1YQ9A

Structure of the unready oxidized form of [nife] hydrogenase
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
261
structure length
261
Chain Sequence
KKRPSVVYLHNAECTGCSESVLRTVDPYVDELILDVISMDYHETLMAGAGHAVEEALHEAIKGDFVCVIEGGIPMGDGGYWGKVGGRNMYDICAEVAPKAKAVIAIGTCATYGGVQAAKPNPTGTVGVNEALGKLGVKAINIAGCPPNPMNFVGTVVHLLTKGMPELDKQGRPVMFFGETVHDNCPRLKHFEAGEFATSFGSPEAKKGYCLYELGCKGPDTYNNCPKQLFNQVNWPVQAGHPCIACSEPNFWDLYSPFYSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Periplasmic [NiFe] hydrogenase small subunit
publication title Structural differences between the ready and unready oxidized states of [NiFe] hydrogenases.
pubmed doi rcsb
total genus 81
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 1.12.2.1: Cytochrome-c3 hydrogenase.
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
A PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 1yq9A01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 1yq9A02
5ADUS 4UEWA 5JSYA 1UBTS 1WUHS 1WUKS 4IUBS 3ZE8A 3H3XA 5A4FS 4C3OB 1WUIS 4UQLA 5JSKA 4UPEA 2FRVA 5JSUA 4KO3S 1UBJS 3ZE9A 1WUJS 3RGWS 3CURA 4U9HS 1YQ9A 4KN9S 3MYRA 4KO4S 4UCXA 4CI0B 1UBOS 3AYXB 1UBHS 4KO1S 1YRQA 4UCWA 3ZEAA 2WPNA 4UCQA 1UBRS 4OMFG 5JRDS 5D51S 1UBLS 1UBUS 1H2AS 4GD3Q 1H2RS 4UD6A 1UBMS 4UE3S 3UQYS 4IUCS 1FRVA 1E3DA 4IUDS 3USES 4U9IS 1UBKS 4UE2A 5JT1A 3CUSA 3USCS 4KO2S 5A4MS 1CC1S 5A4IS 1FRFS 5JSHA 4UPVA 4UQPA 1YQWA 4UE6A 3ZE7A 3ZE6A 4UD2A 3AYZB 4UEQA 4TTTS 4URHA 4KL8S 1WULS
chains in the Genus database with same CATH superfamily
1SKUA 3B7PA 3T0IA 1XAJA 4JI1B 3N2LA 1MQSA 1GPMA 2J6CA 4DV2B 4MQBA 1ZY2A 2R5NA 4A8JB 4C7XA 6AT1A 2RGEA 4REQA 2QJFA 3R41A 3F5QA 1VFNA 1NULA 1JDJA 2EZ8A 3ZPXA 2XUZA 3UHFA 5LMZA 3VI4B 4BP1A 4NHEA 4YP5A 3E7FA 2E18A 5IYZA 1SIBE 2F3UA 2CF6A 3G9UA 3SX0A 4XVQA 4C76A 1J25A 1WB4A 2I67A 3F6SA 2WUFA 2HBRA 1S9DA 1N92A 2IUEA 3KR2A 1RHRA 3JQRA 3OJEA 1QG0A 3R40A 4OHFA 4U6SA 3TZLA 2R68A 2WJIA 1EFCA 1D2HA 2DHQA 4LXIA 4DYVA 5L3SB 1W36D 1OKKD 1KMIY 2WSLA 2RJNA 3IFSA 1QS0A 2FPSA 4PHTA 5M5BA 4M36A 2BBTA 1IK4A 2Q3JA 1Y3AA 2WVJA 4MVJD 4WOCA 2AX4A 1ANKA 1WW2A 2CNKA 2Q4BA 4H17A 5CA1F 5I7WA 1UH5A 2FLWA 1PQYA 1OTXA 1VBMA 1YDEA 1OYWA 2M6SA 1CQJA 3MGCA 3I2IA 1H0HA 5AJZA 5A4AA 1WHSA 4LWPA 3HUTA 1GKKA 2G63A 1Q0PA 3W6OA 4H0NA 3IGFA 5GOZA 2QQFA 1YQQA 2WU4A 3EQ8A 3FE2A 4LHZA 2REQB 1PK9A 4OSPA 4TTPA 1QIFA 3ZZ0A 2AFHE 3OMXA 3R5XA 1SELA 5JUWA 1YWGO 3EZ2A 1AQIA 4W5NA 4UU7A 4C3UA 1TIKA 1QH9A 3H2ZA 2R7LA 2I33A 2R6GA 5JBQA 4XUCA 3OIFA 2YZMA 1U5CA 5A2QA 1TI7A 1ADFA 4DF3A 2VDVE 2XADA 4NARA 5IJ9A 4Q4DA 5LZ2A 4Q3OA 5AOVA 4KITB 4BPRA 1KO5A 4J03A 4JB2A 3I92A 1CETA 4UEOA 2BFEA 2GPTA 2W93A 2C7VA 3KV1A 3EDCA 1NVTA 4QOIA 5DIZA 3RSFA 5IW8A 1JSCA 3S2FA 3WK7A 4Z7JA 1V8BA 3LIIA 3ZCVA 3Q9LA 2FX3A 3E15A 4M21A 4ACBA 3ZZUA 3G5TA 3L93A 1DLIA 4DB2A 3RSZA 4H0CA 1KI6A 5D1NA 5KPJA 3IIJA 4BQIA 1RKBA 4JJKA 4FI3C 4EBFA 2NZXA 4EKDA 3NUQA 1ZOLA 4P4GA 4WLVA 1XA0A 3MW8A 1NRIA 1NFFA 4K6MA 2E2WA 1C9DB 1LPBB 1SCUA 2PT5A 1VYHA 2YDXA 4QSMA 1ATZA 4UTZA 1BS9A 5EGNA 1L4KA 4PR0A 2HDHA 4QBGB 1NVXQ 4CIAA 3RI3A 4JI5B 5G41A 2QP4A 3CIFA 4CVNA 3MTQA 4O2AA 4WVLA 5JNTA 1ZN2A 4I50A 4UATA 1JFTA 4I6JA 4HGZA 1IDOA 6CHYA 1W1UA 1CERA 4L5AA 3ZGYA 1K8XB 1EUCA 3FROA 5BN5A 3Q6MA 4YI5A 1W87A 1TLLA 3S8YA 1JJBA 1FJHA 2BM0A 3H0EA 1OFUX 3VKHA 1BQ3A 1PZEA 1AO0A 1XMOB 3C3KA 3FLMA 4HYYA 2VK2A 4A7PA 1D2NA 2WI8A 2V4MA 2PNFA 3ZKWA 1R3DA 1L4GA 3IDFA 3O92A 4ZMSA 1H42A 2HA4A 1O8CA 3ABQB 5KB3A 2ZYWX 4G2NA 2W8BB 2A8YA 1TL7C 2CW5A 2X8AA 3DMGA 5GGXA 1T2AA 1M8FA 2BGNA 3C8DA 2CZGA 4PYNA 4LHVA 4ALMA 2RCNA 4BQEA 3R9XB 4EMTA 2F1RA 3VTAA 3HUDA 4BAUA 3H11A 5MFZA 1NJ5A 2Z1DA 4EKGA 3JTEA 3MJFA 3G89A 4CGZA 4M9CA 1MAWA 1EWTA 2W2LA 1QU3A 4X9XA 2FEWB 3ONNA 4RYDA 3A70A 3RLIA 5IDVA 2CXXA 2O3JA 1HEYA 1F20A 3HVIA 2C58A 3R9WA 5TQ2A 1VYVA 3KOYA 2E5FA 1KIFA 2ZS9A 2ZCUA 4QUIA 4DXHA 3HXMA 5J58A 4MW2A 2IS1A 1OXVA 2R6R1 4JU9A 5IJ0A 1CX9B 3U5ZB 3I34X 1BG6A 3MTJA 3VOBA 4XYMA 3PC8C 1FQKA 3SYLA 5THKA 3V2UA 1PV4A 1G4HA 1JG2A 2JI4A 4F9TA 1B23P 3LXRA 5K6AC 1RWPA 3BZUA 1I7PA 2NWQA 5LXTB 2VDNB 4G1BA 1YHYA 2VT7A 4DLLA 2BGKA 2RHHA 1MABB 2PUHA 4PLZA 1Z0FA 1D2GA 2OSVA 2X5XA 1RE0A 4B47A 5HWSA 4NHOA 1LPPA 4M0FA 4ALIA 2NSJA 1TAUA 4DWWA 4LQCA 3RR2A 5ITVA 4KOEC 4D0LB 4A8JA 1AGXA 4B3TB 3CZRA 2C07A 3WX0A 1MG0A 2V5VA 3SX2A 3ZDQA 1ZVVA 1SURA 4KXLA 4YACA 4LSGA 5BW6B 5T4BA 1V3QE 3A4VA 3AUJB 4O1HA 1YVRA 2PV7A 3H6GA 1X7XA 2IDJA 4ZHQA 1NX6A 3WL8A 2IIBA 1XLTA 2VYQA 3K0EA 5AOCA 1S2IA 2DQZA 4JBNA 4FFRA 2EOAA 1QRDA 2IPXA 2RBGA 2V03A 4LY6A 4X1OA 1LS6A 1ZHOA 1HZJA 4U2DA 1MJHA 2OHGA 4J75A 3B6ZA 1NZDA 4UHEA 1X7YA 1WVIA 5L3SA 2X2PA 3I2GA 1H2HA 2X9QA 3UMSA 2B8EA 3I12A 5E3IA 4F6CA 5KDOA 3WBFA 1AT1A 4QRDA 3ZGNA 2E4AA 3TL3A 2O3UA 1HDGO 5BQ5A 2HQSA 5H82A 3ZLTA 5LPNA 2KSQA 1GDHA 4PZCA 3E0QA 2CC2A 1G55A 3G1UA 5JC8A 1CP2A 1FP2A 1L7PA 4KJXA 3ZG6A 5HIAA 1K8YB 4L5IA 1Y4DE 1WZIA 3AUAA 1P29A 4MGEA 4BFTA 2ADMA 4PZPA 4FDUA 3U5TA 1EGMB 2O8NA 3VBCA 1GRQA 1KO1A 1P39A 1RLMA 3H2JA 4ND1A 4CF4A 4XWWA 1Z63A 1XF9A 2P11A 1JHXA 3RF6A 4U3JB 4N8EA 4FXPA 1D1SA 1J97A 1MAAA 5KWIA 4KPYA 5FHRA 3BWBA 3DXYA 3P32A 4M9QA 1T1IA 3CR3C 4O5OA 5JYBA 2DUJA 5L53A 4XIYA 4ESVA 3MQ4A 2ZSUA 5JSFA 2JLUA 2C03A 3HSSA 3KTAB 2IOQA 4TQGA 3KQSA 2ZBPA 1HNWB 2ODBA 5J1TB 1HM5A 3GA5A 3LCCA 4MB0A 2AD5A 1C1DA 2P4UA 3CHYA 4KX3A 4O08A 2YKGA 2PD3A 3ETNA 3CRZA 4XKJA 5BUCA 1QHXA 2QRGA 1RHJA 3HKDA 3KKKA 4R1TA 4X97A 2ZSKA 3E2PA 4DC9A 1MTZA 4ZCPA 1HG0A 2J41A 2JKVA 1AQ6A 2ZYTX 2C77A 2RONA 1FC0A 1YU9A 3H3XA 3HFRA 2R5FA 4CUKA 3KR0A 3R9KA 5AH0A 4UQLA 5EJAA 3ITNA 3TLYA 2BFNA 3DWFA 4GGOA 1RYEA 1Y7HA 3ZD7A 2P2SA 2Y1LA 3JALB 4W63A 5DYYA 1JILA 2JLQA 1VMKA 4EFKA 2QRLA 2RBKA 4KODA 2RGWA 1J0XO 5T67A 2FU5C 5JY6A 2OBYA 5EWLA 1F0KA 1TRKA 2V54A 5HS6A 3PJRA 4R3WA 4Z1MA 2IDZA 4F4JA 1JIQA 1KKMA 2L19A 3IRVA 4MA5A 2BMWA 4NNPA 4JR2A 4EY5A 5B4UA 3M6LA 1ORVA 2MINB 3OOJA 4FSHA 1MH9A 1ZHHA 2P68A 3AJAA 4BFZA 1AK1A 1XYYA 3BREA 3RHTA 4UM9B 2I7VA 1VMEA 1CJMA 4ML3A 1UXGA 1G41A 3L5OA 5AVOA 4EHLA 1XMIA 2MU1A 4QNRA 1KMHB 5GPBA 1FPMA 2H57A 3GGJA 1YL6A 2IK8A 4RVDA 2WDZA 4H3SA 1UC4B 4AY4A 4RTOA 1U3WA 3ANYB 2HLDD 4OSEA 3X1KA 1UBLS 7GPBA 3ICEA 1T0JB 3NYWA 3THYB 4U7WA 4WFQA 3W5JA 2AC4A 5IVHA 1EFVA 2OFFA 2NU6B 4HEJA 3RT7A 3WO1A 1MO5A 1HG1A 1OXTA 4QFBA 1XELA 2MMCA 3O2QB 3CE6A 3OF3A 4ZANA 2W70A 1KVRA 2WYOA 4M0UA 5AIAA 3VO1A 2OK7A 5AUPB 3NDIA 4UNIA 1P6QA 2A92A 2IZ5A 2DP4E 2PAFA 4Y6OA 5DHAA 4J9VA 4CCSA 3OTHA 2XYRA 3PGA1 3MHPA 5IYZF 2PPLA 3VH2A 1R0BA 5KO2A 1RZRA 1DEHA 3GUYA 5BR8B 4E5PA 3NHLA 2A4KA 4Y0NA 5D86A 1C0KA 5J4KA 2YV5A 3ZXXA 4MQFA 3ESXA 5GM2A 1Z6PA 3RVLA 5A0VA 4LFAB 4TLBA 1ISMA 2G70A 1OXUA 3A36A 4HSGA 2QJWA 2NNWB 3UYLA 5FIUA 2JAXA 5A0TA 3ZWXA 1OAKA 3HO8A 3KQUA 4DIDA 1RTTA 1UFRA 1RC1A 1P91A 5G53C 4PLGA 5M7EA 3WRXC 4MHTA 1YVEI 1AZSC 1WPRA 1GGJA 2HIGA 2JK1A 2VJPA 4G09A 1C3LA 3P0JA 4UPDA 3HZOA 5DH9A 3VKUA 4EFDA 3LYLA 2GFQA 3E53A 1EK2A 2YS7A 4I5EA 4IOKA 3VU1A 1W30A 1TZMA 3M70A 1JN0A 2VJYA 3UOGA 1NL3A 2R1ZA 3WDSA 3FPLA 4D46A 1CULC 2ERYA 3PKIA 3RJMA 5HM6A 5I51A 1H4TA 1HF3A 4RNDB 4W9MC 4A0SA 1VIVA 5K6RA 2WZQA 1N2SA 5E8RA 2XI4A 2YWXA 3RC2A 4MH0R 2OHOA 2HLPA 3RIYA 2GEUA 1X7DA 1JBKA 3ZY5A 3X2SA 5EJMA 5IBQA 1E2DA 5IH7A 4O3FA 3MTIA 4YCLA 5K6TA 4EH1A 3D6MA 4GZMA 5EQTA 3SJAA 4Q4AB 5HRCA 1Q0HA 4QL3A 4PPQA 1N34B 2Y2VA 2IUTA 3KZ1E 4XH9B 4AWXA 1G42A 1JAZA 2ZRJA 5SY9A 1GD1O 1N3LA 2I2CA 4BXOA 2ZIWB 4IEEA 2NUAB 5FUQA 5CR9A 5DLQC 5ERXA 3WK8A 1Y3CE 1YZYA 4PLCA 3AY0A 3AB3A 2FP4A 1T6BY 1Y42X 3L7NA 2IHTA 3O74A 4Q9LA 5KDDA 1ZDMA 2PSDA 4NJMB 5CAEB 3I32A 2F43B 1LSJA 1EVJA 2D1FA 4BNTA 2JB9A 4BP9A 5KTTA 1B00A 3RD5A 1JLSA 4LJ7A 3R75A 4HWPA 4AY3A 2C9CA 4EVSA 2GARA 4I0WB 4LF7B 1YB2A 3NV9A 3OC0A 4CM9D 1K0UA 2XB8A 5DCWA 1SCAA 4N01A 1E64A 2R8YA 3KTAA 4O2AF 2J3EA 1I2MA 1K7SN 3CW2A 5JZSA 4I50F 1VYTA 5BV2P 4C3ZA 1N1EA 4DREA 2XODA 1Y6ZA 3CBGA 1IN1A 4AJ2A 3B1FA 4KO1S 3CEMA 3TJZA 3L1JA 4LBYA 4QYIB 1NUSA 4NCKA 3UGKA 5BNZA 1L5WA 3ZEAA 1DKRA 1K06A 1IUOA 1UBRS 5BUQA 1ILWA 4R6WA 4BRSA 4EP1A 4U6QA 4QELA 1IQPA 2Y99A 4XQ9A 4F86A 4AYWA 1ACJA 2IP1A 2QRPA 2YHIB 1ULSA 1YB7A 4KVAA 3NONA 5E0OA 4GD3Q 4PQEA 4UUMA 2BTOA 1LDGA 1JFSA 2O0HA 3U37A 5AHOA 1L5HB 1XN4A 2F9MA 2HDWA 3JALA 2V74B 4MV3A 4OY3A 5P8WA 3RSHA 4EJSB 5LLDA 4KQ2A 4RVFA 5ICEA 4DADA 3TUJC 1QUEA 5LQDA 1PFQA 4PZEA 3QH4A 4MI9A 1U7TA 1V96A 1Z68A 1GPWB 1MEEA 2GF9A 1YRWA 3JYLA 1CZLA 2JBAA 3NNNA 1Y4UA 3DFUA 1XJQA 3DO8A 2PX5A 3A2MA 3DE0X 4N54A 4RABA 3TZEA 1WVMA 2MINA 3WK4A 2C8VA 5C81A 2B25A 3EXIA 3MERA 2QR5A 3B8EA 2R1UA 2MYNA 1AQLA 1ZW6A 2GEDA 3I5AA 5TS3A 5AHWA 2BKLA 3LDFA 1QKKA 2QTHA 2EQBA 1REQB 2XBMA 5K3SA 3DH0A 3R0VA 1VG9B 3C1TA 4Z5XA 1YRBA 3VR4H 4OKSA 3GLVA 2PUFA 3ONWA 3H84A 3ZE7A 5JS6A 4Y2HA 5EYPB 2RHJA 2ZIFA 1SQSA 2FKNA 3LHKA 3S8MA 4D0NA 2DWQA 1PAUA 2HTFA 1ZJ5A 1I4LD 3WY9A 1F5SA 3UGTA 1C7FA 5AK4A 4JYAB 4TXHA 1AOXA 3MJSA 1BGXT 4ESEA 2BHLA 2OPBA 1U7HA 3NHUA 1TJNA 4L28A 4TS4A 4OOFA 3RS4A 3X1YA 1O97D 1WTAA 1U81A 2ZRCA 3GUHA 4Y67A 3IL2A 2BFCB 3VPDA 1Z2OX 3NIWA 3LBHA 2OAP1 2KW5A 2QVZX 4LDZA 4MVJP 4Z3OA 4ZHQF 3I2FA 3PDHA 3KPVA 5FTMA 1N2OA 3WWEA 1GZ7A 1KI8A 1O5TA 2VRNA 2XRYA 3CSSA 4IXMA 1MHTA 2FF7A 2YMQA 4BIMA 1Z4LA 1ZLXA 3VR5H 2OCBA 3K09A 1PSDA 1TNDA 4O2BB 5ARCA 3VX3A 2CJFA 1DJNA 1FUIA 2ARKA 4NZ9A 1TTPB 1AZWA 2I62A 2BZ0A 1JXOA 5AVRA 1JMYA 3N8NA 4PAWA 4YFVA 5E1DA 2AN4A 1IMJA 1DHRA 1GNTA 3MXOA 1A2KC 5FJIA 2GPNA 1BU5A 2XMZA 1YS7A 2ZE8A 3JVIA 4NAVA 1IC6A 2AMYA 4GF5A 1QX4A 2I65A 1JG1A 2I91A 1ZNYA 5BSMA 1OU0A 4K6CA 3ZJUA 1Q57A 2VHCA 2QUJA 2TMGA 2D2XA 3NWJA 3WYNA 4PYRA 4UFPA 1ONOA 4I1YA 1IL0A 3MRVA 3K3PA 3PP8A 2OV6A 3PF9A 1MT0A 4AU1A 5B36A 3RS2A 3DE5X 4NOMA 4EQ6A 4K9MA 2C5HA 1ZMOA 2AKAB 4RDIA 4HDMA 2VT6A 3JD3A 1I2ZA 3KPWA 3LX8A 3OIYA 5EMLA 3ZWPA 4S1OA 1LX7A 1TB4A 4XD7A 3BULA 1Q7BA 3G7UA 2RKBA 4BMXA 4PHGA 4K9RA 2GBCA 4N5LA 2QQEA 4UDXX 1IG3A 2D5IA 5FPYA 3U7JA 2C4MA 1CUUA 2DPHA 1JSZA 3A32A 4DMKA 3RIGA 1C9MA 1MVLA 4ZI5A 3E9ZA 3ZGOA 2QI9F 3I53A 1JYSA 3IPLA 4KK4A 1ODSA 5DNAA 1XRSB 4HCJA 1A9RA 1IULA 1JU3A 1VI6A 1TMYA 1ZISA 2VAXA 2NUAA 4LDJA 4POOA 4QBKA 5JFOA 3SE0A 3VPCA 5LU8A 1ESNA 4G63A 2BTQA 5JYDA 1QP7A 2Y67A 2ZT8A 3GDGA 4OA5A 5CXSA 4OK3A 3I52A 3K9WA 1T5IA 1R4MB 2I66A 3IBSA 3KYCB 3TEFA 5IDWA 5ICGA 3S2UA 2UZ1B 1PJ3A 5FR2A 4P4UA 1SKYB 3DHYA 1EK1A 3BJEA 4O3MA 1ZYUA 4JOBA 3Q6IA 5DRTA 1T26A 3ZYZA 1XTVA 2XVAA 3WDKA 3ODGA 2O54A 1P5RA 1WMAA 3ISVA 4IGKA 3D2LA 1LF0A 4N0DA 3VR1A 1P1HA 1QCCA 3O2JA 4JBYA 5K8UA 3D1JA 1ZSVA 3V3KA 1R6TA 4TVOA 4QDXA 1Y8AA 3OAAD 1JPVA 1SCBA 1JKMA 4OREX 1YCFA 2FZGA 4LXYA 1BRMA 4RZ3A 1HBJA 3I0ZA 4L75A 1NLYA 4C7VA 2CHFA 2OCIA 5L4LA 4G81A 2UZAA 5CMLA 4RSMA 3P52A 4X91A 2FWMX 4DA6A 2OG1A 4P98A 4PEVA 2GRAA 1R7RA 3I1YA 4EELA 4OHZA 4HADA 4FC7A 4E5SA 2HC9A 3OEYA 2YHIA 1U0JA 5M2QA 1K3TA 1CB7A 4DLTA 1BYUA 1N2EA 3C3BA 2YC2C 2ACEA 5D3QA 3FNBA 3VO2A 1BVYF 3WB1A 4J8PA 1S89A 1F4VA 2RB4A 5IMSA 1YH3A 1YA4A 3ELUA 3OT4A 4TQAA 1S2MA 4DSOA 3W2HA 4S1NA 4B33A 1P6XA 5BY2A 3B82A 3WRYA 2E4VA 3R7WB 2Q8NA 2NO4A 1XC7A 2V6MA 1CDEA 3WKDA 2Z83A 4CKEA 3DAGA 2O0LA 1BDMA 3IQZA 3JASB 3ZHQA 2PS3A 4H6XA 4PC1A 4X3CA 5JD6A 1XNQB 3M6XA 3RUIA 2JIDA 2PX6A 1SXHA 3E9EA 3PFKA 5FBQB 4PQRA 3OEHD 4FFVA 3Q5EA 1PFYA 4UKDA 1PEKE 1I3NA 2WHQA 3I42A 3QVVA 3ICOA 1C3JA 4H1TA 1MXHA 4QEKA 1TFUA 4WQMA 1E2QA 2A5YB 3O26A 1LLQA 3JARB 2C7GA 4FX2A 3R44A 4IZHA 2X15A 2H7XA 1IPEA 1AMUA 3IKMB 4U7HA 3QU5A 1ZQ1A 2YNMD 2I3GA 4MK4A 3SI7A 2VLBA 1KETA 1M1YA 3CS3A 3KJIA 3TR5A 4WE3A 2WJYA 1K5DA 1SZCA 3ODPA 5DYGA 3SHVA 4U00A 3TBKA 2R2GA 2AIRA 3B2EA 3NOQA 3V4SA 1XB2A 2VXBA 2ZJBA 5LDHA 2C95A 3U80A 2BFCA 3EUAA 3H1PA 1GL7A 3WJ2A 1M74A 3QMPA 4LJAA 3CVYA 2OCPA 1G3IA 3OPYA 2P5YA 4FLFA 3I05A 1N9KA 1W2HA 2GXQA 2Z5LA 3S2YA 4CLRB 4EQZA 5DN6D 5ENZA 3BE6A 3FXAA 2WQ6A 3IT0A 1RXEA 3DL0A 3L4EA 3LY7A 2IUYA 4FN5A 4FZ5A 1Q3KA 3INGA 4O2BA 4UAJA 4DC1A 4WFIA 2VTBB 1O6ZA 3LX4A 4PU0A 3EIHA 3TQFA 3MD9A 3VKGA 1HTTA 1QGUA 1XBTA 4LRQA 4Y2RA 1YZKA 4INOA 3LLVA 5DK6A 1M1ZA 4QFCA 4QEZA 2QD5A 3U9TA 3ZWDA 3BUSA 4AY5A 2ZYHA 3HKCB 1FDRA 4IKOA 3I72A 1C0LA 1LJ8A 2WE8A 1QFYA 3IVGA 2HJWA 3PUJA 4P22A 4YRDA 5F7ZA 1GM5A 1PJBA 4FZRA 3WL4A 4AKSA 2YJ5A 3AR2A 1VPWA 1QHFA 4ER6A 2BFDA 4WXPA 4Y2SA 4OHRA 5B6PA 2PT9A 4MPJA 2PKRA 2DR2A 1BIFA 5CA0A 3TGWA 4OP2A 4RPGA 5JRJA 2KM1A 1ISPA 2JIZA 2VNJA 5LA6B 5FAKA 4HKTA 2R87A 2C42A 3F3KA 4IIJB 3FZYA 1PR2A 2EVWX 3KOMA 1JLLA 3LGSA 2FMTA 2XGJA 3SQDA 4ZPXA 1LDNA 4KXNA 5KVAA 1DU4A 2VYVD 4FZJA 5IAKA 3CNBA 3A9TA 1XZFA 3DZHA 3JQ9A 1E6KA 1Z12A 2ZKLA 4I3FA 5KNDA 4NNJA 4KPGA 3U4GA 4FNAA 5KJFA 1Z17A 4TKUB 3RT1A 3ZHZA 1CUGA 2V45A 3ZE6A 4KGZA 4BO3A 1ULZA 1YBAA 1RP7A 4R1UA 4Y6QA 1QVZA 1YD7A 4RANA 4YYEA 2EIHA 1T0BA 1JX6A 4NEHB 3RTAA 4EHBA 3LFHA 3OZGA 4C2TA 5A9RA 3W7VA 3W6UA 1R4MA 3KYCA 4PR3A 3R4CA 4IOJA 3WLOA 4DIKA 2BJWA 5AJXA 3C8HA 1Y0BA 1M1NA 5EC8A 5IEJA 3BDVA 5JH7B 3DDHA 5EIOA 4RGQA 1KNXA 3T3NA 3EVAA 3R7DA 1G6Q1 1TU4A 1ZMXA 3OFND 3D3JA 4TWIA 5EUQB 2OFXA 3SR0A 3PX2A 5IJWA 4Z9BA 3DV9A 3L0IB 4XLLA 3W78A 1Z47A 3KFLA 4FNOA 3H5WA 1RMYA 1XDBA 3OLVA 1JQJC 5AVWA 1GG5A 4WLEA 2IVZA 3HP1A 2WAOA 1TDJA 2EF1A 5AKLA 4DOMA 3DO5A 3T7IA 2BCJQ 3DLAA 4WRRA 4GMHA 1D07A 1LQTA 3GPIA 4TV9B 5CDSA 1KTVA 4PSVA 3FVWA 4EWLA 1YI0A 1NU6A 3KALA 2UXCB 1YR1A 3VQTA 3DUFA 2SHKA 1POWA 1K97A 1QBKC 1VCIA 4MYRA 2GN6A 5LQAA 1RC0A 3L7BA 3RUFA 3TE7A 4TYPA 3R3JA 2TSYB 2WTXA 1OI3A 1K5HA 1P1KA 2ISCA 5EGSA 4X6YA 1PG2A 3WWDA 4V02A 2V7VA 3QA3E 2C4UA 2WNIA 2XQFA 3G3EA 3MB8A 2D4AA 5FO0A 2XNHA 1GTVA 5I3CA 1X1CA 3CH7A 3OQHA 1L5YA 1ZI8A 3BWDD 1ULTA 3PI7A 3ZWCA 2HZBA 2R85A 4PBTA 5C5DA 5IPFA 5C53B 1RWBA 1RLIA 1XZBA 3HVUA 3OMWA 4LISA 6PFKA 2D1TA 1C3OB 1JIIA 1XRRA 1BDJA 3M5DA 3IR6A 1OB5A 4IS3A 2XMGA 5F3DA 1HDEA 2JZCA 1ETHA 1WQ4A 3OECA 2Q1SA 4LKRA 5FYQA 2X5KO 3C6ZA 2Y66A 2NLOA 2WFLA 3COVA 3Q9NA 4B1FA 4B31A 4DQ0A 3I6MA 4PGMA 5J4VA 2P69A 1AQJA 1G21A 1T9AA 2ZJYA 4ID9A 1FLAA 3R74A 4YP6A 4JUCA 5IMBA 3WLAA 3TTVA 1VRVA 4B6EA 4EZIA 5KCZA 3L4JA 1POXA 2VQ3A 3FTQA 3EB9A 2OUKA 3H0KA 4K5QA 2ZCVA 1AK2A 1NFRA 1JE1A 1ODIA 2ZVDA 2FH5B 1U0RA 3JARA 4KXYA 2HCRA 2OZPA 2ZQ5A 4OQYA 2P5SA 4UTRA 1T3TA 4QGBA 3IAAA 4EJMA 5HKLA 3R8FA 1CUHA 3C48A 3EMDA 1LC0A 1MIOA 3H05A 4EMSA 2PX8A 3UZUA 5K8JB 2VJLA 3AHHA 1HRDA 3NBQA 1I2AA 3EDQA 2E55A 3GIWA 3N8GA 4AX4A 5KINB 5JT1A 3B85A 1NNUA 4N7MA 3RABA 1QPGA 4RELA 1Z0ZA 3H2BA 3RRNA 5EEGA 1NVBA 4HF7A 3WGKA 3UF0A 2PPVA 3GPCA 4CLRA 3OG9A 1JA9A 3WP1B 1I7QB 1T8TA 3ECAA 1ZK0A 2FZWA 2IXEA 1JQKA 2HJRA 3JQBC 4NU8X 2RHRA 4G89A 1J8QA 4NU6A 3VHQA 1XP5A 1QAMA 3DDOA 1JJIA 4S1VA 3EASA 3BB3A 1PJ8A 1P75A 3CCFA 1YUMA 2V97A 3S68A 2XWBF 3DKVA 2H17A 1YRHA 4QYXA 1E3SA 2WSIA 1OQAA 2H1SA 2IQ5A 3JW8A 4D5EA 1FTYA 4HPWA 1SQ5A 2XY4A 1W96A 3GVXA 5G3YA 3S1SA 3KJHA 3HKCA 4NRDA 3V6LA 3LQYA 4A8PA 3ZW9A 1FPQA 2QX9A 2V4ZA 1EK0A 3CWCA 1RYMA 1F06A 4PLFA 1G1MA 3F8WA 3TTWA 1ZN7A 4FJ1A 4EIWA 4JS0A 4HDAA 1JF8A 3Q40A 1QC5B 5EIFA 3TIGA 5CCDA 5EP1A 4DIUA 3QZUA 3WWPA 2NTVA 2QN1A 4LS3A 2ZUSA 3PEFA 2DB3A 4PRKA 2J85A 4HRAA 4EF5A 2OD2A 3T7SA 4JL6A 1RWKA 5LA6A 4EUNA 2PUEA 3S4YA 4MA0A 5JNVA 2ID8A 4PQYA 2Z5GA 1SKBA 1F8GA 9MHTA 1USIA 2CL6X 4YMUA 4H15A 1NBMA 1CF2O 3WGYA 2YQZA 3NETA 3PQ6A 3A1VA 2F62A 4NJOA 2AJDA 1SOVA 4J0JA 4GUAA 4HAOA 4PGGA 3TAUA 4KYIB 5AW3A 1GCIA 5LN1A 4TKUA 1BXRB 2HA6A 5BO5A 2CVOA 3L0SA 3RANA 1GKUB 3AXSA 3WMFA 4Z99A 2CNBA 2G0TA 3NNSA 1GA4A 1UM8A 2ZG6A 5IF3A 3MB5A 2Q5QA 1L7DA 5D85A 1OLXB 1U6IA 4F1KA 4YMHA 4NU0A 4KXWA 2YFQA 2AL7A 3FM9A 5CD1A 2P9JA 4XSVA 1C8VB 2ANCA 3BQMB 4WKCA 1J8FA 1ZEJA 3FGZA 1A4IA 4KQ1A 4AF6A 3IEKA 1CUYA 2WMOB 3FSGA 5BR4A 1NMSA 1ND6A 1PL8A 2ZSEA 5JH7A 1CJSA 2XUHA 1AQUA 3A1UA 3N2IA 5LB4A 4KAFA 2P6NA 4G5QA 5FEUA 1FF9A 4CEJB 1Z6ZA 1TECE 1Z4OA 1ISIA 2OLKA 1VL2A 3NIFB 5IN5A 1G2PA 1QB7A 2GCIA 2GD2A 2N1MA 2ORED 5FAXA 2QW0X 1JLHA 1RI4A 3C5WP 1KK0A 3K0BA 1FFWA 4P58A 3C4QA 2FUG1 3QKTA 5AKJA 3K0SA 2VR1A 3O3MB 4KWEA 4TKVA 2ZE6A 4RHTA 5F52A 1Z26A 5GIOE 1KOFA 2EKPA 2ZRQA 4DCMA 1H6BA 3MM4A 4KO8A 3DJYA 3GFBA 3TTXA 3DHWC 4R1MA 1QFJA 2VDWB 4B48A 4TV9A 4EEXA 3ANMA 2F4VB 4AI6A 2MSWA 2GTHA 3JVVA 3NAGA 1UPAA 3I9LA 3QF4B 4KK3A 4R8LA 1QIEA 1EINA 4XX0B 2AMFA 2CL7X 2EATA 4FEEA 3RM3A 2J45A 2VYND 3U4MA 2ZWOA 2CK3D 3K5WA 4JB3A 1UBKS 4MV8A 3M3DA 4UVEA 3KQWA 5D6NA 1NNSA 3DMPA 1MA0A 1HSZA 4BTVA 3NHJA 1Z5NA 2XQKA 5ESDA 4DMUB 1EZZA 1VPLA 4PSKA 3TRJA 2O0JA 4B4VA 4P3XA 3GU3A 5FEMA 4OXQA 1IXYA 1K8QA 3DVQX 4MV7A 4FIZA 5EI5A 4Q7JB 1K0FA 1CY7A 3N5CA 1BKSB 1BCSA 1UIMA 3BPSA 1L7NA 3HBNA 4JVSB 3UMMA 4JI0B 3NGLA 3RRYA 3IEVA 1NTOA 3KWFA 5DB4A 1PWZA 3GCGA 3ZWAA 2DX7A 2Y4NA 1DP4A 4Z0HO 4EJFA 2V6BA 4A0FA 3DDNA 2QVGA 3IXMA 4Z9AA 3TZ6A 5KNBH 1EQAA 2KX7A 3BK7A 2DWPA 1BZYA 1A71A 1M6NA 2KI5A 2Q07A 3OZAA 4A8HA 3O95A 4QBFA 1K63A 1GCUA 4KU4A 1TKRA 2RHLA 4O2BF 4Q39A 5JWOA 2DWOA 3H9EO 3OE5A 5FOSA 3D2CA 2OV4A 4D0RA 4B4OA 2GETA 2A3RA 2M98A 3HWX1 1JQ5A 1RAIA 2I03A 1JZTA 3MOIA 3WMEA 2ZPAA 1FU8A 4GMKA 3RU3A 1B2RA 2Q1XA 4NG4A 1QDUA 3L0BA 2XA1A 1O9BA 1C7RA 2RGUA 3P9NA 5EXSA 1EFAA 1MEJA 2W6NA 4KLNA 4AS2A 5EJ8A 4RTSA 1SIOA 3ESQA 5BMVB 1EX9A 3HZRA 3UTCA 1GDDA 3IR7A 4ZI3A 1N7GA 3A11A 3QKWA 4O2RA 4OGGA 1TAGA 2AXNA 2CLDX 2GVZC 1HT1E 3MCVA 5CA0F 1PG0A 2YINC 4DDVA 3U4AA 3ZDAA 4CU2A 1EQUA 1A9QA 3V2IA 2O8EB 1EX6A 5DDIP 1L6RA 2MYUA 3GA0A 1A9XB 3RFUA 4KFCA 3SBOA 4F3YA 2VQDA 1U6KA 2GJ9A 1EB8A 1NW9B 2G76A 3OETA 2BMJA 4GPAA 4K9PA 5EQJB 4GOMD 1T15A 3BL8A 4RXUA 2WD9A 4ND4A 4OJMX 5T4HA 3TIVA 3GZ4A 4PCLA 4NS1A 5DM1A 1H2ZA 3AT1A 5DGTA 3RC9A 1N2BA 1RR6A 3ENZA 3U3OA 1PHPA 1OWLA 2YJ6A 4KZPA 4WKPA 1NXSA 5H70A 4NXNB 1QC5A 2YV1A 2NACA 3CT6A 5JC1A 2RGBA 3KYIB 2ODWA 1DOAA 5AP9A 3EUWA 3OKPA 4YB8A 1LCIA 3K20A 2ZWAA 2QF7A 2OQVA 3WWCA 5FBHA 4B76A 2OB2A 1ZD2P 1X19A 3VTZA 3M3HA 2DBZA 3QFFA 3EBPA 4M46A 1E2LA 4FB5A 2QRHA 5A3RA 4MGYR 1FL9A 2FA9A 3P5SA 3HYTA 4R84A 2QUKA 3H9QA 2O7VA 5BSUA 1IZ9A 1KEUA 1IZYA 3JRXA 2JGLA 3OI7A 3UMRA 1ZU4A 5IFLA 3P5BA 2HXSA 4EL0A 2VQFB 3DB2A 1XPRA 5HE8A 1FBTA 2FW0A 1U04A 2IP4A 3KDSE 2O7RA 3KG2A 2IH5A 4FN4A 4KGVA 1XJ5A 3FMOB 3FWYA 3MTAA 4AKTA 1WZUA 1OLXA 1Z07A 2CNOA 4Y6SA 2RHMA 2XT6A 3V1TC 2RKWA 4CFZA 1YDGA 4IY1A 2IXFA 3OCUA 1VBFA 4D3ZA 1HI9A 1Z4MA 5DRYA 2H1RA 3A4TA 2BRUC 2YICA 2FFBA 4YRPA 3VC3A 4LXXA 4FFDA 1DXHA 3LUBA 3PNSA 2QM7A 3ZDRA 3PQDA 5CG2A 3EIFA 2D3TA 4WN9B 3ZHSA 5L6MB 4Q1CA 2BMFA 1E63A 5DFAA 2QUHA 3IURA 5FI0B 4WEQA 2DFNA 3ZU4A 4IJ5A 4K46A 3O2NA 3H3JA 4NV0A 3NVKI 2ZIZA 4GM1A 3TRIA 3URKA 1AG9A 3AJDA 4DZTA 2QP9X 5AHKA 1KQFA 1M8JA 1RYZA 1EVLA 1VSUA 1YBFA 4R0MA 4BGIA 1FTWA 3QVTA 2X0RA 1EAMA 5CJ2A 2XZLA 3JX9A 3U17A 4ZOAA 2CDAA 3WL7A 4Q4JB 4B71A 1PTKA 1YR6A 4ZZIA 4FYYA 3BWVA 3GLSA 3B13B 2F8LA 3ND5A 4ZRMA 5IAEA 4EO4A 3D6FA 3NH6A 5I7VA 3AZPA 3EZXA 4B35A 5KNCA 5KX5B 4U0JA 2I55A 3U7EB 4BGVA 1ODTC 3RJ5A 3G0GA 1O54A 1XZJA 3NHRA 4GU5A 3V1LA 4BCCA 4Y6LA 2YFYA 1YB5A 2WNHA 1WKVA 3DFZA 4HS4A 4YR9A 1EESA 2OBFA 3QYJA 5B1SA 3EZFA 4DHWA 5HE9A 5K20A 4MJLA 2J0QA 5F2EA 2WUGA 3TAXA 4Z9YA 4GOXA 1W5SA 2CYBA 1EXNA 2A58A 2HHJA 1E7YA 2JFBA 3K5HA 3ZX4A 3HSKA 4UASA 3PXEA 4Q9IA 2BZSA 1NLMA 1UANA 2ZJ2A 1K27A 5J5VA 3RQSA 5C37A 3I62A 2PFGA 2FZ4A 2AUMA 4ED9A 1G18A 4ZPJA 2XUAA 2PSJA 4L27A 3DDSA 4L5YA 2GBGA 4YCSA 2XMCA 1ISHA 4P4LA 3LOPA 4TZKA 1KSGA 1SKYE 2WC1A 2D0IA 2FRVA 3OUTA 3R9IA 4RO0A 3TS1A 4Z1OA 4M3NA 1G6OA 4P83A 1G2IA 3W2FA 4NP6A 2VF7A 1N9GB 3AY3A 3EC7A 4OHKA 4WFJA 2BTEA 4O4IA 4F91B 5EIAA 5GZ3A 3A26A 4NZOA 2ZBRA 3VPSA 2C0CA 5AW7A 3ZY6A 3AEYA 1OKKA 1ZO8A 4AM8A 4B82A 1H1DA 4DIMA 5A4KA 4MVJA 3ZEIA 4BKPA 5F23A 5ALIA 1RXIA 2H31A 4U2GA 2KMLA 3NHPA 1WCIA 3PWZA 1G8FA 2IEAA 4W7HA 2OO3A 1NYRA 4MYHA 2RAUA 2Q2NA 1NBOA 3Q3CA 2XNKA 1VKZA 3PPYA 4R8KA 1RWNA 3LQQA 2HMWA 2OFOA 3HZZA 3LOQA 1Q1AA 3L18A 3VU9B 2ROQA 4ENTA 3D4BA 3KU4A 4ZU3A 3A1WA 2BGMA 2DUWA 3PDWA 1XCLA 2J9ZB 2R7MA 3MINA 1GUAA 3MTDA 2RK4A 5LFAA 2HDNB 5T64A 1RJ9A 3TMKA 4PGFA 3PC4A 2CHGA 5LA6F 1T3GA 3K70C 1DWPA 5DCUA 4CM1A 4K9LA 1XD8A 3EZLA 4XQEA 2BMDA 4QOGA 5CGZA 1WXXA 4CFYA 3PXBA 3ABIA 1YTLA 3SXUB 4BLQA 2O50A 4B73A 3DMRA 1XDZA 2FWPA 2XKKA 5K99A 3CO5A 3EFOB 2YIDA 4HH4A 4LY9A 3PEVA 1GN9A 4L7QA 2OUIA 4BVJA 1PLJA 4B4KA 4EYSA 1GPDG 1HEIA 1AS3A 2GO1A 3EK2A 2A5FA 1GITA 4W8HA 1THMA 4BUZA 1W5BA 4QHTA 3P0HA 4HRVA 4U2BA 2VS1A 4RK6A 4D9JA 1HMYA 2O8FB 4GX2A 1H5NA 2QUAA 1KGSA 4XWYA 2ISQA 4IIXA 4LHXA 3DNMA 1OI2A 2WAYA 1SJ9A 2J46A 2ZRHA 1IMOA 2GF0A 2JCVA 4LNUA 4BMNA 5JH7F 1NQOA 2COUA 1U1FA 2FV8A 2HM7A 2KQUA 2AXPA 1E3TA 4C4YA 4YJKA 2NVBA 1H3FA 1ZRMA 3WGMA 3H5AA 4CM8B 3CVWA 5I7UA 4L76A 4BTLA 3ELDA 4EI2A 5K2OA 3FDFA 4OQMA 1GTSA 1GPLA 5HQJA 5JCOA 2N46A 1PEAA 4NBLA 5B7PA 4DKJA 1L5RA 5JCPA 1B74A 3HYCA 4XWOA 1FCJA 4EFNA 1G98A 2XIQA 2I2AA 1UDBA 2J32A 3V4PB 1FVOA 3EVEA 3ZVNA 4FYKA 1EBFA 4ZHSA 1Y89A 3KHKA 1GZ6A 4OLHA 4TV9F 3UV7A 5SV2A 1NSFA 4MRNA 5K3CA 5IZ4A 1GXSA 2Q9CA 2OGTA 2WZBA 4JD5A 4L85A 4EB0A 1H8ED 2QY6A 3KLPX 1PL7A 1Z0JA 1QSGA 1VJRA 2BGIA 1WUIS 2P6OA 4JBHA 4Z0NA 5CB4B 5JD4A 4OMCA 1TTTA 1J8YF 1Y80A 3PC7A 3PNQA 3W3ZB 3I0MA 1WCWA 4E5KA 2HO5A 1VM6A 2B61A 4G41A 3N3AC 1FZTA 2J33A 3FFAA 5GMOA 1FMFA 1T2EA 2RJOA 2C3MA 3N07A 4US2R 1O89A 2LCIA 3LL4A 4HDOB 4EPWA 1USWA 1YE3A 4NKRA 5LLSA 1GNQA 1BN7A 3FHLA 3HFGA 3WP0A 5IKEA 1XCPA 1G38A 2OFPA 1NQWA 1YUBA 1YFJA 4AY6A 5DNVA 1YAHA 3AUUA 1C7QA 1TM1E 1JHAA 2RIPA 3Q1KA 5KX5A 4NCHA 3TCKA 3FYHA 4LF9B 2Q7XA 2ZBUA 3FYSA 4TZ6A 3EY9A 4YCBA 1ZN9A 4KQ9A 2ECPA 1Z15A 2Y0DA 4EUKA 5AJYA 4BQPA 5K3OA 2YVKA 2VK4A 2W6QA 3X1WA 2QSJA 1P8AA 4ZVOA 2G80A 2VPWA 2O20A 2IP2A 1UDWA 4ND2A 4IQ8A 5I9TA 2C5FA 4A03A 3SKXA 2VEOA 4AMUA 5I9LA 4F2PA 4ECEA 1F12A 3CLSD 1P7YA 5KDLA 3WYGA 4PFSA 4DA8A 2W4MA 3MLBA 1FDOA 3IIIA 2ZAOA 1PWXA 2IYNA 1CXZA 1XZCA 2NPIA 1O08A 4MGHA 5AVSA 4GRAA 4FC6A 5TARA 2ZUEA 2ZJ8A 2YWHA 3KFVA 3ZCXA 4B5LA 2BR5A 3P9QA 2ANBA 2QMUA 5FUVA 1M7BA 5FPPA 2WUWE 1SQGA 1DV1A 2YMMA 3QEOA 1YZUA 3I5MA 2XOEA 1GQSA 3L6EA 4TXJA 1VHTA 3ZBQA 5LD2B 4CFSA 2PX3A 3T4EA 3F90A 1GQYA 4TTJA 3FZQA 5EP4A 2WWWA 5IM5A 3WYEA 1FMLA 1UDXA 1JT9A 1A9ZA 2NZVG 1F2TA 1N9GA 1TCCA 1YB4A 2NXNA 2W83A 2XHZA 2LDXA 5B30A 1AGRA 3G49A 4AWAA 3D7SA 2HK6A 3QTTA 3W5CA 1H85A 1ORRA 3BM5A 4ZVKA 2X4LA 3ZWOA 1VG0B 4PTYA 2P4HX 3VOAA 3QFTA 4GYWA 1L3CA 3EOAI 3GFTA 4Y2YA 3T5PA 3ER8A 4J49A 2NO0A 4MQMA 2EQ5A 4F46A 4TM7A 1PR5A 1S8AA 1YRLA 1FP6A 1N8SA 1Y8RB 4RKQA 5H7XA 1P1FA 3RTBA 2A57A 1Z5VA 1W29A 1AN9A 1Y5IA 4MLPA 4TRJA 5J43A 5JNUA 2A0WA 5ISMA 1KJZA 3QEBZ 2PUGA 4JQOA 3VHLB 1DAFA 3BJIC 1CD5A 4Y2XA 5H80A 4NR0A 1W48A 3IUNA 1XA4A 2PO5A 5C8DA 3T7RA 3ZCUA 2FSPA 2LVBA 4B9AA 3VU9A 3UGJA 3WTCA 2DTXA 4N3NA 2K2WA 3C6MA 3FHOA 4I19A 4N49A 3F6RA 3QY0A 4MUNA 1QU2A 1DQRA 3HI6A 3MTGA 3AM1A 1EX7A 1CJKC 1XDGA 1E0AA 1Z7YA 4ZO9A 3V32A 1TXGA 2NSLA 1GN8A 2P41A 1FXUA 3FF1A 1H69A 3AINA 5DGIA 3L6CA 2A14A 1T4GA 1LDMA 4ZALA 1FMJA 4YRTA 3PENA 3TRHA 2JZNA 4ZREA 2HL6A 2Z98A 3F7NA 1X1RA 3G7NA 2WSYB 4PZ0A 4FKMA 4RCVA 1Z4KA 3P9SA 4RFSB 4ZQHA 4BCBA 4G0YA 2QB5A 1FU4A 1N5RA 3VJMA 3LM8A 2NUTA 1NV9A 4MJXA 4V0LA 3GQBA 2X2OA 1UBNA 1SO8A 1YIDA 2QJTA 3MHTA 2YR0A 3CVOA 3K70D 1KJ9A 3IQWA 4DZZA 4UHJA 1JQDA 2FI1A 3QVGA 2FR8C 4XOUA 5EMHA 1VRCA 1THTA 1U0HC 1SUSA 1NW4A 4WZAB 1DJOA 3RK0A 4MR7B 4UPEA 3UT5B 2O8FA 3FPHA 3DBLA 4PBRA 4ON9A 4PINA 1E2NA 2QRVA 2Y0CA 1E99A 1M1XB 2EFEB 3EF1A 2SBTA 3PZBA 2WE7A 3LKDA 2XXJA 3P9KA 1TU0A 1M2VB 3EMVA 4FINA 3RGGA 5A9TA 3C8ZA 4PM4A 5FWXB 1ZOSA 5IT0A 1HX7A 1ZOPA 4GLLA 4CM8A 1VCNA 4GMDA 1QFMA 1THGA 2AC7A 1FTNA 1KYYA 2E82A 3D6VA 3WLSA 4QULA 3REGA 2CLKB 1NW8A 1PK8A 2NZ2A 4YP7A 3EGXA 3MUNA 3QW2A 1SCNE 2P79A 1ST3A 4OH7A 4F1JA 2WHRA 4IDHA 3T3GA 3EH1A 5H16A 3HLTA 1E2FA 3B78A 1YZTA 3ETEA 4JXJA 3A2NA 4UOQA 3K5IA 4XVCA 5JATA 3QTBA 4AF7A 3I9OA 1I4WA 4UUQA 2J5QA 2QD2A 2V8BA 4FYWA 4LG1A 5KYYA 3HBFA 3H5OA 3E1GA 3H13A 2H00A 2HSJA 4G65A 3MWYW 4QPJC 4KPUA 4F3NA 2HT6A 5IZCC 3DBVO 1F38A 5CUQA 4OJTA 1XR3A 1RM5A 5F1OA 4C30A 1JRLA 2W6PA 2YWJA 4KVGA 5DI9A 2FN8A 4AICA 4MV1A 2HLDA 4M1YA 1QRAA 2CDBA 5CDYA 5BORA 5FTWA 3QFRA 4JJ6A 3REQA 1F2DA 2Y1FA 4XTCS 2QRNA 1ZN8A 2C3OA 4IIUA 2QG9A 1V2HE 1U98A 4EUSA 3KEFA 2R8BA 3K9BA 1QTNA 3L6DA 3UK6A 1YVPA 4G4GA 3RYCA 2DUMA 2J0EA 2XRFA 1FXSA 3ACCA 2MR6A 1PTJC 5CFPA 3MC1A 3INYA 4L02A 5DHTA 2ZWMA 2J1LA 5SY4A 4S35A 4H6PA 4F2DA 1D04A 1ICIA 2IUFA 2K4MA 3JSXA 1J4AA 4IGIA 3G2LA 1COZA 3PK0A 5CBPB 3EG5A 4NCIA 2ZJ3A 2CXNA 2WF6A 3HRKA 3QUQA 4Q1VA 4O4IF 1K4KA 3LSYA 1OJ7A 2GD6A 1NPTO 1X80B 2X9GA 1X1QA 3EQ2A 3K92A 2EKQA 5FWDA 2ZYUX 3S40A 1PT5A 3EQ9A 3RSLA 4JOSA 3SQWA 3W8RA 2OV2A 3DVLA 1N5DA 3ZWWA 1W1IA 4JXXA 4MVJF 1GPH1 5ALPA 3OFVA 2J59A 2NYUA 3GEHA 4XB6B 4CDGA 2H85A 4E21A 5B3JC 3EXFA 2GZAA 3S7TA 4OQ4A 1N0UA 2D62A 1EBBA 1Y98A 2YXEA 2VHEA 3LCVB 1WU8A 3MF4A 2IT1A 1J00A 4CLDA 4L8GA 4BBZA 2CFCA 3LCJA 3ESBA 4TRRA 5B4VA 2V7XA 3IB3A 3H5NA 4AJLA 2CV1A 4DMMA 5B1DA 3GT4A 3L6RA 4RC9A 4BLPA 1FOEB 1QIHA 2VPYA 3M6AA 5FTKA 4JI7B 2QA5A 1OHHD 3WNDA 2HUNA 3NALA 4FZ3A 2EZTA 4MLZA 2XXAA 3RS8A 2WG1A 3GG9A 5JXJA 2EYQA 2OHVA 2YZKA 3CUVA 4LEIA 2IV2X 3RW9A 4B81A 5DGCA 3C74A 4MUGA 2BVNA 1MH1A 3W2IA 4BWYA 5LKAA 1BDIA 2ERCA 2WKWA 4MIEA 4BNJA 4RVGA 3B6KA 2C4TA 4IDGA 2IF2A 1IVNA 1I3CA 1VMAA 2CZCA 3UAOA 3RU2A 5AWFC 5I45A 2AG0A 3JQ7B 2IZ7A 3J81k 1ORWA 1SXJB 4TROA 1CRPA 3WOVA 2VSOA 4KO3S 4J7UA 3KD2A 2QZZA 5CDFE 5GVSA 1WR8A 4DFDA 3MYRA 3DCNA 4PRYA 2OHJA 3U4HA 2X0IA 2YQ4A 4RMGA 3TTTA 4DW8A 2WA2A 5KVQA 1YACA 4DV7B 1I5EA 4ZQFA 4CR8A 2A59A 1ZH0A 2C78A 1TAHA 5F12A 3UPDA 4RLFA 2O1XA 2FZ5A 4J0GA 1GAWA 2CLEB 3FDZA 3QV2A 3WJ7A 1RIIA 4CM9A 2K6GA 3L8HA 3M82A 3K15A 5MDHA 3MFQA 4XD2A 5ANRB 3UHPA 1KL7A 3UMBA 1LEHA 4RFSA 1BOFA 4OBWA 3V4RA 3MPOA 6ADHA 5G1OA 1MAUA 4KRGA 2DU8A 3L7IA 4FEYA 5JAMA 3HYRA 2ENWA 4RHXA 3STUA 3E27A 2VZLA 4PYOA 3H75A 2CXOA 2GHRA 2ZS7A 2W11A 5G0TA 4NBVA 2CVHA 4G23A 4M7PA 4OHMA 2DQ4A 1QHIA 2E87A 5H68A 4R40A 2H52A 4B46A 1U8XX 4JQCA 1GJRA 3ZE2B 4WZAA 4EPYA 4OFBA 4C21A 1JHOA 2QU8A 4KQEA 4LTMA 2LD4A 2PJZA 3DXZA 4INAA 3UT5A 1F1JA 4YUWA 3GDWA 3FFBA 1NKTA 4FS8A 4JWTA 1A8PA 3UWSA 1N8NA 3F98A 4G37A 3W3AH 4LXGA 1JPNA 4AUMA 1JVSA 4YNBA 4K8RB 2R751 2H7VA 4Y6RA 4TWJA 4A2PA 1Y7TA 1DKLA 3VMFA 1N0HA 3D8NA 3STXA 3T7EA 1T6XA 2CEAA 2FETA 1G5TA 1T43A 4JGIA 4JX8A 3M49A 4Q3NA 4QYSA 2Y77A 1ML3A 5DASA 3SMVA 4CL8A 4LF5B 4WPGA 3TTYA 1Y6RA 1LW6E 3L6OO 2RBEA 3THSA 3NTVA 2H5LA 1TPZA 4HFNA 4URFA 3D3KA 4AK9A 4BV8A 4Q7LA 4KHPB 5KX5F 1XTTA 2HREA 1G8GA 2BI7A 3LWBA 4IDBA 5ULLA 4NPAA 4EMBA 4YCNA 3CQ9A 2Z5VA 4J43A 4TYYA 1RRMA 2PH7A 4DG5A 3KQLA 3DCYA 3SFZA 3R0JA 3ZWKA 1PDOA 4PSUA 2HX1A 4UU8A 2ZRGA 1RQRA 1JAYA 3LFUA 3KR9A 4KWCA 2YZNA 5JO9A 2YYZA 3CZPA 2R6DA 1WD5A 3JRNA 4TTTS 5BRNA 5F73A 2Q5FA 2OYCA 2HIMA 3O03A 2FR1A 5LDGA 2IKSA 3WSWA 1MDFA 5DSTA 3DUWA 3A9WA 3OZBA 3DTVB 4MW0A 2V96A 4O4HA 1O96B 2NT4A 5A4JA 4TZ0A 2IQIA 1T3HA 5KSYA 3PFWO 4PSCA 5FO1A 2I4RA 3DTYA 3T3OA 1ONPA 4ENUA 1JDBB 4ZO6A 2XTMA 2C04A 4G5YA 2XCTB 4J0CA 1OY1A 4JA0A 1U4SA 3HUUA 2XVZA 4JVOA 2WA1A 1XTZA 1OGJA 4G0OA 4G9BA 4RACA 1XMXA 1G6HA 1UT6A 1A76A 5CBPA 2H07A 3O7MA 3ZJYA 1YKFA 2PEYA 2Q3HA 2Y2UA 3D2AA 1L7QA 2GZHA 3LOUA 3WNCA 4AX8A 4BP8A 2QTAA 2H1LA 2CFIA 3THOA 2PT6A 4UQOA 1E6LA 4PVCA 1JQLB 1LNSA 3JWGA 5ALYA 4WKBA 4QUGA 3A4IA 4YQEA 4FGUA 1EHIA 4LK2A 1NLFA 3RO7A 5KYYB 1TLTA 1ESZA 1V25A 4H1VA 5BPHA 4G8CA 3CF4G 4KXVA 2H92A 2DXIA 3LO8A 4F6RA 4O5AA 5K4AA 4BMCA 3FJ1A 4DR6B 3I30X 1GL3A 3LHFA 2AEFA 3GX1A 1UFOA 1I4TD 2JRLA 2Y93A 2ZJ5A 1HSOA 4ZO4A 1JA1A 1KP9A 1O6BA 3ZCQA 4L16A 5LL6P 3GRVA 3PE4A 4GWKA 1J06A 1I3OA 3WRXA 1DKMA 5A2GA 3BKXA 4ERNA 1II8B 2CJXA 2RFLA 3PE6A 1SIUA 3RKSA 1PLKA 3AFIA 2F4NA 4AS1A 2ACKA 1DZ3A 3C39A 2HW8A 4L4XA 4CEHB 1VHDA 4KMRA 5J2TB 4ZK2A 4KR7A 1U7XA 1BKYA 3QX8A 3D3WB 1HKHA 1RI3A 3MMSA 3ANXA 3FUUA 3OQNA 1OGIA 4JBLA 1Z06A 4Q4HA 3JQ7A 1JKJB 4RWZA 5F1KA 5JXIA 3ABSB 3MWKA 4PQGA 4ENQA 3FOFC 4PO8A 5HUQA 5M04A 3RSQA 2BFWA 4GX0A 1UBFA 3KQYA 3USES 3DL2A 1TZKA 4II7A 3TRFA 3JWJA 5EAIA 4RQUA 3HA5A 4S1TA 5K2MA 2OA0A 2B20A 1IZ0A 2HQBA 1CUBA 4M54A 2PWYA 3K1JA 3FTPA 4D9MA 1JWLA 4Q00A 4MDFA 2MIIA 4OB6A 1ZIPA 1LQUA 2LP4Y 2PS1A 1BXKA 3E9RA 3HGQA 1PEDA 1U8UA 1YC5A 5KQRA 4CDMA 1QZ3A 4LV6A 3OAAA 3GFQA 1N7HA 4S1PA 3PRYA 4BTEA 3HGMA 3K71B 4YJDA 4ZCTA 4Q7MB 1MCZA 5C4IA 1MIHA 4HGOA 2F55A 1QRSA 1RHQA 4F5DA 3IAFA 4F92B 1O5OA 4HBZA 2H4JA 1P60A 2OE2A 4DR4B 4BNMA 4IDOA 2UV8A 4ZRNA 3I37X 5GONA 2FSIA 3R5FA 1KRHA 2IZ0A 2X6RA 3ZJVA 1D9XA 3BAZA 4FEAA 1S7CA 4RCZA 5HUJA 4IHQA 1WKBA 3GVHA 1P4SA 2YWFA 1JHYA 2LIPA 1T4CA 2PKXA 4WJZA 3QTLA 4N8SA 1IOZA 2WJZB 1P1RA 3FTDA 4GDMA 3TNYA 1U0TA 3CX6A 4YLGA 4CT0A 2XMPA 4YHBA 4B3DA 1R9JA 2HFKA 5EZ5A 2DFDA 3L6BA 4E3WA 1LFDB 3FR8A 4D42A 1WQ3A 2A3NA 2YHSA 3CZ4A 1RWWA 1TGVA 1JI3A 3CT4A 4DNQA 4FHDA 5EZYB 4J94A 2IW1A 1EUQA 3G8AA 2FKAA 2PCLA 1UMCB 3C1OA 4I5GA 5DM70 3M5CA 1QAQA 4PYMA 4AJKA 1SBCA 2O1WA 1J1IA 5DHPA 2V0NA 5EMNA 4BY9E 1XA3A 2ZT5A 1C41A 3D31A 2AX3A 1Y82A 3OEHA 1U2ZA 1WNFA 4Z7QB 2WT9A 4JYZA 1AS0A 3GRYA 3DBRB 2G1AA 2QRMA 1EDZA 4XVHA 1SBIA 5KYVA 3Q3IA 1FNBA 2CJWB 1SG6A 2JHAA 2YXPX 1XO1A 2UDPA 3NR2A 2J3MA 3ETJA 5KVVA 1RSZA 2HZ7A 2JEZA 5T4FA 4PG8A 2PMCA 1O96A 2UVPA 3PFFA 2YNMA 4KMMA 3O94A 1U0GA 2FMHA 2NW6A 3F3MA 5HGXA 3MCAA 2FWJA 1VECA 3IVXA 3COWA 1B0AA 2J7PD 5M29A 3G2KA 3KRTA 1N2HA 3KYBA 2ZM6B 3V4LA 5E7QA 4M76B 4S2UA 3UHAA 2ID7A 4A3SA 1DCMA 4AXXA 4WH0A 1NW7A 4V0KA 3OPNA 1U7ZA 2DCMA 3MT9A 3O4FA 3BEOA 4PZLA 1N8TA 5DN6A 3D6HA 3MJEA 1D2AA 2A7QA 4D0GA 4M1EA 4JA2A 3B1XA 5G4KA 3SOZA 1Z28A 4QJIA 2JFPA 1ZP6A 3H2HA 1L0BA 3FNEA 3KX2A 2VDRB 4C0BA 2Q5OA 4YV1A 1DUIA 3KQMA 3M5WA 2VJOA 1CS0A 4Z9FA 4Y7DA 3SM9A 4PN3A 4C29A 1ZINA 2V3CC 1CSEE 1Y4SA 3UO8B 4UTVA 2X1LA 1ELOA 3C4VA 4B87A 1X74A 2X1VA 1TMOA 4R0VA 3IVRA 4RY8A 4HQFA 4MKIA 4NAHA 2C29D 2ZJ0A 1DEXA 2O2GA 1E6WA 2DFTA 3NYQA 4MITA 2JF0A 4YH1A 1NN0A 1UAYA 5BN4A 1UEXC 3BHNA 3I1FA 4H7DA 2YV2A 3ZY2A 1B43A 2IXAA 2P5UA 3A58B 3F4LA 3TOXA 1CR4A 1DEKA 1NVVQ 4WZBB 1L5KA 4AROA 5C1DA 4YUYA 5GJBA 2GK6A 1NHWA 4E4RA 2QTBA 3V8NA 4MVCA 2VDMB 2QAGC 3IKLA 2HHAA 3NUZA 4NICA 3K5PA 3TCXB 3WV5A 4NMWA 1AV6A 3ND7A 2HMTA 1FLVA 1TADA 1E1YA 3SN6A 3ESRA 3UB2A 5HJ2A 5I9IA 2BYTA 4MJ3A 4OQNA 2R96A 2VYVA 1B4DA 3DDCA 3MELA 4OXNA 2A9QA 4G5XA 5HFNA 4C7KA 5C5EA 4CEHA 3LI2A 2FUCA 2PMDA 5J2TA 3D3WA 1LSUA 1Y48E 4P3PA 2WOJA 3FYUC 4EW6A 1IU9A 2E49A 3FCOA 1JKJA 1JWAB 3ROXA 4E5VA 3FFXA 2PXAA 4JB8A 5AKYA 2XGSA 3OCZA 4JELA 4HNHA 2QLLA 4BE9A 1QORA 1KZ1A 1IN7A 5TVKA 3CUYA 1TD1A 4N7JA 2H1OA 2Q62A 1VC2A 4F38A 1M75A 5JQGA 4QU9A 4YMLA 2QX7A 5JNLA 1ZWKA 3B3GA 5HQTA 1M2JA 1SHUX 4CE6A 1U7DA 2W43A 1U1CA 3N6XA 3PX7A 3OFNA 1C1XA 3GZNA 1E9DA 3PHGA 3WNVA 2LGJA 2GFHA 3AEQB 4KOAA 3RVBA 3F9RA 4ZAVA 821PA 2WV7A 4CKCB 5JYCA 1I14A 3OZXA 2OG2A 2XQJA 3FX2A 3KV3O 3OF2A 4UBKA 4DA7A 6Q21A 1YI8A 3HU3A 4A5SA 3M3PA 3JQ8A 1QFSA 2AXEA 4BUCA 4C5AA 3KLMX 3HB0A 5E2IA 4DLXA 2NXJA 2I6SA 1A5AB 1VPVA 3GEIA 5AICA 2A33A 1Q95A 3FCAA 3RYTC 1QR6A 5FR1A 4FLEA 2UYGA 3EGWA 4WNCA 1KI9A 5AW9A 2HA7A 3KU1A 2VHTA 3QVMA 1IJKA 3BMOB 3C7CB 1GSHA 5JI2E 2R62A 3HSYA 3ED5A 3PCXA 4FS3A 2OR3A 2W42A 5JXHA 4YX9A 2G6TA 1CQIB 2ODQA 4H7FA 1PZNA 4K6OA 4DY4A 4D99A 4YJ3B 5EZYA 1Z0AA 1KYVA 2WU8A 1XNJA 2VRWA 1T8UA 3B9PA 2XUGA 1TW3A 4LZLA 4O4HF 4UBJA 4ZOCA 2BEVB 4R1NA 2HXGA 5JY1A 3ADDA 2QUBA 3DM5A 3KELA 5A6SA 2XOXA 1XTKA 1P2UA 5B3LA 1RPTA 1SOAA 3O21A 3WGIA 3QPDA 2PYZA 1FTQA 3E70C 5LJIA 4YALA 4YMSA 3R6GA 2VNAA 3KIPA 3LZ6A 3E22A 3TB6A 3UQYS 3EPHA 1TVMA 2H4XA 1VE1A 5BSWA 3CZ5A 3KVOA 3DBRA 4Q7QA 4GRIA 4LSWA 4RPKA 1U9YA 1VLQA 3HYSA 4AZ0B 1E9VA 2JIMA 4UZSA 1GRCA 5A05A 1U63A 1PYOA 1TUGA 4OKNA 3ELBA 5B1IA 2TMYA 3WQBA 4B84A 3UJDA 3KZMA 3ZNPA 4XI9A 1SXGA 1SUAA 2HDOA 1XMSA 5D5HA 5THXA 4CODB 4EG6A 1LJLA 3LVBA 4N03A 2ICAA 1PS0A 3HY3A 3NTOA 2IYQA 3LE8A 5HKKD 1EZ1A 4DSZA 3IJ5A 2VHJA 4KVFA 3ONFA 3HXTA 1DKUA 2Y1XA 5J5AA 2CGEA 2W2VA 3AO0B 1PNQA 4KR0A 3S29A 2XD4A 2Q41A 1SAYA 3KUDA 1BXZA 5KKAA 4UD2A 5B1YA 5IT9A 3RB8A 4WSOA 5DPMA 4A2CA 1H0SA 1JR3D 3GI1A 3VKVA 5BXYA 1YOVA 1YVUA 2PWPA 4QPCA 1GEGA 1JFRA 3Q3JB 1BSVA 3UY4A 2CCGA 2D5CA 4HV4A 3MZ0A 4RA6B 3NWEA 4XUEA 3NFRA 3UKDA 3M6IA 4BFLA 2QX6A 3C16C 3VDNB 4BX8A 4OP1A 1WLSA 4ZVLA 2R8EA 3NASA 3AR3A 5ALGA 1P19A 3KJXA 3EEOA 4MW5A 5HRAA 3FWZA 1W35A 1RW4A 3DOFA 4U7GA 5K3FA 2ZRAA 1GL6A 3C6QA 2I2WA 2Y6VA 2VXYA 4MX8A 1CVIA 4ACAA 2OV1A 3FPAA 1RDFA 4G56A 1LSSA 1MB2A 2E4ZA 3GBSA 3FNIA 4ZQEA 4KN6A 3CGGA 3URMA 3WMWA 4E03A 2DJIA 5AW1A 2QGZA 1F3LA 3CH4B 4JLDA 2XITA 3ND8A 2FFHA 3R8CA 2G0AA 4S2EA 3SF8A 3ESYA 1N6KA 5CX1A 3WIUA 5H1YA 4G9EA 2G71A 4IV8A 5LQMA 3GG2A 3PHCA 5HKAA 2NVOA 1W25A 2W6ID 3I8SA 3QXSA 3REFA 1BNCA 3BQNB 4ISBA 1KKLA 1VE7A 1YJXA 3A7DA 4QT0A 2V98A 3ZLUA 4EG0A 2ACWA 2EBHX 5DLEA 4Y9DA 2IHKA 3NG1A 4P7GA 3I4CA 1SOMA 3O4JA 4NX2A 2JEOA 5CK5A 1ZL2A 3MS4A 1GGEA 5LB2A 4DCPA 1J5EB 3Q6NA 2YASA 5DV9A 5TMEA 4DNPA 2BFMA 4DS3A 4WBNA 3SSOA 4X6LA 4F2WA 3GMDA 1O4WA 4OUDB 2Q1TA 1V5FA 5GONF 1CR6A 2VRBA 4LPSA 4XGRA 4ARZB 5HZGA 3U44B 1EWRA 2HU8A 4KX5A 2FVXA 3N0TA 1GGKA 2JH8A 3KQTA 3UFXA 1Q12A 1U31A 3CXUA 2QXYA 1ISRA 1GZ5A 1Z29A 4NMLA 2GHIA 3GJYA 3M6WA 1IVSA 3HO6A 2CXRA 3SYTA 1M34E 3DOJA 3BJZA 4PYLA 3A6KA 3WOHA 3AHJA 4PIVA 4TGLA 5L3QB 3AEQA 1YZHA 2A5JA 4OGKA 1PVVA 4JEHA 1ULAA 2I2XB 5E9JA 1BVUA 1NP3A 4MARA 4CKCA 4KIFA 4YRNA 4PONA 4LX8A 4XIIA 3DTTA 1J23A 1P4RA 2D5LA 2PLFA 3O4GA 4JAVC 3EDMA 4X41A 1KZHA 1P4HA 4B34A 1ZHFA 3UJ7A 4PYJA 2HR1A 1FTGA 5EMMA 1P5FA 1ADBA 4B7CA 5BOSB 1E3DA 1NVVR 3E7PA 2C7OA 1EYZA 4GP6A 2P2LA 2OL4A 1UP7A 3GLQA 4DCCA 3NYIA 1BCRB 3SJUA 4OQXA 4L8VA 5B1EA 2ERXA 2IH2A 5HS4A 3LY8A 3HYLA 4YCAA 3EXG1 1ZK2A 2IFTA 3BMOA 3Q8XB 4IXNA 2VYNA 1M2WA 4KLAA 2QN6A 2CK3A 4R9UC 3HBMA 4UHBA 1ZONA 2YWRA 1C29B 5CXXA 3U1VA 3WQSB 1NLZA 2JLWA 3JWEA 4PGAA 4BZWA 1VG1A 4ZGWA 1CQIA 2FN3A 1JEOA 3LHDA 2JH9A 3BWMA 1XOIA 4W9NC 4YJ3A 3LC0A 1SXJE 2FZEA 2ZI9A 3CC8A 4Y98A 3GFRA 4EYQA 1FS6A 3DE2X 2P9EA 4GE0A 3I9NA 5IBRA 2ZB8A 1E1RD 4BJHB 5AHRA 3CRNA 4FMCB 5G0UA 2ZK7A 1TYZA 4NY1A 2PQ0A 1GKIA 1UPTA 2FMUA 2IWRA 3GR6A 2J6IA 5CH8A 1EE2A 3W8EA 4FD2A 3E9CA 4B3FX 4EB8A 6LDHA 4KDCA 2WTAA 2WIBA 3NRBA 4HDKB 3UXHA 1VKHA 4WXMA 3C41J 3DULA 2C7PA 2ZSJA 1MQ9A 3L0DA 4Q3EA 1QV6A 3MBKA 2AG8A 3VSAA 1UODA 3G9XA 3R8XA 3UPUA 2VQSA 1YDWA 2WD7B 2Z2YA 3L7LA 3T61A 4DXDA 5ICMA 4G4SO 1UIRA 1SCKA 3SS7X 1PNTA 2BISA 3GLHB 3B9QA 2QV7A 2BE9A 2GM4A 3OE4A 4NYJQ 1Q1GA 3ISJA 3KYJB 1NOKA 4IXTA 1DQNA 2C3PA 1BQEA 2ZITA 2PRZA 4PGHA 4QSHA 1T2NA 5BSTA 2ATXA 5AM2A 3H8WA 5G1PA 2FN7A 3PI6A 4WN3A 1L4YA 5KYGA 3ZGLA 1RKQA 4LHEA 3DFMA 4J6FA 4FJ0A 2C8JA 2P6MA 3CTMA 1BE6A 1Q1NA 3HBLA 5IUJC 2OYRA 3VHXB 3K0HA 4JP1A 2NU9B 1A4RA 2IYRA 4JJ8A 5G0VA 4E31A 2DTEA 3T3HA 4DQXA 3FGOA 5MN4A 5KQPA 4LJYA 4XA8A 1F2UB 5C8YB 2ZYIA 4RZHA 5TQ0B 3V00A 3GD5A 3CVXA 1MX5A 5L95A 1CUVA 1AIPA 3B2QA 5DXJA 3KZXA 1HK7A 2B1IA 3DBOB 1O6GA 3HCBA 2LKCA 1DC3A 4RA6A 3WKEA 5BSKA 1W4CA 2TMDA 2JVJA 3Q41A 3GJTA 4CT4B 3N2NA 2J6HA 2VEDA 4RZXA 5J2TF 2DPMA 3RVRA 3JQBA 3PPWA 4JXZA 3C3PA 1PJTA 3L1KA 3DV0B 1U2GC 5DVZA 2ZSDA 3QKSB 3EIUA 1R0LA 3FFTA 4M86A 4NYIQ 4A0HA 1QK3A 2GM9A 3LQRA 5GZ6A 4GG1A 5DKFA 1UBUS 1CUZA 3AERB 3WLRA 3CVJA 3F7OA 3LGAA 2PXHA 5IX8A 1QLJA 3LK7A 4Q3CA 2BMVA 2JKZA 1J33A 3FMPB 2XV1A 2Q3LA 4IZIA 4DHEA 1BGWA 3U39A 4NBSA 2VAWA 5JQGF 3IP8A 5M3BA 1I4DD 4LRUA 2XZPA 3V34A 1K86A 1NJ1A 2CJPA 5TF4A 3FPCA 3KE8A 4I08A 4K28A 4QPPA 2CF5A 4GM4A 3FKJA 4KFRA 4E70A 1GTZA 3OOYA 4MRSA 2FXVA 3WISA 1Q77A 4PAQA 3O1JC 1JTEA 4UE2A 4D9GA 6GPBA 1W8IA 1KAQA 3CUSA 4L50A 1Q1EA 2WKSA 2YXNA 4M1MA 4DVJA 3A2KA 1DJLA 3LRTA 1L7BA 3Q7QA 4MNTA 1SCQA 3DTNA 2GEVA 5AVYA 3GLIB 4KR3A 3U3ZA 4EDFA 2C9MA 3IEUA 1CR2A 4OUDA 2OV8A 1OLUA 1CLUA 1L5FA 3E6AA 3E48A 3IMFA 4KQJA 3P97A 4NBNA 1V6SA 4W1PA 5FPSA 2GFIA 1CUSA 3OTOB 1IBSA 2L17A 5LMUB 2P9YA 2B94A 2H63A 4RYLA 3T9AA 4D9IA 1DKNA 5C3UA 5JMWA 4JJFA 2QDXA 2NPFA 4PN7A 2NOAA 4PSDA 1CQXA 4CYMA 1I1QB 1V35A 2D0PB 1MMFB 3OCXA 1X94A 3UIEA 1R0RE 2HK7A 2WM9B 3CZQA 2OBNA 4YROA 3VFDA 5L3QA 4U8HA 4KACA 1ZNXA 1DC7A 2O3SA 4HT3B 1XF1A 2GVNA 5KUTA 1W581 5EZYF 2XZOA 4UCFA 4HYQA 4WASA 3GJ8A 2GWRA 4X54A 2V65A 1D2CA 3ECSA 3KNZA 1VB3A 2V5UA 3IILA 1BWPA 1N2CA 2QE7D 3A4YA 2RARA 3F74A 1HT2E 3KJFA 3FKSD 1J9GA 4A6EA 1V6AA 1V41E 3RBVA 5DNDA 3RUCA 4TS9A 4D8XA 1U5BB 3V9PA 1BCRA 1RPJA 4LOLA 1NMXA 2H18A 4EY8A 3GEMA 2VOEA 2Y9PB 3MJRA 2HEGA 2QTVA 2MT9A 1PS9A 3RTEA 5A4FS 1U0FA 5CDTA 1UUFA 2D1YA 5KU7A 2ZFUA 5JSKA 4PAMA 4C05A 1V3UA 3BFJA 2BFAA 2H51A 1U1EA 2V7TA 2REXB 4TMKA 4KPFC 4JNKA 3S44A 1VMDA 2OC9A 4RV9A 3PWTA 5AKGA 4FR0A 1KEEA 2COKA 2VZ9A 4JYPA 2LZ0A 1NM5A 2W2QA 3VDXA 2QUIA 2ZUTA 1V9SA 4M0DA 4Q9HA 1GLGA 1RRGA 2L69A 3PHJA 2WJWA 4HAUA 5HZKA 1E79D 1UXKA 2QZ4A 1XNHA 4QJ3A 4IP0A 4E12A 3DB1A 1P77A 4OFWA 5ALUA 3A1CA 1PDVA 1LK7A 1UADA 3C7TA 1X7WA 5D7BA 3BL5A 4RL6A 1FRZA 3GQVA 1LLCA 4YDRA 2X3FA 3FD8A 1JNXX 1E3IA 3O8OB 2D2IA 3BICA 1Q83A 4MUKA 5K3BA 4F9FA 3KVVA 1KVUA 4ZCQA 1GZ3A 4C07A 1DIHA 1ZCFA 3PGKA 3SE7A 1PJCA 3BGSA 3DC7A 1BN6A 2AOTB 5L45A 1TTHA 3QVUA 1LTHR 3PEUA 4BB9A 5AYVA 1OVGA 3P2KA 5KOJB 3VDRA 3ZHCA 1P1JA 3RAGA 3S81A 5H02A 3R3HA 2JAUA 3AUXA 1IRXA 4MVJM 4KLRA 3TNLA 2KBEA 1P9NA 3C6YA 1Z7BA 4D4GA 3NOXA 1QCDA 4IKPA 4MQEB 4F5ZA 1OW3B 3I61A 1CKEA 3ASZA 1MR3F 1JIUA 1VE3A 3CU5A 4YK7A 5DMHA 4HUTA 4ZJUA 1HRKA 5C8YA 1AUVA 5TQ0A 3N7UA 1C5KA 4QQNA 4W1QA 4WLNA 5U4QA 3JSAA 2ZP1A 2X5NA 3F78A 3LAWA 1P8JA 2A6PA 3PD0A 3BXFA 2AFIB 3GRAA 4EMUA 3QUAA 3U19A 1A1SA 2K7ZA 1UMDB 2HRCA 2OT3B 5JDIC 5FWYA 2PUVA 2JL1A 2IZZA 1D09A 1PD0A 1B73A 1SCDA 4TKLA 3DV0A 1HOXA 3SEAA 2NT3A 3VZRA 5EJFA 3CJTA 3SC4A 5BXQC 3NORA 2IYXA 4FCVA 1OASA 1PR1A 4DCGA 1W0JD 1QB8A 2GBPA 4E2ZA 1NF8A 1JEEA 3N9IA 1BWRA 2JVIA 1GFIA 4I1VA 5AQEA 3LD9A 1TOAA 3BQ9A 4TLCA 5ERGB 1PU2A 3AERA 3CNHA 4WBNF 3OD5A 1Z8DA 3M33A 4L73A 3W5AA 4I99A 1BMFD 4DC0A 2F3QA 1QE3A 2E0IA 2GZ3A 1IY1A 2AEEA 1GA6A 2UVDA 3EAGA 3LMKA 4GR9A 1QH1A 3TW6A 2P9HA 3MQFA 5K03A 4W6QA 2I71A 3UJAA 5REQB 2P67A 4TXMA 5LCXA 3L7OA 3E1SA 3QWIA 6NULA 1OF1A 1BFKA 3DNPA 3ORRA 4NYJR 2OOKA 1KBQA 3NU1A 3Q1LA 4L4RA 1AF7A 1AX9A 4TN5A 2ZI7A 5LR6A 1TA9A 3CH5A 4NZZA 2G7ZA 3ETDA 1WBDA 3OPYI 4BFYA 1CIJA 1OXXK 4JVLA 4HNAA 1QHYA 1IXKA 2DF8A 1U3TA 1UBTS 5CVDA 3KLNA 5ES3A 3PYMA 4XR4A 3GLIA 2G9UA 1RWMA 1ODJA 5F7XA 1OLSA 4FYHA 4YRMA 2I6XA 4TL7A 3THWB 1LGYA 1LRKA 4YRFA 3B1WA 3S99A 1L7VC 3J7AC 4RIFA 3OWXA 1WB5A 1WXDA 3MAJA 2HA5A 1KE2A 3SNHA 2GX6A 5AJHA 1QQAA 4YECA 2IUSA 2JCGA 1MTOA 1H8EA 2NGRA 3UMGA 3WGLA 4A26A 4B6QA 1NUQA 3L46A 1HZZC 3D4OA 4JL8A 4NZPA 4YRRA 4JBXA 4YJ2A 5C52B 1WX1A 3L8EA 1PE0A 4JMPA 3THRA 1DRVA 1E4EA 4AJJA 1NXWA 3FDXA 3A3NA 5E6UA 5IVDA 4EYGA 1OXSC 4KYTA 4CTJA 5DBHX 1ECCA 4YJ3F 4WZBE 7REQB 3IKVA 2VT3A 5FUYA 3N2YA 1TK3A 2QW8A 3J81A 3N1UA 2LIVA 4QWMA 1VFPA 3ID6C 2VP5A 4NYIR 5IK2D 2H06A 4LXQA 1DAGA 2O2HA 1R74A 4CKXA 1B41A 1U5BA 4DDKA 4YT2A 3SJ7A 1I0ZA 4I1OA 5MFPA 3TR6A 2X0FA 2A5LA 2GPSA 2R65A 2DH6A 1HV8A 4AMZA 3BXPA 3O8LA 1E2EA 1ZVJA 2RI1A 2QMYA 3LDGA 2PRSA 3QWBA 5CEEA 5F5XA 2O5RA 2P30A 3LC1O 5FOQA 3KT8A 3WXMA 1UEIA 2HMVA 4GX5A 2IEBA 3VA7A 4BNHA 1QRUA 4LZPA 3AEUB 2D0DA 1DDGA 3NTUA 3QWAA 4EVIA 2WABA 1MP0A 3OQIA 3V9AA 4URVR 1G9SA 3GMSA 1H93A 4C0XA 4EPRA 3HDYA 1Z22A 2CL0X 4XDYA 1ACMA 4GR5A 3DE7X 3K1ZA 4V0ME 3O82A 3M6UA 3H97A 3OP4A 2WWFA 3IA7A 4BQSA 1XTSA 3IEPA 4ITUA 3UANA 5JADA 3S2EA 2E4WA 2Q0SA 4PC7A 1DWQA 5JISA 1L9XA 5HNKA 2E85A 3FOBA 2JKYA 2AMLA 1F7UA 4UQPA 3AEZA 2EP7A 2VRCD 3UUGA 5EINA 4MYTA 5SYMA 1O95D 3COJA 1XTIA 2EW2A 5ADWA 1HNXB 1JHRA 4GMXA 5D00A 1N2JA 1B1AA 1N6HA 1YR3A 1QIDA 1NDHA 4PYQA 1QDLB 2BELA 2BE7A 2QL7A 3C1AA 4YT5A 2CL5A 3TF5A 4X60A 1N1DA 1KEZA 1SEVA 4MRVA 2VHYA 5KOJA 4OX9Y 1Y81A 1OREA 1U80A 1PR6A 2QM0A 4MUAA 1XCGB 3FIUA 2FQ1A 1OFUA 1UXOA 4IDQA 2HADA 1OUMA 5FWAA 4Y18A 3HCEA 5BQOA 3MCUA 5ES4B 5HYVA 1D1PA 4CG3A 1RHUA 1Z4JA 4Q12A 1HA3A 1ULUA 3MT8A 1NIJA 1G59A 5HQ3B 1V3TA 1S2GA 1P0CA 2AI1A 1S1MA 4CKZA 2FLKA 1JHPA 3M4JA 4PZAA 3I1JA 2PLWA 2GUWA 4QDKA 1GUYA 3MIIA 4U2CA 1NVKA 1T0PA 4QGFA 3AK4A 5BNTA 1RXVA 4MW9A 1E32A 2Z6VA 3ZW7A 3F47A 1UZAA 1RC8A 2JG3A 2Q3CA 1C3VA 3DZIA 2V7QD 4RXMA 2B1QA 2VF8A 1E96A 3C7AA 2VP6A 5IC4A 2PJDA 5I4CA 2OENG 4X7BA 5EWJA 2I8CA 1F1BA 4CIYA 3ZHRA 2M1ZA 1K6MA 2EJUA 4ZV7A 5EHZA 2CDCA 3RF7A 5TE9A 4BO0A 4I5FA 1R0KA 1A88A 1ADYA 4KTVE 1UBJS 1HYGA 3ZKAA 4ZOLB 2YV4A 5H4GA 2NIPA 4LQ4A 5K8LA 3DOCA 4GKKB 3CVVA 4LE0A 1GCOA 4W5WA 3ZQ4A 3BH0A 5CLLA 1P1CA 3LDUA 4DSUA 2ZTUA 3KSAC 1IY8A 1XTJA 2QT0A 1PWHA 5REQA 1F17A 3P2IA 4H31A 2ONYA 4O8CA 1VL1A 1B42A 1BD3A 1Q3HA 3CF2A 4WBSA 2BBOA 2LRHA 1J8VA 3VR6D 3DLCA 3GLTA 3H7IA 1QYRA 3G5MA 4GI1A 2HWYA 1G3MA 1NV8A 2YWCA 3H87A 4MVYA 1EDOA 4AF8A 3G0IA 3CZCA 3EQ6A 2Q46A 1Q7TA 2XBUA 2HHCA 4P35A 5JDCC 1VHLA 4URWR 2X8JA 1L9KA 3KE9A 2VJDA 3PBKA 4KH1A 3DE3X 2WW8A 4LGMA 4WCFC 4WXEA 5ECWA 4DBVO 2B2NA 3OM0A 4DUZB 1BE8A 3J7TA 1R5NA 3TGPA 1WHTB 5JJBA 4Z53A 2NADA 3CEHA 5IKMA 3NXSA 2VDKB 1DRJA 5FLXA 1V1MA 3EIWA 4NFSA 2V0GA 1DE0A 3FLAA 2OCGA 4KFSA 2YMLA 1FNCA 3GXBA 3GD7A 4ZTBA 4ZTZB 2CFSA 2IC5A 1UMBB 3KXDA 3UNXA 3ETHA 3TQTA 1YJAA 1M6WA 3BMCB 1QVWA 4RHEA 3FG9A 4E11A 2IS4A 3VZBA 2F7SA 3QLTA 3TGLA 3B53X 5J4HA 3I9FA 5F33A 5EJ2A 4ZVSA 3IJRA 1V7CA 3PDIA 4FFBB 3AOGA 4X85A 1W88A 4YN3A 4B3IA 3ZYCA 3QPCA 5FOXA 4NSNA 2V7WA 1KSFX 2FYTA 2AK3A 3E5NA 3H04A 2WQZA 1MHPA 3K9NA 4J4HA 2WB2A 4GBED 3UWKA 4EHKA 2ZJFA 3RK1A 4D74A 2O0KA 5LYJA 1IOWA 3QSYA 2CLHB 3V1UA 3L8GA 4KE7A 5BSVA 2HHLA 3T94A 5JWRA 1YCHA 4BQQA 1YOBA 1WOMA 2H8KA 4RAQA 4L57A 2UZ0A 3ZBTA 1R6BX 5NLLA 3NBKA 3O8QB 3FWPA 1NNI1 2WU3A 4ND8B 4R2JA 4Y9UA 2B4QA 4XLTA 4YAJA 3GLFB 1XT6A 4MW6A 3T9CA 2V58A 2QLMA 2EP5A 3I6BA 3JATA 3PG5A 5CIQA 3VR3D 4G0WA 3SYRA 2O2JA 1NC1A 3QHAA 3VC1A 4HLQB 4Z2AA 3DVRX 4XVRA 3OCVA 5JPIA 1CJTC 2AMVA 3FW1A 1NMZA 4LYHA