3IILA

The structure of hcinap-mgadp-pi complex at 2.0 angstroms resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
175
structure length
175
Chain Sequence
PEFMLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coilin-interacting nuclear ATPase protein
publication title hCINAP is an atypical mammalian nuclear adenylate kinase with an ATPase motif: Structural and functional studies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, transferase
total genus 65
structure length 175
sequence length 175
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2009-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3iilA00
3RS4A 3LBHA 1ODFA 4P4UA 2CK3A 1IJFA 2MSEB 1OFTA 1W4RA 3BAFA 3I73A 5DIFA 3B1ZA 3TSOA 4BLPA 4B76A 4HI0E 4AURA 2NMVA 3U7HB 1M7HA 3SJCA 3MJRA 3HDTA 4JIMA 2OM2A 2IC5A 2QEQA 5EE5B 4MKHA 5JEDA 2ZIAA 3UIEA 4RSGA 2QA5A 2AXPA 2ATVA 2FFHA 4F4IA 3BOSA 3Q9LA 2C77A 5DSZA 1VG8A 2FNAA 2GHIA 1YZUA 5KPJA 1H8ED 2IYTA 2REBA 1R5NA 1OW3B 1KNQA 5SZIA 1BH2A 3FPAA 4MYCA 5HZKA 2NPFA 4QKQA 3GMTA 4HAYA 4DEXA 4B6EA 4W5WA 2HCJB 3RAPR 1XTKA 1MOZA 2D2FA 1UM8A 2RGNC 5FBQB 1OKKA 1U9IC 2NO0A 4TTQA 5FPTA 1OYWA 1TU4A 1XCGB 1DBSA 1P73A 2XOKD 3M4YA 4TLAA 5E95A 4ZDJA 1EX7A 4L9WA 3NEJA 2ZPTX 3IHLA 2K5UA 3PUVA 4FMBB 4EPVA 1SVWA 3CRQA 2JCSA 3QVUA 4BZQA 4MYUA 4A8JA 1HA3A 3N5CA 2CVFA 1E2EA 1N6RA 4Q1BA 4BRUA 2BKEA 2X2EA 3L0IB 3KB2A 1P61B 3F3YA 4P4SA 2ZR7A 2FGJA 4D0GA 3AP2A 4IEIA 1II8A 2J1LA 4NYMR 1Z0KA 3L8ZA 2CBZA 2R6CA 4A0HA 4PAOA 3QOFA 1XJ0A 4S2EA 1R8QA 1X86B 5DN6D 2WKQA 5FPHA 1E96A 4PZLA 1WMSA 1JR3D 1QHIA 4Q1AA 2FFAA 4B32A 1BYUA 2FSHA 2CL6X 3HR8A 4A2PA 3TW4A 3LY5A 2V3CC 4IDNA 4IW3B 4FCTA 1DAFA 1JALA 4LYFA 5BN4A 1H8HA 1MO4A 1IN8A 5JJKA 2XNSA 3DEFA 4KSBA 4JT4A 4QGGA 2HLDA 1XZPA 1RZ3A 2EU8A 2KB0A 1MT0A 3AKEA 3DZDA 3ZS8A 1TQ2A 4LC0A 2O8FB 5KDDA 1AQYA 4FXPA 5FPYA 2FH5B 1G19A 1NLZA 1KO7A 3F5FA 3WYFA 1SXJE 1E2HA 1Z0JA 2D2EA 5FI0B 1KYIA 4NPHA 4AI6A 1VYTA 2CL7X 2NTYC 3QG1A 2OSBA 3RRYA 1JB1A 1GNPA 2ZSBA 2DFTA 2FDCA 4TYPA 2FPLA 1VIAA 1NN1A 1QHXA 1R10A 4JL8A 2FMXA 3QPVA 2CNWA 3GJ8A 2QMOA 4QGFA 4D82A 2GJKA 2QRNA 4PAMA 4TTRA 5JCZA 4ESVA 2ZI4A 4ZDWA 4ZCIA 1XCMA 5EE3A 3ADDA 3TUJC 1GL7A 2YWGA 4JVLA 1AS3A 5EUQB 1KI1A 1XTQA 3A1TA 3X1DA 2B7CA 4WW0A 4CT4B 4OHVA 4B47A 4FINA 3WMFA 1XTRA 3ECCA 1CTQA 2QPTA 3V4FA 3KFXA 4P4TA 1NBMD 521PA 4LJ7A 3P1JA 2W2TA 2CJWA 1W1WA 1KO8A 4LK2A 4D0NA 4AKIA 2W6JD 3QF4A 4MRVA 1E99A 2IS4A 1XNJA 4ZPXA 2JJ2D 2G88A 1OH8A 2EVWX 4PFSA 4PR0A 2A3RA 2XNDA 1T9HA 2IYUA 4M9SA 1RYHA 3GFPA 4JJKA 2ZQ5A 3L82B 1N6PA 3AVXA 2A5JA 5AR1A 3C15C 2OHFA 4ON9A 4LBYA 4MYTA 4Z54A 2P5TB 1CR0A 2X1VA 5C18A 5AUQA 3UKDA 4NCHA 1UEIA 5K8UA 2O8BA 3UXMA 1N5JA 2ZXUA 4D6PA 1Q1BA 1ZUHA 1GKYA 4Y0VA 1E2IA 5DHAA 1ZNXA 4B6FA 4GT1A 4EJSB 3RS3A 2Q3MA 1JQLB 2LWIA 2R6AA 3C5CA 3Q8XB 2GCPA 3THWB 4AKGA 5G3YA 1KZGB 3PENA 3LVRE 3L43A 3QBVA 3EC2A 1WB9A 1U8ZA 5JBQA 1OFUX 4C30A 2H7VA 4A4DA 2IBMA 3CIOA 2QTHA 3ADBA 4DDVA 3E1SA 4WZ6A 3O8RA 3OZXA 2QAGB 1ZD1A 4OJQA 1L8QA 2OUKA 2R6DA 4ESHA 1NMXA 1PUJA 4AWXA 4DRZA 1XMJA 2XAUA 2YHSA 3D7MA 4R9UC 2BMEA 4X8HA 8OHMA 1YZNA 2ZRMA 1I4TD 1PJRA 5FBVB 4HB4A 5HZHA 2IX3A 1VMAA 3R9XA 2J59A 2E9SA 3BB3A 1U8YA 2AKAB 3M1IA 2QORA 4E5UA 2PLFA 2QT0A 3Q85A 2A7QA 4CEJB 4DWJA 4C0JA 1N0VC 3LFUA 2G1JA 2WHXA 4LGMA 2GK7A 1GRRA 2PZGA 2EFEB 4H1UA 1UF9A 2R8RA 3AP1A 2VHTA 1TX4B 1CR2A 4ITRC 4MDEA 1AK2A 4W5JA 1KOFA 2J0QA 1E1RD 3A4MA 2FGKA 2O8CB 2A2ZA 1Z08A 3W6OA 1HV8A 3AB3A 1NMZA 2PH1A 1T5IA 1BO6A 4R2IA 3I62A 2XB2A 4RFVA 2VA8A 4GMXA 2CHQA 3SJAA 1CIPA 4AG6A 1Z6XA 1KZ7B 1WP9A 2F43A 3DHWC 2QMEA 3GP8A 3TGPA 2ZRFA 3TBKA 1KKLA 3DM9B 4JLDA 4WXRA 3CW2A 4TT3D 4D26A 4MGIR 3WYAA 4POAA 3PEUA 1O3YA 3DKPA 3R8CA 2O8EB 2OCAA 1HUQA 3O8BA 4JLKA 3UMSA 2F3RA 3W9YA 5TVKA 1ZD9A 2BJVA 5JJIA 3LWNA 5K8LA 4CF7A 3UATA 2ZRGA 2FF7A 1IN7A 1G6HA 4Q5IA 4CW7A 1YZLA 4YMTA 4JL6A 1VG1A 3SE0A 1VYVA 4JLJA 4LJ4A 4RD4A 3CH4B 5KHOC 3U60B 2OFOA 1OH6A 4PQYA 3U61B 1VPLA 5CDFE 3CX7A 4IXMA 1YJ5A 1F60A 4V0LA 3L0SA 3BWDD 4PPFA 2VHJA 5LD2C 3V4RA 2A5YB 1LNZA 1NP6A 3NDPA 3QUSA 3NH6A 3SQWA 1KSGA 2WKPA 2ZUBA 1TAGA 3OE7D 4GPTA 5CK5A 4AC9A 3LVQE 1XEFA 2GZDA 2QBYB 1N2CE 1YZQA 2IS6A 2IW3A 4Q48A 3FHCB 5HE9A 3CUEF 3K0FB 2G3YA 1SKYE 4MRPA 4IDPA 3BXZA 1X1SA 3ZVNA 4OHYA 3KXLA 4DSNA 2AN9A 1BYIA 4BASA 1CF4A 2PEZA 2GESA 2KBFA 2PT7A 1G17A 3JVUA 2WWGA 2YYZA 3QXJA 5LB2A 2RGGA 3NHAA 2GF9A 3U3OA 3OF5A 4FMDB 3NIBA 2IUTA 4L9SA 5BWMA 4ZI2A 2GXAA 1XFAA 3WRXC 2ZM5A 4XWOA 1G3UA 5FOSA 4Q4JB 4KODA 4DC9A 4QHSA 2NZ8A 2MSCB 4RZUA 2OEPA 3AF4A 2ZEJA 4NZYA 4KCGA 2QT1A 5TXGA 1TF5A 1Z0AA 2VP4A 3FKSD 3OFNA 1SKYB 3WRYC 4Q1FA 1FX0B 5L3VA 2JATA 2AFHE 3A6PC 2HEIA 3GQBA 2HYIC 4AYXA 2X19A 2IEYA 3ASZA 4RD1A 3VAAA 5CB8A 2QNRA 4M4SA 1EFRD 5KYKA 2BDTA 5IK2D 2E1RA 4C2TA 3KDSE 3EZ6A 1QHGA 3LXXA 3OIYA 4TQUS 3GLGB 5EP1A 2ZTSA 4RD3A 3K09A 1SVIA 4UXIA 5EQTA 3SNHA 3O47A 4DKXA 2B8TA 4HB3A 1F2TB 1Z07A 1ZD8A 4IVQA 4DXAA 4KVAA 5M04A 1EFCA 2ONJA 3MGCA 5FUYA 1GVNB 1JJ7A 3CRW1 4YQFA 2HXSA 1HQCA 3QY0A 1GZSA 1N0UA 3PV0A 5D3QA 2CL0X 4TMVA 2XTZA 4C0LA 3H86A 2BBOA 3CM0A 4B34A 1T91A 5CM9C 3P4XA 1JAIA 1NJGA 3SYLA 1KAOA 3P27A 2B92A 1R0YA 3AVUA 4JVMA 1FP7A 3TLXA 3KXKA 5EXTA 2O8DB 4DDTA 4JLOA 1KI6A 2GJAA 1Z6AA 1KMQA 4K46A 1D6JA 2D4HA 3CRRA 1D5CA 4FD2A 4Q4AA 1G3IA 4BGDA 3LBNA 1OFIA 1XXHB 3FWYA 4M1OA 4QBFA 3BD9A 5EXXA 1A7JA 4CYMA 4DUGA 1BOFA 4NYIQ 4EPXA 1OIVA 4G5OA 1P2UA 2AD1A 3A1WA 1E2GA 4MYHA 2WJVA 1KJWA 1W49A 2OCYC 4PC6A 3WP0A 3QXCA 2ZE5A 4UQOA 5FTJA 5JWHA 5BN3A 1NVWQ 5J4KA 5CYPA 3OEHA 3RVBA 3MWJA 3T06B 5FR2A 1RRCA 4IOLA 4OQFA 3EPJA 1QG4A 3UANA 1P62B 1ZUNB 1Q22A 5SZJA 2ZAMA 2J46A 4B3FX 3U7FB 1EWRA 4LYJA 2H18A 4XSGA 4B48A 4LCBA 1KSJA 2NPIA 4M9XA 1KI9A 1I4LD 4AK9A 5K8IA 3MSXA 4DHEA 2XX3A 1OXXK 4PX9A 2NO9A 5C4MA 2QSYA 3LX5A 3G82C 3J81k 3T1QA 2Q9BA 1NSFA 1XP8A 3B9PA 3IIMA 3AF3A 4HAWA 4KFSA 2QU8A 1ONBA 5KSYA 2YC4C 3A1UA 2FPMA 1XDBA 3VHLB 2V54A 3VU9B 2FFBA 5HCNA 4C0KA 4QM6A 2YV5A 3KKQA 4CIDA 4EQ6B 1EFUA 1T8TA 1XTSA 1ZU5A 3GLIE 1NY5A 2QRZA 3AM1A 1RPZA 5K8TA 2OV2A 1SVSA 3H1TA 1OYYA 3NTUA 4NE2A 3RABA 2ZYWX 1XD2A 2EFHB 4DLUA 1Q1EA 3U4QA 1E2FA 1E9SA 3AUYA 4BWYA 1EWQA 4NYMQ 1UADA 4TSFA 1QHSA 1BMFD 4K8OA 4QBHA 4QFMA 2RAPA 2Z43A 1VHLA 4M22A 1FNMA 1I2MA 1RKBA 3AH8A 1KGDA 4B71A 1NMYA 4TZ0A 4Q21A 4FCVA 5KPDA 4P31A 2ZANA 1KI2A 1CRQA 4QRHA 1SXJC 2BMFA 1ZCAA 3VQTA 2H17A 1DPFA 4BLTA 2Z4SA 3DZ8A 4KU4A 2V6JA 3I92A 1FQJA 2KI5A 1F2UB 1E3MA 4M21A 4B35A 2F1IA 1I4DD 5EP2A 2SHKA 1E2MA 3ZIAD 1IY0A 1IXSB 4DCNA 1QVAA 3CRVA 2WJGA 1N6HA 4RKEA 1SVOA 4EKDA 2ZREA 3GJ7A 1Q3HA 3FMFA 1E9RA 4NCNA 1D2EA 4Q1CA 2N42A 2G83A 4LYAA 3NC1C 1YHNA 1WBBA 3NWJA 2R65A 1KO1A 1E0SA 2ZRIA 5JI3E 3IEVA 3DDCA 2VHUA 2VP0A 3AEZA 2J41A 2ORIA 3ZVMA 2HYDA 4PSKA 4ZDIA 1Z6YA 1COWA 3MD0A 2WAYA 4YMWA 1JPNA 4X8LA 4MDFA 3MMPA 3PXGA 4Q18A 4DJTA 5KOYA 3QKSB 3P26A 2IYSA 1U90A 2ZVPX 2ZRPA 1C1YA 5EXSA 821PA 1MR3F 5EZ5A 1W5TA 4HLDA 4PC3A 1DARA 4C2UA 3C8UA 5EP4A 3GLHA 2QAGC 4I1SA 1R7RA 4C7OA 1NY6A 4UNNA 3THXB 1EFHA 1ZIOA 1N5KA 2KWIA 4RJLA 4A6PA 1UKYA 5TY0A 4BFZA 3LD9A 3RLFA 2GRJA 4BPBA 3SQXA 3OEEA 3TVDA 4HDOB 1GM5A 3IBGA 3QNUA 3VHXA 1CLUA 2QZ4A 3FMIA 4LV6A 4M1SA 4Q66C 1NIPA 1U0LA 1Z22A 5EJEA 5HR5A 2VP6A 4LPKA 1YU9A 2QE7A 5JJLA 4DSUA 2F9LA 4PZYA 1AM4D 1DAEA 3NBXX 4FWTA 4AD8A 4OKSA 2ZR9A 2ZRJA 1A4RA 3CKLA 1CXZA 2JIZA 2ZRHA 3CNOA 2BMDA 1MABA 4MQBA 1EESA 3LAWA 4DEYA 4JBXA 2B21A 2GKSA 3GFTA 1KI3A 1GTVA 3AKCA 4RZ2A 2HV8A 3ZYCA 3UK6A 2A30A 1QHHA 2XTMA 3EZFA 1RE0A 2B8WA 1V5WA 1D9ZA 1VYUA 1W0JA 1J99A 3AF1A 4C9BA 4N0EA 2OO7A 5CB6A 1LY1A 4URYR 4U5XA 5C4GB 2BM1A 2XSZD 1LS1A 4C0SA 3FHOA 1R2QA 2EFDB 4PQFA 2HJGA 2ZJOA 2BBWA 1XMVA 4GOXA 5BW8A 5LD2B 2QAJA 3DMNA 3AQ4A 3IKJA 4GBMA 4GZLA 4JS0A 5EE1A 4XIGS 4B3GA 4JT2A 3T5DA 1W46A 4MKGA 4GP6A 4BRWA 1CJVC 4W5HA 5GADl 3QVVA 1YE8A 3IQXA 1Z5ZA 5L8VA 3C14C 3HU3A 1G5TA 4YXWD 4BEBA 4HEJA 2VIIA 5JSZA 4GOJA 2HXYA 2WWFA 3EPLA 4HZUA 2B7BA 5KSZA 4XD7A 5DLQC 3NBZC 4LUCA 2BCJQ 4GP7A 1US8B 4Q4HA 3K0AB 1I2DA 1RW4A 4G3XA 1N3BA 3EC1A 1H8EA 4L8GA 3WBJA 2PBRA 2ZYUX 1RJ9A 2ZJ2A 1GNQA 5AUNB 1UEJA 2VSOA 2YINC 1Q1ZA 4CEHB 2ORVA 2PLRA 3UMFA 1XPOA 3TNFA 1T6NA 4UJ5A 3ADKA 3EG5A 1HT1E 2NZJA 2QQ0A 4KBGA 3ZD7A 4QNRA 1D2MA 5DH9A 4E03A 5GJWC 2LKCA 2ERXA 4A82A 4RZXA 2PZFA 1G8FA 2Z0MA 4IRUB 5FPKA 2ZRAA 1ETUA 5SZKB 4WA7A 3RRZA 2JEOA 2NO7A 2OG2A 3QF7A 1UKVY 5JWRA 1J7KA 2G9NA 3MG9A 4B3CA 3IQWA 3WY9A 3KTAA 4HUQB 5TARA 1AGRA 4JLNA 2P6UA 3PUYA 4PHFA 1R0ZA 2R6GA 3NDBB 4TYNA 3B8HA 1CULC 1J70A 1GL9B 2JLQA 4OK6A 5EXPA 3T1OA 1HT2E 5BXQC 4JYBA 4UXHA 2C8VA 2HT6A 3SR0A 4D25A 1JEEA 2C9CA 2GXQA 3OIVA 1PLJA 1S3GA 2QMHA 1TTTA 4A0GA 2UZIR 2VTKA 1B23P 1XEWX 2IYQA 5DN6A 3AV0B 4X8MA 3K70C 3QQ5A 1FOEB 2ANBA 4HLQB 4FI3C 3AVYA 2ZI3A 3QJYA 4BLOA 3I5XA 3RANA 1W36D 1KDOA 3N2IA 1F6BA 1G291 4QJ5A 2J0UB 1T4GA 2FV8A 2QY9A 4N0DA 1AS0A 2MMCA 2WJHA 4WOPA 2XB4A 3LLMA 1Q1QA 2R2AA 4U02A 4NU0A 5KUTA 3LNCA 4BQSA 2EWWA 2WSMA 3CF2A 4TTPA 4DLZA 1IAQA 5CM8B 5JI2E 5KNDA 2CK3D 4HB2A 4QBGB 1NIJA 4MH0R 5FBLB 2F55A 3B1WA 3IO5A 1WQ1R 2IYVA 3G0HA 2Q9CA 1VCIA 2F1JA 1KMHB 2ZI7A 2ANCA 3W8NA 4F91B 3HYTA 3I3SR 3C4JA 4B3XA 2GBLA 4EFMA 2NO1A 2VPPA 3A37A 1W47A 5IRCD 3KZ1E 1FUUA 2G77B 3BB4A 3FOZA 2AWOA 1AKEA 4RD0A 4MUBA 3PFIA 4V0NA 1WA5A 3DVLA 1GITA 4AG5A 3BORA 3AVVA 1GG2A 2A5FA 1Z28A 3UWKA 2AFIE 2V4ZA 3K0CA 1JBKA 5DYIA 5DE3A 1DOAA 5JZVA 2FU5C 4GRAA 1PV4A 1NBMA 2GEDA 4ACBA 3PEYA 2FEOA 3CNNA 3BB1A 1C4OA 3W8RA 4CZ2A 2FOLA 2W6JA 3KJIA 4ACAA 5JWOA 4CGZA 4P33A 1U98A 2QM8A 3E2IA 4P32A 2IXEA 1XWIA 3GCGA 5AJVB 3A1VA 2AD5A 1GP2A 2OESA 5EP3A 2FSIA 3L8YA 3SYKA 2I3BA 1IM2A 1ZRHA 2GCOA 3BBPA 4URXR 3CLVA 2GILA 5TB5A 1NN0A 1HY3A 4M1TA 4JVNA 5FPSA 3GFOA 3U6BA 4YMSA 2Z4RA 4LHXA 4V03A 2WWYA 3AKYA 3CWZA 4YLGA 2WPDD 3B82A 2O8FA 3H0KA 3CNLA 1E4VA 1ZW6A 2OXCA 2YOGA 2P65A 3ONWA 1TUIA 4HLUA 5IF9A 1GWNA 3VKHA 3GJ5A 2CJWB 3A58B 2KE5A 1SXJB 2Z6VA 1P60A 1FFHA 2YOHA 3LO5A 3AVWA 2AK3A 3FB4A 2YVUA 1J2JA 3RWOA 4JVSB 3GLFA 4V0ME 2QTFA 2JJ1D 3SBEA 1J90A 3AUXA 1GKIA 3QEOA 5G53C 1RRFA 1H8HD 3ZH9B 4I4LA 4PC1A 2QL6A 4Q9HA 3T5GA 3KKOA 4W7SA 4RFSB 2V55B 1OXVA 2CLSA 1E6CA 3MUFA 4CEIB 1GUAA 1L2TA 3IUYA 3TMKA 3LXRA 3SHWA 2GAOA 1P2TA 2WICA 4A1FA 2W0MA 1IBRA 5FI1B 1ANKA 3EAQA 1SVMA 1T0HB 3A36A 1G7TA 2PX3A 2Q21A 1G9XA 2MSDB 2OT3B 3TUZC 4IOMA 4C0BA 1IXZA 2D7CA 1OH5A 2CXXA 1XMSA 3R7WB 2CNWD 1TPZA 2QP3A 2GAAA 2F1RA 1E1RA 1CP2A 1W2GA 1OFHA 4Q4LA 4HUTA 4IFBA 4BFYA 1NLFA 3HWSA 2NO6A 2W6ID 3QXSA 4RZ3A 1AKYA 5JEEA 6Q21A 1PUIA 1UAAA 2H57A 1IN4A 1P4SA 3PUWA 4EJSA 1P9WA 2I4IA 3CX8A 4TT3A 1SXJD 2XJ9A 2BBTA 2Q3HA 2ZE8A 4PPQA 3THWA 1YVDA 4IKEA 1G3MA 2XNDD 3CONA 4PSAA 2CHGA 1P7CA 3TQCA 1UKEA 1U81A 1ZNWA 4QHYA 4TQ9A 1YR6A 1S9HA 2ZSAA 4G5GA 1Z0DA 5B58C 1E2NA 4ASUD 4LBVA 3HU2A 3KJGA 3FTQA 2PMDA 2BEJA 4M9QA 3BFKA 1E98A 4NKRA 4PSVA 4JKYA 3REFA 4R7ZA 4H1VA 3BERA 2ERYA 3B13B 1IXRC 5E7MA 4Q7KA 4K81B 1IOZA 2MMGA 4PXAA 3KL4A 5H70A 3SOPA 1HE8B 1MO3A 1FW6A 1RYFA 2AHOA 1NVXQ 3GD7A 4UNRA 2N1BA 2PT5A 1DS6A 1E2JA 4ABYA 4CEJA 3OE7A 2C9OA 4YMUA 3KKNA 1D8TA 2ZRLA 4LDJA 3BIFA 3T61A 3ND9A 3R8FA 4MRSA 4EFLA 1SKQA 2ZUDA 5H68A 2DWOA 3TVTA 5JECA 3SN6A 3B5JA 1K5GA 1CRPA 4OQXA 5FL3A 4EPWA 2OLJA 2BCGY 3EIQA 2O8CA 2WOOA 2FN4A 2C99A 4ZO4A 1UDWA 3SI7A 4D4MA 4KLZA 3QXHA 2OBMA 4J0QA 3B78A 3VR2A 1R0XA 5C1BA 3EXAA 4F93B 1OXTA 5DI3B 1XD8A 2DHRA 1DG3A 1RRPA 2IA5A 2F1HA 4S35A 3PG5A 5CJ2A 4F38A 1GNRA 2E87A 3QKUA 4LPSA 4RY2A 2IHBA 3TJZA 1DO0A 4OI2A 3HU1A 1IJEA 1E9BA 3BS4A 3MAAC 2JASA 2O8EA 1Y3AA 1E9EA 2NGRA 4IVRA 2ODNA 4TL7A 3RS0A 3RWMB 2WMOB 5FUWA 1V43A 4Q19A 3FKSA 2AL7A 2P0EA 5FL7D 2ZSFA 4I81A 3U5ZB 3GJ0A 2C5LA 2W2XA 2W0SA 2PMKA 4A9AA 4A2WA 1IY2A 1NVUQ 2WJJA 1G7CA 2IYZA 1XTJA 2J7PA 4KV9A 1RIFA 4IDQA 4LV8B 2FJUA 1KI4A 2PCLA 4Z8XA 2PJRA 5FH9A 1G21E 1Z3IX 1FMJA 1LF0A 3RNLA 1SGWA 3CRMA 4MITA 1AA9A 5HKKA 4Z1MD 4NMMA 2WMNB 3W6PA 1W36C 4OK3A 3FYHA 3GJ3A 4G01B 4G5QA 1YRAA 3CO5A 2JLSA 5H1YA 4G5SA 2G1KA 5AJWA 1GFIA 1N0WA 4RKFA 4ARZB 2QBYA 1Q3TA 1KDPA 4DIEA 3K0FA 3KQKA 1CJTC 1TADA 2IWHA 1YQTA 3CB4A 2FEMA 4V02A 3O8CA 2C04A 4XSHA 1LVGA 5JFGA 4GL2A 2L0XA 3A1SA 2GETA 3QPWA 3FFBA 4L15A 3IDQA 2YNMA 4TN1A 1D9XA 3RHFA 2IYXA 1S2MA 4NHOA 4CT5A 1U94A 5FOXA 2XGJA 4DLVA 3M0EA 1FL9A 1YRBA 1S1CA 3B60A 3DOFA 4LRWA 4WBSA 4FN5A 1PLLA 3FGNA 5J5CA 4BFUA 3FHTA 2JLRA 3AVPA 3CF0A 3FMPB 1CU1A 2H8KA 2IYWA 2ZE6A 2JDIA 3K70B 5KU1A 2CLDX 3LX8A 1CBUA 1DO2A 1W0KD 1VECA 1JQJC 2VP5A 5EE9A 3RRMA 4DVGA 2OAQ1 1W44A 4OHWA 4XWKA 2GDJA 4M1YA 1FP6A 2AWNA 1P2VA 2P2LA 3F8TA 4KYIB 4PHTA 5BQ5A 2VYFA 1NKSA 4YONB 3QIAA 2UZ3A 2QTVB 1XCPA 3GLGA 2OBNA 4ERNA 3PITA 4D80A 1VTKA 1FTSA 1F2TA 2PL3A 2IL1A 1Z2CA 4NTZA 2OZEA 3K9GA 2AR7A 4DB2A 4A8JC 3V9PA 3I72A 4HB0A 2GNOA 2RGNA 4EDHA 3LH5A 4PPGA 1U9IA 2GWHA 2QROA 4DT1B 2HCBA 2CVHA 1R4AA 1ELOA 1SVLA 1SZPA 4QGHA 1VHTA 2WVJA 2VRWA 3EWSA 1LF5A 4ZIRA 2LCFA 2D74A 4MGYR 2XZLA 3SC3A 1KO4A 1X8KA 1G7SA 1JECA 4EPRA 4TMXA 1FPMA 1MO5A 2VP2A 2ZS7A 4DLSA 1R5OA 4M0LA 2C2HA 2WV9A 3SZRA 1DE0A 4BFSA 2O8DA 2REOA 4MKFA 3BC1A 3SJZA 1GILA 4B44A 2EW1A 4NYJR 3IGFA 4LBZA 1YZKA 1QG2A 1XXHA 4JLAA 5J4LA 1DTSA 1KK0A 2V1UA 2ZJ8A 3N2EA 1BMFA 3RC3A 2GVDC 4KJZA 3D31A 3BK7A 3K70D 3KJHA 4URUR 2ZU6A 3PIRA 3LBIA 2FSGA 1KK1A 1GOTA 4QL3A 3PEVA 3TH5A 1T8UA 3I61A 1HEIA 2I1QA 4N1AA 2VQSA 4A15A 1JPJA 1UBEA 2P6NA 5J4HA 1KK2A 1HTWA 2QP9X 2CCKA 1W5SA 4I1VA 3X1XA 1LB1B 4JL5A 5AJZA 1VDZA 1XRJA 4QOSA 5TMPA 1YZGA 2JLWA 4B43A 5CITA 4NH0A 2DWPA 4P3YA 3ZGXA 4DUGD 4V0KA 4E09A 3SJBA 3U4QB 2BIFA 2H92A 4HAXA 4DLRA 4EIWA 5FBRB 1A1VA 4Q9KA 3U44B 2WWHA 4ZCLA 2ZRNA 1W2HA 2J9RA 2OXRA 1BS1A 3SFZA 1Q12A 1OV4A 5JLJA 4OI0A 1E2LA 4TLBA 2KBEA 1O87A 3VU9A 3BFXA 2WIAA 3MCAA 4GNKA 4OHXA 4O0MA 2XZOA 3HYRA 2P6RA 4ZDKA 4EQ6A 1E79D 3GLIB 1DVRA 2F3TA 1HURA 1R0WA 2QG6A 2RKOA 2WKRA 2V7QD 621PA 1UBGA 3FMOB 3K8YA 4A2QA 4Q00A 4CDGA 2YJTD 3KUDA 2YWHA 3GJXC 4RCZA 3NC0C 1SHZA 5HPYB 2Z5FA 4PQRA 2A78A 4LBWA 1MV5A 3GLHE 1M74A 4YC7A 1P2SA 3TAUA 1T5LA 1LV7A 3NHBA 4IFEA 1SVKA 2DWQA 4DLXA 4Z51A 1SQ5A 4QHTA 1M7GA 1WCV1 2NOAA 4KHZA 2DFLA 2VLIA 3MWLA 1AZSC 2IS2A 2H5EA 4XOIA 1FNNA 1U99A 1E4YA 4L5BA 2NQ2C 2KJQA 1F2UA 1E1QD 3EARA 1GSIA 1LW7A 4FMCB 1TEVA 1JR6A 5L3QB 3T1VA 4JLPA 4JJZA 4Y0AA 4P0TA 4O2LA 2ZSEA 1QZXA 3QENA 3CPJB 4LHYA 3ND8A 3UMRA 3UPUA 1EX6A 3ZD6A 3GLHB 1G6OA 2FFQA 1E0JA 1N25A 5FOTA 5FUXA 3MFYA 4C0QC 4U00A 1CEEA 3M6AA 3TAHA 1M34E 4URVR 1GAJA 1WF3A 2QUZA 2OE2A 4HAVA 4JKIA 2ZS8A 5GJCA 5D3MB 4A6XA 1OE0A 3GJ6A 4NCJA 4TYYA 1VIYA 2ZRKA 4LJ6A 4A92A 2BVNA 4G0NA 3U2QA 4D2IA 1JAHA 1KJZA 1ZM9A 2N46A 1E2DA 3BGWA 3QEJA 4IJMA 4URWR 4II7A 4AYWA 4PZZA 4BFWA 1Z8FA 2F9MA 3ZLJA 1XPUA 1VG9B 3Q5EA 5L3SB 2FPKA 2ZJ5A 4QC2A 3W3AA 5CIWA 3THYB 4TL9A 5GVRA 3AF0A 3THXA 3ZZUA 1G7RA 4BECA 1CJMA 1TQ4A 3QSYA 1OT3A 4LC1A 4F4CA 4QJ4A 4UJ3A 3WP1B 3ZQJA 4YXWA 1AJEA 4ILEA 4DSTA 1XTIA 2X8AA 2XXAA 3VFDA 2ZITA 1ZNZA 4RD6A 2P67A 1UDXA 3BE4A 1S8FA 2WM9B 2OAP1 4HYYA 2EFCB 5H8WA 2J3EA 4OQLA 1LTQA 2G0TA 1IY1A 1E9FA 2IUUA 1TF7A 1X8LA 1NVVR 4IEEA 3T15A 1IONA 4BFXA 1S4QA 3IHWA 4BLSA 4R71A 3DL0A 4DLWA 3AKDA 1Z29A 1RC8A 3QXXA 5UKDA 4I1UA 2IXFA 4GMDA 4OI1A 4TLCA 3S1AB 3W3ZB 3BRWD 3TSWA 3LW7A 1Z83A 2J0VA 3OEED 3NBYC 4B3BA 4EFNA 4LHWA 1N6OA 4I1OA 2V9PA 1DELA 2CHVA 3P4YA 3L0OA 1FUKA 4PO8A 2YKGA 1PLKA 4YDHB 5JSZB 2I1VB 5GJBA 2D62A 3C7KA 4HZUB 2F7SA 2FWRA 3LRPA 4EPYA 3EW9A 4QGAA 1W36B 3GPLA 2ZI9A 1XEXB 2VH5R 2WWXA 4IOJA 1U2RA 1XF9A 5LPNA 4PPNA 3C5HA 3QKRA 4NDZA 3OAAD 1DAMA 3C41J 1G1MA 1KSHA 3DM5A 1MRNA 2F6RA 1MKYA 2IYYA 3R9IA 4WIAA 4BLRA 5KNBA 5B64A 1DG1G 4DCTA 2FA9A 3AGQA 1KO5A 4OI4A 5DGXA 3DOEA 2RGXA 1RVDA 3ZS9A 2XOKA 4KSCA 1R8SA 5GJVC 1KIMA 2GCNA 3KXIA 4AY2A 2FZLA 3B1XA 2ONKA 1EG7A 3I1FA 5JMTA 2V8OA 3EASA 4JSYA 3VKWA 1US8A 3K0AA 3NVAA 1B0UA 4CVNA 3W5IA 3K9NA 4BLQA 2YOFA 3SFVA 2GZHA 1QF9A 1OB5A 4Q02A 4OQMA 4KVGA 4CEHA 3LLUA 5FUVA 1YR9A 3F0TA 1CS4C 3K09C 4NYIR 4PANA 2REXB 1OHHD 2CCJA 1ZCBA 3PUXA 1HH4A 1TL7C 2TMKA 3P32A 1T0JB 4TMKA 3HPRA 4TLDA 2Q9AA 2WSSD 3GEEA 1XJCA 3IIJA 3MWYW 2CEAA 2DR3A 3EPKA 2OLKA 1E2KA 1OJLA 2JLYA 2O52A 1OLOA 4XD7D 3U7GA 2ZI6A 1JR3A 1WXQA 2IEZA 1IN5A 5FTMA 1E2QA 3TKLA 3UWOA 4C0AC 4DCVA 3KKMA 4HUQA 4A36A 221PA 4C3ZA 4IVPA 4A8JB 4B3DA 1A5TA 1XU4A 4JBWA 2D3WA 1G8GA 4TLEA 1VCMA 1WE2A 3E70C 3U7EB 3LA6A 4P4SB 4E22A 3VKGA 2O0KA 2G6BA 2IS1A 3WNDA 4O25A 3CR8A 1II8B 1NBME 5BN5A 1N5LA 1NSTA 3KX2A 2ODEA 1Q57A 2GEUA 3AP3A 2ODWA 2QSZA 1PVOA 4QJ3A 2Q0HA 2J0UA 2WTUA 1AZTA 2QI9C 4QNMA 1G8YA 2JJ8A 1L4UA 3RSLA 5LDDC 5E7JA 1CJUC 2GJ9A 4TMWA 5DNYB 1NKTA 2BJWA 2IF0A 1GRNA 2JAQA 3I8XA 2WZQA 5KDLA 2WPDA 5BYJA 3QI2A 4ZV4A 2GA8A 2OBLA 2WWWA 2A9KA 1AS2A 4NL4H 5DISB 2EWVA 3BH6A 1FQKA 1NI3A 2NG1A 2ODBA 3LQRA 2VF7A 3IO3A 2RMKA 4TL6A 4Z8YA 3W5JA 1FTNA 3TRFA 5JHHB 5F2EA 2O0JA 2CE2X 3I32A 3K1JA 1U0JA 1XX6A 1OPXA 1XB2A 1KMHA 4D4JA 4DIDA 3K9LA 3Q7PA 1OKKD 1CJKC 3RDPA 4ZKDA 2EQBA 2JJ2A 2AXNA 4US0R 4M8NE 2XTNA 4KAXA 3IIKA 2JJ1A 2GCOB 3GLFE 2XEXA 5IHPA 4JLVA 4Q03A 5F98A 4AKEA 4Q1DA 3TR0A 4QM7A 1LFDB 3FKQA 2FG5A 3EX7C 4DLYA 3REGA 4CRWB 3K0SA 3ICQB 2UVQA 3WMEA 1E0AA 3QG5A 3CR7A 1KSFX 3WHKA 2VHCA 2DY1A 3NBFA 3TUIC 4BFVA 4L16A 2BMJA 2FE4A 4KLNA 5J4VA 1YKSA 4KI0A 1OSNA 4AKHA 5G3ZA 1KHTA 3Q5DA 5ANRB 1N6IA 1AQUA 4M9ZA 5J47A 4F92B 1OH7A 1VCOA 3LV8A 4FMCF 1N6LA 3QF4B 2AX4A 2QQEA 1HE1C 3ZJYA 4LJAA 2IK8A 1ZP6A 3ZVRA 2C98A 4IOKA 3GLFB 1ZUIA 4NYJQ 5CIQA 4EPTA 3H2YA 3X1WA 4LI0A 4GDFA 1W4CA 3OHMA 3DKVA 1DADA 2ZAOA 5EE0A 4B2PA 2GJ8A 4UNQA 5SZHB 4ZI3A 2W6IA 1G5PA 4QXAA 2W2VA 4HLCA 1S96A 5IDVA 3B1YA 3MLEA 2O8BB 4LJ8A 5FTLA 2XITA 2HLDD 3H4MA 4Q9JA 2GXSA 3EA5A 4Q7MB 3PR1A 1E69A 4DLTA 2Z83A 1L4YA 1SXJA 3IBYA 5LB4A 4UKDA 1S3SA 1S0UA 2HF9A 5TDHA 2IF2A 5CLQA 2JLXA 4O3MA 2ZSDA 3HP1A 5FFMA 2WWIA 3PEWA 2J0SA 4ASUA 2IUSA 2WJIA 2LKDA 1D2NA 2VL7A 2ZRDA 3AF2A 1X8JA 3O8DA 3T35A 4V0OA 1J8YF 2Q3FA 4NCIA 1NN5A 3WBKA 1S1MA 1NL3A 3NXSA 2HDNB 3IPXA 4RFSA 3RC8A 4IDOA 4LJYA 4CEIA 2RGDA 2ECKA 2OILA 2R9VA 3HPQA 3VR5A 1X3SA 5KSPA 1FZQA 3QKTA 3D6TB 3T12A 1SHKA 5AUOB 2RH5A 3QPUA 3RYTC 4N3NA 1QRAA 5FOWA 5CLLA 2B6HA 4V0MA 1E0KA 4PC2A 3R7WA 2JLUA 1UKZA 3JZAA 2NIPA 3Q7QA 4IXNA 2YWEA 1ZU4A 4PO1A 4BZXA 4YMVA 4HATA 4AIIA 3CPEA 2C96A 2J87A 4XVUA 4HZIA 4KFUA 3ASYA 1P6XA 4LY6A 2JLZA 1KK3A 4Q9IA 3R9WA 3AGPA 4MRNA 2QAGA 1G4UR 3OIWA 1YR7A 2GZAA 1ZNYA 2O5VA 3Q3JB 2WJYA 1OXSC 3VNUA 1P3JA 1ZYUA 4JLMA 4D4KA 2D7DA 1TMKA 1NN3A 2XJ4A 3AVTA 1MO6A 2F43B 1P5ZB 4TYQA 5KDOA 5DYGA 5FOVA 5JS7A 2QMUA 4L4UA 4MGZR 2DCUA 4C0HA 1KDRA 5JCPA 5FL7A 3L0PA 4FCWA 4KO8A 4DZZA 3KUCA 3NH9A 1EK0A 3I8SA 4M1MA 1K6MA 5CJPA 4IHQA 1XD9A 4QG7A 4HAZA 4MA4A 3NKVA 4R2HA 1ZMXA 4OJKA 1TNDA 3U3KA 1E32A 4DDWA 4LJ9A 1Q20A 3CWQA 4XTCS 2P3SA 1F5NA 3R20A 2DPXA 1JJVA 1C9KA 3CX6A 721PA 2QPOA 1DEKA 4Z1MA 3KQLA 1DAIA 2PEYA 1P9RA 1GIAA 2RHDA 2BOVA 3WNBA 4M2LA 1F3OA 1YR8A 3WHLA 1IQPA 1L7VC 4JLBA 3X1ZA 4BEJA 2XZPA 5HTKA 5LBIA 1U0HC 1E9CA 4LHVA 3WNCA 4LSGA 2UKDA 4KFRA 1AIPA 1AGPA 5AWFC 1QBKC 5CYOA 4D0LB 1Z47A 3B2EA 3VX4A 1ZINA 4F7WA 1KDTA 1Z0FA 3BH0A 5DI3A 1UBFA 1ZC3A 3A4NA 2QN6A 4TZ6A 4FIDA 1KY3A 3K0EA 1EFRA 4R98A 2ZJZA 5EUMA 5DHFA 5IK2A 3NG1A 3AVQA 1DAGA 2ZRCA 1KY2A 3PCRB 3MJHA 2EFGA 1N6NA 2RGAA 3TW8B 1QDEA 2DYKA 3ZQ6A 2FSFA 2PJZA 3UG7A 1FMLA 1ZVQA 3KQHA 2C03A 2J5XA 2VBCA 4C4PA 3W34A 1CR4A 1W7AA 3EIHA 1ESNA 3NEYA 1W0KA 1NLYA 2ZETA 3DPUA 4TMTA 5KSOA 1E94E 1ZM2A 2ZU0C 5F3WB 3ETLA 5JHGB 1W4BA 4OK5A 4US1R 5CDFA 3C16C 4KBFA 1NVVQ 4PHHA 3FFAA 1ZM3A 2ATXA 3ICEA 1XZQA 3KQNA 2FX3A 4XWAA 1G8HA 3EZ2A 3OIUA 3GLGE 5FTNA 4WZAE 4Q4JA 3RRNA 4F4JA 4ARZA 4UNPA 1UBCA 3PUZA 1RRGA 3B7GA 4JSTA 1T3LA 2GEVA 4B2IA 1G16A 2JGNA 5C46F 5J4YA 4JBYA 2ZJYA 1Z06A 4NCKA 4KITB 3U6KA 1WDTA 3VMFA 1FX0A 2GTPA 1TU3A 3TK1A 1Z2AA 4W9MC 2J7PD 1P72A 4GZMA 1MRSA 3IILA 1II9A 2GVZC 4JMPA 1Z6TA 121PA 2RGCA 1R5BA 1MH1A 2IWRA 2W00A 3PVSA 5HKKD 4B33A 3HJNA 3FE2A 1G3RA 421PA 1WBDA 2VP9A 1KI6B 1XJQA 2KSQA 2VO1A 5AJXA 5E4FA 1XEWY 3B85A 1X1RA 5JRZA 1DAHA 2BBSA 1XXHE 3DMDA 2CLCX 2CCGA 4Q4AB 1ZIPA 2GXUA 2ZROA 2DFNA 5G41A 5B2ZA 4I99A 2DBYA 2WIBA 1ZM4A 3OFND 5FBWB 5G40A 4B75A 1X6VA 3OESA 4ZIRB 4X8OA 4A0RA 1PZNA 4XVQA 1OXUA 3GEHA 2QPAA 5C2JB 3EA0A 4ZKEA 4XH9B 2ZVQX 5A0FA 5L3RA 2A5DA 5CK4A 1K8RA 2QGZA 2DFKB 2BV3A 4H9GA 2GBLC 3UG6A 4QBIA 5B57C 2QENA 4PTLA 3B9QA 1TQ6A 4NONA 3FDIA 4M1KA 4KXFB 2HF8A 4PHGA 4JZKA 3SU8A 1KKMA 4LV5B 2R44A 4HDQB 3ZVLA 2HT1A 4DT1A 2ZUCA 4OBEA 2RGBA 2ZJAA 4YDSA 2G0NA 1W48A 2JDID 2V6IA 2EYQA 1NJFA 1ZBDA 1UPTA 2OCBA 5EZ6B 5B30A 1ZAKA 1OF1A 1W4AA 2C95A 2QP4A 3BFVA 3EZ7A 3RSOA 4E07A 3K0CC 4HAUA 3D3QA 3VR1A 3P20A 4G5RA 3RS5A 2ZI5A 1EFTA 3EZ9A 1TEXA 3U3RA 2PCJA 2BM0A 4U7DA 4B73A 5F9FA 4TYWA 2PX0A 1NG9A 1E79A 3X1YA 3TSZA 1TF2A 1Q0UA 4MRRA 1GL6A 1EXMA 4HSEA 4LX0A 1VCNA 5A5GA 1G8PA 3FVQA 1NNEA 2ZRBA 5KO2A 3KQUA 2V7QA 1GKUB 2IT1A 2VHQA 4B2LA 4LWZA 4D81A 2PZEA 2W58A 4TMZA 4WXPA 3W6NA 5KNCA 5A4JA 2VEDA 4EAQA 4Q01A 1XD2B 4BZPA 4MKIA 1K5DA 3SEAA 3ZIAA 1G18A 3TIFA 2GJSA 4RD2A 3BH7A 1BIFA 1N5IA 2IYLD 3V00A 4PO9A 4XTRA 2JLVA 1WRBA 2WAXA 4JYCA 3Q72A 2H16A 3WXMA 1P9NA 1TUEA 3N70A 4WVFA 3E5HA 5AK0A 5F9HA 2RGEA 2CDNA 4HLUC 2CMKA 3OEHD 5JS8A 2ASEA 2RHMA 3L2OB 2Y8EA 1DAKA 4Q7LA 4GSYA 3SS8A 4LYHA 1M6NA 1E1QA 2O0HA 1OB2A 4PAQA 4UXJA 4XJXA 3ZZTA 2GK6A 3LW8A 5FOUA 1Q44A 1KJYA 1T3HA 3T34A 3U44A 3QE0A 3B6EA 3CZPA 5IT5A 1M1YE 3U3JA 3KB1A 5E3HA 2AK2A 1E9AA 1G5RA 3PQCA 1T3SA 3QBTA 3AVOA 2OCPA 3A4LA 2R6FA 4DCUA 2H1LA 2IXGA 4TQAA 4LZZA 1E2PA 4WAUA 3WMGA 1NG1A 5J40A 1M7BA 3W90A 3GLIA 3EWAA 4D4LA 1R6BX 2VSXA 4HDCA 3MRSA 1ZM7A 2J7KA 4KFTA 1S9DA 4A0FA 1KAGA 2CE7A 3GEIA 3A8TA 4DB4A 2R62A 3SYNA 1QVRA 3G5UA 3VR3A 4RVCA 1G3QA 4TSFD 1IN6A 4DBLC 3DO6A 2YZ2A 2ZS9A 1Z63A 4Q7JB 1KI7A 4M1WA 1P75A 2A5GA 2C78A 2ZYTX 5FTKA 4C7OB 2X77A 5HE8A 1A2BA 3KFVA 1Y63A 4EJSC 2C9YA 1TQDA 3ADCA 5AJYA 4WZBE 1ZJ6A 1M2OB 5JRJA 1II0A 2ZE7A 4RCYA 3TE6A 4LJ5A 1XPRA 2ZJBA 4O2RA 1CKEA 1HQYE 5L3QA 3BJIC 2X2FA 3QKSA 4DCSA 4LHZA 2XSZA 3K53A 1XBTA 2RB4A 2HUPA 3IEUA 1XMIA 1A2KC 5BYKA 2J45A 4MGKR 3VNVA 4NP6A 3LQQA 1QHYA 1GRQA 1KI8A 4B74A 4US2R 4TWZA 5GVSA 1MABB 2BC9A 2RCNA 1OIXA 2JA1A 4UNSA 1ZC4A 2BEKA 3WYGA 3EIEA 3CBQA 5FR1A 4G1UC 4XVRA 5AUPB 4OHZA 5D3MA 4DDUA 4GOKA 2WBLC 1COWD 1QHHB 2BHRA 4AYTA 4M53A 1OIWA 2XXAB 3CZQA 2IHYA 1U8AA 1J8MF 2ZYVX 1Z0IA 3JZMA 3I4LA 4DSOA 4FWIB 5TV2A 3SBDA 4IDHA 2BKUA 3CF6R 3LDAA 3VR6A 1G4AE 1VKJA 2WOJA 1HYQA 4Q1EA 5L3SA 3THYA 3RS2A 3OAAA 3SHFA 2OFXA 2P5SA 5DO9A 3X2SA 1AN0A 1A82A 2W83A 3D8BA 4FMDF 3EPHA 1CR1A 4OYHA 1JXMA 3RS7A 3PJRA 4GFDA 1RFLA 2ORWA 2VF8A 5P21A 2GF0A 3GJ4A 2QM7A 1ESMA 3TQFA 3U3MA 3T1TA 1G41A 3H84A 2OFWA 4BE7B 3B1VA 4PC7A 1IHUA 1JXOA 2ZR0A 1NRJB 5HCIA 3I5YA 1LS6A 2QE7D 1BKDR 1VG0B 2EYUA 2VSFA 4BUJA 3VTKA 1M8PA 1JEDA 4Q4HB 3QKRB 4KYUA 3VX3A 2YWFA 4LOAA 4BFTA 1RJ9B 4OQNA 2JIZD 3SDZA 2QGNA 1F48A 1Z6GA 2YC2C 4NBSA 1KNXA 2HJVA 4MUAA 3S1AA 3ZZ0A 1JI0A 2D06A 1OHHA 3CPHA 3IPYA 1NF3A 3KKPA 2FZ4A 3JVVA 2IYRA 1N6KA 1E9DA 2WSSA 3MWKA 1W0JD 2DB3A 3K9HA 5KTYA 3TR5A 4TL8A 1KTVA 2Q6TA 4GI7A 4EUNA 3KJEA 1EGAA 1UFQA 1UJ2A 1GDDA 1Q21A 4Q9LA 4FW9A 1G64A 1H65A 1G20E 1JR3E 2BWJA 3VR4A 1XEXA 2V1XA 5DI9A 3ZDQA 1JNYA 5ELXA 3THOA 3KTAB 1QHNA 5E7IA 2AKYA 3CH5A 4ZCMA 3HR7A 1SULA 4Q47A 1YZTA 4URZR 4OL0A
chains in the Genus database with same CATH superfamily
3LBHA 4NMXB 1Y9DA 4P4UA 3QPDA 3R8XA 1QYIA 4C05A 5KTPA 1IJFA 3I73A 1W4RA 4J16C 5DIFA 5IHXA 3B1ZA 5K3FB 5LC1A 2F48A 4B76A 3E23A 1XWFA 4QPPA 4HI0E 5GOZA 2NMVA 3AHIA 1JFFA 3MJRA 3HLKA 1M2EA 1P4HA 1V5GA 3FH0A 4JIMA 4M7OA 3BREA 1WZCA 5JEDA 4BIMA 5JQGF 5GMOA 1PGQA 2C2ZA 2DPMA 2Q4RA 2ZIAA 3BICA 4RSGA 4CM8A 1FMFA 4IIJF 3Q9LA 3VSAA 1JHQA 1KARA 5JH7F 2KYRA 4R9NA 4DWVA 3JSXA 1CETA 1QCYA 1YT5A 2RH9B 2M1ZA 2AN4A 2XT6A 2GHIA 3DXZA 3ESQA 4OHRA 4QUDA 1HNNA 1YZUA 2M98A 4Q1VA 1H8ED 3KHKA 5KPJA 2G0AA 3ZEAA 3MXOA 5DSXA 1OW3B 5E1DA 4UULA 1KNQA 5EJIA 3RO7A 3TFWA 4BNLA 5AESA 3FPAA 4OQPA 1E4OA 1NVAA 2B6NA 3TIGA 3OUZA 2XLCA 3V2UA 3L79A 5DF1A 3RAPR 3ZW9A 5C7YA 3ZJVA 5FA5A 3PDJA 2D2FA 4CIAA 4KLAA 2FHPA 5B3KA 1XHLA 3WLNA 3LLCA 1DBSA 3UC9A 1HDIA 1JP7A 1EX7A 1I3MA 1W581 4L9WA 3WK5A 4MWGA 3V1TC 1PTKA 2HWKA 3M6WA 3PXAA 2R47A 5ER9A 1ADFA 4C20A 3T0IA 2ODTX 3QU9A 3MUEA 4C3UA 2H4YA 2JCSA 3VDQA 5TQ2A 4BZQA 4BNGA 1GN8A 1PR9A 4Q1BA 2XBUA 5HF9A 3L0IB 4L6AA 5K01A 3MNFA 2H1HA 3ED5A 4ZRNA 3LP6A 5CEFA 1G66A 2WZBA 2QL9A 2ZR7A 1U2PA 4HFMA 3MHPA 1J1ZA 4G85A 5G4LA 3TXXA 2ID4A 4RIIA 4JQZA 3ZI7A 6PFKA 2KS6A 2EXXA 2J1LA 3P9PA 4WKOA 1JEAA 1H6CA 1WDKA 3NV7A 4NYMR 1Z0KA 1ZCZA 4Y6GB 2CBZA 3GDFA 4GSLA 4W1QA 2Q6KA 4R05A 3TDMA 3KE9A 4ZU1X 1WMFA 1EP2B 3LGAA 1NAHA 1FVHA 2G25A 4Z0NA 5FPHA 5T6MA 1N4AA 3SS9X 4D41A 1QHIA 4LG1A 4Q1AA 3P94A 3PQEA 4FTWA 5E4JA 1BYUA 5AOBA 2YZGA 1N2BA 3JD1A 3ZE2B 1J1UA 1QF7A 1XZJA 2JIPA 3HV0A 3KOYA 3OTIA 3UV7A 1EQAA 5FV4A 1G59A 4FCTA 1DAFA 2DAPA 3KPYA 3L8MA 1DLIA 2QU7A 3FNRA 3ITEA 3V33A 3HB1A 2OFPA 1IN8A 5IC6A 5JAZA 1JTEA 3WKDA 3DMTA 1VRVA 3QOWA 1A4IA 2EU8A 2JIOA 5IG2A 1ISMA 1FUYB 1QIHA 3AEXA 1JHRA 4LC0A 4Y3UA 4S24A 2FH5B 1E3IA 1K98A 3TNLA 1SXJE 2V65A 3ZWKA 1Z0JA 1OPRA 2Y6UA 4YJKA 3SQMA 1KYIA 1KEVA 2GKOA 4N40A 2OP0A 4YTEA 2CL7X 2NTYC 3QG1A 3WR5A 3ZU3A 2WTNA 2PR2A 3G1TA 3KJXA 2FDCA 3C3PA 2CD9A 4MA0A 4TYPA 4YJGA 1JG3A 1C3OA 1QHXA 3ZN2A 3QPVA 2YV2A 5EJ2A 3GJ8A 2QMOA 4D82A 2GJKA 4TTRA 3VZSA 5AW1A 5JCZA 4ESVA 1CDOA 3S44A 4DLTA 5EE3A 3EBPA 2OWEA 4XZ3A 1UXJA 2YWGA 3TUJC 1V4VA 2NU6A 1AS3A 2XWPA 1MX1A 1XTQA 1UPFA 2J0EA 2E4ZA 2WJ3A 3NTVA 3Q3HA 4LJSA 3BGVA 4NK4A 4FIZA 1U28A 2PU5A 4FINA 1DINA 3CIFA 1OC2A 2QX9A 3ECCA 3ADPA 1CTQA 3KFXA 2H4XA 1CDZA 5LCXA 5HIMA 1NBMD 3D2BA 3B20A 4EF4A 3PQ8A 1W1WA 1QIJA 1Z3CA 3JYNA 4HBGA 2W6JD 4MRVA 4ZPXA 1E1CA 1OH8A 5LNK6 2BRUC 1CUCA 2J31A 2PX5A 4FONA 5FBKA 5KIAA 1XKXA 1KQOA 2IYUA 3ANXA 2EQAA 2D5CA 4M9SA 1WZIA 3GFPA 3PQ6A 5K6AA 2I67A 4ZGWA 1CY6A 1N6PA 1SN7A 2JH3A 3B70A 1GR1A 5AR1A 5KQMA 3AVXA 4QVKA 3T5PA 4LBYA 4MYTA 2X2OA 1OZHA 2PJUA 4QYIA 4DG8A 2DULA 3EIOA 1Z2OX 2JB9A 4JJGA 4CLOA 4N54A 5AUQA 4BO6A 4Z49A 1EU1A 4NCHA 4HEQA 3FSEA 5ISMA 3ZCUA 1UXGA 4M9RA 2P4UA 1Q1BA 1PT9A 1GKYA 4RNDB 3VXKA 5DHAA 3GG2A 1ZNXA 2G4CA 4BV9A 1RAGA 3IKTA 4B6FA 1IUKA 2YMPA 3HGQA 2A84A 2DKOA 2LWIA 4I3HA 5B3JC 1WABA 3C5CA 2GCPA 2AYZA 3L43A 1B7GO 5CRIA 2XWSA 2YYAA 5I5GA 3GN2A 5JNLA 1DC6A 2C42A 2KPOA 4AICA 5JBQA 1JTFA 1ZFNA 4NMWA 1DKUA 1H6DA 4BQOA 3CIOA 4M99A 3ADBA 2QWXA 4GLOA 2CFTA 2WYVA 1BX0A 5JD3A 4WZ6A 4V2IA 4DPKA 4OJQA 4WXYB 1L8QA 1RABA 1ZMOA 4UU1A 4X66B 4EKEA 1NXWA 4IF4A 1XMJA 4NWIA 4ZEWA 1NOKA 2XD9A 1SG9A 2ZRMA 1UXOA 3DZBA 1PJRA 3K9CA 3KC2A 4HB4A 4EOGA 5ALPA 4YO8A 2G9QA 5DJ5A 1N2XA 5D5PA 2CHEA 2IOHA 1IULA 2E9SA 3PNOA 4PNPA 5KTKA 2R86A 1ZZGA 3M1IA 2ABWA 3C24A 4YIHA 2QT0A 3Q85A 5DASA 3GAAA 2WJPA 4XKJA 4IS2A 2J4CA 4FJ1A 5DGIA 4AMYA 1I32A 1H2EA 4F1KA 1UF9A 3PKJA 1HOTA 3B89A 2Y0PA 3A4MA 3ZWWA 1FDIA 1DKNA 4HH0A 4AF7A 2H3EA 5K20A 4BCCA 2HSEA 3TQIA 3AUJB 4YRAA 1X14A 3SJAA 3A06A 3L7KA 1Z12A 4UHDA 3H0CA 1OU0A 4AY4A 1V8ZA 5CXQA 4MMYB 2NZ2A 1KZ7B 4DC1A 3DHWC 3FCYA 3TGPA 2ZRFA 5TLSA 3WIEA 4MUEA 3DMGA 4X24A 2Z6AA 4BNXA 4Q3LA 1PZFA 3A32A 2P6OA 5F23A 4ROTA 1T0BA 3GEMA 1O3YA 1HUQA 3O8BA 3MJCA 4JLKA 4KQWA 3UMSA 3KLOA 4HEA1 3OOWA 5B55A 1ZD9A 3A7DA 3LWNA 1FFSA 3LA8A 4CF7A 3UATA 2FQ1A 1ZD5A 2B2CA 2ZRGA 4QEZA 2FF7A 1G6HA 2VDUE 4LXYA 1MC5A 4PYKA 1PFYA 4Q5IA 5SV2A 4CW7A 5TIIA 3DHVA 4P80A 2IZ0A 3NVDA 3SE0A 2G5PA 5KHOC 3C3CA 1CNFA 2XVAA 2P1DA 3USCS 1U2EA 1WD5A 4UU7A 1JYSA 3BHJA 1C41A 4L02A 1VPLA 3N2ZB 2DBQA 3HWX1 3VOTA 1QO7A 4U2FA 3KE8A 1JKJB 1SKUA 2VHJA 3FYUB 3MYYA 4BKQA 1XRRA 5CVCA 4MVYA 2CB0A 5LD2C 4YP6A 1VJTA 2ZIWB 3MAGA 3CX3A 2PGOA 5KNCH 4GKAA 5BV7A 3Q2OA 4KDFA 4L5JA 4WPGA 4AC9A 3FIUA 3LVQE 2PD3A 2EF0A 5TSDA 3NFYA 1YZQA 2O20A 2A9QA 5L7YA 2C2OA 4IHAA 4M98A 4Q48A 4E5YA 3O7MA 1ZKMA 1PEYA 4BP8A 5HQ3B 1X1SA 3AFHA 3GQVA 3ZVNA 2NQTA 3I64A 3JQBC 1ZXXA 3QOXA 4BASA 4CR8A 2GESA 3ZWPA 4X65B 2DH6A 1STOA 3JVUA 4IIDA 5A4FS 1XHFA 5F1KA 1Z4KA 1I9CA 2RGGA 1RZRD 4MICA 3U3OA 3FPFA 3WL4A 4C4OA 4RIHA 1XMXA 3NIBA 4OQZA 3WMXA 1WR8A 4RMNA 4E5KA 3OLVA 3L6EA 4P0PB 1XFAA 2ILVA 2XKAA 3WRXC 3U09A 2XMBA 1UJBA 3LC1O 4RETA 4AB1A 3G6KA 4AJPA 4QHSA 2Q5CA 2XYHA 5H5JA 4ZK6A 2NZ8A 5JTTA 2P9HA 1BOOA 4RZUA 4CF5A 4WJLA 2XNCA 3KRTA 2FWMX 5M34A 2ZEJA 1A8QA 3L8HA 3P5SA 2QT1A 4NZYA 2DEUA 1PDWA 2J5BA 5A7HA 5TXGA 3V2GA 1GT6A 1W25A 3NO4A 1DC4A 5CX4A 3WRYC 2VHVA 4F3NA 4ZJZA 3DD5A 3HSKA 2XWBF 1K5HA 3E84A 1HEUA 2Y67A 3F1LA 5BR1A 5TJHA 3E8XA 5AI8A 3GA0A 3GCZA 5FNZA 2X7XA 3N6VA 4RD1A 5HKAA 4OG2A 5CB8A 4FEEA 3QYAA 5IK2D 5T7BA 4N82A 5JFOA 4D4IA 2E1RA 1Y3IA 1RQGA 2PUJA 3GLUA 2E89A 3SFTA 3L1KA 4II3A 2GEFA 3NPAA 1PWHA 1SOVA 1VC2A 2RGWA 3K09A 4N18A 4UXIA 4WZAB 4DKXA 1J0BA 4N5HX 4BN4A 1F2TB 1UFOA 1Y80A 3FDZA 4DXAA 3FHLA 2ONJA 1PJ3A 5DHTA 3CWCA 5FUYA 4E2YA 1GVNB 2P2SA 2QTAA 4G2NA 3N86A 2HXSA 4YQFA 1M6HA 3QY0A 4YCDA 3UCEA 3HJCA 2FQXA 3LECA 1KQNA 3CLKA 4C0LA 2C2GA 2ID9A 2WT9A 2I6XA 4QWWA 3VZRA 1KVTA 3H86A 4OBBA 7AT1A 5L7WA 4KPEC 2B5VA 1ID8A 1NJGA 2Z58A 4ARBA 4ZP1A 3TRIA 4N0PA 5LU9A 3FJOA 4RQUA 3RVQA 2YNMD 5T3UA 2O8DB 2Y93A 4DDTA 1QG0A 4RPGA 1VFNA 1EG2A 4GP9A 2O5CA 3S5UA 2AHRA 4M8KA 4XYMA 4O4IA 1D6JA 2BI4A 3CRRA 1D5CA 4H60A 4LRXA 1A88A 4FD2A 4Q4AA 4M1OA 3WA7A 2VBGA 2PTGA 4EW1A 2J5KA 4QBFA 1MH9A 1A7JA 2EOAA 4PZPA 4ENTA 1MB0A 4DQLA 2BY4A 2I4OA 4EPXA 4G5OA 3H2KA 5DLDA 3K9BA 1UBTS 3GYGA 3J7AC 1GY8A 5ECYA 1E2GA 5K0FA 5AW8A 5FD8A 2ZTVA 4DQVA 1SJ9A 1W49A 1LK5A 5L45A 4XEUA 3SQOA 2OCKA 3U40A 5SY4A 3QXCA 5BNFA 5FTJA 1V39A 1NVWQ 4ZMRA 3OEHA 3T06B 5C7OO 1DLJA 3CJTA 1RRCA 4L57A 3INYA 4IKOA 4IOLA 4OQFA 5CLIA 5TQ0B 3WQSB 1JEYA 1Y89A 4HGRA 4K9MA 2C2YA 2RK6A 1ZUNB 1PS8A 1Q22A 2I5PO 1CHDA 1YV9A 2FPUA 2HU8A 4NS4A 3FI9A 3G2NA 3WQBA 1IXYA 2H18A 3VZDA 1EGQA 3IVCA 2WJ4A 4B48A 1KSJA 4X95A 4MR9A 3L93A 3MSXA 2LV8A 1M0EA 5C4MA 2PD4A 3PL5A 2VJMA 3W2IA 4ND5A 2HO5A 2R7MA 2WAOA 3SEZA 3G82C 4WERA 1JG7A 2FI1A 1UPAA 2GASA 5ALWA 4O4HF 4YV1A 2CJXA 2JIQA 3WI7A 1PCXA 3WX0A 4DNFA 4HNQA 3QFHA 4RTPA 1H1TA 4EA7A 2RIRA 3GVIA 4Q9AA 4FGUA 1SKMA 2VDWB 5AW0A 3UT6A 5EHGA 3NT2A 4RM2A 5DIZA 4DMLA 4FFVA 2JGEA 4QM6A 1EP1B 5TPWA 4EQ6B 5C5DA 3AM1A 1T8TA 1XTSA 4E5NA 3ISVA 2C4KA 1TW3A 3BCRA 2QMQA 3OZEA 5FUBA 3H1TA 1OYYA 4DYDA 1FYEA 1JPVA 3IVMA 1BEEA 3U4QA 1CEQA 1E2FA 1E9SA 1VGRA 1IBSA 2FY8A 3UB2A 4TSFA 4LVCA 3IUMA 1QHSA 2O8NA 3ZHBA 1DHTA 4QBHA 2VAPA 4IKPA 2QIOA 2RAPA 4KEAA 3STUA 4JC8A 1KGDA 4RSRA 2QSJA 2OBFA 4LKRA 4TZ0A 4JFAA 1GG8A 1J23A 2HSZA 4F3RA 4ZYZA 1RQ7A 1HWYA 2VOEA 4P31A 2ZANA 4FBLA 5EJGA 4C7MA 1FSPA 3WJ2A 2WQZA 3KQVA 4UVEA 3EVFA 4WCVA 1SCJA 4HNVA 3WS7A 5H80A 1C9EA 2H17A 2EBWA 3A1EA 3A9RA 4F84A 4PCAA 4I6EA 4DZRA 4FC6A 3KQWA 3L7LA 2R7KA 2A58A 4E5PA 3TO5A 2V6JA 1U80A 1SZCA 2P2GA 3G0DA 3OZRA 3PI7A 1XK6A 4LZJA 1AO3A 4M21A 4B35A 1I1HA 2GHRA 5ITVA 1I4DD 4UU8A 2ISQA 1IXKA 4P93A 4UASA 4KGDA 1KGSA 1WXWA 3CRVA 3IQIX 3EEYA 2LDXA 2ZQZA 2XDQA 1JH9A 3G3EA 1NV9A 4EKDA 3GJ7A 3BKWA 3TM5A 2WFLB 1WXHA 3IE1A 2C07A 3O3MB 1BXRB 4LYAA 3NALA 4FT4A 3TZ6A 1E0SA 3HO8A 3K2EA 2V6MA 2ZRIA 2IOQA 4ATNA 1X13A 2FTKE 3IEVA 4IDBA 4S0XA 2B25A 2ORIA 3LIIA 3OLQA 2HYDA 4R1SA 1TB4A 3P9KA 4PSKA 3UH0A 3C6KA 1PL8A 4RORA 4WCFB 1KL7A 3GEGA 4QDXA 1EJBA 3HWRA 4X8LA 4MDFA 2RH8A 5JXIA 2M32A 5KOJB 3QKSB 4FXOA 4HGNA 3ZE6A 2IYSA 1MT3A 2FVYA 3KTFA 4JP1A 2JFOA 3VKVA 2ZCVA 1FTGA 3NJRA 1LBQA 4MB0A 3ZHRA 3ETGA 1THTA 4JGBA 4JNKA 4AN1A 2WE8A 1JJAA 2C4HA 1W5TA 1FW8A 2FSPA 4HLDA 4PC3A 4XEHA 1DARA 4W6ZA 3IP6A 4RGVA 1C8KA 3JAWA 3PX3A 4AUEA 4A91A 1E5XA 3JQ8B 4BC1A 3G0BA 2AN1A 3O1JC 4GZ6A 1NVEA 4Q15A 2XE8A 1S7GA 4HV4A 1EFHA 1QRSA 1YB2A 4HSGA 3B2QA 4CQMB 4URHA 1FFAA 1DBPA 3PHHA 2FLKA 4GYKA 4RJLA 4A6PA 1UKYA 2ICAA 3TZLA 1W30A 3NPMA 4CIVA 4GUAA 1BS9A 4BPBA 1GGHA 3SQXA 2H1CA 2AJTA 4G1EB 3OEEA 4L8WB 4NV0A 2QV7A 4GGMX 3SVLA 3IDAA 4P1ZA 5EA2A 4IH1A 3QNUA 1YB7A 3MFQA 5CVVA 1O03A 3WIVA 5BPFA 2C5FA 2Q9UA 1MA3A 2HCRA 3AW9A 4JLUA 1E63A 3F4LA 4M1SA 4HRVA 2PKEA 3HHEA 5EJEA 3I0ZA 2YS7A 1YU9A 2QE7A 3DZGA 2W93A 4DSUA 1HT0A 1AM4D 4QU8A 5YASA 3W7VA 1X7ZA 1Y8RA 5AKGA 2QLNA 3NBXX 3N0WA 2BP7A 4MNTA 2I8LA 2OQIA 2ZYIA 4OKSA 1P1BA 1T8RA 2ZR9A 4CM4A 4YASA 1N1EA 4KPYA 3SC2B 1MABA 1U2TA 1Y5MA 4XM2A 1ZGZA 2A6PA 4DEYA 4ETWA 1M34A 1U9CA 3BXOA 4RKWA 1GG9A 1L6RA 3GFTA 4BNZA 3V7WA 2P91A 1GTVA 2P27A 3AKCA 2NSYA 3F98A 4H0CA 4IXTA 3LXMA 4QTZA 3DUWA 3EZFA 5B1HA 3GMDA 1E3SA 3S2YA 2GN8A 4DRXB 4YCCA 1RQXA 2RI0A 4C9BA 2VUIB 3IHTA 2DOKA 4U7TB 1NVMB 2BM1A 3MWEA 4C0SA 5D1NA 4PQFA 3IAM6 2WG0A 5B58T 3SZLA 3N87A 1INLA 4EY4A 8ATCA 5JIBA 5D5QA 5BW8A 5AO9A 4EECA 2EFJA 4G4SP 5ALQA 5DNDA 1DQNA 3AEKB 3AQ4A 4I2VA 3TAXA 4XIGS 2PD6A 4HAIA 2NU9A 4C4YA 1DDIA 4BCDA 2P2DA 4MKGA 4WBNB 2Y0EA 1U1EA 2NVBA 1CJVC 3CFYA 4NVRA 4O4LF 4B6OA 4CQMD 1Q1AA 5CFOA 3IQXA 1KS9A 1S89A 3WV4A 3BWCA 1ONNA 2JKVA 5L8VA 5F4ZA 1S2LA 2FQQA 1UDCA 2W8ZA 4KIUA 3JASA 3PVCA 3V4SA 4YPVA 1FYWA 1CUXA 1LDNA 2IOFA 3LQKA 2H9IA 2OHHA 4BEBA 1I7NA 3N39C 4XB6B 4QOIA 4HF7A 1HDZA 4TWRA 4X84A 1G2QA 2F67A 3LQ4A 3W5DA 3GC6A 3RODA 1JDBC 5KSZA 3LT1A 4W1PA 3D5QA 4ER5A 8ABPA 2ZTLA 3K96A 2GLXA 1Z39A 3HKBA 2PY6A 1N3BA 3F1KA 4G3XA 4L8GA 2VPIA 4O5OA 3WBJA 4GQIA 5B7NA 3G7SA 1R4MB 3SY8A 2CDCA 4LECA 2DUNA 4MPJA 1CT9A 4NNJA 3IUJA 1DTEA 2XZDA 4CEHB 2PLRA 4RW0A 5EIBC 2C8KA 3H7IA 5DM1A 1T6NA 2E4VA 1EH5A 1WZUA 1TAHA 3BULA 4UJ5A 2HRCA 4YRLA 4ZAGA 3UV3A 4P4LA 3ZCXA 2QQ0A 2OLEA 3E3MA 4UMDA 4AMGA 3OQHA 3WWEA 3ZH2A 3B7WA 3CVJA 4OKIA 4MYDA 4RZXA 4ZOLA 3ILVA 4DARA 1PI3A 2ZRAA 1MBZA 1QQ5A 4NZNA 1U0EA 3KYCA 1CRWG 3WGYA 4YT4A 3N8GA 4W5RA 4GO1A 2JEOA 2NO7A 1JL3A 5FYQA 1OBVA 3QF7A 3OT1B 3TR6A 1R00A 2YHUA 4G26A 2RARA 4E2WA 4TV8F 2IU0A 2PBFA 5TARA 4RSMA 1JR2A 4KQHA 3L9XA 1QTQA 4Y67A 2BFEB 2AXEA 4BQNA 3NDBB 1XRPA 1FS5A 5F9MA 4G81A 3RTGA 4NJMA 3ILHA 2SICE 3PPWA 1SQFA 1JDZA 2XQIA 4BVBA 5B4UA 3CXUA 2C8VA 1G0NA 2QM0A 4KMRA 4LQLA 2EG9A 1V8FA 1ZH4A 2FKNA 2H65A 1S3GA 3OIVA 4A0GA 1IBLB 3DSRA 1GTRA 2UZIR 5BN5B 3UJ8A 4TXLA 2R1TB 1Q91A 3AV0B 4X8MA 3G8DA 4HDSA 1JEQB 4H2DA 4M76B 5LQMA 3MOGA 3LYAA 1Y98A 1ZZEA 3A7EA 1PFUA 1V1RB 4X54A 1ORDA 1F6BA 1OYOA 1Q19A 1U8XX 1YUBA 2EX1A 2GRAA 1MTZA 2HEGA 3DQZA 3DEIA 4WHMA 1AS0A 2MMCA 5DYNA 1P1HA 1U2GA 5JVDB 1GXSA 3W2EA 1UBMS 2BFWA 2R2AA 4LISA 4NU0A 4U02A 3PZBA 3RVOA 5KUTA 3KJFA 3NORA 3FVVA 5FI3A 1DBRA 2OG1A 3G68A 4IMPA 1QNLA 4L5AA 4CR6A 1IAQA 2EBHX 4EENA 3HZHA 5KNDA 3QVJA 4JAVC 1NIJA 3MPOA 4JT8A 3C43A 4BB6A 5SYAA 3G2PA 1O1YA 1V1MA 4O1IA 3P0IA 3BSSA 3PUJA 3G0HA 3W5VA 4OHFA 3QVGA 2VNIA 4D79A 1WF6A 1QLJA 4GD3Q 3GVCA 1MB9A 3H9JA 3HYTA 3I3SR 3LUBA 1OROA 2JFWA 2V96A 3GV0A 2OOKA 3WWDA 3ID6C 3A37A 4P6VF 1MUUA 1HTBA 2I54A 3CV3A 2AWOA 1ZA1A 4RD0A 2AIRA 5AHXA 4MUBA 3DE0X 5ERGB 1VHJA 2I6UA 3EF0A 1Y9JA 1O96A 4C0XA 1N7IA 1YE3A 3NOOA 4BVKA 3OWHA 5LQSA 4CV2A 3AVVA 3OY7A 4RU1A 1NJSA 2A5FA 2ZLBA 4RY8A 3H83A 1FCJA 3KP1A 3O0TA 3Q0IA 4LSWA 2AFIE 2GBPA 3UWKA 2BYTA 1H3EA 2B61A 4I4TF 1Y9AA 5DE3A 5JZVA 3QVLA 3KOMA 1PV4A 4JJ8A 1SUEA 2EZTA 3P0HA 4L73A 4NJOA 3RFVA 3PEYA 4OVKA 1C4OA 3STVA 2VJCA 3RJ5A 4OGKA 4L7QA 2O3RA 1T3GA 4N9QA 1Y1QA 3GT0A 3ZLBA 2IXEA 4EMTA 1SR8A 1HL7A 3EVNA 3HYSA 1GP2A 3MCUA 1I3NA 1F8FA 1ZAYA 1E7MA 1Y33E 3CZCA 1ZRHA 2GCOA 3JD2A 3R6WA 4IUCS 3TBFA 4UMEA 3ZX4A 4B3JA 4XVCA 2IPOA 5A5VA 5LXTB 4LF4B 4ZOEA 2SECE 2AEMA 5LA6B 2O7NA 4JVNA 2BEUA 3GFOA 3U6BA 1ICIA 3GFFA 3VOBA 2Z4RA 4LHXA 2WWYA 4JY7A 3IP8A 3CWZA 2WPDD 2EP8A 1CJBA 3R3SA 4YDRA 5HCUA 1AKTA 5A0VA 2AFIB 5BMVA 3A3YA 2OQRA 3WBFA 3H0KA 3DPIA 2POCA 2YOGA 4J2HA 1L7AA 4ND4A 3ONWA 3ILXA 1PYGA 4HLUA 4HWGA 1CUYA 4FKBA 5IF9A 3GJ5A 3K2IA 2PUGA 2Z4TA 3WWCA 5F2NA 5CM2Z 4OL9A 1V1JA 2MIIA 3AVWA 4OKNA 1AKUA 4PYQA 3MGAA 1J2JA 5CYGA 2PX2A 3QW4B 3FNQA 4RZQA 2J67A 1ORIA 1GKIA 1KYTA 3LVFO 1MD9A 5AMXA 5G53C 4CMIA 3GVHA 4FKMA 3UAOA 4ZAXA 1H8HD 2P9CA 1RWNA 4QGBA 2JGMA 4W7SA 1OLSA 2XT9A 1QOZA 3RUAA 3OHSX 4KRYA 3RYHA 1E7RA 3LXRA 1ATIA 1P2TA 2F59A 2GAOA 2W0MA 3PGKA 3Q9NA 4BMNA 4GBED 2D1FA 1NV8A 1IBRA 3H11A 3RJMA 3EXIB 3EAQA 3GVXA 4TKUB 7MDHA 2Q21A 2HAEA 7ABPA 1R0KA 1SPBS 4HGQA 3QPBA 4YGXB 4ZARA 2A4MA 3GG9A 4IOMA 2D7CA 2CXXA 4MWTA 2D00A 4Y2SA 1VPVA 4BXOB 3S6JA 4JEMA 2X6RA 1JLSA 4Q4LA 1WSWA 2P40A 4LVOA 1NLFA 3IAS6 3N75A 5LQCA 2O06A 2D1TA 2IEGA 2YJZA 3HWSA 4EW2A 2W6ID 4DDMA 4RZ3A 3TX2A 2XMGA 4JODA 1GUFA 3BXHA 1ZK1A 1LK0A 4J3NA 1WZEA 4IXDA 5C8VA 2Z3VA 3ILSA 1IN4A 1MTOA 3NHKA 4DMMA 3C39A 4TQGA 2I4IA 3MERA 4EJSA 1PR6A 4TT3A 4E33A 2OCLA 4G0VA 5TE9A 1DEXA 1P0QA 3PIIA 3THWA 3ZCSA 5JJCA 1D6NA 1PJ2A 3CONA 4HWRA 2JEYA 5H0IA 1P7CA 3G2OA 2W6CX 4HN4B 1ZNWA 2IPLA 2VUSA 1S9HA 2ZSAA 3COSA 2V5UA 3PGA1 3QA9A 1Z0DA 1DKOA 4D80A 4KQ1A 4MWSA 3FTQA 2BEJA 4Q3OA 3BFKA 1E98A 3P8ZA 4I7EA 4IICA 3BZWA 4V0QA 3GF4A 1GZHB 4R7ZA 5DDIP 2Y77A 5E6RA 1K06A 4CFYA 5JNTA 3BERA 2GYVA 5C52B 2CWDA 4A8PA 4DM4A 4RMIA 3DLHA 1IOZA 1V6AA 1P17A 4PX5A 3RTAA 1KFKB 2YMQA 5H70A 1HE8B 2GN9A 1QYWA 4IINA 5A5DA 4KGXA 2HZBA 4YP0A 4NICA 4BKOA 2XMSA 1NVXQ 1T1JA 2W8BA 4MLZA 1GPAA 1T36B 2PT5A 3WK8A 5M2QA 2ZCUA 1TAQA 3K3PA 3WKBA 4ZRMA 4NE7A 2OVFA 3RQIA 2XQKA 3KKNA 4JUDX 4EBBA 1D8TA 1OV6A 4OLFA 4MRSA 2ZUDA 5JECA 2Q7OE 3SN6A 2FYTA 2A0WA 3B5JA 3H87A 1K5GA 1XRQA 1YI8A 1D8AA 3R5HA 5IAGA 1KYZA 3JQGA 5K8JB 1UDWA 3C0KA 5IT9A 3E9NA 4MQFB 3BRQA 1PJCA 4X7BA 1ZK2A 3E1KA 4FYJA 2QLMA 4J0QA 4KLZA 2JW5A 1PZGA 2HPVA 3B78A 5EWLA 3U17A 3ZNQA 3EXAA 4FFDA 5DI3B 2HSGA 3UKJA 2YUIA 3GCWA 4G0YA 2CNBA 4V1CA 2JHPA 4AMZA 5JDCC 3U1BA 1U0OC 1YZYA 3IOYA 3OZSA 4S35A 3GGOA 3FUCA 1SB8A 2V9CA 3IQDB 3DDOA 3PG5A 2BFMA 4IRXA 3VTFA 3EEOA 1A2QA 3OPYA 2KW5A 1H2WA 1F4VA 1MGPA 5A4AA 4HQNA 3KSAC 4X6LA 2EKQA 2JASA 1PQWA 2CY0A 4IVRA 4TL7A 3RWMB 4BU1A 5FUWA 3GWZA 2PRJA 3FKSA 3RRXA 4BNTA 3TG8A 2AL7A 2QHXA 2X5NA 1S2OA 2FB9A 2ZSFA 1V3VA 3R41A 1NQTA 2VK2A 3CEMA 3JARA 2HK8A 2C5LA 4ITVA 1TTHA 2G04A 4KAAA 2AR9A 3VPXA 1NASA 1IY2A 4J4TA 2WJJA 2IYZA 3QLVA 1RIFA 2VFAA 2D54A 3I28A 4XIIA 1G2IA 4DUPA 3EMBA 2PJRA 5DM0A 1G21E 4QBKA 3R7SA 4BV2A 4D8YA 2D6FA 1Y34E 3RNLA 5GP1A 1AA9A 3FYDA 1EUDB 1UODA 2GFQA 1Y7TA 2N9UA 3NHRA 1UDRA 3QFFA 3WBBA 5J2TB 1QQTA 4X6UA 1QORA 1QWSA 2XA2A 3PFFA 4U9UA 3TSYA 3VNRA 1W36C 5ICFA 3OUUA 1JG4A 2I29A 4G5QA 4BRSA 4RQTA 2GGSA 5DULA 4RQBA 4HYTA 1L9XA 2XGMA 2NN3C 1U2SA 1N0WA 1VIDA 1D2CA 3NBAA 3C3MA 4G5SA 4LY0A 1E7QA 1Q3TA 4IG9A 4RKFA 3WTCA 2X3UA 4ARZB 4KR3A 4R8VA 1DOHA 2GLUA 3L4BC 3TZKA 2FOXA 3K0FA 2VNSA 4DIEA 4H7JA 1KZYC 1I5RA 1TADA 3UT5B 2OK7A 5CAEB 4V02A 3HA3A 2VYNA 2ZVJA 1RAEA 1U6KA 3OQIA 4MQ4A 1HE4A 1NW3A 3IP7A 4MVJH 1M1XB 2GETA 3QPWA 4L15A 2BMAA 3IDQA 4CFSA 1ZWKA 3PBKA 4JWTA 3L04A 2F3UA 1S2MA 3WGVA 5B12A 5IASA 4RL4A 3T7TA 4I9FA 1IEVA 2FWIA 3OKPA 4FYIA 4G8BA 5DCYA 3P9QA 4H1TA 3AY6A 3M0EA 3N76A 1YRBA 1PAUA 2RAVA 5SYMA 2W90A 3L05A 2XLBA 1HK7A 2ZK7A 3RPEA 2ZBDA 4E12A 1YL6A 1OZFA 3GJQA 5JASA 1Z18A 2IJGX 3DPSA 3FHTA 2VN8A 1V96A 5DM2A 1JIIA 5JTUA 1EXWA 2I4RA 1Q7RA 2JDIA 1EVIA 1SIOA 1XTVA 3K70B 5EN4A 5KU1A 1DUIA 2CLDX 1ZN9A 3JWGA 3IOBA 1SUSA 2D2VA 1VECA 1JQJC 4IR7A 2BL4A 3BE6A 4DOMA 1W44A 4MCJA 1SG6A 4OHWA 3RG8A 4GYJA 2O5RA 3EUEA 2HA7A 4ND8A 1FMTA 2C1ZA 3WNQA 4BE9A 1T4CA 2AWNA 4P38A 2W2MA 1PJAA 4PHTA 3H16A 3OSZA 1LTHR 3NV9A 4MV6A 2VYFA 1JYEA 1SK8A 2B34A 1FMCA 3QIAA 1ZO8A 5CDSA 1O6GA 3TZCA 2NXCA 2D1RA 3L8CA 3PITA 3F90A 3LZCA 4PCLA 1VTKA 3TFQA 1U5CA 1FTSA 4Q3EA 5DCLA 4G0UA 1Z2CA 2OZEA 4Z1OA 3I9NA 4W1SA 2GPJA 3DFZA 3M2PA 1A7UA 2X7JA 3IEXA 2QG4A 2QROA 2F17A 4WY2A 5BQOA 3U56A 3OU7A 4INOA 2JRCA 1SVLA 4AJLA 5J58A 3QE2A 4QSMA 5BV2P 1SURA 3QOYA 1K08A 3SLRA 3BJRA 2QRVB 2GPSA 2LCFA 3EULA 2D74A 3L7YA 3OECA 3RM3A 1NOJA 1TCUA 1Z17A 2Z56A 4LZWA 2Z8YM 3IT2A 4CM9D 1ZRSA 3JCZA 1DE0A 1JJFA 3DKRA 3SZRA 1L7QA 2B2NA 3HJAA 4U9IS 4N47A 4AJ1A 4LBZA 4R83A 4EY5A 5EJ7A 4XVHA 2C9DA 5A62A 3HL4A 2Y1XA 4JLAA 2RFLA 5EFOA 3LYHA 1H4QA 2YY7A 1UWKA 4GXNA 1PQ4A 4RWZA 4S0ZA 1HMPA 1GZ4A 5SY6A 1YS4A 3T9FA 1IZ7A 4B45A 3R5SA 1XZKA 2GVDC 4DDKA 2BHSA 2PM8A 3IQFA 1YJCA 4OFWA 4OJNA 2D8MA 4P84A 3JTMA 4C01A 4OAOA 4EW3A 3TEMA 3K70D 1Z33A 3AM5A 3DMTC 3ETDA 3CW8X 1WDMA 4OUKX 3G7NA 1KK1A 1ECBA 2QQ5A 3DGEC 1T8UA 4MVJE 1HEIA 5KYYB 3A14A 3QITA 3SC4A 3IVGA 2VDRB 1I9GA 2YXDA 1QYCA 2P6NA 1KK2A 1HTWA 4OTZA 5DM4A 2HRDA 4I1VA 4JL5A 3AT1A 3HGTA 3JQRA 3QLEA 4QE3A 4LKOA 3V1MA 4G41A 3SEQA 4DQ0A 1IJKA 4N9WA 1XRJA 4QOSA 5TMPA 1YZGA 4C2AA 3PTAA 1EE2A 3MPUA 4NH0A 2DWPA 2GN2A 1PQYA 2Y68A 3CMMA 4P3YA 2Y1WA 2YFKA 5EERA 1KDZA 2I6FA 1PSDA 1A1VA 2PGJA 2PVSA 3O2JA 5FBRB 1KAEA 3O8QA 3IL2A 3U44B 3FZEA 1P29A 2WWHA 4U7JA 4RPJA 3AUTA 2ZPUA 3ZNPA 4HKTA 2CV0A 3AM3A 3HSYA 5CFLA 1AQIA 1L1FA 1U28C 2AGVA 1P1FA 2G9RA 4NZZA 1L5ZA 1SCIA 1JDSA 2B1JA 1O87A 5E6SB 3ZBTA 2G6TA 1UJ6A 2PGAA 2PQ0A 4F2GA 4ZDKA 4NC9A 4NMHA 2LPMA 3KALA 4MAFA 4L4XA 3ZIDA 5DLPA 3CS3A 2I2BA 1GYQA 5CB4B 4QOJA 1HURA 5K6AC 2QG6A 3VJMA 2XEDA 3VPBA 2V7QD 4XIJA 621PA 4A23A 1QKIA 5JSUA 3JD0A 4D74A 4IO0A 5G4KA 4RTKA 3YASA 1BE0A 1QO9A 2DU8A 4D9MA 2G70A 1HQKA 4NPCA 3IULA 3QE3A 4RCZA 4NNOA 1AHPA 4LXXA 3RB8A 5HPYB 2OGZA 1KU6A 3FTPA 4M8IA 2A78A 1MV5A 2EAUA 3BG5A 3KBOA 1XYYA 4I5EA 2QPLA 3GVPA 4CTJA 3W8EA 4CIXA 4YQYA 4PEVA 3CUYA 1JDUA 3TAUA 1T5LA 3GLTA 3OIDA 1YWGO 3RUFA 2DWQA 1ZHOA 3Q7SA 3RHZA 3S2SA 1JFLA 2WF9A 3HNOA 4QHTA 3DZIA 4D46A 2P5YA 1B6GA 3BEOA 4JD5A 2AZMA 1ZIYA 4L4ZA 3AJEA 3I1IA 3WWOA 1FNNA 1T2CA 5FWAA 3K0KA 1E3LA 3EARA 5LMZA 2YIMA 1B6SA 1KYWA 1LW7A 2QSUA 1LI5A 2COEA 3JAKB 4GF5A 4HDNB 3T1VA