1YB1A

Crystal structure of human 17-beta-hydroxysteroid dehydrogenase type xi
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
244
structure length
243
Chain Sequence
RRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITGVKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 17-beta-hydroxysteroid dehydrogenase type XI
publication title Crystal structure of human 17-beta-hydroxysteroid dehydrogenase type XI.
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 93
structure length 243
sequence length 244
chains with identical sequence B
ec nomenclature ec 1.1.1.62: 17-beta-estradiol 17-dehydrogenase.
pdb deposition date 2004-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1yb1A01
4PZDA 1IYZA 3INTA 1WPQA 3VHRA 3OH8A 4BMSA 3A06A 4XQ9A 2NADA 1BW9B 3DONA 2C0CA 1PU2A 4B7CA 3K5PA 1UP4A 4PVCA 4TKMA 1P1HA 2IZ0A 1Z74A 4QO8A 4K28A 4R9RA 1HSOA 2DBZA 1R4NA 3ZNOA 3ZU3A 2X7HA 4F46A 4XIYA 1I01A 1GR0A 3WOHA 4DC0A 2WSBA 2P9EA 4QQRA 2BFMA 3DFZA 5A5EA 1HE5A 2AEJA 1PR9A 4DPMA 1E7MA 4XZ3A 3GUCA 5EN4A 3W6UA 1H9BA 3VAZA 3GN2A 1M6WA 3GAZA 1LDGA 3U4DA 4CM5A 1IZ9A 1HXHA 3JD2A 2JD1A 4I5FA 1VJTA 1N1EA 2O23A 4FB5A 2VTDA 3WYEA 2ILTA 3RKUA 2VYNA 1IE3A 4E12A 1GQ2A 4EJ6A 2GCGA 3GN1A 2EGHA 1DRUA 5A1TA 5A02A 1XR3A 4R1SA 3WG9A 1V3TA 2GGSA 1LDNA 2JD2A 1X1EA 3ADOA 3K8ZA 3A1NA 2QQ5A 3RUHA 1LQUA 2B36A 2NU8A 3RROA 3DAPA 2GZ1A 4ZQGA 4IDBA 4NFHA 4FD3A 3W8DA 3A28A 3WJAA 4IZIA 4A2CA 4XWYA 2ZB7A 4YJDA 1DDOA 1V8BA 2NU7A 3SBOA 3P7MA 5BNIA 3DTTA 3QV1A 2R00A 3NX4A 1WW8A 3KTDA 5T8KC 2AMFA 1UDAA 4NU6A 4R1NA 5DULA 1LUAA 3TZ6A 2O3RA 4WOKA 4U0KA 3ROQA 1YB5A 3ONFA 3OEYA 4U8GA 3JQ8A 2O3SA 4G5HA 4CLDA 2VUSA 3PHGA 4L8VA 4M54A 5TJHA 4EYEA 1M76A 1T2EA 2B83A 2H63A 3LT0A 1DB3A 5JS6A 5L40A 3NT4A 4H7PA 5KVVA 2JAPA 2OFPA 4AJ2A 1SNYA 4DQUA 4YJFA 2CDAA 1BSVA 2O3TA 1PR3A 4GPD1 4NU5A 3PVZA 1HWYA 2RAFA 1NQTA 1Q0HA 3RCBA 2X23A 3OFSA 2CVZA 4RQUA 5JNLA 4J3FA 1KEPA 1Z82A 2PKRA 1A7AA 1KY5A 1WLYA 2HU2A 1PSDA 4XR9A 4D79A 4D3FA 1LA2A 3MTGA 5DCWA 4DLAA 1ZSVA 3RAJA 1EMDA 1D4FA 1T24A 4W9NA 3RUEA 3MJTA 1MFPA 2XXBA 5KVCA 3VPFA 2P91A 3IC5A 2NVBA 4ND4A 4L4SA 4J16A 4CL3A 4WK6A 2NUAA 4BKOA 1HDGO 2PKQP 1ID1A 3VDQA 1HDYA 1E1LA 3GPIA 4FOSA 1HYEA 1QORA 1R0SA 4JK3A 3UOGA 5MGBA 3E03A 2EIHA 4IZHA 2Q3EA 3OJEA 3CE6A 3HG7A 4IDDA 1B8VA 2GO1A 2XAAA 4K6CA 1SOVA 1D1SA 4OQYA 3WR5A 4BO3A 3JYNA 1GADO 2Q1TA 3AM3A 5DBIA 3PWKA 3EZYA 1GUZA 1NASA 3H3FA 2Y67A 3TZKA 1F14A 4JROA 1QKIA 2HLPA 4KWHA 2FOIA 1VSUA 5T57A 4ZHSA 5A9SB 1R16A 3BMQA 4RVGA 1I2BA 1YKFA 3Q1LA 5CFZA 3GNSA 4FJ0A 4AJIA 2EHDA 1JAYA 3ANLA 1XWFA 4B3HA 5ADHA 2O3UA 5DF1A 3WQSB 3TFOA 1XCBA 3ADPA 3G1TA 5ER9A 4JBIA 3EMKA 1G0OA 2HK9A 3H5AA 1K3TA 1T1RA 1UXJA 5JAZA 2ZK7A 4RF3A 3LC2O 2AXQA 2G5CA 2OORA 3EAGA 3KYDB 3RIHA 5ICMA 1EE9A 5F3RA 2IZZA 1ZJZA 4BO9A 1SOWA 1ISHA 3D3EA 1E7QA 1PJQA 3TNLA 2FSVA 1EEHA 1V6AA 2E48A 2PY6A 1A72A 2PA3A 3BMQB 4WLOA 4ZRMA 4FFNA 3VDRA 4E5NA 2YZ7A 4WUVA 2FR0A 2JFFA 2R6JA 2VZ8A 4CM4A 1ISJA 3PJDA 1EFLA 3M2PA 4INAA 3L9WA 1OC4A 4MVJH 5B1YA 3LF2A 3NJ4A 5CAEA 4CV0A 1FXSA 1LTHR 3JTMA 5IFLA 1WAMA 3UICA 1A5ZA 4CLOB 4QT0A 4FFOA 4FGSA 5L95A 3FSRA 3P19A 5KCZA 1NR7A 3FN4A 4HNGA 4EW6A 2PGDA 3RBXA 4URFA 4E0BA 2BFAA 3GFGA 5F1KA 3GLQA 1PWXA 1GAEO 1K5HA 2WYUA 3C1TA 5COBA 3K73O 3UXYA 5JFOA 3G1UA 3HUDA 2YUTA 4OH1A 4JNKA 2QYSA 3ANMA 4GWGA 1GL3A 3V2UA 1YBMA 1ZIDA 2JHFA 1LSOA 2X9VA 3DOOA 2I67A 2JFGA 4Z0PA 3WIDA 3DTYA 1QLHA 1MV8A 1XQ1A 1KYQA 5KJFA 5JLAA 4XD2A 2Y0EA 3PLRA 3C24A 4KQXA 3HZZA 3PHJA 1DPGA 1B8PA 3H9GA 2V65A 5F1PA 4E2YA 1FJHA 1JWAB 3AWDA 3D3WB 3VPHA 2GPTA 2YFQA 1A9YA 3BIOA 1JTVA 1NP3A 2PD4A 4BNTA 2ZJ0A 3E5MA 2ZTMA 4GX5A 3E1KA 3DB2A 3NV9A 4BNKA 1HLDA 1F17A 3GG9A 4P4NA 3OBBA 3TSCA 4WCFA 3QVTA 2NV6A 4FSHA 1C1XB 1C0KA 8LDHA 2QYTA 3E48A 1PGPA 2P68A 3AOEC 3LT4A 2DTDA 5TC4A 1QLJA 2W8ZA 3H9QA 1PWZA 2E4AA 3GVCA 3GHHA 2EW2A 4PLCA 3OJ0A 3BTUA 3PI7A 1I24A 2PFGA 4PFJA 3DZBA 1CYDA 2EKPA 1UR5A 3SLKA 4D41A 5T64A 2ZTLA 3X2EA 4MKRA 4BNUA 4B3JA 3L77A 1CWUA 2AE2A 1U7HA 3FBTA 4E30A 3ZHBA 4CR8A 4B4VA 5IZCA 5G4LA 3AUAA 4IY1A 3U49A 3WXBA 1HF3A 4CLXA 3JQDA 2PH5A 1V3VA 2AQIA 4EJMA 4PRLA 1WZEA 2Q4EA 1NVGA 2X9NA 2DBQA 2B4TO 2DFDA 3WNQA 2BKAA 4NJMA 4BKUA 4BNHA 5JYEA 2FWMX 5U9CA 1OAAA 1OI7A 2O4CA 1KC3A 4JJIA 4OKIA 5KIAA 5JW6A 3JD3A 4L4XA 5JMPA 2OZPA 3R3JA 3WTCA 4QSMA 3INRA 4Q3DA 3WS7A 4J0FA 2VHZA 3GVIA 1ISMA 5AQ1A 5I8WA 1ZNQO 2DTEA 1F0YA 1LLDA 2JKVA 3AY7A 1ZSNA 1PZFA 3DBLA 3EVNA 1ORRA 1DHTA 1PS0A 1ZK4A 2HK7A 2Y1GA 2QRJA 4UUOA 4AVYA 5CEFA 5HTOA 3FWNA 4NJMB 1B3BA 3BZUA 4GX1A 3P2OA 3V2HA 4IM7A 5HS4A 1R15A 2C7VA 4GKVA 3JD0A 5DZSA 3L4SO 4GX2A 2DLDA 3F4BA 3I9NA 1FDTA 3HN2A 5G4KB 5G2OA 4R1UA 1U3UA 3ETGA 1P1RA 2BD0A 3ZWOA 4DXHA 2C5AA 1Q1NA 2EERA 5ER6A 4ROSA 4XB1A 2VN8A 2X8LA 3NUGA 4ITUA 5J23A 2YQ4A 5B4VA 1AE1A 4PCVA 2O7SA 5CPFA 1KBZA 5JMWA 1CRWG 1YRLA 5ENVA 3KZVA 3KB6A 1WVGA 3WQQA 1TLTA 2Y1DA 1ZW1A 4DTIA 1NQAO 1ADGA 1OOEA 2GDZA 5TJ9A 4LCEA 2P5UA 3QRWA 4IDCA 1DO8A 4GSKA 1C0LA 3HJAA 5TIIA 1B14A 1IZ0A 1HDOA 1X14A 5BSGA 3I5MA 2TMDA 5KJ6A 5CHEA 1BDMA 4EGFA 2X58A 3OIGA 1P44A 4CR7A 4RGBA 1BXGB 1GEGA 3O26A 3JD1A 4D0RA 4PLGA 1NAIA 1JKJA 2DU8A 3OQBA 3ZWBA 4XQGA 4J4TA 3AM4A 4PLTA 1HZZA 2NTVA 4BNJA 3QQPA 1W8DA 1HZJA 3C7DB 3D5TA 4NFSA 1MLDA 3M1AA 4JN6B 1KC1A 4PG6A 2R00C 2ZCUA 4IS3A 1WMAA 1BGVA 1E3WB 4J6FA 4MVJA 1ZK0A 4ZJUA 4DIBA 1DEHA 1JQBA 4LMRA 5JCJA 1TT5B 3O8QB 3ZH2A 3WFJA 1OMOA 3HSKA 4LMPA 2Y66A 1QYCA 5IJZA 4AG3A 4I1IA 1FMCA 3E9MA 1QMGA 2BLLA 2Y99A 2DFVA 4CM7A 3AU9A 1GZ4A 3KSUA 3NT2A 1NFQA 2P4HX 1UAYA 5T6BA 5GMOA 2YDXA 1BRMA 2FPGA 4NK5A 3S2GA 5LDHA 3WLFA 3ZV6A 3VZQA 2RH4A 1IPEA 1NVMB 3LVFO 1BVUA 1LU9A 4U6QA 1PQUA 1PTJA 4CM9A 5GZ1A 5K6AA 2V6FA 5KOIA 2IYPA 3GT0A 1MG0A 3K9QO 2EG9A 3TN7A 3IP3A 4AJ1A 3F9IA 1YDEA 1Q7CA 2AA3A 4Y67A 4AJOA 8ADHA 3W1VA 4YEDA 1IHXA 2O7QA 2W98A 4RDHA 1KETA 3B1FA 1HEUA 2D5AA 4XX0A 1E1NA 1GPDG 2Y68A 4W9NC 3BHJA 3EK2A 3PHHA 4EZBA 4FN4A 3D4OA 3I6QA 4CPDA 2EXXA 2O3QA 4QUKA 3N58A 4R4JA 3ZNQA 1DSSG 3F3SA 4IMRA 1MXFA 4D7AA 1I2CA 6LDHA 1PJ4A 3TQHA 4PLVA 3IKVA 3FPCA 1H94A 3PWSA 3U4CA 4EEZA 1HYGA 2VCYA 4M8SA 1R4MB 3WB9A 4YJGB 5L53A 4D45A 2AE1A 3GR6A 1PGJA 4JCOA 3GRPA 1HDXA 4ALNA 4OQZA 4IJVA 1GYPA 4KOAA 1M2WA 4O5OA 3I52A 4Q39A 4TRNA 3IIEA 4IDEA 3VTFA 3ZNPA 1ARZA 2EWMA 3HADA 4MPDA 3DAGA 4LW8A 4A10A 3IJPA 4AJ4A 4W7IA 4W82A 1AUPA 1I3NA 2I3AA 4IGEA 4XGKA 4IDAA 4BNVA 1UDBA 1JKFA 2GUGA 5L4NA 3GG2A 5TT0A 2X0RA 5EPOA 2B4RO 3CZRA 1CQJA 2DTXA 2C07A 2X9GA 1M67A 2G0TA 3PJGA 3JQ7A 2PGJA 1ZJYA 3AUUA 1CERA 2BHLA 4B3IA 4YAJA 4YAKA 1QXSA 2HDHA 2OUIA 3RJ9A 5I7SA 2B37A 5TQVA 2HRBA 4IIVA 2C82A 2PH3A 2CMDA 3NYWA 4AJHA 5AXCA 4RLSA 2BFPA 1O9BA 2XF8A 2WD7A 1O89A 4K1LA 2HJSA 2XOXA 1PGOA 4Q3EA 4TMFA 4WLUA 1I36A 4WLFA 3ZNNA 4PG7A 4U5QA 4ZVVA 1IHYA 1AXGA 4C7JA 4DUPA 1HDCA 1C3VA 1B7GO 2ZIZA 3WIEA 1U9JA 5LDGA 1LC0A 3JQGA 1Q7GA 3OETA 4JBGA 4NHEA 4WE3A 5CG1A 5KVSA 4OM8A 3V1UA 3FR8A 4FCCA 3HFSA 4B4OA 1N5DA 1ZUD1 4AFNA 5JBIA 5ES3A 3MTJA 1NM5A 2YY7A 1SB8A 4FFLA 3ETDA 3MOIA 4XDZA 1OC2A 1HDRA 3V5NA 1Y8QA 3HN7A 1SO8A 1NPYA 1CEQA 5I9NA 5FI3A 2HMVA 3M2TA 4L75A 3VH1A 2BELA 3LC7O 1X7GA 3ZI0A 5TRTA 3VPXA 3ZWWA 3W8FA 5A3VA 2BGKA 2EV9A 5DOVA 4ALLA 4F45A 5DN9A 3WLEA 4CQMB 5B4UA 3H6KA 4I5GA 1XA0A 2Y1EA 5F1OA 1NTOA 2Y93A 4AJLA 4DBVO 3KXDA 3MZ0A 4ZD6A 1UXHA 1ONPA 2E82A 3H65A 4B7UA 4EUEA 1EK5A 1ZEMA 5JC8A 1Q0QA 4W99A 4DL9A 4XDYA 3K96A 3EUWA 3DHNA 3IOYA 4DA9A 5BQFA 4XEHA 2NU6A 4O6VA 3C7CB 3T7EA 4E6PA 4CM1A 4JLWA 4BNXA 4IQ0A 2GSDA 1E0DA 5A03A 3NTRA 3ZV4A 2WE7A 3H9EO 4YAIA 1P1JA 3BMCA 4OGWA 3KSDO 4MP8A 1DAOA 1A4IA 2WJPA 3RUFA 3IAHA 4RF5A 4I9HA 1D8AA 1SEPA 4L73A 5I9LA 1DFHA 3DZGA 3OP4A 2ZATA 3WQRA 1H2HA 2O3JA 1UJMA 2I66A 4WJZA 4DREA 2Q1UA 2HMSA 1EBFA 1P45A 4MVJP 3HNPA 3VZPA 1H6AA 1YOVA 3HE3A 1T2FA 1YL6A 1E5QA 1H5QA 4MKXA 4ID9A 4XJSA 3JD4A 4Y9DA 4UULA 3T7CA 2O2YA 2POQX 4BO8A 1U3VA 1Z7EA 3JQEA 1DFIA 1UXIA 1DOHA 1KY4A 3GNTA 3VPSA 1ZCJA 3AOGA 1PZGA 3BMNA 3NT5A 1YJ8A 3GA0A 3PLNA 1VL8A 4S1VA 3ZWAA 2D59A 3D5QA 4H16A 4DQVA 4PGFA 3I4FA 1C1DA 4HWKA 4DYVA 1U5CA 1J0XO 1DBVO 1O0SA 1SB9A 4AJPA 4BQPA 1RM0A 4YR9A 3JQFA 3U4IA 1R4NB 3FF4A 1CJCA 1PJCA 3WGTA 4GLLA 1LXCA 2DQ4A 2W90A 4J43A 3HQ4O 3DR3A 3OECA 1KEUA 4XQCA 4BOYA 1MGOA 4C7KA 1E6WA 3ANNA 3TZQA 1PJ2A 1E7SA 3JQBA 3KRTA 5EINA 3V1YA 2VHWA 5FEUA 2NWQA 1N1GA 2HJRA 4IDFA 2R2GA 4PLPA 1IY8A 3H7AA 1SCUA 2ZTUA 1LC3A 1ULUA 5CPBA 5AOVA 4MIEA 4RO0A 5DDIP 4CMJA 4A0SA 2Q2WA 4HNHA 3F4LA 4RPGA 3DBVO 4GVXA 3KLMX 2NACA 4XYBA 4FBGA 1VL0A 3PRJA 4B4WA 1C14A 2D8AA 3U62A 4YAGA 3JQ9C 3MJVA 5FYDA 1DIHA 2G76A 3F5QA 1YQGA 3AW9A 1GPJA 1LX6A 2EW8A 1ZBQA 1XLTA 1T25A 1A4UA 3U0BA 1GCUA 4BO4A 5BSHA 1YONA 1KS9A 2X5OA 4KMSA 3KEQA 3TF5A 4FFPA 4MJLA 5DCYA 3ZW8A 1R0KA 4K9DA 3DBRA 4OOFA 3PHIA 3AI1A 4DPLA 3E8XA 2BGLA 3JQCA 1V0JA 4UEKA 2CDBA 1TT7A 2HO5A 4XR4A 4RVUA 2HQ1A 2A35A 4YAEA 3RC7A 1DC3A 1M6HA 3JQ8B 5IXSA 3I3OA 4R3NA 4TRRA 2X0IA 1U5AA 3F1LA 1LDBA 4E4YA 2JFHA 4JJFA 5BT9A 1SZJG 3TWOA 4EI2A 1E6EA 1NPTO 2BGMA 4HV4A 1U1IA 4YJFB 2NM0A 3DBRB 5JDIA 4Y8VA 2VYVA 1XELA 1PIWA 3N74A 4LCJA 2C7GA 1NYTA 1NFRA 3GDOA 3ZWMA 1U2DA 1S7CA 3V8BA 2B5VA 4OKNA 5DOZA 2VHXA 9LDBA 1VPDA 1X0XA 4CMIA 4HFNA 1NPDA 3L07A 4KQWA 4NR0A 4AJEA 4NFYA 4M55A 4XIJA 4K26A 1K89A 2J5KA 1G0NA 2DM6A 1K2WA 2E37A 2F00A 4D42A 1Y5MA 5CG2A 4TVOA 5JY1A 1XDWA 1BXKA 2O4UX 3M1LA 2WD8A 4WPGA 4EBFA 1LSSA 5C7LO 3LSYA 5CEEA 3ZWPA 1JVBA 3AFMA 5I7VA 1T1SA 1R37A 2VNAA 1I33A 1P77A 1WDLA 1NWCA 1KERA 5JY6A 4IJUA 3O38A 4W4TA 2AW5A 1W73A 4CV2A 1XQ6A 1QV7A 4CR6A 2Z5LA 3CH6A 1E7RA 3PPIA 4YVFA 4P4LA 4CMIB 1ZK1A 3RASA 3EHEA 4XYGA 3QJ5A 5L45A 4ND1A 3PXXA 2QZZA 3ZHYA 4RL6A 1RYDA 3BMOA 3BTSA 3E82A 3EYWA 1U3WA 4PVDA 5K6AC 3ROKA 4GBJA 1XU7A 1T2CA 1LLQA 5JDCA 1MC4A 1B8UA 3RUCA 5I7FA 2VNSA 3LQFA 1PS9A 1QP8A 2J3KA 4YPOA 2ZYAA 4WLVA 2P4QA 1P0CA 3LLSA 3QLJA 2AQKA 1JWBB 4I9NA 1RM5A 1VSVA 2ZB3A 2ZTVA 1HLPA 2PZLA 3KYCA 4GMFA 4BV8A 3DMTC 2G82A 4PG8A 4LN1A 3DWFA 1LQTA 3ASVA 3H4VA 1XG5A 3FNEA 4NDNE 5HBRA 4BNWA 1CQIA 3MWEB 4R9SA 2YYYA 3D4PA 3GNQA 5A04A 4RQTA 9LDTA 3L4BA 4FDAA 4CV1A 1AXEA 3AFNA 2Q45A 4FJ2A 4J7CA 1Z7BA 2FMUA 3B6ZA 4YRBA 3P5SA 1VLLA 4H3VA 1Y1PA 1K6IA 2IYOA 4L76A 3L9XA 4KDEA 2VOEA 3UCEA 4ZN6A 3EDMA 4DVJA 1A71A 4BB6A 1LLCA 2A4KA 2EKLA 4EJ0A 2QX7A 4MP3A 4CM4B 5JXWA 1HE3A 1JKIA 2FHSA 3RC2A 2C54A 3G0OA 1Y8RA 2GN6A 3C85A 3DZKA 4YQZA 2NVUA 3IKTA 2YV1A 1I30A 4YCAA 1E5LA 3B1KA 2GRAA 4FW8A 5AYVA 5ENDA 3ZHZA 1FDUA 4ZRNA 2Q4BA 3PJEA 1U7TA 3HDYA 4ALKA 1GV1A 1TEHA 1EFKA 2NSDA 3RBVA 3UH1A 5EMHA 4L4RA 2NU9A 1P1IA 1E7YA 1ISGA 3UW3A 4BNIA 2OOSA 3PDUA 2PKQO 3CIFA 3CTMA 1DC4A 4B8ZA 1V35A 4CMHA 2CNBA 2EJWA 1YVEI 3L6EA 4AJKA 1KVSA 1RKXA 3F1KA 3DAFA 4UUPA 2W2LD 1PL8A 3JYOA 1UXKA 3GFBA 1HDZA 1ML3A 3ZWNA 2I6TA 3OJOA 3H2SA 4RZIA 3CMCO 4M87A 2QIOA 3I9MA 2AQ8A 3ZV3A 3ONEA 4P4GA 1YQDA 4CQLA 5C7OO 2DBRA 2ZYDA 3WBFA 3ZU4A 3GOHA 4PLWA 4DIOA 4CMEA 3GQVA 4NPCA 4Q3NA 4RVSA 3PGJA 4BVAA 3WTBA 4F6LA 3CUKA 4LSWA 1EE2A 4J1QA 2GN8A 3PZBA 1X7HA 2HMTA 3R0IA 3I4CA 3UFXA 3RU7A 1SC6A 2X86A 2CF5A 2I76A 3DXFA 4M86A 1MXHA 1MP0A 4LVCA 4WCFB 5L7WA 1Y9EA 3AY6A 3VVBA 4BNZA 1I32A 4Z9YA 1DXYA 1E7WA 1LRLA 3FNHA 2FP4A 4NH4A 2DAPA 2OO5A 5TSDA 4EEXA 1E3LA 1GV0A 3H9JA 2BI8A 1BVRA 4ALIA 2SCUA 1HSZA 3MJ4A 2CF6A 1EUDA 2HKIA 3RBZA 1GUYA 5COAA 1E3IA 3WBBA 5I7EA 4R68A 3IDSA 3S2FA 1PX0A 2NTJA 5CDUA 3ZU2A 4CLHA 3PFWO 3VOSA 4WLNA 1EVIA 4FQ8A 4Z9XA 4OYRA 5AVOA 4L0QA 3GZ4A 4MP6A 2X6TA 5KWEA 4N5LA 3UCFA 1GZ3A 1YBAA 1RPNA 4JGBA 3BYZA 1A9ZA 4ND3A 4BB5A 2B4QA 1MX3A 1H0KA 3QWFA 4D3DA 4NQZA 4WCDA 1T4BA 5KVQA 2BI7A 5U4QA 3CKYA 4HFMA 4TRMA 3K30A 2ZQYA 2JHGA 3ZWCA 4BNGA 2P9GA 1GZ6A 4J49A 4ZA2A 3IS3A 4MIYA 4NIMA 4CLRA 3AU8A 1GDHA 2OP1A 3PQDA 3PK0A 3WICA 1NQ5A 4ZU3A 4IXWA 3A9WA 4TZKA 2ET6A 4MOWA 3RFXA 2JCYA 1ZVMA 3DBLB 3HDQA 3PYXA 5T8KA 4YJHA 1Y81A 1ZEJA 1B26A 2D4AA 1LBEA 4OHUA 4GLOA 1Q2XA 2UUPA 2VZ9A 4GX0A 4ZGWA 4XA8A 4WLEA 3GHYA 1DLJA 4XRRA 4FOOA 3BAZA 3EVTA 5G0VA 1UDCA 2O48X 3GUYA 5JO0A 5LC1A 3I23A 1LLUA 1WP4A 1XIVA 3ZCXA 1KVRA 2Q2VA 5EQFA 4BO6A 3OA0A 2HK8A 4D46A 2NQ8A 2XXJA 3A4VA 4CM8A 1D7OA 2A9FA 3FI9A 4JIGA 4RORA 1CIVA 1N9GA 3FTNA 4RLHA 3S8MA 5BSEA 1NNUA 1I0ZA 3TZCA 1PJSA 5KTKA 3P2YA 3JQBC 1KVQA 3UAGA 4IPTA 5BNTA 4RJTA 1MUUA 4RDIA 5A3JA 2DUUA 2D1YA 2NNLD 2NLOA 2D3TA 3Q9NA 4TVBA 4NBUA 4YT4A 1NHWA 3AUTA 1J6UA 4XCVA 4YDRA 1CDOA 2A94A 4IIUA 2CVQA 1TXGA 4N5MA 5EESA 2C29D 1SAYA 2YHIA 1ONOA 2FRDA 4JP3A 3VKUA 1LRKA 2Q50A 1YH3A 4DYDA 1HE4A 5KJCA 3SXPA 3PEFA 1W0CA 2VWPA 4CMGA 3NKLA 4OXYA 5L7YA 3GMDA 4BMNA 4HADA 1YE3A 2RHCA 1QYXA 5G0UA 4U6SA 3ZGYA 4AICA 3KSZO 3QVOA 4NBTA 4YT8A 1EUZA 3WGZA 3K6JA 2DKNA 1DAPA 1PS8A 3EZLA 3GVPA 1PJ3A 4G65A 4MVJF 4ALMA 1L7EA 1J5PA 2UUOA 1RJWA 1P1KA 2V7PA 2WYWA 1KEWA 1RYEA 2WYVA 3JYQA 2C20A 1P9LA 1UP7A 4MVJM 4LISA 3I1JA 4BNLA 4GVLA 4DQXA 3DOJA 1QSGA 2OHXA 3ZDFA 3KUXA 4IINA 4RPLA 5KKCA 1XU9A 1RM3A 4J2HA 1RM4A 3AK4A 1SMKA 3EW7A 3CINA 3UGKA 4P38A 2WEKA 3RC1A 2Z1MA 3OICA 5HS6A 2Y0DA 3LF1A 3TL2A 1NQOA 2PV7A 3BXXA 5FWNA 1H6CA 3TDKA 3QY9A 3H9UA 2I99A 4P22A 3HDHA 5C7IO 1N92A 1O8CA 4DMLA 1N2SA 3Q11A 2I9PA 3RU9A 3JQAA 3H2ZA 3E5RA 4WNCA 4MVJG 2CFCA 4Y6RA 1XSEA 4UVGA 3DBHA 2HUNA 3NDRA 1SBYA 4E3ZA 3LYLA 1O95A 3GPDG 2CZCA 1NR1A 5CP8A 4YWJA 3RVDA 3MOGA 3DC2A 2IZ1A 4OSOA 3WSVA 4FFMA 3DZIA 4FC7A 4UVHA 2PR2A 3GGOA 4J4HA 2VOJA 4E5YA 3D0OA 4RPKA 4B8WA 4PN3A 3L6DA 5I9MA 3LU1A 3DEYX 4PZCA 5JC1A 3JQAB 3GDFA 3HWRA 1ULSA 5G0WA 3EY4A 4IJKA 2WTBA 5B37A 3OJLA 4GKBA 4BO7A 3FD8A 3GGGA 5ILOA 4IDGA 3W4KA 5TT1A 3K31A 2IODA 3GC6A 2O50A 4N5NA 3KOUA 3ULKA 3IUSA 5MDHA 1OFGA 4IMPA 4Q3CA 1J49A 1YB4A 2OMEA 1VJ1A 4RF2A 5ITWA 4F3YA 2J3HA 4WGGA 4TKLA 2UYYA 3KO8A 4UREA 5L9AA 1LNQA 4Z3DA 4EITA 4BGIA 3WJ7A 3JV7A 1KIFA 3JQ7B 3L4BC 3O4RA 2VT2A 1AGNA 3NRCA 4XQEA 1RWBA 3FTPA 3AI2A 4YACA 4BNNA 4JJGA 4NZ9A 4BNFA 3RFTA 1JLLA 4O63O 1YGYA 2FR8A 3SX2A 1E1MA 3PIIA 4AJNA 4Z6KA 5HM8A 2WD7B 2RHRA 3QVWA 1LJ8A 4KP7A 2PZMA 4CUKA 2BH9A 4ESOA 1H93A 3PHLA 1IL0A 5FFFA 1DLIA 3RUDA 2WDZA 1H9AA 3GEDA 4UVEA 1CF2O 3WDSA 2EP5A 4PG5A 1GUFA 1YJQA 3W6ZA 2BRUA 2CUKA 4E2ZA 3JQGB 5CEJA 2G1UA 3AI3A 3BTOA 3L0DA 1PQPA 3CSDA 1DIGA 3SEFA 2J8ZA 4IXTA 4J9UE 1VM6A 4CQMD 4OXNA 1YB1A 1UZMA 1P33A 1ADBA 1GFSA 4IS2A 4E2WA 4LRTB 5C5IA 4R54A 2H6EA 1GY8A 3HB4X 2VHVA 4UUMA 1Y8QB 1P1FA 4IJWA 4U0JA 3KHUA 1D3AA 1OZAA 2X0NA 2VRCD 3DFUA 4WEOA 2Y0CA 4ND5A 3ZWYA 1EVYA 2E49A 4YBZA 4I9UA 1X15A 3FWZA 1EDOA 1LDMA 3VVCA 5BR7A 1KVUA 4OJNA 1I3MA 1PGQA 1ZXLA 2GASA 3OQ1A 3T4EA 2P5YA 3NTQA 3F6YA 1UP6A 3QWIA 5JAMA 3LLVA 5HA5A 2W4QA 7MDHA 1GD1O 1DC5A 3AJRA 3R1IA 1FDSA 1NBOA 4J2OA 5CDSA 4WCFC 1E3EA 1YS4A 1BW9A 4KTTE 4TRJA 4WASA 5DBFA 1VKNA 3NDIA 3I9LA 5CDYA 2Y05A 2Y1CA 4E13A 4DC1A 3AY3A 3WNVA 2X5KO 3U09A 4GAEA 4L74A 4Y6SA 4BUCA 1MB4A 5IAAA 2P2SA 3ZZNA 4BKPA 3QSGA 2IEBA 3BHIA 3PTZA 1HTBA 3BMCB 3DZFA 1T2AA 4J7UA 3MCVA 3IJRA 3PFFA 2WMDA 5IG2A 4GL4A 2GR9A 2VHYA 3DQPA 5IZCC 2C2YA 3E18A 5TF4A 2B5WA 2YFHA 3FR7A 5HRUA 4H15A 1SEVA 1B3RA 3OIDA 2GYYA 4ONEA 2Q99A 2XPCA 2QHXA 1YOVB 3QW2A 3OMLA 5TLSA 1PJBA 2X22A 5L7TA 1EQ2A 5C3MA 1BDBA 2JCXA 3NAQA 3ZU5A 4NBWA 3ITDA 2IXAA 3MEQA 2Q1SA 4TWRA 4FPXA 1WDMA 4HP8A 5LCXA 3ITKA 3PDJA 4CODB 1DHRA 1ADFA 5IDWA 1CETA 3C3XA 1U4SA 2IRWA 5B4TA 3ST7A 3TOZA 2FZWA 2GLXA 5JCXA 3BMNB 3HB5X 4QEDA 3FCOA 2AHRA 4J0EA 5IF3A 1K0UA 4LRSB 1C1DB 1XEAA 2AEMA 1DRVA 5EQDA 3OEWA 5F21A 3ON5A 1PJLA 3SC4A 4BGEA 4LSMA 3W8EA 3CEAA 1GQYA 2VYND 3C8MA 4ZQHA 2WM3A 2IEDA 3WMXA 1GCOA 3GAFA 2ZKLA 1PZHA 4YT2A 1DJNA 2GN9A 1R12A 2ZCVA 3RI3A 1W4ZA 4CMCA 3GDGA 5G0TA 5FI5A 3LC1O 4GH5A 1VJ0A 2FSSA 1VL6A 4BNYA 1E77A 1N7HA 2OBYA 2V6BA 2V6MA 4QFDA 3E9NA 2PD3A 3AM5A 1W6UA 1LSUA 4S3MA 3EGOA 2DT5A 4CUJA 1WWKA 1XHLA 2I65A 5L3ZA 4ALJA 3WWZA 1EVZA 5EJ2A 2DPGA 3ZV5A 1E3JA 5K0ZA 1GQQA 2YJZA 2ZJ1A 3OSUA 4BMVA 4LVUA 1IUKA 3R6DA 5DP1A 4YT5A 5DCUA 1YWGO 4OMUA 2DUWA 2D5CA 5CDTA 3UHAA 3K2BA 4WKGA 2B69A 5F5NA 4J4BA 1I10A 5A9RA 1FF9A 4XB2A 2FR1A 2TMGA 4J9VA 4JXKA 4WOJA 3VZRA 4PLFA 4KZPA 3H8VA 3DOCA 3TRIA 3OIFA 4J91A 4OXKA 5GZ3A 3X2FA 1F8GA 5T5QA 4JP2A 1IULA 3Q6IA 4G2NA 3WMWA 2EEZA 3NEPX 2Q2QA 2HCTA 1G6KA 3LT2A 5TNXA 5K9ZA 3WFIA 2QRLA 1EBUA 4ND2A 3PP8A 1PJTA 3WGGA 3QWAA 4A03A 2PK3A 1B2LA 4EUFA 5L4SA 4M89A 2ZYGA 1UAGA 3OA2A 4CMAA 1YQXA 3FNGA 3WGHA 4XYLA 3SLGA 4D3SA 4J1NA 2CY0A 4BNMA 4IQGA 1BG6A 1WXDA 3WGQA 4B79A 4BS9A 3ZWXA 4CLEA 2VYVD 3PYMA 4YQYA 5A9SA 2CVOA 3RJ5A 2YV3A 4GI2A 3UN1A 2H9IA 3LZ6A 5EL0A 4CL8A 2J5RA 4QFCA 2AG8A 4FC6A 1ENOA 4PIVA 3JQ6A 3KVOA 1P31A 3QVSA 2GZ3A 2Z95A 5AXDA 4DLLA 3KBOA 5BSFA 1V9LA 4RPJA 5DT9A 1VI2A 1NWHA 1KEVA 1FDVA 3PJFA 4OL9A 2YDYA 4PG4A 4A7PA 4MDHA 2W2KA 3KYDA 5IXYA 1NX6A 3Q2IA 4RVDA 4CM6A 1I3LA 2PTGA 4CV3A 4NNJA 3A14A 1MG5A 3D4NA 3IL2A 4HXYA 1X1TA 3F5SA 5GY7A 2X0JA 4NMHA 4J1SA 4PRKA 3ORFA 1JVSA 4TZTA 4O59O 1JAXA 1B0AA 1LRJA 2FPIA 3IMFA 4L9RA 4QXMA 1PL6A 2CDCA 3G49A 4MKZA 4R5MA 2ZB4A 3CZMA 4HBGA 1QRRA 1U28A 1X13A 1V3UA 2NVWA 1PQWA 3BMOB 1NFFA 3SC6A 4GWKA 2W2KB 5H82A 3U3XA 1WMBA 1Y6JA 4J1TA 4XYMA 3VH3A 4Q9NA 3WSWA 4CLOA 1O94A 1Q0LA 5KJEA 5ICSA 3GEMA 3PZRA 3GMSA 2FZEA 1TVEA 2B35A 2HMUA 2VT3A 1NHGA 2Q49A 3FBGA 5AXAA 1DIAA 2EGGA 2VTEA 3KYCB 3W4IA 4UVDA 1HRDA 3SVTA 1ENZA 3S2EA 4NBVA 5ILGA 3HDJA 3ETEA 4DRYA 2X5JO 5THKA 2Q1WA 2A92A 1ONNA 1X7DA 1MA0A 1GU7A 2QRKA 3QVXA 2CSUA 2QZ9A 1HYHA 4K6FA 4NBRA 1U8FO 3OHSX 1HL3A 3BHMA 4N7RA 4BGUA 4IBOA 4E5PA 4MVJE 5AXBA 3QWBA 4YYZA 5CDGA 3QE3A 3DO5A 1IOLA 3S1LA 3H5RA 2ZQZA 4Q3AA 1B15A 3D3WA 4BO1A 4I8XA 2P9CA 1BTOA 3R3SA 1E6UA 4IGFA 4IUYA 4RZHA 3KM0A 1Y8RB 4DGSA 2AEFA 5F5LA 2UVDA 2NVUB 3H3JA 3TL3A 5IZ4A 1ZH8A 2W2LA 4R1TA 5L4LA 4MIOA 1YXMA 2NQTA 3NDJA 2PLAA 3WYCA 3E6AA 3SJUA 3TFQA 3UKOA 4YA6A 4BO5A 1XYGA 4CMKA 4DMMA 4RV9A 4B4UA 5EIOA 1M75A 1NXQA 3U4HA 1BWSA 4XYEA 4BKQA 1C1XA 1T4DA 1ZFNA 2BFOA 2EKQA 5BNFA 1HKUA 2PD6A 1E92A 4CMBA 3BTVA 5A9TA 4E5KA 4A73A 5JPIA 3RUIA 1K6JA 2YHUA 3DZHA 4BL5A 4RCVA 1IPFA 2QG4A 1I5RA 3F47A 5G0SA 1N7GA 3QWHA 4GQAA 1JW9B 2JL1A 3VTZA 4E31A 1E1KA 1VKOA 1Y9AA 2AG5A 3DHEA 1ISIA 3WGYA 3C1AA 4ZQEA 3UF0A 1K6XA 3MJCA 2PZKA 1DC6A 4BKRA 3C1OA 2GN4A 1D1TA 4OO3A 4CQLB 3ENKA 3NJ8A 4MINA 3RFVA 5ITVA 1YL7A 4MVJI 4FIZA 1Z75A 3FNFA 3TJRA 1GYQA 1KVTA 3JYLA 3U5TA 1J4AA 3SJ7A 3OM9A 1UZLA 4D43A 3WWYA 4E32A 1ZSYA 2VWQA 5GZ6A 1UXGA 1QYDA 1ZMTA 3TPCA 3PGXA 1HT0A 3WGOA 3GZNA 4ILKA 3AUSA 4CUZA 3B70A 3ZN2A 2O2SA 1P0FA 3STHA 1BHSA 2E6UX 3D64A 3TOXA 3PQFA 1YDWA 1ISFA 1H2BA 1JU9A 2HAEA 4QO7A 1C0IA 1P3DA 1VRWA 4OAQA 4XGIA 3RUAA 4PLZA 2PGLA 4DBZA 3UUWA 4II2A 4YTEA 2ZB8A 2J6IA 1PGNA 4CM3A 1OBFO 1ZXBA 5G4KA 3F46A 1G1AA 3GZNB 3NGLA 4YRAA 1SPXA 2GERA 3JCZA 3NTOA 2FN7A 2FPPA 1LDEA 1S6YA 3ONDA 4M49A 4UEJA 5EERA 4FJ1A 4BIIA 3V1TC 4I08A 4P8RA 4R69A 4XKJA 4KDFA 4B7XA 4Q3BA 2HRZA 3ZW9A 1KOLA 5DNAA 2DBVO 3GH3A 3PQEA 4E33A 4JBHA 3FHLA 4NG5A 2Y1FA 5I8ZA 4TSKA 3S55A 3U9LA 3DL2A 4BO0A 3JQ9A 4HY3A 4Z0TA 4EDFA 4BQRA 2G17A 3T4XA 4HFJA 5T67A 4DIFA 4Z3KA 4TQGA 3JQFC 2WE8A 3D7LA 1ENPA 1GEEA 2CD9A 4J7XA 4CLRB 3ABIA 1Z45A 4KUEA 2FY8A 3CMMA 3UCXA 3OJFA 1NAHA 1U2GA 3QHAA 1BXGA 4BO2A 2VUUA 4RVHA 4YJHB 2OBNA 4C4OA 3FPLA 5FF9A 1L1FA 1YL5A 2H5LA 4O0LA 3CPSA 4NI5A 3RQSA 2RH8A 1QYWA 2VWHA 3ZWVA 5B12A 2RIRA 2X4GA 1AHHA 4A27A 5DBGA 3RC9A 4JX8A 1UH5A 1WNTA 1VC2A 3KV3O 5H81A 5HWSA 1E3WA 3D1LA 1EDZA 2VQ3A 1EQUA 3H5NA 3VKVA 3G3EA 3KEOA 5TGDA 3I6IA 1TT5A 3O8QA 4XJTA 1DJQA 1ZO8A 2AQHA 3B1JA 2V6GA 1WZIA 2PWZA 1I3KA 4A26A 1P74A 2JD0A 4CM8B 5JAQA 3MWDB 3I9JA 4YB8A 4N18A 1X0VA 1ENYA 1N9GB 5A06A 5JE8A 4DLBA 2EP7A 2B0JA 3VPGA 3VC7A 2IXBA 1I8TA 2J5QA 3WX0A 5KNLA 4FFRA 4YRDA 1EVJA 4AJJA 5A05A 4R51A 5C37A 2IDZA 1JN0A 4UVIA 4KUGA 5IDYA 2C2XA 3COSA 4Y98A 4MVJD 4HFRA 3RSHA 1BXZA 3V2GA 5JCJD 4CJXA 2YHIB 3K2EA 1HETA 2GNAA 3WGIA 3IUPA 4E21A 4R01A 3QA9A 3GGPA 1YBVA 1LEHA 1T26A 5THQA 5JAIA 1ZK3A 1UZNA 5JYDA 4GGOA 1YO6A 3C7AA 4UAGA 2F1KA 3QP9A 1H6BA 3HHPA 5IN4A 3Q9UA 3O9ZA 2UV8A 3ZHXA 5JDIC 4IQ8A 3HFGA 1PZEA 1ZKMA 2JJYA 2BMAA 2OP0A 1ZZEA 4BGVA 2LDXA 3G79A 3DZJA 4R3WA 3N7UA 3Q3CA 3RD5A 1IB6A 2OXIA 3JSAA 3S2IA 1BMDA 4ZICA 1B16A 1F8FA 3DMYA 3MJSA 1Q7BA 4CM9D 1R4MA 4YJGA 1N8KA 2YQ5A 2PNFA 1DIBA 1L7DA 5H83A 1EZ4A 1QYVA 3DMTA 4U7WA 1EK6A 5IDXA 4QX6A 4II3A 3DHYA 4I5DA 4W7HA 5A4DA 4HKTA 4PLYA 3GF4A 1ZMOA 2LDBA 3ICPA 1NVTA 1PEDA 3GEGA 4F6CA 5COQA 4RF4A 4NJOA 3JYPA 3GVHA 1XKQA 4J90A 3RWBA 1C0PA 1TA4A 6ADHA 3UVEA 3RKRA 1XGKA 3IQDB 2X1HA 4R41A 4I5EA 5KJ1A 4G81A 4KWIA 4PLHA 1Y7TA 4AL4A 2PZJA 1FDWA 1QV6A 2BF7A 1H6DA 1R66A 2IE0A 3OQ6A 3JQAD 3WYBA 2D0IA 2JCVA 3I83A 4GSLA 4ZQFA 3DBHB 5JDCC 4MO2A 1Z6ZA 4OSPA 4R16A 1AN9A 3I9KA 4N54A 4UUNA 1TB4A 2WWRA 1EUCA 2JAHA 3EC7A 4XGNA 1MFZA 7ADHA 1DRWA 3KYBA 2RBEA 2VRBA 4GGPA 3ICCA 3TZHA 3Q0EA 4WECA 2GD1O 3KETA 4A5OA 3K92A 1DFGA 2UDPA 4E5MA 4FGWA 3BA1A 3ROMA 2NTNA 3G17A 2GF2A 4FR5A 2Z1NA 2OL4A 2D2IA 1ZK2A 3KLPX 1F06A 4XRGA 4LK3A 2HSDA 4QTZA 1U4OA 4PZEA 3GY0A 2OGUA 1JA9A 4O1MA 1O5IA 4FS3A 4BHTA 1LSJA 2EF1A 4YXFA 4QECA 3LDHA 4HUJA 5A5FA 1UUFA 4WNIA 1O6ZA 3I9OA 3QIVA 3GVXA 1PL7A 1U8XX 3CXRA 5DP2A 2I3GA 1R6DA 4OIMA 1AHIA 4Z0HO 2J3JA 3M6IA 2Y1OA 1Z73A 4KTVE 1LDYA 2VUTA 3MJEA 3AOEA 1R0LA 3PWZA 4M1QA 3W4JA 5KKAA 4CQMA 2GZ2A 2C5EA 5IN5A 5L51A 3ROPA 2Q46A 5JSFA 1T2DA 3VZSA 2C59A 1A27A 2VRCA 4NK4A 2I5PO 3LT1A 4TROA 3VH4A 4D44A 2YV2A 4D0SA 2RCYA 2HMWA 1MC5A 2J3IA 5JO9A 4BV9A 1M66A 3LK7A 4ZQBA 5TX7A 4DWVA 4OOEA 1TI7A 4RPHA 2VZ0A 2H1SA 3Q2KA 1FK8A 3GK3A 3IP1A 3PYLA 1HE2A 4Z9FA 3B20A 3ASUA 1QG6A 2UAGA 1A7KA 3PIDA 4JQCA 3INGA 2QW8A 3L6OO 1GYRA 4DPKA 1QR6A 1Y5RA 4UEOA 2DPHA 4KUHA 3GRKA 3OF2A 1E3SA 4HX5A 2DVMA 3FRJA 2VWGA 4Y6PA 1U3TA 2YW9A 1DIRA 2DC1A 1I2ZA 1WDKA 3E9QA 4GMGA 3VH2A 2EJVA 1F12A 4CMEC 1LI4A 3ENNA 4WEQA 5TS3A 1JDJA 4EUHA 4W6ZA 4LGVA 4E2XA 3O03A 4R5HA 1GTMA 3DDNA 5U1PA 1ADCA 3NGXA 4RVFA 1VE9A 4X54A 5IDQA
chains in the Genus database with same CATH superfamily
1T91A 1J2EA 2JBHA 3THRA 1JJVA 1P8JA 3DFMA 5ERYA 1JEAA 3PDIA 4ZI2A 2N1BA 1YI8A 1OFVA 2NZWA 5ICFA 2HA3A 3K5PA 4TKMA 5H4GA 4QARA 5KYWB 2ATXA 1Z74A 1UPCA 1JIVA 2ETVA 1ZH6A 1XVUA 4QEKA 4B35A 3I6MA 2JLBA 1VE6A 1CUFA 3ZU3A 2OOKA 2X7HA 1MZPA 1N2CE 2MWMA 2VDWA 1L5ZA 1E2FA 2GBGA 2XCSB 1DQYA 1R0BA 3CWZA 4DPMA 2H7XA 3NHYA 3C74A 1Y1QA 4JJ8A 1DG3A 5EN4A 5JSQA 4KG7A 1KTVA 3VAZA 3GN2A 1M6WA 1CCWA 1LDGA 3GAZA 4W5JA 1IZ9A 3JD2A 4XFDA 2JD1A 4I5FA 4FKZA 3LDFA 3V4PB 2NAFA 4C0XA 3HK2A 2VTDA 1KK1A 1ZRNA 3DKRA 3RKUA 1IE3A 4LZLA 3C5HA 3CF6R 2F3QA 3KOOA 1DRUA 2ZIUB 3LECA 4BX2A 5A02A 1XR3A 4O2LA 4R1SA 3WG9A 1LDNA 3D3KA 4KPUB 2H31A 3DVLA 3CNNA 3F3MA 3O93A 4M1SA 1E66A 2ZULA 2OSBA 3LHFA 4ZDWA 4B31A 2JARA 2QQ5A 3RUHA 4DQ0A 4P4SA 4TYWA 1BWPA 1LPBB 1LQUA 2NU8A 3F49S 4D92A 1D04A 5DTEA 4IDBA 1SELA 2FN9A 3VJMA 2Q21A 2XCLA 1FNDA 4MI1A 3KALA 2DQZA 1RRFA 4LRWA 3DTTA 3LOUA 2I33A 3QKSB 3E22A 3KTDA 1ZGHA 1OUMA 3L8EA 4NU6A 1TW3A 2IHVA 2PZ8A 1XUOA 3A3KA 4R1NA 4NLLA 2RKBA 4C4YA 4HB3A 4U0KA 2GBLC 3IVGA 3O90A 1HPLA 4G5XA 4LDRA 2YC2C 5DM70 5EZYB 1TMKA 1EK1A 2H0AA 1LW6E 3FCUB 2O3SA 4CLDA 1YI0A 3HWSA 1P5ZB 1U31A 2A9PA 2ODAA 2Q7XA 3H5VA 2PBLA 4RD4A 2VUSA 3SIRA 1P0QA 4L8VA 1A8UA 5KQPA 4NX2A 1U3FA 3W7AA 1PUJA 2H63A 3LT0A 2D1FA 5L40A 2RJ3A 1JB9A 4TMZA 2C4KA 1FVHA 4L5AA 4PPNA 4JUBA 4YJFA 2CDAA 3BULA 4JOQA 3S99A 2W71A 2QTTA 3DXYA 1U9ZA 2HDOA 2IBMA 2NTYC 2PSEA 4I9GA 1Q0HA 2RAFA 2VG8A 4E88A 3GRFA 3MTEA 3OFSA 2CVZA 2QUAA 4HHEA 4RTOA 3ZDCA 1CHDA 1CY1A 5I5GA 2ZE6A 1RYBA 1Z82A 4CG2A 3AF5A 2DFTA 1A7AA 1ZCZA 4YH1A 2PZEA 2D2FA 1KY5A 1WLYA 2R25B 5DGDA 3HB9A 1DXQA 1GVNB 3C48A 4RS4A 4D3FA 3BL8A 4FE7A 1LPNA 4M6WB 1TJPB 2RBGA 4MUJA 4DLAA 2JFYA 4A6XA 1ZSVA 1KMHA 1EMDA 2R62A 2IU4A 1T24A 2XVMA 3AO0B 4RHEA 3RNOA 2X8JB 2G8NA 4KO2S 3VPFA 4F4JA 2P91A 4XVHA 1GUDA 1O77A 3OHMA 3RAFC 4CL3A 1AKTA 1ZD2P 1HDGO 2PKQP 3DLPX 3LXRA 4F60A 3JR3A 1RLJA 2NO7A 4MLDA 3VDQA 5FUQA 1HYEA 1AUXA 1QORA 2VL7A 1EWRA 2RH5A 4RDCA 3S2YA 3SD7A 1Z2NX 2GESA 5AVKA 3EDRA 4S1TA 2POCA 4IZHA 4Y2VA 3T52A 4F92B 1GG5A 4HZUA 3GFPA 1MD9A 3GA7A 3CWCA 4OYHA 3MMXA 2QR3A 2BGTA 2F48A 5EY5B 1QH8B 2B7LA 2PXHA 3TJMA 1ZCFA 2RGYA 5JXJA 1SOVA 1D1SA 2P0EA 3D5EA 4UHCA 1AX9A 1Z2AA 4MYTA 2JBWA 2N47A 2XNDD 3MTDA 4JP1A 4L7QA 2ONKA 5GIPE 3MLEA 1L6RA 3C3EA 3C39A 1GUZA 3EZYA 5BRJA 3D6NB 1C4WA 3TZKA 3L41A 1QKIA 5TMDA 5EUBA 3QVGB 4XW2A 4H77A 4PX5A 5CT9A 2FWBA 1NIJA 1YKFA 3Q1LA 4FFBB 2XOKA 4EHNA 3TDNA 2VYCA 3W7VA 5ADHA 2OHHA 2GXAA 3EMBA 5FQNA 3G9ZA 5ER9A 2OFWA 1YULA 3BEDA 1H3NA 4C4PA 3V7NA 4FGUA 1YFZA 2JIQA 1G0OA 3LX8A 4ODIA 1X8JA 3PD0A 3WYNA 1K3TA 1QHEA 3DE4X 4AG5A 2AC7A 4KGZA 4WDRA 4C29A 3NIDB 5F3WB 1V7QA 1Z34A 3ILSA 3S68A 3EAGA 1KAOA 2WT4A 5C0OE 4RY2A 4JAVC 5FUXA 1T6YA 5HF5A 4BO9A 5LXTF 1JA0A 5JZOA 4JVOA 4OP2A 5DGIA 5CLFA 1QC5A 2E48A 1FTGA 2PY6A 4HAVA 4YP1A 4FFNA 4E5NA 4TLDA 5ICCA 4OXIA 3KVRA 2FG6C 3R5HA 2FR0A 4MUFA 4WUVA 2FPIB 2ZIWB 4OB8A 3V8RA 1QGOA 2M1ZA 1RYZA 1ZU5A 3EEBA 3R0JA 5LJIA 5ECGC 2OK8A 1EFLA 1AY0A 1Z6YA 2IEGA 1NULA 3OHPA 4ZVMA 1QF9A 2A3NA 3KR1A 1ORWA 3GFQA 4FBMA 5CTAA 2Z8ZA 3FCCA 4WOPA 4MRNA 3HY3A 3LX6A 3PFBA 4BZZA 3DEIA 1KAHA 1WAMA 4WINA 4C08A 5ILQA 3UICA 5AVXA 2ZBUA 3LK6A 5K8CA 4YLEA 4QT0A 3VYUB 5JPCA 1UPAA 4FFOA 1JDTA 2I3DA 3DVRX 4HWOA 1CY4A 4LZZA 4Q93A 4IL5A 5HG0A 3E2PA 4BJ6A 1NR7A 1R0YA 1R9GA 4FX2A 2IDKA 3BXEA 3HV2A 4JYMA 4URFA 3DXZA 5GTDA 3BDIA 1J8QA 2J3MA 5BWBA 1SHZA 4Z4QA 3GFGA 5BORA 2B2CA 3WB1A 3GLQA 1RRGA 2A1TS 3OJWA 3GARA 3CUYA 1B0ZA 1Z5VA 1A9TA 3JQQA 4FQ5A 1KAQA 2WYUA 2XE6A 3K73O 4RKQA 4URYR 4B7ZA 5F7OA 1KAEA 1Y8CA 2IIVA 4OH1A 3IB6A 2QXUA 2NMVA 3P2EA 1GL3A 4RLFA 1ZIDA 4GPEA 2JHFA 2OESA 3DOOA 3QPWA 4HB4A 4X62B 3OE7A 1UK9A 3WIDA 1AZSC 1XQ1A 3DTYA 1JDZA 1A76A 4GOND 4WZAE 1BRTA 1TTHA 1M1UA 4XD2A 1I7DA 1EA5A 3L05A 3PS9A 4MGHA 3HZZA 5BV8A 1GPAA 2Q07A 2BHNA 1HT2E 1FP4B 5AM2A 3ECCA 2HV8A 4BLVA 3H9GA 3FVVA 2N75A 3Q88A 2GAOA 3GIWA 1N5JA 1FJHA 2DKFA 3O3OB 4HCJA 4E2YA 3AWDA 3NV7A 2JGKA 1P6QA 1L5KA 4C9BA 1XL0A 1PW7A 1KS2A 1CZOA 3GLHE 4COKA 1JAIA 1NC3A 5FWYB 2Z2IA 4J6EA 4C0AC 3OFVA 2XYPA 4IFEA 4QGAA 3E5MA 2HLNA 2OBLA 5JRDS 3W05A 2N9UA 3H5WA 2PBFA 3EXHA 3AIIA 3NV9A 1YJBA 3PR1A 3FLEA 3FYSA 1CUWA 4QREA 5C34B 3WHKA 1HLDA 1Z8FA 2YRFA 3GG9A 2BFBA 2F8LA 3DXXA 3OBBA 2LCFA 3IAUA 1HOTA 4FYMA 2CZQA 3TTTA 4D9IA 4FNOA 1CY8A 4QVKA 1L5MA 4BFUA 6PFKA 5CFQA 3QE0A 1PGPA 2Q9BA 3AOEC 3LT4A 1JFTA 4RHXA 3TIGA 1RTTA 2W8ZA 1PWZA 3IUJA 4PHFA 2VYQA 5A4MS 1SCAA 2I6UA 2HD4A 4H7KA 4ZT4A 2O8CB 2H3EA 3KQPA 4ZT7A 4G0OA 3RAPR 1J1IA 1CVIA 2EFHB 4KXUA 4R2JA 3SLKA 2VQSA 1M0WA 3EQ9A 4BZWA 4D41A 2A5LA 2ZTLA 3ACCA 5T64A 1RQPA 5JS2A 3GJ6A 4BNUA 4D9KA 4N3BA 1GTZA 1FNSA 3K05A 5KI6A 5I9IA 1Q3TA 1U7HA 1VI5A 2JKZA 2RGBA 3IAS1 4I81A 1TQ6A 1PQYA 2O5VA 4I8DA 2XQGA 5G4LA 1QE0A 2QLFA 3AUAA 3COJA 4REQA 5BO5A 1IN5A 1L9KA 4DFDA 3S4YA 4NXNB 2AGVA 5FOVA 2AQIA 5CM9C 3SYKA 3N0XA 1S2GA 1W46A 1WZEA 1S7GA 3QE2A 2X9NA 4QXPA 1UDXA 3M5WA 4U3JA 3NHUA 3WNQA 3WA7A 1XTRA 5AJHA 4BNHA 1SG6A 2JW5A 3DLHA 3MD9A 1RWXA 2JJ2A 2CSXA 3SYRA 3G5LA 4CGYA 5KIAA 2CV0A 5E1OA 3WV4A 4B3GA 3AESA 5JMPA 3UMSA 3R3JA 2OFXA 3KFVA 1XN4A 2EGUA 3UK7A 2UZAA 3KOWA 2Q4RA 1M7HA 4GXTA 4BEBA 3J80A 3E35A 4ZHQB 1YASA 4JMPA 5P21A 2BYTA 1FYDA 1Z7GA 2GMWA 2HI0A 2RAUA 2VHZA 1JFRA 1TAQA 5KAPA 5AQ1A 2G0AA 5JWRA 4US0R 3SZLA 1F0YA 3AHHA 3PNKA 2Q3BA 3DBLA 1A2KC 4LI0A 4AVYA 1ORRA 1PS0A 3MOSA 2FSIA 1E2NA 5HTOA 1EB9A 5CEFA 4NJMB 4GYJA 4MDEA 4JU9A 1B3BA 3BZUA 5AK0A 3P2OA 1X1AA 3V2HA 1MJGA 3SQOA 2Y0PA 5SZIA 3JD0A 3OX3A 1XZJA 3I9NA 4Z8YA 5HGXA 1NYRA 1QE5A 2G7MC 2E4VA 3CX7A 3HN2A 4DDWA 2YRWA 3ETGA 3FKSD 4C04A 2BD0A 5BUZA 5KNDH 2QN8A 2YRXA 4JXJA 1Q1NA 1TCVA 1ZNXA 1U0FA 5ER6A 1KWKA 1G7TA 2VN8A 2X8LA 2XCOA 1GPKA 1NN5A 4ZWNA 1F9AA 5B4VA 2C3UA 4ZVPA 4EYGA 4A36A 1LJUA 1N5LA 4DLTA 3ROEA 1U63A 3LYHA 4H7IA 1VB3A 3ACDA 4DGQA 1R8SA 3KB6A 3ED5A 4MNTA 2BISA 1WVGA 3N2KB 2HCFA 4DV1B 1TLTA 1RJ9B 1ZWKA 2BEUB 3ROXA 4AXBA 4HATA 1ABFA 5HDQA 3ZZMA 4DTIA 2VCEA 4ZT6A 4F3RA 2WLSA 1ADGA 2GDZA 5TJ9A 2EBHX 2Q6LA 3EG9B 3FZEA 4KXWA 1PNQA 5DJ5A 4DMUB 1XVTA 5I51A 1DO8A 3KVVA 1C0LA 1WHTA 2PUFA 3A32A 1HDOA 4UXJA 4KV9A 1E6LA 3LRPA 4DN6A 5BSGA 3D6TB 3ETLA 1KI3A 3I5MA 4AMUA 4FFSA 3E0XA 4YA6A 5B1EA 3OIVA 4F3TA 3SN6A 1XAGA 1TD9A 1BDMA 3DKKA 1TC2A 2X58A 3MIIA 4C5AA 4EGFA 2V3WA 1OB2A 1XJWA 1I4EB 1QIGA 2O7RA 3I39X 4H0NA 4PLGA 1G8HA 2WAAA 4MEBA 2EARA 2R87A 4EHJA 2C2HA 4MGZR 1OD6A 2DU8A 4OIFA 4Q1AA 2W6ID 4QOEA 1M8JA 4MPRA 2FZ5A 3REQB 3ZE0B 2ZKIA 4V39A 2NTVA 2VTKA 2EJTA 1R5NA 3EIOA 4HLDA 4P82A 4QTUB 5CHYA 4BC0A 3O4VA 1QIMA 3C7DB 3D5TA 7YASA 1P39A 1MLDA 2HWYA 2VP9A 3M1AA 3Q7QA 4GQBA 4UU1A 5ERGB 5CFRA 4MYCA 4ABTA 3KLOA 2RGWA 4J6FA 5BSMA 2BR3A 1HQKA 3TB4A 3ZS9A 5L6MB 1P7YA 5JS8A 5EP2A 1TT5B 5AKIA 4IXMA 5DO9A 5K3FA 3VSEA 4IRUB 3UHJA 3KU1A 1P19A 3L0CA 1RRPA 2J07A 2ZUDA 4HYQA 4RPCA 4OP1A 4HGPA 4L4YA 5IH7A 1X42A 3O0TA 3AU9A 1PV2A 4DSUA 1XNGA 1M2VA 4UOQA 3GLRA 1SXPA 5DLDA 4K6OA 3KSUA 4BWVA 3O31A 3HKCA 4X92A 3NT2A 4QRDA 4X20A 1D03A 5T6BA 5LIRA 1YFJA 2F8TA 3HDGA 4P6VF 5GMOA 3ERCA 3SXUA 4HRXA 3GCXA 3PL1A 5DN6A 3SZRA 4DADA 4DIKA 4CIBA 4YFVA 2OHIA 1L8AA 3S2GA 1RFLA 3ZV6A 3PFNA 4RTKA 3WL6A 1IPEA 1DZIA 1JSCA 1SCJA 1VIVA 4Z1MA 4R71A 3ZEAA 1LU9A 1JAHA 1YOBA 1PQUA 1PTJA 4US1R 5K6AA 1XQYA 2V6FA 4R3UC 4CG1A 4V0SA 4MS3A 3D7MA 3M9WA 1TCCA 1EZZA 2GBIA 2OBBA 2QP4A 3F9IA 3LBFA 3OOEA 1SFRA 1YDEA 5ALQA 1D9ZA 2DOKA 2AN3A 4KO8A 3TNDA 4DXDA 3T1YB 4NFLA 1XU4A 3QEJA 1LI7A 2OA0A 3W1VA 3U4QB 1IHXA 3UHFA 2W98A 3VO2A 4CT0A 2X5NA 4QA9A 3RK4A 1AKMA 4B45A 2C5SA 1FQKA 1D6SA 5C1IA 1E1NA 1GPDG 3FGZA 2DP4E 3V4OA 5EZ5A 4V3BA 3AV3A 4FN4A 3A0RB 2D2XA 2P6UA 1DCMA 1LVUA 2H54A 4QSHA 5ALLA 1Q5PA 1DSSG 5EZQA 2X1MA 1SVNA 1BS1A 4J3NA 4D7AA 1UQUA 3EVFA 1IBKB 1EK2A 3IKVA 3QVVA 2IHUA 4PLVA 5F3DA 3GQBA 4MIKA 4EEZA 4OI0A 2YW2A 4PYJA 1VMKA 3I9V6 4BEVA 4E6EA 4YJGB 3ZW7A 4AO6A 4PC6A 2AE1A 4UNNA 5L53A 2SHKA 1ZVQA 3A25A 5LR6A 1PGJA 2MJLA 3JU3A 4JCOA 2H11A 4BEWA 1HDXA 1UPTA 3JRNA 3G8DA 4E1VA 5EKDA 2Z4RA 1E4EB 1V39A 2O8VA 5C81A 3ISJA 3ZLJA 5FOWA 4IKPA 4I6GA 1BD3A 5A0VA 1XI2A 1N3BA 1GGMA 1NDQA 3Q10A 2PZGA 2ES4A 4FR2A 4Q39A 2HRQA 3IIEA 4A10A 3AJ9A 4MPDA 4AJ4A 2X41A 3AY0A 4W82A 1AUPA 3KT0A 1WBBA 4IGEA 2ERCA 1GRCA 1VI6A 3JWGA 1UDBA 4EAAA 1QDUA 3FMIA 3T95A 3U0VA 4CKZA 3ESXA 5TT0A 2ZUTA 2X0RA 4C4XA 5EPOA 1JQDA 2H8GA 3D3QA 4Z53A 4AMBA 1CQJA 4XUDA 2ZI7A 2C83A 2C07A 3IALA 4OAOA 3PFKA 2G0TA 4P3YA 3PJGA 3REOA 1DEXA 1RSZA 3QXCA 5TDHA 2IH5A 2YUIA 3AUUA 1Q12A 4MUXA 4ENRA 2W58A 1GKKA 2C57A 4YAKA 1QXSA 2OUIA 2B37A 2C4HA 3WKEA 3HXQA 5TQVA 1F7VA 4LHSA 4UU0A 1O94C 2EC5A 2DERA 1Q2UA 3B6MA 3WIBA 5HK8A 3B7WA 4DY6A 3DJYA 2QVXX 1PVVA 2A9VA 3H4IA 2VF2A 5JAUA 1AMOA 1M3SA 2HJSA 2O52A 2XOXA 4ZVLA 2VF4X 3KR0A 4DSAA 4TMFA 1WZNA 3KZNA 4LK2A 4C4SA 3DAHA 1JR3A 4MA5A 1KP3A 3A36A 3KDSE 1JNYA 2IW3A 4D97A 1IIBA 2ZIZA 1CG6A 1U9JA 3WIEA 2E89A 1LC0A 3FE2A 3OZIA 4WE3A 5B55A 4OM8A 5AI5A 4FCCA 5HOEA 3G2NA 4DLZA 1F2DA 2F17A 1ZUD1 2IUFA 4AFNA 1KSHA 1OAOA 5SY9A 1VQ1A 3MOIA 5HF6A 4XDZA 4IXNA 3TXAA 2Q41A 1OC2A 4DTCA 6GPBA 1JMKC 1XYVA 3E05A 3KU4A 1OWMA 1A1VA 2HDWA 3VHQA 2TMYA 4C0KA 5DBEX 1CEQA 1RCFA 1NJ8A 3M2TA 4RIEA 5FI3A 4TQAA 2BELA 4D9MA 1H3EA 1X7GA 2HLDD 3W8FA 2RI1A 3R41A 2R7MA 3QKUA 1IZYA 1NXVA 1PN3A 3ID6C 3IOCA 2QMQA 1SBZA 2IPMA 3MUOA 4HR7A 5FBRB 3TLMA 4YCBA 4ALLA 4UKDA 3ICWA 3R2JA 4CQMB 2GEBA 5AKHA 4C4AA 3RJMA 1V41E 2P3OA 4OY3A 2J85A 4M8IA 5B4UA 5E2IA 2I55A 4KIWA 5F1OA 2AOWA 2O2HA 2Y93A 1E79A 1XXLA 1Y3CE 2A1UB 2XT6A 3OD1A 2G7ZA 2ZT8A 4D56A 3MQ2A 2JI9A 1UXHA 4KGXA 1EFPA 1EWTA 3AVYA 3GUVA 3FOAA 4CFSA 4EUEA 2C4NA 2ZSHA 1UBSB 2VQEB 5BQFA 1UBOS 1RJEA 4O6VA 4XEHA 3STUA 1W44A 4GI3A 4TS3A 5FL7D 3IXQA 4CM1A 3PC8A 1OAKA 2JHPA 2IF2A 1THTA 3IMCA 3VR4D 1CEXA 2XYRA 3ZXIA 1OY1A 2RHJA 3T38A 1JRLA 4MEJA 5FR2A 2WE7A 3WRWA 4QC2A 2J08A 5CT5A 3RF6A 1SC1A 3KSDO 4IHKA 4QQKA 2B5OA 4JI6B 1XZKA 2AG0A 4OUDA 4MWSA 4I9HA 4PXAA 4RF5A 2LNDA 4MKHA 1I7QB 1DC7A 4Q4HB 3UQYS 1DFHA 3QX7A 2ZATA 3QUCA 1XVVA 2C5HA 2O3JA 4JJZA 1KYXA 5FBHA 4AZWA 2W00A 4CKYA 4DREA 1M34A 2HRRA 1EBFA 4TTSA 3MYRA 3TQSA 3AUJB 4M1YA 2YV4A 4WNAB 5JWHA 3NONA 3DF7A 4I1RA 2Q8NA 2D3WA 2WJZB 4QUEA 2HMAA 2OECA 2O2YA 4IIJF 4K6HA 4LYAA 4WACA 2XRYA 4FE3A 1KSJA 1C4OA 2A88A 4D3XA 1Z7EA 3JQEA 2QQ0A 1PR1A 3B9PA 2H4YA 5P8WA 2VHTA 2ZE5A 4JJEA 5AW7A 3MQ4A 1AS0A 3VPSA 4ZVUA 4PPYA 2F67A 1YJ8A 3PLNA 4K9PA 4ON9A 3SHFA 3UYLA 3T35A 1PSZA 4DIEA 1KMNA 1NQXA 4PGFA 5T4HA 3BL5A 3EC1A 3PDIB 1U5CA 3W2GA 1O0SA 3R9WA 1WD7A 4AJPA 4BQPA 4W8GA 2PS0A 3JQFA 1J0EA 2VO1A 4DDHA 2CK3A 2D0OB 1S3FA 3FF4A 1CJCA 1PJCA 3HBAA 4C7BA 4GLLA 2VDWB 5DSXA 4ETNA 2W90A 1W76A 2AK2A 1EIWA 2R3SA 3T5TA 2HQRA 3DR3A 3TBHA 1KEUA 3UBMA 2IH2A 1MGOA 1IEVA 5F52A 3LKVA 2IC5A 4QWWA 1PJ2A 3JQBA 1S96A 1JHAA 2BEWA 1T2UA 2R2GA 4UBJA 3CSUA 5EA2A 5HFNA 1D8TA 2DPMA 4LTMA 2VTBA 1LC3A 1ULUA 3LNTA 3K0BA 4RA6A 4MIEA 5CPBA 2JEYA 1M0EA 2O8DA 3T9CA 2JCBA 3TK1A 3RADC 5JEEA 2Q2WA 5AJXA 3LW7A 4IGIA 3P0FA 1MEEA 2ZYVX 4KE8A 5ALXA 3F4LA 4RPGA 4TLCA 2Q3HA 2RK6A 3CW8X 2BUCA 4ARUA 4O4LA 3W2HA 1FSSA 2H7VA 4GVXA 4NYMQ 4EVRA 1QUEA 3WLMA 3IPXA 4YCSA 1VL0A 5C1PA 1EXDA 1JUDA 5JATA 1EDEA 3IKMB 1DIHA 1GRVA 2REOA 2JANA 2C2KA 4RM3A 4ZCRA 5EHXA 1OYOA 2QQEA 4P4SB 1ZH4A 2NU8B 1LX6A 4IGAA 1IOZA 3RK1A 5I47A 4EGAA 3WGVA 3PX7A 3AERA 1FXWF 1G5PA 3DAYA 1T0PA 4KMSA 1KOJA 4X6LA 5AK6A 4FFPA 2MYNA 3ZI7A 5AHXA 3X1MA 3PF9A 3ZW8A 3EPPA 3UK1A 5LA6A 3VMFA 5C8VA 2EQBA 4DPLA 4G36A 4EL0A 4C0LA 2V7BA 3LGSA 2Q0QA 1FS6A 5DV9A 4UEKA 4O4LF 4DM3A 1E0SA 5AJYA 3AVXA 4XR4A 2IIQA 4RVUA 4YHBA 3UWPA 1MIHA 1DC3A 2ZP1A 3K94A 4HMOA 5IXSA 4U5XA 4H59A 1Y1SA 2F6RA 2IYZA 4MX8A 4E5UA 4R3NA 5JD6A 1JBEA 1P5FA 1DBQA 2EDCA 4LMBA 4N5DA 3TRJA 3I5XA 2GA9A 2X0IA 1U5AA 1ZIYA 2F55A 4FXOA 2ZIFA 4TX1A 3RYFA 4E4YA 1HGXA 4TYQA 5BT9A 1E2PA 1LPSA 4MPTA 1NPTO 2AN4A 3R23A 4EI2A 1N2GA 4LJLA 5DKFA 2E9SA 2H2DA 5E4TA 4YJFB 3U1TA 4IMJB 3DBRB 2WBLC 2WJYA 1E9VA 2I2CA 2VYVA 1XELA 1PIWA 1YVDA 4Y8VA 2C7GA 5LA6F 3WP1B 2G1PA 4DMRA 1NFRA 2BTOA 4BFXA 3QV2A 3PC4A 5DYIA 1Z9BA 1KZ1A 1PRYA 1R5JA 4FX5A 2WWIA 5IEJA 5DOZA 1PL0A 1K5DA 1TCUA 3LH5A 9LDBA 2F62A 1I4TD 1U11A 1NPDA 2WFLA 4NR0A 4WTOA 4AJEA 1J0BA 2HRCA 4NFYA 1C7FA 4XIJA 4ZV9A 4TSFA 3WP0A 1ZS9A 1JMVA 1C9JA 4YMGA 4G2TA 2O2XA 2E4WA 1G0NA 2C5LA 2ZWPA 1Y5MA 3E8MA 4X1IB 5TQ2A 1KMHB 4UCXA 1Q20A 3M1LA 3OLCX 4Y2UA 3RS2A 4MPPA 3HXMA 1ABEA 1JVBA 1UDRA 2BW0A 2VTVA 1R37A 2XDWA 4M7PA 1WDLA 4RD0A 3A2KA 3HBNA 2P0YA 4WOBA 3PFIA 2J9ZB 3DOUA 4QQNA 1BWRA 3KXLA 3MWKA 3O38A 3NAGA 2JLRA 4IJUA 2DUMA 3EY9A 3U81A 1XRLA 4DM7A 5JJBA 3K0AA 3E84A 2Z5LA 2B3TA 3PNPA 4P4LA 4YVFA 1DKNA 2Y27A 4CMIB 4X6UA 5WRFA 1PBTA 1UBMS 5ALKA 4HZUB 3H75A 3KB8A 2ZTHA 1FMTA 4NONA 3QJ5A 5L45A 4FMCF 4ND1A 2R6AA 5ARCA 1RT9A 1HE8B 1H9CA 1Z29A 2O2GA 4UC0A 5K6AC 2PX6A 2IL1A 1XU7A 4CG0A 1IUNA 3NHJA 2H92A 4UJ5A 1X1QA 2VNSA 5F1YA 1P9OA 3SKXA 2WTMA 4EHLA 4J7AA 5I7FA 4YPOA 2IY9A 4M9RA 2P4QA 3DT8A 5GV7A 1P0CA 3B2EA 3DAOA 3JZAA 4Q05A 1G59A 2GM3A 1MAVA 1M2OA 3H99A 5DNDA 2X76A 4RTQA 1CZUA 1RM5A 1VSVA 2XZPA 1VJCA 2ZTVA 1F6WA 1HLPA 1QJ4A 2PZLA 4IRXA 2XBLA 4WK2B 1DL5A 4ND6A 5K0CA 5LJLA 3NHMA 3DWFA 4ZO4A 1KZ4A 2G63A 2NXJA 1TOAA 3I0ZA 3SLRA 4DJDC 5HBRA 1IXYA 1UBUS 2EX1A 3CQ9A 3ML1A 2G4VA 2YYYA 3D4PA 3G59A 4G5RA 1FY2A 3AEKA 4WN9B 1W47A 2H5EA 1QZZA 2FP3A 2ZAIA 4IIXA 2XNSA 4KVZA 4Q7EA 1M1NA 4KU4A 3RJZA 3NWBA 2J33A 2X2EA 3BGSA 2QTLA 4CV1A 3EBPA 1GKUB 4J7CA 3PSAA 1TJNA 3P5SA 2JGIA 3E7FA 3EDYA 4H3VA 4EY3A 1POXA 2QXTA 3MWLA 4LWZA 3GIDA 1Y1PA 3OZEA 3QMPA 3UUGA 3EGCA 2IYOA 3EWNA 4IJ6A 1QC5B 4MUBA 2VHUA 4QIHA 4ZN6A 3B5IA 1AUQA 3N0WA 3B7PA 2FUG1 3TFWA 4GIBA 1ZJ4A 3T7AA 4RTRA 4BB6A 2VHQA 1O0BA 3L7IA 2COUA 2V8OA 3C97A 2VJOA 5IAJA 2NZYA 5JS1A 4D6PA 3O8DA 1QVAA 1I7NA 2C54A 2KS6A 5DH9A 3WOVA 2NVUA 4ADSG 5LZ2A 1JQKA 3OLWA 1Y4UA 1Y6QA 2MR6A 3GT3A 5CIYA 4MJ3A 1XEXB 2AFHA 4RK5A 2E1PA 4N4AA 1XWWA 5EEHA 5ENDA 3R7DA 1GTVA 3EGIA 2CV1A 3IMKA 4F91B 5BR1A 1GNPA 3CJQA 1U8YA 4A15A 4Q4LA 3HDYA 3RDPA 3TQRA 2UVPA 9GPBA 4KCGA 1A9PA 3M1YA 5TGZA 2OGWA 1TEHA 2E85A 3KE8A 2GXUA 3B9QA 1EP2B 2VK1A 3OOJA 3QU9A 4AN0A 1NVBA 4DLSA 5BV0A 5KOYA 1HG1A 3N87A 5IBPA 1EHIA 2H0RA 1MC8A 1YQTA 4ENSA 2YHAA 4NZYA 2ZYRA 2J3EA 5MN4A 5EHZA 3CTMA 4IYJA 4YONB 2X0EA 5YASA 4B8ZA 4A91A 1V35A 3PT5A 4CMHA 2CB0A 3I9V1 4CDRA 4IIEA 3L6EA 1PKXA 4I4CA 3UGQA 1U0OC 3ZOKA 3ZJ4A 4F93B 1RKXA 3F1KA 1Y8AA 3SDZA 3DAFA 4UUPA 2W2LD 1PL8A 3IQWA 1URPA 3JYOA 4LWPA 1MB0A 4AJ9A 5K20A 5LQAA 2H2GA 2J9FA 5EJ4A 1L3BA 4P5EA 3ZWNA 4DG5A 1FSFA 3PCXA 3H1GA 3OJOA 1N0WA 4RZIA 4HDKB 1X1BA 4EF5A 5M34A 2QIOA 3C5CA 4CVNA 4G0NA 4A0FA 3S70A 2DBRA 2IHKA 2J4DA 3IH5A 3IP6A 1BIFA 3WBFA 1SHJA 4PLWA 1XMIA 2A9OA 3BH0A 2C84A 4KQHA 4CMEA 4LVNA 1I6MA 4TWBA 2RGGA 3WLLA 4BVAA 4LSWA 1EE2A 1ZGAA 3PZBA 4YMIA 5HPYB 4NECA 2HMTA 3LDGA 4EHIA 1Q0TA 2K2WA 3EXHB 1GGFA 4EFKA 3UFXA 4HEQA 4ZCPA 3B6KA 3OLYA 2V3VA 2X86A 1YJ5A 4JA0A 5KBYA 2BFBB 4QDOA 1CU1A 5B2EA 4G8BA 3AY6A 4FONA 5EJFA 4BNZA 1I32A 5JOQA 2I4MA 3U3ZA 4I4TA 2XTNA 4NH4A 2VXCA 2DAPA 4X60A 5KTMA 4UXHA 1BVRA 2QT9A 2SCUA 3F4KA 5GOTA 1HSZA 1S2LA 2EZ9A 3MJ4A 2P35A 4OF4A 4JLNA 1S9DA 3EVDA 3IDSA 1QU2A 2NTJA 4OK6A 3DLIA 3MM4A 1R8JA 4RFSA 1MAAA 3ZU2A 2HU8A 5BWCA 1NF8A 4ZT2A 3RKSA 2BMDA 2R1VA 3PFWO 1SUAA 2IV7A 2IXGA 4OQ4A 3UJCA 4HLNA 3HC7A 1BQEA 4DCMA 4OYRA 2QLJA 3JWIA 3EWSA 4XUEA 2ANCA 2Z6VA 2ZU0C 3AUKA 3PC8C 2REXB 1XZIA 4ZI7F 2PZBA 2X6TA 4REQB 5HJEA 4N5LA 1GU1A 2BFEA 2DX7A 2Z4SA 4I4TF 1OH6A 1QP0A 4ZEMA 1D09A 1VDZA 1L5QA 1X3SA 2ZJ3A 3I34X 1KP2A 4GZMA 4Y2TA 5HCIA 4DAOA 4IEEA 1A9ZA 5EMKA 3I30X 2B4QA 2WDPA 1RBYA 2BTQA 1A69A 3KKMA 4EG8A 1VSQA 5CURA 3BC1A 4RKWA 2O57A 4NQZA 4B4DA 4FYHA 2BC9A 2CMKA 2QTZA 2VT7A 1U7WA 4JZKA 3N5CA 4WCDA 3SHVA 4AIRA 3G2LA 3KDPA 4TRMA 4EJFA 2L42A 2TSYB 4C07A 2PZFA 2IYNA 2JA1A 3AESB 5IF9A 5G02A 2YS6A 3ZWCA 2FUKA 4BNGA 2JH8A 1K8XB 1KYZA 3PNOA 2I4TA 2Q5HA 2GJ8A 4J49A 4J0GA 4ZA2A 3QF7A 3ZIAD 3VNVA 3OOSA 3AU8A 1NQ5A 4B82A 3KPUA 5IM5A 4F1JA 4MOWA 4F0JA 4BYGA 1J21A 1L5YA 5TS2A 4AF8A 2VK2A 1S2OA 3DBLB 3ICOA 3Q0IA 4UHBA 5KYVA 5T8KA 3GLSA 2H1WA 4U7TB 1Q0UA 3TBFA 3TLAA 1ZEJA 1ZGZA 4G1FA 3GP3A 4GLOA 4GNKA 4W1QA 4GX0A 2RGUA 3OZWA 1DBIA 1EJ0A 4FXPA 4QRHA 3AM1A 1DLJA 1NVEA 3T34A 3LL4A 5AW8A 4QHTA 3EVTA 2KM1A 5CCEA 2I62A 1U9IC 3AP2A 2R1ZA 2O48X 4RGYA 3DM5A 3NIFB 5LC1A 3AYZB 4G23A 5ADVA 1WP4A 1QB7A 1RPTA 1H42A 2GRJA 4JB8A 3VR4H 1VB5A 3G0GA 2P7IA 1KVRA 1CUXA 3DTNA 4YFYA 4CGZA 2PYDA 3DE7X 4D46A 2IPXA 2CJFA 2Q5LA 3EGDA 3NBAA 4CM8A 1FVFA 3GLTA 1UBFA 3L92A 3T1NA 3ZC3A 3PGLA 1CIVA 3FTNA 2XJ4A 4ZMBA 5F9HA 4WNYA 1W75A 1XEFA 1G291 3N59A 3SG0A 4MUYA 3FM9A 3JQBC 4RKFA 3P2KA 2ISCA 3S29A 4ZKDA 2BEJA 1RXYA 4IPTA 1X39A 5BNTA 2HF8A 3BA6A 5K0TA 4XAQA 4EW2A 5JNUA 4HNUA 2DUUA 2NNLD 2BFFA 2VVTA 3FFXA 3H4TA 2D3TA 2GO7A 3KLBA 4WADA 4KXFB 4EI7A 1U0HC 1WHTB 1ULZA 2R1UA 3K2QA 1XJQA 5I8PA 5KTRA 1EIZA 5FPKA 4H1UA 1MV5A 1NHWA 4MLZA 3OEHA 4YT4A 5AD1A 3IRUA 1PJZA 4DV2B 1CDOA 2A94A 4IIUA 3IEUA 1TXGA 4FHDA 1MB2A 2WY2D 1YZ3A 5EESA 2C29D 2YHIA 1XN1A 2A5FA 3DL0A 4JP3A 1Q57A 1IWOA 2R48A 5FULA 2XCRB 4RANA 3SXPA 1OWNA 4URUR 1AK1A 4CMGA 4A82A 3G82C 2IP4A 4G4JA 5K51A 1WV0A 1SN7A 4FR0A 1QAQA 1XXHA 4JVMA 5L7YA 1B74A 2QM0A 3D7SA 3TTSA 1EVKA 1GCIA 1KAGA 4BMNA 3EPLA 3A9SA 1QYXA 3NOXA 2BT4A 3ZGYA 3L7NA 3DA8A 2KLBA 1N6IA 1Y63A 1V8OA 4XUCA 1GM5A 1NMQA 6YASA 2DKNA 5EIFA 3EZLA 4G65A 3W34A 1PJ3A 1BDIA 3E27A 1SQFA 4MVJF 5KMGA 1U99A 3IULA 5KOJA 1P75A 1YHNA 5K3FB 1X70A 1ODJA 1U0TA 3JYQA 3L7AA 3RYCA 1QGYA 3N2ZB 1NBWB 3HMKA 2ZR9A 1FVXA 3HXPA 3LQ1A 3OSZA 2D6FA 4H35A 1M2VB 1W36B 3H1BA 3KUXA 3ZHQA 1Q1GA 3K6RA 5EXPA 4C6SA 3HKCB 4X20B 5THXA 5LQCA 3CXUA 2WJJA 4J2HA 3R9XA 2D2EA 1ZLXA 1RC8A 3SXUB 2YYAA 3TXYA 4P3PA 4D81A 3AR2A 1RYHA 3UGKA 1XCOA 3OX2A 1Z39A 2YC4C 3F98A 1V4VA 1K8ZB 3MTBA 4KBGA 4HPWA 1JHRA 3JALA 3OICA 1W0KD 4WKBA 3D3JA 2WHYA 4IH9A 1KK0A 3SFVA 3KHSA 3QJYA 4M98A 1HTTA 3PQ7A 1YTUA 1QK5A 3ZLTA 4Q9IA 4RDXA 3P9YA 3QBTA 4MS3B 4BZPA 2I99A 1CB0A 2VEOA 1W9HA 4QYSA 2AVNA 2HPZA 3COYA 2ODEA 4B6OA 4C89A 4DMLA 1YZVA 2C2BA 5JNRA 4ZDIA 1IBLB 1BGXT 1P0IA 1U04A 3E5RA 4WNCA 4MVJG 4TTJA 3EASA 4L28A 5JMOA 4W63A 5KU1A 4O3MA 2HWKA 3DBHA 2AR0A 3FDJA 4Z9BA 3IT0A 3N2EA 1ISRA 4QJ4A 2ONZA 1I2MA 3RS0A 2Y77A 3EIQA 5M04A 1U4NA 5AICA 4DSZA 1Z3CA 3UJ8A 1IBRA 2QNRA 3CONA 3MOGA 3DC2A 2OXTA 2BEKA 2WICA 4OSOA 3WSVA 3VAAA 1RWOA 3LV8A 2PBZA 5JH7F 1ZJWA 3JXEA 4A2WA 4BMZA 3UOWA 2WF9A 2PUTA 3ZKWA 3SR3A 3GQBB 2VOJA 3F9RA 4E5YA 1UPFA 1NW7A 2Z4TA 1WDWB 4WI1A 1DUSA 1YR1A 4PN3A 5FA8A 1UBKS 2OCPA 3W2EA 2BIFA 3LU1A 1QGUA 4JMLA 2J48A 4EENA 5JC1A 4EY8A 1NBEA 4LXXA 4MVWA 1YQ9A 3HWRA 3Q72A 5A4KA 1H2FA 2YBDA 2D2VA 5HKOA 1CDDA 2F1OA 1ZJJA 2P3SA 4GKBA 1YS6A 3AHDA 3NC1C 5JJKA 4E46A 1L5RA 3W4KA 3OTGA 5ILOA 3K31A 2IODA 1RXWA 3VYRB 3GC6A 3DZCA 1EPUA 2YINC 5MDHA 3FWHA 2FSVC 4ZAVA 4YPVA 4M1TA 5ITWA 4HPXB 4F2DA 1G2PA 1CE8A 5ALYA 1TAHA 4TKLA 5B3KA 4HNAA 5K0BA 3IAM1 3PC6A 2LPMA 2Z3WA 1CQJB 4IP0A 4QVIA 1DX4A 3FW1A 2QAGA 3WJ7A 4NICA 1O6GA 1G63A 3L8ZA 2AIRA 4YP0A 3UC9A 4QD3A 4JEMA 4EA9A 3O4RA 3ZDQA 2PVCA 3CISA 1QGED 4GXRA 4PAQA 5C53B 1AGNA 1RJGA 1KDRA 3GEIA 4BNNA 1SD1A 3NPAA 4I1VA 4NEQA 3RFTA 4FLFA 4O63O 1DU4A 1XWIA 1G98A 2Z2JA 3QX8A 4JODA 2X42A 3D8NA 3OD5A 3OOYA 3QEMB 5HM8A 2JAUA 2RHRA 3IPCA 3BSYA 1SVMA 2G36A 3LLCA 4S12A 1HMYA 2FMTA 2PQ0A 2IWRA 3PUVA 1KXJA 3FCAA 2BDUA 2JCGA 3ET4A 1CUYA 5E7JA 3PF8A 1ELOA 1WZ2A 4DG8A 3VPDA 1T4GA 2CUKA 3CLUD 4PYNA 1ND5A 1LBSA 1Q1BA 1SU4A 3OQIA 2G1UA 4D79A 4YXWD 4MMZB 4ZJZA 1A82A 2J8ZA