3IILA

The structure of hcinap-mgadp-pi complex at 2.0 angstroms resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
175
structure length
175
Chain Sequence
b'PEFMLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coilin-interacting nuclear ATPase protein
publication title hCINAP is an atypical mammalian nuclear adenylate kinase with an ATPase motif: Structural and functional studies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, transferase
total genus 65
structure length 175
sequence length 175
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2009-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3iilA00
1FL9A 2ZE7A 5AR1A 3TMKA 4EJSC 3AQ4A 5FUYA 4B44A 1KO1A 1Z0FA 3QSYA 1P2VA 3VX3A 4Q4AB 221PA 4E03A 4WZAE 2WTUA 1Q0UA 3IEVA 4AIIA 1E4YA 4TT3D 3WRXC 3SHFA 4YDSA 1E32A 3Q7QA 4DEXA 4Q5IA 2PT5A 5AUQA 4DXAA 5JHGB 4M1KA 1HT2E 1YE8A 2AKYA 1BMFD 2JJ1A 3VR1A 1CULC 4C0AC 4CIDA 3UATA 1TAGA 3TUIC 4CDGA 2VP5A 4JL5A 1GM5A 2ZUDA 2R8RA 3H2YA 4F4JA 4ESHA 4ZIRA 2WAYA 2J0VA 4A0FA 3CPEA 3M0EA 4KLZA 2ZRKA 1JI0A 3T1VA 2IWRA 3T35A 3BJIC 1U81A 5IDVA 3TAHA 4KSCA 2V7QA 3K9HA 5FBLB 1E2IA 2ZR7A 3W5IA 1OXXK 3FMIA 1OIWA 3CX7A 2WIBA 3DZ8A 4G01B 3ZJYA 3SQWA 1TF7A 4GBMA 4YMVA 1ZUHA 4TMZA 1U98A 4LK2A 1G291 5J4LA 4Y0AA 4BFXA 2OE2A 2JLQA 1E2MA 4JMPA 3ASZA 2KE5A 2ZRAA 3CLVA 2FMXA 3DMNA 3LVQE 3W6PA 3CPHA 2G77B 2IT1A 3EG5A 1X8LA 3THXB 1JJ7A 1E98A 2C9YA 1AQUA 2CNWD 2QAGB 4QM6A 1GP2A 4PAOA 4YQFA 1KI9A 2XOKA 4NYIQ 4JS0A 4PHGA 1YR6A 5F3WB 1W4CA 3BB4A 4JLAA 2OCAA 3HR7A 2XXAB 4HDQB 2IL1A 2K5UA 4WZ6A 3P4YA 5KDLA 4LJ7A 2ZRIA 3B60A 3TKLA 3KKQA 5FTMA 1P60A 3TVTA 2PJRA 5AJVB 3P4XA 3BB3A 1XMJA 1F2TA 2CCJA 5AUPB 4EPVA 4P4UA 1P9RA 1N5IA 2X8AA 3LD9A 1UBEA 2GJ9A 4HAYA 4ABYA 1X86B 3AF1A 4MUBA 1JPNA 1HE8B 4X8LA 2PZEA 1E79D 2P67A 2OV2A 4C0HA 2HT1A 5TVKA 4L5BA 4YC7A 3SFVA 1O3YA 3NEJA 4F91B 1EXMA 4OHYA 121PA 3V4FA 2GVDC 1D9ZA 2QAJA 1GL7A 1ZU4A 2V1XA 1MR3F 3AP1A 3MRSA 3MWJA 2BM1A 1YVDA 4HYYA 2RMKA 3AVQA 5AJXA 1KAGA 5KTYA 3MWYW 5TY0A 1N0UA 4MRVA 4LBZA 3U3OA 1JAIA 4G3XA 1KMQA 1OE0A 2FWRA 3DDCA 4OK3A 1AZTA 2FJUA 2ANCA 2QM8A 1DO0A 1ZM2A 3CNLA 4OQFA 3ZS9A 4HUQA 2XNSA 5B57C 2FG5A 3QE0A 4Q1BA 1NY6A 5L3VA 1CLUA 2WJIA 3IDQA 4DLSA 1LB1B 4M1OA 3A1TA 2QSZA 1Z6GA 5HPYB 1RYFA 3Q9LA 1XDBA 3NBFA 4LBYA 1F2UA 4XTCS 4EIWA 4EJSB 1NSTA 5FI1B 2FPMA 3B7GA 3C14C 4DLUA 5IK2D 4TL7A 2P6RA 1NVWQ 2O8DA 5EP3A 3C8UA 3L8YA 1BKDR 4E5UA 2R6DA 3R7WA 3CO5A 4BZPA 2QPTA 1E9AA 4HZUB 1QDEA 2JIZD 4Q4HA 5FI0B 4ZDKA 4RZUA 1W0JD 3GLFA 2IF2A 3VR5A 1NJGA 4C0SA 2AFIE 1GKUB 3OAAD 2OZEA 3C5HA 4MKHA 2QBYB 4UNNA 4A6PA 5AJWA 2VLIA 3AVOA 3SYLA 3TR5A 1UKYA 3WYAA 1PUJA 3FVQA 1NNEA 2QT1A 4DUGA 2GK6A 2YC4C 4IRUB 4V0LA 2CK3D 3PITA 5AJZA 1E2KA 2GCOA 4CVNA 4DDTA 2OCPA 1AJEA 1VTKA 3FFBA 4RFSA 2XB2A 2V9PA 4AYWA 2BBOA 3WBKA 3HPRA 4IEEA 1UBGA 4DDVA 1Y3AA 4ACAA 2P5SA 2ZRMA 3A8TA 1CR0A 2IW3A 3CZPA 4RD2A 3VR6A 2WMOB 4Z54A 2ZE6A 1DE0A 1ZD8A 3L8ZA 4MKGA 5JMTA 3HWSA 1XPUA 4DRZA 2WJJA 2CLCX 3IHLA 4A36A 4RD6A 1XWIA 2C77A 3FOZA 4JZKA 2J7KA 2YOHA 2CEAA 2GBLA 5EXPA 1BYIA 3QKSA 2ZYWX 2OFXA 3T1OA 4DLZA 5BN3A 1E94E 2XEXA 2ZRFA 3QPWA 3G0HA 3AVPA 3JVVA 2C78A 2MSDB 4JLPA 4ZI2A 2OEPA 1S1CA 4KYIB 3T61A 1KAOA 2G0TA 2QTVB 2HT6A 4HLUA 1J8MF 3WXMA 4V0ME 4FMBB 3WMGA 1S8FA 4OHVA 2GXSA 2QG6A 5KOYA 5EP2A 2Q9BA 1RC8A 4P32A 2ZROA 3MAAC 5KO2A 3AV0B 3PUXA 4IOKA 5L3QB 2V6JA 5EXTA 1XXHB 5HE8A 1ZBDA 3OE7D 5HR5A 2ZSBA 2VBCA 3OFND 3SYKA 1X3SA 2WICA 3D7MA 3KL4A 3QOFA 3X1YA 2WM9B 4AC9A 1CJVC 4D2IA 3R9WA 4UJ3A 5KYKA 4TSFD 1CJUC 1ETUA 4LHXA 4URZR 1W4BA 5CJPA 3TJZA 1ZC3A 1N0WA 2F1RA 1A82A 3AVYA 3LA6A 2EFHB 1K6MA 1AM4D 2J9RA 2J0UB 2P65A 4OYHA 2ZXUA 1NG1A 1XXHE 3PV0A 5J4HA 2NMVA 3LQRA 5EXXA 2G0NA 2VIIA 1KK1A 2F1HA 4DLYA 2MSCB 1N6HA 2Q6TA 4HLCA 1NN5A 1DVRA 1W4AA 4C4PA 2H5EA 4TLDA 4AKIA 4MH0R 3IQXA 2N42A 5FTNA 3SE0A 1DBSA 1X1SA 1KHTA 2I3BA 2Z0MA 2FSIA 1OFUX 2ZU0C 2QZ4A 4M9ZA 3RABA 2I1QA 5TMPA 1QG4A 2WKRA 3CF6R 5FH9A 4AG5A 1L7VC 1ZM4A 1KI4A 2B8TA 1DAIA 2RGNA 4YXWD 3TUJC 5P21A 3A4LA 2IYVA 3FMPB 3KQNA 2PLRA 4DSUA 1DAMA 4W5WA 2TMKA 5BN5A 1G3QA 2W6JD 2WWFA 2A5YB 1N3BA 3CF0A 3DVLA 3EA0A 4NHOA 4O2LA 3RSLA 2JLVA 3CPJB 4YLGA 2ZUCA 3MJHA 3SC3A 1XX6A 4ZV4A 4KXFB 1ZAKA 4LYAA 4PQRA 1Z22A 2HXSA 4QHSA 4U7DA 4CEIA 2QP9X 4HB0A 2PJZA 2R6AA 4OBEA 4OI4A 3OHMA 2IWHA 2ZJZA 4ILEA 3B9QA 3MGCA 1EFHA 4Q4AA 4X8MA 3RC8A 4MYHA 3O8DA 5AJYA 3OEHA 3U7FB 4NYMQ 3QXCA 4EPRA 3DKPA 3I73A 1U0HC 1TEVA 2WKPA 2G9NA 2JJ1D 4LBVA 2PH1A 1Z63A 1XEWY 4U02A 3MWLA 1T9HA 3CNOA 1ZJ6A 4A0HA 1S9HA 4BASA 4NE2A 3S1AB 3W3ZB 1W49A 4IW3B 1NMYA 1IONA 1XF9A 4PPFA 4HB4A 3SDZA 2WWGA 1T6NA 1LF0A 2ZQ5A 4OQNA 3KQUA 4J0QA 4B3GA 5JS8A 2V7QD 2F1IA 1Q57A 2IUSA 4TQ9A 3MLEA 4IKEA 1U8ZA 3R8CA 4B32A 2OBLA 1FQJA 4OI0A 2BIFA 1WA5A 2NQ2C 3IKJA 4MITA 3B5JA 1HV8A 4NCHA 2IYZA 3EX7C 5FBQB 1DAHA 2YHSA 3RS7A 3NIBA 2XOKD 3THXA 2I4IA 4FMCB 1GIAA 2ZYVX 1G8PA 4AK9A 1EWQA 1SQ5A 1SVOA 1XJ0A 4HLDA 4URVR 2F9LA 4NL4H 2ASEA 2YJTD 4KCGA 2XXAA 1A4RA 1OJLA 3KJEA 5K8TA 1ZM7A 1SKYB 3SJBA 4ZDJA 5K8LA 2KB0A 4V02A 2G6BA 2OCBA 1M7HA 2CHGA 2NO0A 1TX4B 3X1DA 3UWKA 4B6EA 5C46F 2VL7A 3K0CA 4OJKA 2QN6A 4OHZA 2ATVA 2IS4A 1OLOA 1OXTA 2ORIA 4OK6A 3ZQ6A 2QY9A 3DEFA 5FR2A 4D6PA 1XEFA 2A5GA 1L4YA 1N5KA 3EW9A 3I32A 2A9KA 4LHYA 3FMOB 3NTUA 4JYBA 1GITA 4PC1A 1S3SA 1YZNA 1SVKA 4Q21A 4Q7KA 1OIVA 5C2JB 3A4MA 4FWTA 1S4QA 2CXXA 3ZVNA 4UKDA 1GSIA 3HU2A 3KFXA 1KNXA 4PC2A 4ZKDA 1SHZA 4B47A 2C5LA 2X19A 2C9OA 3CBQA 3B78A 3B1WA 2CHVA 2V4ZA 1KO8A 2WMNB 3FHTA 1KY3A 3WYFA 5HZHA 2ZS7A 3IBYA 1KTVA 1F48A 2GBLC 3ZYCA 1Y63A 1W46A 1XTIA 2C9CA 1J70A 2ODBA 4CF7A 2WZQA 4IDOA 5B58C 2DBYA 3A1WA 3Q3JB 1ZCBA 1G17A 2Q3FA 2ZRJA 4U5XA 4GT1A 2WJGA 4EJSA 1G8YA 3HJNA 1UKEA 1WRBA 3PXGA 4KFTA 2O52A 1Z0JA 4M1YA 3AKDA 721PA 4V0KA 2IYQA 4Q00A 4GL2A 2ZTSA 4F92B 1ZNWA 4PAQA 3B1VA 4HZUA 4TWZA 1UM8A 2IX3A 3EC1A 3FHCB 2MSEB 2CMKA 2FU5C 3PENA 2IYUA 4BLRA 4R2HA 5CM8B 1FPMA 2W0SA 1AIPA 4M4SA 1HTWA 1LFDB 1CKEA 1T5IA 4BGDA 1P9NA 2QBYA 2ECKA 1LVGA 4POAA 1F60A 4XVQA 2VPPA 4B3DA 4BLPA 4DUGD 2YVUA 4DB2A 3A37A 4XVRA 4CT4B 1CXZA 4DSOA 1E4VA 1XRJA 2Q21A 3C5CA 4PO8A 3LX5A 4B2LA 1X6VA 2NIPA 4C3ZA 1N5LA 4UXHA 1Q3TA 2QGNA 3KKNA 5CLLA 5SZJA 3RS4A 3T15A 3V4RA 2GJKA 3WY9A 2IYYA 1DS6A 1E2JA 1S9DA 3GJ7A 3MD0A 4RJLA 1FNMA 3BH0A 1J8YF 2YZ2A 2ZAOA 4PSAA 1KO4A 3T1TA 1F5NA 3IQWA 3RS0A 4P31A 2VP6A 1E2NA 2RGNC 4JT2A 1J99A 3L82B 3VTKA 3RS3A 3BWDD 4DCTA 1WBDA 4D82A 4D4KA 4D4LA 4F4CA 4IEIA 1IQPA 3TQCA 2XJ9A 2G1KA 3BE4A 4H1UA 1EFUA 2ZRLA 4PANA 1NVXQ 5E95A 3AM1A 4FWIB 1UKVY 2C03A 1IJFA 2H8KA 1S96A 3FKSA 1Z0DA 1FP6A 1G9XA 1A7JA 3LQQA 1R4AA 4L4UA 3EPHA 1XTRA 3VU9B 3KJHA 2ZYUX 3B1ZA 4AKGA 4U00A 5KPJA 5E3HA 2D62A 4US1R 5L3QA 4LC0A 1XXHA 1VDZA 3EC2A 4JVNA 1NL3A 3AVWA 4Q7MB 4HAXA 4OQMA 1G6OA 3ZVRA 4C7OB 1XJQA 1OPXA 5EP4A 1Z08A 4B74A 2WJHA 2GXUA 1AN0A 1I4TD 5BYKA 1OW3B 2CL7X 3LDAA 4YDHB 2PBRA 1SVWA 2XTZA 1E9CA 2N46A 1YU9A 4IVQA 5DE3A 2HYDA 2J0UA 1OXSC 1IJEA 1AS0A 2NO1A 1J7KA 2XB4A 2ZRPA 3NBZC 3BB1A 4S2EA 1NF3A 5BW8A 4IJMA 4RD1A 4DC9A 4MGZR 2BEJA 1G7RA 2QL6A 4Q19A 2ODNA 4M22A 3PEVA 4PO9A 4QOSA 2YWFA 4LHVA 5FUXA 1IY1A 1COWA 2MMGA 4F38A 4OQLA 4TL8A 2FH5B 3GFPA 2WVJA 2ZJ2A 1CTQA 3U3RA 4LYJA 4PZLA 3VFDA 3SN6A 1OSNA 3N2EA 4URXR 2EU8A 1H65A 2B7CA 1Q20A 4BUJA 1DELA 3B13B 1XTKA 4LJ9A 1MRNA 5FOUA 3GMTA 1ZM3A 3CR8A 4JSYA 2QAGC 2ZIAA 5BYJA 3TH5A 1OKKA 4NP6A 3C41J 2OBNA 2B92A 3PVSA 2XITA 1SULA 3NEYA 4IFBA 4QFMA 4XIGS 2WWXA 5TB5A 5HKKA 2ZS9A 1JR3A 4LUCA 5KDOA 2J45A 2Z4RA 1RE0A 1OFIA 2EFEB 4LPSA 2AFHE 2FN4A 3IO3A 2Q9AA 4PC3A 3OEHD 3WHLA 1JQJC 1U2RA 1KGDA 3BH6A 2ZS8A 3BS4A 1IN7A 1U8AA 1YRAA 5KNDA 5JLJA 1G3UA 1M8PA 3PJRA 3K9LA 3PCRB 1P4SA 3QJYA 3THWB 4MDEA 1GTVA 5JWHA 4HZIA 1E6CA 3GD7A 1HQCA 2ZSDA 3I61A 1EFTA 2GCNA 4KHZA 2JLUA 4PZZA 3ZZTA 1Z0AA 2ZEJA 3GLGE 2C98A 2F43B 4IDQA 3SI7A 3S1AA 2QTFA 4L9SA 1VCMA 4B3FX 1CJKC 1CBUA 2D7DA 2ZREA 3LW7A 5JJLA 3U60B 4UNQA 1GDDA 1UEJA 1E96A 4M9QA 2YYZA 3ZS8A 4FXPA 3K0FB 4W5HA 3KKOA 2IXGA 3LBHA 4JL8A 2D2EA 4AD8A 1HY3A 3VKGA 1FW6A 2ZI4A 3CRRA 4L9WA 4YMUA 4FMCF 1IXZA 1II8B 3L0PA 4D0LB 4I1SA 5IT5A 3RRZA 3QPVA 3W8NA 3UG6A 1R8QA 4KLNA 5E7MA 2VQSA 1CP2A 2F1JA 3LWNA 4IOMA 2CHQA 3PEUA 4QC2A 2VP0A 3EZFA 1VYTA 3LVRE 5GVRA 2Z4SA 2IXEA 1LF5A 4IDNA 1DTSA 4NCNA 5JZVA 4Q4JB 1ZCAA 2OILA 3EWSA 1KI8A 3X1XA 1GVNB 3TQFA 5EQTA 2YC2C 2IYTA 4QHTA 3PEYA 4QJ3A 5JEDA 2W00A 3PQCA 3TUZC 2H17A 2CVHA 1E1RA 3B9PA 3PUYA 4FCTA 2WOOA 5FPHA 4B34A 3R8FA 1MOZA 1N6KA 4X8HA 5HCNA 1A2KC 2J3EA 5TV2A 3CH4B 3Q85A 2W2VA 2YOFA 2ZJAA 1ZW6A 4FCWA 4E22A 3GJ4A 3FFAA 4MKIA 1RFLA 4MRNA 4AURA 5JSZB 1UAAA 5GJBA 5GJVC 2IUTA 3NWJA 4JBWA 2RKOA 4KFUA 4GMXA 5SZHB 2J87A 3QBVA 1G18A 1N6PA 1E1QA 1ZC4A 2ZR0A 5BQ5A 1J90A 5CLQA 1ZM9A 2NG1A 4WXRA 1RPZA 2IUUA 1W1WA 2FNAA 2GXQA 4URYR 3LXXA 1AQYA 3ZDQA 1TMKA 2RGDA 1MH1A 2ZJBA 1G5RA 1UADA 3O8RA 3AF3A 2QM7A 3RANA 3AUYA 3W90A 5JRJA 2JLYA 2QROA 1GFIA 2E9SA 3CX6A 3F5FA 5AWFC 2PCJA 3FHOA 2IA5A 4QJ5A 3VR3A 4B33A 1KI2A 4FW9A 1E0AA 1DAFA 2WKQA 2HV8A 1XEWX 4NCIA 3WP0A 5DGXA 2O5VA 3UXMA 1P7CA 4LY6A 2NOAA 5EE0A 1NMZA 3B1XA 4NBSA 4AKHA 3RWMB 1M7BA 1E3MA 4LV5B 2FOLA 5ELXA 2AL7A 3TBKA 1GUAA 3EPLA 1I2MA 4PPGA 1KO7A 4GOJA 2H7VA 1VIYA 2ZJ5A 3PUVA 4TYNA 1W44A 1G3RA 1QHSA 1SXJB 3B82A 2GAAA 1GILA 3IIMA 4NPHA 2FE4A 1ZU5A 4QGAA 2GWHA 1EWRA 4UXIA 3QI2A 1BIFA 2EYQA 3NBXX 2W6IA 4DSNA 4H9GA 3V00A 1NVUQ 2VHJA 1WQ1R 1MKYA 3OZXA 4I1UA 3REFA 4GZLA 1E99A 1HEIA 2A2ZA 3KFVA 3R9XA 5F9FA 3LXRA 4BFYA 4R71A 1T3LA 3SEAA 4C2TA 2ORWA 4BLTA 1N6LA 1NBMA 4WIAA 1FX0B 1QZXA 2RHDA 5FOVA 4Q7JB 3GJ6A 2DY1A 3SYNA 5A5GA 1ODFA 2DHRA 4GMDA 4JLVA 1RIFA 4DCUA 3X1WA 4NYJQ 4O25A 3PUWA 1GG2A 1Z29A 4IVRA 3UG7A 4DVGA 1XMIA 3A1UA 4TQAA 3CRVA 1T0JB 3NDBB 2DWOA 3M1IA 1JBKA 4WOPA 1GKYA 3EPJA 3THYB 1KYIA 1WXQA 2GHIA 4QRHA 1H8EA 2ONKA 3I1FA 2A5JA 2PL3A 2P3SA 2OT3B 4K46A 1IY2A 3N2IA 2G83A 5J40A 1Z2AA 4Q01A 3K9GA 4URUR 1MO5A 1YHNA 2BMEA 2GESA 3TVDA 5AUOB 3LH5A 3EZ7A 2FF7A 3FKSD 4B2PA 1AS2A 3X2SA 4JJKA 1N6RA 3QKUA 3WNDA 3UPUA 5J5CA 5JI2E 2PCLA 4CYMA 1JEEA 1CR4A 3H86A 4B35A 3W6OA 1FFHA 1G3MA 4F4IA 1R5OA 1ZIOA 1N6IA 4OHXA 1F3OA 3VU9A 1GZSA 3QG1A 1PJRA 3UK6A 1W48A 1CR1A 2NO6A 4KV9A 4F93B 4XTRA 3IBGA 2F7SA 1AZSC 1T4GA 1IN5A 4EFMA 1MT0A 4B48A 2FSGA 3E1SA 2BMJA 4C7OA 1PLJA 3ZD6A 3EZ9A 3B2EA 3OIWA 5JCZA 1KJYA 2LCFA 2GCPA 2B6HA 1QG2A 2H57A 2BOVA 1GRQA 2QNRA 4LBWA 3C7KA 1XFAA 4ZCLA 4R98A 1PLLA 4WA7A 4Q4LA 1V5WA 4RD3A 4W5JA 3RC3A 1E2GA 4HAZA 3ZVLA 3A1VA 3GJXC 1KZGB 3NG1A 5LPNA 1M1YE 4UNPA 1COWD 1VG9B 4V0OA 2D3WA 1EFCA 3FWYA 4PO1A 1NKSA 3JVUA 3HYTA 5CK5A 2ORVA 3QENA 2HDNB 2ZRDA 2ZETA 4CT5A 2GF0A 1M74A 2QMHA 1MO3A 3I62A 4KFSA 1PVOA 5FTKA 4LPKA 4Y0VA 4PXAA 2PLFA 1PV4A 1G7CA 2GILA 4HI0E 4KBFA 4V0NA 3EZ2A 4TLCA 2JA1A 4M2LA 2VYFA 3GPLA 1OKKD 2OO7A 3AGPA 1Z06A 3AKCA 1EG7A 2D06A 2OLJA 5HE9A 3UIEA 5HKKD 3VNVA 1U9IA 1CJMA 2JLWA 1EX7A 2WPDA 2FPLA 1JR3D 1RRPA 4PR0A 5SZKB 4OJQA 1Z6YA 4TMTA 1EGAA 1IN8A 1IOZA 1KI6A 1EFRA 3U44B 2UZIR 3OESA 2NPFA 4DSTA 5KSOA 2VSXA 2XZPA 2XSZA 3RRMA 3TE6A 2HF8A 1NI3A 4TMVA 5KSPA 1NIJA 2P6UA 2QSYA 3GLGA 5FTJA 2V55B 1HURA 4KU4A 3DOFA 1NVVQ 1K5GA 1ZUNB 1MABB 3IHWA 4M1WA 1XZPA 4Q66C 4M21A 1DAEA 3N5CA 4Q1FA 4MUAA 1AGRA 3THWA 2WBLC 4OHWA 4A8JB 1NN3A 3UANA 5AUNB 3J81k 4A1FA 5JECA 3KKPA 4MRRA 1E9BA 4B75A 4UQOA 4EQ6B 1W5TA 2VTKA 4II7A 4BE7B 5JS7A 2J7PA 4HUTA 3H1TA 2F43A 1T5LA 5F2EA 3UMSA 3BRWD 1VYVA 5FOXA 1CS4C 4URWR 3LLMA 1C4OA 2ZVPX 1Q1EA 3W9YA 2ZJ8A 1FTNA 1XMVA 5JJIA 3SBDA 2WOJA 4JJZA 4P4SB 4Q9IA 4HSEA 1E0SA 1VCOA 1P73A 5TDHA 2QI9C 3MMPA 2C2HA 2ZI9A 1VG8A 3BK7A 3K0FA 3ZIAA 2EWVA 3KUCA 1R6BX 3QXXA 1YKSA 4QXAA 1VCNA 4BFSA 3QG5A 2PZGA 4EKDA 4G1UC 2O8CB 1II8A 4ASUA 1E2HA 2CLSA 3U3MA 2QE7A 5A0FA 2J46A 4TN1A 4JLDA 3NXSA 1WB9A 1W2GA 4N3NA 3RVBA 2ZAMA 3RYTC 4QBGB 4KJZA 1UBCA 1NSFA 3OF5A 4Q4JA 1JR3E 2P0EA 2CDNA 4YMWA 3Q72A 1E1RD 1PUIA 5UKDA 2X2FA 2KJQA 8OHMA 4L8GA 1UF9A 1N0VC 2DFKB 3QKRB 4DIEA 6Q21A 2GZHA 4A2PA 4B71A 4LGMA 3U3KA 3VAAA 2OCYC 1NLYA 2GZDA 3K0EA 2OLKA 1W36C 4IOLA 3NH9A 3BFXA 1XD8A 4MGYR 1W2HA 2ZE8A 5JSZA 5KU1A 1E1QD 1OFHA 1OXVA 2Q9CA 4EDHA 2AD1A 1M2OB 1II9A 4E07A 4BRUA 4LHWA 1LW7A 5JWOA 2OM2A 1ONBA 1UBFA 3ZQJA 2VO1A 3TLXA 1DADA 3KQLA 2PMDA 2SHKA 3AUXA 5DO9A 3QXSA 4NDZA 2VF8A 4KI0A 5KSYA 3FKQA 4AYTA 2XZOA 1XTSA 3RHFA 2F3RA 2BCJQ 3BORA 4MYUA 4PSKA 4BFWA 4BLQA 5DSZA 3QPUA 2ZRBA 1KY2A 3AKEA 2AKAB 1JALA 2QAGA 3F8TA 4M9XA 1KJZA 4QBIA 4ZO4A 5CIQA 4DCNA 4AWXA 4CRWB 3AVUA 1Z2CA 2W0MA 1KI3A 4ITRC 2EVWX 5JJKA 4WXPA 3ICQB 5L3SB 4RKFA 3G82C 3B1YA 3KKMA 1YZLA 1Q1ZA 3W34A 5HTKA 5TARA 3VQTA 1G5TA 2IC5A 1E2FA 2JLSA 4DB4A 1OB5A 1QVRA 1SXJA 4ZI3A 821PA 2HUPA 3DOEA 1AK2A 5EZ5A 3EAQA 2DFLA 2JJ8A 3TSWA 2W6ID 1KI1A 3RSOA 1SKYE 3UMRA 4Q1EA 1SVLA 3GJ3A 1QHIA 4LC1A 2YWGA 2QMOA 1AS3A 4PHHA 1DPFA 4C2UA 1L4UA 1NBMD 4X8OA 1KDRA 1TF5A 1KNQA 2X2EA 3QEJA 2GNOA 5H70A 4BLSA 3RNLA 4FINA 3BFVA 4XWAA 1DG3A 1FX0A 1Z6TA 4AYXA 2FFAA 1VYUA 1P9WA 2PEZA 1XD2B 3KJGA 1OFTA 2ZJYA 4LHZA 3CWZA 1OH5A 5CDFE 1NIPA 5BWMA 3CNNA 3PR1A 1TADA 3GEHA 4HAVA 3H0KA 3MFYA 1H8ED 5LDDC 1A2BA 1U0LA 3L2OB 2BC9A 2JJ2A 3E2IA 3THYA 2H16A 2BBTA 1XTJA 3QUSA 1P2TA 1U9IC 4Q1AA 2RAPA 4ZDWA 2QT0A 2GEVA 1JNYA 2ZI5A 3T1QA 5E4FA 2X1VA 621PA 4ZCIA 3WNBA 2HJGA 1Q44A 4DLTA 3AEZA 3U2QA 3IUYA 3K0AB 2WIAA 3IO5A 1HYQA 4JVLA 4QKQA 2RGGA 5KHOC 4NYIR 2P6NA 3EIEA 3IEUA 4A0GA 4EPXA 1W36B 2IS1A 4JIMA 1YJ5A 4LJ5A 1LS6A 3TW4A 4JBYA 2ZRCA 5LB4A 2FV8A 5EJEA 2BVNA 2R44A 2IEYA 4QJ4A 2GZAA 4BWYA 5M04A 2O8EB 1XPRA 2R65A 4MRPA 3B8HA 4JVSB 1SVSA 3HDTA 1NY5A 1NBME 4DCSA 3FPAA 5FPYA 2OHFA 4HLQB 4IVPA 5AK0A 3K1JA 2DCUA 5CB8A 1AA9A 2PZFA 2VHCA 5KNBA 2IF0A 3OIVA 3ASYA 3HU1A 4NCKA 4G5SA 4NH0A 4RY2A 2GA8A 5EXSA 2XTMA 4A9AA 1LY1A 3EARA 2BHRA 5FPKA 4TMXA 3ADBA 3SJAA 4XWOA 1R2QA 1XU4A 5FOSA 1ZRHA 3BC1A 3W5JA 1A5TA 1RYHA 4QNRA 4E09A 1XMSA 1O87A 1GNQA 1NG9A 4PQYA 3FTQA 4DT1B 1D2MA 4Q1CA 1QBKC 2ZI3A 3IIKA 3ADKA 1W0KA 2JLXA 4C0BA 3NDPA 1OIXA 2WPDD 2WWYA 4TYWA 1R5NA 1T3SA 1V43A 2HEIA 3RS2A 2J0QA 1EFRD 5DI3B 2ZITA 2XSZD 1RRGA 5DN6A 3BXZA 1JJVA 3GLHB 3LO5A 1KSGA 3K0SA 3U44A 1QHXA 1G5PA 2ODWA 2YINC 3TAUA 2Z83A 3E5HA 2QRNA 2P2LA 3BBPA 1P75A 2IYLD 2NO9A 3PG5A 3IPYA 2QGZA 3BD9A 3TRFA 1DAKA 1DEKA 3TW8B 3ZZUA 2FDCA 1U0JA 2IYXA 4EFNA 1MABA 1RW4A 2F3TA 4I99A 2AD5A 5G3ZA 1X1RA 3IILA 4GRAA 3ZD7A 1CF4A 2JCSA 2QMEA 4S35A 5DLQC 4ZCMA 2Q0HA 3GEEA 2J7PD 4A8JA 1UDXA 1GRRA 1QHHB 1TU3A 5B30A 2OSBA 2E87A 1DOAA 4JKIA 4Q7LA 3SJCA 3U61B 4EQ6A 4G5RA 4Z8YA 1JR6A 3SQXA 1UDWA 2OBMA 3VX4A 5FUVA 2D4HA 1E9SA 4GZMA 1UPTA 5J4VA 3W3AA 3KJIA 2GK7A 3DM5A 4KITB 5J4YA 1GL6A 2ATXA 4P4SA 3TK1A 3ADCA 1KK0A 1R0ZA 4FIDA 3T12A 3CKLA 3ZIAD 1TL7C 5KNCA 4QBHA 2AXPA 3I8XA 2VSOA 1D5CA 4JLNA 5EUMA 1MO6A 1XCGB 2BWJA 3Q5DA 5DIFA 5FBRB 4ASUD 5GJWC 2QE7D 2XX3A 2WWWA 3K70B 3FYHA 3HPQA 2O8CA 1JB1A 1YZKA 1TTTA 4FMDF 2ZU6A 1G1MA 1XBTA 4DDUA 1FUKA 1XJCA 5DYIA 2DB3A 3KTAB 3FDIA 4HDOB 4ERNA 4LCBA 1SXJC 2FSFA 1LS1A 1G64A 2PX3A 3QF4B 2ERXA 3GQBA 3KUDA 3QF7A 2HCBA 2WJVA 4I81A 4LJ8A 4GDFA 1DARA 1US8B 4US2R 1QHGA 1Z8FA 4C9BA 3A36A 3QKRA 4PSVA 3I5XA 1G21E 5J4KA 3ZZ0A 1C1YA 3QNUA 2Q3MA 2VEDA 1TQDA 2EYUA 3QXJA 1S0UA 3VHXA 3CH5A 4Q18A 4C30A 2PT7A 4G5GA 2EFDB 2IEZA 4Q9JA 1RZ3A 1R7RA 3QIAA 3L43A 2WJYA 1TQ6A 4DHEA 1L2TA 1U90A 5KPDA 4HAWA 1IM2A 2O0JA 4MYTA 2BEKA 3OEEA 2GRJA 2A30A 2AK3A 2WSSA 3LW8A 4JLJA 5G41A 4C0KA 4CEHB 1OF1A 3VKHA 2QP4A 4UJ5A 3Q7PA 3KQKA 1ZD1A 4DKXA 4LI0A 4PQFA 4HB3A 3SS8A 2KI5A 2LKDA 2WAXA 3U7EB 4IHQA 1FUUA 4NTZA 5IHPA 1Z28A 4KO8A 1JXMA 1KKMA 1OYWA 2JAQA 1HQYE 4A15A 1NJFA 1U99A 2QPOA 4I4LA 5DISB 5EE5B 4Z1MA 4B73A 4DIDA 5L3SA 4AY2A 4TTRA 2AN9A 1Z5ZA 1WE2A 1TNDA 1SXJD 1ZNXA 1G8FA 1I2DA 1E9DA 3K9NA 2GF9A 3M4YA 4TL6A 4EPWA 4OQXA 1S2MA 2JDIA 4W7SA 2NO7A 4XSHA 3DM9B 1SVMA 2G88A 2AR7A 3A4NA 3AF0A 5DYGA 3QEOA 1BH2A 1XNJA 1HUQA 5G53C 1QRAA 3QKTA 4KODA 1Z6XA 1XZQA 2V8OA 1XEXB 2W2XA 4Q1DA 4QL3A 4TLAA 5G40A 5CDFA 1ZNYA 1CR2A 1ZVQA 2IS2A 3U6BA 4BEBA 4JLKA 4B2IA 4GOKA 4NYMR 5D3QA 1GKIA 4MYCA 1SVIA 3RS5A 4M9SA 1IAQA 2QMUA 3IGFA 5EE9A 2PX0A 2NGRA 1ESMA 4HEJA 5IRCD 2ZE5A 3SHWA 2EFCB 2X77A 4IOJA 1VG0B 1XD2A 1XB2A 1YR9A 2ZSFA 1FMLA 4O0MA 4BRWA 1SKQA 4HATA 2G1JA 3EIQA 2LWIA 4OK5A 4MGIR 2CE2X 2UKDA 3E70C 2VHTA 1W5SA 4RKEA 1N6NA 1UEIA 1TQ4A 4H1VA 3SNHA 1T8UA 3B6EA 2JJ2D 4TZ0A 2HLDA 1W4RA 3K53A 4PHTA 2GJSA 5FR1A 2DFNA 3F3YA 5BN4A 1G20E 4JLBA 2CVFA 4PFSA 3NKVA 3THOA 2AWNA 2VRWA 4ZDIA 1HH4A 2L0XA 2A5FA 3BERA 4NONA 2O0HA 4Z51A 1G4AE 2V54A 3OIUA 2CL6X 3U6KA 2W58A 4V03A 5LD2C 4MA4A 5KSZA 1MRSA 3W8RA 3K0AA 1UKZA 4JLMA 3ZH9B 4Q9HA 3GJ0A 1VHLA 1FMJA 4PC6A 2F9MA 3SOPA 2UVQA 4M1MA 4B76A 3BFKA 5GADl 1SXJE 4Q48A 1G41A 2OFOA 3HP1A 4KVAA 4PAMA 5C18A 1M6NA 3LV8A 1XD9A 2DPXA 3QQ5A 4IFEA 4R9UC 4RFVA 5FPTA 3DKVA 2WWHA 3KXIA 3IIJA 3LX8A 1FNNA 4WW0A 4EPTA 4MDFA 3RRNA 3WP1B 3CW2A 4A8JC 4EFLA 4C0QC 2O8EA 2D7CA 4HB2A 4D25A 2VF7A 4OL0A 1CJTC 2GJ8A 2XAUA 1NN1A 1T8TA 2VA8A 2KBEA 4MKFA 2ZI7A 1RJ9B 4B6FA 4DLRA 5BXQC 2DYKA 3RRYA 3KB1A 2CLDX 3QY0A 2OUKA 2XGJA 1VMAA 1HE1C 2ZJOA 4BZQA 2RGAA 2FEMA 1IXSB 1FZQA 3G5UA 1ELOA 1GRNA 3ONWA 2OFWA 1ZINA 1YZGA 3BAFA 5JBQA 5CM9C 1G8HA 3PEWA 4PC7A 2IBMA 2QTHA 2RGCA 1W0KD 4DEYA 2CE7A 1P2SA 4JT4A 4DT1A 2BMDA 1UFQA 3LNCA 3KXKA 1E2DA 4BFUA 1E0JA 1AKEA 3VKWA 1P62B 1NRJB 3DL0A 1OH6A 1RRCA 1BS1A 2GTPA 1P3JA 4B3BA 4BFVA 5A4JA 4R2IA 2O8FB 3RDPA 4JL6A 2IYWA 1H8HA 5DN6D 4JYCA 5DI3A 1TEXA 1Q21A 3EXAA 5EE1A 4GP6A 3DO6A 4NKRA 1ZIPA 3GLHA 3OIYA 1ZMXA 1CRPA 2AX4A 4KYUA 2B21A 3A58B 4M0LA 4QGGA 4P4TA 1NP6A 4Q02A 1C9KA 2FZLA 3A1SA 5ANRB 3I5YA 4A4DA 1XP8A 4W9MC 1WF3A 2OAQ1 521PA 2E1RA 4CGZA 3LBNA 5DNYB 4D4MA 2Y8EA 5H8WA 3SZRA 3REGA 4K81B 4TMKA 2WSMA 4GNKA 1R5BA 2J5XA 1CEEA 2AWOA 3O8CA 5D3MB 3GP8A 1QHHA 2W83A 1S1MA 4RSGA 3CB4A 4ARZB 4RZ3A 4M1TA 3ETLA 3PIRA 4PX9A 1T3HA 5GVSA 3O47A 3KXLA 1HA3A 2PEYA 5L3RA 1NLFA 1KDOA 3D31A 3UKDA 2YNMA 1GWNA 4GFDA 4NZYA 3K09C 1KMHB 2XZLA 5E7JA 2BKEA 2NTYC 4RD0A 1K5DA 1X8JA 2BV3A 3BGWA 2ZRGA 1VCIA 4CEJB 3CRMA 1E2LA 3KDSE 5KDDA 2V1UA 3H84A 5FL3A 1YZQA 3B85A 3LFUA 4KAXA 4XWKA 2HXYA 2ONJA 4CEIB 4DJTA 1JEDA 4PTLA 5LD2B 3CR7A 1WDTA 4M8NE 2CCKA 3I4LA 1WBBA 3T5DA 1N6OA 1ZP6A 4XH9B 1DG1G 1YRBA 3Q8XB 3ECCA 3FMFA 5FOTA 1KOFA 4C0JA 2VP2A 1YZTA 3KTAA 3ND8A 5SZIA 4A6XA 2ZM5A 4DLVA 1KDTA 2EQBA 1F6BA 4ACBA 3QF4A 4GSYA 4B3XA 3BIFA 1VHTA 5JHHB 3EA5A 2BM0A 3C15C 2Q3HA 2C96A 2QPAA 1US8A 3ICEA 2AK2A 3P26A 3W6NA 2YWEA 4D0GA 4B3CA 1VIAA 1XPOA 4PZYA 4QNMA 4UNRA 1KZ7B 2JEOA 1T0HB 4BFTA 4RVCA 1P6XA 3TNFA 1D2EA 5DI9A 5E7IA 3SBEA 3D6TB 2YWHA 4BZXA 1DAGA 2Z6VA 3U4QB 5CYOA 2GAOA 1AKYA 1E9EA 1TQ2A 4BQSA 4DWJA 4BLOA 3AP3A 3BOSA 3LBIA 2ZRHA 1IN4A 4D81A 1IY0A 3D8BA 2I1VB 3OEED 4RCZA 2AHOA 1G8GA 1KJWA 2WSSD 2H18A 4KSBA 5JFGA 1W7AA 1N25A 2QORA 2DWPA 2ERYA 2ZI6A 1OV4A 4PPQA 3MSXA 3GLIB 3NC0C 4DDWA 2R6CA 2BMFA 4L16A 4CEHA 2GEDA 5F9HA 2CJWB 3U7HB 3VR4A 2QUZA 3I92A 4XVUA 2VHUA 2PMKA 2QEQA 2GXAA 1NN0A 4ZPXA 1KK3A 1SGWA 2V6IA 4LYHA 2BCGY 1T91A 4FMDB 4O2RA 1ESNA 3RWOA 2FFBA 4A2QA 2FSHA 1D9XA 3HR8A 4Z1MD 1WMSA 3CUEF 2O8BB 3GLIE 5FBWB 3UMFA 5JCPA 1RKBA 2B7BA 1OXUA 2NZ8A 4N0DA 1ZNZA 3EASA 5DH9A 2IYRA 1E2PA 5CJ2A 1SZPA 3AH8A 4NMMA 2J59A 5EE3A 2NZJA 2RB4A 1OYYA 2ZANA 2JDID 1OHHA 1YR7A 2EFGA 4IXMA 1I4LD 4WVFA 2ZSAA 5LB2A 5C4MA 3ND9A 4EUNA 3ZLJA 4MGKR 4JSTA 4QGFA 4JLOA 4QG7A 4WZBE 3NHBA 2YKGA 1JECA 1AGPA 3ZGXA 1IXRC 1TUIA 1WCV1 4UNSA 4ZKEA 2ZYTX 1XEXA 2QP3A 2FPKA 3QBTA 1IBRA 3RAPR 3FE2A 2R62A 3WNCA 4LDJA 4XD7A 4KFRA 3DPUA 2IHYA 3AF2A 3JZAA 2D74A 1K8RA 3MWKA 2XNDA 3EWAA 4K8OA 3C4JA 2CL0X 3H4MA 1E2EA 4F7WA 1GOTA 5KUTA 4EPYA 4D80A 2FX3A 2IYSA 1VECA 1GAJA 3ZVMA 3TIFA 4EAQA 4TTQA 4C0LA 4D26A 1W47A 1ZUIA 2C8VA 2HLDD 4HAUA 3CONA 5FL7A 4I1VA 4Q47A 4RD4A 3IPXA 2D2FA 1XCPA 4OI2A 3T34A 1DO2A 4DZZA 5JWRA 1JPJA 1KK2A 3P1JA 1M7GA 1OT3A 3MJRA 3NVAA 4ESVA 2BDTA 2YV5A 4N0EA 3F0TA 1JAHA 2HYIC 1YZUA 3KX2A 4TQUS 1MO4A 1QF9A 2WWIA 1J2JA 3ADDA 4TT3A 2IHBA 3TGPA 2C04A 3EPKA 4LYFA 3L0IB 5HZKA 5K8IA 4GI7A 4RCYA 5FBVB 2BJWA 5JI3E 5J47A 1X8KA 1VG1A 1OH8A 5DHFA 4ZIRB 1BMFA 3HYRA 2P5TB 3NBYC 3T5GA 4LJ6A 4IDHA 2VP4A 2MMCA 4HDCA 3I8SA 1Z07A 1W36D 1KSJA 1L8QA 2R9VA 1N5JA 2JASA 5B2ZA 1B0UA 1YQTA 3DMDA 3QXHA 2IK8A 2RH5A 4G5QA 5GJCA 2BBWA 2GEUA 1UJ2A 3I3SR 2A78A 4A82A 5K8UA 4LWZA 4D4JA 4OKSA 4GPTA 1N2CE 3EZ6A 4TYPA 2F55A 4MRSA 2OG2A 4CW7A 3KB2A 3U7GA 2ZPTX 2UZ3A 1ANKA 3RLFA 4DCVA 1R10A 3DHWC 1QVAA 2CBZA 3GEIA 4AG6A 3BH7A 2B8WA 2OXRA 1CRQA 1RJ9A 1VPLA 1NMXA 2FA9A 4KVGA 4PHFA 4R7ZA 1Z6AA 2DR3A 1Q1BA 2CNWA 1Q1QA 3SR0A 3LLUA 4DLXA 4DLWA 1IHUA 5C4GB 3WHKA 4TL9A 2KBFA 1D8TA 4Q03A 4HLUC 1ZYUA 3CWQA 3K70C 2WHXA 421PA 1GNPA 1F2TB 2JATA 3DZDA 4LJ4A 3JZMA 1VKJA 3SJZA 1RRFA 1KDPA 2YOGA 3CRW1 3TSOA 3K8YA 3Q5EA 1G4UR 4RZXA 1M34E 4WBSA 1OH7A 1H8HD 2EWWA 1SHKA 3QVVA 4UXJA 2GJAA 2O8FA 2Z43A 1PZNA 2DWQA 1FTSA 1E79A 1XCMA 2OXCA 2ZVQX 3CIOA 3CZQA 3D3QA 3NHAA 2VHQA 3VMFA 3TR0A 3MCAA 5FTLA 2BJVA 2R6FA 4GP7A 4M1SA 3SFZA 4Z8XA 1JQLB 3AKYA 4P0TA 4XSGA 5F98A 3CRQA 1B23P 1S3GA 3X1ZA 2FEOA 4LRWA 3AP2A 3QVUA 5EP1A 1LTQA 4AKEA 2FFQA 2ZSEA 4TTPA 1LV7A 3R20A 4HUQB 2HJVA 4LV8B 3U5ZB 2H1LA 5CK4A 3L0OA 2OESA 3KQHA 5IF9A 1LNZA 2AXNA 2KWIA 3GJ8A 4ON9A 5D3MA 4IDPA 2WV9A 5H68A 1G3IA 2OAP1 1KSHA 1I4DD 2QRZA 1E9FA 4ARZA 3GFOA 4NCJA 3U3JA 1EESA 2R2AA 5L8VA 1F2UB 3AF4A 3EIHA 4O3MA 2J0SA 4FI3C 2VH5R 4V0MA 4YMTA 1P2UA 2F6RA 1NLZA 2RGBA 4TYYA 1P5ZB 2O8DB 2CCGA 4TLEA 3AB3A 4NYJR 1U94A 4M53A 3GJ5A 5IK2A 4LX0A 3R7WB 1BYUA 2QENA 3C16C 1D2NA 4Q4HB 2JLRA 2J1LA 5CYPA 1KMHA 2JLZA 1Z0KA 2A5DA 2C99A 1R8SA 3GLFB 1OB2A 4CEJA 4TLBA 1Z0IA 2A3RA 4YMSA 2JIZA 3K70D 3WRYC 5TXGA 1W0JA 4MQBA 3VNUA 1NKTA 1HT1E 4TMWA 2EW1A 1QHNA 1ZD9A 2DFTA 3OAAA 1BO6A 3LAWA 4DBLC 4XOIA 3WBJA 3WYGA 1KO5A 1RVDA 5EUQB 2GCOB 4TZ6A 3GLFE 2ZRNA 3FB4A 2O0KA 3KZ1E 4N1AA 1GL9B 3HU3A 3PFIA 2CK3A 3GLHE 4P33A 3SU8A 4RFSB 3UWOA 3NC1C 2A7QA 4G5OA 3O8BA 2QQ0A 4IXNA 4AI6A 4LSGA 2R6GA 1MV5A 2Z5FA 3I72A 2HCJB 3NH6A 4KBGA 4JKYA 1KKLA 2FGKA 1FP7A 3V9PA 2QU8A 4P3YA 1U8YA 4QHYA 2LKCA 3MG9A 3TSZA 4JVMA 1E2QA 1R0XA 5B64A 1Z47A 1R0YA 2RGXA 1YR8A 1Q3HA 2J41A 1G6HA 3U4QA 4LJYA 1FOEB 3QKSB 1QHYA 4Q9LA 1D6JA 2FFHA 1E69A 1GNRA 4A92A 1KSFX 3LY5A 2HF9A 4LJAA 5HCIA 2KSQA 3M6AA 5FFMA 3P27A 1P61B 2NPIA 4FN5A 5H1YA 4BPBA 3PUZA 4TYQA 1KI7A 1KIMA 1A1VA 1WP9A 1JXOA 2JGNA 3GLIA 3AVTA 2GKSA 1R0WA 2GVZC 1G7TA 2ODEA 3P32A 1FQKA 2C95A 2CJWA 2IS6A 5EZ6B 1Z3IX 4A0RA 4WAUA 4NU0A 4QGHA 3VHLB 3FGNA 1Q22A 4US0R 4LV6A 2H92A 3CX8A 2VSFA 4GOXA 1KI6B 2QA5A 2ZR9A 3LRPA 5FUWA 1G7SA 3OE7A 4RZ2A 4G0NA 3CM0A 2FZ4A 2O8BA 2XTNA 2VP9A 3OFNA 3WMFA 5FPSA 5CITA 1E9RA 1TU4A 2W2TA 3WMEA 4L15A 3GLGB 4CZ2A 5C1BA 5JRZA 1OHHD 4TSFA 4QM7A 2XJ4A 4Q9KA 3K0CC 2BBSA 3AGQA 4LZZA 3AVVA 2RGEA 4D0NA 2G3YA 5CB6A 2REXB 4BFZA 2RCNA 5JEEA 4XJXA 3L0SA 5DHAA 3R9IA 4LOAA 2ANBA 3GCGA 1CIPA 2GETA 1TF2A 1XTQA 4XD7D 2RHMA 1BOFA 1II0A 1NVVR 5LBIA 4FD2A 3VR2A 1EX6A 1Z83A 2XNDD 3N70A 4QBFA 3AVXA 4BECA 1PLKA 4JBXA 3T06B 1E0KA 2REBA 2QQEA 3MUFA 4A2WA 4FCVA 1TPZA 1G16A 1P72A 2BKUA 2REOA 4B43A 2V3CC 4YONB 3K09A 4YXWA 5CIWA 1CU1A 1EK0A 4I1OA 4BEJA 4PPNA 2IXFA 3CF2A 3GFTA 2FGJA 5FL7D 2GDJA 2N1BA 3A6PC 1G19A 5G3YA 1Q12A 3P20A 5FOWA 2W6JA 2ZUBA 4OI1A 1TUEA 1IN6A
chains in the Genus database with same CATH superfamily
2QVBA 4FGUA 1FL9A 2ZE7A 1G6KA 4BX0A 3S3TA 4EJSC 2W71A 1J06A 1WB4A 1KO1A 1G98A 3QSYA 1XDUA 5CJJA 1NYLA 4XCVA 3IVAA 1OLSB 221PA 2EJCA 2JGMA 3UWDA 2FWAA 5IJAA 3WRXC 1RCUA 3DF7A 1T26A 3O91A 1N9GA 3GRFA 3Q7QA 1RHMA 4WKBA 4YDSA 4NCAA 4TTTS 4DEXA 3LC7O 4B31A 3RGGA 2AKYA 2HIAA 3KZVA 5G0SA 3SHTA 1FLVA 5GOZA 4LXHA 1BMFD 2JJ1A 4J91A 4KUHA 4C0AC 4ZHQF 1TAGA 1L5HB 4MUJA 1NYQA 2R8RA 4EI2A 1RYDA 3NCTA 2F3UA 3D43A 4F4JA 4P2BA 4PFKA 1X7ZA 2WUDA 3RVKA 3PXCX 2J0VA 3UHAA 5HM6A 1DBIA 1U3WA 2EQAA 4GU5A 5HMMA 2W6ZA 2B3DA 4R16A 1QCDA 1TI7A 4UU0A 2IWRA 3ROFA 2J31A 3BJIC 1RAGA 4G1FA 4IX9A 2FZGA 4JDUA 3JTEA 2V7QA 1KOJA 5YASA 3I0NA 3ZCVA 5BO5A 3KT6A 1E2IA 1Y1KE 3FMIA 5TT1A 5JQWA 5AW0A 3SHVA 1ECBA 1PX0A 3DZ8A 3ZJYA 2QZSA 5JAIA 1TF7A 3AHFA 2NUTA 1ZUHA 2UZ1A 3DHEA 2GD6A 3IAS1 4EYSA 2YY5A 2OE2A 1RLOA 1SC3A 2JLQA 1K3UB 2MSKA 4JMPA 1SBHA 4TLLB 3CZ4A 2RG7A 1QZZA 3DMNA 1WW2A 2EARA 1NOJA 3DVQX 2G77B 1MZPA 3H1EA 1HTBA 1ODJA 3NGXA 4HGRA 3THXB 4EHAA 4N49A 3M6WA 3TGWA 3TTWA 3GN1A 4HYTA 1WKBA 1M34A 4PAOA 3ROTA 1KI9A 4WLNA 2XOKA 4NYIQ 4JI7B 1J1IA 1YR6A 3LWDA 1EXNA 1SU4A 3E8SA 3IEKA 4D9NA 4HDQB 1PGJA 4XIIA 3E15A 1GLNA 3TKLA 5KDLA 1JHAA 2DJ5A 3IB6A 3B70A 4NMHA 4DREA 2PKWA 2PJRA 4F2GA 3P4XA 4INZA 5MDHA 2CCJA 4EPVA 2OECA 1P9RA 3TZEA 4GOND 4ZMRA 1PSWA 5JD4A 3EG9B 3IDSA 1UBEA 1QPZA 4YRDA 2Z2KA 4GXRA 5F2OA 1JPNA 4JJ8A 1OBHA 2PZEA 4X8LA 3ZBUA 1E79D 2P67A 3ESDA 3O4RA 3MMZA 4KQFA 5JOQA 2QAIA 1P5FA 2GTIA 5AW3A 1JUDA 5TVKA 1TYCA 3MBIA 4UE3S 4XDZA 2QLNA 4AZ3A 1QRSA 2ZB2A 1OGYA 3SFVA 3ZDDA 2F59A 3ESZA 3PP8A 4I1PA 1D9ZA 1ZU4A 2NQ8A 1V5FA 3O03A 1IY9A 3HCFA 3OPYI 3RUAA 3MRSA 3MWJA 3U7QB 2BM1A 1B6TA 4P86A 4HYYA 3JWJA 1CFJA 3AVQA 5AJXA 1E3LA 1SUSA 5CXUA 4E46A 2ID9A 5LWQA 1R9GA 1YI1A 1V0JA 1K75A 1JAIA 3DB1A 4JHLA 5ARCA 5G1NA 4NBVA 1OE0A 1IXKA 4OK3A 1VMIA 2R8ZA 2BGLA 1DDOA 1Z6PA 1WXEA 3EMDA 3VZSA 4OQFA 3CNLA 2UYYA 1GCUA 2GEKA 2R5WA 5E4TA 3W8EA 4EVSA 1ZD5A 3C6MA 3HVUA 1Z5VA 3EAFA 1CLUA 4FDAA 3KK0A 3GT0A 4DLSA 1LB1B 4O8ZA 2GCEA 5HTOA 3QEBZ 1P9LA 3OICA 1PJCA 2QSZA 3G7UA 5FA5A 3V3TA 4IXTA 4HT3B 1W88B 5JYEA 2Q27A 1GHTA 1RYFA 2JI7A 1VRVA 4NESA 5E6RA 1I7DA 5DOZA 2JFFA 3TSAA 3S2ZA 4U4AA 5BQFA 3I5MA 4DA7A 5HUHA 4JQSA 1EE2A 3B7GA 4BGEA 3KTFA 3SQOA 4AJJA 4RV4A 3W8FA 1HYGA 3OZ7A 2B34A 4ZVKA 1RP1A 3SJUA 1SIBE 2G4LA 2J9XB 2IITA 3K5PA 2VP3A 3KZOA 3DEAA 1F14A 4HZUB 3B7PA 1XKQA 2V7GA 4Q4HA 4DJTA 4OHPA 5KYTA 3GLFA 1G0OA 2JFHA 3QI7A 4MR7A 5B1DA 5G4KA 4F04A 1SXPA 3NZEA 1RDFA 2AFIE 5AVTA 2BHNA 4OAPA 3C5HA 2QBYB 3AR3A 4YIHA 2Q4BA 4DPMA 2O07A 2XDAA 3O8OA 4F3NA 1A8IA 1HE5A 1UKYA 3QW4B 4JA0A 3TQIA 1CUXA 3A9RA 1YK1A 5B37A 1X39A 4QQKA 3D6UA 1FDSA 3R6TA 4KUGA 4JJ7A 1N3LA 4OXIA 3PITA 3B6IA 4IHAA 1BS2A 3F6CA 4L1KA 4REQB 3QMVA 4H60A 3WK9A 3BXPA 1DRKA 1WNFA 3UICA 1BGVA 4K9MA 2HSZA 3WVNA 4QUIA 5K0CA 4RFSA 2XB2A 4JJIA 4MJXA 3HPRA 5JR3A 1LH0A 1HSZA 1UBGA 1Y3AA 3WGGA 5J63A 4AQYB 2B9VA 3CZPA 4RD2A 2CKDA 4TRJA 1ZH2A 3P9NA 4AX4A 1RBQA 3RYFA 2BDEA 2IH2A 1DT5A 4MKGA 3EXHA 4LRYA 5JMTA 1XPUA 5H3HA 3D8RA 4GD3Q 2X3UA 4A36A 4DV3B 2H1RA 4RD6A 1XWIA 2C77A 2CLFB 3D0OA 2YOHA 1EGQA 1H2XA 3DZJA 2GBLA 5EXPA 1ACJA 2HM7A 3FDXA 4L7QA 5LU8A 2OFXA 2QKYA 3T1OA 2C8KA 4ML3A 5EERA 2GPNA 1P4RA 4CIAA 2C9MA 3QPWA 5FA8A 3G0HA 5L40A 3FPFA 1SG6A 1M1NA 2ENUA 4DJFC 1XMOB 4ECAA 4TKUA 4ZVVA 5HHTA 3A6DA 1U4NA 3COJA 3OQHA 1ORRA 2R8XA 3HJHA 3WXMA 2VG8A 1QE5A 4V0ME 3F73A 3HA2A 3E9NA 3JQBC 2P78A 2VKQA 4FMBB 3WGHA 5KWIA 4GIBA 1N8NA 3DEJA 4RWEA 5LN1A 3FOAA 3AERA 1HDZA 4K6HA 4XUDA 4N47A 2VI5A 2Q9BA 5TE9A 4P32A 2ZROA 2QHXA 4P54A 2XE6A 3PUXA 3CWCA 4MUMA 1ZIYA 4QATA 4AMGA 2CWWA 2V6JA 5HR5A 1XXHB 3WXBA 1DP4A 2ZSBA 2D0DA 3NTVA 1RQ7A 4DS3A 1L7XA 4JZYA 1X3SA 2AE1A 2WICA 3DLAA 3KL4A 2C7GA 3X1YA 4D2IA 1CJVC 4EJ6A 3L8FA 2HRDA 1L4MA 3OCXA 1GU7A 3OX4A 3P96A 4FYVA 3K30A 4HAIA 1CJUC 3CG4A 4HFNA 4TSFD 3RYHA 5KYKA 1FSPA 4URZR 3I5AA 1W4BA 4AXBA 1LNSA 1UC4B 1DUVG 2JKVA 5EXEA 2H11A 4F5EA 2FPXA 2IEGA 3LA6A 4EUSA 4AF8A 3G7SA 4UDXX 2J9RA 1QGUB 2J0UB 5LP1A 4OCZA 3RNOA 4DYHA 2ZXUA 3PV0A 3ER6A 1JTEA 1XTZA 2OO5C 4MVXA 4X65B 2VRCA 4DV5B 3LQRA 4JXXA 2G0NA 1MC8A 6REQA 2JAPA 3HVIA 4JENA 2MSCB 2Q6TA 3O83A 2QX6A 3HJRA 5FV7A 4L22A 4CF4A 3U0BA 4YX9A 3PWKA 1M5RA 2NVWA 5D7NA 5CAEB 3DLTA 4EVRA 2QL7A 4AKIA 2VJOA 4MH0R 4N7MA 3PGJA 4IJVA 1DX6A 4W5TA 5FOQA 1DBSA 1X1SA 2I3BA 2XWJI 2W9XA 4NENA 3FFXA 2JZCA 5DXFA 5EJ9A 3IV9A 2EKLA 3RABA 3TZLA 4RPCA 3LOQA 4J07A 2A0WA 2LRHA 1E4EB 4UVGA 4XIJA 3N87A 4G0ZA 5TQVA 1DAIA 1EB8A 1WCIA 2FW8A 4E51A 1XRNA 1C5KA 2ZJ0A 2IYVA 4Q6BA 2ZT5A 5A3RA 2PLRA 4HNUA 4DSUA 2EFYA 3F4BA 3UJ6A 3WTBA 4KSYA 4NHOA 3CPJB 4MLPA 5GPBA 3ZGZA 3FMVA 1XK7A 3M4XA 4ZV4A 2P5UA 1ZAKA 2PD6A 2G82A 1Z22A 4PQRA 2HXSA 2QXYA 3K6KA 4D56A 2R6AA 3VM6A 2G08A 3DE1X 4ILEA 2BGGA 1EFHA 3PDJA 4KDCA 4HGYA 5IABA 4WT7A 1NJ5A 2FKNA 4XE5A 4FT4A 1EFLA 2ZVJA 3QXCA 4NYMQ 4K05A 5J1TB 4EPRA 2AKEA 5K8VA 2VUIB 1C50A 4UOEA 1LDNA 1T8WA 4KQEA 3KDAA 2PH1A 4K6OA 4FB5A 2XOXA 1LBEA 2P9QA 3W5HA 2RHRA 1S9HA 3BGDA 1YUBA 4NE2A 3NJRA 3W3ZB 1PT5A 3DWIA 1AOXA 1DKLA 2GD1O 4HB4A 3WGLA 3WV4A 3UPTA 4GPEA 3I64A 3H2ZA 1WXFA 4IMRA 1DEAA 4OQNA 4LDZA 3U0VA 1FJGB 4J0QA 4GLBA 2L69A 2BEWA 1GTL1 5IKMA 2EJUA 2WSIA 3E9MA 2IUSA 3COWA 3EGOA 3IP3A 1KJJA 2DLNA 4TZ0A 2NYUA 2A3NA 4OBBA 3ZN2A 1WQ4A 3MC1A 3OJ0A 4E7PA 4E4RA 1JKJB 1SELA 1U8ZA 2IE8A 3DDSA 2YHIB 2OBLA 2J3IA 4UEKA 1FQJA 1CUHA 1Q7CA 2EDCA 3MS7A 4P4LA 4QQ8A 2BIFA 1QCCA 2PTHA 2PVCA 2H2FA 2TSYB 1GPYA 1R0KA 2R48A 3BXGA 3FCUB 4S0ZA 1YRYE 3ACDA 3HY6A 3ZGYA 2VNJA 2VT6A 2HU5A 1DO8A 2H1HA 3ADOA 4HDMA 5EPEA 4BNDA 4L85A 2ZSJA 2YIVX 4IS3A 4Z1OA 1U1IA 5IF3A 1P0PA 4QOEA 4WI1A 3RT7A 5AJHA 1JSLA 3NIBA 4IIYA 1G8PA 4DIOA 1EHCA 2A6PA 4M8LA 4NECA 1EWQA 4E5PA 2FG6C 3W2FA 2DKNA 4OMFG 4IXWA 4WLOA 2X0DA 2ASEA 2YJTD 3ISJA 3Q2KA 3GB9A 2XXAA 1UFOA 4BP1A 1RFGE 2NP6A 1FFYA 1RQXA 5K8TA 1CQIB 4ZDJA 1SKYB 2WYUA 4LDAA 4P7FA 3SJBA 2KB0A 1V39A 1BXKA 1YQQA 2GO7A 1DJLA 2OCBA 3CLUD 2NO0A 1IC6A 1Y6FA 4JLSA 4U8HA 1SCUA 3MIIA 1Z5OA 4D0RA 5C46F 3R5SA 4LWPA 3E22A 1RXYA 3FG9A 1OXTA 3FNBA 4BQOA 3QLVC 4EATA 2J6IA 2XYGA 1M2NA 2H5IA 1AGNA 1L4YA 4HF7A 3U31A 4D6PA 1UM9B 2ZTHA 3HCWA 3NONA 3NTUA 2PQ6A 2Y2UA 1S3SA 1PR0A 1YZNA 3OT1A 2QLMA 4Q21A 1WSDA 5ALJA 3A4MA 5HFJA 5KX5A 1DZ3A 3AJAA 4AMYA 1AGYA 1JAXA 3AW9A 1NUSA 4FWTA 2Y1FA 3ZVNA 1C7JA 4LOIA 1XQYA 2PUCA 3DDZX 1KNXA 5EKUA 4ZKDA 1B3BA 2WQ7A 1SHZA 4GPAA 5DM2A 2CB9A 5DEOA 1RXCA 3CBQA 3AI3A 4BB0A 5IYZF 2P79A 4LTNA 5F5NA 3ZWQA 2CHVA 2V4ZA 3HDVA 3BILA 4E5MA 1CNFA 4R84A 5A2GA 3I34X 4Z0HO 3WYFA 3OO0A 1VLJA 1X2BA 4AY3A 2NWQA 1MVLA 2GBLC 2QDKA 1ZX1A 1CY4A 2WHPA 3U4CA 3Q1KA 4TOIA 4BO8A 5KKNB 4PTZA 2C9CA 4CMBA 2ODBA 1V3QE 3GLSA 1NJSA 3EXFB 3P2IA 4LY0A 1ND6A 1ZCBA 4L5CA 2FW9A 2Y76A 2JRLA 3JD2A 3RTDA 2OMEA 5B7GA 1N2ZA 2ZRJA 4OU5A 4IGFA 1CUWA 1QO9A 3O21A 3VC2A 4U5XA 4GT1A 1ZVVA 3L0ZA 1XHEA 2WWRA 3HJNA 1D4AA 2RB5A 2YY7A 2BW0A 3O1JC 4Q12A 1J0EA 3UAOA 2UDPA 4FJ0A 1Z0JA 4OF4A 2QM0A 3AKDA 4X91A 3U37A 721PA 1A8SA 4B0OA 5HUJA 4GL2A 2XUAA 3T5PA 4F92B 1ZNWA 2WYWA 3B1VA 4PAQA 5GGXA 3DO8A 4JU8A 1TM7E 3UFXA 2IX3A 4AO7A 3EC1A 3FHCB 3UJPA 2ADMA 1Y1TA 1CDDA 1LRKA 4EYQA 4A26A 3KV1A 4U2KA 4QDUA 2B0JA 1AIPA 1CJBA 1HQKA 1CKEA 1REQA 1T5IA 5B1IA 3GLKA 3DLBA 2OHHA 3BMQB 9ABPA 3H97A 1F60A 3LL4A 2DT8A 5AICA 4YB8A 4DIFA 5CYFA 4DUGD 5KC9A 2P4SA 2VTBB 1E1CB 1TDJA 4WOCA 5M34A 1T2EA 4DB2A 1LWNA 4W5NA 1RLIA 3S8MA 1XRJA 3FDJA 1E3IA 1JG4A 4YRSA 4PO8A 3LX5A 4K8RB 4HFJA 1X6VA 2NIPA 2V5UA 2BZ0A 3CA8A 4FJ1A 5HRAA 1KH1A 3HC7A 2XDWA 5DLEA 2O5RA 3RS4A 3IVRA 5K0LA 4AKTA 3R40A 3UUGA 2BGKA 4JA2A 2HRRA 2IYYA 1NR5A 4JODA 3VR6D 5I7EA 1M1YA 1Z39A 5JY1A 1KBZA 2G7ZA 3AHDA 4ETIA 1E2JA 3KWMA 4ND3A 4ZVSA 2E21A 4H7FA 4CKBA 4PN3A 5B3LA 4E1BA 2WG2A 1RPJA 4L8LA 1J8FA 2ZAOA 1LRJA 4P3OA 1GSHA 4BU0A 5FFFA 5MFZA 4KE6A 3IV7A 3LRXA 1YL5A 2XMGA 4ZVQA 4JCOA 2UAGA 3RRXA 3PVZA 4MXDA 4CCYB 3L04A 4WY5A 2OFFA 3WWCA 1A4IA 1J99A 3IKLA 2QZPA 3K4PA 3D8HA 4GMGA 4IRXA 4MVJD 2Y92A 4NOLA 4QASA 4Y9UA 4BMZA 3O3NB 2Y1LA 3HDJA 1WR8A 3NRBA 4ZANA 4ZCSA 4D4LA 4CIWA 1WBDA 3RFVA 1U2EA 13PKA 1NFFA 2R25B 3ZQUA 3VO1A 1EFUA 2J33A 1TO2E 4TS4A 4PANA 1NVXQ 3AM1A 2DUNA 3A11A 1UKVY 2PT6A 2C03A 4KO2S 1IJFA 3KEQA 3O4FA 1ZONA 1S96A 1K4YA 3H5RA 3C5EA 1A7JA 1A2OA 3L3BA 3L79A 4HQFA 4BCCA 2ISCA 3FBGA 3LQQA 1R4AA 1XVAA 5E3JA 1T9DA 3RAGA 5TQ0A 4PGHA 4XYEA 4FZJA 3B1ZA 5CHYA 1X7WB 5ED4A 1FBTA 1U2GC 2XQIA 4J94A 5KPJA 3HCDA 1M83A 2VN8A 3KHUA 1NL3A 4JVNA 3U39A 4Q7MB 1DCTA 3QFRA 4I55A 1L7MA 4OQMA 1G6OA 3A32A 2RSLA 4ZK6A 5KTPA 3R5XA 3GLQA 4FONA 2PFGA 5CD9A 1Z4QA 1WTCA 4Z2YA 1I4TD 1V35A 3EBLA 3JAWA 2CL7X 2H1VA 1SVWA 4E31A 2WZCA 3HP7A 1EWKA 2IYNA 2A9OA 1Z68A 2G07A 3VVMA 2N46A 5D7BA 1BROA 1DCMA 1AVTA 3FGPA 3A3YA 4JJEA 1KVUA 1YONA 3AU9A 4KQ9A 1OTHA 5CTJA 5BQOA 1WO8A 3NBZC 1JQBA 3NT4A 4S2EA 1E5DA 3HG7A 4IJMA 4DC9A 4MGZR 1G7RA 2JFPA 1I0ZA 2OQRA 5FWYB 4HNSA 5E9WA 1EDEA 2OYRA 3MUEA 3AR4A 4FQ8A 1GTJ1 4H7HA 4F38A 2YWXA 3RTGA 1Y1RA 2FH5B 3B3JA 2WVJA 3GFPA 1CTQA 3AR6A 4OATA 1RI2A 3FTPA 3MOSA 4ZJZA 5FWXB 5AW6A 5KYWA 4O4LF 3PFBA 3IUEA 3SN6A 1HKHA 1ZCFA 2EU8A 2Z3WA 4KDRA 3OQPA 2BTQB 5K0BA 4NCBA 2YMLA 3AR8A 3L7LA 1F4PA 3RVDA 1MRNA 1T5SA 3QUAA 4DGQA 5FOUA 1SNYA 4ZQGA 4LZJA 2QAGC 1QH9A 1DWPA 2ZIAA 3SYRA 3TSYA 3Q7TA 4NP6A 3C41J 2OBNA 4G5YA 1VI2A 4FLFA 2XT9A 4GOLD 4PX2A 4DJ5X 2ZS9A 5JJ5A 1ORHA 3UW3A 1Q91A 2ZWVA 3S70A 4BP9A 2J45A 2NZUG 4B4OA 3T7DA 3L6UA 2N75A 1ML3A 3PDIB 3L1UA 2I99A 4FR5A 4CHGA 1FS6A 3R6DA 4PC3A 2EKPA 1SD2A 2BD0A 4UHEA 1JQJC 3WLKX 4BO7A 1K8YB 3GJRA 1DAPA 1ZIXA 2RHJA 2ADFA 8MHTA 3BA6A 4IHJA 1YRAA 4P98A 5AJTA 4G4IA 5E6SA 1G3UA 1L7BA 3L84A 4DMRA 3PJRA 3K9LA 3PQ7A 1MAHA 1P4SA 3I9V1 1E6CA 1JSXA 2ZSDA 3CNBA 3DAHA 4MKRA 2GCNA 2J0EA 4RK0A 4LG1A 2P35A 3PNLA 1O5IA 4PZZA 4AJOA 5JRDS 3LUKA 2PXHA 3DOCA 5CNMA 2C98A 3E3MA 3GLGE 3ZK8A 1I2AA 1V7QA 4IDQA 1GEEA 2ZSUA 2QTFA 3LLVA 3USES 1H85A 2QMQA 3ON5A 3KALA 4TKVA 3ZJVA 1EIWA 3C1AA 4B3FX 3K94A 1IHOA 4NQZA 4XUGB 4KVFA 3ENKA 1FVHA 1WULS 4R31A 5IDYA 5HQ3B 1J24A 3V1LA 1JG6A 1DJOA 1H22A 4CIXA 3IIIA 3ZS8A 1SUWA 5CLIA 1G9TA 4KN9S 4PN7A 4GX0A 4AD8A 3LBHA 4N12A 3ZLBA 4H1TA 1C7IA 3UCEA 2OPHA 2KMLA 1PL7A 5GM1A 2ZI4A 4NEHB 3CRRA 4BTVA 1YS1X 5AKGA 3ETHA 2D8AA 4QEDA 2WINI 1RM5A 5HCUA 4H2DA 3SYTA 5AIAA 5AI5A 1FSGA 4TTVA 4B5LA 2ZULA 1YZ3A 2FZ5A 5BPHA 4KLNA 4K9RA 3OCJA 5I48A 1CP2A 3LMKA 3PQDA 3PPWA 1M2FA 4GX2A 4U2EA 5IBRA 3LWNA 4IOMA 2Q4OA 3RTCA 2D00A 4XUCA 4FEEA 4D1YA 2HMSA 5GVRA 3S1LA 2VPXA 4NCNA 3WOHA 3V4LA 1FLNA 2FQ1A 3Q98A 4E21A 5FT9A 5ALDA 2PUWA 1IDN1 5BR7A 2E37A 1W0CA 2W2QA 5ALGA 5EQTA 3SSNA 4QJ3A 5FX2A 4RTKA 4PONA 3TUZC 2H17A 3O2SB 1GARA 2CC2A 2ECOA 2HOQA 3JQQA 4A0SA 3B9PA 1PFKA 3PUYA 4R0VA 1U9CA 4LFCB 3B5IA 5J43A 1J0CA 5KYNA 2ZUTA 3OWXA 2RHLA 1FYFA 4YJ2B 3TMYA 4KQIA 3R8FA 5AW7A 2FCRA 1DKUA 5HCNA 5JCJD 2J3EA 3BXFA 1NJ8A 3EW7A 4PSCA 2XYHA 4DXDA 2W2VA 2P4HX 3VH1A 1ZW6A 4FCWA 5J2TF 3GJ4A 1K6EA 3I6ZA 3VBEA 1Y3DE 4ZHQA 2Q29A 2Z30A 5JSZB 1R8JA 2GN2A 2Z1MA 3PQ4A 3HZHA 3WHIA 2QVZX 2RKOA 3G1TA 3ZBTA 4JB3A 3I37X 3RUHA 1E1QA 3RVSA 2ZR0A 4IXDA 5CEEA 1B73A 3L7BA 1UMKA 1R8YA 4GYJA 5A3JA 4K3UA 4G26A 3BXOA 1NDUA 4RACA 1RWPA 3I1JA 3PC8C 5ALOA 2NXCA 3RSQA 3A2MA 3ZCSA 4BNGA 3CT6A 1PV1A 2O48X 3JQAD 4F2WA 1QQ6A 3ZDQA 2VZ0A 4Q82A 1KERA 3AHGA 1MH1A 1RLTA 1FJ2A 3C45A 3TZHA 1G5RA 1IG3A 3AF3A 2VXOA 1BMQA 3DE0X 1F9AA 3SP1A 2Y1KA 4AJ9A 4J7UA 4MB0A 3CSDA 3SZMA 2DRIA 5JRJA 1D7OA 1VBMA 4J1TA 2QROA 3A9SA 4GEGA 2AT1A 5JLAA 1XEAA 5ARDA 4QJ5A 3ROEA 3VR3A 4FW9A 3LGXA 1C4XA 1RD4A 2ICAA 1VPEA 3M70A 4S1VA 4ZAGA 4RGBA 2O5VA 3HA5A 4HD8A 4YLYA 4U7FA 1BCSA 4OLBA 2PKYX 3RWMB 3CUSA 1E3MA 5ELXA 2AL7A 4POOA 3BZBA 2ZP1A 4MB2A 3PPIA 3SOZA 4AY5A 1VHJA 1KO7A 2A0XA 1Z56C 2Z2YA 3IE2A 4MRMA 3FUTA 3PUVA 3V4VB 4DM7A 3LSYA 1G3RA 3B82A 1SXJB 1Y7LA 5A7GA 4QGAA 3IURA 4B9AA 3HN6A 5B3JA 4CU2A 4J3FA 2W2KB 4FJ2A 1WLSA 1AKWA 3UAYA 4D92A 2EYQA 2VNSA 3UT5B 1X9HA 1X80B 1VLHA 2EERA 2NXEA 4DSNA 2CFSA 5FTWA 4M0CA 1T4DA 2VHJA 1PX2A 3OZXA 1F8XA 4X93A 2IV7A 1JIKA 1HEIA 4FFPA 5G1OA 5F9FA 3VU0A 3R9XA 5EJFA 4PRKA 3KQWA 4GGMX 1E6MA 4BBZA 1ML4A 4NC9A 1NBMA 4P3KA 3UB3A 1FX0B 1Z82A 3QTBA 2HO5A 2RHDA 2YJ3A 5K4HA 4FM9A 2Y4OA 4PF1A 3F47A 4DTIA 1CS0B 4RLHA 1ESZA 2WM8A 2FMKA 3OTHA 4OQYA 5EHNA 4EX7A 2P69A 2MDTA 1HETA 1GZUA 1VSBA 2MHCA 3LCMA 3PFFA 1XZKA 4G07A 1ULHA 3ICVA 2HO4A 1BOOA 4L73A 4DVGA 4DRXA 4HTAA 4XM0A 4QVIA 3DWEX 1XO1A 2RJ3A 2XCUA 4EO9A 1USGA 3CRVA 2PVSA 2ZWOA 5AMXA 2OXTA 5CVCA 3A27A 3ROGA 1JBKA 4WOPA 1B26A 1GKYA 4RGQA 4Q3NA 3USCS 4P53A 2GHIA 3LZCA 1IWBB 4WX2B 5EWMA 3EPJA 1EA5A 1UT8A 4R83A 2C54A 4YV7A 1NVKA 4BCDA 3P5BA 3N0RA 4GKBA 4KGZA 2IKQA 5KWVA 1IY2A 3BREA 2XMQA 3N2IA 5J40A 2EP8A 3R9KA 1YDMA 1ZXBA 2W6OA 4URUR 4DARA 5LVAA 4P82A 2BFFB 3UKJA 1QCZA 5IBCA 5M5BA 1YSCA 3T7TA 3TVDA 4FT2A 1PO7A 3V8BA 2WHRA 4WMLA 4O2AB 1FSZA 2XVAA 3X2SA 1N6RA 3A2NA 3QKUA 2AN3A 4H3KB 4EG5A 2WZDA 3HXMA 1H0KA 1JQEA 5J5CA 2HQRA 5JI2E 4OGLA 1SA0B 1CR4A 1F4VA 3H86A 4B35A 2NVBA 3ZHVA 1G3MA 3DHYA 2D54A 4F4IA 4E88A 2IPOA 1HG0A 3VU9A 1GZSA 3UAGA 1KR2A 1PU2A 1C41A 2VC2B 3N6RA 4BO0A 2NO6A 2DHEA 3GPCA 3S68A 3PQEA 1IN5A 1FQOA 4K9QA 3U1VA 3ZNNA 4B48A 2FSGA 4Q3AA 4QAQA 4MMYB 1JHRA 1HEUA 2BHSA 4C7OA 4JGGA 1PLJA 1HBJA 1RMTA 3N3AC 3EZ9A 3U49A 3OIWA 1LDBA 2J3JA 3RIHA 4C6SA 3NIGB 2GCPA 2B6HA 3G8YA 1F8UA 4U2GA 2BOVA 4HQ0A 2CMHA 3LPLA 1DRWA 2I4LA 2C58A 4QBTA 1XFAA 5I4IA 1BD3A 1PLLA 2UZ0A 4R98A 4PE5B 4Q4LA 1E2GA 1GPDG 4HAZA 3ESRA 2JJMA 1KZGB 1SM4A 2IQ5A 2A1TR 3AZPA 4WLFA 4XD2A 1J0AA 1COWD 1QQBA 1RHKA 1NKSA 2EZ8A 1EUDA 3QENA 4I3HA 2ZRDA 1MV8A 1WZUA 1YK0A 2GFQA 1M74A 1CQWA 1MT3A 2GARA 2P6OA 1GAEO 1XLWA 1BCRB 3MTJA 3AUAA 1S5PA 4KFSA 4P35A 4Y0VA 5ECDA 5FTKA 3WGVA 3I30X 1I4WA 3TJRA 3WV5A 3MWDB 4NFSA 4UARA 3NV9A 4KE9A 5K0ZA 5ILOA 3ZWKA 3NHZA 1L8AA 1E1LA 1PWHA 3NOXA 4UDYX 5F33A 4TLCA 2AI1A 3NLLA 3EDMA 1W30A 3WGKA 1OKKD 1GFZA 4DV6B 2MYTA 1EG7A 2QRMA 3AKCA 3UIEA 4KIUA 5AI4A 3HSSA 1CJMA 1YR2A 5LQAA 2JLWA 2WPDA 3EVNA 1RRPA 5GONB 3ZWMA 5BUQA 3CFYA 1DKMA 3EE6A 3X43A 4OJQA 1IOZA 1IQUA 1D09A 2XMSA 4OXKA 1U31A 3KOZA 5KSOA 1PJ8A 4TMVA 2HQBA 2AR0A 2P6UA 1WVMA 1Z45A 2V55B 4AM8A 4CV3A 2UUBB 2W4QA 1DKNA 3C0KA 4YUWA 1HURA 2TS1A 5IVDA 1ODTC 3RADC 3ZVKA 3IAAA 1ZWLA 2D7JA 2I22A 3WBBA 1TO6A 3VUEA 4LFAB 1MABB 1G21A 1M8FA 4U3JA 3FLAA 3IHWA 2Q46A 4M21A 4IQFA 1DAEA 4V2IA 4Q4CA 5BORA 1PBTA 4QPNA 2DHCA 2VF2A 1K98A 4MINA 4IY1A 4FX2A 4K03A 4ZV7A 4ZYTA 4JJ6A 3D6NB 5AUNB 4F84A 3L7IA 1SQSA 4B75A 4INOA 3VBCA 1W5TA 1ZLYA 2J7PA 3FIJA 1TIKA 2LTAA 4HH0A 5NULA 3RK1A 3RR2A 4AJ2A 4D9MA 4HUTA 4RTOA 2QXTA 1VYVA 1YCGA 5FOXA 3TFQA 2INGX 1C4OA 1RACA 2P27A 4Z9YA 2H1FA 4V38A 5IXJA 5JJIA 1Z6ZA 4I9NA 1B1AA 4Q9IA 1DOHA 3ZWCA 1K8XB 4P08A 1MPTA 5AW1A 3EWNA 5TDHA 3Q6IA 2QI9C 4LYGA 1JFFA 1NAHA 4I9UA 3AJEA 2YTZA 1ECLA 3K0FA 4N39A 4LZOA 5JCXA 2WT4A 5FYQA 1SFRA 4ME6A 4PG7A 2C7QA 5F4BA 3ZI7A 1VL5A 1VCNA 3P9YA 2AMLA 2VCEA 2O8CB 3TZCA 4ASUA 2BH2A 1E2HA 3JAKA 1KIAA 5ETJA 5JU6A 1CT9A 3PLNA 4TN1A 5NLLA 1NNUA 3L7KA 1YIDA 2E5FA 4KKXB 1E7QA 2A14A 4KPUB 3TF5A 3QVJA 2H1IA 1YAHA 4KJZA 1JFVA 4AZTA 4O0LA 3SE7A 3V6MA 2F8TA 1JR3E 5AVQA 3H2BA 1EFPA 4NI5A 1RYEA 1WMEA 1M1XB 3E9QA 3EUWA 2BF4A 4BMVA 4Y18A 2AG0A 3W2TA 4RVSA 5B6PA 3T7JA 3UQZA 8OHMA 3HSYA 4X1IA 4Z86A 2JIRA 2RAUA 3PUKA 4B81A 4DIEA 3IERA 4QYSA 2GPAA 3TW0A 4B71A 1YB6A 1YZFA 3UMCA 1BHQ1 1GCOA 2OCYC 4YRPA 2A0UA 3FWPA 3P8ZA 3KEMA 4OSEA 1W36C 3VHXB 3L7OA 1W2HA 2ZE8A 3HCBA 3NKLA 1QPBA 1OFHA 1HDRA 1OXVA 2Q9CA 2AD1A 3D4PA 3PDWA 4LYDA 2WWTA 5CEJA 1WUKS 1LW7A 2R68A 1KFBB 2QN3A 4LHWA 2QRUA 1CUZA 3PYXA 1UBFA 1UMCA 4E3ZA 4YHBA 4NJEA 3KQLA 2SHKA 4I6EA 6CHYA 1B6GA 4CM4A 1AHPA 3UUFA 1IMOA 4WCFC 5FV4A 3P45A 1FTWA 4UMEA 2CJPA 2IX9A 4QA9A 4MV0A 2XQKA 3HR4A 2JKYA 1XTSA 3EN0A 3VPDA 1QVZA 1WDWB 2F3RA 3Q10A 4BFWA 4MYUA 1J07A 1NJ6A 2ZJFA 4BLQA 4D8UA 2O2ZA 2WMDA 4UBIA 4BUCA 3ABOB 3KQQA 4JI4B 1MC1A 1WLYA 2I6FA 3H6KA 3HCOA 4S1PA 4FBGA 4ZO4A 3FJOA 3T8YA 2UXDB 4L0CA 2DMRA 5CIQA 5AKZA 4AP9A 4CRWB 4LE1A 1YOBA 2YDXA 3C7CB 3VV3A 4GKVA 1QYVA 2BUCA 1GKKA 3E9CA 1XNRB 4OM7A 1JEYB 1QGAA 1YT5A 4EB6A 3WGZA 5JBNA 5L3SB 3WWYA 1IPEA 3CLTC 1IWPB 4BNNA 1G5IA 3MPOA 1W5BA 4PBSA 4RKFA 3TLEA 1Q1ZA 1HM5A 1SCKA 3EVEA 5HTKA 1HOXA 3VQTA 1G5TA 1P5JA 2DC1A 3FAZA 1T0UA 2P9TA 2V7BA 4A1OA 4LF4B 3O5AA 4X0EA 4DB4A 4MIEA 1OB5A 1NV9A 1BKYA 3QWFA 4LNUA 4I66A 4BATA 2V7PA 2B69A 5I7OA 5ALXA 1ZJYA 5EZ5A 3ZDCA 2NXNA 5DGHA 1KI1A 4X92A 1SKYE 2FJ0A 3PCTA 4WH0A 3O9VA 1WP4A 1Q16A 3UVEA 4X66B 4LC1A 2YWGA 4KXYA 3FR7A 1AS3A 3RG8A 1PWXA 3FRJA 2IIPA 2P40A 2WUGA 1MIHA 4KO1S 1L4UA 4NJOA 4XA8A 4J16C 2X2EA 3QEJA 4AY6A 4ZZIA 5C8XA 3IRVA 2LUOA 5JAUA 1OX4A 2ZSIA 3KPUA 3E8MA 1NVEA 2Z56A 4LZNA 1MGPA 4DL9A 1E0DA 1LK7A 4XPIB 3SX0A 2CSXA 4JR0A 1P9WA 2JD1A 1GZ4A 4PG5A 4DLPA 3WIVA 1XD2B 1AKTA 2A4MA 1OFTA 1XQ9A 1OC2A 3KJGA 4FR0A 4KAFA 4X1YA 4LHZA 1H0SA 3O2JA 4I14A 2PUVA 3V6LA 1D2RA 5IYZA 5FHQA 3QNWA 4O1HA 4NK4A 1BRMA 4XEUA 3T7EA 1JIJA 2IEBA 5JVDF 4IFTA 4BVFA 3QITA 5DHRA 3WADA 3MFYA 3GZNB 3IKTA 1X7YB 1VA4A 4L2IB 3ICPA 4EGQA 1A2BA 1U0LA 1BE1A 4UPEA 4KMRA 2NNWB 1JZSA 2H16A 3HDGA 4G41A 2E3JA 1T9KA 3QUSA 4F11A 4UBMA 1M34B 1E7YA 1FRNA 2WFLB 4Q1AA 5LIRA 5DNCA 3LNTA 4BV9A 2GEVA 4IQGA 3T1QA 5AW2A 4EJ0A 5JXJA 621PA 2ZYAA 2QB5A 4L5JA 4XWTA 2WWVD 4IEFB 2PSJA 2P68A 1CQJA 3ZHYA 4AUKA 1Q44A 1ST2A 3N76A 4GO1A 4QLBA 1GCIA 3ZDRA 3M9XA 4GR5A 4ZT3A 4EG1A 2H4ZA 2IYOA 3AEZA 3U2QA 3K0AB 5CCEA 1TYBE 3QVOA 4HH1A 1K7FB 5DCLA 2WB2A 4QYTA 3CVJA 2P6NA 3IEUA 1XLUA 3TLJA 2B8JA 3IOBA 3LY7A 4FGKA 2RIRA 4JIMA 4A0GA 4EARA 4EPXA 1K68A 1MPXA 4A91A 5JZSA 5TSDA 2PMEA 1NFRA 2DPLA 3CC8A 1EX1A 2E4WA 3HKEA 1DBQA 2ZRCA 4IINA 3WAGA 3DO5A 2B8EA 5K3FA 2BMVA 2GZ1A 5FD8A 4YR9A 5IFLA 1RTTA 1KF0A 1YRQA 4OO3A 3QVGA 1PJAA 2OVBA 4MAFA 3B8HA 1L7DA 1MQAA 2XXBA 1AV7A 1NY5A 3ADPA 4OHKA 2G67A 3DDNA 1U8CB 4HLQB 3H11A 1PFQA 3HCPA 5P8WA 1C0IA 4HXFB 4EHHA 5CFNA 3ONDA 5CB8A 4TSKA 1WW3A 4WVLA 1K7CA 1LBTA 2PYDA 4RIEA 2XUPA 1RJFA 5CCBA 3JD4A 4MP3A 4F5ZA 1WY7A 3G8AA 2FE1A 4YN3A 3A9UA 1JG1A 4NCKA 3OZBA 1EQUA