1YB1A

Crystal structure of human 17-beta-hydroxysteroid dehydrogenase type xi
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
244
structure length
243
Chain Sequence
RRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITGVKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human 17-beta-hydroxysteroid dehydrogenase type XI.
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 17-beta-hydroxysteroid dehydrogenase type XI
total genus 93
structure length 243
sequence length 244
chains with identical sequence B
ec nomenclature ec 1.1.1.62: 17-beta-estradiol 17-dehydrogenase.
pdb deposition date 2004-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1yb1A01
4GWGA 3ZWVA 1EBUA 2IODA 3AOGA 1G6KA 1K0UA 3FWZA 4FOOA 1PWXA 4K6FA 2CF6A 4XD2A 4C7JA 4CLRB 3BHMA 2DU8A 1KVUA 1R0SA 4QXMA 3ADPA 4DPLA 1ZSVA 2BD0A 3CZMA 1YQDA 3A1NA 4M1QA 4U0JA 4P4GA 5TRTA 1Y5RA 3IJRA 1NBOA 4ZQEA 4YXFA 3HFSA 2P4HX 2VWHA 1PQWA 3AUUA 2C2XA 3RUCA 4FOSA 2V7PA 4UUOA 4BL5A 4ESOA 4MKZA 4WOJA 2Q1SA 2JKVA 1DIGA 4IZHA 5A06A 4KWIA 4LVCA 1DSSG 4ZQGA 1BGVA 2ZTMA 1QYDA 3LDHA 3WFIA 4BNVA 5T57A 5I7SA 2FRDA 3PXXA 4IJVA 4BKQA 1OZAA 3G1UA 5IXSA 3CINA 1C0PA 4ALIA 1Y8QA 2B5WA 4K26A 1PX0A 5KOIA 1NQOA 4MP6A 3ZZNA 1PL6A 3AY6A 3PK0A 1ENOA 4DUPA 3KO8A 4G2NA 1K3TA 3LT0A 4EJ0A 1LC0A 3PZBA 2UYYA 3CEAA 4E32A 2XXJA 4TZTA 1D1SA 2G17A 1CRWG 1Y8RB 3KSDO 1B2LA 1LDBA 3TOZA 3OQ1A 4XGKA 1TT7A 4EEZA 1BW9B 3E03A 1N5DA 2J3KA 4GL4A 2DAPA 3ETDA 3WJ7A 4HP8A 3QWIA 1ZCJA 4EJ6A 1UXIA 1EMDA 4RF3A 5DCWA 3H7AA 2VWPA 4PZDA 4B8WA 3INRA 4NFHA 3WTCA 3D5TA 4XQEA 2ZTLA 4N5NA 4O59O 4YAIA 5L4SA 3FTNA 3X2EA 3RBVA 1TA4A 1FDTA 5L95A 2D5AA 4EDFA 3KOUA 5GZ6A 1IHYA 4QT0A 1GQ2A 2J6IA 2AEJA 3WIDA 1X1EA 4Q9NA 1OMOA 4HV4A 3RQSA 5KNLA 4IMRA 3DOJA 1MG5A 3F4BA 2VHVA 2P9CA 1VI2A 1C14A 2AEFA 1U3TA 5L51A 3ZHZA 4MINA 1A71A 1IY8A 4R3NA 3C8MA 1WDKA 1NWHA 2E49A 1GV1A 3GLQA 3FBGA 2GZ2A 2PKQO 4PLYA 5HRUA 3BAZA 3ZU3A 1ISJA 2YHIB 4CLRA 1R16A 2UUOA 4YTEA 1UXKA 1BG6A 1NX6A 3LVFO 2HMTA 5HM8A 1MUUA 5JCXA 3JQ9C 2PR2A 1GPJA 2Y1EA 3ZWAA 3BTSA 3NRCA 1LEHA 1GUFA 4I8XA 2X0NA 1AXGA 3DHYA 4NK5A 4NU5A 1UAYA 4B79A 4U7WA 2ZB3A 1GCUA 2PTGA 4YA6A 2D5CA 2QX7A 4DYDA 5DT9A 5ER6A 2IYPA 1R0LA 3JQBA 3IP1A 5DNAA 4LSWA 4N18A 3Q0EA 1I2CA 2X8LA 4BO8A 2YFHA 2G5CA 2JCYA 3F5QA 3TN7A 1SCUA 3SEFA 3VPHA 2CFCA 2Y1DA 4QUKA 1EVJA 4TQGA 2VYVD 3PHHA 2W2KB 1QKIA 3JQAA 5JW6A 1DPGA 1H6AA 4KUGA 1GQYA 1JAXA 3CUKA 2DTDA 3V1UA 1QYCA 2WWRA 1I10A 1P1IA 2HMUA 3KTDA 5TSDA 3FHLA 4KTTE 3PFWO 3VTZA 3TF5A 2C2YA 1A72A 1BSVA 2JAPA 3WG9A 3PLNA 2BF7A 1P1HA 1PZFA 4ALLA 1EVZA 3F46A 4E5YA 3OM9A 1PL7A 3V1YA 3L77A 1X7DA 1NWCA 1ZKMA 1PJ3A 1SEPA 4J7XA 3GFGA 1BMDA 3TJRA 4LW8A 1TI7A 1PL8A 3PYMA 4BMNA 4FB5A 4NJMA 2VWGA 3IP3A 4RVDA 4HX5A 2EIHA 1F8FA 1I33A 5KJCA 1EQUA 3ZWBA 2OUIA 2W90A 1JQBA 1PU2A 2YQ5A 2AE1A 2PGJA 4RVSA 4BQPA 3BMQA 5AXDA 3I5MA 3UOGA 5IJZA 3D3EA 2CNBA 1R4NB 4IQ8A 3I3OA 4ALKA 4Z9XA 2O48X 3W8DA 5A4DA 1UXJA 2VWQA 3WYEA 3WS7A 3DXFA 3AFNA 4JJFA 1U3WA 1ZFNA 1ZW1A 3ONEA 4FR5A 4KMSA 4L74A 1XHLA 3UFXA 3C1TA 3WMWA 2NQTA 1G0NA 3DAPA 2RAFA 5H81A 3OHSX 1ADBA 4Y98A 1Q7CA 3K8ZA 1JDJA 1NPYA 1PSDA 3UN1A 4CM8B 5F1KA 4DWVA 1OC2A 4UEJA 5A3VA 1Y81A 1DRUA 1WMBA 4R3WA 4NBVA 2AMFA 4CMEC 2VCYA 2ZYDA 3QWAA 3ZHYA 3GDOA 3C1AA 4GX0A 1N7HA 5JAIA 3BHJA 3HZZA 3G0OA 3ZHXA 3UCEA 1TLTA 2FMUA 3QSGA 5C3MA 1HTBA 3DZJA 3L9WA 1DBVO 2X86A 2NTNA 1PJLA 3PYLA 3T4XA 2IZ1A 3GEMA 3JQ9A 3H6KA 4R9RA 2EF1A 1VRWA 1IPEA 3BMNB 4UVEA 1KEVA 1MG0A 1ULSA 1WAMA 4EW6A 2DFVA 4RO0A 1T4DA 5CDYA 3JQ7A 3S55A 4I9UA 5G0VA 1HSOA 1VL8A 2C82A 1IZ9A 1GUZA 1LTHR 4ZICA 2VT2A 4NHEA 4DBZA 2WD8A 5L7TA 3EDMA 3MTJA 4TKMA 3RFVA 3QVWA 2VHWA 5TX7A 2HJSA 3UVEA 5IDXA 4DMMA 4GMGA 3F5SA 4CM6A 1HE5A 3N74A 5TT0A 3JYNA 3ASVA 4R51A 1PR9A 3EAGA 4PN3A 3AU9A 1QLHA 3GVCA 3K30A 1CERA 3NKLA 1VC2A 2QRLA 3Q2KA 4EI2A 1I3MA 3A4VA 5EPOA 1KEPA 1DFIA 3DBVO 1LC3A 2DUWA 1XU9A 1LDYA 3ZNOA 1MA0A 4TVBA 4PRKA 1HLDA 1LDGA 5JDCA 4MDHA 5F21A 2H6EA 3D4NA 4J4HA 2HSDA 4R68A 5JMWA 4NBRA 2Y99A 5FI3A 3BXXA 3BTOA 5ADHA 4O6VA 4IJKA 5LDGA 3RC7A 4IM7A 1UZMA 4CV1A 1E7WA 1E3WA 4OQZA 4Q3NA 1R37A 2EGGA 1K89A 4KWHA 4ND3A 4YJFA 2UUPA 3ZCXA 4BMVA 5FFFA 5I9MA 3GDGA 4EGFA 1HKUA 3OIGA 2I76A 4N7RA 3CIFA 4ALNA 1V3TA 4AL4A 4XJSA 4Z9YA 2ILTA 4GLOA 4CM8A 4BNFA 1DC4A 4PVDA 4ZN6A 1JVBA 3O8QB 4QTZA 1DB3A 4IDBA 2FZWA 3MJSA 1X15A 1YB4A 4IINA 4OKNA 4S3MA 1X0XA 4NFYA 1DC6A 2B35A 5IF3A 3K5PA 2Q49A 3V5NA 3U4DA 3ULKA 2HDHA 2OL4A 1HYHA 4N54A 1QXSA 3H3JA 5T64A 5FWNA 3AOEC 2WEKA 2Y0CA 4NK4A 4B8ZA 3FR7A 3HQ4O 4TROA 3RFTA 2NQ8A 3EHEA 4R4JA 5ILGA 3JQ8B 3WJAA 1HDCA 4NU6A 4BO9A 3DBHB 1NR7A 2YZ7A 4L4XA 3WQRA 2DLDA 2H1SA 3LF1A 3I1JA 3JQFA 3DMYA 2VTEA 4PGFA 2I66A 1SAYA 4CM1A 2P9GA 2AHRA 5B37A 4RJTA 2TMGA 4RORA 3KB6A 3NX4A 3IOYA 1ADFA 4GQAA 4RZHA 1I01A 3U4HA 4ZRMA 3EYWA 1CYDA 5COAA 4WKGA 3SC4A 3KETA 3TSCA 4Q3AA 3MEQA 3ZV5A 5HTOA 1A9ZA 3A14A 2J3JA 4N5LA 2ZYGA 3DC2A 1A7KA 2BI7A 2F00A 3AUAA 3DFZA 2NU9A 1AHIA 1DFGA 3KYBA 3DAFA 4OGWA 2BLLA 2NUAA 1QV6A 5AOVA 5HS6A 3K73O 5HBRA 2X9NA 3OMLA 5I7VA 3NTQA 2YHUA 1KIFA 1UP6A 1JN0A 4YEDA 4XDZA 4CMAA 1ARZA 4DGSA 2J5KA 1ZJYA 4H7PA 1E1KA 5CG2A 3M2PA 4P8RA 3CKYA 4ND4A 2GGSA 4MVJI 3KSUA 1HYGA 1IPFA 1C0LA 2IZ0A 2O7SA 3L9XA 3ZNPA 3D5QA 1W6UA 5TNXA 1NAHA 2HKIA 2HLPA 5COBA 3S2EA 4DQXA 2PZKA 4H15A 4K6CA 1WZIA 3M2TA 3WLEA 1PGPA 2C5EA 2NVWA 3KRTA 5DF1A 1YDWA 5F5NA 3ABIA 2FR0A 4ND2A 1EFLA 1T2EA 2F1KA 4JJIA 1PZGA 1BTOA 4PRLA 5G0UA 1FF9A 4R16A 1ENYA 1YOVB 1DDOA 1HXHA 4WLNA 4RF4A 5IN4A 4PLGA 1SPXA 3JD1A 4C7KA 4IXWA 3LT1A 1N2SA 5I9NA 4AJJA 1GZ4A 3UICA 2I67A 2PA3A 1IB6A 1XSEA 2DBZA 3LSYA 3O4RA 3MOGA 3CMCO 4KQXA 4JX8A 3PJGA 3TZ6A 3Q11A 1ZK3A 4ND5A 1GDHA 4IS3A 3TZCA 1LBEA 1Z7EA 1SBYA 4Z3DA 1DEHA 4OOFA 4Z0PA 4W6ZA 4Y6PA 1I0ZA 2X0JA 4XEHA 1VKNA 4WLEA 5EMHA 4P4NA 1RYEA 1LA2A 3QIVA 1MC4A 2YDXA 2JFGA 4BNHA 4FQ8A 1P1RA 1EDZA 5T67A 2WM3A 1GADO 2B4QA 3GGGA 2QRKA 3JQ8A 1ISGA 1KY5A 1B8PA 2GRAA 2VYND 2DT5A 2JJYA 4XKJA 1W8DA 3H9QA 4HFMA 2C07A 1LLCA 4L8VA 1YB5A 5K6AC 3X2FA 1YRLA 2NWQA 2VUTA 4Z0HO 4IJUA 1PJBA 5JYDA 2PKQP 3GNSA 2FR1A 3P19A 1NYTA 2GCGA 2HK7A 1A9YA 1KS9A 4B7XA 1ADCA 4GPD1 4YAEA 4HFNA 3AI1A 2VZ9A 2A35A 2PH5A 3DBRB 5BSHA 5A9RA 1HZZA 3I9NA 1PGJA 2HMVA 1I5RA 3DMTA 3TQHA 4D44A 5COQA 4Z3KA 5KWEA 1GAEO 3K96A 3OICA 4CM4B 3JD0A 4YT5A 3H9UA 3PFFA 4PLHA 1UDCA 5ES3A 3ETGA 3RIHA 3WNVA 1MC5A 1Q1NA 1PWZA 3PQDA 1I32A 1N9GA 2Q2VA 4JGBA 4OIMA 3R3JA 1UAGA 4E4YA 2NVUA 2JD2A 1PGOA 1GY8A 3KYDA 2VOEA 3IC5A 4XYGA 5TGDA 2AG8A 1QLJA 2YQ4A 4BNNA 2OP1A 5BSEA 5C7IO 4XQCA 1P31A 4R1NA 4B3JA 1X0VA 5KCZA 5KVCA 4GLLA 2TMDA 3IJPA 2Q46A 2QZ9A 1P3DA 3BMCA 2Q99A 5JAMA 2DTXA 1ONNA 4J91A 3OEYA 1JWBB 4PLCA 2Q4BA 4RV9A 4I5DA 4J2OA 1YOVA 3I83A 2B83A 4PG7A 5CPBA 3JQBC 4W7IA 1C1XB 3C3XA 4CL8A 1B14A 4FD3A 3NDRA 3H4VA 1FK8A 5BNTA 3WNQA 3RC9A 2FN7A 3GUCA 4HWKA 3OJEA 1NAIA 3OJ0A 3WSVA 3HG7A 3AWDA 2P2SA 5C37A 3OA0A 4IDCA 3V2UA 2W4QA 4OH1A 1VLLA 2IXBA 3GGOA 1NHWA 3E9MA 3NTRA 3VH3A 5FYDA 3WGOA 3QHAA 5AXAA 2O4CA 1GCOA 3R6DA 2Y1GA 2OFPA 2C54A 2E6UX 2FY8A 4PZEA 3A28A 1WXDA 3GNTA 1HETA 4PLTA 4A7PA 1PTJA 1YGYA 3I6IA 1R15A 5KVVA 3I4FA 4FJ2A 1JKIA 3O9ZA 4WLVA 5AQ1A 5L4LA 4AJKA 4J7CA 4YRDA 3RUEA 2C0CA 3INTA 3QVXA 4J43A 2CDBA 3QWFA 4W9NC 2GYYA 1OI7A 4E31A 4CLOA 4URFA 1YONA 5ILOA 5CHEA 3ASUA 4FIZA 2OMEA 4DA9A 3CH6A 3HHPA 5EQDA 3GZNA 4NDNE 1RWBA 3GN2A 4DC1A 2B0JA 4FGWA 4W9NA 3GA0A 3PRJA 2NADA 3ZWMA 4B4VA 3F3SA 3MJ4A 1M76A 2G1UA 4G81A 2CUKA 3SJ7A 4J0EA 1YS4A 1ZVMA 1HL3A 4M8SA 1E6WA 4HY3A 2EKQA 1A4IA 2V6BA 1EDOA 1Q2XA 5KJ1A 2ZTUA 2DKNA 4YT2A 1X7GA 4CMIA 2YV2A 3LT4A 3DEYX 1MFPA 4IJWA 2DFDA 4A10A 4ILKA 4CLXA 4LCJA 2GN9A 1T1RA 1P9LA 1LRLA 3PI7A 3EMKA 4CMHA 1UDBA 3TZKA 3W1VA 2E48A 2GN4A 1N8KA 3KYCB 3N58A 1C1DB 3ADOA 3RJ5A 3HDHA 3LZ6A 1QV7A 5IZ4A 1LDMA 3M1AA 1C1XA 1GQQA 4BNXA 1T25A 5JSFA 5JDIC 1RYDA 4GKVA 1AN9A 4NIMA 1ZEMA 3EVTA 4IIUA 1P33A 4MVJH 4ZGWA 3TOXA 1P1FA 4EUEA 4TMFA 3LLVA 1WMAA 2ZCUA 1NM5A 5ENVA 1ZO8A 4YPOA 3OJOA 1C0KA 2WE7A 1Y8RA 4XR4A 4DMLA 1YB1A 5LCXA 4DC0A 3HNPA 4AVYA 4Q39A 2RH4A 3FN4A 1VJTA 4GSKA 3IUPA 1Z7BA 2YDYA 2PGDA 1VSUA 4MIEA 2FZEA 3I9JA 3DFUA 3PHLA 5EERA 2ZQZA 3GUYA 3PZRA 4D43A 3E48A 5L9AA 4RCVA 2Y05A 4TRNA 3I9LA 2R00A 4QX6A 4FN4A 3Q9UA 2FPIA 2PY6A 3OEWA 2GASA 1OC4A 2FOIA 3Q1LA 4U8GA 5ICSA 4YAJA 5TF4A 3WWZA 4CMCA 1ZUD1 1VSVA 2O7QA 2BGMA 1SOVA 2UVDA 3FNEA 2Y0EA 2JD0A 3W6ZA 1BVRA 3D1LA 3UKOA 1A4UA 4BGUA 4J7UA 3C7DB 4MKXA 2O3TA 5JFOA 3GZNB 1PQUA 4JN6B 3GK3A 2Y68A 1H2HA 4F6LA 3INGA 4D79A 1FDUA 3BYZA 4JBHA 2VT3A 1LX6A 1I36A 3VZSA 3QVOA 2EW8A 1DIRA 3FNGA 2X9VA 3KVOA 3GZ4A 1WDMA 1H6DA 2GO1A 2AQHA 2B4RO 3ROPA 2O3JA 2D4AA 2WYVA 4BB6A 5HS4A 4LMRA 1R66A 3WGYA 3VAZA 5DBIA 1LXCA 4WNCA 4CMIB 3K31A 3IMFA 3ZV3A 1YVEI 1AUPA 2CZCA 4FFMA 3H2SA 1HDYA 1H9AA 1EK5A 3GG2A 1BDMA 4UUNA 4ZD6A 3Q2IA 3TFOA 4Y67A 4J6FA 1JU9A 3FNFA 3H9EO 1A7AA 3GAFA 2AQIA 2G82A 4IDGA 4WCFA 3PEFA 4BQRA 3GH3A 4X54A 3JYPA 5DP2A 3OQBA 4L73A 3PLRA 4E6PA 3SVTA 3WWYA 1KY4A 3AFMA 4FC7A 4JXKA 3LYLA 4AJ2A 3HN7A 4TRMA 2HMSA 3OJFA 4PLWA 3H5RA 2Q45A 1E3IA 7ADHA 2XAAA 2ZIZA 2O2SA 2W2KA 2QYSA 3FNHA 3OP4A 3VKVA 3ZH2A 3RJ9A 4K9DA 1MXHA 3QWHA 4RLHA 2EGHA 4OMUA 4UVDA 5K9ZA 3L6DA 3ZW9A 1F8GA 4JK3A 2ZB8A 4TRJA 4YAKA 4ND1A 1U28A 3BHIA 1UJMA 1BHSA 1KERA 3UHAA 3RUHA 4E2WA 3LC7O 2DQ4A 4YAGA 4FPXA 4A27A 3GFBA 4B4OA 1ZK1A 4BVAA 4XX0A 2GERA 4OSOA 6LDHA 4RDIA 3VPXA 1U2DA 4I08A 1UDAA 1U7HA 4J4BA 4CUZA 1GZ6A 2FHSA 4FJ0A 1T2AA 2ZYAA 2YHIA 3S8MA 4B7UA 3B70A 1PJCA 1B16A 4BKPA 2JCXA 4R9SA 2X5OA 4IQ0A 2ZQYA 5T5QA 1R4MA 4I9HA 2PLAA 1VPDA 3DZKA 2I5PO 4BO3A 4PLZA 5A03A 3DHNA 1CWUA 1S7CA 3BMQB 4HKTA 1E6UA 3AK4A 5FF9A 2HAEA 1M66A 2NU8A 5CEEA 1GR0A 1K6XA 3U9LA 4J9VA 3C24A 1F06A 1D4FA 1DC3A 4IDEA 1ID1A 4KP7A 1KVSA 1Z82A 5I7FA 3HDJA 1Q7BA 4J1NA 4DRYA 4MIOA 4F45A 1PZEA 2IZZA 5ER9A 1J49A 5KKAA 1E6EA 1GPDG 3HDYA 2O3SA 3TRIA 3WYCA 2EV9A 3MJCA 4CLEA 1JW9B 1E5QA 3VC7A 3JQAB 1XQ1A 3AUTA 2NACA 2R6JA 1LRKA 2VYVA 1HDRA 3AM4A 3JYQA 1H94A 5JCJA 3P2YA 4AG3A 4QSMA 2P9EA 4RVGA 4FFLA 4GAEA 2HRBA 3D4OA 3AM5A 5A5FA 5B4TA 1T26A 4MVJF 3ST7A 1CF2O 1O89A 1XU7A 3K92A 1XELA 4CQLB 1RM0A 1PR3A 4RZIA 3LF2A 5K6AA 3NTOA 4BHTA 2VRBA 2CMDA 4WLFA 1DIAA 3C85A 1B15A 3RUDA 4GX1A 3PVZA 3KBOA 4WCFB 4RVHA 3WB9A 1MFZA 2YJZA 2YUTA 1M2WA 1D3AA 3GQVA 5A1TA 1M75A 1SB8A 2HU2A 2Z95A 2HCTA 1X14A 3TZQA 3QY9A 4EJMA 1LSSA 4NPCA 4GMFA 3JCZA 3WQSB 3GVPA 4U0KA 3ITKA 4QO7A 3S1LA 2Y1OA 3NEPX 4BO4A 4CL3A 4D46A 3KLMX 1ZZEA 1YJ8A 2PH3A 4ZRNA 2E4AA 3DB2A 1GUYA 3WGQA 4INAA 2C7VA 5CEJA 4CUJA 4NBUA 3WGGA 4RPLA 1CQIA 1FDSA 1UXGA 5BSFA 3RWBA 2VHYA 1KC3A 1ISHA 3TL2A 1PIWA 5I8WA 3NT2A 4HXYA 3D0OA 2VZ8A 4GX5A 1YBAA 1Z73A 2D2IA 1HDXA 4OXNA 4ZJUA 1N92A 2OXIA 2C7GA 3W4JA 3HWRA 4ALMA 1RM5A 4FW8A 3MTGA 4BKOA 3U5TA 2X58A 2X23A 7MDHA 3GN1A 5L40A 3IKVA 5A9SB 3RBZA 1NFRA 2QRJA 4MKRA 2NVBA 1QR6A 3ZN2A 2JAHA 3AY3A 3P2OA 3E8XA 1J0XO 3D3WB 1Q0LA 5GY7A 5JO9A 1AGNA 4LSMA 4L4RA 1HYEA 4XB2A 4XB1A 3RSHA 2XF8A 3OIFA 4AFNA 1NQ5A 1CJCA 4IS2A 2YW9A 1UUFA 1MLDA 1NHGA 2C20A 3DO5A 4II2A 4MPDA 4NZ9A 1IE3A 4YJFB 4HFJA 5I8ZA 2WJPA 1NTOA 1I3KA 3JQ7B 4WE3A 3VZQA 5BQFA 1CIVA 4XJTA 3PGJA 1WW8A 2CD9A 4KDEA 4YQYA 1WWKA 3O8QA 4W7HA 3SX2A 5CDSA 4CMGA 5ENDA 1E5LA 5CEFA 5JNLA 2VTDA 4BNUA 1VJ0A 3H5NA 1L1FA 1PZHA 4PG4A 5H83A 4IGFA 4MVJD 4FFRA 1C0IA 1KEWA 2QW8A 1PJ2A 1XWFA 4YT4A 4BOYA 2UAGA 5L3ZA 3LLSA 4GVXA 3PHIA 4MVJA 5MGBA 2Y67A 5DBGA 3SLKA 3OECA 1DHTA 1YE3A 3GG9A 4I1IA 1Y9EA 4J90A 5LDHA 1LNQA 1W73A 3W8EA 2GF2A 1SEVA 1WDLA 3JQDA 3AY7A 2GLXA 1EQ2A 3K2BA 4XGIA 1B3RA 1NVGA 4MO2A 2EHDA 4OKIA 3KV3O 2EW2A 3NJ8A 1PGNA 3PWKA 2IE0A 1RJWA 1MXFA 3O03A 4C4OA 5CDTA 1KC1A 1BRMA 2RIRA 2OP0A 1PS9A 3DZGA 3QLJA 4DLLA 5G0WA 3ZHBA 4MVJG 2PZLA 4UUMA 6ADHA 2J3HA 5C7OO 5TJ9A 3GEDA 3PHGA 4R41A 4BGIA 3ITDA 2GZ1A 3AU8A 4IUYA 4O1MA 3PWSA 2GR9A 1L7EA 3ZU5A 2VNSA 3T4EA 1LLDA 3KSZO 4JP2A 3WR5A 4CLDA 2VQ3A 1QSGA 4IQGA 2P4QA 4BNYA 3PHJA 1FMCA 3FBTA 4ZQFA 5IFLA 2GN6A 5T8KC 4LRSB 1EZ4A 4QEDA 3LC1O 4RPKA 1MGOA 3ICPA 2R2GA 3JSAA 3W8FA 2ZB7A 4GGOA 3WBBA 3ZU4A 5GZ1A 1IHXA 4TWRA 5B12A 2DBQA 3CXRA 2O3RA 4QFCA 5G0SA 2D59A 4OXKA 1ZK0A 5JAQA 4FBGA 1ONPA 2IRWA 2GN8A 3RU9A 3U4CA 4E30A 2BRUA 3DBHA 1X13A 1DAPA 3AI3A 4EUHA 1DLIA 4MP8A 1BWSA 1QG6A 4E12A 5A3JA 1GD1O 2DPHA 2J8ZA 1ZMOA 5DULA 1KOLA 4PG6A 4DQUA 4AJEA 1ZXLA 2EXXA 4A26A 4BNZA 1KEUA 4XA8A 1E0DA 1ZK2A 2AE2A 4O5OA 1E7QA 4OQYA 3L6EA 3F9IA 2X6TA 2I65A 3ZWNA 4MIYA 2ZK7A 3OSUA 5EL0A 4RQTA 2DM6A 2UDPA 4I5FA 4U6SA 1NQTA 3FSRA 1H5QA 2ZCVA 4K28A 2AQKA 3PJDA 4RGBA 4WECA 4J2HA 1LRJA 4JP3A 3DTTA 5HWSA 5DDIP 3QWBA 1IOLA 4WGGA 2Y0DA 1K2WA 2NU7A 3A06A 1QP8A 4UEOA 1NVMB 3PDUA 4PG5A 1VJ1A 5A05A 3VHRA 3WX0A 2X7HA 4UEKA 4AJ4A 4CQMD 4L0QA 5EESA 4CR7A 2EP7A 2ZJ1A 4UVHA 5BNFA 2NM0A 2ZJ0A 3L6OO 4BIIA 4CV0A 1V35A 3KZVA 4CM5A 1B0AA 1DHRA 2B36A 4XZ3A 4DPKA 1PQPA 1XA0A 1UR5A 3DR3A 2Q2WA 4W99A 4XQGA 4F46A 1GFSA 5KJEA 1J4AA 1SMKA 4M87A 1BXKA 2A4KA 5F3RA 2ZB4A 1HT0A 3KYCA 2EJVA 2B5VA 4GGPA 4WUVA 4TKLA 2VRCA 4RPHA 3HDQA 5L7YA 1HSZA 1HRDA 4BMSA 1PJSA 4HFRA 4LMPA 2EP5A 4ONEA 3R1IA 1K6JA 3H3FA 3JD2A 4PLVA 1T24A 1ML3A 3NGLA 3RUIA 9LDBA 1YQGA 4GI2A 4BKUA 1WVGA 1Z45A 2NTVA 2B37A 1ZIDA 1WLYA 3E9QA 2X4GA 5TQVA 1M67A 3COSA 4OSPA 3ZWYA 3RROA 4IY1A 2PD6A 4M86A 1Q0QA 5CPFA 5CDUA 4NH4A 4Y9DA 2GSDA 2NLOA 2XXBA 4R01A 3VOSA 1XQ6A 3S2FA 4G65A 3RVDA 4KUHA 2C29D 1E3JA 3Q9NA 2WMDA 3VVBA 3EZYA 2VNAA 4II3A 2A9FA 4ZVVA 1Z75A 4LGVA 4AJLA 2A92A 1RKXA 1C3VA 2UV8A 3S2GA 4CMEA 4IGEA 3F1KA 3MZ0A 3L07A 5T8KA 1DXYA 1EVYA 3NJ4A 2JL1A 1LSJA 1GU7A 2OBYA 1H6CA 1XYGA 3NGXA 4BO0A 4CM3A 5B1YA 4DQVA 5C5IA 3FD8A 1TT5A 2X0IA 1ISFA 3NDIA 3RASA 1RM3A 1J5PA 3WGTA 4WPGA 4R69A 3E5MA 3FCOA 4JLWA 4RLSA 4WCDA 2HK9A 2OHXA 3WMXA 1XIVA 3DBRA 4DYVA 3IUSA 5JO0A 3ANMA 3PYXA 1E3SA 5KJFA 1PJ4A 2A94A 1Y6JA 3QA9A 3ANLA 3DL2A 5THKA 5MDHA 3DWFA 4CODB 1VL6A 4HNHA 5JYEA 1NXQA 4EUFA 3NYWA 4RL6A 2CVOA 1W0CA 4CM9A 2Q1TA 3DTYA 2JFFA 4E5NA 4EZBA 4ZU3A 2VN8A 3QW2A 2O4UX 1HE4A 2LDBA 5JAZA 3DQPA 1V3VA 2J3IA 3B20A 3GF4A 3UF0A 2J5QA 4B4WA 4YR9A 3VPGA 5KVSA 1B8VA 4IDDA 5F5LA 4EYEA 5KVQA 3LC2O 2NV6A 3HB5X 5JDIA 3PJFA 1PS8A 2CVZA 3E1KA 4D42A 1A27A 5CP8A 2IDZA 3PIDA 1H6BA 4CLOB 4NR0A 3FRJA 5JC8A 1ZMTA 3ZV6A 4JROA 3H9GA 3I9MA 5DOZA 5LC1A 4A73A 4BKRA 5KKCA 2DBVO 1EE9A 2PV7A 2EG9A 2X0RA 2X9GA 1LUAA 3H65A 1F0YA 4NI5A 3D4PA 3O26A 3DZBA 4PG8A 4D3DA 3L4BC 1R6DA 2EEZA 4FFNA 1Y8QB 4Y8VA 3DOCA 1YWGO 2VHXA 2AXQA 3V1TC 3WLFA 3K6JA 3VPFA 1A5ZA 8LDHA 1B3BA 4W82A 3MJVA 1MX3A 2OO5A 4N5MA 2BMAA 2YY7A 3CZRA 1H2BA 2V6MA 1V6AA 3LK7A 1NR1A 2PZJA 4E5KA 4NMHA 3HB4X 4J4TA 3G1TA 1DO8A 1O6ZA 1DOHA 4JBGA 3ONDA 4J1QA 2Y93A 1BXGB 4I5GA 5G0TA 1LU9A 1PEDA 1Y1PA 3ICCA 4GKBA 4Q3BA 2AG5A 4XCVA 3U0BA 5C7LO 1YBVA 1JA9A 3ENKA 4YRAA 3VZPA 4ZA2A 3QV1A 4NQZA 2FSVA 3ROMA 4BO5A 2BFOA 1ISMA 1B26A 3WGIA 4IDAA 5EINA 3ZU2A 1EE2A 3C7AA 4OHUA 4KUEA 1ZNQO 1HDGO 4UULA 3UXYA 4E33A 2HQ1A 3G49A 2X22A 2PNFA 5H82A 3QVTA 3M1LA 3GHYA 4I5EA 4IIVA 4DPMA 2BI8A 1YH3A 4JQCA 3GMDA 5U9CA 4M55A 2QYTA 1T2FA 2CY0A 4JCOA 3V2GA 3GVHA 4FJ1A 3I52A 3RUAA 1DJQA 3MJEA 2YFQA 1AHHA 1U5CA 3OH8A 4BNMA 2W2LD 2BFPA 1G1AA 3WFJA 3F6YA 4XIJA 1ZJZA 4YRBA 1XDWA 5CFZA 4FS3A 3DONA 3IL2A 3UAGA 3IQDB 4GH5A 4YYZA 4FDAA 3EW7A 4YT8A 4PFJA 1SC6A 3KHUA 3CTMA 3B1FA 1IL0A 1E7RA 3HADA 3OJLA 3RC2A 4D3FA 5G4KA 4TSKA 4FGSA 5IZCA 3O38A 1LLQA 1CETA 4CLHA 3AW9A 1KYQA 3CE6A 3VDRA 2DUUA 4CQMB 3RBXA 4E5PA 3IDSA 4FC6A 4L9RA 4TRRA 4RPJA 4CQLA 4U5QA 3ROKA 1YDEA 4BNKA 5K0ZA 1BW9A 5JCJD 4OYRA 3IKTA 4AICA 5G2OA 5I7EA 3H9JA 3BTVA 4NFSA 4E2ZA 3FWNA 3JQEA 4UVIA 2IEBA 2GPTA 5DN9A 8ADHA 5IDQA 5TJHA 3KEQA 3GHHA 1C1DA 2H63A 4QO8A 3TDKA 1T1SA 4MJLA 4BNLA 3I9KA 4E2XA 2HRZA 2G0TA 1P0FA 4BUCA 2SCUA 3MWDB 1GYPA 4R5MA 4CMBA 4D41A 4E2YA 3B6ZA 3W6UA 4AJHA 1YBMA 4CR6A 4J1SA 4BNWA 4IZIA 2NSDA 2DBRA 3LT2A 3TNLA 4L4SA 3T7CA 3STHA 2OBNA 3L0DA 1W4ZA 3FPCA 5F1OA 1IUKA 4XDYA 1BXGA 4XRGA 4KOAA 2AW5A 4IXTA 4ROSA 1P45A 4PCVA 1O8CA 1EUZA 4D3SA 2XOXA 1K6IA 2RBEA 1RPNA 4DXHA 2FWMX 2BELA 3HFGA 1FJHA 3H2ZA 1GYQA 3VPSA 5U4QA 3WSWA 4YWJA 1YKFA 3VH2A 3QJ5A 5F1PA 2GDZA 2B4TO 4XYLA 3DHEA 1UP4A 5BSGA 2NNLD 1ADGA 1P74A 5EN4A 2FSSA 3GEGA 2DVMA 2OOSA 1TB4A 3SLGA 3VDQA 3ZNQA 4BO7A 1GTMA 1DAOA 1ZXBA 5T6BA 1U3VA 1U4SA 4RF2A 2H9IA 3RUFA 2Y1FA 3LU1A 5EIOA 2AQ8A 3FPLA 2PFGA 3GMSA 4BO1A 3E6AA 4R5HA 1NP3A 3AI2A 4UUPA 4Z6KA 4PIVA 3SBOA 1XR3A 1U8XX 1U4OA 3AUSA 4LK3A 4R1UA 3P7MA 4OXYA 5KJ6A 4YQZA 3IS3A 3PQEA 3IIEA 5THQA 3ZI0A 1ZBQA 2PD3A 1ZSNA 3QRWA 1DIHA 3EGOA 4MOWA 5G4KB 3VZRA 3CPSA 2EKPA 3RAJA 4TVOA 1LJ8A 3JQGA 3WQQA 3AOEA 1D7OA 3PIIA 1UZLA 4Z9FA 1F14A 3HJAA 3GNQA 4CMKA 3U4IA 2D0IA 4O63O 1Q7GA 3DAGA 3AJRA 1JWAB 2V6GA 4YJDA 5EJ2A 3ORFA 2V65A 4YB8A 2ZKLA 4F3YA 2VYNA 1LLUA 5IZCC 2PZMA 1O94A 4M49A 1GZ3A 2ZTVA 1KETA 1N1EA 4B3HA 1NASA 3ZW8A 4YJGB 2VUSA 3JYOA 5GMOA 2Z1MA 4LRTB 1P0CA 2OORA 4MVJP 1NVTA 5AXBA 3UH1A 2DTEA 4NNJA 1ONOA 3WBFA 1Y9AA 5A9TA 3R0IA 4OL9A 4WK6A 1YXMA 3GPIA 4S1VA 2HO5A 2AEMA 3PDJA 3U3XA 5U1PA 4KQWA 4L76A 2QHXA 2GD1O 4E0BA 3JQAD 4XYMA 1DIBA 2WYWA 3HN2A 4R54A 3NT5A 4F6CA 1T4BA 1XLTA 2NTJA 2Q2QA 3R3SA 3BA1A 4YJHA 3W4IA 1HE2A 2O2YA 3TPCA 1E3LA 4FSHA 3GT0A 5I9LA 1NFFA 3GC6A 2WYUA 1DLJA 4XR9A 5JC1A 2GUGA 3GDFA 3DOOA 1TEHA 1KVQA 1U2GA 1V9LA 1EEHA 1R4MB 3BIOA 3HE3A 3KEOA 1I3LA 3MCVA 4RDHA 4CJXA 1AE1A 4J9UE 1BVUA 3I23A 1Z6ZA 3ZGYA 1WZEA 1TVEA 2D8AA 4A5OA 1E1NA 2R00C 1UXHA 4XYEA 4EEXA 1KBZA 3UW3A 5ITWA 1H93A 3WICA 1XCBA 4XQ9A 4EITA 1NFQA 3JQ6A 4HNGA 2JFHA 4D0RA 2C5AA 4RPGA 5TIIA 1BDBA 3GRKA 5GZ3A 4BS9A 1E7YA 3QE3A 2W98A 5BNIA 1LDEA 2X5KO 4WEQA 4DIBA 4IDFA 5JY1A 2JHFA 4D45A 2BH9A 4DTIA 1UZNA 3E82A 1GEEA 3JQGB 4XGNA 3DBLA 1FXSA 3RKUA 1Y7TA 2BGKA 2PWZA 4KZPA 1ZEJA 4J1TA 5A9SA 4FFOA 1I24A 4ID9A 4YCAA 4DIFA 3D64A 1U8FO 4BNJA 5A04A 1VM6A 1YO6A 3VKUA 1E7SA 3FI9A 3CMMA 3FF4A 3QP9A 4ZHSA 4NG5A 2CDCA 2P68A 2Z5LA 3GY0A 1MB4A 3VH1A 5BR7A 1U9JA 3ONFA 4TZKA 4XWYA 1X1TA 2V6FA 5B4UA 1O9BA 2E82A 2WDZA 3ENNA 1WNTA 1X7HA 3GGPA 4DIOA 1MV8A 1I2ZA 1LSUA 3MOIA 4DLAA 1XEAA 1NPTO 1WPQA 2FR8A 2JHGA 2X1HA 4LN1A 5L53A 5B4VA 3F1LA 3T7EA 3NUGA 1DFHA 1L7DA 4YJGA 4LISA 4QQRA 4WCFC 2OZPA 3QQPA 4BO2A 4J3FA 1U5AA 5JMPA 2GNAA 2YV3A 3DMTC 1H9BA 4P4LA 2D1YA 3KUXA 4KDFA 3F47A 4IBOA 4GSLA 1LSOA 1ZH8A 3NAQA 3OF2A 1RM4A 5JXWA 2HK8A 1E3EA 2HMWA 2H5LA 3ZNNA 1DRWA 1E3WB 1CDOA 1LDNA 1HE3A 3EZLA 3P5SA 3WGZA 2O3QA 1U1IA 2FP4A 2P91A 4PVCA 2QIOA 3WGHA 4RVFA 1QORA 4MVJE 4CV3A 2EJWA 1DRVA 1E1LA 1F17A 3GOHA 1NQAO 3OFSA 3PPIA 4P38A 5TC4A 4YJHB 4CPDA 3BMOB 2RCYA 1ZSYA 3V8BA 4D7AA 3PGXA 3K9QO 1DJNA 4A03A 1GEGA 4NJMB 1D1TA 3G79A 3UGKA 4ITUA 1QYXA 4KTVE 1G0OA 3JD4A 1D8AA 3ZWOA 5FEUA 3D3WA 4OM8A 3ROQA 3OBBA 5AXCA 2Z1NA 3SJUA 4DLBA 4NBWA 1T2DA 2WSBA 5IXYA 4XIYA 1R4NA 2C59A 3GAZA 4M89A 1M6HA 5JE8A 4K1LA 1I30A 1BXZA 4U6QA 3HSKA 5BT9A 3C1OA 3DZHA 1TXGA 4B3IA 2PGLA 4AJOA 4OOEA 5JLAA 3EVNA 4JNKA 2PK3A 1LI4A 4E3ZA 1XGKA 2BGLA 4CV2A 4CM9D 1WP4A 1B7GO 3DDNA 5IDYA 5DCUA 1UH5A 3E9NA 4PZCA 3I4CA 3WXBA 1Z74A 4XYBA 4GVLA 4B4UA 1HDZA 2BKAA 3DBLB 4AJNA 4J49A 1UP7A 3AM3A 1E1MA 2QQ5A 4RQUA 1T2CA 3G17A 3E5RA 4IMPA 2NU6A 1J6UA 3JD3A 3ZDFA 1V8BA 4BV8A 2VOJA 1NNUA 3MJTA 3GR6A 2RH8A 1IULA 2EERA 2I3AA 3JTMA 5J23A 4AJ1A 4QECA 4ALJA 3FTPA 4J16A 3PTZA 1I3NA 4A0SA 5JS6A 3V2HA 1E92A 1I2BA 3WYBA 4ZQBA 3TFQA 1VL0A 4BNIA 2WD7B 4PLFA 3JQCA 3JV7A 3BMNA 2D3TA 5ICMA 3C7CB 1U7TA 2P5YA 4AJIA 4YACA 4BGVA 4OJNA 3PP8A 4MVJM 1FDWA 4YBZA 2I3GA 1ORRA 3RFXA 2Q1UA 3Q3CA 5L45A 3RCBA 1KVTA 2Q50A 1ENZA 4R1SA 1PJTA 5DP1A 1ULUA 5CDGA 2FPGA 3K2EA 3TL3A 5KTKA 1VE9A 2J5RA 2DPGA 2Q1WA 1HDOA 3ANNA 2JCVA 1EFKA 1SB9A 1YQXA 3D7LA 1E7MA 1O0SA 4LVUA 3WDSA 1OAAA 4FFPA 1HLPA 1HWYA 2RHCA 1GL3A 2XPCA 4CM4A 3HUDA 5JBIA 1P77A 4E13A 4M54A 4Q3DA 3CSDA 3GVXA 1MP0A 2AA3A 4MP3A 1EUDA 4RVUA 5TT1A 4Z0TA 3BMOA 1LQUA 4UVGA 5IAAA 3G3EA 3BZUA 1N9GB 1R0KA 2IYOA 2Q3EA 3H5AA 3OA2A 5HA5A 3IAHA 1I8TA 3PJEA 3JQFC 1OBFO 4UREA 2NVUB 3WIEA 4BV9A 4DBVO 3RD5A 5G4LA 3PWZA 3JYLA 4HBGA 2X5JO 4HUJA 3NDJA 2Y1CA 1S6YA 3RI3A 1QYWA 2CSUA 1JVSA 2W2LA 3BMCB 3VVCA 1HF3A 3DZIA 2ET6A 4D0SA 1N1GA 2JD1A 3ZWXA 3NV9A 1GV0A 5EQFA 1H0KA 3I6QA 2I99A 1HEUA 1IYZA 1HZJA 1OFGA 2CF5A 3TZHA 3TWOA 2GZ3A 4JJGA 2G76A 2W8ZA 3GVIA 3KXDA 3OQ6A 5FI5A 4B7CA 4J0FA 3F4LA 4I9NA 3VH4A 2VZ0A 4UAGA 5IG2A 3L4SO 4GX2A 3W4KA 1SOWA 1Y5MA 5CG1A 4HADA 1OOEA 3ZWPA 3U09A 4Y6SA 3ON5A 1JAYA 4DVJA 3NT4A 1QRRA 1E77A 1NPDA 1EVIA 1XKQA 1V3UA 2E37A 3H8VA 3L4BA 1EK6A 3ZV4A 4BNTA 1P1KA 1P44A 5CAEA 5DZSA 2RHRA 2LDXA 1JKFA 5KIAA 2O50A 1LQTA 4G5HA 4WNIA 1ISIA 1YL6A 5JDCC 2B69A 3LQFA 2HJRA 3N7UA 1EUCA 3A9WA 1M6WA 2WD7A 4L75A 2YV1A 4QFDA 2HUNA 2P5UA 5TS3A 1B8UA 4BB5A 3KM0A 4Y6RA 2WE8A 3FR8A 1SO8A 4WLOA 4LCEA 5JPIA 4CM7A 4CQMA 2IEDA 3KYDB 4FCCA 1GYRA 2IXAA 1U3UA 4YDRA 3M6IA 3QVSA 4P22A 4BO6A 1Q0HA 3GPDG 3RU7A 1O95A 5JY6A 4Q3CA 2CDAA 1KVRA 4OAQA 1VKOA 2BFMA 4PLPA 3S2IA 3WOHA 2QG4A 4RF5A 4DL9A 3EY4A 3PQFA 1K5HA 1V0JA 1P1JA 3ETEA 1SNYA 4DREA 4CR8A 4WOKA 1JKJA 2PD4A 2PKRA 1DC5A 3VTFA 4WEOA 5ITVA 2Q4EA 5A5EA 1AXEA 3RC1A 4E21A 5L7WA 2VHZA 3EK2A 5DOVA 3E18A 1N7GA 2QZZA 4WLUA 4JIGA 3U62A 1SZJG 2EKLA 5AVOA 4IPTA 3UCXA 5IN5A 3B1JA 4E5MA 1QYVA 3EUWA 3GRPA 4H16A 1JTVA 3BTUA 2YYYA 4Q3EA 1YL5A 4NJOA 3B1KA 4ZQHA 4CMJA 4GBJA 4AJPA 1JLLA 2OGUA 4BGEA 4JBIA 3RKRA 3ZWCA 4R1TA 5AYVA 1O5IA 4BNGA 5IDWA 1YL7A 5L4NA 1YJQA 4NBTA 1CEQA 3SXPA 1FDVA 4W4TA 4A2CA 3SC6A 1CQJA 2I6TA 2I9PA 3EC7A 1XG5A 4O0LA 3DZFA 1EBFA 1PGQA 1QMGA 5DCYA 2BFAA 3U49A 2Y66A 3KLPX 3OETA 2VRCD 4H3VA 4YVFA 4XRRA 1TT5B 3UCFA 2VUUA 3WTBA 2DC1A 5TLSA 2POQX 1PS0A 1ENPA 1F12A 5DBFA 2O23A 4WJZA 4OO3A 3OIDA 3MWEB 5A02A 1ZK4A 3ZWWA 9LDTA 2O3UA 3Q6IA 2ZATA 1PJQA 2BHLA 4EBFA 3UUWA 2WTBA 1IZ0A 4WASA 1R12A 2CVQA 2FPPA 2EWMA 4GWKA 3I9OA 4CUKA
chains in the Genus database with same CATH superfamily
3L7DA 3W5AA 4KQ1A 4LZPA 1A2QA 1G6KA 2FUKA 2HO4A 4FOOA 5KO2A 1PWXA 1UZAA 3BXEA 2F55A 4P4SA 3X1WA 4G01B 1TJ4A 3BHMA 3H0EA 3PFCA 1NLYA 3FVQA 1V3QE 1C3OB 4L4YA 4R1LA 3MB5A 1R0SA 3OOHA 4EECA 4F93B 5HK9A 4DPLA 2A5DA 4BQSA 4UTRA 3CZMA 1YQDA 4M1QA 1I7LA 1N2GA 1SCDA 2VNHA 3PX2A 2FPIB 1ABFA 1RHJA 1Y5RA 2HGSA 2Q9AA 1P81A 4WFQA 2PSEA 3ZGNA 3QBTA 4IX1A 1W8IA 4ZP1A 5EQJB 5LN1A 1GTZA 5CT4A 3E15A 1FFAA 3N2EA 3EZXA 2VWHA 3C45A 5FOSA 2C2XA 2IPAB 3RUCA 3Q4GA 4RY9A 1PL0A 1HNXB 1JIQA 2B4KA 2Z83A 3WLSA 3LPAA 4WVFA 2CMHA 3EYAA 1G1MA 1ODSA 1DIGA 2RHBA 3LUHA 4IZHA 3K0FA 1T5LA 1FOEB 5A06A 2XKKA 1SXJA 1Z2AA 2GEJA 3E9EA 3GFQA 1OWOA 3M5DA 1KJNA 3PENA 4ZQGA 1KSHA 4BNVA 4UM7A 1Z0DA 4MKFA 5KUTA 2FRDA 1G9TA 4ZPJA 3RG2A 1OZAA 4ZYXA 1UDRA 1V9SA 2CJPA 3CINA 3BH6A 4IF6A 4PICA 5CUQA 2V3CC 2EQAA 4UOEA 4YAOA 4C2UA 4ZCLA 3C5VA 3TVDA 3T1NA 1GTRA 4L51A 5KOIA 2OSVA 1Y4UA 2JI4A 3L18A 2LCFA 3V1LA 2QMOA 3KL4A 1GXSB 2ZIAA 3PICA 5C34B 2O06A 1K4MA 4J76A 4DANA 1RWPA 3EBPA 3OSZA 4Y2HA 5DGCA 5K8TA 2NO6A 5DLEA 3LFHA 1RXWA 4NXMB 3Q8WA 3BAFA 4A36A 3VHXA 4Z4GA 4KR6A 2PS0A 5SICE 2PSDA 3KSDO 1B2LA 3L0SA 1N5OX 5EFZA 2J6CA 3UHOA 1TEZA 1UJ2A 4Y2JA 3AHGA 1SCQA 1SK9A 1TT7A 1VLQA 4A1FA 3QUCA 3ZYCA 2JS7A 1EGHA 4M60A 3E03A 6GPBA 3D2AA 2R1TA 4HP8A 1HEYA 3ND6A 4MLCA 3GYBA 4CKEB 4I50A 4RF3A 1LBTA 3H7AA 1OBOA 5ITZA 3INRA 2O8DA 4V1CI 2OAQ1 3M89A 4N5NA 1IM8A 1E2QA 1N0UA 3BORA 1E9RA 2BZGA 4RPIA 3RHZA 4KMOA 1YZHA 8ABPA 4M53A 3RBVA 3TSWA 1FBTA 2D5AA 4MW2A 3LK6A 4EDFA 3EGWA 1JBQA 3KOUA 5GZ6A 1EXVA 4QT0A 1G4HA 3G8AA 1GQ2A 3PNPA 1P4RA 1Z7YA 5GWXA 4FHEA 4CRWB 2ZUSA 1C3JA 3KQLA 2C3OA 3Q41A 1OMOA 4XWAA 3DHVA 5FAXA 5C4GB 4IHJF 5BR4A 1G7TA 5CLIA 5HQ3B 4UXIA 2VHVA 5IYZF 1UL1X 1VI2A 3U7QB 1KGDA 4B3RB 1C14A 1TKBA 3LHKA 4LMBA 1RPAA 2C92A 4JEUA 3ZHZA 1W88B 3L1JA 4R3NA 5KQSA 4RKFA 2OZLB 3C8MA 3GO4A 1GAJA 1NWHA 1P4SA 3SQDA 2OCIA 2Z98A 3K0AA 4GPTA 3LUFA 5FNVA 4CLRA 4ABTA 4E5SA 4F5WA 4YTEA 5AVJA 3T0IA 3X2SA 1TM7E 1KK3A 2GEUA 1NMXA 3I4LA 1MUUA 1TDJA 1G8MA 4L4UA 2Y4OA 3EXIB 3JQ9C 3STTA 3RTCA 1MENA 3BCUA 3NTUA 1GUFA 1THMA 5F2NA 5KVAA 4W5RA 4HDAA 3TLCA 3DHYA 4KMRA 4WZ6A 3L43A 5JU6A 4G41A 1VCHA 2HA3A 1D9ZA 1GCUA 4YCDA 2G25A 1CFZA 1WIWA 4U2GA 5FP0A 2DZDA 3AG6A 5JH7B 2DHCA 1BA2A 5E6RB 4QOIA 3O3OB 1E2HA 4EI8A 1XZNA 5C8YF 4N40A 1D04A 3BXGA 3K6KA 1OBVA 3DCJA 3KWMA 4HNRA 3TR6A 3T1HB 4QPCA 3OJCA 4LDJA 3AL0C 1G6OA 3IPAA 1QZZA 4YK7A 1O77A 2XMPA 4N18A 3LP6A 1HM5A 3O7WA 3DO6A 1I2CA 2ISCA 2X8LA 2PEYA 5I9TA 4BO8A 4DG8A 3ZDCA 3ZY5A 4RH0A 2B20A 2OCKA 4KACA 4N8SA 1MIOB 4QYXA 2RGWA 4ESEA 2W6PA 2CFCA 4DGQA 4HVCA 1T9BA 2DMRA 2Y1DA 3P0EA 5IW8A 1QKIA 4UHKA 5HFAA 1L7BA 2FPKA 2WFMA 4CU2A 5JW6A 1S9DA 1IG0A 2B61A 1H6AA 2I3ZA 1WF3A 2RSLA 3LBYA 5DM2A 3K15A 1KZHA 3V8QA 2QG9A 1GQYA 2EP8A 4ZK2A 1R9GA 5DTIA 2ZI9A 3CUKA 4PGHA 4JLPA 1K4KA 4J0KA 3V1UA 4YV1A 2Q7OE 2WTUA 2QJRA 3KT0A 2I4TA 1SKQA 3EXHB 3PFWO 3TQTA 4EATA 2R1ZA 1Q92A 3BB3A 2C2YA 5HKAA 1F60A 3OI7A 3PLNA 1Z6QA 4Y2XA 4ALLA 1EVZA 1XI2A 2OV1A 1UDXA 5H4GA 3F46A 1OIXA 2D1FA 4ID3A 4MW9A 1K6MA 3L3BA 3VPCA 4K9MA 4YDHB 4PX5A 2YJ5A 2FDXA 4ZYZA 2ID8A 1XU4A 3NIFB 2PBLA 4HB4A 4QYSA 3B2NA 3KEFA 3T61A 1ZCBA 1SEPA 3O95A 2G6TA 3V00A 3G2HA 1AY0A 2C4MA 2JIZD 3TJRA 4FB5A 3I61A 3LC0A 3IHWA 4CNQA 5DN6D 4TWJA 3ZDZB 1NN1A 4HX5A 2JEZA 4JHLA 1CC1S 1PTJC 3REQB 2DPXA 3VNBA 1GTL1 2W90A 3KB1A 4BATA 1PU2A 2R7KA 4C6HA 4EQ6A 4HWOA 2R44A 1V43A 3WK9A 3BMQA 1N0WA 5AXDA 3UOGA 1V5EA 3G2PA 3K5HA 3R0ZA 4GP7A 3GWZA 3D3EA 3K0SA 2FUG6 4Y2UA 4G8CA 1CNFA 5HE9A 5CFOA 3I3OA 1ODCA 4ALKA 4PS0A 1Z2PX 3LUKA 2JDIA 4EEKA 2L0XA 3CPHA 3EXEA 1FLNA 5A4DA 3AFNA 3M6UA 3ONEA 5AESA 4KMSA 3X0DA 3TB6A 2F7SA 2X8JB 4DMUB 2IZ7A 1CUHA 2V9CA 1Z0KA 2NQTA 4BYMA 1FDRA 1CQWA 2QX8A 3OHSX 4INOA 3K8ZA 1PSDA 2Z08A 2C2WA 4YCJA 1DRJA 3ZJTA 4IICA 1P4AA 4DWVA 2ETVA 2E89A 2IT1A 2NZ2A 5EHXA 4HRYA 5KKNB 4LA4A 1Y81A 1CULC 2AMFA 2V03A 2KW5A 4S05A 3C1AA 3WY9A 4ETMA 1N7HA 4PZ0A 4S35A 1KQNA 5JAIA 2BR3A 3BHJA 2QDKA 4F85A 1V2HE 3HZZA 4C4ZA 4DDUA 5A4FS 1Q17A 4FINA 4DC9A 3B5JA 1EIZA 1QZ3A 1OXMA 2G63A 3M1YA 5AI8A 2R8RA 3GJ7A 2WVJA 3L9WA 3O0DA 4BTEA 4FX5A 3MRSA 1CRPA 2E1RA 4LY6A 3VNAA 3GEMA 4ENPA 2GVZC 3JQ9A 3KUKA 4AP9A 1S1MA 4J3JA 4P7FA 2EF1A 4R9RA 4RC9A 3MGGA 4C87A 3JAWA 1SZCA 2H3HA 4UVEA 1MG0A 1Z2OX 3EWNA 4G84A 3TLGA 2DFVA 4ILEA 1T4DA 3FDFA 4IG9A 9ATCA 1C7ZA 1UKZA 4CDRA 1C30A 5JVDA 4RX1A 1XTQA 1P2VA 5DJ5A 5EZSA 1IJKA 3UWOA 3CF6R 5AHOA 4YMHA 4HEA1 1NULA 4C0HA 1V1MA 5HEKA 4NEQA 4UQLA 3T8YA 1UT8A 5EY5B 4BC1A 1OTXA 1VB5A 1RTTA 3V7UA 2WD8A 5L7TA 1CJVC 3TKYA 1FVOA 2QY6A 1XMVA 2VHWA 1IUPA 2HJSA 2IY8A 2Y0BA 4B7ZA 4JT4A 3F5SA 3VYRB 5TT0A 2ORWA 4A8JA 3Q15C 2NUAB 1GRVA 3DKRA 2J6HA 4QDUA 3AU9A 3D4BA 4IUCS 4LKRA 2ZVDA 3OF3A 5DNYB 1PR1A 1E3TA 2RGUA 4K46A 1M2JA 4INZA 3A3PA 3BXFA 4OX9Y 2E4XA 4XD7D 4C0WA 4J94A 1EVKA 1TAGA 2QRLA 1Q84A 1I3MA 2AGVA 3CWQA 3DO8A 3Q2KA 2IUUA 3AZPA 2JI6A 3HCEA 4KIUA 1NQXA 4RM2A 1KEPA 5CA0B 2PJRA 2CEAA 2AEEA 1LC3A 2I78A 3A26A 1XU9A 3CLRD 3H5WA 1LDYA 3L01A 1MA0A 4HS9A 1L5MA 3ZNOA 4JYCA 1T0BA 1HLDA 4DZTA 4DEXA 4MDHA 1JQJC 4R68A 3PCTA 2OV8A 5IMSA 1KI1A 3I37X 2GAIA 3UY4A 3CG0A 1VIVA 3PQ3A 2RHWA 3BTOA 3R4CA 5ECDA 5ADHA 1VECA 2XUDA 3MVEA 1T0JB 4IJKA 4GLBA 5B3AA 4IM7A 3RC7A 1WEHA 1E7WA 2Q5JA 2J9FA 4OM7A 3ZIAA 4OQZA 4Q3NA 1Z9BA 1R37A 1L6RA 5C0OE 4BTLA 5G3YA 2QJTA 2VH2A 4KWHA 2RGGA 2A5LA 2UUPA 2VXCA 3AEUA 4IUBS 3T1QA 1IEWA 4BMVA 4EGFA 1GITA 4EPYA 1BU5A 2JJMA 4N7RA 3CIFA 3EHDA 3ZEAA 1TVCA 4UQOA 1T6XA 2ZRFA 3ZIAD 4XJSA 3PX7A 1DOAA 2K2QB 5AICA 4D4LA 1QH0A 2HU8A 1N3LA 2IY9A 4PVDA 4PAOA 3CO0S 3KIPA 3O8QB 4LMAA 1EWYA 5FFMA 4QYWA 2GN1A 3ZHTA 4IINA 1JQ5A 4PO1A 4S3MA 3V97A 4NFYA 4RD3A 1DC6A 3CX6A 4B0OA 5AFSA 4Q6WA 2O5RA 2Q49A 3H5VA 2O0LA 1GPBA 4PCUA 2H31A 4YWHA 3FPSA 4PYLA 5BN1A 5H9WA 1QXSA 1G5HA 2O9JA 3BH0A 2AC7A 3LV8A 4FEGA 3KZ1E 5H3HA 5T64A 1I3OA 1U2RA 2WEKA 4YX9A 6AT1A 5K4GA 4JYAB 3FR7A 4TROA 3R6TA 3RFTA 2O2HA 3EHEA 5ILGA 1YI8A 5A4KA 4RFVA 5CB0A 3PJRA 3O84A 4NU6A 4LWZA 5CXSA 4DCOA 3TIIA 1KR2A 3NHLA 4N41A 4GBMA 4L4XA 3L6RA 3WQRA 4J07A 3LF1A 3OFJA 3RRBA 1EX6A 1FVHA 1A5AB 3QFFA 3VR2D 3PC2A 5B37A 3UAWA 1RC1A 2J67A 3E5NA 3NX4A 1R9NA 1Z3IX 2PSHA 3L6UA 3LWBA 2IA5A 1FS5A 4KAJA 1RQLA 5COAA 1SHLA 1YS9A 1NX9A 2IHJA 2QTFA 3HL4A 4D02A 3TSCA 1YVPA 3MEQA 1UPUA 3ZV5A 1RZRA 3N75A 2YY5A 2O05A 4IVPA 3OT5A 1XZBA 4MGEA 1HORA 1N6PA 2GWHA 2P77A 5I4IA 1ODIA 2NU9A 3G2JA 3CVYA 1W44A 1JMKC 1CZNA 5E9QA 1QV6A 5HS6A 4WN3A 3K73O 3QTBA 4H6WA 3NTQA 2C00A 4FILA 1MQ9A 4XDHA 4O33A 5DLYA 1E64A 1S9HA 3CUSA 1DTSA 4UDOA 5HKBA 3NBFA 1L5NA 4MHTA 1ZJYA 2NX2A 1RWVA 2FXIA 3D6VA 5EJIA 4H6XA 2EX1A 5EWJA 2GGSA 4AUEA 1IPFA 5DXJA 4L4ZA 4M9ZA 1PZMA 3CBQA 5CDFA 3CF0A 1J1ZA 1BYUA 3R8FA 3B5IA 2A67A 2P9FA 3E9DA 3FMFA 3PNMA 2VBFA 1Z8DA 2OHOA 3CM0A 3C6BA 3D8TA 4JEIA 3SFTA 3S2EA 4F4DA 4H0NA 2YX1A 5ED0A 4XWOA 3D81A 4UMDA 3WLEA 3M2TA 5JSHA 3WMRA 5F5NA 2C42A 4CCYA 1L5YA 3CQ9A 4RHUA 5HVNA 5LBTA 4URXR 4ND2A 1EFLA 3TNJA 3WLIA 2PBFA 5KHAA 1BTOA 1ELOA 3NHBA 1TYEB 4WLNA 4RF4A 4I3HA 3DEAA 5IN4A 4Z4EA 4PLGA 3EVEA 2ZWOA 4MUNA 2VJQA 5FL7D 1UMBA 3VISA 1F6WA 1ZCAA 2XUPA 1T3GA 4WZBE 5HKOA 4AJJA 1DX9A 4RGVA 2DBZA 2C0PA 4Y7DA 2JFBA 3O4RA 5L3RA 5IS2A 3MOGA 3H2GA 4YLEA 4H6PA 2YIDA 4QYMA 2IX9A 3PJGA 1ZUHA 1D4ZA 3QMMA 2AFVA 2QUHA 3ZVMA 1ZK3A 1IY1A 2F9MA 5K2MA 1M0EA 4DKJA 5KYKA 1V26A 1IOZA 4M36A 2CHEA 1LI5A 4Z3DA 3TBHA 4OOFA 3W2EA 1XN4A 1AMOA 4AIRA 2HA7A 4RHYA 1I0ZA 4IUDS 2C4HA 1VKNA 3DLTA 1TEXA 1NU8A 4RTLA 1RYEA 2XUQA 1MC4A 2JFGA 1BE1A 2VJKA 1OA0A 2ZIXB 2ZPUA 2WM3A 2CVPA 3L8EA 2B4QA 4J0CA 1F8UA 3JQ8A 3C4VA 1ISGA 4KKVA 3DYBA 2X1LA 3KKQA 1P72A 2VYND 5AOBA 2DT5A 1W8DA 1J42A 1UFKA 1QANA 1LLCA 2C07A 4TMXA 5I6DA 3S3TA 1V5GA 1SKBA 3D4LA 4G1FA 1E2EA 5E4FA 1YRLA 3X2FA 4YROA 4EG7A 2CFTA 1AUXA 2WV7A 1UBRS 3DMNA 4FNOA 4HB0A 1PJBA 4IJUA 3ZQ4A 2OENG 1K7EB 3U3MA 3EVFA 1PRYA 3O74A 1S3FA 2PKQP 4LJRA 1I1HA 3B82A 1DWOA 2H18A 5D3KA 2GCGA 2HK7A 3RABA 2L19A 3IA7A 2HA4A 4RA9B 5GIOE 1CJSA 2YMMA 3AP3A 4ZT3A 4JLVA 2A35A 3A6HA 4NS1A 2JEYA 3DBRB 5JD4A 2BW0A 5HDQA 1I5RA 5IEBA 4OHYA 2IX3A 4D44A 1JUDA 3H0KA 3JZMA 3TE7A 2NZJA 4EIWA 1DT3A 5KX5F 4Z3KA 5KWEA 3DB1A 5J4KA 4CEHB 1FTYA 1EFVA 4L15A 3JD0A 2LCQA 4P7BA 3PFFA 4C78A 1QO0D 2V7GA 3B2EA 2AL7A 4PLHA 1UKYA 2QI9F 3RIHA 3WNVA 4BLUA 3O3NB 4HSGA 3M4ZA 4JUDX 2XE6A 1MC5A 4MRNA 4QUJA 1RD4A 2M6KA 4EJ2A 1VDZA 3L0CA 3PQDA 4LAFA 1XZMA 3Q8XB 2AOVA 4OIMA 2Q2VA 3HJBA 2IIBA 3WB0A 3H11B 2DPMA 1SKAA 1H2AS 3D1JA 3DL7A 2WWWA 3KYDA 1WDWB 3QBVA 4ZPXA 3IC5A 3FCXA 1QLJA 1F3OA 2VKQA 2YQ4A 3OURA 1FU7A 2ZRBA 2YWRA 4UFNA 4AG6A 5KS2A 5LOVB 1S8FA 1KAOA 3QV2A 2RK6A 2YTZA 5C7IO 5KTOA 1P31A 3WA6A 3L7NA 5DGHA 4FU0A 4DCUA 5AD1A 1CUVA 1NOIA 3JATB 3GIWA 4LNUA 4DIUA 1XRRA 4GLLA 2BAGA 3K1AB 3TEFA 1S2IA 3UBMA 3BMCA 3D8NA 2XYVA 3AB7A 1Y4ZA 3OEYA 4PLCA 1Z5PA 2VFAA 2ZSHA 4MI9A 3ZCUA 4DXDA 1YOVA 3I83A 3KTOA 4G5SA 5A6SA 3THYB 4K9RA 1C9YA 3TOSA 5FH9A 2PVCA 3C3XA 3KVNA 2H5IA 1ZD2P 2CV2A 2AKEA 4YMGA 4RNDB 4XEUA 5BNTA 3VUEA 1AZWA 3GUCA 1ODFA 2VHUA 1E2NA 3BVPA 3MCTA 3OJ0A 4AM8A 3N87A 2Z6QA 3M9WA 3AEZA 4RU1A 1GCGA 5GM1A 2WVHA 5C37A 4EF5A 3A9TA 1OWLA 3V2UA 2O2GA 1NJ5A 3BD6A 2IF2A 2W4QA 5B53A 4OH1A 2JH3A 3KPVA 5AJZA 5D5HA 2VTBA 3TLJA 2VR1A 1VLLA 2IXBA 3GGOA 4JZYA 4RAQA 4TS4A 1SPBS 4G6ZA 4PPGA 5CJPA 3WZLA 2BBTA 3RRXA 4QPDA 2NP6A 5FYDA 2ZRMA 1EHYA 1TAUA 1QRSA 4FFBA 4JJ8A 2OFPA 5CYFA 5DYYA 1JEOA 1QH8A 5LMZA 1BH6A 1WXDA 3A28A 2RGAA 3H86A 1WZUA 2HHAA 3CLRC 1G41A 4U7FA 3JTEA 2RB5A 1W36B 1EUCB 2Z2XA 1H3EA 1RCUA 3AESA 3PQCA 2AW3A 3FOEC 5DNCA 3FB1A 4C0XA 5KVVA 3ZXXA 2FMTA 3DAOA 5FEMA 1E1RA 3IHTA 5DBEX 3WL7A 2VJLA 1QAMA 1PK7A 3LCMA 2P41A 3UT5B 1OIWA 2BISA 3I62A 5KSYA 1LH0A 4ASUA 2LXNA 2E0IA 2C8JA 3INTA 4D3YA 1OI7A 4PANA 1R0XA 2FQYA 4WXEA 4BVFA 5BPFA 3VAYA 4UPEA 2HMAA 2B8JA 4IHKA 1TX4B 4LXQA 4OYHA 3ASUA 5CHEA 1PFVA 1HFJA 2A5JA 1M6VB 3CH6A 4A0FA 5EQDA 5ALUA 3N2GB 4HLUA 1RWBA 2IGTA 5CHYA 3R7AA 3WYAA 4DMHA 5F23A 2R7AA 2GJ4A 3GA0A 3PRJA 4B4VA 4EY4A 1CFJA 4Q9IA 4TXJA 3IDOA 3MJ4A 3NYRA 4KGDA 5GOTA 1U7ZA 4M38A 1NUUA 4MTLA 1YS4A 2B7BA 3KSAC 3OLYA 3UJDA 1I7PA 2WILA 4OK5A 4ENQA 3HTXA 2VAXA 1Z2NX 1EYZA 2IGBA 2ZTUA 3B78A 4MEAA 1RFLA 3AETA 1THZA 2BJVA 2CUTA 4C89A 1JEQA 1TC2A 1OGJA 5LP6B 2VI5A 1JYEA 5WRFA 1MFPA 4IJWA 3ZC3A 4OJMX 4F2DA 4GWLA 2BFEA 3B3QA 2IS2A 3LBFA 4CLXA 3P1JA 5C1OA 3INYA 1ES9A 3SSOA 2WG2A 1XEWX 4FZJA 1V5IA 4P35A 2GN9A 3SIWA 3PNOA 1P9LA 2LUOA 1OCEA 2E85A 1T15A 3HDTA 3PNSA 1WQ3A 2D1RA 3HPQA 1UDBA 5BT8A 2XDYA 1KJ8A 2E48A 6REQA 1SXJB 4NYMQ 2VRWA 4BQEA 5E9WA 3RSSA 1ODKA 1SD5A 3VR6D 3RJ5A 4DF3A 5FUXA 3HDHA 4HGRA 1SKUA 3AERA 4X1OA 1PUXA 2B9VA 4O29A 3UGTA 2AC2A 3LLUA 5JSFA 2WTNA 5EJ6A 2BMDA 4RV5A 2QBYB 2PLRA 3DXXA 2XCUA 1Z18A 4BX3A 4NIMA 1CY0A 2WYHA 1TF7A 1QM5A 3IRVA 4LXIA 3R9XB 1BMTA 2QGNA 3CH5A 4TXMA 3A04A 3NCHA 1ZJ5A 1K3UB 4IIUA 1NKTA 4KXNA 1KFCB 1VLHA 3TOXA 2EQ5A 2V0GA 4S0ZA 1DKPA 1Z35A 3H7IA 1JFVA 3S5JA 1KFBB 3MWEA 1GGHA 4W1QA 5ENVA 3AUFA 5HK8A 3V4VB 1Y8RA 1YB1A 3EEBA 3KWLA 2YJ6A 2RH4A 5CH3A 4F3NA 3KELA 4GSKA 3IUPA 3UMVA 3VVLA 3VR5A 1KYIA 4REOA 1VSUA 4MIEA 1XFDA 1WW2A 1N57A 2OXCA 2FZEA 1XJWA 1ETHA 4RK4A 1F8XA 5EERA 1M2FA 4OU4A 3RSGA 3KJZA 4IF4A 5LZ2A 1LGYA 1B0ZA 1JLHA 3C74A 4D43A 3VJMA 2G77B 3QA3E 2RGYA 3BIFA 3HA2A 2WTEA 4P86A 1H0SA 1FSFA 1KK1A 2BMVA 2EFCB 4L6CA 2Y05A 4RCVA 5ESXA 4C14A 1XZAA 1ZHOA 2FF7A 1Y34E 4QX6A 3AHJA 3SKYA 2QWXA 3EVBA 2DQYA 2O6LA 4AS3A 1FNNA 2GASA 4B2YA 2FOIA 1PT5A 1SOMA 1KO1A 1TQ8A 16PKA 1P19A 2KQUA 2RAPA 2VNJA 5IAEA 5ICSA 4PC6A 2O7NA 3HP4A 1P8JA 3U7FB 2J3MA 3IXQA 1VSVA 4OMDA 3BJRA 3FAZA 1XB2A 3NM4A 5JCOA 5IJAA 3F4KA 4Q15A 3QXCA 3U7IA 4CF6A 1C7IA 4LCBA 4EGCB 6YASA 4TYYA 4BGUA 5EIWA 3GZNB 1PQUA 1W87A 3VMMA 3C15C 3GK3A 3A31A 4JBXA 1US8A 4L0DA 3WL6A 5CD1A 1W88A 2EDAA 3FW1A 1V6SA 1VXOA 3KVRA 1MO6A 2FHPA 3CPJB 1LX6A 1I36A 2WNSA 3UFBA 1C30B 1G17A 4C7JA 5AVXA 1S5PA 3MWJA 3RU2A 1DIRA 3FNGA 2X9VA 2D8MA 3GZ4A 1WDMA 1H6DA 1XKLA 2AQHA 2GO1A 4WZAE 4AMUA 1RQPA 2D4AA 3KQNA 4KR7A 1FSZA 2H85A 3VAZA 1AHPA 2NV2B 2AN5A 4WNCA 3TGLA 1TUBB 3VZBA 4A6XA 5D8DA 4C20A 3UPDA 2CZCA 1PFGA 2PYZA 3BGIA 4FFMA 1Y3AA 4QGFA 4PM4A 4ZYYA 2GKSA 4BAGA 1G20B 1H9AA 4E08A 2BEWB 2NOAA 4ZD6A 1E2DA 2VYFA 2B9EA 2RGEA 5C9ZA 4JXZA 5FR2A 1ESZA 2CLKB 2I3BA 2WWFA 2JI9A 4Y1EA 1X1CA 2FN9A 3T5CA 2X8BA 2AQIA 4WCFA 5F98A 4RDCA 2QVCA 4ZV9A 4BQRA 4D92A 1EHCA 4L73A 4M0DA 4YRNA 1G3MA 3CNHA 3RREA 1H1TA 1G55A 3BL6A 1KZ9A 2RG7A 5F7ZA 3HN7A 2HMSA 4WKPA 4B3SB 1ODLA 1RLIA 3QUSA 1YZKA 2JLAA 2XAAA 2ZIZA 5LKRA 2BEUB 2W2KA 3NRJA 3PT5A 1A3CA 2ZAIA 4ESVA 4LFCB 3PC4A 2OC9A 2CE2X 1VSTA 2EGHA 1UAAA 3DPUA 3IT2A 4BVKA 1LBIA 1RU3A 3DE2X 5DYIA 1F8GA 3SM9A 4TRJA 4KPYA 1GNPA 3EFHA 1T8UA 1U28A 4KIWA 1ZCFA 4ND1A 2COUA 5MFZA 5ALMA 2WFLB 3HKEB 4CFSA 5HX7A 5AMXA 4J6EA 1D8TA 3LC7O 4MYHA 4DEYA 5HQ3A 2PM8A 3QXGA 2MMGA 1ZK1A 3ZLVA 4NMLA 2GERA 3HVRA 6LDHA 2BGRA 4PHGA 4ZYVA 1XVAA 3B8EA 1YFZA 2WJ3A 3OM8A 2BBSA 1TA9A 1CCWA 1UZUA 2FHSA 3CEMA 1EK0A 4MCJA 5G53C 1XVVA 1C4OA 1E1CA 2HN9A 4FJ0A 3LUJA 1R00A 1WBBA 4AZTA 5FNVB 3QFSA 4I99A 2IIVA 4J3NA 4AKEA 2G1JA 4Z5XA 1B16A 5ECGC 4BFSA 3GT7A 2P75A 2QV0A 4IXDA 5T7BA 2QAGB 3FOCA 1TYDE 2MWMA 4NC9A 3ZR4B 1SVNA 2W6ZA 1KYYA 1R4MA 4I9HA 3BMXA 2XMGA 4N3AA 4Q3KA 1EVEA 2ZBUA 2P2CA 2WPDD 3LSTA 1WOMA 2PLAA 1VPDA 3NBQA 3ROTA 4BO3A 5FRDA 2C7QA 3C5HA 3KQQA 1QX4A 2AXNA 1GJRA 4FK8A 4L28A 4O4JF 4EQ6B 2CHQA 5A03A 1YR8A 1FFXB 2Y0PA 3HB0A 4BBJA 4F92B 2XZOA 5DHQA 4CQNA 3VNUA 2NP7A 4ZARA 3OWXA 4I81A 2X0EA 2NU8A 2YOHA 2XMSA 1NVAA 3C2QA 4QUDA 4KL8S 5FV7A 4C4XA 4BPRA 1ID1A 1VZ3A 3L0ZA 2O8EA 4QBHA 2OLEA 4ZCIA 2K5UA 4QREA 2ETXA 4F45A 4DCVA 2PH7A 3KR9A 4J29A 4HDQB 4KIJA 2OD2A 5HHTA 2VATA 3S70A 1CY6A 1DC7A 3H19A 4XVQA 3SIRA 3CF4A 4OI4A 2FLWA 1EXMA 4F21A 1E5QA 1JW9B 4MPRA 5LMCA 2CNNA 4HWTA 1XQ1A 2C4WA 5EIFA 4EB3A 1E58A 1N2BA 1XZCA 4XLZA 5HCUA 2ZJ5A 4CG3A 3H8WA 4L6IA 1NF8A 5JCJA 5K4AA 3K1YA 5I7OA 3OKFA 3GOQA 1Q44A 2XMZA 4QSMA 4DUGD 3BA6A 4OXXA 4I55B 4K03A 3WAGA 1T26A 3C7KA 3PHCA 1CF2O 3R2JA 1KNQA 1XELA 2X0KA 2PWPA 2VHCA 3SP1A 3WKDA 4RZIA 3LYUA 4D9NA 1VE5A 2BFNA 2VDNB 2CMDA 3KX2A 4E03A 2MCFA 3M5WA 2VLBA 1L7NA 2YJZA 2YUTA 1M2WA 1D3AA 3OZIA 3CRRA 1M75A 4P3YA 1R0WA 5A1TA 4DV6B 1SBTA 3STXA 3CN9A 3EXHC 1AUOA 4EJMA 3QY9A 3VNVA 1LSSA 1M7GA 3N5CA 4OMFG 4YR7A 4R2LA 5HRCA 3GVPA 4U0KA 3WL3A 3ITKA 2OM6A 4QO7A 3S1LA 2HUPA 2Y1OA 3NEPX 4CL3A 4DLWA 3LZCA 4D46A 2Z0MA 2IEAA 3KOWA 4JYPA 4EYSA 4ARUA 4EUNA 2PH3A 1RACA 4IOMA 2HCJB 2FWPA 4KVAA 3WGQA 4INAA 1LY1A 5EEHA 5F4BA 1KP3A 4CUJA 3NWPA 3PRHA 4Z2AA 5AJXA 4RPLA 4LF5B 1JR3E 1FU4A 1LVUA 1FDSA 4RZUA 4BXOA 1AHNA 1LB1B 3DXYA 5BRNA 3SQMA 2VPPA 4XX0B 2W37A 2VHYA 3TL2A 1ISHA 1EGAA 1E0KA 1JPVA 1JQKA 1P2TA 1QOQB 2GPNA 3NT2A 4HXYA 1Q20A 4Q4JA 2RGBA 3AR5A 4ZXPA 1Z73A 2JIZA 2WTAA 3E2PA 4UTPA 1NJFA 1IBLB 3OM0A 1NBAA 1XJ0A 3R5JA 3OIWA 1BROA 1NNLA 3B52X 1DKNA 1RI2A 2Q3JA 3AG5A 4FHCA 4PIPA 3V7FA 3VQTA 4ALMA 3U5TA 3AY0A 4E6EA 3GFFA 3IX7A 1O94C 4JR1A 4HDMB 1OGIA 1JG2A 2IUYA 3EZ6A 4UZFA 3CVXA 4LBVA 2HT1A 4G5OA 1NFRA 3DUFB 1U4NA 2XSZA 4TLCA 2XUKA 4YP7A 3F7OA 1K7SN 3E8XA 3V3TA 4PR0A 1NI4A 4JZKA 2Z58A 2JDID 4DILA 1IEXA 4RXMA 2OECA 2YWCA 4I8IA 3FPJA 3LLCA 1CZHA 2DY0A 3TEJA 2ZIXA 2W93A 4WNYA 4IIJA 4KFUA 1DAFA 2DBYA 4B5KA 2BEJA 4F2WA 1SQGA 2BM1A 3JWJA 4BCCA 3DO5A 1CSEE 5HZGA 4MPDA 1IE3A 3VNSA 1HV8A 3CU5A 4HFJA 4PRYA 5BWOA 2I1LA 2JGFA 5JVDB 3G1WA 4A6DA 2LGJA 4N3CA 4PCLA 3TNFA 1QPGA 4DWJA 4NDZA 2BE9A 4P0TA 2ZP1A 4RA9A 2IUTA 3VOAA 2P78A 1I2DA 3O8QA 1WXHA 5CGQB 3SX2A 4D4IA 4N49A 1USUA 1YQTA 3OLXA 4IEFB 3K1ZA 4OREX 1ISRA 1QHEA 3OF5A 4P9NA 5CEFA 5JNLA 1XDZA 4NCKA 3LNCA 4TQAA 1V4VA 4TM7A 2G9UA 3H5NA 5LMNB 2B3TA 1KO5A 3KWFA 1ZNXA 1PZHA 3QPWA 4PAMA 5E0KB 1ZP6A 3DMGA 2BJWA 2ZPAA 4IGFA 4RHTA 4W5WA 5ALQA 4K9QA 1BQ3A 5EGSA 2TYSB 3N2NA 4TTAA 2PL3A 2RFLA 4FFRA 3UJBA 1I3CA 2XD9A 1KEWA 1V1RA 2QNIA 5DGXA 4YUWA 2VF7A 5BUCA 4HMOA 1G9XA 1JDTA 3S7TA 1JJVA 5ILQA 2ZJ2A 5DBGA 4UBOA 5GVSA 1YE3A 1WB9A 5F33A 1O96B 2J0VA 3DHWC 3W8EA 2VYCA 2GF2A 2H4YA 2VF5X 3JALA 3QSYA 4L8WB 1OI2A 5K8UA 1QZUA 2GLXA 4BLWA 3FFBA 3OQNA 3JWPA 3M3HA 1WD5A 2JIOA 2JLWA 3RJTA 2EHDA 4BAZA 5EKSA 3NJ8A 4JLUA 2HU7A 2IE0A 1XQ9A 1BN7A 4Y3UA 5EXXA 1RJWA 2WG1A 5K3FA 4MWDA 4O4HA 3HPRA 3MYYA 2PFSA 3O03A 3VOTA 3KSMA 5AKZA 5UKDA 4D6PA 1TIBA 1PS9A 3EEFA 5K6TA 3SVLA 2HIGA 5D1NA 4XXHA 2C2GA 1JQ3A 1DBPA 3RK1A 3ZHBA 4NCAA 3FTFA 4UUMA 2FMIA 1R4ZA 3M70A 2V7VA 3AEUB 2OPHA 3UXEA 1PEAA 3SZ3A 1DG3A 2EFDB 2ZAYA 3GEDA 4HAXA 5JSZB 3R5XA 5LZ7A 4Q4HA 4KV9A 3MUEA 4BGIA 3Q7SA 5BNZA 5AW5A 1DIOB 5DPMA 4AKSA 5G02A 2BI4A 3NVDA 3ZU5A 4TQ9A 4WJLA 3M33A 3VU8A 4GM1A 3KSZO 4JP2A 1YKGA 2D2FA 1FNSA 1MABB 1TTQB 2P4QA 5T4EA 3A4LA 1FMCA 3WGNA 3GCGA 2FLKA 5IFLA 3U4QA 1Q16A 4LRSB 5H9VA 1J2UA 1Z0JA 2BGNA 3LC1O 1XMJA 5FADA 4K0KB 5ARBA 2DHQA 2C1EA 2OHJA 4GGOA 2VTKA 3ZU4A 5A62A 4J0QA 4TWRA 5GZ1A 2XCSB 1H85A 3IQHX 4Y9RA 3HR7A 4JKOA 3ZHVA 1HOXA 2E87A 2XW6A 1ZK0A 4NRDA 3F74A 5JAQA 5HZHA 1ZIYA 4ARVA 5HJ5A 2XECA 1N2CB 3DOIA 5J2TB 1KORA 2XYQA 4AX8A 4ABYA 2UVPB 4WTOA 2UZAA 1OH8A 1QG6A 1Y4SA 3KKNA 1XFAA 5DSXA 2ZKIA 4L7QA 4DNFA 4DQUA 5A7HA 4KI7A 1ZXLA 3KXLA 5CU7A 3AC0A 3C14C 1KEUA 5FBQB 2ECKA 4BNZA 2IOFK 4UCQA 1E0DA 1UT5A 3B9BA 2AE2A 4O5OA 1SQ0A 1E7QA 4OQYA 3RJZA 1MA3A 5T3YA 2X6TA 4WKOA 1U1DA 3C3BA 3H83A 1P80A 4B83A 4FYMA 2ZK7A 3OSUA 3QKUA 5JS8A 1E4EB 1MVLA 5DLPA 2P2DA 4RQTA 4B5LA 2DM6A 1QIDA 4U6SA 1NQTA 2D0OB 1H5QA 1M1YB 1J2JA 2XD4A 3F5DA 4NENB 1OF1A 2Z3WA 4RGBA 2HV9A 1LRJA 3DTTA 3IOBA 4PX2A 2GJSA 3QPVA 2AI3A 3PVSA 1Q1BA 4NARA 5JS7A 3QWBA 2W11A 5HOQA 3CVWA 5F7OA 3WWDA 1WCV1 3A06A 4Q05A 2W22A 8ATCA 4PWZA 4V03A 5CNIA 4X6YA 5H4HA 3VHRA 3OZSA 4UEKA 1MIHA 1DGQA 4PNHA 5E95A 2YN4A 4DJJA 1XMPA 2AMVA 3PPVA 4G85A 4H77A 4HQRA 4OEHA 4UVHA 1B41A 4V39A 4Z1MA 2C04A 4B3MB 1N32B 4ZV4A 1RPJA 1DQNA 3UB2A 1V35A 2CD7A 3KZVA 3GJRA 5DHFA 1B0AA 1FX1A 4EY7A 3LP5A 3NMUF 5DYNA 4ZYLA 1FMLA 3DZCA 4HGOA 4DV3B 1NUHA 3GMTA 3DR3A 4DYHA 1QFYA 2Q2WA 3IMKA 2PIDA 2FG5A 1X80B 2VP6A 4IWYA 4M87A 5C46F 4MMZB 3SYRA 2JARA 2ZB4A 1OVGA 5AJVB 1YSCA 2EJVA 4I36A 4TKLA 5IJ0B 1NMQA 4XM1A 5K20A 3TRDA 1HSZA 1HRDA 1QGOA 1TJ3A 4U7TB 4BFLA 2FWIA 5IC6A 4X97A 3UJCA 1W4AA 2JFXA 5T4HA 3R1IA 3SAJA 1K6JA 3FOBA 4NV0A 2Z2JA 2YBEA 3LUGA 4OMCA 4CKWA 1H05A 2FQWA 3C5CA 5E9AA 1QQAA 1PEKE 5LXTF 4GI2A 5GP1A 1WVGA 5JASA 2ID7A 1I4WA 1WLYA 1CRLA 5CNMA 1CZLA 3KHKA 1V39A 5THXA 5CFLA 3H11A 4BY9E 1M67A 4PC1A 3ZTTA 3RROA 3SQWA 1QOPB 4M86A 3WYNA 3PDCA 3SDBA 1OXUA 2NLOA 3MAGA 3VOSA 3NS7A 4M8LA 2GLUA 1UJCA 1U0FA 4KN9S 5BV8A 2P30A 3I2IA 3CEHA 4IAOA 3W9BA 4AF7A 4A9AA 4J1TC 5DEIA 2WMDA 1A2KC 3EZYA 2A9FA 1E4OA 3USZA 4EPVA 2WRZA 2A92A 1GLNA 1FP2A 4KXVA 3S2GA 1WSBA 4OHWA 4CMEA 3OE7A 4J8PA 5G40A 4GI7A 4BRWA 3THYA 4L8FA 5AKIA 2JGNA 3O4JA 1DXYA 2ORIA 3AJ8A 3HBNA 3NJ4A 1N2EA 1MOSA 1CNEA 3OZBA 3W3AA 4I4TA 3OMXA 3OZXA 3LXRA 3A3OA 4MYCA 5IMBA 3U1TA 5B1YA 3MERA 1TT5A 2G5PA 2X0IA 1AKQA 3MNFA 3S44A 4CW7A 3MPOA 4YUZA 5FPHA 2YXBA 3WGTA 2QQFA 2X4LA 4OLAA 4R69A 4RLSA 2ODBA 2AVNA 4JLWA 3SIXA 2JA2A 2CJYA 2OHXA 3DBRA 2PUWA 3IEMA 4DYVA 2B98A 3O8RA 1YJBA 4Q1VA 5KJFA 3SR0A 4DAOA 2QJOA 2RI0A 1KPHA 1YS2X 2N1BA 5THKA 4UHJA 1EK2A 3HJGA 1VBKA 3DWFA 4ZVQA 2IWRA 2YNMA 5JZSA 4HNHA 5CVUA 5JYEA 1NXQA 3SXJA 3GV0A 3DE7X 3T99A 4D3ZA 4EUFA 3HXKA 3LBIA 1TW3A 4JL6A 4LHWA 4NNPA 2CVOA 1NW9B 4CL2A 4AJ9A 1PT8A 5IABA 4XVRA 2O0JA 5ARCA 3RS7A 2VN8A 1MHTA 1H65A 4UATA 2LDBA 5SY4A 5TVKA 3TJMA 4DT1B 1PZXA 3B20A 1BGXT 4I7EA 2BPOA 3V4OA 4LQDA 3VPGA 4BCBA 4PHCA 1MC1A 1YB7A 2IU6A 2OQVA