2ZSHA

Structural basis of gibberellin(ga3)-induced della recognition by the gibberellin receptor
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
338
structure length
338
Chain Sequence
b'EVNLIESRTVVPLNTWVLISNFKVAYNILRRPDGTFNRHLAEYLDRKVTANANPVDGVFSFDVLIDRRINLLSRVYRPAYADQEQPPSILDLEKPVDGDIVPVILFFHGGSFAHSSANSAIYDTLCRRLVGLCKCVVVSVNYRRAPENPYPCAYDDGWIALNWVNSRSWLKSKKDSKVHIFLAGDSSGGNIAHNVALRAGESGIDVLGNILLNPMFGGNERTESEKSLDGKYFVTVRDRDWYWKAFLPEGEDREHPACNPFSPRGKSLEGVSFPKSLVVVAGLDLIRDWQLAYAEGLKKAGQEVKLMHLEKATVGFYLLPNNNHFHNVMDEISAFVNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable gibberellin receptor GID1L1
molecule tags Hormone receptor
source organism Arabidopsis thaliana
publication title Gibberellin-induced DELLA recognition by the gibberellin receptor GID1
pubmed doi rcsb
total genus 122
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2zshA00
1K63A 1FFBA 2WHPB 5FOQA 4AZ0A 3O9VA 1AC5A 3C6ZA 1JFRA 3H2HA 2WIGA 4DSAA 2GYUA 4BAUA 4DMKA 4PF1A 5JD6A 4DMFA 5K3CA 3HXKA 3G0BA 3TJMA 4TGLA 2G63A 4Y2PA 4BAZA 1W76A 1C7JA 3H19A 3QMWA 5C8ZA 1ZI9A 4G9EA 5CH5A 4Y2TA 3FCXA 3I2GA 3CCBA 2WIKA 3DLTA 1N5MA 2OXEA 1AZWA 5AI0A 4EY5A 1N5RA 4CG1A 1GXSA 2QUAA 4DNPA 4IH4A 1XZLA 3GROA 4BYMA 2BUAA 3JYHA 1DQYA 4FKBA 4BBZA 4ARBA 1H23A 5ESRA 1THTA 3GZJA 4N8EA 6YASA 5AI8A 5K3FB 1LPBB 3G9XA 5E4YA 3V1MA 4QDOA 1ZJ5A 2XMBA 3HACA 3VJLA 3OPMA 5K3EA 4MQMA 4KE7A 1BEEA 3N2ZB 4UBJA 3OURA 5AKLA 5E2IA 2ES4A 4BDTA 3V1KA 3C45A 4WDQA 2XMRA 5I7UA 1A8QA 3ZPXA 4OD0A 1BRTA 4P92A 4BVJA 4OU4A 2ZJ7A 1FFAA 3G9ZA 5D3ZA 3OG9A 2Z8ZA 1QIMA 2OQVA 1DWOA 3QPCA 2WFMA 1ZGCA 2PL5A 3DQZA 1YSCA 2XMQA 3I2IA 3WA7A 4X3CA 1MNAA 3D7RA 3H2GA 3K6KA 1E5TA 4AMZA 4Y2SA 2H7YA 3KOOA 3B5EA 4UBNA 4UBOA 5AP9A 4DM7A 4OYYA 2HU8A 3L1JA 2I3ZA 2PU7A 2QRUA 3HYSA 4H7FA 4Y2QA 2BUCA 3FSGD 1XZEA 4HAIA 4BCDA 5LKAA 1XQXA 5AICA 2VJAA 2YASA 2PX6A 3WZLA 5T4FA 3W2TA 3F96A 1ZI8A 4CG2A 1CV2A 1K6EA 3A2MA 3KWFA 4DNOA 3DD5A 3W06A 4ZI5A 4H7HA 5CRIA 3R3VA 5AK5A 4E15A 2O2IA 2RONA 5HZGA 3WWDA 5FP0A 4DSZA 5CURA 5ALZA 5CTAA 4KACA 5JANA 2H1IA 1TRHA 4BAGA 4U2EA 4FNGA 1DINA 3K2IA 5DTIA 2WHPA 2VJBA 4P9NA 3QYJA 5FPPA 1AKNA 5EFZA 5AKIA 5JYCA 4QA9A 2HA6A 2NW6A 1MPXA 4EB0A 5ALOA 3OOSA 3KWJA 1ODTC 1Y7HA 4WFIA 3DKKA 2AJBA 3O4JA 3WKEA 3YASA 1WHTA 5ALWA 2QS9A 1IMJA 1YB7A 1FFCA 1XZFA 3V1LA 3H0CA 1E89A 1FFEA 4IHAA 2BGNA 1BEZA 3T52A 5LZ7A 3FOBA 1VA5A 4MJ3A 5LZ2A 2XUJA 1CUVA 3WMRA 4X6UA 4O08A 4L72A 1X2BA 1MX5A 1OCEA 3PUHA 2LIPA 2WG1A 5AM3A 5EHXA 1YAJA 1ZD3A 3V1NA 1BN6A 2XMGA 3G9TA 4GEGA 5K3BA 4MEAA 1Q0RA 1CR6A 2RGUA 5LP1A 3S8YA 3IDAA 3I2HA 1JMKC 5HK8A 2OCLA 2QJWA 1TQHA 4HXGA 2WU4A 3BIWA 4B84A 3IUJA 1J06A 2ORYA 2VAXA 1UWCA 4D9JA 1ZJ4A 1QFMA 3WK6A 4G1FA 4ZV7A 5JIBA 4W1SA 1CUYA 3RARA 2XQGA 5FLKA 4QEKA 2Z3ZA 2G5PA 2QXUA 4MXDA 4Y9SA 5BV7A 4EUSA 3GELA 1BE0A 3WK4A 3D59A 1N1MA 4F21A 4J0JA 1GGVA 2J3QA 1WOMA 1TCAA 4WCVA 4G8CA 4KR0A 3WKDA 2OLEA 2ZSIA 4B9EA 3OTQA 4KJXA 1RWQA 3VKFA 3TGLA 2PVSA 3PFBA 5IH7A 2WJ3A 5A7FA 2HA3A 1XLVA 5LIPA 3O9MA 5AK3A 5EIEA 1YB6A 1MAHA 3R3UA 2C4HA 3H1AA 1Z68A 3G9UA 1HQDA 3BIXA 1J07A 4UHDA 5HFNA 1GT6A 3IULA 5J3JA 3EQ7A 4F60A 4HS9A 3M3DA 3DNMA 3H18A 2QJRA 5IVDA 3IUNA 4BVKA 5AH0A 4K5QA 3D5EA 2XI4A 4BDSA 3IB3A 3PE6A 4L9AA 3D2AA 1KEZA 4UFPA 4QWMA 1DX4A 3TEJA 4MYDA 2JGMA 4C4ZA 1HKHA 1UK9A 5AI4A 1U2EA 4Q1VA 1QIFA 4BRZA 2WFLB 1IZ8A 4RPCA 1JJFA 1XLWA 1W75A 3JW8A 1CUGA 4QNNA 3PDCA 4CI9A 4BTVA 1JJIA 1G42A 1MN6A 4FNMA 4KYVA 4B6GA 1QTRA 2CB9A 5AM1A 3BL8A 1MJ5A 5AKEA 4GECA 2E3JA 2OCGA 3O4GA 2VT6A 4X92A 3C6BA 2WHRA 1F8UA 3VJMA 1UK7A 5IVKA 2WQZA 5CBKA 4GXNA 3LLCA 3ICVA 4J0DA 1CUAA 4GWLA 1P0IA 2B4KA 4B81A 3AZQA 4C88A 2ROQA 4QDXA 5ALLA 5ISMA 3AILA 1UK8A 3K9BA 5AM0A 4OPMA 2QKYA 2WLSA 1PV1A 1LPMA 4LKOA 1QOZA 1UFOA 1YAHA 2RHWA 2PUJA 4XVCA 1R9NA 1ODSA 4X97A 2QTBA 1K8QA 5JD5A 5JARA 3AZPA 5BWCA 3AIKA 3H17A 3DOHA 4GW3A 1L7RA 3QITA 5AM4A 4C01A 4WFKA 2CMFA 4X91A 5ALKA 4RE6A 4Q3OA 4OB8A 3FCYA 1ORVA 5K3DA 1LPSA 4PO3X 4C89A 3F9CA 1GZ7A 4QLOA 5CXXA 4B83A 2QXTA 2PSJA 2XMCA 3ZLTA 5A62A 2DSNA 5ALEA 3HC7A 4P93A 1LPOA 4L3WA 4F5ZA 4GHWA 5ALDA 1ZOIA 2DHEA 3D3NA 1MX1A 4ZRDA 5C8VA 1MNQA 5JAPA 1Y7IA 1CUFA 3AUKA 4KE8A 3PI6A 3E1GA 2D5LA 5DYYA 4BZZA 3WL6A 4X71A 4C6HA 4NS4A 1XZAA 3A70A 3PFCA 4K2AA 2PU5A 3C8DA 2Y1KA 2HFJA 3DOIA 4F0JA 1XFDA 5LLSA 4X94A 2XUOA 1XQVA 2ZYRA 3UUFA 5JASA 3V9AA 2QT9A 4FOLA 2XMSA 4JUIA 3L1IA 3I1IA 4H35A 4W1QA 3E3AA 4LYEA 5LZ9A 2RHTA 4AO7A 4X85A 1GPLA 4DMCA 2C5FA 4KRYA 4PNZA 1EXWA 3DL4A 4J0HA 3ZWQA 3MUOA 2WG0A 4FBLA 1ACJA 1E8NA 5KREA 2YYSA 2R11A 2HRQA 3C87A 3WL8A 3DYVA 3M83A 1G66A 5AK4A 3VJKA 1LPPA 2CKMA 2X8BA 2ZVDA 1VZ2A 4H0CA 4UBMA 1QIHA 2VF2A 4EY6A 1NU8A 2R8BA 1QGED 4AN1A 1QJ4A 1XZKA 2XUDA 3L1HA 2XMZA 1WHSA 4DNQA 4CG3A 1VXOA 4W63A 2WFLA 4I4CA 2I3DA 4UHCA 1QIEA 3WK5A 2YXPX 3STWA 3KSRA 2RAUA 4ZGBA 2GBGA 3WWOA 3IUMA 3GA7A 4FBMA 2AJLI 1QE3A 5AI5A 1TCCA 2H9YA 1GKLA 2XLCA 3CCCA 2CUTA 2HU7A 4LIPD 4TVKA 5CXUA 1R50A 5DTJA 2GYWA 1EDEA 2OCKA 3FAKA 4LXIA 5JAOA 5CMLA 3I28A 3NGMA 4H7EA 3FLBA 4TPKA 3T4UA 3QPAA 2BGRA 4FLFA 1YCDA 3WWEA 1WM1A 4G4IA 4EZIA 3I6YA 3BDVA 3WYDA 4H7JA 3W04A 1ZD4A 5HKAA 2GBCA 1E8DA 1J1IA 3RLIA 1DQZA 4BTLA 3H1BA 2OGTA 3RK4A 2AJDA 1CUSA 2JGLA 5HKBA 1XRMA 4X95A 2PBLA 4UFNA 1HLGA 2OAEA 2WUFA 1GKKA 3AFIA 2XUAA 2OPHA 3SC2A 4B9AA 2AXEA 2WTNA 3WZMA 1AGYA 1A8SA 1XZIA 2ZYIA 1HPLA 2PPLA 3GUUA 5JAHA 4E46A 5D3KA 3ZV7A 2CEKA 1H2WA 2JEZA 2VATA 4BZWA 3M82A 4XIIA 2WTMA 5BWBA 4B82A 2DHCA 1QO9A 4FHZA 1M33A 3WI7A 3ESCA 5T4BA 1WCYA 2PSFA 3FSGA 4RNCA 3IUQA 3A6ZA 1LZKA 2DQZA 4M0EA 4X7BA 1NX9A 4GLBA 4BB0A 3QMVA 3AJAA 5ALIA 4S0XA 1DWQA 4N8SA 3ANSA 4YASA 4Y2YA 3LIIA 3WWPA 1U8EA 4AMYA 4OU5A 4FFVA 5IVIA 3LIPA 5HFAA 3W9UA 4IO0A 4AXBA 5JAUA 3FLAA 5T4EA 3SX4A 1GPKA 1L7QA 2G5TA 5CW2A 3TRDA 3IA2A 3C43A 2FJ0A 4B7ZA 4CIBA 4I3FA 2XQJA 2XT0A 4AX4A 4U2BA 4WY8A 1X2EA 4V2IA 4HXEB 1CLEA 3LS2A 5EHQA 5AI9A 2Y2UA 2XDWA 1CUBA 1QIKA 1GQRA 4CIAA 3WKBA 1XZHA 4J0IA 5FV4A 1AMNA 2Y6VA 2VA9A 2DHDA 1VLQA 2V98A 1CQWA 3WKAA 2AJCA 5K3AA 2C0QA 4FLEA 5SYMA 2PSDA 2WU3A 3I2KA 1IZ7A 5FDFA 2XLBA 5FUMA 1YA4A 1XZMA 1EX9A 3VISA 3C5WP 1ZIYA 2HHAA 1QIDA 1MX9A 1LPAB 2XUHA 2J4CA 5F4ZA 1G5FA 2ZJFA 1VJ5A 2YH2A 3DJYA 2WILA 4BE4A 3CN7A 4J3JA 5AKJA 4W1RA 2OG1A 2QZPA 1EK1A 1BU8A 3W05A 4RGYA 2XQFA 3GFFA 1P0PA 1J2EA 1ORWA 1DU4A 2BUBA 1UKAA 5I8PA 5D6OA 5KBYA 1A8UA 4UBLA 3G0IA 5FPQA 4J0GA 4KRXA 5JATA 1W6RA 4P08A 1WB5A 4BCCA 4J7AA 5AHXA 1HDEA 3AZOA 1XRRA 3VVMA 3I1YA 3VDXA 4AB1A 1A88A 4BATA 1O6GA 3CXUA 2EDAA 3ZLVA 1ZI6A 1PFQA 5A7GA 1DTEA 2C7BA 2H7CA 2X76A 3KD2A 4B85A 3DEAA 3H2KA 2WM2A 3WA6A 3GBSA 4Y2VA 4MQLA 4Q82A 4HVTA 1CUJA 4HTAA 4Q05A 4X93A 4Y7DA 1FFDA 3ESBA 3HZOA 3JWEA 2GZSA 5IVHA 1JJBA 4KAJA 3R0VA 1FSSA 1I6WA 3FWHA 1DWPA 4ZV9A 2ACKA 5HF8A 3DDUA 2ZYHA 5A6VA 3BE8A 5LZ4A 2CBGA 2ECFA 4X00A 1AUOA 1W52X 4K6GA 3H2JA 5ALYA 1XZJA 3HI4A 3KXPA 1QO7A 1CFJA 1OXMA 3LP5A 3ICWA 3RKSA 1MAAA 3IURA 4KEAA 4M0MA 1SC9A 3G0GA 3QH4A 3WIBA 2PM8A 2HDWA 1CPYA 5AKGA 5H3HA 1IUNA 4UUQA 3ZI7A 4DGQA 4INZA 2B20A 5AK6A 2IIVA 1JT2A 1UKBA 3CN9A 2ZJ6A 4BVLA 4WY5A 5ALGA 3STYA 1FJ2A 5AIBA 1LLFA 4JH0A 3BWXA 4DLNA 4LHEA 4G8DA 4MYSA 4KAFA 1YS2X 4N5HX 5ALVA 4B0PA 4IH1A 4WDRA 1GPNA 4UHFA 4G5XA 1EB9A 3R41A 2OGZA 1BROA 3EQ8A 5BOVA 2Z8XA 1EI9A 2PSEA 4B80A 5ALHA 1VE7A 2O7VA 4Z49A 1XROA 1DT5A 3DS8A 1CUCA 3C6YA 4U2GA 4KAAA 3WJ1A 4A16A 1MT3A 1JKMA 4ROTA 5ALRA 3D2BA 3STTA 3F97A 1S8OA 1YS1X 3P2MA 3U0VA 1SCQA 1R1DA 3ESDA 4OB6A 1XRNA 3BJRA 1EDDA 4GDMA 3I2JA 1C7IA 3W9BA 4AN0A 3HJUA 2J4FA 3D0KA 1ZD2P 1JI3A 3STVA 2DCMA 4PSUA 2K2QB 3E4DA 2I03A 1IUOA 4DTCA 1XQWA 2FJPA 1JMYA 4N8DA 2WUDA 3MVEA 1T4MA 3FVTA 2JEYA 2XE4A 1OILA 3R3ZA 3HLKA 1CUWA 2WIFA 2QM0A 1EHYA 4YPVA 5A7HA 1B41A 4DNFA 2G4LA 2VAVA 3FYUB 1XLUA 3EQ9A 4ZREA 2QOEA 5AJHA 5JALA 2OCIA 3M81A 4IQ4A 1SOMA 4H7IA 1SCKA 1WB6A 2W22A 5DNUA 2JGIA 2XQKA 4Q34A 3BXPA 2QMQA 4QWWA 4C4XA 1IVYA 4W1PA 1YA8A 4WFJA 2WJ6A 1L7AA 2DFPA 1H2YA 2GBIA 1XRQA 4KE6A 3G02A 2QR5A 3DL7A 2WHQA 2VQ6A 2WKWA 4XJVA 1RYYA 3R3WA 2VJDA 1BCSA 4B0OA 1EB8A 1ISPA 4M0FA 3HRHA 1U4NA 3S2ZA 5DNVA 5LKRA 1CRLA 1R4ZA 2VSQA 1CUDA 3QPDA 5CT4A 5AOCA 1QFSA 2XMDA 4WJLA 4DIUA 2JF0A 2XB6A 1TK3A 3D4LA 1NU6A 4W9RA 4HZGA 1H2XA 1JU4A 2VT7A 3WKCA 4OSEA 1ODCA 4EY7A 3G7NA 3FBWA 3AINA 1K5PA 2XUIA 2WFZA 3EBLA 2C0PA 3IVMA 3UMJA 2BCEA 4X6YA 5K5EA 1VZ3A 1XRPA 4CCWA 2RI6A 4CCYA 3VVLA 4HRYA 5ALSA 3HSSA 5HCUA 5JZ9A 2Z5GA 1EA5A 1BS9A 4JYPA 2V97A 5HF6A 4Y2RA 2XUKA 2WIDA 4NMWA 2CZQA 1VOTA 4K6KA 5DYWA 3NUZA 4NZZA 3C6XA 4HRXA 3UUEA 5AO9A 5ALFA 1F6WA 3IIIA 4JNCA 3G0CA 1QIIA 1MTZA 3WQHA 4Y2UA 2VEOA 4J0CA 3F67A 2BAGA 3NOXA 1YR2A 1F0PA 2QUBA 2X5XA 5AKKA 2B9VA 2GZRA 3DCNA 3B12A 2WUGA 5HQ3B 1ETHA 3OM8A 4E11A 5EIHA 1GQSA 1LNSA 2WG2A 4EY4A 4PW0A 4G9GA 2V9ZA 3WJ2A 5IKXA 4CCYB 2JIDA 3SK0A 3EIOA 3ZLUA 2OQIA 4X90A 1ZGBA 4UHHA 5C7YA 1PJAA 5ALNA 1AURA 3WK9A 3WK8A 2O7RA 3AIMA 1XQYA 5JZSA 3H04A 3FLEA 3STUA 4QDTA 4Y2XA 1CQZA 3PF9A 5AM2A 3HABA 4HXFB 3QZUA 1R88A 3C8HA 4Q3KA 2AJ8A 3EF3A 2PUHA 5HK9A 4OCZA 5LZ8A 3KDAA 1EVEA 3BF7A 4ZXFA 4BRSA 3ESAA 5HQ3A 1WB4A 4C4YA 1Y37A 1QIJA 1HL7A 3DYIA 4UFOA 5KWJA 2RIPA 5ALMA 3U1TA 4MWSA 3O4IA 1X70A 2JGJA 3WLAA 4QDZA 2XQIA 5EIAA 2QVBA 1H22A 1UK6A 4G8BA 4LXHA 1WPRA 4QDUA 2ACEA 1UZAA 3F98A 4PV7A 2OAGA 4YK7A 1WPXA 2WUEA 5DJ5A 2HIHA 1UOOA 4YX9A 1QIGA 3STXA 3ILSA 4MWTA 5I9IA 1USWA 2B61A 5AKZA 4PSDA 1XKTA 1KU0A 5CT9A 5CT5A 4EBBA 1K4YA 3E0XA 1CEXA 3MUNA 5LZ5A 3C70A 4J03A 3V48A 4AQDA 4QLAA 1SCIA 3WYNA 5DYTA 2HA5A 1N8SA 5AKXA 5DLPA 4U2CA 2UZ0A 3B3QA 5ALJA 1XZBA 1QONA 3R40A 1ACLA 5KWIA 2Z3WA 1CVLA 4H7KA 5DWDA 5AIAA 4OB7A 1UOPA 4J0KA 2BKLA 1A7UA 1T2NA 3OC0A 4DMHA 2HA4A 4L0CA 4XX1A 2D0DA 4PSCA 2HADA 4BP8A 1EVQA 4DYHA 3R3XA 1CUEA 3I6MA 4GI1A 1F0NA 1TKRA 4FWBA 1ZD5A 3F8SA 3O95A 2WJ4A 3QMMA 1E66A 1RP1A 3BDIA 2CJPA 4UBIA 1MU0A 2DQYA 5DNWA 3QVMA 4QZVA 1TCBA 2HL6A 3PUIA 3WWCA 2FX5A 5AOAA 2EEPA 1EH5A 2JGEA 4FLMA 5CH3A 3C5VA 4PQEA 5JADA 5CT8A 1SFRA 5AOBA 1AX9A 3D2CA 2GYVA 1LBSA 2JGKA 5LYYA 2XUQA 2C58A 4N5IX 4C87A 3FNBA 4H7DA 1AQLA 5A71A 5HF5A 1VE6A 1QTIA 2BFNA 4UBKA 5EHNA 4EA6A 2XUGA 2JBWA 1JU3A 3FYUA 1Q84A 4RE5A 2HA0A 4EHBA 3FYTA 4BP9A 1H2ZA 4NVRA 4KE9A 5FRDA 1VKHA 2P8SA 1LPNA 5ALTA 2DR0A 2IX9A 5CH8A 5SYNA 4BE9A 2C5GA 1QLWA 4Y2JA 1KU6A 1UXOA 2BJHA 1G4HA 3WL7A 1CUIA 4FMPA 5AKHA 1D07A 4BCBA 1TIBA 1E3QA 5C8XA 5ALPA 1EDBA 1Q83A 2J3DA 4G4JA 3MGAA 5E4JA 5ALQA 1IUPA 2I78A 1XZDA 2FUKA 4LXGA 1UT6A 4ZWNA 2HRRA 5D7BA 4K6HA 4JEIA 1B6GA 3I2FA 2VJCA 1VXRA 3BF8A 4BC0A 5HF9A 3Q8WA 4AO6A 1CIJA 2ZSHA 3PICA 5FKJA 3AIOA 5ALUA 5FXMA 1UKCA 4U2FA 3QBJA 4E14A 1LZLA 4U2DA 3WL5A 4ETWA 1CUXA 4OUKX 2HA2A 3FVRA 1LBTA 3A2NA 5JD4A 1BN7A 3LCRA 1EINA 1E8MA 2HM7A 1P0QA 3VXKA 1YASA 4EY8A 2V96A 1O6FA 2HA7A 1XRLA 1HBJA 4G4GA 2WIJA 2ZYSA 1CUZA 5C81A 2Y6UA 3PF8A 4FDMA 3O0DA 2ONCA 5AI6A 3G0DA 5EGNA 4MEBA 1ZICA 5E4TA 4X6XA 2GBFA 3RM3A 3X3HA 4ITVA 1Q0ZA 1W1IA 4UHEA 2OGSA 4A5SA 2XUPA 1R3DA 2H7XA 1DT3A 1C4XA 1XZCA 3HEAA 4FFWA 4OYLA 4UHBA 5CT6A 3H2IA 5A2GA 4BC1A 4UPDA 4GBGA 4CFSA 1THGA 1DX6A 4H77A 4ARAA 3ED1A 4H18A 4QE3A 2HU5A 1EK2A 3QM1A 3FYUC 4LYDA 2EDCA 1CUHA 4IH9A 3Q0TA 1QZ3A 3NWOA 3A2LA 4XWGA 1XKLA 3DKRA 2IITA 2W6CX 7YASA 1U65A 2JGFA 3SWWA 1R9MA 1CUUA 1BCRA 3WIOA 3R3YA 5EHZA 3ANTA 2O2HA 3G8YA 5YASA 1ZIXA 3IBTA 1TAHA 2PSHA 1VA4A 4I19A 5K3FA 3O4HA 5ALXA 1P0MA 1W4LA 3I6ZA 2O2GA 4A23A 1UOQA 4JYMA 1XZGA 5AM5A 2Q0XA 3WK7A 4AO8A 3N0TA 4FTWA 2WSLA 1LGYA 5T4HA 1MO2A 2PKYX 5EI5A 5JZBA 2VTVA 3BJMA 4AZ3A 4Q3LA 2Y2VA 5AKYA 2HFKA 2XUFA
chains in the Genus database with same CATH superfamily
5DOVA 4NEQA 4KXNA 4QYWA 2Q8NA 1FFBA 3GMSA 2VPZA 2HK9A 5FOQA 3TPZA 1M2VA 2WICA 2BF4A 2WW8A 1HZJA 1PUJA 3IHTA 2M98A 2C7GA 3HXOA 1DKQA 4LSMA 3VU8A 3FWKA 4N5DA 4BAUA 4XZ3A 5CK5A 4DMKA 5FPTA 3AVOA 1M5TA 5T8KC 4LFCB 4DG5A 4EW2A 4H2DA 1OOEA 4GUDA 3THRA 3VHQA 2NUTB 4Z4EA 1SHLA 4BGEA 1PQ4A 2R79A 3B3FA 2ZEJA 5C37A 2Q45A 4OAQA 3C7DB 4K6MA 2PZFA 5KJFA 2J7KA 3BORA 2FGJA 4DJTA 1N33B 1FUKA 3LGSA 4MJXA 5ENDA 3JWIA 1KPGA 2M1ZA 1Z5PA 3HCNA 2J32A 3TECE 4TGLA 3OJEA 3DYBA 4WK4B 2IP1A 3P0HA 1AOXA 1ZCZA 1N1GA 2CLIB 3LV8A 3O8LA 2XE7A 4HDMB 2ZVJA 4Y2PA 4BVFA 5I7VA 3SZLA 3BCUA 3AF6A 1TLFA 5I6DA 1NSFA 2JFQA 1NL3A 1E1RA 1RQ2A 1C7JA 1E9EA 3NV9A 1CZUA 1A04A 3MXOA 4D92A 4GKVA 5C8ZA 5C1BA 2UYCA 1UZNA 1EK0A 3TQFA 2VWPA 1J2UA 2ZSJA 4CQNA 2A35A 4DQ0A 2JI4A 3RIHA 2AK3A 1DEKA 2BKUA 2DUMA 2ZYDA 3FGPA 1YOBA 5I8ZA 2MCFA 3CJTA 3I2GA 4Z0PA 3CVXA 3GU3A 4CQMD 3R23A 5CVVA 1ZC4A 2WDZA 5DP1A 3QOYA 4R9UC 5G53C 4M0CA 5BQOA 2VCEA 1GU1A 4XEHA 5K09A 3NLLA 3Q9UA 3GLVA 2IYZA 3LOUA 1MW8X 4C43A 1S7CA 1XZLA 2C3UA 4YP7A 2DTXA 4CQLB 2EFJA 1Z5GA 2OAP1 2O7NA 3BUSA 5C7IO 2OVBA 5TQ0A 3G8DA 1BEUB 1U2ZA 4MARA 2VLBA 5IT5A 2GD1O 4RMHA 1CZLA 3DHYA 1LRLA 3JAWB 1HL3A 4CN9A 5JNUA 2G40A 5KC9A 2J0QA 5K3FB 1FLDA 3TQTA 4UXIA 2NTJA 1DIGA 5B6IA 4RD3A 3BXGA 4LA4A 4O59O 5HZKA 4QDOA 4D4MA 5FOVA 3V97A 4QRIA 3DZKA 1YS7A 3CGGA 1BAPA 5FWYB 4F2HA 2IS2A 3CBQA 4OGLA 1TGYA 3K0HA 2CB0A 1E1QA 3G8CA 4Q4JA 1WR8A 4WVFA 3JARB 3QENA 3EIHA 1VKRA 3COVA 3GRFA 4DWOA 5IKMA 2WB2A 4ISCA 4YJFA 4BB6A 1UEXC 1ZCAA 3QBDA 4IGKA 4OK5A 4LCBA 5CNKA 4NE9A 2ES4A 4TLAA 4HEJA 1ZUHA 2BFAA 3C45A 4DIDA 5BNZA 1SB8A 4JELA 5JPDA 5BUZA 4JLNA 3DOFA 3L3BA 2XMRA 5KYWA 2GVNA 3AUYA 1U3DA 1D1PA 3FKQA 1BWQA 3FNHA 4LK3A 3LDAA 4S2UA 3VR4D 4D6YA 2DSTA 4B3FX 4LRTB 4D7AA 2Y27A 5KNCA 1X9GA 7REQA 2B78A 4AKIA 2BKVA 3HEBA 1YVEI 3ONNA 2H07A 3O6VA 1DC5A 3Q9LA 3L1VA 4OU4A 4IEIA 1U0TA 2FEOA 1BWSA 2ZJ7A 3G9ZA 3K1YA 3EPPA 4Q7EA 3ZW7A 1GTSA 1J56A 1LNZA 4TS3A 2OQVA 2LE0A 4DZTA 1W8IA 2JAXA 3P0EA 3QPCA 3BIJA 1ZGCA 4F4HA 2VOJA 4EL0A 1ZJZA 4GLLA 4O02B 1R5BA 3FHOA 1DBPA 1YSCA 3I2IA 4GSKA 3QXGA 2IYPA 5EWMA 5BT8A 2RGBA 5JLJA 1YKGA 3WA7A 4KR7A 4RJJA 1A9SA 4R1MA 5EXDA 4DIFA 4EO9A 1I14A 3ZY6A 3L7AA 5C5CA 2ZETA 5J2UB 4EW1A 2LBPA 4C2UA 1YONA 1KQ3A 1WG8A 1W88A 4KQKA 2BPOA 2YW2A 1KFCB 5FOXA 1NJ1A 2OHOA 3GW8A 1FIUA 3ZY4A 4CM1A 2YXLA 4DA9A 1Y5LA 1AY0A 1O8BA 3PZBA 1A69A 1A82A 5AP9A 4OGKA 2GAJA 5DT2A 3GT3A 2UUOA 3WLQA 3S2GA 1AV6A 1Z16A 4DM7A 2XTZA 3ADDA 3P0IA 3TFQA 1OLSB 4XA8A 1FPQA 5B7PA 2VAMA 2R6GA 2COKA 4NBSA 4OYYA 1OH5A 2OQ2A 3V7YA 1AKTA 4OG2A 3N8NA 5KS2A 1BH2A 1IWPB 2ZTHA 2QRLA 4MI6A 2I3ZA 4BVEA 4ZC8A 2IZ6A 1ZO8A 3K9NA 1D2RA 1O9BA 1VSUA 2ZAGA 3QLVC 2IZ0A 2K5UA 3PNSA 4MWGA 3U9SA 1RM3A 4MJLA 5M34A 1OWNA 4O8CA 3NVKI 1LSUA 5LNK6 1Z36A 3H05A 5BN4A 3EC1A 4EQ6B 1U2DA 3FSGD 2ZK7A 3KEMA 2W6IA 4G5OA 2JCGA 4DPMA 4S04A 3D02A 1IL0A 2ZRGA 3GC6A 3GLKA 4BQOA 5IRCD 5DHAA 2QTHA 4B7AA 2JZNA 4A2QA 1P3Y1 4WWHA 1SCBA 3S3TA 4U6SA 5T4FA 5FI0B 1B1CA 4DT1B 5EJAA 4OM7A 4CG2A 2CL6X 5H81A 1K6EA 4JFAA 1MIHA 4EG3A 3OE4A 3NMUF 2IDZA 2Q3HA 3A6GA 3KWFA 4M60A 2O8DA 2BFPA 1Z4PX 2G1JA 4QHYA 4ZI5A 1U4SA 2YJNA 3LVFO 3UV7A 1IPEA 2OD7A 3C1TA 4CCAA 4D0NA 1VPTA 1FLAA 2QQ5A 3HN7A 5F5NA 5JAZA 4RMGA 5TPZD 2PGAA 5HZGA 4RNDB 3DOJA 1ZOOA 3E1KA 4RMNA 2Z9DA 1MO5A 1BMFD 2P40A 3ETLA 2Q2WA 1E3DA 4E4YA 1E1LA 5BNIA 2VTBB 4C6SA 3F47A 4K81B 3OKPA 1SY7A 4ZCTA 4RBNA 5BOSB 5CURA 2VDMB 4QULA 4V02A 5ALZA 1DIAA 2XKAA 2BHLA 1FP1D 1GUFA 4KACA 4OYRA 1VJCA 4PC6A 5JANA 3L43A 4K9PA 2JCYA 3VBEA 1ADYA 2AQKA 4WEOA 1D0SA 5KMGA 1PEYA 1EZZA 3HB9A 4U2EA 2VZ0A 3PZRA 4NBVA 3ZE9A 1VKOA 4CV0A 1VJ1A 3FZGA 3DEZA 1IN4A 1RQ7A 3JQAA 4YYEA 3PHGA 4H3VA 4P9NA 3HP7A 1UT5A 2WR8A 3KYCA 3QYJA 3SE0A 3WTCA 1MB9A 3LL7A 3R9XB 2W2MA 3FRIA 2BJVA 2IHTA 1ARZA 3CF0A 3IEIA 3LYUA 4QA9A 5KVSA 4ARIA 1T24A 3I30X 1JE1A 2DBVO 2Q8QA 1UBHS 1W44A 4LX8A 5ALOA 1X8XA 3JQRA 2YWBA 3CRVA 1DARA 3FAZA 4EFDA 3L8HA 1IZYA 2P9GA 1DO8A 4WKGA 3KWJA 1V2HE 5J5VA 4WLFA 2GEBA 1PR9A 3DKKA 1F20A 2AJBA 3OTIA 3O4JA 3PC4A 3Q85A 3VR4H 3WKEA 5KYKA 4F92B 1E69A 1SBTA 2B4RO 2XOKD 1TECE 3O4RA 4EH1A 3YASA 1QHNA 1BOFA 3W7VA 1ZUNA 4MPJA 4MS3B 4GL4A 3D31A 2RI0A 1TZBA 4HX9A 1TLLA 2KS6A 3V8NA 1JFSA 1XZFA 2BJWA 3V1LA 4C0AC 5FWXB 1KOJA 2Q4EA 4JFRA 2QZSA 4CG0A 1AS3A 3IERA 1TA4A 1DKLA 1KZ4A 5FTNA 4K03A 5FEUA 1IK6A 3T52A 5LZ7A 1VA5A 3DUWA 1FDWA 3PIIA 5LZ2A 2XUJA 5F4BA 3KR2A 2A78A 4NPHA 4BEBA 3FSRA 2WE8A 3A1WA 4HOYA 4O25A 4X6UA 4YJ3A 3WMRA 4DREA 3VQTA 3M3PA 2VIIA 1MX5A 4AJPA 3DD1A 1NJ8A 3FH0A 2BEUB 2W37A 4MHOA 2YMLA 5A02A 4H08A 4WA8A 4LWQA 1JQKA 2LIPA 4TWBA 1UBMS 3DPIA 5BWMA 5AW8A 4CTKA 3B5IA 3FMGA 1W47A 4GM0A 4MX8A 3EWAA 5EHXA 1RD4A 1JPUA 1R8SA 1W59A 4MV1A 1DPFA 3IAM6 1KYQA 2X1HA 1WTAA 1WHSB 5AQ1A 3G9TA 4GEGA 3DCJA 1BFKA 4FCTA 5KTOA 2Y3IA 1XI2A 2M2IA 2AWOA 3EFHA 3S8YA 3I2HA 1COWA 1YQ9A 2K6GA 1P6UA 1G17A 3F7NA 2VCYA 4YXFA 4HXGA 1NF9A 4GKBA 3IESA 3OQIB 4Q6WA 3CHYA 4JDPA 1I0LA 5E1DA 5B4TA 2HBZA 1Z5ZA 2NXNA 3U1BA 4OHKA 1JECA 1S4MA 3WICA 4TXLA 4CV2A 4QQRA 3ESXA 1E2JA 1XJCA 1Y9JA 4PFSA 1H93A 3U26A 4RY8A 1I7PA 3FY4A 3ZKWA 1H8HA 4Z53A 2ZSKA 3O8OA 1HDIA 2TMYA 4TWIA 4DRZA 3P26A 1NF2A 4S1VA 4ZV7A 5HX7A 1BC5A 5T64A 2OFWA 4Q7MB 1JSCA 1G3UA 4EI7A 3OO1A 4EVQA 4JX8A 3R0JA 3PXXA 1ZL2A 2JLWA 4E4RA 1RXYA 5CP8A 5L4SA 4KJZA 4MQFB 2ZIFA 4I1UA 3QKWA 1NJ6A 4JSRA 4WGGA 4MXDA 3U4AA 3TZ6A 4EUSA 3LHIA 4OL0A 5J2UA 3LNCA 4ZZ1A 1BE0A 3OJLA 1Z33A 1O57A 4JODA 3WK4A 3ZGYA 1JAIA 3RK0A 2FUG1 4J7UA 4C6RA 2F43A 5EHGA 2HHLA 1QH9A 1ZJ6A 2PL9A 1WF6A 2XCLA 2ZCUA 3G5TA 1XDSA 5D2CA 1CR1A 4ZU3A 2D06A 2P35A 3PCRB 4B3JA 3UANA 1LTKA 3VH3A 2X2EA 2RHDA 1G7TA 3MCTA 3KKZA 2J3QA 1FFXB 5ETJA 3EC7A 4IJQA 3ND5A 5IBPA 5B6JA 4P82A 2OSVA 3ZIAA 2SHKA 4G8CA 4KR0A 2W8BA 1XXHB 2VTEA 3O3CA 3MCZA 1H2AS 1GCUA 1S96A 3AJ8A 4TVBA 4B9EA 3MB8A 1SCJA 1PR4A 3UICA 1BO6A 5A6SB 3W8NA 4JJ4A 4A92A 5HNKA 4M0DA 4E30A 1G21E 4KFSA 1W5TA 3DOOA 3MQFA 2VRCD 3SC4A 1PO7A 2IYQA 1WKBA 2QRVA 3JQ6A 5AW7A 3TFWA 1BSVA 4QO8A 2Y1CA 3S55A 3SGLA 2HA3A 3BMQB 5LIPA 3LO5A 2MSNA 2GH1A 1YB6A 2HF9A 2C4HA 4ZO8A 3EVNA 1R6DA 3CF2A 4H1VA 3RFVA 4EQ6A 3H1AA 5TDHA 5MHTA 4G01B 4HEQA 4ZEVA 4X3PA 1AF7A 1V43A 2QA5A 1T6ZA 5K0TA 1GT6A 3DR5A 1JT9A 2FG6C 2QTGA 2R87A 2VWHA 3IULA 4Q02A 4YRJA 5C1IA 2Q1UA 3RSCA 1JTVA 1AKQA 4CL3A 2C0CA 5COAA 3A6PC 1G8MA 1Q57A 2YJ5A 2YYAA 3LUCA 4IJUA 3M3DA 2WJWA 4QELA 3LPNA 3DMTA 1MEEA 5AXDA 4OHXA 4B3HA 4UTVA 2P9JA 1L1FA 1VE5A 1QWOA 1C5KA 2A1TS 4LAFA 4F72A 2RK6A 1K3TA 2QJRA 3DLBA 2ZYTX 4MRMB 4CWAA 4NI5A 4TKLA 4EKEA 2DWUA 5GM1A 1JR6A 2V3CC 3SHQA 5SY4A 4OLAA 4CIDA 2ZI7A 3C2QA 3NOQA 4JU8A 4NZNA 4Y9DA 1IEVA 3ZHXA 2WUVA 1YFZA 4BVKA 1GZSA 2XITA 3OX3A 4K5QA 4QUDA 1QH8A 3I92A 2H59A 2LDBA 1MVOA 1TEHA 4L9AA 1JILA 4V3CA 3D2AA 5ERXA 4UASA 4A3SA 4B5LA 3C48A 4RLQA 1JEQB 1D4AA 3TEJA 5EKTA 3QELB 2AYXA 2AD1A 3DZCA 1OXBB 2MYNA 1WDTA 1HY3A 1RWKA 4TLBA 1TJ4A 4WCFA 5AI4A 2FPRA 1KJJA 2R65A 1DVRA 2D4AA 3ETJA 3NM5A 1JFFB 4GYKA 1AM4D 3X2EA 5KOJA 2WFLB 3DL2A 3L4KA 3KQHA 1AO3A 1E62A 2QE7D 1H2EA 4PPGA 2WWVD 4DW8A 2F9MA 4P83A 1DCFA 1E7MA 2K4MA 3GFVA 2W4QA 4XR4A 2OLJA 5PNTA 1AUPA 3FPJA 4DPLA 4QNNA 3KCNA 1H4VB 1BDBA 2FG7C 2IVFA 4BNHA 2X7JA 1E5XA 3AM5A 3IJRA 4PQFA 3PB3A 3ZHZA 2Q6VA 3GCZA 2HSEA 1G42A 1T4BA 3GDOA 4M7PA 5IVPA 1BE8A 1MN6A 3KP1A 4OQEA 5LU9A 4UDNA 4FNMA 3R6DA 3J81A 3KJHA 1VSQA 4LF5B 3VJRA 1I7QB 2J9GA 2B1GA 2H9AA 2VL7A 4YP5A 5AVWA 2GZHA 2XRZA 1Q15A 1SVUA 3KB8A 5AM1A 4DQLA 2G80A 3PR1A 1CC1S 1GVNB 1MJ5A 2NU6A 3B2EA 3P0FA 4W99A 1RJFA 4AYTA 1HMPA 3AUTA 4MVJF 2I4NA 3PTAA 5JCJA 2CMDA 2OV6A 4KFTA 3EGOA 3CZMA 4GECA 2Z2XA 3RHZA 4OMDA 5CIYA 5E6SB 4AIIA 3THYB 4MA4A 1O3YA 4HWKA 1UANA 5GONB 5H70A 3O4GA 2VT6A 4A8HA 2WYHA 3JD4A 4H3KB 4AJJA 4KXQA 5THKA 4A2WA 3C6BA 1YULA 1F8UA 2A84A 2WHRA 4BPRA 1UXKA 2J41A 1YQTA 3F3MA 1FP2A 3QJGA 2GM4A 4KWTA 3W5BA 4GXNA 1KFKB 4L8VA 1G98A 3D81A 4INPA 1VCMA 4D4JA 3A4TA 3TSWA 3ZV4A 1WW8A 1KEEB 3DXZA 3OIYA 3AZQA 3OKFA 4ZU6X 4BVHA 3PR2B 3EF1A 1HT0A 3A1TA 3KJZA 3MBKA 5F51A 1GU0A 1P7PA 2QLLA 3KQOA 4IDAA 3K0FA 2C3PA 5AM0A 2QKYA 2WLSA 3GGJA 1LPMA 3ADBA 3AL3A 4MGHA 2W7TA 4HMPA 3WL3A 1ZA1A 3OF3A 4X97A 1J1ZA 4CKBB 5DN6D 5DEOA 1UKZA 2BFBA 3NB0A 5KSOA 2P2SA 3ROXA 4HYTA 4DQDA 1K8QA 1VB5A 1YMQA 4EI2A 4J2HA 3JYOA 2RHMA 1JVSA 1GGHA 3TIFA 1MQ8B 3CTPA 4N6GA 3H17A 4U8HA 4E5KA 3HE3A 1GPH1 1H1LB 3QITA 2VTKA 5ER6A 4Z2AA 4M9CA 4HDSA 3DMHA 1Z7BA 3N2NA 3OTGA 3PWSA 2AF4C 5IT0A 4YIHA 1GQFA 2H1RA 2R00A 3D4PA 3GRAA 3L4SO 4MRNA 4R5HA 2XCRB 2R1ZA 2NTNA 2J59A 3LT2A 3NHUA 4OB8A 1F8FA 3FCYA 4WY2A 4PXYA 5CB6A 2JFBA 5EMMA 4HFMA 4YLGA 5GONF 4UU1A 2UUAB 3Q8XB 3FRJA 3CX4A 3UK1A 3OHSX 1LPSA 3PLNA 4BO6A 1K27A 1GZ7A 2C2MA 1XTJA 1P2TA 2NOAA 4OGFA 2ZKIA 1A2OA 4LOAA 3LX6A 4QLOA 2QXTA 1R8XA 4B83A 2KLBA 2XMCA 2HK7A 4OHWA 5FHRA 4R8MA 1NYLA 2OBBA 3PEFA 4UMEA 1DBSA 1ZCJA 1NPDA 4YQEA 1DBIA 3EVDA 4KMOA 5B3KA 3P5BA 3CVYA 5IXSA 5K8JB 2AMYA 1UZUA 4GHWA 2P65A 4KDFA 4PLGA 5ALDA 3OH8A 2G8NA 2OXCA 1KEWA 1MX1A 1I2ZA 1ND5A 1TFRA 4INJA 1M76A 4BBPA 3BXEA 2E1RA 1NDUA 1X3SA 4DEVA 4Z9AA 1Y8AA 1GQOA 1MNQA 1SURA 1VYTA 2O2SA 1U8AA 5CK4A 1FMLA 1CUFA 1VHQA 1W0JA 2XD4A 3ENKA 3BMOA 3GRUA 5C4GB 5FOWA 3E1GA 3A1NA 3BILA 3KAQA 3KVNA 1V9SA 4B8YA 2VN8A 4MO2A 4DLSA 3BMNA 1R0YA 2ZBDA 4YI3A 5HGXA 1YQEA 3WIVA 4AZ0B 3BE6A 3DFFA 4X71A 3UIEA 4D0LB 4ETNA 4NYJR 4ZU1X 4PQGA 3GEBA 3NNSA 4DBVO 1DIOB 3A70A 1UPUA 1AJEA 1OKKA 2AG1A 4K2AA 2C2BA 2PU5A 4YP0A 4AQYB 5ICFA 3ZE2B 2HIMA 3PFNA 4YGYA 3C8DA 5E1OA 1TOAA 3INTA 4K26A 5KX5A 4ENRA 3EEQA 3G68A 2AI1A 2VC2B 2ECQA 4QTXA 3F4KA 3WX0A 4X94A 2IKQA 5C5DA 2IOQA 1XQVA 4GMHA 3UUFA 3RYCB 3ZGXA 4CMIB 4HH3C 4RM3A 1U11A 3F0TA 3ZCTA 2F1JA 3H6GA 4PNPA 5KSWB 4ENSA 1ZSNA 2XMSA 4JUIA 4DV7B 4AY4A 4ZVVA 2OBMA 4V0OA 4H35A 2GTHA 3OLQA 2WVGA 3E7XA 4AW9A 1N2XA 1Z47A 2FN8A 3L8MA 3JWJA 2QRVB 1OWOA 3FWYA 4I81A 4W1QA 5F64A 2W2QA 1D4FA 4K6OA 1QCDA 1BMTA 3N3BC 4EEZA 5AXAA 3U60B 2RHTA 4IDQA 5LQDA 4CIYA 3K9HA 3NRJA 1I7LA 3HVIA 3UWSA 1C7ZA 1L7VC 2OHIA 4HMQA 1B43A 2EBFX 4GPD1 3KKMA 4M9ZA 5C5IA 2DPGA 4U7GA 1RZ3A 5JCPA 3HJAA 1UFKA 4KRYA 4RZSA 5TPZA 2F1KA 3TM5A 3UT0A 2IP4A 6GPBA 4QVIA 4Z0NA 3H8JA 2Y1OA 3ITNA 1GYPA 1O6CA 4PGFA 2WG0A 5EUMA 1KF0A 4J16C 4KBFA 1E8NA 4OAOA 2UU9B 3W78A 3THYA 1LF0A 2YYSA 3X1DA 4XIYA 2F8TA 1IIBA 2VHWA 4D9KA 4WZAA 5HKOA 5T6BA 3R9XA 5F9MA 2CE7A 8ATCA 1XO1A 2C2HA 3IELA 3K7EA 7MDHA 2Z9BA 4V0KA 4AY6A 3KD3A 4BU1A 1LRJA 4O8ZA 4PSKA 1AKMA 4YH1A 2X8BA 4UOEA 3BIOA 4PC2A 1NRWA 3T7RA 4RANA 3Q3VA 2I22A 1CEQA 1HE3A 1UXJA 3V2GA 2C4MA 2XB2A 3ICOA 4WXRA 4C0HA 1TCVA 3JD1A 4HLDA 5GVSA 2P67A 1I5EA 2A9KA 3H2YA 4EJMA 4EY6A 3ADOA 3H86A 1J0BA 2Y99A 5HM6A 1QGED 4TQ9A 2D0IA 3TW6A 4YLEA 2V74B 3ZNPA 2XUDA 5LU8A 2XMZA 4P35A 1YE3A 1ZNWA 4HATA 4DC0A 4BMCA 5BMVA 2LW7A 1VXOA 4W63A 2Q3EA 2WFLA 2UVPB 4HI0E 5KQRA 5E9JA 3Q0IA 4Y1FA 3RVLA 2Q28A 4K6CA 3TTTA 3V8PA 3WK5A 4HNRA 3VR3A 5GINE 4I50B 5FBZA 5AXBA 1QJCA 3NALA 4GPIB 2YXPX 4ZOLB 1XN4A 3ROGA 4ILEA 3HDHA 4MWSA 4MQ6A 4YNBA 3GJ3A 4XX0B 3B1KA 3IUMA 4H31A 4LWZA 3Q8KA 5C35A 3NTOA 3NEJA 1ADFA 3KU1A 4FBMA 4R98A 1IC6A 2DKFA 1QE3A 1KI6A 1NPYA 2H9YA 3HNRA 2YR0A 2CHGA 4MW9A 5EQJB 521PA 4M9SA 2KWIA 1YB1A 2I7CA 1G8YA 4Q15A 1UFVA 1XKQA 2ZANA 4FOPA 4NJOA 4GZ3A 2HU7A 4QXOA 5AVJA 3QUCA 1ZHOA 3LQ1A 2DFDA 2W83A 1MFPA 3TZLA 1VI6A 3F8TA 3QLUC 3H9CA 4EDHA 1W5BA 3S1AA 2HSGA 3S29A 4PBTA 2ZRDA 4GBMA 2DFLA 2DTDA 4OQYA 1P4HA 3E81A 3KVVA 4FI3F 3WRYA 4CHTA 2N0SA 4ZYVA 1USVA 2PBRA 3QHAA 1QRTA 1T5OA 2GYWA 2OCKA 2CVHA 3KYBA 2Y1LA 5JAOA 5A9TA 1BU5A 2CMKA 4B46A 4INAA 4CODB 1M3SA 5FPSA 2PMFA 3I28A 1P2VA 3M9WA 3RCBA 4TSRA 3O1IC 3V2IA 1XDBA 4F3YA 3KS9A 4HNAA 1T91A 5EJ8A 1YNSA 4BKMA 3P4XA 3FB1A 3QPAA 2J48A 3PITA 4BEWA 7AT1A 5JNVA 3RTEA 3RSSA 4HY3A 3WWEA 1WM1A 4PGAA 4LMBA 4EVIA 1RI4A 3I6YA 4UDOA 1IN7A 3GLRA 3L6UA 3RSOA 2PUFA 1ZGAA 1F1BA 5DX1A 5WRFA 1FPMA 1U80A 3HHEA 2XDAA 1GYQA 3UHJA 1TZMA 2JFNA 3U48A 3W04A 2D2XA 4L74A 5HKAA 5ICSA 5H4HA 2F67A 1E8DA 3BZBA 5CX4A 4BKPA 4CN8A 1PJTA 2PEYA 1SXPA 3KALA 3EZ9A 3N59A 3NJ8A 1BHSA 1I32A 1OXTA 4FGJA 1NVAA 4TTRA 4RACA 4CGZA 3KUXA 3P2OA 2RK3A 2YV5A 4KP7A 1YIDA 3L7NA 3SLRA 1EJBA 2R5NA 4FW8A 2B1JA 4RD1A 1KSGA 3RK4A 1N0IA 3SZGA 4DR2B 1FFXA 4CRWB 5IN5A 5D01A 1XDUA 2D5BA 1I4EB 4M2LA 3VTFA 1HZZC 4BUCA 5HKBA 1Y3HA 5EKSA 2LRHA 3PUWA 3QVOA 4RTQA 1H3EA 3MAJA 2I4LA 3R3SA 4AZSA 3EZ6A 4Q3NA 1LVGA 1RMYA 4X95A 2AE1A 3KZMA 4IDNA 2PBLA 2OAEA 1PIWA 3QEJA 2QMZA 3C41J 2JGAA 3MJTA 2OPHA 1X7XA 3M4YA 5C4MA 2CUKA 1RYEA 4ITUA 4DCSA 1YRYE 2AXEA 2G06A 2WTNA 3B7PA 3NETA 1ZLXA 3ZWXA 4QTYA 3H1EA 2D1FA 4KR6A 4E22A 5IM4A 4JAVC 3GUUA 3OT1A 2D3WA 2ZT8A 5FO0A 2JK0A 1X80B 5AVSA 3BEOA 4F11A 2PMCA 1Z0DA 3QSYA 4YYZA 1FF9A 3REOA 2IBMA 2GS9A 4HAYA 4I1RA 2PIAA 3FCEA 1CLUA 1KK2A 2YWCA 1K2VN 3GGSA 3HVHA 3NHAA 2FZCA 2L19A 4TTJA 3WHIA 5JECA 2QTCA 1UBKS 2FWPA 1QV6A 2GEUA 1SUCA 2VPXA 4RZQA 3M82A 2FEAA 1BZYA 2X8JA 2FLKA 3AR8A 3RS0A 2Z58A 1JPVA 1UBJS 3LK6A 2E4VA 2HXSA 4K3VA 3BSSA 3TTUA 5BWBA 3WQSB 3WFJA 2Y0PA 3VYWA 4FHZA 4B3XA 2GZMA 1E2MA 1YZ3A 3MM4A 3QEMA 3JYNA 1E58A 3RIEA 4PS0A 3UMFA 4U7JA 3G88A 1R10A 4C4PA 4E5MA 1D5WA 3R6GA 1G5TA 5IBQA 4PG8A 2YRFA 4RIFA 1WCYA 5LDHA 1DQRA 1F9EA 1NIPA 1YRQA 3FSGA 4QDJA 1U2RA 3C3MA 4FB4A 1BFUA 1BJRE 3IUQA 1W36C 4LDRA 1WUHS 4BUJA 3E7WA 5F3RA 3EDYA 1ZJJA 1GGKA 1NVKA 3NH6A 1S3SA 2VPQA 4M0EA 3FCUB 2X0RA 1N2EA 1N2GA 3MSXA 2RARA 5JH7F 4HO1X 1ZEJA 4MGYR 4BB0A 1U6IA 4PLFA 3UPUA 3NBAA 3AJAA 1YF3A 5IBRA 3OF5A 2WNIA 4WQMA 5E1BA 5BQPA 4CKCA 1RZUA 3JRXA 3UJ9A 4DCJA 2HEGA 4EHDA 4GKAA 1Y7PA 4YJKA 4EG1A 3VNAA 5CD9A 5ERYA 1E9CA 2H3HA 4UARA 2X0KA 3FBGA 1H0SA 2DERA 1VGVA 4PNEA 5AUQA 3RDPA 4CKWB 2NPIA 4AJ2A 5A06A 1DFHA 2DH6A 2O23A 2PX5A 1EDOA 3SC6A 4C4RA 4EKDA 2BFDA 3IL2A 5HCNA 2NADA 3GL9A 1U8EA 5F1YA 4ACBA 2UYYA 3ANNA 4AMYA 1LJLA 2WB4A 4L0QA 5EXEA 3PYXA 3OZWA 3EXHA 3OI7A 1X9IA 2I1VB 2R85A 2VSNA 4GOOD 4KYTA 5IVIA 5M29A 1Q7BA 1VLMA 2PIDA 5KTPA 1CF2O 1XQ1A 1DADA 4IO0A 3HUEA 3BMNB 2Q62A 2VF8A 4K6FA 1XYVA 3WLHA 5T4EA 2LD4A 3CRRA 4UVEA 4NCJA 3EEFA 2Q4OA 1KNXA 2IE8A 1XAHA 2IYSA 1TJYA 3BDAA 4RVHA 1ECBA 2A14A 1E0KA 2Y92A 4GWGA 2GVZC 3TI9A 1QHFA 3GIDA 4X20B 2B8WA 3T1TA 4D3YA 2OMKA 5FUBA 4D2IA 1RWOA 3OQPA 3ND7A 4YMTA 2BE7A 4DR1B 1JR3D 3GJRA 4M55A 1GRCA 5ITZB 4H16A 1KZYC 1OC2A 4MUHA 4RV4A 1IWBB 3B60A 1DTSA 1Z4LA 1QGAA 1G6OA 3PPVA 4RX1A 4YHBA 4DS3A 1HX7A 3HCPA 1X2EA 2CFSA 2P4EA 1XMSA 3NKLA 5CFPA 1C1XA 1EVZA 1JLLB 1PR5A 3GVHA 4I55B 1Z0KA 1ZUD1 4REQA 2QVZX 5AI9A 5DX8A 5EQFA 3NIBA 1ENYA 4CF5A 4CETA 3RC7A 4W5NA 2PXXA 4TMTA 1GG2A 3D7LA 3JATA 5KVQA 3OOHA 4O4JF 4CM9A 4B8WA 2Z6VA 4U6QA 3HZRA 1XZHA 4LECA 2AT1A 4IG4A 2Y6VA 3NT5A 5FFMA 3I3SR 1V7QA 3U3DA 4HJXA 1NLMA 2DHDA 3P2EA 2J6CA 4GR5A 3O94A 3MCAA 2IVZA 1RT9A 4WOBA 3ILXA 3OOEA 4YC7A 3I62A 3OIDA 5K3AA 4B45A 3DF7A 4XB1A 5T3UA 1VB3A 2GN8A 3DDCA 3IKLA 4BX3A 1ZQ9A 4WBNA 3CISA 1YTLA 3MXTA 3ON5A 2WU3A 2IPAB 3F6BX 5F1KA 3HDVA 1UDBA 1YI0A 3WLPA 4NU5A 2A33A 5JC8A 2P6NA 3DV0B 3AHGA 4LOLA 1CNEA 1H2BA 1LK0A 5D6NA 4HVAA 3PNOA 2QMYA 4V1CA 4UEOA 3GAAA 4JOQA 3U4CA 2VDKB 3IPLA 3LM8A 5JFTA 1UDRA 4JLAA 4PEVA 4L3OA 3K9FC 4IJWA 2O2YA 2EG5A 2I2WA 4XTRA 2PKQP 1YJBA 4G65A 3FE2A 1NKVA 3URMA 4GVLA 1N32B 1IDN1 1J99A 2QMUA 2WSIA 2HDOA 1VJ5A 5CLGA 4W5QA 1RM4A 2JCXA 2YH2A 2G1KA 3CFYA 1ABBA 4I1SA 4WINA 1Z4IA 2XBLA 3DJYA 3K15A 4XPZA 5GVRA 4KOEC 3S7TA 3DNPA 1RRCA 4WZBE 2OD2A 2FSGA 4YT2A 4OL9A 1G8HA 2AW5A 4DUPA 4OHBA 4OGWA 1BVHA 2ZRPA 4Q1BA 1X3LA 4QIHA 3P9KA 1BS2A 1QHHA 1VIMA 3C4QA 4W1RA 4PXSA 1P6QA 4KIUA 3CX7A 5LB2A 3UM9A 1BU8A 1HDOA 3UOWA 2CLHB 3UG6A 2B6NA 5H3CA 4FX2A 3RVQA 1ZIOA 3ZWAA 1TZJA 3GBPA 1E4YA 1KI9A 3I32A 4XX0A 4AN4A 5A4FS 1EFAA 5SZHB 4XCQA 4P32A 5I8PA 1PR1A 1EGMB 3B48A 4XD2A 4N65A 5D6OA 5KBYA 1A8UA 2CL5A 1J0EA 4QPDA 4UBLA 3IO3A 2TMDA 4P34A 3V3KA 2PWYA 1P5JA 4PTYA 1MB0A 4X45A 4RSHA 4BCCA 2YN0A 5ES3A 2XNCA 4BP3A 1ZH4A 1MBZA 2J6HA 3ZK9A 4HP8A 4Q24A 3KPWA 5AHXA 2R6JA 4LWPA 1KKUA 4AY5A 5CAEB 2HLDD 4L78A 1RTTA 4B3MB 3VVMA 4FFLA 1GZHB 5I4IA 3PC8C 2Q0QA 4HRAA 3VU3A 3B89A 4BATA 1O6GA 3CZ4A 3HWRA 4LRQA 3ADCA 1GTZA 3R7LA 4KBGA 3KRTA 3LWZA 4D9CA 4RHEA 3F4BA 3FVWA 2O2XA 4YR9A 2ZSBA 1PFQA 1T2CA 2XVYA 2NSHA 3A25A 3MUFA 4RJKA 2PNJA 4Y9TA 5H0IA 5JS7A 4DB2A 5TV2A 4BMOB 5ADHA 3KKLA 3TB6A 1OLUA 4B3GA 1MOPA 1GR0A 1SAYA 3JTEA 2GZ1A 3FF4A 1M6NA 2XGOA 4DLXA 5KWVA 2A1IA 1Z82A 4BBJA 2FN9A 1OY1A 1Y3CE 3GBSA 4BWFB 4FYIA 4Y2VA 1F4PA 3V55A 4GPEA 3E3NA 1JHAA 1STOA 1SVWA 2D0PB 3OCYA 2C77A 3IR7A 1JUDA 2B69A 2GJ9A 4PS1A 1OVMA 2C54A 4HTAA 4U1RA 2W6JD 5K6RA 2PFGA 4WN9B 2WM3A 4X93A 3ZBUA 1G3QA 3HZOA 2CNWA 5JTUA 2A7XA 5EJ5A 1EDZA 1ZJWA 1SOVA 5A4MS 2FR8A 4BGVA 1ZK2A 5DK4A 4GOXA 4FEGA 1D5CA 2JLQA 1Y1TA 4I1VA 4OXRA 2I99A 4OHYA 1FSSA 5JHHB 1PHPA 1WO8A 1K6JA 3QVUA 1IM8A 1TTTA 2FI1A 3G3EA 4G5SA 2QE6A 1A4XA 3EXFB 2CXPA 1JL3A 5A6VA 4ME6A 5IPFA 2ENWA 3O1JC 4YUWA 3BE8A 4RJLA 1S0UA 1EA7A 3UJCA 2B4QA 5LR6A 3FNEA 1QG2A 4QGGA 3VSBA 1CEEA 1QQ6A 4O1MA 3TCNA 4BHTA 1N9KA 4IDHA 3SEFA 1PNQA 1E0DA 1KMIY 2DLNA 2FMHA 1W2GA 1J4AA 3PEVA 3BH7A 3LKBA 3Q15C 4K6GA 5CVDA 1Q21A 3WGQA 3PVSA 4WESB 1X8JA 4FFNA 1G55A 3VV3A 1L1RA 4OJQA 5ALYA 1EFHA 1KK3A 2N47A 5HIMA 1C9MA 1EFDN 1FVXA 3EHEA 3KXPA 2VZ9A 1HG1A 1SHJA 1H4TA 3EZ7A 1ZA2A 3ITEA 1WUJS 3NWBA 3ZDFA 4A1FA 3M6AA 3NIWA 4J1NA 4D9BA 2Z3VA 4EM6A 5KTMA 3HVUA 1OXMA 1P9OA 3KTFA 3NEAA 4RPIA 1ZD9A 3IURA 3ZCPA 2C20A 4KEAA 3TTWA 2CL7X 1ZP6A 1ZRHA 3M49A 4YAJA 3G0GA 3BTVA 1SG6A 3B1FA 3QH4A 4Q39A 4E5VA 4M8KA 3WIBA 3KEQA 4JITA 1X6VA 1U28A 3H8SA 2IDMA 1AZTA 4HGPA 5DM4A 5BY2A 5AKGA 1JJAA 1OB5A 5JPIA 2HV8A 1VHWA 4NAVA 3PUKA 4INZA 2OO7A 8OHMA 4HUQA 2EWVA 4EKYA 1SVOA 3T3IA 3NHKA 1E2KA 1G8SA 1JQ5A 1RWWA 3MRXA 5SYAA 4BVLA 4NG5A 5MGBA 5ALGA 1F3OA 3QKUA 1G4AE 2V54A 2V7VA 5F1PA 1LLFA 1TLTA 3NTXA 4WHMA 3JQBA 3RRFA 4CLHA 2HMSA 3OICA 2FV8A 4YPOA 1W30A 3BWXA 2YV3A 3I42A 1EE2A 1KY4A 2YWDA 3JATB 4HZUB 4UUOA 5JLAA 3TSYA 3JAMA 4LY0A 2IL1A 5DCWA 5KI6A 4IV5A 2C9YA 1D2HA 5HS6A 2XNDA 4ZOBA 1PV2A 3F7MA 1EXDA 4G8DA 1E20A 4MDYA 3JVIA 4O0MA 5IFLA 4KAFA 4N5HX 2X3FA 1KI1A 1KJWA 2J9RA 3Q3GE 4H1UA 2DGDA 4OXIA 1HDGO 4G5XA 4I3HA 3R41A 2G04A 1FQOA 1VRWA 4ICIA 4FZVA 3JXEA 1OMOA 4R0NA 4EAQA 3L0PA 2XECA 4CKCB 1PTJC 4ER0A 1ECCA 5CCBA 4O6VA 2QENA 2QSUA 1ES9A 5CAEA 2Z8XA 2RGRA 2BBWA 1DWUA 4F85A 3MC1A 4AWBA 3BGDA 4LRSB 4EFLA 2E2WA 4UJ3A 1OJ7A 4QARA 3K0CA 5LYJA 16PKA 2Q46A 3HMQA 5U4QA 1C29B 1JR4A 2AG6A 2R68A 2PTGA 1B0ZA 2EJCA 3DS8A 3IP3A 4HHEA 4M0KA 3CKKA 2ZJ0A 2JLCA 5GMOA 5B2ZA 3ZJUA 4U2GA 1FRZA 2E82A 1Y5RA 3RU7A 4E2XA 4FJ0A 1M5RA 4RF4A 3AXTA 1DZ3A 3IEXA 1JKMA 1FU8A 3D2BA 3IOBA 2C5BA 3UJAA 4R2MA 1S8OA 4Z8YA 3ZI4A 3RFXA 3UCXA 3MYRA 1B8NA 3E9YA 2A8YA 2BM0A 1VJTA 3AESB 1SCQA 1Z35A 3OY2A 4X63A 3AGPA 2FW6A 1A8PA 2PWPA 3D8RA 4CTJA 3U7JA 5IKEA 3GT0A 3ESDA 1BQEA 4IWNA 4NJMB 3D5QA 2NN3C 4LFBB 1KO1A 3BEDA 4NECA 5ICMA 1AT1A 5I4CA 1C3XA 5K99A 4OKIA 1EBBA 1OHHA 3A1SA 1KZHA 3SFVA 1DCMA 4YAIA 3I2JA 2ZS9A 4CM6A 2P3QA 4Z9BA 1JPJA 1YRAA 3DW1X 1X1TA 5JJ5A 4A8TA 4KHZA 4BO2A 3HJUA 3HY4A 4MQFA 2LR0A 2XJ4A 1M8FA 2XDQA 2I6FA 4HX2A 1A96A 7MHTA 1Z2PX 2ZBRA 3MWEA 4O29A 3RBVA 2D7DA 2NYUA 3QKTA 1R9GA 4TX1A 3W7AA 3WSVA 4LZAA 3HB5X 4PAWA 2QT0A 5LUBA 3ZHQA 3FZEA 1GHTA 1FX1A 2E87A 3LC7O 3RBZA 2DCMA 5IAOA 1GLNA 3G6KA 3NBZC 4FZ5A 4PSUA 3CLTC 2K2QB 4Q9AA 2Q7OE 5FH9A 3GT4A 3KKKA 1LBEA 1M2OB 2GAIA 3DZGA 3X0DA 4DTCA 3FD8A 3RRXA 1PBTA 4LDAA 4XI9A 5DASA 3MVEA 1HT2E 5TR9A 3FYHA 4C1NA 3FVTA 2Q3DA 4HQ0A 4B6RA 2GCOB 4E5PA 5BSHA 4XYEA 4RY9A 3MRVA 3R3ZA 3B70A 2BGTA 3GEIA 4F5EA 2AI2A 5TARA 2X1VA 3OE1A 2A5GA 1U5AA 1UJBA 5EZYF 3SM9A 2B8JA 3DE2X 3EDOA 4AX8A 3OPXA 3SF8A 1X7ZA 2AVDA 3UNXA 1U8FO 3N0XA 4D9HA 2GAFA 1OHHD 4CM8A 3B7WA 3H1PA 4OQMA 2VAVA 5K3SA 1WV1A 2G0NA 1XAIA 1RAAA 3EQ9A 4FFSA 4J8PA 5C34B 5DHSA 3UO8B 1BHO1 4C4OA 1WF3A 4I6JA 4ENWA 1EAMA 4KXVA 2ZIWB 2XR1A 1V11B 1COWD 5GZ3A 4HQLA 1FRQA 2HWWA 1DX9A 2Z56A 4O4IA 3M81A 4FFRA 5DMHA 4EB3A 3QVWA 4WNIA 4WOPA 4BMYA 4H7IA 1MRNA 1GCIA 1UKEA 2G88A 2L82A 3AG6A 4IY1A 2VKQA 3IAHA 4I6EA 1WB6A 5JJKA 2W22A 4KO3S 2G17A 2XQKA 3N6VA 1HEUA 3LLUA 2VZLA 2H2IA 2Q6KA 3F6EX 3OFND 5FBKA 1V9CA 4M0UA 3WP1B 4BLPA 1ACMA 2H52A 1W85B 6PFKA 3T7IA 1N6LA 1S2NA 1NTRA 1RU3A 2A59A 2H1WA 3B9PA 3GCGA 4M87A 3VOSA 2PV7A 1WUKS 2Q07A 3HKCA 2Q7DA 3A14A 3H5VA 4JASB 1IVYA 4C4XA 1HR0B 4YJDA 3T7TA 5HUJA 1U1IA 1UCFA 3KLNA 4QUIA 2F4NA 1UPBA 3TM4A 3VV2A 3ZC3A 1H2YA 4C4SA 4XR9A 1RAGA 2EBHX 4D45A 3KOXA 2ZZKA 2ZI4A 1ZMOA 1O89A 3Q11A 5SICE 4Y1EA 1EWRA 2IYOA 1WDWB 1T3LA 2VP9A 3G02A 2A5YB 1H6BA 2ZBGA 3PVZA 4FNAA 3A3KA 4L76A 4XARA 4Y9UA 1CIVA 5DN9A 2ST1A 3S8EA 1BVUA 1UZMA 4GL2A 4YN3A 4ABYA 2VQ6A 2RHLA 3EGXB 3AR3A 1EZ1A 6ADHA 1S3GA 1OX6A 3KLOA 3PD1A 4RHFA 1J7KA 4RVSA 3U1VA 2C1EA 1L2TA 3BZUA 4MUXA 1KIAA 1T9KA 3D1VA 4ZQEA 3PJEA 2BYTA 4C2AA 4RXTA 2HNKA 3BWBA 2IGTA 1RXWA 3UT5A 3HY3A 2IU3A 4CW7A 2FRDA 3BGOS 3QJ5A 1AK1A 3EVEA 3QPDA 1R5OA 1QFSA 4HGNA 3IHLA 3TOVA 1C7EA 1QZUA 2XMDA 1DZIA 3T7DA 4CKEB 4D56A 3GD5A 4KO8A 1KRHA 4G0UA 1XDZA 1T8UA 3PLAE 3HJRA 1JDJA 3ESQA 3GZNB 1EWYA 4FR0A 3L5OA 4URVR 4BJ5A 1KY2A 4KYIB 3BD9A 1GAJA 5HBRA 3DLPX 1TYAE 3K0AB 3LUAA 1TVMA 4AZWA 4MVJH 5LD2B 2Q2QA 1QCYA 2GD6A 2VT7A 4OBXA 3AT1A 4I5EA 1TO6A 3WKCA 1NBME 4EMUA 1NOKA 4BNDB 2ZPAA 4NQZA 1ODCA 2WABA 3AINA 1RLOA 3AF4A 4LGVA 4TMKA 2NUTA 3K2EA 1E3TA 4D02A 5FTLA 3VKHA 5E6SA 1YA6A 2WFZA 3BHIA 1UMDA 4P80A 3O8QB 2IYAA 2C0PA 2VRCA 4E33A 4HTFA 4P4SA 4J4BA 4L22A 4FS8A 4GPZA 3RFUA 3LDGA 3CLHA 1YZNA 3TYXA 4X6YA 5K5EA 1MJFA 2WZQA 4IIJB 1PFKA 3ASZA 2O19A 1H5QA 4O0LA 5ECYA 2OT3B 4R9SA 5BSWA 2B5OA 3DQPA 5EP3A 2DAPA 4HRYA 1IPFA 3FSEA 2FZGA 1N3BA 3FSJX 4Q9KA 4MJ7A 1EA5A 4GAEA 3GLGA 1M1XB 5EQTA 1SU4A 3SKYA 1WV0A 1GKUB 8GPBA 3D3WA 2FB9A 1KA9H 4FDUA 3OZUA 2IDJA 4RF2A 1EVLA 4BGIA 1HO3A 5KHAA 4BQQA 2WKQA 5EZ5A 3T4XA 5EJ9A 3RVBA 3AP2A 3NWEA 4PC3A 1M0WA 3KAKA 3PGJA 1OZGA 3BYZA 1C8KA 3DVLA 4FGLA 4OQ4A 4OXNA 2A9JA 3I4FA 4BRUA 1PEKE 3C6XA 3HXMA 3JARA 5JDIC 1M8GA 1Z07A 1ZH6A 5A5FA 4GEKA 1QB8A 2P7IA 4OH1A 1GGJA 3U5ZB 3RT7A 3FWPA 3UUEA 2ZUEA 4DDHA 1CQXA 1GCAA 3DM9B 4TL7A 1VLJA 1U98A 4HQ6A 1F0KA 1VECA 2R66A 2H9IA 2X2PA 3IIIA 3NX4A 4JNCA 1QIIA 4DADA 4HRVA 1IATA 4J0CA 2P9EA 1NMQA 3IALA 3NRBA 2ID9A 3OT5A 2X6RA 3ROPA 2JFOA 4D4LA 2QGZA 1Q92A 4DLRA 4IVPA 1ECJA 2NSLA 2R44A 3HBMA 4M6WA 1YR2A 2B1RA 5KNBA 3QOFA 3H8VA 3CBGA 4FR2A 1E79A 2YHIB 4B2YA 1HG0A 5AKKA 2X3YA 3WSTA 2TMKA 3ZDBA 3DCNA 2WJIA 3T8YA 5HQ3B 1VL0A 2QDKA 5EIHA 5BV2P 3U3MA 3DHVA 4HC4A 4JLPA 3NI2A 5CDHA 3MMXA 1SVKA 3KXKA 1PF7E 2ONYA 4TT3A 3AUFA 3U37A 3K20A 4WN3A 1IK4A 5J9FA 3T9CA 4CCYB 1RFGE 2JIDA 2O4UX 3SNKA 3EPLA 2QZ9A 4TKVA 1RC8A 4OEHA 3ZLUA 2DFKB 3ND6A 4RAOA 5K8LA 3GLHA 1T4CA 2PY6A 1WPGA 4W82A 3U39A 1MP0A 3CINA 2POQX 2PZGA 3DSRA 4FNOA 3BTUA 4IFEA 4R68A 5ALNA 4C29A 1AURA 3ISTA 3WK9A 1Z4KA 3EDMA 6CHYA 3QNWA 4F84A 1G7CA 1S9HA 4QJBA 1M2GA 4ED9A 3CM0A 3UJNA 1WSAA 2C8VA 2HCRA 3FLMA 1C4KA 2EKBA 4LV5B 4N5MA 1I7SB 4UKDA 1A7JA 3EODA 4QDTA 1EGHA 1V8OA 4EX6A 1NMEA 2G25A 4FMCB 4OLBA 1DXOA 3CIFA 3VZDA 4DWWA 3BULA 1TU3A 1V4VA 2OEPA 2WPNA 1TKCA 1EUDA 3AVPA 2OHFA 3LMKA 4PZCA 5FBVB 2FPPB 3QZUA 1JYEA 1GZ6A 3G5MA 3RJ9A 4IZOA 4AF8A 4E94A 2H5JA 1J2RA 1AIPA 1DAHA 3C3CA 2PUHA 5B6PA 1F9AA 5HK9A 5E6RA 1SRQA 1N7IA 1ZFNA 2YICA 4R40A 4YPFA 3CVVA 3HWWA 3ID6C 5TGZA 4PN3A 1S9DA 4BN0A 1N5JA 1A5BB 2D1RA 2QU7A 4RJ2A 5IT9A 1P17A 2HIGA 2QN3A 1CQJB 5FADA 5LQSA 5HG0A 1V25A 3GLIA 5DN6A 2WJZB 1XTPA 2JL1A 4OQDA 2I1WA 3GJXC 4I2NA 3UAYA 1WZNA 3EDQA 3UXMA 1DMSA 1RXVA 1WB4A 3FDZB 4R2XA 5EUCA 2X7XA 1B42A 1NLZA 3E05A 3WOHA 5JOQA 1YZYA 1Q1QA 1Z2DA 3DXFA 4DDTA 2NUAB 2ZYWX 3QXHA 2QMEA 4RS4A 3O8QA 3K1ZA 1KPHA 2IIBA 3K1AA 3TI7A 5CR9A 1D1QA 3L49A 4IIBA 4MLCA 4DR5B 2G7ZA 3O73A 4EK9A 5ESWA 9LDTA 4FI3C 1XTRA 2VO1A 1J0AA 1Z0IA 1G9TA 1RXSA 1GPMA 2VHJA 3EVGA 3NKVA 1X70A 2JGJA 3K6RA 3QYAA 3FA2A 3NT4A 1IJFA 1GUBA 3UY4A 3WYBA 4DQVA 1HTTA 2FZKA 1FXSA 4DVGA 2FHSA 5LQNA 3L1KA 2Y71A 4G8BA 2DOKA 5TGDA 1JGTA 1WPRA 1V95A 5KNBD 1X13A 3DE3X 4QDUA 4NZOA 2TYSB 3QIVA 1UC8A 2O50A 3OOWA 3I04M 4IDBA 1AUXA 3BBPA 4N12A 4TS4A 4OAPA 1Q7RA 4LXXA 2V9PA 3HEMA 2QIPA 3IVXA 2YMPA 1KI2A 1OGIA 2K7ZA 3M2TA 4ASUD 2D0OB 2AEMA 1GD1O 3K96A 4LN1A 2CNBA 1UBLS 3DLIA 1QYXA 1U2QA 3P2IA 2HIHA 4R1QA 5FPKA 1NBMD 2R1VB 5NULA 4OFBA 2AZXA 1K1EA 4P4SB 3IVGA 3WRYC 1ISMA 1YXMA 2X77A 1F0YA 3VH4A 4M9RA 4Z0TA 2J0EA 1NXQA 1DUSA 1UJ2A 1XTTA 2YVKA 3PEEA 1B0UA 5FL7A 3Q3CA 4PSDA 1JIXA 3NM4A 4DRXB 2A0KA 3SQDA 3RYTC 4WK2B 3IS3A 4A5OA 1KU0A 3TUZC 3EGXA 3LXRA 3UK6A 5CCXA 1NT2A 2EQ5A 4HQFA 3RYHB 3UHPA 3PIRA 2I6GA 2JBHA 3KC2A 1PZHA 1CEXA 2YHBA 3MUNA 4MIEA 1W5AA 2NT4A 1FTQA 4Q16A 2R4UA 3ZGVA 1TPZA 2R6R1 1P1FA 3WYNA 1EUQA 4PIPA 4DV0B 2C94A 3TK1A 3MTBA 3T1NA 4MDFA 4XLTA 2D7JA 4ALNA 4NV3A 3M6VA 2YZMA 4BLVA 2UZ0A 3MYYA 5ALJA 4HTFB 3DZIA 2NAPA 1RVV1 1I3KA 1V3QE 1XZBA 2FA9A 2IHKA 3E2MA 3EY9A 3R20A 4TXMA 4CUZA 5HKKA 3TLAA 2HV9A 2PS1A 3FOWA 1O6ZA 1YU6A 4QG7A 4EF4A 2NU7B 2BEVA 1XEXB 5AFSA 1XGKA 3LXUX 5B1IA 1NUUA 3KOWA 3SQLA 1TIPA 3NW9A 1RAHA 4AT1A 4BFVA 4F97A 9ATCA 4BOYA 1G6HA 3FOCA 4QU8A 1A5TA 1O7JA 3SVZA 4OB7A 3QFFA 3WDKA 1PYDA 1IY2A 3JPWA 3AB8A 3PGA1 4IFTA 1JA1A 3IAS1 4IVQA 4A8PA 2R6HA 4V0RA 1L5OA 1CS0B 1P9LA 2Z9CA 3MTGA 4KFRA 5LXTB 1NVEA 3GPBA 2BKLA 2D6FA 3ULKA 4V2IA 4XX1A 4L07A 3HY6A 3UOAB 2IOFA 1O0BA 1NI3A 4MTCA 3LPMA 2D0DA 2H8GA 2PZMA 3FNIA 5CJPA 5BRAA 3LU1A 1FL9A 1C50A 3K4HA 1L4GA 2Q1WA 4ZAVA 4X84A 4RTKA 1RHMA 1DPGA 3TTSA 2WTXA 3L7DA 5CPFA 3F2VA 5BN5B 3TLGA 1IBRA 1FP4B 1IXSB 2XGMA 1RVDA 2B36A 3PS9A 5FLYA 4D98A 2P9TA 3E5MA 4RDHA 3HWX1 4R2LA 3PX2A 2PUAA 4JLMA 2BRUA 4D3ZA 1TYEB 3VNRA 4K40A 3UAZA 3K0CC 2P8JA 1ZD5A 2H4JA 3F8SA 3D6NB 4IBOA 4UTPA 2AXNA 2VP3A 5A04A 4LEIA 2WJ4A 1HYEA 3QMMA 2D3TA 1E66A 1RP1A 1N75A 2N9UA 5I9SA 4ZT6A 1I1OA 4NCKA 2DQYA 3ENNA 3R8FA 3EAGA 4QZVA 2O4CA 2RK4A 2YHIA 2WZDA 3L02A 4UUNA 5KPDA 4YR7A 3TG2A 2CLEB 4QYIB 4XWWA 1Y1QA 1XEWX 1UJNA 2HL6A 2ZE5A 3PUIA 1Z7GA 2P7HA 4S35A 2EYQA 3LC0A 1M34B 3AX6A 5CH3A 2QWXA 2FP3A 5GADl 5KVCA 4V24A 4HSGA 1G20E 3DTVD 1T9CA 2PANA 5TC4A 5A5DA 5G41A 2E0IA 1TYBE 1Q95A 1I94B 5AOBA 5JZMA 1XZNA 3P4UA 4N6NA 3D2CA 2X0NA 4MINA 4N49A 1LBSA 1A50B 2JGKA 2A57A 2UVPA 3RVPA 3UMVA 2OKGA 2BM1A 3E8XA 2I55A 2NGRA 2Q3JA 1AUQA 3N7TA 1VHDA 2HZBA 3KLMX 4N5IX 4PLYA 1NXPA 4FHGA 3L6RA 5AJVB 1XB2A 3HCEA 3T34A 4CU2A 5I48A 2RAFA 4OJTA 2WAMA 4HLQB 5HF5A 1KWKA 5FYDA 1JHXA 1NQTA 4KCGA 4AURA 3V7WA 2BFNA 4OKSA 5K4GA 1GFSA 3O83A 5EHNA 2HZ7A 3C3WA 3WXMA 2XUGA 1JU3A 4JP1A 1KZ9A 1DRUA 4OIMA 3P0RA 2BWJA 3V4LA 1Q7CA 1T8SA 3ZDDA 1G8JA 3EVAA 2OUKA 2ZVPX 4IDGA 2PLAA 4UVDA 3FYTA 4Y2GA 2ZTLA 3EXG1 2QI9C 3EH1A 1VKJA 4FYPA 4BO1A 2PJUA 1J2YA 2A7QA 2J85A 5J40A 1T13A 1K8RA 2YZKA 5TPWB 4YRDA 2TMGA 2FVXA 2IHJA 4AD8A 3BHNA 1PJ3A 2P8SA 5ALTA 3F5DA 2IX9A 1C9EA 1MV5A 1N5OX 2OD9A 3BB3A 3ILVA 4G86A 2PZLA 4NENB 5SYNA 4LISA 3WLKX 4BE9A 2OMEA 4HUJA 5F9FA 4BWYA 2UXBB 2JAQA 4PHHA 5HWSA 4OVKA 1GNLA 4PC1A 2BJHA 2EFGA 1G4HA 2ZE6A 4LRUA 2AZDA 4WLOA 5TXGA 3RRNA 3L7LA 3WL7A 4ZJZA 3HM9A 2FWBA 3T5TA 2JH3A 3EZYA 4ZEXA 4A91A 4P3XA 1D07A 1T29A 3IP1A 4FU0A 4K88A 4EI9A 1PEDA 4M21A 4LZOA 3JQ8B 3KJQA 3NR2A 4OJNA 3V4FA 3UBTA 1IHYA 3ZHUA 4UTRA 2YW9A 1Y4UA 3WG9A 2X9LA 5CBPA 3GARA 2BCJQ 4G1EB 1IBCA 2QTTA 2DUUA 4JEIA 1M6VA 4L73A 1JEDA 1KIFA 1TPYA 3C14C 5A4JA 3I2FA 4O2AB 2A9VA 4R8RA 5HF9A 1A4UA 2PXHA 4NNOA 4TS1A 3RIYA 2ZI6A 5CYOA 1D4ZA 3KHUA 3OX4A 2GFIA 4MQEA 3F9RA 4GOMD 4KB5A 2OFFA 3I58A 4ZVLA 2H06A 4DEYA 5CD1A 2FFRA 1SBYA 1YQDA 5ALUA 5J4YA 5EP4A 3WGJA 2CMGA 1Q3HA 2PRJA 2O8BA 2Y93A 3QBJA 3U3JA 1BMFA 1L5RA 4NRDA 2QX7A 4I1PA 3ORFA 2AFIA 4U2DA 5CM2Z 2ZWIA 3TR5A 2FETA 1FNNA 3NCHA 4JLKA 3UMSA 2Y0CA 3ZWDA 4ZYTA 1W581 4RKFA 2HA2A 3MMZA 4GLJA 5JPCA 3I52A 1Z25A 3JQAB 1XCPA 4PZ9A 1C1YA 1UAGA 2C4UA 5DHTA 4AWXA 5HGJA 3LUKA 5BW6B 1TVKB 3NH9A 3PEWA 3L7OA 5JD4A 1IWOA 5IARA 2D1YA 3UG7A 3DE6X 1EINA 4M1EA 1E8MA 3GFTA 4FCWA 4Y6RA 2CW5A 3NZEA 2X5JO 5CU7A 1NF3A 1PJCA 1SXIA 1P1KA 1DG9A 2BMDA 4UDYX 2C57A 2JD1A 5JHGB 2PMDA 4DCMA 2Q2NA 2Z08A 4WMLA 3RVKA 4POOA 3QBTA 4C21A 4FZJA 1EBUA 1CUZA 1SVNA 4IUDS 4B2PA 3GLHE 3BOSA 5C81A 4O3MA 4KN5A 3STHA 2BFCA 2O57A 1XPOA 1Q2UA 1IN5A 1ZY2A 1L4HA 1TJ3A 4L5IA 2JI7A 7ADHA 4TMZA 2YMQA 3O0DA 1CEYA 1H8ED 1TF2A 3HL0A 2D54A 3UJHA 2O6HA 3KEOA 3TMYA 3MJCA 3GH3A 3MWGA 4DUGA 2I1LA 2H6EA 3G0DA 2VYNA 1OWPA 1YDGA 4O2AF 1N0HA 1AGRA 3G89A 1KXJA 5HRAA 4KPGA 3CKYA 5E4TA 1A4RA 4N3BA 5LOVB 4J2OA 4TM8A 3AFNA 3KKEA 4BGUA 5KYXA 2Q5QA 1LWOA 4AS3A 5HUHA 2PCLA 1PT9A 3G0HA 1VIVA 5JT1A 1M7HA 4HNGA 4F9GA 5BV1A 1FNCA 4QBIA 1XVTA 2RSLA 2X9VA 4BXOB 5FNVA 4ZQBA 4A5SA 3M9LA 1LC3A 5C0OE 3WR5A 1YZHA 3IXLA 4YRCA 4FFWA 4NZMA 1HQKA 1PK7A 3CSUA 2QVGA 4ER6A 4A2PA 4JT9A 1D4OA 4DAOA 4LV6A 1SCDA 3IMFA 1WJGA 4I5IA 3RBXA 4OHCA 1WEKA 3BQ9A 3CH5A 3RLFA 2Q9AA 1YIAA 2BGLA 2I2FA 4FR5A 4EO7A 4QPZA 2FWNA 2GARA 2KHZA 3LK7A 4Z9YA 4WBNF 3G5AA 2G8LA 3JD0A 3MFQA 4QE3A 1WZEA 4NYMR 1Y1RA 4IHJA 3ND9A 4CKWA 4IIDA 4NR0A 1QYVA 1HOXA 3M5CA 4IH9A 2FZEA 3Q0TA 1RLTA 2P3SA 3HJTA 3ECSA 3EIFA 2QAGB 3MT9A 4XWGA 3D4OA 1ONBA 2JIMA 3UJ8A 3KSUA 1E3EA 2ZITA 4C7BA 5CEFA 5EESA 4L2IA 1LJ8A 1RRGA 1GG9A 2IXEA 3SS8A 4YMUA 7YASA 3VKGA 1EUZA 1J49A 1G2IA 1U65A 2J09A 2JGFA 3NANA 1XEAA 1NBAA 3B8EA 4DDMA 3QYPA 4U4AA 2QX4A 5EHZA 3TQCA 1DEXA 1M1YA 1VBFA 3L0CA 3FKSA 2D7CA 3ANTA 2DCUA 2PUWA 4RZUA 1KKMA 1XOIA 3N39C 4TLDA 3W4IA 5BN5A 4YJ2B 1W9HA 1YB2A 2E9SA 5D7NA 2QL9A 1R64A 4I19A 1U2TA 4AP6A 1WMEA 3B2NA 1IY1A 2X2OA 3O4HA 4W8HA 3K70D 2H1OA 2VHVA 3K8YA 3IV9A 3D4BA 3CW2A 2BMEA 2GPBA 4UZFA 5IULC 5I7EA 1P0MA 1Y3IA 2EYUA 2QZJA 3ET5A 5BXQC 1QRSA 1YL5A 3I6ZA 4M89A 5GJWC 4A23A 4TSFD 5M7EA 2CNWD 4MHTA 3H11B 4JYMA 4RTMA 4JROA 3KXIA 1VMAA 3PKJA 1GA1A 2X86A 1YHNA 2WV9A 2HBRA 3E9QA 1QGDA 3B78A 3BQNB 5L3QB 1ZW1A 2BOVA 3EB9A 1I1NA 1MO2A 2WMYA 1JJ7A 1LFAA 1QRRA 3LH5A 4JBHA 4H4CA 4N9WA 2QT1A 2VTVA 3DTTA 5LDGA 3W8FA 5KX5F 2E4UA 4ABTA 1YTUA 3RYCA 1O95A 5EPEA 2XWPA 3EZXA 3S5JA 3ZYZA 2V7UA 2XADA 1EYZA 5LXTA 3EWIA 4Q3LA 1CFZA