1YB1A

Crystal structure of human 17-beta-hydroxysteroid dehydrogenase type xi
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
244
structure length
243
Chain Sequence
b'RRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITGVKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 17-beta-hydroxysteroid dehydrogenase type XI
publication title Crystal structure of human 17-beta-hydroxysteroid dehydrogenase type XI.
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 93
structure length 243
sequence length 244
chains with identical sequence B
ec nomenclature ec 1.1.1.62: 17-beta-estradiol 17-dehydrogenase.
pdb deposition date 2004-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1yb1A01
1MGOA 3DO5A 1IULA 3AY3A 3NT5A 3C1TA 3OH8A 2DUUA 2ZQZA 2B69A 1GYPA 4J49A 4GVXA 1QYDA 1ORRA 4FFPA 1LRLA 5IXSA 3GT0A 1CYDA 4RDHA 4PLVA 4OSOA 1ADBA 4F6LA 1IYZA 3I52A 1SO8A 3OBBA 1TA4A 1GV1A 1WVGA 2FRDA 3DEYX 4YYZA 4ALJA 3HUDA 3JQ8A 2HJRA 4I5EA 2C2XA 2R2GA 4JROA 4A2CA 2Y99A 4WPGA 3MTJA 4OGWA 4MVJG 3ZNQA 1ZXLA 2PV7A 1I5RA 2A92A 1A72A 1D3AA 4BO8A 4BNWA 3FN4A 3PQDA 3F5SA 1WAMA 3OJFA 5JYEA 4OXNA 5HTOA 1ZNQO 3AK4A 2OZPA 2SCUA 2DBZA 3GZ4A 3PGJA 3D4NA 2JAPA 2O4UX 4TRJA 4CQMA 2C54A 3KSUA 5KNLA 1I01A 1YJ8A 3BMCB 3DZGA 4PLFA 2G76A 3RD5A 5G0WA 4CMJA 4KUEA 2I67A 3OETA 4PFJA 3I23A 5LDGA 2FN7A 3A4VA 5JO0A 2YV2A 1HDRA 3JQ8B 4PN3A 5JY1A 4RVDA 5FI5A 2JCYA 4CL3A 3PLNA 5TT0A 4TSKA 1Y5RA 2FSVA 4BMSA 3JQGA 1I3MA 2JAHA 4YT8A 4IIVA 2VUTA 3IS3A 3UW3A 1MP0A 3F6YA 5JC8A 4B4UA 2CVZA 2Y66A 2AMFA 5KKAA 3BTOA 3WMWA 1EE9A 4CQMB 3QE3A 4L4SA 3TNLA 1ZK3A 3QVWA 5JCJA 5K6AC 1NPDA 1OI7A 1WPQA 4BKRA 1NQOA 2Y1FA 2D0IA 1JU9A 4ZU3A 3GUYA 3RC2A 4F6CA 2NTJA 4BUCA 3E03A 5B4UA 3TOXA 5BNFA 1QKIA 3QJ5A 1PJ2A 2YHIB 2EHDA 1SMKA 4JLWA 3CPSA 4PLGA 4ALMA 4W7IA 9LDTA 3BXXA 4ZD6A 3WS7A 5L51A 1KETA 1PJCA 2EKLA 3DTTA 3ST7A 3AW9A 1ZK2A 3WQSB 2X9GA 2D8AA 4KWIA 4R9SA 1T2FA 3U09A 1EQ2A 3DBVO 2VRCD 3NRCA 1EFLA 4CUJA 4BGVA 3N7UA 3U5TA 4OMUA 4B3JA 1AHIA 4IPTA 1PIWA 4BNHA 2ZYGA 5U4QA 1UZLA 2ZJ0A 4II2A 3WFIA 1FDSA 3R3JA 4J9UE 2DQ4A 1HWYA 1P1IA 2JFHA 3DTYA 3JQBA 5CPFA 2O7QA 1YH3A 4Q3NA 2GZ1A 1UDCA 5DP2A 1ADCA 4L75A 4MVJP 3VPSA 4AJKA 1BXGB 3GG2A 4ND5A 4QTZA 1HEUA 2DTEA 4D42A 3WGHA 4H3VA 3MJEA 3RJ5A 2D4AA 3AU8A 4IQGA 4CMCA 4XZ3A 2AQKA 1KVTA 5JDCC 2QRLA 2EW8A 5TS3A 4QECA 1T1RA 2CSUA 3S2EA 1DC5A 1R4NA 4OJNA 4CUKA 1SEVA 4RPKA 1TVEA 3BTUA 1A4UA 2UV8A 1Z6ZA 3R0IA 5F1PA 5DCUA 4ND4A 2NVUA 2ZIZA 5DCWA 5FEUA 3GRKA 2EKPA 8ADHA 3G1UA 1NVTA 1VKOA 3ZWPA 2VHYA 5EQFA 1YBAA 3DXFA 1NM5A 2O3SA 3Q11A 3ROMA 1Q0QA 1M6HA 4BNZA 3SJUA 3V8BA 4FCCA 2DKNA 4MKRA 3RVDA 4X54A 4GX0A 4DTIA 5TQVA 3WICA 2W98A 3ZU4A 1ZO8A 3GAZA 1R4NB 5A3JA 3WB9A 3QVSA 4RZHA 3AM4A 3JQFA 4B7XA 3PYXA 3JTMA 3FI9A 4AICA 3JQCA 2I99A 4KWHA 4NFSA 3E9MA 3ZH2A 4L74A 2Y1DA 3H5NA 1YKFA 1KC3A 2YW9A 4NFHA 2JL1A 3DMTC 1LLCA 1W73A 4OQZA 1E7YA 1VRWA 4DRYA 2O3QA 3EY4A 3OJLA 1BGVA 5ITVA 3BMQA 4UREA 5BNTA 3NDRA 3VOSA 4BNKA 2P9EA 4CR6A 1H9BA 4JNKA 1ZKMA 4NU5A 5EPOA 3JD4A 2ZK7A 1QR6A 4A10A 1A5ZA 3ANMA 4R69A 2AG8A 4BO4A 4E5PA 4U8GA 4PZDA 2PA3A 4W9NC 3E9NA 1FJHA 5I9MA 4XX0A 3D4PA 3UN1A 1X1TA 2VQ3A 4GX5A 4HFRA 4OQYA 4E12A 4KP7A 3UH1A 2CZCA 2EV9A 1GYQA 4FD3A 1T1SA 2TMDA 3O8QA 4CLRA 1DRUA 4UUMA 1BTOA 5IZCC 4U6SA 1HLDA 1NFRA 4E5KA 3WLEA 4B3IA 1B7GO 1HYEA 4CLDA 1U1IA 3FR8A 4GMGA 2RHCA 4IBOA 1B2LA 1ZJZA 4LMPA 3VH3A 3RUDA 2A35A 2Q99A 4L0QA 4XB2A 5C3MA 5EJ2A 1V35A 5COAA 2G5CA 1M75A 4R16A 2EERA 1DIHA 5CHEA 2UDPA 4LCJA 3VH2A 3WGYA 4M49A 3TN7A 4CLRB 5K6AA 4IXWA 1JWAB 3A28A 3JYNA 4W4TA 2B4QA 2Q2VA 5JCXA 4GGPA 4DC1A 1U8XX 2VYND 4W6ZA 1ZZEA 3CMCO 4CMHA 2HK9A 1XLTA 5A05A 3GRPA 4FOSA 3GVIA 2ZTLA 3B1JA 3JQDA 3O03A 2JD0A 4JBIA 4P38A 4Y6SA 2YV3A 3S2IA 2PLAA 2WSBA 4CM7A 2QRKA 3PPIA 4KDEA 4KTTE 4CLOA 3KVOA 5IF3A 4EUEA 2D5CA 1B8UA 2XF8A 4XIJA 1E77A 1F14A 2EJWA 3GG9A 3H4VA 5L7WA 2TMGA 1X13A 3V1YA 5BSEA 4YAGA 1EK6A 1B3BA 1VJTA 1YQDA 4FW8A 1IZ0A 3F47A 3O9ZA 1VC2A 3DZJA 1NR1A 4I9NA 1TXGA 2EP5A 1P74A 1QG6A 1M6WA 3K2EA 4Y6RA 1GAEO 1PX0A 3L4BC 1XA0A 2QIOA 1Y9EA 1YQXA 2B36A 4CLOB 1DFHA 1B16A 3A06A 4ND2A 1JDJA 4F45A 3OHSX 4HUJA 3CINA 4J2HA 4IMPA 4RVGA 5CFZA 2X1HA 4OAQA 2VT2A 2WE8A 2IYPA 4MO2A 2V6BA 5MDHA 1BDMA 3DL2A 3W4JA 1WDLA 1LTHR 1V9LA 4GX1A 1RYEA 1RYDA 1Y8RB 2I9PA 3F4LA 4MVJA 4DL9A 1VJ0A 4S1VA 4PVCA 1K6JA 1NAIA 4GWGA 3T7EA 3DZKA 2Y1OA 1HE5A 3QRWA 2X5OA 1R6DA 4ZQFA 4YB8A 2VT3A 2GCGA 2GN9A 4E5MA 4J16A 3QP9A 3ENKA 1HDXA 2ZYAA 2AQHA 1O89A 3RUHA 7ADHA 4Q39A 4IDBA 4RPGA 4M1QA 4YQZA 1ENPA 4HX5A 5G0TA 3ONFA 1T2AA 1V3VA 4RZIA 4ZRMA 2GN6A 4C7KA 2ZB4A 2YUTA 1PU2A 5J23A 1M2WA 2PZKA 3T7CA 4DLLA 4L9RA 1OC2A 4LK3A 1F8FA 1Q7BA 5AXCA 2O4CA 3ETGA 1YB5A 4TRRA 1ARZA 2IE0A 5CDGA 2HMWA 4I5FA 4D3SA 4NK5A 1MLDA 1V0JA 3EZYA 3T4XA 4DPMA 2NSDA 2I5PO 3MOIA 3ZWYA 1D4FA 3JQ6A 4WE3A 4EJ0A 4ESOA 3KETA 1EFKA 2EP7A 1ISIA 2B83A 5THQA 1P1RA 4P4GA 4CMAA 4FC7A 4ID9A 1GZ4A 1E7MA 3WJ7A 5DCYA 4CLHA 2BELA 4BNXA 2HLPA 3AY6A 3RFTA 3NX4A 3OF2A 2HRBA 1EK5A 3NYWA 2W8ZA 4UEKA 3BMOB 3QV1A 4FSHA 1UDBA 2CDBA 1DRWA 1UAGA 3F5QA 4ALLA 4DVJA 4UUNA 2YYYA 1C0PA 4CL8A 2IZ0A 2C0CA 4TROA 1QYWA 1F8GA 4GLOA 2DC1A 2VHVA 1XR3A 2VYVD 2WYUA 5I9NA 4H7PA 3AUUA 3FPLA 2LDBA 3DBLA 4XQEA 4ZQHA 4MP6A 2H9IA 5L3ZA 2B35A 5BSGA 3H9UA 2YDXA 4BOYA 2WD7A 3G49A 2Q49A 4W9NA 4YXFA 1ZBQA 1HZJA 3C1OA 3CIFA 2RH4A 3OJEA 1LDBA 3PJGA 2YY7A 5IZ4A 1E6EA 1YO6A 2JD2A 4AJJA 4XQCA 1NR7A 3WBBA 1EUZA 2GSDA 1HL3A 2Q1TA 1H94A 3FHLA 1GPDG 2Y1CA 3MJSA 3I9OA 3MWDB 5IZCA 3Q2IA 4R1TA 1DIAA 1KS9A 1HXHA 3OEWA 3DBLB 1NTOA 1NNUA 3G0OA 1QV7A 3LT0A 3W8DA 1MX3A 5L45A 4NI5A 4M89A 2WD7B 5G4LA 1NVGA 1E5QA 1YDEA 4ZHSA 1JWBB 4YAEA 5ENDA 1FMCA 4PGFA 3OIFA 1XQ1A 4XDZA 3WQQA 3DAGA 2VWGA 3B1KA 3UF0A 1PR3A 2UUOA 3O38A 3IOYA 2H5LA 2W2LD 2J3JA 3JYQA 4W99A 2Q2QA 4ONEA 1RJWA 4YBZA 2Q1UA 1XDWA 5HS6A 4DIOA 1CQIA 1PGJA 4JXKA 4J1QA 1EMDA 4AJPA 5KJEA 2VN8A 3H2SA 5IFLA 5DN9A 3RIHA 3DFZA 1Q0HA 1IHYA 1DAOA 2PZMA 3E1KA 3Q1LA 3WNVA 2FP4A 4JCOA 3PWZA 3HDQA 1TT5B 1GDHA 3U4DA 5EQDA 2A9FA 4PCVA 3QWHA 4U5QA 4O6VA 1E6UA 1WP4A 2Y05A 1ISMA 3U9LA 2EWMA 5ER6A 4Q3AA 3IUPA 3P2OA 1TEHA 3C7DB 3C7CB 3S2FA 3I1JA 5EN4A 1Y5MA 2PGJA 1G0OA 3AU9A 4XIYA 5TIIA 1QXSA 3PDUA 3DDNA 1HE4A 5T57A 2AEMA 4BGUA 4DMMA 4AL4A 4ZN6A 1J49A 3L6DA 5T8KA 2OOSA 4NFYA 3X2FA 3I3OA 1BVUA 2D2IA 1NBOA 4XYEA 5TF4A 4WLNA 1K5HA 3DHYA 2NTNA 2Q1SA 4FPXA 4BMVA 3D5QA 3SC4A 4CM3A 3F1LA 4BO6A 3RQSA 1EVZA 3TL3A 3NTOA 5FWNA 4OH1A 1QLJA 3WGIA 4E4YA 4B4VA 3LZ6A 4NR0A 1IE3A 2NM0A 4IINA 4QFDA 1KVRA 2EXXA 3IMFA 4XEHA 1O94A 3AI2A 1DO8A 4BKQA 5AXDA 3X2EA 4XB1A 3BTVA 4IS3A 4ZVVA 2J5KA 4J4HA 1E3WB 2CVOA 4A73A 5TC4A 1PZFA 2A94A 1UDAA 2H63A 4BGIA 4OIMA 3AUTA 4KTVE 1ADGA 4YJHA 1ONNA 5A4DA 4RGBA 2RHRA 2EEZA 3ONDA 1GFSA 3HHPA 2GDZA 4J7XA 1N8KA 1H2HA 1M67A 1PGPA 1W6UA 1YOVB 5C37A 1YVEI 2NUAA 1J0XO 3WFJA 4DUPA 1PWXA 1IOLA 3ETEA 4YPOA 4YEDA 3LF1A 1EEHA 3I9LA 2BRUA 3BMNA 4IM7A 3UICA 4OSPA 3LC1O 2QYTA 2NACA 1XELA 5TX7A 1MXHA 3ZNPA 1U4OA 3W8EA 1YJQA 4CM9D 3UUWA 4FB5A 1U3VA 2D1YA 2H6EA 3KV3O 4DYVA 2XXJA 3FTNA 2P68A 4WUVA 4YJHB 4YJGB 4NJMB 5CDUA 5A04A 1X0VA 3UHAA 4WKGA 3PEFA 4IXTA 3AM5A 1I24A 1HT0A 1L1FA 4N5MA 1DRVA 4JQCA 4Z0TA 1ONPA 1QORA 3K30A 2NVWA 4QEDA 5LCXA 2O3UA 2X0JA 4XA8A 2BGLA 4EYEA 3M1AA 3RAJA 3JYLA 4K1LA 3GGPA 3OIGA 3P7MA 5DP1A 4B79A 1FDTA 4XQ9A 1G6KA 2GASA 1I30A 3HNPA 5DZSA 2HMTA 1DFGA 4UVGA 1R0LA 1WDMA 1BDBA 2GZ3A 3JQAA 3EVNA 4RCVA 3CKYA 3TPCA 3UFXA 2BF7A 3HFSA 5EMHA 4BHTA 1NWHA 4ND3A 3WSWA 4A27A 4B8ZA 1R66A 3M1LA 1YXMA 1P1KA 2Y67A 3WDSA 4DIFA 3DBHA 1U7HA 3L0DA 4CV0A 5KJ1A 3VH1A 3D64A 4JK3A 4XR9A 3NTQA 1DLIA 5FF9A 1I0ZA 1KEVA 2O3TA 1K6XA 3FRJA 4TKMA 2FOIA 4R4JA 3CEAA 3W8FA 2Z1MA 4O1MA 3WLFA 4IJVA 2BI8A 4TVOA 2F00A 3EYWA 3ZWNA 2Y1EA 1EUDA 4Z9YA 4ILKA 1U4SA 4CM8B 3GVCA 1C1XB 1T26A 5G4KB 4CQMD 3VC7A 4JP3A 4DREA 4S3MA 3ZNNA 4MVJH 2C5EA 1LXCA 1PZGA 3KZVA 3PHHA 1H2BA 4BNVA 4D3FA 4TRMA 3B1FA 3H7AA 3N58A 3KYDB 1GZ6A 4I9HA 4RF5A 4CV2A 4HNHA 4PVDA 3DBHB 3GVPA 4MOWA 2GF2A 3K8ZA 3I6IA 1ZSVA 4YCAA 4AFNA 4A03A 4ITUA 3VZPA 2X8LA 3FNEA 3OQBA 3ZU2A 1LNQA 5TLSA 1ZIDA 1Z74A 3WGQA 2D5AA 4IUYA 4PLYA 4Z9FA 2I3GA 1PS9A 2EF1A 4CMKA 3S8MA 3QWIA 4MIOA 1PJ3A 1DSSG 5JCJD 1NP3A 1MXFA 2OBYA 4YT4A 1PQPA 5H83A 3PZBA 3ONEA 1J6UA 3F9IA 1UZNA 1ISJA 1O9BA 1NHGA 3QWAA 2NADA 2P9GA 3M2PA 3QLJA 4U0JA 3FR7A 3QA9A 2NQ8A 4I5GA 1ZK1A 2BFOA 4WGGA 1AXGA 1K3TA 2Q4EA 1NYTA 1QP8A 2VUUA 3TZ6A 3ZN2A 1A4IA 4A7PA 1HSOA 1JVSA 2DFVA 4LISA 2GN4A 3KXDA 1BWSA 1UP7A 3ASUA 5CPBA 4QXMA 2NU6A 3CSDA 4J3FA 1A7AA 2VZ0A 1YWGO 5JPIA 3JQGB 1X1EA 2OP1A 3FF4A 4OM8A 3ICPA 4OXKA 1ZSNA 4L4XA 4ZRNA 3TJRA 5TRTA 1W0CA 5A9SA 4TZKA 2VNAA 1JLLA 3VPGA 2ZB3A 2BHLA 3DAPA 1O0SA 1EE2A 2GLXA 4NU6A 1UXGA 3VTFA 1XQ6A 2R00C 3W4IA 3VKVA 2B37A 4J9VA 4I8XA 1WNTA 1UR5A 2YV1A 1MFPA 3C1AA 3EK2A 3HZZA 3WTBA 1LSUA 4BB6A 4BO5A 1CQJA 1LC3A 2Q4BA 3F1KA 4IQ8A 4YRDA 2CNBA 3PTZA 3ZI0A 1P9LA 2O48X 1K2WA 4EUFA 2P2SA 3EMKA 4WJZA 1E1NA 3GEDA 4I08A 3R3SA 5CDSA 4E3ZA 4MVJM 4R68A 5A9TA 1OFGA 1HLPA 1DPGA 3K5PA 1GEGA 2P9CA 3PDJA 4RV9A 3ASVA 3JYPA 5LC1A 1SBYA 2XXBA 5IN5A 1GY8A 1NFFA 3TZQA 1V6AA 3OA0A 4OHUA 1T24A 1EQUA 2RH8A 2DLDA 4IY1A 4A5OA 4ROSA 1R4MA 3GFGA 5C7IO 5I9LA 2VRCA 3NTRA 1SB8A 3VVBA 2J3KA 2UYYA 3D1LA 5H82A 4G5HA 4PRKA 4RPLA 3GUCA 3E5RA 3ANLA 3E48A 3LU1A 3NGXA 1T2EA 1Y6JA 4HFNA 3QVXA 1JN0A 2J5RA 5T67A 3FD8A 1V3TA 3I5MA 3TFQA 4BKOA 3KOUA 3OQ1A 4II3A 3OMLA 2JHGA 4R9RA 1BW9A 4AJ4A 4MDHA 3WGTA 3DBRA 4CMBA 3KEOA 1LC0A 4PG5A 4WLUA 3DHNA 1WXDA 1R4MB 3GZNA 4GI2A 4XYMA 4BNIA 5AYVA 1ID1A 1AHHA 3PZRA 3IJRA 1Z7BA 1N1EA 2Q50A 4PG4A 4DLAA 4DQXA 2NVUB 4IGFA 1P1HA 5T64A 4XYLA 1E0DA 3NJ4A 4KDFA 3NDIA 3PIIA 4TRNA 3C7AA 4BNUA 5KIAA 4E0BA 4J43A 5DF1A 5BR7A 4BV8A 2WYVA 5KJ6A 4TVBA 5DOVA 3KTDA 3OFSA 1I3NA 1EBFA 3MCVA 3VPHA 2I65A 3DBRB 3A9WA 3HDJA 3V2HA 2BFMA 3FNHA 3IDSA 1NVMB 5IG2A 1B3RA 1DDOA 3ZV5A 1LRKA 5L53A 2WYWA 3RUFA 4JX8A 4JJIA 3DWFA 2D59A 4AJLA 4TWRA 1ZJYA 3AWDA 4EJMA 1H0KA 1E7QA 2ZTMA 1BHSA 3QQPA 2DUWA 3SBOA 3AUSA 4GKVA 3ZHYA 4R1SA 3I4CA 3JSAA 3ULKA 3PGXA 1NQ5A 4Z0PA 5TGDA 3G3EA 3TDKA 3VVCA 5ENVA 2IEBA 3BHIA 3N74A 4EDFA 4Z3KA 1SAYA 3EGOA 3DZFA 4L8VA 4KUGA 1BXKA 4IMRA 4CR7A 1DEHA 4D44A 3BMQB 3TOZA 4XDYA 3U3XA 3ITDA 1VPDA 1IUKA 1LA2A 4DPLA 4UVIA 1RKXA 1PJ4A 3TF5A 4CUZA 1YB1A 4EEXA 1VL0A 2FPPA 3K73O 2CMDA 2JCXA 4J1NA 3LQFA 4R1UA 3GVHA 4URFA 3RU7A 5ER9A 2QZZA 2BFAA 5IJZA 4UAGA 1U2DA 3JYOA 3MZ0A 3WX0A 4N54A 2OBNA 3ZU5A 2C82A 1CDOA 1CETA 4N5LA 5BQFA 1NWCA 3OSUA 4G65A 3QWFA 3B6ZA 1HF3A 3GEGA 3FWNA 3O8QB 3RFVA 1X7GA 1E3IA 2Z1NA 3H9JA 1XHLA 3S55A 4D46A 4BQRA 1P3DA 3DAFA 4BO9A 1AUPA 3UGKA 3VTZA 4BNYA 5U1PA 2QX7A 2O2SA 4I5DA 1SEPA 2GZ2A 3ENNA 1X0XA 4Q3CA 4BNMA 1TB4A 4K28A 1PL7A 1XIVA 3D7LA 1A27A 1F06A 5JE8A 3RFXA 4CQLA 3BA1A 2FHSA 4FJ2A 3GNQA 3U4IA 5A3VA 3GN2A 1E7WA 1YGYA 2X86A 3AM3A 1WW8A 4AJHA 5JAZA 3W1VA 1PWZA 3IKVA 2HMVA 3BHJA 3RUCA 1QLHA 3PLRA 3PVZA 3D3WA 3RC1A 2DTDA 4BKPA 1N7HA 1E3LA 3EZLA 2X0IA 3FBGA 4JIGA 5G0SA 4NH4A 2EW2A 3ZWOA 4GLLA 1I32A 2X0NA 1DIRA 3STHA 1Y81A 1B15A 1Y8QA 4TZTA 1R16A 3DONA 3KRTA 4H15A 3NT4A 4OOFA 1P0CA 3WYBA 2W90A 1LLQA 1KY4A 4EZBA 3ZWVA 5IDXA 4O0LA 2VOEA 3RJ9A 2AE2A 2XPCA 2GERA 3L6OO 1BSVA 1VE9A 2JHFA 2G1UA 3K96A 3WGGA 5A02A 3DR3A 4XYGA 1C0IA 2C5AA 1ZVMA 2PD4A 2P4QA 1TI7A 4WLVA 1GV0A 2OFPA 3B20A 5JMWA 4OL9A 4R3NA 1Y7TA 3KEQA 2DBVO 2PZLA 3ADOA 5KKCA 1GQQA 2WEKA 1ZUD1 4RJTA 4YJDA 3RC7A 5JDCA 3ANNA 2Z95A 4EW6A 1I2BA 1R15A 5ICMA 3H8VA 2UVDA 1ENZA 4MIYA 3VH4A 3TWOA 3WMXA 1DIGA 1LQTA 3NJ8A 1LEHA 3AJRA 3LYLA 4RPHA 2O50A 1XU9A 1YRLA 1DBVO 1O5IA 2X58A 2E37A 1DJQA 1JW9B 3G17A 4BO7A 1UP4A 1Z45A 4K9DA 4WEQA 3W6UA 3ROKA 5JDIC 1P45A 2YJZA 3LDHA 4LVUA 3CXRA 1ENYA 2OP0A 2DT5A 3BZUA 1VM6A 5COBA 4KOAA 1BVRA 3PYMA 4MKZA 3IL2A 4XQGA 2V7PA 2HK7A 3PP8A 1WLYA 4YAJA 1YL7A 1IL0A 2VHWA 3NGLA 3GDGA 2WTBA 3LF2A 1LSJA 1GL3A 5B4VA 1ZEJA 1CRWG 1C0LA 1T25A 4MVJE 4RVHA 2G0TA 3RU9A 1I3KA 4IS2A 4Z9XA 1KEPA 1HTBA 4WECA 4ZA2A 3TZHA 1KYQA 3O26A 2Q45A 4WOJA 4BQPA 4YRAA 1NAHA 4EUHA 1C1DA 1HETA 5L95A 1EDZA 3P2YA 1ZH8A 1Z82A 4RQTA 3KO8A 4WNCA 2CFCA 1GQYA 4YA6A 4A0SA 1XKQA 2X9NA 3DMTA 3I83A 1LDNA 1LU9A 3RKRA 1H6DA 4WCFC 4D0RA 3FCOA 3EVTA 2FZWA 4BO0A 1YONA 1LSSA 1I10A 4BMNA 3HQ4O 3ZWXA 3ROPA 1YL6A 2PTGA 2ET6A 3H3FA 4EBFA 1DOHA 4EI2A 4CM1A 3PRJA 3H2ZA 3CTMA 3K31A 3JQ9C 4D3DA 1KVUA 1GZ3A 1FXSA 3EW7A 3UOGA 4CODB 2NWQA 4BB5A 1C1DB 2QRJA 1HDCA 1CF2O 2BD0A 3ZDFA 1S7CA 1V3UA 1GUYA 4UUPA 4MINA 4CM4A 5B12A 3JQEA 3NT2A 5DOZA 4CMEC 1XEAA 4CV3A 1PZEA 4J0EA 4QFCA 3L77A 2CDCA 1LUAA 3JD3A 4NG5A 3E5MA 3MOGA 5L9AA 4YT5A 3V5NA 3B70A 2X5JO 2IZZA 4NDNE 4QO7A 4D45A 2ZTVA 4ZQEA 3VZSA 4B4OA 1I33A 1KVSA 1HDYA 4AJIA 3PHLA 4BGEA 2OUIA 3WNQA 5CG1A 5U9CA 2JFFA 3DZHA 3GN1A 3FNGA 2WE7A 4BNFA 3LVFO 4IDEA 4OKNA 1UP6A 3ZCXA 3DOCA 4UVEA 1NFQA 2QYSA 1XCBA 3ZWWA 2C20A 2I76A 3AFMA 3AOGA 3BAZA 4JJFA 3WIDA 3C3XA 2DAPA 2IODA 3MTGA 2AXQA 2GNAA 3CH6A 2FR0A 1AGNA 4XGKA 5B1YA 1LBEA 1FK8A 3NKLA 3WIEA 2OMEA 4P8RA 5JS6A 3V1TC 3QY9A 5IN4A 1RM5A 1T2DA 3SX2A 2VTDA 3NUGA 4FGSA 2WJPA 2UAGA 5DT9A 4TQGA 1KY5A 3S2GA 2QZ9A 1QYXA 3HSKA 3K6JA 4DMLA 3HADA 4D43A 1EBUA 2VTEA 3MJCA 3TQHA 4BIIA 2BI7A 4PG6A 4J1SA 2D3TA 1LRJA 4HY3A 4AJEA 3LK7A 4HKTA 3U62A 4MVJF 2AA3A 1U28A 1HDZA 5JLAA 1PGQA 2E48A 2FMUA 4G81A 4DXHA 1PR9A 1BRMA 4FQ8A 2X0RA 4MVJI 3WWYA 1VJ1A 1LDEA 2GGSA 2PY6A 3HJAA 4J90A 1DAPA 4MP3A 4U0KA 3L4BA 3NAQA 5CEFA 3H9QA 3NEPX 1ZFNA 1GEEA 5KCZA 3OP4A 5DBGA 1JA9A 4RORA 4PLCA 2W4QA 5L4LA 3M2TA 1IPEA 3TL2A 3FSRA 3K9QO 3KB6A 1TLTA 4RVSA 3GC6A 4YT2A 4KQWA 1N92A 1PQWA 1Z75A 1I8TA 3GNSA 3SXPA 4NIMA 3V1UA 1XYGA 1VI2A 2ZB8A 3PQFA 2VRBA 3HE3A 4HFJA 2Q1WA 3LT2A 4BO1A 5B37A 4JBGA 4PZCA 3GDOA 4RL6A 3H5RA 4B4WA 2DFDA 4R1NA 5THKA 4B8WA 4BO2A 4RF3A 3HFGA 3KLMX 4J4BA 3PWSA 2ZATA 1L7EA 1YQGA 4FJ1A 1QSGA 4PLTA 4E30A 3UKOA 1A71A 7MDHA 1QRRA 1LX6A 1NASA 3GR6A 1J4AA 3W6ZA 4Y98A 3RUIA 2E82A 3I9KA 3ZWBA 2JJYA 4FFMA 3FPCA 4IJKA 5CG2A 5IAAA 1ULSA 1PQUA 3PHGA 4YTEA 3JD2A 2A4KA 5T6BA 4FDAA 3CE6A 1N7GA 4DC0A 3MJVA 5JMPA 2YFHA 3AFNA 3GMSA 5BSHA 1E1KA 3GEMA 1YDWA 2C2YA 2NU8A 3CMMA 3HG7A 4HADA 3RI3A 1VSVA 2ZJ1A 3L07A 1K6IA 2Y0DA 4N7RA 4OO3A 4R54A 2FR1A 5ITWA 4I9UA 2C59A 1PTJA 5A9RA 1R12A 1LDGA 1I2ZA 1YBVA 1MA0A 1HYGA 5I7EA 3P5SA 3BMNB 5JW6A 4I1IA 2GN8A 4EJ6A 2XAAA 4JGBA 3VDRA 3UCFA 1R0KA 4UEJA 2E49A 1YBMA 4Q3EA 2OHXA 4WLFA 4EEZA 4GL4A 3ZWAA 4LRSB 2B4RO 1PL6A 3QHAA 5KVCA 1I2CA 4ALKA 1PL8A 4CM5A 3JQ9A 1GYRA 1I36A 2PK3A 3GOHA 3MEQA 4MIEA 4E33A 1ZSYA 5AQ1A 3KLPX 4E2YA 1BXZA 5K0ZA 3G79A 4GGOA 4Y9DA 4CMEA 1VLLA 5EINA 4BKUA 6LDHA 2PD3A 4OXYA 1FDWA 1U3UA 3DOJA 4GKBA 3JQAB 3RCBA 2HCTA 4PLHA 4K6FA 3ZW8A 4RVUA 5F21A 1MC4A 1DFIA 1A9YA 4CM6A 1HE3A 2HK8A 3ZHBA 3H65A 1NPYA 1B14A 3ZNOA 1O6ZA 3C8MA 3F3SA 3BMCA 1PS0A 3SEFA 3IP3A 3EDMA 1PGNA 1QMGA 1RM0A 2GR9A 4RVFA 5DBFA 1DHRA 1GR0A 5KVSA 4ALNA 3DC2A 5ILGA 1HDGO 2GYYA 4B7CA 1X7DA 1F0YA 1UUFA 4O63O 1D1TA 4IDFA 3L4SO 2C07A 4M87A 3VAZA 3WGZA 5L7TA 2AQIA 2X4GA 1PZHA 1PJQA 2PKQP 1E7SA 4JJGA 4DQVA 2DM6A 4E32A 5L40A 4LRTB 2BFPA 5BNIA 3IIEA 2PNFA 2R6JA 3Q0EA 3Q9NA 1IPFA 1VL8A 2B0JA 2EKQA 2NVBA 4GSKA 5HWSA 4LCEA 3LC7O 4PIVA 5I7SA 1GCUA 2J3IA 2ZYDA 1RM4A 1PSDA 3ZU3A 3OIDA 3LT1A 2YHIA 4ALIA 5AXAA 1E6WA 2E6UX 5CP8A 2CD9A 3WSVA 1WWKA 3Q6IA 3VPXA 3RROA 3PYLA 2NU7A 3ITKA 3K2BA 1DC6A 2J8ZA 4GBJA 4NNJA 1KC1A 4AJOA 3RC9A 1VSUA 1UH5A 2HDHA 3H3JA 3VPFA 4O59O 3U0BA 2PZJA 2NV6A 2DBRA 4JP2A 4B3HA 3ORFA 1QV6A 3PJFA 4E2WA 3KYCA 3H5AA 4HXYA 4WLEA 4J7CA 2IRWA 3ICCA 4J7UA 1MG0A 1DHTA 5KJFA 2POQX 4AJ2A 2JKVA 3V2UA 2IEDA 4DBZA 2DU8A 3ZWCA 3KSZO 4YR9A 1DIBA 2OL4A 3WTCA 2IXAA 4E2ZA 2AW5A 1DJNA 4MPDA 4KUHA 1LJ8A 3T4EA 3E6AA 4M86A 3GHYA 5I7VA 1BXGA 4D7AA 2AE1A 5A5EA 2OXIA 2Y93A 4UUOA 5A9SB 3H6KA 3CUKA 3KYCB 3PFFA 1IB6A 3AI3A 1YL5A 2X7HA 4XYBA 4F46A 1D8AA 4H16A 2X9VA 3OJOA 1E1LA 2YDYA 3AI1A 5I8ZA 4XCVA 4ZGWA 4E5NA 1P31A 1R0SA 3ZV4A 2YHUA 3VHRA 5KTKA 2J5QA 5ES3A 3UCXA 4ZJUA 4LSWA 3Q3CA 4AJNA 2V65A 2WM3A 2AEFA 2OORA 3NV9A 3PI7A 1P1JA 1FDUA 1P77A 3HN2A 3MJTA 5HS4A 2ZB7A 2ILTA 3G1TA 3DFUA 2HRZA 1UJMA 2F1KA 2G82A 1Q1NA 2HMUA 2NTVA 3ETDA 4HNGA 4BNJA 1JAYA 1YB4A 2VWQA 3JD1A 3KHUA 4GWKA 4NZ9A 3OICA 5ILOA 5L4NA 2NU9A 2DTXA 3Q2KA 5KJCA 1OMOA 2YZ7A 5EERA 1Q0LA 2CDAA 4M8SA 5L4SA 3BHMA 1HDOA 3CZMA 3UXYA 2Y0CA 4GPD1 2VHXA 2X6TA 5BT9A 2I6TA 5EIOA 2QW8A 2VWHA 4QSMA 1E92A 4FGWA 1MV8A 3C24A 1P44A 2WWRA 1E3EA 3L9WA 4W82A 4IGEA 1OOEA 2FWMX 3E18A 3OA2A 3ZWMA 1RWBA 4RF2A 5IDQA 1W4ZA 1U9JA 4HBGA 4F3YA 1BG6A 2HAEA 2IXBA 1YS4A 3SLKA 1P33A 1M76A 4AVYA 4N5NA 2BH9A 3GFBA 2JD1A 5KVVA 3L9XA 2Q2WA 4C4OA 1K89A 1CERA 4KQXA 1GPJA 1BW9B 1SNYA 4M55A 3AOEC 2PGLA 3W4KA 1N9GA 3RBXA 1GD1O 3KBOA 1ISGA 4ND1A 3COSA 1PEDA 1EZ4A 4R5HA 3GZNB 1E3JA 2FY8A 3C85A 4J2OA 4JN6B 1NQAO 2I66A 2Q3EA 4IQ0A 1WZEA 8LDHA 3E8XA 1LLDA 2BMAA 5CEEA 1Q7CA 3D5TA 1ENOA 4JBHA 1PGOA 4AG3A 1XG5A 1V8BA 2EJVA 2P91A 2NNLD 5CDTA 3HN7A 2PH5A 2VUSA 1N1GA 2BLLA 4MJLA 4QQRA 3F4BA 3ZZNA 2Z5LA 3H9GA 3FWZA 2C29D 4RO0A 3F46A 1DC3A 4LN1A 4BNGA 4DIBA 1N9GB 5I7FA 1F17A 3TZCA 3IKTA 4KZPA 5TSDA 2FPGA 4XRRA 4BVAA 4FFLA 5JAMA 5GZ6A 4ZQGA 5F3RA 5KVQA 1KEUA 3I6QA 1B0AA 2AEJA 4DYDA 2XOXA 4FOOA 4BNNA 2WMDA 4YWJA 4UEOA 4FBGA 3EC7A 3GPDG 4J1TA 3WR5A 2J3HA 2RBEA 4YDRA 1A9ZA 4GVLA 4QX6A 4CMGA 3TRIA 5CDYA 1D1SA 1XGKA 2B5WA 3GLQA 1ZXBA 1LSOA 1OC4A 3RKUA 3D0OA 1MB4A 2NLOA 3BIOA 1KOLA 4D79A 1EDOA 4QUKA 4L73A 3DOOA 4FIZA 4NBTA 3PIDA 3EHEA 2X23A 1IHXA 3TZKA 4E31A 4CPDA 3GF4A 3HB4X 2X22A 4IZHA 4NK4A 2BKAA 5JFOA 3INGA 2PFGA 1GCOA 3S1LA 2UUPA 3VZQA 1JKFA 3WJAA 2EIHA 4N18A 4GH5A 4RLHA 4P4LA 5FYDA 1ZEMA 2CF6A 3INTA 3UCEA 4Y67A 4INAA 2C7VA 3ZHXA 2BGKA 2I3AA 3SJ7A 4E2XA 5AOVA 2O3JA 1Z7EA 4OKIA 5DBIA 4PLZA 3DZBA 4ZQBA 3I4FA 1KEWA 1C14A 1NQTA 4IDCA 4J0FA 1XSEA 3P19A 1WMAA 4FN4A 4BNLA 4YQYA 3WXBA 1ISHA 2R00A 4NBUA 4A26A 1SZJG 1VL6A 1DC4A 4LMRA 3DZIA 2GRAA 4HFMA 3PHJA 2ZCVA 5HM8A 4U7WA 5JAQA 2E4AA 4PRLA 1PJTA 1NPTO 4MP8A 1UXJA 2HUNA 4Z3DA 1DXYA 4PLWA 4C7JA 5GZ3A 1FF9A 3SC6A 4MVJD 1A7KA 4CQLB 2CVQA 3CZRA 3A1NA 1W8DA 4BO3A 1DB3A 5HA5A 3IJPA 3FBTA 2VYNA 3WQRA 9LDBA 1BMDA 1SB9A 4LGVA 2HQ1A 1T2CA 4L76A 4CV1A 2P5UA 3OEYA 3I9MA 5JO9A 3MWEB 4YAIA 1JVBA 5A1TA 4Y8VA 3VKUA 5TJ9A 2P4HX 1Y8RA 2V6MA 3GA0A 5JAIA 3D3WB 1Q7GA 4NHEA 5TT1A 2JCVA 3PJEA 2EG9A 3QVTA 5HBRA 4E5YA 1H6BA 3PK0A 4DGSA 4EGFA 4BL5A 5JSFA 5T8KC 3UVEA 1ZK0A 4IIUA 3QWBA 1G1AA 1HSZA 1U5CA 1HRDA 1Y8QB 3R6DA 4PZEA 1U5AA 5B4TA 2V6GA 1CIVA 4OOEA 4XD2A 5JXWA 5C5IA 3OQ6A 4DPKA 2CY0A 4P4NA 4R5MA 2PH3A 3GAFA 4W7HA 1FDVA 1HE2A 2Y0EA 4QT0A 3SLGA 4GMFA 4DA9A 2B5VA 3ZW9A 1ADFA 3OM9A 3GMDA 1MG5A 3QIVA 1LDYA 3HDYA 3SVTA 3TFOA 5G0UA 4ZICA 1PS8A 3JD0A 1JQBA 1O95A 4QO8A 2W2KA 3EUWA 3BTSA 4NJOA 3I9NA 4NQZA 4U6QA 3KYBA 3LC2O 2OGUA 2Q46A 1SOVA 2YQ4A 4PG8A 2VZ8A 4Z0HO 3DHEA 1ZMTA 1E3SA 1OZAA 2DPGA 3K92A 4UULA 4WNIA 2O3RA 2GPTA 4MKXA 1GTMA 4GX2A 1RM3A 2YFQA 2PKQO 5HRUA 3WYEA 3GK3A 4XR4A 3RUEA 3BMOA 1O8CA 4IZIA 1ZMOA 3DMYA 1UZMA 3GGOA 1LDMA 5DNAA 2PGDA 1ONOA 1ZCJA 3AOEA 1B8VA 1NX6A 3M6IA 4WASA 4R3WA 1T4DA 1X14A 4PLPA 4Q9NA 4K26A 2W2KB 1EVYA 1SC6A 5LDHA 1H9AA 1F12A 3O4RA 3E82A 4WEOA 3WBFA 3Q9UA 4D0SA 1G0NA 1XWFA 4CLXA 3GVXA 4FFRA 4WCDA 4DQUA 4XRGA 4E21A 5JYDA 3AY7A 2VZ9A 3OJ0A 3KM0A 2JFGA 3INRA 2ZKLA 3D3EA 1IZ9A 2X5KO 2AG5A 1GUZA 1WMBA 3LT4A 1HZZA 4XJSA 5A5FA 4NPCA 3FTPA 3ROQA 1P1FA 1GQ2A 1JTVA 5ICSA 5AVOA 4LVCA 4Z6KA 5GY7A 2O23A 5F5NA 2VCYA 1AE1A 5COQA 3GDFA 1MC5A 5F5LA 4HV4A 1MFZA 5CAEA 2VHZA 5TNXA 1IY8A 2ZQYA 1R37A 4J6FA 5GZ1A 4E6PA 1C0KA 3TSCA 1ULUA 3PQEA 1Y1PA 2PR2A 4TKLA 1UXKA 1GADO 3GNTA 3UAGA 3FNFA 1KERA 2FZEA 3PFWO 4FJ0A 4BNTA 3GH3A 3KUXA 5KOIA 3IQDB 4IJWA 2EGHA 3AUAA 1PJLA 5F1OA 3JV7A 4NBWA 4DBVO 2J6IA 1H5QA 4CM4B 3LSYA 5JY6A 3ZV3A 2O2YA 2VYVA 2RAFA 3LLVA 2FSSA 1LLUA 1PJSA 1U7TA 3WOHA 3HB5X 2BGMA 4M54A 3BYZA 3LLSA 4UVHA 2EGGA 5FI3A 3U49A 1QYCA 3WYCA 3RUAA 3WG9A 1OBFO 4NMHA 5G2OA 4PG7A 5A06A 5C7LO 3JQ7A 5BSFA 4BS9A 1TT5A 3IP1A 4K6CA 3QVOA 4RF4A 1ML3A 1U3TA 4R41A 3RASA 1EVIA 2B4TO 3KSDO 5L7YA 5JBIA 3DQPA 1E7RA 5I8WA 3HDHA 3JCZA 2HJSA 2P5YA 2Y1GA 4NBRA 4R51A 1JAXA 3H9EO 3V2GA 3ZGYA 2GO1A 3ZV6A 1NHWA 4J91A 3IAHA 3IC5A 4XGIA 3RSHA 3JQ7B 2FR8A 1X7HA 1I3LA 1Q2XA 5EESA 4RDIA 2HMSA 5IDWA 2PWZA 5FFFA 2W2LA 4FR5A 4IDGA 1GUFA 1VKNA 5GMOA 2IZ1A 4LSMA 5CEJA 4CMIA 6ADHA 4CLEA 4R01A 2DBQA 2QG4A 3E9QA 1H6CA 2O7SA 2C7GA 2RCYA 1TT7A 4TMFA 3GPIA 5TJHA 3RBZA 3OECA 3R1IA 5F1KA 1S6YA 2IYOA 3NDJA 4GSLA 4Q3BA 5DULA 3PXXA 2CF5A 4IJUA 5H81A 4XKJA 2GUGA 3A14A 1QYVA 4FC6A 1B8PA 1E3WA 3WWZA 4B7UA 5G0VA 1K0UA 5IDYA 4DWVA 3I9JA 1Y9AA 4FS3A 4Y6PA 1HYHA 4CR8A 1L7DA 4XWYA 4CJXA 3QW2A 1YOVA 3RWBA 4P22A 1U2GA 4CMIB 1C3VA 5MGBA 4AJ1A 1WDKA 2QQ5A 5JDIA 1KBZA 1LI4A 1JKIA 4NBVA 4WLOA 1SOWA 5C7OO 1WZIA 5EL0A 2LDXA 4IDDA 5ADHA 4J4TA 1E1MA 3GQVA 3PJDA 2ZCUA 1X15A 4OYRA 1PJBA 1CWUA 4KMSA 5JNLA 1JKJA 3RBVA 2G17A 3ON5A 3EAGA 1CEQA 3PHIA 5KWEA 3GY0A 3JQBC 1AXEA 3ADPA 4RPJA 4NJMA 4YJGA 4YVFA 4EITA 4WK6A 4LW8A 1EVJA 2H1SA 4D41A 4YJFA 4WOKA 3QSGA 1RPNA 1MUUA 2QHXA 1GU7A 2WD8A 2VOJA 2HKIA 3JQAD 3DB2A 1EUCA 2DVMA 2VNSA 4FFOA 4HWKA 3VDQA 4Q3DA 1UAYA 4BV9A 4O5OA 4YAKA 1AN9A 1B26A 1CJCA 2HU2A 4WCFA 1H93A 2RIRA 2NQTA 1KVQA 2AHRA 1ZK4A 5AXBA 3GGGA 1P0FA 4XGNA 1J5PA 2IDZA 1N5DA 1LQUA 3GHHA 1UXIA 2GD1O 4YJFB 4DLBA 5JC1A 2HO5A 1KIFA 2PD6A 2DPHA 4IDAA 1UXHA 1OAAA 2WDZA 2ZTUA 4RLSA 1SPXA 3ABIA 3MJ4A 4E13A 3D4OA 4GQAA 4YACA 1XU7A 1YE3A 2YQ5A 3HWRA 5K9ZA 5T5QA 1U3WA 4FFNA 4CM9A 4XJTA 1Z73A 4HP8A 4RQUA 5IXYA 4CM8A 2HSDA 4L4RA 4YRBA 2OO5A 1C1XA 2FPIA 2AQ8A 2CUKA 2Y68A 5G4KA 1E5LA 4WCFB 3L6EA 3U4HA 1HKUA 3VZRA 3IUSA 3U4CA 5A03A 3JQFC 5DDIP 1SCUA 1D7OA 1NXQA 1ZW1A 1U8FO 3ZHZA 3WGOA 1T4BA 1H6AA 3PWKA 4UVDA 1M66A 3KYDA 1DLJA 4G2NA 1ISFA 4GAEA 2PKRA 2V6FA 1N2SA 2VWPA
chains in the Genus database with same CATH superfamily
1DKLA 1MGOA 4I5IA 2G1PA 1IULA 2ZRQA 2YWEA 3AY3A 4UXIA 3AB8A 3E22A 3OH8A 3OM0A 4WDQA 2B69A 5EWJA 1EFCA 1GYPA 3HP4A 1QH9A 1BD4A 1ONBA 4XFKA 1EWQA 2KBFA 3GT0A 2IUYA 1JS1X 2GAIA 3C7TA 4D81A 1KO1A 2WNIA 3LPCA 1RJFA 4I4TA 1SGWA 1SO8A 3C4VA 3IXQA 3LW7A 2A84A 2VPTA 4KNWA 1S4MA 2AL7A 4HMPA 2HB6A 2Q6OA 3HUDA 4QL3A 3JQ8A 5IHXA 3EPKA 3LO8A 1P4GA 4I5EA 4JROA 1OKKA 4PZ9A 5LA6B 3U7HB 1TZMA 4MVJG 3ZNQA 4XLLA 4Z8YA 2IUTA 2PV7A 1Q6YA 1PEYA 1VG9B 3CGWA 1A72A 4QSHA 4IXMA 3FN4A 1P1BA 3F5SA 3JVEA 1H42A 3KQWA 4M1ZA 4WXEA 4WBNA 3AK4A 1BOOA 1N9KA 3RK1A 3LXRA 1W5EA 2Q28A 2XRZA 3D81A 4TRJA 2FQ1A 4CQMA 4DAOA 3WI7A 5JALA 1SC9A 2I4IA 5EHGA 1I01A 3BMCB 3DZGA 1M2OA 5FNZA 1NF9A 5LDDC 2FQWA 2B9EA 1M1NA 4LJ6A 1ODTC 3KOMA 4ZO6A 4WKNA 2I67A 3D8TA 3I23A 1F9EA 5ELMA 3A4VA 1SHLA 3ZBUA 3JQ8B 4PN3A 5JY1A 1JKXA 3HU5A 1BGWA 4S04A 4G0WA 4RVDA 1YI0A 4WFJA 2WFAA 4CL3A 3PLNA 3Q6NA 3TB6A 4TSKA 4E09A 1KFEB 3O6VA 1MKYA 2Y9PB 3ND9A 1HA3A 3F6SA 1CNMA 3JQGA 3OJCA 3P32A 4F3CA 2DQYA 4IIVA 2VUTA 3GEIA 3IS3A 4UJ3A 3L1HA 2DUNA 1TMOA 4B4UA 2L42A 3A4TA 3BGIA 1FNCA 5AHRA 5KPJA 1CX9B 2JIQA 3WMWA 1GILA 3DF9A 4LE2A 2RK3A 3N8HA 3CRZA 2Q6KA 4CQMB 1Z5VA 1C29B 4L4SA 1E2MA 1T8UA 3AJEA 5K6AC 4V39A 1BCSA 1WPQA 4BKRA 3RVSA 2D06A 2D0IA 2QM3A 1Y9ZA 4I7EA 1KDYA 4OXIA 2C5GA 3TR5A 1B0ZA 2D5IA 4BUCA 3FPFA 1V4NA 2WKWA 1QKIA 1RHMA 2QRVB 2YHIB 2Z09A 3F67A 3M9WA 1G19A 4OB8A 4UMVA 3PFBA 1AKVA 4HXFB 1NVWQ 3K9FC 1Y3DE 3JZMA 2WU8A 3U44A 1C41A 3T3OA 5BRJA 1U0LA 2UZIR 5L51A 3ROEA 3L8FA 3ST7A 3AW9A 3QLEA 3VR5H 1PUJA 1BX0A 3WQSB 2VP4A 2J7PD 2LTAA 2Z2IA 2FN8A 3ZVKA 3P8ZA 1SKMA 5H4GA 3AHFA 3U09A 3S0JA 4KE9A 3X1XA 1AKRA 3IHWA 3FPBA 4WK0B 1KZ9A 1X8LA 4ZT7A 3D0QA 1JU3A 4RELA 1M9NA 3M3HA 2BI4A 3E2MA 4WZBE 1GVHA 1JR3D 2O8BA 5D86A 3CVYA 2JZCA 3NHJA 1G2PA 1M54A 2K4MA 3KR1A 5T4EA 3TI7A 2QL7A 3O4GA 3TLJA 2NUPA 3FA2A 4BNHA 1QE5A 2ZYGA 4WESA 3TSOA 4BP9A 4BC0A 1KU0A 4II2A 3OF5A 4J9UE 1M74A 3R3JA 4MR8A 1GPMA 2TYSB 1XI2A 3DTNA 1X7WA 3RSCA 1JE1A 2JFHA 3DTYA 521PA 4G4SO 2ES4A 2O7QA 4LXIA 3IT1A 2HD4A 2RI0A 3UHOA 1SVUA 1DTWA 1UDCA 3PXBA 5DP2A 4ZAVA 4OQMA 2QYOA 4EHLA 4MVJP 1KAMA 3RJZA 5HOEA 4PBSA 1THTA 1VBNA 1U2SA 3TEFA 3QELA 3K6KA 4M1MA 4QTZA 3W5UA 3OTQA 3O5AA 1HY3A 3WGHA 4R40A 2PUFA 3O7MA 4H3VA 3DE7X 3MJEA 4MW4A 2D4AA 3BWCA 4HQOA 4F12A 4IQGA 5FULA 2R6DA 2FLVA 2OCKA 1V7PC 3PUJA 1QNFA 1RWXA 1JWLA 2CN1A 2YYZA 2A5FA 3GO4A 1XDSA 5IWCA 2C4KA 4TSFD 1DC5A 4GMXA 1ULBA 1G5TA 4JEMA 4OJNA 1W0KA 4RCZA 4ATNA 3EZXA 1T2VA 1UEXC 2EX0A 2JJ2D 1TGVA 3NKVA 3R09A 4BFSA 2AIRA 1EM8A 1PCXA 1RKQA 2UV8A 3ED1A 4XWTA 5ECWA 4CI9A 5DCUA 1QBGA 1NVAA 2NZUG 4EGAA 5A7FA 3WB2A 4A6DA 2IF0A 1M34A 1CZLA 2NVUA 2Z83A 1A3CA 2ZIZA 3BRSA 2GBGA 1ABEA 4JQZA 2QQFA 3G1UA 1VKOA 2RBGA 1OZGA 1V37A 4RIEA 2ZS9A 3W6OA 3Q11A 1L5RA 2J9RA 3DKPA 5LMUB 2B20A 4BNZA 1WM1A 1YJCA 5GJBA 1Q1AA 3L8HA 4OQDA 3OX2A 4ASUA 2R8BA 2PJZA 3EVCA 1IAVA 4IRMA 1TQ6A 4KODA 4X65B 3A1VA 4YUXA 3AEQA 1WR8A 4XARA 3QMMA 1A50B 2QN7A 1RE1A 4WCVA 4OH7A 4DXDA 3THOA 3TTSA 2G7ZA 4A8JB 3JWGA 1NW9B 1TU4A 1PWYE 4RSHA 3NP7A 5SZJA 3WB9A 1T8PA 4IKOA 1G8HA 3QVSA 2VNJA 4NZOA 1MU0A 1W2GA 3JQFA 1L5YA 3FTDA 4O8ZA 1IVSA 4NICA 3PYXA 5IAOA 1M34B 5IYZB 2C7QA 3DB1A 2FZ4A 4D4LA 2AC7A 1EGHA 1C9KA 1L4KA 4NFSA 1HFWA 4EHBA 2CCKA 3MSCA 2XYHA 4M7RA 1YVPA 3DG9A 3GGJA 2IDKA 2VSFA 1LNSA 4NFHA 4BX0A 3WA7A 3DMTC 3WRVA 2ZUFA 5IVHA 1NMSA 1W73A 4ZOEA 1D0IA 2GPSA 2D2EA 4E3WA 1KI4A 1B76A 1UK6A 2O3QA 4QQNA 4B9AA 4F86A 2BUBA 1ZD2P 3DYBA 5ITVA 5AVXA 4UREA 4LVNA 3TD9A 5FTNA 3VOSA 4BWYA 4JGGA 4LOJA 4CR6A 1Z4JA 3ZWKA 4G24A 4JNKA 1ZKMA 2GCNA 1XP8A 4BATA 2VZLA 5FUWA 2ZRNA 5LP6A 3JVVA 1X1SA 4A10A 5K3EA 4GDMA 5AM5A 5E4TA 3WYNA 1WUYA 3ZE9A 4BO4A 1GZHB 2LGJA 4HGPA 4UNIA 4JJ4A 4PZDA 2PA3A 4GE3A 5I9MA 4XX0A 1CNEA 3SZOA 5GGXA 1PK9A 1VP9A 5ERGB 1CB0A 3OLXA 3ZR4B 4ZV9A 2V7QD 3KUUA 4ZVQA 2A9JA 2R97A 3EFEA 4LDPA 4G63A 2H4XA 2HXGA 2L0XA 4R1MA 4OU5A 2TMDA 4K81B 1SUWA 1XVLA 4AAYA 2MINA 1I1HA 4TKZA 1SC3A 5KNBD 1NFRA 2HU7A 2OCDA 1PBNA 4FFDA 1GPKA 2R0QC 3S8YA 1SBHA 3ZDRA 1KI7A 1Q14A 1U1IA 1YI1A 3BGOS 4IBOA 5LP6B 4EUKA 2VH2A 3VH3A 5BURA 3SVLA 4ARZB 2P9ZA 4G9BA 4L0QA 4N4AA 4MCHA 2OE2A 3H97A 4PX2A 3EEIA 2OHJA 1IY9A 2WOJA 4LKOA 2R6AA 5EJ2A 2ZUEA 4F3NA 1K2VN 4HAZA 2V5UA 4XX0B 4YRLA 2QTNA 4KX3A 1V35A 5EY5B 3RRBA 4QM6A 4WL0A 1M72A 4DV1B 1CJBA 3DLPX 2HYIC 1L4UA 1FDIA 1C4WA 5M3BA 1YDHA 4LCJA 3VH2A 1G8PA 3TVYA 3BUSA 3WGYA 3TN7A 1HDEA 1KWKA 3RK4A 3GLTA 4Q05A 4OMFG 4L2IB 5CA0A 4A36A 4IXWA 3A28A 1M5UA 2LVBA 3JYNA 4PPGA 2B4QA 4L5BA 4MGZR 4QUHA 5GJCA 3VSDA 3W8NA 4BJ6A 2MINB 1H65A 2W42A 1YE8A 2I3BA 1U0EA 4Z51A 3TX6A 2QL6A 4D3YA 1SKQA 3NM5A 4BVLA 5A05A 2AN5A 4I1PA 3GVIA 2RH5A 4OHPA 3D4IA 2IOHA 3O03A 4JBIA 4HGYA 3H2HA 2QWXA 3M89A 2Q0HA 1QP4A 1NW3A 1EHYA 3UJBA 4M7WA 2DFNA 3QFCA 4UUAA 4EUEA 3CRNA 1JSRA 3OT1A 5P8WA 3KHTA 4NE2A 1B8UA 1RMTA 3REOA 2EJWA 1Q19A 5ED0A 3VHXA 4K9OA 1NKVA 4HDSB 4DHEA 1X13A 3V1YA 3TH5A 1U28C 4YAGA 5CA0B 1SUEA 2ZG6A 3IDZA 4RMJA 4RFLA 5BSRA 4QBHA 1B3BA 5GTDA 3MHPA 1TCBA 2P5SA 3WGNA 2V7EA 3GCZA 3ND8A 1ZUNB 2ECQA 2UVQA 5K8VA 2PXXA 1VC2A 2JBAB 3S1AA 4AMBA 2OVBA 1TXGA 1YZFA 1TCVA 4ZO9A 5E6RB 1DAFA 1P74A 2EZ9A 3OE5A 1QG6A 4Y6RA 1PX0A 3ISTA 4X91A 5CA1A 2CE7A 2XZDA 4OJMX 1XA0A 2QIOA 1G6Q1 4K9QA 2WSMA 4WHMA 3GJ4A 3JALA 2GF0A 2PWAA 1YQXA 4V3BA 3R7AA 1XMPA 1A8IA 1WETA 4U2DA 2XNSA 4WJLA 4HUJA 2PL3A 3L8DA 3F8TA 3OT1B 4IMPA 4C1BA 4P0QB 4B85A 4NP6A 4W7SA 4OAQA 1O95D 3VHXB 1XKXA 2WE8A 3W78A 5AW5A 4YQFA 2ST1A 4KACA 5MDHA 4BWVA 1GVNB 2V7VA 4NZMA 1EA7A 1WDLA 2NPOA 4M53A 2ZROA 3I45A 1F3LA 3I0NA 1BJRE 3A37A 3PDWA 1GCIA 1Y8RB 4MVJA 5GAJA 3DHWC 1VJ0A 1UJ4A 3HL0A 4PVCA 3EFOA 4S1VA 1NAIA 5F2KA 3WNDA 4A8PA 4GWGA 2COKA 2GMWA 3EIEA 2BGTA 3EIFA 3DZKA 1GR1A 3HUFA 1KP3A 3MTQA 4KJXA 3QRWA 5HIIA 2X5OA 2F9MA 1CUXA 1R8JA 2AF3C 4U39A 5CA1B 2VT3A 1ZL2A 4J16A 3ZDYB 3ENKA 4PZPA 1C4XA 1HDXA 2AQHA 2XGJA 3WLJA 1Z4PX 3KDSE 3VO8A 4RPGA 3SAJA 2G40A 4YQZA 3ZIDA 1ENPA 3SYRA 2Q8PA 3GCWA 5G0TA 3FHJA 3GROA 1XZLA 3DL0A 4EG4A 4NY1A 4I46A 2VHCA 2YUTA 3I09A 2YHSA 2VDRB 1WNFA 1D2CA 4ZYYA 2ZM6B 3L01A 4UPVA 1Y37A 3OTHA 3D6VA 4OI1A 3L7JA 1F51E 4J94A 3T7CA 2X42A 3GLIB 1PLKA 3A32A 3GI1A 3M82A 1OC2A 1EJ2A 2FMFA 1NY6A 3LX6A 5AXCA 4QEKA 3H3XA 1PBTA 4I8DA 4GOLD 1ZH2A 2HMWA 3NONA 5FOSA 1EYZA 3LYUA 5ICCA 4R31A 6REQB 3AH8A 2BBTA 3NLLA 4XVQA 4DZRA 4YUAA 2OWEA 2QVZX 4KR2A 2MMGA 3ACCA 3K53A 4WE3A 3KETA 3DMDA 3HV0A 5BNWA 2J41A 3AFIA 3U3RA 5FBLB 4CMAA 1REQB 2XTAA 5KNDA 5EIAA 5ADVA 1YRQA 5HJEA 1OTXA 4KDCA 4B3BA 1PT6A 2ECPA 1AZWA 3MUNA 3SY8A 3CSSA 3NETA 1AF4A 2SKCA 4LQLA 4O29A 4TXLA 1G4HA 3R5HA 3RFTA 5HKKD 2IKSA 3V4SA 3CZ5A 1EK5A 3UBTA 4B74A 2CFTA 3HY3A 2W6ZA 3FNQA 2W8ZA 3EVGA 4MLCA 4UEKA 4YJ2B 1R10A 2QX8A 4ALLA 1DRWA 2P35A 4CKXA 1Y6RA 1FYEA 2A1UA 2VDUE 2W00A 2UYHA 5TS2A 4B5LA 4G4SP 2J4DA 1W0JD 3L49A 1SA0B 2VAWA 2I2AA 3OESA 3M1YA 4GLOA 4NZPA 2VYVD 4M0LA 4RU1A 5KTNA 2WSSD 3FSEA 5AI4A 3T0FA 1D9ZA 1BX1A 4ZQHA 2FEOA 4W6QA 5L3ZA 2B35A 1GNLA 8ABPA 1RJEA 1ST3A 2XGGA 5LYJA 2NV0A 3G2PA 3G68A 3R24A 1NF2A 1SCDA 4C0QC 3G49A 4W9NA 4YXFA 2WIAA 1MMFB 3JZDA 4R0VA 1VHWA 1ZOSA 3NDPA 1HZJA 3CIFA 5HE9A 3HEBA 5DGDA 4KU4A 3K0HA 4KXFB 1LDBA 2YY7A 4LAFA 4F8YA 5HZHA 5IZ4A 1YO6A 3LCUA 5EUCA 1SXPA 3OLQA 4XQCA 1Z6AA 2K2WA 4KVGA 3WBBA 1FMFA 1HL3A 1H94A 4K6HA 3PEEA 2A1UB 3AL2A 3MJSA 5IZCA 3UNXA 2VJCA 3C7KA 2MU1A 5CAEB 1VRVA 1CP3A 2LRHA 1VDZA 4BU0A 2PS9A 1NTOA 1E1QA 3W8DA 3LT0A 4O2AB 5LYJB 3WLNA 5L45A 4HYTA 4WACA 4M89A 4BMXA 5EKTA 1E5QA 4LPKA 5I3ZA 1EGVB 4BEJA 1JIJA 1IBSA 1LQ2A 1YD7A 4YAEA 5ENDA 3EZ9A 1VL5A 1FMCA 5T4BA 1Z5ZA 2BGRA 3DMRA 2Y2VA 3AVWA 2FF7A 3T9AA 3NBQA 1KQPA 2JIOA 4EI7A 2G9VA 3OMWA 2O8DB 2F4NA 2VWGA 1YZ3A 2YN2A 1J22A 3UF0A 1PR3A 4DLWA 2GXQA 3IOYA 2H5LA 5CXXA 4KQ9A 2B21A 4TWZA 1RJWA 4AIRA 3Q0TA 4MJXA 1U1GA 1PVDA 5HS6A 2W6OA 2PX0A 2JARA 4TL7A 2I6GA 3JAKB 3SOPA 3ZZ1A 5AM2A 1J2RA 1EMDA 1II0A 4IF4A 1T0IA 4J1QA 2V9PA 4V38A 4ES6A 4TWJA 4B34A 5JMOA 4I4NA 2B8TA 4AZTA 5IFLA 1CUZA 5IC4A 1IHYA 2O20A 3E1KA 4OQFA 4MYCA 4MKHA 1GAXA 3OAAA 4JCOA 2R3SA 4TV9F 3HDQA 4X0EA 1JJFA 1TT5B 5KTSA 1E2KA 3U4DA 3BRWD 2EFDB 3DEHA 2C42A 5EQDA 1ZINA 4ZT5A 4U5QA 3BJZA 2QORA 3CG4A 1E6UA 4O6VA 4FXOA 3RRYA 5M5BA 1VXOA 3FGZA 4GI7A 4KQ2A 3C7CB 1JIIA 4DARA 2CJWB 2XNKA 5EN4A 3D2BA 3PX2A 3OD5A 3ZGOA 3EJWA 2HIHA 1JQLB 2HRDA 3AU9A 4M0KA 5A1JA 1QXSA 2ZW9A 5GPBA 2C7PA 2G07A 5BMVF 4YRJA 2Q5QA 2YCBA 2WKRA 3CC8A 2PM8A 3PNSA 4J3NA 1ZAYA 4K6OA 5T57A 3BKXA 1MC1A 5CJPA 4BGUA 2YJGA 1QG2A 5KQRA 3ACBA 1J49A 1FVOA 3L6DA 2PXCA 4IR7A 3PQ5A 5T8KA 2FJ0A 4EG0A 1N2EA 5EIWA 3RF6A 5CB4B 3M3DA 2GARA 1KYYA 5TF4A 2C92A 4QUAA 4FK8A 1K5HA 2P3QA 1R00A 1D8TA 2VSNA 2OKGA 3KLOA 4FPXA 2JA2A 4JLJA 3SC4A 1XTPA 2H3EA 3F1LA 4BO6A 4US1R 4UE3S 5G1NA 4YHHB 2XRMA 4GXRA 1UC4B 2RC6A 3GLIE 3LP5A 4OP2A 3FYCA 1QLJA 4HQLA 1QHFA 1TL7C 5EE0A 1DWUA 1ZMBA 3EASA 4B09A 4WFKA 4E4YA 1JEDA 4D9FA 2QBYA 1VXRA 1PQ4A 2BJVA 5DN6A 2BMJA 3A04A 3GBSA 2EXXA 3NHUA 1CY6A 2W6JD 4XEHA 2R8EA 1Q22A 3AI2A 2X2OA 2R6R1 2Q6VA 2G3YA 2VJPA 4XB1A 4BKQA 4DEXA 2XECA 3FH0A 1CZNA 4DFDA 4O3MA 4J4HA 2HZBA 1XJCA 3PSHA 4R7GA 1FJGB 1K7CA 3QUSA 4UCQA 4E2FA 5B1HA 3FWHA 4L57A 3OPQA 4L2IA 3UAYA 3TG2A 1DADA 1YCGA 3NUQA 2H4WA 1RHUA 2A0FA 3N39C 1ONNA 1RYMA 4L28A 1UMDB 4EI9A 2RHRA 5DMHA 1GFSA 3FNIA 2GDZA 5AUOB 3C74A 4J7XA 3HJRA 4LOIA 2XCIA 3K1TA 3ILHA 5C37A 3W5SA 1I2AA 2KX7A 2FFHA 2IYXA 4BLPA 4DUPA 2JB9A 4X44A 4XB6B 4P31A 4YEDA 1FRNA 2ZSFA 1OX6A 5AK3A 3TUIC 4X84A 3GLRA 1G21E 4QTTB 3IAUA 4IM7A 3UB3A 4PQRA 3ZCQA 4HNRA 1ZS9A 2BGIA 3M4ZA 4U9UA 1AMOA 1V8PA 4MS4B 2V74B 2EJBA 3FB1A 3GJTA 1A5TA 2AFHE 4TT3A 1MXHA 1Z12A 3WOVA 1O3YA 2ZAGA 2WK1A 1LPBB 1LBSA 4OHFA 1U3VA 4R81A 3STVA 2ZPAA 3FTNA 4BFTA 3TOCA 1ZG3A 4GF5A 4MUFA 1D5CA 3B6MA 4YJGB 3FJ1A 1Q0PA 2IEIA 3U3ZA 3SKXA 2V0NA 1TW3A 4UU7A 4DMUB 4AO8A 1RYYA 1S89A 2BKLA 2YVAA 4LVOA 4KO2S 1L1FA 4JQCA 3MWKA 1IIBA 1ONPA 4RHTA 1QORA 3AHIA 2OY0A 2NVWA 3K30A 4Z54A 1MJNA 2O3UA 5DM60 2F3RA 2BGLA 3QBEA 3WNBA 1E2FA 1DAMA 4G1VA 5I7HA 4CGYA 1SCBA 3A6HA 2BTQA 3JYLA 3V97A 1KXZA 1Y9JA 1Z4OA 3AFOA 4B79A 1FDTA 2P27A 2YFYA 4UM5A 3RYTC 1QPZA 2FAXA 2H85A 2PYZA 2PKWA 3QPCA 2WKQA 4OBWA 3NGMA 3P20A 3T5BA 4RAOA 5KOJA 4BHTA 2BF7A 4JKOA 3AIIA 5EE5B 1LPOA 5EMHA 3WSWA 5BW8A 4BBJA 1WZUA 3CF2A 3M1LA 4OYYA 1P1KA 1TM4E 3WDSA 4DIFA 4RCYA 4F7WA 3T34A 1J0BA 4O2BF 1U7HA 2X9LA 3L0DA 4BZXA 5JEDA 3NDBB 1T3HA 4AX8A 5ALKA 4A2QA 1NG9A 4BFUA 1FPMA 2PGOA 2VAVA 5KDLA 4JB0A 4LHXA 3LTEA 3CEAA 1OY1A 1YACA 2C1XA 2Z1MA 4FI3C 4O1MA 4IOJA 5IJWA 2PO5A 4TVOA 2NZVG 3A1DA 1UMKA 4C0BA 2Y1EA 1YRBA 2OHIA 3IQWA 4Z9YA 4ILKA 1FSSA 1U4SA 3GVCA 1TO1E 3SN6A 4QOSA 1K66A 3DS8A 1T26A 3TNFA 1KNQA 3IQEA 1KDOA 1P1CA 2IW1A 4F93B 3FPAA 4DREA 3CW2A 4QTYA 1FLDA 1K68A 1N3YA 1XDUA 2C5EA 3FGNA 4IKPA 4QG3A 3QFTA 4MCJA 2RHBA 4F21A 1TYCA 3H7AA 1RCFA 1OLUA 2G25A 1B93A 2B8WA 3NM4A 1ZGHA 2GCOB 4YUZA 3GVPA 1KAOA 5LKAA 2ZE6A 5JMTA 1O6BA 1OAOC 2IW3A 2F59A 3IAAA 3RSFA 1M1XB 2X8LA 2FSHA 3OQBA 4EG6A 1ZIDA 2FWIA 4K9KA 1GNTA 1Z18A 1CUDA 2BHNA 2HUPA 2QN2A 3HP7A 3NYRA 3FZNA 3QKIA 4KAFA 3PGLA 2E9SA 3V42A 5H3LA 4L15A 3VX3A 1A04A 5EKSA 2EF1A 2VZEA 1NBWB 1WXIA 3S8MA 2FEPA 2V7XA 5JTTA 5FJJA 2WTUA 3CJRA 3SEQA 5JCJD 1NP3A 2EAUA 4EG3A 3VI3B 1A9SA 1OLUB 2FYTA 5ENZA 1L5QA 2EQAA 1LNZA 2QUAA 2NIPA 5ALRA 3U1BA 3IKJA 4BJ1A 4XFJA 2GAAA 2E4VA 1O9BA 4DNPA 2OV8A 3UKDA 2NADA 4GFDA 5B6IA 5DX8A 5GIOE 1I7DA 1FU7A 3CNOA 1P2FA 3QA9A 2LV8A 3TMAA 1D0SA 2JGKA 1P3JA 4WGGA 1AXGA 4Q3LA 2VUUA 1M8JA 1NYTA 3LBNA 3TZ6A 1JKMA 5BN1A 2UYCA 3AP2A 4C6TB 2FMXA 1SQ6A 3WAJA 4BASA 1NYRA 4F92B 5K3SA 1FTNA 2WSLA 2C9CA 3B38A 4HAOA 4X6LA 4OQPA 2YINC 3U37A 3IE1A 3SQMA 2R4TA 3I62A 1BWSA 5CITA 4AK9A 4F4CA 1V48A 1KO8A 1PJAA 2Q8QA 2CNNA 4TMYA 2DHEA 2NU6A 1KKLA 3JRWA 4X1OA 5CIWA 3PVCA 1RFGE 2GCEA 3ADKA 4QU0A 1X1EA 3WIOA 1Y80A 2ZVJA 3MCTA 3RAPR 1AT1A 3VR4H 2H1WA 2N1MA 2XX3A 3D6NB 1ZSNA 4L4XA 4QBGB 1MTZA 4KYUA 1L4NA 1UDWA 5A9SA 2IS1A 4ER7A 2VNAA 4ZU1X 1I1QB 2ZUUA 3KQTA 1BN6A 1O0SA 1EGQA 1CE8A 2SKEA 3MS2A 1QZZA 4FMPA 1IBMB 1NG1A 3HXLA 1Q1QA 3EQ7A 3IUBA 4YBRA 3RSLA 1CP2A 2ERCA 3GJZA 5EP3A 3B1VA 1IEWA 1R8YA 1D2AA 3FOAA 4J9VA 2WUEA 1YQWA 1MFPA 1P6UA 3EK2A 4XVHA 3VX4A 3KELA 1Q57A 4BO5A 2IELA 1EJ6A 4IQ8A 3QEMA 2CNBA 2RGXA 3M83A 1YHNA 2TRSB 3PTZA 2HQRA 5EI5A 3T4PA 3ZI0A 2O48X 2AHOA 4W1QA 4EUFA 2H1LA 3EMKA 3LBFA 3NHAA 3IP8A 1NJ8A 3MGKA 2IZ7A 5IM4A 3GEDA 1EFDN 2ZBUA 2XR1A 2NUBA 3KS9A 1NZDA 1U94A 4G07A 2ZSIA 1CE8B 5DGHA 1HLPA 4MUJA 4OUDB 3GJYA 5BWLA 1TTQB 3AWIA 3OZGA 3WK7A 3JYPA 5LC1A 1D4AA 1SBYA 2OCPA 1EINA 2GJ9A 4RVNA 4TYNA 1IC6A 5CB0A 1ESZA 1H8HA 1NFFA 1SH7A 1V6AA 2I34A 2W2TA 4NOLA 4OHUA 3OPMA 4OJKA 2RH8A 4D4MA 5AKYA 5C7IO 2R1TB 2IIBA 2AX4A 4N5HX 1ULHA 2VRCA 1A7UA 2C4TA 5F4ZA 3VVBA 1WKVA 1CTQA 2BFEB 3BSWA 4UMFA 5H82A 4G5HA 4PC7A 4PRKA 2O7NA 4RPLA 4XJVA 3GUCA 4Z1MA 3ANLA 3E48A 3SBOA 4B71A 1T2EA 1Y6JA 4HFNA 3HCEA 4NCNA 4KDRA 1JNYA 2H5JA 4DDHA 4MW6A 3EDOA 2OBBA 1OWPA 1R0WA 6NULA 3H2GA 2FJPA 5HYVA 1ES9A 3FZGA 3L06A 1B43A 4DR2B 1B1CA 3BE5A 1GA6A 4I4TF 4ZANA 5CFLA 1M33A 2Z5FA 1E0KA 2JPDA 2RB4A 3IPXA 1E2UA 4ROTA 4EO7A 4MDHA 3H2KA 3M7IA 1O95C 5DI3A 2WHQA 3MLEA 4E22A 3KEOA 1LC0A 1RIIA 4J29A 1BFUA 2DWCA 2P1RA 4PC2A 4ZI7A 1F38A 2M32A 4XYMA 3ABOB 5DISB 4CG2A 1WBDA 4DJDC 1GTSA 3IJRA 5CGZA 1Z7BA 4DQXA 1TZJA 4PG4A 3G7NA 2O2ZA 4KK4A 4WBNF 1I51A 2FX5A 2PLWA 3GFTA 4HB0A 1G8AA 4C2AA 3FOEC 3AKDA 5T64A 5KIAA 3GMIA 1CFZA 1GWNA 1FP6A 1UBHS 3NDIA 3M6MD 4TRNA 2BFNA 1E0SA 1P2BA 4QGFA 2EKBA 1M34E 2G71A 5E38A 4E0BA 1IJKA 4KLNA 2WYVA 2IYVA 4K88A 1KJZA 1VZ2A 4UHEA 4ZT6A 5IXJA 1JDZA 5FT9A 3PJRA 3GBPA 3TZLA 4GZMA 4WD3A 2P2LA 2I65A 4X7PA 4AF8A 4Z3OA 1M1YA 3RYHA 3A9WA 4IZOA 4L16A 5AVWA 3FNHA 1NVMB 3DULA 4F06A 1ST2A 1LRKA 3RRJA 3ZV5A 1EP1B 1W29A 1QPBA 3W3ZB 4LJ9A 3ILSA 1G98A 3WJ1A 2AR7A 3BSFA 1J00A 5CGQB 4ZI7B 1NN1A 2D59A 3AR4A 1Z83A 4GZLA 5D3ZA 3RLIA 3KCNA 1ZJYA 2J08A 3USCS 4Z7QB 2FWPA 1KMCA 1LFDB 1E7QA 2KW5A 1WXQA 1BHSA 2ZTMA 3IRUA 4MQ6A 4OGFA 4XSVA 3FPSA 4YIHA 3W5CA 1NVUQ 1YBFA 3CU5A 3L6RA 4MWEA 3H5WA 1ZAKA 1IH8A 3JSAA 1NQ5A 3Q7TA 3UWDA 2X1MA 3G3EA 4EECA 2ZJ8A 3W3AD 3WZLA 3N74A 1OILA 5FRDA 3SZLA 3ZZMA 3JRNA 4DNQA 4Z3KA 1FJXA 3EGOA 1RZVA 3IVAA 1GXSA 1DAEA 3QUCA 4JNCA 2PRKA 1M1YB 4KMRA 3RYHB 3CF6R 3B85A 3UB2A 4ARAA 4N8EA 5H9WA 5JZVA 1XRQA 2FN3A 3KJIA 4TTPA 3TOZA 4ZCIA 3U3XA 2E1RA 5EKXA 3AFHA 1ECJA 1MPXA 5J5CA 3RWBA 5IDVA 1VPDA 3RYFA 4X24A 4S24A 3QSYA 2HK6A 5JH7A 3G5UA 5G1PA 1RWQA 2E18A 3PL1A 3AVVA 2WVAA 5AI0A 2X5XA 1EFRD 1QOQB 1A9XB 4N76A 1WXHA 4CG0A 3TLXA 2IT1A 1YC5A 3O21A 1E2HA 3HO6A 4YPFA 2JCXA 5AUQA 3LQFA 3RVBA 2WT8A 1TYBE 3IBTA 5ER9A 2BFAA 4UM9B 5B55A 2HXSA 1IBRA 2XDAA 1ZCZA 1FU4A 4HSEA 5EIEA 1NWCA 1BE1A 3JSXA 4AECA 1H4SA 1XTRA 2ZTSA 1JMYA 3B6ZA 3QWFA 4HZGA 4XQ0A 2CLFB 1XFAA 1OD6A 1X7GA 1E3IA 2R8XA 4IDQA 3WKEA 4B2LA 2I2WA 4B40A 4LGMA 2CL5A 3RYIB 1WQ1R 4P3KA 3T5MA 1DUSA 3UGKA 4BO9A 4EG7A 3VTZA 4DV6B 2O2SA 3H5LA 3LPDA 5JH7B 3MUOA 2RB5A 1T2UA 2A78A 3BK2A 3ENNA 3QA3E 1JNXX 4PHGA 4Q1BA 1XEXA 2JAOA 1XIVA 1OU0A 3LGAA 3TIXB 3AKCA 4ERXA 3EQ8A 3BA1A 4LDJA 4X63A 1YUNA 3GNQA 1QE3A 3T3HA 5FBRB 1E7WA 1OA0A 2GPYA 3WGMA 1L8OA 3FF1A 3P9PA 5FHQA 5I5EA 1K1EA 3AM3A 4UBJA 5FO1A 2IH2A 4N3CA 2RHOA 1OFTA 3EGEA 1AHNA 2XEXA 4HWSA 2R4UA 3SU8A 3KSMA 1GCAA 3O90A 4QPZA 1KK3A 3HB7A 3PCRB 5L3RA 3NOQA 2CNKA 1NXVA 1QLHA 1X77A 3PLRA 3DDOA 1Y0BA 4Y2YA 3HACA 2W37A 4MWBA 2X0IA 2VP2A 3U4AA 4OJTA 2ZAOA 3LWBA 3BWEA 5EXEA 3TRKA 2NPIA 1NT2A 3K72B 2JCSA 3RVJA 4UBNA 5BUCA 3CT4A 3UATA 3W5HA 3KT0A 1G60A 5CR9A 3B2NA 3BAFA 1APBA 3R3UA 5CBPA 4OOFA 1PNRA 4Q9DA 3W9SA 3GLKA 3X1KA 4O0LA 2VOEA 1MJHA 2BPOA 2VDWA 3QM1A 3UK2A 1BEUB 2VJOA 1YA8A 2J67A 3Q8MA 3AHJA 3K96A 2CV0A 1T9AA 4PY2A 4B6GA 1UJBA 4XYGA 2ONCA 2H8KA 5A2GA 2RI1A 3U2QA 1XDZA 1TI7A 1NJGA 1LVUA 5FBHA 2OFPA 2F48A 3D3NA 4BGDA 1U0BB 5KKCA 1G8FA 2DBVO 3LP8A 2WEKA 5JDCA 5IFKA 1G7SA 4YJDA 3ANNA 2Z95A 3IHKA 5B7QA 5ICMA 4F8EA 2NZWA 4MULA 2OCLA 1NOKA 1I4EB 2CJYA 4XIFA 3TWOA 3WMXA 3ZK7A 3M8KA 3NJ8A 4GU5A 2G83A 2IYAA 3BBPA 4RVCA 4Y1GA 2GCPA 2O50A 1OQAA 4WUTA 1YRLA 2P0EA 2LW7A 1ZI8A 2X58A 2E37A 5C31A 3IJ5A 2XA2A 2Z4SA 4GBMA 4XI9A 1NDHA 1BS2A 4QGHA 4EB6A 4RA9B 4MLZA 3CXRA 1ZGAA 2VBIA 3RTAA 4G4IA 4YMHA 1Z6QA 1WCIA 3PYMA 3GLSA 3QLVC 2G4LA 2F62A 4MKZA 1KR2A 3X1MA 1ZR4A 2GRJA 2HK7A 3THRA 1WLYA 1XZJA 5A5VA 5JJ5A 4M36A 4RQAA 1J06A 3LF2A 3QMPA 5K05A 1I1NA 3SKVA 5KHLB 4S0ZA 3LNTA 4R2HA 1CRWG 1C0LA 4MVJE 5LP6F 4UM8B 1RXCA 3AERB 3ILXA 3NIFB 1I3KA 3SGLA 2QRGA 2KWIA 4EW1A 2DR0A 1KEPA 4WECA 4ZA2A 1LY1A 4PNEA 1QC5B 8AT1A 4HMOA 1D2GA 4TV8B 3O26A 1H0HA 1SWVA 3ICWA 1TU3A 1YS6A 2Z6VA 3OKAA 3B1XA 3JATB 1HBJA 1QH1A 5FI1B 3RABA 5L95A 3VC3A 1ZH8A 2XT0A 3ORRA 4JLUA 1V3QE 2H65A 3DEJA 3R6WA 2R7MA 3GX1A 4QVGA 3AR7A 1G9TA 1RAGA 3B82A 2X9NA 3I83A 3FCEA 3RKRA 1LU9A 1QIDA 2XXAB 4KXYA 3IBFA 3TLBA 4H1WA 1R6VA 4WCFC 5FOUA 3FCOA 3MRXA 3TG8A 2QMOA 3GRAA 4BO0A 4M0FA 1VPWA 2VBGA 1SD5A 1YONA 4KYTA 2D13A 5I51A 4C7OB 1I10A 3VMMA 1CW2B 2VF8A 4DABA 2NXWA 2PFKA 4ESEA 4AMZA 2RGGA 5FFMA 3U1TA 3A1FA 3VQTA 4ZXFA 4EI2A 1ZN2A 2O19A 2X0FA 3PRJA 3H2ZA 3HR7A 4UUQA 5D2CA 3M6FA 2QM8A 1RWNA 1OXBB 5CCXA 5IKXA 2O2XA 5DLPA 2QRJA 4R9VA 1CF2O 1JRLA 5A3SA 2PUEA 3ZDFA 3KAJA 3RU2A 4YMLA 1JBKA 1S7CA 3KPYA 1STOA 1DI0A 1RHKA 5HWSA 1Y33E 1SHJA 3KWMA 4LZWA 1MENA 3I42A 1YCDA 3GBVA 5DOZA 1GIAA 4YMSA 1VMAA 4CKYA 1TF7A 1CQXA 4P58A 4RY2A 4CV3A 4ZZ3A 4N47A 2XKJE 5JVDB 3F9CA 1TKAA 3L0SA 4J0EA 1HLFA 3L77A 3GPLA 3JD3A 4U2KA 5C81A 3ASZA 1Z16A 3PVSA 4FZVA 2ZS8A 3KYIB 1U8EA 3JR3A 4PYKA 5HBGA 1JJVA 5J1TB 4I9FA 4BX2A 3ICEA 4D45A 2ZTVA 3MCAA 4F96A 1YV9A 2R62A 2G04A 1OIWA 1JA1A 2P79A 2O0KA 2ALJA 3FKSA 1IN1A 4FLFA 1HDYA 2AVNA 3BH0A 4H18A 4BQEA 1WQ3A 3N2YA 3PBKA 3QLUA 3WNQA 3NHWA 2C7RA 1M5TA 3CONA 1RFLA 2VP6A 4BY9E 3I4LA 1QUEA 3FNGA 4G1EB 2H2IA 2I7XA 3VZDA 2CL6X 4DF3A 3K9CA 4UEWA 3DOCA 3RTDA 3ESAA 2XTNA 2HRQA 2C20A 7ABPA 4JI2B 5FBVB 1U2ZA 2YBEA 3AOGA 2WQ7A 4GP6A 2BN4A 3WIDA 1G20B 3KCQA 1XD2B 3Q5DA 221PA 3MTGA 4FBLA 4WWHA 1KH1A 2GNAA 2AK2A 3G2QA 4C4TA 4ECEA 3SIXA 5CA1F 1Z0ZA 2XMCA 1LBEA 1RAFA 1L5FA 3B51X 4B6QA 2OMEA 5M04A 3V1TC 1Z5NA 2DHQA 2REQA 3B2QA 1RM5A 3TPFA 3SX2A 3QXCA 1IU9A 1C3OA 3NUGA 1WG8A 1D4ZA 2UAGA 5DT9A 2QD4A 2JBHA 3P4XA 2ACWA 3OE7D 4XD7A 3S2GA 4KGDA 4GECA 1JMVA 4D43A 1NXOA 4TVSA 1W19A 2MTBA 1Q0UA 3MJCA 3QPWA 4BIIA 2BI7A 3WISA 4EVSA 2D3TA 4LGYA 3WLAA 3BZBA 4HY3A 4EZIA 4MAMA 4OK5A 1ZNYA 3NIGB 1F0PA 4UC0A 4AJEA 1QVZA 3U62A 4MVJF 2VQ6A 3UPUA 3FVRA 1L5HA 4OF4A 2LE0A 3JWIA 4NZYA 3HI6A 5BUQA 3O93A 3UFBA 4GM1A 1PR9A 2ZS7A 4FGJA 2X0RA 2X8WA 3HN6A 3QOXA 4NMLA 3WWYA 4DV0B 1FEZA 4O4JA 1LDEA 2PY6A 4YECA 2HDWA 1DAPA 2APJA 4MP3A 2DWOA 2REQB 3NI2A 1C7ZA 2ZIXA 5DB4A 1B00A 2HJWA 5CEFA 4OREX 4PX3A 3T6KA 4INJA 1TJYA 3LA8A 3K8OE 3OUTA 1Z2DA 2P65A 5DNYB 1JA9A 2ERYA 3OI7A 3TL2A 3HVUA 1SRRA 2XBUA 1Q50A 2WA1A 3QW4B 1TLTA 4RVSA 2CZGA 4IL5A 4KAJA 1ZVJA 2IPAB 4KQWA 1Z75A 3GNSA 5CVUA 5HSGA 3V1UA 5L6MB 3PPVA 5AOBA 1S3GA 3USZA 1G3MA 1RR6A 2XE4A 2Q1WA 2OECA 4EX7A 3V1NA 3EISA 3OO1A 3G2HA 1NJ5A 4C21A 1QHSA 2DFDA 1FVHA 2ZIXB 4R1NA 1JDVA 4KXUA 3R0VA 3NYQA 1RU3A 4PAWA 2WMOB 1VFPA 4B8WA 4BO2A 5AW8A 1YJBA 1ZVKA 3ZGLA 3PWSA 3AUYA 1OYYA 1I9GA 3CKMA 3HBJA 4G1BA 4H4DA 3SK0A 4QLAA 4W5JA 1C9NA 3T12A 5JCOA 1CUBA 7MDHA 5KU7A 1NUPA 4JUCA 4UHFA 1XRPA 2WAXA 5JD3A 4P98A 5LLSA 2GH1A 4IIDA 3I9KA 3Q41A 3UJNA 1Y8ZA 4QATA 2BKXA 2F8TA 1N3BA 4HF7A 4YN3A 1URPA 1Z5GA 1UKZA 1FS6A 3PHGA 5F73A 2M2IA 2D6FA 4FDAA 2AMYA 4LZZA 3HXPA 1JDSA 4D56A 4DC0A 1FX1A