1YQ9A

Structure of the unready oxidized form of [nife] hydrogenase
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
261
structure length
261
Chain Sequence
KKRPSVVYLHNAECTGCSESVLRTVDPYVDELILDVISMDYHETLMAGAGHAVEEALHEAIKGDFVCVIEGGIPMGDGGYWGKVGGRNMYDICAEVAPKAKAVIAIGTCATYGGVQAAKPNPTGTVGVNEALGKLGVKAINIAGCPPNPMNFVGTVVHLLTKGMPELDKQGRPVMFFGETVHDNCPRLKHFEAGEFATSFGSPEAKKGYCLYELGCKGPDTYNNCPKQLFNQVNWPVQAGHPCIACSEPNFWDLYSPFYSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic [NiFe] hydrogenase small subunit
publication title Structural differences between the ready and unready oxidized states of [NiFe] hydrogenases.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 81
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 1.12.2.1: Cytochrome-c3 hydrogenase.
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
A PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 1yq9A01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 1yq9A02
5JSHA 1UBHS 4UCWA 4C3OB 1CC1S 4OMFG 3CUSA 3H3XA 3ZE6A 1UBLS 4KO4S 2FRVA 5A4MS 4UPEA 4UQLA 4UE2A 4KO2S 4UD6A 4UE6A 3RGWS 4U9IS 4UPVA 1E3DA 5ADUS 5A4IS 4KN9S 5JSYA 4UEQA 1WUHS 5JRDS 1UBJS 4UCXA 5JT1A 3ZE9A 3ZE8A 4CI0B 1WULS 1YQ9A 4TTTS 4UQPA 4IUDS 3UQYS 2WPNA 1WUKS 1H2AS 1UBKS 4KO1S 3MYRA 3AYZB 3CURA 3USCS 4KO3S 1UBRS 4IUBS 1UBOS 3AYXB 1WUJS 5JSKA 1YRQA 3USES 4URHA 4UEWA 1WUIS 1H2RS 3ZE7A 1FRFS 4UD2A 1UBMS 4IUCS 5D51S 1UBTS 5A4FS 4UCQA 1YQWA 1UBUS 4GD3Q 4U9HS 4KL8S 4UE3S 1FRVA 5JSUA 3ZEAA
chains in the Genus database with same CATH superfamily
2G6TA 3PHLA 4IJ5A 4RKEA 3V7WA 3SFVA 3R7WB 2C9BA 4PFSA 1F8FA 1Z74A 2CGEA 3OFND 1IHOA 4XI9A 2OUIA 2H65A 3V7FA 1W93A 4Q5IA 3UPDA 1TLLA 3D6NB 4UCWA 4X44A 1JECA 1E9BA 3PUWA 5CURA 4FBLA 3RFTA 3F46A 4ZGWA 5FV4A 2WHXA 1K7FB 1MVNA 5KYWB 1Y81A 1VKJA 3L2OB 3PTZA 4M55A 3RC7A 3RTAA 1S89A 2Q1WA 5TF4A 2Y76A 1SWWA 4BMVA 1KH2A 1KQGA 1Y6ZA 2HPZA 3B6IA 3VDQA 5CA0B 1QH0A 1A2QA 3HH8A 4I1SA 3Q8MA 4HVAA 3JTEA 3FAKA 4FCTA 4ENTA 3PQ3A 1OT5A 4BO7A 1SR8A 2UYYA 4TKUA 1M67A 3F4LA 1ZIXA 3I37X 2QQFA 1FMCA 4A0QA 1UUFA 3CC8A 2PIDA 4MHSA 1TMKA 2J3QA 4WA7A 3NALA 2YW9A 2XV1A 3WIDA 4X1YA 5KSZA 3OE1A 3ZV7A 4E4YA 3OLCX 1BD4A 3JQ7B 2QN8A 4OBBA 4X95A 2OORA 2V8BA 2IHNA 3ZJTA 1VL8A 2Z3ZA 2WUDA 5IVIA 3T7AA 1A7KA 2OBLA 4WCVA 3R6DA 1BS2A 1WSAA 4MZDA 3GJTA 3O4HA 2CF5A 2FZKA 4FZ5A 2ZE6A 1SBQA 2O5VA 3GRVA 4DT1B 5J43A 4AMVA 2DFPA 4HTFA 3Q3IA 4G0OA 1V6AA 3VPGA 4EHKA 4P98A 1D4FA 2FE1A 3AB7A 1PJQA 3AEYA 3IV7A 3PUIA 4H7KA 3VYWA 4I3GA 1HNWB 1PG2A 1V8ZA 1WCIA 4AJOA 5F9HA 1XTZA 1OQAA 1PZXA 1DBVO 2HK8A 4BFUA 5M29A 1UOQA 3I92A 3W79A 2XUOA 4MKFA 2JH9A 3E70C 4DSAA 1ZNXA 3F4BA 2XMPA 4N0QA 1M6EX 4DLNA 3O8QA 4G4SO 3TW8A 5KUTA 4X60A 3TQCA 4DV1B 3ESXA 3LZ6A 1CUZA 4NENB 3IERA 2Q0SA 1H2AS 2GASA 3QTBA 1XTUA 5FJJA 4RKRA 4MB0A 1HYQA 5L4LA 3ICCA 4JLBA 4CT0A 1GTRA 3D7KA 4F9FA 4XWGA 4XD2A 4DTCA 4INAA 3G9XA 1G6Q1 1RBQA 1Q17A 1TCVA 1ZPDA 4RMHA 2X6QA 2DFDA 4UEKA 3ZD9A 4CUJA 3KZCA 4UOEA 5KMGB 2HDWA 2TSYB 2PX2A 5DBGA 1XEWX 5L6LB 4MQFA 2IZZA 3Q98A 1PI3A 1FDVA 5AM1A 3KOUA 4F72A 1M66A 2CUZA 2PZAA 3R3VA 1RYMA 2FEKA 2JS7A 1MQ9A 4JJGA 4ZVTA 2FWRA 2VBCA 2IA5A 4V1CI 3HDYA 4Z9AA 5CDYA 1Z7BA 3BZBA 3TQFA 3GB9A 1G0OA 3IHWA 4PAWA 5EZYB 4P4NA 2OZKA 1W4RA 3TPZA 3L4BA 1H2ZA 3DMNA 4RJ2A 1CY4A 1KYTA 1L3BA 3LY5A 1NIPA 1JR3D 2GHTA 4NFYA 1GRNA 3CLRD 2XZTA 3GJ7A 4NV3A 3VR2A 3UJPA 3WYNA 1QFZA 2OD9A 2NXJA 2QX7A 3H9QA 2JJ1D 4ZXPA 1GPMA 1NLZA 2VDJA 2B94A 4Q3LA 2R68A 4GMKA 4MX8A 4HH4A 4E0BA 4J29A 4L1KA 2XEDA 5JBNA 1W5SA 4MITA 1FVFA 1A2BA 1XD9A 4IJUA 1GZ5A 2FPPB 2AOTB 4KN6A 4EF5A 1ZUIA 5BR4A 1OGIA 3KSMA 3DZCA 4J07A 1G59A 4MVJF 2QQ0A 4TQGA 2VUSA 4HS9A 4PO9A 2C5GA 2ZE5A 2D74A 2FZCA 3VDRA 4QARA 5AVTA 3LVQE 1I94B 2O07A 3EAFA 1B26A 5HDQA 4YCSA 3OCVA 2BHSA 1E2DA 4NHEA 1X7ZB 2V8OA 5C9ZA 1TLFA 1IN8A 1FLDA 3IV9A 1BDMA 4NG4A 2Z98A 2PDAA 5CW2A 5ER6A 2ZIWB 1ZL2A 2HQRA 2QZ4A 4OGGA 2LWIA 1H1TA 2OENG 3L0BA 4B9EA 5EHZA 1XCMA 3ASVA 3NB0A 1CTQA 2WW8A 3H42B 3O2QB 1MXHA 1RMYA 2EFDB 1I4OA 3A2MA 4C2TA 5HZHA 4G1UC 3C8MA 3ZY2A 1VM6A 1VPLA 2N1MA 5GADl 5CIWA 4K9MA 4P82A 3LHFA 1SKYE 1RYYA 1YFZA 1TKAA 3CRVA 3K70C 1QQAA 1RS0A 16PKA 1TQ4A 3DVSX 2C7VA 2G1KA 4E07A 3IVRA 4B43A 1PJSA 1IJFA 4FVTA 1PFWA 1E1CA 5C80A 3ZCRA 2QUKA 2FZGA 3UT0A 3PC8C 1ZI6A 3KPYA 4HDNA 4XWTA 3ZJ4A 4LF4B 4I19A 1YS2X 1C9NA 2ZPTX 1DBQA 2CL0X 2G28A 1ZI8A 4XVUA 4HZUA 3MTGA 1TEZA 1H6DA 1IG3A 4GT1A 1XF9A 4A36A 4QVIA 1DQYA 5I9BA 1NV9A 3UM9A 4UQPA 2P7IA 4ZOLF 3EULA 1CG6A 3QEAZ 3EQ6A 4TTRA 3EY4A 3NW9A 4PC6A 2PMEA 3ZUGA 1II9A 4OXYA 5BW8A 3BK2A 2LP4Y 4E11A 1RAGA 4R40A 1N3IA 4Q4JB 2R6ZA 1VQ1A 2PX8A 4FCWA 3FRJA 2I6SA 2YJTD 1Z9BA 1ZNWA 4A23A 5LP1A 1ZJWA 3G5UA 3DEYX 1B2LA 1NQ5A 1N1EA 3H13A 1ZCZA 3QE3A 4IIJF 5DEIA 3C24A 1GSAA 2JD0A 5J59A 3P96A 5DBOA 1WP9A 1HQKA 2AYYA 4JY7A 3H2IA 1F8YA 3GHHA 3EGIA 5IULC 2GJKA 2EKQA 3UK2A 3OJXA 5DBFA 3GQBB 5TT0A 2D1QA 2X0JA 4BMZA 1YCGA 5IZCA 3L7BA 1ZEMA 2QPAA 4BX8A 4EI8A 2QTBA 2XB6A 3FYUC 2X9VA 2OO5A 5ICFA 5D8DA 1Z4IA 1IN5A 2IU4A 3HGQA 1TXGA 3AHDA 3NO4A 2W6CX 3PR2B 3WYBA 4FGWA 1SXJC 2PVPA 1XCJA 4MINA 3T9BA 3EPLA 4BMDA 1SKYB 5DO9A 3RSZA 2JFXA 1T1SA 1U3GA 4FK8A 5LUBA 1QFMA 1X7HA 3GI1A 1O8BA 5KTTA 2IHBA 2CJXA 3M3HA 4G0QA 4G8CA 2W2KB 4DSNA 1B8VA 5BN3A 3J7AC 4F8JA 5D3MB 1HURA 4KI0A 3VXKA 3M4JA 1UBUS 1JL3A 2UZ0A 1BG6A 3PPWA 1UL1X 4RKYA 3ZGVA 3RC2A 5KTOA 3MWJA 3O4VA 1ST3A 1U8EA 2AN9A 4XCQA 3RRNA 1N2BA 4ZT4A 1U7PA 1CF9A 1DC4A 1NW4A 2NT3A 3N87A 2VFAA 1DAFA 3Q4GA 1R8QA 4G81A 4OV6B 3MWFA 1DBPA 1HV8A 1Y3BE 4CTNA 4OIFA 3HYLA 1BDHA 2E9SA 3F8SA 1QCDA 1LRLA 2GPYA 1TD9A 3F5MA 3QKSB 1E7WA 1PQWA 4MVJM 1XCPA 1JMVA 1M34E 2AC4A 5EMHA 3S5JA 4MPPA 3RFFA 3S7ZA 3SJUA 3TLCA 5ER9A 3H1TA 3LS2A 5BQFA 3QX8A 1LD3A 2ONCA 3PDIB 4DADA 5K09A 4HNAA 4GO1A 1J24A 5AO9A 1YQEA 5G0VA 2V6MA 3S81A 4OUKX 3W2HA 5FAXA 2CBGA 4M0FA 4DDKA 1U3UA 4BNNA 1ZN2A 3HEMA 3GLIA 4KR9A 1YZ3A 4RD1A 4CM3A 1GTMA 2LVBA 2RHMA 1BWQA 3NWJA 1QGOA 1ZVMA 2QLBA 4OATA 2GPJA 4OBWA 4DXDA 2C9YA 3PWKA 3RC9A 1SCJA 1G3QA 2A9FA 4NCIA 2JLQA 1GPKA 3CX6A 1M1NB 1TEHA 4OQNA 5K0GA 2P41A 1NURA 1D4AA 2VUHB 3FTDA 1UXIA 2MT9A 1QS0A 1L7QA 3FG9A 3NAZA 4B44A 2QMOA 3AEQA 1X1DA 2ZJZA 1Y5RA 3A1VA 1EGHA 3O31A 3UNXA 5H8WA 1IK6A 2ZUWA 2GKOA 1HDCA 1GQOA 2VKQA 3O0DA 3DR3A 4O8ZA 2P30A 4R6WA 4R41A 2LE0A 4RU1A 3TXYA 4COOA 5JPDA 4WJZA 5J1SB 1LRKA 4WK2B 4X8HA 4BBZA 3Q2IA 3ONVA 4E5VA 2OYCA 3TRKA 3RYIA 4WJLA 2AZMA 4ITVA 1ZGCA 3B6ZA 1NE7A 1PP4A 4Q1AA 3AV3A 1P39A 3E9DA 3WZMA 5CCXA 2GAIA 3G13A 3HJFA 2NV6A 2Q0HA 4G5QA 2CNLA 4PG4A 4RXUA 1O57A 4QOJA 3JW8A 2FSHA 1U90A 4IILA 4XDYA 2NTNA 1I6MA 1UOPA 3BE6A 3DYIA 4G89A 2CMGA 2XT0A 4RS3A 2P6NA 3WRXC 3GLRA 5D6OA 5HW0A 5J4LA 2XY4A 2QE7A 1GNQA 2OCGA 4MAAA 4X92A 1E1MA 4M76B 5EQJB 5C3UA 3PA6A 3WDLA 4FHDA 4BZWA 3QHQA 4PPFA 3REOA 4E51A 2I9KA 3VU1A 1JG6A 4JYAB 1UMDB 3SC6A 5JI2E 1YR7A 3UGJA 1KQ3A 1DJLA 3TTSA 2VT2A 3PNOA 1BWSA 4CCSA 3LD9A 3A04A 3NM5A 4JA0A 4L51A 1YVPA 4B7XA 2APJA 4NXMB 1TC1A 1WSDA 4R16A 2KYRA 5EXPA 1PR3A 1FDWA 4DR7B 2AF4C 4M0MA 3ESYA 5K6TA 3W6ZA 1QRTA 1AXRA 3D3KA 1WNTA 4I9UA 4YHHB 5JD5A 2YN2A 3BMQA 4PRZA 3BMCA 3EXEA 4PSDA 5KQRA 5H68A 2R1VB 2REOA 3K15A 3VJRA 3QEJA 1C9EA 5L4NA 5KYYA 1UK6A 4L72A 2X9QA 1E1RA 4UREA 4E30A 1XMIA 5T4EA 1V1RA 1WQ1R 3HA5A 3KJHA 1P2TA 3QRWA 3W9UA 3U7IA 3EJ6A 5JEDA 2AFRA 4WNIA 4LDQA 2UAGA 2NSLA 3KAPA 4CMCA 4PTLA 1PL7A 3ZCTA 1PT5A 1J09A 1HI9A 4X3PA 2C57A 1OKKA 4PAOA 5E7QA 4U7JA 5FEMA 1P91A 1E5VA 1S3SA 5DTRA 3PPXA 3PQ7A 4LA4A 1KDYA 3AETA 4MAFA 2A86A 3R5TA 3MCZA 3CEPB 5AW4A 4LE2A 2OB1A 1XHEA 1YQWA 2V6JA 2W48A 2FFRA 3ORYA 4U02A 4AN4A 4EGFA 4DMMA 2FYTA 3BMXA 1GPUA 1WHSB 3SE7A 4HYTA 5JSUA 2PYZA 3QE2A 2IYQA 3R8XA 3WYCA 1HY3A 2TMKA 5J1TB 3P71T 3ED5A 4RSRA 1GQ2A 3PFBA 1SQGA 4LWQA 5DT9A 1XPUA 2DSNA 5EP3A 3WBJA 4D82A 3PNSA 4DKXA 3O1HB 4OAPA 3HCOA 1P5FA 1EGQA 3IBSA 4S12A 5F21A 4C3OB 1KFKB 4OMUA 3AHIA 3CVXA 3V97A 2OK8A 1WPRA 3NETA 4II3A 1TDJA 1HNZB 4NULA 2VHVA 1NQXA 2DPXA 2CK3D 2CCKA 1U2PA 2FPKA 2NO5A 3M49A 3MTDA 1ONNA 1RYNA 1T9CA 1BEUB 1Z08A 4WOCA 4DUGD 3CVWA 3LM8A 4DNXA 2QMEA 5BYKA 4GNKA 3GJSA 1YS4A 2ST1A 5KVSA 2IUUA 1RXUA 5LDDC 3N2EA 3WGQA 1RVDA 2BTOA 4UM9B 2IS4A 2VR1A 1UC9A 2P9CA 4BTLA 2QX4A 3OWHA 4F5WA 3CQ9A 4YJHB 1MO4A 4N4AA 1MAVA 2JZNA 1CERA 3DTNA 3PGLA 4G5XA 4HAIA 4V24A 2I91A 2J59A 3K0FB 3K2BA 2K2WA 4J0JA 5DYTA 5LLSA 1TM2A 3TVDA 3W3ZB 4RF2A 2RGCA 4JJ4A 1F0NA 4QNRA 4XX0B 1C3LA 2N3ZA 2CJFA 3QVKA 2VPPA 4KC0A 4MWBA 1AXEA 1QQBA 4NI5A 1EXNA 3LUBA 1F2UA 1YJ8A 1NBIA 4ZODA 3LIIA 1T3HA 2FG7C 1K27A 3LUDA 5JYCA 3QVWA 2GEDA 1TCAA 3DKRA 3F6SA 1A77A 1BX3A 3PHIA 4B79A 3AILA 1LSJA 2KLBA 3PENA 5KNDA 2FA9A 3CH5A 3K1YA 1JYFA 3PLAE 2JG3A 3JAKB 1B6TA 4DREA 1WXEA 2XIJA 2GN8A 3I09A 3WNZA 1IL0A 2IH5A 5DRTA 1QGAA 1BKYA 1RXIA 2PU5A 1PFVA 4YAIA 4PRYA 1C3XA 3MD9A 5E3HA 2PBLA 2X8WA 5AI4A 3CLRC 4G0PA 4K9LA 3MCUA 4H1UA 3S99A 4EF4A 2IYWA 3CBGA 4MUXA 2H11A 2DPMA 3PEWA 3QLUA 3AKZA 2ZCUA 2IYPA 1IY1A 5DI3A 3I9NA 5KSWB 1M72A 4J3NA 4ZQCB 1KWKA 1G5IA 3EWAA 4UU0A 3V1TC 4YAKA 4CLRA 3U44B 3B60A 5FPHA 3B5IA 4J0KA 4YV0A 4L4XA 3E9ZA 2VJBA 3WLRA 2HT1A 1ARZA 1GU0A 2VYFA 2VNIA 2VXYA 2PLAA 4IUBS 1JSLA 2WTAA 2AF3C 1BWPA 5IFKA 1YCFA 3JARB 3WA6A 4HDRA 1TMOA 1YRQA 3HJNA 2J0SA 3UOWA 4M8LA 4Q3CA 5TGTA 4DG9A 1WVMA 5EUQB 5AXDA 3KR1A 3TWOA 5KQMA 4O2BB 2ZTHA 1GUZA 1RRKA 2F64A 3FUCA 1QC5A 3CW2A 5H3CA 4G1VA 5COBA 5IAGA 2X0DA 3AVXA 5KNDH 3W6PA 1LPAB 5SY9A 1MJHA 2OAGA 1TJ5A 2ZIFA 4HUQA 1DKOA 3R3JA 3U4CA 3QFCA 2JCGA 3QUCA 4N5IX 5CX4A 4BKQA 2GVZC 2XI4A 3H7IA 5MHTA 1KP2A 3T0GA 2EF1A 3QPUA 4D80A 3ESAA 1E9EA 3MTJA 4H7JA 4FB5A 3BFVA 4K40A 1GNVA 2QTRA 1PYDA 2ECFA 1RP7A 4S24A 2ZYVX 3LHKA 1PV1A 1X2BA 1RKBA 3MIZA 4Q9LA 1BJKA 1POXA 2IXBA 2O57A 5HGXA 3WDSA 1LRJA 4ZYXA 1D8AA 3IR7A 3GJRA 3CRQA 4JBNA 4MQLA 3V00A 4BMYA 1M2OB 2BDUA 1PGNA 3FCSB 2CXOA 3B1VA 4CKCB 5LZ7A 2FSVA 2AXNA 1ULUA 1GTG1 1XRPA 3BDIA 3BCRA 1RM5A 1U02A 4RMNA 3W1WA 4K0RA 2O6HA 4NIMA 4CNQA 2F3QA 2XCUA 4EGJA 4JUAA 4MW4A 4C0WA 1EUCB 2JIBA 2XLCA 2ZVDA 4BGIA 3CUUA 2WQ7A 4ML3A 1D0VA 1VGRA 3IJPA 3N8GA 5CT9A 3SI7A 3ZDYB 1MHPA 2HWUA 5GGXA 2D2FA 2QPOA 3JWEA 3RO7A 1APBA 4QPNA 1OBFO 2BFEA 2Z58A 4DMKA 4DV7B 4PIPA 2B8JA 1NVUQ 1V8FA 4JEHA 1TAHA 2V4MA 1SUBA 3TJZA 1Q91A 1UJ6A 3BWCA 2GBGA 2YJ6A 1NKVA 2ZIUB 3UANA 4ARBA 2ROQA 3KIPA 1LBEA 3OE4A 4BLTA 1QGUA 3T7JA 1V11B 5FWXB 4XX1A 3RRXA 2NGRA 2WB4A 3KP1A 4D2IA 4DA0A 5TQ0A 4R3UC 5A3VA 4X7MA 3ZN2A 1RP1A 5J4HA 1XLTC 2JRCA 1R5JA 4V3CA 4K81B 2F4NA 1X38A 2P6MA 3GLVA 3TD6A 2ZIAA 3GOQA 1F3LA 5BSKA 1IDOA 1K5GA 1KERA 2VDVE 4L07A 3U6KA 1K8ZB 1NP6A 3SBEA 1JPNA 1OLSA 2GAAA 1KYQA 2ZZKA 2E87A 5DK6A 1YC5A 5FO0A 1O0CA 3VPDA 4MRNA 1MQ8B 3EVGA 5T3YA 3MT0A 3VAYA 4YRKA 2VNAA 3GL9A 2JAUA 2Q4DA 4ZV4A 4EA7A 2BMAA 1BCRA 2QM3A 4IZ6A 1KZYC 2WNHA 1JDSA 1G64A 1MO6A 4MW1A 5DBHX 1XPOA 2HN9A 2JJ2A 1PFQA 3FW1A 2FWJA 5DLYA 4OFZA 4C04A 4IDFA 3AR7A 4QGFA 4U7FA 5JAIA 3F8TA 1SUCA 2DYKA 3PL1A 4U2CA 5FI5A 4A8JC 5HR5A 1CZHA 4TUYB 2ZWPA 3F6YA 1LBTA 2C2GA 4M1ZA 3AG5A 4K6CA 4ODIA 1RAAA 3ADDA 4FFBB 2B7LA 3PD7A 3QITA 1A9YA 1E3TA 2FKAA 4Z7QB 1OPRA 1KZ7B 2WFZA 3N05A 2VCHA 1I3LA 4IEFB 1Z82A 2QMHA 1FDRA 4XPIA 1Z4PX 1ABBA 4C01A 1ORRA 4DANA 3MUNA 3RABA 4YMLA 4NV0A 4HR7A 2HADA 2Y3IA 2R4TA 3L40A 4HMPA 4RY9A 1XIVA 3QW2A 1JI3A 2BRUA 5M04A 1K8QA 2YIJA 3FUWA 5DI9A 2ATXA 1Y5NA 4IGFA 1SO8A 5DNEA 4ZD6A 3V7UA 2PAFA 1Y6QA 4U2FA 1H2RS 3SXUB 3A6HA 4CMGA 3O95A 3MIIA 3LBYA 3G6KA 1PU2A 4JAVC 4RESA 1OROA 1PT6A 2WIDA 2XVZA 3JYLA 4MVYA 4NDAA 3LBIA 3WMGA 4BPRA 5CFNA 3O3CA 5GY7A 2XXBA 4C7OB 1K98A 1ZD9A 5JXGA 3LBAA 2ZE7A 4GM1A 4MJ3A 3KJZA 2EIHA 1AN9A 1N57A 2HY7A 5DMXA 4DLWA 1TTPB 1W34A 4XM0A 5I7VA 1JIUA 3NDIA 2CDRA 3OMXA 4IVNA 4I5IA 4QJIA 5D84A 1L1FA 3SS8A 3I9FA 1WMEA 1XFDA 2AJDA 2CDAA 2EZTA 2VA8A 3I53A 1G20E 1KO5A 2ZRGA 4KDEA 3DE5X 3OI7A 2IOFA 4X41A 3V4FA 3MSCA 4R7GA 1X1AA 1CLUA 2WJZB 1NMYA 3CLVA 3O83A 1OWPA 4J0QA 5CR9A 1TJ3A 2CVOA 2Q3JA 3EQZA 4QIHA 3CUKA 2YYSA 5IXYA 3UAGA 1ZD5A 2E48A 1G8KA 5CLGA 5CG1A 4PR0A 2GPWA 5BWOA 2CNNA 2D2IA 2PWBA 1COWD 5KWVA 5IAKA 4Z4FA 4MPJA 1L7BA 1V5FA 3GCWA 2UVQA 4MCIA 3RQSA 1D7AA 1F48A 2H92A 5K0FA 3S6JA 4U2BA 1PJ3A 2FPUA 2VSFA 4KN5A 3TSOA 3UAZA 1T4MA 4D81A 1X8JA 1JDZA 4ZPJA 5LBUA 3E9RA 1XRLA 4RC9A 2QTMA 3MYYA 1FFXB 1OJLA 1N3YA 1NM5A 1SXJE 1Q0PA 1T9HA 4DAEA 4J7AA 3TUZC 2B7CA 2WIBA 2B6HA 5AR1A 4H6PA 3K70B 3FNRA 3S2EA 4G56A 4F5YA 1GEGA 2DPLA 5FWAA 5DSTA 1B15A 4C07A 1U65A 2I54A 1LDNA 3PGXA 3MWDA 4QKQA 3NMUF 2F9FA 2D1TA 1G2QA 3CGWA 1TU0A 4FDVA 1T6ZA 4G9BA 4MRAA 1T3SA 1OAOC 1UKAA 4TYMA 4ZDJA 1FUUA 3H83A 2YZ7A 1E3JA 3I61A 3O8CA 2E55A 3TJMA 3HB7A 3JU3A 3T1YB 1MO2A 3E5RA 1CY1A 4BQQA 1MJGA 4CM8B 1POWA 1WUHS 3U6BA 4P81A 2JKYA 4BTVA 3ADCA 2FXIA 2YC2C 1K7XB 1ETUA 3BA1A 5FLEX 3U61B 2Z1NA 3ZE8A 4MGHA 3I6YA 2CCJA 1STOA 1FRNA 1G20B 4YJKA 2AHRA 6LDHA 4N6NA 1N2ZA 5FWYB 4O25A 1P45A 4KIGA 2QGZA 2XNDD 2NP7A 2OV1A 4DAOA 1HRKA 1M73E 1NBAA 4BHTA 3THXA 4QULA 3NHJA 2Q6KA 4REQB 4KQWA 1EK6A 1F2TA 2KMLA 2AT1A 3QE4A 5A4KA 1RFLA 1A9PA 3GVCA 2ERXA 3F67A 3L43A 1TTTA 3G0IA 3GMIA 5HQ3B 3TTWA 3NDBB 2AK3A 5LL6P 1XWFA 4J1NA 3V1MA 2VWPA 2WPDA 3BH6A 3C5HA 4YRTA 4BL5A 5CLFA 5HILA 3JWGA 3VTFA 3TMAA 4G0NA 3MLBA 4CETA 3QVMA 1EI9A 4YAGA 1N8SA 3FYUB 3U1BA 5T67A 3IUJA 3LH5A 1RHKA 3ESQA 2ZT6A 1BWRA 1SXJB 1U9JA 1D07A 1X8XA 4IIXA 3U3XA 3GUHA 3W5JA 3WBFA 2TECE 4KXVA 4MOWA 3BDVA 1O4VA 5IH3A 4FGKA 5GOTA 3MT9A 1ZQ9A 2EERA 1ULAA 2PKQP 2XMZA 4HN9A 2JEOA 2V54A 3W5DA 4QUGA 5D3KA 3ZK7A 2FQQA 4HH3C 4YLYA 1KI7A 2HA7A 3CMMA 4IL5A 2GA8A 1L4UA 2Y1CA 4M83A 5IEJA 1U8CB 4O08A 4RF5A 2W6OA 4EKDA 1REQA 2G7MC 4JDUA 5HF6A 3HCPA 4CG2A 3HU5A 3ASYA 1JHZA 1H0SA 3LCVB 1I7PA 2ZBVA 3FNHA 2JCSA 2P4HX 1VMAA 4FYMA 4KPFC 2RH5A 3U7GA 2XUDA 4FXOA 3JPYA 5BSRA 2I3GA 1J22A 1JFFB 1CS0A 1N1DA 2JFUA 4WUVA 4EHFA 4B8ZA 2CMHA 2VEDA 4QO8A 4DVJA 1N2EA 3UUEA 1SG6A 1FP4A 3EMDA 2ZBDA 4NK5A 2MHCA 1SBTA 4HDKB 4YRRA 4P7FA 1W25A 3F6PA 4IQFA 4YONB 4QYIB 1A2OA 3NM6B 2PR2A 4IVQA 3MWGA 3ROQA 2VPXA 4YMTA 2JAPA 1NRIA 1MABA 4CQNA 1AF4A 1FYFA 3ZV5A 3OQHA 3WGIA 1BMDA 1KR5A 5HIJA 2Z4TA 2H2HA 1QKIA 3CUSA 5K0BA 4K0KB 1OIWA 5HNKA 2DWCA 2BGRA 2WFMA 2BFDB 3VH1A 2CLLB 2QD5A 1FTWA 1Y4SA 3PJFA 5ARBA 3MRSA 1QSGA 3C4VA 1OMOA 1SZCA 3HCAA 3KKNA 4Q9HA 1IIBA 4DRZA 3OQIA 1VIYA 4BKUA 3ECAA 5P21A 4BO6A 2FN9A 3L8ZA 4YACA 3WX0A 2V3WA 4D8TA 1IQ0A 3K9LA 5B12A 2XUKA 3KUCA 3NAMA 2I03A 4L7VA 5ED0A 2PA0A 4G2NA 3UFXA 3X1ZA 3KKOA 3RFUA 1AE1A 2IZ6A 3AI1A 1FDOA 5F5NA 4EUSA 4QBHA 2OBNA 3H2YA 4ARAA 5I6DA 1RRGA 2GRAA 3OZGA 1H8HA 2WICA 1NJGA 1KHHA 3LK7A 5K9ZA 3SIXA 1C9YA 4UM8B 3I9KA 4LK3A 5JSYA 4JQYA 2BKAA 4MPRA 1IY2A 1R64A 1E18A 2ZT5A 2ZROA 1HZZC 1V71A 4ZU1X 3RS7A 1L8AA 3IT3A 3VBCA 1R6AA 3OTQA 4CCAA 3BJZA 1WLSA 3GFGA 1XCGB 4MKGA 5T4HA 2CZCA 3PQCA 3LHDA 4RIFA 3ZR4B 1NJ6A 1TK9A 2VP6A 2QTCA 2JAWA 1L4MA 3N76A 1GPJA 2CDCA 2H7YA 1CKEA 4JUDX 2BCEA 3WKDA 4BNJA 1YKGA 2PO5A 3E22B 2X6RA 4RAQA 1RPNA 4C4PA 4PSVA 3CH4B 4X5OA 1LLQA 3QJ5A 3LDHA 4ZARA 4A5OA 5JAUA 4FM9A 2YZGA 1N4AA 3RYFA 1ZM2A 2EX1A 4G9EA 3SGLA 1A50B 1DC8A 1SCUA 1GUYA 3BXOA 3K31A 4BS9A 1Y1PA 4ZJYA 3VR5D 5K8CA 3WLOA 3GT4A 3OPQA 4MKRA 1NZDA 2YWCA 4XIFA 2Q4TA 4IQGA 4D4IA 3H65A 1Z22A 1RWWA 5L45A 2AOUB 4QGAA 4HSGA 2W0SA 2X5NA 3N6RA 2IYOA 3THRA 4YJ3B 5ECDA 3SR4A 5GMOA 1V3VA 4P22A 4Y2RA 5JSKA 3X0DA 1IMJA 2HAEA 2DLDA 4NAVA 4PXYA 4J0HA 2VTBB 3ZQ6A 1QVVA 2PWYA 4G5YA 1YBVA 4F45A 5KVCA 2WE7A 3K9WA 2XXAB 4X24A 3EUFA 1Q11A 3FFTA 3ZZ0A 4IFTA 4DEXA 3OPYI 2DERA 4JGBA 3U2QA 4JP1A 2FSUA 4WW0A 2WJ6A 1XVLA 2CYAA 4CE6A 2J08A 4TZ0A 4OH1A 1GGJA 4GPAA 5A03A 3LKDA 4PZPA 2DQYA 4EJSC 2PZFA 3MBIA 4EO4A 1S96A 1V4VA 3O5AA 3R3UA 1BRTA 4O5OA 4Q37A 3KEQA 3O82A 3QSGA 2DQ4A 2WHQA 3CF4G 1ZSYA 3MAAC 1YHYA 2II6A 4TTJA 3RF6A 2E1PA 2I65A 2NNWB 1B73A 2YJ4A 3AF1A 1C1XA 3K7EA 5EJAA 4DIOA 1IBLB 3D9QX 4LJLA 4TWAA 1AH2A 2IHYA 4D3DA 3LLMA 1V45E 3PJGA 4I66A 5E9AA 3WNVA 3HL4A 2I62A 2HSJA 4YALA 4X90A 3ZYZA 3DOUA 4NABA 3OIUA 4EVIA 2BM8A 2D6FA 1D9ZA 3DHVA 2IYUA 1SCKA 4WKOA 2EGGA 3U7HB 5HQTA 1YVRA 1SVUA 3IVCA 4QICA 4PHTA 1D5CA 9LDTA 5JZMA 3G2PA 3E3MA 2VJDA 1B1CA 1CJUC 1O6ZA 2CXQA 3KTDA 4GP7A 4QYSA 2B83A 2GD6A 2OFWA 1X1CA 5DOVA 1AKEA 1JTFA 3AF3A 1DS6A 1K8XB 1IUKA 3ES9A 1S2GA 4HXEB 4X20B 3TRIA 3RIHA 1ONPA 4P4TA 1C3OA 2FPXA 2O52A 3DC2A 1I1HA 2Y1XA 3IBGA 2FOLA 2FHPA 1YS1X 3SD7A 4KXQA 3WK5A 3FHJA 4MV7A 2I3ZA 4ZT6A 3L6UA 3O6VA 4L9SA 3SVTA 2A5YB 2AN4A 4PPYA 3BL5A 3OP4A 5CLQA 4DARA 5IPFA 1JILA 4MUNA 4DLTA 1HTTA 1OBCA 1TEXA 1J0BA 3FYHA 1KL7A 2RK3A 4G09A 2C5LA 1YIDA 4IHJA 2FWAA 3RHFA 3A4NA 2J0UB 1XZNA 2D8AA 2PWPA 3KAJA 3QE0A 1Q7TA 4RY0A 2PVSA 3IBFA 1G8PA 2ILVA 4OH7A 5C7LO 4TZ6A 3DE4X 1OJ7A 2VUUA 2ADOA 2HGZA 4MVJE 3K2IA 4JHXA 5ADVA 3U4QB 4KVFA 4I14A 4RFSA 4DA7A 3BF7A 3MM4A 5EINA 2OLKA 1RHQA 2JRLA 2Y2VA 4NFHA 5DK4A 4IV5A 4Z4CA 1YFJA 2RBGA 1W46A 1LFDB 4DLVA 3EVEA 1GSHA 3F3KA 4ALLA 3SX2A 1DC6A 3VO1A 1EPUA 4U2KA 2WYOA 1Z36A 2IU3A 1MG0A 1SURA 2OR3A 3EYAA 4QJ4A 4YVFA 5ARDA 5KZMB 5MFPA 4OHRA 1XTPA 3P5SA 2CLEB 4PLZA 1QE3A 5KINB 2HU2A 2MSNA 4YCJA 2AG0A 5HIMA 1YMUA 1I4WA 2FPIB 3D4PA 1EVYA 1VKOA 2E4UA 2EGUA 1O87A 3DDUA 2XTMA 3NIGB 4M7RA 2A2ZA 4NCNA 4BZXA 3QVXA 4TL8A 3HO1A 2R65A 3M7IA 1JG4A 1H8EA 4C2BA 5L53A 3VC3A 3RUDA 5JYEA 3A6KA 1XAIA 2HUPA 2JDID 3P9XA 4XFKA 1IAQA 4EJ6A 1RCTE 2R87A 4Z5XA 4XJSA 1NJSA 1RKQA 1X6VA 2HTFA 4JGGA 5F33A 5IS2A 1O97C 2ZSBA 4EAAA 3BKXA 3GJZA 3NOXA 1OFGA 3ZE7A 4D4GA 3OZIA 4TL9A 3AHJA 4YIKA 4M38A 5CX1A 3EMVA 1Y3DE 3FDJA 4BLWA 4C21A 4B3SB 2BGGA 2B1IA 1T5LA 3U7JA 3L8FA 2JLSA 2ETVA 2BC9A 1W5TA 3RARA 3T38A 1F60A 4QFMA 3LKVA 1IM2A 1A8PA 2P2YA 1A4IA 2JFQA 5EIHA 3KSZO 3CKMA 5DLPA 4Z8YA 4BFTA 4JI8B 1MVLA 1IHUA 3JD1A 3R0VA 2ORYA 1CUCA 2OORC 4JLOA 1ZOPA 2J85A 3DEJA 3G23A 3FJ1A 3GLGB 1R1DA 3GDFA 2A33A 4DM4A 3OVMA 2R48A 2A9RA 5C5IA 5BR1A 4GGOA 1G18A 1JFRA 4NH4A 1GO2A 1KAQA 3OUTA 3UW1A 4LJ5A 5BV7A 1E2EA 2A0KA 3SN6A 1IRIA 3JQEA 1VMDA 1J2TA 4UNNA 3TX6A 1I1QB 4YDRA 3V8VA 1E9AA 1VA5A 1W75A 2C8KA 4IG4A 4BN0A 4E2FA 3TBFA 2WHPB 5JD4A 1X13A 1EFCA 3ZTTA 4L78A 4E94A 5SICE 3D2AA 3OX1A 3DD1A 4RJJA 1TRHA 4C76A 3PL5A 1X9GA 3JVEA 3T7SA 4WBNA 6NULA 4Q18A 4WK6A 4F06A 3QE9Y 5AW6A 5HTOA 3F7NA 4QGBA 4WXHA 2FJPA 3JRNA 4ZEOA 5CLLA 1M6VA 3D5QA 4EFNA 1V39A 3GJXC 5FULA 4MP3A 2Q6VA 1PGQA 2X1HA 3OF3A 1M9NA 1SC1A 1WPQA 4LJSA 5GV7A 1VBMA 2X9NA 1T91A 3BGIA 3QMPA 3GLQA 4CVNA 2Z2KA 1ZBQA 1MQAA 2P1DA 3L7YA 3PVCA 2CE7A 1LPBB 4H3VA 5JLAA 3DLHA 4D25A 4AF6A 1TW2A 1Y82A 3HDJA 4HB2A 4KN9S 1QK5A 4ZOLB 3WKAA 5C37A 4CF7A 2K2QB 4ENSA 4Q7EA 4KG7A 1U8ZA 2G9ZA 2D06A 1N2XA 3HJUA 2ISSD 4ROTA 3H75A 1DMRA 1R3UA 3N2GB 1U2TA 5A6SA 5I7RA 1CVIA 1OLOA 3EFHA 4AJIA 1AV6A 3AQIA 4CR7A 2RE8A 3NKVA 3SLRA 4BNTA 3ENVA 2QYTA 3GGCA 4IIJB 5DX1A 5D85A 4A8JB 4BRZA 1G8SA 1OPXA 3WMXA 3VTAA 5A4DA 1CJVC 5A4JA 4DV0B 1JG7A 2QVXX 4DLYA 3SYTA 2WZDA 4CV0A 1MEOA 2B21A 5FHQA 2I80A 4KR0A 3ZGOA 5EG5A 4KQJA 1O0BA 4FSXA 3Q3VA 3RPEA 2GTIA 3STXA 2JLBA 2XGOA 2YMLA 2J9FA 3ITNA 3RVJA 4X65B 3PIDA 1YRYE 4YWJA 4WRRA 1MEJA 3K6SB 5E2IA 1YB1A 4ZOCA 3GLSA 3K6SA 2P2ZA 3P8ZA 4AP6A 2DWUA 3O8OA 3L4BC 3FKSA 2B2CA 5IM4F 1LFAA 4XOUA 4ZO6A 1QOPB 3DGEC 3TI7A 5CNKA 1P29A 1BXRB 2RH8A 4X8MA 1JMKC 4E2XA 5EIOA 1FCJA 5J2TF 3G3EA 2HHCA 5IP5A 2R0QC 2OE2A 1HDRA 2P2NA 3ZXSA 3KXPA 4KGZA 2EHDA 5BSWA 1II8A 1O5OA 1NI4A 2V7GA 4G9GA 1RJ9B 4IIVA 3QBJA 1NC1A 1YQQA 3OZDA 4QECA 2ZKIA 3TIGA 5CDFE 1ZU4A 2NU8A 3MJSA 5A7HA 1GTJ1 2XCOA 3DZ8A 1NSYA 5TPZD 2ZT8A 5FNZA 3I5XA 5A4FS 4NX2A 3BRCA 5EGNA 5GIOE 1GD1O 2OWEA 2JBWA 2PMKA 3OAAA 2G25A 4EW6A 1KZ6A 2NU9A 2RHDA 5CM9C 5FNVA 1XRQA 1M0TA 5CBPB 3HACA 4MV5A 3BB3A 1IZ9A 1TPYA 2NADA 2PSFA 1C9MA 2XSZA 3F3YA 3LC1O 2M1ZA 3Q3CA 3QX7A 4I6JA 3RBAA 4YUYA 5CEEA 4RHEA 4EARA 5JROA 2WM8A 4O4HA 2Q3FA 2JIQA 4IY1A 2PKWA 4LMBA 3B2NA 1G3MA 2BOVA 3DMTA 5BSMA 1PKEA 3ID6C 1OWNA 1WWKA 1Y7PA 2POCA 3AEUB 4YUVA 2DLCX 2HIMA 2HXYA 1WXQA 1WR8A 2HNAA 3EVFA 4HH1A 5JNUA 2OXFA 2NZYA 3F78A 3JSXA 2X22A 3AVOA 5LVAA 2QYOA 5AKGA 1G7RA 1U6JA 2BPOA 2C99A 3CX8A 2IT1A 4F84A 3RK0A 4AT1A 4BMNA 1DQPA 2W00A 1I6WA 4ETIA 2ZZMA 1W6UA 4JZKA 4N0DA 1PBTA 5FD8A 4B87A 5MGNA 2QE6A 2PO7A 2OHFA 3ZIAD 3SU8A 1JXMA 4BJHB 1G9TA 1J8VA 5IHXA 5JJIA 1C9DB 1PR9A 3ZGXA 4IR7A 3GFTA 4QTTB 3PWSA 1J70A 2O1EA 1ZOOA 4YX9A 3BWDD 1I3KA 1KH3A 1LSSA 1RQ7A 2ZYGA 3A37A 2O8DB 2XR1A 4CDGA 3A3YA 3WHPA 2ZTSA 3S2ZA 3TOCA 3K8OE 3GUYA 4I7EA 3IC5A 4K8OA 4Z4EA 4EP1A 2ZJ2A 1XZHA 2BD0A 3REGA 1QNFA 3WLMA 1QWOA 2R97A 2O6LA 4LF6B 3OZEA 4FTWA 3GQVA 3WQRA 2O7RA 3BH0A 4RXTA 3G02A 3N70A 4A16A 3S1AB 2JIMA 3DDZX 1V16A 4D9GA 1PGPA 1XZGA 4TTQA 4FFOA 2O0KA 2FZWA 3PRKE 4PYIA 4P0PB 1IWOA 2EWWA 3HWWA 3BVPA 4AURA 5L3SB 1KZGB 2G1UA 2QSYA 3FXAA 2VRNA 1N6RA 2R84A 2OO5C 3QEKA 3REQA 2BGMA 2Q49A 2Q9BA 4B5LA 2EX0A 2OZVA 2OPHA 2GYWA 1ND6A 2ODWA 4K9DA 5DM60 2XUQA 4XD7D 4P08A 3K9HA 5JU6A 1NI5A 4ZJPA 3R4VA 4QYXA 4YJFB 2P27A 3C6ZA 2I6TA 3C5CA 1CEXA 1L5RA 1XEAA 2CVPA 4MI1A 3PR1A 4JZYA 3T5TA 3OT1B 3ZK8A 2YXBA 3A1WA 1W96A 1NBEA 4NBTA 2QD3A 1UZNA 2D2VA 2VA9A 2XDYA 3IP8A 3GP3A 3O2JA 2JIRA 4UFNA 4Z8XA 5KO2A 3B70A 4GQBA 2I4NA 3ZWCA 3QPVA 1HDIA 2CB0A 3BREA 4UJ5A 4JN6B 3DEKA 1YR9A 1P3DA 1ZW6A 3NNSA 3ZS9A 1XDUA 2LGJA 1NU8A 3R3HA 1OFVA 2WK1A 1DU4A 2H17A 2O3TA 4QNNA 3H5NA 5DXAA 1J0AA 5KJCA 2JAHA 5GVSA 4UTVA 1ZINA 4KE7A 3I9LA 4ZOQI 1TKBA 4UQOA 3OESA 4KX5A 1AUVA 2WSLA 3FDZA 4LXTA 1WSWA 2NVOA 1SD1A 2X0EA 1UANA 4A27A 1OTXA 1P62B 3EIXA 3DL7A 3JZIA 2FPRA 4IEEA 1FFEA 1NL3A 4R0NA 4U6QA 5AKYA 4QFDA 1UCFA 1PE0A 3AUFA 1XZ8A 4U7TB 3V1NA 3WQQA 1MV8A 4J49A 2CJYA 5IDQA 2JFPA 2XWBF 1AN0A 4A8HA 5I7AA 5JSHA 3TRFA 3P9NA 1QO0A 2O05A 5C46F 3INRA 1N6IA 1Q21A 4K03A 2QSZA 2E21A 4DMCA 4GC9A 2GEKA 1NT4A 1TQ8A 1CR4A 3L01A 3JQBA 3QOFA 2X1MA 1J23A 1Z4LA 3GVHA 4GI2A 3WK4A 2XEXA 1L7EA 3CM0A 2FRVA 1XVTA 4I0WB 3LL4A 2PXCA 5LZ4A 3A70A 2VP9A 1NONA 3RVDA 1ZK1A 1MJ5A 3WYDA 2IYEA 4OLJA 2BTQB 3BGVA 2ZUCA 1G19A 4UD6A 3T7DA 1UQTA 1ZC3A 3DBIA 1HDZA 1WTAA 2Q21A 1QX4A 4KDCA 4W6QA 2O8FA 4F9GA 4H59A 1ODIA 1EGAA 2WA2A 3D1VA 1U3DA 4OI0A 5CIQA 1BXGB 3SJCA 1TF7A 1GTL1 1K0UA 2HSGA 1KI4A 2VDKB 2ZQZA 3IDOA 3LFUA 4O4IF 3LRTA 5K3AA 3RG8A 1Z6PA 2GHQA 2VSOA 3AINA 3GDGA 2NTEA 2QM8A 4I50A 5DTJA 2FLKA 1PGJA 4TSKA 1I80A 3NORA 4L9WA 4YYEA 4MUGA 2FJ0A 2KE5A 4ERXA 2QTFA 3CZ9A 3OQMA 1WE2A 1NNI1 3HR8A 1USGA 4M54A 3ND5A 5GVRA 2ARKA 2I3AA 1XZJA 2ZDQA 3DHNA 1Y6FA 1VKHA 4ZK2A 4BXOB 2OCDA 1M10A 4PE5B 5K6RA 1G8MA 1PJLA 5K0EA 3PYMA 3FUXA 3B9BA 3HXLA 2QVZX 3WK6A 2W8BB 2Q0XA 4AY4A 4PIVA 3O7MA 4M9CA 2E3JA 5IX8A 4ETNA 1QM5A 3TXAA 1DAHA 3E58A 6PFKA 4KRYA 2ZAYA 1ZH6A 1JV2B 3GAZA 1XI2A 3NR2A 1YOBA 2WT9A 4ZQIA 2CB9A 4C3UA 1CUDA 5ISMA 2R8ZA 3QPAA 2AS0A 2H3EA 2HWWA 721PA 1FC0A 1Y3IA 2IEZA 4YECA 5JI3E 3MJRA 1IJBA 2FZEA 3CIOA 1ADFA 5DN6A 1BGVA 4YCCA 3THYB 2UYCA 3GZJA 4EO7A 1MUUA 4U8HA 1USWA 3QVSA 4MJXA 5KDDA 4XYMA 1MC5A 1XZFA 5E7JA 1JE1A 3RT7A 2IYVA 2KS6A 4INZA 4A91A 1A1SA 4IIDA 4BV9A 3L8MA 5JCPA 1QRDA 1X9IA 4OHXA 2X6TA 3MUOA 5FOTA 1QHHB 2DFLA 2PGNA 1S9DA 2QIOA 4Y0AA 4V2IA 4BFLA 3CF6R 4A2PA 1M76A 2PUBA 3C3YA 1T2AA 3OIVA 1X7XB 2IBMA 1KEEB 2NVUA 3HKBA 1A98A 1YNOA 4UEWA 3SOPA 4FCVA 4EJSB 1MAUA 2HIHA 4ETMA 2QN3A 1FUIA 2GXQA 1E4YA 3R5FA 1YJCA 1LV8A 2ORWA 1ZM3A 1SQFA 2P65A 3BE5A 3P1JA 4LKRA 3DLTA 3AGQA 3ZZ1A 4CKWB 4CLHA 2W5UA 2ZBEA 1Q84A 3NWOA 4W5NA 3WQBA 4LV8B 3ZW7A 1PX2A 1GPWB 1ZRSA 5CFQA 3ZVMA 5AD1A 1NBME 2D13A 3FBTA 3H5LA 3OH8A 2G82A 3P9QA 1WV0A 1YQGA 2FGJA 1TUBB 1L4BA 2OC9A 4RY8A 1YS6A 3SC3A 4G36A 4AD8A 3PNBA 1DKNA 1N6PA 1I4TD 2WYWA 2YHSA 2RB5A 5ITSA 1MOQA 1YE5A 4JBLA 1KJIA 4MKZA 2IP4A 5CYFA 1Z3IX 3SLGA 5KMGA 2OXRA 3FR8A 1NFFA 1G8HA 1G5TA 3QWAA 4II7A 3WHLA 2W2MA 3UMJA 4DY6A 1CULC 3M82A 4BZQA 2VK4A 3PUXA 3AM1A 3ZE6A 4UMDA 2HPHA 5DCYA 3FTPA 3LUJA 3NUQA 4P4LA 4TLDA 3SKYA 1WMDA 3NC1C 5IKXA 4LZJA 3FGPA 3R3WA 4B45A 3F6EX 4U3JB 1BE1A 3BD9A 3T54A 1B42A 2F3TA 3ABOB 3KVOA 3ZHCA 1VI5A 1MVOA 1BFKA 2QMUA 2AZDA 5HRAA 5KAMA 5MN4A 1XTBA 4I4LA 1YBHA 1F2VA 2RJOA 2WHRA 3LBFA 1CDOA 4MMYB 2AKYA 1JKFA 1YR3A 3OCJA 4AUEA 2YOFA 4ZYLA 4JYZA 1MZPA 5DNAA 1EWVA 5ESWA 2R96A 2H08A 2EW2A 3G17A 1PUXA 3F9IA 4IVPA 4ZYVA 4WY2A 3CEMA 3GA5A 3MBOA 2P75A 2RAVA 2R47A 3SQLA 5HIKA 4CPDA 4M1QA 3TAXA 1UF9A 1LLUA 2W2PA 1T8RA 3PWZA 2C4VA 1MX1A 3U0VA 3EZLA 2X9GA 1CE8A 4TKZA 3M9WA 1EESA 4L5BA 1E1LA 1I2MA 2HH9A 1XGKA 3D6AA 3AIKA 4HQNA 4RE6A 4Y9RA 4D56A 4F21A 1D04A 3BFXA 5JISA 1XHLA 4K9OA 5FBHA 4OK6A 3PXAA 1J2JA 1OWLA 1SZJG 1W0JD 4OBEA 1H8HD 4ZQEA 5C3MA 2JW5A 3ZQUA 5A3QA 3FWZA 1RYEA 5AW2A 4HAWA 1ILWA 5C52B 3H99A 4BNIA 3CA8A 1KSHA 4PC1A 3K0KA 4JLSA 2DX7A 3MGBA 4R7ZA 5JNTA 3LWBA 4EUEA 5LU8A 3KJFA 4HKTA 1XEXA 2PMWB 3AHCA 4IDPA 5G1PA 5KTSA 1JKIA 3AY0A 1NC3A 3VPXA 2JZOA 2VXCA 3HNRA 2W6JD 4Y98A 3EQ8A 2XX3A 4OI2A 3JALA 2EL7A 3OPNA 1DELA 1M2WA 2I55A 1E89A 3KVVA 2J33A 1TZBA 1ZNYA 2Y93A 1FMTA 3BXXA 5DTIA 3IHKA 3LZCA 4E5PA 3HY3A 4EPVA 4DDWA 1M0EA 2QB5A 1XRJA 3TRHA 3IOCA 1VRCA 3I28A 1G8FA 3CG0A 3ONDA 5IT5A 2Q9UA 4N3CA 1ZOLA 4MW9A 3TG2A 1KI1A 2GF9A 1LLFA 3GAAA 1G5PA 3E9NA 4EPWA 4EYKA 3K1AA 4Z0TA 1UBMS 1VPVA 4IUCS 1P5HA 5JD3A 3CN7A 1CR6A 3LLVA 4L0MA 1JEDA 3VTKA 2I8CA 2JD2A 4QPCA 4H3SA 2PRKA 4LFAB 3FOEC 1KKMA 2QUIA 1GNTA 1PJTA 2QN7A 4U9UA 4UNPA 3KM0A 2GARA 1BMTA 4DHWA 1P0QA 3EQ9A 4B3DA 2XOKD 1FJHA 4YP9A 3L7NA 1NP7A 4AX4A 3P27A 3ZNOA 5H3HA 4MLZA 2WAAA 3BM5A 3K94A 3CNHA 3GEBA 3RKUA 3WAJA 3FIUA 1Y1QA 2Z09A 5H7XA 2VJNA 1RE0A 1SUPA 1EUZA 3Q7SA 3SWWA 4CMIA 4MWSA 3GAMA 2GQ0A 1RRCA 5FYQA 4KQFA 1GZDA 3DHEA 3HO6A 1F9AA 3K6KA 5BUQA 2BYTA 2AEJA 1HTBA 4NOKA 3EGDA 1M6YA 2I66A 4YROA 2YYZA 1C3EA 3LX5A 4BVEA 4JP8A 1UBLS 1NI3A 4WY8A 4IHJF 1FSSA 4Q3BA 4ZWNA 1U9CA 2H7XA 3JQ6A 2PMDA 3UMBA 3KB1A 1QH1B 1TIPA 4DWJA 3WGUA 5IYZF 3TW8B 1AUPA 3WGMA 1MORA 4G84A 1PJCA 4MWGA 5TLSA 4HAXA 2AZTA 2PUCA 2G88A 4DB2A 1JEYA 1QZZA 1D6NA 3C41J 1M2JA 2C61A 4AZWA 3NG1A 1D2HA 2AMYA 4RGQA 4YT2A 2PX5A 2VZ0A 3C7AA 2XE6A 2ZUSA 1I1OA 2HEGA 2P62A 2K7FA 3PNYA 4F9TA 1BS1A 2XIQA 3AM4A 3H17A 3JCZA 1LTHR 1DLJA 2WF5A 5IRCD 4C30A 3LUPA 1Q0TA 3OEHA 4PAMA 3RVSA 4TVBA 1I0IA 3LKBA 4TMTA 4R9VA 3WGVA 1SFRA 2ONZA 4W9RA 5JCJA 4F3CA 2AK2A 3QHAA 2A4KA 3G8AA 4ZRMA 3BWBA 4FLFA 3TGLA 3QTTA 1XZQA 4OMCA 2ERYA 1OUMA 4FLEA 2KQUA 1U28C 4BVLA 3C3EA 3VO2A 3K1ZA 1AKYA 4C7JA 1ODLA 5GINE 4JR2A 1ZCFA 1SOVA 3I5YA 3JQ9C 4EDHA 3VX4A 1G3RA 2HSWA 4C6SA 1MNAA 1IBCA 2COEA 2ZW9A 5AW5A 2WSBA 3H8SA 2LD4A 1USIA 2ZYWX 1U0SY 3CGGA 4L15A 4M36A 3V55A 1E9CA 1HT2E 4HRVA 3CURA 1KNXA 4CDRA 1YCHA 2L17A 1GKIA 1DOAA 5E1OA 2P9EA 3KWFA 4YRAA 3IB3A 1I4DD 2TS1A 2EF0A 6ABPA 3UPTA 5KQPA 1MGPA 1KPGA 1NOKA 3JAWA 3KOWA 3ZLTA 5KYGA 2EFCB 3WTBA 5KNBA 4QO7A 2I67A 1CY2A 3I30X 1VSVA 2GAOA 1O9HA 1UK8A 2H4JA 1Z6ZA 3QVUA 1QWSA 5CD9A 2QP3A 1Y1LA 2AE2A 4R1QA 5TSDA 2ZQYA 1C0KA 4W9NA 1J1UA 1M8PA 5EL0A 4U7WA 5CBKA 1IUOA 1O4WA 2BE9A 2GJ8A 2QHXA 1MW9X 3D81A 3N8NA 4X3CA 3PSHA 2AMVA 2WWVD 3FBGA 1GLGA 1CX9B 3R3XA 4I4IA 1Y3FE 2BCGY 5AKZA 3AL0C 3SQDA 4BAGA 3N58A 2AX3A 4OP2A 2OGZA 5SYMA 3OC6A 4V0MA 3V4PB 3GO4A 1SOWA 4DEYA 1C50A 5HVNA 2QR5A 3C7KA 2EBHX 5IARA 4D4LA 2ZRMA 3BIFA 3OICA 2VO1A 1BKSB 4MR9B 4PONA 8ADHA 1F8UA 1U5BB 1B6GA 3ZLVA 2BWJA 3WL8A 5EFOA 2QP9X 1C0EA 2VHTA 1J0XO 4S35A 5CUQA 1YF3A 3KOOA 4CMEC 4FD3A 1E1CB 5D87A 3EG9A 1JQKA 1J42A 1JJAA 1ST2A 2YCBA 3D0OA 1ISJA 4HDNB 4W8OA 5AWFC 5JO9A 3VC7A 3WYFA 3CF4A 1ZJZA 1N5MA 1UZAA 4HZUB 4MV6A 2QV7A 1PJZA 4WZAB 2Q3EA 2W71A 1E0KA 1Z5GA 1S8FA 4AMUA 2BZ0A 1M2EA 1E1QA 3RTDA 4E14A 3A27A 5EY5B 1NWCA 3NTXA 3RVMA 4RKWA 4KQMA 3ANMA 4UE2A 5FRDA 2I1LA 1W76A 1KVRA 1TVMA 2ECOA 3P9PA 4G23A 4JU8A 3ROTA 4DLAA 2VT3A 4Z1MD 1AGYA 1ZH2A 4JL5A 2GLTA 1YS7A 5EOVA 3UGQA 4NY1A 5A2QA 4ZGGA 1RBYA 1XMXA 1P4RA 3FZYA 4C7KA 2X41A 3GLIE 1IMOA 4BO0A 2XA1A 5BWLA 3HC7A 1DDIA 4KGXA 4CGZA 2FZ4A 3SZOA 4DPKA 4LE0A 3UVEA 3HJTA 2V0NA 3MTAA 2Q3LA 4FFDA 2GRJA 4Q3EA 4IIEA 4KSYA 3QV1A 4W8HA 1LH0A 3AXTA 2E5WA 1D9XA 1U04A 1DPGA 1ODCA 2H2AA 3R5HA 2ADFA 4PC3A 3QVJA 4NJMB 4DN6A 4F4FA 1D4ZA 4MAMA 4XLZA 5JNVA 2GBCA 2QN9A 4WPGA 2XUIA 4AZ3A 2IYNA 4F38A 4CG3A 4AQDA 4KSCA 1VL6A 1Z25A 2WSSA 4V38A 3SX0A 2H5LA 4HPXB 1WULS 4Q82A 2OV2A 4BUJA 4Y9SA 1Q77A 3RF7A 1N36B 1OLUA 3MTQA 4WEQA 2WR8A 1K3UB 2Z9CA 1SKAA 2GEVA 1ZP6A 1H0HA 1XELA 2QTVA 2YUIA 1Z5NA 1OWMA 2WKSA 1T5BA 4EEKA 1HPLA 4LVUA 1E3WB 2E1RA 2Z8YA 2AN3A 5B1SA 5BOSA 3X2EA 2FF5A 2R7AA 1KJQA 5GONA 1FA9A 3F98A 1IXRC 5FL7A 5AQ1A 2X7HA 2BZ1A 1E2MA 1NQAO 2Z2IA 4KFTA 1AB6A 1Z73A 5FNVF 5ADWA 2B82A 2HCBA 3EVDA 3EXFA 3A1TA 3NGMA 2WWFA 3PF9A 1IOZA 5EERA 3PICA 1D0IA 2CF6A 2Y2UA 4HNAB 1BOFA 1KAOA 1E5DA 3KQMA 3VUEA 4DGQA 5DHFA 5DXFA 5IG2A 2W2NA 2XGSA 5JNRA 3GLIB 3I32A 2Q1TA 2DR3A 1J9GA 3FB1A 4HX5A 4TXNA 3RUCA 4MZXA 5EYPA 3G9TA 1B14A 1CBUA 1FRFS 4L4YA 4WDQA 4EA6A 3RBVA 5IU6A 1RSZA 4MGZR 1U7DA 4OD0A 4UHFA 5CEFA 1E62A 4J6EA 5DGCA 3C6KA 2X5KO 3AC0A 1U81A 5PGMA 3C6YA 3GRFA 5HCIA 2AR7A 2CLIB 2VJLA 3A7EA 3FHLA 1XA0A 4QRHA 5DGIA 2PY6A 3FD8A 1X80A 4KAJA 1KVUA 1JLLA 1JIIA 3T3EA 4ZDKA 2HMAA 1KR2A 1R10A 1W1UA 3FCYA 4TXMA 1PAUA 4O2RA 2OCXA 1HKHA 1RWXA 1NJ1A 1Z2DA 2DWQA 2LNDA 2C3MA 2XGGA 3RYIB 2X8JB 1TYEB 1W48A 4HDQB 2FP3A 5JYBA 3OAAD 4OGWA 4X6XA 2GETA 2XYRA 2J6HA 4IRUB 1JBEA 3SJZA 2O8BA 3OHSX 4DA8A 3GEPA 1E9SA 3PJRA 2BI7A 3EUEA 2H2FA 1IHXA 3BTOA 2Q5HA 1GYPA 3D7RA 4XARA 2ET6A 4GPD1 3TB4A 4ZJUA 5BSVA 1XT6A 4YP5A 3CHYA 5DRYA 4AC9A 1A8UA 3KT6A 4Z7JA 1PR2A 1Z0ZA 4FMDF 4Z4IA 3L18A 5JJLA 3EODA 3FSRA 2IV7A 2DLNA 3DR5A 4FMBB 4YRFA 5HYVA 2ZFUA 5EUCA 3DKKA 3WDKA 2QSUA 2RKOA 2WIFA 2A35A 4FFWA 2QJTA 2J3EA 4WCFC 2R1TB 5KCZA 3JQ8A 1ZLXA 5AHWA 3U4HA 4EZIA 3DFUA 2XQJA 1N5OX 3PITA 2ZTMA 1W4LA 2XITA 4C0BA 2FW8A 4E3ZA 3EIOA 3G7NA 1JT2A 3SZLA 4E5NA 5JHHB 1MA3A 1QTIA 1FBNA 1TPZA 1XEWY 3F2IA 1E60A 3PNKA 3R75A 4F1WA 5KYYB 1J4AA 1CT9A 2O2YA 4ZMRA 3UYLA 4DDUA 1V1RB 4GWLA 2JGDB 2VJKA 4URZR 2WD7B 2YMQA 3OM9A 1ZBDA 4X8LA 1HK7A 5ITZA 2PBRA 3VH3A 5JT1A 2HLPA 3M6FA 3HXOA 5BSEA 1UC8A 1PV4A 1BFDA 1OE0A 4B0OA 3SBDA 5AW9A 1KWGA 3EXIB 4GPTA 5JWHA 3VYUB 4JLAA 1OX5A 5EPUA 3AH8A 2C88A 1Q3KA 3FF1A 3O4FA 4RA9B 1LNZA 2AH5A 3KYDA 1R6VA 1RYZA 3ZVRA 1X1QA 5IWCA 3OZTA 4DR5B 3KT8A 3LC7O 5AI6A 5IT0A 1PNRA 1IHYA 2C83A 2QUJA 3AYZB 4HX2A 1Q1GA 2DY0A 3BE4A 3EDMA 1RAHA 1IZ7A 1GZSA 1BSVA 1GG5A 1KO4A 1UXJA 2ZSDA 3ONNA 4RPCA 2QD2A 5E3IA 3UB4A 4O0MA 4EK9A 2PZMA 3EDQA 5EJEA 3IE2A 1QIEA 1U3VA 1UFQA 1Q92A 2WE8A 5E38A 5FR2A 5K01A 1LWOA 4EMSA 4I3FA 4B2IA 4CU5A 1YGYA 5C4MA 1UMCA 1TQDA 4RZXA 2PQ0A 5DBIA 3W2GA 1H1LA 5LDHA 3DPSA 2LCFA 2ZUFA 3KZKA 4YRCA 2TMYA 4CQMA 2ZEJA 1RI5A 3H2HA 2VWQA 3DO6A 3KCQA 2RHCA 2I2CA 4LSGA 5TGZA 1FFBA 4DBLE 1NRWA 3FZEA 4OX9B 3O92A 5AJWA 2ZOSA 1CQIA 4FOTA 5C7OO 1Q16A 3O9MA 3OU7A 2W9XA 3NHBA 3ZZUA 1NVGA 3I9V6 2QOEA 5J5VA 2FW7A 2WLSA 1YVEI 4OHBA 1P4HA 5U4XA 1FXSA 1VLVA 2QJFA 3JZMA 3KQOA 3KX2A 4I1PA 3IUSA 3LGXA 5DM2A 4F71A 4L6CA 1F2UB 3CZ4A 3LC0A 1N25A 1U6IA 4DCUA 1O6BA 4HMOA 4MCJA 1NYRA 1QG2A 3FWPA 1AA9A 4I5EA 4XSHA 1FFWA 1UAGA 2EP8A 2X3YA 5HK9A 4LOIA 4IZIA 4YT8A 1YQTA 4OMFG 2GEUA 2XA2A 2R8OA 1GNLA 1NXTA 1QHIA 4KLRA 5FI0B 1E9VA 4I50F 4OP1A 3T3NA 3SP1A 5E4JA 4LDJA 4BNDB 3SIRA 3QPCA 5B36A 3HJCA 2IP1A 2DPYA 4RIEA 5KBYA 1QO0D 3RR2A 4CL8A 1B8OA 5TR9A 5KTKA 5E0KB 5KJEA 5BNIA 1J2UA 2NO9A 5EJ6A 5DI3B 1KEKA 3F6RA 1KOLA 3TLGB 1JZQA 4HF7A 1YD7A 4ARZB 5A5EA 4AWAA 4HNQA 1B6RA 2DJIA 1U0OC 4TMYA 4CM5A 3UK1A 2B4TO 1KI6A 1X7YA 1CR2A 3LDAA 3GP8A 2C98A 1F38A 5DHTA 1PJ2A 3P9YA 4OFBA 4I08A 1R0CA 1SVKA 1Y3CE 4M1EA 4N47A 2I4TA 1LPNA 1XBTA 3CX4A 4NU5A 1TMYA 4P9NA 5GTDA 1SRRA 2PV0A 4QLAA 4ZO7A 4HDRB 5KTPA 2HNBA 3OBIA 1YQDA 1H6CA 1QKKA 3NTUA 4F1KA 1MT3A 1KMMA 3KBBA 3P9ZA 1ECLA 3CLTD 3D4IA 3SR3A 1ESZA 5JEEA 1XEFA 1P8JA 5FTMA 2P2LA 3UWOA 4QXQA 4E31A 2L19A 2WZQA 1QC5B 1QZUA 3GRCA 1N7HA 4E5YA 5E7MA 2R5FA 2HRZA 3DE1X 4CT5A 1WMBA 4DQDA 3LUFA 1OTHA 1ML3A 1T2CA 2KM1A 1BN6A 2QDXA 2VF8A 1JVBA 3EZ9A 3R5SA 4KMRA 4WKPA 1BJRE 1Y1RA 2H18A 4YXFA 3IAM1 4GXTA 1XLWA 1Z6AA 3ANNA 4FE3A 4JLMA 3TECE 2MSEB 2Q62A 2ZSEA 3RAJA 4OHOA 2GJAA 4WERA 3ZX4A 5J2TB 2R60A 2NUTA 1ZITA 4MYDA 4DKJA 2C92A 1S7CA 4NCXA 3NBMA 3ZHTA 4LG1A 1T3TA 3D4OA 4H17A 2YN0A 2CFRA 2WG0A 5IN5A 1IE3A 2H85A 2VPZA 3AYXB 1AF7A 4YPFA 4WKBA 3REFA 3F3SA 4C9BA 4XIJA 4Z54A 1F9EA 5AIBA 1R0RE 2GS9A 1JKJB 2H7CA 3LCCA 2VG8A 3K9GA 3CVJA 5J5CA 3FJOA 4LYHA 3H11A 3RASA 2E4WA 3TTVA 3GUVA 4DZTA 4NK4A 3MTIA 4UUPA 2C9ZA 1Q7RA 4GRDA 4NSNA 5ALNA 4XWYA 3O0TA 2ZR0A 1JXQA 2I5PO 4N6GA 1I10A 4EG6A 3N74A 4ND3A 1FYEA 2FEOA 2IYXA 1G98A 5IUJC 1EP2B 1GZUA 3HDTA 1NSTA 1MJFA 4PANA 4QFCA 2FW0A 2O0MA 1OVMA 4FONA 3ZY4A 2BFEB 1PSWA 1ENPA 1Y63A 2C03A 4U9HS 4OYYA 2ZM5A 4EYEA 1YMQA 1C7JA 2WUWE 1G2PA 2ZI4A 3LA8A 4XGIA 3FE2A 4QVKA 1BXZA 1C80A 2FQXA 2OCKA 2VHUA 3BK1A 1BA2A 3BXFA 3QU9A 4TWRA 2RGBA 5TQ0B 4MS3A 4TRRA 3CVUA 4IPTA 1QR2A 2D4AA 2RAUA 4ZALA 3KKZA 4KDRA 1CSEE 1T8UA 3R4CA 4ON9A 3I9MA 4D3XA 1NW3A 1CR1A 3L3BA 3EVZA 2YV3A 3O75A 3OPXA 5D86A 1RWNA 4B1FA 1KOGA 2YYYA 3O3MB 4TT3A 1OIVA 4W1QA 4XVCA 4ILEA 1HE4A 3KVNA 4N7MA 1E77A 4JB8A 2MYPA 5A0FA 2K87A 4O2LA 4RVSA 3R9KA 4F1JA 1VJRA 3AKDA 3D0RA 3M2TA 4ICIA 2ZWOA 3GZTB 1BCRB 4Y2VA 4BUCA 5H4GA 4GWGA 1D5WA 4ENWA 5BN5B 1YR1A 4G8DA 1CR0A 2Y1KA 3L05A 1U3WA 3P94A 4ZVOA 1ULTA 1P9RA 2G4VA 2PZLA 3HJAA 4WXMA 2YXEA 1UMBA 1WKCA 1V5GA 4K9KA 1ODKA 3K8ZA 3NEJA 4LNUB 4JOCA 3FCOA 1KZHA 1OGYA 4HRXA 4F92B 4HH0A 5CVTA 5CA1A 1KVSA 4AN0A 4Z7OB 1EHCA 2A3NA 2QN2A 4JVSB 1YJBA 3GVPA 2QDKA 3F7MA 1E0SA 1ODTC 3QLJA 4XPIB 5CT5A 4XQCA 3ZY3A 1ADGA 1HLGA 3OD1A 2J4FA 3P0JA 4MKIA 4RM3A 4AKIA 2IDKA 4KFCA 4RK1A 3G5MA 4WINA 1W87A 2P9JA 3D0QA 1GTVA 2Q1YA 3BB4A 3IBTA 5AK4A 5TMEA 4YPVA 3AIMA 1RZRD 3DP7A 4YMSA 1NBHA 3VKVA 1WUYA 4AKGA 2H3HA 1O96A 1F4LA 2P4EA 2X0KA 1H9CA 4U7HA 4X61A 5KHLB 4C6TA 2DMRA 2YIDA 3PT9A 5FR1A 3IB6A 3THWA 2B98A 5FOSA 5TARA 2WU0A 3JQRA 4WLOA 1W2WB 4DJFC 1SD5A 4NJEB 4BN4A 2FG5A 2QT9A 5FV7A 3QA9A 2O4UX 3TSCA 3CO0S 1C7ZA 1DUSA 3JQCA 4W7HA 4JYBA 1FU7A 4F4CA 5B2ZA 2OM2A 5CXXA 1DARA 5CDTA 4BE7B 4WBSA 4D42A 1B0AA 4OSPA 5F9FA 4ZI5A 1KAEA 2QVYX 4BNGA 4JT9A 3WRWA 2J4CA 3BHIA 1LVHA 4MWEA 3UUGA 3ZHXA 4ZGBA 1JFVA 1ZDMA 3GPIA 3Q88A 5B37A 3DEHA 2PJRA 2CFCA 2F8SA 5EXSA 1Q6YA 3MS2A 5JAPA 2NLOA 1OA0A 3IODA 2VQ6A 1YI1A 1ZJJA 1JJIA 1XVIA 3DMTC 5G4LA 2QTNA 3LPLA 3VJKA 5BRJA 1FQKA 2HMVA 4QG3A 1LW7A 3V1UA 3B78A 1P77A 4JUBA 5K3FA 5HFAA 4DR4B 1Z4QA 1A76A 1UADA 2JHAA 2ZT7A 2XT6A 5ALVA 4OOFA 3VNRA 3ZX5A 5EMKA 3K1TA 2ACWA 5FPSA 1EA5A 2JI7A 5D51S 5JQGF 1OCEA 1NG1A 3BRWA 4I1IA 4X6YA 2MWMA 3OO0A 2P1ZA 1GCAA 4IWYA 1KXZA 1N5KA 2Z5LA 4TOIA 1KEVA 1W0KA 2A0XA 2PL5A 1JA0A 2H1SA 3CFYA 4PWYA 4KL8S 1DNPA 5CK5A 5PNTA 1SQ5A 1ISIA 3E7FA 3C48A 3MWDB 4PNHA 2AG5A 1TVKA 3NANA 4F56A 1ESCA 3FPHA 1KO1A 3GMSA 5ALUA 1H85A 5KTYA 3K16A 2XTJA 1RYBA 1WRBA 4FMCF 3VR4A 1RQ2A 2AYXA 2UVDA 4L8GA 1OHHD 4OQFA 2YQ4A 2WQ6A 3GMDA 4TN5A 2YJ5A 4JP3A 1EJ2A 3UWSA 3WIOA 3VFDA 2AUNA 4YEDA 2QL9A 3IQXA 2WWYA 3FYTA 2E5LB 3NDJA 4CBVA 4FQ5A 3FSGA 2XRMA 1G21B 1N9KA 3B2EA 4BB5A 4DYDA 2PWZA 1A3CA 4RD2A 2H7VA 2B4QA 4O4IB 5A02A 3OQJA 1BW9A 1G55A 2E37A 1EZZA 1EVZA 2OG2A 3LGSA 4AWBA 1HETA 3VDMA 3P2EA 3THXB 3LVBA 1YB2A 3NUGA 1PEAA 4GVXA 3RTGA 1F2TB 1Z68A 2YJZA 4R5HA 1H2WA 10MHA 1ZH4A 1FDUA 3D8SA 1BHQ1 5J47A 4B6GA 4CI9A 5A3SA 3EIHA 5JADA 3QEBZ 2FWIA 2QVCA 3PUYA 5AT1A 3F96A 2PJUA 2WDPA 2PT6A 4JEUA 3DGFC 3RK1A 1XZEA 1OBHA 2PANA 3TFQA 1XD2A 3H5IA 1O94A 5B55A 4Q3DA 1PR4A 4D9EA 1ECPA 1XYGA 3HRIA 3JQFA 3VYRB 4DQVA 1FYWA 5FLYA 3MMXA 5JJBA 2D4HA 2DHCA 3G8CA 2H0QA 1QGZA 4DCTA 3VR4H 2Q28A 4CLXA 2N47A 1NHWA 4HAVA 4E03A 5IFLA 3EFBA 3QELB 4P7KA 3EDRA 4DW8A 5L3QA 2C5BA 3AP3A 4LQ4A 1W7AA 1KXJA 3UICA 3EDCA 4FT2A 1XOIA 1V0JA 3CPJB 3DMRA 4OVKA 4MP6A 4Q9DA 1J8YF 4Y2XA 1REQB 3ETEA 1QJ4A 5D3QA 4BTEA 2KLHA 3X44A 3NHLA 3T7IA 2HMWA 1VIMA 3DZBA 3ENKA 3K5WA 4FC7A 4YRJA 4ZICA 2VJOA 5I4KA 5KPDA 3AF6A 2OKGA 3DDWA 4JCOA 4R98A 4UBKA 3QIVA 4AUMA 1NVFA 1OXBB 3HXKA 1KFCB 4AB1A 2HO5A 1FMLA 1I5OA 1QVWA 3ACCA 4PPQA 2CLMB 4LI0A 2IVZA 4DA4A 2VI5A 4G6ZA 4IOMA 5TJ9A 5AI0A 4YQYA 4BGDA 3WMWA 2PHZA 1XDZA 2G63A 2H9YA 1FJ2A 1PJAA 3DFMA 4D57A 1PWEA 3TPCA 2H9IA 4IJVA 3S7TA 4Z4QA 1MABB 1ZHOA 3JVUA 2XUJA 1E59A 3NHKA 1H2HA 2MYTA 4GUDA 1GPLA 4GI1A 4GGMX 3RSOA 1JTEA 4Z4HA 4E88A 4ZYWA 4RL6A 1J0EA 4C29A 2Q4EA 5DGHA 4D3FA 5LIPA 3GPDG 1AS3A 3OQIB 3JQBC 1BHJA 5EI5A 4EF6A 5DM0A 5J2UA 4N41A 4KQHA 2IJGX 3T1QA 1S2OA 1U7XA 2YWEA 1T9ZA 1AKMA 2O2HA 2JGNA 1NVVQ 2F8LA 1BQ4A 2VK8A 3AWIA 3PC7A 4KWIA 4C4OA 4R7TA 5B58C 1VE3A 4DC0A 2XGMA 1MQSA 3UFXB 2QTWB 4BN5A 3FY4A 3IHLA 2A0WA 5JCOA 4E4TA 3I8XA 4HDSA 4U5QA 2BF7A 3ZV3A 2XCLA 5G0SA 3UYKA 1L5FA 4IX9A 3L9WA 4LDPA 4W5TA 3INGA 1LKZA 4B7CA 5LLDA 1RPZA 3OG9A 2V3CC 3AL2A 3BIOA 4Q47A 2I29A 4R54A 3FTFA 5KVQA 4LFBB 5IT9A 3FIJA 2J45A 1OH5A 2XKJE 1PK8A 5LJLA 4WSOA 4JQZA 5T4BA 5EAIA 4DV5B 2XWPA 3OZ7A 1LK5A 1TA0A 4JKOA 3HVKA 1CP2A 4O1MA 3VSAA 1J9EA 4WJKB 2ZUTA 1BZYA 5FCDA 2HMYB 5U4QA 4XEHA 1QDLB 4WCFB 3HI4A 4H77A 4JXJA 3HYNA 1A04A 4RF4A 3RYFB 5KYKA 4H18A 1YBFA 2ZSAA 3G68A 1K3FA 3P4YA 2GM3A 1ZRMA 3LUHA 3OJCA 4ZPXA 5EESA 2DFKB 4TMKA 4AYXA 4F91B 2NTVA 3NXKA 1BNCA 3QLVA 1Y8QB 3QWIA 3TQOA 3T3PB 2JCBA 4FX2A 3NFRA 5AVJA 3T7TA 2DHDA 1Z5ZA 1ZC4A 4NEGA 3OJOA 4OM8A 3I0ZA 3QEMA 2IIPA 4ZMSA 1H4QA 3PB3A 1A8HA 3DNMA 4HDCA 4PZAA 2DKFA 5AW8A 3EMKA 1FTQA 3FOBA 2Q7XA 2XTAA 1GUBA 1J99A 1DHTA 2HLDD 3ER8A 3V1YA 1NSFA 1R8JA 4EJ0A 1NAHA 3CVVA 2WM3A 1R9MA 4MICA 3RS5A 4C5BA 1S3IA 1JU9A 2J3IA 4CG0A 2KPOA 4FW9A 3NM4A 3D02A 4EIWA 2GCNA 2X1VA 1XP5A 5GONF 4DQKA 2KBEA 2O2SA 2DUJA 3RUEA 1A5ZA 4MV3A 1NXSA 4DXAA 3CNOA 1UJMA 1U0JA 5FEUA 5AIAA 3I9JA 3QEOA 2JLUA 1QU2A 4LS3A 1Q7CA 2P0EA 4H7DA 3DOHA 5G2OA 4LHVA 3UG6A 1TLTA 2QUHA 3N6XA 3PI7A 4S2EA 1GU1A 4XIGS 2H2WA 5F2EA 2YYAA 3MFYA 4KREA 1YHZA 3ELDA 1MRNA 3L04A 1ORTA 4U0KA 1C1XB 1IJEA 5E6SA 5JZOA 1ZISA 1ZL0A 2EIXA 3OZRA 4E33A 3UKOA 4NNPA 4JQCA 1IH8A 2AJ8A 1Z34A 1T0PA 3IUPA 3RM3A 3WWYA 4N40A 3H2GA 1T5TA 4EHBA 5T3UA 1L4LA 1VHLA 2F17A 5TGDA 2NU7B 3PXDA 3N5KA 1D1SA 2PUTA 1WZ2A 3GDWA 4D9KA 5AJHA 1FJGB 5DIFA 4GNRA 5HSGA 2YY6A 4LGCA 1A7AA 3G0DA 3K6RA 3TBHA 2F1JA 4WQMA 4ASUA 4WV3A 4LN1A 2DRIA 1UKCA 3H6KA 3PDHA 1VZ3A 2OBMA 4C6HA 1OFIA 1ML4A 1C8LA 1KFJB 3HYSA 4JI2B 1PJ8A 2XUHA 3BJMA 1QYVA 1C3OB 2IQIA 4RENA 1KYXA 4GMHA 1VJTA 3B8HA 2PV7A 2GJ9A 3K09A 3V3TA 1QP4A 1NKSA 1K0FA 1ZO8A 1DAOA 4ISBA 4J9VA 4NARA 2BM9A 4DPLA 5MN6A 1JBQA 2RKBA 1Y8RA 1L2TA 1RDFA 1SBZA 1XRNA 2QRGA 3HWRA 1R0YA 3O3NB 4IHJB 2LDBA 5SY4A 3U3OA 3MEQA 3B12A 4LJRA 2Y6VA 4WLVA 2D3WA 3EASA 1L4NA 2PSHA 5G3YA 3TQRA 5IYZB 2HXSA 3JYOA 1SBCA 1XTIA 1US8A 2DCMA 2C82A 3GGSA 4HGQA 4IWXA 1SPBS 4G1CA 2C5EA 1YTLA 4POOA 3ETLA 2NSHA 1H5UA 3DV0B 4QXRA 3GN2A 1TIBA 2QD4A 2FVXA 4DWWA 1ZN8A 3K73O 4UZFA 4JEIA 3EWNA 3SSNA 5A0TA 2PH3A 3GLFA 1U7HA 4QDTA 2GM9A 1ZGAA 1OXXK 5JWRA 5AP9A 2WWWA 4TWZA 3X1YA 1VJGA 3HB9A 4PSAA 1DC3A 1YONA 1FP6A 4EGQA 2XBLA 1MLDA 4MO2A 3EUAA 2I4LA 3ND7A 4PGGA 4W99A 2GHIA 3SZRA 1FSGA 3A6FA 4DLPA 5FA6A 2BAGA 3EE6A 1L7AA 2FDRA 1N1GA 4K26A 4PWZA 3QZUA 5LDGA 1KZ1A 4KMSA 4WD3A 4CWAA 2BFMA 3T5DA 1ZEJA 1R88A 2NVBA 4UHHA 1EUDA 2FEWB 1DRKA 1WW2A 3CJRA 2XADA 1IATA 3F71A 1I51A 4MI6A 1DX9A 3L6OO 2P9GA 3M4XA 4JOSA 3HR4A 3TDKA 1JDNA 4JUCA 2OO3A 1T3GA 2BEWA 4I3HA 4D96A 3PNLA 2V59A 2VAMA 2PLRA 3O7WA 3IMGA 5DE3A 1GRQA 1JSRA 1O89A 4B9AA 5C32A 5JS6A 1A71A 4PYQA 5JSQA 2XE7A 1L8OA 3O9VA 2H54A 3TR0A 1OILA 3PHJA 3QYFA 4D74A 2UUAB 1FQWA 3L7CA 4I1VA 1ZM9A 3PXBA 4FIZA 4GLFA 2XF8A 2ZPAA 2YFYA 5DX8A 1DRVA 2EFGA 2LIPA 4X63A 1WXXA 2O8VA 4IFEA 4CMKA 3MLAA 1U1DA 4TT8A 1HLFA 3FZNA 4LTDA 1WMAA 1CS4C 3D6FA 4KO3S 1V6SA 1JVNA 1T26A 2FGKA 3L7KA 4HG2A 5JD6A 3EC1A 3R6WA 1I2CA 2QY6A 5JPCA 1AGPA 3GJ0A 2Y1FA 1F0YA 2CVQA 4X9XA 5EFZA 2BE7A 4NYIQ 2OQRA 3EPHA 1D2MA 2R00C 4NJOA 4CTOA 4EELA 1YGPA 2FN4A 1RADA 2Y0PA 3USES 4F60A 3C1OA 3EVTA 3BSYA 3N2ZB 4RJKA 4RTOA 4L8VA 2D00A 3A06A 1NR1A 3IESA 1B1AA 3LJKA 4J0GA 3NAGA 2I3BA 3Q3EA 1AKTA 2ZRAA 4BATA 4GF5A 4YK7A 2O06A 2Y1OA 3HI6A 5CH5A 1WAMA 3JYPA 2VUTA 2N46A 4UVDA 4K1LA 1I6KA 2R44A 4AG6A 4OQMA 1M6VB 1EG7A 3RKRA 2UVPA 4AWXA 2ZI3A 2WNIA 2PFGA 3EFOA 2IHJA 4L0CA 5C5CA 2I6GA 3JQPA 4NAUA 3WGTA 2G9NA 1I2BA 4BDSA 2JJYA 3EF3A 4J16A 2AJLI 4JROA 3RHTA 1I30A 3WL6A 1C14A 3K9CA 5CPFA 1GQSA 4RJLA 2P6PA 5A5DA 1VOTA 1EE9A 1XDGA 5A6SB 2FLVA 4LK2A 3I76A 2OXIA 1MTZA 3P0IA 3Q9SA 3SJBA 3SZ3A 1KO8A 1I3MA 1LPSA 5EIAA 4HDAA 4L74A 3M5CA 4G5OA 2PJZA 3VO9A 5COAA 1G63A 2F67A 3PE4A 3TGPA 2BSAA 5JPIA 3NBUA 2JFFA 1NW8A 3B48A 4OB7A 2HDOA 5ESDA 1TT5A 1U6KA 3NJ4A 5K4AA 1XWIA 3ZXUB 4N39A 4CIVA 4YUAA 1YVUA 3SIWA 2J9FB 3KZMA 4GW3A 1EAMA 1KETA 4ABTA 3SMQA 1CU1A 3U5ZB 1E69A 3T4XA 1KBOA 2NZXA 5J63A 2Q3BA 4O6VA 1PLKA 2PCJA 2HJWA 1DKQA 4OM7A 5SZKB 4AXBA 2NO4A 4PC2A 4EITA 1VL2A 3EZ6A 3FPEA 3MJDA 3VU9B 1ZHFA 3P0FA 2DXIA 2KSQA 3M5PA 1SELA 2WSYB 1JHRA 3H86A 2H0RA 1SVMA 1H2YA 3B89A 3MWEA 2AI2A 1ZMTA 2V65A 1Q1ZA 5CJ2A 4B4UA 2XDQB 1CZNA 1WW3A 4GKBA 4Z3DA 4MI3A 4HFRA 5BW5A 4YA6A 1YOVA 1RLTA 2ZATA 3IR6A 1CUFA 3NT5A 1II8B 1Z26A 2CL7X 2Y4NA 1NI4B 1ECCA 1RKVA 5IC5A 5BQ5A 4IKOA 2HSZA 5WRFA 3ENQA 3PX2A 4W9NC 4URUR 3M1IA 2NU8B 1YQ9A 5G1NA 2B78A 4IUDS 1I7QB 2WYVA 3E0QA 4MYSA 3OZUA 4LC1A 2YZ2A 4Q9KA 2NU9B 2ATCA 1UC5B 5FNVB 3WSVA 5B7QA 2AHOA 4JXXA 4HADA 3H0EA 2CBXA 3KVYA 3OZVA 1C29B 3TW0A 3IVXA 4HQ0A 1L5OA 2H8KA 1OFHA 2RG7A 2RJ3A 2JLRA 4BVGA 1U8TA 2QS9A 1H3FA 1UXKA 2XKAA 1FSPA 2C7PA 1AUXA 1NE2A 1PWZA 3ORSA 3U26A 2A1IA 2ZTVA 2X0FA 2V5UA 1WD7A 1QO7A 5CNJA 1T2NA 3NCHA 3ZDFA 2VHEA 1B41A 3ZHUA 1EKXA 3E4CA 3K0AB 4XB1A 1MN6A 4GH5A 4IDAA 2V96A 4D9HA 3W7AA 5JDIA 2C7QA 2IH2A 3F49S 4TS4A 1XQ6A 3E3OA 3W5VA 4ARSA 1VCHA 3FDFA 1EA7A 2OC4A 3RUFA 3RAEC 2DJ5A 1NJ5A 1NZJA 4HBGA 5DHRA 5EUMA 1DGQA 1DINA 3IP3A 1T1IA 1PT9A 2E85A 3COPA <