1YB1A

Crystal structure of human 17-beta-hydroxysteroid dehydrogenase type xi
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
244
structure length
243
Chain Sequence
RRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITGVKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human 17-beta-hydroxysteroid dehydrogenase type XI.
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 17-beta-hydroxysteroid dehydrogenase type XI
total genus 93
structure length 243
sequence length 244
chains with identical sequence B
ec nomenclature ec 1.1.1.62: 17-beta-estradiol 17-dehydrogenase.
pdb deposition date 2004-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1yb1A01
2O23A 2Y67A 3PPIA 1VL6A 2I65A 1J4AA 4BGVA 3VAZA 1FDUA 2EW2A 1E3LA 3DOOA 4D41A 4EUEA 4FCCA 3JYNA 1JAYA 1DFGA 1B7GO 4CMAA 3L77A 2YFHA 4FFMA 3IP3A 5IAAA 4IINA 4JROA 1DEHA 6LDHA 5B37A 2NV6A 4J7UA 5AVOA 5A9TA 1X7HA 3HUDA 4IDFA 5TGDA 1KVQA 2OP0A 3INGA 1KBZA 3RUDA 3QVWA 3ANMA 1U9JA 4FFRA 3GPIA 3R6DA 4G2NA 1YJ8A 1RYEA 1I33A 4KTTE 2OMEA 4BVAA 3U49A 2GF2A 4BMVA 1DRWA 4R01A 4Q3NA 5ILGA 3PXXA 4ZQHA 1EE9A 4F6LA 4IJVA 4NK5A 1MFPA 5A05A 3C8MA 1Q2XA 4HFNA 3LK7A 1ZVMA 2CD9A 4N5NA 3H5NA 4J4TA 4GBJA 2UAGA 3NDRA 1HDZA 1B8VA 2CSUA 2QRLA 2HSDA 1QV7A 4HKTA 4GX0A 1U3UA 4RVHA 2EHDA 2XF8A 4LSMA 1E3JA 4NFSA 3S2EA 3H7AA 3FWZA 4WCFA 3DB2A 1MG0A 2AA3A 4XQGA 1V0JA 3C1OA 4DL9A 4IJUA 3GEGA 3DZKA 1VI2A 4BV9A 1DPGA 2CY0A 5A5FA 2VUSA 4CODB 3WMWA 1NFQA 3VKUA 4RQTA 5B4UA 3RASA 3G0OA 1FDTA 2FP4A 3AUAA 4MVJA 1J0XO 3ZWCA 1S6YA 1LEHA 1MFZA 4BOYA 2R00C 3GAFA 1E7QA 2BF7A 2GN9A 2ZATA 1SB9A 2UUOA 2VOJA 3LLVA 3GK3A 2IZ1A 3AI1A 4BO7A 3LC2O 4CM9A 2FMUA 3Q1LA 3UUWA 3RC7A 3VC7A 3DBLB 1U3TA 5EN4A 1FDWA 3DXFA 2G82A 4KMSA 4C4OA 3P2OA 1JDJA 5LDHA 2QRKA 4F45A 5J23A 2P68A 1E3EA 4UVGA 3WGZA 2ZTLA 1LDEA 1O9BA 4D3DA 3EAGA 3I9OA 2J6IA 1U3WA 2YHIB 1YB4A 4OL9A 1NQ5A 1W73A 4J0FA 1HYHA 2J3JA 3WNQA 1ZK4A 2IDZA 4LISA 2FZEA 2JD1A 1DOHA 4M54A 1GR0A 4TKLA 2VT3A 3C7CB 1GZ6A 1M67A 2Q1WA 1WXDA 1ZK1A 3EK2A 3KLPX 3MWEB 1CEQA 3EW7A 3RBVA 2FWMX 3H6KA 4BKUA 2EEZA 3TJRA 4KUGA 8ADHA 1KEUA 1UXJA 4JIGA 3ICPA 3ORFA 5COQA 2QX7A 3KRTA 1JWAB 3FRJA 2E6UX 4LSWA 2EKPA 3VZQA 5MDHA 4WCDA 1TVEA 4IZHA 4CMEA 3OMLA 2IRWA 1M75A 3I23A 3JQ8A 3CZRA 2O4CA 4R16A 1PSDA 2O50A 4WNIA 1BRMA 1JQBA 1A4IA 1KVRA 1CQJA 4FC7A 3CEAA 2YUTA 2RCYA 3W8EA 4BGIA 4CM9D 4Q3CA 2PTGA 1CERA 5ITWA 1D8AA 5JBIA 3GLQA 3ZHBA 5A04A 4CV1A 2HMWA 3JQ6A 2X1HA 1QLHA 3I4FA 3JQEA 3M2TA 4MVJD 4B7XA 4HUJA 4OJNA 4CM8A 5FWNA 5BNTA 5BSFA 1PR3A 2DTDA 4WGGA 1LDBA 2NU7A 4E33A 5DF1A 4RJTA 4YYZA 3U5TA 3I9KA 3D4NA 4BGUA 5ITVA 3E5MA 2IE0A 1VSUA 1UXKA 1V3UA 3PHIA 4RORA 3CPSA 4DWVA 5TIIA 1R0LA 2YHIA 1UDCA 2QHXA 3Q2IA 2X9NA 1YE3A 3F1KA 4S1VA 4MDHA 5GY7A 2AE1A 4HFMA 3F5SA 1O5IA 3GRKA 5C5IA 4ZGWA 5CP8A 3TPCA 1E6UA 1M6HA 3KLMX 4W9NC 4WE3A 3VH3A 1DAOA 3JD1A 4RV9A 4CQLB 3DHYA 3I52A 3MJ4A 4U0JA 3GGGA 3OJFA 1GCOA 4XCVA 5KJ6A 2JAPA 1OI7A 3WYCA 3BZUA 3K5PA 3HB5X 4LMRA 3FR7A 4OMUA 5EMHA 1KEWA 3PYMA 1KEVA 2D0IA 1DFHA 3UHAA 1J5PA 4Q3EA 3HJAA 4IM7A 4CLHA 3ENKA 1BW9B 4L0QA 3EVTA 1E0DA 4K6CA 3CSDA 1EUZA 1P31A 1YQXA 2C29D 3Q3CA 4L73A 1TA4A 1IPEA 1Z73A 1JKJA 4Z9XA 3O4RA 2OZPA 3AUTA 5BSGA 2X9VA 2CUKA 4EUFA 1P1FA 3QQPA 1UH5A 1KOLA 1DC4A 1CETA 4CLXA 5LC1A 2V7PA 4NBTA 3CIFA 1Q0LA 3AWDA 4E2ZA 1BXZA 5KVCA 4J1QA 2ZYAA 4Y98A 1QYXA 4BNLA 4CUKA 3MEQA 4ZJUA 3DTYA 4B7CA 1OOEA 5A06A 1LSSA 1VM6A 5G0SA 4CMEC 4H16A 4L9RA 4HNHA 4R41A 4CMJA 7ADHA 4E2YA 2CDCA 2PZMA 1ZSNA 1YQDA 2C2YA 1WDKA 2OP1A 1M6WA 1YVEI 4B4VA 4WLEA 5KKCA 2Q46A 1NVGA 4Y67A 4N5LA 1LRJA 5IZCA 1E7MA 4U0KA 1W0CA 4JJFA 4J7XA 1E7RA 3O03A 3MTGA 4AJIA 3ZWBA 2AW5A 3GDGA 1N1GA 2DKNA 4A27A 4E4YA 2PY6A 1HE5A 1M76A 2BFOA 2JHGA 4CMGA 5DP2A 1DLJA 1H2HA 3V8BA 3L6OO 1PZEA 1T1RA 1SOVA 1JKFA 4FIZA 4HX5A 4IQ0A 4E2WA 5A3JA 4PCVA 4PLYA 4AJ1A 1NPTO 5IFLA 4XR9A 5K6AC 5C37A 2RBEA 1I2CA 4YQZA 1IE3A 1UZMA 3EUWA 1HE2A 3M6IA 4LRSB 2FR8A 3PP8A 1WMAA 4GMGA 4MPDA 4NMHA 3MOIA 1ORRA 4DBZA 3ASVA 4GAEA 4M87A 2HK9A 3QV1A 4QFCA 3GZ4A 5BQFA 3RC2A 4BGEA 4E0BA 1XG5A 2NM0A 5JO9A 3WSVA 5T57A 4AVYA 2JCVA 4XYLA 4Z9FA 4ZN6A 4RVGA 4E6PA 1PX0A 5THQA 1SEVA 4UUMA 1HTBA 3KXDA 3JQ9A 3M1AA 5AYVA 5IDQA 4OIMA 3LT0A 1NM5A 1GAEO 3TL2A 5EESA 3ONDA 4O6VA 4OKNA 3STHA 1AHHA 1HZJA 3O26A 1QLJA 2YYYA 4CR6A 1KETA 5G4KA 6ADHA 4R3WA 3WYBA 1E3WA 3NDJA 1V3TA 5ICSA 3CE6A 2WYUA 4TRJA 5COAA 5U4QA 5GZ1A 5DULA 4GLLA 3IL2A 3WICA 3BHJA 4DLBA 1E7WA 3FBGA 4URFA 3AM5A 2VN8A 3P5SA 2GCGA 1QYDA 2Y1DA 4L74A 5G2OA 5TF4A 3LT4A 3DZJA 4QECA 3EHEA 1GCUA 1XSEA 3KM0A 4H7PA 2DAPA 1NR7A 2C5AA 1RWBA 2I67A 2X4GA 4NQZA 2PZKA 5I9MA 1FJHA 1HYGA 4NNJA 1XGKA 2YHUA 2I66A 3ASUA 3QWIA 4IUYA 1CRWG 4KP7A 3RJ5A 5JW6A 5DBIA 4XQ9A 3KB6A 3RBZA 3WFJA 3GN1A 4FFOA 5TX7A 3OIDA 3D64A 5DCYA 1AHIA 3ROKA 4DIBA 1F0YA 1U2GA 4RZIA 2JL1A 4DBVO 4PLHA 4WEOA 2AHRA 4BO8A 1NXQA 1LDNA 2H1SA 1LUAA 3UFXA 3GH3A 3U9LA 1ISIA 4AJJA 4BO1A 3W8FA 3H9QA 3D4OA 3FPCA 1HSZA 4ND1A 4BNXA 3OJ0A 2W2KA 3HZZA 1LA2A 4A7PA 4CQMA 4L8VA 1UJMA 2NU9A 3RUEA 4CMIB 1K6IA 3T7EA 2NVUB 4YAJA 3GZNB 1PS8A 1MUUA 4OGWA 4Y9DA 5H81A 1AE1A 2OOSA 4KWIA 2O3UA 4LMPA 2BFAA 3OJEA 1LSOA 5CFZA 5GZ6A 4WLVA 3WBBA 2JHFA 3DZBA 4L76A 3QHAA 1GV1A 3HFGA 5F1PA 3PRJA 2F00A 1RM0A 3G17A 1JWBB 3DBVO 5JAIA 5JAQA 4Z3DA 3TF5A 2EP5A 1KS9A 4PLZA 1Y5RA 3PIDA 1S7CA 5ADHA 5JDIA 3PZBA 5JCJD 1PJLA 4AJNA 1ZMTA 3E9MA 3C24A 2YV3A 3WR5A 3E1KA 4YRBA 4IZIA 4A26A 1DAPA 3E9NA 1PZHA 1RYDA 2Q2QA 1HWYA 4RF4A 2LDXA 3R3JA 1XHLA 3ULKA 1ZW1A 1EUDA 2AEJA 2EG9A 2D1YA 4XYMA 5L95A 4J1SA 5IDWA 1PIWA 5EJ2A 3ROPA 5F1KA 1LDMA 3UICA 5IDYA 3WXBA 1Y8RB 4ROSA 3PQDA 3QWBA 3ZWWA 3NGXA 2PKQP 4KQXA 4PLTA 5T5QA 2PWZA 1MXHA 4FD3A 3S2IA 1E6WA 1P3DA 3ZNPA 2JAHA 4F3YA 4XA8A 5HS4A 4DQUA 1WWKA 4WKGA 1WDLA 3K73O 4XQCA 4YAGA 4R3NA 2BHLA 3A28A 5KJEA 2QYSA 2O7SA 3FCOA 4BO9A 2OUIA 2AQHA 1U5CA 4WLFA 5KTKA 2DTEA 1Q0HA 1P77A 1V35A 1YL6A 4UUPA 2I99A 3OA2A 3WWYA 1MG5A 3OJLA 1E3SA 3VPSA 1U8FO 5TRTA 4GGPA 4TWRA 3KSUA 1I3MA 3G49A 1NHWA 4HXYA 1YQGA 3GAZA 2YV2A 5FFFA 2H63A 3NT4A 3AY7A 1VKOA 4OKIA 1UZNA 3B1FA 2WJPA 4XYGA 4I08A 4LGVA 1U7HA 2EERA 2DUWA 2G76A 4GKVA 4YJGA 4HBGA 1H9AA 4DC0A 3TQHA 3DEYX 3QY9A 3JQCA 4R1UA 4MIEA 3SC4A 1VSVA 2DVMA 3UCEA 2X22A 2VYVD 3VH1A 3RI3A 2B4RO 4TKMA 3S2GA 2UDPA 1UUFA 2P91A 4FJ0A 5DCWA 3V1UA 1MLDA 1Z75A 1ID1A 3DONA 1EFLA 3TOZA 1ZK3A 4W99A 1VC2A 5HA5A 4PZEA 3PJFA 4NPCA 3H3JA 3JQAA 1E5LA 4CMKA 1Q7CA 2YW9A 3UCXA 4DPKA 1B3BA 4U6SA 3P7MA 3Q11A 1DIGA 4IJKA 2PNFA 1PGQA 3HSKA 3BMCA 3MWDB 1NTOA 4OXYA 1ONNA 5BSEA 5T8KC 3BMQB 3IJPA 4WNCA 5ER9A 1TT7A 2GYYA 1E3IA 5FI3A 1PGJA 4XRGA 4Q39A 1X0VA 4IS3A 1NR1A 2IXBA 3PWSA 4I5EA 1GEGA 1H94A 3ZNOA 3DAGA 1E7YA 4GI2A 4HP8A 3MTJA 2Z5LA 4QT0A 3A14A 4DIOA 3WYEA 2EJVA 3RFXA 4DUPA 2C82A 2HAEA 5A02A 1HYEA 3ZHZA 1XLTA 2WTBA 4UVDA 1ZK2A 4LVCA 4INAA 1SB8A 3VVCA 1GUYA 4XR4A 4IDGA 3L9XA 2Q50A 4I9NA 3IC5A 1PWZA 1PEDA 3BMOA 2HMSA 2Q4BA 2X5JO 5B12A 3D3WB 3HWRA 1OZAA 3TOXA 4BNMA 3TSCA 3EGOA 1W6UA 1DHRA 4AJEA 2HUNA 4AJHA 1EQ2A 5TNXA 2VQ3A 4JK3A 4BNYA 1VRWA 2HKIA 2C5EA 2JFGA 1XDWA 3JYPA 3UCFA 1ADFA 1ISFA 1CF2O 4H3VA 2QW8A 1GPDG 1I30A 2AQKA 1EVYA 1FF9A 4U5QA 1I5RA 3F46A 4RF5A 3NGLA 3ROMA 5IJZA 3QVTA 1T24A 4NJMA 3MOGA 4ND5A 1JKIA 1MGOA 1P1JA 4DRYA 3ZW8A 1V9LA 2O48X 2X8LA 3WQSB 3UGKA 1BWSA 1JLLA 1P74A 5L7TA 4CMBA 4CR8A 4EJ6A 2X0NA 1HE4A 2X0JA 1DIRA 4JLWA 1ISGA 1QV6A 4O63O 2FN7A 4M55A 4S3MA 2BMAA 1UAYA 3FF4A 4Y6RA 2EV9A 4BQPA 2F1KA 3V2UA 3GGPA 5CDGA 3JD2A 3T4EA 2B4QA 1ZKMA 1PJSA 3DMYA 2GASA 4I5GA 4P4LA 4RLHA 3NRCA 4WCFC 5G4LA 5A4DA 1UXHA 1P1RA 4BNIA 2GD1O 2PK3A 1IY8A 1UP7A 2Y1GA 2VZ8A 3PYLA 1U1IA 1VJ0A 2DBVO 1U3VA 3GVIA 4GWGA 1LXCA 4PFJA 4CMHA 4R1NA 1T2EA 5IXSA 4D79A 4GX2A 1A7AA 3JYQA 4OHUA 4JJGA 4XIYA 5EL0A 3D7LA 2PGLA 3EC7A 2J3HA 3D3WA 4B7UA 4NI5A 2J8ZA 3GHYA 3JQ7A 4MVJM 4UEKA 5DCUA 2EIHA 2OGUA 3DZFA 3KVOA 4LCJA 4CLRA 3HB4X 3QSGA 4YT8A 1B26A 2H6EA 4Z0TA 4JP3A 4XEHA 1LDYA 5AQ1A 1A7KA 3PLNA 3Q9NA 1MX3A 3FI9A 1TXGA 2O3SA 4PLVA 1NAHA 3D5TA 5BSHA 4MP6A 1Q7BA 1H9BA 1VPDA 4UUOA 1O6ZA 3GUCA 4B3IA 3E48A 3G3EA 3ZW9A 1CYDA 1I0ZA 4C7JA 1E7SA 4E5YA 3GPDG 2Y68A 4J2HA 1G6KA 5HM8A 3DR3A 3QA9A 3LLSA 2NNLD 1EK5A 1LLCA 3KV3O 3D5QA 1UAGA 5HS6A 4ALNA 3LZ6A 3R0IA 3JCZA 2QIOA 1J49A 3LU1A 4DMLA 4W82A 3ZU3A 4RPHA 4PLCA 3ZH2A 2B35A 2C0CA 1NFRA 2BD0A 3NKLA 1ZXBA 5IZCC 3DO5A 1DIHA 3IUPA 2BI7A 2NVBA 2FY8A 2B69A 3ABIA 4AICA 4PVCA 1XEAA 3NUGA 4X54A 3DBLA 1VKNA 5IN4A 5THKA 2EKLA 1BDBA 2BGMA 4Y6PA 4YPOA 2CDBA 1AGNA 4BB6A 3DMTC 5C7LO 3OIGA 4FDAA 3OIFA 4IDAA 4WPGA 1WDMA 4A10A 3G1UA 3HDJA 3RU9A 4PLWA 1HDCA 4TVBA 1NNUA 4GX5A 1YDEA 3WS7A 4J9VA 2WYWA 3EVNA 4GQAA 1BTOA 3KETA 4MVJH 2GR9A 3DDNA 3KEOA 5G0VA 2VCYA 1O95A 3DAPA 3JSAA 5A9RA 3FTPA 1YOVB 1MC5A 5I8ZA 4UEJA 3OQ1A 4FN4A 5KIAA 4FJ2A 2ZIZA 1F06A 4PG5A 2C7GA 4WLOA 4IBOA 3TZCA 1DC5A 3E82A 4RPGA 1YOVA 4O1MA 4RLSA 1H6CA 2PZJA 4Y6SA 4JXKA 3N58A 4NJMB 4QO7A 1IUKA 3WWZA 4D42A 3AJRA 1QORA 3WGOA 4MVJI 4YAIA 1E3WB 4BKPA 5L9AA 1PJ3A 4D46A 3TZHA 5CHEA 3UAGA 3WGQA 3ZCXA 3F6YA 3HNPA 3SX2A 1BHSA 1BXKA 3H65A 3GVXA 5JE8A 3V5NA 1YKFA 1IPFA 3NAQA 5L7WA 1JW9B 3IUSA 4GPD1 3S8MA 4J6FA 2GO1A 1DXYA 1PR9A 4OOEA 1ZBQA 3WGHA 2HK7A 1UZLA 1WW8A 1KERA 2NWQA 3GN2A 2D5AA 3FD8A 4EJ0A 3AUUA 3OECA 2VHWA 1WNTA 3WIDA 4MOWA 2C59A 3K2EA 4YRDA 4PZCA 4BKQA 2ZQYA 3OA0A 9LDTA 5EQDA 4A73A 2VHZA 2JFHA 3BMNA 1U8XX 1G1AA 3AY6A 3LT1A 3NJ8A 4YBZA 2Y93A 1EEHA 1UP6A 4HFRA 1K6XA 4MIOA 2IYPA 1B15A 3OICA 5F21A 2D2IA 3WGTA 1XCBA 1TT5A 3OFSA 2PGJA 3GUYA 3TFQA 1DSSG 1N8KA 3JD0A 4DQXA 2WYVA 3AW9A 4MVJE 4W7IA 3DWFA 1P44A 5DT9A 4E30A 1HDRA 2DFDA 4HWKA 4JX8A 4IQ8A 1HRDA 3RD5A 3ONEA 3T7CA 4ZQFA 1R0SA 7MDHA 1C14A 4BO4A 3KO8A 3DBHB 3EMKA 4BKOA 1BW9A 1SCUA 4IIUA 2D8AA 4FBGA 2VHVA 3E8XA 1HEUA 2D59A 1D4FA 1QMGA 4RPLA 5EQFA 1HXHA 4Z6KA 5CEEA 3AK4A 1ZMOA 3DBRA 1R4NB 1IOLA 8LDHA 1PQWA 1C1XA 3K2BA 1O89A 4A0SA 3DL2A 5TT1A 4C7KA 2RH8A 4NHEA 5ENDA 4BO3A 4KUHA 3QIVA 1DC3A 2P4QA 3IMFA 3E5RA 4CQLA 2NLOA 4YQYA 3HDYA 2AEMA 2FSVA 3KHUA 1C0KA 3UVEA 3FNGA 4B8ZA 3PGXA 1NWCA 2GUGA 1KY5A 1XIVA 1DJQA 4NJOA 3WFIA 1EVIA 1Z6ZA 2AQ8A 4RF3A 4IDBA 3N7UA 4D43A 4NZ9A 2W4QA 1XQ1A 2OBNA 4GMFA 3BHIA 3KYCB 1LQTA 5JPIA 2UVDA 4XD2A 2V65A 4WEQA 5KVVA 5L45A 1GQQA 4CM8B 5KWEA 3ZN2A 1PGPA 4OSOA 3O8QB 2GZ2A 3L6DA 5C7IO 3ZHXA 5EIOA 3DFUA 3W4KA 2QRJA 4JBIA 2VUUA 3BMNB 4BO5A 2EP7A 1NHGA 3PWZA 4M89A 4NBVA 3RUCA 3L6EA 4DYDA 1GADO 1GQ2A 3IDSA 1PQUA 1PZGA 2Q49A 4XZ3A 2OO5A 4YXFA 4CM3A 3F1LA 2Q2VA 4DIFA 4ND3A 4QTZA 2IEBA 3I9LA 1QRRA 2YQ4A 3OHSX 3QWAA 4QUKA 3VH4A 2NQ8A 1P45A 1PTJA 3BHMA 3GY0A 3ZI0A 3RSHA 1K89A 4PZDA 2WEKA 3KBOA 3FPLA 4B3HA 3A9WA 1PL8A 1C3VA 4N5MA 5DOZA 1ULSA 2O3TA 4EGFA 2VYND 3K96A 4R1TA 1P33A 4NK4A 4WLUA 4W4TA 1ENPA 1RKXA 3QJ5A 5CDYA 3AI3A 4WLNA 3NTQA 5EINA 2XXBA 1T2AA 1DFIA 2I6TA 3JQBC 1E1KA 1H2BA 4JN6B 4I5DA 4ZRMA 5G0TA 3O38A 4ZHSA 4YT4A 3CKYA 2JFFA 4O5OA 2GZ3A 2ZTMA 2EJWA 5L51A 2Y66A 4TRNA 3WNVA 2JCXA 1NQAO 1P0CA 3EZLA 2ZYDA 4NH4A 3VPFA 5IG2A 3KYCA 3FNEA 1GPJA 3IKTA 3PDJA 2DC1A 3KZVA 2GN6A 1A71A 3BTUA 1EZ4A 3WQRA 1VL8A 4ZQEA 2I3AA 2HO5A 4L4RA 3OM9A 3DMTA 3WG9A 3C7AA 1LI4A 3EZYA 4A03A 2AG5A 2VZ0A 1Y8QA 1E6EA 1UR5A 2P2SA 4XGIA 3MJEA 2QZZA 1DLIA 2FOIA 3QRWA 3PWKA 4GH5A 3W4IA 1AUPA 3PTZA 2VOEA 4CQMB 1KIFA 2HLPA 3AU8A 4XDZA 1YXMA 3BMOB 1D3AA 4J7CA 2W98A 1G0NA 2XPCA 3JD4A 3VZPA 4WUVA 2O4UX 2OL4A 2DUUA 4E12A 3GMSA 5JC1A 3E18A 4TSKA 5AXBA 5L7YA 4F46A 1H6BA 1SBYA 3I1JA 1LX6A 4NG5A 4IGFA 4BNNA 5I9NA 4Q3BA 4Z3KA 4NBRA 1KVTA 4XQEA 1M2WA 2OXIA 3A06A 3NDIA 3ZWAA 4PN3A 3ETEA 3IIEA 3FBTA 4MKZA 3H2ZA 2HRZA 4WCFB 1JVBA 1B8PA 1PGNA 3AM3A 4XGNA 2QQ5A 3JQGB 4YAEA 3C7DB 3GG9A 1I3NA 2GGSA 5JLAA 3L0DA 3EYWA 4BNTA 2DBQA 3K8ZA 3WDSA 4RVFA 2CF5A 4J43A 4M1QA 4E13A 3NT5A 1BMDA 4ZU3A 5A03A 3DHEA 1N2SA 1R6DA 2BFMA 1LRKA 5TT0A 2PH5A 3GDOA 1GDHA 3CUKA 2GERA 3F5QA 4BNZA 1KC3A 2GDZA 2GN4A 1ML3A 2NSDA 1YO6A 5G4KB 1C1XB 2O7QA 2Q1TA 4JCOA 4NFYA 4PRKA 3RC1A 3KUXA 4CM7A 4AJOA 5DBFA 4JNKA 2YY7A 1QP8A 3A4VA 2Y0DA 1ZJZA 4IIVA 5HWSA 2V6BA 1RPNA 1R15A 2JKVA 4YJGB 1A72A 5EPOA 2R2GA 3WJAA 3TRIA 4GGOA 4WJZA 2GSDA 2VRCA 5JYEA 4EBFA 1YH3A 4IGEA 3P2YA 3TZ6A 4E32A 4ESOA 1HKUA 4YJFB 1FMCA 5A9SB 4OO3A 3GFGA 1K3TA 2W2LD 1DDOA 2C20A 3K92A 2V6GA 4ILKA 2B5WA 1HSOA 4RPJA 5ER6A 1OFGA 2PZLA 3U4CA 4BIIA 5JFOA 3H5AA 1MXFA 5A9SA 3WLFA 1DC6A 1GYQA 9LDBA 1N7GA 2YV1A 3W8DA 1A9YA 3GRPA 1P1KA 4M8SA 4B4UA 3W6ZA 1YS4A 2GPTA 2I5PO 2AEFA 1HDGO 4R68A 4ALMA 3WB9A 2PGDA 3P19A 3M2PA 3ZWMA 3FHLA 5K9ZA 1PJCA 1QYCA 4B4WA 4BNWA 1GQYA 4EDFA 4U8GA 4YJHA 2IXAA 4AL4A 1H93A 4PG8A 1WPQA 1K5HA 1N5DA 1PU2A 1UDBA 2BI8A 2PD4A 1HDOA 4J1TA 4JQCA 2NACA 1E77A 1ZXLA 3I6QA 2VTEA 3V2HA 4D45A 4ZQGA 3ON5A 5FI5A 4CM6A 3HFSA 4TMFA 2PLAA 4XB1A 1ZFNA 4ZRNA 3VH2A 1U2DA 4P4GA 1D1SA 4AFNA 2G0TA 4LW8A 4CLDA 4OXNA 2FPGA 3K9QO 4R69A 4R9SA 5K6AA 5T8KA 4B3JA 3ZNQA 4B8WA 3ZV3A 2RHCA 3VOSA 4CLOB 4QXMA 3X2EA 3ZHYA 1T2CA 5HTOA 3QVXA 1FXSA 1R37A 1ZEMA 4IXWA 4RVSA 3QWHA 1PS9A 3DTTA 1F12A 2FR1A 4DREA 4BV8A 3Q0EA 3C85A 3JQAB 4WECA 4YWJA 3INTA 3QVOA 4GSLA 4QO8A 3K30A 4BMSA 5KJFA 5GZ3A 4R4JA 3PVZA 3PLRA 2DM6A 1BDMA 2CVQA 3SC6A 2W8ZA 1VL0A 3WTCA 4YRAA 4E5KA 2Y0EA 3RFTA 5IDXA 1Y9EA 2DPGA 2BH9A 4QQRA 4WASA 4EEZA 3MJTA 4MP3A 1LJ8A 3JD3A 3FNFA 4J0EA 1E92A 2GZ1A 4U6QA 4YAKA 2RAFA 2X9GA 1X7DA 4HADA 1O0SA 1CJCA 4BKRA 1SOWA 2C7VA 2EKQA 2P4HX 4OH1A 1V8BA 4L4XA 1XU9A 3TNLA 1IHXA 1H6AA 2G17A 3FNHA 1PJTA 4Q3AA 2AMFA 1DIBA 2HU2A 4BNJA 1P1IA 1WAMA 3C3XA 3ZV6A 3DBRB 3L9WA 1QSGA 2J3KA 3PHHA 1ZIDA 4K9DA 4YA6A 1ZO8A 3GVPA 4R9RA 3RJ9A 1C1DA 1MP0A 2OHXA 4FFNA 3MJCA 1TLTA 1PGOA 3F9IA 1C0PA 2ZKLA 4OOFA 3PEFA 3E6AA 4P4NA 1E1MA 3ONFA 4GVLA 4U7WA 3AOEA 2O3QA 5JSFA 4FS3A 4CMCA 3ETDA 4TRMA 3UKOA 4K6FA 2QYTA 3F47A 4EZBA 5ENVA 1YB1A 2HCTA 2UYYA 4CL8A 4MO2A 2WD7B 4KOAA 4FSHA 5KJCA 4GKBA 3JQ8B 3OQ6A 4L4SA 5HBRA 3IKVA 1EBFA 3GT0A 5L4SA 4MP8A 2VT2A 3A1NA 1ENYA 2V6MA 4RDHA 4XWYA 2IZZA 4DLAA 4N18A 3BAZA 4CV2A 1DRVA 3R3SA 1YJQA 4ND4A 1Y8RA 4DYVA 1CDOA 1XWFA 3H3FA 4RGBA 4IY1A 3FR8A 3UXYA 2IZ0A 2P5YA 2RHRA 1T2FA 5G0UA 2A35A 2X86A 4DPLA 1R4MB 3K31A 4XIJA 4NDNE 1I24A 4CM1A 4EUHA 5KJ1A 2ZTUA 3CH6A 1UXIA 3L4BC 4J9UE 4OSPA 1B14A 2NTJA 2R6JA 2BKAA 4CM4B 1GZ4A 2PA3A 4II2A 5F1OA 1PZFA 1Y7TA 5MGBA 2A9FA 3S2FA 1GYRA 2BFPA 2GLXA 3MJVA 1N92A 4JGBA 4LK3A 4CPDA 4BNVA 1OMOA 5B4VA 3JQFC 4OXKA 3JYOA 3RC9A 2WDZA 1J6UA 1H5QA 5U1PA 1SO8A 1U7TA 1IZ9A 3JQGA 4KQWA 1HLPA 1Y9AA 4G65A 3DOCA 4YDRA 2IYOA 3RUIA 1I10A 3GG2A 4WOKA 3RUHA 1EE2A 3CXRA 3AOEC 4L75A 2AQIA 2CMDA 4YVFA 2X5KO 3RCBA 1NFFA 3GVHA 2VYVA 2FPPA 3B1JA 1R66A 2CNBA 4ZD6A 3ST7A 3KSDO 1VE9A 2VWHA 2XXJA 1NASA 4KUEA 5IZ4A 5JNLA 5AOVA 1ENOA 5JY6A 1KYQA 1PJBA 1EK6A 2NU6A 1B3RA 2HMVA 5FF9A 4QSMA 3H5RA 5JCJA 1IZ0A 5TJHA 5IF3A 1R4NA 1P0FA 1T4BA 2X7HA 3PHLA 4RPKA 4YT2A 1HDXA 1KEPA 1PJ2A 3DZIA 4A2CA 2E82A 4XX0A 1QR6A 2Y1FA 4NU5A 2SCUA 3COSA 3NJ4A 3QW2A 1EDOA 1H6DA 3GNQA 1WMBA 3PHGA 1GUFA 4FFPA 4G81A 3QE3A 2Q1SA 1PWXA 1HETA 4YB8A 1NX6A 2ZB3A 1NYTA 1M66A 1BXGA 1QYVA 3ZV4A 3WJ7A 3OSUA 4HV4A 1SC6A 3I5MA 3I6IA 2WWRA 3ZU5A 4CLOA 1R12A 1T26A 1Z7EA 1YBMA 1FK8A 1N1EA 2R00A 2VHYA 2NVWA 2VNAA 1R4MA 1QXSA 4Z0HO 4QEDA 2WM3A 3ZWPA 3VTFA 3WX0A 2Q45A 4ZQBA 2PR2A 4RVDA 4MKXA 4R54A 4AJLA 4N7RA 5CDTA 2DLDA 5JAZA 5ILOA 1E1LA 1NP3A 3U62A 3WQQA 3VTZA 3WIEA 2FR0A 1K6JA 2Y05A 3ZU4A 1E5QA 1TI7A 1K2WA 1P9LA 1U5AA 3AFNA 3C1TA 3I4CA 3OETA 4I9HA 4WOJA 5TC4A 3ZZNA 1W4ZA 4UREA 4BHTA 3WBFA 4DQVA 3BIOA 3DFZA 3OQBA 3NTOA 4P38A 4W9NA 1DIAA 3LT2A 3PQFA 4YJHB 4DC1A 2WD8A 4ZA2A 1GV0A 2P9EA 1Y8QB 2FHSA 2VRCD 1YRLA 1HF3A 2X6TA 2BGLA 1WZIA 5ICMA 4GVXA 2EF1A 1LTHR 1ZUD1 2Q3EA 3CZMA 4PLPA 5ES3A 1F14A 4M49A 3TDKA 1DHTA 3DZGA 3U0BA 1U28A 2Z1NA 1C0IA 1EVJA 2A94A 2ZCUA 4XRRA 3KSZO 1GYPA 3SJ7A 1ENZA 2Z1MA 4PG6A 2Y1EA 4KDEA 1GU7A 3LC7O 4YJFA 3WTBA 3VPGA 3RQSA 4IS2A 3RAJA 3H9EO 3U3XA 1BSVA 3Q6IA 1PS0A 3BYZA 3ZGYA 3IP1A 3MJSA 3BTOA 3LF1A 3NYWA 3VKVA 5JDIC 1Z7BA 2CVOA 1XR3A 3H2SA 4IPTA 4UUNA 4UVIA 3TZKA 4D3SA 5A5EA 2NVUA 2Q1UA 4D3FA 4KDFA 3PQEA 4AJ4A 1X15A 1Y1PA 2ZJ1A 3RU7A 3VVBA 2FPIA 1ONOA 2D5CA 3ENNA 4ITUA 3M1LA 4K26A 4MIYA 4Q9NA 4BL5A 2CDAA 3LF2A 2FRDA 2DQ4A 3SLGA 4YT5A 4CLEA 1X0XA 3WMXA 5F5LA 1Y81A 1ZCJA 2NTVA 3VPXA 1NBOA 3C1AA 4D0SA 4FR5A 1IL0A 4E2XA 4XB2A 5JY1A 3OH8A 3FTNA 3TL3A 1T25A 1GUZA 3CMCO 2VUTA 1HE3A 1V3VA 2C2XA 2J5KA 3QP9A 3GNTA 3ANNA 4G5HA 4TQGA 2Z95A 4E5MA 2NADA 1F17A 4TZKA 1LRLA 4MVJF 3V1YA 4DMMA 5JDCA 1LSJA 4NFHA 1ADBA 4NIMA 4TVOA 2QG4A 4II3A 2VRBA 2Q99A 1EBUA 2YJZA 4R1SA 2Q2WA 4H15A 5L4LA 5I9LA 1ULUA 3GVCA 3H9JA 4IXTA 2AG8A 4D7AA 4XJTA 3BMQA 4YR9A 3S1LA 5FYDA 2WE8A 2JD2A 1MV8A 3KEQA 1UP4A 2PKRA 5LDGA 3PFWO 2WE7A 2C07A 4FGWA 2CF6A 3QLJA 3PFFA 2ET6A 1LLDA 2EWMA 1R0KA 3F4LA 3T4XA 4AJPA 3PI7A 1LC3A 1JA9A 4M86A 4OQYA 4RZHA 3LSYA 3OEWA 3IJRA 3U4HA 2LDBA 1T2DA 1VJTA 4J4BA 2DBRA 4UVEA 5LCXA 2Y1CA 1NVTA 2HMUA 3JYLA 4K28A 4Z0PA 2DT5A 3NV9A 1N9GB 4FGSA 1LLQA 1CIVA 3HQ4O 4DXHA 3DBHA 4XDYA 2GN8A 3KYDB 3PJDA 3RWBA 1T1SA 4PLGA 1AN9A 4CR7A 4TZTA 1NAIA 1YB5A 3JQBA 3NT2A 5CG1A 3D0OA 3W1VA 3B70A 1IB6A 5H82A 3JV7A 4B4OA 1YBVA 5C7OO 2ZYGA 3E03A 4ND2A 2O3RA 5BR7A 1KC1A 1NPYA 4IMRA 4FB5A 4HNGA 4RVUA 3PDUA 1NVMB 4FFLA 1BVUA 3W6UA 1TT5B 3PIIA 3GEDA 4XGKA 3INRA 1TEHA 2BLLA 4CV3A 3QVSA 4NR0A 3ADOA 5TS3A 5AXDA 3IQDB 1B0AA 2E37A 1YL5A 2I76A 5A1TA 1SMKA 2B0JA 4JP2A 5JCXA 4JBGA 3WSWA 4J91A 3U4IA 4JBHA 2QZ9A 4KZPA 2E49A 3G79A 3H4VA 3HDQA 4ONEA 1DJNA 2H5LA 2PFGA 2O2YA 2A92A 3FN4A 1LSUA 5DNAA 3WOHA 1ADGA 1U4SA 4YCAA 3GMDA 2I3GA 4AJKA 3L4SO 3BTVA 2GNAA 5DDIP 1GEEA 4Q3DA 3SBOA 4GWKA 2YZ7A 2C54A 3Q2KA 3UH1A 3RUAA 2OBYA 1JVSA 3U09A 2P9GA 1GFSA 4ID9A 4I9UA 2B83A 3GQVA 4YJDA 1QYWA 4J3FA 3B20A 5HRUA 2BGKA 5GMOA 1GY8A 1RM3A 3N74A 5I7FA 3ETGA 3O8QA 5U9CA 4ALLA 4UVHA 1B2LA 1WP4A 4PG4A 3GF4A 3LC1O 1A4UA 5TQVA 3U4DA 3PYXA 1T4DA 1ISMA 2NUAA 4XYEA 4ZICA 1N7HA 4J16A 3V2GA 2JJYA 4K1LA 3B6ZA 3GC6A 3JQ9C 5KVSA 4MVJG 4GL4A 4EW6A 1G0OA 3K6JA 4P8RA 4R5MA 3GHHA 2RH4A 4D44A 4BO0A 2G5CA 3KTDA 2ZQZA 2V6FA 4PLFA 1HT0A 1RJWA 5K0ZA 2PD3A 5JMWA 5L53A 3VZSA 1ZSYA 5BNIA 1Q7GA 1NWHA 3UW3A 5JYDA 3LQFA 2O2SA 4CM5A 3F3SA 1EFKA 4RO0A 2J5QA 4O59O 4J90A 3CMMA 2FSSA 2HRBA 3SJUA 4BO6A 2EGGA 1ISJA 1XYGA 4WK6A 2HJSA 1JAXA 2W2LA 4GLOA 1JU9A 1A9ZA 3D3EA 3I83A 1LC0A 5EERA 3ZWOA 4EJMA 1SZJG 1SEPA 5H83A 1NQTA 1BG6A 4MVJP 2XOXA 2A4KA 4CMIA 3UOGA 1UXGA 4BNHA 2BRUA 4EEXA 4FW8A 1PJQA 5FEUA 3AFMA 1O94A 3QWFA 3GDFA 1L7EA 4BS9A 1NPDA 1R16A 3AI2A 3LVFO 1Y5MA 4FJ1A 4LRTB 2EXXA 1LBEA 2VWGA 4N54A 4A5OA 1RM5A 4GSKA 3ICCA 4IJWA 2ZK7A 2YQ5A 4TROA 4MKRA 2UV8A 2D4AA 4PG7A 3FSRA 1BVRA 1ADCA 1F8GA 4OYRA 2GRAA 2B37A 5T67A 3ADPA 1I3LA 1Q1NA 3H9GA 4LCEA 2PKQO 1UDAA 4CUZA 1SPXA 3GFBA 3H8VA 3HG7A 4DLLA 1ARZA 2X0RA 1ONPA 3NTRA 4J4HA 4R51A 4RCVA 4BUCA 4IDCA 4J49A 2JCYA 4D0RA 5JXWA 1YWGO 5L4NA 1XA0A 5BT9A 1X1EA 1X14A 2RIRA 5JMPA 5DOVA 3UF0A 2BELA 4MJLA 4BMNA 4KWHA 4IMPA 3TN7A 3JQDA 3DC2A 2P5UA 5DBGA 1F8FA 3B1KA 4CUJA 2IODA 2OORA 1AXGA 3D4PA 4FQ8A 1TB4A 2VWPA 4YACA 3Q9UA 4BQRA 2TMDA 3NEPX 4BNFA 4DA9A 2ZTVA 2WD7A 1LQUA 1ZJYA 2B5VA 1E1NA 3SEFA 4FPXA 3X2FA 1D1TA 3BA1A 2AE2A 4BNGA 3OEYA 3GR6A 2VTDA 2NU8A 5T64A 5TSDA 1FDVA 1I8TA 3BMCB 2POQX 4DVJA 1FDSA 2P9CA 4UEOA 3KYDA 2J5RA 4NBUA 4OQZA 3I9MA 1V6AA 3WGIA 3OF2A 3PK0A 1EVZA 1LDGA 1I32A 1L7DA 1N9GA 1EUCA 5TJ9A 4BO2A 3FWNA 4R5HA 5F3RA 4FOSA 2W2KB 3PJEA 1H0KA 1Q0QA 1QG6A 3GA0A 3NX4A 5T6BA 3RKUA 3ZWXA 5JS6A 3GGOA 1GZ3A 3GZNA 3ZNNA 2ZJ0A 3ZWNA 3GEMA 4KTVE 2EW8A 3G1TA 1OC2A 5CPFA 3EDMA 1OC4A 3DHNA 1KVUA 1X1TA 2YDXA 4QFDA 1DB3A 5IN5A 3ZWYA 4DPMA 2VZ9A 2VYNA 3S55A 5IXYA 3I9NA 2PD6A 4EI2A 4NBWA 4CJXA 4LN1A 1YL7A 4I5FA 3CINA 3ANLA 5F5NA 3E9QA 1SNYA 5JO0A 2B4TO 4FOOA 2E4AA 2CVZA 4F6CA 2H9IA 2YFQA 1K0UA 1IYZA 2HQ1A 4HY3A 4CM4A 3RROA 1SAYA 1CWUA 4BNKA 5G0WA 3L4BA 1DRUA 1B8UA 1GTMA 3AUSA 3HHPA 4DTIA 4P22A 1CQIA 3IS3A 1XU7A 4XKJA 3KOUA 4PVDA 3ZV5A 4E3ZA 4I8XA 1Z74A 5L3ZA 4GX1A 5CDUA 2Y1OA 1Z45A 2NTNA 3SXPA 2DPHA 4RDIA 2VNSA 2W90A 3KYBA 1HL3A 2HJRA 2Q4EA 1EQUA 3JQ7B 5A3VA 3RUFA 5I7VA 3JTMA 5BNFA 3HN2A 3MCVA 4JJIA 3RKRA 4BB5A 2ZB4A 4RF2A 2HK8A 4NU6A 1ZNQO 1ZZEA 4YEDA 4E31A 3HN7A 1JN0A 2FZWA 5C3MA 1HLDA 1YDWA 5DZSA 2EGHA 4PIVA 5DN9A 2DU8A 4XJSA 2J3IA 4EYEA 1I36A 5CPBA 1ZSVA 4AJ2A 3DZHA 2O3JA 1W8DA 3F4BA 3ITKA 5AXAA 1KY4A 2D3TA 4PGFA 3VDRA 1AXEA 4XYBA 2AXQA 3L07A 1ZEJA 1I2BA 4RQUA 1OBFO 4I1IA 2PH3A 5KKAA 4Y8VA 2I9PA 1PL6A 3LYLA 2WSBA 5CEFA 1WZEA 1QKIA 1GL3A 3O9ZA 3BTSA 1YBAA 2JD0A 3LDHA 3BXXA 4UULA 4DGSA 5CAEA 2DTXA 2TMGA 1XKQA 2VWQA 3TZQA 4CL3A 2IEDA 3VHRA 2ILTA 2HDHA 2X0IA 2G1UA 4MINA 3R1IA 2UUPA 3OP4A 3WGYA 3ZDFA 1JTVA 5CDSA 1IULA 3ZU2A 3VPHA 1A5ZA 5I8WA 1ZH8A 3CTMA 3RIHA 3WGGA 4E5NA 1LU9A 5CG2A 5JDCC 3OBBA 1D7OA 1U4OA 5I7EA 4OAQA 3JQAD 1HDYA 1PL7A 3SVTA 5KOIA 1I01A 3AY3A 4QX6A 1HZZA 2PV7A 3RFVA 3GOHA 3V1TC 2YDYA 5I7SA 4ALJA 4J2OA 4AG3A 3PGJA 3RVDA 1EDZA 1PQPA 4IDDA 3MZ0A 1YONA 1L1FA 1DO8A 4BNUA 4RL6A 1BGVA 4W7HA 1NQOA 1C1DB 1DBVO 3DOJA 5AXCA 2E48A 3UN1A 1I2ZA 3AM4A 1MA0A 2DFVA 3AOGA 5JAMA 1KVSA 3D1LA 4Z9YA 4CQMD 2ZB7A 1OAAA 1X7GA 1A27A 1VLLA 3GNSA 2WMDA 5B1YA 4OM8A 5B4TA 1RM4A 3HADA 1GD1O 3HE3A 4W6ZA 2OFPA 3RBXA 3VDQA 2CZCA 5L40A 3OJOA 4E5PA 3TWOA 4CLRB 4LVUA 1BXGB 4ALIA 4IDEA 3H9UA 2NQTA 1I3KA 3I9JA 3DAFA 2Y99A 3W4JA 4B79A 1Z82A 3WLEA 3TFOA 1O8CA 4O0LA 1YGYA 2CFCA 1P1HA 5CEJA 3VZRA 2Y0CA 3IOYA 4UAGA 1Y6JA 5TLSA 3AU9A 3ZWVA 4TRRA 2DBZA 5COBA 1LLUA 3IAHA 3SLKA 2B36A 3JQFA 1XQ6A 1EMDA 4ZVVA 3HDHA 4FC6A 1MC4A 4CV0A 1MB4A 2ZB8A 2X23A 1XELA 3PHJA 3I3OA 2XAAA 1VJ1A 2VHXA 3PZRA 5DP1A 1ISHA 4E21A 4HFJA 4J1NA 2X58A 1PJ4A 3ROQA 5KCZA 4YTEA 3PJGA 3ITDA 3DQPA 4PRLA 5KNLA 2ZCVA 1LNQA 1C0LA 4IQGA 4EITA 1IHYA 3EY4A 2X5OA 1ZK0A 1X13A 4ALKA 1WLYA 1B16A 5JC8A 1WVGA 5KVQA 2HMTA
chains in the Genus database with same CATH superfamily
2Y67A 4LJRA 4MV7A 2IU6A 2E3JA 1QV9A 4BGVA 4GR5A 1Q91A 1CF9A 1EJ2A 3NJRA 4G5FA 2G06A 3DMNA 3R41A 1RS0A 1OWMA 2O6LA 4PX5A 1JAYA 4ZCSA 1SQ0A 4F4DA 5DO9A 2DEUA 3ZX4A 1NUUA 2FG7C 4FFMA 3UJPA 3R6GA 4ZOLF 4WMLA 3I0ZA 3SY8A 7YASA 4V03A 4DZZA 1AHPA 1DWOA 3G8YA 2GA9A 4CG1A 2YZKA 4HWGA 3UZUA 3MINB 1X7HA 4KXUA 4LTNA 3RANA 1H4QA 4BZWA 4E5VA 2OP0A 1KBZA 2O2JA 2FLWA 3T3EA 3R76A 1UJCA 1PQ4A 3TSZA 2XBLA 4NV3A 1NF3A 1L6IA 4Q48A 4JLOA 2JW5A 3DOFA 1APBA 1DRWA 3HCNA 1IAVA 4R01A 1Y48E 3TSWA 2PQMA 4MVWA 3JSXA 1GZVA 3VSCA 1IN6A 2F43A 1XEXA 4Q9IA 3VISA 1RXIA 3G2LA 5D2CA 1P5ZB 1H2ZA 1DP4A 4D81A 2OXFA 4WT7A 1Q2XA 4CL0A 1NDQA 1BA2A 1WKBA 1ZVMA 2CD9A 1P39A 3LK7A 3ZR4B 4J4TA 4WD3A 3UKDA 2QT9A 1BS9A 1B8VA 1RQLA 1Z0ZA 4Z5XA 3NHBA 5D6NA 1E8NA 4GPZA 5FP0A 1B73A 3VR6H 4IRUB 2D54A 1FRVA 2HV9A 3IXMA 2O1EA 2BHRA 2XF8A 3AUYA 3OZDA 4LSMA 4RVHA 4WFJA 5EKXA 5GVRA 1FVOA 4ZI3A 1AJEA 5KQGA 3X3HA 1SBHA 3RNOA 2FQYA 3KFLA 5FOQA 3UMFA 4M1OA 4WCFA 1PR0A 5HBGA 4DDWA 3GARA 4K8OA 2IHUA 3DB2A 1MG0A 4X00A 3UT5B 4PIMA 1GZUA 4DL9A 3THXB 3UO8B 4FFBA 4PAMA 3FI0A 1Z34A 2AS0A 2JK0A 3DZKA 4L5YA 3C3CA 1N7JA 1U3GA 1JB9A 3X1WA 3KPWA 3WMWA 1NFQA 3I01M 3VKUA 1G7SA 5B4UA 4N82A 2FP4A 4EG4A 4KXLA 1A8IA 4BFYA 3VR4A 4O4HF 1YE5A 1C3EA 2W6CX 2R00C 3GAFA 1G8GA 1W0JA 4J0JA 1Z0DA 2GM4A 2QTWB 3PEVA 4R2WA 2IZ1A 3RREA 2I6XA 3LYHA 3OD1A 3Q1LA 5H4GA 3P0HA 2XCTB 1DBSA 3DBLB 4KV9A 1V45E 1ZWLA 3SVZA 1FDWA 1LPMA 3FJYA 3LBAA 3UFXB 5L8VA 2IYWA 2P6PA 5AM3A 1M5UA 2C4WA 2HZBA 3BJIC 3AYXB 4GGMX 1BMFA 3V4ZA 3IQEA 5EMNA 3O7WA 2V98A 2WZBA 1XRSB 2YN0A 3EH2A 4Z9AA 1KI2A 1V1JA 4RTMA 1O9BA 4D3DA 1R3DA 1Z29A 2ECOA 2J6IA 4GMHA 5BWOA 1SUBA 4ESVA 1KDTA 2EFJA 3B8HA 3M0EA 4KQFA 1YB4A 2TECE 2ZFUA 4OL9A 4DY4A 4EB3A 1WCIA 4J0FA 3WMGA 4WBNF 6CHYA 5KTYA 1E60A 3ENZA 1KR2A 3HY6A 1DOHA 1YQQA 2OAQ1 3IUBA 5GV8A 4GKJB 1QZTA 1GSIA 1XEWY 3C7CB 3ICVA 2C8LA 4JBYA 4ZT4A 4MAAA 1YGPA 2IUUA 3JAKA 2Q1WA 1YF3A 3F6PA 1L5ZA 3CNNA 1UJ2A 4K0KB 1KA9H 3VXKA 2VP3A 3EW7A 4QUGA 2C2HA 4Z2YA 4MQEA 5M5BA 1T3HA 3W5DA 2QN3A 2OLJA 1AQLA 1BH6A 3OOYA 3L0YA 1C1YA 2QTLA 1MT3A 4JIGA 3O47A 4NOLA 3ORFA 3HFJA 4EYQA 1TTTA 2CVFA 1YVPA 5AJUA 3HRHA 2P3LA 3O9VA 2HI0A 1NW6A 1R64A 4UZEA 3VZQA 2WQ6A 4DSZA 5AIBA 4CMEA 1RXEA 1L4FA 2Q3CA 1EDEA 3OMLA 1DXQA 3EZNA 4LTMA 5E2BA 4DOMA 4CKCA 2JZNA 3AEXA 1B6TA 3I23A 2YVUA 2QUZA 3JQ8A 3P9SA 4Q93A 3T9BA 2JEYA 4DUGD 1FP6A 3EIFA 1JLRA 2O50A 1V7ZA 2DSTA 3G02A 4JYPA 3IERA 3CR7A 1GCAA 4L15A 4A2WA 1A4IA 1KVRA 2VQFB 3CEAA 3OKAA 5LIRA 2OHHA 4X85A 4D9FA 1KOJA 3VYSB 4CM9D 1K4KA 1QX3A 1E18A 2H18A 2FW6A 1SUCA 3D3JA 4GE0A 3VR5D 5LQMA 2C78A 3GLQA 4F3TA 2OO5C 1QCDA 3A11A 1K5DA 1VHLA 3NVDA 4YMSA 2NO1A 3VC3A 2JBWA 2XBMA 4Z99A 2PUWA 3BGWA 4Z4CA 4WH0A 1UJ5A 2DFKB 2ZJ2A 3FUVA 4PGGA 2C7RA 2VQDA 3BFXA 1XP5A 1E63A 1U0JA 3FTCA 2QTRA 1TADA 2IX3A 1EHYA 1PR3A 2AVNA 3I0MA 3PEWA 3PRHA 2Z0MA 1V11A 3D4NA 4KV7A 2EOAA 1ZESA 2A5YB 2RAPA 4G1UC 4HF7A 3WP1B 4KXFB 2I8AA 1LCIA 1UODA 1E99A 4L4UA 1NOIA 2NUBA 1YZYA 1D4AA 1R0LA 1GP2A 2YHIA 1UDCA 2QHXA 3Q2IA 4KQMA 2X9NA 3VU0A 3WNDA 4B2IA 3LY8A 3HJHA 1E2EA 3BCSA 1TK2A 3DE5X 1F0KA 3F5SA 2BCJQ 1U7XA 4RK5A 1AS2A 1AUVA 2H85A 4MGEA 1EUQA 2X13A 1MT0A 3UTDA 2KM1A 1E6UA 1MORA 1XZBA 5LA6A 4D4GA 3HY4A 3HA2A 4WE3A 3VH3A 5CM8B 4ALNA 4CFSA 1FL9A 1Q0UA 2DPXA 5HRCA 3JD1A 5I4BA 2CYCA 3GGGA 3OJFA 3PICA 4XCVA 5J58A 5LNK1 2X9QA 3N5CA 3PDWA 3BKWA 3WYFA 2FW1A 2IXEA 4B6FA 3HUUA 4LZLA 1QE0A 4GI5A 2W83A 3K5PA 2NW6A 4IJ5A 1IHUA 2C3PA 1KEWA 1VLZA 1WQ1R 4FD2A 4ILEA 4NAVA 5AKKA 3UUEA 1ORWA 2AGVA 1XV5A 1NJ6A 4TMWA 5CUQA 3FSGD 5AM2A 4X1IA 1M0WA 2BUBA 1W6RA 3WBJA 3T3IA 3KQLA 4BEBA 4KYUA 1BW9B 1EDDA 1H8HD 1B23P 2JA2A 1E0DA 1K0FA 3HO6A 4KLNA 4EK9A 3EPKA 3K0FB 4U7HA 1YQXA 3U39A 3CNBA 2XCOA 1JDSA 2ILVA 2LUOA 3RVPA 2M98A 4KG7A 1EM8A 2YHBA 4J07A 4Z9XA 1TCAA 3AUTA 4OI4A 4ZQCB 2PU7A 3UOWA 5BSGA 2NYRA 2X9VA 3EGCA 4HDCA 2EVWX 1V1RA 2Q4OA 3IEKA 2YNMD 3JALA 2F8MA 4NZOA 4D0NA 2EFDB 4JOBA 1PN3A 1UH5A 1DC4A 5E95A 5ERXA 1Z4QA 3CIFA 3OPYA 7AT1A 2Z2XA 1EX6A 2C9YA 4N39A 3EVAA 1R9NA 3BM5A 4J1QA 1T9GR 2PX8A 4Y98A 3UAZA 1M5TA 3SC3A 4ZJUA 5ICEA 4MICA 3V48A 4KGVA 4EO9A 5A06A 1OOEA 2ECKA 2WJGA 3HXMA 1VM6A 1I1OA 1A77A 4V3CA 3K8OE 2EL7A 3Q12A 3T3OA 2DJ5A 4H16A 4L9RA 4CMEC 4ZXFA 5J4HA 4XX0B 2JPDA 2CDCA 2JF0A 3EVBA 4UTRA 3H7IA 3F7NA 3EIHA 3HY3A 1M6WA 4B4VA 3DLCA 4G5OA 2FE1A 3AV0B 5FBWB 4LC1A 3KLNA 2VQ6A 3TECE 4WLEA 2X2EA 3EH1A 5FKJA 3OM1A 5KUTA 3PEUA 1QHNA 2FN3A 2WMOB 3EBPA 3FYCA 4F7DA 3H2KA 1SFRA 3I39X 1E7MA 2FW7A 3NONA 4J7XA 1E7RA 2PUHA 3ZWBA 1UKZA 2XRFA 1YRYE 3ANSA 4FR0A 1FU4A 2DKNA 1N1GA 2AJLI 2BR3A 2PY6A 1J06A 5DT2A 3ZYZA 4ZHQF 2I03A 4LZNA 1QGZA 5KQPA 4CMGA 1DLJA 3V8BA 4HX5A 4IQ0A 4FIZA 1CIPA 3JVUA 4LY0A 4PCVA 5AWFC 2BGNA 4YGXB 1B0ZA 5IFLA 3E1GA 4PGMA 1VG8A 3BCHA 3P9ZA 5K6AC 5C37A 1MU0A 1TNDA 3U48A 3QPVA 4HSGA 1RJDA 1MF7A 4YQZA 3U7HB 1UZMA 1G5IA 4RSGA 2XB2A 3BJEA 4WNAB 5E3IA 1ULAA 1KPHA 4GMGA 2O54A 4LZOA 4G1FA 3DT6A 1B8OA 1E0JA 4GAEA 4ZU1X 1SZPA 3ZHTA 2C2MA 4QFCA 3GZ4A 5ALHA 5ABPA 5BQFA 5LJIA 3SHQA 1X9GA 4UZFA 4F4IA 3EX7C 3ASYA 5T57A 4XYLA 2O7VA 1RCFA 3GIDA 1ZVQA 2HGZA 1AVTA 4IIDA 4TS9A 4UARA 4UXIA 1KL7A 3ND9A 4IDOA 4DRXB 1P8AA 1HTBA 1Z83A 4RHFA 4DCPA 4BGDA 1OHHA 4YCDA 4Z4FA 4KWEA 1YZLA 4W5HA 2GCOB 3E15A 2XE6A 1GAEO 4E3WA 3DH0A 4QUDA 3BWYA 3UAOA 4OKNA 4JJKA 4LZPA 5DMXA 3O26A 4A6PA 5EFZA 4BAUA 1T3TA 4K9RA 4MYRA 5IYZF 2I1LA 4A0RA 2HQBA 3FYDA 3HEAA 4V24A 4KB5A 1V3TA 5H02A 3JAKB 4OF4A 1DIOB 5GZ1A 1Z88A 4CDGA 1JHXA 1JDBC 2VT7A 4NU8X 5J43A 3IL2A 2O8EB 1QMPA 3WICA 1FNDA 4KITB 4DLBA 1PUIA 2FE4A 3N8GA 1GR1A 1QFJA 1QWSA 2J0UA 3AM5A 4CF4A 5AHWA 2VG8A 5K3OA 1JHAA 3GH1A 1NLUA 5LR6A 2P2CA 4QD3A 4M9ZA 2BFFB 3DZJA 4B3DA 2ZRQA 3HSSA 2FYTA 3NWEA 3Q40A 3U19A 3LD9A 2DAPA 1NR7A 2C5AA 2LIPA 1EEXB 2V74B 3U17A 2QB5A 5I9MA 3MG9A 3ZWPA 3HR8A 1XGKA 2YHUA 4L6CA 4N6NA 5JW6A 1XC7A 1CRWG 4N65A 2EFYA 3CZ5A 5DBIA 1UBFA 4S05A 2WJWA 3GN1A 4FFOA 2FQ1A 2WSSD 3SX4A 3SZRA 4DSUA 1K5PA 4EJSB 4RZIA 1DNPA 2PJUA 4FKZA 4NV1A 3IAAA 4WEOA 1C7IA 2AHRA 4J03A 4CCAA 5L3QA 3W2FA 5EEGA 1RADA 2H1SA 3UFXA 2F6RA 5C31A 2RKOA 4I4TF 1XCLA 3JVVA 1XQVA 4AJJA 2H07A 1QK4A 5CVDA 4BWVA 5D3QA 3NWOA 3UHOA 3X1MA 3A37A 3L7BA 1ODCA 4ND1A 1U1EA 4FFWA 5DISB 1W36C 5ALMA 3HZZA 4BMPB 1JHZA 1XRJA 4N3NA 4P08A 2ZS7A 1ZAKA 1CQXA 5T4FA 3O93A 4CMIB 3WKDA 1JIXA 4PQGA 2OBMA 5LBUA 4BFVA 3DDHA 4I50F 1OWLA 1ZU5A 1PS8A 3HA5A 4MWZA 1MUUA 4XSGA 4RHTA 4PYQA 2TS1A 4AZSA 5DHUA 3LA8A 3S1AB 2OOSA 4K3UA 3VQTA 2B8JA 4O29A 4EB0A 2WAAA 4KE9A 2OQRA 3OJEA 4RZQA 3RTAA 1TYDE 4TTRA 4Z54A 5CVUA 5BSUA 3UJ9A 2JHFA 3IR7A 2V4UA 4ZVUA 2R8OA 3MELA 2BDEA 1MR3F 3QHAA 2PN1A 5AW1A 4Q03A 1IJEA 1Z3IX 3LLUA 4F3NA 3BA6A 1OYOA 5DHRA 1SCDA 4QYMA 2MHCA 1FJXA 2ZI5A 4M1SA 3N6XA 4MPRA 1RQRA 4OREX 3M4XA 1F4PA 3ZH9B 3RH0A 1Y63A 3VJKA 3ZKWA 1F38A 1XZGA 1H2FA 2AXEA 5FA6A 1S7CA 1I2MA 3KUKA 4IWXA 3QELB 4GS5A 1W8IA 1KMQA 2OV1A 4QJ5A 1RAHA 2Q27A 1GLNA 3QVGB 1LB1B 2J3QA 3U31A 1RZRA 4BQOA 2GLUA 2V7VA 4H08A 4TLDA 5GJCA 5EXSA 1TZCA 2FLKA 3U7RA 2X40A 2RC5A 2AOWA 1UOQA 2B9EA 4Z86A 3TXAA 4U39A 2BJHA 3MK31 3GQBB 1IM5A 2X3FA 4MR7A 3WLLA 4A26A 1DAPA 4ERXA 1JFTA 1NJ1A 2ZAMA 5CFPA 1BDHA 4UNRA 4QSHA 4XWKA 3WHKA 2LDXA 3QQ5A 3R3JA 5F2EA 1ZW1A 3U0VA 1OROA 4Y7CA 3ULKA 4R2JA 4NMMA 3EMBA 1TUGA 1ODLA 1Z28A 4MV8A 2Z58A 4C4PA 1RIFA 1VLVA 2EG9A 2CLFB 2IIQA 5JR3A 5L95A 5IDWA 2AC2A 4ZANA 1W4BA 5SZKB 3S7ZA 2V6IA 3KQSA 1IPHA 1KK1A 1GQSA 3B2QA 3H11B 4NQRA 5IDYA 3NVAA 3VU9A 3O9MA 2UXCB 3AEKB 1FDRA 2WJHA 3QXCA 3NG1A 3NGXA 3MWEA 1XLUA 2W2VA 1IQPA 3BJZA 2PAFA 5T5QA 3L4JA 2R3SA 4QDOA 2ZSFA 4FYMA 1U2SA 5K3SA 1PR5A 2NYAA 4G4GA 4DQUA 5DHSA 1UOOA 1I1QB 2DWCA 4N5HX 3I9FA 2BHLA 3FYUB 2O7SA 2PBZA 5IVIA 4AYTA 1HGXA 1U5CA 4MW4A 1U7OA 4MK4A 2YZ2A 4EO7A 1KQOA 1P77A 2WQZA 4Y1FA 1V4BA 4BWGA 1P0PA 2I99A 1EM6A 2X1LA 3OA2A 3EGVA 2F62A 2MIIA 3T7KA 3V7FA 3NDBB 4TWRA 3GNLA 1I3MA 4IILA 3K0CA 3SLRA 1NHWA 1L8AA 1UBSB 1XA4A 2H63A 5FFFA 4CF6A 3Q72A 3TE6A 2CFSA 2L2QA 2WZDA 3R24A 5EA2A 3NT4A 4BFXA 4CT4B 3HSYA 1MEEA 3VKHA 4HEHA 2WM2A 1WQ3A 3RAGA 2EJBA 5ALVA 1TDJA 2QENA 2DUWA 1G9XA 5JNSA 1VCOA 4YJGA 1VMDA 1XHFA 3I8XA 2WSSA 3DVSX 4HBGA 4ITRC 1TZ2A 4DC0A 1DKPA 1Z25A 3DEYX 3QY9A 4HI0E 4B17A 5HP4A 2NO0A 1R5NA 5SYNA 4XCQA 2FMKA 5TMPA 3DFIA 4RY0A 2BW0A 4HS4A 3UCEA 1GAXA 1DAKA 2YC4C 2ZSHA 1SBIA 4IFIA 1YHZA 2JLCA 1S2MA 3WSTA 4DIMA 1CS0B 1E3QA 2B4RO 4JT8A 4Z4IA 4KFCA 3CCCA 4RETA 1Y5IA 4XEUA 2P91A 4HZUA 2GPAA 2Z2ZA 4R2XA 3SJBA 2PSHA 4CRWB 1N2HA 1Z75A 3KTOA 4HN4B 1ZK3A 1U9IA 1T8TA 1L1EA 2EX0A 1FBTA 2WFLA 3H3JA 3OG9A 5EHNA 4CMKA 4Z4EA 1GQRA 5D85A 3MGKA 4ZXPA 3FCXA 3TUZC 2AMYA 1XVUA 1H3NA 2BLNA 2H0QA 4K6HA 3QGMA 4HWSA 1DWUA 1T5LA 3P7MA 1PK7A 1NF2A 3G68A 4PSCA 4F9FA 3WGMA 1EG2A 1IBCA 2QSJA 4LHYA 2JGEA 4R6XA 4QJBA 1WUTA 1NTOA 1P80A 1ECCA 4ARVA 3OY2A 1UFKA 2BGRA 1T8SA 5B58T 4WNCA 3WMFA 1GITA 3I1FA 2ZR8A 3DNPA 5FI3A 1PGJA 3N05A 2HJVA 3NHJA 4OUDB 4RGYA 4IS3A 4E1BA 2X4LA 3LE8A 2XTZA 1TYZA 3ZXIA 2NZUG 5KNCD 3ZNOA 2AWNA 1QG4A 2Z1DA 5CLFA 2ZAOA 2ZZNA 1AY0A 1E7YA 4GI2A 5BMVA 5JEDA 1QFYA 1SKQA 3MTJA 4TMVA 5LQAA 1IM2A 3RFXA 1N2CE 2PBLA 2C82A 4C4TA 4DUPA 5JZBA 3AKEA 5J4LA 5AVWA 4JBLA 1Z2NX 2DWUA 1IJFA 4PYIA 3PIRA 2OFFA 2BZ0A 4IDGA 1XRMA 3RK0A 3MIIA 2XKAA 4HBZA 3BMOA 4IOKA 3WB2A 4D9JA 2HMSA 1JFFB 2X5JO 5BQOA 3UMJA 4Q02A 4YK7A 4EG8A 2XIJA 4DMRA 3TOXA 3AESA 4A4DA 2ZYHA 3HMQA 3VVLA 1ODJA 4AY6A 4Y1GA 2WHPA 4DJJA 1W6UA 2VDQB 4AJEA 3AL3A 4Q4AB 4AJHA 3P2KA 4Y2UA 1H69A 3CLSD 2J1LA 4BNYA 4G0ZA 2UUBB 1XDWA 3UCFA 3GRUA 3BORA 4TOIA 1XZJA 1OZHA 3IMEA 3TK1A 1GPDG 4JJZA 3KQNA 4ER0A 4OI2A 2BFEA 3I8OA 2YMQA 4U5QA 5C3UA 4XIIA 5LQSA 4CKBB 4KIUA 3NGLA 2COEA 4JHLA 1T24A 2O2XA 1U99A 3MOGA 1P1JA 1SK9A 2IY9A 4R7ZA 4GBED 1V9LA 1DQRA 1SIUA 2MYNA 1OW3B 4UFOA 2XEDA 3IDZA 1P2VA 3WQSB 3DCNA 1BWSA 2C8VA 4I7EA 1JLLA 1P74A 5L7TA 4NNOA 3MFQA 2P3SA 2JFQA 1HE4A 2X0JA 1K7EB 1DIRA 4KSYA 1R5BA 2DHDA 2QU8A 1ISGA 1BS2A 3AEYA 1KYWA 4WESB 4ZVTA 3ZE7A 5I8PA 2J0SA 1PT5A 4HXGA 3S1AA 2EV9A 3GD5A 4BQPA 2F1KA 1CQPA 4I5GA 4LXUA 1K2VN 1QG0A 2XMPA 3AHIA 1YR9A 2V45A 2XUOA 4TMXA 2PJZA 3EEIA 2X7XA 4WVLA 3WL4A 4YRIA 1SELA 1V71A 4JOQA 1PG0A 4WOPA 5C51B 2Y1GA 1QTIA 3O83A 3BPSA 4K8RB 1WXQA 1ZIXA 1U3VA 2VPPA 4MEAA 4KO4S 3F6EX 3GVIA 4GWGA 2XYHA 1JFLA 2Z3VA 5DWDA 5GJVC 5JZSA 3VTKA 3G5LA 4K6KA 1Z4MA 2JGMA 1F6WA 2G9ZA 3NALA 2LCIA 2P3QA 3JYQA 1OAKA 3RU2A 3UMYA 3SQXA 5EL0A 3LXRA 3IMKA 5E7JA 3RIGA 1XQ9A 2J3HA 2PX6A 3B7WA 1FRZA 3K1TA 2WKSA 2J8ZA 2A0FA 3JQ7A 2EIHA 3ICWA 2ZG6A 1JV2B 1W5EA 4GPBA 4M76B 3NOOA 3DZFA 4Z3OA 1RWMA 3DLAA 1T9DA 2H6EA 4Z0TA 2IXTA 3CTPA 3EIUA 4X3PA 3T9AA 4MV9A 4IH1A 3WKAA 1A7KA 4YP0A 3W8RA 1TXGA 2VP9A 4PLVA 2IOFA 4GR4A 5BSHA 1HNNA 4LWOA 3FYSA 1O03A 4S1OA 5JRJA 4OHVA 1L5SA 2AH5A 1SULA 1YAJA 4YUZA 1XAIA 1EGQA 4HDMB 4MWCA 3QBEA 1A2BA 2WIGA 3GUCA 1Z35A 2NZJA 4B3IA 4V0NA 1CYDA 1RPTA 4D0LB 2QM0A 1KOFA 5FBKA 4BEWA 3N0XA 4UZSA 3D9QX 4J2HA 2EJCA 4EJFA 1G6KA 4JC4A 5HM8A 4P0QB 3LLSA 4G5RA 1L5QA 1EK5A 2O8EA 3LBHA 4H18A 1U0EA 2YYZA 1UAGA 1UKAA 2H9AA 4MLPA 3R0IA 4DLXA 1GVNB 2H2DA 2CXTA 3INNA 1R8SA 4W82A 3ZU3A 4WZAA 2ZROA 2QMHA 3R9KA 3TD2A 2RGCA 2V7GA 3ZH2A 4PYJA 5K0BA 4ZQIA 5DTRA 3TD6A 2BD0A 1TEVA 1TVMA 4YBRA 3WLSA 1DIHA 4DLYA 3AEQA 3HWX1 3KD2A 1KOGA 3ABIA 3HEBA 5F4BA 4UAVA 4G5SA 4AICA 4C7XA 4PXYA 1XEAA 2Q3HA 3NUGA 2Z6VA 5IKOA 3L4EA 2W2XA 4NAUA 3IIKA 4AYWA 2HJGA 4JY7A 3D31A 4LZJA 2EKLA 2BGMA 3OMXA 3VKWA 4YPOA 1QOQB 1RLUA 1V1MA 2A1IA 2JANA 1AGNA 3IELA 1VA5A 3OFJA 4IXDA 1HE1C 1Q83A 3IVRA 4O2AF 1VP9A 5K3FA 2REBA 2FW0A 3OPQA 3L18A 4EBBA 4DC9A 5GIPE 2H5IA 3IA7A 1AA6A 3RU9A 1SXPA 1OTHA 2J5BA 2QVCA 1NNUA 5C8YB 2XSZD 1Y6FA 5DRYA 4NF2A 1E2JA 2WJVA 3D6FA 1WPRA 4UNNA 3K70B 2ZKIA 1BTOA 4U3JA 2GR9A 3DDNA 1E9RA 2WJJA 2VCYA 1RBQA 3D8BA 1P7ZA 1W0KD 2P2DA 3PE6A 3T7RA 3E7XA 5K8CA 3H86A 2ANCA 3EQ9A 3FWYA 3HLKA 5I8ZA 4A5SA 2H17A 4LFBB 1YCDA 4UEJA 3TE7A 3TO5A 2R68A 4QBKA 2FPWA 3KQTA 4FN4A 5KIAA 3MRXA 1HI9A 2YMMA 1CY7A 5CT5A 4JI4B 2P2LA 2NXJA 1TU0A 1M1UA 2E9SA 2MSKA 2Q6OA 3EZ6A 1GVHA 1DC5A 1YOVA 1LFDB 3NNSA 1H6CA 4D42A 1A50B 4NJMB 4ZYVA 4AB1A 1BA3A 4MYDA 1QIMA 4MVJI 3QY0A 1E6MA 3IHTA 1AUOA 1MX1A 3FCCA 3HYLA 3PE3A 4D46A 5T4BA 3COZA 4Q9HA 1FOEB 1RRMA 2BFBA 3H6HA 3NNNA 4KC0A 3WGQA 2YIJA 3ZCXA 5CFMA 1T5OA 5D01A 1FFXA 1R8QA 3SX2A 1SXGA 2A8YA 4E03A 3HJFA 1BHSA 1LJUA 2QT0A 2KE5A 5DM60 1P19A 1YKFA 1MD9A 3NAQA 3HK2A 1L7RA 4GKAA 3Q7PA 3S8MA 2DWQA 3H13A 2ETXA 3DYVA 4YRRA 1CUVA 1UZLA 1ETUA 1NQUA 2XYVA 1WW8A 2IEYA 3TJZA 1TCBA 1WM1A 1A7JA 3F3KA 3FFXA 1L8QA 3GN2A 4R40A 5BQ5A 1BQEA 4Y2GA 1RLMA 4DM4A 1UKEA 4P31A 4KRFA 4YRDA 3GX1A 1F4VA 5CB4A 2ZQYA 4YI5A 2PPLA 4YRFA 2VHZA 4A73A 4DMGA 4KR6A 2JFHA 5AK5A 2WT8A 3DYBA 3NJ8A 5BWCA 3PXDA 2Y93A 2E4WA 2JJ1A 2P9JA 1KKLA 3DWGA 1X77A 3FCEA 3N2IA 5EIAA 1OCEA 1ZNZA 2G4CA 4BVGA 4RZ3A 4F6RA 5JWRA 2A9RA 2I87A 3OICA 2HA3A 5JWHA 1MJHA 4EG7A 1M2NA 3NWBA 4ZOBA 1A8HA 2ZSEA 5TPWB 3KQHA 2AJBA 2WWVD 3AUKA 2R8EA 4QLOA 3PCXA 1VIMA 4DQXA 2HYIC 1KO1A 3GCDA 4RWZA 1P44A 4KQCA 4NCAA 1HDRA 4HWKA 4JX8A 1ECJA 4IQ8A 5CXUA 2X6RA 1NRIA 5BO5A 3QLVC 3RD5A 1SWVA 1WULS 5DNVA 5B6JA 1MABB 2IIBA 1C14A 4L8FA 4BP1A 2CKMA 3DWEX 1ZWKA 6AT1A 2EBFX 4IIUA 2UZ3A 3NXKA 4YJ3B 2C1ZA 3ZTWA 1HEUA 2D59A 2VDNB 5G1PA 5K0TA 1EFPA 2WICA 4MV3A 3RVBA 2HCFA 2Q6VA 4F2PA 3R23A 1OLOA 4M7PA 1G6HA 5ALZA 3DMFA 3NEJA 1H4SA 1YJXA 4C7KA 1N0HA 4JELA 1M2VA 4MUHA 4W5QA 1R6BX 5ESRA 1P62B 2WHEA 2FA9A 4N7MA 1XJ5A 2P4QA 4KRXA 1DXOA 1I7LA 1N7IA 3W5VA 2F9FA 4ZYUA 4CQLA 5JXIA 5H8WA 4YJ3A 821PA 1QPBA 3HDYA 2AEMA 3KHUA 4BDSA 1C0KA 4B8ZA 5I51A 4UBIA 3J80A 1EWVA 3UTCA 1IWPB 3DKIA 2FRDC 4UOEA 4NJOA 4MWOA 2LTAA 3EGXA 4NBLA 2VXCA 2Q5FA 1WSAA 1E8DA 3WAKA 1G21B 2FPPB 3GROA 1M1XB 1DQSA 4IDBA 4Q0MA 4F1JA 3ZDBA 4D43A 3F8WA 4NOJA 2W9XA 1NJGA 1I4DD 3ET4A 1JLHA 4RSRA 3RYFA 4GMFA 1TM5E 3H1GA 3ITNA 3RGGA 4KPYA 4RZXA 1WCXA 4KLAA 5JPIA 1YR1A 1C7FA 2K2QB 2V65A 5L45A 3LUHA 1GQQA 3HJTA 1TIKA 2G1JA 4KNYA 4OSOA 3EPRA 4F6RB 3SEAA 3CURA 3L6DA 3ZHXA 2AXNA 5EIOA 4ZC1A 4EUKA 2X5XA 2L82A 3EUEA 3KVVA 2VUUA 4JBIA 3WAJA 1NSYA 4BO5A 1QF7A 3FSEA 3UBTA 1AQ6A 3FZGA 3L6RA 4NYIR 3SE0A 4DLVA 4FMCB 1O3YA 4PNZA 4DYDA 3LUKA 3EAFA 3I64A 3UGQA 3WLJA 2ONZA 5DHFA 4XZ3A 2OO5A 3S27A 3T9EA 3G2NA 4PRYA 5CNIA 4EPRA 4GUDA 4DIFA 3FOAA 3G9TA 1AT1A 1ZINA 2YQ4A 3QWAA 3K71B 2BCEA 4QUKA 1ECGA 1WUYA 1T4CB 3M33A 1KO5A 4PY2A 1NQXA 4UTNA 3RSHA 1B6SA 3CX6A 1QHSA 4BVLA 3BRQA 1J7KA 1HORA 4JLVA 3O1LA 1F2VA 2FPRA 1MOPA 1PL8A 3P9YA 1A8UA 3PQ3A 4K05A 2W70A 4XWOA 1RMQA 2GESA 1CJUC 2AK2A 3HBAA 4GRDA 4N5MA 3OZXA 4BBPA 4D4MA 4P53A 3BB3A 1VHQA 2V3WA 2CCGA 5I01A 3LXUX 3K96A 4JJ8A 2Z6AA 1B1CA 1NLZA 2VP2A 2D7CA 3IAS1 1ENPA 3W79A 2FMTA 2RGRA 4MQEB 4OKSA 2C99A 1V39A 1T2AA 1DFIA 2ISQA 2VK8A 3JQBC 4BRZA 5JAOA 5JTUA 1EK2A 3ZCUA 2I4RA 5JPDA 4DWWA 3PX7A 2QU7A 1P18A 4I1OA 4I5DA 4EHJA 2CNWD 5HZMA 5K2MA 1KXJA 1B74A 3BXPA 3MCUA 4ZRMA 5G0TA 2ZUTA 3RSZA 5KNBD 3HU5A 3JQPA 3KELA 3CKYA 4M99A 3ZE6A 1JU4A 1LV8A 2GTHA 2GZ3A 3VTAA 2EJWA 4DDVA 5L51A 4MCHA 3WNVA 2JCXA 3NOVA 4FYXA 1D5CA 2AN1A 2EFCB 2ZUWA 3KYCA 3IKTA 3CU5A 2DC1A 2NG1A 2ZJ7A 1KKMA 2GN6A 2QD5A 1A71A 3B2NA 3KZVA 2HO5A 3W34A 4L4RA 1XJCA 1J8VA 3WG9A 3QHQA 4KVZA 3HP1A 4XM1A 4RANA 2G09A 3RYIA 2AG5A 3CGGA 1Y8QA 3M6XA 4OV6B 1E6EA 3A6PC 4AKHA 4FI3F 3CKKA 3WHIA 5GV7A 3ZHOA 4TSFD 2DHCA 3VNSA 1KJZA 3W4IA 3PTZA 3PC3A 1SHJA 3V33A 1HEYA 4CQMB 1H5NA 3UK6A 4PYNA 1EJ6A 3AU8A 3MQFA 3F49S 3D8SA 4RC9A 5HVNA 2OV8A 3HZHA 4RSHA 4HD8A 3OF5A 3VYUB 5EE0A 2JRLA 4QDKA 5B2FA 5FX2A 2JAQA 2XPCA 1RKBA 4CTOA 1GA1A 4RM2A 5IH3A 2O4UX 3WIBA 4BE7B 2V8OA 4GYWA 5C8ZA 1HY3A 1N0VC 2DJIA 4WK2B 3IT2A 3E18A 1Q1BA 4TSKA 3UMRA 5EP1A 5L7YA 4DV6B 1SBCA 3PQ2A 3I1JA 4Q3BA 1IQ0A 5FOUA 4ES6A 1R10A 1W5BA 3NHMA 1IN5A 4P82A 4E30A 5JNVA 5I7AA 4WFIA 5LFAA 4J6EA 2JVJA 3E9EA 1KVTA 2FPOA 1M1NB 3K1AA 3GLFA 1XYVA 4QGHA 5A0FA 2OXIA 3A06A 3ELUA 3NDIA 1AZLA 4WK4B 5M3BA 2VJMA 3LHKA 1P5RA 4EG0A 3H2ZA 3LW7A 1TO1E 2WU8A 1KYXA 2HRZA 5HUQA 1TKRA 3K2QA 1OH7A 3FTEA 2QQ5A 1U2TA 4MA5A 1ZRNA 2BJWA 4YAEA 5AVSA 1UOEA 3FDJA 3C7DB 4G0NA 3MPOA 3A7EA 1W48A 3GG9A 3VUFA 4G0UA 2Q0XA 2G5GX 4X7MA 3PXAA 2A9QA 1G3MA 2C0PA 2PS9A 2QJTA 4WZBE 4UHDA 1Q19A 3L7CA 3VX3A 4O33A 2CF5A 3D59A 2CXPA 3ZBTA 2GJAA 5LP6C 1A76A 1X87A 2O2GA 4B7ZA 1VLMA 5DMHA 4ZU3A 2C4MA 5LZ2A 4RMIA 3IUMA 1XRPA 1V96A 2ZSJA 4DA7A 5K0EA 1MJNA 1I5EA 2PHZA 1ZH2A 3NCHA 3CUKA 4K9LA 2IYXA 1RKUA 2ZRFA 3AXSA 3F5QA 2XXAB 2D1TA 2VC2B 4FGLA 4TKVB 1BMQA 1TYAE 1XCGB 2GDZA 2NSDA 3CRNA 3HA3A 1KDOA 4G1CA 4KAAA 2O7QA 2Q1TA 1JI3A 1JHDA 2P9ZA 4F5DA 2ZB2A 4EHDA 4RFVA 4CM7A 3K6RA 3KUXA 3I92A 5CXSA 2IC5A 5KSWB 1K4MA 4GXTA 4WKNA 5DBFA 2H54A 2YY7A 4ZRDA 3A4VA 3ZY3A 1LGYA 1NVWQ 2CXXA 2V6BA 1RPNA 3UNXA 3EC2A 3GJ0A 3NWJA 1UC8A 4PIPA 5AI0A 3WJAA 2QRVB 2PH1A 5E1DA 3DXXA 2WU0A 1BDJA 4HYYA 1F9AA 5EKSA 5JYEA 1N3YA 1DG3A 4EBFA 1RFLA 2P35A 1NI3A 3MCTA 3GLHB 3P2YA 4BLOA 4ESOA 3TTYA 2GJKA 3EQ8A 4OO3A 3GFGA 1K3TA 5A6VA 1NY5A 3H2IA 2CV2A 2QSZA 3F3YA 3TW4A 2V6GA 4ILKA 4LDRA 4D4JA 3D8UA 1QE3A 2PZLA 3RT7A 2ODEA 1DQNA 3H5AA 4W5JA 2V1UA 1T2NA 2VJNA 3AB3A 3H1FA 4QVKA 3N3AC 4FWIB 9LDBA 1DMSA 2E55A 1FDIA 2F43B 2IV3A 3WI7A 1I2DA 2YV1A 4C14A 3UWMA 1N6IA 1WB4A 1A9YA 1FNCA 4X44A 3HXQA 3UWOA 2J9FA 3ZVKA 1QCYA 4K40A 2GPTA 2N9UA 1W88A 3BWBA 4I2VA 3VMFA 4C22A 1B8NA 1Q1ZA 4PYMA 1QF9A 1PYGA 4ZOQI 1BOOA 1RI3A 3D1JA 3OAAA 4V0KA 1U0TA 4EENA 5K9ZA 1YMQA 1LVUA 3MJRA 4OI1A 2Z30A 2XNCA 3H8WA 2IXAA 3QE2A 2I2FA 1QS0B 3L6UA 4NCHA 4TKUB 4U8GA 4L0CA 3S28A 3SCZA 3CUEF 4GW3A 3IRVA 4HRXA 1TMOA 1PU2A 1UDBA 4J1TA 1HDOA 4DW8A 4NE2A 5LUBA 2IS2A 1KO8A 1VBFA 1YU9A 2VTEA 1O58A 1VE3A 3R8XA 5MFZA 3BFKA 4I5IA 1X42A 5ED4A 3TGWA 1V47A 3FETA 4LBYA 3C3MA 3OT1B 3T0FA 5BMVB 5K01A 2PLAA 1QANA 5FO1A 1HQYE 1NT2A 1FYWA 5LMUB 4LDNA 1U2DA 3BS4A 4XIFA 1SOUA 4AFNA 3FGOA 3ZDDA 2H1RA 3PFGA 4Y0NA 2HY7A 2ZS8A 4PEVA 2ZBUA 1X19A 3B9QA 4B31A 1N0IA 3DLBA 1IM8A 2Y71A 5JXJA 5AOBA 1PDOA 3DV0B 4B3JA 1EJ0A 1D07A 3ZV3A 2ATXA 2G72A 4HC4A 1SUEA 4G0PA 3SKXA 2GTPA 2HQOA 1GA4A 1X38A 3DUWA 3B12A 2YS7A 1L5KA 1JBQA 4RVSA 3TRJA 3HJGA 3ICQB 1SQ6A 2C31A 3I32A 1AX9A 3DTTA 3ZXSA 4C0SA 3BFVA 3VR4H 5B57C 1TM3E 1ICIA 1VJCA 4F56A 4MARA 1W59A 3N59A 1J33A 1VE1A 1ZJ6A 2JFXA 3QVOA 4GSLA 3GFPA 4YPFA 4TMYA 3K30A 2GILA 4OHWA 2XVAA 3SF0A 4OFXA 3V2IA 4I0WB 5KJFA 2QR3A 2QRPA 3PVZA 1M34E 3BWEA 1ZA2A 4IG9A 2DM6A 3RC3A 1BDMA 1QWOA 2CVQA 3E22A 2J3LA 2IPLA 4MS1A 4G1BA 5J5VA 3W3ZB 4OJYA 3RFTA 4JXJA 5JS7A 4H6VA 2DPGA 2XX3A 4HGOA 1AZTA 1PR6A 4RS4A 4M3NA 3UFBA 5E6UB 2NU9B 2ABWA 1VL2A 4Y2PA 4RIEA 2YFYA 1KI9A 2RGEA 5BWMA 5FH9A 4I14A 1IDN1 3FKQA 1MRNA 4RIFA 2RAFA 2X9GA 2XE8A 4AZ0A 4CFYA 1JDVA 4AF6A 3AF6A 2DETA 3FPBA 5KQSA 1ZISA 2GZDA 3NHKA 5FTJA 5F7ZA 2C7VA 4U9IS 5HIJA 4GZMA 4L4XA 4DHWA 3K72B 1IHXA 2W0MA 4PCLA 1WD7A 1YRWA 2G17A 3FNHA 5GGXA 3TR6A 4ZYLA 4IDQA 4CKZA 5IVHA 2HU2A 4PX2A 1SXIA 2QAGA 1GTL1 2PX4A 4JLSA 4BNJA 1WAMA 3ZV6A 4K0RA 2VUHB 2CGEA 3PHHA 4F4CA 2REOA 3QVJA 1MDFA 2VH1A 1ZICA 1ZO8A 4FGZA 1LV7A 3U3JA 3RJ9A 2I7TA 1Z2OX 2C03A 2OHXA 3LY9A 4FFNA 9GPBA 5A6SB 3SSOA 3ZXUB 3P32A 3CZ9A 5H9WA 2ZKLA 4OOFA 1KQPA 3EF0A 1I4OA 1X3SA 3BKXA 3E6AA 4QUIA 2BOVA 3RFFA 3WLQA 1IXZA 1AS3A 1D2CA 1DELA 3H5OA 1F5SA 2C0QA 1BJKA 1UQTA 2WWHA 1BHJA 3MGGA 3DDSA 5KDOA 4H4CA 3MTEA 2VDOB 1J9GA 4Q37A 2RBGA 2OCAA 3V1KA 3LQRA 4L78A 3SM9A 3UKOA 4K1XA 4X3CA 2QYTA 3F47A 1PRYA 3O1IC 5KOJA 5DX8A 1T5HX 2OT3B 4MO2A 3AUJB 4MVXA 2WTUA 1KJ9A 2I6UA 5BQXA 5KJCA 2ZIWB 2YVQA 4QULA 3F67A 4TLCA 4ZCTA 4L4SA 5KCMA 3I2GA 2FCAA 2GPSA 1EBFA 2B4AA 5L4SA 2VT2A