3IILA

The structure of hcinap-mgadp-pi complex at 2.0 angstroms resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
175
structure length
175
Chain Sequence
PEFMLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title hCINAP is an atypical mammalian nuclear adenylate kinase with an ATPase motif: Structural and functional studies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, transferase
molecule keywords Coilin-interacting nuclear ATPase protein
total genus 65
structure length 175
sequence length 175
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2009-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3iilA00
3E70C 4OK6A 2OBNA 1OXTA 4IVQA 4JBWA 3I1FA 1ZJ6A 2GCPA 2ZIAA 4OK5A 2IWHA 3AVYA 5J4LA 2H8KA 1KTVA 2B7CA 3UWOA 1Q21A 1MH1A 4I81A 1EK0A 3F3YA 3OAAD 4TYPA 2IYLD 2VSOA 1AS0A 1ZVQA 2QRNA 1OFHA 3BE4A 1II8B 1M7HA 5AUQA 2QZ4A 1JJ7A 2WWHA 2XSZA 4MKFA 4QBHA 4XD7D 1OH8A 3TBKA 3TSWA 3LAWA 3N2IA 3QSYA 1E2LA 2PLFA 1OFUX 3EZ9A 1G7SA 5DI3A 2G0NA 4B47A 2GF0A 1YHNA 4JS0A 4LJ9A 3AVXA 4D26A 3BJIC 2NTYC 2HJGA 3QKTA 4PQYA 3H4MA 3PUYA 4Q7JB 4EPWA 4Q01A 4DKXA 3GJ7A 1AJEA 3CPJB 2DCUA 1N0VC 1HTWA 1P9RA 3NBZC 2QMOA 1NLYA 5CJ2A 3ZS9A 5J4KA 3KKNA 1AS3A 2XAUA 2CEAA 4NYJR 2H92A 1C4OA 5EXPA 3QF4A 1Z0FA 2XZLA 1XD8A 2MMGA 2AX4A 2H18A 3T12A 1KKMA 4LV8B 2HLDD 3ECCA 3FPAA 4Q4HA 5FUYA 5AJZA 2CBZA 2OEPA 3Q9LA 4B43A 3WBKA 3SYLA 4ACAA 3EPKA 3K0AA 4EAQA 2Z0MA 3VKGA 1F6BA 3EIQA 4RY2A 3WY9A 3NDBB 1Z63A 4KAXA 2QAGB 2W6JA 4PTLA 5K8IA 3H2YA 1KZGB 1GITA 1Q57A 1XJCA 1P72A 1TQ2A 2NG1A 3TQFA 5CJPA 1NSFA 2E1RA 2CCGA 4IOKA 4C4PA 1G41A 1EFCA 4NMMA 3FB4A 4LX0A 4G5QA 1P7CA 1R0ZA 2O8DA 1ZD1A 1W4CA 3U7HB 2QMUA 4KFUA 2CJWA 4QGFA 4QJ4A 2G1JA 1HURA 3L0IB 5IT5A 2QTHA 2J1LA 1LS6A 3BB1A 3SEAA 2QBYA 4RD1A 4YDHB 1RRCA 3CBQA 3Q5EA 1T5LA 4AKEA 3LVRE 2O0KA 1FP6A 3X1ZA 1P60A 1Y63A 2JLVA 3B7GA 3THWA 1TQ4A 5J40A 3IHWA 1BH2A 2AFIE 3VR5A 1ZM4A 2GXUA 2Q0HA 1VIAA 1S0UA 4JL5A 2IUUA 3DZ8A 2C8VA 4FI3C 3UG6A 5D3MB 1SQ5A 3W5IA 2EU8A 3AGQA 3OHMA 3Q7PA 1GFIA 3H84A 4Q9JA 2IWRA 1S4QA 3A58B 1WF3A 5JWOA 2I4IA 1KZ7B 3BOSA 3UATA 3W90A 1NG9A 5DE3A 3KDSE 4MGZR 5CIQA 1G7CA 2QM7A 1NVVQ 1RZ3A 2OT3B 521PA 4CF7A 4A0GA 4US2R 2CE7A 4NYIQ 3RHFA 4L9WA 3U3JA 5SZJA 1EFUA 3SHFA 2CNWD 3U2QA 3P32A 2ODWA 3IHLA 3PQCA 3RRYA 1J7KA 1TMKA 2VSFA 1N2CE 2JDIA 3PR1A 1Z29A 3MUFA 1RKBA 4YDSA 4GT1A 4RZ3A 5FUWA 5IDVA 5AUOB 2FF7A 3QPVA 2ZI5A 4M9ZA 1ZP6A 3CRW1 3U44B 3AF1A 4FMDF 5BXQC 2IS1A 1JBKA 1OXXK 2JLSA 3IUYA 5FOVA 2CL7X 2XB4A 3GJ8A 2JLZA 3QBVA 2Z83A 4GP6A 1Q1EA 4MUBA 2VO1A 2KWIA 3MWYW 5KYKA 5HE9A 4JL6A 4US0R 2ODBA 3TUJC 1G291 2V9PA 3RS0A 2YWHA 1G20E 2ORWA 4A92A 2B8TA 1VHLA 2JLRA 1ZCAA 1QRAA 4URWR 1ZU4A 1GSIA 3WNCA 4DIEA 4DLYA 2NQ2C 1MO3A 4C0AC 4TMWA 4DDUA 4QOSA 2HV8A 2VP4A 2CK3A 1H8HD 5KUTA 4DZZA 2IBMA 1SGWA 2G6BA 4BLRA 2FU5C 1C9KA 121PA 2A5DA 3CPEA 2YJTD 1KO4A 3LX5A 4DWJA 4OHZA 1MRSA 4DDWA 1KI6A 1IHUA 4R71A 5E7JA 1E0JA 1FUUA 1JR3D 3ASYA 3FGNA 4AG5A 1S9DA 3WP1B 2WAYA 721PA 3O47A 1OH5A 2GRJA 2F55A 4M9XA 5KNDA 1W7AA 2ZYVX 5G40A 5LB2A 1XNJA 1N3BA 2HT6A 3KKMA 4ZDKA 2B92A 3A1TA 2D7CA 5IRCD 2OCPA 2FFHA 1LF0A 4JSYA 1GKYA 1Q1QA 2RCNA 4KCGA 3VR2A 4MYUA 1U90A 4L9SA 5CB8A 2ATXA 3WMFA 3ND9A 3RNLA 5JRJA 1QG2A 2MMCA 4MH0R 4PQRA 3OEHD 2LCFA 2ZRMA 4BASA 1W5TA 2A3RA 2I1VB 3BFVA 2IA5A 2XGJA 2HDNB 2PJRA 2OAP1 2GAOA 3VU9A 1DAMA 2OSBA 3NC1C 3LH5A 1GL7A 4TYNA 2XTMA 1N6HA 2ZEJA 3F8TA 4UQOA 1E2NA 3WNBA 3CZQA 1Q3HA 4WXPA 5HKKA 2IS6A 2O0JA 1CRQA 1FUKA 1ZIOA 3IIMA 4CEHB 1F48A 2PCJA 4OJKA 1A4RA 2YWEA 4DJTA 1YZQA 5G3ZA 1X8KA 3K0CA 3IDQA 4GMDA 1IN6A 1TEVA 3B13B 2ZM5A 4ASUA 3UPUA 2AWOA 2VF7A 2RGXA 3CKLA 1IN4A 3PEUA 1SKYB 2JAQA 1GIAA 1E4VA 2ZRDA 1NY5A 2WJYA 2V1UA 4TTQA 1PUJA 1G1MA 3U60B 3W8RA 4W5JA 3CNLA 3EG5A 5AJXA 1XMIA 2MSDB 2GESA 3B85A 4II7A 3FMOB 3C5HA 2XX3A 1E0KA 1OPXA 3K9LA 4L5BA 3AKDA 5EE3A 1N6LA 4Q48A 3W34A 1G21E 2ZRHA 1VCIA 4KI0A 2BBTA 2NIPA 1BMFA 3EAQA 1D2EA 2P6RA 5P21A 3O8CA 3LBHA 4OHWA 3CF6R 2D2EA 4LJ5A 4HAXA 2X77A 1OB2A 4QM7A 1GAJA 2FDCA 2GETA 3Q7QA 3ICQB 4B3BA 4HB3A 2FA9A 2FPLA 3AVVA 2ODEA 2XXAA 3LD9A 2RHDA 1A2BA 3KQKA 4PHFA 5CIWA 2A9KA 4M9QA 3I73A 5FTNA 3THYB 3EPLA 1KI1A 1IY1A 4Q19A 1EFRD 3P4YA 3K0AB 4DEXA 1E2EA 4FIDA 2G88A 3EW9A 1OF1A 3ASZA 4Q47A 5FI0B 3C7KA 1YRBA 4C0HA 1F2TA 4DT1B 1GL9B 3M0EA 2ZAOA 1H8ED 3PXGA 2XJ9A 4RD3A 3SQXA 2CNWA 2TMKA 4X8OA 5KNBA 1ZAKA 3TAHA 1X1RA 1UFQA 2P5TB 1TADA 3BBPA 4ARZB 2KE5A 5L3SA 1KAOA 3RC3A 5L3SB 3T34A 3LDAA 2G3YA 5GJCA 1GM5A 3SYNA 4PC7A 1LVGA 2ZS9A 2QSZA 4GOKA 1O87A 2FPMA 2X1VA 2OBMA 2G77B 2QGNA 3CUEF 4HB4A 2WSMA 3SZRA 3K09A 4US1R 3SS8A 1M74A 1NKTA 1T8TA 1W0JD 1JEEA 4PFSA 1PV4A 4DLZA 5FOUA 2G83A 4W9MC 1UADA 4NTZA 1OFIA 4P0TA 5TY0A 5C2JB 3KFXA 2ZRIA 1FZQA 3OEED 3A4LA 4B76A 1HE8B 3LVQE 5G41A 3HPRA 4ZCMA 4BZXA 2XZOA 1SVOA 4DLUA 1JQJC 1KK2A 2ZITA 1W4AA 3IGFA 4KBFA 2ZS8A 1E2HA 3KUCA 5JS8A 1IJEA 5EZ6B 3KX2A 3A1WA 4IDHA 2D06A 1WRBA 2GXQA 2AD5A 4C0LA 1BO6A 1XCMA 3B1ZA 2WPDA 2E9SA 4RZXA 2OV2A 3PUZA 1JI0A 2FZLA 2ZE6A 4Q9LA 1W36C 2IYWA 4LY6A 5JLJA 2WTUA 1IONA 4IDQA 4JBXA 2LWIA 1CXZA 1LY1A 2UKDA 3QF4B 1Z6GA 2XJ4A 2WWFA 2XEXA 4LBWA 3HP1A 5ANRB 1KJWA 1RYHA 4Z51A 1S3GA 3B2EA 2ZYUX 1KSJA 3PFIA 5FOSA 5CLLA 1UDWA 3VAAA 1G7RA 1KI3A 2W0SA 1W4RA 3EA5A 2Z43A 4OHXA 5G53C 4PHGA 4ESVA 4C0QC 2JLQA 3GLHE 3GD7A 3ADBA 1ZUIA 3QNUA 4M1SA 4FW9A 3LW8A 4G5GA 4HZIA 4LC0A 1HUQA 2WJHA 3TUZC 5JSZA 3VR4A 4E5UA 5A4JA 2AKYA 4RZ2A 1M34E 4OQLA 1E9FA 5HKKD 4XVUA 1BYUA 4R7ZA 5DI3B 1CU1A 1P73A 2O8DB 3M6AA 4Q7MB 4WZ6A 4BE7B 4AKHA 1P2TA 2PH1A 4DBLC 3KJEA 5EE0A 4ASUD 4YMSA 2HCJB 2GCOB 5TXGA 3D3QA 2DFTA 4Q9IA 1PVOA 2QMHA 2EWVA 3RS5A 1SVIA 3QIAA 1FNMA 4LHXA 4PHHA 2QBYB 1P6XA 3ZD7A 3TQCA 5FPHA 4B2IA 2YVUA 1LTQA 5J5CA 2BBOA 2J87A 2J0UB 2GZAA 3KUDA 4TSFA 3ZZTA 4IKEA 1YZGA 4B32A 3I62A 1JQLB 3MSXA 1KAGA 1NN5A 4C2UA 4KFTA 4P4SB 4KLNA 3RC8A 3ZYCA 3SNHA 4F91B 1HYQA 4NCHA 1Z0KA 1JAIA 2QE7A 4JZKA 5L3VA 1QG4A 4TYYA 2J0QA 2F1RA 3AQ4A 4FN5A 2JJ2D 3TJZA 1JEDA 4LDJA 3Q85A 1NN1A 3U61B 5JMTA 5AJVB 4E09A 4BLPA 2X19A 3EC2A 1HY3A 4Z1MA 3UMFA 4JLVA 3PUWA 3CR7A 5D3QA 1MO4A 2DR3A 1RJ9A 5CM8B 3DZDA 5AWFC 3VU9B 4TLDA 4Q9HA 4AI6A 4ZKDA 2PX0A 1KJZA 1Q1BA 1P9NA 3K9GA 2ZSEA 3TH5A 1XEWX 3QKRA 1SXJA 5KPJA 2Q9BA 4P4TA 1U0LA 4YC7A 5IF9A 3KB1A 4R2HA 5F3WB 2ZRJA 1HQYE 4MKIA 3QXJA 4LRWA 2ZANA 2AHOA 4A2QA 3MMPA 1O3YA 2KI5A 4TL6A 1GL6A 4BFYA 2XB2A 4MRNA 3WXMA 4CIDA 3CRRA 4KODA 4DCUA 3QXCA 3PIRA 3HJNA 5A0FA 4OI1A 4OK3A 2A5GA 4ZDWA 3I92A 3FWYA 3RVBA 4EUNA 1D2NA 3NDPA 1KO8A 4AYWA 4S2EA 4BLSA 1G3QA 2HXYA 3MWLA 4AYTA 1T91A 1XCGB 3IQWA 1SXJE 3ZVMA 4FCVA 2ZI3A 4LK2A 2HYIC 3GLGE 4ZDJA 3U7FB 5EXSA 4Y0AA 3D6TB 2DHRA 2ORIA 5KDOA 4PQFA 5EXTA 1XXHA 2IT1A 3W3ZB 1OIVA 5CYPA 2C2HA 2H1LA 1YVDA 2IEZA 6Q21A 2GVDC 421PA 1MO5A 3KTAA 4LBVA 3WP0A 4AG6A 4CEJA 1FPMA 4DIDA 4Q4LA 4PZYA 3OEEA 1P2UA 3TVDA 3V9PA 4D25A 1KK3A 1G4AE 2IYUA 1G6HA 1JR6A 2XOKD 4M1KA 4ON9A 4MGKR 1KY3A 3FVQA 4P4UA 2BBWA 3AUYA 1JALA 2DWPA 2GF9A 5EE1A 3U3OA 1Z6YA 2YHSA 2FSHA 3VKWA 4W5WA 4C0KA 2VBCA 2ZYWX 4R2IA 1M8PA 1NBME 3OZXA 3EZ2A 1XD2A 3QXHA 4G01B 4GI7A 5UKDA 4XWKA 1XD2B 5FTJA 4U5XA 2QAGA 4IDPA 2D4HA 4ZI2A 5J4YA 1YZLA 3CM0A 4OQMA 4W5HA 4WW0A 4JVLA 2PJZA 3SFZA 4P32A 1VMAA 1Y3AA 3LLMA 2REOA 3T5GA 1XTJA 5LBIA 5EP3A 2QNRA 2PL3A 4M1OA 2FMXA 5DLQC 2AFHE 2QT1A 5DH9A 2ZJZA 2W00A 3OE7A 1BMFD 4JJZA 3P26A 3SFVA 2JIZA 1GDDA 3GLHB 4Q5IA 1RC8A 3OAAA 1KK1A 1KNQA 2AK3A 1US8B 4GOJA 4KFRA 4KBGA 2EFHB 3SJCA 1SZPA 1KSFX 4BPBA 1S3SA 4KYIB 1E2DA 2AL7A 2BKEA 1OIWA 4KU4A 5A5GA 4UNPA 4EFMA 4DLTA 1DO2A 4WIAA 1CEEA 5FBWB 4MRRA 4QKQA 4WAUA 3FTQA 5FBRB 2Q6TA 1UJ2A 4JLPA 1TX4B 3GJ6A 4LSGA 1U81A 4HUQA 3B6EA 4X8LA 1DAGA 2GEUA 2VL7A 4XWAA 1IBRA 5FUVA 5KDLA 3BGWA 5DGXA 4HLUC 1MRNA 3A8TA 1IQPA 4Q1DA 2QORA 2VPPA 1Z0DA 3T06B 3JZMA 1F3OA 4IEEA 4MQBA 3GPLA 5E7MA 2DYKA 2QU8A 2QQEA 4RD6A 1RIFA 5FFMA 5DHFA 4Q1EA 1AZTA 1Q22A 1VHTA 2FWRA 3UMSA 1OH6A 4F38A 3LWNA 2A5YB 4BUJA 1DAHA 4B3GA 4EPRA 4TTPA 1YU9A 4NKRA 3P1JA 4DSUA 3A6PC 1E79D 3IKJA 1E9CA 4MDFA 2YKGA 5K8LA 3RABA 4IHQA 2C9CA 3HWSA 1Z5ZA 3THXA 4M9SA 2QGZA 5JCPA 1N6OA 1XFAA 1E9AA 3E5HA 2VRWA 1N6PA 1BYIA 3IEVA 3PEYA 3DM9B 4JKYA 1W0JA 4WXRA 4NCJA 1E2FA 1F2TB 1KI7A 4I1UA 3M1IA 1A1VA 3NHAA 4O2LA 2A2ZA 3JZAA 3I8XA 4KXFB 4UXHA 2IF0A 2HF8A 2GKSA 1GOTA 4A0FA 4P3YA 2RGEA 4HZUA 1XPUA 1G3RA 3SE0A 4LV6A 4C7OB 4HAWA 4JVSB 3O8DA 5F2EA 3U3RA 1E94E 3RSLA 3QENA 4LJ4A 1ZD9A 1ZINA 4EPXA 4A36A 5GJBA 4AKIA 2O8BA 3DVLA 4M22A 2ZRKA 4RD2A 2BM1A 2GCOA 2VF8A 4UNSA 5GVRA 3DEFA 2EVWX 1PJRA 3B9PA 1XDBA 5FPSA 2VHJA 1R8SA 3K0SA 4JLNA 2KB0A 3L8ZA 4R9UC 1D9ZA 2W6IA 1ESNA 1XD9A 1SVKA 4MYCA 2REBA 4RZUA 1Q44A 1G6OA 4NE2A 4MRSA 3A4MA 4UXIA 1KDTA 1OHHD 4WBSA 1E2GA 5JWRA 5CYOA 1ESMA 2RGGA 2QP4A 1G17A 1GRRA 1ZW6A 4NL4H 4CDGA 2C96A 2HXSA 1E2JA 3B82A 4HDCA 4IFEA 1OKKA 3BIFA 2ECKA 1ZBDA 4P31A 1OIXA 3KQUA 4Z8YA 1VG1A 1W2GA 2GAAA 3K70D 2IYQA 5JJLA 3GLGB 3GLGA 4TT3D 3LXRA 4MKGA 4TTRA 2NPFA 2AD1A 1W44A 4B3XA 3KL4A 1Z0JA 1WQ1R 2PMDA 3ADKA 3FHOA 3NXSA 2BMEA 4A0HA 1Z0AA 2VLIA 1ANKA 2B8WA 1DPFA 2V54A 3X1XA 4AWXA 3GLFB 4YXWA 3U6KA 2QM8A 3LBIA 3CPHA 5C4MA 3LRPA 4D6PA 3MAAC 2FE4A 2A7QA 1PLKA 1G4UR 5C18A 2W6ID 3UWKA 1UF9A 4L15A 4IOJA 2O8EA 3AH8A 4F4JA 1A5TA 2IC5A 3AP3A 4LCBA 4OI4A 5TARA 2AXPA 3A1UA 1W49A 3QE0A 2ZSAA 4IOMA 4PSVA 1Z47A 3ZJYA 1G8HA 2ZJYA 3EIHA 1EXMA 3HYRA 4UJ5A 2HEIA 4TL9A 2W2TA 1H8HA 5AJWA 3SYKA 3VKHA 1VYVA 1EWQA 2ZR7A 1F60A 1GKIA 1CJVC 4TZ6A 5DN6D 1G18A 4YMVA 3B8HA 3IO3A 4B44A 4TQUS 4CRWB 2OXRA 3UXMA 3RRMA 4NCNA 4MGYR 2KBFA 3SHWA 1U2RA 1NN3A 1XWIA 4ZPXA 2QSYA 5DSZA 2ERXA 1OJLA 1E9DA 1KYIA 2IHYA 4L8GA 3N5CA 2ZE7A 1R8QA 3GLIB 1ZMXA 2J0SA 4Q4JA 3W3AA 3TW4A 5FPKA 2PBRA 1YZNA 4JT4A 4S35A 4B2PA 3GP8A 5BN3A 1M6NA 1XMJA 1K8RA 3QF7A 5FUXA 4DT1A 1UBCA 4D0LB 5JI2E 1IN5A 1P2SA 1G8GA 4QBFA 3FKSA 5DHAA 2ZUDA 4TL7A 3IBGA 4HLQB 2BWJA 2WV9A 4NP6A 3D7MA 1J90A 3QKRB 3BRWD 2D74A 3NH9A 4QRHA 3RDPA 4AKGA 2J3EA 3OIWA 2RHMA 1P2VA 2ZUCA 3FYHA 4KYUA 5EE9A 4LHZA 4XOIA 1Z28A 1JXMA 5F9FA 4IVPA 4HLUA 1E9BA 2YC2C 1ZNXA 1UDXA 2FV8A 3MRSA 1DOAA 3K9NA 4B75A 2RMKA 2J45A 3P20A 4F4CA 3TE6A 1CJUC 4URVR 5B64A 2QENA 4OBEA 4F4IA 1G5PA 2W0MA 2XNDA 1DBSA 2EWWA 2WWIA 2AKAB 1N6IA 1T9HA 3L0PA 1E9RA 2PZFA 3I32A 3AEZA 2ZI9A 1UBEA 1RFLA 1XEWY 3ZH9B 3U4QA 1KI2A 1P4SA 4AC9A 1XJQA 3VHLB 4F7WA 3O8RA 5TB5A 3G82C 4QL3A 1KNXA 1L2TA 2BBSA 5CDFE 1NSTA 2GTPA 4KFSA 1D2MA 3EWAA 3OIYA 4Q1AA 2OILA 3SBDA 4ACBA 4DHEA 3TW8B 4M1MA 2HJVA 4B34A 2F3RA 1R5NA 2HYDA 2YV5A 3SN6A 3TNFA 3CWQA 3Q8XB 1CS4C 2O8CA 4PR0A 3ZDQA 5E3HA 1IJFA 1RJ9B 2IHBA 2V55B 2WICA 4A6XA 3QY0A 4Y0VA 2JLUA 4G5RA 3FKSD 2O0HA 3MFYA 1AZSC 2ONKA 1X86B 2R6CA 5HTKA 4A82A 1S2MA 4V0ME 1VPLA 5BYKA 2QL6A 1OXVA 4UNQA 1DE0A 3U7EB 3THXB 1XX6A 3KKQA 4H1VA 1JB1A 4GPTA 4KITB 3B1YA 5L3QB 3OE7D 1GTVA 1T5IA 1AIPA 4CT5A 1NN0A 2JIZD 2HT1A 2W58A 5BYJA 3DKPA 1UEJA 2F1HA 4PO1A 1J99A 1P75A 1G8FA 3CX7A 3UMRA 1UKYA 4B3DA 4AYXA 4PPQA 2HUPA 2QPAA 3FHCB 2FSIA 2R6FA 3DKVA 1XEFA 3LXXA 5JZVA 1IOZA 5BW8A 1KDPA 4XD7A 3LQQA 5JJKA 4OI2A 4XTCS 1M7BA 2O5VA 2ZRGA 4RCYA 2R62A 4XTRA 4UJ3A 1E2MA 4Q1FA 1K5GA 2HCBA 3EXAA 3CONA 5AJYA 2FPKA 3Q3JB 2XITA 4U7DA 3SQWA 2JLXA 2ZREA 2RAPA 1QHNA 2ZJ2A 4IXMA 4NYMR 3ZZUA 3PITA 4Q9KA 1KI6B 4CVNA 2DFNA 2ANCA 1D8TA 5DIFA 2OESA 4KSBA 1EG7A 1K6MA 3SJZA 1UBFA 3LY5A 2WOOA 1PUIA 4L16A 4D82A 2WKRA 1NG1A 3BS4A 4QNRA 2CLSA 5EP4A 2GJSA 5HR5A 2FFBA 1NI3A 5C4GB 4BFWA 1CR1A 4NYMQ 4TN1A 2C77A 4ZDIA 1WBBA 4OQFA 1DAKA 1U0HC 2HLDA 5DISB 1G3MA 1N6NA 4Z54A 2GJ9A 1XP8A 2WZQA 4JLAA 621PA 1X8JA 1T0HB 4URZR 5FPYA 1UKZA 3W6PA 4HAYA 4FCWA 2GVZC 2UVQA 4JLKA 5KU1A 2WSSA 4NDZA 2Q9AA 4F93B 1MABA 3V4RA 1MABB 3C15C 4DB2A 1GNRA 3CLVA 3SC3A 2A5JA 2ZJBA 2IYTA 2NMVA 2ZRNA 5JEEA 4JMPA 2WIAA 4RD4A 1KGDA 1X1SA 4C3ZA 2JLYA 1I4TD 1P9WA 4TYWA 2RGCA 4LJ6A 2OAQ1 1XPRA 1U94A 3PEWA 4N3NA 1YZTA 3GLIE 1HEIA 3NC0C 4YMWA 3WMEA 2ZSBA 4TMZA 4WA7A 2WVJA 2QPOA 1FX0A 3X2SA 3NH6A 2NPIA 2K5UA 5C1BA 3FMPB 2CL6X 1JECA 4LHWA 4AY2A 1CJMA 4BEJA 3EPHA 5H8WA 3NBXX 3KXLA 2VH5R 3L0OA 2WWXA 4A2WA 4DC9A 1T3LA 2QQ0A 5EJEA 3F0TA 3P4XA 4BRWA 4QBGB 1GVNB 4O25A 1E0AA 4JSTA 2R44A 2REXB 4XVRA 1UKVY 2JATA 2NO7A 1NBMD 3BH6A 2O8FA 3DDCA 4QHTA 1CF4A 3FFBA 4Z1MD 1OXSC 3GJ3A 2VHCA 1IY0A 3GJ5A 4DLSA 3B60A 4KLZA 5L3RA 4CEJB 3DO6A 4O0MA 2Q3FA 1MO6A 3MJHA 4Q03A 2PT7A 4XWOA 2H16A 4ZI3A 2VHUA 4DLRA 821PA 4TLEA 5DNYB 4MRVA 4Q7LA 3TIFA 1U0JA 2JGNA 1C1YA 2FEOA 3THYA 3UIEA 4TT3A 2EFGA 5E95A 5FTLA 1KY2A 2A5FA 1QHSA 4BZQA 4ZCLA 4PSKA 2A78A 1GUAA 1OV4A 4V0MA 5TV2A 5JJIA 5EE5B 1OT3A 4MGIR 4YONB 2OCBA 2AR7A 1KMQA 4NHOA 1Z3IX 4NZYA 3RS2A 1ZNZA 2R9VA 2RGBA 1NMYA 4ILEA 4H9GA 4LJ7A 1SVWA 1HT2E 5LDDC 4A2PA 2HF9A 4HI0E 4PC3A 2D2FA 4LBYA 4HZUB 2BJVA 3QOFA 5FBVB 1SKYE 1QVAA 2BC9A 1LB1B 1Z0IA 2FGKA 3BK7A 3GJ4A 1CBUA 4KVAA 3ZLJA 1TU4A 2O8BB 4B6EA 1VKJA 2GZDA 2I3BA 2V4ZA 1E2PA 3KB2A 3ND8A 4I99A 2QROA 2ZVQX 3KQLA 3BB3A 1LS1A 4AURA 4BFXA 4TLAA 3KKOA 4CGZA 2QY9A 2YZ2A 1N5LA 4G0NA 3DL0A 5GVSA 1ZNYA 3MWKA 3QKSB 3K9HA 3T1TA 3MWJA 1L8QA 2YWFA 1E98A 2C95A 3E2IA 1N0WA 1XXHE 1Z2CA 1A2KC 2MSCB 2J41A 3NHBA 5EP1A 1QHYA 1KDOA 3F5FA 4M8NE 4UNRA 3CO5A 2O52A 4HATA 4EJSC 1XBTA 1Z83A 4HUQB 2WBLC 4URUR 2XNSA 2F43A 3PVSA 1QDEA 2F43B 2QMEA 2AN9A 5H70A 3R9XA 3ZVRA 3CH4B 4D4KA 3WNDA 3ADDA 1NVWQ 5EXXA 1E1QD 2VQSA 4DDTA 2XTNA 3HU1A 5BN4A 4FMBB 2FGJA 3CNOA 1DARA 4NONA 2F3TA 2ZAMA 2CVFA 3REFA 3L43A 2R65A 3WYGA 4E07A 4M1YA 4G5SA 2ZQ5A 5LD2C 5FOXA 1ZC4A 2BM0A 1VYUA 3KQHA 1II0A 1T3HA 2CK3D 4IEIA 2WWYA 3U7GA 4HDOB 3HR7A 3FHTA 4RJLA 3T61A 1KSHA 1SKQA 1N25A 1FW6A 5AK0A 5AUPB 4N0DA 3GLIA 4QGGA 4D80A 2OM2A 3I4LA 4TLBA 4B3FX 3CH5A 1G8PA 3IBYA 3RS3A 1NVXQ 3QJYA 2ZJ8A 2PZGA 1KMHA 5FTMA 1T3SA 4ZIRB 1WCV1 4O2RA 2PZEA 1N6RA 4GZLA 3AVWA 5BWMA 2MSEB 2ZUBA 2G9NA 1YZUA 2BVNA 3HU2A 1S8FA 5KHOC 2R8RA 3EIEA 4M0LA 1AQUA 4G5OA 3CRQA 4GZMA 3C16C 4LZZA 5JRZA 1P3JA 1KO5A 3ONWA 4HDQB 4NYJQ 2H5EA 1U8ZA 2JJ8A 1U98A 4LWZA 5FTKA 1W5SA 1N5IA 1N5JA 3L0SA 2IXFA 4RKEA 5AUNB 2Z6VA 2CJWB 3BD9A 3NKVA 1W48A 1WP9A 2WMOB 2FX3A 1QHXA 3VFDA 1E6CA 1RRGA 1Z6TA 2VYFA 1TQ6A 3AKYA 1XEXA 1YKSA 1VG9B 1AKYA 1Q12A 4U00A 4CT4B 2F6RA 1NIJA 2OG2A 4DSOA 4DUGA 4Q00A 1MT0A 1A82A 1ODFA 2WMNB 2CLDX 2P67A 2ZRFA 3EARA 4RCZA 1ZM2A 3H1TA 4P4SA 4MITA 4NCIA 2GBLC 4JLOA 3DHWC 3IO5A 5D3MA 2QAGC 5IK2A 3U3MA 4BFSA 2IYRA 2P6UA 2R6DA 1XB2A 2DWQA 2IL1A 4CEIA 1QHHB 3SJAA 3GCGA 1QBKC 3VNVA 3N70A 3KKPA 2OBLA 2FOLA 4NH0A 2B7BA 4DCVA 3K70C 3LA6A 3R9IA 2WJJA 2C9YA 4LYHA 3QBTA 3Q5DA 4JIMA 3B1VA 2H57A 4POAA 1H8EA 3C4JA 3CB4A 3R8CA 1R5BA 2F1IA 2F9LA 1X6VA 2QPTA 3DPUA 2BEKA 4PPNA 4ZO4A 5HZHA 4LHVA 1GZSA 2FZ4A 2GXAA 2CDNA 3PEVA 2E87A 3NIBA 3ZGXA 1U8AA 1F2UB 2GEDA 1AK2A 4AK9A 3G5UA 4QC2A 2GK7A 3TVTA 3AF0A 4RD0A 4DB4A 4JLDA 1IN7A 5IHPA 5L3QA 1XPOA 5F9HA 1GP2A 1NNEA 2KBEA 4D0GA 2OUKA 1JPNA 4GSYA 3B5JA 4PANA 2P6NA 1BOFA 1WA5A 1OKKD 2CL0X 4GRAA 4V0LA 1I4DD 2D62A 5SZIA 1JPJA 2P5SA 5LPNA 2N46A 1NP6A 5CM9C 1II8A 4TQAA 3K1JA 2BCJQ 1CJTC 1S1MA 4FCTA 5CK4A 4TMKA 3LW7A 4JT2A 4V0KA 3EZ7A 4NPHA 4B74A 2D3WA 1ZCBA 3NG1A 4BLTA 2ZE5A 5IK2D 2NOAA 1CULC 2NO0A 2WM9B 2ZI7A 3FMFA 1Z8FA 1W46A 2EQBA 3AVUA 1M2OB 1NJFA 5FPTA 1E32A 1R7RA 1E99A 1UPTA 1COWD 1Z6XA 1U8YA 2GEVA 8OHMA 3TAUA 4BLQA 1QF9A 3CF2A 2CHQA 2WSSD 3IPXA 4QXAA 5TDHA 3THOA 3FMIA 1SVLA 4NYIR 1CLUA 3PG5A 4XSGA 1TQDA 1VIYA 5H68A 4HB2A 3K70B 4KO8A 3TKLA 4WZAE 3CWZA 4OKSA 2IXGA 4TL8A 3T5DA 2IS4A 4B35A 3QPWA 5B57C 1DADA 1UEIA 2NO9A 4JYBA 1RYFA 2GJ8A 4Q4HB 3SBEA 2VP0A 1BIFA 2VEDA 1OLOA 1RRPA 4DCTA 5HCIA 2QRZA 4I1OA 5LB4A 2WJVA 2CLCX 2GJKA 3AV0B 3LO5A 3MGCA 4PAMA 1XTSA 3UK6A 5FBQB 4YXWD 1OSNA 1FTSA 1N6KA 2J5XA 3MG9A 4R98A 3I5XA 3R7WB 2CXXA 1FQJA 2ORVA 4MUAA 1K5DA 3WMGA 3PUXA 3T35A 2C03A 5KSZA 2YOGA 3H86A 4M4SA 3W9YA 2BOVA 1ZRHA 1DELA 1ZC3A 3QVVA 5DO9A 1DS6A 2WOJA 1OE0A 1IY2A 3WRYC 5FOTA 3KJGA 2YNMA 4LJAA 1WDTA 1CR0A 3BH0A 1Z06A 2R6GA 1UBGA 1COWA 2OLJA 1NL3A 1H65A 2F9MA 3K0CC 4QHSA 1JXOA 3B1WA 4Z8XA 1E9EA 2JCSA 1I2DA 1FFHA 1FX0B 1SULA 1US8A 1ZIPA 1J2JA 2ZETA 2ZJ5A 4M53A 2GJAA 4P33A 4BECA 4ERNA 3C5CA 3PCRB 2PT5A 3NEYA 3RSOA 3A37A 2J0UA 3KJHA 4LGMA 4C9BA 4FMCB 3THWB 3SR0A 1G16A 4EPVA 2DB3A 4TMXA 2IW3A 2Q3HA 1NVVR 1W36B 5KOYA 4FD2A 2C98A 2JEOA 1Z08A 4NCKA 2OZEA 2C78A 3JVUA 1R0WA 4JLBA 4OJQA 1QZXA 1R4AA 1VCMA 5DN6A 3VQTA 1XXHB 1E3MA 2O8FB 1E1RA 4IJMA 4AD8A 1XF9A 4PHTA 2ZR9A 2Y8EA 4FMCF 5K8UA 1XTQA 3RRZA 2I1QA 3AF4A 4EJSB 1G19A 1E9SA 3CX6A 2EFEB 1AS2A 4GBMA 3FE2A 3QXXA 1J8MF 3BB4A 3PJRA 4DCNA 2SHKA 1JNYA 3AVQA 2VIIA 2OLKA 2W2XA 2IYSA 5L8VA 3CNNA 4WVFA 5B30A 4JJKA 4CEHA 3FDIA 4BRUA 1N0UA 1S9HA 2P3SA 2VP9A 2ZRCA 4TYQA 2CCJA 3TGPA 2ZSDA 4OI0A 4MKHA 5J4HA 1ZYUA 2ZSFA 1EWRA 3MLEA 2BIFA 2ZR0A 4U02A 3TR5A 4MDEA 5JWHA 1DTSA 1MR3F 1IXRC 2FJUA 3U3KA 3SOPA 1V5WA 5FR2A 4FINA 1KK0A 1Q20A 3A1SA 1P5ZB 1MV5A 3RS4A 1W2HA 3D31A 5M04A 4D4MA 2R2AA 4F92B 2RGDA 221PA 3AP2A 4A8JA 4A15A 1GG2A 5SZKB 3HDTA 5KDDA 3TMKA 3LNCA 3SJBA 3X1DA 2CHGA 2OFOA 2IF2A 3NBYC 1G5RA 2J7KA 2YOFA 4JLJA 4D0NA 1OH7A 1BKDR 2NZJA 2GILA 1R5OA 1E1RD 1XCPA 1OYYA 4X8HA 1YR8A 2GNOA 1FNNA 1YRAA 3WBJA 3KTAB 1XZQA 2AXNA 1YZKA 2Z4RA 3NTUA 3QKSA 3KXIA 3VR1A 2OCYC 3A1VA 4JYCA 1SXJD 4OQNA 2JLWA 2VHTA 3PUVA 5B2ZA 3ICEA 4JVMA 5SZHB 3T15A 4E22A 1R0YA 2C9OA 4V0NA 1WMSA 2RGAA 5CLQA 2DY1A 2Z4SA 1FMJA 3AF3A 2WPDD 3AKCA 1GWNA 2PCLA 4JBYA 2J7PA 2EYUA 1M7GA 3DOEA 4UXJA 2X2EA 4TMVA 2QUZA 4FWIB 4W7SA 1ONBA 3EA0A 1XTIA 2BKUA 3TSOA 1U9IC 4PAQA 3L82B 3J81k 4IFBA 1AGPA 3VNUA 3TLXA 1ELOA 4DVGA 5FL7A 5CDFA 2FEMA 4D4JA 3QG5A 2QE7D 1F2UA 5FR1A 2EFDB 4UKDA 2BEJA 3DMNA 2BDTA 4GP7A 1DEKA 4WZBE 1CR2A 1IXZA 1KKLA 2CVHA 3SU8A 3V00A 3GLHA 3I5YA 4M21A 5EP2A 4A0RA 1LW7A 4LBZA 3QKUA 2W6JD 1T4GA 1G8YA 1Q3TA 2CMKA 3VR6A 1GRQA 1TEXA 1KMHB 2XTZA 3VMFA 2OFWA 2QEQA 4ZIRA 1ZUHA 4XVQA 4CW7A 1NF3A 1TPZA 1AQYA 1NMXA 2FH5B 2XOKA 4QHYA 1DAFA 2RKOA 4CZ2A 2FSGA 1R0XA 3BORA 2ATVA 4Q02A 1NY6A 2QP9X 3ZVNA 5J4VA 2FNAA 4KV9A 3RRNA 3RANA 1T8UA 3O8BA 2GK6A 2VA8A 1EGAA 5KSYA 1CP2A 2N1BA 3OESA 1UM8A 2B6HA 2RH5A 3B9QA 4IDOA 4LJ8A 1FTNA 3K53A 3A4NA 4GNKA 4B2LA 4BFTA 5KSOA 3GFPA 1YR6A 2P2LA 1TAGA 4YMUA 4ABYA 2YWGA 1I4LD 1S1CA 3PV0A 1LV7A 1VCNA 4PO8A 4YMTA 3BC1A 4V02A 5LD2B 3GEEA 4TSFD 1QHGA 3AF2A 3UKDA 3U6BA 1GNQA 1TF5A 2N42A 1U9IA 1W36D 3GJXC 2JDID 3LQRA 5FL7D 3QEOA 4I1VA 4XIGS 3T1OA 3IEUA 2KJQA 3HPQA 3UANA 3A36A 3ZZ0A 4C0SA 1LF5A 2ANBA 1CKEA 1SVMA 2V8OA 1Z22A 4CEIB 5JEDA 2ZS7A 1YJ5A 3RAPR 2EFCB 3R7WA 1R10A 2C99A 4N1AA 2ZVPX 3GJ0A 4A1FA 4Q4AA 3S1AB 3VHXA 3NBFA 1W47A 5JHHB 4GFDA 5TMPA 4M1WA 4BEBA 2NO6A 4IW3B 4K46A 3AUXA 4DXAA 2OFXA 1CR4A 1KIMA 2Z5FA 4Q21A 5KTYA 4IRUB 4QGHA 1NKSA 1ZNWA 4LYFA 3BWDD 3JVVA 1GRNA 3T1VA 4HAUA 1UKEA 3GMTA 1NBMA 2ZROA 2J0VA 4KSCA 1IN8A 2CE2X 4PZLA 4ESHA 1VCOA 4PZZA 3W5JA 3G0HA 2WWGA 1JR3A 3IQXA 3FKQA 4BZPA 3BERA 5CK5A 1FMLA 2Q21A 2V7QA 5EQTA 3W8NA 4GDFA 4EDHA 4HSEA 2NZ8A 2X2FA 3DM5A 3QQ5A 4C30A 2GA8A 2P65A 2GHIA 3RS7A 2OXCA 3T1QA 5JS7A 4BLOA 3ZQ6A 4I1SA 5KPDA 3ETLA 4HLDA 1W0KA 3HYTA 1B0UA 1ZU5A 3MCAA 3RYTC 1HE1C 1IAQA 2ZRPA 2ZE8A 2OHFA 1XU4A 4D4LA 3AVPA 2O8CB 5JHGB 2AK2A 3WRXC 2IYXA 3RWMB 2IUSA 2B21A 1D5CA 5DI9A 2IEYA 2FN4A 5DYIA 1M1YE 2ZYTX 1EFHA 2JA1A 3P27A 1SVSA 1E2QA 3BFKA 1SXJB 5EUMA 4EFLA 4AIIA 4RFVA 5HPYB 3AVOA 4IOLA 3TK1A 2ZJOA 4MA4A 1L4YA 5KSPA 3LFUA 1TNDA 4LUCA 1V43A 4PC1A 3OEHA 4JLMA 1D6JA 1Q0UA 3EZ6A 1KI8A 2JJ1D 4QJ5A 3VTKA 2QT0A 1KI4A 3LLUA 4IDNA 2J9RA 2V7QD 3CIOA 1E1QA 3BFXA 1E2IA 3EZFA 1G64A 3WHKA 4BFVA 1RVDA 1QHIA 3SI7A 5B58C 2O8EB 2VP6A 4A8JB 2GXSA 5JSZB 1VDZA 2DFLA 2DWOA 3CF0A 4LPKA 2ZRLA 3R8FA 2IYYA 4LJYA 4BFZA 3NEJA 1CIPA 1J70A 1UAAA 1E79A 2BCGY 1TUEA 4PPGA 1WBDA 1DAIA 1ZM9A 4KJZA 2ONJA 3ADCA 3AM1A 5BQ5A 3EPJA 1CJKC 4URYR 5EZ5A 2YINC 1U99A 2ODNA 1AKEA 1R2QA 2FFQA 1CRPA 2V6JA 2YC4C 4I4LA 3PENA 4J0QA 1DG1G 2BMJA 2H7VA 4QM6A 3VR3A 2WHXA 4EFNA 5JECA 2G0TA 1XEXB 4K8OA 4CYMA 3CRVA 3X1YA 1CTQA 5JCZA 1BS1A 2IK8A 1R6BX 1EESA 3ZVLA 3U4QB 2W2VA 3KFVA 3LX8A 3X1WA 2GCNA 1TTTA 3MD0A 3K09C 5K8TA 2NO1A 1EFRA 2QTFA 4TWZA 3C8UA 1HA3A 2JASA 4BWYA 3B1XA 4JVNA 1YR7A 2QP3A 4M2LA 4V0OA 2ASEA 3BAFA 2JJ1A 1QHHA 1JAHA 2DBYA 4EQ6A 2X8AA 1OFTA 1EX6A 2QG6A 3KJIA 2LKCA 1F5NA 4GL2A 3W6NA 3GLFE 4B6FA 2LKDA 1VG0B 3EWSA 1SXJC 1PZNA 3OFND 2XZPA 2V3CC 4Q7KA 4NU0A 3GEIA 5H1YA 3RLFA 3B78A 1W1WA 1YR9A 1PLLA 3VX4A 1JJVA 1G3UA 4QNMA 2VTKA 1N5KA 3U44A 3TRFA 1XMSA 2ZJAA 3K8YA 3ZIAD 4EIWA 3ZQJA 4RVCA 1SHZA 4MYTA 4RSGA 3Q72A 4PXAA 4MYHA 2ZXUA 1TL7C 2R6AA 3GEHA 2IX3A 4H1UA 4LI0A 3AP1A 2CHVA 5DYGA 2XNDD 1LNZA 2IYZA 1XJ0A 3L8YA 1VTKA 1DAEA 1WE2A 3WYFA 3AVTA 2QN6A 2WIBA 3L2OB 3NWJA 4MRPA 1XMVA 1WB9A 3TUIC 4JKIA 5JI3E 4A9AA 2V1XA 1WXQA 1XRJA 4TMTA 1T6NA 4V03A 2RB4A 1TU3A 3UG7A 3C14C 2VP2A 4Q18A 1NLZA 1RW4A 4C7OA 1PLJA 4KVGA 4K81B 4HYYA 4XJXA 2GBLA 1JR3E 4E03A 4HLCA 1IM2A 2ZPTX 1EFTA 2ERYA 2IS2A 1AGRA 4EJSA 3R9WA 2KSQA 2J7PD 4URXR 3HU3A 1KSGA 3CX8A 4Q1BA 4C2TA 1OB5A 1VG8A 3QUSA 4A4DA 1GILA 4DUGD 3U5ZB 4Q1CA 2PEZA 2XXAB 1L4UA 1NIPA 2FSFA 4QBIA 2C5LA 1XZPA 1T0JB 4IVRA 3QEJA 4PPFA 1L7VC 3AB3A 4PC6A 1OHHA 1ZD8A 1XTRA 1Q1ZA 3REGA 5EUQB 3AKEA 4A6PA 4O3MA 4LV5B 4N0EA 3QXSA 1OXUA 3CRMA 2Q9CA 4LPSA 4D2IA 2EYQA 1KO7A 4EPYA 1NMZA 2PMKA 4M1TA 5G3YA 1AA9A 2IUTA 4XH9B 5J47A 3LBNA 3ZS8A 4Q4AB 2PLRA 1DO0A 1I2MA 3S1AA 3DOFA 2PEYA 3I3SR 4ZKEA 4DLVA 3N2EA 4HAZA 4RFSB 3K0FA 4RFSA 2H17A 2J46A 3SDZA 2Q3MA 1KJYA 3K0EA 3K0FB 3WHLA 4DCSA 3E1SA 4D81A 4TZ0A 1YQTA 4HEJA 1AM4D 5GJVC 4QJ3A 1OYWA 3MJRA 1X8LA 3AGPA 3BXZA 3D8BA 3R20A 4G3XA 4X8MA 1HV8A 1KDRA 4B33A 4OQXA 3IILA 3M4YA 2RGNC 3CW2A 1E2KA 3QI2A 5AR1A 4C0JA 2PX3A 1J8YF 4DLXA 1KOFA 2BV3A 5FBLB 3W6OA 2J59A 1II9A 2BMDA 4OL0A 3QG1A 2YYZA 1ZM3A 2QTVB 1E69A 1Z6AA 3NVAA 2BHRA 3DMDA 1NRJB 4TQ9A 1NLFA 3OF5A 1QVRA 4IXNA 2WKPA 2QAJA 1ZUNB 1GNPA 2IXEA 1VECA 2FFAA 2P0EA 4PC2A 3GFOA 3CR8A 4QG7A 3EX7C 4DEYA 4C0BA 5GJWC 2ZRAA 4DRZA 2OE2A 5C46F 2CCKA 4LC1A 5ELXA 3ZD6A 2WAXA 2V6IA 2RGNA 2ZI6A 4LYAA 5FL3A 4DSTA 3VX3A 2C04A 1NJGA 1DVRA 4NBSA 1E4YA 2WJGA 2WJIA 4QGAA 4LHYA 4ITRC 4JL8A 5JBQA 3KZ1E 1EX7A 2QI9C 1KHTA 2OO7A 3RWOA 4GMXA 4YLGA 1OW3B 1ZM7A 4B3CA 4Q66C 4BGDA 3EASA 3FOZA 2OCAA 5E4FA 4EPTA 4G1UC 4QFMA 5CB6A 4PX9A 2D7DA 1E0SA 3CZPA 1RPZA 1IXSB 2ZU0C 1G9XA 1RE0A 4HB0A 4WOPA 4DDVA 1NVUQ 5FH9A 1FP7A 1D9XA 1S96A 3LV8A 3GLFA 1FL9A 3IIKA 2UZ3A 2W83A 3I72A 4BQSA 1ETUA 4B48A 1Z07A 2FG5A 3EC1A 5HZKA 2VP5A 1KI9A 1AN0A 4BFUA 3OFNA 2ZTSA 4LOAA 4HAVA 5FOWA 3C41J 1G3IA 4UNNA 1TUIA 1HQCA 1G5TA 2GDJA 3KXKA 2AWNA 3I61A 2VSXA 4ZCIA 1A7JA 3WYAA 1FOEB 4DSNA 2BMFA 1W0KD 2GZHA 4PAOA 3ZIAA 4LYJA 2JJ2A 3GQBA 5KNCA 1TF7A 5HE8A 4PO9A 1VYTA 2NGRA 4OYHA 1B23P 5FI1B 4GOXA 3IPYA 5KO2A 4ZV4A 3IIJA 3QVUA 2EW1A 1GKUB 4A8JC 2VHQA 3TR0A 5CITA 3QPUA 3TSZA 5E7IA 1FQKA 2ZRBA 3BH7A 2A30A 1G7TA 4L4UA 4HUTA 1XTKA 2ZU6A 1KO1A 3KQNA 4TLCA 4FWTA 2IYVA 3I8SA 4KHZA 2XSZD 3FFAA 2WKQA 1Z2AA 2DFKB 5GADl 4B73A 1RRFA 1HH4A 5BN5A 1DG3A 5F98A 3H0KA 5JFGA 4DLWA 2QA5A 2YOHA 1HT1E 1SHKA 2F1JA 4XSHA 4B71A 4OHVA 4Q4JB 2BJWA 1P62B 3HR8A 4EQ6B 4OHYA 1LFDB 3OIVA 2L0XA 5TVKA 1X3SA 4YQFA 4FMDB 4PSAA 1P61B 3V4FA 3GFTA 2WWWA 1MOZA 1W4BA 5HCNA 1TF2A 2UZIR 3OIUA 1MKYA 1YE8A 4ARZA 4EKDA 2G1KA 2DPXA 2GWHA 4FXPA 2F7SA 1E96A 4RKFA 2ZI4A
chains in the Genus database with same CATH superfamily
5EIWA 3OZIA 4OXKA 4IVQA 2GLUA 4JBWA 4DWOA 4GYKA 3D2LA 2G6TA 1VPEA 2EBFX 2W4MA 3ZE8A 5GZ3A 3IE1A 1FFAA 1KTVA 2UYHA 3SF8A 3VJKA 2BFWA 3RS9A 3OZRA 4I81A 1EK0A 4M0UA 4OMUA 3C6KA 2DETA 2R1TB 1ZRMA 2FN9A 1F6WA 3DAYA 1ZVQA 2QRNA 3ET4A 5KNDD 1II8B 3AFHA 1KVQA 2A0WA 1YKGA 2GB4A 4MKFA 3UWMA 3TSWA 3WL5A 4RDIA 4ERXA 4INOA 2QXUA 3GVPA 3KEGA 3RHZA 4BXOB 1YA4A 1D07A 2O2XA 1CDEA 1ZHHA 3EZ9A 3WKDA 1E4EA 4B47A 1YHNA 2VDJA 4UMFA 5JPIA 3WQQA 3QEMA 4F2HA 2G82A 2NTYC 2HJGA 3VOTA 1PR2A 3CIFA 5TMEA 4QEZA 3H4MA 3U3XA 1LSOA 3AX6A 3GBVA 3CEPB 1YI1A 3INTA 1YS4A 3CPJB 4KNVA 1NXSA 2DCUA 3IE0A 3CY6A 4RX1A 3IMFA 2PAFA 4PTZA 2HW8A 3WSVA 3ZS9A 5CJ2A 1LSJA 1RVV1 2XLCA 3SVLA 3IP3A 1QKJA 3ZTTA 4IMJB 4YAIA 4P93A 4KKVA 5HVNA 3B20A 3UM9A 3A6EA 5FULA 3CZ4A 1J0EA 3L6DA 2WUDA 2HIAA 4NV0A 5DGCA 4QZVA 2IPAB 2AX4A 4F6CA 2H18A 4MP3A 3T12A 1KKMA 1Z73A 3ECCA 3Q7EA 3I12A 4Y6OA 5EWMA 4Z0HO 5JANA 4HX9A 3Q9LA 4B43A 1O54A 3TE7A 3AHDA 5SYNA 3K0AA 3V97A 4IM7A 1CQJB 1GT6A 3EXHC 2FW6A 3G9ZA 4ENVA 1FK8A 4AVYA 1Z63A 1P80A 2W6JA 3KHUA 4S04A 1M33A 3H2YA 1P6UA 5CVEA 1CUAA 1GITA 4GKJB 2V7WA 3L8FA 4L72A 1X7GA 1MEEA 3N8HA 5A6VA 2P6PA 2B5OA 3OWOA 4OQEA 3I9V1 1NSFA 1SHLA 2AR9A 1B0AA 3NP7A 3V4OA 2V3VA 3RC9A 4EG5A 2EJTA 4YV7A 3WWYA 3PHCA 1R37A 5L7WA 3E9RA 1JG7A 1UKBA 2WM2A 3HA5A 3EGWA 3LDFA 3K5HA 3NUQA 4LX0A 3GAZA 5CURA 5DMHA 1P7CA 1QP8A 4WZBA 2CJYA 4WOBA 2O8DA 1ZD1A 1W4CA 5JAUA 2V0GA 2G8NA 3PC2A 1CUZA 1YDHA 3IOEA 2G1JA 1HURA 3N6VA 1X80A 5A7GA 2D13A 3AMVA 3DGFC 4UCFA 5T4FA 2XW6A 2BM9A 2NU7A 1HDXA 3GJQA 1SMKA 1YONA 4PY2A 2OENG 2ODTX 2G7ZA 3JQAB 4J4HA 4UHCA 3BB1A 2PD4A 3OOWA 4MVJA 1B74A 2CXPA 3R3YA 1RRCA 3NJRA 3Q5EA 4AKEA 1PFGA 1WDLA 1Y63A 2PBFA 2G9QA 5CX1A 3ER9A 4QAJA 1DQRA 2AJCA 3HBNA 2OK8A 4O4LB 3HA3A 5DHRA 4CF6A 3INGA 2XQFA 2EOAA 3HJHA 4A8PA 4JKOA 1LX6A 2YWBA 2IUUA 1KFCB 2C8VA 3DZ8A 3UG6A 1SQ5A 3P9CA 4PTYA 3W5IA 3VTZA 4IXTA 1T6ZA 4MWBA 3OHMA 1FJ2A 2WF7A 1GFIA 1NVFA 3L6BA 2WTMA 3A58B 3Q3VA 3QU5A 2UU9B 1ZK1A 3PPWA 4WADA 2JHAA 2I8AA 4UQLA 4PIVA 2XRYA 3RHTA 5CIQA 1G7CA 2QM7A 1L8XA 4R2XA 4A0GA 2HK9A 2ONZA 3G88A 4EJMA 2CE7A 1K1EA 3OCVA 5KIAA 3PK0A 5SZJA 1XGKA 4CMAA 1EFUA 2WABA 2X41A 3U2QA 2B4AA 1JP7A 3DYBA 4YP7A 2JDIA 1Z29A 3Q0EA 5IDVA 4RZ3A 1HZZC 4J29A 2DGDA 1ZP6A 3EA4A 3U44B 4FMDF 3F2VA 4JQOA 5B4TA 5FOVA 3EVBA 2XB4A 4QPPA 4KUHA 2CFTA 3GJ8A 4YASA 3IJEB 3QBVA 1P2FA 2BGMA 3A9WA 4GP6A 1Y0BA 3M6UA 4GGPA 2VO1A 3TJMA 3RFTA 3ZCSA 3MTBA 4G0QA 2BGWA 5FQNA 1HMPA 5LSAA 3DFMA 5AKGA 5HE9A 1NPTO 2ODBA 3AFOA 3QE3A 4Q6WA 2A0UA 4EW6A 2YWHA 3KSZO 4HD8A 3B9BA 3PNBA 2Y05A 1MVNA 4TUYA 4R84A 1QU3A 4B79A 1ONSA 1ENZA 1T1IA 4PCVA 1ZU4A 2G8LA 1XZ8A 2FLVA 4UBOA 4DIEA 1YMUA 3DWIA 1RZVA 3E7PA 2WAAA 4S1TA 2PUEA 4PAWA 4TMWA 4QOSA 3E53A 2Z1NA 2E5LB 1X9GA 3MPOA 1BHJA 4DZZA 1T9GR 4U2DA 2H51A 2G6BA 3E9MA 3TZLA 4BLRA 2PGLA 4DCGA 2OY0A 2A5DA 4WLVA 3LX5A 4DWJA 4YAGA 3EISA 5BWBA 4URFA 1FUUA 1JR3D 3ASYA 4AG5A 1C2TA 4YRPA 1SUDA 3GBSA 4IUCS 4BFLA 3O4GA 1UP6A 1NTOA 4M9XA 2HN9A 1ZMBA 5KNDA 1T0IA 3N2GA 4AJKA 2AXQA 3O8OA 4ZDKA 5ERYA 4ND5A 4AMBA 2SECE 2DKOA 5IRCD 1ECCA 1XZJA 2H2FA 3MA0A 3DKRA 3HSKA 1RLJA 2JFXA 1R6TA 5BN5B 5AM3A 3L6OO 4IO1A 3WLJA 1QDLB 1SKBA 2GM5A 2QG4A 1GYPA 5E6RB 3KSMA 1QYVA 2AUTA 2MMCA 4MH0R 4M49A 5KJEA 1V5GA 3IOYA 4HDMA 1W5TA 2I1VB 3BFVA 1E7SA 2IA5A 2XBLA 4KTVE 4COKA 1U4SA 2XF2A 2HDNB 1MJ5A 5B6JA 1KORA 3LYLA 4RF3A 1PS0A 5JE8A 3PGKA 4D8VA 1NYRA 2OSBA 3K73O 5ITZB 5AVYA 2JGEA 4YCDA 3EDYA 1K5PA 2ZEJA 1HTTA 4B3SB 1EVKA 5TEVA 3VUFA 3F8TA 3NBMA 1E2NA 4UQOA 2FW0A 4FFSA 4YECA 3CZQA 5E8JA 1EIWA 4AZVA 1IG0A 1EDEA 4KAJA 1ZG3A 4JBLA 5A3RA 1ZIOA 1RZUA 2IPLA 1YZQA 3FGZA 3KTOA 5G3ZA 5IVIA 5I7UA 1F38A 1PJCA 3E8MA 4GMDA 2X0EA 3ZCRA 3HVKA 1C1DB 2A0KA 4ASUA 1C1XB 3UPUA 3ZY2A 4IEFB 3HJTA 4KK4A 4EGSA 2C3PA 1RDFA 3H1PA 1FDTA 3S8MA 2ZRDA 4OF4A 2C94A 3ZY5A 1F7VA 4O2BF 2X7XA 4R0MA 5DNEA 4TTQA 1PUJA 1H2BA 5EMHA 3URMA 3E2PA 3NOXA 3MMXA 4W5JA 3CNLA 3KDAA 2OZKA 3GK3A 5DNVA 2FEAA 1ZI6A 2MSDB 2WINI 5ALTA 4F1WA 1DRKA 1LLQA 3GRCA 2AFVA 1W88B 1KQ3A 5JNUA 3FMOB 4KO2S 1UT8A 1E0KA 1OPXA 2D5LA 3TD2A 5T4BA 1PWHA 4JJFA 6AT1A 3MWEB 3AKDA 2NU8B 1QC5A 1X92A 2ORYA 1PJSA 1GLGA 3R7AA 1A04A 1BMFA 1HFKA 4JWTA 4TKUB 3WISA 1QM5A 2BFBA 3P9KA 3L0YA 4EHAA 2PO7A 3LBHA 5L95A 3O8CA 4H18A 2VUTA 2UZAA 5K3AA 2D2EA 1SJ9A 2HGZA 4UOEA 4FVTA 4PVCA 4QM7A 4ODIA 1DQPA 3Q7QA 4B3BA 3PRJA 4HSGA 4TZKA 4KGDA 4TKVA 3BWBA 4EJ2A 3MGKA 5JAMA 3OUTA 4W1SA 4DLAA 4ETNA 2JGMA 2ODEA 2XXAA 1EUCB 1EQAA 3K2IA 3P9RA 1NJSA 2YW9A 4KMMA 4TXNA 1OWOA 5ICFA 3FYUA 1F2VA 2A9KA 4KQEA 4M9QA 3I73A 4YJ2B 4ZTZB 5H5JA 4LDNA 5IX8A 4QAQA 1IY1A 4P82A 3C24A 2WC1A 3VTFA 4M3NA 3K0AB 3IL2A 2CFOA 2J32A 4LF6B 2P8JA 1JQKA 3PFFA 4OIFA 3SYMA 3RYCA 3FCAA 3STYA 1MPTA 3PHJA 4Q47A 4R1LA 2HMWA 4KN6A 5E9AA 5FI0B 4BV8A 3HZHA 3V1MA 2I65A 1GL9B 2NT4A 1MDFA 3F5QA 5CRIA 1B16A 4X20B 3PXGA 3AEKA 3SQXA 1K08A 2EATA 3KB8A 3UJCA 2I76A 4BN5A 3MQ4A 1TM7E 2WTBA 2KE5A 4EM6A 4PS1A 3PDIA 3WXBA 5L3SB 4BTVA 3LDAA 1GM5A 4R8RA 3SYNA 4BLVA 5LWQA 1PZFA 3E48A 4ND2A 1X1TA 4HB4A 2AF4C 2WSMA 2GHTA 3K9QO 1L4HA 1QIGA 1C9YA 1Z82A 4US1R 1HE4A 4N47A 1I9CA 1SXHA 4TTSA 5JYEA 3COJA 4UCWA 1P91A 1I4EB 1Y1SA 1NKTA 1RNLA 1JEEA 1TVKB 2LW7A 1OJ7A 3HE3A 3EVGA 4DLZA 5LDGA 1LUAA 3E23A 1RHJA 4AXXA 4LRUA 4FZVA 4OXYA 3VNQA 2FZ5A 5AJHA 1YZ3A 3NORA 4IL5A 4NARA 1OFIA 3ABZA 4NTZA 4P0TA 4R1PA 5C2JB 1KIFA 1U2EA 1JLHA 3FPFA 3NTXA 1FZQA 3OEED 3A4LA 2AF3C 4MJ3A 1HE8B 4B76A 5G41A 2XZOA 4DLUA 5ALEA 1OPRA 1KK2A 4NENB 2ZITA 4E3ZA 1KQGA 5EUBA 1E2HA 5JS8A 3L9WA 3II6X 3T3EA 2C07A 2W71A 4ESEA 3COYA 4RSHA 2VXCA 3RVRA 2CL5A 4IDHA 5C3UA 2D06A 2VUSA 1WZ2A 3MMNA 4JT8A 5L40A 4OY3A 4LDZA 2FR1A 4RZXA 3PDWA 1UJCA 3L1UA 2ZE6A 4OA5A 1C7JA 2QLJA 2NSLA 3ESCA 3HI4A 3RAJA 1W36C 4ZPJA 1Y1PA 1JTEA 4H0FA 1SVUA 2BKVA 3L7BA 4KOAA 5JLJA 2WTUA 1IONA 3O90A 4JBXA 2JIPA 2UKDA 2ZSHA 2XEDA 5H3LA 3W1EA 4I2NA 4B40A 4O4IB 1TDJA 2XJ4A 5B4VA 3EQ6A 4LBWA 5ANRB 4MPDA 1VYHA 2QLLA 1ESCA 2Z3ZA 1CVIA 1C30A 4WFQA 4BNVA 1HNZB 4YLYA 5IMBA 5FOSA 4QVKA 2CVOA 3FI9A 3V7WA 1L7PA 3OJ0A 3D81A 1W4RA 3EA5A 2Z43A 4OHXA 2OXTA 1V8BA 4BMVA 4ESVA 2IYNA 4R01A 3THSA 3GLHE 1U80A 3I2YX 3W7VA 3RM3A 2OFPA 2YQ4A 5FQOA 2JFFA 4G5GA 5FFNA 4KXMA 4LC0A 5BSMA 1MFPA 5AI8A 2YUTA 4KQFA 5EY5B 2PXCA 5D1NA 4HC4A 5K3CA 4E5UA 1N2EA 3Q4GA 3CLRD 4HWRA 2BEWA 4OQLA 4LHSA 1YBMA 3BREA 4YUZA 3LG2A 5CLHA 5DI3B 3CNBA 1P73A 1KAMA 3RO7A 3ZU5A 3FPLA 1Z4PX 2GKOA 1BA2A 2FHPA 1FNBA 2PH1A 4DBLC 4MW5A 3PGJA 1V7CA 2FKNA 2C1EA 2Z1DA 4LA4A 4R68A 4ASUD 4BNXA 5J1SB 2QX6A 1F8YA 5JU6A 1U2ZA 2C9MA 3WJ7A 3OQMA 4LDQA 2IHTA 5AK6A 3E1GA 4WNCA 1MCZA 3DXYA 1NV9A 1ZXBA 1MAHA 2H8GA 2EWVA 2YASA 4HJXA 4NEHB 4YRQA 5CLJA 1U4NA 5IBPA 2H11A 4Y2HA 3OTIA 3OT1A 2Z8XA 4RTLA 3AKZA 3MHTA 2BBOA 2X58A 4O4HF 2J0UB 3KUDA 3YASA 3ZZTA 4IKEA 5A04A 1U2GA 1JQLB 2QUKA 1V5FA 1RHRA 4QPZA 4ZXPA 3RAFC 4P7BA 1OGYA 3K71B 3ZYCA 2WYOA 2H1OA 1Z0KA 2QGFA 4IGEA 1NJ6A 4JVOA 3LC1O 3KR0A 1F4VA 3N2LA 4I3GA 4ZREA 1SIWA 1H69A 2BE7A 4EO9A 4RQAA 1SFRA 3AQ4A 3W5CA 1ZVKA 1LI5A 2PUWA 2DR2A 3FTDA 3H65A 2QD2A 3U61B 4ISBA 2G72A 1DRUA 5C8YF 1SCBA 4E09A 4BLPA 2X19A 5DYWA 5IVHA 4ND7A 3CR7A 2C3OA 4BNZA 2PRKA 1MO4A 1X1AA 1RJ9A 5AWFC 3O83A 5K0TA 5DNDA 1FNCA 4RWEA 4TLDA 5EYPB 4FYIA 4QO8A 1XTZA 2QV7A 4L75A 4FMPA 4C76A 2PX0A 5KWIA 1Q1BA 4GUDA 3ZXIA 2V5AA 2ZSEA 4WCFC 1SXJA 5ECDA 3VYTB 3MZ0A 4P4TA 3TNYA 3S70A 1ABBA 1PVVA 1GGJA 4OQ4A 3R7NA 5F9MA 4LF9B 3GHYA 1VQ1A 3I37X 5T57A 1BFDA 1N1MA 1PU2A 4XX0A 4A2QA 3MMPA 3G2PA 2KI5A 3FPCA 3K6JA 1OLSB 1GL6A 4BWVA 2XB2A 1J0AA 1IWPB 2IE8A 4MWZA 1ISFA 3D7NA 5TS2A 2WAOA 5C3MA 3MEQA 3IDFA 1BE1A 2VCEA 2W4QA 3MGBA 3HJNA 3PIRA 1QTIA 1U3CA 4C4XA 4ZDWA 3W04A 1NVDA 2IW1A 3DTVA 3I92A 2R00C 3FWYA 4J7AA 1DCFA 3NDPA 1ST2A 3RVBA 3UAOA 4EUNA 4HRXA 1XQ9A 2QN1A 3M6VA 5DBEX 4INAA 4RO0A 1H4TA 1DJOA 1NR7A 5KVQA 3MWLA 3VR0A 1P0PA 4AYTA 2RAVA 1WXGA 1Z18A 1T91A 1XCGB 3HN2A 3Q6MA 4B7UA 5AESA 1SXJE 1X7XA 4LVUA 2NYVA 3ZVMA 1MIOB 1TE2A 2W11A 5BYBA 2CXTA 3TS1A 1YJXA 2IU3A 3MD9A 4E2XA 1R5JA 3ZGYA 1XTVA 2J3HA 1E3IA 5BP7A 4U6SA 3D6TB 1W8DA 4Y67A 1XXHA 5LUBA 2X0KA 1HPLA 2H5JA 4F4HA 4ER5A 1OIVA 5CYPA 1W0CA 3DB2A 2C2HA 2FPWA 2R84A 4J9UE 5H9VA 2ICAA 3A7DA 3N2KB 4FDAA 1RXVA 3GPCA 1SA0B 1W29A 3WP0A 3HJAA 4FSDA 1ODSA 5DB4A 3TMYA 5EG5A 1WOMA 2B82A 2AYYA 4DIDA 4PZYA 5BN1A 2YV4A 2IYUA 5AM1A 1PR3A 2IV2X 2XOKD 4A6PA 3UQYS 2O06A 4MGKR 1KY3A 1PX2A 2PGDA 1N92A 4ON9A 4E51A 1G38A 3NR2A 3LCJA 1ZIDA 3AUYA 3ORSA 4JD5A 1IBMB 3MWFA 2HMTA 5H16A 3U3OA 4AF8A 1M1UA 1G21B 1NOIA 2HCFA 4B8YA 4EKEA 1TTPB 1EVLA 2Z6UA 2ON6A 4ALLA 1FSPA 2XIJA 4NICA 4TXMA 2ZYWX 3LCCA 1M8PA 5EWJB 3SHOA 3UH1A 1RHKA 1PGPA 3OZXA 5CEFA 4MWOA 1XD2B 4H17A 2AKEA 3JXEA 5FWYA 2MHCA 4U5XA 4QUJA 5DMXA 5J1TB 1OMOA 4EY7A 1LLUA 1YZLA 2WA2A 1ECJA 3G1TA 1ACLA 2FWMX 3HO6A 3LO8A 4QUIA 4W5HA 4QUGA 4F38A 3ENWA 4QXQA 4JB8A 4I55F 4MK4A 2R4UA 2JGKA 2G0AA 2R25B 4U5QA 5MN6A 1E6KA 1NMQA 3UJDA 1VMAA 3ZHOA 4GD3Q 2HQBA 2PX4A 1OTXA 1Y3AA 4JQCA 2B69A 3RIEA 3SR4A 4CMHA 2REOA 2VRBA 1XTJA 1L3IA 3T5GA 2NPOA 3BSFA 4CM9A 4J0GA 2XQIA 1SWWA 3KXPA 1BXRB 1DB3A 5I7HA 1BVYF 2BI4A 2Y9PB 3PI6A 1BZYA 2WHPB 2ZJZA 4LWPA 1PGQA 2EGGA 3QVTA 4L08A 4D9GA 3R4CA 2QM0A 2QVBA 3A6FA 4X6UA 5KWSA 3OAAA 4MB0A 2ZQYA 3WWPA 1US8B 2C54A 4KFRA 2EFHB 4WKOA 5BV7A 4K8RB 6GPBA 4ZEXA 1S3SA 3OPYA 4C7JA 4CODB 5CX1B 2WHEA 4X62B 1U0TA 1OIWA 2ODAA 4KU4A 3IIEA 5HGXA 4EFMA 1Z7EA 1GTJ1 1YGPA 4FC7A 4N4AA 5FBWB 1E3WB 1U3TA 2VDWA 3GARA 4LE0A 5FBRB 3HUDA 3HDQA 4HNGA 3GJ6A 3RUDA 1U81A 4HUQA 4X8LA 3GMIA 3ZXXA 1XTBA 3GGCA 3PFNA 4A0QA 2WQ7A 1DFIA 4XGIA 1BMTA 3COZA 4HXFB 1WG8A 2NAPA 4C6TA 1UXGA 5KQSA 3WZMA 1MRNA 2NVBA 2ST1A 5F3DA 5ICMA 5J43A 1LNSA 5F1PA 2X0DA 3ILVA 3JZMA 4IEEA 4MQBA 3GPLA 1LLFA 4LYYA 2CB9A 4MVJD 4X85A 1N4AA 3WGOA 5ILOA 3RUIA 4INPA 4O4IF 3UFXB 1Q22A 3ASVA 3AYZB 1EAMA 3O2JA 5HILA 2GPYA 1OH6A 2A5YB 1P9LA 4EPRA 4NKRA 3E81A 5IJXA 3A6PC 3DLCA 4LMPA 3H99A 4PICA 1E9CA 1ND5A 1ESEA 3F8SA 4LXTA 1YBVA 4RE5A 5K8LA 5C5IA 2YKGA 3RABA 4A8HA 2P3LA 3CLUC 1AUPA 2QGZA 4K5QA 1RXUA 1WUIS 4TKLA 1VOTA 3GD5A 5JCPA 1ZGZA 1VGQA 3PTLA 2QYTA 4CIYA 4CCAA 1KE2A 3E5HA 2PV7A 3F9CA 5LUAA 3JQBC 2JGLA 1W0JA 4G0YA 4NCJA 4OGKA 1HC7A 4RACA 3VC3A 1F2TB 5KBYA 3BL6A 4IY1A 1IBLB 2C4VA 1A1VA 3JZAA 3BXFA 3ZNPA 3MHPA 5HSGA 3UXHA 4ABTA 4DBZA 2UXCB 3LPMA 4PBSA 1AC5A 1NUUA 2GKSA 2IF0A 3LPAA 4MTCA 4LSZA 3OPYI 5ENDA 3IV7A 2RGEA 1XPUA 3H9UA 1NWCA 1TO6A 4FOSA 4YRJA 1E94E 3ICVA 2DZDA 1Z34A 5JBNA 4LJ4A 3HVJA 1EK1A 1ZD9A 1ZINA 4EPXA 2FDXA 1I3NA 2DUNA 4GXQA 4M22A 1YRWA 1RMYA 2QYHA 4EY3A 1PFQA 3DHNA 2C1XA 4N5HX 4ZYXA 4MHTA 4KRFA 5GVRA 3DEFA 3JY6A 3QV2A 5BNFA 1PIWA 4FEEA 5JXJA 4YRSA 3RJZA 5FPSA 2XCUA 5JD3A 2ZVJA 3DYIA 3K0SA 1N8SA 4XGNA 1M8FA 1UMCA 4GEGA 4FC6A 2FB9A 2G9ZA 2HSWA 2W6IA 1IOVA 1ESNA 1MMFB 2D0PB 1EQ2A 4MUFA 3ZXSA 2QTRA 1SVKA 3BJZA 3RRBA 2REBA 4H60A 3VH4A 4MRSA 5HDBB 2CZCA 1JDJA 2JCYA 4OM7A 1Y6JA 2B34A 4QECA 4NOMA 4BO9A 4AAYA 1DC6A 2B25A 3TTVA 4GRDA 5CYOA 2FMTA 5CCDA 5B7PA 2QP4A 4HGPA 3W2HA 1GRRA 1VE5A 1ZW6A 5ESRA 2HCRA 3CZCA 1L7MA 1Q6YA 2C96A 1E2JA 2HXSA 4K6OA 4EYGA 2H31A 1I2BA 1QGOA 1UDCA 2ECKA 3E9DA 4UE6A 4IWNA 5C7IO 3V6MA 2H65A 1I2ZA 1QE3A 2NW6A 3DBLB 1OIXA 3KQUA 5L4NA 3BHIA 2BUCA 1ORRA 4GOMD 2JKYA 3KXDA 3C6MA 1Z4QA 3C0KA 5EIXA 5JJLA 1BC5A 4ZVLA 4LVOA 3BCSA 4O2AB 5AVJA 5IJ9A 3GLGB 2BR4A 4E7OA 5AI0A 2P9YA 1DI0A 5KVVA 2AD1A 2RIRA 3GNTA 5E3JA 2QJFA 3FCOA 1D8AA 1OLSA 2MR6A 2NVOA 3C5VA 3ICWA 2GCEA 2P40A 2Q8NA 3C1AA 5HKOA 4JR0A 5KOHA 2QR2A 4A0HA 2VLIA 3EXG2 3W3AD 1P2BA 2B8WA 4MPJA 1GYRA 2V54A 4CMEA 4CV1A 4YXWA 4NVRA 3LBIA 5C4MA 1JLSA 1I7PA 3ISTA 3LRPA 1RAHA 1V11A 3OJFA 3HWWA 3BRQA 4EG3A 4KQ1A 1PLKA 5C18A 5DTEA 5G0TA 3UWKA 4C3VA 5H9WA 4ZHQB 4IOJA 1OFVA 3AH8A 2R48A 4KK3A 5TARA 1E6LA 5U1PA 4EEKA 3HKDA 2ZSAA 3DEAA 1P2GA 3ZJYA 1G8HA 4B3IA 1ZGGA 5IP5A 4UJ5A 4QX6A 2F4VB 3OIDA 2BDUA 3VGPA 2H7CA 3VKHA 1SD1A 1K7SN 4UM9B 1CNMA 1DIBA 1Y7HA 1EWQA 2ZR7A 4MGEA 4JUCA 4EECA 1GKIA 1KFJB 2IJGX 4JY7A 4I7EA 5DN6D 3AJEA 1KEKA 3C8HA 3IO3A 4QUDA 1HLGA 5JUWA 4KO1S 4YP0A 4JC8A 3RRMA 1D1SA 2VN8A 1ETHA 5G4KB 2KBFA 2Q0XA 1A9XA 3AL0C 4YB8A 2FKAA 4L2IB 5T3YA 4WBNA 1PEKE 5BSFA 4QOHA 5DSZA 4P83A 2ERXA 2ZOSA 1QIJA 4MR8A 2HGSA 1DHTA 4S1VA 3OA2A 3PQ6A 4XPIA 3OP1A 3IQGX 2V74B 4FLMA 4NJMB 4PGAA 4GPBA 4V0SA 3T4EA 1H1LB 3PHGA 1JDPA 3AESA 3L49A 1ZMXA 1JFLA 4JT4A 1YZNA 3VI3B 4S35A 1XVLA 4OOEA 3GP8A 5BN3A 3VSAA 4W1PA 4UHBA 3IAM6 1K8RA 2OYSA 2ORED 2Q1WA 3FRIA 3MMSA 1IN5A 1P2SA 1QR2A 2OCGA 3QA3E 2ZUDA 2BYTA 2IEDA 4NP6A 4Y2XA 1J90A 2CHEA 2P30A 3HCBA 4BMCA 3NJ8A 3OIWA 3N3AC 4MRMB 1P2VA 4F85A 1Z5OA 4E33A 3SQDA 4XOIA 4BX0A 2PSSA 1E7YA 1NULA 4HLUA 3HUEA 2YC2C 5K6AC 2FV8A 3RJ5A 1DOAA 1NDHA 2FW1A 3LQ1A 2J45A 3P20A 5T6MA 3TL2A 5IS2A 3AXTA 4RV9A 5IC4A 2QENA 2GD2A 4AMUA 4YUWA 3G59A 4RQUA 4OYYA 2KW5A 5FRDA 2HMVA 4BHTA 1MJNA 1E9RA 2PZFA 4I4CA 5KWEA 2E37A 4DNOA 1ZIYA 2P4SA 1GHTA 2VTVA 4X92A 3ZH9B 5JALA 1QFXA 3MIIA 1KI2A 5AI4A 1XJQA 2C5AA 4UPEA 2BEUA 2IQ5A 2W48A 3OPXA 4M86A 4QL3A 5TB5A 3O8RA 4DV6B 4F3NA 2VHXA 4RZQA 4YQZA 3O0TA 5F23A 1PS8A 1NSTA 4Q1AA 1D2MA 3EWAA 4UHHA 3W0LB 5DP1A 5B1SA 3DF7A 1F0PA 5DOVA 1R5NA 3SN6A 3B1FA 2VTBA 4RGYA 1FLDA 3CUKA 2V98A 3ZDQA 3S2SA 2G9RA 2NACA 5E3HA 4C78A 2NN3C 1R88A 4KR2A 1UJ6A 3DAOA 3FVWA 4Y0VA 3HKCB 5K8CA 3MJTA 1ORIA 3H4IA 2JRCA 3HY4A 4H3VA 4IGFA 4RVOA 4ZI7F 5JV5A 5JMWA 2J3DA 4CMKA 3FKSD 2PZJA 4QBKA 2O0HA 3MFYA 4YAFA 5DW0A 5IARA 4XIJA 5EUCA 3WDKA 1XDSA 1SQ0A 2FPRA 1JRLA 2RHWA 3DV0A 3U26A 3DVAB 3T7AA 1SHJA 1ONOA 3UK2A 1GG5A 1CEQA 3MT7A 3PPXA 5K6AA 4H59A 1OXVA 4QOGA 3KG2A 4RK5A 5CBKA 1C3EA 4UNQA 3QMWA 1IB0A 2AMYA 2GHRA 4HDSA 3E5NA 1ZJ5A 3KKQA 4H1VA 4TT8A 1RWNA 3ZE7A 4CLEA 1DHRA 4KKXB 3OTHA 4V1CA 3B1YA 1DBIA 3LKZA 2TMGA 1AIPA 2QLFA 2JIZD 3KKKA 5PNTA 3FETA 1B8NA 2POCA 2W58A 3BX1A 5BYJA 1I3KA 1UEJA 2BMWA 1J2YA 5IAEA 5HJ7A 2EKBA 4UATA 3QHAA 4AYXA 2UUPA 3IPRA 3A11A 2VDUE 4R81A 5LXTF 3SQNA 5BW8A 2AFHB 1LBSA 5JJKA 4BXOA 1D0IA 4OI2A 4RZHA 2P0YA 2QQGA 4PGMA 1M7BA 4XTRA 5J9FA 2IKQA 1GR1A 2Y77A 3CWCA 4UJ3A 2HCBA 3F6YA 3ZH2A 1NKVA 3BXEA 3Q3JB 4RH0A 1QK5A 2ZREA 2RAPA 4H7EA 2HRQA 3HCCA 2J4DA 4NYMR 4OKIA 3ZZUA 3EF1A 2I34A 3EUFA 1P74A 1SK8A 1PYGA 2GRUA 1M5UA 1EG7A 1K6MA 1V25A 2X0JA 2WOOA 4S2UA 2B94A 1G8JA 5LP6F 4K6GA 2O7SA 1NG1A 3JQQA 3QBDA 1M2FA 4QNRA 2BRUA 2VUHB 2JZNA 5HR5A 1TJNA 3WHIA 4ZVVA 4BP3A 5D7NA 1A96A 4ZODA 1N77A 3KWMA 3QPCA 1PV1A 1D0SA 1WBBA 4D9BA 2BMVA 1KQNA 1UWLA 2HLDA 4YUYA 1Y8ZA 5F5LA 4BO6A 3GH3A 5AW9A 3TCXB 1YU6A 3K9BA 3P94A 1E5VA 3A9CA 3S2UA 3KVNA 1DC3A 1P1HA 2I4RA 2WZQA 2YVLA 4RKWA 4DAEA 1T0HB 1H2HA 4URZR 621PA 5KNCH 1UKZA 2DR0A 3DLHA 1XTUA 3ZE9A 4JLKA 1X7WB 4OFXA 5KU1A 1QB8A 2P4HX 4H1TA 2WSSA 4K05A 5JQWA 1DQYA 4F93B 3LUCA 5FWXB 1Z9BA 2Z9DA 1U7UA 2I55A 1MABB 2J5BA 2XWPA 5B1IA 4DB2A 1ACJA 3CLVA 4YV2A 3SC3A 1T2CA 4MQEA 1MJHA 1MX3A 1OFGA 1QS0B 3NGMA 1RKUA 2NMVA 1T1GA 1X1SA 2J0EA 4ZAGA 4EYKA 5CVCA 4CMGA 1M6VB 4Y2QA 4C3ZA 4Q4CA 5HJ5A 2NSDA 4EFKA 4MICA 2JLYA 3MVEA 5FXMA 2Z30A 4CM3A 1XPRA 3GPBA 4LJ6A 3ZLTA 1QU2A 2WYVA 1X80B 5JCOC 3PEWA 4N3NA 3F6RA 3KJXA 4EGAA 3NC0C 1M0SA 2AQIA 2OV4A 3M6XA 4YMWA 8ABPA 4UD6A 4A23A 2O9JA 3QVLA 4BE9A 2I62A 4DDMA 3DONA 4TMZA 1E5LA 3LHIA 3ST7A 2Q3JA 3IUBA 1T5SA 3NX4A 3RVSA 3V1NA 4YT8A 4NSNA 4EEZA 4DADA 1MLDA 1DWQA 4LDAA 4HQNA 5C1BA 1PZEA 3GXOA 3FMPB 3K8QA 1OLXB 1CJMA 4YJKA 3RLFA 4P80A 1KAQA 1QQ7A 4GE3A 3KXLA 4UTZA 5DRTA 4IQGA 1JA0A 3TNJA 2KLBA 1Y8AA 2B3TA 2OOSA 3BTVA 4RVNA 2FXIA 3ZWDA 4TTTS 5IKOA 2B7LA 3D6AA 3P4XA 4IIJA 4RKRA 1MIOA 1UKCA 4BRWA 4O25A 4C29A 4UUOA 1E0AA 3AINA 2GF2A 2XD4A 1AU9A 3D7KA 2AZ4A 4XVRA 2JATA 1OX4A 3L1IA 4QIHA 4DG8A 1P2DA 2FSUA 1UM9A 3NO4A 3NAMA 4IHJA 4RK7A 3ZD9A 1Q77A 2VWGA 1OXSC 3DOOA 4RLHA 4C5BA 2LXNA 4ZT2A 3GJ3A 4CU5A 4MA0A 5LP6B 4HYQA 1RZRD 4KLZA 2YMPA 3A28A 1WMFA 1LRKA 4TPKA 5CB4F 1H23A 3HI6A 5F2OA 2H16A 4Q05A 2LTAA 4B09A 1LU9A 2O3QA 4JYPA 4N0PA 4Q7LA 4DMHA 1G8MA 1O2DA 2BFCA 2JGNA 4X5OA 1Q0TA 1QRTA 2H29A 2WFZA 4NI5A 2AB0A 2EFGA 2XT9A 2C2BA 5E95A 5KJCA 4IIEA 4BZQA 3FIJA 3QUBA 4PSKA 3VJRA 4PYNA 1OWLA 4OH1A 4WN3A 4OL9A 5FLYA 1OV4A 2POQX 3DMTA 3F78A 5TV2A 1N75A 3IUQA 3PNMA 4E21A 5JJIA 4MGIR 5ER9A 4MA5A 3L4JA 3S81A 2JFBA 3RS2A 5LA6B 3K92A 5HW0A 3O1JC 4PIMA 3X43A 5LL6P 1ZOIA 2WIKA 3R44A 5K7SA 3ZG6A 5EA2A 4DR5B 3T7JA 3OQNA 1Z2DA 1QBGA 4A2PA 1P7VA 2HF9A 3MCVA 1QIHA 4HI0E 4LRXA 4PC3A 1MJGA 4LBYA 1FFYA 5KAPA 5HIKA 1UKAA 2DUWA 1T24A 1GGNA 1QVAA 3OQPA 3QOFA 5LJIA 5LZ4A 5SYMA 5I4BA 2RC5A 2ES4A 3WJ2A 4KE6A 1W5FA 1J09A 2A86A 4ZQEA 1TU4A 1PD0A 2BFDA 2PX2A 2W93A 2NXCA 3EBOA 4HNRA 1WVIA 5COQA 1YIAA 2LNDA 2RKWA 2YJ6A 4OHCA 3ORYA 3EJ6A 1Y7IA 1LS1A 2WF8A 3E82A 3QKIA 1SVNA 1VRVA 1Y3FE 4WOCA 4GNRA 4BFXA 5B55A 2GLXA 3BGIA 1MEJA 1RBMA 3D3JA 2QY9A 3KKOA 3PYXA 4RGQA 5DU2A 4BDTA 4BKOA 4EHNA 4X6YA 3GXBA 3QKSB 3OM1A 4BPRA 4D3FA 2WZCA 3MTJA 4V1CI 2YWFA 1QX4A 4JI0B 3OCXA 1L5VA 3KQQA 3T5MA 3FZNA 1DFHA 3HLKA 3SPXA 1A2KC 4N54A 2HX1A 3TZ6A 3VZPA 1CS0B 1THGA 3LSTA 1QHYA 1U8EA 3MJFA 3JQPA 5GONA 1J8DA 3SSMA 3CO5A 4P0PB 4P5EA 4DR7B 5H0IA 2EJVA 4I66A 1I32A 3WK4A 3O1HB 3Q3EA 2EZ9A 1XBTA 3M3PA 1O95D 1IOWA 4HUQB 1W96A 4CDNA 1U1GA 2E48A 4EKIA 1JWBB 3ZI4A 3EG9B 3QI7A 4YPOA 1VLQA 3WLHA 2F43B 3A06A 3R9XA 1R6AA 3ZVRA 4D4KA 3WNDA 1X1BA 4MV7A 3ADDA 5EXXA 2VQSA 1RBQA 4JQYA 3HU1A 5IUKC 2DSNA 4LG1A 4ANFA 2Q5IA 4LAFA 1RYZA 3CNOA 3GFSA 5E38A 1DARA 1GCAA 3OUUA 3B12A 3KEMA 5ER6A 4BO3A 5J58A 2CVFA 3REFA 2R65A 1H93A 1D1PA 4D46A 5DZSA 5KQPA 3FLAA 1V7PC 3H9QA 1A9OA 1NBAA 1N3IA 4TRJA 3LCMA 1VYUA 1UBUS 3KQHA 2IBSA 4UEWA 2ZWAA 3IKTA 1NBIA 4B17A 1J33A 1OOEA 4IINA 4IEIA 3SLRA 4E3WA 1K89A 3GUCA 3HR7A 3FWHA 1UWVA 3VDXA 4QXOA 4Q7QA 1N25A 1N5DA 5AK0A 3CG0A 5KX5A 3O94A 3OPVA 1FLAA 3E15A 1V1JA 4N0DA 3GLIA 4K40A 3H42B 1JYSA 3HZOA 4XFKA 4BJ5A 1IRXA 1OTYA 5TGTA 4CE6A 1G8PA 3MNFA 4LJKA 3QJYA 5IYZA 1T3ZA 4ZIRB 3HG7A 4O2RA 1TOAA 1QK3A 2FMKA 5JSYA 2VSNA 4QQ8A 2MSEB 1TYDE 1Y1RA 4HN9A 4OHMA 3EK2A 2JIOA 3FCCA 3H11B 3HU2A 4GOOD 3ESXA 1EBBA 4I5EA 4G5OA 1SC3A 3CRQA 1YQWA 4LVNA 4LZZA 1JKJA