3IILA

The structure of hcinap-mgadp-pi complex at 2.0 angstroms resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
175
structure length
175
Chain Sequence
PEFMLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding, transferase
molecule keywords Coilin-interacting nuclear ATPase protein
publication title hCINAP is an atypical mammalian nuclear adenylate kinase with an ATPase motif: Structural and functional studies.
pubmed doi rcsb
source organism Homo sapiens
total genus 65
structure length 175
sequence length 175
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2009-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3iilA00
3S1AA 2ZS8A 2IXGA 3RC3A 2BEKA 3MRSA 3U3KA 4WXPA 4RD2A 4D4JA 1R10A 2OCBA 1ZBDA 2WIAA 2QAGA 1UDWA 4A8JB 5CDFE 2C5LA 3EA5A 5KNBA 2EFHB 4Q9KA 3QKSA 3QVUA 4PC3A 5HKKA 2WSMA 2DWPA 4BFXA 4HYYA 1OXTA 2N1BA 5EXPA 3VNVA 3ZQ6A 1X6VA 1T3LA 4L8GA 4ON9A 4QFMA 4ESHA 1NMYA 1LNZA 4TYQA 5KYKA 4PC6A 2JLUA 4MGZR 2ODWA 1W4AA 3VHXA 3EPJA 1U8YA 3MWYW 5EUQB 1XEXA 1DE0A 2DFTA 3NH6A 3QJYA 2B6HA 4EPRA 2HJGA 5JHGB 1QHYA 2MSDB 2G0TA 2BM1A 4URUR 2Y8EA 2B7CA 4V0NA 4Q21A 1A4RA 4D4MA 2WWIA 1TQDA 2OE2A 1FMJA 4DB4A 1G8HA 1G3MA 3DL0A 1QHHB 2QPTA 1I4LD 1FNNA 1OFHA 3GJ0A 1E2HA 4AC9A 3GLFB 2VSXA 4RFSB 1YZTA 3R20A 3IKJA 5E7IA 1JXMA 3EC2A 1OV4A 1EFTA 3GFTA 3KFVA 4PZLA 4GZMA 5J4VA 2YKGA 1AIPA 1QG4A 1EFRD 3BWDD 4CVNA 5HKKD 1G9XA 2OEPA 1TQ4A 1DVRA 1KOFA 4QHYA 3EZ2A 2GTPA 1G3IA 4ITRC 1U81A 1JEDA 4QOSA 2DFKB 2QTFA 5AK0A 1JR3A 2Z0MA 1QVAA 2ZSFA 3LBNA 1HT2E 3X2SA 1IAQA 2F6RA 4GP6A 1IXZA 1NN5A 1N25A 1HH4A 3EA0A 3BK7A 4RD0A 4OI1A 3SE0A 1FQJA 1K5GA 3KXLA 3FMFA 4ZDIA 1E2EA 4CEIB 1CBUA 3T5GA 3EPHA 2IYTA 4M1SA 3U44A 2XXAA 1HA3A 4KSCA 4JLVA 3E2IA 2GEDA 2X19A 2XB4A 4ZDWA 1C1YA 1J7KA 2QORA 3PV0A 1Q44A 1D2MA 2R6GA 4RZ3A 3LW8A 5CYOA 4CEHA 1GNRA 4DLRA 1LS6A 5SZJA 1KO5A 2QL6A 3ZLJA 1TF2A 3QEJA 2EW1A 2FDCA 1GL9B 1KY2A 4O2LA 1MO6A 1NL3A 1UKVY 3VTKA 2AK2A 2VSFA 1OJLA 2F3TA 3E1SA 2VIIA 1CJKC 1JJ7A 4QGFA 4BLOA 2B8TA 2JEOA 1ZM3A 3DZ8A 1A82A 4E22A 1JR3D 2QBYA 3VNUA 1QG2A 1P7CA 1NG9A 3OFNA 4MKHA 3M1IA 1XMSA 1Z0DA 2FZLA 4LGMA 4GMXA 4M2LA 4PXAA 3QVVA 1R0WA 4OBEA 3KDSE 2WJYA 1RJ9B 5SZHB 4D25A 3P26A 2D2EA 2QP4A 3DOEA 1TF5A 1ZVQA 4MGIR 2A5FA 3AM1A 4JMPA 3IDQA 4C0LA 1XEWY 1D6JA 3C8UA 2FFBA 3CIOA 2IK8A 3CF2A 4LUCA 3FMPB 3RYTC 5TARA 1E2PA 2B92A 5JJKA 4TTPA 1VG0B 1L8QA 2F1HA 5BN3A 1KI3A 3P20A 2ZITA 2O8FA 4PHHA 2OBLA 4B47A 1GTVA 2KBFA 2ZVQX 4BFSA 1OB2A 4FN5A 4C9BA 2I4IA 4UNSA 4QJ5A 4M9ZA 1ZD8A 4AURA 4NYJR 3BS4A 4XH9B 2QAJA 3P27A 3MSXA 3MFYA 4B3FX 3B6EA 4B3CA 4GFDA 2V54A 5IF9A 1EFCA 3OFND 2ZSAA 5FTKA 1CR0A 4LX0A 3PFIA 2GEVA 1W7AA 2F43A 1ZMXA 1XX6A 3HR8A 3D6TB 2PJZA 5IRCD 3VHLB 3ASYA 2VP2A 4YDSA 1SVOA 2FE4A 3D3QA 4R71A 5FPSA 4YMVA 2ZJ5A 2Q21A 3W90A 3GLGB 1SVKA 1R4AA 2ANCA 5AR1A 1DAFA 3GJXC 3K1JA 3ZH9B 1UADA 2GCNA 4P4UA 2WSSD 1T8TA 2F1RA 1BOFA 2BV3A 2P3SA 2QTVB 5E7MA 1JR3E 1DAKA 2JLZA 3NH9A 1T4GA 4EPYA 2HXSA 4HB0A 4CRWB 1VHLA 4BEBA 1HTWA 1XTSA 3SR0A 4LOAA 2A5YB 1MT0A 1TAGA 4IOKA 1JPJA 2W2TA 2XZLA 1MRSA 5L3RA 4KSBA 4LJAA 1KI6A 1S8FA 4TYWA 4NKRA 1GSIA 5GVSA 1P3JA 1SXJC 3RS4A 1E32A 4HAWA 2PZEA 1Z6AA 2W0MA 4EFLA 4JBWA 3C5HA 3NVAA 2FH5B 3KJIA 4G5RA 3CW2A 5CM8B 1LW7A 2OILA 2ZRAA 2F55A 2ECKA 4HAUA 3CLVA 4U00A 4ZO4A 3LRPA 3IO5A 3TW8B 3VFDA 3D8BA 4TN1A 4ASUD 4OK3A 2DB3A 1TQ6A 2NTYC 3KKPA 3WNBA 3R8FA 4P31A 4R98A 3P1JA 1FUKA 1RZ3A 5CJPA 4QL3A 1JQJC 1T8UA 2FPMA 5LD2C 2Q6TA 3K9NA 4X8LA 2RHMA 3AUYA 1CR2A 4ZCLA 4NCKA 1MO4A 3QBTA 2DYKA 4JJKA 3E70C 4F4JA 3KKNA 4GBMA 5JS8A 2V3CC 4UNNA 2QEQA 4MRRA 2HXYA 2DBYA 3TSWA 4IW3B 2OCPA 4ILEA 2VP4A 3SHWA 2ATVA 1GM5A 2GXAA 2GAAA 1WDTA 4M8NE 3EG5A 2ZU0C 1ZAKA 4JLKA 3B82A 1CRPA 3H4MA 3CKLA 1OH7A 3LNCA 2MMGA 1KAOA 1U9IC 4DCVA 4KLNA 2H92A 4FI3C 4X8OA 2NMVA 4TTRA 2OHFA 3V9PA 2LCFA 1RE0A 2ZRCA 1MH1A 3MJRA 3TUJC 4WVFA 4TLDA 3WP0A 721PA 2AFHE 2ZUDA 2ODNA 2ZRLA 4TQUS 4BECA 3NBFA 4A36A 1ZIOA 2G3YA 4OHYA 4M22A 3CF0A 1G8YA 2JJ2A 4GDFA 2OO7A 4XVRA 4C3ZA 4JKYA 1NJGA 2WJVA 3BFKA 5E7JA 1NVXQ 2WBLC 3GFPA 2JLXA 4IVRA 2J46A 2NO6A 3EC1A 4M1WA 3ONWA 2VBCA 5CK5A 5KSYA 4R2HA 3ADDA 1T5IA 2ZYVX 4PZZA 1OPXA 2CCJA 2CK3D 5KO2A 3EWSA 3OEEA 1E4YA 1N5JA 3AVYA 1EWRA 5C46F 1W5TA 4TYNA 4PTLA 1KMHB 1S1MA 4E03A 4DHEA 2QG6A 3QF4B 2NIPA 5A4JA 4IOLA 2VHQA 2BM0A 2IYWA 4S35A 5JSZA 2D7CA 3WYGA 4D0GA 4WZ6A 2QU8A 1E0KA 4IDOA 5HZHA 3U60B 2IWRA 2ATXA 3LAWA 2JASA 2ODBA 2L0XA 3HDTA 3BGWA 2CHQA 2ZAMA 1QHHA 1JI0A 4LJ5A 2JJ2D 3DKPA 1E0AA 3MJHA 3VR2A 2OZEA 1EFUA 2X77A 3A1WA 5UKDA 3W3AA 4FCTA 3GLFA 1YR8A 4BPBA 3A1TA 1OLOA 1YR7A 3A1SA 2WKPA 4RFSA 1COWD 1CULC 1AKYA 2VTKA 1KO4A 4GMDA 1F2TB 1YE8A 3N2EA 1TX4B 4JT2A 3CRMA 4LHZA 3GFOA 1UAAA 4W7SA 3WXMA 1MABA 3ZIAA 4B3BA 3VX3A 3OEED 4IXMA 2IW3A 4UXJA 4LBWA 3TE6A 4QG7A 1H65A 3K09C 3PVSA 1RYHA 1NVVQ 2AKAB 3NEYA 4US2R 3DM5A 3IEUA 1XMJA 1UKYA 1SZPA 1AA9A 4A92A 3KJHA 4JT4A 3O47A 4K46A 2A30A 3KB1A 3SYKA 4DEXA 1R5NA 5ANRB 4AKGA 4DSUA 1E98A 1FZQA 1YZNA 4JLBA 4MKGA 2RGDA 1RKBA 1W47A 2YWEA 2VHUA 2IS2A 3RS0A 1PLKA 1IN6A 3TLXA 4D4KA 4IDHA 2GCOB 1P5ZB 3M4YA 1E9EA 2JIZD 4LY6A 2Q3FA 4W5JA 3K70B 2PBRA 5J40A 2ZSBA 3QXJA 1GDDA 1OIWA 2GHIA 2GVZC 3H2YA 4A0RA 2QGZA 3PUWA 2QAGB 3VQTA 1DG1G 5BN5A 4GI7A 3QKSB 2J5XA 5HPYB 4C0AC 2DR3A 2XITA 4GP7A 4I1VA 3ND8A 1T3HA 5CK4A 1F48A 4B6EA 1JXOA 3X1WA 1RJ9A 1VYTA 1CIPA 3QXSA 2ZU6A 5TXGA 1OYYA 1SVSA 3RRMA 3QNUA 2J7KA 3ZVNA 3W8RA 1M7HA 4PAQA 4X8MA 1XEXB 5DLQC 5B2ZA 5DNYB 1G8FA 4URZR 5JI2E 4QJ4A 3EXAA 2VQSA 2J41A 1P2UA 2ZI3A 2RHDA 3LBIA 2QZ4A 1Q1EA 3RNLA 2VP5A 1KZGB 5KPJA 4CDGA 3A1UA 5JECA 2CVFA 3CX6A 1N3BA 2WHXA 2GXQA 4MYUA 2FGKA 4OHVA 2Q3MA 3BB3A 1VDZA 1VCOA 2R8RA 4N3NA 4RVCA 4YXWD 3AF4A 3NG1A 3LWNA 2YC2C 2ZUBA 5DSZA 1E9CA 2FSGA 2P65A 4PC1A 1N0UA 3LD9A 4MKIA 3GLFE 2JDIA 4FMDF 4LSGA 3I92A 5HTKA 3OEHD 3DMDA 3REGA 3SHFA 3ZQJA 5JFGA 4FIDA 2VHJA 1XPOA 3K0FA 1G8GA 3PJRA 1G7CA 3GLGA 3GJ4A 3L8YA 2WIBA 1SHKA 2EWWA 2KJQA 4A4DA 3K8YA 5GADl 1VYUA 3SQXA 1E1RD 2Q3HA 4XJXA 2PEZA 4WW0A 1S4QA 1U2RA 2A5GA 1PVOA 1PJRA 2FJUA 2H18A 4LK2A 3JZMA 4M9QA 1Z6YA 2QI9C 4IHQA 3LFUA 3U3JA 1E79A 1JR6A 4PQYA 2C9CA 1G64A 3HYRA 4Y0AA 4HLUA 2BKEA 3BORA 4BFZA 4CEHB 4LBVA 4Z54A 4NYMR 1JJVA 3RWMB 4EQ6A 2Z6VA 1DBSA 3UG7A 3THWB 5DIFA 4TLCA 1N6PA 1Z08A 2CMKA 2V55B 3GEEA 2R6FA 1E2QA 5H68A 2CCGA 4KBFA 3U3RA 5JI3E 2FSIA 1OSNA 3IIKA 1GKIA 1O87A 3FKQA 2QBYB 2UKDA 3B85A 3QKRA 2HEIA 3PG5A 5F2EA 3CR8A 5FOTA 3W5IA 2J0QA 4Q1FA 4XTCS 1TU3A 2GK7A 3QY0A 4A0HA 3IIMA 3AVWA 4NL4H 5GJBA 2PL3A 4MUAA 3BIFA 3SZRA 1KI4A 1E79D 1ZD9A 3BJIC 3VR4A 2A9KA 4PHFA 4PZYA 3WBKA 3UMFA 1XFAA 1ELOA 3EW9A 4BFTA 1TU4A 3FFAA 2IXEA 2ZRMA 2ZSEA 2O8FB 3W5JA 4LYJA 3X1XA 4AYTA 2DWQA 1P2TA 2IEYA 4HZUB 4HLDA 4W5WA 3LX5A 2ZQ5A 3PEVA 3MWLA 2NGRA 4XVQA 5G41A 2GAOA 1BYUA 4AIIA 5C4GB 2MMCA 5KU1A 1CJUC 3PEWA 3BH7A 4PPFA 1NIJA 5JWOA 4M0LA 5B30A 1NBMA 1KIMA 2ZRNA 3A1VA 1P2VA 3ADBA 1CU1A 4D80A 4OI0A 4POAA 2YNMA 2PLFA 2QPAA 6Q21A 4G5GA 2OM2A 4GOXA 3D31A 3B1XA 2QT1A 3SEAA 2QT0A 4NYJQ 4NCIA 5DHAA 4NMMA 4F7WA 1N6OA 1PUJA 2TMKA 1AS2A 3G5UA 5F9HA 2ZR7A 3NBXX 1ZJ6A 3PCRB 1V43A 3UANA 3ZZ0A 5JWHA 4AYXA 4CEJA 3VKWA 3CNNA 2QE7A 2XAUA 4HZIA 1VCNA 4KO8A 5AUOB 2ZROA 3CH4B 3FYHA 5F9FA 3HU1A 1ZNYA 4WZAE 4E5UA 1ZM7A 2JLVA 4LWZA 2ONJA 2VF7A 2EQBA 3C41J 3GLGE 4DSTA 2OUKA 2AN9A 2ZRDA 5CLQA 4A2PA 2XJ4A 3KKQA 1F5NA 1KI1A 3M6AA 3FMOB 5GJWC 3FHCB 3BB1A 1NBMD 3WHKA 4JVSB 3LW7A 4JLAA 4GSYA 4KXFB 1KI6B 1IY0A 2ERXA 3EZ9A 5BXQC 2WWXA 3GEHA 1WCV1 1QRAA 5LBIA 3CRQA 4PPQA 4PC7A 3A8TA 1KI7A 1X3SA 3GJ7A 3FHTA 1P61B 3PR1A 2XEXA 4D0NA 2QTHA 3W6OA 4EPVA 3EZ7A 2DCUA 3W6NA 3L2OB 1TQ2A 2WM9B 3GLHA 1KK1A 1IN4A 1TL7C 1GVNB 3B2EA 3QKTA 2QE7D 1N6RA 1N6KA 5B58C 5EXSA 1E69A 4LPKA 4ZV4A 1F2TA 4M9XA 2Z43A 2G9NA 3R7WA 1SKQA 3BAFA 5EXXA 5E95A 3RS3A 4URVR 5AUPB 4BRUA 4CEIA 5JJLA 4MRPA 3TQFA 1S0UA 1W0JA 2RAPA 1N6NA 1YJ5A 621PA 1EK0A 1ZCBA 2ZJ2A 1Z2AA 3HJNA 2BJWA 2OG2A 4IDNA 3SFVA 1DAHA 1MO5A 2C8VA 1ZM9A 2V6IA 4ACAA 1AGRA 2JLYA 1W36C 2ZE6A 1QZXA 4YMTA 2UZ3A 3I8XA 4Q03A 4NH0A 1KI2A 1R6BX 1KDTA 3NIBA 4LHWA 4URWR 1ZNZA 5DH9A 3SC3A 3ZZUA 4B44A 1SKYB 1JECA 1FX0A 3FKSD 1OFIA 4TSFA 1CTQA 2XNDD 1TTTA 5AWFC 1VCIA 1E1QD 4DEYA 4XWKA 4Z1MA 3TW4A 4MRSA 4D2IA 3TBKA 4XIGS 1KK3A 1QHGA 4YMWA 5HZKA 1IN8A 1KTVA 1XTIA 1Z0FA 1DAIA 1NBME 3QKUA 5CLLA 5FTJA 3KXKA 2EFDB 2QY9A 2XOKD 3AF3A 4Q1EA 3T1VA 4DIDA 2JJ1A 1VG1A 1Z06A 1G4UR 3DOFA 2E1RA 1OIXA 3MG9A 4BZXA 3THXB 3CPJB 1Z83A 4V03A 821PA 3NBYC 3H0KA 4A6PA 5FUWA 1KY3A 4L5BA 1Q0UA 2YOHA 2JCSA 3KQNA 3AKDA 4MH0R 1S3GA 2PT7A 4R9UC 1BH2A 2CL0X 3AF1A 2GVDC 2QMUA 4HAZA 1Z07A 1Q21A 5FPHA 1G3UA 5KDDA 2Z83A 4Z8YA 5G3ZA 1SXJB 1CJTC 2ZUCA 1U8ZA 1QHIA 4KCGA 4U5XA 5FOXA 3LDAA 3MWKA 1U98A 4QNRA 1ZRHA 2IF0A 5IK2A 3AEZA 2QP3A 5JSZB 4AKHA 1P9NA 1II8B 4DC9A 3TGPA 3B1VA 3IBGA 2FOLA 2H57A 3QENA 1ONBA 4JL5A 3DKVA 1I4DD 5J4YA 3K70D 2P5TB 3OAAA 1OHHA 3WYAA 1M6NA 1E9SA 2ZI9A 5LB2A 4EAQA 2XSZA 1VECA 2QROA 1GILA 2JJ1D 3I1FA 4YQFA 1HYQA 2J0VA 1PLJA 2YWFA 5FPKA 3T06B 4AYWA 4MDEA 2IS4A 1FNMA 1R7RA 2VRWA 1P9RA 4NHOA 3QPUA 1MABB 4OHXA 4UXHA 2DWOA 2A5DA 5CIWA 2QRNA 8OHMA 1Y63A 1XTKA 3AB3A 3R9XA 3VAAA 2OBNA 2ZANA 1X8LA 1ZP6A 4HB3A 4MYTA 5BYKA 5L3QB 3B5JA 3X1DA 4M1TA 1R5OA 2NPFA 3T1OA 5IK2D 3ADCA 1W2HA 1KKLA 1KNQA 2IYRA 3UMRA 3R9WA 2VL7A 3W8NA 4BWYA 4JLMA 1RFLA 1LVGA 3RLFA 1DPFA 4R2IA 1N0WA 5CJ2A 1JEEA 1D5CA 1JQLB 1N5KA 1XNJA 2WPDA 5M04A 1ZC4A 1G19A 2O52A 1K5DA 4RY2A 4FWTA 4IKEA 2BCGY 5DO9A 4DSOA 2OESA 1PLLA 2DFLA 4L15A 2XTMA 4BFWA 4IVQA 4MUBA 3THWA 2OCAA 1YZQA 3UWKA 2LWIA 4Q4LA 1E96A 4LZZA 4D6PA 1TEXA 3F3YA 3T5DA 3QBVA 2CHGA 1XD2B 2JLQA 3Q7PA 4KLZA 3ZZTA 2VP0A 2REOA 3CX8A 4XWOA 4RD4A 1WP9A 1VG9B 3K9LA 3TJZA 1G18A 1R8QA 2H16A 2ZS7A 1FP6A 4JBXA 3IPYA 3DHWC 3O8BA 2WJHA 2ZVPX 2IYYA 3Q5DA 1IOZA 4Q00A 2IC5A 1WMSA 4B35A 4U02A 1J99A 1M74A 4G01B 5EE3A 2WPDD 3AVPA 1Q3TA 4KFTA 4QHTA 4Q7JB 1RRGA 3TVDA 3UG6A 5JCPA 3ND9A 2BEJA 3CNLA 1DG3A 1JAHA 3SU8A 4OQXA 3DEFA 3KQUA 4OQLA 1XRJA 4HZUA 3JVVA 4BLSA 4BQSA 1KJYA 1A7JA 1XMIA 1QHXA 1OF1A 2D3WA 5LDDC 1IXRC 3NEJA 1Z2CA 3MAAC 4C0SA 2BBWA 4A0FA 1R8SA 2R2AA 3IQXA 5TMPA 2ORWA 4Q02A 3U3MA 1WA5A 1GG2A 1HV8A 4J0QA 2CE7A 4NE2A 1DADA 2GK6A 2CCKA 5KSZA 2H5EA 4LYHA 3RS7A 2VYFA 1FPMA 2FFHA 4M9SA 3K0FB 4OI4A 1XD9A 1DOAA 3NHBA 3SBDA 1FMLA 5LPNA 1XJCA 4TQAA 1L4UA 2HCBA 1E2JA 1HT1E 2PCJA 5EXTA 3N2IA 1YHNA 2XZPA 1KJWA 2RGBA 2XJ9A 3B1ZA 3RRNA 3DDCA 4Q47A 1LB1B 2N46A 4NTZA 1KHTA 1E99A 2BHRA 1XMVA 2FWRA 2HYDA 1ODFA 4OHWA 4KBGA 4LJ6A 3B78A 4RZXA 1YZLA 4LHVA 2BMJA 4B3XA 1S2MA 3SYNA 4EQ6B 3JZAA 1OYWA 5J4LA 4LV5B 4WOPA 1U94A 4KODA 5AJZA 2V9PA 3QIAA 4P32A 2GJKA 4F93B 4A8JC 2ZXUA 3TRFA 4CW7A 2W6IA 4TYPA 3VKGA 1KDRA 3RRZA 2VLIA 2AHOA 1SVIA 1UF9A 3QKRB 4Q7KA 3ZYCA 1EX6A 1XXHA 2FPKA 2XTZA 3DVLA 3L0OA 4C0KA 4G3XA 3KJGA 4Y0VA 2R62A 3X1ZA 2P2LA 1AM4D 2FGJA 1T9HA 1OH5A 4D81A 1GRNA 1Z0IA 3SOPA 2C03A 3AKYA 2WZQA 4LJ4A 1RW4A 2G77B 1Z6TA 3I73A 4RCYA 2IEZA 3ZVLA 4DLZA 3SFZA 3QG1A 1E94E 1VHTA 5FBQB 3CM0A 1HEIA 5LB4A 3PEYA 4BZQA 1W44A 1IQPA 4KU4A 1M8PA 1KSGA 1TADA 1W48A 2RCNA 3KJEA 2JA1A 1X86B 3U5ZB 1RRCA 4LI0A 1E2GA 4TT3A 2W6ID 3EPLA 2KI5A 3QEOA 3TNFA 4Q48A 3V4RA 5H8WA 4WBSA 1G291 3A4MA 3KQHA 2P6RA 4RD3A 3AP1A 1UKEA 2OLJA 4M1YA 4N1AA 4XWAA 1L4YA 5TY0A 2IYZA 4HDOB 3AF0A 4LYAA 3TUIC 2ZJ8A 3RS5A 3CR7A 4S2EA 3NC1C 4QBHA 3QQ5A 1ZYUA 4IRUB 2J45A 3C7KA 2YHSA 1II9A 1W5SA 3LY5A 5HR5A 4O3MA 2AFIE 2VP6A 4QGAA 3THXA 3GQBA 3IILA 4CEJB 4TZ0A 2FEOA 3TVTA 3OHMA 5GJVC 1E2KA 1Z47A 2GF0A 1MRNA 1VMAA 3A4LA 3EIEA 5JHHB 4TMTA 2JLRA 4P4SA 4I1OA 4TMXA 2I1VB 1AS3A 4TT3D 1Z3IX 1SXJA 4B3DA 1E2LA 4PO8A 3T35A 3B1YA 5AJWA 3ZDQA 5FBWB 3RANA 4C0JA 1XZQA 2ZR9A 3GP8A 1II8A 1KK0A 2XX3A 4IEEA 1XPRA 1TNDA 1DARA 3FPAA 3OE7A 2CLDX 1Q3HA 2IUUA 5FOWA 5IDVA 4I1UA 2UVQA 1NMZA 3LA6A 4Z8XA 4JYCA 2G6BA 4NYIR 2FF7A 2QMHA 3Q8XB 3GLHB 3UATA 4JJZA 1RVDA 2REBA 3ICEA 1XB2A 2R9VA 1A2KC 3TK1A 3IUYA 3Q72A 3CWQA 2QQ0A 1NP6A 1KAGA 3R7WB 4Z51A 1WBBA 4QBGB 4QNMA 1Y3AA 3QXXA 5G40A 2BBOA 3TMKA 1U0JA 2V6JA 1J8MF 4XSHA 3RABA 5DN6A 3V00A 3FDIA 2WWFA 2GWHA 1SXJD 1XBTA 4H1UA 3RC8A 2AD1A 1OFUX 2FG5A 5L3QA 2NQ2C 1HUQA 4HLCA 2P67A 4N0DA 1L2TA 2GJSA 5F3WB 1CR4A 5CM9C 3P32A 4DCSA 3BOSA 3AP2A 3K0SA 1U9IA 2J9RA 3SJCA 1R0YA 1C4OA 5B57C 2W83A 3OE7D 4QKQA 421PA 3TH5A 1DO0A 4CT4B 4AY2A 2V4ZA 4O2RA 1MO3A 4TL6A 4DDVA 2BVNA 3C14C 1T0JB 1FX0B 1W4CA 4DCUA 3UXMA 3GEIA 1KSJA 1ZU5A 2VHCA 2RGNC 3HU2A 3OIYA 4GNKA 2HF8A 1WQ1R 2RB4A 1GL7A 2QM8A 3QI2A 2AWOA 4LJ8A 4LC0A 1CJVC 4NPHA 5FOVA 2PX0A 3KQKA 5EZ5A 4NZYA 1SKYE 4XOIA 1DS6A 3ZIAD 4ESVA 3T1TA 1QHSA 1B0UA 1CP2A 1DAEA 5FTNA 5DN6D 3TIFA 1XD2A 1P9WA 3FB4A 5KUTA 2DPXA 3LBHA 4DLXA 4JBYA 4RD1A 5FI1B 3ADKA 3KXIA 5TVKA 2BBTA 2C2HA 1HY3A 1D9ZA 1I4TD 2B21A 4Q9LA 3AVOA 4LHYA 2ZM5A 4IVPA 3T12A 4KITB 2GETA 2QP9X 1Z63A 5JS7A 3SDZA 1R5BA 2EWVA 4KI0A 4WXRA 1VCMA 2EFCB 1Z0JA 221PA 1WXQA 2W2XA 2R6CA 2C96A 4FMCB 1ZD1A 4K8OA 1D9XA 4TLAA 4HUTA 3SQWA 1SXJE 3CWZA 2QSZA 2NG1A 1M1YE 3KTAB 4LCBA 3PQCA 4AKIA 4DCNA 1M7BA 2H8KA 2RGXA 2ZRJA 4LV8B 3O8CA 4C30A 1ANKA 5CITA 4PHTA 2EYQA 2IT1A 3IQWA 1UKZA 2IYXA 3B8HA 3K0CC 4OI2A 5EP4A 2WWGA 4ARZB 2CVHA 2PZFA 1YZGA 1NKTA 3K09A 1W0KA 1Z22A 5G53C 5FR2A 2E87A 2ZE8A 3LVRE 1OB5A 2RKOA 5EE0A 3U61B 2JGNA 3CB4A 1V5WA 5L3VA 4I1SA 3IPXA 1TUEA 2GBLC 5JZVA 2R6AA 1N5LA 4PC2A 1W36B 1G16A 1KO1A 3CUEF 2IA5A 1E4VA 2WKQA 4CF7A 2A78A 3LXRA 1K6MA 5K8IA 2ZI4A 1EXMA 5HE9A 5EP3A 2CEAA 2D74A 3CX7A 2IYUA 4TMVA 4JSYA 4FW9A 2WOOA 3OIVA 2RGNA 5EE9A 2ZRIA 1GZSA 4KVGA 3RVBA 3DPUA 4ZKDA 3V4FA 2HT1A 2O8EA 2P0EA 4PO1A 4Q9JA 5KTYA 3MWJA 1GOTA 4QHSA 2HDNB 4TLBA 2AK3A 4AG5A 4LC1A 2PMKA 3VR5A 3WY9A 1P75A 2OAQ1 4NBSA 2YINC 4JS0A 5HE8A 1W2GA 3NBZC 5H70A 3NC0C 3Q85A 1IY1A 1N6LA 2JDID 5HCIA 4C0BA 2FX3A 2BOVA 3UPUA 4L9SA 4G5SA 2WTUA 4GPTA 1G17A 4RJLA 1I2DA 2QA5A 3IHLA 1KGDA 4YDHB 4BUJA 1IONA 3QXHA 4G1UC 3VR3A 1XTRA 3DMNA 1PV4A 1AQYA 1AZSC 1ZINA 4QJ3A 1GNPA 1K8RA 2FMXA 1Z0AA 3AVQA 3I5XA 2ZJBA 2LKCA 1LV7A 2PT5A 2ZRHA 121PA 1XJ0A 3AGQA 3I4LA 1G8PA 1SGWA 3VU9B 3ZVRA 4V0MA 4BZPA 4BGDA 2QM7A 2V8OA 4CT5A 2WICA 3G82C 1GNQA 2VO1A 2REXB 3TR5A 4FXPA 3WBJA 1N2CE 2F1JA 3KKMA 4BFVA 4BLRA 1Q22A 2ORVA 2HYIC 1MR3F 4MYHA 4MKFA 4TL7A 5KDOA 2ZRGA 3KB2A 4HSEA 1ZCAA 3W6PA 4JSTA 2AXNA 3CZPA 4NCJA 3U7GA 1BKDR 1H8EA 1US8A 3NWJA 4OJQA 2CLCX 4HEJA 4JLDA 4Q4HA 2ONKA 1QVRA 1QDEA 4WAUA 1Z6XA 3B60A 3KKOA 2ZRKA 1OIVA 1P72A 1E3MA 1BMFA 4MGKR 2RGCA 4Q1AA 5L3SA 4JLPA 4XTRA 4DUGA 1HQYE 5HCNA 1AZTA 3SS8A 4OK6A 2QENA 5AJYA 1RPZA 4P3YA 4TLEA 4US0R 2GNOA 1NSTA 4LPSA 4DLWA 4K81B 1B23P 4KFSA 4RZ2A 2IF2A 4B2LA 1FTSA 2IYLD 2ZPTX 2FZ4A 3AKEA 4Q7MB 5KSPA 4IJMA 3W9YA 3TKLA 4A15A 4US1R 1T91A 2KE5A 2YZ2A 3NHAA 1II0A 2W6JA 4P0TA 2IWHA 1F3OA 1ZM2A 4OQFA 1AS0A 3WNCA 3AKCA 2EYUA 3EAQA 5IHPA 4FWIB 1RRFA 3L43A 2BKUA 3I32A 5C4MA 2C98A 1A1VA 3U2QA 2BWJA 1E2FA 4HLQB 1H8HA 2V1UA 2FEMA 5CB6A 4F4CA 4EDHA 5KHOC 2O8BA 2QAGC 1EESA 3F8TA 5B64A 2WAYA 1BMFD 1Q12A 3KUCA 4QM7A 1N0VC 2O0HA 3GLIB 2ZE5A 1U99A 3LVQE 3U7EB 1XXHB 4DUGD 2IS6A 1XP8A 4KFRA 1Q1BA 4EPWA 1CXZA 2ZYWX 2R65A 3PEUA 2ZJAA 2OXCA 3REFA 2BBSA 4HUQA 1L7VC 4WZBE 2BC9A 3Q7QA 4M1MA 4EFNA 3AVTA 2R44A 4ERNA 1G6OA 2W6JD 3SJAA 4C7OA 4AI6A 4QGGA 2QSYA 4QBIA 5ELXA 2J0SA 2GDJA 4B6FA 1FTNA 3BH6A 3A4NA 4DLVA 5FL3A 3R9IA 3I62A 1UM8A 1KK2A 3TAUA 2FV8A 1J2JA 3E5HA 4B2IA 3SI7A 4II7A 5JEDA 5BW8A 1J70A 4R7ZA 2D7DA 4QGHA 4TYYA 4IEIA 5AUNB 4BLPA 2A2ZA 4C0HA 4L9WA 3BBPA 4DDUA 4Q1BA 1DAMA 5FFMA 3FOZA 4CIDA 1TUIA 2FSFA 2G83A 3UMSA 1U0LA 2YYZA 3CPEA 5JRJA 1MOZA 2JATA 3PUYA 1NIPA 1N6IA 1EFHA 3CF6R 2QGNA 3I8SA 3QXCA 2AD5A 2IYVA 3KQLA 3IEVA 4IOMA 5EP2A 1W0JD 1XZPA 1SVLA 2ZYTX 2KBEA 3U6BA 2CL6X 4N0EA 4AK9A 1IBRA 4Q66C 4TQ9A 2RGGA 4IFBA 4P4SB 4AWXA 4XSGA 2GZAA 1E9FA 3H86A 5D3MB 3EX7C 2WJIA 1IXSB 1UJ2A 1ZUIA 3CRW1 3CRVA 4PFSA 3TQCA 4BEJA 5JMTA 4OK5A 4Q4JA 2J7PA 4AD8A 1C9KA 4F4IA 1GAJA 1HQCA 1M2OB 5EE1A 2QRZA 2ZRPA 5EP1A 4TSFD 1W49A 3K53A 2ZJOA 1E2NA 1DTSA 1GRQA 1EFRA 2ORIA 4YC7A 2YJTD 3RAPR 2BMEA 4LBYA 3VR1A 3CNOA 3W3ZB 4Z1MD 5JWRA 1G3QA 1X8JA 4PAMA 4D4LA 1VIYA 4L16A 3BFVA 4DVGA 5JBQA 2ZJZA 3KTAA 4M1OA 3ETLA 2OT3B 3LLMA 3QF7A 1KO8A 1M7GA 1D2EA 2W0SA 2WAXA 4LDJA 5FPTA 3ZD6A 5C2JB 4ZCMA 3ZGXA 3RWOA 3O8RA 5LD2B 5BYJA 2C95A 4RKEA 2IX3A 2W00A 2X2EA 4ARZA 2Q9CA 1R2QA 2NZ8A 4E09A 2Q9BA 5GVRA 2EFGA 1ZM4A 3OIWA 1YU9A 4FD2A 4EPTA 2YVUA 4B2PA 4RFVA 4WIAA 4ACBA 3GLHE 2JAQA 4JLOA 4KV9A 4TMZA 3AV0B 4NYIQ 1FP7A 2J7PD 1YR9A 1ZW6A 4LJ9A 1NY6A 2DFNA 3QG5A 1AKEA 1OXUA 1ZNWA 2P5SA 1DO2A 1VPLA 4MRVA 1O3YA 4PSKA 4YONB 1D8TA 3I61A 3UIEA 1S3SA 4QXAA 2YOGA 1OKKA 3OAAD 4DB2A 2JJ8A 4GL2A 1OHHD 2J0UA 2MSCB 2PCLA 4LV6A 4KJZA 5FR1A 3EZFA 1DAGA 3UWOA 2XSZD 5K8TA 1GFIA 4X8HA 4EUNA 3Q9LA 1BIFA 2O8DA 3BB4A 4KYIB 1GIAA 1SQ5A 4IDQA 1G6HA 3LQQA 1E2MA 4ZI2A 3AVUA 4W9MC 5DI3B 1G4AE 2BDTA 1G7TA 2ZS9A 5C1BA 2VEDA 1GRRA 3NTUA 1GUAA 3VR6A 4HAVA 3AP3A 1Q57A 3TUZC 2MSEB 3BC1A 1F2UB 3HPQA 1W36D 4JZKA 3AVXA 1CEEA 5J5CA 2J1LA 1NMXA 2W2VA 5G3YA 4JIMA 3T1QA 1E9AA 4XVUA 2C77A 5E4FA 4URXR 4WA7A 1TPZA 1Z0KA 2BMDA 1CS4C 1IN7A 2NOAA 4DCTA 4TL9A 1NN3A 4HDCA 2HT6A 1I2MA 2AWNA 2I1QA 3SYLA 3TSOA 4B75A 3VU9A 3AVVA 1JB1A 1OKKD 2ASEA 4TL8A 1G7RA 2ZYUX 4UNPA 3J81k 3AQ4A 4DDWA 3U7FB 3B9QA 3PENA 4RZUA 4B32A 1AJEA 2HLDA 1QHNA 2BCJQ 3PUVA 4DZZA 3U3OA 2O8CB 1Z5ZA 2NZJA 4JKIA 3GPLA 3AH8A 2ZRFA 5P21A 2YWHA 1UDXA 1OW3B 3B13B 1CJMA 5BWMA 2IYQA 1KI8A 2H1LA 1DELA 3OZXA 4LJ7A 4B48A 1UBFA 4EJSC 2O5VA 4PPNA 4IFEA 3SJBA 2W58A 4JVMA 4QC2A 1KI9A 5GJCA 1XEFA 4ABYA 1RRPA 1CR1A 2WSSA 4P33A 3SN6A 3U7HB 1T6NA 3GJ6A 2A3RA 4O25A 1ZUNB 2F7SA 3L8ZA 1Z29A 4PSAA 1XF9A 1BS1A 3HWSA 3A6PC 4DIEA 4PX9A 1T0HB 1WE2A 1LF5A 2GJ9A 3RDPA 4BFUA 1UEIA 4YLGA 1E9BA 1S9HA 3FMIA 1A5TA 1A2BA 1G41A 1JBKA 5A5GA 3FGNA 2ZI6A 2HLDD 3EIQA 4RCZA 4PR0A 3RSOA 5C18A 4NCNA 1PUIA 4Q19A 5BN4A 4EKDA 1GITA 1YZKA 3GJ3A 2ERYA 1QF9A 2WWWA 5FL7A 2O8EB 2HF9A 3U4QB 1XJQA 1U8AA 4BRWA 3I5YA 2GZHA 5FBLB 4ASUA 3WRYC 4NU0A 2FU5C 3T34A 4B74A 2FPLA 1WF3A 1OFTA 1NJFA 4UQOA 3ASZA 4ZKEA 2AR7A 4B71A 2ZR0A 4KFUA 5AJXA 4JYBA 3THYA 4OHZA 4FCVA 2GEUA 3GLIA 2D2FA 2VSOA 3MCAA 2EFEB 2C78A 4PQRA 2GXUA 1Q20A 4NYMQ 1F6BA 5AUQA 4C2TA 2C9OA 1KNXA 1GP2A 2CNWA 3CONA 1LY1A 1UPTA 4B3GA 1KYIA 2VF8A 4C2UA 1XCPA 5JJIA 4UNRA 2F1IA 3GCGA 4OL0A 2J3EA 3RRYA 1IHUA 1JNYA 4KVAA 2XGJA 2GJ8A 2GESA 2GRJA 4IOJA 2SHKA 4HDQB 2JLWA 1UFQA 2QMEA 1UBGA 2WMOB 5FL7D 3ZS9A 4FMBB 3QUSA 3K0AB 2ZETA 2G0NA 1YKSA 5JRZA 2AX4A 2WJJA 3EIHA 4M53A 4A2QA 5KNDA 2NPIA 4EJSA 5D3QA 3WYFA 3AGPA 3VMFA 4MITA 3NKVA 2P6NA 1AQUA 4NCHA 4ZIRB 2Z4RA 3CBQA 3QSYA 4CZ2A 2GILA 2ZI7A 2C99A 1US8B 4GT1A 1JPNA 1KKMA 1KJZA 4JL6A 2VH5R 4Q4HB 4IXNA 2CNWD 3UK6A 4B76A 3H1TA 2ZTSA 5K8UA 1KZ7B 3TSZA 3B7GA 2CK3A 2OSBA 3B9PA 4IDPA 5L3SB 3LV8A 1NKSA 4U7DA 4HAXA 2FFAA 1W4BA 2HCJB 1LTQA 2OFWA 3NXSA 3IBYA 4CGZA 4DBLC 2ANBA 3C5CA 4DXAA 3HP1A 3MD0A 5D3MA 4FINA 2PZGA 3BD9A 4LHXA 3MMPA 4G0NA 3HPRA 4E07A 4Q18A 3CZQA 2F9LA 4EFMA 2RGAA 3C4JA 2C04A 3ZVMA 4LYFA 1EWQA 3A36A 1Z28A 4A8JA 3ZS8A 1XD8A 1COWA 2BJVA 3A58B 1NY5A 1FQKA 1ZUHA 2P6UA 2IHYA 2OFOA 3FWYA 1S1CA 3RS2A 1ESMA 2ZREA 1S96A 2WKRA 4OQMA 4GZLA 2O8BB 1XPUA 5CIQA 3CPHA 3MGCA 1IJEA 2WJGA 5DHFA 1N6HA 2OCYC 2VA8A 1KDPA 1J90A 4V0KA 4L4UA 1ESNA 1F60A 1TEVA 3KZ1E 3P4YA 3FVQA 2GZDA 1EX7A 1XWIA 4PHGA 3WMEA 4HUQB 4JLNA 2ZRBA 2ZIAA 4BFYA 1RC8A 3GLIE 4OQNA 1XXHE 3LQRA 4DT1B 2QN6A 1IJFA 4ZDKA 4QM6A 1ZU4A 4C7OB 4A1FA 1NI3A 3I72A 2ZAOA 5DI9A 2IXFA 2FA9A 4A0GA 1XCGB 2G1KA 4H9GA 2CHVA 3QOFA 1LF0A 1YVDA 1Z6GA 2CBZA 3RHFA 5KNCA 1IM2A 2JIZA 2FN4A 5TDHA 4Q1CA 3I3SR 1E9RA 1S9DA 3WP1B 3LXXA 1UEJA 4D82A 1PZNA 2KWIA 3BRWD 4TWZA 4BE7B 1ETUA 4Q7LA 1E0SA 1E9DA 3F5FA 2RGEA 4TZ6A 2CL7X 2G1JA 1XTJA 1E6CA 5SZKB 4LBZA 1KO7A 4Q5IA 1T5LA 2NO0A 5FI0B 1G5RA 1VTKA 3HU3A 2LKDA 1LS1A 3WHLA 1OXVA 5FUXA 5DI3A 3WNDA 2NO7A 3N5CA 5SZIA 1VIAA 2WVJA 1OH6A 3NDBB 3WRXC 4G5QA 1FUUA 3CH5A 4LJYA 2GCPA 2G88A 5KSOA 1MKYA 2IS1A 3DM9B 2CXXA 2CJWB 1IY2A 2CE2X 1NF3A 1F2UA 3P4XA 1Q1ZA 2PJRA 2PX3A 1LFDB 1YRAA 3KFXA 4Q4AB 2H7VA 1RIFA 3EARA 2ZEJA 4HLUC 3S1AB 3SBEA 5EZ6B 2IYSA 4Q4JB 2WMNB 3BFXA 1CKEA 3GD7A 3MLEA 2PEYA 1OXXK 3SJZA 4DLTA 1NN1A 1W1WA 3LLUA 4YXWA 1W4RA 4O0MA 3FHOA 5FH9A 2O8CA 1TMKA 2KSQA 1SHZA 4F92B 3G0HA 4URYR 5JEEA 3TR0A 3QPWA 1WBDA 2WOJA 2EU8A 1G21E 2J59A 1G1MA 1SVWA 3OEHA 1HURA 5FTMA 2WWYA 1X8KA 4G5OA 4HATA 4RD6A 4HB4A 4GOKA 4M21A 2IHBA 2GXSA 1OH8A 2AL7A 2DHRA 3SNHA 4B33A 2N42A 1E1RA 4FMDB 1G20E 2FSHA 2VPPA 2QPOA 3VKHA 1KSHA 3L0SA 4V02A 2QQEA 2XZOA 3HR7A 5JLJA 5KOYA 4BLTA 4MRNA 5DISB 2I3BA 1OE0A 4AG6A 1R0ZA 2Z4SA 3WMFA 2HV8A 5CYPA 3WMGA 5JCZA 3BH0A 2R6DA 4FMCF 4GOJA 2B7BA 3C16C 3THOA 1J8YF 2XTNA 1D2NA 3T61A 2A7QA 2WWHA 3R8CA 2ZI5A 3Q3JB 4UNQA 2D4HA 1XDBA 1WRBA 4DLSA 2IUSA 2OLKA 2D06A 2XNSA 4M1KA 4QBFA 1FW6A 1GKYA 5H1YA 4V0LA 1NG1A 2J0UB 3H84A 4DKXA 3CRRA 1HE8B 2GKSA 3X1YA 2E9SA 1VYVA 4F91B 3IHWA 4NONA 2V1XA 4B34A 2ZSDA 4NDZA 2AXPA 4OJKA 2JLSA 3PIRA 3U4QA 5FBVB 1OXSC 2O0JA 1FFHA 5FPYA 4H1VA 4YMSA 2O8DB 3EPKA 4C4PA 1GWNA 1W0KD 2J87A 4UJ3A 5DYGA 2NO9A 5J47A 3HYTA 3U44B 2XXAB 5FOUA 2A5JA 3M0EA 4I4LA 1HE1C 5A0FA 4FCWA 2QNRA 2X8AA 1CF4A 3N70A 2RH5A 3DZDA 3L82B 1P2SA 3Q5EA 1NLYA 3CO5A 4DWJA 2IL1A 2ZJYA 4A9AA 1E2IA 1G3RA 1Q1QA 4JLJA 3KL4A 1R0XA 3KUDA 3L0PA 4MYCA 1VG8A 2YC4C 5FTLA 4DLYA 2OXRA 4C0QC 2EVWX 3FTQA 1VKJA 4CYMA 5KPDA 4BLQA 3EWAA 1TF7A 3DO6A 3JVUA 3PUXA 3OF5A 4RKFA 2OV2A 3ECCA 1NRJB 3EZ6A 2RMKA 3OIUA 2Z5FA 2OFXA 4DLUA 2OBMA 3K0AA 4OYHA 3U6KA 1ZNXA 1G5PA 3KX2A 3NDPA 4GRAA 2NO1A 5TB5A 1YZUA 1GKUB 4A82A 5FBRB 3LO5A 3K0CA 1X1SA 2FNAA 2Q9AA 3ICQB 4BASA 3IO3A 3ZD7A 5K8LA 1QBKC 3PUZA 4ZIRA 1P4SA 2C9YA 1BYIA 3VX4A 4PSVA 3AF2A 1P6XA 4M4SA 3B1WA 1RYFA 2D62A 2ZE7A 4MQBA 2AKYA 2F9MA 1SULA 2GBLA 3QPVA 5E3HA 2CDNA 3C15C 3TAHA 1KDOA 3BXZA 2FFQA 4HI0E 1G5TA 2WV9A 2OAP1 4B73A 3FFBA 5CB8A 4NP6A 2GF9A 4B43A 1NVWQ 4TMKA 1U90A 5J4HA 1P73A 2X1VA 3K9GA 4MDFA 1WB9A 521PA 3MUFA 2F3RA 4XD7A 5L8VA 4OKSA 2Q0HA 4UKDA 5CDFA 2X2FA 3BE4A 2F43B 2VHTA 3K9HA 4PAOA 4V0OA 4ZI3A 3PITA 1XTQA 3FE2A 1NN0A 2HUPA 1MV5A 1SVMA 2QUZA 1N5IA 3IGFA 5DGXA 4Q01A 1IN5A 4JVLA 4KHZA 4P4TA 3A37A 2HJVA 3K70C 2DY1A 1P62B 1NVUQ 3UKDA 1E2DA 1H8ED 3OESA 4F38A 3O8DA 4Q9IA 2IBMA 4PANA 2PLRA 2VP9A 3K0EA 3GMTA 4ZPXA 5EE5B 1YR6A 1XEWX 5BQ5A 2YV5A 1NLZA 3LX8A 4PQFA 4QRHA 5EQTA 1KSFX 3THYB 4YMUA 2PMDA 4Q9HA 3GJ8A 1NNEA 4DSNA 1AK2A 2ODEA 5DYIA 1E0JA 1KMHA 5F98A 4ZCIA 3QF4A 5AJVB 4PPGA 1AN0A 2CLSA 3W34A 3T15A 5KDLA 2QMOA 4XD7D 5EUMA 2IUTA 1AGPA 4MGYR 4ZDJA 1NSFA 1X1RA 3GJ5A 1ZIPA 1UBEA 4I99A 5FUYA 3LH5A 1YQTA 1XCMA 4MA4A 1JAIA 4DT1A 4JL8A 5FUVA 1YRBA 1Z8FA 1BO6A 4TMWA 2V7QA 3FKSA 1CRQA 1NVVR 4UJ5A 4D26A 1XU4A 1EG7A 2XNDA 4TTQA 4W5HA 3PXGA 1E1QA 4EIWA 1H8HD 4I81A 1EGAA 1OT3A 4JVNA 1UBCA 4KAXA 4V0ME 4EPXA 4EJSB 1G7SA 3EASA 4AKEA 4PO9A 1CLUA 4DDTA 1KMQA 4KYUA 5TV2A 2BIFA 2YWGA 2XOKA 5J4KA 1M34E 4DJTA 4Q1DA 1P60A 2B8WA 1DEKA 1GL6A 1U0HC 3AUXA 3QE0A 3ZJYA 5IT5A 1JALA 4A6XA 3BERA 2BMFA 4LRWA 5EJEA 1NLFA 2H17A 4DRZA 1FL9A 2XB2A 2K5UA 4A2WA 3F0TA 2KB0A 2UZIR 1FOEB 2CJWA 2GJAA 4UXIA 4HAYA 2V7QD 3D7MA 5DE3A 2YOFA 3L0IB 3RSLA 4D0LB 1W46A 2PH1A 1ZC3A 1T3SA 2O0KA 4Q4AA 3IIJA 2GCOA 4HB2A 2GA8A 4RSGA 5FOSA
chains in the Genus database with same CATH superfamily
4MV3A 4UUAA 2QRPA 2ZS8A 3S1AA 3ROKA 4CL3A 1NTRA 4Q82A 4ZYWA 5JD4A 5KYYB 1ZGAA 2C92A 5FUMA 5BQ5A 2OCBA 1ZBDA 5AIBA 2R6R1 3KOOA 2QAGA 1WCWA 4NENA 5CDFE 1EUCB 4REQA 4Q9KA 3DVRX 3KQTA 3QVUA 5G0SA 5I9NA 1V9CA 1QYIA 4A8TA 4B6SA 2N1BA 4TTSA 2JFGA 5EXPA 1KRWA 1L1FA 3VNVA 1D04A 2XYPA 1V8FA 3ZGVA 3H0CA 4R1OA 4QFMA 4INZA 4D9BA 1PGPA 3IUJA 3KQSA 4AJNA 4PC6A 4DILA 4IYRA 1RLOA 3ESZA 3Q2KA 2CHFA 1W4AA 3KT8A 1GV0A 3OOWA 2AJCA 5JSHA 1U8EA 1WOYA 4XM1A 1EZZA 1KP3A 5F7OA 1MB4A 3QJYA 4EPRA 5JHGB 1QHYA 3LK7A 4OX9B 1SR8A 2P1ZA 1FS5A 4URUR 1U28A 3MJFA 3QUCA 1IWPB 4Q21A 1VXOA 1A4RA 1DZIA 4D4MA 1ISHA 4XWTA 1X70A 2A3NA 4ROSA 4H4CA 2JFOA 4XW2A 5AW7A 3GCDA 4C88A 1F8XA 3DTVA 2R5WA 4RPHA 3L7IA 1FCJA 1YJQA 4GPIB 3UF0A 1LX6A 2O8VA 3AM3A 3TD6A 5LZ8A 1F06A 4O59O 3LHDA 3R6LA 4PZCA 3SZMA 1H2XA 3R20A 3Q0TA 4QE3A 4C08A 1GZ4A 3JD1A 2PY6A 3CZRA 5BSTA 3DAHA 4DA9A 1AIPA 1XDWA 1EFRD 1KQPA 3BWDD 3H13A 4HNUA 4LJRA 1CHDA 1G9XA 3F47A 5AM1A 2IH5A 3EK2A 2A59A 4IV8A 2NV2B 3DSRA 3EZ2A 1XUOA 4MS4A 4ZGWA 2PSSA 3HLYA 5CJJA 2COEA 4RLFA 3NHZA 3FRJA 1PCXA 2P9GA 3ZU3A 4UTNA 1XAGA 5AK0A 3OZEA 1SUBA 1JR3A 4W7IA 2Z0MA 2WABA 1P5HA 2JVJA 4EL0A 1L9KA 1HT2E 4ETWA 1IAQA 1IXZA 5CP8A 1NN5A 1V39A 4FYMA 3EA0A 4FJ0A 4GPD1 4NJMA 4OI1A 1E3WA 1K5GA 2XUOA 3MHTA 3KXLA 3ZWKA 1E2EA 2FE1A 3FWZA 6PFKA 4J9VA 4Z3DA 3FROA 1Y1TA 3EDRA 1D1QA 4HVTA 3VTAA 1ZJ5A 3T5GA 1LI5A 4M1SA 1CQJA 1AY0A 3KVNA 2XXAA 3I53A 4JLVA 1WU8A 3E2IA 2FN9A 3ORSA 4KSCA 2JAHA 5I7UA 2VR1A 2X19A 4M3NA 2ET6A 1NI5A 3HY4A 4ZDWA 1J7KA 1ECFA 1Q44A 4IIGA 4KQFA 4PNPA 3W7VA 5I4BA 4R1QA 1H1DA 3KEOA 1YK1A 2AOTB 3F74A 4OUDA 1U5BB 4RIGA 1KO5A 5C5EA 3ZLVA 3NEAA 2IEBA 1X1QA 1BFDA 3FX2A 4GGPA 2HU8A 3HCNA 4TRRA 5B12A 5I01A 3G59A 4QUIA 3VTKA 2OCIA 3V55A 2IQIA 4MXDA 1CUWA 4DIFA 5LFAA 3G7NA 2NUBA 1ZOOA 4QXQA 2B8TA 2FXIA 2ZM6B 3PK0A 1A82A 5LA6A 3I3OA 1JR3D 1O54A 4RKYA 4CGYA 4E22A 3WGMA 4M87A 3HV0A 4FN4A 1FLVA 2CC2A 1ORDA 3OFNA 4MKHA 4UOZA 1QG6A 4GMXA 3NGLA 5M7EA 2B34A 5U9CA 1R0WA 3UHOA 3OZRA 1QYRA 1UJNA 1PHRA 1ULSA 3KDSE 1NQTA 4NULA 5SZHB 3SSOA 5LUAA 4D25A 4WCFA 3F73A 4IIJB 3RAEC 2AEJA 4MGIR 5THKA 3AUJB 4IFIA 3VR6D 3KOWA 3FHLA 2PGLA 4UU1A 2FFBA 4N65A 3EPPA 4HGQA 3MTJA 5M3BA 4ZMRA 3NOQA 3ENQA 1JZTA 3FTDA 2GZSA 2PXXA 4DBVO 5BN3A 3TSCA 4QA9A 4H7DA 3ERCA 3EH1A 4PHHA 4B47A 3WBFA 2ZVQX 2NUAA 2W2PA 1Z4PX 4FN5A 5DRTA 3J80A 5TMBA 4DNFA 1YGPA 1J1IA 4RA9B 4NYJR 3C0KA 1TZ2A 2QAJA 3HXLA 3P27A 4FEAA 3MSXA 2AFHA 3LDHA 4C7KA 4E11A 3MFYA 3V7FA 1S89A 4EECA 2H1FA 3AWIA 1BMTA 3EMVA 4RA6B 2IZOA 3KSBC 3D1VA 4O1MA 1TEZA 1EFCA 3MM4A 2WU0A 2ZSAA 3OFND 4W99A 4AN4A 4LX0A 1MENA 1T3TA 2CMDA 1RQNA 1CLEA 2VYND 3AK4A 1IZYA 3M5DA 2X6TA 3U1TA 4ZREA 2PJZA 2YRWA 4X7RA 4LQDA 1UWKA 2QT9A 3IPAA 5B1IA 3ASYA 3VHLB 4C06A 5IRCD 1NJ2A 3FI9A 4E0BA 5DW3A 4Z0PA 1QP7A 2NZXA 1JDSA 4R71A 3TEMA 1QIMA 1T6ZA 4ZEXA 3EVAA 2Q21A 1X3LA 3EJWA 2N3ZA 3Q1KA 3W90A 3A9UA 4EUSA 2DBVO 1NW4A 1UM9A 2GBGA 2GCNA 3ZN2A 4P4UA 1DFIA 3VKVA 3LE8A 1BOFA 5C31A 2QTVB 2PZAA 5E7MA 5KNBH 1VOTA 1DAKA 2JLZA 1RTKA 2HXSA 4RK7A 1GFZA 3RC1A 5BN1A 4JY7A 3EXHC 3U4DA 1VHLA 5IS2A 3E23A 4TUYB 3SR0A 1JA9A 1V48A 1X7ZA 1ORVA 3TM4A 4LHSA 1MT0A 2HPVA 4LXGA 3OZCA 1WD7A 2PAAA 4JASB 2HK7A 4RH0A 1EU1A 5ALYA 2XZLA 1MRSA 1I3CA 2IYOA 3OMXA 4R41A 4WN9B 4Z2AA 1CEXA 3JYLA 1XQWA 1S8FA 5HOQA 4G56A 3SE7A 2Q5OA 2J3LA 1P3JA 4BHTA 5C0OE 4EELA 2QL9A 2B8JA 1REQB 4Y1GA 4HAWA 1GG9A 1Z6AA 1LWOA 1ADFA 2VXOA 3N5KA 4G5RA 1U7ZA 4LI3X 1LW7A 1I80A 2WU1A 3ZHYA 3S8EA 2F55A 3HDJA 3EVDA 3DBLA 4HAUA 3PFNA 2QZJA 1T4BA 4YRTA 3CLVA 3D8RA 3VUFA 2O5CA 3IO5A 3PNPA 1Y4ZA 4TN1A 4UEKA 3AFOA 4OK3A 1FC0A 4O08A 1E3LA 2NTYC 5ECYA 5BQPA 5KMGB 1FDWA 3EVTA 5I7WA 4WH0A 4F3TA 2MR5A 1ZN7A 4QOHA 1RZ3A 3SSAA 5LL6P 1SG9A 4A23A 1QU3A 2A1IA 2O5RA 2FN3A 2Q6TA 3K6RA 3K9NA 3R6WA 4MEBA 1JA0A 4ZYLA 5H9VA 1CR2A 4JJKA 2B82A 3KKNA 4GBMA 1K63A 4E13A 5JS8A 4UNNA 2QEQA 3H1AA 3PC4A 3UJHA 3G2QA 4IW3B 4X1OA 2ENUA 5KYGA 1H2AS 2RHTA 3FCUB 2ATVA 4M8IA 4NV1A 1LK7A 2D2XA 2GAAA 4B40A 4Z0TA 4DY4A 1T25A 2ZU0C 4D3SA 1N0IA 2Z30A 1Y8RB 1BDIA 4X1KA 3K0BA 1BFKA 1NNI1 3H4MA 4PG7A 1OH7A 1XLUA 3AXTA 2E82A 3CLUD 3LNCA 2CJPA 1KAOA 3LRTA 4HH1A 5F4BA 3RG2A 4EEZA 1DKLA 3WDLA 1ZLYA 2OFPA 4DCVA 5KVAA 2EDCA 2XDYA 4R1UA 3KEQA 4X8OA 4WGFA 3D2LA 2LCFA 4BVJA 5CBPB 3OM8A 4JLSA 2PLNA 2JKVA 1U02A 3T5MA 4EGFA 1JXAA 5D5PA 721PA 3TOZA 4TQUS 2R96A 2BGTA 3AG6A 3MTBA 1ZIOA 2I2WA 1X7XB 2Y2UA 4AQ7A 1E2UA 5AK3A 1DKNA 1ESDA 1XZMA 1U2DC 1QC5B 1U8TA 4KDFA 3AL3A 5BMVA 3BFKA 4CMJA 1EVJA 5E7JA 1PGNA 3I30X 3MCUA 4WRRA 1ISPA 5CXSA 1ZONA 2J46A 2NO6A 3QE9Y 2PSDA 3BIXA 3OF3A 5D7BA 4AP6A 4RXUA 4ZZ2A 5D3ZA 3EZXA 1OZFA 2FSVA 4O4HB 1T5IA 3KZNA 1OPXA 2CCJA 1P4AA 3PQFA 4JYAB 4DUZB 1GXSA 4JMLA 1J23A 1HEYA 3AVYA 1EWRA 2CXNA 1K9SA 5C46F 4TYNA 2YYYA 3RKRA 1S1MA 4E03A 4FEEA 1TT5A 2HMUA 3MGGA 2ETVA 1K6XA 1VZ3A 2ZWPA 1JILA 2K7ZA 4IOLA 4B8ZA 2BM0A 3OO0A 5JNTA 4A3SA 1W73A 3HH8A 2BEWA 2X3FA 3LQ4A 4LXHA 3WYGA 5LJIA 5CITA 4HQ0A 3VDRA 1N2XA 1V3TA 1O6ZA 1XRPA 4BP3A 3E15A 1R18A 1NJ6A 2ZAMA 1JSXA 1JI0A 1QHHA 3FDZB 4KWHA 3DKPA 5P8WA 1DXQA 3ZDRA 1LQTA 3VR2A 1TJNA 3A1WA 3NVKI 5LU9A 2OFFA 5F23A 1WUHS 4FFBB 2V96A 3A1TA 4R1NA 2FEAA 4Y1RB 4KGDA 4LOKA 3WK6A 3PPXA 3C70A 1FFAA 3V97A 3V8RA 1XKTA 2H2IA 2QRKA 4ZVVA 1C9EA 3HJTA 4NNOA 1QM5A 3ZWQA 1NYLA 2VWHA 4NJOA 4DC1A 1SG6A 3GFOA 2X4GA 1JLMA 2VSNA 3MA0A 4HTFA 1MABA 1ULUA 3ZV6A 3R23A 3S6JA 3R0JA 3IT2A 5GV7A 3VX3A 2IW3A 2V7XA 3CKYA 5BOVA 4B3BA 1Z62A 3TE6A 1Y4SA 3MS7A 1H65A 3K09C 1QIGA 2YUIA 3DMTC 2PZMA 5JR3A 4US2R 1UXKA 1XL0A 3DM5A 3R0IA 2PYZA 2QMYA 2HRZA 4X6UA 3DXZA 1V11A 1UKYA 3MMXA 3WTBA 3ZDFA 3WGNA 2AN1A 3H9EO 5T4FA 4A92A 1U80A 2WT9A 3ZZ1A 1PVVA 3WGYA 4EMSA 1R5NA 4N7BA 4EVIA 1T4MA 1J5XA 1YZNA 1IZ0A 1UPFA 2ID7A 2ZAIA 5CLFA 2B37A 1I1NA 1IVSA 4NEHB 1T1SA 4HGZA 3VR2D 3DT8A 2IY7A 4DA4A 1IN6A 2I7DA 2WWVD 3BSWA 3ZHUA 3GMDA 2AMJA 1P5ZB 4ZV9A 2Q3FA 5JZOA 1C1XA 1TLFA 2RIPA 4QO8A 4EAAA 4UVEA 2DP4E 1OIWA 2G63A 4YV2A 2GVZC 1YD7A 1WTAA 2VYVD 2TMGA 1ZQ9A 3H2YA 3K4PA 4RW0A 4LXTA 4F11A 3VQTA 3CLSD 3LU1A 4E4YA 2H48A 4EYSA 1W88A 4GI7A 5C37A 3C3JA 4UM9D 2AOWA 1L4GA 2VF2A 1E7WA 2XITA 4GP7A 4UDNA 5CK4A 1F48A 3ZU6A 3DMPA 2QZSA 1V41E 3R3WA 1VYTA 4UTOA 1B00A 1B8PA 1NUPA 4MNTA 3QXSA 3A9VA 5TXGA 2YXLA 4XVCA 3RRMA 1N2CA 3ABOB 3QNUA 1D2CA 3ZVNA 1YJAA 4UREA 1KS2A 4G26A 2C5SA 2N1MA 3VHXB 1FBTA 3VUEA 1XEXB 1GYPA 1EDBA 3E3AA 5B2ZA 1WZIA 3N7AA 5IJ9A 1G8FA 4IIFA 3LL7A 4RHFA 3EXAA 2ZI3A 3FPKA 4DAEA 3RH0A 2RHDA 2ZDHA 1Q1EA 5ICFA 2EX4A 1KF0A 1TLTA 2Q4RA 2VP5A 3FWPA 4CDGA 3A1UA 3AI1A 3W77A 3II6X 1BW9A 2QRMA 4LVUA 1ULHA 5E6RB 5EA2A 4JI7B 1Q7GA 4OHVA 2FETA 2HIMA 4M0KA 2Q3MA 4DLBA 1VDZA 3DQQA 3T7AA 3K3PA 4KNYA 4M0MA 1NYRA 3CEAA 2R8RA 2JD0A 4RVCA 2FR0A 1NNLA 3H2BA 2VI5A 3NG1A 3FGZA 4OP3A 1ETHA 1HSOA 3MIIA 3ORQA 2AR9A 2YC2C 3WYCA 1JJAA 2Q3EA 4U8HA 2IYNA 5U4XA 3RBAA 3AHIA 3DW3X 1N0UA 4YAGA 4CKWB 3B9RA 5DM4A 2H2FA 1UBTS 1J0XO 2E85A 3CEMA 3DYBA 3OEHD 3ZQJA 2QTWB 3HNRA 4JJ7A 5JFGA 2VHJA 5H59A 1LLQA 1G8GA 3PJRA 5TE9A 1AUXA 1R9MA 1PW7A 3R9XB 3GLGA 2WIBA 5I5EA 1PBNA 4A4DA 3K8YA 2XMCA 2IH2A 3SQXA 3W6UA 1QFSA 1LCIA 4BFCA 3DVAA 1U2RA 1OZAA 1ORWA 1Q0ZA 3MJDA 1RI5A 2FJUA 2A4KA 3JZMA 1YBMA 1DINA 3PRJA 2QI9C 1U3VA 3AJ9A 2WYUA 2ZYIA 2BFMA 2X8JA 3AB8A 2RHRA 3GG9A 3INNA 3LXMA 3PFKA 1RXUA 3PWKA 1U65A 3ASUA 5EZYA 3SBOA 8ADHA 4EUEA 5JAUA 5LQRA 2AHRA 4CTOA 3HYRA 3NT5A 2UDPA 3WHPA 1I3LA 4HQFA 1LI7A 4WFKA 1DAOA 4BQIA 4LBVA 4ZC8A 3UH0A 5HXAA 1TMGE 1JJVA 5ALIA 1E6MA 4WSOA 1DEHA 1OFGA 4C7VA 4TLCA 5FNVB 2PE5A 4DBLE 4MW9A 3LZCA 4B7AA 2F64A 4DQKA 1AKTA 1GSHA 3C5VA 2V55B 3B36A 3GEEA 4YREA 3E7XA 3EIFA 3A4IA 2G5TA 2Z9BA 5JI3E 2RB5A 4AJJA 1VGQA 3IIKA 5AVTA 3FKQA 4IH4A 1L5NA 2UKDA 2ZWVA 4QXMA 3AHCA 1OROA 3B85A 4DJFC 1C14A 5CXXA 2WK1A 4YMIA 4DLKA 5JY6A 3W5IA 3BMQA 4J94A 4W6QA 1TKRA 3TZBA 3A3NA 2J0QA 4Q1FA 1WZEA 1OBVA 4ISCA 5EJ8A 5LZ9A 3L7MA 3QY0A 4WEQA 4YRCA 2WYWA 1PV2A 4I1IA 4JC5A 4MO2A 1WL8A 2A7XA 2JAWA 2EBWA 3BIFA 1XNHA 1KI4A 3EZGA 3K92A 3PNVA 4MWOA 4W8OA 4FS8A 5ULLA 3ZWXA 2WT8A 2AJLI 1JMKC 1GD1O 1W5FA 2W6MA 4PHFA 3O9MA 4QBTA 3LGXA 4AP9A 5IH7A 1BS9A 4BDTA 3QU7A 4BFTA 1O5TA 3DZJA 3OD1A 2Q3LA 1EX9A 1OWMA 2W37A 2ZBEA 3QWIA 2I2DA 2J31A 2DWQA 3QSGA 4AMZA 3JQFA 3GL9A 3FVRA 2AC2A 3G1WA 3N2KA 2XYQA 2ZQ5A 3L77A 1PT7A 1ONPA 3MWLA 4QSMA 5AW1A 2IH4A 1YDGA 5AW5A 3SJUA 4AIIA 2B5VA 2MMCA 2FHPA 5DBEX 3PEWA 3FDFA 3QBJA 1C3JA 1QXSA 4N48A 4M0LA 1NC3A 2NT4A 5B30A 2IEIA 1GGEA 3HBAA 4EJ6A 4PCAA 4X45A 4JXJA 1RE1A 2YX1A 3B1JA 4JLWA 1RZRA 3D3JA 1GQOA 4G5GA 1RPJA 1GZ7A 4OJYA 2B1GA 2W42A 3IEIA 3INRA 3GBPA 4RK6A 1NC1A 3GT4A 4KQEA 3P96A 4E3WA 2V7BA 5IN4A 4LY9A 2AG8A 1EM8A 3KQMA 1RP1A 3DFKA 1K5PA 2VDNB 4IJ6A 2WFLB 3IMGA 3ZZ0A 1HG1A 5JWHA 4D43A 4TLMB 3O4IA 4CM3A 3K15A 1VCNA 3TNDA 2PT9A 4QODA 3FYHA 3R4VA 1UP7A 4WZAE 2P4UA 4E5DA 2XUAA 2VUTA 4DV6B 4S24A 2JLVA 2GBCA 5CLQA 4PHCA 1M75A 3TIGA 1F5NA 1ODIA 1X1DA 5JIBA 5FA6A 4BIIA 2XQGA 3OZTA 3FHCB 3WO1A 4WECA 4ZRNA 2OSVA 3W04A 3I64A 3M7IA 3T6KA 1SWWA 4PGAA 1WXEA 2LIVA 4XX0A 1V1MB 2IGTA 3M3PA 2B9EA 2YXNA 3VZRA 3CRQA 1Z5WA 2VNHA 1T24A 3OQ1A 4NQZA 4PC7A 5TMDA 3TAXA 1GLVA 1KDVA 4J3NA 1GDHA 1KI7A 4JAVC 5AM2A 2C1ZA 3X2EA 2UYYA 4KMOA 2PMFA 1QLWA 3HJBA 4REMA 1PE0A 3I9OA 2Z9DA 4NMXB 3TOXA 2WM9B 1E6UA 2JFNA 1AUVA 1I6KA 1KK1A 1IN4A 1XT6A 4IIUA 4N03A 4IRMA 3VV3A 3C7DB 3L4EA 5JSFA 2GAFA 1NJSA 2GYYA 4TWAA 3QW2A 3WRWA 1E69A 2BGKA 1HXHA 2FWPA 1F2TA 4L78A 1LZLA 2Q5IA 2JFWA 1Q2UA 3KYJB 3CA8A 1DUVG 4URVR 2P1RA 2VPYA 1PWEA 4KAAA 4FP9A 1I1HA 5EYPA 5AUPB 2PUFA 3FFTA 2I4RA 4MRPA 2OXEA 4Q93A 4UHCA 3M3DA 2NAFA 1F6DA 3VU8A 4P0PB 1BH6A 621PA 1XVAA 3BWYA 1Z2AA 3HJNA 4MR9B 2OG2A 5CBKA 3BAZA 4TV8A 4F8YA 2E1PA 2C8VA 1ZM9A 1EZ4A 1YFLA 1EI9A 2HADA 1BQ3A 2ZE6A 4BNDB 2UZ3A 3I8XA 4WKNA 4YT4A 5IDQA 3NXKA 1YZVA 1C80A 1R6BX 4EJFA 2CFRA 2NU9A 3GVCA 5JXJA 2PFGA 3OE1A 4URWR 5E6SA 2C4MA 5LLSA 3N3AC 3HDQA 4GOND 4DA8A 1JECA 3FKSD 2G0AA 4PAGA 4E46A 2I8CA 1QF6A 1J5PA 3WGQA 1D1TA 3BFPA 2BZSA 1UKBA 5AWFC 3WWDA 3C45A 1KK3A 1F51E 4FHCA 5HZKA 1KTVA 1TW2A 1Z0FA 2IY8A 3OP1A 3QKUA 5CLLA 3EGWA 4HGOA 2PUHA 4LVNA 2R4TA 1O2DA 1XYGA 2EFDB 4LISA 2QY9A 1JMYA 5A3QA 3T1VA 2JJ1A 1VG1A 3CBGA 3THXB 1QOQB 3FBWA 3GPCA 3EXHB 3HEAA 3NBYC 4A6PA 1N1MA 3WWZA 1KJIA 1EIWA 4L5BA 2YOHA 2FEWB 2LXNA 4I4CA 4MOWA 4JOSA 3KQNA 4BCBA 3AKDA 3D8HA 1S3GA 1U9YA 3EGDB 4HDRA 2CL0X 2Q3CA 2QTTA 2QMUA 2NSDA 1LNSA 3AR8A 2C57A 3EC7A 5TQ2A 1ZIYA 4S2UA 5KDDA 3DEKA 4YJ3A 4Z8YA 5G3ZA 1CJTC 2Z04A 1UP4A 2PL9A 1M1YB 3LDAA 1W96A 1JHPA 1LJLA 1ZRHA 1BGWA 1EH5A 1QGDA 4L4RA 5DIZA 3JRXA 1FVFA 1P1KA 4ZVKA 5I9TA 5IK2A 5L95A 3FGPA 4FYIA 3TGPA 5FEMA 3B1VA 3V5NA 1C7ZA 2FOLA 2YJNA 4ARVA 2A0KA 2RFLA 2XRZA 3HKEB 4JL5A 3IV9A 2PGAA 5F76A 3GPBA 1OHHA 1NUAA 4PPYA 3WYAA 1P1RA 2AYZA 4PIVA 1XN1A 2C7VA 1V7ZA 4OYRA 3T9AA 5KJ1A 4LOJA 3H3FA 3G2MA 1BU5A 2JJ1D 4URHA 1UJ5A 3TLCA 4BQQA 5KNBD 5LQNA 3E5RA 2Y93A 2C2YA 2F59A 1RRMA 2J0VA 1PLJA 2DULA 4I5IA 3ZV3A 4MDEA 4YTEA 3M1AA 3HKBA 2TRSB 4MINA 4MV7A 4GOOD 1R7RA 4JJIA 2VRWA 1P9RA 2KPOA 3PCTA 1VL5A 4RMIA 1X13A 2Q7DA 3U31A 1KYXA 4KPYA 1RWXA 2OD9A 2MT9A 1SZDA 1CV2A 3JW8A 1ZVJA 3DLHA 1GLGA 1WS6A 3G9TA 3T4EA 3CMCO 3E9CA 1JVNA 2PKXA 2P9YA 4LMRA 4N12A 3VAAA 1L1QA 4BFLA 4EL5A 2OBNA 1UBLS 2PX8A 2ZANA 1ZP6A 4LSZA 5AI8A 3NNSA 4KXXA 3RBXA 5L3QB 3B5JA 4N01A 4COKA 1R5OA 4PGGA 3T1OA 5A62A 2OENG 2FRXA 5IK2D 1KKLA 2CLOB 3R9WA 3VJRA 2VL7A 3SFTA 2G36A 1U11A 4DBZA 1J8QA 3WLSA 3I6QA 4GSLA 3C1TA 5CCXA 1LVGA 3RLFA 2ESRA 3CT4A 3WSTA 1JEEA 5M04A 2WPDA 1G19A 3COJA 4RMHA 1BXGB 1G8KA 1MQ9A 1XZHA 2PRKA 1TZCA 1HX7A 1PLLA 3KL2A 3UW3A 1PWZA 3Q5GA 1X7GA 4B7XA 2QD2A 4XB2A 3W2FA 1YDFA 2CT8A 3X43A 2WJ4A 4WXEA 3GEBA 4GYYA 3QGMA 2ZTVA 1PGOA 3LLCA 2PANA 3CC8A 3UWKA 3DMYA 1EUQA 1XQ1A 1J9EA 1E96A 1Q6ZA 2BEVA 4JJEA 2YIDA 4LZZA 4D6PA 5F33A 3S2GA 5KVQA 4WLNA 5GIPE 1CB0A 1RI1A 4D92A 3LGAA 1XD2B 2X58A 2VP0A 2I0FA 3CX8A 2ZOSA 2JFZA 4RD4A 3RT1A 1HSZA 1I7SB 3LUPA 1A27A 2PZBA 2XB8A 1QLHA 5NULA 2ZS7A 1FP6A 3IPYA 1KDYA 3O8BA 4CG0A 3IOMA 2ZVPX 2QTAA 2GFHA 1JDZA 3S29A 1DBPA 4YQZA 4B35A 2A88A 2E4VA 1SD5A 4DE5A 4BNXA 1JI3A 2WPDD 3NIGB 3AVPA 1NSYA 5F1OA 3ZW8A 4G1BA 1RRGA 1PEAA 2HWUA 3QEMB 1GYQA 4B4UA 3PD7A 1FRVA 1AUOA 4WXMA 5IMBA 4F56A 4G0UA 3CNLA 1DG3A 1PS9A 3Q3VA 3QPCA 3WVNA 4D1YA 4OMUA 4M1EA 3WKDA 4OQLA 2J0EA 1PJ8A 2EW2A 4BQSA 1M33A 3JQGB 3A6EA 1K8XB 1YA4A 4MW4A 2ON6A 3DAPA 4H7JA 1QHXA 1OF1A 4OBBA 2D8MA 4G4JA 1EHIA 1I8TA 3ELBA 3MQ4A 4XQ0A 3MAAC 1BMQA 3W5VA 1JDNA 4U7TB 4H2DA 4OXXA 2UXDB 3DCJA 4BMSA 5TMPA 1OR8A 3G8CA 4JI5B 5CDYA 3U3MA 2YWXA 1WA5A 4D4GA 3C7CB 2X1MA 4L7QA 1NGSA 2DH5A 1ADYA 4PEVA 1TZBA 1QO0D 2H5EA 3OQPA 5A04A 3A1CA 1Z35A 3CW8X 3I5UA 3NNDA 3HXMA 3RS7A 1FPMA 1JQBA 2FFHA 1NXOA 2WSIA 1HE3A 2BH9A 3K0FB 4OVKA 2XYVA 3ICWA 2B0JA 2H08A 1KJ8A 3E9QA 2PCJA 4BAUA 5EXTA 2COKA 4L4XA 2PGXA 2RGBA 1JFVA 3CMMA 1P0IA 3B1ZA 4BKMA 4QASA 1XGKA 4OJTA 2C2BA 3L7KA 1CHNA 1KHTA 1V1RA 2GERA 3UMVA 1ZLXA 2X6QA 3BWEA 1NVGA 3ZBTA 2ZPUA 4IJWA 4TXJA 1PQYA 1S8OA 1RT9A 4KBGA 4LJ6A 2XYHA 4ZK6A 1BVYF 3K30A 1XROA 3P7MA 1QHFA 4FOOA 2YDXA 4HPXB 3VPSA 1SXIA 2C94A 3SYNA 2CV2A 4HXFB 4KFCA 2O4UX 3P8ZA 4H0FA 4RY9A 1X80A 1WUYA 1JHYA 1U2GC 1V47A 5ECWA 1KBOA 2VS1A 2I3AA 4YEDA 4KODA 3AOEC 4TQGA 3JPWA 3RVMA 1L4BA 4F93B 4KR6A 2I76A 2W6IA 3I2JA 4CV1A 1M2VB 1KDRA 1U1CA 4LHEA 5JXGA 4PYJA 3MJSA 4UUNA 1HL3A 1VRCA 2PG3A 1AKRA 1SVIA 2AHOA 2VLIA 3NRJA 4Q7KA 1ABBA 1XXHA 2FPKA 1J49A 3DVLA 3O93A 4MQUA 4Q3CA 1GVHA 2EF1A 5AHWA 4OHBA 3O84A 5IC6A 4Q37A 5BVGA 1T9HA 1Y80A 4CUJA 3QXGA 2PX5A 4XCXA 3EPRA 1DL5A 3L0BA 3UWPA 1NVEA 4E51A 3O3MB 4YK7A 2DLCX 2Z8YM 1VL6A 5CG2A 1ODLA 2BPOA 2AGVA 4R1SA 1HDYA 4EYQA 4CIXA 4LXUA 5DNAA 3I2YX 2Z6UA 4KQMA 1JHXA 2QG4A 1RXYA 2UZAA 1RM5A 1X7YA 3N3BC 5JDCA 1DNPA 3CSSA 3SIWA 4BUCA 3RIYA 5KJEA 5T7BA 3T0IA 3H97A 5FBQB 1L8XA 3CM0A 3VNAA 1W44A 1IQPA 3INTA 1FMTA 3MN1A 3H8VA 4L6CA 1W48A 3HJCA 3DT6A 5IABA 2PU5A 5FD8A 4B1FA 4N5NA 1YNOA 4C29A 1QKJA 1PR2A 4RVFA 4LI0A 5JAPA 2OORA 1RRCA 1Q0RA 3QH4A 3LT2A 2W6ID 4R40A 3SR4A 3UEOA 5JS1A 1JG3A 4WL0A 3V33A 2OM6A 1QUEA 1MO2A 4IHJF 2A9RA 3OQIB 2DUUA 3V4RA 4WBSA 1G291 2CLIB 5EIBD 5IBPA 3KQHA 4RD3A 1EKXA 2OLJA 3FOWA 4N1AA 4W5QA 1Z2OX 2QUBA 4HDOB 3QVTA 4QUEA 3CLSC 4MGHA 2IPNA 3TUIC 1WSWA 1M73E 2OWDA 2ZJ8A 4BO5A 3CR7A 4R05A 1L4NA 4QBHA 4RKRA 3UZUA 3SQDA 2IXAA 2O3JA 4IRUB 4ZEVA 5EJ7A 1II9A 5DW0A 2MHCA 2MINA 5ESWA 1NBOA 1GSAA 2AFIE 4QGAA 3QPBA 2PH7A 1XTTA 2DM6A 2XE4A 1NF2A 1TJ5A 2FEOA 2PD6A 3C3PA 1Z47A 4N4AA 4OOEA 1J1UA 5JHHB 3RU7A 3PGMA 4PG4A 4CKEA 5MGBA 3GEMA 3E82A 4IY1A 1IC6A 4EI9A 1C3EA 4ZO9A 5H81A 1T9DA 2LR0A 2MYUA 3GX1A 4MQ4A 1TTQB 4TMXA 1AS3A 5A0TA 1V25A 3PTLA 5I51A 1YIDA 1E1CA 1SXJA 2PKCA 3N6RA 1YTLA 4B3DA 1D1PA 4W6ZA 1E2LA 4BLWA 2J3HA 1A5SB 5F5XA 2O4CA 4C0JA 3RPEA 2ZR9A 2C07A 1GUZA 5EJ6A 2JJYA 5JFOA 1KK0A 4IEEA 2NVOA 4NEQA 1DARA 2Q5LA 3OBBA 1NV9A 1U63A 1KIFA 1XMXA 2X2OA 3PNLA 5FOWA 1A9XB 5IDVA 1G20A 2ZWAA 3I6YA 3EFOA 3UXHA 3OQNA 3ZHXA 1EGQA 4XCQA 1Z5NA 4Z8XA 3RVNA 1QB8A 4JYCA 2G6BA 2J9XB 3OWHA 4D9JA 1C0LA 1KFEB 3MTDA 3V2UA 3UATA 6NULA 1RVDA 4NOJA 4K03A 2W9XA 4P4NA 4TWRA 2WB4A 3GGDA 1JYEA 5DWDA 1XQYA 4L76A 3ZD9A 2G1UA 2WP8J 1NP6A 1BS2A 1JW9B 4Z51A 1OY1A 1Y3AA 2W6QA 2XUQA 3QNWA 3QXXA 1ORTA 2X4LA 5G40A 1ILEA 2BBOA 1EFKA 3TMKA 2E21A 3UCXA 2V6JA 2O1SA 4XSHA 2Y27A 3QU9A 4NIMA 2H4ZA 1YHYA 4O4LB 1KJ9A 2YXBA 3ACDA 4ARSA 2AMLA 3FDIA 5CTJA 2GWHA 1SXJD 2H1HA 3JAWA 5CB4B 3WFJA 5AOCA 3HVHA 3ZOKA 2BFEB 4HLCA 4N0DA 2P67A 1L2TA 2V9ZA 3WKBA 1CR4A 1Z2PX 3P32A 2QTRA 1PL0A 3NGMA 1QCZA 2RI1A 1EE2A 5CFQA 2YWDA 4QPNA 4Y9SA 3KU1A 4OFXA 4QKQA 421PA 4A8PA 1FFBA 1J4AA 1DO0A 2YHIB 3ZWOA 2C7RA 5CIYA 3KOUA 5EKXA 4F8JA 2C00A 3W3AD 2VHCA 1LBQA 4JUCA 1MA3A 4GNKA 4KH1A 3DFZA 1MT3A 1WQ3A 1I5OA 4DR5B 1BE6A 1FXSA 3IVAA 3PRYA 3D6AA 4C4OA 4AJ2A 1MAVA 3GH1A 1YRLA 2M9MA 5TNXA 4A1OA 3VPXA 1R64A 1U7DA 5CT9A 3DHNA 4PYOA 2D2VA 5EZ5A 1SKYE 1TIPA 3VSCA 4ZMBA 5CB4F 1Q92A 5GZ3A 5E2IA 2D8AA 4Q16A 4ESVA 1RC0A 2ZSHA 3UGKA 3LCRA 1B0UA 4I1YA 2G82A 5L7YA 4UM7A 4A2CA 3IAM6 1R6XA 3TLGB 1P9WA 4BIMA 1TM3E 4HH0A 2AG5A 3WYEA 2IUFA 3FMVA 3C7TA 1DIOB 1V16B 4JI2B 1R0LA 2X0FA 2IZZA 2H06A 3AESB 3C4QA 3ADKA 4CMEC 3KXIA 5EIHA 2C2HA 4S3MA 1D9ZA 1I4TD 3P0FA 1KFBB 2VXYA 2YY5A 3AVOA 4ZARA 3TD9A 2X41A 2QP9X 4IZIA 4KKXB 4FK8A 4ZO6A 3ZU5A 3ABQB 1K3UB 2B6NA 1VIVA 4FFVA 1X38A 1B3RA 4W4TA 2EFCB 4EFKA 1Z0JA 1XVLA 1WV0A 2W2XA 4DVJA 5C81A 2LCQA 2R6CA 3UB2A 3HZZA 1J8FA 4BMOB 1PT9A 3IBSA 4UU8A 1J2RA 1OWOA 4HUTA 4KZKA 3SQWA 3JPYA 4GR5A 3BEDA 2JCBA 2F62A 4QQNA 4AKIA 1SM4A 4MLDA 3NUQA 4DCNA 1UXIA 4I5FA 3ITNA 3U4HA 4CU2A 2YUTA 1E2BA 1T10A 3K8OE 1KWGA 1OV6A 2WM8A 1QK5A 4MVJE 3WGJA 4WKBA 4OI2A 1A9TA 1QANA 5EP4A 3BCSA 2JD1A 3CGGA 5KOJA 4GC9A 1YZGA 2NU6B 4Y3UA 3HZOA 4HWKA 1U3CA 1Z22A 1GNLA 2R11A 2WMDA 3GFQA 2ZXEA 3LYHA 4IIEA 5ALUA 3T7SA 2E87A 3JSXA 2RKOA 4ESEA 1UFRA 5J2UA 3H6HA 3R7FA 5JDIC 1DMRA 1JWBB 1GZDA 2BJHA 3EQ7A 2VZ9A 5EMHA 5C1OA 5L3VA 3HKCB 5FJJA 2W8BA 1D3AA 1G98A 2R6AA 2XGSA 3S55A 2KLHA 3CUEF 3ECAA 1E4VA 4R1LA 3TFOA 1M2NA 2A78A 1SBTA 3LF1A 4EKYA 4GE0A 1WF6A 3ZNNA 1K6MA 1KZ9A 5LZ5A 1KWKA 3PE3A 4FFNA 1G60A 2OV8A 4ZOLF 1CEQA 4EB8A 4RQTA 5AO9A 1SUWA 3CLKA 4JSYA 4GXQA 1HM5A 2WOOA 3K6KA 3WB0A 3E9DA 5EE9A 5IZCA 1GZSA 1K68A 2Q6IA 3A9CA 4KVGA 1HYEA 4C3UA 4J0KA 3BGDA 2NU7A 4DV0B 2EARA 5JQGA 3DPUA 4ZKDA 1MP0A 3AW8A 5HQJA 2HT1A 2P0EA 5KTYA 2FW6A 1RWOA 3U56A 4QHSA 1URPA 2ZTLA 1T26A 2PMKA 2F3PA 3VR5A 4MQFB 2Y0EA 5FULA 3WY9A 2J5QA 1JA1A 2YINC 5F12A 1E1YA 2AOXA 5C3MA 1HKUA 1ICEA 3P0IA 3BXOA 4L8LA 5A5EA 3ZCSA 2PMWB 3O94A 3NC0C 1IY1A 1RKVA 3UPUA 4C0BA 2NSLA 1DDGA 4XQCA 4LKRA 3CQ9A 3GN1A 1SQ0A 4WDRA 4F5WA 4GPTA 4JBHA 3TQHA 2HSWA 2QA5A 3EQ6A 1UBSB 2C3OA 2ZW9A 4MJ7A 1B8NA 3IHLA 3ZTTA 3QBEA 4YDHB 4BUJA 4KSYA 3TRIA 3N59A 3QXHA 4KNVA 3FYCA 4KO4S 4RF5A 1SHUX 3WWYA 1PV4A 1AZSC 2WAMA 1MX9A 1GNPA 2FPXA 2QD1A 4FILA 5KWJA 5D51S 2LKCA 2EBUA 3I4LA 3UOWA 1L9XA 1NVFA 1WXXA 4OMFG 3ZVRA 2PGJA 4TGLA 1MBZA 4R31A 4V0MA 3N2LA 1Y1PA 1O6GA 4GX1A 3T95A 2V8OA 1ENPA 3G0GA