2ZSHA

Structural basis of gibberellin(ga3)-induced della recognition by the gibberellin receptor
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
338
structure length
338
Chain Sequence
b'EVNLIESRTVVPLNTWVLISNFKVAYNILRRPDGTFNRHLAEYLDRKVTANANPVDGVFSFDVLIDRRINLLSRVYRPAYADQEQPPSILDLEKPVDGDIVPVILFFHGGSFAHSSANSAIYDTLCRRLVGLCKCVVVSVNYRRAPENPYPCAYDDGWIALNWVNSRSWLKSKKDSKVHIFLAGDSSGGNIAHNVALRAGESGIDVLGNILLNPMFGGNERTESEKSLDGKYFVTVRDRDWYWKAFLPEGEDREHPACNPFSPRGKSLEGVSFPKSLVVVAGLDLIRDWQLAYAEGLKKAGQEVKLMHLEKATVGFYLLPNNNHFHNVMDEISAFVNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable gibberellin receptor GID1L1
publication title Gibberellin-induced DELLA recognition by the gibberellin receptor GID1
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hormone receptor
total genus 122
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2zshA00
4K2AA 4C4ZA 4UBKA 5EHZA 1J2EA 4OU4A 4BAZA 4GEGA 1I6WA 5F4ZA 5DNUA 4HZGA 4LHEA 1WPRA 3B3QA 5SYMA 2WUDA 1QGED 1FJ2A 1IVYA 4UFNA 4JYMA 4CCWA 3WL6A 5FOQA 4AZ3A 2PSJA 3D2AA 4F5ZA 4EA6A 4BC0A 1QIGA 2WUEA 4CG1A 2ZSHA 2WKWA 2EDCA 3EIOA 2VSQA 1CUJA 2WUFA 2OGTA 4X3CA 5AKKA 1LZLA 4PW0A 4FDMA 4M0MA 4HTAA 3CCBA 4BZZA 1U65A 1CUGA 3F96A 3IUQA 2PUHA 2VF2A 2LIPA 4ARAA 2EEPA 2QR5A 2V96A 4L3WA 1G5FA 1UT6A 4MQMA 5AKJA 1MAAA 2OG1A 4FBLA 5D7BA 1QOZA 3WWPA 1XKTA 4LXIA 1UOQA 4G5XA 1CR6A 1XZKA 3BWXA 1DWPA 3ESCA 3KD2A 1C4XA 4NMWA 2OLEA 2OAEA 1R4ZA 2WG1A 4LIPD 1FFDA 4AX4A 5DLPA 3AFIA 4QA9A 3ZV7A 2QTBA 5AICA 1UOOA 4KAAA 4FOLA 3WMRA 3FCYA 3RKSA 1L7AA 5CXXA 3KOOA 4UPDA 1IUOA 1U8EA 1B6GA 4B85A 4LYEA 4ZGBA 5HZGA 5JANA 3C8HA 2YYSA 1HL7A 3CN7A 5AM1A 1CUXA 1JI3A 4EUSA 5K3CA 3GROA 3SWWA 4AQDA 3D2BA 4UBMA 1Y7HA 4HAIA 3FYUB 1S8OA 2CKMA 2JEZA 5HF9A 4ETWA 4KACA 1ZJ4A 1DWQA 4MYDA 3LS2A 3VJLA 3N2ZB 5AK4A 1XZBA 2WIKA 5HK9A 3I6ZA 4UBLA 1H23A 2QUAA 1CUHA 3DEAA 1BN6A 2BUCA 1EINA 4N8EA 4FBMA 2VTVA 1CQZA 4FWBA 4ZREA 1F6WA 1KU6A 1LPMA 4F60A 1QFSA 2PPLA 2OXEA 3ESDA 1QTRA 1YS1X 3L1IA 3WA7A 2B9VA 3RLIA 3R3UA 2J4FA 5AK3A 1JU4A 3PI6A 2GBFA 1ZD3A 3LCRA 4KAJA 4QE3A 3OC0A 5LZ9A 4WFIA 5AH0A 1VZ2A 1AUOA 2PBLA 4HXGA 1TK3A 4DSZA 1NU6A 3WYNA 4J0CA 5LZ5A 3W9BA 2QXUA 5JZ9A 3PUIA 2PU5A 1BU8A 5AM5A 5BV7A 5AI5A 3MVEA 4B6GA 1XKLA 3S8YA 1ZD4A 1X2EA 4X85A 1BROA 2CZQA 3DYIA 2DR0A 1HBJA 1R3DA 5DTIA 2PSHA 4H7EA 3VJKA 1CVLA 5DYTA 1IZ7A 2QMQA 1KEZA 3SX4A 3STYA 1QIMA 2QXTA 4Y2PA 4I19A 2B4KA 1GQSA 3AZQA 4DM7A 1A8SA 2AJ8A 5IKXA 2QRUA 5CBKA 4DYHA 2XE4A 4ZI5A 3QZUA 1SCKA 6YASA 1XRLA 3MUNA 3ZPXA 5ALXA 4AB1A 5AM2A 2ZYRA 4BDTA 1ODSA 2WFLA 3G0BA 3DJYA 1LPBB 4B84A 3IUNA 2FJ0A 3V1NA 3WKEA 4AN0A 5JD6A 2AJDA 3PE6A 1GKLA 2O7RA 1Y7IA 1BCSA 3FLBA 4X6XA 3DQZA 4Q3LA 4U2DA 1E5TA 1MU0A 4PNZA 3I2KA 4X94A 1MX9A 3WA6A 1XZDA 5ESRA 4G1FA 5AKEA 4CFSA 2I78A 3WI7A 1EK2A 1CUSA 4B0OA 4H7DA 3ICVA 3V1LA 3STXA 4WDQA 3C43A 1YAHA 4FNMA 2WHQA 2XQJA 2BUBA 2ZJFA 4PSDA 3W05A 5A62A 1DINA 5HF5A 3H18A 4BZWA 1ZI8A 4BVJA 2VJCA 2ONCA 3C6XA 2WLSA 2JGFA 5K3BA 1QIEA 1VA4A 3FLAA 5DYWA 4DMCA 2DHEA 1N5RA 5K3AA 4XX1A 1MN6A 2JBWA 4P92A 3UUFA 5I9IA 5JAPA 4AO8A 4QLOA 4X7BA 5A7GA 4H7IA 3DOIA 3IUJA 4I4CA 5SYNA 4KR0A 4Y9SA 3U1TA 2HA2A 3QPCA 2HRQA 3WKBA 2WTMA 2PL5A 1UKAA 1P0QA 3WWCA 4U2GA 4C4YA 4W1RA 3G0CA 5FUMA 2JF0A 3A6ZA 5HK8A 5EGNA 3V1KA 1QIFA 1CUDA 2DQYA 2ACEA 2H9YA 4HRYA 1IMJA 3A2LA 2XQFA 2XMRA 5LZ4A 1DU4A 3G9XA 2RAUA 1EX9A 4Y7DA 4U2EA 3V9AA 3G0IA 1WB5A 2QOEA 2C5GA 5ALJA 3C6ZA 2RIPA 3GFFA 4ZXFA 4N5IX 1E3QA 1GPNA 1QLWA 1TCAA 3DD5A 3HI4A 2DSNA 1ZD2P 4I3FA 3JWEA 4BDSA 2XUHA 3VXKA 3C87A 3I2GA 5AHXA 4BVKA 3IB3A 1THGA 5I7UA 1QE3A 3DNMA 3H04A 4BYMA 1H2XA 4DMFA 1USWA 2HL6A 1U2EA 5ALGA 1UXOA 3MGAA 1DQZA 1G66A 5LIPA 5HFNA 5AOCA 5JD5A 4OD0A 1XLWA 3WL5A 2I03A 3WIBA 4RE6A 4X71A 2HU8A 3TRDA 5CH5A 2XLBA 5AKHA 2VATA 4H7HA 3PFBA 1A8UA 4H35A 3WK5A 3L1JA 3O4GA 1CIJA 5CT6A 5CT8A 3D0KA 4IH9A 4HXEB 5K3DA 1VA5A 4H7KA 1GT6A 3WZLA 1M33A 3U0VA 3R0VA 5LLSA 3AIMA 1QIJA 2XUIA 1HKHA 4G8BA 2HFKA 3CCCA 4OB8A 4AO7A 2WFLB 4UFOA 5ALEA 3AIKA 2VQ6A 1XQYA 5ALZA 2CUTA 3R3VA 3HEAA 4QNNA 3IDAA 4X92A 2O2HA 4X6YA 3VVLA 1UOPA 4P9NA 1G4HA 1XLUA 1TKRA 2Y6UA 3DL4A 4B0PA 2HDWA 3M82A 1BEEA 2WHPB 1QIIA 3QMMA 1ORWA 4BCCA 2Z8XA 1FFBA 1R88A 3WL7A 1OXMA 4A5SA 5LP1A 5IVDA 4Y2SA 5AKXA 1K63A 4CI9A 3BIXA 3E4DA 2V9ZA 1R50A 3HABA 1UKBA 1CUUA 3ILSA 1AGYA 3WQHA 3N0TA 5JAOA 1P0PA 3M3DA 4F0JA 4DMKA 3F97A 3RK4A 1ISPA 3I1YA 2OQIA 2GZRA 3QMVA 2YASA 4IH4A 5D3KA 4QZVA 5AOBA 2XUOA 2ZYHA 1EDDA 4QWWA 2JEYA 1HQDA 1EDEA 2IIVA 1IUNA 2AJBA 5DNVA 5AOAA 4BRZA 4BCDA 4FNGA 1CEXA 2X5XA 3H17A 2XMGA 5T4BA 3ANSA 3F98A 5H3HA 5IVIA 5CTAA 5HCUA 4HRXA 3ESAA 3O95A 2VAVA 1CUWA 1VE6A 2W6CX 4X6UA 4N8DA 1GXSA 1CLEA 3D3NA 5EFZA 3DKKA 2GYUA 4BCBA 1A7UA 5HF6A 4X90A 4CIBA 3AZPA 3WWOA 2WJ3A 1CQWA 5AI9A 2PKYX 2JGEA 4GWLA 5JADA 3WK4A 1JFRA 3BL8A 3C6BA 5JATA 3G9UA 4J0DA 3W06A 2C5FA 4QDUA 4ITVA 2PM8A 1CPYA 1CUVA 4PV7A 1XFDA 3CXUA 1AZWA 5AK5A 5LKAA 2WIJA 3WK6A 4G8DA 5ALKA 1CUZA 4N5HX 3H2IA 5C81A 3OURA 4X00A 4H0CA 1ETHA 4ZV9A 1YCDA 3W2TA 4W1QA 4BTLA 2QZPA 3SC2A 5AKLA 1XZGA 4KE8A 2G5PA 4OCZA 3PDCA 1W75A 3Q8WA 3H2KA 2HA3A 4BBZA 3P2MA 3WL8A 1EXWA 2O7VA 2OPHA 4C88A 4B83A 3FYTA 4B81A 2HA6A 3IVMA 3NOXA 2QJWA 4AZ0A 1SFRA 1DQYA 5IVHA 2FJPA 5CMLA 4K6KA 1VJ5A 3I2IA 1PJAA 2PSEA 4PQEA 1Q84A 1UK8A 2X76A 4K6HA 1CUFA 1SC9A 3R40A 3WKDA 2BAGA 1CUYA 5EIAA 2HA4A 1VXRA 4AXBA 2EDAA 2IITA 3L1HA 5HQ3A 2AJCA 2D0DA 4Y2YA 1TAHA 1W4LA 2ZYIA 4Y2JA 1FFAA 1LBSA 4BAUA 5ALNA 3KDAA 3K9BA 1EI9A 4MJ3A 3FCXA 2RHWA 2HA5A 4JUIA 4KJXA 4FHZA 3FLEA 3HJUA 4EY7A 2ECFA 4DLNA 1AURA 2NW6A 1XLVA 4BRSA 5ALHA 5ALRA 2XMCA 3C8DA 4C01A 3WJ1A 5K3FA 3B5EA 4FLEA 4UHBA 2OQVA 4CIAA 1MJ5A 4BTVA 2H7CA 4FLMA 1QIDA 3H0CA 5CURA 2HFJA 3I6MA 4LYDA 4UFPA 1XZLA 3H2HA 1LPAB 3G9TA 1L7QA 1THTA 1L7RA 3NGMA 1D07A 3BXPA 2HIHA 5ALFA 2C4HA 4TPKA 1TIBA 5C8VA 2JGJA 1UFOA 5E2IA 4OU5A 2YXPX 2E3JA 4B80A 1MNQA 1EH5A 2C0PA 3DS8A 1ZI6A 4UBIA 2P8SA 4U2CA 3O0DA 1W1IA 4ROTA 3ANTA 4QLAA 5CT9A 2VT7A 3G7NA 1HLGA 1UK6A 4KRYA 5IH7A 1OCEA 4Q34A 4TGLA 1G42A 3W9UA 3ZI7A 1LBTA 5CW2A 4P93A 3W04A 3IUMA 2BGNA 4QWMA 3EQ9A 2QVBA 1ZIYA 3OG9A 5JARA 1K6EA 4H77A 2XUPA 4Z49A 1CV2A 4AMYA 2HA7A 4W1SA 4C6HA 2WUGA 1O6GA 1BE0A 1ODTC 2WIDA 3DLTA 2R11A 5CRIA 2WFMA 5JAUA 4KYVA 3T52A 2ES4A 4MQLA 2QKYA 1N8SA 2I3DA 3BDVA 4EB0A 2RONA 3WK9A 4EBBA 5DTJA 4EY8A 4DTCA 1CUCA 1UKCA 2H7YA 5KBYA 4W1PA 1EB9A 4WFJA 1J1IA 4P08A 4K6GA 2XUQA 2GYWA 3H1BA 5EHXA 3G02A 2WM2A 1HDEA 1ZI9A 1XQVA 3Q0TA 4J0GA 2XMSA 3QPAA 1ACJA 3SK0A 1QIKA 4L9AA 4M0FA 3FVTA 1AMNA 2ACKA 4PF1A 1R9MA 4F21A 1SOMA 1YSCA 2FX5A 4J0KA 4JNCA 4G8CA 1Q0RA 3STTA 3R41A 3H1AA 4RNCA 1AC5A 3AILA 2DQZA 2CBGA 4L0CA 4U2FA 2HRRA 1YA4A 4C87A 2BFNA 4B7ZA 3FSGA 5AJHA 1LLFA 3KWFA 3BF8A 4G4JA 4FMPA 1F0PA 2B20A 4WFKA 1LNSA 2WTNA 3KSRA 4OYLA 1JJFA 5JASA 3FNBA 5EHNA 3C6YA 3BJMA 4EY4A 3OOSA 2O2GA 3KXPA 3PUHA 5CT5A 3QITA 1K5PA 1VOTA 2XUAA 1W52X 2GZSA 4WY8A 1RP1A 2XUDA 3NWOA 1RYYA 1ODCA 2AXEA 3D59A 5YASA 5ALOA 1KU0A 4Q1VA 1H2WA 2Z3WA 2BGRA 2BKLA 3GA7A 5K3FB 2QUBA 3AIOA 3PICA 3IURA 3QBJA 2WQZA 3FWHA 2C7BA 2UZ0A 1PFQA 2QM0A 2XI4A 2XT0A 2XUGA 4QEKA 4WCVA 5ALLA 1YA8A 4GI1A 4EZIA 5T4HA 1CRLA 2Y1KA 4QDOA 2GBCA 4TVKA 5FP0A 4D9JA 5A6VA 5DJ5A 5HKAA 3QH4A 4Q05A 4Y2RA 4AO6A 4PSUA 3M81A 5AI6A 3BDIA 4EY5A 1GKKA 1LPPA 4B9EA 4O08A 3A2MA 2OCIA 5T4FA 2HU5A 3LLCA 3C70A 2OCKA 1VZ3A 2OGZA 2PUJA 1LPOA 1JU3A 3AINA 1IUPA 5C7YA 3ZLVA 2AJLI 3I28A 4INZA 3X3HA 2DCMA 1SCQA 1YAJA 2ZYSA 4KAFA 3FYUA 2ZJ7A 1VLQA 4Q3OA 1MX1A 4X91A 4A16A 2JGLA 3O9MA 1EVQA 5JALA 3WIOA 3HACA 1QFMA 2HM7A 4EY6A 5EHQA 3VKFA 1JJIA 4G4IA 3TJMA 5LZ8A 2JGMA 1WM1A 4LXGA 3I2FA 1F0NA 3H2GA 5DYYA 2J3DA 1MX5A 4GDMA 3JW8A 2RHTA 4IH1A 3AZOA 3GELA 5E4TA 1UWCA 5D3ZA 3CN9A 4B9AA 5A2GA 5HFAA 3QYJA 4H18A 3PF9A 4OB6A 4BATA 3FSGD 3ZWQA 3A70A 4DSAA 3E1GA 3DDUA 1R9NA 1EDBA 4LXHA 3OM8A 4MYSA 1CFJA 4IQ4A 5JZSA 5E4JA 3DKRA 1ACLA 3F9CA 4KE6A 5AKGA 5LZ2A 3QPDA 4LKOA 5ALQA 3R3XA 1J07A 1CUAA 1ZGBA 1UK7A 2C58A 4UBOA 1GZ7A 3FBWA 1XZIA 1Y37A 2W22A 4UBJA 1Q0ZA 3TEJA 3ICWA 3S2ZA 5CT4A 1XRMA 4E14A 4MWTA 4YASA 5JIBA 1XZAA 1IZ8A 4Y2VA 2HHAA 4MXDA 4J03A 1CUIA 3RM3A 1DT5A 3MUOA 2OCGA 4Y2UA 5E4YA 5KWIA 3F67A 1EA5A 2WHRA 4B82A 7YASA 3A2NA 4ZWNA 4NVRA 4CCYA 1P0MA 1BN7A 4JYPA 2QS9A 1ZGCA 3E3AA 5AM4A 4M0EA 4OPMA 4BB0A 1TCCA 4Q3KA 2XDWA 1TRHA 3D4LA 3AJAA 4E11A 4G9EA 4XWGA 5ALMA 4DGQA 4GHWA 3D2CA 1WHSA 1TCBA 2C0QA 4Y2QA 1AQLA 1SCIA 1VXOA 4G9GA 2I3ZA 1XROA 1EK1A 3WJ2A 3NUZA 3QVMA 5K3EA 1K8QA 3ZLTA 5FPPA 2VJBA 2G5TA 3JYHA 5AM3A 4BAGA 1HPLA 3WK7A 1ZOIA 1GPLA 3AUKA 5AI8A 4KEAA 2WIGA 4AMZA 1WB4A 4JEIA 2V98A 4XVCA 2RI6A 5AM0A 1AX9A 2QT9A 1T2NA 4H7JA 2OAGA 3VVMA 4FFVA 2XQIA 5K5EA 5CH3A 4DNOA 5BWBA 2Y2VA 3TGLA 2H7XA 3WWDA 3FOBA 5A71A 1QTIA 1JMYA 5AKYA 1AKNA 1MT3A 1TQHA 2X8BA 1A88A 2JGIA 2R8BA 1NU8A 1MPXA 5FLKA 2Z8ZA 3IIIA 1JJBA 3EQ7A 1BS9A 3I6YA 3ED1A 5T4EA 2XB6A 1BCRA 2GBGA 1XZJA 1UZAA 2PSFA 3FAKA 4QDXA 2XMDA 4GLBA 1DX4A 3VJMA 3G0GA 3STVA 4C89A 4RPCA 5EI5A 2J4CA 4DMHA 1FFCA 2D5LA 4IHAA 2PU7A 5FDFA 5I8PA 1YB6A 3V48A 3B12A 1F8UA 1QO7A 4UUQA 1QZ3A 3ESBA 3OPMA 5AO9A 1T4MA 3HYSA 5BWCA 3LIIA 3BF7A 2HU7A 4EHBA 4WDRA 2RGUA 3GUUA 3VDXA 3EQ8A 3O4IA 5AP9A 1J06A 4ARBA 5KWJA 2XQGA 1LPNA 4UBNA 4NS4A 2WILA 1JT2A 3PF8A 2JGKA 4FTWA 4ZV7A 4OUKX 3HZOA 3KWJA 1BRTA 4A23A 2CEKA 1CUBA 4N8SA 1Q83A 5DNWA 4K5QA 2H1IA 4J0JA 4OSEA 4H7FA 1E8DA 4HS9A 3G0DA 3QM1A 2PVSA 5JAHA 3STUA 3STWA 2WFZA 3RARA 4RE5A 5KREA 2CB9A 1VE7A 1DT3A 3QMWA 5HKBA 4MWSA 4XJVA 4Y2TA 1JKMA 5EIEA 1XZMA 1CUEA 4UHHA 1EHYA 1H22A 4CCYB 4BE9A 5ALVA 5AKZA 1GPKA 1MAHA 5ALSA 3FYUC 3GZJA 3WWEA 3HLKA 2ZJ6A 5ALPA 3I2JA 2VJDA 1QONA 3T4UA 5ISMA 1GQRA 5LYYA 4GW3A 1YR2A 4YPVA 2JIDA 3BIWA 1DX6A 1XRPA 2DHDA 4UHDA 2XUFA 4MEBA 2WJ6A 1WCYA 5J3JA 5JYCA 3O4JA 4RGYA 4G4GA 3LP5A 1R1DA 3C5WP 3K2IA 4GXNA 4UHCA 2GBIA 4UHEA 1NX9A 1DWOA 4X97A 1GGVA 2OCLA 3ZLUA 3BE8A 5AIAA 4DNPA 1WOMA 5AK6A 1E89A 2WIFA 1X2BA 5JZBA 5EIHA 3OTQA 2WHPA 5LKRA 3G9ZA 1MNAA 5CXUA 4BP8A 1EVEA 2DFPA 3H19A 1ORVA 1A8QA 1H2YA 5ALTA 3DCNA 3UUEA 3V1MA 3EF3A 2Y2UA 3WYDA 1W6RA 2G4LA 5C8XA 3D7RA 4YK7A 1YB7A 2Z5GA 5A7FA 5AKIA 2IX9A 2G63A 1UK9A 4J0HA 4ZRDA 2ROQA 2FUKA 1LZKA 5HQ3B 2WJ4A 1P0IA 1XZHA 3DOHA 4WJLA 5IVKA 2DHCA 4FKBA 1K4YA 1O6FA 4BC1A 2B61A 1QO9A 4CG3A 5C8ZA 5ALYA 1ZIXA 5FKJA 5ALDA 2ZVDA 1WPXA 5AI4A 2VA9A 3EBLA 4V2IA 1U4NA 2PSDA 3K6KA 2XLCA 3HRHA 2K2QB 4AN1A 3D5EA 2OGSA 5HF8A 5LZ7A 1PV1A 4GECA 1N1MA 5AI0A 1ZICA 4WY5A 3VISA 2WU4A 2XUKA 4Q82A 3IBTA 1Z68A 4OB7A 1FFEA 3DL7A 4X95A 2Q0XA 4CG2A 1QIHA 4BP9A 1YS2X 2WSLA 4BVLA 2Z3ZA 4FFWA 4U2BA 3BJRA 4DIUA 1QJ4A 2GYVA 4XIIA 2XUJA 3YASA 1E66A 3M83A 4BE4A 3IULA 1JMKC 4PSCA 3E0XA 1B41A 4E15A 2YH2A 3I2HA 1XZFA 2BCEA 2BUAA 4J0IA 5FXMA 4IO0A 3C45A 4QDZA 1LGYA 1XRRA 2PX6A 4E46A 2XMQA 2WG2A 5A7HA 4DNFA 3LIPA 2VJAA 3IA2A 4W63A 2XMZA 1XRQA 2WU3A 4W9RA 2VAXA 5FRDA 3WK8A 3DYVA 2CJPA 1N5MA 4PO3X 3O9VA 5JD4A 5FV4A 2VT6A 4J7AA 3HSSA 1XRNA 5D6OA 3UMJA 3GBSA 1MTZA 4KE9A 4UHFA 5ALWA 1XZEA 5DWDA 3O4HA 3H2JA 4GBGA 4S0XA 2WG0A 1E8MA 1XQXA 3R3WA 2ORYA 1YASA 2O2IA 1C7IA 1W76A 1WHTA 1XZCA 2ZSIA 1WB6A 4L72A 2HA0A 4KE7A 4X93A 3WKCA 3F8SA 2Y6VA 1FSSA 5ALUA 3C5VA 3FVRA 5FPQA 1LPSA 2VEOA 3R3ZA 1C7JA 5ALIA 5CH8A 1XQWA 2QJRA 2XQKA 2XMBA 1ZD5A 4FLFA 3HXKA 2BJHA 1E8NA 1VKHA 4YX9A 4KRXA 4Y2XA 3PFCA 4MEAA 1DTEA 2V97A 4DNQA 1H2ZA 1RWQA 2CMFA 3I1IA 3WZMA 3HC7A 1MO2A 3WLAA 4OYYA 4JH0A 1EB8A 1ZJ5A 5AIBA 4C4XA 5BOVA 1BEZA 3R3YA 4HXFB 3WKAA 1X70A 4QDTA 2HADA 2J3QA 4NZZA 1OILA 4J3JA 4HVTA 3G8YA
chains in the Genus database with same CATH superfamily
5SYAA 3CRRA 3AEQB 4OH1A 2ZU0C 1YRYE 1QCZA 1HORA 4Y3UA 4PFKA 4O2BA 2OHFA 5H70A 4ZJYA 4ZQCB 1J2EA 1UQRA 3VYSB 1AGNA 1DV2A 3IPXA 1BYIA 3ANYB 3E9MA 3H4IA 1NOKA 3ZC3A 3BKXA 1Y34E 4PLWA 2PS1A 4RMJA 4BWFB 4ZHQF 1J9EA 1HRDA 2XXAA 1CG6A 1P1CA 1Z2DA 4ZYYA 3B6ZA 4E12A 2GFQA 4BQEA 2J4DA 1QU2A 2B1GA 1GZ5A 2R1ZA 4GEGA 2OY0A 4LPSA 1I6WA 5F4ZA 4PYJA 2FUEA 3HKCA 5EXSA 2YL2A 5BSWA 5KYWA 3AR6A 4HTFA 2QLJA 2QROA 1JQDA 2C2GA 2Y71A 5I9TA 3KBBA 2QW0X 4TWZA 2GX6A 2WWFA 1L4YA 2R751 1J9GA 2FF7A 2IXTA 4M1QA 5B1YA 2G82A 4IIUA 2WTUA 2PKEA 4L3OA 4ASUD 1G20B 3A1CA 2NT3A 3HKDB 1VSVA 2E87A 2EF1A 1PFUA 2PV7A 2V58A 1GUAA 3RD5A 3ESQA 2A9QA 2Y4OA 1FTQA 3A1NA 3HLTA 4OGFA 3P9YA 4RMNA 5A4JA 3NHWA 3NT5A 1A9QA 1NVDA 4GWKA 4L4RA 1MXHA 1H8HD 4IO1A 3G13A 1T26A 1KZYC 3HWX1 3JPWA 5JJBA 2X0KA 1C0LA 5I47A 3PCRB 4ZQIA 1KYWA 2PSJA 3HB7A 4JROA 3DPSA 3SYRA 4EA6A 2XZOA 3F5SA 3HVUA 1CR0A 1U3TA 2WYHA 1W4AA 1DPGA 1ZH6A 3GK3A 2X5NA 3MJRA 3M1YA 3V7YA 2WUEA 1P19A 3CF6R 4LXUA 4TV9A 2EDCA 4RD3A 2CVFA 2C3YA 2WWTA 2YVQA 1D2AA 1ZA2A 1BU5A 1OASA 3OBBA 2VEDA 3M6IA 4WRRA 1P6UA 2BHLA 4X3CA 3LQYA 1LZLA 1ZLXA 4PYOA 1CQPA 2SBTA 2HR1A 2VJOA 2ZT7A 2W2LA 4OFWA 1S7GA 2VDOB 2Z1DA 1AZLA 3CCBA 4CM8B 5CFQA 5T57A 4JOCA 3EXEA 3JYNA 1S1CA 1ZVMA 3AM3A 3MWDA 3ELDA 3QYAA 2P27A 1M8JA 1V9CA 4WAUA 3WLJA 3VA7A 5TX7A 1FQWA 2VSFA 4Q1DA 1YRBA 1GYPA 1M0TA 2C2WA 2FB9A 1GUDA 1EFRD 1GAQA 2VF2A 3VZCA 5AHRA 5KQMA 4MQ4A 1CJMA 5MF6A 3DLCA 5JT1A 2LIPA 4ARAA 3AERA 3IT2A 3SQOA 3JQ7A 3ZWNA 3HO6A 1PS0A 1G5FA 1UT6A 1AUQA 1E1MA 2IELA 3INGA 4L3WA 4MQMA 4P36A 1QYXA 4RO0A 4CU5A 4RJTA 1H6CA 1XMOB 2PG3A 1GLGA 5MHTA 4HNRA 3V2IA 3Q72A 1WXQA 5GVRA 4B40A 1ODJA 4KIFA 1IY9A 5B37A 1BE8A 1RCFA 1VC2A 3SY8A 2H2AA 1Q7BA 3LCVB 4L02A 3U2QA 4UZFA 3EZGA 1BXRB 1FUUA 1OI2A 1QOZA 3ID6C 5FOXA 1U0LA 3WWPA 1J2JA 3BPSA 4RY2A 4NAHA 1JAYA 1U6KA 4XH9B 4RPGA 1KMMA 1UMCA 1SHLA 1QG6A 2D00A 2A1TR 3PGKA 2CHGA 5JZVA 1FL9A 2OSBA 1XTRA 1IN6A 1ZU5A 4MA0A 3ZJVA 4AX4A 3NBQA 4YRKA 5KTYA 2EHDA 2ZTUA 1XE3A 2B21A 3AFIA 1W88B 2X2EA 5A6SA 5KU7A 3UB4A 2NXCA 4H08A 2F3TA 2LNDA 2LTAA 2QX4A 1XDGA 5AICA 5ECGC 8GPBA 1RXWA 1ADYA 4UUNA 5FTKA 1O0CA 4KAAA 4KMOA 1VL8A 1KIMA 3V8NA 2RD2A 3KTOA 1GUBA 4DZZA 1KMCA 5K0SA 1A7KA 4BFSA 4TZ0A 1P61B 4PLTA 3RKSA 4R1NA 1M66A 1W0JA 2GUGA 1HYGA 4BV2A 4DMKA 3EZ9A 4NQZA 5CXXA 3KOOA 1IUOA 2HAEA 2J9RA 4K9LA 4AY4A 3DMTC 4BQNA 4CG0A 5HZGA 1I2AA 2NV2B 3FPAA 1HL7A 4EG1A 3KQSA 4QFCA 1W93A 4XCVA 2W2KB 4ITRC 1IZYA 1JI3A 2I3AA 1M2FA 1X1SA 4HPXB 1TYBE 3GROA 3VH1A 4EUSA 5LXTA 4B3GA 3Q8MA 4PLHA 3M6MD 3BD8A 2XWQA 4W7SA 4OAQA 2FZ4A 3SVZA 3EEIA 4U2KA 2G83A 3NUGA 4C0LA 4DREA 5CA1F 5BMVF 5JAMA 1Y98A 5DXFA 2UYHA 1C2TA 2DFLA 3U60B 3WP1B 3U9SA 3GG9A 2OV3A 1L5KA 5BWLA 1XD2B 3RH0A 1IB0A 4PO8A 3T7IA 1ZJ4A 3S2GA 4WL0A 4B7XA 3OT1B 1EWKA 3L7MA 2CY0A 1LLQA 5AVZA 5CU7A 3GRUA 2JRLA 4IDDA 5AK4A 3V33A 1UDCA 1XZBA 3AB8A 4X6LA 9ATCA 4Z6KA 1E2BA 1U0JA 2GPJA 3WGMA 1RWXA 3COJA 1RBYA 3LY7A 2BE9A 3W7AA 4ZVOA 1OFGA 2QUAA 2XCIA 1DWUA 4RW0A 1HE8B 4C06A 2NSLA 2O8EA 1WHTB 1ENZA 2WZQA 1ZIPA 3OIWA 3W7BA 1CD5A 1X42A 3D5QA 5AW9A 2I4MA 4DWWA 1CEEA 1TW2A 3I9V1 1XTJA 1P9WA 3IVAA 4L9SA 4FWBA 3PUZA 3AESB 4IIXA 1LNQA 1P6XA 5KZMB 4ZREA 5TLSA 1A50B 3IPCA 4BV8A 2YYZA 3ABZA 3KQOA 2G6BA 2R1UA 3K0AA 1QFSA 3GMSA 4PCUA 4B7UA 5EJ9A 1NJ8A 4RA6A 4G01B 4D43A 2ZR0A 1E3LA 1YQGA 1A5BB 3ESDA 4FUQA 4LZWA 4QPJC 4RSRA 2KSQA 3UXMA 5K0JA 3ENVA 3E7DA 1YMUA 2L17A 2QE7A 3VGPA 2BBWA 3W2GA 4RHTA 4BFLA 2X3YA 2AIRA 3U3KA 5F1YA 4LFAB 3UB2A 1GGMA 5JZMA 5AK3A 1JU4A 4MUKA 2GBFA 2B8NA 3EUAA 3SE0A 3VPHA 4BX9A 1F5NA 1V16A 4JN6B 1K92A 4WERA 3OC0A 5TQ0A 3KOZA 3REQB 3SS9X 4DKXA 1JDSA 3QLVA 4JJ8A 4RZIA 3W5BA 4ZAZA 4Z9XA 5DTQA 3ZDRA 2CXTA 5BV2P 2WPNA 4RFSA 4QJ3A 4KXVA 1ZCBA 3FFXA 4EMBA 1EQAA 1Y3HA 3OX2A 2FR8C 4X45A 5LPNA 2GDJA 3QXSA 3KZMA 4EG8A 1RTTA 1QC5B 1XNHA 1H6AA 4MO9A 1OHHD 4FYHA 2PT6A 4WNIA 3ADBA 1GT91 1VI2A 4J0CA 4PY2A 4PRZA 3A6HA 3NT4A 3C8UA 2FQWA 4XX0B 1BKYA 1QTNA 5TVGA 3TDMA 4D9BA 2C2KA 4JT4A 3THXA 4Q1CA 4FFBA 4LHWA 5EPEA 6CHYA 2G1PA 1BU8A 1W1UA 1NZDA 2I6QA 4DCTA 4HG2A 1IG0A 3CRNA 4ND3A 4F71A 5AM5A 2CNWA 1Y8CA 2O9JA 3O91A 2XECA 4YACA 1Q91A 3F78A 1D04A 1ZLYA 4O2AF 4B6GA 1NMXA 3OZEA 1NW4A 1ZD4A 2QVZX 4KMRA 2EZ8A 1DKNA 5J5CA 2XMPA 5AVUA 2J5QA 4CF6A 1TA0A 1BROA 1PW5A 4N7RA 3LA6A 4EGQA 4FVTA 2WWYA 1TKAA 2Z4RA 2PUBA 1GQQA 4PR3A 3RCBA 3KVRA 2XTNA 2DG2A 1R3DA 1ZRSA 2PSHA 1MOQA 1ULZA 1X9GA 2ZIGA 4JGBA 5CLHA 5FR1A 3SS8A 3PPVA 4FIDA 1Q16A 3H11B 4JJ6A 1PZXA 4L4YA 2HLHA 2W98A 5GJWC 5I7AA 5JNTA 4LRUA 1ZUNA 1ZHOA 1U1GA 3EIHA 3OZXA 1GO2A 3DBOB 4RIEA 3U3ZA 4EFLA 5I7OA 1X1QA 1RWVA 2HTFA 4GXTA 5KVAA 3P2OA 1MW8X 2WSSA 3HU5A 1YZHA 4DM7A 2ZVQX 3DP9A 3T5AA 2IBTA 3GWGA 3MJVA 4G56A 2WIBA 3D43A 4B47A 1D09A 1RM5A 1Y9JA 2XE4A 1A9SA 3HCRA 4MUXA 2NU9B 4NZPA 3CZ4A 4UW9A 4DUZB 2ZS7A 4EF4A 3P20A 4BXOB 1SCKA 3CKYA 3EDYA 5JECA 1JA1A 2E4UA 3CPEA 2EJCA 5B2EA 5KVVA 2CUKA 4TKVB 4JFAA 2HJSA 3AFOA 1RSZA 2OGWA 2NU7B 4LRQA 3KPJA 3O83A 1SUEA 3IJRA 3P9ZA 3ZQ4A 2O19A 3NWPA 2Q99A 4J49A 1JG4A 1CFZA 1OXXK 1I7LA 1TFRA 4AURA 1X7HA 1TLLA 3I5MA 4BDTA 2N1BA 4DOMA 1JHPA 2UXBB 3ENQA 1E61A 1ODSA 3OY2A 2ZM5A 2PLRA 2R85A 3DJYA 3G0BA 3BD9A 3QENA 1Z0SA 5FPSA 4B84A 1MVNA 3L8CA 1UPUA 1P7PA 1VIYA 4ND2A 5CFPA 1KQPA 2HHJA 3QEOA 2ZQYA 2AJDA 3FMFA 3OI7A 4XARA 1PUIA 2Q0HA 1L5HB 2VZEA 5DBIA 1G8KA 1E0DA 3TQIA 5FNZA 121PA 4PN7A 4BJ3A 1DXYA 4BNVA 3FLBA 2IPNA 3CJRA 3FDXA 2PJRA 3QP9A 2AR0A 2GZHA 3NOVA 3MT0A 2DM6A 3FDIA 1MU0A 1TPZA 2B1IA 3H9GA 1D1SA 4HDNA 4PNZA 4UQPA 5GGXA 3W2EA 1G8MA 5A04A 2FP3A 3JASB 4HMQA 4FPXA 5TQVA 4Z9YA 1F14A 3EGXA 4RF2A 3NBZC 5ESRA 4ZRNA 3ZE8A 1AS2A 1TYDE 2D8AA 2X2PA 3OOHA 5CVDA 3SF0A 4RL4A 4Q9HA 1NUTA 3TMKA 4Q3AA 5H9WA 1CUSA 3OO1A 1T1SA 1U7ZA 4P7BA 1JFFB 1U0TA 4N3BA 1YE5A 3OT5A 3GLGB 3STXA 4IZIA 4WDQA 5EMNA 3LJKA 4G0MA 2DTXA 4HDKB 1EXVA 621PA 2VHCA 1SJ9A 1E96A 2V6BA 3Q9LA 5EXTA 1L4LA 1LF5A 1E9EA 1E79D 2HDNB 2ATVA 2YRWA 3UJCA 4CN9A 3VR3D 3HBAA 3IEXA 2BUBA 4NI5A 5AW3A 4MTCA 4S35A 2O52A 1SBYA 3T5BA 2OV6A 1OFUX 3ORRA 3I0ZA 3H97A 3H9UA 2BIFA 4IZHA 4M76B 5HF5A 3H18A 1GL3A 4BZWA 4NE7A 1E4EA 2QUIA 3SIRA 5IM4F 5KTRA 4F3TA 2CK3A 5IUKC 3OZVA 2HWYA 1IIBA 2A35A 2CYBA 2C3OA 3C6XA 3OP4A 4AD8A 5LQCA 4UEOA 5B7QA 1SM4A 2Q49A 2H1CA 4LK3A 3T41A 1FRNA 3WGYA 1DKMA 4WN9A 5BR7A 3AY3A 4TMTA 5FHRA 1VA4A 2W7TA 1LK7A 3UT5A 3FLAA 4DMCA 4GRIA 1TT5B 1GR1A 3KCQA 1ZMXA 2IYZA 5FO1A 4MWDA 3ADCA 2X4LA 4OJMX 4ZYVA 2IU4A 2Z57A 1TTQB 1T8PA 3U3DA 4KBGA 4RKYA 2QR2A 1P0FA 2AQ8A 3DE1X 3V00A 3I62A 1MN6A 3D3WA 4OYHA 4PIPA 4U7GA 3FTPA 2PWYA 4HGPA 4AO8A 1PJ3A 5FUWA 5I9IA 1N8KA 1QRUA 4ZYLA 2W0SA 1MBZA 4M8NE 4H7IA 5T41A 1OYYA 4KIJA 3O3MB 1YQEA 1HE3A 1ND6A 2V8OA 4XFKA 3KQLA 2F3PA 3Q4GA 3WHKA 2OXFA 3R3SA 3IELA 2A92A 3E48A 4N0PA 3QE2A 4JYCA 2FU5C 3SX0A 2DRIA 4JI0B 3H4MA 1ADFA 2I62A 2I6GA 3FCSB 3GVIA 2IGTA 3S27A 5F1KA 4B5KA 1C1DA 2PGJA 2RGBA 3R09A 4WK6A 1VSQA 3STHA 1Q6ZA 4MAFA 1QANA 1UKVY 3BWDD 2HMUA 3DHYA 3WWCA 3AI7A 2COUA 1YJQA 3FOAA 4MI6A 1YZTA 3KR2A 6REQA 3JQFC 4U2GA 1Y3AA 5CDFA 4JBHA 2DLDA 1KPIA 4F8YA 1W581 4XWAA 3S55A 1KBZA 2DAPA 2D1FA 2KB0A 2C2ZA 3BXGA 1ZVQA 3GQBA 4C4YA 5KYYB 2PGOA 5CVJA 1KP3A 3KKOA 4YTEA 2ODAA 1VGVA 4YAJA 5FUMA 1TKCA 5I7HA 5BSEA 4HQ0A 1MB4A 1UJCA 1IBLB 1B15A 1FPMA 2BMDA 2NGRA 1V5GA 3K31A 5DK4A 4BOYA 1NW8A 1EBUA 3H7AA 1JRLA 2DQYA 2H9YA 2FCAA 2QN6A 3KUDA 5IC6A 1SCUB 3RAEC 1U7WA 2JJYA 3E1SA 2Q8NA 3NWJA 4PYQA 2V9CA 4IKOA 1RWBA 2AC2A 5KKCA 4MS1A 3ZW9A 2C95A 1JE0A 3G9XA 5DEOA 4D25A 1KI7A 3GGOA 3KE9A 5FWXA 1DV1A 2C9DA 3L04A 4NL4H 3WWYA 1X1EA 1YO6A 1VYTA 3CUWA 3KB8A 4U2EA 3NFYA 5HUHA 3WNZA 5BNZA 4H1VA 8AT1A 4KO3S 2O6LA 2PUWA 1PTJC 2C5GA 5ALJA 3AKCA 1SU7A 3C6ZA 2CFIA 4BRUA 5HVNA 3S3TA 5AD1A 2VTBB 1GPNA 1W7AA 4K9SA 4BQSA 1IBMB 2DSNA 2R8YA 2Q5EA 4KV7A 2FH5B 3P4UA 4ZT4A 3ZHYA 2VRCA 3ETLA 3LRXA 5CFZA 2HLDA 3MGCA 2YTZA 3IBSA 4AJNA 2HIMA 2PZJA 4Q12A 5EEHA 4M99A 4DIOA 3C87A 3LLVA 3KKQA 3ND8A 4NAVA 5T3UA 2DR3A 1GG5A 3I2GA 2CFRA 4IXTA 5AJXA 3DKIA 3C8MA 4O1IA 3UAZA 1H9AA 1H2XA 1CU1A 4KXYA 4MYHA 5EWLA 1XTVA 3MOGA 4TV8F 4JC8A 2P4QA 1T6XA 4DB2A 4DLSA 5JTTA 3G2NA 2D5BA 2A30A 3WDLA 1V7PC 2P2YA 4XWOA 1KDPA 1R12A 2O1XA 5EAIA 3U17A 4D79A 2AE1A 5K4AA 5LA6B 3L1UA 3C4QA 3N8KA 1SXQA 3AO0B 5INTA 5TEVA 2FZWA 3MBKA 3UTCA 2QLNA 2ZB2A 3I3OA 1YJBA 1V47A 4ZCTA 5JD5A 3OSUA 4CTNA 1B43A 3GH1A 2LWIA 4TLBA 1UP7A 2F55A 2AXNA 1WZEA 2I03A 2ON6A 2AMFA 3FRIA 4G86A 1R6TA 4X71A 1T4BA 1R4NA 3TRDA 2XGSA 4Q3NA 2C59A 3EPHA 5CH5A 4R81A 2A9RA 4H7HA 2C4VA 4D3YA 3L46A 4S04A 1EEXB 4FIZA 1XZQA 4CEJA 3FETA 4E1AA 4EW3A 1SBZA 5AVJA 1RRFA 4UUPA 2RB4A 1CIJA 4XCQA 4EF5A 1TYAE 3EYAA 3D0KA 3UWMA 3ELUA 4X84A 4YONB 3BFJA 3AJDA 4W5WA 3WB1A 2PJDA 3KE8A 5JPIA 3C0KA 1LTQA 3MW8A 1GZUA 5COBA 2JKYA 1Z0KA 1VA5A 2QENA 2YS6A 1ZO8A 1PT9A 2FPOA 3PCTA 3IOYA 4FYVA 2DT8A 1Q0UA 3DO8A 4PGMA 1E3IA 4TWJA 1KFEB 1QHSA 2ZB4A 4N3GA 5B64A 1YUNA 3HO1A 3VR0A 3OU2A 2QJOA 3QA9A 5FI0B 4XWKA 2AFIA 3VR5A 4AKGA 1MPTA 1I3OA 4K40A 3OQHA 3VV3A 1Y4SA 2MYPA 3IBFA 3L0CA 4BFVA 3AIMA 1R9JA 4AECA 4G8BA 2HFKA 4I81A 4OB8A 1WZUA 1QF7A 2D06A 1VL6A 4ID3A 4ADSG 1XALA 1OB5A 4NCAA 4AO7A 2ZXUA 4HFMA 1CIPA 3Q3VA 5CITA 9LDBA 4HP8A 2EJWA 2K87A 4YP1A 3IQIX 3LBYA 1ULHA 2VSXA 1P5HA 2C5SA 5AK0A 3IE0A 2WQ6A 1XQYA 3PUYA 4HL6A 3WNDA 1H1LB 3G2PA 5ALZA 4YJ3A 5ED0A 1J1ZA 1JUDA 1P9RA 5FORA 3HEAA 1J49A 5EZYF 1T2FA 4CUZA 1GDTA 3LLMA 1STOA 1NTRA 2GM4A 4QAJA 1PV4A 2FQYA 4DTIA 4LGVA 4PSKA 3HCWA 1O9GA 3CINA 4UCWA 5C4GB 3NV7A 2AA3A 3GPCA 2ZG6A 4X6YA 3ZVRA 4RTKA 1XLUA 3CZMA 5CJPA 2Y6UA 3SXJA 5BWMA 3C7CB 4GNKA 3KK0A 4KITB 3GRVA 2GVDC 3PGXA 3SYNA 3K3PA 3LV8A 3QMMA 1G0NA 4OJQA 3T9EA 3DH0A 3ZKAA 1QYWA 3L4SO 5KDDA 1VP9A 3Q10A 1I7PA 3AXTA 3H2SA 3X1DA 3CZ5A 5LP1A 4ZK2A 5C4MA 2PUDA 1N4AA 2X40A 4C07A 4CI9A 4Z53A 2OEPA 2QDXA 3L4BC 2W11A 3EODA 3ZK8A 5F2EA 1G6Q1 2Z4SA 3CW9A 4LZOA 1DOHA 3TW8B 4D9HA 2UU9B 4OQDA 1CUUA 3OHPA 5CLGA 1MOPA 1YJXA 5TC4A 2QIPA 3N0TA 3WQHA 4AYXA 4ER6A 2XVYA 721PA 5C51B 5KNLA 2JKZA 4Z0TA 5IASA 3JQ9C 3M3DA 3I9JA 3EAFA 4RBNA 4QOHA 1JZTA 2FSVC 1G6HA 2Q62A 5CA0F 2OBXA 5EJMA 1DAKA 2VHXA 3FSJX 2OQIA 3GDGA 3ODPA 1TYEB 1WKVA 2IOHA 4X0EA 5LLDA 1RXVA 4X1YA 2A1UA 2OXIA 1EP2B 1R8QA 1B8NA 2ACVA 1V37A 2ZYHA 1ORRA 4CV0A 1WS6A 1XDSA 2FWAA 1N4DA 4HPWA 4RKEA 1G7TA 1SXHA 1EDDA 4QWWA 2FPPB 3L5OA 4F9EA 2K6GA 3LXXA 5HJ2A 4CEIA 3EXG1 1HQDA 4GPD1 2O2DA 4YCBA 4C7KA 5L6MB 3GUZA 5I9LA 2QBYA 2WC1A 1IUNA 4AS2A 4II2A 2G4VA 1JF8A 1M10A 2LCFA 4TTAA 5EP2A 4FNGA 1AZSC 3R5KA 4NEQA 1XZ8A 2Q2WA 1DKQA 4M9ZA 4MUJA 1BEUB 1IWOA 5IVIA 1XMQB 2I0FA 4LC1A 4EX7A 4AS1A 3GA0A 5HCUA 3DBHA 2W2QA 4HT3B 4Z1MD 3BEOA 4TL9A 3ESAA 3K1YA 4II3A 1UOEA 2DE0X 4PZ0A 1Q0LA 2E4XA 2YY7A 3LO8A 3M49A 1HRKA 1RAAA 4IS3A 4UU0A 1KI6A 1GCGA 2YWGA 1GXSA 2JI9A 4G1EB 3Q5EA 4OHMA 3VGJA 1OT5A 1OLSB 3IRUA 3RSOA 3TFQA 3UV3A 4ZI7A 3HP7A 4NV1A 3I53A 4KWIA 4NZNA 4QBFA 4RHFA 5FNVF 2O8DB 3TW0A 3AF3A 2W6MA 4CIBA 2J3JA 3AZPA 3CGGA 1T5OA 1AS0A 4Y18A 2DX7A 1N57A 1GVHA 1LVHA 2IXFA 4I50A 4OH7A 3ZQUA 4BPRA 3KSAC 2ZJ4A 5E7IA 1XXLA 4EMTA 4NXNB 4GKAA 4NOMA 2IHYA 4NCJA 4ZGWA 1FRFS 5TPZD 4LGCA 2AG5A 3C6BA 5B36A 2BN4A 2X4DA 3G9UA 2JGNA 5KAPA 4OQMA 4CHTA 1NXXA 2Q7XA 2JGDB 3QKRB 4TRJA 5BN5A 2J9GA 4KLAA 3AG6A 3ZVLA 5DX0A 1GNQA 1K3FA 2C5FA 4EPXA 3OF3A 5F9HA 1DO0A 4ITVA 3RRMA 1KO4A 2PM8A 3LCCA 2GM3A 4LHSA 1C3XA 1CUVA 2FVXA 2JFPA 4KQJA 1XFDA 1QNLA 1TRKA 3R7WB 2GLUA 2NPFA 1L7DA 3HJAA 5LKAA 2CHQA 2DFVA 4M3NA 5ALKA 1WTCA 5FAKA 2XNDD 2QWXA 2QW1A 3PD0A 1VJ0A 4N5HX 3F1KA 2G08A 1KFKB 5CCXA 5BPHA 1ETHA 4JT9A 4P4SA 2AJTA 4C76A 3RI3A 2A14A 1WLSA 2GJAA 1P5FA 1E9CA 1CQIB 2Q8PA 3W2TA 4DCUA 4YHHB 2GPBA 4DCOA 5G4KB 5T6BA 1PX0A 2REQB 1FP2A 2EIXA 4HQRA 1Z13A 2OILA 4DIBA 1WB9A 3GD7A 3GFPA 3VVBA 3GT3A 2X8LA 5AW0A 1E32A 4FR2A 4Z51A 4MP8A 1K7YA 1FRQA 3ETDA 1OYWA 3VBEA 3ZTWA 4ICIA 1W75A 1RC1A 4JQYA 1VPVA 4ZEOA 2G67A 2JLAA 4KO8A 2JLQA 3H2KA 1E2DA 1C9DB 1EIWA 3FGZA 4M53A 4MVJG 2H1OA 5CB4F 3ECCA 3WL8A 2ZB8A 1EXWA 1EK5A 1FYEA 1T8UA 5REQB 1E7RA 1DMRA 2EX0A 4R84A 3TBFA 2B30A 3TLAA 1KJYA 4GQIA 3SYLA 3U39A 2FW1A 2I2BA 1YACA 3GGCA 4QPZA 2WVGA 3KKEA 4KOEC 2B2CA 2VR1A 4N5DA 1FDOA 5F3RA 3KWMA 4KN6A 4IY1A 3VI4B 4IHJA 3KS9A 4A0QA 2QJWA 4AZ0A 4FI3F 2OHXA 5T67A 2FJPA 2O3TA 1XCPA 2RJNA 3KZVA 1VYUA 3EDOA 5FBZA 5BPFA 3I2IA 4PZDA 2F17A 3C3CA 3TAXA 2H9AA 4MR9B 1X38A 1EFAA 2HYIC 3CTMA 3M6UA 3WR5A 3QU4A 4AP9A 2DPYA 3EZXA 2PS9A 4KPUA 4PQEA 4WN3A 1YDFA 4J2OA 2CCGA 3RVNA 2QQGA 2X7HA 1Q84A 4M1TA 4ANFA 1CUFA 1SC9A 3GMDA 4HLDA 5B58T 1B7GO 2E6UX 2BAGA 2X15A 1E1RD 4IF4A 5EIAA 3RIYA 3K1AA 3WKDA 1U80A 3O2SB 2HA4A 4QUHA 1ZMRA 2B69A 4BU0A 1N5LA 1CY8A 3P45A 1T5DX 4UASA 5DHQA 3ICCA 3SM3A 1U2GC 1YZLA 2KWIA 4R6WA 1B00A 1PZGA 3SHQA 1WUJS 4EPRA 2IITA 3JQRA 4K46A 2JIZD 3OIUA 5DCUA 3G5AA 5HQ3A 2OOKA 2D0DA 5SZJA 3FVQA 1TI7A 3GLHE 1SMKA 4HHEA 2RGCA 4OHWA 4Y2YA 1MDFA 1FFAA 1E2MA 1LBSA 1G21A 4Z99A 3RJZA 4BAUA 5B4UA 1NJ1A 3E3NA 2NUAB 3K0EA 4DDVA 1PDVA 1GG8A 2E4VA 2YJTD 3K9BA 3KDAA 2X41A 5JBIA 1T91A 3HWRA 1XKXA 4GKVA 2I7TA 4I6JA 1DLIA 2RHWA 2X0FA 3ONEA 4CM7A 4PGAA 3WISA 1ZL2A 1JT9A 2ZBEA 1E2HA 4FHZA 4BO3A 3FLEA 2ZBVA 2ZVJA 3E8SA 3HJUA 2AYYA 3IQEA 3MTJA 4KQHA 4BN0A 1ZPDA 2QR3A 3A05A 4U63A 4WESB 3ZR4B 4NRDA 1GU0A 3JARA 1KI3A 4RIFA 3GGDA 1MA3A 2NWQA 5K7SA 2QT0A 1ZONA 1TTTA 1XLVA 4GPEA 4C03A 2XCOA 4V24A 5DIZA 2H4ZA 1GFZA 2AMYA 4QJIA 5CIWA 2JVJA 1L4KA 1OE0A 4UHBA 1S96A 2VJPA 4QO7A 1NM5A 3R0ZA 1DXQA 3V4SA 2D0OB 3M6FA 4IRXA 3IUPA 3DM5A 1QUFA 4OAOA 1DUSA 4DR3B 3DLHA 2Z95A 3B52X 1CCWA 3HU2A 3I6MA 4UFPA 5KSWB 3U44B 1G2PA 4QREA 1XZLA 4WH0A 4E1VA 2HWXA 1OLXA 1Y6GA 4DG9A 1JHMA 3PR1A 4C43A 4C5AA 3RSCA 2WSBA 5AJYA 2UYGA 4TRMA 2VWHA 2DT5A 1O5IA 1CHNA 1WMFA 4PFSA 4KKXB 3IJPA 3ZBTA 3PQ3A 4YCDA 2GH1A 2ARKA 3ROPA 2DBQA 3NGMA 1T8RA 3WQRA 2QTMA 5BRNA 4YAUA 4Z4EA 2UUPA 1MH1A 2HIHA 4G4SO 3R3HA 2BFMA 2NSYA 1TIBA 5L7YA 4AUKA 2F1IA 2PA0A 3BIFA 3PX2A 4RVOA 2VYND 2IIBA 4WXEA 1U8ZA 2DQKA 1WTAA 3B9RA 2D2VA 2HT6A 1PR2A 1E3WB 1UF9A 3ICOA 3K9HA 4PHFA 5EQFA 3I0NA 3VTFA 4F7DA 1BWPA 5F2KA 3ETEA 1UBMS 2VTBA 1U9IA 3M89A 4HLNA 1PE0A 1Q1GA 2H92A 2ILVA 3GFSA 4OMUA 1NPTO 3QFCA 2YQ5A 2O8NA 4GRAA 4I9NA 4QTYA 3A4MA 5F78A 3OE4A 2Z4TA 4INAA 3EVBA 4A0GA 4XUEA 2D0PB 4C9BA 1BWQA 2Q4BA 2XF8A 4IXDA 1M1ZA 3VAAA 1OLUB 4CMBA 3SBEA 5LUAA 3ANTA 3EHDA 3KYIB 5CT9A 3CF2A 3WE7A 4ZO7A 3G7NA 3L0IB 5EUQB 2R8EA 1JDUA 4PFQA 2RGXA 1ZESA 3NI2A 3PKZA 2YZNA 2A9JA 2EW2A 4TTSA 3HTXA 2GLXA 3CLUC 3D9QX 4UXIA 4QYIB 5B57C 2OTCA 2R00A 2R6FA 4MCHA 4RKQA 4ACAA 3HR8A 4PICA 3JTEA 4V0KA 3D6FA 4RTNA 1NLYA 2XEXA 3BGIA 5KOHB 4WCFB 1AGRA 2AYXA 5H1YA 3E6AA 5KQRA 1QSGA 3W04A 2WHEA 3UJNA 3AB3A 3IUMA 1DX9A 4QWMA 3I5AA 4H27A 2QVBA 1RC0A 1XA0A 4M87A 4AROA 2AF4C 1O87A 1DMSA 2AX4A 2IP1A 3TTSA 3GP8A 1V8PA 2FE4A 4UCFA 2WUVA 1P1BA 3MXTA 3M33A 4W7IA 3WYBA 3DOCA 3EFOA 3IKVA 2CLEB 2HXYA 3GDWA 5F1OA 1LBQA 2WUGA 3Q15C 5JJCA 4QO8A 3JQAD 1ODTC 4WZBA 1QWSA 2GAFA 3MTAA 1NG9A 1ZC3A 5WRFA 1CZNA 5BSFA 1DRVA 2BJVA 4TT8A 2WMYA 4HR7A 5KVQA 4D4HA 1NNSA 1V1RB 2B4YA 3PLNA 2UXDB 2LXNA 4ND1A 1Z8HA 5KOJA 1YGYA 1RJEA 3T3HA 4AULA 2QKYA 2WWGA 1XTQA 1N8SA 1SKAA 1EP9A 2I3DA 1PL8A 2I3GA 3I92A 4JUFA 3WK9A 2IYFA 3NDJA 1K7SN 2PHZA 5C5CA 1BG6A 5K6AC 4GLOA 1F60A 1S1MA 4LHZA 4NCXA 4N5LA 4ZDJA 4CMCA 4D3ZA 5BSHA 2X77A 2HW8A 3FPFA 3SMQA 5HUJA 4RHYA 2EGHA 5EZ5A 3QUAA 3RYFB 1UKCA 1W36C 4ZOQI 4O1MA 3SR3A 1KC1A 4PBTA 2ZJZA 2IF2A 2DWPA 2VWPA 3K1ZA 3QUCA 4QBIA 1J1IA 2AOUB 1OFUA 5KYUB 1V4NA 2XUQA 3H1BA 3PHIA 3UFBA 2DLCX 3DMPA 3UV6A 4ARUA 1DL5A 5JWOA 3FKQA 5DI3A 5IJ9B 3AL0C 3RUAA 1PHRA 2PMFA 1M2JA 3AR2A 3L7CA 4X20A 4GL4A 5BT9A 2QUZA 1X1CA 1ZI9A 4NNJA 2NTJA 4J0GA 4H1UA 2I7DA 3AQIA 1E2LA 4MQUA 2C4WA 4ZANA 3CLSC 1UH5A 1Z2OX 3T6KA 3KSDO 3QPAA 3TR5A 2VHQA 3CMMA 4J07A 3JQAB 4RZXA 5HWSA 5K6TA 1JEDA 1PT7A 2YDYA 4ARCA 3CSSA 2OL4A 4EB3A 3D02A 1P8AA 3RVBA 5IBQA 2YC4C 3X2EA 1Y4ZA 3ZH2A 3ACBA 2KE5A 2F3UA 2R4UA 3DEJA 3FVTA 2WU8A 4WOJA 1GAWA 2ANCA 3ZBPA 4OI0A 1RWMA 3NH9A 1PGNA 1F2TA 4F21A 2F9FA 5LP6C 2F1JA 2NN3C 3COSA 3DXZA 4LCBA 3FHOA 4B2YA 1TJ4A 5BVHA 5A4FS 3FDZB 2N75A 1RMQA 2FX5A 5B7PA 3VU9B 3SFTA 3SVLA 4MI3A 3ZDCA 1T36B 3E9ZA 3QU9A 4N3NA 4DADA 1KZHA 1I5RA 3STTA 4M1OA 1MR3F 3R41A 5FEMA 1CDDA 4KU4A 1BGXT 1RWPA 4MS3B 4EG5A 5FEUA 3ESRA 1I10A 3IAFA 4Q9NA 4A2CA 2HC9A 2N0SA 1HSZA 2HMAA 4TXHA 5CW1A 1V26A 2R6AA 2CBGA 4MARA 5PNTA 1P7YA 2BFCB 4U7WA 3TSAA 2GVZC 2CCJA 4U2FA 4C87A 3GT0A 4O0MA 4O4LA 3P8ZA 4B7ZA 2C5BA 2VDLB 3UIEA 1AQUA 1TC1A 1BMFD 3NLLA 1MQ8B 3H2YA 1D9XA 1ZM9A 2WUWE 4LQDA 3EQ2A 4R3WA 4BNKA 1MHTA 3IJEB 1RS0A 1FE8A 2ZT6A 3BF8A 3JSAA 2WPDA 2ZRAA 1XCBA 4PIMA 4DDUA 1DAMA 4G4JA 3ZBUA 1ZOLA 3H4TA 1F2DA 3RSQA 4OATA 3PBKA 5DIFA 1OTHA 2PNFA 5EIBD 4WBNF 1DG3A 2R8OA 3VPDA 1O1YA 3P9CA 1E1QA 2ZUVA 3DBRB 4H6VA 5EKSA 4ZHQB 4KQCA 5AVWA 1SC4A 5EJ6A 1FQJA 4RTOA 3HKDA 4IIEA 3S2YA 3ZVMA 3RS5A 1AHIA 1BFDA 2YUTA 3NOOA 3BJMA 4PAQA 4IMRA 1DTSA 1YKSA 4KMSA 1WSWA 1GRQA 3NHSA 2JL1A 1Z82A 5ENZA 1ZX1A 5G53C 3KXPA 4FR5A 4N7MA 5CT5A 4ZOLA 4MUIA 5ECWA 3QE9Y 4PEVA 3N53A 2ZEJA 3G0OA 4LHXA 3GL9A 5IW8A 4MCAA 2XYRA 3B8HA 4V3BA 4HDSB 2R25B 3P2EA 1V9LA 1JR3A 2XUDA 1Q7EA 1FP1D 3FHJA 4UM9D 1SHJA 1E2IA 1HG0A 3AKEA 5KWIA 3EC7A 1KU0A 1PSDA 1H2WA 1B1CA 1X8XA 3L0BA 3ZV4A 1KZ1A 3JTMA 1RQ2A 4NABA 3A6FA 1F2VA 3CE9A 3GA7A 1EK6A 4BVAA 4N0EA 5FPTA 1KO8A 4N9QA 3U7HB 2I22A 4EG3A 2BM0A 4PNPA 3GIDA 4XTCS 4IDEA 4YI5A 4YBRA 3C3EA 5EXEA 2ZTLA 1QHEA 3OBIA 4MP6A 2XCQA 2XZDA 2UZ0A 3UYKA 3OMWA 1L5GB 1PFQA 2XT0A 1ZUD1 1UJ4A 4CFYA 2HBQA 3CLVA 2QSUA 1TF2A 2PK3A 4WCVA 3GLFA 1J0DA 4XXHA 2AXPA 3WV4A 1J42A 4A82A 1P7CA 2XZPA 4O2BF 1PK9A 1ABBA 1HLDA 1T4CB 3RUDA 4MGYR 3A32A 5AVTA 7REQB 5GINE 1KK2A 3CA8A 1NDHA 2IHUA 4KLNA 1E3DA 1H8HA 4QDOA 4EUHA 3ZZUA 4AY5A 5KWSA 1N3BA 2GBCA 4WIAA 1VQ1A 5TS3A 1BXRA 1ND5A 2NXWA 4AQ7A 2G4CA 5A6VA 2PE5A 5FBKA 2ZYTX 4EYEA 2P69A 3L4JA 4GMDA 2ADOA 2P40A 4GYYA 4QODA 2BR3A 4PC3A 3ZXIA 4UM9B 4G23A 3WNCA 2XITA 2YY6A 1UP6A 1GGFA 4TWRA 3JZMA 3GEPA 4HQLA 4NBSA 2J6CA 1SG9A 2Z30A 3ITEA 1IQPA 3P4XA 4HNGA 2WKPA 2VH2A 3HA7A 3A4IA 3N7AA 4L0DA 5GMOA 1NAHA 1W88A 4NULA 2V7BA 2VJYA 1LSSA 1YH3A 2XZTA 2CLLB 2E37A 1Z18A 4O08A 4PXSA 3T7SA 3QEBZ 2IT1A 1BO6A 1DKRA 2OCIA 5CM9C 4K0KB 5KNDD 1FU7A 2EWWA 3VHXB 4LE2A 2O7NA 1I14A 1R8JA 1UC8A 3HUUA 3IB6A 1POXA 1Y82A 4Y8VA 1U63A 2DCUA 2OGZA 3IOMA 2ZULA 4KXLA 1OIVA 1UM9B 2H2IA 4IKEA 4OBEA 5C5DA 4O4JA 3GAFA 5HKOA 4CRWB 2ICAA 2B4QA 4TV9F 3RAGA 4KB5A 3A25A 3T4PA 3LFHA 3ZLVA 2YVLA 2O8VA 4FFLA 4INZA 1NSTA 2YWCA 3OCWA 4LGMA 3L3BA 1J39A 4EKYA 3OQIA 2ZUUA 3THWA 2CXNA 2BEVA 4NJEB 3SOPA 1AXGA 3V6MA 1ID8A 3F4KA 3QHQA 4KAFA 1VE5A 2VVTA 4KH0A 3VR5H 4ESOA 3HB0A 1CQXA 5FWYB 3QEAZ 4K2HA 1VLQA 2CN1A 4TTTS 2G5CA 2BM1A 2JGLA 3B6EA 2GHQA 1T8SA 2GAIA 4EO7A 4OUDB 5SZHB 4E0BA 1A4IA 3EQZA 3H8SA 4MQFA 5T6MA 3GG2A 1TZBA 3PTAA 4QQNA 4OGLA 3HACA 4DXAA 3OT1A 2HCJB 3RRNA 4YB8A 3B85A 1XPJA 4U9IS 2XB8A 1QH8B 3GGPA 4OHYA 5BMVB 3PJEA 4JVMA 1W4CA 4HDOB 1WVIA 3DF9A 1N0HA 3DLPX 3DKPA 1K6IA 2Q5OA 3IUEA 2GILA 2VDVE 3IHKA 1S6YA 4G4IA 4HFJA 2FFJA 1WM1A 3AEUB 3ZHBA 4EBFA 4AIRA 2QTRA 2ALJA 3VU3A 4WVLA 3QE3A 1XMXA 4ZO8A 2Q8QA 4RSMA 3H2GA 1L0BA 4YCCA 1WW3A 1LD3A 3ORHA 2BWJA 5DYYA 1V11B 1MX5A 3NAZA 2NO9A 1PWEA 4UTVA 1VCMA 4BV3A 4AJPA 4KWCA 13PKA 1R0YA 3GELA 4MV0A 5FTMA 3RHSA 2W2VA 5BUQA 5J4YA 2ZROA 4OA5A 5JPCA 4KC0A 1G17A 1KH2A 1SHTX 2XTZA 2ZRLA 5D3ZA 5CCEA 3RE1A 3GZNA 1IJEA 2NADA 2GBLA 3IMKA 4PCAA 1BH6A 5HFAA 3QYJA 4FHCA 1YUMA 4S1PA 4KOAA 5TY0A 2ZJBA 4L2IB 3DBLA 1RVV1 4OB6A 4CM3A 3I5XA 3HCAA 4BATA 3PGVA 1ZBQA 2F67A 1U04A 3ZWQA 1ISMA 1NWHA 2A9OA 3A70A 2QMHA 3E1GA 2NO4A 2QG9A 4KRFA 3FKJA 1I0IA 3REQA 1II0A 1RKBA 3O0TA 2UZ4A 4LE1A 4ZAGA 3M5DA 1XTPA 3COVA 4EPWA 4UU8A 2H5LA 4BNNA 3OM8A 5K2MA 3DZJA 4YCNA 3TDKA 1HA3A 2WD7B 1CJUC 4IXNA 3G5UA 2B37A 4IQ4A 1GYQA 4PS1A 5AUQA 1XCMA 2HCRA 2Q9UA 3BH0A 5E4JA 4CIVA 2HDOA 5D51S 1M75A 4FSXA 2C2XA 4MHSA 2QY9A 4LKOA 1AO0A 5LLTA 4G5HA 3ZWVA 2JLUA 4XAQA 1MX3A 5LXTF 5TGDA 4RANA 4ARZB 4TX1A 1UBUS 3KEOA 4Q02A 2LD4A 4XX0A 3ZHSA 3EPKA 1ZGBA 2XT6A 1TUIA 3WL4A 1FNDA 1DKPA 4Q9DA 2QGNA 4M1YA 3BH7A 5TPZA 4EB6A 1EUDA 3JVUA 2HGSA 2PS0A 4HWKA 2UUOA 4UBJA 2FSFA 4YV7A 1BQ3A 2GNAA 1NUSA 3DPUA 3AVQA 2H9IA 3Q7QA 3K8OE 3T5MA 5GWXA 4NEGA 3GUCA 3PR2B 1G16A 4L5JA 5C37A 3U6BA 4X8OA 1WPQA 3OTGA 4C7JA 2EJVA 3NXSA 4FN4A 4I1RA 4KCGA 1XZAA 4Y2VA 4D1YA 5HM8A 5JIBA 3AW9A 4IILA 1A97A 1TNDA 2YN2A 2RSLA 2EFJA 3IGFA 3QVLA 4NOKA 2D54A 4ZVUA 3G2QA 4B4UA 1DT5A 4X8MA 5IXSA 2VRNA 3DKVA 1I8TA 1Y1TA 2CXSA 2I3BA 3WG9A 2F3QA 1E60A 1B4DA 3KHKA 4G0ZA 5AYVA 1Z4QA 4FMCB 1E1CB 3S81A 1EA5A 2WHRA 1SEVA 3ZU6A 1TQ2A 1FNSA 2HJHA 3H11A 1JBKA 3LQ4A 1QHHB 2QN7A 4NVRA 3SSMA 3ZWWA 3KYDB 1BGWA 1QRSA 1KMIY 4Z9AA 1OHHA 3BWBA 4BMPB 5J2UF 3B1WA 3A9CA 1ZGCA 3LUPA 3FPSA 2A5JA 3HGTA 3LZ6A 4GZ5A 4AUEA 4CGYA 4BB0A 5JMWA 5L40A 3UF0A 1ZMOA 2Q1UA 5I7EA 1U99A 3INYA 3C6MA 4HN4B 4HSGA 3D4LA 4PO9A 2SNIE 4ZYUA 3EEOA 3TL3A 4E11A 2YMLA 4KQ9A 4MX8A 5SZKB 2Q5HA 1ZD8A 3LPMA 4G9EA 5C9ZA 4ZVVA 1M54A 2RGYA 1UPBA 1N2HA 2X23A 3CUVA 3FH0A 3IKJA 4G5GA 4MOWA 2I67A 3U31A 1IVSA 5AJTA 4GHWA 1L8LA 4ZU3A 4DLAA 4BXOA 2R5WA 3T3OA 4JU8A 3TL2A 4B8ZA 2G70A 1AQLA 5FOSA 3EEQA 5IDYA 4UD2A 3LQFA 3QFHA 2FK7A 1SCIA 2JH9A 3A6EA 3PHHA 4HC4A 4DC9A 4TKVA 4EJ2A 1A4UA 2JZOA 3D8SA 4E5YA 5LBIA 3QVMA 4G4SP 3SN6A 3TSOA 2O8BA 3KX2A 4LJ6A 5K3EA 1JVNA 2XVMA 1SHKA 1D2HA 3I4CA 1NDQA 2E4YA 2G17A 3EFEA 3KQKA 4IJVA 2NQ8A 5D5HA 1JTEA 1P2FA 4RF4A 5C1BA 3ZJYA 5EQTA 3ILVA 5I7WA 3CLUD 2CMGA 5HIMA 3IQWA 3G2IA 4GI2A 4URUR 1HNXB 2XBMA 2WTBA 3V4RA 2BW0A 3AUKA 3PC7A 4P98A 4OFXA 5AI8A 1Q7GA 2PY6A 5JNRA 3JD0A 4LWOA 2IEIA 5LMZA 1OXBB 1DAIA 4LXXA 5AUPB 2AHRA 1EJBA 4GOKA 1WB4A 2ZSBA 4JEIA 1JDTA 5ADUS 1HO3A 1QLHA 2V98A 1M1YA 3LK7A 4BEJA 4ER0A 2Z83A 1AE1A 2EW1A 2PH3A 1OBCA 2JAUA 1G55A 3VNVA 1U7OA 2A9FA 4GOOD 2V0NA 4J2HA 5FBHA 4ALMA 3NW9A 1VLMA 1NI4B 1QK5A 3HO8A 4BFYA 2P1RA 4PQYA 3L6CA 3VVMA 4MWEA 1SKUA 4CT4B 2OLKA 2PBRA 1QKJA 3IDSA 2YFKA 4PQRA 4RY0A 3IEKA 5K5EA 1B23P 5CH3A 4DNOA 3GFOA 5BWBA 4D46A 5L3QA 4X62B 2Y2VA 3FZEA 3IA7A 4HGQA 1Z8NA 2N46A 3BK7A 4GOXA 4MV4A 1OBFO 4DWOA 5I7FA 3FHLA 4UVGA 1PQWA 1UDWA 4WINA 3GHYA 1V96A 1YGPA 2JJ2A 4ETIA 3ZIAD 4YMUA 1Y81A 5EJ8A 3WVNA 3F4LA 1NRWA 3J7TA 3TNLA 4P82A 2JGIA 2APJA 5A4AA 4LNAA 1NSYA 4P84A 1IONA 1SPBS 1GTZA 1Y9EA 2A3NA 2H1WA 2GJ9A 1BDMA 3FB4A 1ZH4A 4GEKA 2R48A 1L7VC 4ZCMA 3DTYA 3EQ7A 2R96A 2PWZA 3IIEA 1D6MA 1VLZA 4Q48A 4YRIA 1ZUHA 3JQEA 1FS6A 3QNUA 3UENA 4G37A 4CUJA 1TTPB 1UAGA 5FUXA 3DXYA 3OUZA 1BS2A 2HF9A 2XD9A 1RU3A 3D8RA 3WSVA 1WXIA 3PRHA 1TT5A 4FC6A 2BSXA 3QKSA 1NA5A 3FAKA 5FOWA 5NULA 3IKTA 3A3NA 3LDGA 4QDXA 4DMMA 2H65A 4GLBA 3KC2A 5K8JB 2QXYA 4N49A 4O5AA 2PXHA 4LWPA 2NO6A 2WWVD 3PC8C 4M86A 1HE2A 3OJFA 1U5BA 2CXOA 4ZPJA 5DB4A 2WEKA 4RD2A 3ENZA 1OPXA 3MQ2A 3NIWA 4R41A 4BNZA 2UZIR 2D62A 2PGIA 1E79A 3L8YA 3IMCA 4IX9A 4Z0PA 4ZYTA 5B58C 4OP1A 1G38A 4KHZA 1I3LA 1SUBA 3FCUB 3GX1A 4I9FA 1YL5A 2A0WA 1QVRA 3VMFA 1N3IA 5BYJA 4F3CA 1RE0A 3I6BA 2IUSA 4NOLA 1OGIA 4RH0A 4ED9A 4YQFA 1DUVG 2R7AA 3EULA 4JL6A 3UH0A 1DXOA 1QZ3A 1AK2A 1G3MA 1UBNA 3E18A 3ESBA 3NGLA 2ZYGA 1GZHB 1T4MA 3T3EA 3T7KA 3HXPA 5SY6A 4CEHB 2X14A 7ABPA 3LIIA 1L4FA 2W2NA 3ROQA 1JQ5A 1TL7C 2HU7A 2B34A 3E0QA 4DEYA 5FH9A 2QTGA 2O50A 3GUUA 1BC5A 3EE6A 3O8OA 4MTLA 3WY9A 5AW7A 4CODB 1SIOA 1HT1E 3B1KA 5H3CA 1DAPA 4KV9A 4P38A 3WHPA 4IWXA 1A1VA 4KKVA 4N54A 2IYTA 2PPVA 3ZCTA 5CM2Z 5JWHA 3PIIA 1J06A 1JH8A 4GPBA 4KNWA 4ARBA 1PD1A 2VYQA 2XQGA 4NY1A 4EMSA 4ERNA 5KWJA 1ISGA 3N8IA 5D5QA 3GPBA 1RAGA 1H1TA 2OVBA 3K53A 5TARA 3WNQA 1XIVA 1FYWA 3MOSA 2VPTA 1YZ3A 3OQPA 1LPNA 1ZHHA 4DLWA 4NYJQ 2VTDA 4NS4A 2BGWA 2PBFA 4PGGA 1RT9A 4Z4FA 3KEFA 4ENWA 1C8LA 5U4QA 3HFJA 1I4LD 1YJCA 2GPTA 3VTZA 3KWJA 1BRTA 3SBXA 1US8B 4D4MA 1Z6AA 3G5MA 5ENVA 2ZSJA 5LP6B 4QM7A 4MWZA 5JSZA 2X6TA 4JC0A 4EJMA 1AIPA 3QTLA 1Z4PX 1GD1O 1Q1BA 2GHTA 5DNWA 4K5QA 2P2SA 1HY3A 2VF4X 3NHMA 5ESDA 4EATA 3Q9NA 1UQTA 3QM1A 4MQEA 2V1UA 2QTZA 1IXKA 1H93A 2PVSA 3ZI4A 1TCVA 4B45A 1P1FA 1XAHA 3NEYA 4H4DA 1XF9A 4KVGA 3OU6A 1QRRA 1BTOA 4JOQA 4JVLA 5A4MS 4BMYA 2GEFA 2QYOA 2CDCA 4U8GA 3K15A 3RARA 1R0SA 3BMCB 4Y6RA 4RE5A 1KO7A 1GPMA 5KREA 1VE7A 3QHAA 2CD9A 3EW7A 2LIVA 2CV1A 4BMSA 3RODA 2O06A 4XD7A 3LUHA 2JIBA 3UT6A 4MWSA 4XJVA 5M29A 2J85A 3GAAA 1SUAA 1NW6A 3NC1C 5KMGA 3TQSA 1RHKA 1XZMA 3ZHTA 2BF7A 3MOIA 3QX7A 3HZRA 3UMMA 1QK3A 3F71A 4JJGA 2HGZA 3DMHA 1A0OA 4M83A 4TV8B 1S8FA 3RTEA 3Q8XB 4DLKA 4Q9KA 3CXRA 3A6JA 4F92B 1R64A 1AJEA 3PPWA 4BE9A 1QLJA 5ALVA 1R0BA 2CHFA 3UK0A 1QP7A 1L7NA 2WJPA 5A0TA 2EERA 1NXOA 3CYFA 4FGJA 1GPKA 2VUUA 3JU3A 2VLBA 3EC2A 2JBAB 3BJIC 4FHFA 3HA5A 1M2EA 1EMDA 3FYUC 3KPYA 3K71B 1N5OX 3HLKA 4DY6A 4CKXA 1J20A 4NV0A 2ZJ6A 1AN9A 4H4CA 4E1BA 5A3VA 2X1LA 3EOBI 4OOFA 4P54A 2RHRA 3GLQA 1X7WA 1QONA 3HDGA 3T12A 5ISMA 1Y0BA 4XVUA 2D2IA 1OZFA 1MA0A 1RXSA 2O5EA 1GQRA 1PLKA 2GO1A 3GW8A 3OCCA 5IAGA 4HDQB 4RTJA 4OM8A 8MHTA 2BFWA 2QX7A 2P5TB 1VL5A 2AQIA 1L2TA 2R6DA 2A7QA 4DLLA 4OHOA 9GPBA 2LCQA 1OXTA 5DXJA 4DR1B 2JIDA 2YHSA 4L85A 4I1IA 1C8KA 2BEWA 2JB9A 1T2AA 3VFDA 2B5OA 1Z25A 1QNFA 2Q1XA 2UZ1B 5BXYA 3QOYA 1PZFA 1OGYA 3ZHOA 1UC5B 2DHDA 3QUTA 3I05A 5D5PA 4OIMA 3FPGA 4HF7A 3WFZA 4W9MC 4B3SB 1J4AA 4N4AA 1KZ6A 2EFGA 1C7ZA 3MWYW 1L4GA 4QX6A 1Q2XA 1U3DA 1HDRA 1NVFA 1JWAB 2EKZA 3A1UA 4YAFA 2BM8A 4E4RA 5JC8A 2ODWA 2GNPA 3EXIA 2J0QA 1NX9A 2FW8A 1TX4B 2ZRMA 3OOWA 2NUPB 4W99A 4NZ9A 4J16C 2C29D 4PBSA 1JLMA 4Q0MA 1N2CA 1PVVA 2RHCA 1R6BX 3U1VA 3LLUA 3LUKA 1ENPA 3ZLUA 4O5OA 2I4LA 3PPYA 1GTVA 2WJAA 4RA9B 4OFBA 1OMOA 2OG2A 3FA2A 4TLCA 4OQLA 2WAMA 4Q6WA 5BQXA 4GVPA 5AK6A 3N6RA 4MUEA 2A88A 1NW3A 4ZJPA 1T0UA 3HKEA 2I4OA 4HBZA 4O33A 5D1NA 3N70A 2LR0A 1BVRA 1QHYA 3ASYA 4PYNA 1O89A 1PP4A 2BFOA 1CJSA 2IVZA 2WA1A 4MROA 4JR1A 4YEDA 5FPYA 5HQJA 3SFVA 4A9AA 2IV2X 2OT3B 3LHDA 1FUEA 4Z8XA 2W6ID 1UODA 1ZAYA 2NU6B 4RK1A 4DIEA 4RK0A 1S02A 3JVDA 4B43A 5CXUA 3KHTA 3F46A 5E95A 3RRJA 2IY9A 1YBHA 1EZZA 3E7WA 2DFPA 5A3JA 1ZBDA 3H19A 4CDGA 1U8FO 4RXMA 1ORVA 2FSPA 2JFUA 1XYGA 4YUYA 4IF6A 2ZDQA 4JJAA 1AV6A 4MW4A 2QNRA 1E1LA 4BO4A 1FCJA 5K4GA 5CDFE 1H2YA 1K7XB 3EIUA 3DCNA 4GXQA 1TO2E 4Q1AA 1Y3BE 4QQ8A 5K6RA 1NVXQ 1QVVA 2JARA 2XADA 3DMTA 4NBRA 2OA0A 3DR3A 1FFYA 5DGXA 4BE7B 4A3SA 1T2EA 3VKWA 4E5KA 1PF7E 2VRBA 1SK9A 1W6RA 2W2XA 1BFUA 3AKZA 3QEMB 3QVSA 1YL6A 1YZGA 1ZK1A 3D7RA 4YK7A 2QYSA 2C5HA 3ED5A 1VKOA 2WRZA 4ZYWA 4IRUB 1PI3A 1ZVKA 4BO6A 3KKNA 3PT9A 4ND4A 4BB5A 1L5MA 2IX9A 2G63A 1V7ZA 3OZSA 3SYTA 1UK9A 4B3FX 4DHEA 1ULSA 3WQBA 4LV8B 2GJ8A 2GXSA 5IPFA 3LWZA 4LHVA 4RF3A 3TAHA 2Z6AA 2HTEA 2FUKA 2QJFA 3RRYA 2BZ1A 3SEAA 1T25A 1CX9B 3K0KA 4Q3EA 3KUXA 2II6A 2I6SA 2I65A 2P9CA 4G0XA 3RO7A 2H18A 3A26A 1P7WA 2VAWA 1XZHA 4XR9A 1XEFA 2FWJA 3ULKA 1RWOA 2DHCA 4UQOA 1IEQA 3KQTA 4ZZ0A 2YJNA 4S2UA 3F2VA 2WJYA 3CH6A 4BC1A 3LQRA 4GP6A 4YJ3F 4V0ME 2B61A 2ZUTA 1KETA 2CZGA 1C1XA 4M0PA 2OOSA 1U8UA 1R4AA 5JFOA 2HUPA 3IPLA 1DHTA 4FSDA 4H1HA 1TECE 4QTZA 4BJHB 3QPVA 1SH7A 3EBLA 3BQNB 1D2MA 4V0OA 3BCHA 4PYRA 4YLEA 1P7ZA 1IN7A 2V59A 3MUFA 3OWHA 2G8LA 2ZJ5A 1JIIA 1O97D 2P9TA 3QLTA 4PC6A 5BSRA 1T15A 4DY4A 2IRWA 2YJ5A 3HRHA 1K89A 3EW9A 3KAKA 4P3KA 2VNKA 4WXPA 3K8QA 3DXFA 4DBLE 3M3PA 1TVMA 1ZN2A 4I3HA 1HFEL 4XVRA 2JCGA 3TWOA 4CIYA 3LF2A 2NZJA 2BHRA 2RC6A 1TZJA 3BMNA 4IFIA 3V8QA 4CJXA 4ZC1A 5KYNA 3WRWA 4WY5A 2JA2A 4TTRA 2QZZA 3GUYA 4CV1A 3H5RA 1ZW1A 4PO1A 2WU4A 1L7MA 3ZHCA 4ARSA 5ICCA 4F06A 3JQQA 1YQDA 4R7ZA 3SZUA 3D6MA 2CB0A 3FYCA 3SKYA 3KD3A 4NF2A 3WLKX 2JGDA 3KPWA 3PWZA 4X95A 2P6NA 4F2WA 5AUNB 5K0FA 1Q7CA 3MLAA 4ZT7A 3CGWA 1YS2X 3TNYA 2ZBGA 4BIIA 4BVLA 4QATA 4FEEA 1HEYA 3I6IA 4AMVA 2CKDA 5IWAB 1PEAA 1GR0A 2FR8A 2WW8A 3QG5A 5LQRA 3AUTA 3BWMA 3KJQA 3R7WA 5LOVF 2X8AA 4WMLA 3BJRA 4ABYA 4IUCS 3LGAA 4IIBA 3TIIA 4CQJA 4TYYA 3N86A 4G2TA 4OXNA 3NTXA 4XEUA 3D8NA 1KK0A 1FLNA 1NMZA 2FXIA 4DM3A 4EZEA 1R10A 3R9WA 2IS4A 1KKMA 4IYJA 5JNWA 4YCAA 1CIVA 1E66A 3M83A 2WP0A 4RCVA 3CF4G 4G5RA 3VPFA 3AHJA 1RACA 2AWOA 3SJ7A 2XDAA 2ZAGA 2QX6A 1VE3A 2O6HA 3E1KA 4DLVA 4PSCA 2GXAA 1KBQA 1KJNA 4AKIA 1XV5A 1KFCB 1S2IA 3QKTA 4UM8B 1Z0FA 2YH2A 4GVXA 4E15A 2HMWA 3AR5A 4OBWA 3I2HA 2BCEA 1DNPA 4AWAA 1HFWA 2X22A 4PGHA 4R2KA 3B1YA 3TEMA 1AQYA 4IO0A 5CLFA 3SEZA 3OJXA 1KQGA 2ZRNA 1M83A 2OO5C 5DP1A 3GJSA 4UE2A 2W6JD 3NC0C 5C7OO 5JXJA 4GP9A 1PWYE 2VRWA 3T06B 5HX7A 4U7DA 2UYOA 2QUJA 2WG2A 4JJEA 3VO8A 1U1CA 3AVOA 3TJRA 5DM70 4NCHA 3LIPA 2IKSA 1JR6A 4M7WA 1P3JA 1T0PA 1VKJA 2I9PA 4N5MA 4ZI7F 3HUFA 1Z83A 2R97A 4IJUA 1KDVA 4AAYA 5CB4B 1XRQA 4W9RA 4ZQGA 3CX3A 5LZ4A 2DQ4A 2VAXA 4DJ5X 1DC6A 5A5EA 4L4ZA 3DYVA 3BSSA 2CJPA 2DFDA 4G5FA 1F5SA 4I50F 4MR9A 2QTVB 1T2UA 5JD4A 3U1BA 4BUZA 1MVLA 3KJXA 2FW6A 1B3RA 5DN9A 4TMFA 2O0LA 3HNRA 1VG0B 1V48A 3B48A 4GQBA 4WV3A 2G09A 1MOZA 3E27A 2MMCA 4KE9A 3B2EA 4DSOA 1XZEA 1ACMA 1NJ5A 3EVFA 5F3WB 4JITA 4J4TA 1U7HA 2RC5A 3H2JA 4GBGA 4DJDC 4DANA 4F84A 2X58A 3KEGA 2WG0A 1PWXA 3DV0B 3ZGNA 4D81A 4GOMD 3KG2A 1HOTA 2YCLA 1RI2A 1CQJA 4JLDA 3LW7A 1WMBA 1QAOA 1KDRA 1YASA 5G3YA 2O2IA 1C7IA 5EY5B 3TLCA 4AJLA 3CEPB 1Y4AE 4CNBA 1A9OA 3E15A 1RIIA 3W8EA 1W76A 2V6JA 4Z5XA 1SA0B 1BDJA 1XZCA 2ZSIA 3BFVA 2VDQB 1U3GA 1JNYA 1AA9A 5DLQC 4C2AA 3D1LA 3RIHA 1K5GA 1K75A 2HA0A 3B2QA 2GN4A 2IXGA 1W5FA 2WVJA 3GCWA 3R7FA 4EY7A 1MB9A 3WKCA 2QVCA 1ORIA 2OD9A 1VB3A 1G5QA 1TM7E 1LLCA 1WDMA 2QRQA 3BCRA 3NASA 4QUDA 5ALUA 4LJRA 2VEOA 5HKKA 2R8XA 2DTDA 2YUIA 1C7JA 2R6GA 3TIFA 1XQWA 4UOQA 2XQKA 3DVRX 5T7BA 4FLFA 1M2VB 4IYRA 1E8NA 4Q19A 2QP9X 4YX9A 4ZZ1A 4YRJA 4KW7A 1DO8A 2NZ2A 3N0VA 1I33A 2KBFA 2P9BA 2GK4A 3LHKA 4TT3A 4XWTA 5F52A 3VYUB 1NBWB 1DTEA 4CVNA 4IGKA 2Z08A 3H3JA 4LCEA 3ZD8A 2CMFA 3I2YX 4BFUA 1MO2A 2ODBA 4IHJF 4E5PA 2ZW9A 3I37X 1WD7A 1EB8A 2AMJA 3U44A 4Q4CA 4TLEA 5AIBA 2G80A 3KTAA 1HUQA 4HB2A 4C4XA 4HEA1 2AVNA 4Q15A 3SSOA 3ZX4A 5IAOA 1NR7A 5ICEA 1XQ1A 3F7OA 1UMDA 3P2YA 3AI2A 4JDPA 4JT8A 2BFBB 4XM2A 4A0FA 3RYCB 2HJRA 1EGAA 1QJCA 2MDTA 2SCUA 2B99A 2OXCA 3WKAA 3LX8A 1DKUA 1FFXA 1RXUA