1YB1A

Crystal structure of human 17-beta-hydroxysteroid dehydrogenase type xi
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
244
structure length
243
Chain Sequence
RRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITGVKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 17-beta-hydroxysteroid dehydrogenase type XI
publication title Crystal structure of human 17-beta-hydroxysteroid dehydrogenase type XI.
rcsb
source organism Homo sapiens
total genus 93
structure length 243
sequence length 244
chains with identical sequence B
ec nomenclature ec 1.1.1.62: 17-beta-estradiol 17-dehydrogenase.
pdb deposition date 2004-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1yb1A01
4PLWA 1XCBA 3MOIA 1HYGA 1GZ4A 1PQWA 2EG9A 5I9NA 3F5QA 2GRAA 1HRDA 2HMWA 5TQVA 3S2FA 1EE9A 5K0ZA 2J5RA 4OHUA 4GWKA 4R1SA 1IOLA 4D0RA 5CPFA 3P2YA 3IAHA 4D3DA 4G81A 4BNTA 5BQFA 3LYLA 1FJHA 9LDTA 4A7PA 3KVOA 1H6BA 4MIOA 3OIDA 1LNQA 3DBRA 2IYPA 4CMAA 2B4QA 4J0FA 1ZK0A 2V6MA 5JMPA 1C1DA 1BTOA 4TVBA 3CH6A 4ALLA 1LC0A 3GN2A 1UZLA 3UGKA 5K6AC 4II3A 5CG2A 1V0JA 4KUEA 1FMCA 4BNMA 2I76A 2J5QA 1I10A 1QV7A 1GR0A 3T7EA 3I6QA 5KKCA 2ZQZA 2OORA 2QHXA 1V35A 4R1NA 4R41A 4WLEA 3CINA 1SPXA 3KO8A 3DBLB 3HWRA 3RQSA 1ZMTA 1E3SA 5IXSA 1HLDA 3GG2A 4E33A 3AFMA 1DIHA 3AOGA 3VC7A 5A9SA 1JWBB 3A06A 2FMUA 1CYDA 3N58A 1XG5A 2RHRA 1LC3A 2PFGA 5CDSA 1H2HA 4QFCA 4AJHA 3V1TC 1O9BA 3TFOA 5TF4A 3TZ6A 4CLHA 3JQ9A 2X9NA 5DBFA 2P4HX 4QUKA 2Q2QA 4A27A 2ZTUA 5DDIP 2V65A 1R37A 3F1KA 2DLDA 2WM3A 4YTEA 3ZHYA 5JCJD 2NACA 1R12A 4L76A 4XYGA 4BO7A 1Q7GA 4E2ZA 4YJGA 3D7LA 3IKTA 1H93A 3WGTA 2YQ4A 1J49A 4XQEA 1KETA 4Z9YA 3WJAA 5MDHA 1ZO8A 3G3EA 2EW8A 1NQ5A 2IZ1A 2O3RA 2NTJA 3MJ4A 2O3JA 3GH3A 2O4UX 3NT2A 3BHJA 3DZKA 1OOEA 1ISFA 2GN6A 4UUPA 3T4EA 4KUHA 4NIMA 3UUWA 3VDRA 2LDBA 3L4SO 2NVUB 2NU8A 2PKQP 3ETEA 1WP4A 3C24A 1RPNA 4CM8B 1KEWA 1I24A 3BA1A 4JCOA 2NVBA 3DMTC 3ON5A 3RFXA 3EHEA 1YQDA 2AHRA 1YONA 1D3AA 3GPIA 4EJMA 3K2BA 4IQ0A 3OBBA 1I33A 2YHIB 4BMNA 2C20A 3OECA 4GL4A 1HDRA 1U5CA 3GN1A 4KQXA 4WEOA 4IPTA 3FR8A 2X4GA 4FCCA 5H81A 3SVTA 4UVIA 4YA6A 3GAFA 1B14A 3V5NA 4CLOB 5I7VA 1WVGA 3TWOA 1XU9A 3MJEA 3RIHA 4M55A 3GK3A 4YYZA 4JIGA 1WDMA 1E77A 2HO5A 2O23A 2VHWA 4P22A 2FOIA 2FPPA 1MG5A 3WICA 1EVZA 5CDTA 4XYMA 3PGXA 1JKIA 4QO7A 5F3RA 2AXQA 4WCFA 2PD4A 5TRTA 4AJEA 5CFZA 4NU6A 3D4PA 4C7KA 2VT2A 4LN1A 1HDXA 1HLPA 3MJCA 3JYLA 3WR5A 3ZN2A 5JSFA 3HN7A 1DFIA 1WWKA 2X86A 2OXIA 1YQXA 2PTGA 4XWYA 1C1XB 3G49A 4KDEA 1U7HA 3QLJA 3A14A 3INTA 3ICPA 2ZB4A 3I6IA 3KETA 4HBGA 5JW6A 5DCYA 3E8XA 1U7TA 4YACA 3VH1A 2O3UA 3VH2A 3ZNNA 4AJKA 4E5NA 1DC5A 3FSRA 3N7UA 3KTDA 1T4BA 1XEAA 3TN7A 2GZ1A 1F0YA 4DREA 4KUGA 1U3TA 4XB2A 4QT0A 4DLBA 2DVMA 1TT7A 1SEPA 1S6YA 2DFVA 4EEXA 1P45A 2G0TA 3PLNA 3PQDA 4XA8A 3C8MA 4QQRA 5C7LO 3X2EA 2Y0DA 5THKA 4ALMA 4LSWA 4OM8A 1HTBA 3E9QA 1MXHA 1E7WA 3HADA 3PHGA 1CQIA 3ZHXA 5GZ3A 4R5HA 4D41A 3BIOA 2LDXA 3NKLA 2QG4A 4B8WA 1MUUA 3RKUA 3RFVA 5T57A 3SXPA 4DIFA 1LLDA 4ZU3A 1R0SA 4DPLA 4NH4A 1JKFA 3PYLA 1LQUA 4GLLA 4AJOA 2RCYA 4BO8A 7MDHA 3DZGA 1LSSA 2BMAA 3ZV5A 1PZFA 1Z6ZA 3GPDG 2P9EA 4AJ4A 2JD2A 1ZSNA 3AM4A 4IXTA 3UAGA 1DB3A 1I36A 1PX0A 3E9NA 5B4TA 3QHAA 4IDAA 1LRLA 3L77A 4BKPA 5IN5A 3ZWMA 4JLWA 5L53A 3OJ0A 1NWCA 1Y7TA 1SAYA 1QYWA 2BELA 4M8SA 3QWAA 5F5NA 3GAZA 3U4HA 5TLSA 1X0VA 3GR6A 4BGUA 4FGSA 1VJ1A 5TGDA 3ZHBA 3GNTA 4HV4A 2C59A 3FNHA 1ULUA 3I9LA 1JAYA 2IXBA 2Q99A 4DA9A 5HS4A 3WGOA 5JAZA 3U5TA 1H2BA 1N9GB 3JQ8B 3E1KA 1YBMA 2P2SA 4J91A 1I01A 3C1TA 4A10A 3RBXA 2O3TA 2AG8A 1R15A 3TF5A 1J6UA 4J6FA 3HQ4O 4MVJF 3BXXA 3L07A 3PZRA 2O48X 3TZKA 2R6JA 3JYQA 4XGKA 2G1UA 1TI7A 2ZATA 2J3KA 3A28A 1ZZEA 4FC6A 2TMGA 3ITDA 1KVTA 3WX0A 3G17A 4J1TA 4BNKA 3RBZA 2HU2A 3M2TA 5CDGA 3PJFA 4BO2A 3EVTA 1P1JA 4MVJH 3VPGA 2VWQA 3GA0A 1PJTA 3VTZA 3NT4A 5G4KB 1IULA 4P4GA 2GASA 4F6LA 3VPHA 4AICA 5KVCA 5IN4A 2OHXA 1YS4A 1WMAA 1E0DA 3C1OA 1TLTA 5JPIA 1WW8A 3BMNA 1ISGA 5L95A 1SCUA 4B7UA 2ZCVA 2AQKA 3K2EA 3LF2A 3WOHA 4IY1A 4F3YA 1P33A 2FP4A 1Y8QB 4PGFA 1JDJA 4D7AA 3GMDA 4RPLA 1SMKA 4BKUA 1DRUA 1F12A 3NGXA 1SEVA 4AJIA 3V8BA 2HMTA 4N18A 1KVSA 2QYSA 2I6TA 2HMUA 1Z75A 1MFPA 5LCXA 3MCVA 4YEDA 4CMIA 2VRCD 5G0TA 2Y68A 4BKRA 1HL3A 3GGGA 3F6YA 2WSBA 4BMVA 5JAMA 3EY4A 2PGLA 4B7CA 5ITVA 1HEUA 2DQ4A 3P2OA 3ANLA 3EYWA 2AG5A 2BFMA 3FWZA 4BB6A 3LLSA 3ZV3A 2B35A 4GWGA 4Z9XA 1YRLA 4J2OA 2PR2A 4RVFA 1P31A 5IG2A 1I3MA 3IC5A 3I1JA 1WAMA 3LT4A 4MIEA 3NEPX 4FDAA 5KJEA 5THQA 4CV0A 4F6CA 1E6EA 2R00C 4HP8A 4BO4A 5B4UA 1VJTA 3R3JA 1DJQA 4FFOA 2YQ5A 3TPCA 1SB8A 3BYZA 4CMEA 4EITA 5L4NA 5IXYA 2JFFA 2EGHA 4LCJA 4ND5A 4PFJA 3NTOA 1R4MA 1N7GA 3ZWVA 4P4LA 5IZCA 1XELA 4K6CA 4H7PA 2XF8A 1Y1PA 3IL2A 1T1SA 1JN0A 1OBFO 3PXXA 1AUPA 1AHHA 2Z95A 1ADFA 2HJRA 3L9WA 2BLLA 5BR7A 4U0KA 3FCOA 5BSGA 1KY4A 5A04A 5CPBA 2BFOA 5C5IA 4IDCA 2Q2WA 1ZKMA 1UH5A 3L4BC 5L3ZA 5TJ9A 3ZNPA 5EJ2A 1DSSG 3UH1A 2GERA 4MVJA 5L7TA 1LXCA 2VUSA 3KSZO 3U49A 1LSUA 4HUJA 5I8WA 3LC2O 3PGJA 2DUUA 4OQZA 1CF2O 1JLLA 4JP2A 1XDWA 4J2HA 8LDHA 4OKNA 4RPGA 3UHAA 3JQFC 1D4FA 1H6AA 1ISJA 3TQHA 4CQMA 3W8DA 4D43A 5EIOA 3S55A 1K3TA 4PG5A 1R4NB 1UUFA 1ZCJA 4N5MA 3PLRA 2Y1GA 2QRKA 1NASA 2YJZA 3AJRA 4RGBA 4DBZA 5G0SA 1JU9A 5IJZA 2BGLA 3SBOA 4Y9DA 1LTHR 1IZ0A 3F9IA 4I5FA 5JNLA 1GQ2A 2VNAA 2NVWA 1O95A 3ZV6A 5C3MA 1ADBA 2G17A 3D3WB 4OSOA 4Z9FA 4Q3DA 1WNTA 3GHYA 3KRTA 2EXXA 1U8XX 4FBGA 2DUWA 3ZU2A 4JNKA 1CRWG 1LRKA 4H3VA 3RCBA 4N54A 4R3WA 4BO0A 1GQQA 3COSA 1Z7BA 1BW9B 4D3FA 3QVTA 5AXDA 3Q9UA 4ITUA 4ZHSA 1VL0A 3C1AA 3B1FA 1T24A 1NYTA 5JDCA 2ET6A 3M1LA 3UXYA 2WD7A 3MTJA 1Q7BA 2GR9A 2HRZA 3R1IA 4FR5A 1SOVA 4B7XA 4L75A 1NVMB 3RUHA 4KP7A 3VPXA 1DRVA 1Y8RB 3DHEA 4Q3BA 1HDCA 1GDHA 4U6QA 1Q7CA 4NK4A 4ALJA 1F8FA 4J9VA 5ICSA 3GEDA 3FPCA 1AXEA 2X23A 3W6UA 3EDMA 3BHIA 1NR1A 1KC1A 3IUPA 2ILTA 4E3ZA 3OSUA 1P77A 4EGFA 1PIWA 3PIDA 3H7AA 4A2CA 5L4SA 4XIJA 4A26A 2PKRA 4BS9A 4KWHA 5F5LA 2VTDA 3B1KA 3ROPA 3INGA 4FQ8A 1MA0A 2VUUA 4GGPA 1CIVA 1YOVA 4YRDA 1IYZA 5K9ZA 4IDGA 3GZNB 4Q3NA 2CF5A 4BVAA 1N8KA 4MO2A 2AE1A 4OIMA 1QYCA 2ZYDA 4NFHA 3W8EA 4XDYA 3TFQA 4UREA 3FWNA 3TNLA 2BHLA 2HUNA 1QMGA 3DOOA 3GDOA 4FJ1A 1JKJA 4IMRA 1YVEI 2CVZA 3SLKA 4OOEA 4YWJA 3VPSA 5JMWA 1HE4A 4G5HA 2QIOA 3JQ9C 3DAGA 1KOLA 4BNLA 2IE0A 2UDPA 4YAIA 5FI5A 4J4HA 1VPDA 1WLYA 2EV9A 1G0OA 3GNQA 4FIZA 3E48A 4WGGA 2IZZA 2NSDA 3UW3A 1NPDA 1KERA 1E3WA 1M6WA 3KYBA 3LC7O 4UUOA 3ANMA 3E9MA 1P74A 3H65A 3QJ5A 3AU9A 2NTNA 1ZNQO 4FOSA 4CM5A 2HMVA 4MVJD 4FOOA 5ES3A 4PLCA 1GY8A 5KWEA 2X0NA 2PLAA 4RVGA 1VSVA 4J16A 5TC4A 4CMJA 4LISA 4XQ9A 1LLUA 2X9GA 3RUDA 5JFOA 1DLJA 3E5MA 4CR8A 1GUZA 3RAJA 2P5YA 3L6OO 4PVCA 4MINA 1H0KA 3GRKA 3H2ZA 3WQQA 4MJLA 3I3OA 1E3EA 4FFLA 1DIBA 2Z1NA 4Q3EA 1GPJA 4LRSB 5L9AA 3H3JA 4HFMA 3FNEA 4IQ8A 4RQTA 3GOHA 1BXGB 3B1JA 2VNSA 4RORA 1BWSA 2ZB7A 4WPGA 3VAZA 3SJ7A 2CVOA 1PJQA 3Q1LA 2BF7A 4PG6A 3OJFA 5T67A 4AL4A 2PA3A 3HJAA 1DAPA 3GGPA 4FD3A 3DONA 3KUXA 2RH8A 1GEEA 1ZSVA 4J90A 3DFZA 4B8ZA 5FWNA 2B5WA 3IS3A 4Y67A 1T1RA 1VKOA 1K0UA 5F1PA 1PGOA 1GADO 4YJFA 2OUIA 1DAOA 2O4CA 3NAQA 4I9HA 4L4RA 3G0OA 1GL3A 2YV3A 3DO5A 1T2FA 1BSVA 1CETA 3FTNA 1C14A 4W6ZA 2B0JA 4BKOA 4U6SA 4CV1A 1TVEA 4JX8A 1UDBA 4DRYA 5GMOA 2RHCA 1CERA 1H9AA 3F4BA 3OF2A 1RM4A 3PQFA 3GVIA 3JV7A 4WKGA 3PP8A 1GCOA 4ILKA 3RC1A 3K8ZA 2Y67A 3P19A 2EHDA 3C7AA 1I5RA 3AM3A 4E2WA 5KTKA 3S2EA 1QP8A 3ULKA 4PG8A 4XCVA 4BMSA 3DZFA 3UOGA 3D64A 4XJSA 1I3NA 3BZUA 4Q9NA 4WK6A 2C5AA 4AFNA 4PRKA 4FS3A 1X7DA 3H2SA 1YL5A 3ZW9A 1K6XA 4OH1A 3AK4A 4OO3A 4IXWA 1KEVA 5CEFA 3WSWA 1W0CA 4CMKA 4ND2A 1T4DA 5G0UA 4YRBA 3LC1O 5ICMA 1ADGA 5EL0A 4RVUA 4XIYA 1DBVO 3AFNA 2PY6A 3DB2A 4FFMA 3STHA 3I4FA 3I4CA 4KDFA 3VKUA 5TS3A 3U4IA 3WSVA 1XQ6A 4MVJG 2I66A 1T2CA 4NJMA 1A9YA 2D5CA 3K73O 4OQYA 3O8QA 1FXSA 1C0PA 3D0OA 3E5RA 1W8DA 5H83A 5DZSA 3CMCO 3WXBA 2DT5A 1N7HA 1XHLA 3DL2A 4ZRMA 3ETDA 4NDNE 1FDTA 1Q2XA 1K5HA 3KXDA 3L9XA 3QVSA 1KYQA 3NRCA 1E3IA 2YHIA 3HDHA 4GH5A 1AXGA 3EGOA 4YDRA 1SBYA 5U4QA 3CUKA 3QP9A 4BNXA 1F17A 1HSZA 1EE2A 5LC1A 1U1IA 4BGVA 4ESOA 4LGVA 4J0EA 1EQ2A 2GLXA 2OO5A 2WYWA 3JQBC 4RF5A 1GYQA 4WOKA 2I67A 4NI5A 4Y6SA 1JVSA 2P5UA 1ONNA 1ENPA 1HE3A 4R68A 4TZTA 4Z0TA 5JO9A 3VVBA 2C29D 4CV3A 4CLEA 1BVRA 4PZDA 2RAFA 2POQX 3GNSA 2AQHA 2ZB8A 4QO8A 1LBEA 2A9FA 4O1MA 1MGOA 1XQ1A 4INAA 3VZQA 2IODA 2FHSA 3UFXA 1V3UA 1EMDA 3RJ9A 3PWSA 4O6VA 4FFPA 5TNXA 4YQYA 1G0NA 4R1TA 2JHFA 4E12A 1GU7A 4YB8A 3ZH2A 3AUSA 1JVBA 3K31A 1MX3A 3KYDA 2CFCA 3V2HA 4CM4A 5A1TA 2XPCA 2CMDA 2ZTMA 4J7XA 1J4AA 3RASA 1NFFA 3WGHA 4TSKA 2D3TA 2P4QA 1PEDA 4U0JA 4QFDA 2VQ3A 5T5QA 4DPMA 3QIVA 5B1YA 1ZFNA 4GKBA 4NPCA 4TKMA 3ZWCA 3JTMA 3BTUA 4IGFA 4PG7A 1DXYA 1GUYA 4YT5A 5BNFA 3LZ6A 4L8VA 5KVQA 4CUKA 2D0IA 3BMQA 5FFFA 1M75A 3ETGA 1YO6A 3GVPA 3MOGA 1B8VA 4GLOA 4BL5A 2HKIA 1G1AA 2ZTLA 3DZHA 1P1KA 3K5PA 1E1LA 1GCUA 3U4DA 1OMOA 4BGEA 5L7WA 4BHTA 4N5NA 4BUCA 5GZ6A 2CF6A 4WLOA 5U1PA 4Y98A 3EAGA 3AOEC 2FSVA 1AHIA 3KYCA 4JQCA 4NBWA 4BO1A 3PFFA 3PHIA 3E18A 4NK5A 2YUTA 1UDCA 2I5PO 1IZ9A 2XAAA 3DBRB 4L4XA 5HA5A 4R54A 1WZEA 4TRMA 2YW9A 4XD2A 3I9JA 2OL4A 1C1DB 4R5MA 3GRPA 2FSSA 4E32A 5JS6A 3GGOA 4RPKA 1I0ZA 5A9TA 2QZ9A 2NU9A 3H6KA 2GN9A 3PWZA 3FI9A 1XYGA 1TT5B 4RLHA 2C54A 1IHYA 3NJ4A 1DO8A 4RPJA 3F5SA 4CM3A 3CMMA 3SJUA 2Y0EA 1Z82A 2YV1A 2GYYA 4QX6A 3OMLA 4DUPA 2Q4EA 2FR0A 1PWZA 4MVJE 4CLDA 3KOUA 1E7SA 4YJHA 3RUFA 1AGNA 4W9NC 2QW8A 3WB9A 2D5AA 1E5QA 3UCEA 4K1LA 3B6ZA 4TMFA 3IOYA 4OL9A 1E1MA 1VI2A 2Q4BA 4EUHA 2X1HA 3JD0A 1RYEA 1V9LA 2VRCA 4CJXA 5A9SB 1GD1O 1R6DA 3ADOA 4Q39A 1ENOA 1ENZA 2X22A 3KEQA 4BOYA 5DOZA 2AE2A 1QYVA 4IIVA 1DOHA 3EC7A 5EQDA 4EEZA 3WWZA 3RC7A 4WJZA 3W8FA 2IXAA 3L6EA 4P4NA 4ZQFA 2J8ZA 3AU8A 4M49A 4A73A 4EI2A 4ZQBA 4GX5A 3OP4A 1PR3A 2O3SA 4DIBA 4CMGA 3WGZA 5C7OO 1MP0A 2VWPA 1G6KA 3ONEA 4UEOA 1QKIA 3OH8A 2I3GA 2QZZA 4WNCA 2IEBA 4BNGA 3KZVA 5I9MA 2DBZA 2X6TA 2YFHA 4TROA 1B8PA 4CL8A 5JDIC 2EEZA 1RYDA 1E92A 1TXGA 4O0LA 5CP8A 4AJ1A 4XDZA 9LDBA 5CAEA 2W2KA 4Z0PA 2HCTA 5JLAA 1KEUA 5T8KA 2CDAA 4PLZA 1W6UA 3LK7A 3OIGA 3GDGA 4NNJA 4GMFA 4UVDA 4CQLB 1LJ8A 1NHWA 2EP5A 2GZ2A 3OM9A 3ZCXA 1Y8QA 2HSDA 1P0CA 2DC1A 2VZ8A 2JL1A 1HZJA 3LVFO 5HM8A 2VWGA 4BNUA 4PN3A 2GUGA 4WLFA 2JD0A 2V6GA 2O3QA 3LSYA 5FEUA 1B15A 4XB1A 1Z73A 3G79A 2HQ1A 4QXMA 4IIUA 4Y6RA 2ZYGA 3WTCA 4GGOA 5COBA 3PTZA 5B4VA 3ZGYA 4EJ6A 5HBRA 4B4OA 1PTJA 4WCFB 1FK8A 1ZBQA 3H8VA 1B3RA 4JBIA 3ICCA 4IINA 5K6AA 3W4IA 1ARZA 2BH9A 3FNFA 5ENVA 3UCXA 3KV3O 2PD6A 5AXCA 4XQGA 2J3HA 1T2DA 3UF0A 1E3JA 1HETA 2X5OA 3L6DA 5HRUA 1SNYA 4XR4A 5AYVA 4EUFA 1PGPA 4R1UA 2DTDA 1N1EA 4CMHA 2Q1WA 3BMCB 3PJEA 1KY5A 1YB5A 1ZJYA 3QRWA 3WNVA 5JAIA 1OI7A 4JK3A 1ZXLA 3H9EO 1C0LA 1TEHA 1YL7A 4BNIA 5A5EA 2C2XA 1A7AA 1CEQA 2C82A 3DBHA 4JBGA 4MP3A 3GEMA 3JQCA 3OEWA 2EGGA 3PWKA 3FN4A 5A5FA 4L73A 1ZUD1 4QTZA 1ZW1A 3IKVA 4TKLA 4I8XA 1D1SA 1W4ZA 1R16A 4JJGA 1E3LA 5A4DA 3CIFA 1VLLA 4UULA 3JQAB 2GGSA 2EKPA 2D8AA 3ABIA 2O7SA 1HSOA 2C7VA 3DEYX 3GDFA 1BHSA 1MC4A 4GX1A 4IJKA 1DJNA 4CR7A 3MJSA 3ZWPA 2FZEA 4MIYA 4TZKA 5DOVA 1UR5A 4DQXA 1O0SA 3DAPA 3GUYA 2H63A 3QA9A 3VDQA 1DRWA 2E49A 3H5AA 4BIIA 3PJGA 3NJ8A 3LT0A 5ER9A 2ZK7A 3AUTA 2Y05A 4WOJA 5BNIA 4LCEA 3SEFA 2NLOA 2HAEA 4PLGA 1EDOA 1MFZA 3WMXA 3ZWBA 1Y9EA 4RF2A 3DMTA 1NHGA 3D4OA 3DHNA 5DBIA 1R0LA 5FI3A 4WCDA 4PZEA 3I9NA 2CZCA 2NUAA 3C7DB 1DIGA 2YY7A 2X5KO 1PZGA 3ENKA 3L0DA 3DR3A 3MWEB 5H82A 1WZIA 3TZCA 2VUTA 3ONFA 4PLVA 1B16A 5KCZA 3D3WA 3V2GA 3R6DA 3CTMA 4R9SA 3SC6A 1YB4A 2FRDA 3GQVA 1E7QA 1O89A 2OP1A 4J7CA 4XYEA 1BXZA 5G2OA 3W1VA 5ER6A 3GT0A 1ZK3A 5KJ6A 2UUOA 1I2BA 1I32A 3VHRA 3SX2A 4HNHA 3ASUA 3JQ6A 2DBQA 5A9RA 1AE1A 4J1SA 3BTSA 1W73A 2FR8A 5L4LA 3IJPA 4GPD1 5BSHA 3DTYA 4HWKA 1H6CA 3RC2A 3ORFA 2I9PA 3PK0A 1KVRA 1PZEA 4FGWA 1OAAA 4LSMA 1Y8RA 2IZ0A 4BNNA 2NU6A 4DBVO 4CMCA 2H6EA 4RF3A 4ND3A 1LDMA 1EVIA 3TL2A 4JJIA 1JTVA 2VWHA 3IIEA 1I3LA 4AJ2A 3OA2A 5GY7A 4IMPA 1XKQA 5B12A 5TT0A 2PK3A 1BMDA 5KIAA 4UVHA 4GQAA 3KSDO 2OOSA 2BD0A 3VH3A 1PSDA 2NQTA 3P5SA 3VKVA 5CEJA 4CMBA 4IS2A 4RCVA 2YFQA 1SZJG 3O4RA 4FFRA 1NNUA 3ANNA 4YJDA 1LDYA 2DBRA 3NYWA 1NFRA 4IZIA 3DMYA 4J43A 3WIDA 4D45A 1CDOA 1LDNA 1UXIA 3GZNA 4HFJA 1Z7EA 5IZ4A 2A35A 3OQBA 4K26A 1FDSA 4YCAA 4R51A 6LDHA 4CMIB 3DFUA 1Q0HA 4PLPA 3NT5A 4HFNA 1UXGA 3GVCA 3PHLA 4DPKA 2Q3EA 5JYDA 4P8RA 2UYYA 2PH3A 4PZCA 1HDGO 2PZKA 2E6UX 3MWDB 1AN9A 3I9MA 1P3DA 2PV7A 5ILOA 1YH3A 2ZIZA 3PQEA 2BI8A 5EQFA 1NWHA 5ILGA 3W4JA 3JQGA 4DYDA 2PGJA 5JY1A 1E6UA 2EKQA 5BSFA 3C85A 2ZYAA 5IAAA 4ZGWA 1UXHA 3DOJA 2A4KA 3JYNA 1M6HA 1DLIA 3CXRA 3WWYA 3I83A 2OGUA 3OJOA 5EN4A 1EBFA 1FDVA 1ZEMA 1WXDA 1BXKA 2OBYA 1DFHA 1QYDA 1N92A 2EIHA 5LDGA 4NMHA 1DDOA 1X0XA 2A92A 3HDYA 3ZU4A 4JP3A 5JY6A 4BO6A 1R4MB 4U8GA 1EK5A 4BGIA 2GD1O 2JFHA 3RD5A 3BHMA 2FR1A 4C4OA 4R69A 5L7YA 2ZKLA 4XYLA 4E5KA 3KB6A 1H6DA 1ULSA 3NV9A 4I5EA 4ZD6A 3ZWNA 1QV6A 2J6IA 2NADA 3JYPA 3RJ5A 1XU7A 2PH5A 3ONDA 3ZHZA 2DTEA 4CLRA 1ZMOA 2VYVD 3JCZA 1GQYA 2B83A 2P68A 2GNAA 4GVXA 3OJEA 1UDAA 4LW8A 3WYBA 7ADHA 4QSMA 2GPTA 2HMSA 3NDRA 4IUYA 2PWZA 3HDJA 4ZA2A 1E7RA 1Q0LA 4D0SA 1EFLA 2OMEA 3Q0EA 1NQOA 1I2CA 4Y8VA 1FDWA 2BI7A 4AJPA 5T8KC 1C0IA 2G5CA 2AW5A 5EINA 4II2A 4MVJP 2A94A 3NTRA 3JQ7A 2VZ0A 1Y81A 4CQMB 1P0FA 2YDYA 3HG7A 1P1RA 5IFLA 5GZ1A 1FDUA 3TRIA 5LDHA 1PQPA 3TDKA 3INRA 1PJCA 4J49A 4OXNA 2P9GA 2X5JO 4NG5A 4AG3A 1UAYA 3JD1A 4J4TA 4E13A 3F3SA 3BMOA 3VZPA 1ZK2A 2FY8A 2O50A 2FN7A 3KHUA 4IZHA 2R2GA 2J3IA 3H4VA 4J3FA 4YAGA 5ENDA 4CM7A 3AW9A 2CNBA 1E1NA 4J9UE 1IE3A 3U09A 1N5DA 4L0QA 3KBOA 1T25A 5CHEA 3FTPA 3HE3A 4XYBA 1YDEA 2X0IA 4J1QA 1F06A 2C07A 1NPTO 4HX5A 1B8UA 4UUNA 1PS8A 2WD8A 4E2XA 1U2GA 2JCYA 2WD7B 3S1LA 2HDHA 4WASA 3WGYA 1BGVA 4JGBA 3DZBA 2VRBA 4K9DA 4GAEA 4YT4A 2EERA 1V6AA 4PLYA 5ITWA 2C5EA 4OSPA 1JWAB 2R00A 4KTTE 1BDMA 5I8ZA 3UCFA 1QRRA 5KJFA 5F1OA 1ZK1A 2ZB3A 3EVNA 4TQGA 1C3VA 3RUAA 4DIOA 3DWFA 3ITKA 5JO0A 3OQ1A 4XQCA 2QYTA 5BSEA 1X14A 3DOCA 3I9KA 4IBOA 2CVQA 1U9JA 3D5TA 1P9LA 2VCYA 1HXHA 1I2ZA 1Y6JA 4RPHA 1EBUA 1NR7A 2HLPA 1EFKA 4B3JA 5DF1A 3E03A 2WDZA 3IQDB 3O9ZA 1IHXA 3AUUA 4WCFC 5DNAA 4I5GA 2B4TO 2ZQYA 2SCUA 4FN4A 3RUEA 1YOVB 5L45A 2D59A 3ZDFA 2JFGA 1ZSYA 3Q3CA 3C7CB 1ADCA 5IDXA 2I99A 1U3WA 1DC3A 1ID1A 1JW9B 3M2PA 2HK7A 3NTQA 4F45A 4ZVVA 3OICA 3HN2A 3EMKA 4EUEA 1DIRA 2C7GA 3DBLA 4FB5A 2EKLA 4DMMA 1RM5A 3TZHA 1UXJA 3WYCA 1PJ4A 1XA0A 1TB4A 2V6BA 5JYEA 5KKAA 4E0BA 5L51A 4NFSA 1O6ZA 3WGGA 2VHVA 3JQFA 1LLCA 2I3AA 4RDHA 1U3VA 2FPIA 5CG1A 3AY7A 4GSKA 1N2SA 2EJWA 4XZ3A 3RWBA 4AJJA 3M1AA 4LMRA 1VJ0A 2CD9A 3EZLA 3OQ6A 4GKVA 2YZ7A 3ZW8A 4L74A 1LSOA 4F46A 1E3WB 1WDKA 2CSUA 3RI3A 4D42A 4RO0A 1T2EA 2I65A 3LT1A 1I3KA 5TSDA 4OMUA 4E6PA 3VZRA 4PLFA 4GX2A 4WUVA 1LEHA 1A72A 3H9JA 4NBVA 3ADPA 1HWYA 1YXMA 5DN9A 3ROKA 1HDOA 1LRJA 1I8TA 2AQ8A 3PRJA 1DC6A 1GPDG 4MVJI 2NQ8A 4XKJA 3K96A 1EQUA 1M2WA 1SC6A 3VH4A 4CUZA 4KOAA 1X7GA 1PGJA 2BFPA 4B4VA 2X0RA 1U8FO 2QRJA 3ZWWA 2NVUA 4PLHA 2NWQA 4CM8A 6ADHA 2C2YA 3PZBA 3WDSA 3GEGA 4ROSA 4EJ0A 1UJMA 2JHGA 4JN6B 5T6BA 3WYEA 5KVVA 1ENYA 1P1HA 2IYOA 4E4YA 3BAZA 4Y6PA 2AEMA 1NFQA 1YDWA 3GG9A 5JC8A 1K89A 4XX0A 1NQTA 2X58A 4CLOA 4AVYA 1Y5RA 4PVDA 5U9CA 3RU9A 1GV0A 3E82A 2RBEA 4DC0A 4E21A 5J23A 3CKYA 5DP2A 1GZ6A 4TVOA 1KS9A 3WQRA 2B37A 3QWHA 4ZRNA 5JE8A 4YJFB 3N74A 5JC1A 3MZ0A 3CZMA 4YT8A 3EZYA 2F00A 3NX4A 4RVSA 1TT5A 2QX7A 2ZCUA 1Q0QA 2DKNA 4O5OA 3FRJA 4XJTA 3UVEA 5A03A 3FF4A 3K6JA 4EYEA 1HDYA 4O63O 1H5QA 1GUFA 2WYUA 4QEDA 1VL6A 3QE3A 5COAA 4FFNA 3ZZNA 4D46A 1EUZA 3GZ4A 1C1XA 4RL6A 1PL7A 3PDJA 4I1IA 4Q3AA 4GX0A 4BNJA 1L1FA 3HFGA 2X7HA 2OBNA 3G1TA 2GCGA 2JAHA 1RKXA 2HK8A 2RH4A 2WE8A 3JQEA 1GTMA 3KEOA 3TSCA 4CM9D 1UAGA 5EERA 4M89A 4LVCA 1OC4A 2Q1UA 4U5QA 3SC4A 2D2IA 2F1KA 3NUGA 4E2YA 1DHTA 3QVXA 4Z3DA 4BNWA 3K30A 2H9IA 1ZIDA 2PZJA 1BDBA 1BVUA 1J0XO 3WQSB 3ZWAA 4K6FA 3S2GA 3QVWA 1HE2A 2Y99A 3JD4A 1LDEA 2PZLA 4IDBA 1KC3A 3RUIA 1ISIA 2EF1A 3ZV4A 4UEKA 1DIAA 1UP7A 4GSLA 5DP1A 1QYXA 1ZEJA 4WE3A 1PWXA 1EZ4A 4H15A 2B69A 2WMDA 4CLXA 4NJMB 1P44A 3ZNQA 1QR6A 3I5MA 3O8QB 4YBZA 5HS6A 3VPFA 4DGSA 3JQDA 1LLQA 2Q50A 3QQPA 3HB5X 3I52A 1EK6A 1BG6A 4CQLA 4DTIA 1VRWA 3GLQA 2G76A 5A02A 3B20A 3D1LA 4HADA 1TA4A 1A5ZA 3GC6A 3QVOA 2BGKA 2O7QA 2X9VA 4BQRA 4MKZA 2JAPA 4R9RA 3HDQA 4W7IA 3IMFA 4LVUA 4IGEA 3T4XA 4YAKA 1PGNA 3FR7A 2EW2A 2WJPA 2VYND 2IEDA 4KTVE 3WMWA 1M76A 3WGIA 4NU5A 3RC9A 1E7YA 4KMSA 4WLNA 5AXAA 3V2UA 4ID9A 4CMEC 3QWFA 1WPQA 1N9GA 1PZHA 3JQ8A 3HFSA 1DHRA 1QLJA 2GN8A 1ONOA 4J4BA 2X0JA 3JD3A 3I23A 5IZCC 1BRMA 1U4SA 2Q1TA 3FNGA 4DYVA 4BO5A 2JCXA 4N7RA 3TOXA 5FYDA 2O2YA 3LF1A 3TL3A 4PIVA 3DDNA 1JA9A 1QG6A 4XRRA 5CEEA 4BNHA 1L7EA 4NZ9A 3KYDB 3DHYA 1NP3A 1PR9A 2UAGA 1ZVMA 3GFBA 4CM4B 2HRBA 3BMCA 3DTTA 4I5DA 1VKNA 2UV8A 4LK3A 8ADHA 1RJWA 5EESA 3MJTA 3WLEA 4YJGB 3A1NA 1KIFA 1XLTA 2IRWA 4DLLA 4JXKA 1FF9A 1XWFA 3ST7A 4GMGA 4OYRA 3RSHA 1YWGO 1VL8A 5G4KA 2P9CA 4PG4A 4FSHA 4LMPA 1NXQA 5AOVA 1X15A 1K6JA 4W4TA 3W4KA 4KQWA 3RBVA 2PD3A 1YBAA 1LI4A 1X13A 5A06A 3BTOA 1J5PA 1O5IA 1UXKA 1GYRA 1YQGA 2Y93A 3D4NA 3JQAA 3BMQB 4W99A 3GUCA 4YQZA 4CV2A 1NX6A 3PDUA 4BV8A 5BT9A 3IDSA 3KLMX 1A4IA 3WJ7A 3U4CA 1B3BA 3CPSA 2YHUA 3PVZA 3ZI0A 3MEQA 1GEGA 4YT2A 4IDFA 1ZXBA 4RDIA 4ZQHA 5B37A 4N5LA 2CDBA 2UUPA 5JAQA 4UEJA 3GVHA 3KYCB 4TRRA 4PLTA 1NPYA 3Q11A 1UZNA 4YPOA 3FBTA 4CR6A 5F1KA 1A27A 4A0SA 3GVXA 2WEKA 2VOEA 1E6WA 2H1SA 3F1LA 3NGLA 1U4OA 2UVDA 4BQPA 1EEHA 1RWBA 1XGKA 3S2IA 4EZBA 3ASVA 4NBRA 5T64A 1PJ2A 3LLVA 5KNLA 4U7WA 2E48A 3H9QA 4IJUA 3T7CA 3OFSA 3EUWA 2VOJA 4NBUA 3WBBA 1KEPA 1U5AA 1V3TA 1D1TA 5JDCC 4BV9A 5EPOA 1GFSA 2DBVO 1UP6A 3B70A 4YJHB 3JQBA 4NBTA 4RV9A 2DFDA 2AMFA 4Z6KA 1K2WA 3RROA 3WFIA 2HJSA 2DTXA 3AI1A 3FD8A 4DMLA 4R3NA 2HK9A 5JXWA 1SO8A 2YDXA 1VE9A 2Y1FA 1IPEA 2DPGA 2W4QA 3PFWO 5DBGA 2VT3A 4CL3A 2Q46A 2PKQO 1HYHA 1O94A 5L40A 3GFGA 3JYOA 4MKXA 5HTOA 4TRNA 1B26A 1UZMA 1PL8A 1DC4A 1ZH8A 4TWRA 2OFPA 1VSUA 1KBZA 2BFAA 3UN1A 4ZQGA 4GI2A 4D3SA 3VOSA 5TIIA 1WMBA 4URFA 3VVCA 1IPFA 2Q49A 2H5LA 3QY9A 1GZ3A 3AWDA 2XOXA 2NU7A 2W2KB 5TJHA 3O26A 1LX6A 3WG9A 4ZJUA 4Z3KA 3LU1A 3CE6A 1H94A 2QRLA 3LDHA 3R0IA 4P38A 3TZQA 2D4AA 5TT1A 3UICA 2AEFA 1H9BA 1MB4A 2V6FA 3FPLA 3K9QO 1R4NA 2VYVA 2Y66A 1DFGA 3BTVA 4MDHA 4NQZA 4ZQEA 4Q3CA 2WWRA 3AOEA 3PJDA 3TJRA 4XEHA 1D8AA 3LQFA 3ZU3A 4S3MA 2ZJ1A 1OFGA 2VHZA 2ZTVA 4KWIA 1S7CA 4W7HA 3ZWOA 4M1QA 1A4UA 4ZICA 3H9UA 4BNZA 1Y9AA 1U28A 1PQUA 3Q2KA 5G4LA 2DPHA 3NDIA 3H3FA 3LT2A 3WTBA 2EP7A 4BO9A 2FWMX 3GY0A 5TX7A 4DQVA 1HE5A 4WECA 2FPGA 1Q1NA 3JQAD 4JJFA 1BW9A 3GMSA 1R0KA 3MJVA 4IDEA 4WNIA 4E5PA 4OKIA 3PYXA 4WEQA 1XR3A 1YE3A 2BKAA 1CWUA 1QLHA 1ORRA 3Q2IA 4ND4A 3CSDA 4IJWA 4EDFA 4I08A 4GBJA 4XR9A 2DAPA 1LUAA 1A9ZA 4W9NA 3RVDA 3K92A 1JQBA 4M87A 3NDJA 3OJLA 3GHHA 4RLSA 3DBHB 2Y1DA 1LDBA 4MOWA 5IDYA 2GF2A 4YR9A 1A7KA 2VHYA 1M66A 2Y1CA 4B3IA 2C0CA 3HSKA 1QSGA 2NNLD 3C3XA 3DBVO 2CDCA 2W2LA 4DXHA 4YXFA 1PU2A 1IY8A 1LSJA 3BMNB 4NHEA 2E37A 1Z45A 1YBVA 4I9UA 4RVHA 2NTVA 3QV1A 5IDWA 2B4RO 2GO1A 3EW7A 4YRAA 1QXSA 1LDGA 4R01A 3F47A 1U3UA 2NV6A 1E5LA 3GF4A 1V3VA 4MPDA 3QWBA 1V8BA 5CDYA 5KJCA 4DL9A 1ZJZA 5JDIA 3HUDA 2PZMA 5ADHA 2DM6A 4YAJA 5AVOA 3WGQA 4J1NA 4E5MA 3P7MA 4IQGA 4NFYA 2JJYA 2QQ5A 1NQAO 3I9OA 2BRUA 2GZ3A 4E5YA 4RJTA 4KZPA 1CJCA 1ONPA 3KLPX 1IUKA 3HB4X 3WNQA 3DQPA 4RZHA 3IP1A 1B7GO 4CM1A 3DAFA 4FW8A 4M54A 2ZJ0A 3EK2A 3O38A 5IF3A 4ALKA 1YL6A 3UKOA 3V1YA 3ROMA 2JCVA 4IS3A 4XGIA 3DXFA 5BNTA 3QW2A 1HKUA 4PRLA 5KJ1A 3OA0A 3KM0A 4EBFA 4HNGA 5DT9A 4L4SA 3ZWXA 4CPDA 3RFTA 5MGBA 3HNPA 3ZNOA 4FC7A 4G2NA 1QORA 2PGDA 1F14A 2EWMA 4OXYA 4C7JA 3VTFA 1F8GA 3U62A 3A9WA 1NBOA 3U9LA 2E4AA 1VM6A 4B79A 1IB6A 4PCVA 1MXFA 4L9RA 3MTGA 3PHJA 1EUDA 2WTBA 4A5OA 4DWVA 3AI2A 5I7SA 5AXBA 3QSGA 1NAIA 1HZZA 2CUKA 1PJLA 3KSUA 1LA2A 2W8ZA 3IP3A 4B4WA 3JSAA 2YV2A 4H16A 2W90A 5JCXA 4G65A 4R4JA 3RUCA 4RVDA 4HXYA 4AJNA 1NAHA 3TOZA 4B4UA 5IDQA 5FF9A 4HFRA 3R3SA 4CM6A 5COQA 1MG0A 1A71A 4E30A 1BXGA 1IL0A 4FJ2A 1EDZA 2P91A 4HY3A 5I7FA 2GSDA 1GYPA 3D3EA 2BGMA 1I30A 4JROA 1EVYA 3WFJA 5KVSA 1PL6A 1HT0A 2AQIA 1EUCA 3OIFA 4ALNA 1RM0A 5G0WA 4D79A 5DULA 1GAEO 3OETA 3OHSX 2Z1MA 2X8LA 3IJRA 4A03A 3FBGA 1P1FA 1Z74A 3PIIA 3RU7A 3IUSA 1NVTA 2YYYA 1RM3A 3PEFA 5DCWA 2VZ9A 3V1UA 1ISMA 3CZRA 1SB9A 1WDLA 3ZWYA 4BO3A 1KVUA 1R66A 1NTOA 1L7DA 3U0BA 3ZU5A 3VZSA 1PJ3A 2VHXA 5EMHA 4RQUA 1P1IA 3AI3A 4JBHA 3ROQA 3H9GA 4CUJA 4ALIA 4DQUA 4I9NA 5A3JA 4ONEA 1X1EA 1N1GA 2W2LD 2TMDA 4S1VA 1YB1A 2JD1A 1MC5A 1LU9A 2VTEA 2WE7A 3DZJA 3JQGB 1M67A 4M86A 3RKRA 1DPGA 5HWSA 4IDDA 4X54A 4TRJA 5F21A 3WIEA 2V7PA 1YJQA 2Q2VA 3AM5A 3F46A 1PS0A 4UAGA 4J7UA 3Q9NA 4NJOA 4YAEA 1NVGA 2D1YA 4E31A 1NM5A 2CY0A 4CODB 2G82A 3H5RA 5C37A 4MP6A 5I7EA 1SOWA 4WLVA 1ZK4A 3AUAA 2DU8A 4B3HA 1LQTA 1YKFA 2GN4A 2NM0A 4Z0HO 2Q45A 2AA3A 1YGYA 4BNFA 1HYEA 3AY3A 1MV8A 4CQMD 1PGQA 3G1UA 2IDZA 3Q6IA 1X7HA 4CLRB 1XIVA 2Q1SA 4MVJM 2PNFA 4CM9A 4EW6A 5G0VA 4BB5A 4HKTA 1PS9A 2J5KA 3A4VA 3AY6A 4DC1A 2B5VA 4K28A 1B2LA 3S8MA 3PHHA 3PYMA 4OOFA 4W82A 5JBIA 2OZPA 1Y5MA 1B0AA 2EJVA 2W98A 5JCJA 3O03A 4UVGA 1HF3A 3U3XA 2FZWA 2JKVA 4R16A 3WS7A 3JD2A 1E7MA 3HZZA 1E1KA 3L4BA 5DCUA 4BNVA 3X2FA 4GVLA 1UP4A 4UVEA 2XXBA 1KVQA 4BNYA 3WLFA 4DVJA 2WYVA 1OZAA 3DZIA 2J3JA 1VC2A 3OEYA 3JQ7B 1CQJA 5C7IO 1D7OA 1K6IA 4OGWA 3PI7A 4RF4A 4ZN6A 4XGNA 2Y1OA 5KOIA 4AJLA 3PPIA 1C0KA 1O8CA 1YJ8A 4O59O 4OJNA 4YVFA 1ML3A 1T2AA 3E6AA 4LRTB 3CEAA 1X1TA 2B36A 1XSEA 2RIRA 4MKRA 1OC2A 4OXKA 5CDUA 3BMOB 4D44A 4OAQA 1PJBA 3H5NA 1PJSA 1HDZA 3WBFA 1T26A 4FJ0A 1U2DA 4IJVA 2O2SA 1JAXA 4NR0A 5A3VA 1MLDA 2GDZA 3F4LA 3SLGA 2VYNA 2XXJA 2Y0CA 4WLUA 2Z5LA 3DC2A 3ENNA 4FPXA 3W6ZA 1GV1A 3M6IA 4MP8A 4IM7A 3D5QA 4QECA 1ISHA 5I9LA 3HHPA 4UUMA 5A05A 4ND1A 4RZIA 2VN8A 3FHLA 2OP0A 4DLAA 2AEJA 1DEHA 2E82A 3QWIA 4BKQA 1EVJA 4XRGA 5AQ1A 2Y1EA
chains in the Genus database with same CATH superfamily
2QL7A 1FFGA 4RHCA 1TQ4A 3BXGA 1SHUX 2PGAA 2QMZA 3JVDA 4J0CA 1JKXA 4FUQA 2EG9A 2NSYA 4IW3B 1C50A 1EX7A 2VBGA 3F5QA 3FMFA 4EPWA 4IDNA 1ZGJA 5I9NA 4EWLA 4DV6B 5JSZA 2QGNA 1OJLA 1ADJA 4D0RA 4BQSA 2ZUFA 3O0TA 3K2QA 4HATA 4G81A 1ZJJA 2OO3A 4LI3X 4BNTA 1KARA 4D3DA 3LYLA 5DN6D 1FJHA 5KTOA 3L7NA 4QPJC 3LCUA 4DZZA 3LYUA 3NORA 1FMJA 4MIOA 1VLZA 2VF5X 3DBRA 4CMAA 2B4QA 4M9XA 2ZRIA 2QZPA 1NV8A 2R2AA 1QYIA 1M34A 1PTJC 1DCKA 1BTOA 1WX1A 2XUAA 1LC0A 1HV8A 2SCUB 1AK1A 4Y6QA 1RHJA 4UHKA 4F5ZA 2DT8A 1CKEA 1V0JA 4GLFA 2GPWA 2PN1A 3M6MD 4BNMA 2UUBB 4ACBA 2W2NA 4CIWA 2ISSD 1QGOA 3I6QA 1QTIA 5KKCA 5LP6F 1T6NA 1KY3A 2QHXA 1V35A 1NXPA 4R41A 4F9TA 1E18A 5JANA 4EY5A 2Z8ZA 1EVLA 3RQSA 1WDWB 4GMXA 5F77A 1DEOA 1UPXA 3L82B 2WFAA 1OX4A 5IXSA 1EINA 2QK4A 3BFPA 3IT2A 4MMZB 1WW3A 5DWDA 5ESRA 4EHDA 4XIFA 1YBFA 1Z9BA 2NP7A 3T52A 1LNZA 3AOGA 1H42A 3TAUA 1LTKA 1QBGA 2OK7A 2VXBA 3MB5A 3TD9A 3C14C 2X2FA 1LF0A 4QTYA 3A06A 4BMYA 3PC7A 4IUCS 2O7VA 1CYDA 1Q3HA 1GAXA 4ZOQI 4HTFA 3HCOA 5CIYA 2PX5A 3KB8A 2RHRA 4FMDF 1L1RA 5CDSA 3GARA 4PR0A 2UXDB 4JLBA 4MHOA 4O8ZA 4REMA 4Q82A 2QKYA 2RH5A 1X6VA 3B3JA 4DQ0A 2P4HX 4K9OA 3H83A 4PYIA 1IK4A 5DDIP 2V65A 4EAQA 1KAMA 4RXMA 2J0SA 4E4RA 3E9YA 3ZVMA 4LFBB 4AZ3B 3G68A 1AN0A 2E0IA 2DLDA 2WM3A 1SWVA 2JW5A 4RQBA 5CLLA 2P3OA 3ZHYA 4ZPXA 5AVTA 1RC1A 2J87A 4ETIA 4JGGA 3D7LA 3B48A 4GOOD 3SQNA 3WGTA 3ZKWB 2H16A 4Z9YA 1H8EA 1Z2EA 3L84A 4AKEA 4B80A 4EGQA 4AWBA 4P0QB 3WJAA 1VJDA 4OJKA 1ZO8A 2E6KA 3RW9A 4H1WA 4NRDA 1PT9A 2Z5FA 3AMVA 1YQ9A 2QN1A 2NTJA 3JZDA 3MJ4A 4LRXA 4ENSA 4DV4B 4RA6B 4FZJA 4D8TA 1G55A 2Q5QA 1MB0A 1ISFA 3STXA 3WP1B 4UUPA 3T4EA 2IYSA 4HXEB 3VR3A 1I4LD 2PKQP 2J7KA 3MC1A 1JG1A 2C4MA 1E9DA 2DHCA 1ZBDA 3BA1A 4WKCA 2XNJA 5HQTA 4RD3A 5B55A 1KYWA 1O0CA 3EHEA 5KPJA 2JPDA 4IQ0A 3NR2A 4OHKA 4F9EA 4MWSA 2AF3C 5IAJA 1YR9A 1JSRA 3O31A 3T7JA 4BMNA 2C20A 5B1EA 2IIPA 1HDRA 1U5CA 4KQXA 4LHWA 3DEIA 3GEBA 4X00A 4W1PA 2X4GA 3GAMA 2ZSUA 3SVTA 4UVIA 1YZNA 1B14A 3V5NA 5F7XA 4WHMA 3PNPA 1WVGA 4I3FA 3TWOA 2I8LA 3VSBA 1JQKA 2NUTB 4YPFA 3RS0A 2IIQA 2FRDC 1JIVA 2FUEA 1E77A 2HO5A 2ZRCA 3NHPA 4X64B 1N8NA 3CG4A 4YP7A 2GM3A 1DZIA 4CETA 4C88A 1EVZA 5CDTA 1NLUA 3KOOA 4QO7A 2XT6A 4C7OA 1DEAA 1BOOA 2BR3A 1F2TA 1ZH4A 1W34A 1JL3A 4IX9A 1CUHA 1E2EA 4NU6A 1S89A 2O19A 5K03A 1YA4A 2VT2A 4M0KA 1WSAA 3KKPA 1HDXA 5JSFA 1FP7A 3A1CA 3T3NA 1DFIA 1WWKA 2R68A 3B6KA 4CFYA 3R40A 2YIDA 2BZ1A 3QENA 1YQXA 1UDRA 2PTGA 2JFWA 3T3PB 1XE3A 2BEKA 4B9AA 3M0EA 4DBLC 3GFPA 2D8MA 4UM9D 1F2VA 5BWCA 1WW2A 2YVUA 4BECA 1E1QA 2P3LA 1U1DA 1CHNA 4PHTA 3RTCA 2P5SA 5DCYA 4CNQA 1M2VA 2IHYA 5BV2P 3VH2A 1U7TA 4Y7DA 2M1ZA 3U81A 3VH1A 5JYCA 2NO1A 1R00A 3KTDA 3LDFA 1XEAA 1L5HA 3T3HA 9ABPA 4DREA 2GAJA 1RDFA 4DILA 1FNSA 1MQ9A 1ZIXA 2DFVA 2GMWA 3MCZA 1P45A 2CXNA 1P4RA 4L3OA 2GPSA 2R65A 2UYQA 4COOA 2Z6UA 2WUGA 3PQDA 1CJTC 2DPXA 4FBLA 5EIHA 2V3VA 3X2EA 4HSGA 5ECDA 1YA6A 2HA0A 4LSWA 3RE1A 4ZI3A 4C6TB 5DM70 1P18A 4BL5A 1FFXB 2XA2A 1K0FA 4EI9A 2QX6A 1BH6A 5G40A 4P92A 2WVGA 1DAEA 4LTMA 4C05A 4FYHA 3SXPA 1IK6A 1LLDA 1UKEA 4P7JA 4DPLA 4WY5A 1N0HA 4NH4A 1OZFA 1PD0A 1WXGA 3A04A 1LQUA 1RXIA 4GLLA 3TINA 3I5AA 3T12A 1Y8CA 3KVRA 3DXZA 4MQLA 1MZVA 1DRKA 2PSHA 2XZOA 5TQJA 4D0NA 1QPBA 2BR4A 3RSQA 5DNDA 5E7IA 3U3DA 1JEYA 1I2AA 2YJ6A 4Z4GA 2HW8A 2JD2A 3ESQA 3WGNA 1ZSNA 3UAGA 1DL5A 2HQRA 1DB3A 5EP4A 4EJFA 4DG8A 1LRLA 2CL6X 3DPSA 3PEVA 2J5XA 1FFSA 2P9FA 4YLGA 3CSUA 3P26A 1H2RS 3OJWA 3NHSA 5SYNA 1M3SA 2C7PA 3GL9A 3GR6A 1TFRA 3W78A 4BGUA 4CT4B 1P7PA 1VJ1A 5TGDA 1T9AA 4MUGA 3ZHBA 1PNRA 2ZUTA 1USVA 3UY4A 4NCIA 1OV6A 1N2CB 4L2IB 1Y3AA 3FNHA 2CNWD 2PUJA 1Z88A 1SXJD 5JYBA 4I55F 1E62A 2Q1XA 1JLSA 3QVGA 5BYJA 3K0HA 1WOYA 2OUKA 4XOIA 4TSFA 4DA9A 2FN9A 3CNBA 5HS4A 5JAZA 5KTSA 2ZWIA 1Y7LA 4OB8A 3SIRA 4FTWA 5BNZA 1DP4A 1YZHA 3C1TA 3FVRA 1P0QA 2BMFA 4MW0A 4IIXA 2O3TA 2AG8A 1PKEA 5DX8A 3TF5A 4OJTA 1FL9A 2YWFA 4D9FA 1B8OA 3L8YA 4EB0A 4F0JA 2G9NA 2O48X 3ENWA 3TZKA 2BE7A 1E2IA 4MGKR 1U7WA 2Y9PB 2CXRA 1U0EA 2G1UA 1H2WA 1W52X 3PNSA 4UPVA 1IBKB 2GAOA 1GQOA 3IIKA 3OT1B 4NABA 5AKLA 2VH2A 2NZXA 3V80A 4E22A 2WINI 4BXOA 4GKJB 3G17A 3CCCA 3NAZA 5DASA 2BM9A 2O6LA 2CC2A 4ASUA 1VKJA 2HGZA 5ITZA 4EYQA 1P1JA 4MVJH 3IGFA 1IN1A 2QSYA 3M4XA 4HS9A 1NMQA 3R9XB 1JWLA 1IBRA 2C00A 4LBWA 5GOTA 5FTWA 3V7YA 1IULA 3IAXA 3SF8B 1GUBA 1R3DA 5IU6A 3FF1A 5TQ0B 1QRSA 2GCOA 2XMPA 2HBYA 3HFRA 5F5NA 3VPHA 5KVCA 3M82A 1R10A 1ZH0A 5DSTA 1DIOB 1YS4A 2C9YA 1T0HB 2XRZA 3TIFA 3PGVA 2Z0MA 2AFHE 4WBXC 3UK0A 4YYEA 3OPQA 4B7UA 2A9QA 2NT3A 2ZCVA 2AQKA 3E1SA 4YDQA 4WXPA 3BJIC 4H60A 1FS6A 1JDJA 4D7AA 3GMDA 4RTJA 1G42A 4OSEA 3RVPA 1FYFA 5A7HA 1N2EA 1F12A 4FB4A 5HKKA 4OLBA 3I42A 1I80A 2V8BA 2VBFA 5EJEA 1Z6TA 2QYSA 1DE0A 3DMPA 3EGDA 3I8SA 1MFPA 5A5DA 2PGNA 2Y2UA 5G0TA 4AZ0B 4DB4A 2Y68A 4BKRA 3EAQA 2ZJ6A 3ZGZA 2YUIA 1WXIA 3TNJA 1GZ7A 2ZBPA 3QOXA 1N5LA 1V8OA 2YWEA 3LP6A 1WU7A 2C7BA 2PGLA 3I5XA 4AD8A 4V39A 2GARA 5TEWA 5CUQA 3N8GA 2AXEA 5ITVA 1AO3A 1RIIA 4KRYA 5FULA 1R27A 3GCGA 3HB0A 4BC1A 3FWZA 1PJRA 1GPAA 1XZIA 3GYGA 4LEIA 1EX6A 2PYDA 4GWGA 1UMCB 4CIXA 4GOJA 2Q3HA 4LZOA 3VDNB 4RD6A 1OBOA 4QDTA 3OUTA 5FA5A 1NU8A 2W6OA 4RVFA 2OBFA 2HT1A 1U7XA 1QP0A 2IBSA 1ZLYA 1GFWA 3J81A 3NP7A 1T9DA 2PV0A 4R0VA 4F04A 4QXPA 5H80A 1FMFA 3UHJA 3KT8A 4CTMA 2AD1A 2ZE5A 3R0XA 4JGIA 5KSYA 5THQA 3QX9A 1E6EA 5CXQA 4NS1A 1UDWA 1V8ZA 1M8KA 1F5SA 2AV6A 2IHJA 2YQ5A 3CPJB 4FFOA 5GPBA 3EMDA 3X1WA 4EKDA 2YVLA 3KPYA 4LCJA 1COWA 2XWJI 4MUAA 3A6FA 1N7GA 1YS2X 2OHHA 2AYXA 3C3EA 3HHEA 3N05A 3ZTYA 1ZAYA 2I7VA 4MARA 1Q1ZA 5DTIA 3A9SA 2I6GA 2C5LA 2XKBA 3DEJA 4H7PA 1WF6A 1Y1PA 3I6BA 3IL2A 4ETMA 1JN0A 3A1EA 4HDOB 4B71A 1H05A 2AFIE 4LYJA 4EB3A 1W1WA 1TYAE 1ZGHA 2JBAB 1TM4E 5K0GA 3AGPA 3IXQA 2C94A 1RQ7A 1EDBA 2WJWA 1F0KA 1E64A 2IKQA 3FCOA 4U0KA 2QSUA 2NZ2A 2C2WA 4NCXA 2NPFA 1NYQA 4J0IA 4IDCA 4MS4A 2GPYA 1U65A 2WIAA 2ALJA 3BJZA 2XH8A 3PXEA 5E2IA 4HZIA 4NZMA 5L3ZA 5TJ9A 3JARB 1DSSG 4YNBA 3B52X 4HWRA 1LXCA 4WSOA 1SIUA 3F9RA 5AIAA 4EFKA 5L7TA 3PT5A 1FLVA 1BKYA 2FJUA 2PUVA 4KL8S 1D2CA 3ZW7A 4C14A 2OB2A 2GAIA 3HPQA 3O92A 3PGJA 2DUUA 3M81A 1KJ8A 1GPWB 3REGA 1GPH1 3T4UA 4H7EA 1XDWA 2ZBVA 4C6SA 1MAVA 2Z56A 4OKNA 8LDHA 3UHAA 2YJ5A 3I2IA 1Q19A 1OZGA 2B8JA 3TQHA 3MINB 3S55A 3HUTA 3R5XA 4HNSA 4EB6B 1P5HA 5IKMA 1R4NB 1NONA 1YJXA 3HK2A 4HDRA 2F55A 5T4BA 5CLQA 2Y1GA 1T0PA 1Y4AE 2QRKA 4ITRC 2QLBA 3AJRA 5DIZA 5ICCA 5C3UA 4LI0A 5AKEA 4F56A 4Z99A 1QQBA 4Y9DA 1LTHR 1IZ0A 1WDTA 5SV2A 1Z7GA 3FB4A 3T5DA 3TDMA 2VNAA 3K32A 1ADBA 1FYWA 5KZMB 3RSSA 2D0PB 5HILA 4AWAA 3C1UA 1PQYA 4KB5A 4Q3DA 3KRTA 2J3QA 2EXXA 1U8XX 2ZYRA 4FBGA 2KWIA 4HPWA 1RPTA 1UK8A 1NQWA 4HNAA 4JNKA 1NIJA 3PPXA 2CJWB 4OLJA 5C9ZA 3FJOA 4LHVA 1Z0ZA 2FLVA 1XRNA 3AEUB 2ZYWX 1VG9B 5BR8B 3E2PA 3COSA 2ID7A 3FMGA 2HCBA 2GFIA 3DDUA 3QVTA 3CX3A 3OU7A 1G63A 2A78A 3Q9UA 3HWWA 3B53X 1LPPA 1OX5A 3AB3A 4UBLA 5J2UA 5EMJA 3BWMA 1P6UA 2WD7A 3CVUA 1Q7BA 3THWA 1E2MA 1SXHA 3RHZA 4RWEA 4H1TA 4MR7A 1SOVA 3K4PA 4PX2A 3HCEA 4ABTA 1U98A 3MTBA 1UBJS 1M5UA 2AJDA 4HSEA 1NVMB 4GDMA 1JFRA 4KGVA 5DX0A 3M8KA 2VPWA 2ZE6A 1JB9A 1Y8RB 1XMIA 4Q3BA 1BDHA 1GDHA 4OYHA 4WX2B 1D4AA 4Q37A 3MBKA 2PUDA 1LI5A 1SCAA 3TNFA 2WHYA 2D3WA 3RVBA 3MPOA 1I51A 2FPOA 3GEDA 4FCVA 5IYZB 3Q8MA 2ZTSA 4R84A 2XDYA 3EDMA 4L4UA 3BHIA 1NR1A 4HCJA 4Q4CA 1W9HA 5DNWA 1EGAA 5A2QA 1EFVB 3EG9B 2JHPA 3M6FA 2G4VA 3OBIA 2RFLA 1PEYA 4WZBB 4E3ZA 2JFQA 4EGFA 3HB1A 3ZE9A 3GRCA 2WKRA 4A2CA 3SGLA 4XIJA 5ESDA 5E6RB 3TQRA 4A26A 4KWHA 2VQ6A 4EMSA 3U3MA 1PR0A 3ROPA 4FQ8A 4AMBA 4GGPA 1DGQA 3T5TA 2PLNA 1IYZA 3T06B 3EDQA 3AESA 3BRWD 1A3CA 1VJCA 5CB4A 1PDWA 3GZNB 4Q3NA 3NGMA 2HMAA 3CPHA 3O2JA 2DOKA 3GJ4A 1YBHA 3BFKA 4MPJA 1BIFA 3W8EA 2GN1A 3TFQA 4OL0A 1YCFA 1JA0A 5JUWA 2HUNA 3T7DA 2VJPA 3UA3A 3HM2A 1JSLA 1QMGA 5DN6A 4KR0A 3K8OE 4B81A 4EPVA 1YVEI 4IEFB 2CVZA 3IR6A 4OOEA 3QLTA 1QG0A 3KB2A 3HJRA 1T5BA 3P9RA 2AN4A 4PW0A 1GNLA 3JQ9C 4Y1RB 2A7QA 4Y1GA 1YI1A 2NUBA 2VP6A 2IE0A 4B40A 3MGAA 1PLLA 2JLBA 1FVFA 2RHLA 3NONA 4J4HA 2IEZA 4OJYA 7GPBA 3AP1A 1U7OA 3K70C 1BGWA 1P0MA 2W8BA 2H06A 5ERXA 3C5WP 2QM8A 4PC7A 1QRTA 3O4IA 3AILA 4LAFA 3U3KA 4IVRA 1KI9A 3TK1A 1V9CA 1YU9A 3ANMA 5ICGA 3E9MA 3VX3A 1M8GA 1P74A 3AU9A 3WDMA 4DSUA 1ZNQO 1UQTA 1SKYE 4M8NE 2IH4A 3E5HA 4MVJD 1INLA 3WLQA 5CH5A 4FOOA 4Z86A 1MC1A 2G07A 2YWDA 3OE1A 4O4JF 3VNQA 2J9RA 4QG3A 1OROA 3RAGA 1ZNYA 3KDAA 1GY8A 4PLCA 4RVGA 2BF4A 3GMIA 2JI7A 1ODIA 4OQMA 4LISA 2QTNA 3CUTA 4KMMA 2X9GA 2QTAA 5HF8A 3H86A 1JAHA 5JFOA 3E5MA 4CR8A 3HACA 4ZEXA 1D03A 3LP8A 1DX9A 2P9JA 5EIBD 1EUYA 2WFLB 3E7FA 1XCJA 5A6VA 3UJ7A 3FLAA 3GJ6A 3H11B 2X9LA 3W9BA 3WQQA 5BNWA 4MJLA 1XNGA 1VPEA 4EG8A 3I3OA 1E3EA 4Q3EA 2CLMB 1K6EA 3SPXA 2J7PD 4LRSB 4HFMA 3FNBA 4IQ8A 4RQTA 1ORVA 1BXGB 1S01A 3LK6A 4MKHA 3CRQA 2QLTA 2F9MA 5T4HA 3ZHCA 2CVOA 1PJQA 3Q1LA 5P8WA 4BZZA 3OJFA 4M9CA 3OFVA 4I50B 2BFWA 3TGLA 1WBJB 4DLAA 1U80A 4FD3A 4JLKA 5J1TB 3C45A 1GEEA 1T0IA 2WWHA 2CL5A 4B8ZA 2P90A 4GM1A 1MT0A 1QGUB 1Z2OX 4RJLA 5D85A 3BILA 1V4BA 1E6LA 2X8AA 3N76A 4FNOA 2D7DA 3FMOB 1N6HA 3MILA 1GADO 1G8MA 1QH8A 2Q29A 1RAAA 2JLXA 4QVKA 1Z5UA 1JI0A 2J9FA 2O4CA 3PUHA 3UNXA 3D8NA 2YV3A 3DO5A 5SYAA 1T2FA 1BSVA 1WSWA 4PC3A 3A1TA 3FTNA 4MW1A 1C14A 1UEIA 4ZT5A 2UVPB 2R8ZA 3CISA 4OFXA 3ZZTA 3FI0A 3UM9A 4EBBA 3BB3A 5GGXA 4CVNA 4EAAA 5KOHB 4DRYA 2W6NA 4AN4A 2YXLA 4HUQA 5GMOA 4RGQA 1Z2CA 3F4BA 3PQFA 4QTTB 1EJBA 1NDHA 1T8UA 2IIBA 1TO2E 2H11A 3NHBA 2P41A 3L79A 3RAPR 2ZJ7A 1GGMA 3CZPA 4RSHA 1XZBA 3E4CA 1TL7C 2ZRJA 1OWPA 1H2EA 1KKLA 4LFCB 5AVVA 3AM3A 1TGYA 4J0DA 3HYNA 5FJIA 3RS2A 4Z3OA 4JJKA 3ANSA 2FPLA 3BN3A 5A3RA 1TMYA 4RY2A 4Q9NA 1YR6A 3L40A 4WK6A 2C5AA 2QDXA 2I2FA 1X7DA 4C3UA 1D6SA 4RKFA 5KWSA 3V4SA 4IXWA 4X94A 2WUWE 1PFQA 1W96A 3HGMA 2P7HA 1BYIA 1USIA 2BV3A 1AHNA 2QT0A 2WM9B 1XVVA 5EZ6B 3ZLUA 3T5AA 3UMYA 2VDKB 3FX2A 1U7UA 3DLBA 3ILVA 3BJMA 3DTVA 3VR1A 1TUBB 4V03A 5FWYA 3DV2A 3O95A 3HKEA 3NFYA 3STHA 2XQGA 2PMCA 1HQDA 5KOJB 3ROTA 3VKFA 1JQAA 2CBGA 3IAEA 3E23A 2BFEA 5NLLA 3EW9A 3V7WA 4BMXA 3L1IA 3R09A 3N86A 1XQ6A 3M4JA 4X1IA 3QTBA 3DCYA 2HMYB 2RB5A 4NJMA 2D5CA 4OQYA 1A9TA 3MTAA 1YJ5A 2AKYA 3D0OA 3EXG2 3GW8A 1BHJA 2XWBF 4NJEB 3T7KA 3WWPA 5D01A 4CTJA 5DZSA 3EQZA 3E7PA 3CMCO 3KQMA 4IJ6A 3UH0A 4ER3A 4DV0B 3HJNA 3T5CA 1XHLA 3A6GA 3CKLA 3ETDA 2QD1A 1N2IA 5EIWA 4LYAA 1E2LA 4LX8A 1K5HA 4LZNA 2EZ8A 4WXRA 1KYQA 4PSAA 4ZU6X 4UNQA 1VL1A 2VDPB 1ZM7A 3E15A 3EXFB 4L3WA 2OVFA 1T2VA 2XCQA 4K05A 3CUKA 1ZD4A 2FPRA 4KRGA 4PR3A 4Q4HB 4TTRA 2ZYVX 1FUEA 4IDOA 1HSZA 1Z4OA 3WO0A 4AW9A 3C8DA 3VR6D 4FDTA 3U7QB 2GLXA 4BTLA 3PR1A 1XTSA 4R68A 1HE3A 2GXSA 1U7PA 5E4FA 2GWRA 2FAXA 4CV3A 1YE5A 3NU1A 3P2JA 5C1BA 1BVRA 1NJSA 1L7AA 5HE9A 2AQHA 4MB0A 3KQOA 2YX1A 3LQRA 4O1MA 3EVEA 1CZNA 2G80A 3PC6A 3QYJA 4O2AF 2B1QA 1WQ1R 2FE4A 2K7FA 2NO9A 3PRKE 3I73A 4WT7A 5TNXA 3T9FA 4R1TA 1S2IA 4ZO8A 5AOBA 4BVHA 1Z0UA 1SR8A 2F8MA 3GQBA 4BFUA 4O5AA 3AUSA 5DXFA 1JVBA 3UWDA 4Y2XA 1GCAA 1G5IA 3IESA 2OC9A 1N6KA 2BC9A 5CH3A 4B2PA 3VQTA 5K0ZA 2HIMA 1DWPA 1OUMA 1J4AA 1H4TA 1DBWA 4D80A 1AZLA 3CONA 2FWRA 3G9XA 3K09A 3Q7EA 3ZE0B 5M34A 1SXJA 4JI3B 2P4QA 4ESEA 4HRYA 4U0JA 5T5QA 4DPMA 1FXWF 3QIVA 4YMLA 5EHQA 1ZFNA 5HEKA 5DE3A 1DS6A 1T43A 4TKMA 2V3CC 3K9FC 2GCPA 3ZWCA 5A0VA 4IGFA 1D2GA 1O6FA 3V3TA 4FWTA 1RYNA 4KR9A 2Q3MA 4YT5A 3X43A 3UC5A 1XRQA 1JHXA 3NV7A 5KVQA 3LX4A 3K9HA 3G2KA 1PI3A 4MQEB 2OXCA 2OPBA 3BK2A 1FQWA 1MJ5A 2D0IA 3BMQA 3MD9A 4UUBA 5FFFA 3N2YA 2J67A 3C4QA 3MOGA 1B8VA 3RHFA 2X8JB 5GOZA 2RI1A 2AL7A 2AN5A 3RVJA 2B7LA 2FX3A 1P1KA 3K5PA 3OTWA 4MW6A 3URMA 1E1LA 4C0SA 2UXCB 5REQA 1OMOA 3U4DA 3S1SA 4TYWA 3OUZA 4N5NA 4BHTA 4BUCA 1KEKA 2CF6A 1L9KA 4YCBA 1N2XA 3V4OA 2HEGA 1J2TA 4Y98A 4FXPA 2VNHA 4BO1A 4FEGA 5CDFA 4CWAA 2FSFA 1BX3A 4P32A 1OXSC 3E18A 2X3YA 4QELA 5GP1A 4O4LB 4LJ5A 2I5PO 5HA5A 4AXXA 4B4DA 1G3RA 1R0RE 4IRUB 3MELA 4O08A 4C21A 5K3DA 1IB0A 4TRMA 5JH7F 2C5SA 3ZGXA 4D9IA 1U28C 3SZRA 4F3RA 2OL4A 3CYFA 3RYIB 1E1CA 1XTZA 2YZNA 2J3MA 2OZKA 2HA6A 1I0ZA 2DWUA 3ZD8A 1AO0A 3WLMA 3UK6A 2PWPA 5ALWA 4MV8A 1TT5B 1W88B 2WWXA 2PSEA 3IEIA 3HY3A 1FNCA 5AJXA 5FOWA 4G0WA 2C9CA 1CVLA 2MOKA 2ZUUA 4RPJA 2EFJA 2RAVA 2W6ID 4TS4A 2H54A 5JXJA 2I33A 5CVUA 4JELA 4QX6A 2GYYA 2XDWA 1YHYA 3DOIA 4H27A 2FR0A 4RH0A 1PWZA 4MVJE 2CWWA 5EZYB 4CLDA 3CUWA 2JH3A 3RUFA 3M4YA 1YS7A 2MMGA 3PFBA 4W9NC 5TQ2A 1CP2A 1MVOA 4OCZA 4OQ4A 2R1VA 4TMFA 3ML1A 3KXKA 3O8DA 1GRQA 1S1MA 2Q4BA 3TDNA 4TTSA 1VYHA 1QGZA 2HCRA 4M9ZA 4R83A 3JD0A 1RYEA 1V9LA 1V4NA 4JJ4A 2W2PA 1OIXA 1AD2A 2QUKA 4Q16A 3FGZA 3OE5A 3ZJTA 1ENOA 1S9DA 1QFMA 3KEQA 3SQOA 4B48A 5DOZA 2QG9A 3RABA 1P2UA 2J3EA 4P3XA 2BMDA 4IO0A 3X1ZA 3ZHUA 2RK3A 5LQJA 2P6OA 5ALXA 1VLMA 3BSYA 3IAM6 1J9GA 1RYYA 3OQJA 4JKOA 4RJJA 3K1AB 3GA5A 2CLKB 2EFGA 5JQGA 1EXWA 1OGJA 3C3BA 2QRPA 3CLUD 3DFKA 2F9LA 4MRSA 4O4IF 3EF3A 2G8NA 2NAPA 3OH8A 2C1EA 4KW7A 3OQNA 1RCUA 3NASA 4HN9A 3VU8A 4F4JA 5BVGB 3EXG1 3IV9A 5EMKA 4ZZ1A 4HZUA 5EPUA 4DCPA 4FUTA 1BEZA 2QRZA 2A3NA 1CDZA 1O54A 1EGHA 2XMSA 3DGFC 2JLSA 3PEEA 2CLFB 2JFBA 2RI0A 2EL7A 4ZIRB 4O0LA 9LDBA 3ODGA 2W2KA 3PC4A 4WACA 2HCTA 5ENZA 2NU8B 3V1LA 4D8VA 3NAGA 1N7IA 4PLZA 4Y2RA 3VHXA 1YOBA 1W6UA 4UVDA 1KO7A 4CQLB 1MTZA 3TUIC 1MBZA 4DTCA 2RAUA 1Z25A 4I7EA 1LJ8A 1SK8A 3WO1A 4BAGA 4F11A 1SZCA 1Y1KE 2GZ2A 3ZCXA 1U8UA 1Y8QA 3OVMA 2HHHB 1P0CA 4QTXA 4NV0A 4X8HA 4N5DA 2B2NA 4CG0A 1E59A 4N0PA 2JI8A 1ZCZA 2ZBDA 1HZJA 1O03A 4LJ9A 3U7JA 2ERCA 2P65A 2VWGA 4BLRA 5HM8A 2RHBA 2VJNA 1P7YA 3FDXA 5G41A 2JD0A 3LSYA 2O3QA 4ZK6A 1C3EA 2F1JA 2HA5A 4IF6A 1GKYA 1L8OA 4EHLA 5FEUA 1JHDA 1K92A 4HYTA 4NY1A 3EQ9A 1A9QA 2CE2X 2OKCA 3VR5D 4YRJA 1UKYA 8MHTA 3C3YA 4IIUA 4JBWA 5HBGA 4A2PA 2ZYGA 5LB4A 2QTVA 4G01B 4EUNA 1ZHFA 4NL4H 3LNTA 3SM3A 5HBRA 3ZGYA 3PRHA 3HTXA 1NLYA 3DSRA 3PE4A 4A8PA 4PRZA 1B3RA 1FZQA 2PT5A 4IINA 3J7AC 3AEKB 3MYRA 1LD3A 4HJXA 3V4ZA 3F8WA 3IKJA 3UCXA 5BQPA 2ZVDA 4C7MA 1T2DA 3DL0A 1E3JA 2X5OA 2FQWA 2B9VA 3L6DA 4IIJA 4KFRA 3RDPA 4BVJA 3AT1A 3L3BA 2AHOA 2VSOA 3BIWA 2OV4A 3O5AA 4WKOA 4XR4A 5C53B 3RU3A 5AYVA 4R1UA 2IITA 2DTDA 3E58A 3BMCB 4RD1A 1Y6ZA 1IJBA 1ZJYA 4C0QC 2FXVA 1MGPA 1QHGA 4WFJA 4JUDX 2ZSJA 1TEHA 3GFQA 4MYSA 3ZY3A 2C2XA 2FUG6 4YRAA 1M1YB 5L6LB 4MP3A 2L42A 3PWKA 5IFKA 3HA3A 1VHTA 1XRJA 2QN7A 1UBMS 3NYIA 2OB1A 5A5FA 1EESA 3DP7A 4OFBA 1XTQA 2VJDA 2NMVA 4A92A 1D1SA 1W4ZA 1L5SA 4F71A 3HO6A 1J90A 2ZRFA 1J56A 4TSRA 2VTBB 2GGSA 3QE0A 2JLZA 3KWFA 2EKPA 3VYTB 2CL7X 5I51A 3BDAA 2BMWA 1MX1A 4S05A 3NHFA 3SK0A 1HSOA 3STUA 3F97A 1U5BB 1BHSA 1FFDA 2ADFA 2BHTA 4ZCPA 5T4FA 3IE1A 4CR7A 4GEKA 4W9MC 4MYTA 2BTQB 4GYWA 2H00A 3KZ1E 1EP1B 2R4QA 2DR2A 2IBTA 4TZKA 3UWSA 1WKBA 4WBNA 1XZNA 5FWXA 6PFKA 3PDHA 3GUYA 3RK4A 4BQFA 3HR4A 2HXSA 3VDQA 4E07A 2XBLA 1VI5A 3KUCA 4MWZA 1DRWA 2E49A 4BIIA 4X1YA 2NN3C 4G5YA 4YRPA 4GOND 4NCAA 4UTRA 3LA8A 2Q27A 2ZK7A 3R9IA 3AUTA 2Y05A 4WOJA 3SEAA 1PF7E 5BUCA 3SEFA 1V11B 2PS1A 4UOZA 2JH8A 1P7CA 1CZLA 5KDDA 1MFZA 4IH9A 3WMXA 4DHEA 5IT5A 3PKJA 4UNNA 2FN3A 4LJ6A 2IUUA 3D4OA 5CW2A 3AF6A 2OLEA 4MWTA 3TTYA 2HRCA 3QA3E 2BFCB 4EHHA 1G8YA 1YB7A 4XW2A 3PUJA 5JADA 4L8WB 3WL6A 4OHYA 2ANCA 3H97A 3L43A 3M6XA 3P9KA 2X5KO 4OB7A 4OYYA 2Q6VA 5AM2A 1HNXB 2ZEJA 4FCTA 2J1LA 3ORHA 4DOMA 1FSPA 1DBPA 5H82A 3BE4A 2JAUA 3I2YX 1WU8A 3F5DA 4FBMA 2OQ2A 1KI6B 3WIVA 3TZCA 1ZR2A 2KHZA 5D3ZA 5IX8A 1B16A 1T9ZA 3FGPA 5KCZA 3V2GA 2CGEA 4R9SA 3S7TA 3N7TA 3LIPA 4FN5A 2QL5A 2WJ6A 5DVZA 1BEEA 1TRHA 4OEHA 4XYEA 1F6DA 3W1VA 1KYZA 2QRQA 3N53A 4PS0A 2J6BA 1VA5A 1J1IA 3QFHA 1L5MA 1P75A 4L8GA 1F7UA 2OHVA 1I32A 1QDLB 3VHRA 2GS9A 3VUEA 4RFSB 4MEAA 4IJQA 3JQ6A 3HNRA 1K9VF 4OVKA 1AE1A 2PKEA 2J4FA 4QRIA 1W73A 1XD9A 3MPUA 2PS9A 3HSSA 2HBRA 5C1DA 2OGZA 5KMGB 1OWNA 4FU0A 4Q12A 3RC2A 5TLSA 1N6NA 2N1BA 3EAFA 3ZDAA 4FQ5A 5DYWA 2WU1A 3QKIA 4WFIA 4FGWA 4PQEA 4C07A 4KQHA 1JR3A 3SI7A 4R1QA 1RQNA 5BVHB 1TYZA 3SSMA 1I1QB 2IZ0A 4EVIA 2NU6A 2GB4A 3MTIA 1NUUA 4EDHA 2H6EA 2XGMA 3Q7QA 4RF3A 3ANXA 2B92A 3N59A 5ITSA 2VDVE 4JJIA 4M4SA 2C92A 2GZHA 2VWHA 3IIEA 1RP1A 3EBLA 1YR2A 3NRJA 3OA2A 3THOA 4B74A 5B12A 5TT0A 1P4AA 2C5BA 3A0UA 1BMDA 4G8CA 2V59A 4UVHA 4WH0A 1SCUB 3SYTA 1H1TA 3W04A 3KSDO 2QSJA 1QPZA 5HFNA 3VH3A 3DQQA 1AKRA 3VKVA 4YRIA 5CEJA 4CMBA 4IS2A 3U3RA 4FFRA 2FP4B 3ANNA 1W1IA 2N9UA 1QE0A 3HKBB 4PYMA 1G60A 1DRJA 4W8OA 4B34A 1ZONA 3NYWA 2WMNB 2C8KA 2V7TA 4WQMA 1CDOA 3ELDA 1LDNA 1NMSA 1RWOA 5DTRA 1UXIA 4MGIR 1Y8AA 4FR2A 1RQLA 4G85A 4HFJA 4PGGA 4ZC1A 4K26A 3DV0B 2ODWA 2GUWA 5FNVA 2O1SA 4QM6A 5AHWA 1CS0A 1UXGA 3GVCA 1ZNWA 4JUCA 4LOHA 2QTCA 5HZMA 1KDPA 4JVNA 5LNK1 4PSDA 2FMKA 2PZKA 3RM3A 3A2MA 1AN9A 3I9MA 1NW3A 1P3DA 1TCBA 1L5OA 2IYUA 4GG1A 4NICA 3WMFA 1FFBA 3OHMA 1JHMA 4ARUA 2O8CA 4YWHA 1MCZA 2YC2C 4K6KA 3QUSA 1T35A 3ZG6A 3ZV7A 4AMZA 3KALA 4D3SA 2VH1A 2F62A 3IR5A 3B6JA 1U7DA 4WAUA 4EHJA 3V1KA 5ILGA 2O57A 5DK4A 4HB2A 5FUWA 4NE2A 1WZ2A 1KO5A 5BSFA 1UPFA 4MS1B 4PY2A 3DOJA 3VUFA 1IIBA 2CJFA 1CE8B 1N6IA 2QAIA 5DLDA 1T9CA 2G9ZA 2PMFA 2EAUA 5F52A 1G3QA 3O6VA 2OGUA 4QU5A 3OJOA 5EN4A 4MAFA 1EBFA 2QQ0A 2O1WA 3R7WA 3GFVA 3SNKA 1T5IA 1G9SA 1N92A 1Y6FA 2P67A 4NMHA 1X0XA 3OTGA 3ZU4A 4IHJF 4UTXA 1GPNA 4KQEA 4JP3A 5LJIA 1R4MB 2Y4OA 3GNLA 4HGOA 4U8GA 5BMVF 4P31A 4KX5A 4XLZA 5CJJA 4I3HA 4CN8A 1GRVA 2FR1A 2KBEA 3GJ5A 4R69A 4TXNA 1L5GB 2ZKLA 4L8YA 4OLHA 4A0GA 1H6DA 4E5KA 4PEVA 5TPWA 3W34A 5ANRB 4ZD6A 1QV6A 2J6IA 3AF4A 5IT4A 4RK0A 2YC4C 3V8NA 5K3EA 3HJFA 2PH5A 3W8NA 3AM1A 1HDEA 1ZMOA 1QHFA 3CZCA 1GQYA 4K5QA 1NDQA 5EWMB 4DQKA 2P68A 1NLFA 4FSXA 2CLDX 3EXHC 3LCCA 4URYR 2ECFA 1KJYA 1ZN2A 1DNPA 2WJGA 4LW8A 3WYBA 1GAQA 4GECA 4PXAA 2GPTA 5IVIA 3CNEA 2PWZA 2WIFA 3HDJA 1E7RA 1UJ6A 4NQRA 4ZMSA 1EFLA 3DEAA 3Q0EA 5HMMA 2QLMA 3B51X 2FMTA 1QWOA 2GOYA 2JGFA 3B89A 2Z98A 3I1YA 2AW5A 3L49A 4DJ5X 3EMVA 1U2SA 4V0NA 2GTPA 3CRVA 1TVKB 1DEKA 2FKNA 3TG8A 3CVOA 1S2LA 2Q8QA 2AR9A 1CRZA 1GPMA 2PRKA 3JQ7A 3NTRA 4Q4JB 3FNRA 3W5SA 5CT4A 4YAUA 3RNOA 1Q44A 2C03A 1TZCA 1WUTA 2FYTA 4B84A 5GZ1A 2PPVA 5LDHA 2EKDA 1CUYA 4QEKA 3ZBQA 3D5EA 4G5RA 4OXNA 4X7BA 3ZOKA 4C4XA 2P9GA 3G9UA 2CV2A 4FGUA 5EMMA 4JUIA 3C3WA 4NPHA 2PIDA 4K6HA 4LHZA 3TW4A 3P0RA 4II7A 3UMMA 2FN7A 4IZHA 1U6IA 3SFTA 1GXSB 3F6CA 5FV7A 4DSOA 3WGUA 4ED9A 4TMWA 5ADWA 2UYHA 1E1NA 1H85A 1R0YA 2Z58A 1KORA 3VR6A 1N5DA 3AGQA 1NT2A 4G1UC 2B34A 4L0QA 3WL7A 4UE2A 5CHEA 3B5JA 1YB2A 3OPVA 2ZI4A 4AYXA 2FWBA 4BE9A 2Y77A 3GEPA 2X0IA 1W30A 1G18A 1QF6A 3GZTB 1ZRMA 1F06A 2C07A 1NPTO 1B8UA 4JP8A 5AVKA 4FYJA 2OBLA 2J4DA 4FR0A 2H8GA 1PS8A 2VEOA 2WHPA 4ZCQA 5BUQA 1RPZA 1U2GA 2JCYA 5FI1B 4BNDA 1TM7E 3AX6A 3C8ZA 3QKRB 4HDMA 3EIUA 4DSAA 5IW8A 1Y3FE 2HDHA 1M2GA 7ABPA 4O8CA 3WGYA 3JWEA 3U9TA 4JGBA 1A7UA 3QX3A 1M2JA 3K1YA 4GAEA 4JQZA 3RIYA 4OYLA 4NV1A 4KO1S 4OSPA 3L8GA 1JWAB 1D1PA 2Z2XA 3WMEA 4ECEA 2BEVB 2WWIA 1ESNA 4TMTA 5KJFA 2O2DA 2F43B 3EY9A 4N3NA 1XYYA 3IQHX 4DIOA 3U44B 4BGDA 4TMVA 1S3GA 3ONNA 4FX5A 2B21A 1DC8A 4Q05A 5LBTA 4ZAGA 2COEA 3TTWA 2YN0A 4IBOA 2ISQA 5FT9A 2IEIA 3ZQ6A 3GAAA 2VCYA 1CB0A 1I2ZA 1Y6JA 3RAEC 1NR7A 1IOZA 2CXXA 2HLPA 4B3JA 2I71A 3IQDB 4QLAA 3IO3A 1J8FA 4F96A 2SCUA 2QRNA 3ME5A 1RLUA 2WA1A 3B3AA 1ZD9A 3N0VA 3BE5A 9ATCA 2GLTA 4YHBA 4LPSA 1JW9B 1ID1A 2PIAA 1JIIA 4X3CA 4GR5A 3H19A 2XUFA 5AI9A 4ZVVA 2H4WA 5K05A 4ER5A 2C7GA 1EJ6A 2EKLA 1EAYA 2BKEA 1RM5A 2JZOA 2WSYB 4KIWA 1YHZA 4MVCA 5FOQA 5JARA 5JS8A 2XDAA 3EHDA 4PSVA 4UZSA 2JFPA 5J5CA 5BQXA 3TW8B 2Z9DA 4RVNA 3V8QA 3JQPA 3HWSA 4JBNA 4RYDA 1O6ZA 3H13A 1VBKA 3QUBA 3IILA 4M1TA 4EPYA 4MZDA 3L1UA 2I3AA 2ECOA 2QTHA 2BVNA 2IW1A 1WABA 4MSUA 3AY7A 1QRDA 2VDWA 3FWPA