA 4NFSA 1JDSA 4KQ6A 1OLOA 4IV5A 4J16C 3C41J 3NO4A 1V11A 1EPUA 3HVIA 4M1QA 3HLYA 2XDQA 4OXIA 1QZUA 3NNNA 3L6UA 2CE2X 1KE2A 4WK6A 3KTAB 3ET5A 4YVFA 2ACWA 3AEKB 1E6CA 5AHRA 4F06A 3DL0A 3T5TA 1FFWA 4U7FA 4O2BB 5CGZA 2XOXA 4PGGA 5ALGA 4KMSA 4JC5A 2H63A 2RHHA 4J75A 4LHVA 4E5YA 1AXGA 4OHFA 1KQFA 5KC8A 3IA7A 1GQSA 3MWFA 2WSYB 3FNHA 4OHMA 3ZE7A 3V1YA 5TXGA 4EYQA 1E1CB 1A9XB 4RV5A 1KQGA 4M89A 1WXQA 1JFRA 1SHUX 1VB3A 4AK9A 2YJGA 1EINA 3OM9A 4E14A 3A6GA 4Y6SA 5ICEA 4LDZA 1AGXA 2PT9A 4QQRA 3E2IA 3INGA 1WMFA 1T5IA 2W8BB 2ACEA 4X6LA 4PXSA 4XSVA 2BONA 1L1FA 2FFAA 2PLAA 3ZW8A 1A9TA 1MZPA 4A03A 3I6YA 1C9NA 3N1UA 5CH3A 1SVSA 4PGAA 5F1PA 4G26A 3RUPA 4FTWA 2ODNA 2ZKIA 1UBFA 1B23P 4N41A 2P9BA 1ZJ5A 5DI3B 3DZKA 2HEGA 4LOJA 1A4UA 2OFXA 3N7TA 3MILA 3SYRA 3ZWKA 1RJWA 1ZU4A 1OBFO 1CUAA 3UT5A 3ZWVA 1PWHA 2XCQA 1VKRA 3SHVA 5BR1A 1WQ4A 2C95A 1A5SB 1QS0B 3NIWA 4XDGA 3AX6A 3VZCA 3OF3A 3ITDA 2R0QC 3P7MA 2BTEA 4XWTA 2Y1GA 1HC7A 4HB3A 2CV1A 2AOTB 1S8OA 2GJ4A 2ZCUA 3HFSA 3JATA 3PTLA 3BTOA 2P0AA 3UUGA 3AH8A 1ULHA 1IY2A 5HOQA 1IVSA 5AQ1A 3DBLA 3OPYA 4HQLA 4MW2A 1L7NA 4J91A 1PK7A 3QFCA 2OSBA 3W3AH 1MPTA 1W25A 4UD2A 1RKQA 2OM2A 3CJQA 4CMCA 1B14A 3HCCA 1VXRA 3H17A 3WSVA 4PYLA 2HMAA 2R6AA 3K0AA 2VRCD 1P2BA 1RPJA 3RKUA 5COAA 3KXPA 2VJKA 3MS4A 2PWBA 1XVLA 2FP4B 4ZTUB 2HHHB 1DKRA 3TWOA 3X2EA 4DQUA 2Z1MA 2W6IA 4Q21A 4C2AA 5FUWA 1E9VA 2BR4A 2FUCA 4ZVLA 1XYYA 1PG0A 1G6KA 4I66A 2EU8A 2ZJ2A 2AKAB 2XYGA 4L9RA 2F1OA 1KJ8A 1NLYA 2EFJA 3TAHA 4R9VA 2JDID 4AXBA 1Y42X 4HVCA 4YDQA 2JLRA 3R0XA 3O3NB 2NT3A 1CHDA 1EP1B 2LRHA 2P7IA 3MTEA 2ZJFA 2QTCA 1XROA 4U63A 3AHHA 3MWKA 3RFUA 1SXJD 3P97A 3A0UA 3FLBA 3QKUA 4V39A 3TX6A 4LJ6A 5AUNB 5IKPA 3GUVA 1ZEJA 1PR0A 2N47A 4JP5A 2FUG6 1UKAA 2F43B 4U9UA 5F52A 3KVOA 4HSEA 3TSYA 1PFGA 2FPOA 3QVVA 3LYLA 1BA3A 3AF2A 5LJIA 1XWWA 2V6JA 1RI4A 3RWBA 4GMXA 4WZZA 1RAAA 1W4AA 1ANKA 2QRMA 3JQDA 2RE8A 2WDZA 3L7CA 2WSSA 3Q3CA 2FQQA 4S2UA 3KSUA 3AIKA 5CNMA 5JCOA 3CZMA 4ETNA 2PM8A 1XN4A 4R01A 3IOBA 1TQ6A 1N0HA 4ZAFA 3CWQA 2ID9A 2IHTA 1CJBA 1MB3A 1QAQA 1FFAA 1JALA 3HB4X 3T54A 2PKQP 3MRVA 3OCWA 1QGUA 2Q6TA 4DA9A 1QGAA 1QCCA 5KJ1A 3VJKA 1EDDA 2ENWA 1G60A 2F9FA 2NYRA 3LNCA 4RWZA 5BT9A 2XV1A 5CDUA 5EHXA 1Q1QA 5CVUA 2DUJA 3BXEA 3HA5A 2Z2XA 3IGFA 4OM7A 5DHSA 3G59A 5BSGA 5DM4A 2OA0A 2C2WA 3BUSA 4WIAA 1J7JA 2H48A