1YQ9A

Structure of the unready oxidized form of [nife] hydrogenase
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
261
structure length
261
Chain Sequence
KKRPSVVYLHNAECTGCSESVLRTVDPYVDELILDVISMDYHETLMAGAGHAVEEALHEAIKGDFVCVIEGGIPMGDGGYWGKVGGRNMYDICAEVAPKAKAVIAIGTCATYGGVQAAKPNPTGTVGVNEALGKLGVKAINIAGCPPNPMNFVGTVVHLLTKGMPELDKQGRPVMFFGETVHDNCPRLKHFEAGEFATSFGSPEAKKGYCLYELGCKGPDTYNNCPKQLFNQVNWPVQAGHPCIACSEPNFWDLYSPFYSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic [NiFe] hydrogenase small subunit
publication title Structural differences between the ready and unready oxidized states of [NiFe] hydrogenases.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 81
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 1.12.2.1: Cytochrome-c3 hydrogenase.
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
A PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 1yq9A01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 1yq9A02
5JSUA 4OMFG 4UD2A 4KO2S 2WPNA 4UE2A 1UBHS 3ZE6A 1UBTS 5A4MS 1FRVA 4UEQA 1H2RS 4UE3S 5D51S 4U9HS 4U9IS 5JRDS 4C3OB 3RGWS 3UQYS 4UQLA 4IUCS 5ADUS 1YRQA 4UCWA 3H3XA 4UPEA 1FRFS 4URHA 4KO4S 3CURA 4CI0B 3ZE8A 1UBJS 4UPVA 4UD6A 5JSHA 4UE6A 3USES 4UCXA 4UCQA 5A4IS 1WUHS 1UBLS 1WUIS 5JT1A 5JSYA 1YQWA 1WUJS 4GD3Q 3ZEAA 3AYZB 3AYXB 1UBUS 3ZE7A 4IUBS 4UQPA 1UBMS 3MYRA 2FRVA 1WUKS 3ZE9A 4KO1S 1UBOS 3CUSA 4IUDS 1YQ9A 1CC1S 1UBRS 3USCS 1UBKS 5JSKA 5A4FS 1E3DA 4KN9S 1WULS 1H2AS 4TTTS 4UEWA 4KL8S 4KO3S
chains in the Genus database with same CATH superfamily
4DM3A 3ZK7A 3L8FA 2UAGA 4EY5A 5KVVA 4KN8A 4B5KA 3NDIA 4TS9A 2FPPA 4YPOA 1UKYA 2CD7A 3QKSB 2OXCA 1CIJA 1GT6A 2I7VA 2PZBA 5CEEA 1LI7A 4HNQA 1DT3A 4CMJA 1K08A 2EVWX 3ETGA 1BZYA 3C4JA 1GYQA 3GAMA 3WY9A 1D6SA 3NORA 3OFNA 2FG6C 2V5AA 3PZBA 4RADA 4XEUA 1Q50A 1JHZA 1MAUA 1GQQA 1LRKA 1QZ3A 2MYPA 2PX8A 5G41A 3SZMA 2B6HA 3CF4A 4X60A 3CLTD 2HWYA 1NR1A 5IAEA 1EK0A 2AEFA 1B14A 1KMHB 1RXUA 1V6SA 2HCJB 3GFSA 3CNBA 4OJMX 4REMA 2OHXA 1NJ8A 4O25A 4HLUC 2GRJA 1H1DA 1P0IA 2WYUA 3KEGA 5IYZB 3GXBA 1KEZA 1CETA 2ZTVA 2B4RO 1QU2A 2VK8A 2OP0A 1EG2A 4DCTA 2Y0CA 2JATA 1GGEA 3BWDD 4RFSB 3VMMA 1LNQA 3SYKA 1NAHA 3U31A 3PJDA 4BMVA 2I34A 4YJDA 2ZSJA 5EHNA 1J97A 3T7RA 4LXQA 1D8TA 1K9SA 1KI6B 1JU3A 4MS4B 4Q6BA 1VHLA 2Z6QA 1Q2XA 3PVZA 1IRXA 3OICA 3SQLA 3SSNA 1SKAA 2IYTA 4DG9A 3SNKA 4IDFA 2WB4A 3PP8A 5JXGA 4MVYA 4DR5B 2HIHA 4WBNF 5BVGB 2FJPA 2MMGA 5HQTA 4PHCA 1VCOA 2D1SA 1KC3A 2HA7A 1G1MA 1N2IA 1SB8A 2P0YA 4KBYA 2BGLA 1G6KA 3FJOA 3I9LA 3NUGA 5DHRA 3DDOA 4NSNA 2D1FA 3KLMX 5DE3A 3R7DA 3RQSA 4IIDA 3M7IA 3JD4A 3KZ1E 4FUTA 4G3XA 4R9UC 1OI4A 2OUKA 3ORFA 4J76A 4B3BA 3I2GA 4AKSA 4Z2AA 1I1QB 3AERB 4ZCQA 5E1DA 3K0FA 2IC5A 2IEYA 2QN9A 4G5SA 4AJ9A 4FVTA 3QWHA 2G1KA 1FEZA 4GP6A 4J07A 2YOFA 5IHPA 3OOSA 2EOAA 2C99A 2H85A 1VHQA 2UZ1A 2OL4A 1CR4A 2M9MA 2RCNA 1TVCA 5DLQC 4ARVA 2PO7A 3LPLA 4XGQA 1OXTA 1RI1A 3H9JA 1OLOA 4IFIA 1KYQA 1YMVA 3DH0A 5BVHA 4RIHA 2QI9F 2WZBA 4KIGA 1E3WA 3C87A 5L7WA 1GL6A 2D8MA 4JLUA 4EF5A 5BY2A 3QKTA 1Z2PX 4C2TA 1ZH2A 2IZOA 4DTIA 3LL4A 1VKZA 2OOKA 5J1TB 3UK0A 3PF8A 1FRQA 2VHQA 4KX3A 5HZGA 1H23A 1WXEA 3RVKA 1ULZA 3PE3A 2IH2A 3GMSA 5JNVA 1T9GR 4M36A 5AI8A 2AFVA 1JKIA 4PIPA 1VSTA 1NXTA 4XX0A 4DTCA 1AS2A 4ALMA 4BP9A 2ZIXA 4UU0A 1FYEA 3D3WA 1TF2A 4QE3A 1T6XA 3CPHA 4IXDA 1TCVA 1IAVA 3F73A 4KIJA 4XQEA 5DI3A 3CR3C 3TNYA 1NVBA 1OCEA 2ZTSA 2QTCA 3DMHA 2QRHA 4ZCTA 1OT3A 5M7EA 4ARCA 1EUDB 1JFVA 4PWYA 1B15A 3V2GA 4XUCA 1RM0A 1SCQA 2YZNA 3BG5A 3NAMA 1EJ6A 3EDYA 4HZUB 2CNWA 3KHUA 5T6BA 3DPUA 3DR5A 3UNXA 1SR8A 1T4CB 3X2SA 3OA2A 4DA4A 1BKSB 3G17A 4HB2A 4S2EA 1GPDG 3QE2A 4CKWB 2A1UB 4F4FA 2G08A 3JRNA 1X7WA 1F8UA 3OEHD 2C78A 4KRXA 3C3KA 2H16A 3PDCA 2J46A 2FCAA 1VM6A 3ECCA 4F45A 2YWRA 3GPCA 1KO8A 3IPAA 4YJHB 2HRQA 1GPAA 3L7JA 4OJYA 4OJKA 4J0DA 3V1NA 4Q1AA 1RRMA 1Z8NA 2R8EA 4NAVA 1N5IA 2O05A 4TN5A 5AJXA 3N8KA 1V7CA 1XZBA 2FUNB 1SZJG 4DLZA 2JLWA 4M49A 4MX8A 1A5BB 1NASA 1Y9ZA 4PGAA 1YKFA 1NE2A 2EFCB 1UJNA 3E9RA 3I9MA 3RYCA 3U4IA 3U37A 2BELA 3AF0A 2GN8A 4H7HA 2XOXA 2OWEA 2B36A 2A0FA 3CJTA 3VU0A 4YDQA 5EJ8A 2NW6A 3QU5A 2ZWPA 4IGAA 1ZCZA 2KJQA 2Q07A 3F0TA 2J30A 3G2KA 3IAS6 4R8LA 4G81A 4YFYA 3UGTA 3U5ZB 4C2UA 2ISSD 2UU9B 1R2QA 2QRMA 2ZGVA 3F9RA 2RDMA 1E5XA 1KJIA 1Y7IA 1M2OA 2WM3A 2YWXA 2Z83A 3CLRD 3HL0A 3I2FA 1YUMA 3PIIA 4FMDB 4S1OA 3S28A 2X0KA 3BT7A 4D3FA 3T1YB 1MEEA 2V65A 4KQCA 2Q29A 3IQEA 3I62A 3TPZA 1Z0DA 4NBTA 4PZCA 5C5IA 3D3NA 1V41E 4UCXA 4D56A 4DABA 4JH0A 2Z2IA 5C8VA 4EGQA 2NV6A 3DOUA 4W5OA 3DOJA 2CBGA 1HLDA 4HFMA 1JWAB 2NT3A 3H7IA 2FW0A 2HN9A 1YQDA 3EEIA 3OZ7A 3ROKA 1OSNA 2FRDA 3DB2A 3E6AA 2IYQA 2V5UA 3BMNB 2ZXFA 3N59A 4LPSA 3TKYA 3UCEA 3W2HA 3VOTA 1UBUS 4GLLA 5KWEA 3JQ9A 4DS3A 5EJ7A 5JD6A 1TIPA 5DTRA 3TZQA 2YWCA 4UARA 3N2KB 1VKNA 3ET4A 2FRVA 2QT9A 3IURA 3THWA 3C4QA 4I08A 4JVSB 3NBAA 3T12A 4CMBA 1INLA 1ZN7A 3ST7A 4IPTA 4YI3A 2BFNA 1WDTA 2QRNA 2BW0A 2R1VA 3R7FA 4DR4B 4NZMA 2WTMA 5E6UA 4H77A 1RTKA 2QY9A 4D8UA 3IR5A 2V0CA 1HYHA 4L27A 5ECGC 3SJCA 4YCAA 2VJPA 1WCYA 3SM3A 4FILA 4TXJA 2Y1WA 1TVEA 3JSAA 5JSKA 4MV0A 2NU6A 3T06B 2XH8A 2HMYB 3ZG6A 5JBQA 3ZVKA 5EXPA 2O7SA 1IN6A 1JVSA 1TVKB 2XMGA 4JD5A 4PZEA 4KJZA 3SPXA 4BWFB 3JD0A 1A69A 1A5TA 4F38A 1SCUB 1MLDA 5GP1A 1A8SA 3O4VA 3C3MA 3WQSB 4AJ2A 1GNVA 3M8KA 3DV0B 2PMDA 3PJGA 4LI0A 4MEJA 3DZJA 3LW7A 2Q5JA 5JG7A 4TS1A 2AQHA 4ZHQF 4QTTB 3ZIUA 1SUAA 3P9NA 4MV1A 4Q1EA 2JLUA 1WDKA 2O0JA 1BGWA 2J3QA 3K53A 3N1UA 1M83A 3CZAA 1WSDA 4DSAA 4JLBA 5KNDH 3WSTA 1C30A 3EZ7A 2IYVA 1I4WA 2NXJA 2EZ8A 4QSHA 5B7QA 2Z3WA 2CLIB 4HEHA 2BHRA 3ESCA 3FGZA 1KZ1A 5J40A 3AVOA 4QOEA 3EAGA 1WMFA 5B57C 1DIHA 4X64B 2Q0XA 1JHAA 3QZUA 4U9IS 1QLWA 3PQFA 2PRKA 3NIBA 3D02A 3U17A 2XZOA 3KELA 2X5JO 1F5SA 3RGWS 2VA8A 3K0AB 4EA9A 3KLNA 4W6ZA 1VE1A 1ZM2A 4LMRA 1CLEA 5SYAA 2HJWA 1IY1A 1SBZA 2GAJA 5ARBA 1FVHA 4RTPA 4EB3A 2YMPA 5LD2C 2R9VA 3EA4A 2EBHX 1D4FA 2B83A 1R50A 3PD1A 1W44A 4MAFA 2WWWA 4QYTA 2WSBA 3MQ4A 3NOXA 1HM5A 1G63A 3U4GA 1SG0A 3PNOA 1J2EA 1QFYA 3IQDB 3TF5A 1QK5A 2BFDB 4WX2B 2XTJA 4EQ6B 3HU5A 4OHKA 4EHAA 3NV7A 2Z08A 3AI2A 3WLTA 5DX8A 1MDBA 2GZMA 4D3SA 4YRRA 1CJVC 4NC9A 4WUTA 4TZTA 5JC8A 1EHCA 1F0YA 5TJHA 4EYQA 2B34A 2V55B 1LQUA 2LZ0A 3RUIA 3H65A 1XCBA 5JCJA 4ZDJA 1TA4A 1DG9A 4ZI7F 4A8HA 1DTWA 1KFBB 2ZVJA 3ABRB 4H7IA 4R5MA 1DSSG 1TKCA 3X1XA 5BWNA 1WSAA 1U9IC 1PS9A 3O1HB 4U2GA 3UWPA 1TEZA 3UBTA 2OUIA 1Q84A 1AZSC 1JHRA 3CGGA 3CE6A 4DLLA 5KYGA 1T5IA 1K06A 4LJ8A 4RZXA 5TARA 5I7RA 4NK5A 1TYEB 1AKUA 1JJFA 3DZIA 5AKZA 3C1AA 3I73A 4LVCA 4C01A 1Y4SA 3VNRA 3V7YA 3GJQA 4AY4A 3KQUA 1REQA 3DD1A 3S1AA 1XX6A 4PYLA 2BONA 4F46A 2HLDD 2RH4A 3IEMA 4RGQA 1LRLA 1JG1A 1ULTA 3PV0A 3R7WA 3T7DA 3P0EA 4Q4DA 4BLQA 3ZK8A 2KE5A 4QVKA 3VR4A 4OHWA 1CUBA 1O6GA 3TKLA 1M2GA 4JVOA 1ZS9A 4FYHA 1V7PC 2SKCA 3T3GA 1YQ9A 2O1XA 2IE0A 3HRKA 4AWBA 1W19A 1RJEA 4BNXA 3ZY4A 1X7YA 1LX7A 4OEHA 1JMYA 1PD0A 3GG2A 1UT6A 3KZOA 2A58A 5IPFA 2GCPA 1GAEO 1YIDA 1YONA 5JAQA 2XODA 1KNQA 1KBZA 2CZGA 4ASUD 3DKVA 4Z8XA 1PRYA 2VPYA 1E2FA 4U7GA 3NFRA 4JI2B 1S3IA 4E22A 2E4WA 5KDOA 4GOOD 1CP2A 4XOUA 4P4SB 1J0DA 3SFVA 1E3EA 2CYBA 4G5QA 1XDBA 2ZTHA 1PK7A 2R7KA 3U48A 1GVNB 1G8SA 1PWZA 4FFWA 1U81A 4CKCA 3MMNA 3GJ4A 1KK2A 3SVTA 3AKDA 5ALIA 1ZI6A 2MOKA 1MEJA 3AVXA 3TVDA 1MJNA 2DUWA 2CDCA 1N7JA 3LDHA 2J7PA 3K31A 2P4UA 1DELA 3LIIA 5LA6F 3L1UA 1RPTA 2B1IA 3PTZA 4XCQA 2IHNA 3ISTA 2BEUA 4B3CA 1DKPA 1EFRD 2WVGA 3ZVRA 3VPHA 3WL8A 1JKMA 2WJPA 4JP1A 4G0OA 3DZGA 4R6XA 2GYUA 5DK6A 2WWVD 3NAGA 1GRRA 3HYRA 2C03A 3B78A 1VJ1A 3B7GA 3HVIA 3LLSA 4IMRA 1MUUA 3HKEA 2OBBA 4MW6A 4YV2A 1T3SA 3LSTA 4TL8A 2WJGA 3FR8A 3VVBA 2VUTA 4BFXA 4S35A 3V3TA 2BL4A 4UAUA 1R4MB 1KKUA 4F06A 2QMOA 1YOVB 4RKRA 1I2ZA 1W88B 3URKA 2NOAA 2I3AA 3UQYS 4AQDA 3T5PA 4MARA 2QORA 2VNSA 2F2TA 2Z43A 5AXDA 5HF8A 3RFVA 4HUTA 1LBIA 4EPTA 5A3QA 5AKYA 2OO3A 3IE1A 2IS1A 1RQXA 1WHSB 1YRQA 3NOOA 4ZVOA 1YZYA 1NQAO 2VTBB 2V9CA 1HT0A 4MRPA 2R7AA 3J7AC 3B6KA 3ILSA 1OYOA 4AJPA 5HVNA 2PV0A 2QV0A 3NS7A 3KYIB 5BUZA 4EUSA 3K71B 1G7SA 3WLSA 1X7GA 2QD3A 2YWDA 3L5OA 1KSHA 3O8NA 2EGHA 2XGSA 4OBEA 3VDQA 4RLQA 1T3GA 2PR7A 4AYXA 2Z1MA 2OWDA 3JAMA 4IL5A 1UDRA 2VSOA 3EXFA 4XJSA 3TAXA 1JEYA 5IAJA 3TLMA 3JQGA 4WXYB 1BVHA 1OFIA 2GPYA 1U65A 2Q2VA 4UPVA 5K6AA 2RI0A 3M34A 4NZZA 3K8QA 2DCMA 1XJWA 4JKIA 1CD5A 1T5HX 3BHJA 1AQYA 2QN3A 3CCBA 4MQLA 4U1RA 5EERA 2JFOA 1KIAA 3T9EA 4L28A 4PC7A 4BX8A 4BMXA 1VBNA 2LIVA 3DLIA 3I72A 1YZKA 3I9NA 5KOJA 5IM4F 2J41A 1A9YA 2AF4C 2R8BA 2WYOA 3QVOA 1Q74A 2OBXA 4FBMA 5CMLA 4AIRA 2BWJA 3ONWA 1FP4B 1QQ6A 1KQ3A 3O4FA 2OV8A 2WMOB 4CL3A 2FPGB 2D7JA 1LPOA 4NRDA 1ISRA 3GDFA 3DE2X 4LDAA 4KREA 4IO1A 3ND6A 2OB1A 2X8LA 1Q7GA 3IP6A 4UM9B 2XCRB 3KIPA 3UM9A 1KEKA 4J90A 2JDIA 2FVXA 3NALA 2C7VA 3B5JA 1DPFA 3WWCA 5ED0A 1A4XA 5DRTA 5JCZA 1ODCA 3OWXA 4CQNA 1P17A 2JI6A 1PDVA 3KVNA 1GFWA 4J2OA 1SUBA 2ZJOA 3GGPA 4L5BA 3BF7A 2FOIA 4CMIB 3OI7A 3L9XA 4MWBA 3UENA 4E1BA 2QXTA 4DJ5X 1RQLA 4N9QA 4Z7OB 2WIAA 2GN6A 3FIJA 2XB4A 2FFQA 2K7ZA 2TS1A 5EP4A 4N0DA 1H2ZA 3REGA 4A0RA 5KYTA 2CVZA 3WBBA 3HMQA 2QE6A 4X8OA 3H1FA 4GNKA 2JHPA 4OI2A 3JQQA 4N3AA 1NXXA 9LDTA 1X9HA 4FFMA 5JCXA 3DTVD 5C80A 2HA3A 2JLSA 3RDPA 1D0VA 3N86A 2VNKA 2W2PA 1GTSA 4ZOLF 1ESNA 2YMLA 4BO2A 5EKSA 4XRGA 2XOKA 2Q3BA 1NQXA 4MUEA 2BP7A 2QIPA 2DBQA 1O96B 1E98A 1JEOA 1FNBA 2GRUA 2I6QA 1ML3A 2GZAA 3D7SA 1U2DA 1ZINA 3S55A 4BN5A 3KZVA 3WMGA 4DQ0A 5C5EA 1Q15A 2IYLD 3MGKA 4KWHA 4MB6A 1NW8A 5FNZA 3L4SO 2Y1FA 4PBSA 1G21B 1MENA 2DHQA 5D00A 3L6UA 4GP9A 3O1LA 3RTAA 4M46A 3V8MA 2IEAA 5EFZA 1U2SA 1THTA 2NV2B 4YAUA 3UHPA 4UHEA 1OTHA 1Q7BA 5FYQA 3BK7A 5DOZA 3AL0C 2AMVA 2YRXA 4AECA 5LZ5A 4KMOA 1I4OA 1SFRA 3C1TA 3H4MA 1UOPA 4KV7A 5DFAA 4YV0A 1C3JA 2QVXX 4ARZB 2YQ5A 1ZJJA 2Q5IA 2YBEA 2DE0X 3GA0A 1E9FA 4I5IA 4I5EA 4IV5A 4RL6A 1RW4A 4TWJA 3RRZA 1CT9A 4PC3A 1E3IA 4JAVC 1COZA 4JOCA 4K9PA 1SG9A 3WGOA 3GUHA 2QTMA 3S8EA 5B2EA 1PR5A 1K7SN 1Y3DE 3FWYA 3ZNPA 2CF6A 4FOSA 1G5TA 1T13A 4TUYA 4D8VA 3G02A 1GG2A 1UMCB 3R0IA 2ESRA 4R51A 2GCOB 4G8DA 1L0BA 2AMYA 3UGQA 4Y2VA 1CYEA 1V4BA 5C51B 1T8WA 4NESA 3ZQUA 1ODKA 4Z3DA 2F1HA 3FETA 1E3LA 3DAHA 2EX0A 2AC4A 3JZAA 1Z5VA 3HACA 4K6GA 5EJEA 4AROA 3HVRA 3ZHTA 1UQTA 3L84A 4K3UA 2GB4A 4OAOA 3V7WA 2FSHA 2G1PA 1SCDA 1TI7A 4YRPA 1TD9A 4BMPB 3UOAB 3CXRA 1FP6A 2P9CA 2IX9A 4IZHA 2NO0A 3R7AA 4LG1A 1JQAA 3NEJA 1E63A 1TQHA 1IBMB 1ZMBA 3FRJA 3JCZA 3THOA 4EO4A 1V16B 4MGHA 2B8JA 1X94A 1V8PA 2OAEA 1A50B 1APBA 4FZ3A 2CMKA 4IEEA 1QSGA 1O95D 4OP1A 1XRQA 4FCWA 1Y6JA 1XSEA 1RKVA 3GLGE 2J6IA 3IB3A 4UZSA 5J59A 1U7TA 5LSAA 3NKFA 3EN0A 1V6CA 4L9AA 2XZPA 2YZKA 1JA0A 3AKEA 4J4BA 2YXPX 1IXZA 1M7BA 3AI7A 3EVAA 3IXQA 4R7GA 4G56A 2VHXA 4MW1A 4GIBA 1V3VA 4ZOCA 1LQTA 5TJ9A 5FUYA 3RUDA 1EB9A 3ZI4A 4FWTA 4GMDA 4DZTA 2G17A 2YXDA 2P9QA 4I7EA 1S4MA 3Q6IA 1WW3A 4YMUA 1G60A 4M1MA 2AOTB 2H00A 3LCJA 3PRJA 1NN5A 4UXHA 4CL0A 5B2FA 5JYCA 3W5AA 1H22A 3L7CA 4A3SA 2AB0A 5ITZB 2QTNA 5DHUA 2PL5A 3NVAA 3DW1X 4MI9A 4ZVRA 1LNSA 1CE8A 5FFFA 3AB8A 4XJTA 2IXGA 2GM4A 3O9MA 2E4XA 1RBQA 1E2KA 1Z33A 1WB4A 3SR3A 2CC2A 1QNLA 2F9LA 3LP5A 2E37A 4O4HB 4RTKA 2GAFA 3U09A 4WLOA 1S3GA 3OAAD 2ZYSA 2B4YA 3SHVA 3P4YA 2ZR7A 4HADA 3CY6A 4DANA 1BDIA 4LX8A 3D2BA 4DDKA 3QEMA 5DYGA 1YGPA 1EWQA 3A3KA 1UXGA 2YWFA 4QHYA 3AUUA 4XEHA 2GDZA 3FNHA 3E8SA 2OECA 4LA4A 2E6UX 2IDMA 3PQEA 4L0QA 2R6JA 4XIGS 5EJ2A 1NKTA 2B35A 4JSYA 3VMFA 5CTAA 4F86A 1GV0A 2GS9A 2M98A 5BQXA 2WWYA 5A6SB 4BV2A 2AJBA 2AC2A 4KDEA 1R64A 1EVLA 2A7XA 1T8TA 2VF8A 2J31A 2QMUA 3DAYA 5CJPA 4YMSA 5FEMA 4OGFA 5T41A 3W5CA 2JLAA 1OYVA 2WABA 5TQVA 4RESA 2F4NA 1ZCBA 1QYXA 1X8XA 4IYRA 3AV3A 1M6YA 3AKZA 3I1YA 3BWMA 1O1YA 3FKQA 3RNLA 2QEQA 1DTSA 2A9RA 3MMZA 1RC1A 3C8HA 1KEUA 1L5QA 4YALA 4N3GA 4TXMA 4X7MA 3ZCVA 2FRXA 1ZOSA 4D9MA 2VDKB 1Y6FA 2UYGA 5CA0A 3TRIA 1P0PA 3NASA 1VE6A 1U2RA 4AU1A 1DX4A 1I0ZA 3OUZA 1NONA 4INZA 4F21A 1I5OA 4U63A 2VAMA 3GJ5A 2A88A 1ZIDA 4V0RA 2X0FA 2MR6A 2R44A 3JQAD 3E27A 4BRZA 3DTTA 1A27A 1ENPA 2H0QA 4YXFA 2WM2A 2W11A 2O48X 2WD9A 3QY9A 4OM7A 5LKRA 2IPOA 1SA0B 1W1UA 2YDXA 1L5NA 4N1AA 1E1LA 4MIYA 4PS1A 2W8BB 3OZUA 1NURA 3HB5X 3QEKA 5CT5A 3UT5B 3E23A 3HDJA 3GV0A 1FX1A 4KPYA 2A9JA 1GOTA 2J7KA 3P5SA 4BCBA 2CSUA 2A1TS 2HJHA 3IV9A 4RABA 4X90A 3LNTA 5B64A 3ADBA 3EGXB 5KVAA 3GDOA 1CHDA 1D1SA 1F3LA 2JKZA 2PRJA 3H9UA 3MWDA 4H4EA 1HE4A 4B7ZA 1MG0A 2E85A 2MSEB 4ZQGA 5I7WA 1YCFA 1XMSA 2NPIA 1PK9A 2JKVA 4H0CA 1QRTA 3HNPA 4P33A 4M3NA 3HSKA 2GTHA 1LD3A 2J5RA 2PH1A 2H63A 4NABA 4PYIA 2ZRIA 3KPYA 1MABB 2P5UA 4LBVA 2H07A 2RJOA 3BTUA 1QIJA 1TW3A 3B3JA 4WPGA 3L49A 3FXAA 3MWEB 4CQMD 5CDHA 5CLIA 4JOSA 2X5OA 5JJ5A 4EUHA 4OOEA 2B5WA 3QE0A 2FW8A 3WJ7A 1L6RA 2FHPA 3CUVA 4QD3A 4IIUA 4OVKA 3VR3A 3KLBA 2PY6A 1OH6A 1YJQA 4M8NE 3B1VA 5DCLA 4ND5A 4XSVA 1JWLA 3FNQA 2P2YA 2Z3VA 4MR8A 5TEVA 1Y8RA 2IQIA 1FUUA 4E21A 1X39A 2IHKA 2E89A 1OWLA 3A70A 3NHJA 3D7KA 3Q9NA 1PO7A 4KQMA 2FKAA 2EAUA 2RG1A 3OCXA 1RWXA 1GCOA 1Y89A 2FR8A 2JFUA 5CB6A 3BXOA 3EUEA 4Z49A 1Z4JA 5HFJA 3ZHSA 1PJ2A 5HOEA 1EH5A 3GFQA 4K9MA 3ZWOA 4DJFC 4CEJB 4DB2A 3C6XA 1R6XA 5LB2A 1SK8A 2NNLD 3JQEA 4M22A 4QPDA 3LMKA 5DT2A 1C8LA 1XA3A 4ZVNA 2H57A 3KETA 4PNHA 3HCNA 4DB4A 3NFYA 2GEVA 3U3XA 1VYHA 1T1JA 3PHGA 3DMYA 2GN9A 4TKVA 1RABA 3P9CA 1XQ1A 1Y9AA 3BGWA 4ARSA 2HWKA 4MRAA 5BXQC 3OOEA 1H3FA 3TAHA 2IU4A 1N4AA 3SY8A 5ALRA 4UCFA 4E4TA 5HHTA 3RFTA 1XZLA 3E18A 3KOUA 4ER3A 3RSFA 1FSSA 1NW4A 2MYUA 4ESEA 2EL9A 2WM9B 3FLMA 3EK2A 2W43A 4R1PA 2P5YA 2FN9A 3IIIA 1JQBA 4HC4A 4KXVA 1KDVA 3H5AA 1UFKA 3H5LA 4BO8A 1X8KA 5A71A 3JAWB 1T10A 3FPLA 1SK9A 4EZEA 4B7UA 1D4ZA 4PZ9A 4AWXA 2QF7A 3VC7A 4N65A 2OM2A 1IK4A 3NM6B 4C29A 3NHPA 2ZZNA 4AI6A 4TWZA 1L1FA 4YBZA 2E2WA 3H17A 1DLJA 2DPYA 2QTBA 3FWKA 4IS3A 3GT3A 1JZSA 2A57A 3TFWA 1JIKA 2XMBA 1E79D 1JU4A 2VJNA 1CZNA 3BEDA 3N9IA 4LTDA 1KERA 1XEWY 2WHYA 4OQZA 3UHOA 5DP2A 2XKJE 5EXXA 1IN7A 3ZW9A 3M81A 2GZSA 4J7XA 1CZOA 3ISVA 4B4OA 3HCPA 5K6RA 1FF9A 2AXEA 4I3FA 5G0WA 5L3RA 2W4QA 2HSDA 1XU9A 3AY3A 2D3WA 3I6MA 2ZU0C 1IJBA 2RH8A 3LNCA 5AWFC 3N6XA 3KAPA 2PR2A 2PX2A 2HTEA 3CLTC 3WXBA 8MHTA 2C9DA 3HJGA 3OMLA 4FHDA 1R18A 1AB5A 2BVNA 1C3VA 1CZKA 2D59A 4D9GA 2L2QA 4IIVA 2SBTA 2PWPA 2ZBGA 2FMFA 2WAYA 4LPKA 3I2YX 1CQIA 1DADA 1WL8A 2FJUA 2J33A 1K5HA 2JBAB 3L8DA 4IX1A 4Q01A 1SC3A 5EMMA 2Q3EA 1WUHS 4EKIA 3QUBA 2AE2A 2YWJA 3ZCQA 3N8DA 4EUKA 3HJHA 2ZRAA 1GKLA 4LQLA 1JLRA 1OX4A 3DMRA 3RVSA 2CNLA 4E70A 3FZNA 4FIDA 4DZRA 4Q1VA 3DEYX 3BGVA 3VPBA 1KWGA 4MK4A 3ZEAA 5L4LA 3KQLA 3RWBA 2GTIA 2BGTA 3EJWA 4HDNB 3LK6A 5FV4A 3QFFA 1N25A 3DULA 3GX1A 1F12A 4HGNA 3OTOB 4BYGA 4X3PA 1PT8A 4MRMA 2B3DA 3I92A 2Y9PB 4JYZA 5FPQA 4CG0A 4B4UA 4M88A 1ZDMA 4AO6A 2HHCA 3O47A 1CY1A 2DFLA 1M2VA 4I46A 4US0R 4M7PA 2JHFA 4GX2A 1KI4A 3A1TA 2ZYVX 2AZ4A 3M5CA 1QH1B 4DGQA 2BFOA 1OI2A 5ED4A 4YAGA 4X92A 3JY6A 2BI7A 4UMEA 1UJ5A 4EK9A 1EUCA 1QHIA 2AGVA 1WM1A 1I3CA 1B74A 5CA1B 3EFHA 3NV9A 1G7RA 3R5FA 4DIFA 3VKHA 5E2AA 3IJEB 2AA3A 4BO6A 4ZU3A 2PBRA 4A8TA 1XZEA 3QFTA 3V8RA 5B7GA 1F8GA 2HHAA 3QPBA 3O93A 5BYAA 5TDHA 3PPWA 1PR9A 1ODSA 3GD5A 3GWGA 4L4SA 4JL6A 1PF7E 1QORA 5G0SA 3C3XA 1SVSA 2PZKA 3FBTA 3TCNA 2ILVA 1LF0A 2VBIA 2JGFA 3FPFA 2E18A 4N3NA 4EG3A 3EW7A 3V4ZA 5BXYA 5JQGF 4XKJA 5GWXA 4KC0A 3TLZA 1LTQA 2J32A 1WMBA 1M5RA 4ZTZB 1D0SA 1VOTA 5G53C 3DJYA 4WLVA 1DO2A 3K2BA 4GRAA 4NV0A 4JFRA 2JA1A 5LR6A 3AVVA 1Q0PA 4BN0A 1YO6A 1Y1PA 4L6AA 5I9MA 2XA9A 1RXYA 5IBRA 3G5AA 4DNPA 3DWEX 5ADWA 3CWZA 3E9CA 3A9RA 1IM5A 1OX6A 3UJHA 3WJ2A 4W9MC 1ML4A 2OORA 4XFJA 1SKUA 2GHTA 2Q9UA 3JQCA 3WGTA 4D43A 4EEKA 1ZCFA 5HKKA 4LY6A 4RD2A 4PFSA 3TSCA 4D4LA 1EP1B 3ESZA 1NJ1A 2SHKA 1CR0A 4I50A 3STVA 2RGUA 5TIIA 1W96A 4FCCA 5KCMA 5LN1A 1CS4C 2JK0A 1TJ5A 2VJMA 1VLJA 2QVBA 3HKDB 2X6QA 5FADA 1XJ0A 1G3UA 4N47A 1O5IA 1YR7A 4BE9A 2NYVA 1XELA 3OFSA 1DCFA 1EJBA 2D8AA 2VJCA 3HEMA 4H1UA 4HBGA 4L07A 3W0LB 1ORRA 4MVWA 2DSTA 1L5WA 3PICA 2FLKA 1E5DA 3Q1KA 4D97A 4JYBA 1OJLA 1T4DA 4A23A 3E9ZA 5FWYA 4X7RA 5E2IA 5AMXA 4L02A 4KBGA 1NG1A 1PEKE 5ELLA 3PE4A 1MHTA 4JIGA 3WZMA 3ROFA 3PQCA 5B1IA 3OQHA 1DHTA 5H82A 4EKYA 3GEIA 1DUSA 1OBFO 1Y3CE 3GJTA 3UGKA 3S7TA 3PC8A 2KBFA 1QO0A 1OWNA 4B75A 2ODQA 4TMYA 4E32A 4QGSA 1WQ1R 3Q10A 5D7BA 4ERXA 1PLKA 4FX2A 2H52A 2X8JB 4JYPA 1I10A 5E7IA 1VXOA 3SLKA 3BL6A 3QA3E 4XGNA 4FT4A 3WWEA 2RHWA 5KYKA 4PX2A 2GNPA 4JT2A 4FSXA 1W85A 2WD8A 2WR8A 3CLRC 4Y6RA 2PS9A 3M4YA 2J3HA 4DBZA 5MFZA 2B3TA 4Q21A 2ZEJA 3OE1A 1GT91 1PQUA 2EX1A 3O8LA 1DQPA 4H6VA 2EX4A 3T4PA 4C4TA 1J99A 2JH3A 2WTAA 3UO8B 5HPYB 1PU2A 5C0OE 5JRZA 2JJ2D 4C7OA 4RJTA 2EFYA 3UWMA 2LXNA 2WSYB 4CG2A 1KZ9A 3I04M 4WVFA 5AJTA 2FX5A 2AWOA 4DADA 1P6UA 4Q9KA 1EFDN 3WB9A 2D74A 4JMLA 4WBNB 3D6UA 5KNBA 3L8CA 1QIHA 1DGQA 4MAMA 3B6IA 1JTVA 3GYBA 1BEUB 4MR9A 4UDYX 4NULA 1J5PA 4X1OA 3BFVA 1CXZA 5D5HA 1PNOA 4JNKA 2AK2A 1EIWA 1U2GC 2B25A 4HDSB 1UFOA 1YZFA 1M72A 4ZVKA 3T3NA 2XBMA 1GAXA 1E4OA 3IALA 3O4RA 5BQPA 1RSZA 4HFJA 3K3PA 3K1AB 1RI3A 4PLPA 2C9BA 5M2QA 2I9KA 4NJEB 5FTJA 3AX6A 3RC2A 3WYBA 1W36B 1QFJA 1JAYA 4DDVA 2AG8A 4TWAA 3W2GA 4DT1B 5JI3E 3AHJA 1ADGA 2EKBA 4ZGBA 4BFZA 4V1CA 4CM9D 2W42A 2XSZA 2C04A 3U7EB 1GSOA 3TNDA 3NXSA 4CG3A 4YMGA 4PQGA 1GPJA 5FV7A 1MTOA 4H4DA 5E4JA 3V1UA 2B0CA 4L85A 5H16A 5EESA 5FOUA 3B1YA 4Y9RA 3C1UA 1SUDA 2QL5A 1AXGA 1M0TA 4YT2A 3MCUA 3MPUA 1HDXA 3HNOA 3WVNA 1KO4A 1E0SA 4LVUA 4V2UA 3SQWA 1QMGA 1FQOA 1XAIA 2WTXA 4OQQA 3WTCA 1BWSA 3NC1C 1LC0A 2I29A 3NEPX 1Y5LA 1JB9A 1SUEA 1U8XX 4XRRA 1RJFA 1SCBA 1M1UA 2D2XA 1MO3A 3F67A 3AEUA 5A9SA 3BE6A 3ICCA 4KFSA 4UTOA 1V8FA 3A6GA 2XNDD 3IKJA 3SYMA 3WYAA 3LX5A 5F52A 2R2GA 1HLGA 1P0MA 5B3AA 3H1AA 1J70A 2ZSHA 5EYPA 4GOKA 3ZD7A 1MORA 4AG3A 2Y6VA 4JJ7A 1TM2A 1NBEA 5GQSA 3QLUC 3AEQA 3GEEA 2RSLA 5PNTA 1GDTA 1XMOB 1DHRA 2PN1A 2QZPA 3MS2A 2GKOA 4P38A 4QDZA 3R3YA 4YJ2F 5F76A 5B6PA 3DUFA 1XKTA 1OGIA 3KL4A 3BZWA 3K6SB 2IYOA 2YX1A 1A77A 3H4IA 3EIHA 3ZHQA 1HI9A 5B7PA 2ZIEA 1HPLA 3SDBA 3UZUA 5BV8A 7YASA 2A5LA 3DF7A 2IHVA 3L8MA 2QVLA 1KEEB 3OPYA 3WHLA 3WLJA 3QW2A 1B16A 3EEOA 3THXA 4WH0A 1U3DA 2EWWA 1QWSA 5K3CA 3VOSA 5DBHX 3N0TA 2ZYGA 5DN6A 2GEUA 4QEZA 3ILXA 1Q7CA 2GBIA 3OBBA 4NAHA 3DBOB 3G85A 2XUHA 3ABOB 4W7IA 4AXXA 2EZ9A 3TTYA 3ETEA 1NVWQ 4YJFA 1JHPA 5B58C 4EO9A 1EQAA 2CNKA 1ISHA 3SF0A 4AIIA 3RYFA 3PBKA 4AZVA 1YT5A 3KE8A 3A1SA 3THYB 3LZCA 1ADBA 3UKOA 2C0QA 1R0ZA 1F0PA 3Q7TA 1KFKB 5IEBA 3BZBA 3W4KA 5FO1A 3KXDA 1B73A 1DCKA 2FPRA 2ZUUA 4DR2B 2H51A 1TYCA 1IHYA 4RY0A 4FPXA 3CINA 3T61A 3DVQX 5THXA 3U3KA 5DPMA 3T1HB 1B26A 1W29A 3IJPA 4HS4A 3SFZA 4C3ZA 4WRRA 5FNVF 1K6JA 1W46A 1CCWA 4RLSA 5G4KB 4RDCA 4EJSB 4HAYA 2G5GX 2BTQB 3OTWA 3QF4B 2Q6LA 4KQKA 1DWUA 2I1QA 5TQ0A 3V4SA 4ZZ3A 1SXPA 2BAGA 1RXEA 4KN9S 4UEWA 3HZZA 4YLYA 2CLHB 1UEJA 2FJ0A 4D9HA 3FDZB 4GGPA 2XT6A 1PZXA 4D1YA 3S4YA 2YFKA 1CSEE 3E22B 4REQA 4W6QA 1KMQA 3KUUA 4H35A 1M1NA 1II9A 3EMVA 4MUIA 4V0ME 3TQFA 1ZIPA 5ALEA 4M1QA 4LBZA 2H65A 5JEDA 2YJNA 1SCIA 2UYOA 3LG2A 3V2UA 2Z3ZA 2W6CX 4A0GA 2F1JA 3TXAA 1SHKA 5J2TF 1FE8A 5E4YA 3GA5A 5CB4A 4YPFA 2J0QA 1JDTA 2CLKB 3EQ6A 8GPBA 4S2UA 1Z2DA 4IDQA 5TS3A 1T5SA 3H4TA 3VQTA 2JK1A 4MPPA 4J0JA 4D8YA 4TVKA 2ZRNA 1K4MA 2RBKA 1IQPA 4KR9A 4EDFA 2K6GA 1WABA 4DXDA 5AR1A 3LCVB 4JLAA 1LXCA 2I4TA 3A2MA 4I0WB 5EIOA 3FFXA 2P2LA 1QHNA 2QR2A 4Q24A 1HKUA 4YFVA 4FZRA 2XE6A 5JY1A 2LW7A 1K5GA 5E95A 4S1TA 2O3RA 1TO6A 3C70A 1BX3A 1J42A 3ORHA 2X4IA 4FYXA 2UUAB 3LYAA 3TR0A 2C57A 1LBHA 4ZHQB 5LP6A 3LF2A 1EI9A 4G2TA 3QE3A 2W0SA 2G5PA 5FBHA 2VBFA 2NU7A 3WNDA 3WOVA 3PXXA 3QFCA 2W0MA 3RLFA 1TGYA 3G5UA 1M2NA 4YMTA 4ZV4A 4G8CA 2AJ8A 3WWOA 3F1KA 3GJ7A 3KKZA 5C5DA 1TUBA 4URZR 4N5NA 3ADPA 4F6CA 4QKQA 5CDYA 3DV2A 4PNPA 4LFAB 1QIGA 3LLMA 2NO9A 5TC4A 2VS1A 5IAKA 3VJRA 2OHHA 3WMRA 2EZUA 3GZJA 1N1EA 2BZ0A 1ULAA 1N6PA 4RVFA 2QW1A 4EZIA 4BXOB 1FX0A 4OQ4A 3ZGOA 4RGVA 1TU3A 2VK4A 1XA0A 1ZD5A 4X3OA 2IPAB 4EHLA 1DAKA 5F2KA 1DDGA 3ZHZA 5AW6A 2I4RA 3GP3A 5ISMA 3FHTA 1KSJA 1PL0A 4L8FA 4QBIA 4CFSA 1R12A 4NBRA 1UDAA 3UANA 1JYSA 3LWDA 5SZIA 5HW0A 3B20A 2IHYA 3PWZA 2WF9A 1E7YA 2H5JA 2Q6TA 4ID3A 4NJOA 4KWIA 4M76B 4COOA 4PVDA 1YWGO 4J4HA 1CZHA 1PR1A 3MHPA 2YZ7A 1ZCAA 4PFKA 5ALQA 4Z0PA 1V5FA 4II3A 4UVIA 3BD7A 4U8HA 1QHHB 1V8OA 3IEPA 3U2QA 5IDVA 4OLAA 2YZ2A 1FXWA 5E2BA 2FX2A 1DB3A 2OCGA 4GUAA 2QK4A 1JU9A 1JS1X 4IJVA 2GNAA 2G70A 4D02A 4F2DA 2EKPA 4ZI7B 1X13A 4CUZA 5LQRA 1KZ4A 2DF8A 3TE7A 4E09A 5CEJA 1SUIA 4KQEA 2DY0A 4YX9A 3X1JA 2ZAYA 4NS4A 3F7OA 4DYDA 4MW5A 2QVCA 4KLZA 1I7DA 4YAIA 2ZJ1A 4IDEA 2HJSA 2ZQZA 3I6ZA 2O8NA 2QE7A 3L0IB 1KETA 1L8AA 1MJ5A 2M2IA 2HXSA 4MYDA 4ILEA 3X0DA 2O8CB 1V8BA 3GLVA 1QBKC 2JI7A 3OCZA 2IV2X 1IVNA 2PUEA 1WPRA 2P35A 1AUPA 4N8EA 1KZHA 3RRBA 3ZE1B 4S24A 1XU4A 5BSGA 3ENKA 3R9XB 5DM2A 4R8SA 4IINA 3RAEC 3UH0A 4MUYA 1A9XB 1H5UA 2PRSA 3FPJA 4ZYXA 3FIUA 3GCGA 3A3PA 3GT7A 3B5IA 2OESA 4TL6A 3ZDFA 1Q0ZA 3T5TA 3C97A 4JL8A 3WGMA 4B47A 4B0OA 2YUIA 1UWKA 3KCNA 3L92A 1NFQA 3GARA 3O2SB 4DIEA 2HDWA 2O8EB 2QROA 2JGDB 1B00A 2X14A 4KCGA 3FJYA 3AFIA 4LJAA 3H2GA 3B6ZA 3WGVA 1CUJA 2GPWA 4TMFA 2XMQA 2P2NA 4RY8A 4O3FA 3JX9A 4HGPA 1J09A 4XIFA 1MH9A 4YRKA 1VPWA 1J25A 3HB9A 4MIOA 3H9GA 2VP6A 4YONB 1NE7A 2X0JA 5JVDA 3T5CA 3WK7A 2TRSB 3B1ZA 1TRKA 2ODWA 2Q3DA 2Q8NA 4QYMA 3H84A 5LA6B 1ISGA 3EIWA 3GLGB 2ACEA 2HREA 4EA8A 4UTPA 1V25A 3AF1A 1YB5A 2OSBA 3D0QA 4IH4A 4PRZA 3U4QB 1C1HA 1P4RA 2NWQA 4R2LA 2PCJA 3KTAA 1X70A 2XMZA 3F71A 3SSOA 4YMLA 1XLTC 1Z7YA 4U7FA 1V9CA 5FTKA 3T0FA 3WZ2A 3UA4A 4XR9A 4MUHA 3ZJ4A 4C3VA 3X1KA 5KOIA 3L02A 3J81A 2P0EA 4HGYA 2C7BA 1DV2A 4RZQA 4B8ZA 4X0EA 1T4MA 2YY6A 4DV7B 2WF8A 2BR5A 2NU9A 3MZ0A 4HDAA 4IIFA 5I9BA 3OQMA 4RDIA 1AA9A 1ZM4A 3WWYA 1P2TA 2CXSA 4CM8A 2DPXA 1QKJA 2H9YA 2JJQA 1GQRA 1I6WA 1I1HA 3AF4A 3EVGA 4FLFA 3UY4A 5FUXA 5CLFA 3CVUA 4CXMA 2YCLA 4UTVA 2PFGA 2QENA 2HQRA 1T35A 3E81A 1FNSA 2IOQA 4YNBA 4JC5A 4CT0A 1PQPA 1QNFA 1X1TA 4GS5A 3EUWA 3QX8A 3BPSA 2HV8A 4UASA 4G2NA 1AK9A 2JD0A 3BERA 3HDTA 4IR7A 2CNWD 2IUFA 3KU1A 4DR7B 1P33A 1NNSA 4W5JA 2WOJA 1FTGA 2B9EA 3AFGA 2W6JA 5ALJA 5DSZA 4WZAE 4JI8B 4W1PA 3OZEA 2H2FA 1YB1A 3DFMA 4R2WA 2A14A 4IICA 3TQIA 1RRPA 1BN7A 3MJRA 4JI3B 1V0JA 1Z47A 2RMKA 4AJ4A 4FFBB 3L9WA 1TUGA 1VSUA 1CUZA 3IP7A 5DXFA 5IFKA 4PINA 3R5SA 3FUXA 3LTEA 5FBRB 5HIMA 3SVLA 3HSYA 1OBCA 3L6BA 1IBRA 3NYRA 2F48A 3G6KA 4XYLA 4OBBA 1YUNA 4ENVA 3CVVA 2W7TA 1Z06A 3HZRA 4CM7A 2C94A 2JNWA 2HYIC 4OXKA 1QOZA 5B1DA 1NP6A 1G6HA 2A1TR 1GRVA 2PUCA 4YMIA 4YUYA 2PMKA 4QFMA 1IZ0A 4L95C 1ODTC 1JIXA 5A7FA 2FZVA 3SQMA 5AVZA 2JHAA 4OMFG 4FHEA 4K26A 1Q14A 1TM7E 4O2AF 2FV8A 2HJRA 2ZIUB 3HABA 3A7DA 1BAPA 1NI4A 1STOA 2VZEA 4FYKA 1RLJA 1LBSA 3RPEA 4KACA 2FDRA 3W9YA 4DXAA 1RQ2A 1N92A 4JLWA 5C1PA 1W34A 2B2XA 4M87A 4M1WA 1OASA 1A4UA 4PSVA 4EDHA 2AN1A 3LIPA 3LVFO 5KU7A 4XYBA 5L4SA 3MBKA 1N6NA 2W4MA 3M5DA 1AV6A 2O1EA 1E6CA 4OFXA 3MT7A 1QJCA 1M54A 4MS1B 1R27A 2H2GA 4JCCA 3A1CA 4GLFA 5E9JA 3RS9A 3NHFA 2CLOB 3BHMA 3OFJA 3K9GA 3QKWA 4CLHA 5KWSA 4D9CA 2ZE7A 1FB5A 3CQ9A 3E82A 1BRMA 2OTCA 2PBLA 2A4MA 3Q9UA 4H27A 4PHGA 1D2HA 4BMZA 2A8YA 2XCLA 3DOFA 4HWOA 4UFNA 3DEKA 1NY5A 5AYVA 1JLSA 2QRVB 4LQCA 4NBSA 5JD3A 2JIQA 2H2DA 2PRZA 3OQ1A 2VUIB 1W36C 1QWOA 2VTEA 1FLDA 4G5OA 4GC9A 1GLVA 3Q3VA 4ZOLB 2HO5A 4C7KA 3C8UA 1BQ3A 5HQ3B 2E5FA 2PTGA 3N2LA 4L3WA 3ZH9B 1VL1A 2YHAA 3GI1A 3VI3B 1BDMA 2QI9C 2W2XA 3GJ6A 3RIHA 4KIUA 4EHKA 5B36A 2D5LA 4M8SA 1K92A 2P9BA 3OT5A 4QUBA 4DMGA 3PS9A 3DC7A 3S27A 4JJ4A 1PWEA 4ZI5A 1YFZA 1GN8A 2I03A 3PC7A 5FJJA 2X5XA 3TGLA 5KKCA 1H85A 3RK0A 1J0XO 5HE8A 1MGOA 5JAIA 4F11A 1UDCA 3R0JA 3R4VA 4QDOA 4JEUA 3EGWA 4CKZA 2FSSA 3DBHB 4OUKX 4Q18A 1C8VB 4PANA 3W5SA 1C9YA 5BUSA 1F51E 3R74A 2O1WA 2WC1A 3ONDA 3A9WA 3BXGA 1ZWLA 1JFLA 4DILA 4EOGA 3I4LA 1T0HB 1ZNQO 5DWVA 4O8CA 1CS0B 4EY4A 5HCNA 4AKHA 4LCJA 4NY1A 4ENQA 1PGPA 3PGXA 2RIPA 1YRHA 3BMOB 1M75A 3HA2A 4C6SA 4D6YA 3R0ZA 4Y2SA 3DCYA 3PQ4A 2ONJA 1AZLA 1GCGA 2ZQ5A 5GONA 1P62B 3TEMA 3VAAA 2EZ4A 2FZEA 2B8TA 2PX5A 1C9EA 3AYXB 3I8SA 3JXEA 1OD6A 5CT4A 1WF6A 3CZ9A 3JAKB 2COKA 2G40A 3H1BA 5KYUB 1MVLA 1HDCA 5ER6A 3HA3A 2KBEA 3PYMA 3RSSA 2HJ9A 4C2AA 5E7QA 3ZS8A 2PGDA 1IATA 4C4ZA 3K2IA 3PI7A 4INOA 4OHMA 5GV8A 4ZYVA 1HDIA 3ZVLA 5FH9A 1Z37A 1VMAA 4LJ9A 1NSTA 1VG8A 3PLNA 5DVZA 2J0SA 3EG5A 2CXOA 2Z4SA 3K73O 4M53A 2PLAA 5NULA 1KH1A 1YTUA 3FDFA 3GHYA 2ZJBA 2XUAA 2VPQA 2IL1A 3GCWA 1GTZA 4RKQA 3RTGA 2ID4A 2C5LA 4ZXFA 3Q3CA 4GX5A 4EGAA 2APJA 2CW5A 2YHIB 1V11A 4HRAA 3E53A 3MRTA 1E92A 3RVDA 2ASEA 5JH7F 3EQ7A 2QJRA 2WWGA 4TMTA 2PUVA 2JJYA 4ZVPA 5CBPA 3A6HA 3T5BA 5F51A 3E2PA 5JMOA 1G41A 4NFHA 2XMPA 5DZSA 3ZWQA 4ZAVA 2PS0A 1G8JA 1SBQA 3G6WA 3SX0A 5LDGA 1LLFA 4ETNA 5FLYA 4IWXA 4RVNA 1BHO1 4CKYA 5HBRA 4WY5A 1TM3E 2WV9A 2IIBA 2FSVC 3W2EA 5EP1A 1UZNA 3QPWA 4LRSB 2NYAA 4U02A 2J0UB 1FRVA 2SCUA 3PKZA 1OV4A 4FE3A 3VU9B 3E9MA 4I3HA 4HF7A 3RYIA 5JCJD 4YRAA 3AHIA 3VR0A 2NZXA 3P52A 2D1TA 2UXBB 3GDHA 3NBKA 4C0QC 3B51X 5C8YA 4JL5A 5AFSA 4QGGA 1KK1A 5KSZA 5TPWB 2ODEA 2DM6A 4PBRA 2O8DB 2OVBA 4P3YA 3EXHB 3HKCB 3DM5A 3RJ9A 3CR8A 4E2WA 1JAIA 2QXUA 1SCKA 3OU7A 3PDWA 4JYCA 1DV1A 4X63A 2DHDA 2A59A 3ORRA 3NNDA 4FFOA 2KMLA 3R0VA 3ZVMA 4P5PA 4WGFA 4NZYA 2HY7A 3OP1A 2GBPA 1OV6A 521PA 1DNPA 1E9VA 4KI0A 3ZJVA 4MHTA 4YGYA 3U9SA 4M83A 2OZEA 5IN5A 2H0RA 3FR7A 3VOAA 3VR4D 5D3QA 1S1CA 1F14A 1JLMA 3O2JA 4X20B 3PR1A 2DERA 4BWGA 1NFFA 3JWGA 2R87A 3JQRA 5L3SA 4QDJA 1FA9A 3MFYA 3PC4A 3RYHA 4LF5B 1AZTA 1G1AA 1MQ9A 1QVVA 3ENVA 3HJNA 2X42A 3MSCA 5BNTA 3CG4A 3O95A 3DL4A 3FX2A 6REQA 1N6HA 5ECWA 5JSHA 3Q6MA 4UAGA 1G8HA 2QV7A 3TDKA 3ER8A 4FJ2A 4RF5A 4S05A 3U56A 3S2SA 2PMEA 2CNDA 2QZ9A 3L7YA 4CV1A 5LQAA 3QLTA 4C76A 1C1XB 4RK6A 3MQ2A 3NYWA 1VHTA 2I33A 3KPVA 4KPFC 3NIFB 3IHWA 1SVIA 4OAQA 1MB4A 1PJZA 1SD1A 3CLVA 3T3OA 2D0DA 1L9XA 2FF7A 2FA9A 2J7PD 3GVHA 2ATCA 3L8ZA 3PNPA 3QH4A 4XSGA 2ZT6A 8OHMA 2M6RA 5I9IA 3PSHA 4ERNA 1E2QA 3GY0A 4F9FA 4JQSA 1KI8A 1UXIA 3DZDA 3UXYA 1TK3A 3ZOZA 4IO0A 5AUOB 4N7MA 2P91A 1GGKA 4HRYA 1NY6A 1DINA 1OC2A 5IVHA 1U0FA 3EQZA 5K4HA 3GP5A 4PONA 5CVCA 5JXWA 5HTKA 1OBOA 2EIXA 1FP7A 2BRUC 3ANNA 3S2IA 2C4UA 2O59A 4MITA 1XQWA 4K1XA 2IEBA 2JGRA 3VNVA 2WAOA 5EE0A 1EWRA 3FHCB 1S2GA 3OLXA 4BP8A 3ROQA 4KVAA 1J1UA 4EO7A 1TJYA 4LNUB 3G49A 4BFLA 2O5RA 1J8VA 4C6TA 4OF4A 2FDCA 3NDPA 3PUHA 2FP3A 1SU6A 2LDXA 4JI6B 4AB1A 4NE7A 1LA2A 4DDWA 3MJSA 3HCFA 3IP5A 2QMYA 4OSPA 1L7RA 1XCMA 2QTRA 3DW3X 3G2PA 2C9CA 5G02A 1W1WA 4L16A 2UYQA 4UVGA 3O3MB 2YYAA 4IJ6A 4GM1A 4OI0A 2FQXA 1QAQA 3RRMA 2QJFA 3A27A 3RHZA 2C2BA 3GOHA 1WD5A 2VSQA 1WEKA 3GELA 3L06A 4NJMA 5F5LA 4MI6A 5AVKA 2OHVA 1VLHA 1HV8A 1T29A 1X7XB 3QVGA 4RFLA 3N8IA 4H08A 1QJ4A 3VR6H 1EJ2A 4BNMA 4PE5B 1R9GA 2V7UA 1WY7A 4JC4A 5TMBA 3AR6A 1YUBA 3HUFA 3IP8A 3MT9A 3I61A 3R77A 3KUKA 2NVBA 5LB4A 2R1ZA 3VHXB 4C2BA 4CDGA 1KZGB 3EQ9A 4MI3A 5GGXA 1A72A 1KJWA 1RKUA 1SKYE 3C43A 3GLUA 4QDUA 1DX6A 1OFUX 4PZDA 2GLTA 3F7TA 4YECA 1L1QA 1LSOA 4KQWA 1GP2A 2XQFA 1ZJYA 2BUCA 3EY4A 4N12A 1BD3A 5H1YA 4EATA 3W6OA 1X42A 1M2KA 4N5IX 2JDID 2ILTA 2I54A 2AF3C 4E15A 5JPDA 3TQHA 5GOZA 4PICA 2O2IA 1BJRE 2B1GA 4FE7A 5BRJA 3A9SA 1RWQA 1PJ4A 3ENQA 5EI5A 2W2NA 3RG2A 3BUSA 1GTL1 1BJTA 2HR1A 5AW0A 1NN3A 2VH1A 1VJDA 3OFVA 5FUBA 4ADSG 2XBLA 1UAGA 1ZITA 2VN8A 3MCVA 4S04A 3MINA 3LQKA 4GOND 3KWFA 3AUFA 2FPOA 2FUCA 5BR4A 3BREA 2HNBA 1WF3A 1C7QA 4EBBA 1HQKA 2Q9BA 4FMBB 1Q1BA 2VJDA 2Z5VA 3I76A 4Y0NA 3LHFA 4R40A 5AP9A 2FPMA 4G5HA 2UZ4A 2DH5A 3CEHA 3HCEA 3LBYA 2VHVA 3NBMA 1TZJA 3IGFA 1UDWA 1QTNA 1Q0LA 1PAUA 2WK1A 3PQ5A 5JDIA 4LHVA 1MJGM 3FSEA 1L7BA 1IPFA 3F1LA 1ZESA 2FMKA 1ICEA 5DLEA 3LQ1A 4QGHA 3C3YA 3O8DA 4XLZA 2NO6A 1C9KA 3BYZA 5LCXA 3WO1A 1PTKA 1NBHA 2GHIA 2F8TA 4IQ0A 1WMDA 1XQ6A 2XOKD 1FDWA 1QH0A 1AZWA 1JG6A 2V03A 3WWDA 2W2OA 4O1HA 1SQ0A 1E5TA 2H48A 4MVJG 1GVHA 1QGUB 1ZM3A 4Q5IA 1PYDA 3WBFA 1VCMA 3OQIA 1UMDB 4GMXA 2J6BA 5AJVB 5KIAA 3I9JA 4M2LA 4MJXA 3LKZA 5KDLA 3ETNA 3MYRA 4OO3A 4U6NA 3DHWC 2BBWA 3JASB 1EGAA 1KFJB 1MV5A 1SUWA 4QDKA 5DM1A 4Q7QA 1ZSYA 1N2GA 2IXAA 3LP6A 5CDGA 1CFZA 1IFXA 1XHLA 4KPUB 4POAA 4OUDB 1HQCA 5G0TA 2Q1UA 5EGSA 2YHBA 3W3ZB 2NX2A 2OSVA 1RRVA 4HL6A 3OKCA 3JQBA 4IS2A 4H7EA 3BA1A 4YS6A 5IBCA 2NU8B 1XG5A 2EEZA 3FA2A 4IJWA 4R2XA 4HVLA 5KMGB 1JSCA 4JV5B 1SUSA 3FE2A 4MA0A 4PSAA 4HAWA 3VBEA 3FRHA 3FCOA 2PYIA 4F3RA 1OW3B 1U3VA 3BHNA 4U2BA 3T34A 3JZIA 1GKYA 1Z2CA 3FI0A 1I13A 4HMQA 4A0SA 1A9ZA 4J1SA 3LX8A 4BFSA 4N41A 3BJZA 1RIFA 3TQRA 1ZL2A 2QP9X 2QYHA 3N2IA 3QFSA 3I9V6 4TRJA 1BDBA 1A7UA 1YZGA 3CXUA 4RIIA 1LX6A 3FPSA 5A4AA 1I80A 1XNGA 2GN1A 4KV9A 2B8WA 3CYFA 3PZRA 4IDPA 4CKEB 1PNQA 3VZCA 1S02A 3T1TA 2YL2A 4H16A 3SEAA 1N32B 4HB0A 5DNUA 2D2EA 4KQ6A 4MIEA 3UFBA 2QTTA 3IAS1 4C7MA 2P11A 1PS8A 2OBNA 1RLOA 4LJRA 2IU6A 1EZ4A 2HIAA 2NUTB 3HJTA 4UDNA 4UNNA 4G0WA 4H17A 5AI9A 1X15A 3NGXA 3C3DA 3OEEA 4NCIA 3NHBA 4JJAA 3W8FA 2O20A 2FZLA 3SLGA 1BCRB 1O94D 3DZCA 3GG9A 4YO7A 5LBTA 2O23A 2NN3C 4D3DA 1C7ZA 2FW7A 2DFTA 1EGVB 2DOKA 2GYYA 2J07A 4HQNA 1ES9A 3BWEA 3QKSA 3U7HB 1PJAA 3NTXA 1NTRA 3K0CC 3SNHA 3SC6A 4BNVA 4BBPA 4YACA 3A9VA 2VDMB 3M9WA 3EX7C 4B85A 4AG6A 3RHFA 5IARA 1OI3A 3H3XA 5D6NA 3VZSA 3ZWBA 4GI5A 3COPA 5E1OA 4ON9A 5DHQA 5JQGB 2HCBA 3OKFA 4K8OA 5KWIA 1MRSA 3HNRA 3I34X 5JZMA 5LFAA 1NNEA 4PR0A 5B37A 4GAEA 1VL5A 1DOHA 2QRPA 1KMHA 1KS9A 4S1WA 1TM4E 2XXAB 3O8CA 4GXNA 2AUMA 4UTXA 2WSSA 5IYZA 2HT1A 4A6DA 3GU3A 2QDKA 5JAPA 4G01B 4OHOA 2VDWB 2LCFA 4N03A 4Q9DA 3W5VA 1MC4A 1SIUA 3ZJ5A 1HEUA 1J9ZA 4RFSA 3MOGA 3PGKA 3F4LA 2HPAA 4QTUB 4EPVA 4I81A 1XEFA 4ESOA 1UOOA 3PGA1 1U1GA 4PO8A 4GZLA 3L4JA 1Y63A 2QN2A 1KI6A 2ZJYA 3ESQA 4MS4A 3FNFA 1OA1A 1P0CA 1EFVB 4OXRA 5HZMA 3KTDA 5T4BA 2NNWB 3AY0A 1L7XA 1S8FA 2UZIR 3L7OA 4K9QA 4LOIA 2RH5A 1QHEA 1JFRA 1JJVA 1XT6A 4DNXA 3P0FA 4LK2A 2FUG1 5BVGA 2AG1A 1GYRA 3C6MA 1DBIA 1PSDA 4ETWA 5B6JA 5ETJA 1UQRA 5K3OA 2F8MA 3PYXA 3TSWA 1KVQA 3W5DA 2J85A 3B2NA 2ZUEA 1TKBA 1K0FA 3ZK9A 1RNLA 2PKWA 3N5KA 1JLLB 1XMIA 4RCVA 4EG8A 3ZHXA 2I99A 3L4KA 1XNHA 1Z6QA 4IDGA 1I6KA 3T6KA 2BGJA 3AERA 1J8QA 3TRDA 1Q77A 2DX7A 4F4CA 3GLSA 3EC7A 3GB9A 4W9NA 3NBQA 3OIWA 4ZCPA 1GRNA 4QHSA 2CXXA 4NWIA 2PAAA 2PPLA 2PGOA 3K8YA 3O8OB 3JWPA 3QOWA 4TT8A 5DYIA 3ZNNA 1VYTA 3VZDA 2AVDA 1TEXA 3GYGA 2DKOA 4LE2A 4NEGA 3GVCA 4WXMA 4GBJA 4BVEA 1WXXA 5IZCA 4UDXX 2Y66A 4IVQA 1OFUA 2FK8A 4Q3KA 2MCFA 2IOFK 4DIDA 4BO3A 4RBNA 3I1FA 4ZI2A 1EHIA 1TQDA 2AMFA 3M49A 3QENA 3DDHA 3QIVA 5LQMA 1JB1A 1NBMA 3IQHX 1D04A 4KODA 4P32A 4CMKA 5CFNA 1ZUNB 5I4CA 1L7VC 1W2WB 3RUFA 4UW9A 4D45A 3DP9A 3GVPA 4KAJA 3TJRA 5A04A 4QGFA 2WFAA 4A0QA 4D9BA 4BBJA 3UMMA 2Y0BA 2V58A 3ZD6A 3OJEA 4JXJA 2FCRA 3LH5A 3C8ZA 2XPCA 3LUBA 1TLTA 4TWIA 1N3LA 1VJ5A 2AT1A 4B5LA 5C2JB 4OB7A 4FCTA 2FWAA 3VZQA 3UUEA 3H5TA 4Y2RA 1KGSA 1S9HA 3OPVA 4KYIB 3UB4A 5I01A 4K87A 3UBMA 4OG2A 2JCGA 3M9LA 4KR3A 1TCBA 1D5WA 1P7ZA 1Z8FA 1L8LA 1C7JA 1CDDA 1EUDA 1SB9A 2W22A 3IAAA 3QBJA 3F4KA 2PDAA 4LKRA 3IT2A 3LXXA 3R9WA 2X77A 2O5CA 3PL5A 3TJZA 5DEIA 1G3QA 3K9WA 4RVUA 3TW4A 4QHTA 4NCJA 4Y98A 3FW1A 3FY4A 3ANXA 1R88A 4HZUA 1YD7A 1T4CA 4MLDA 1VI6A 1X9GA 4QRHA 1ZPDA 3S2YA 4I2NA 3EMDA 3TLKA 3WGLA 4CKWA 2GAAA 2A1UA 1NA5A 1T6YA 4MVJP 5HF6A 5CBKA 2XF2A 1QHFA 1RZVA 3V55A 4J43A 3VR3D 1ZFNA 3C3JA 4E14A 4YJHA 2RHJA 2GEDA 1AQ6A 3G2QA 3KEOA 1YDFA 2H6EA 1V1RB 3C0KA 3ZZ1A 3BC1A 1XFDA 1KJ9A 4NMLA 2G4VA 2PEZA 3HN2A 4H3VA 1X1AA 4OYRA 2YUTA 5ER9A 5KO2A 4M1SA 1U3TA 3UW1A 4HB4A 1LPSA 3V4FA 2R6R1 2ZBQA 1JDJA 3B9QA 3A3OA 3KYJB 4YP5A 1DC3A 2DP4E 2V6FA 2QLMA 5J9FA 1Z35A 1T1RA 1XYYA 1ZVKA 3GAFA 3L6DA 5EE9A 3F7MA 4II2A 3WK5A 2I4MA 3FKSA 3MNFA 3NHLA 1M2FA 1NPDA 5FI0B 1B7GO 2PL3A 4GKKB 4BNDA 2G0AA 3C5CA 4FNGA 3EXG2 1R10A 1S1MA 4MVJF 3LQFA 4H4CA 4PQRA 4BU1A 3FUWA 3AQ4A 3FYTA 4E0BA 2QVYX 3ECAA 4YJ2B 2PUWA 1PSZA 1L7DA 1ZVJA 3DYIA 3B1FA 1H6CA 3PNBA 1VG0B 1M8FA 2YIJA 2VUSA 3AEKB 3HO8A 4TVBA 2VWQA 4IHAA 1WW8A 1F20A 2YINC 1IWPB 2J0VA 4RE5A 5A0TA 2AEJA 4QARA 2ATVA 3SEQA 3KR0A 5LDHA 4HNSA 1CDEA 2XKAA 2CV2A 4RKYA 2RC6A 5DGIA 3EE6A 2AJCA 3HDQA 2QAGC 1B42A 1NKVA 5A4JA 1IAQA 2PG3A 2YZMA 3BMNA 1RYYA 4Q9HA 4G25A 5I4IA 3SQDA 4L8WB 1YVRA 2OG2A 1CQWA 3UJ7A 1CQJB 5BW4A 3GJ8A 1KMMA 4L74A 5AI5A 2QG6A 3G2MA 3MN1A 3N2KA 1HNNA 2I91A 4OHPA 5TF4A 3INTA 3DNPA 3B52X 4TSKA 2DQ4A 3CUTA 1EE9A 1FFHA 4ZJPA 4LGCA 1UBCA 3QLEA 1RLMA 3HCAA 1KVUA 1DC4A 2P79A 2HKIA 1BE1A 2EW8A 1DEKA 1YNSA 4W82A 1RACA 1ZI9A 2HU8A 4GMHA 3PEVA 3T4XA 4DSUA 4DWJA 4OAPA 5HCUA 2QZ4A 3UYLA 5HWSA 2KPOA 3CZCA 4TQAA 4U6QA 3WG9A 4BV3A 1GSAA 1ZK0A 2F59A 3GRRA 4HZIA 4QODA 4K0KB 4U7DA 4ZAZA 2HSJA 2QL9A 1H2FA 2W8ZA 4P7FA 2COUA 1XN4A 4C4AA 2F43B 3NHMA 3WQQA 3OD5A 5EHGA 1L4MA 3SZUA 4DSZA 3CPSA 3UOGA 1TVKA 3PD0A 5DK4A 3O4HA 2I5PO 1C7EA 1WXWA 2Y1LA 2XZLA 2ZANA 1BS2A 1JR3A 3QOYA 1SCUA 2WVJA 4PHFA 4BVKA 1NR5A 3ZWDA 2C9OA 5FNVB 4C06A 5ADHA 3RVBA 3DV0A 1AE1A 4M8KA 5D51S 5SICE 1IG0A 3GCDA 4MQFB 4B31A 1I1OA 3TZEA 4HAXA 1YS6A 2PD6A 5ICMA 4Y9TA 4FYPA 5FTNA 3KVOA 3LXUX 2ST1A 3KJIA 4JJ8A 4CLEA 4EITA 3I32A 5AK6A 5EY5B 1RRCA 4GKVA 1HNXB 1ZRNA 3ZW7A 5CDFE 3NWJA 3OZDA 1NM5A 4TTSA 4MRVA 1BVRA 1XJ5A 1YS7A 2AG0A 1YXMA 2UUOA 5AM1A 1FJHA 4GPTA 1N0HA 3DO8A 5FORA 4DNQA 4MJLA 3FUVA 2IXFA 4QZVA 2RONA 1YRWA 2ZS9A 3CONA 4UVEA 1RBMA 1FQWA 3HWSA 1FSZA 1Y4DE 3HI4A 3PFKA 2ZUTA 4D74A 2CZCA 1EVEA 2Q2OA 4UFPA 4KQ9A 4B82A 4MUAA 1QGED 3DVLA 5HOQA 5J2TB 4DUGA 1KRWA 3K0AA 1XR3A 4HAVA 4HDKB 5BSMA 4UJ5A 3K5IA 2ZOSA 2CCKA 4WZAB 4X85A 4DUZB 1SXJE 2Q6IA 1HLFA 4OX9Y 5ES4B 3ZWWA 4Q34A 1HH4A 1PSWA 2EG5A 4YH1A 2VQ3A 5H3CA 5JBIA 2ZJ2A 2HK8A 5KREA 5L53A 1NYQA 2F3RA 1A9OA 3IMKA 3L07A 4FFDA 3ZD9A 5AH0A 3S0JA 1P77A 1CUVA 5BSKA 3UC5A 2GI4A 2ZP1A 3CRW1 1T3HA 2BFDA 3IAHA 4Y18A 3W5BA 3THSA 5IN4A 4KPEC 1JFFB 3R3VA 4MWSA 4Z8YA 1GNRA 5EUMA 4EQ6A 2IPLA 2JCVA 2JFQA 1TB4A 2O6LA 2C1EA 2QLBA 1BYUA 3KSDO 2REXB 1SULA 4C87A 1D1TA 3SSMA 1H8EA 3GOQA 4K6FA 3W06A 5KSYA 4U4AA 4OBXA 3QVWA 1GU0A 3OOJA 2F8LA 5ABPA 2R7MA 4FNAA 3Q87B 1ZRMA 2FQQA 1FBTA 1PG5A 4I5FA 2JGIA 4PRLA 1JPNA 4TL7A 3E3MA 1GGMA 4YRQA 1RAIA 3GBSA 3LPMA 2BJWA 1PW7A 4QQRA 2C58A 4IDOA 2GJ8A 2WJ6A 4J2TA 3FGPA 1TTTA 4Z4IA 1NLYA 3MMPA 1EX1A 3A9UA 2OAP1 2ZJAA 3G5TA 4DNOA 5HKKD 4DWOA 3DYBA 4MUFA 3WK6A 2NTEA 2YYZA 4IFTA 4LHSA 4I6JA 3T7CA 1J2YA 1JEDA 2OCXA 3GGCA 3BL8A 4JN6B 4ZN6A 3K70C 5IVKA 4LYAA 1DC7A 1S8AA 3BRWA 1DEXA 1EAYA 4HWRA 3SS8A 3OFKA 4V03A 5JIBA 1QRUA 1N0WA 2L69A 1UBFA 3A6ZA 3I2IA 2WIBA 4JWKA 5DU2A 1WU7A 5CU7A 5JJBA 3TTVA 3HBNA 4G0ZA 3AUAA 3F5QA 1TIBA 2Z4RA 5EHXA 3C7TA 2AOVA 5CCXA 1YJCA 1KAHA 2ENWA 3TMYA 4JBGA 2WDPA 1IOWA 1PE0A 1IBLB 5EQDA 3N7AA 2Q6VA 3FNEA 4IHKA 4HNVA 4DV2B 1BGVA 2ZJ3A 3W78A 4PZ0A 5FTMA 4IQGA 1KTIA 3AESB 5CLJA 1IQ0A 2ZRCA 4ABTA 3ND7A 1IUOA 4GGMX 3K9HA 2PZ8A 1WXDA 1W30A 1QIMA 2O52A 4F91B 2QN7A 1EGQA 2AN4A 1P74A 4P4SA 4LSMA 3S68A 1QO0D 3LO5A 2ZVQX 3IEIA 4X54A 3E9NA 4KEAA 2N9UA 4QOFA 3TWOA 2Z95A 3V97A 3IMCA 5FEUA 3TG8A 4BQQA 1I01A 3EIFA 1Z82A 2JFWA 3LC2O 4JUIA 1BKYA 4BFCA 3ZJTA 4MVJE 5FOVA 4RLFA 4Y2JA 4LOAA 1U8CB 2X22A 3IKTA 3D6VA 3SGLA 4N54A 1WMEA 4V3CA 2HMSA 5DMHA 1Z4QA 1C0EA 2ZLBA 3MCAA 1X1QA 1ZOIA 1Y1SA 3GLTA 5T67A 3W7BA 3VXKA 3JZMA 1PR0A 2WEKA 3E8MA 4HVTA 2I6GA 2DUNA 2QTHA 4Y1EA 3FGNA 4KMMA 4INAA 1IWBB 1TA0A 1R4MA 1G17A 3LGAA 4G0PA 4AAYA 2IZ6A 1YOVA 1QG6A 1W88A 2HHJA 3BH7A 4UPEA 4Q15A 4WFQA 5KNBD 1HL7A 2VJQA 3BKXA 3H3JA 2ZAOA 4A26A 2ZJFA 4K9NA 4J0GA 4EUFA 3LUGA 2LKDA 3DO6A 3GJSA 1WHSA 2IXBA 2V7VA 1KFEB 2JI8A 4F6RB 3BTSA 2VTBA 3D8HA 4H59A 3ZS9A 5G0VA 4XIJA 3WLHA 2GGSA 5BNIA 3COVA 4RELA 2GBCA 2AFHE 2J4FA 2Q62A 4PSKA 4TMXA 1CUUA 3USES 3Q8WA 1C29B 4B0PA 4W1QA 1QCYA 3R5JA 2DR0A 1D2AA 5AUPB 4Q19A 2POQX 4ACAA 4AZSA 3LY8A 3NMUF 4KWTA 1DXQA 2Z0MA 4C0WA 4CM5A 1OHHA 1TVMA 16PKA 1PV1A 2A35A 1RKQA 2XSZD 3D54D 3KTFA 5AVWA 5CJ2A 1HE2A 2XDAA 2GTPA 2QQ5A 1M7HA 3TOXA 3UT6A 5D3MB 3F4BA 3BL5A 1MB3A 2PFKA 1RYFA 3QJYA 4HOYA 4AZ3B 4W8GA 2CXHA 2B1RA 3ITNA 5THQA 3OQPA 4F3TA 4M0UA 3FFTA 1F8XA 1FC0A 3A4MA 3GFFA 4KQIA 1FP4A 1XTPA 1WZCA 2CXQA 3R6TA 3S1LA 2FPGA 4CLOB 4H7JA 1WDMA 4N6NA 4AJ1A 4WFIA 3KL2A 3PR2B 3B1JA 4LYDA 3UA3A 2DH6A 2Z1NA 4ZPJA 2XUGA 3L82B 3LOUA 1SEPA 4Q37A 4G1CA 1CQXA 1LPPA 3LQ4A 3V1TC 2JIOA 1PQWA 1K3FA 2E4UA 1N6KA 1Z0IA 2JFZA 1LV8A 1E1KA 4YHHB 5GVRA 2E82A 3IAXA 3C74A 1AKTA 2HDNB 4IBOA 4LBYA 1RHRA 4O2BF 4Q9JA 4YO8A 3BS4A 1KE2A 2C00A 4L4ZA 4CMIA 1YQXA 2OE2A 1KYVA 3GEHA 3OPMA 4C89A 2ZPTX 2P69A 4NG4A 2NO1A 5HMMA 3EWIA 3MCZA 4ZK6A 1TT7A 1DUVG 1GZUA 1M8GA 3I9FA 2HK9A 2PGIA 2L82A 3OUTA 4RVHA 2XRMA 1EYZA 3HCRA 3NPAA 3UUFA 2D1QA 4F5YA 3KQNA 3TTTA 3V1YA 1PNRA 4B6EA 3PEUA 1P1KA 1NULA 1Z6ZA 1Z68A 2BISA 2WOOA 2NO7A 2Z09A 3ZWNA 4PVCA 3H83A 4XQCA 5DN6D 1N5RA 4Q0MA 1GNLA 3KQTA 4TKMA 4ZFNA 1O77A 3ROEA 4PRKA 5IX8A 4R9SA 4OQLA 2R25B 3CLKA 4B76A 4WK6A 1XPJA 1JIUA 3Q7QA 4ZANA 5FYDA 3B6MA 1O96A 3LDAA 1CIVA 3F8TA 3L79A 1H4QA 3KYCB 1TW2A 4I1IA 1DBVO 2Z9DA 5EPOA 3IDFA 3WGNA 4XA8A 1HG0A 3IQZA 3FWPA 2H4XA 2XDQB 3B1XA 1G21A 1F4VA 3U7IA 3QXSA 5JBNA 2GM3A 2ETVA 4O2AB 5DHAA 3MGCA 5JSQA 4ML3A 1CR6A 4B44A 2QZZA 4EG1A 2PU7A 1TIKA 1ISMA 1GQYA 4D99A 3M1IA 3KV3O 4PZLA 1T8YA 2D5CA 2QVZX 4FK8A 2NZ2A 4BP3A 4EHNA 1TDJA 5U4QA 5ESXA 1DIGA 1K27A 3A6JA 3QOXA 4ARZA 2QP3A 4DJAA 4QYIB 3FNIA 1DRKA 4MVJI 5IUNC 1EU1A 3LUDA 1JQ5A 2JGLA 5ITSA 2IS6A 1IE3A 4NIMA 2VBGA 5DM0A 3NVKI 4M8LA 3AF6A 4PYNA 4I9FA 1DAMA 5AKKA 3I28A 4MCIA 2YV3A 2Q5EA 3IT0A 1UMCA 3W1EA 3CC8A 3ONVA 4FE4A 4A03A 1Z6PA 1PD1A 2GCOA 2REQB 5EEHA 1WUIS 1C3LA 2VQ6A 3GNLA 4BNJA 3L7DA 3ZHRA 1YR6A 2P27A 2PWZA 5HUHA 3RS7A 2MR5A 5HF5A 1AQIA 2FAXA 4UPDA 2O54A 4BATA 3L0SA 3OKAA 1W9MA 1HXHA 1WUTA 4B2IA 3TR6A 1IOVA 5F64A 5AVXA 5F3WB 2KSQA 3WGHA 1GCAA 1KAQA 2NIPA 2A3RA 2OC4A 2YWEA 2QN8A 5EG5A 1QXSA 3V00A 4EW1A 1LB1B 3K09C 5EINA 1KI7A 2NUPB 3KO8A 3KPUA 1XTVA 1JDSA 2OKCA 3BJRA 2PUTA 3GAAA 3PDIB 3SP1A 1K0UA 3WWZA 3UTDA 1V16A 2IV3A 1OU0A 3W5UA 4P34A 4P8RA 4MOWA 3SAJA 3A25A 1YIAA 4QEKA 2R6DA 3PNSA 4RPJA 5FTWA 4K6HA 1U2GA 2HA6A 4FUQA 3TQCA 4R3WA 4F4UA 3DE7X 4YP1A 1C1DB 4CQLB 5ADVA 4MVCA 2GVDC 2QYSA 4Y2PA 5DGHA 3VC3A 5C1OA 3L6RA 3IDZA 4GR4A 1F9EA 4ZZIA 1SKYB 3OX2A 2RAPA 1RWVA 1VBKA 1NRIA 5D6OA 5FTLA 4M1ZA 3QBVA 4M9CA 5DCWA 3IQWA 4JBNA 4RVCA 5KKAA 3WQBA 2AOTA 3PU6A 3IDSA 4JJZA 4MV8A 5FX2A 2NZYA 1Z8DA 3K96A 3L1VA 1DJLA 1RQPA 4G4IA 5ITZA 2YOGA 3CN7A 3D6AA 3TLGB 1RPJA 2CBXA 2ZYAA 1GAJA 1LLUA 1RE0A 2XW6A 4ZCSA 2GWRA 4P92A 4V1CB 1EWTA 2QN6A 5AUNB 4K6CA 3SXJA 4UHJA 2HHHB 5F3DA 4A8JB 4B74A 1JG4A 4O4HA 2E87A 2VDPB 5FULA 2IP4A 2Y8EA 3OO0A 4MDHA 4OMUA 1PEYA 1FL9A 2DJIA 2LIPA 4EW2A 1HYBA 4Z0NA 1T9HA 3QUAA 2W6ZA 3LCCA 4EHHA 3N0VA 2BE9A 4EYOA 4FDVA 4FMCF 3AJRA 4PLZA 4PC6A 2ZUSA 4CQMB 3BIJA 3ESXA 1R15A 5CT9A 3PVCA 5JH7B 4E5VA 3D6JA 4UM8B 1SY7A 2RGNC 1UXHA 3QLUA 5C81A 3PJFA 4FQ8A 4KYUA 5A6SA 2R85A 2BLNA 4IEFB 3HXQA 2WP8J 4YIKA 3O3NB 1L4GA 1R7RA 4L75A 4Q7JB 1OXVA 4RJ2A 2R11A 5FA8A 2D6FA 4JUAA 5BSWA 4CDMA 4OXNA 3U60B 1E3QA 1IB6A 3QUCA 3EGEA 5B2ZA 2D54A 4F71A 3O7WA 1LI4A 4NU0A 5AOAA 4Z0TA 5FWXB 1M74A 2JG3A 3F6SA 4QTZA 5LXTF 3DZHA 2DLNA 1W1IA 1WQ4A 3A1VA 3TLEA 4DDTA 1NUQA 1H0SA 3K9CA 2AL7A 2W2VA 2WKRA 5D5QA 4E5DA 3NWEA 4QPCA 5KNDA 1CUSA 2PMCA 5B1SA 4ZCMA 4QOSA 5EIEA 3Q8XB 3ICOA 1S3SA 5A6VA 4Q93A 1O5TA 2QD4A 4L9WA 4CVNA 4TV8F 1QP4A 1EFCA 4QO8A 1VE7A 3WIEA 1MXHA 3J7TA 3BB4A 4DC1A 4EA7A 2HCFA 2H5LA 2OD9A 3D0KA 1P1RA 1M6WA 3C3BA 2QE7D 2BMAA 2V74B 1TECE 4EHBA 1RAEA 3ABSB 3EULA 4RQAA 5A7HA 5K0BA 3ZHCA 8ATCA 2PSHA 4DV4B 1SA0A 2CL5A 2D1RA 2QW8A 2I6UA 1P4SA 1NOIA 4KQ2A 3OX4A 2W8BA 2C2YA 3DEHA 4TWBA 3A04A 4ME6A 4WBSA 3UT5A 1NC1A 2EW2A 4EYGA 4C4SA 4CKXA 5ALVA 3UJBA 2PQMA 4XLLA 1IUPA 3STUA 2G82A 3PC2A 4Q4HB 1Z2OX 3EGXA 3R9KA 4DW8A 3TIIA 1VCHA 1XQ9A 1K75A 4MVJH 3K5PA 1E2HA 2Q99A 1U2QA 4CN8A 1L6IA 1TK2A 1XCOA 4P4TA 1I51A 4LXIA 3WA6A 4DOMA 3IPXA 4IIJF 1MABA 5C1BA 4CEHB 2DB3A 3WGZA 1VMKA 1U7HA 2KW5A 4O02B 4BJ3A 4R7TA 3ZCXA 4PYRA 3MWEA 1ZJ4A 1DBPA 2LWIA 3BK1A 3F9IA 4OPMA 3TVTA 1U2DC 1GZHB 2I2AA 2QJTA 3IYLW 3MOSA 1E3DA 5IBPA 3N74A 1MH1A 1A2BA 2VJAA 4QBGB 3QPDA 3PFFA 4F3CA 5ITWA 4Y6GB 3AETB 2B61A 3F5MA 1ORVA 2EBWA 4TT3A 2WUDA 1Y6QA 3C7KA 1SIBE 2VNAA 3EQ8A 3Q5EA 4HEA6 1ZQ1A 2VWPA 1P91A 3NCTA 4K6KA 4GECA 1KQPA 4HWTA 4U2EA 2PX4A 4IG4A 1LRJA 4QU5A 3KEMA 1H93A 3NTRA 3TCXB 3WMFA 4NBWA 2OV2A 1I4EB 1BSVA 2D0PB 3KG2A 3OC0A 1KYZA 1DKQA 2CD9A 3QOFA 2SECE 3QWIA 3TKAA 3UPUA 4YA6A 4CEJA 1PEDA 2LPMA 3G9ZA 5HK9A 3NBXX 3QLVC 4POOA 1W94A 3SDZA 3EQ2A 1MAVA 1EBBA 1A76A 1JAZA 1QRRA 4MNTA 1KOGA 4W1RA 1ZI8A 2BKUA 5CX1B 1U7ZA 2Q9AA 4RK5A 1AH2A 2JLXA 2IZZA 2Q3MA 3BMXA 3HGQA 1S4QA 2NVUB 4MYHA 3DQPA 5HMLA 1XI2A 4BNUA 3M3DA 4EKNB 1V95A 2ZSAA 1VKJA 1MOSA 3T5GA 1Z0UA 3EXG1 2IIQA 1CIPA 1MB9A 2EFJA 5L3VA 1G8GA 2JARA 4CI9A 2CNBA 2A6PA 4RM3A 3PUYA 4S3MA 4BZWA 1TGVA 3EVEA 3HR7A 2B1JA 5ALUA 3CKYA 3TFOA 1QHYA 4YIHA 3OZCA 5K0TA 1AUQA 2WZDA 2MINB 4D6XA 3NDBB 1AKVA 1ZH6A 4P4NA 4D4GA 4RAOA 3O75A 3LUKA 4WDQA 3W2FA 3JAWA 2NTVA 1ETHA 3HM2A 3TQOA 4EWLA 3ZQ4A 1A8UA 5DTEA 5JZBA 3C5EA 3BVPA 4TYPA 1YBMA 3FMOB 3M4JA 3RIMA 1AM4D 4KW7A 4M0MA 2RAUA 4LDZA 3ZE8A 1PWHA 3G9XA 2GZDA 2R6FA 1VE5A 4U2CA 3VSAA 1G6OA 4OOFA 1JHDA 2ZR0A 2WMYA 4C5BA 5BPHA 2JIZA 1E7WA 1Z9BA 5EXEA 1AN0A 1KKLA 2EF0A 3G8CA 1U5BB 3O21A 1R8JA 1ARZA 3QXHA 3DE3X 1BA2A 2OYCA 2Z8YA 1OJ7A 4GX0A 2J08A 4AC9A 3F3KA 1QQ5A 3U0BA 4DRXB 2IJGX 5B1YA 3C45A 2IFTA 3EEBA 1S01A 2J1LA 5TX7A 5BWCA 2CXTA 1NBWB 1ZG3A 2WWFA 2C7GA 3VZPA 5LWQA 4CTMA 1PK8A 3NEYA 2XT9A 1EFHA 1ZQ9A 2I4IA 2YC2C 3TLBA 2JZOA 5AK5A 1DCTA 2DBZA 2BEKA 1X77A 2VDNB 2XEDA 3R7BA 3TH5A 1RI5A 4I9NA 5DULA 2C2WA 2G9QA 5AW9A 1D2CA 1KVSA 4Q82A 2IZ5A 2JBAA 5BT9A 4FEGA 4EYSA 2DWPA 2CXUA 3PHCA 3W6PA 1KL7A 3MSXA 4ONEA 2HBZA 2GZ1A 2RK3A 1XXHE 2OXRA 5B4UA 3D4BA 2JIDA 3JARB 1CU1A 2Y92A 3CUSA 3G2OA 3ZNQA <