1YB1A

Crystal structure of human 17-beta-hydroxysteroid dehydrogenase type xi
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
244
structure length
243
Chain Sequence
RRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITGVKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human 17-beta-hydroxysteroid dehydrogenase type XI.
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 17-beta-hydroxysteroid dehydrogenase type XI
total genus 93
structure length 243
sequence length 244
chains with identical sequence B
ec nomenclature ec 1.1.1.62: 17-beta-estradiol 17-dehydrogenase.
pdb deposition date 2004-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1yb1A01
4TWRA 4HXYA 5CAEA 3EAGA 4NBVA 4FFMA 4XDYA 4HY3A 2I3AA 1PZEA 3VAZA 5U9CA 1I8TA 3KUXA 3DAPA 4GAEA 2DU8A 4UEKA 2V6FA 4I1IA 4F45A 4BNFA 2QQ5A 4B3HA 2OUIA 1KBZA 2ZQYA 4E5YA 1UAGA 3GPIA 3QVSA 4I8XA 3RUAA 1PGPA 1RKXA 1M75A 4U6QA 5ICSA 1GUFA 3GF4A 3HADA 5DOVA 1N92A 3WG9A 4ND5A 3U3XA 3ONFA 4YJFA 3FSRA 3MTJA 3KTDA 4CM5A 1WDLA 1EE9A 3JQ9A 3PYLA 1GD1O 1GQ2A 3DTYA 4RVFA 3BHJA 4ALMA 3FTNA 3H9UA 4XIJA 4RO0A 3LVFO 3VZSA 3K6JA 2O3RA 1FF9A 2O4UX 3W6ZA 4XB1A 1PS9A 2FZEA 1XCBA 1Z74A 1DPGA 4B4VA 3VDQA 1ZXLA 3IAHA 5BSFA 2JD2A 1ZZEA 3JQGB 3WJ7A 4XYLA 4CV2A 3F5SA 1T25A 3OH8A 1T2AA 2BGMA 3PFFA 5CEEA 3OSUA 4M1QA 4ESOA 1E6WA 1B3RA 3RD5A 1Q2XA 1GPJA 2J3HA 4YVFA 4WOJA 2Q2WA 5ILGA 3RUEA 1P1JA 1UXJA 2RIRA 3ANNA 4LVUA 3BTOA 4J7UA 3AUTA 1UDBA 2P68A 3PJEA 2B83A 3INGA 1NPTO 3PIIA 4EJ6A 4UVGA 4GGOA 1E1LA 2QYTA 3JYQA 3IP1A 2VT2A 5FI3A 3FRJA 5TJ9A 4BNKA 4GLLA 3C3XA 4BO9A 3DHEA 3BA1A 4ZD6A 1E7MA 3GDGA 1OI7A 3LDHA 3WGTA 1I3KA 1JN0A 1KYQA 3S55A 4O5OA 1KC1A 1VL0A 3QY9A 1WXDA 4BO2A 1E7WA 3CZMA 2PGDA 2C5EA 3A9WA 3L6EA 3O03A 2O2SA 4WPGA 3UCXA 1KIFA 4BO6A 1I36A 5L3ZA 2G76A 1N5DA 1DRVA 1HDOA 3UHAA 4NR0A 4L75A 3AI1A 1LRLA 1IYZA 2EERA 1IULA 1UZMA 4MPDA 2SCUA 3KYCA 1NNUA 2PKQO 4YJGB 1R4MA 5HTOA 3FPCA 3CKYA 4FC6A 5IXYA 5T8KC 2P4QA 2GD1O 1E7QA 3ZV4A 4DPKA 5CFZA 2EKLA 5C3MA 1LTHR 4R3NA 5ADHA 3VH2A 4I5EA 1QMGA 4QQRA 3IJRA 2P9CA 4YQYA 3O26A 4DPLA 1PQWA 3F1LA 4IJWA 3GUCA 2J6IA 3QWBA 3DMYA 4FDAA 1R12A 2YQ4A 3NT2A 3ABIA 2DQ4A 2O50A 4BNXA 4KZPA 3FD8A 1X1TA 3MWDB 1W4ZA 4XZ3A 4RVGA 3TPCA 2PLAA 5KNLA 5BT9A 3GVXA 3QW2A 3ONEA 4J9VA 3BMQB 4II3A 4HNGA 4LMRA 4QFCA 4BUCA 4BV8A 4F46A 3GEMA 1YOVA 2WD7B 1N8KA 4AJIA 4PLCA 2B4RO 3DFZA 2PZLA 4BKOA 2AG5A 4Q3EA 3ZHBA 2PZMA 3I9NA 3ZWMA 5J23A 4XQ9A 1SOWA 1B2LA 2PGJA 3GGOA 4XGNA 1X14A 4KP7A 5C7IO 4PIVA 3HE3A 4M8SA 3WQRA 1DHRA 1ULSA 5EESA 1FDUA 4ZRMA 4DA9A 1WVGA 1UZLA 1Q7BA 1P1RA 4A5OA 1Q0HA 1HYGA 2EW2A 2XAAA 3JD1A 4YWJA 3KSUA 1B8UA 1J49A 2YV3A 3MZ0A 4JQCA 2ZTVA 1B0AA 4CR8A 5HM8A 5TNXA 4P38A 3ZW8A 4RZIA 1I2ZA 1JAYA 2R00C 5COAA 4MOWA 2VRCD 3RROA 4GGPA 4CMHA 5JE8A 4EEZA 2P9GA 1DRUA 5CG1A 1MUUA 2I66A 2CSUA 3WJAA 5HWSA 1UXIA 4DREA 2AEJA 2OXIA 5CDTA 1V35A 3Q1LA 1DC6A 4LMPA 4KTVE 1ONOA 4KQXA 3HDYA 2NUAA 4A73A 4OJNA 5AOVA 1BMDA 4IIVA 3ITDA 4LSWA 5G0UA 3UGKA 5HBRA 5I9MA 1I33A 3ZGYA 1ZW1A 3K2BA 3KRTA 1YO6A 5IFLA 5K0ZA 1KY4A 1ENOA 1K2WA 3KLPX 4IGFA 2NVUA 3DMTC 3WTBA 1YGYA 4J4TA 3IIEA 4D7AA 3INRA 1L7EA 4NBTA 4QUKA 4RF2A 1PGOA 1ZK0A 4D43A 1D3AA 3JQDA 3JV7A 5L53A 3JQAA 3ZW9A 2G82A 2IODA 1RPNA 1KEUA 1E0DA 3BMQA 3BZUA 1C0PA 1E3JA 3GC6A 3K8ZA 4H16A 1UP7A 2ZTLA 2V6MA 4Q3NA 4RPLA 2BD0A 2WD7A 3OFSA 5TIIA 2B0JA 4XYBA 2O3TA 2ZB8A 3E48A 4XJSA 2D3TA 4QX6A 2F1KA 2VNAA 4YR9A 5A03A 3A1NA 4YAKA 2VCYA 5JY1A 3VZPA 1C1XB 2Y66A 1LLCA 1WNTA 4MVJP 4PZEA 5L4SA 5BNFA 3F9IA 3ORFA 4CM9A 4JCOA 1FMCA 3HDHA 3I6IA 2VTEA 3ZHYA 3GEGA 4XGIA 3V2UA 3CMCO 3ZWVA 3MJSA 3GHHA 3I5MA 1QR6A 1UR5A 1WW8A 3WR5A 1QLHA 1ENZA 4FW8A 3FPLA 4R5MA 1LDGA 5A3VA 2W2LA 4IXTA 1UP6A 4JBHA 1BVRA 4IJKA 1XEAA 4IGEA 1LLQA 5KJFA 4B3IA 1VKNA 1YBVA 4BMSA 2AMFA 4UEJA 4L4SA 3S2IA 1SCUA 4NK5A 4QT0A 4NBUA 1XKQA 1I3MA 1SAYA 4GWGA 2GERA 3CH6A 1UH5A 4IS3A 1EVJA 1HE3A 3FTPA 4CQMA 1ZK1A 2YW9A 3JQ7B 3EHEA 4CJXA 3QVOA 3SXPA 3RQSA 3U4HA 2FZWA 2UAGA 3QRWA 4E2ZA 3RC9A 1N1EA 2VYVD 1F0YA 7MDHA 2EF1A 1S7CA 4WKGA 4IMPA 1LLDA 1U2DA 2JD0A 1DO8A 3AJRA 1RYDA 4CUJA 3ENKA 4PLVA 2I9PA 1DLJA 4DPMA 2GN9A 1E1KA 1N7GA 1J0XO 1EUCA 4KWIA 3RWBA 4WLUA 1VM6A 2A92A 1NVMB 3N74A 4KDEA 3X2FA 5JMWA 1T2FA 4JP2A 4MIOA 4ZQGA 3CUKA 3WQSB 4NU6A 1C1XA 2W2KA 3D64A 4MVJE 1IB6A 4IBOA 1Q7GA 1HYHA 4FJ2A 4GVLA 5JC8A 4UEOA 2JFFA 4YXFA 2JFHA 4ZN6A 2FSVA 2W90A 4BO4A 3GDOA 5TSDA 1F17A 1CRWG 1NQAO 4LISA 5K6AC 3IJPA 4Z6KA 4OMUA 3D4NA 5JCXA 1M66A 3ZV3A 3BMNB 1VI2A 1KVRA 1DJNA 4BNMA 4K28A 4RDIA 3E5MA 2QIOA 4DMMA 1B8PA 4TROA 1WZIA 4CL8A 3VKVA 2X8LA 2B35A 2ZCVA 4XKJA 4A10A 5K6AA 5KKAA 4B79A 1ZSVA 1HE4A 2PNFA 4RORA 3UH1A 4BNGA 1OAAA 1QYVA 2W8ZA 2JCXA 4CUKA 2X7HA 3M2PA 2OBYA 1QXSA 4CL3A 3OQ6A 4DMLA 2HMSA 2VRBA 3TNLA 4Z0PA 4RZHA 1LI4A 4CQMB 2Q1WA 5I9NA 3GQVA 4PLFA 3MJVA 3VDRA 1EVYA 1NXQA 2VZ0A 2YUTA 3CE6A 2I65A 3OA0A 5I8ZA 3F47A 5CPFA 4YQZA 4ALLA 5H82A 2VWGA 5EN4A 2ZK7A 1KOLA 3T7EA 1CYDA 3EGOA 5DCUA 1H6AA 1PIWA 4IIUA 4ZQEA 5U1PA 1T4DA 3SC4A 3ULKA 3PLNA 4W7IA 4BO0A 4XX0A 4ZGWA 3ST7A 3KSDO 5ILOA 3OJ0A 3WWYA 1HDXA 1MFZA 5JCJA 1C0IA 2UYYA 2OOSA 1PL8A 4YTEA 5JAQA 3ZU5A 1EK6A 5KJ6A 3B70A 1OOEA 2AW5A 3GRKA 4XJTA 4R51A 3RC2A 2HMUA 3WSWA 2EGHA 3DBRA 2VZ9A 3QP9A 4P22A 4PLWA 4DXHA 3Q2IA 1BTOA 2HRBA 4OL9A 1J5PA 3AW9A 3C1AA 3PHIA 3I9KA 2E6UX 2A94A 1ZJZA 2Z95A 4CMGA 3OJFA 4FFLA 1PSDA 4HX5A 3RFTA 3WGOA 3V1YA 2E4AA 5G4LA 1D8AA 3BMNA 1E7YA 4UUMA 3L6OO 3DOOA 6ADHA 4RPKA 3BTUA 5TF4A 1YL6A 5FF9A 3KOUA 5FI5A 4CQLA 4IDBA 3U49A 4ONEA 5FWNA 3IDSA 4R1SA 2YYYA 2HJSA 2I99A 2AG8A 3BXXA 4W9NC 5F21A 3IOYA 3QIVA 1BVUA 3ICPA 3HDQA 3VZRA 4DIOA 1R4NB 1ZCJA 1PJLA 4JLWA 4BNIA 3CINA 3JQ6A 1ZFNA 1A72A 1DIAA 1JKIA 3SJUA 1R66A 3UFXA 3VPSA 3S2FA 1GYRA 3PI7A 3QWAA 4R4JA 3GNQA 1IZ9A 1ZMTA 2P5YA 1GEGA 4H15A 2GASA 5HS6A 2ILTA 1B8VA 3N7UA 1NQTA 1VSVA 1XELA 3GNSA 4EBFA 3RBZA 2EWMA 2JCVA 4A2CA 1TI7A 2DPHA 4LGVA 1WWKA 5DP1A 3HUDA 2BMAA 2HCTA 1Y1PA 1XA0A 3V1TC 4FOSA 3PWSA 4D45A 1ZJYA 3QLJA 3I9MA 2RCYA 2YJZA 2V65A 3IS3A 4AJKA 3LLSA 1X7GA 3PQEA 2Y1OA 2V7PA 4Q3DA 2ZCUA 1MLDA 4Y9DA 4B7XA 3BTSA 4TMFA 3WGYA 3FF4A 1V3UA 4M49A 4IQGA 4OSOA 2G0TA 3PHLA 3NTQA 4W82A 1WPQA 4HV4A 3KB6A 1LDMA 1U9JA 1QORA 3TF5A 1E5LA 4AJLA 2O3JA 3W4KA 4YRDA 1U4SA 2EIHA 5JYEA 3PQFA 2GO1A 1HWYA 1WDKA 1NTOA 3JQ8A 5COBA 1R0LA 2VUUA 4YAIA 2LDBA 2I6TA 1CQIA 2G1UA 2D4AA 5HA5A 1NPDA 4JJFA 4E33A 1AGNA 1W0CA 3G79A 4UREA 1K6IA 1BXGB 3WTCA 1BDMA 4Y67A 5F3RA 3JYLA 2HKIA 3O9ZA 2AEMA 1HE2A 4R68A 5ITVA 1DBVO 1ZNQO 2X0NA 3JTMA 5A9RA 5K9ZA 3BAZA 4LSMA 1MX3A 1Z45A 3WNQA 4ROSA 1X0XA 4B4WA 2VTDA 3DB2A 4CM1A 4EUEA 1DIHA 3H6KA 2Q1UA 2ZKLA 4IMRA 4RGBA 4R3WA 1MG0A 3GG9A 1XIVA 1NASA 4DC1A 1HSOA 4DGSA 1I2BA 2VHVA 2X22A 2X5OA 3ZCXA 5IAAA 3EVTA 1I0ZA 2WM3A 3VPXA 5EINA 2OORA 1KVSA 2G5CA 3F3SA 4GKVA 4DLAA 4EGFA 4QEDA 1T26A 3TOZA 4H3VA 1UXKA 1DHTA 1JQBA 4E2XA 2JCYA 2CDCA 1Q0QA 4ND2A 4PLPA 1NWHA 2EXXA 5DF1A 1OC4A 3GA0A 5G4KB 4PLGA 1KERA 5CG2A 1EMDA 2Q99A 2VWPA 4RLHA 4NMHA 1O89A 3OF2A 3RBVA 1PGNA 3V5NA 4A26A 3I83A 1OFGA 4CV1A 4NFYA 1ONNA 3HFGA 2DC1A 1V9LA 3FNFA 1R37A 1LRKA 4MJLA 3TZCA 4A0SA 5JCJD 4XDZA 3NDRA 4EJMA 4CLXA 4LN1A 2YY7A 2NQ8A 2BRUA 3PHHA 1LDNA 1SPXA 5JDCA 1KEWA 1DB3A 1SNYA 5B1YA 1CETA 3FBGA 4CM4B 2PTGA 3GUYA 3VH3A 4P4GA 5JMPA 1DXYA 1TT5A 2CY0A 3JQ8B 3P2YA 3WS7A 1SO8A 4JX8A 5TGDA 2E49A 2FPPA 5JS6A 1VE9A 3WICA 5H83A 1CJCA 4GI2A 1I24A 3VOSA 4M86A 1BHSA 3G1UA 3PGXA 1A71A 1VSUA 2D59A 1JLLA 2I67A 3D5TA 2X4GA 5L9AA 1ZK3A 1GZ4A 1D7OA 1ID1A 1Y9AA 4M54A 3CEAA 3IUSA 1U5AA 4AG3A 4JROA 3TFQA 2Y1EA 3QWHA 3WYEA 2X1HA 4E12A 1E6EA 3EVNA 2EP7A 3FNHA 3OP4A 4WCFA 4ILKA 4BVAA 3UUWA 2CVQA 3SJ7A 1M6WA 3G1TA 4L73A 2PY6A 2UUOA 2D2IA 4J16A 4WEQA 2GZ3A 2O3SA 3OJLA 4HADA 4BKUA 1E7RA 2HK9A 4K6CA 4MVJD 3ZNOA 2D1YA 1YH3A 1VL8A 5KKCA 3NRCA 3U09A 5MDHA 4TKMA 1PQPA 5G4KA 1K6JA 1RWBA 3FNGA 1MP0A 4W9NA 2EG9A 3HN2A 5CEFA 5JC1A 2J5RA 2EV9A 3IP3A 3PJDA 4JP3A 1NVTA 4S1VA 3P7MA 1I2CA 2YV2A 4OM8A 4PZCA 2XXJA 5A5EA 3ZU3A 4OOEA 4BNVA 4GLOA 1L7DA 1KY5A 4FBGA 4XQCA 4CMBA 2ZATA 1P33A 3HB5X 4G5HA 4ND3A 4J3FA 4J91A 2Z5LA 5L95A 3PHJA 1AHIA 1IZ0A 1XWFA 1CERA 4TKLA 3CMMA 1ZIDA 2EGGA 4L9RA 4CMCA 1EFKA 4NJMA 3DWFA 4R54A 1QG6A 3RUIA 5G0WA 1E3IA 1U4OA 2IZZA 1GTMA 3B20A 4U6SA 1N2SA 5I8WA 1DFHA 4J49A 3VZQA 1VJ0A 2X9VA 4R69A 4RPGA 4GBJA 4L4XA 1KETA 2A9FA 3RUHA 3MEQA 2O48X 5I7SA 3A14A 1JU9A 1B14A 2OMEA 3IUPA 2VRCA 3VKUA 4H7PA 1HLDA 2NU6A 2O2YA 2B5VA 3AY6A 4KWHA 3W8DA 4E5KA 2RH8A 1X7DA 4A27A 1ZVMA 1K0UA 4FOOA 4HBGA 1GZ6A 5BSHA 1G1AA 3CIFA 4N18A 2BHLA 3ZWOA 3NGLA 3ZWCA 4PLHA 3OJOA 1ZK2A 3PXXA 2DBVO 1YRLA 3LF2A 1GAEO 1CQJA 1VPDA 1IPFA 2TMGA 4ZJUA 4WECA 1PZFA 3T4XA 4AJJA 5G0VA 5GZ6A 3H2SA 2WEKA 2VOEA 3C7CB 4BMNA 5CPBA 5HS4A 3GOHA 3GFBA 3Q9NA 2ZJ0A 5T5QA 1GYPA 3R1IA 4U8GA 4BNUA 1GCUA 1R0KA 1TEHA 1PS8A 3MJ4A 2UV8A 2HDHA 3PZRA 3GLQA 4UUNA 1H9BA 3C7AA 1E77A 1TA4A 1V8BA 1PJ4A 5KJ1A 5T57A 1HLPA 4BNYA 3NDJA 4WLFA 2PZJA 3T7CA 2R00A 3ANMA 3QSGA 3BYZA 3PPIA 5IZCC 2NU7A 4L4RA 3ZV6A 2PA3A 2C29D 4CMAA 3ZU4A 1NFFA 1KC3A 5CDGA 2CD9A 1I32A 5ICMA 4YJHB 2VT3A 4WOKA 1R4MB 5THKA 1T2CA 5H81A 2OP1A 3PWZA 3P2OA 2C07A 3ZWXA 4BNNA 4O6VA 3H3FA 4W99A 3VVBA 2WE7A 5GMOA 4KOAA 2D5AA 1NVGA 4P8RA 1YQXA 4UULA 4Z9XA 3ROQA 1H6CA 3ASVA 4R9SA 1JKFA 1X1EA 1L1FA 2PZKA 4HNHA 8ADHA 4X54A 1GEEA 1E3EA 2OZPA 1K5HA 3VVCA 5C7LO 3GFGA 2BGKA 1I30A 1NR7A 4CMKA 1PGJA 3GN2A 3JCZA 5IN5A 2ZIZA 3WBFA 3ZNPA 3C85A 4L8VA 1PTJA 3H5AA 1LUAA 5B4VA 4DLBA 2EHDA 4J1TA 4OAQA 4RVSA 1C0LA 1W6UA 3OEWA 4Q3CA 3L9WA 4CM9D 3VPHA 1ENPA 2DPGA 2PH5A 3AM4A 1MB4A 3EC7A 4YT8A 5JBIA 5TS3A 2I76A 1DRWA 4QFDA 1XQ6A 4YT5A 3VPFA 1RM0A 2VWHA 3I9JA 4DIFA 1ONPA 1OZAA 4LK3A 1YVEI 2TMDA 3EK2A 5KJEA 3QE3A 3HFSA 5JNLA 1HDCA 2P4HX 2P91A 1XDWA 3KEOA 2DFVA 4YAJA 4EI2A 2E37A 1H0KA 3DQPA 3H9QA 2X0JA 4WLVA 5ENDA 4XA8A 2NACA 3F4BA 3KLMX 4XYGA 1U5CA 1PJCA 1FDTA 1TT7A 3QVTA 2GLXA 3MWEB 5AXBA 3B1FA 4D79A 4BNTA 3FWNA 5L51A 3HWRA 2HMTA 1YL5A 3H5NA 5IDQA 1SEVA 5F5NA 2FHSA 4BO7A 3E18A 4FIZA 2O4CA 3P5SA 3C8MA 2AXQA 3TL2A 5IZ4A 4IJUA 4J2OA 3RASA 4ITUA 1KS9A 4IZIA 3WGGA 4BGEA 1GUZA 1ZH8A 1YXMA 4Z0TA 2Y93A 4BS9A 5JLAA 1Z7BA 3H7AA 2DTEA 1JTVA 4FQ8A 4RLSA 1NHGA 4BO5A 1YJ8A 4FCCA 4U0KA 3WMWA 4XIYA 4BGIA 1K89A 1IHXA 3AU8A 1EUDA 3SBOA 1PJQA 1ZSYA 1PJBA 3DBVO 5DCYA 5TX7A 3JD4A 3KZVA 3ZWPA 1JW9B 4GX1A 4NJMB 3IKVA 4WNIA 4NU5A 1LDYA 2VYNA 2O7SA 3DONA 3KBOA 1YBAA 4MP8A 4MIEA 1Y81A 5T64A 4C7JA 2HK8A 3RAJA 4BGUA 3NDIA 3E1KA 1GV0A 2DFDA 4XQGA 1DC3A 3C7DB 3W6UA 3D0OA 3DTTA 3WGIA 1PEDA 3DOJA 5ITWA 2V6GA 4XD2A 1P3DA 2PKQP 2WJPA 4XRRA 1AN9A 2GPTA 4E32A 4LRSB 3DFUA 3PDJA 1GADO 1K3TA 1C14A 1P31A 5U4QA 3BMCA 3H8VA 4MVJH 1MFPA 3GZ4A 3KYDB 3R3SA 2BFOA 4IDFA 3UVEA 1GUYA 5IDYA 1H93A 1YQGA 3PRJA 5DNAA 3OBBA 1YDWA 4XYMA 2P9EA 3W8FA 4D41A 2DTXA 4DBVO 5JDIC 3RFVA 2ZYGA 1F06A 3LT2A 3Q6IA 3ZU2A 2PH3A 1XLTA 2Q50A 1QLJA 1DIRA 2Y0CA 2QZZA 3E5RA 4II2A 5IN4A 4MVJI 3AI2A 3BMOB 2UDPA 2ZB3A 2ZTUA 4CV0A 7ADHA 2C59A 1EVIA 2QRLA 3HN7A 1WMBA 3WB9A 3AWDA 1M2WA 2DKNA 2VNSA 2WE8A 4DWVA 1NAIA 1FJHA 1TLTA 1VC2A 1G0OA 2JAPA 2CDAA 2NWQA 3ICCA 3GVIA 3SLKA 1JVBA 3PK0A 3OIDA 1RM3A 3DBHB 3RKUA 4QSMA 3DHYA 1D1TA 2CVZA 1WZEA 3VTZA 1Y8RA 3JQEA 5EIOA 3SX2A 4F6CA 1T2EA 3JD3A 4F3YA 5C5IA 3CXRA 4ZICA 2J3IA 3K73O 3UF0A 3G49A 2EW8A 1MC4A 4ZQBA 1GYQA 4NHEA 3M2TA 4DUPA 3HZZA 2HUNA 3R0IA 4IINA 5IDXA 3Q3CA 4YJHA 3TDKA 2VHZA 4YJFB 3ZWWA 1U7HA 1N7HA 3WSVA 3WNVA 2P2SA 5KOIA 5I7EA 1LQTA 3PVZA 4LRTB 4GL4A 1YB4A 3QWFA 1CWUA 4Y8VA 4E30A 1JWAB 4I5GA 1YJQA 2Y0DA 3DZKA 1TVEA 1H2HA 4OKIA 3MJTA 1P1IA 2OO5A 3GAZA 3EY4A 3GZNB 1PWXA 1Z7EA 3F5QA 5B4TA 5CEJA 5JYDA 5DN9A 5L40A 2GN8A 1PJ2A 1LDBA 4PCVA 4UVDA 4E2WA 1FDWA 2IDZA 2IE0A 1ZUD1 5EQFA 2WDZA 5DCWA 1AUPA 1NBOA 3VPGA 3WGQA 3BMOA 3OETA 3ON5A 4YEDA 2CF6A 3GPDG 3LZ6A 5BSGA 5FEUA 5LDHA 4E21A 2YV1A 1NX6A 4MVJM 1DC5A 2X9GA 4EITA 4A7PA 4GX0A 4DVJA 1X13A 4J2HA 3TZKA 1FK8A 2JHGA 1EQ2A 1ULUA 2QG4A 1FXSA 2RHRA 2VHXA 4INAA 2Q2QA 4CMJA 4Y6RA 1R6DA 3X2EA 4ZU3A 2GNAA 1P74A 4TRMA 1YWGO 5CHEA 3G3EA 4JIGA 2LDXA 1WDMA 4WEOA 3EZLA 4KDFA 3OICA 1LSOA 1D1SA 4IDAA 3WMXA 2HJRA 4IPTA 2BGLA 2XOXA 1A5ZA 1J4AA 2HQ1A 2XPCA 3AI3A 3GVHA 2POQX 3UW3A 4CM3A 3GK3A 1DDOA 2H1SA 1W8DA 4GMGA 1HTBA 3I4FA 3HDJA 4W7HA 3I6QA 4NBWA 4B8WA 3PDUA 3KO8A 4B8ZA 3FCOA 9LDTA 1P0FA 2AQ8A 1UP4A 3KVOA 2GN6A 3WYCA 2C82A 3DBRB 1I3LA 2BI8A 3D3WB 3L0DA 3UCFA 4BHTA 4IQ8A 1M76A 1V0JA 4K9DA 2X5JO 2FP4A 4D3DA 1LLUA 2CVOA 4PG4A 3ROKA 1UDCA 4J9UE 1N9GB 3TSCA 4GKBA 1H6BA 3H9JA 2J3KA 3TN7A 1GZ3A 5A02A 4Z0HO 3ZV5A 2R2GA 4GVXA 4OXKA 4E5PA 3VTFA 4NDNE 3OM9A 1EEHA 4HFMA 4FC7A 4NI5A 2GYYA 1RYEA 3VH1A 3GN1A 4BNJA 2IRWA 4QO7A 3NJ4A 3ZNNA 3OJEA 4AVYA 4FS3A 4RF3A 2G17A 1UDAA 3V2HA 5ER9A 3HQ4O 1E1NA 3ETDA 2JHFA 2Z1MA 1NAHA 1SB9A 4CR6A 1RJWA 1R4NA 3LF1A 1U7TA 3EYWA 1CIVA 1QKIA 4YPOA 2Y1GA 3SC6A 3A06A 3PQDA 1SC6A 5CP8A 2PFGA 5TT0A 2PR2A 2NTNA 2GSDA 2O3UA 4NIMA 5CDYA 1U8XX 1SMKA 3LC7O 2A4KA 4EEXA 4WLEA 2C54A 3KYDA 4RJTA 4B3JA 4QO8A 4PG5A 4B7CA 2FMUA 5I7VA 2B69A 2NU8A 1VLLA 4PRKA 3ZHZA 3RUCA 3NKLA 4TRJA 4D44A 4HFNA 1X15A 4WGGA 2Y1FA 1VL6A 5JO9A 3B6ZA 2WYWA 1XQ1A 3I52A 1NFRA 4J7XA 4OQZA 4YAEA 3UOGA 1PQUA 3FBTA 5TLSA 1XGKA 1O9BA 3JSAA 1M67A 4R1TA 4GMFA 4OOFA 3ZHXA 4I9NA 1GFSA 4J43A 3AK4A 1XU7A 3TL3A 2I3GA 3CTMA 4PLZA 3G0OA 4I5FA 4AJEA 1MG5A 3L6DA 1JAXA 4R01A 1ADBA 1DFIA 5FYDA 1EVZA 1TB4A 4XB2A 5F1KA 4AJPA 3GVCA 3RIHA 4S3MA 2FRDA 2WD8A 3H9EO 2BH9A 1Z73A 3IC5A 1U3WA 1SZJG 3H5RA 1A4IA 4PGFA 4D3SA 1Z6ZA 1E3WA 2X5KO 2W98A 4ALKA 1EQUA 2DUUA 1PL7A 3H65A 3ADPA 1U1IA 2FR8A 2BKAA 1LDEA 1PX0A 3GAFA 3RBXA 4IZHA 1V3TA 4OSPA 4UUPA 5KVCA 4FFNA 3NUGA 2C7GA 3F46A 2HRZA 1E92A 4D0RA 1B7GO 1ISHA 4JNKA 3H9GA 4B7UA 2XXBA 2ZQZA 4FGWA 2NTVA 1EBFA 5F5LA 3W4JA 5L45A 3B1KA 3ETEA 3QA9A 4GH5A 2BLLA 2D5CA 3RJ5A 4DYDA 1Q0LA 1Q7CA 1W73A 3LK7A 4MVJA 4WLNA 4JJIA 3AUAA 4IY1A 2W4QA 1VKOA 1NHWA 1UUFA 1DAPA 1Y5RA 1LRJA 1X7HA 1VRWA 4I5DA 4Y6PA 5DBGA 2PWZA 3C1OA 2R6JA 3DZHA 3VH4A 5A9SB 3PEFA 4M55A 4Z9YA 1H6DA 2Q2VA 3O8QA 3WLFA 3A4VA 1HDGO 4BQRA 1SOVA 2VHYA 3NJ8A 4ND1A 4R41A 3RVDA 2YFQA 1O5IA 5C37A 2NM0A 2C20A 3STHA 3OA2A 3ANLA 2QW8A 3EMKA 3GGGA 1QYDA 3HNPA 3WLEA 1NPYA 1C0KA 5CDUA 2B4QA 3AFMA 3GRPA 1J6UA 2C2XA 2Y67A 4ALIA 2VN8A 4YACA 4Z3DA 1P9LA 2QRJA 3JQBC 2CFCA 4J7CA 4UVHA 3H4VA 4NFHA 4BB5A 1XR3A 1N1GA 1ADCA 4NPCA 2UUPA 5KIAA 2HK7A 3DZGA 1R15A 8LDHA 4R1NA 1BG6A 1E3WB 1HETA 1KVTA 4M87A 1DIBA 4O1MA 1P44A 4C7KA 3VHRA 1EE2A 4N5MA 3FHLA 1O94A 2AEFA 3PIDA 2NVWA 3ETGA 1DJQA 4J90A 4FFRA 1EK5A 3WX0A 1PZHA 1R0SA 3EUWA 5JPIA 4WNCA 1LC0A 4HKTA 3GT0A 1C1DA 4CMEC 5CDSA 3M1LA 1E3SA 3DR3A 4EZBA 4YRAA 4WCFB 4R5HA 2W2KB 2Y99A 1ZKMA 2ZB7A 1U3UA 1ISGA 3Q2KA 4CV3A 4PG6A 3I3OA 1O95A 3TRIA 1BXZA 5T8KA 4BL5A 5G2OA 1P1FA 3D4OA 3L4SO 2VQ3A 4YJDA 3DZFA 2ZB4A 2VUTA 1N9GA 2FPIA 3JQAD 3JQCA 4RV9A 5IZCA 4YT4A 3AY7A 4MKRA 3NEPX 1ZXBA 2DT5A 3TZQA 1YONA 2DM6A 5KCZA 2E48A 2VZ8A 2YFHA 1EDZA 4CLDA 3K31A 3SVTA 4ZRNA 3WBBA 1QYWA 5KVVA 4WK6A 4JK3A 3DC2A 1GL3A 3OECA 2FY8A 4XCVA 3SLGA 4WE3A 3U0BA 1D4FA 2YQ5A 1BGVA 5KWEA 4M89A 3AM3A 1U3TA 1ENYA 2WMDA 2OFPA 3O8QB 4CR7A 1PJSA 3E03A 3WOHA 4FB5A 1DIGA 5EPOA 4NFSA 4R1UA 3AOEC 2YHIA 3DHNA 3U62A 2NV6A 1H5QA 2PGLA 1IPEA 1AXGA 1GV1A 1XYGA 5DBIA 1KVUA 1A27A 3F4LA 2PD4A 5GY7A 4PN3A 5I7FA 4JN6B 2RH4A 2ZTMA 5LC1A 4JBIA 4A03A 3NTRA 1HZZA 3W1VA 1A7KA 2BF7A 1EFLA 2EP5A 2GF2A 2IYPA 3MCVA 1Y5MA 4YT2A 4U5QA 2NADA 3NV9A 2X0RA 4URFA 4CMEA 1AE1A 4MP3A 2I5PO 3QVXA 2IZ1A 1QV6A 1NP3A 5AXAA 2RBEA 1XHLA 9LDBA 3QHAA 1PJTA 5IF3A 4RF5A 4J1SA 4N5NA 1E1MA 2P5UA 4CM8A 2X6TA 4ID9A 1I01A 2B37A 1C1DB 1U28A 5JDIA 3ZDFA 3WDSA 3JQFA 4J6FA 2QRKA 1U3VA 2FR0A 4WCDA 3PYMA 4Y98A 5T6BA 2EJVA 2DUWA 3U5TA 4KUEA 4YDRA 3KM0A 2DBZA 1XG5A 2V6BA 3KYCB 3PJGA 3UICA 3D4PA 3INTA 5AQ1A 4AJ4A 4YA6A 4BQPA 4CM7A 1I5RA 2X9NA 3WIDA 4GQAA 2C0CA 4NH4A 3LSYA 5LDGA 1XU9A 1FDVA 1IL0A 4W6ZA 2NVBA 2NTJA 3ENNA 3FWZA 4MINA 2ZYAA 3U9LA 1KEVA 4PLTA 3I23A 3HSKA 3DBLB 5EMHA 3WXBA 2Q4BA 4FSHA 4R9RA 1O0SA 2Q1TA 1PS0A 2VUSA 1I10A 1ISFA 5TT1A 3D5QA 4N5LA 3LT1A 4AJNA 2GDZA 4CQMD 4BOYA 5AXDA 2HU2A 2HMWA 2EKQA 1JDJA 4E31A 5T67A 1EBUA 1YOVB 4UUOA 1DAOA 4GPD1 3W4IA 1ZBQA 3Q0EA 4MVJG 2WTBA 3EW7A 4E13A 4RVDA 3BHIA 1A9YA 2AA3A 1PU2A 4CLRA 1TXGA 5ES3A 4NJOA 4GX2A 5IXSA 1HYEA 1LX6A 3JD0A 1Y7TA 2CUKA 4KMSA 1ZSNA 1QSGA 5B37A 3TZ6A 2IXAA 1ZO8A 1T1SA 1SBYA 1RM5A 1BSVA 1T2DA 3DZJA 4NBRA 5A05A 3WWZA 2WYUA 2Q3EA 1KVQA 4P4NA 4E0BA 2ET6A 1K6XA 4DQUA 3DOCA 4DQXA 1JKJA 1ZK4A 5A9SA 1BWSA 1H2BA 3L07A 4EJ0A 3V1UA 3QQPA 1ISIA 4DTIA 3TQHA 2B36A 1OMOA 4CMIA 2WWRA 5F1PA 1HXHA 4BO3A 3AU9A 4O63O 4OGWA 2VYVA 2CMDA 1U8FO 4MKXA 2QX7A 5DDIP 1YL7A 2J5KA 3P19A 3DAFA 4B4OA 4N7RA 5LCXA 2HSDA 4O0LA 4Z9FA 5BNTA 4J0EA 4WJZA 3QV1A 4TQGA 3ZZNA 2E82A 3UAGA 1EDOA 1P45A 5GZ1A 1Q1NA 1BXGA 1E6UA 5AVOA 2NVUB 4FD3A 4OO3A 1O8CA 3MJEA 1LSJA 2RAFA 4TSKA 4BIIA 3DBLA 1YS4A 2DTDA 3I9OA 3L9XA 3JQAB 2B4TO 4HP8A 1IHYA 2Q49A 1GPDG 2VWQA 5TQVA 3RU9A 1B3BA 4GWKA 4DLLA 4DRYA 2W2LD 4E4YA 3GG2A 4IQ0A 4NNJA 4IM7A 1YKFA 3N58A 4FFOA 3L4BA 3PP8A 4LVCA 1Z75A 1LA2A 3E8XA 4I9HA 3BTVA 3IL2A 3JQFC 4CLRB 1E7SA 1P1KA 4BKPA 2FWMX 1P77A 3BHMA 3COSA 2OGUA 3HJAA 1GU7A 4D42A 2YZ7A 1LC3A 4XQEA 2NNLD 3PTZA 1PR9A 4CODB 4QECA 3B1JA 4EUFA 5AYVA 4J4BA 4NZ9A 3TWOA 3CZRA 3WIEA 4DL9A 1AXEA 2OHXA 1HRDA 4BO1A 5L4LA 3KXDA 2AQHA 1HE5A 5MGBA 3E9QA 3HHPA 4IDGA 1H94A 4NG5A 1LXCA 1G6KA 4RDHA 4TVBA 4RF4A 2IEDA 4JGBA 4CMIB 1Y6JA 3KHUA 4JJGA 2IEBA 1PGQA 2HMVA 2YHIB 2D0IA 3GR6A 3KSZO 4BMVA 2JAHA 1NR1A 3OEYA 4NK4A 4YRBA 4XGKA 1B16A 4MDHA 5I9LA 3JYPA 4CM4A 4QXMA 3IMFA 3RI3A 4JXKA 4KUHA 4MKZA 5F1OA 1MA0A 1NFQA 1BW9A 5AXCA 4RPJA 5HRUA 3LU1A 1P0CA 2EKPA 3PLRA 4F6LA 2GR9A 3DL2A 4N54A 3V8BA 3NAQA 1OC2A 4QTZA 4UAGA 3W8EA 3JQ7A 1HEUA 3ROPA 3KEQA 2J3JA 2XF8A 3JYOA 1DEHA 4DC0A 4RQUA 3MTGA 3C24A 1NQ5A 2AQIA 3LT4A 5GZ3A 4CM8B 3R3JA 5EERA 4WLOA 1WP4A 4AJOA 3IQDB 1YB1A 2QYSA 5DULA 1ADGA 1ZEJA 2FN7A 4ZQFA 3Q9UA 2Q4EA 3FR8A 1HT0A 1PR3A 4IJVA 3WGHA 3BMCB 4J0FA 5G0TA 2YDXA 1NQOA 3MOGA 2VHWA 3H3JA 2JKVA 3PWKA 5A9TA 2Q45A 3E82A 2CZCA 4E2YA 2C2YA 5EJ2A 3E9MA 1PWZA 1E5QA 1PJ3A 4TZTA 1GDHA 1Y8QA 2JD1A 3MJCA 3OQBA 4IDDA 1YB5A 4WCFC 5JFOA 3FNEA 3JQBA 4IXWA 2X86A 4CLOB 1T4BA 3RU7A 2O7QA 3CSDA 3DMTA 3GDFA 5KTKA 3UXYA 4RVHA 4G2NA 1YBMA 2GCGA 1H9AA 3JYNA 1T1RA 1GY8A 4HUJA 3I1JA 2AQKA 4K1LA 4ZA2A 1HDRA 2J8ZA 3MOIA 3NX4A 4DQVA 5TJHA 3AOEA 4PLYA 3WFJA 5JW6A 1YQDA 4HFRA 3K30A 3DBHA 4TRRA 4IDCA 4Q39A 1F14A 3AOGA 5A06A 4OHUA 4LCJA 2GZ2A 4XEHA 2BFMA 1YE3A 3R6DA 4Z3KA 1BW9B 3OIFA 5DT9A 1BDBA 5DZSA 4XYEA 2CDBA 4L74A 3BIOA 2PK3A 3WYBA 2GUGA 1A7AA 2YDYA 3PFWO 1ZEMA 3GEDA 5DP2A 3OHSX 3PHGA 1HKUA 3NT5A 3E6AA 4O59O 1CDOA 3U4IA 4OXNA 4XWYA 5B4UA 1FDSA 1UAYA 1ADFA 1PL6A 1LBEA 3RC1A 4MVJF 3S2GA 4HWKA 1B15A 1VJ1A 1LNQA 4R16A 4UVEA 4OYRA 4Q9NA 5JO0A 5L7WA 1GCOA 1QV7A 4NQZA 4MP6A 3RSHA 1IOLA 3GZNA 4DIBA 3ZWNA 1DOHA 5KVQA 1X0VA 3V2GA 3QWIA 4Y6SA 4WUVA 3C1TA 4U7WA 3GHYA 1BRMA 1ML3A 2JFGA 2AE1A 1JVSA 4AFNA 4YBZA 1SEPA 2JL1A 3Q11A 1DFGA 3H2ZA 4HFJA 4G65A 4DYVA 1EUZA 1JA9A 1JWBB 3PGJA 1A9ZA 2H9IA 2X0IA 3AM5A 3NTOA 3PJFA 1GQYA 4OH1A 4XRGA 1O6ZA 1A4UA 3S2EA 3TOXA 1G0NA 3K9QO 1MC5A 2A35A 4ALJA 4CQLB 4AL4A 2WSBA 5DBFA 5JAZA 1KEPA 3ONDA 4G81A 3ROMA 4CUZA 1VJTA 1UJMA 5A04A 2B5WA 2AHRA 1U2GA 5TRTA 4D3FA 3T4EA 3LLVA 3S1LA 4Q3BA 4E5NA 3D7LA 3LC1O 5IDWA 2DBRA 4W4TA 4ZQHA 1MXHA 6LDHA 3DZBA 3RC7A 3GGPA 4GX5A 1BXKA 3OMLA 3L77A 3U4DA 3GMDA 4OKNA 1XSEA 2WYVA 2F00A 3ZN2A 3DZIA 4GSKA 4E3ZA 1HZJA 1F12A 3GVPA 4FJ1A 2Z1NA 3ITKA 4K6FA 1C3VA 4FJ0A 5B12A 4ND4A 2QZ9A 3ASUA 4FFPA 3ZWAA 3ZNQA 1E3LA 3SEFA 2ZJ1A 4BNZA 3F6YA 3AUUA 3GH3A 1HDYA 2UVDA 3D3WA 1Y9EA 2Q1SA 3JD2A 2OP0A 3K2EA 3NGXA 4YAGA 2IYOA 4K26A 2NQTA 2OBNA 1QYCA 2PKRA 2FSSA 3DXFA 5BNIA 4U0JA 5TC4A 2GZ1A 3LQFA 1QRRA 4OQYA 5ER6A 3UCEA 4EW6A 1F8GA 3DDNA 1QP8A 4LCEA 5C7OO 1AHHA 4RVUA 2PV7A 2IXBA 4PVDA 4ALNA 3TFOA 2GGSA 3TZHA 1SB8A 3IKTA 2GRAA 1QYXA 4BGVA 2QHXA 1HSZA 1RM4A 5BSEA 3I4CA 1P1HA 1UZNA 4PVCA 2Y0EA 2BI7A 1ARZA 4RL6A 3ZH2A 3PZBA 4FN4A 1DLIA 3KYBA 4ZHSA 1GQQA 1M6HA 5A4DA 2VYND 1LU9A 2AE2A 3TJRA 4CLHA 3ZWYA 4J4HA 2GN4A 3LYLA 3O38A 4KQWA 2X58A 4IDEA 4BKQA 2Y05A 5L4NA 2DAPA 1CF2O 4L0QA 2Y1DA 1HDZA 5JDCC 1T24A 2BFAA 4IUYA 2O3QA 2PD3A 5JY6A 4XR9A 5G0SA 4EUHA 3AUSA 3OQ1A 1V6AA 2HO5A 1ORRA 3E9NA 2HLPA 1EZ4A 4BNLA 3S8MA 4E6PA 5A1TA 4BNWA 3M1AA 5KJCA 2FR1A 1NWCA 1Y8QB 4FR5A 4WASA 4B4UA 1F8FA 4BB6A 2CNBA 3LC2O 5EL0A 2X23A 4CLOA 2DBQA 2YHUA 1MGOA 5JXWA 3U4CA 1DSSG 3RJ9A 3O4RA 4EYEA 3ZWBA 3DO5A 5BR7A 3AFNA 3WQQA 1YDEA 4J1NA 5L7TA 2J5QA 4YJGA 3RUDA 3GY0A 1PZGA 2JJYA 1LQUA 4OXYA 4MO2A 4TVOA 2CF5A 2NU9A 3EZYA 2IZ0A 3GMSA 4EDFA 4JBGA 5A3JA 1ISJA 1WAMA 3CPSA 5JAIA 3EDMA 4FGSA 4Q3AA 3WGZA 4CM6A 1GR0A 4UVIA 3WFIA 4CLEA 2Y1CA 4KTTE 3RKRA 1S6YA 4YCAA 4DBZA 3RCBA 3QJ5A 5THQA 5JAMA 2RHCA 5COQA 1V3VA 1B26A 3PYXA 5FFFA 3NYWA 5KVSA 1ISMA 3ADOA 3DAGA 2C5AA 2H5LA 1I3NA 4PFJA 1TT5B 2Y68A 1CEQA 2HAEA 2ZYDA 2VOJA 1IUKA 3DEYX 3FR7A 4L76A 4AICA 1LSUA 2OL4A 3A28A 3NT4A 2PD6A 4C4OA 1LEHA 4AJ1A 3GNTA 2BFPA 1LSSA 5EQDA 4TRNA 4CPDA 2EEZA 3JQ9C 1MXFA 3LT0A 3HG7A 3F1KA 2D8AA 4E5MA 1Z82A 3RFXA 4BNHA 4I08A 4BV9A 3D3EA 4ZVVA 3K96A 4I9UA 1DC4A 3OIGA 5IJZA 4BO8A 3AY3A 3HB4X 4XR4A 5IG2A 3D1LA 2H63A 4AJHA 2C7VA 4RCVA 4YB8A 3KV3O 2DLDA 2NLOA 3G17A 4TZKA 4AJ2A 4YYZA 1IE3A 1R16A 1LJ8A 1NYTA 3JQGA 5JSFA 1UXHA 4FPXA 3K92A 5A5FA 3KETA 2FOIA 1NM5A 2NSDA 1ZMOA 1HF3A 1MV8A 4GSLA 1WLYA 1UXGA 5ENVA 3ZI0A 1HL3A 4BKRA 4MIYA 4OIMA 2EJWA 4P4LA 3VC7A 3I9LA 4D0SA 1OBFO 5L7YA 4IS2A 4PG7A 3RUFA 4PG8A 4RQTA 2FPGA 4KUGA 3FN4A 3FI9A 4J1QA 3K5PA 3UKOA 5DOZA 1IY8A 5BQFA 2O23A 3L4BC 4LW8A 4PRLA 2DVMA 1Y8RB 4RPHA 3M6IA 2BELA 2Q46A 3QVWA 4PZDA 3UN1A 2H6EA 4D46A 1WMAA
chains in the Genus database with same CATH superfamily
1G20B 4TWRA 2O7NA 3AL2A 2UUAB 2QLTA 3DPUA 5DHPA 1PUIA 1UMCB 4FFMA 1N6HA 1U8ZA 2R8YA 4Q47A 4R8LA 1Z47A 1PZEA 3IHTA 4E1VA 5U9CA 3KUXA 3DAPA 4GAEA 4IILA 1YBFA 3TGPA 3FZYA 5DWQA 2IYTA 4TV8F 4BNFA 4ARCA 1XAIA 2QQ5A 3L8YA 4B3HA 1C7IA 3HRIA 3ZGLA 3U60B 1R0WA 1HM5A 2QE7D 3GJRA 1OU0A 3WWDA 3IB3A 5T41A 1B42A 4OK3A 2W2XA 1GUFA 1RTTA 3AF2A 3B9PA 3BK1A 2CXPA 3HADA 5CR9A 3WG9A 4ZCSA 4DLXA 2QEQA 2IBTA 1KGDA 1RYZA 1BCRB 1JBEA 3ASZA 1UBMS 3JZDA 4CM5A 3JQ9A 4F3CA 1TM3E 1GQ2A 4CTNA 2BTQA 2XMRA 3KL4A 4KYVA 4I36A 4RVFA 4ALMA 4AN4A 4D4IA 4F7DA 1GRCA 4XIJA 2J31A 1JG4A 1T6ZA 3LVFO 2JF0A 2P62A 1GFWA 4G8CA 4XWGA 3V8NA 3JASB 1QUFA 2FEPA 3W6ZA 2V97A 2QENA 4R1QA 3WK4A 4TQAA 1XCBA 3H04A 1UCFA 3VRHA 4GBGA 1B1AA 4JLVA 2R0QC 1FXWF 1M8FA 1ZXLA 3DKPA 3IAHA 3IDQA 4FYIA 5DNEA 3JQGB 1FXWA 5BNZA 2WY2D 3HYSA 4PTZA 2R6ZA 4UHFA 1G6Q1 1F20A 1R0ZA 1T9AA 3BPSA 5AI8A 4DEYA 1ZJWA 1M1ZA 2QTHA 1E6WA 1K68A 3D3NA 3DE3X 3MQ4A 3RD5A 1I9GA 1MKYA 4B9AA 2J3HA 4ZTZB 4WOJA 3BAFA 2FMIA 5ILGA 3VZBA 5LQAA 1P1JA 1V5GA 1UXJA 4L8WB 2BP7B 3H8WA 5HMLA 5B3LA 4JFAA 4U7HA 4JJKA 4J7UA 5CURA 4FYKA 3AUTA 4E6EA 3INGA 2A0XA 4HVCA 2AC7A 1HYQA 1N25A 2H2AA 5EMKA 3ZZMA 5C5EA 2FPGB 3A4TA 1VZ3A 2X14A 2K6GA 1W44A 1GNTA 5TJ9A 4UTNA 3AVYA 1NURA 3OE1A 3I1YA 4NULA 3PQ5A 1E7MA 1X7ZB 4UXHA 1J2UA 4JBXA 4R05A 4EHFA 1SIUA 2M6KA 3GDGA 3LDHA 2CW5A 2J4FA 2LIVA 1TCVA 1OLXA 4AMVA 3JQQA 2ZZMA 2IJGX 4B7ZA 3QY9A 1WXDA 1E7WA 1JPUA 4U7DA 3O03A 3L6EA 4JZKA 1EGQA 3FPHA 4WPGA 4YRCA 3CT4A 3KFVA 1KP2A 3UCXA 4BO6A 1MOSA 3PE6A 3DKRA 1XPJA 2G76A 2JFWA 3KHSA 4W5JA 4Y2TA 1RDFA 2CXSA 2IZ5A 2NXWA 1Q1BA 4NR0A 3W34A 3AI1A 2W6ZA 1XRNA 4CCSA 4Q19A 4D5GA 4CF3A 1SUPA 3U48A 1IULA 1UZMA 3KYCA 1YUBA 1DAEA 2EBHX 5HKAA 3T12A 4DT1A 5AUPB 4HUQB 5T8KC 2GD1O 2IKSA 3AR9A 3V4ZA 4OF4A 1EXNA 5C3MA 1JP7A 1KTVA 4R3NA 2P2ZA 1X7XB 1ORWA 2XQIA 1F38A 1VFPA 1XQYA 3B48A 1QMGA 2FLWA 3N8KA 3V8MA 1SQGA 2QZ4A 4BFCA 3FFBA 2YXEA 3O26A 4XOIA 3QU4A 3TSAA 2QTLA 2GBPA 4FDAA 2YQ4A 3NT2A 1ST3A 4DCSA 1IXYA 2ZRFA 5JU6A 5HHTA 2MYNA 2OK7A 5JS2A 3GNLA 3PENA 2I2WA 2CKMA 1M8KA 4HH4A 1WF6A 4KZPA 1RABA 3FD8A 1HGXA 4RWEA 3PQ3A 5TARA 5CX4A 4FE4A 5HVNA 2PLAA 2ENWA 2PU7A 3K35A 3TOSA 3B8HA 5BT9A 3BDAA 3GVXA 3ONEA 2IPNA 3BE4A 4KXMA 4RSGA 2B4KA 3OLCX 3LIPA 4N41A 4F46A 3G5LA 3GEMA 2C3PA 1K86A 1U7UA 1XMSA 1N8KA 3MBKA 1H5NA 4RSRA 4XXHA 2HZ7A 1WBBA 3MW8A 3EDRA 3UJ6A 3W7BA 2E55A 4Q3EA 4D6YA 1GPKA 3TKAA 2F3RA 3RS9A 3I9NA 3I01M 3CFYA 3ZWMA 1M0TA 5DE3A 4C4XA 5AJHA 3EB9A 1Y1SA 5TB5A 3QX3A 5FJJA 4QOGA 1X14A 3G6WA 1ICIA 4YIHA 1XZKA 2A86A 2JAXA 2XGOA 2WK1A 2W4IA 3LTEA 4RKQA 4B32A 1DHRA 1SU4A 2JGEA 5DTJA 3G7NA 3G0GA 4LY6A 5EESA 1WVGA 5A3QA 3EA4A 3OM8A 4OBXA 3KOOA 4Z8XA 1CD5A 1PEAA 1UC4B 3HCRA 3K1YA 3O4FA 4YGYA 4O4LB 4EPXA 1TIPA 3H1AA 3NMUF 1YCFA 1U9ZA 1K75A 2Q6KA 2W43A 1QGAA 2C2KA 3KQSA 1OV4A 3KQHA 3QMWA 3MWEA 4I2NA 5IYZF 4F4UA 1EQAA 2R00C 3QBTA 4L5CA 1HORA 4J76A 5F35A 5HWSA 2AEJA 4EK9A 4B3RB 1USKA 1QCYA 1DC6A 1QHIA 4C03A 2QMYA 4GP6A 5B2EA 2I03A 1Q22A 3IIIA 4OJNA 4BE7B 3I04M 3DD1A 2AN9A 4HYQA 5I9MA 1I33A 3ZGYA 1Q1EA 3D0RA 3PV0A 2BYTA 3WKDA 3GPCA 5IFLA 4LHEA 3CSUA 4AROA 4X6UA 3FPGA 2N3ZA 1PDWA 3JALA 5CLFA 4UUQA 3UO8B 2UUBB 5E9JA 3INRA 1OI2A 1RHJA 4NBTA 4NV3A 4AU1A 1SR8A 4HD8A 4MRAA 4XSGA 1ZK0A 1U8YA 3UK6A 1L1QA 3IPAA 2A58A 4FIDA 5CLGA 4G63A 3ZW9A 1Z0JA 2X8AA 3EY9A 3ZQJA 1MEEA 3LCUA 3Q3VA 1RPNA 3BZUA 3C6XA 621PA 4W5RA 3EFOB 3K8ZA 1T6YA 3I73A 1K2VN 2BSAA 1W5BA 4TM8A 4S1WA 3VO1A 5K20A 4DA8A 1XDBA 3QTBA 4RPLA 3OFSA 4NP6A 1D0IA 3B1ZA 4N3CA 1EZ1A 1ZQ9A 3A9SA 1FSPA 4ZT4A 2HQRA 2ZB8A 2XQJA 3F4KA 1ZR2A 1SK8A 2D3TA 4YR9A 2VNAA 1BS9A 3FETA 1XZJA 5C4MA 3EXFA 2GEFA 5HW0A 4LGCA 2XE8A 3ZDBA 2WQZA 1NM5C 2Y66A 3PXUA 3FGZA 4TMTA 2V8OA 5L4SA 1P17A 1NRXA 1FRVA 4G3XA 4KXXA 4M46A 3UQYS 3K5HA 4OMCA 3ZDRA 1JPVA 2SKCA 4CRWB 1PV4A 1P39A 3I6IA 4CKZA 3OAAD 1GGFA 3U19A 3N2YA 4XGIA 1RHQA 4YBRA 5F9FA 3CMCO 4D3YA 4A0GA 3QKWA 2ZPTX 3LSTA 1QR6A 1WLSA 2XWPA 1QLHA 1VECA 3G8CA 3IPRA 2C00A 4N9WA 4PS0A 3G8BA 1OHHA 5CA0F 1EG2A 1FQJA 2ZI4A 2ZB2A 4WADA 1SU6A 2QV7A 3OPXA 5DM60 4BWGA 4OHKA 4IXTA 1M1UA 2WWHA 3GLUA 2QMUA 5G3YA 3E3LA 1IXKA 2R8OA 3TUJC 4P33A 3H2GA 4UBNA 3C5CA 2IPXA 4IGEA 4TXNA 1PLLA 2Q8NA 2E4ZA 2R48A 5LJLA 5MFZA 4B3IA 5G1NA 4OAOA 4MW2A 4PHHA 2BLNA 2ZAGA 2ESRA 1K06A 2F8SA 4L4SA 3S2IA 1SCUA 5EJIA 3VNAA 2QPAA 5GGYA 1I3MA 1X94A 3PXEA 5IW8A 1Y8ZA 3UMFA 1GRVA 4KCGA 2VP9A 4EY3A 3ZJUA 1JEJA 1DQPA 4GOKA 4URHA 3FLBA 2OD2A 2V0NA 4TN1A 3VR6H 3RU2A 3BIJA 1EVJA 4FYJA 1ZK1A 3M4XA 5EEGA 3RSSA 2B1JA 1UZAA 5K0NA 4OFBA 3O3CA 5BN1A 4FYVA 4MWDA 3PDWA 3QVOA 4GI5A 4O8CA 4P4UA 4PGMA 3RQSA 3WBJA 4CJXA 5LLTA 3OZEA 2VXOA 3TSZA 3CUSA 1OBCA 4UNSA 4E2ZA 4Z7QB 1N1EA 2O8DA 4YCJA 1C7EA 2VYVD 3AB8A 3OE5A 2IEIA 1VIDA 2R25B 1F0YA 1F6BA 3P8ZA 2BMVA 3QF4B 4RMJA 2OBXA 3VHXA 4F5YA 1N7IA 5BVGA 7MDHA 1NI4A 4MLPA 2Q5FA 1G5FA 1U2DA 4CXMA 2JD0A 4C4YA 4TYWA 1PJRA 4CUJA 4DPMA 1U9CA 4KSCA 1E1KA 2WUDA 3JAMA 1G8AA 2CL0X 1D0VA 1ZI8A 4KWIA 4RZXA 3RS7A 5MN5A 4GRDA 2DR2A 4UU7A 5F51A 1OXVA 2W6ID 1OZGA 5HF9A 1NVMB 4F2PA 3CLRC 5FR1A 3CX7A 4P7KA 3B3AA 4NU6A 3GZJA 2Z08A 1IB6A 2FW6A 4FJ2A 5T7BA 4BDSA 4QUBA 5IHPA 4NE2A 2JFFA 3OU6A 5ED4A 4XGRA 1B6RA 4IG4A 5TMDA 1F17A 4BO4A 1APBA 2C9CA 2FG5A 1NQAO 1LW7A 4I8DA 4BMXA 3LO5A 2UZ1B 4RX1A 4MYHA 1E8MA 2FWJA 4C5CA 1FZTA 3IUJA 1U8CB 4BNMA 1ZM9A 5EKXA 1TU0A 2DULA 2H1IA 5JISA 3ORRA 2BT4A 3JVIA 2QIOA 4IMIB 1FLAA 5ULLA 2XGJA 5LZ9A 3M1YA 2X8LA 1C9YA 2ZCVA 3MJRA 3Q12A 3CT6A 5K6AA 3I72A 4HQNA 4JWTA 1MJGA 2H8KA 5JXJA 1KYTA 4D9EA 3F8WA 2AWNA 3GROA 2XYVA 4IAOA 4CUKA 4L6AA 1M73E 1CDZA 4Q9DA 4DJTA 1UKYA 1QXSA 1Q11A 2QUIA 4QUAA 4CL3A 5KEIA 5KNBA 1NN1A 1WRBA 5CB4A 2HMSA 3CLHA 3V7WA 4RZHA 3G1WA 1NXQA 2B1QA 5I4CA 1AGXA 2YUTA 2I65A 3CE6A 1OHHD 4EY5A 2BR4A 3BJMA 5CPFA 4Z1MA 4R0MA 1U8UA 4JENA 2HRDA 3QENA 4HVTA 2ZXFA 4IX1A 4K3VA 4RK1A 1KOLA 3V48A 1XEXB 5JS1A 3ZXXA 3EGOA 1U2ZA 2XSZA 3R3HA 4HOYA 3VNVA 1U94A 1T4DA 2CHEA 1RI1A 3KKPA 3ULKA 3GIDA 2YIMA 3PLNA 1MQ9A 4TLAA 5FWYB 5HTKA 2HM7A 3CLTC 4A8JC 3K9GA 5KYTA 3SOZA 3ST7A 1E0AA 1A9QA 1S3FA 2ZYSA 4BATA 1HDXA 1T2UA 1WVMA 1C0IA 3EQZA 4Y9RA 2UYYA 4NU8X 2ZIVB 5E3HA 3ENWA 5JAQA 1OOEA 3DAOA 3OMWA 3OE7A 5AQEA 1L5KA 1J20A 4UC0A 3EIXA 2GF0A 1Z06A 2CDNA 2NUAB 1WABA 3ZLTA 1GSIA 2IIVA 3EQ6A 4LTNA 4DXHA 1MB9A 2YXBA 3OSZA 1JJBA 3NXKA 2XNHA 1NMYA 5KBYA 3K9CA 3R2JA 2ZRQA 2HR1A 4XPZA 4PZ9A 3F6CA 5GJBA 1OUMA 3RFTA 3CHYA 3WGOA 5CFLA 1P8JA 3UB3A 4JQYA 2E4AA 5DTIA 1DKUA 1ZM4A 3NNSA 3KJGA 2H08A 3DYVA 3ZZ1A 1P2VA 1YZTA 2Q5IA 1C9DB 1FYVA 1W1UA 1WUHS 3PPXA 4W9RA 4OJKA 5FF9A 5FI5A 3R7AA 2E9SA 4DDTA 1THMA 4NC9A 1W94A 2GHIA 3AXSA 3IDSA 2YYYA 3P97A 4R1SA 1QZ3A 4TWZA 3BUSA 2P6PA 5DPMA 1YUMA 3PC7A 1ZUIA 3ZS8A 4DJ5X 1PR5A 2YHSA 2JGAA 3QIVA 1QR2A 3ICPA 3HDQA 4HYYA 2AYYA 5ERXA 2R3SA 4DIOA 1YK1A 3T1VA 4BVHA 2IP1A 4JLWA 1JIKA 4BNIA 1DRJA 3JQ6A 1ZFNA 2H2IA 4NNPA 4N7MA 4H08A 3SJUA 3HJGA 1E2UA 4IHKA 1R66A 2R47A 5EKTA 3AESA 1P4AA 1T43A 2XNJA 3VPSA 4NU0A 1GYRA 1RVV1 3CKKA 2H9AA 2XMQA 3GNQA 1B74A 1IZ9A 3IUYA 5E4YA 3ZHUA 1GEGA 1H2RS 1KBOA 2G06A 4H15A 2A9OA 4LWZA 3EGDB 2JLWA 1AUOA 4LF4B 1B8VA 1EVLA 3I8OA 1C7RA 3NGMA 1PT5A 3NW9A 3RBZA 3UWDA 4MR7A 3WL3A 3AVXA 2CXOA 4BASA 4A2CA 1QFYA 4EVIA 1TI7A 1OLUB 2AJTA 2TRSB 1Z63A 2HCTA 3MN1A 3UYLA 3ZCPA 4JVOA 1XA0A 2IYRA 4FOSA 3V1TC 3N8IA 7MHTA 2PA0A 1ZJYA 2XQKA 3QLJA 2FX2A 1J2TA 2FWPA 2I0FA 4EO4A 3EQ8A 3K6SA 1FCJA 2NO9A 4AJKA 3LLSA 3FOWA 3JVDA 5EMJA 3U7EB 4WK4B 1TEVA 1XDGA 2N75A 1P0QA 4Y9SA 2WVGA 3MCWA 4Q3DA 1OLOA 2ZCUA 3OPQA 4CCAA 3BTSA 3OCYA 3FF4A 1NXTA 5CTJA 4G9BA 2BFBB 4IQGA 4YDHB 4C0KA 3NTQA 3DLAA 1C81A 2E1PA 4TKUA 3C8HA 2OCDA 2DBYA 4XWOA 2H92A 1ZRSA 3W4KA 5JZ9A 4OHCA 1C3OA 1R8JA 2XB9A 5E9QA 5IKXA 3GPBA 3MAAC 5K51A 1GFZA 2GO1A 1MRZA 3T9CA 1HWYA 1W1WA 2CV1A 4X6XA 1JYFA 4FMBB 5FIUA 3IMGA 3GLIA 2OR3A 1KAMA 4G5XA 3TI9A 2V7WA 2A9VA 2RHTA 2D4AA 3NP9A 5HA5A 3DUFB 3PR1A 4E33A 2YV4A 1NJ2A 3G79A 3LZDA 3MWKA 4UREA 4YMUA 1QO7A 4MQLA 1HG0A 4LHZA 2O5EA 2DSTA 1TU4A 1PL0A 2HKIA 1CUZA 3K5WA 3O6VA 1HE2A 2GYUA 5ITVA 3WIVA 1DBVO 4YLEA 1ZNQO 3JTMA 5D3MB 3RRJA 5HKOA 5BWMA 5K9ZA 4LSMA 5B6IA 1MX3A 2OD7A 3EVGA 1BOOA 3KB2A 1Z45A 4KX5A 3SYNA 4M9ZA 2R7LA 3ER6A 1EUCB 2C03A 1ORHA 1W93A 1SXJB 3GP3A 4QIHA 1BU8A 1C9KA 4PAMA 1IM2A 2PGXA 3N5KA 1SUIA 1CR6A 4I50B 1Q0SA 1YZGA 3ZE7A 1GILA 1HQCA 3CWQA 1NASA 4DGSA 2F1HA 2VZLA 4B5KA 2P2GA 2R66A 2VHVA 4B81A 5IAAA 3ZCXA 3CURA 4ZYZA 1OT3A 2YOFA 4YV0A 1XTSA 2H2DA 2FH5B 4HRXA 2Y4NA 1SUCA 2H3EA 5DFAA 1XAGA 3VPXA 4ECAA 3DW3X 2ZR8A 4IXDA 3H4TA 3F3SA 3LQ2A 4JEMA 4L0MA 2W2MA 3C4VA 4EGFA 4QEDA 4Q02A 3KZCA 4OI0A 2GRUA 1UXKA 4E2XA 1JQBA 4FBMA 5F76A 1Q0QA 2W83A 2Q9AA 3UJ8A 3KDPA 3BEOA 4YCNA 5C1IA 5JALA 4QDJA 4PLGA 4HNUA 4KFUA 2Q99A 3ILXA 2VWPA 4HQOA 2ZBQA 1O89A 2PSSA 3DHWC 3L8HA 4HMOA 1UC9A 4NMHA 1X7WA 4QFBA 1ZGJA 4EKNB 3TTWA 2CYCA 3HFGA 2Z5FA 1TVCA 3A6HA 2DC1A 4KWEA 3WZMA 3NIWA 3L79A 3ZPXA 3MRVA 4C0XA 3FNFA 1EGAA 1R37A 5JOQA 4X3OA 1WBDA 5I01A 2JGNA 1NJ6A 1Q6ZA 2NNWB 3AH8A 5JD5A 2B8JA 2P9BA 1W1IA 4MMZB 2OZKA 1V6SA 3WDKA 4Q7KA 1GQOA 4BAGA 2XD9A 3PHHA 1J99A 2CDRA 2NYUA 4PIPA 4M6WB 3T5CA 3W5JA 5F77A 4AULA 5JDCA 2DG2A 5AW3A 1J90A 3FBGA 2FEAA 3EWSA 4P4GA 3A7DA 1DXYA 1E32A 1FU4A 1TT5A 3RIEA 4M2LA 1MPXA 4MWZA 2XVZA 2G72A 2Q3CA 1UIRA 1HEIA 3TLZA 5HQTA 4FNMA 4AMUA 5LD2B 4MYRA 1M10A 1ODKA 2QGZA 5F7JA 1RI4A 1TQ8A 3G0BA 5H83A 4GI2A 2I6UA 5K3EA 1TFRA 1CK4A 1QIGA 3UXHA 1A71A 2ZUUA 3LKVA 1IDN1 1JLLA 1RXUA 2A0FA 2CJWA 3DO6A 1JE1A 1P0MA 4MRRA 1NNEA 1ZK3A 3L7OA 1JUDA 2PJZA 4ME6A 4F2DA 2YKGA 2BN4A 5DWVA 3G2QA 1G5HA 2YWRA 3RKSA 1SXJA 1XMQB 3KWFA 2XJ4A 2MSLA 4JROA 3TFQA 1WS6A 3VJMA 2Y1EA 3O74A 1HBJA 2F1JA 1E6EA 4ZTBA 4IZ6A 1B41A 1KO1A 3I5UA 4QNNA 1NUHA 4YP0A 2XGMA 2GPSA 3O8OA 4AP5A 4J0CA 4LXUA 4NENB 4J16C 2CVQA 5IUKC 3SJ7A 2PN1A 3G1TA 3DPIA 1HNXB 2IU4A 4LDAA 1U2DC 1RAFA 4UMDA 2D2IA 3FMGA 3I01A 2ZSEA 2B3TA 3NIGB 4QGHA 3PR2B 4DM3A 3Q8KA 3GLGA 1VSBA 1E7RA 3JATB 4MVJD 4AY2A 1YH3A 2FE4A 1VE6A 2GLTA 4BWYA 1BWPA 3P0JA 2NZ2A 1VL8A 5KKCA 2G9UA 3DP7A 3RV4A 4FDMA 5MDHA 4TKMA 1PQPA 1U3CA 2AXNA 3C3MA 1I51A 2GD2A 2QPLA 1RWBA 2X1VA 3FNGA 4W9NA 4WA7A 2NMVA 3R7SA 2XA1A 5LOVA 2J5RA 2NVOA 3FHJA 5H59A 3UK2A 4NJEB 3NHWA 5DNDA 1ZC4A 5AUQA 4RDXA 1I2CA 4AWBA 3W79A 3BQMB 2XXJA 1P5FA 2AUMA 2G1KA 3W2GA 1L5OA 2R1UA 3FYSA 1OY1A 3QKRA 4FZ5A 3IQGX 4HDSB 5JQGA 2UYGA 2ZIUB 2V4UA 2J41A 3AF5A 3NM6B 3S68A 2O7RA 3NHZA 3R7WA 4QVKA 3RVOA 4J3FA 4J91A 4M6WA 4JUIA 4BMYA 1NF3A 2ROQA 2B92A 4O08A 1VE3A 2P30A 1AHIA 1JJVA 3Q5GA 4AUKA 1CERA 4TKLA 3CMMA 2LR0A 5D01A 3ZZUA 1GDDA 1YGPA 3GLTA 2EGGA 2P27A 3AHJA 3IA7A 3PSHA 4L9RA 3I6MA 4UBKA 2HTEA 5EPEA 4PSAA 1JF8A 1L8OA 3RUIA 4DJFC 1U1FA 4OQXA 1TK2A 3PR3A 1E3IA 2IZZA 3BZWA 2IPAB 4Y18A 1ECJA 1OI4A 3IYLW 4ZCPA 3NZEA 4F9FA 5FL3A 1T0PA 3MTQA 1QO0A 4JNCA 2G77B 5BYJA 1VJ0A 1CZLA 3EPPA 1JLLB 3I6BA 3O4VA 3LYUA 4JQZA 4JSTA 1T4MA 3VYVA 4C7XA 1RU3A 1KETA 1T4CB 3EW9A 2ZYWX 1K8YB 2QW0X 3CN7A 3GAAA 4MS3A 2WMYA 6NULA 1B14A 1N5LA 5BMVA 1K92A 4MJXA 4ZK6A 4BMPB 2O2YA 4JLMA 4KWHA 1GPBA 3NYIA 3OWXA 4E5KA 4EYSA 1X7DA 1A5BB 4KO1S 3ZY6A 3O8OB 1CFZA 4Y2XA 1TM5E 1ZVMA 2FMHA 5F2EA 1K0UA 2PMEA 1DS6A 4CQNA 4FOOA 1JIXA 4K2HA 3SFTA 4LF8B 1G1AA 3CZAA 3Q3EA 1JHYA 3PQ7A 2Y1WA 3GLGE 1Z17A 2D2EA 2QMEA 3OJOA 3PCXA 3R6TA 2G7MC 1UEIA 2XE4A 3UQZA 5K8TA 5FTKA 1XCLA 4RFSB 2DBVO 2Y0PA 1YRLA 2YWCA 2ZYRA 2HA0A 2NZUG 3F3KA 3HGMA 2TMGA 3T4XA 1KDRA 4DKXA 4G86A 3H2SA 4HS4A 4ZCIA 3C7CB 3DEJA 4MUBA 4N0MA 2P6MA 5CPBA 3BF7A 1NVAA 1TF5A 2H59A 1FUIA 2MMGA 3GOHA 1I1OA 5JI2E 3Q6MA 5CHYA 3T5DA 4NJEA 4TLMB 4BNUA 2CLHB 2YZ2A 2QP3A 1GCUA 1TEHA 3E15A 4EVSA 1OD6A 3MJ4A 1BWQA 2HDHA 2FPKA 4K8OA 3QKIA 1H9BA 1I4EB 4D99A 4DYHA 5LB2A 3MG9A 3IAEA 3PVCA 4LX0A 1E3MA 3QITA 1FX0A 3QX8A 4O2AA 221PA 3X44A 3ZVRA 5D84A 1KMCA 9GPBA 3T7CA 2OB1A 2J3QA 4RA6A 1WD7A 1XRMA 3BYZA 3QSGA 4LFAB 1NN3A 1HT3A 3OUUA 4R2IA 3HBLA 1R6BX 3LCMA 3LVBA 1O5TA 4LY9A 3X0DA 5LJIA 4OLAA 2TMYA 1MAVA 2PA3A 3IVGA 4YP9A 2JNWA 4L0DA 4A6PA 2C8VA 1ECFA 4G09A 5CDGA 4UTXA 2CD9A 3B2EA 1GNSA 2JIBA 2SCUB 4PR3A 3D9QX 1TCUA 2J4CA 2QYHA 3LGSA 3IIMA 4KO8A 4O8ZA 4TUYA 5T3UA 2VQFB 3GJSA 1FYFA 2XLCA 3RU3A 2PKXA 3LFHA 3PD1A 5CT9A 4AO6A 3ESZA 3P2OA 2RARA 3HUUA 3ZWXA 1VPWA 4R6WA 5BW8A 3F67A 4ZCLA 2JBWA 5IJXA 5LYYA 1DTSA 3H87A 2DZDA 3GLSA 4YRZA 2WE7A 5GMOA 5LMCA 2QV0A 4KOAA 1C30B 1NVGA 4Z51A 2VQDA 4Z9XA 2PFKA 2L0XA 2NAPA 3AFHA 4RABA 3ROQA 2GZHA 3BGVA 4H60A 3S3TA 3C6ZA 3P2JA 3WDMA 4D0NA 3B36A 3SI7A 3ICQB 4HNHA 4KAAA 4LNAA 1KNQA 2VJQA 5EPUA 4N0QA 1LI7A 1Z6GA 1G19A 3MWDA 5EHGA 1GG5A 1M74A 2BGKA 3KX2A 4YDQA 4K8RB 4CMKA 1ELOA 2R44A 3VXKA 4RFLA 1NDQA 2B4AA 1DJLA 1IHDA 2JIPA 3GN2A 3ZJTA 1QE0A 5CA1A 1F0PA 4KIGA 4LHVA 3WBFA 2HU7A 3C85A 3L41A 2F7SA 1PTJA 2HA6A 1LUAA 4KRFA 3MWLA 4CNQA 2L19A 3I45A 5KSOA 1GG9A 3FTCA 5DX0A 1TE2A 2PUHA 4RV5A 1UT5A 4LZZA 3ZQKA 1OT5A 1SVKA 2JLSA 4HJXA 3ROGA 5BWLA 2DPGA 2PH5A 5IM4F 1J42A 1QJCA 4YT8A 5TS3A 2CB9A 1XQ6A 1V41E 4YT5A 5CBKA 2PBRA 3LHFA 5KYKA 5FORA 1RM0A 2VWHA 5FFMA 2BONA 3L1UA 3PUVA 2TMDA 3EK2A 5SZHB 1CY2A 2BEWB 3HFSA 4E88A 2Z2JA 4ZK2A 5JNLA 4YUZA 1P29A 2I4IA 2F8TA 1UBNA 4X84A 1SD1A 2VUIB 4AG5A 4EI2A 2FOXA 4QU5A 3GJ5A 3GLIE 2XNKA 4WLVA 3HFRA 3O1HB 1SA0A 2FWAA 5DK4A 2I1WA 3U39A 3VZCA 1D1PA 2V55B 3M6MD 1TZBA 1G7SA 4BMOB 4WBSA 1OWMA 1FDTA 1TT7A 3VSDA 2IZOA 3C6KA 4RWZA 5KOJA 1G3QA 4D79A 4DLRA 2CEAA 1XDDA 2WUEA 3FWNA 4LJAA 2HMTA 3WYFA 4KG7A 4MJ3A 2PQ2A 1E9AA 1SEVA 4ODIA 3HDTA 3N0XA 4TUYB 3TNDA 3V3KA 3P5SA 5EUMA 2B5OA 2HA4A 3B5IA 3OHPA 1SVIA 1OH8A 2VJDA 4XPIA 1Z12A 4FLMA 4CT5A 2WFLA 1R6AA 5EWLA 5FKJA 4Q4HB 1E2QA 2NT4A 3IPLA 1H4SA 1K66A 4TOIA 2ID9A 3QU5A 1NXPA 1QZXA 5I9SA 2CYAA 4DDKA 3I5YA 2H7YA 3HEBA 5B6JA 1ZH8A 3SZGA 4BJ5A 2OQIA 1SQ5A 1RZUA 3GO4A 3KQOA 5JLAA 3LQ4A 2VDRB 1XXHB 1JTVA 1O6CA 2Q2NA 3KVYA 4DDHA 1G6OA 2CVFA 2XCUA 1E6MA 1MDBA 3D31A 2Q5QA 3PXGA 3FWYA 1X87A 3AB7A 3KLNA 4BGIA 5BPFA 4RTSA 2HW8A 5IRCD 2IX9A 4AF8A 3EGXA 1ZSYA 1PJBA 1OFVA 4BVFA 4KQJA 1AGYA 2ZBGA 3KZVA 5A4JA 4KR6A 2RD2A 2FEXA 3OZGA 3WBKA 4NJMB 2NW6A 3FTFA 4RV4A 3FXAA 4YIKA 3KBOA 3TW6A 1T5DX 3KXKA 2I7TA 2VLIA 1XC7A 1Y81A 5T64A 5IZ4A 2CHVA 2PNJA 1UM9B 4MKFA 5DHAA 3RAJA 1C3XA 2EFYA 3L2OB 4WN3A 2AX4A 1EEXB 2XTAA 3VNRA 3E1KA 1V71A 1R0XA 2DFDA 3CEMA 3LUJA 4MRSA 1LGYA 3WO0A 1U2RA 3IAUA 4KMRA 2RGBA 4B45A 1DO2A 1RRGA 3DOJA 2WNSA 3MSCA 2PKQP 2WJPA 3BWXA 1O77A 3K1TA 2A78A 4WINA 3IPXA 3O83A 3G13A 2WF9A 4LEIA 3DFUA 3PDJA 4NCHA 1MJGM 1P31A 4GD3Q 4TTAA 2P6RA 1GNPA 5KVAA 3TKYA 4EJFA 1MRSA 1V8PA 4QGSA 1SKAA 4BZPA 2A8YA 1M1YE 2VDQB 3AEQA 4YAIA 2PUDA 1QU3A 3IUBA 2A5DA 1MAHA 3I1IA 3LUFA 1JMVA 2R1TB 3OBBA 1V1MB 1KQOA 4DSAA 3LLCA 3U7HB 4X97A 4TKZA 4GOMD 2HC9A 2AFIA 1F06A 1V4NA 2DR0A 2V9ZA 1EGMB 3ELWA 3HVUA 4I6JA 3ZU2A 1PEKE 3DCJA 1DIRA 2JFXA 4Q01A 3TFWA 1TKAA 1AF4A 1NOKA 2ZB3A 2ZTUA 3DL7A 4E2FA 3EXHC 2O2IA 4RKEA 5D6OA 4PNZA 3Q15C 1LV8A 2QDXA 3V4FA 2C94A 3FKQA 3SR4A 4C0AC 1WMBA 3KYIB 2GETA 3NS7A 3AWDA 5H4GA 5IU6A 2D5LA 1C3LA 3IQZA 3S28A 1B4DA 1I7LA 1RYMA 2WSLA 3RS2A 1TLTA 1P6XA 1PUXA 2JAPA 3MCUA 4PANA 4Z7NB 4WD3A 3GVIA 2V7VA 4UBOA 1RQGA 1JVBA 1EVKA 2CN1A 3NKFA 4X1OA 1T6BY 3SLKA 3FOEC 3ZIAA 3EXG2 3JR3A 4JVMA 2WZQA 4ZMBA 4ZOLA 4HGYA 2GTPA 3E61A 4MVWA 3L04A 1KMNA 2HHLA 2QD4A 1D1TA 4AO7A 1WZEA 4D56A 1XZAA 3PDIB 4S04A 3FHTA 3ZH9B 2B20A 3EJWA 2NU7B 5JSQA 3SX2A 2GWHA 5KDOA 1T2EA 2Y9MB 3SZUA 4CTJA 3KOXA 1ND5A 5JJIA 4G4JA 2OCAA 4PWYA 1A04A 1QH8B 2PSEA 3I6ZA 3HWWA 3AEXA 1N0VC 4NHEA 4DUPA 5AI0A 3ISTA 3BERA 5IDXA 2C4NA 3P2MA 1NBIA 2H48A 5FTWA 2XQGA 1AZLA 4QAQA 5HCUA 2DKOA 4DLPA 4JR0A 1U7HA 4ZAZA 4ENRA 5HILA 2P2SA 2AYXA 4CIYA 4DHEA 5IBQA 4EJSA 2RHLA 4AN0A 1YZUA 1HOXA 1GPH1 1Z38A 1ZNXA 2C2MA 2ZIXB 3M3DA 3V8PA 3C8DA 4PGAA 2Z58A 5JECA 1JWAB 1J9ZA 2RAVA 1IEWA 2Y0DA 3UJ9A 4DA6A 2FJ0A 3ESBA 2DHRA 4OKIA 4MWEA 1K7YA 1UM8A 2H0RA 3W77A 1XTVA 2QXTA 4ASUA 1Z7EA 2BEJA 3F5QA 4JELA 5CEJA 3KKQA 3KPVA 5JYDA 1QDLB 5DN9A 2BCEA 2P9FA 3JARA 5EZ5A 4JD5A 3OCUA 2QMZA 4ETWA 3B6JA 2Q3HA 3H84A 4ZVKA 1M8JA 3CWZA 1ZDMA 1ISRA 3JW8A 3T5GA 2DUMA 3GOQA 4A16A 1AUPA 3P4YA 3OPYI 3UAXA 5KWVA 2VT6A 4Q34A 4LZPA 5FEUA 2CZQA 2ZUEA 4E21A 1JB1A 1JG1A 2YV1A 3EXEA 2IYVA 5ESWA 2X9GA 1CUAA 1FYWA 2BKEA 3NBUA 3V46A 4GX0A 2QR2A 4EITA 2JHGA 4CEIB 1ULUA 1H65A 2XRMA 3L49A 3VVMA 1L1RA 1V11A 4WV3A 2EFHB 2G09A 3JWHA 1LBQA 4YPFA 1GG2A 2BZGA 2X8BA 1RYFA 2GNAA 1J97A 2Y27A 3O47A 4BU1A 2V1UA 1IPHA 1JAZA 4M9SA 2JDIA 1AO3A 3SPXA 4PZYA 1EWVA 4QA9A 4M0PA 3LXRA 3U7QB 1MIHA 5IKPA 4WEOA 5FTLA 3EZLA 2A7QA 3OICA 8ATCA 3RTAA 3MGCA 4IDAA 3WMXA 5JD6A 4LV5B 3QE4A 2HJRA 3M8KA 4EOGA 1IQUA 5AIBA 1E96A 1J4AA 2CBGA 2XPCA 5IKEA 2A30A 3G8AA 2I8LA 3SGLA 5KWIA 1T13A 2WYIA 1GAQA 1DUSA 1I80A 2IF0A 4HDOB 3ZD8A 5FQOA 1SVMA 3IH5A 5FPHA 3HDJA 2P9QA 2WKPA 1WSDA 2XDQA 4F96A 4D8WA 2QVCA 3CZCA 4TV9A 4DDWA 1F2UA 2EKDA 3E7DA 1NW5A 2DPMA 3DEHA 1V96A 3COPA 3DL4A 4GGMX 3S2YA 1TKBA 3TDMA 3HJHA 1D6SA 3D6MA 2E3JA 4UTRA 2QPTA 2PL9A 5AVTA 2FPMA 2G63A 4IUBS 4EJSB 4X95A 3PS9A 2WG2A 1V0JA 2HSJA 4JR2A 2CFSA 2X5JO 3TIFA 1BDJA 1FLNA 2Q6OA 1WPGA 4JI6B 4B31A 4JCCA 1A88A 1R6VA 5CYOA 2VYCA 1GZ5A 5CNKA 1GZ3A 2CLOB 3D4LA 4Z0HO 3VAYA 5A02A 3JZAA 1BEEA 2DXIA 4FC7A 2VAWA 4F97A 4B75A 1MB3A 2GYYA 4OXXA 3IX7A 4L2IA 3CJTA 4WN9B 4F4IA 3NJ4A 1NBMD 3FIUA 5FULA 3ZNNA 1OR8A 3M33A 4PPGA 1UDAA 3V2HA 5DW3A 1BRTA 2AZDA 1C29B 1IDOA 2JS7A 5K0GA 1ZAKA 2Z1MA 1KI2A 1SB9A 5CXSA 4B6QA 1R4NA 4KREA 1RP7A 1UKEA 3I9FA 3PUXA 3THYA 1EHYA 3HLKA 5MN4A 1P18A 1ZM3A 1Z25A 4V0QA 5HJ2A 2O8BB 4CL2A 3SC6A 5REQB 4OX9B 2QY9A 1DP4A 3K0SA 5CP8A 4CEIA 5BSKA 1K6EA 3IIJA 5FLKA 5LQRA 3S2ZA 3D1VA 1RXEA 1QK3A 2QLMA 3WZLA 1G21B 3O8CA 2GSDA 3JQRA 4ZWNA 5CDYA 1NRIA 3KU1A 1JI3A 1SMKA 1WXIA 1G64A 2M1ZA 3LC7O 5E6RB 1HL7A 5B7NA 1Y33E 3D5EA 3T5BA 4D96A 1TO2E 5EVJA 4PBSA 5ABPA 2R86A 5DTQA 3KYDA 2BEUA 3E2PA 4B3JA 4B4DA 4I9FA 1KWKA 2RHWA 1Y7LA 4H4CA 4QELA 5KAPA 3T7JA 4LF6B 2NU8A 4RPIA 2F6RA 2WHRA 1K7CA 5KYYA 1NUSA 2PX3A 1ZD1A 3QA3E 1ODIA 3NBFA 3D2BA 3RM3A 1N3LA 2QIPA 4M7WA 1B8NA 2C2OA 1VLVA 3BFXA 1XQ1A 2AJCA 1NFRA 4OQZA 3OZWA 1HA3A 2KWIA 3Q72A 4AY6A 1NN0A 3FBTA 3KK0A 5F78A 2FNAA 3ZHXA 1NBWB 2HF8A 1M67A 4E15A 4EGAA 1GFSA 3HKBB 4FB4A 1FRNA 1QDEA 4BTVA 1T36B 3AK4A 3TL3A 2I3GA 1IHUA 2CNKA 3G0OA 2HIMA 2ZJ4A 3HSYA 1F6DA 1LX7A 1NLFA 3L6DA 4GWLA 3W05A 2EFGA 2Z3WA 4OQNA 1ADBA 3OKAA 3GA5A 1DFIA 4R01A 4JL6A 1G2PA 2HX1A 2OHGA 3G2IA 4YMHA 1FPQA 3F49S 4PNHA 4XB2A 5F1KA 4AJPA 1FMTA 2QQFA 3GVCA 2XZOA 2OGTA 4UHKA 1XD2A 4GLJA 5SZJA 4LTDA 1JSRA 2FRDA 4RA9A 1PG5A 1JT2A 3MB8A 1NJGA 1SZJG 2ZS7A 3H5RA 4D3SA 4DR7B 3TQSA 1M2OB 2VYQA 4BQQA 1FJGB 1URPA 4WN9A 4RL4A 1G21E 3HWSA 1W5FA 2IOQA 2W98A 5IYZB 2CE2X 2PUEA 2HRCA 4M76B 4DR2B 3IPCA 1PL7A 2IPOA 4YCDA 5GQSA 5IKOA 5KTOA 5CNIA 2DMRA 3CRMA 2FR8A 2J6BA 2OILA 3NPAA 2G04A 3U2QA 3OZ7A 1V3TA 1WUJS 5EFOA 4IDQA 1T1EA 3RRFA 3BRCA 1LPOA 4YR7A 5CYGA 5KYGA 1L8LA 3F46A 3R7FA 2A88A 3RVLA 4E7OA 3ND6A 2CB0A 1N75A 4JNKA 3HRHA 3ML1A 1QIHA 4UDXX 2XXBA 5I51A 3WLQA 4Z3OA 1L6IA 2HF9A 2PHZA 3ZE1B 5L45A 1WY5A 3L7IA 5H16A 3HDGA 3D6FA 4BE4A 1JLRA 2C3MA 1TJPB 2DFNA 2DHQA 1W73A 4DV0B 1W96A 4DLNA 4JJIA 3SS9X 3A2NA 3AUAA 4FONA 4M7RA 5KYUB 5LLDA 1Z16A 4JXXA 1XKXA 2P9HA 2B78A 4MROA 2WM8A 1NHWA 1N3IA 4QASA 1QPBA 1DAPA 1RXYA 2ZSJA 3L0OA 4WESB 4MGKR 3RR2A 5KTYA 4J0HA 4IEFB 4KAFA 5ELMA 2XB6A 4OEHA 5ALJA 4M55A 4RTNA 1YIOA 5AICA 5DKFA 4F71A 4OU4A 3R9XA 3PA8A 5NULA 3ME5A 3O8QA 3WLFA 3H0KA 1WXEA 2ZRMA 3OCJA 4AT1A 2YMLA 4JYCA 1HDGO 1O9GA 1RQLA 4O4IB 3EVFA 4BQRA 4GDFA 4UHJA 2VHYA 3NJ8A