2ZSHA

Structural basis of gibberellin(ga3)-induced della recognition by the gibberellin receptor
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
338
structure length
338
Chain Sequence
EVNLIESRTVVPLNTWVLISNFKVAYNILRRPDGTFNRHLAEYLDRKVTANANPVDGVFSFDVLIDRRINLLSRVYRPAYADQEQPPSILDLEKPVDGDIVPVILFFHGGSFAHSSANSAIYDTLCRRLVGLCKCVVVSVNYRRAPENPYPCAYDDGWIALNWVNSRSWLKSKKDSKVHIFLAGDSSGGNIAHNVALRAGESGIDVLGNILLNPMFGGNERTESEKSLDGKYFVTVRDRDWYWKAFLPEGEDREHPACNPFSPRGKSLEGVSFPKSLVVVAGLDLIRDWQLAYAEGLKKAGQEVKLMHLEKATVGFYLLPNNNHFHNVMDEISAFVNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable gibberellin receptor GID1L1
publication title Gibberellin-induced DELLA recognition by the gibberellin receptor GID1
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hormone receptor
total genus 122
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2zshA00
2HA6A 4MWSA 5CH5A 1CEXA 4J03A 3AUKA 4F60A 3RK4A 4DMCA 1R4ZA 4G9EA 4BTVA 2HA7A 4QNNA 4HVTA 5EFZA 2QVBA 4UBOA 4BCBA 1XZIA 3LP5A 2ZSIA 3D59A 1X70A 3CN9A 1XZDA 2QM0A 2BAGA 1R9MA 4DNPA 4HAIA 3GA7A 3W9UA 2Y6VA 3H04A 1ZJ4A 3I2JA 3I6ZA 3PICA 4N8DA 1ZIXA 2ZJ7A 4UFOA 3IURA 3TGLA 2OLEA 3WWOA 3D4LA 5DYYA 4GLBA 3SX4A 2XUJA 2VJAA 2CEKA 4I19A 4FLEA 5ALMA 1FFBA 5ALHA 4V2IA 5AM5A 2IIVA 1EHYA 3FLEA 2HA2A 5AM2A 3K9BA 4M0EA 1HPLA 1LPAB 1DQZA 5A7HA 3OC0A 2PSFA 3BJMA 4RPCA 4KRYA 2XQKA 3IA2A 4TGLA 1CUZA 5ALEA 4NMWA 4UBMA 4BBZA 3EF3A 3D0KA 1XFDA 2VQ6A 3F8SA 3UUEA 4WFIA 3ZLUA 2WFMA 5HCUA 1CRLA 1QO7A 3PFCA 1QLWA 3EQ8A 4LYEA 1CUSA 5JZBA 3TEJA 2VTVA 1ZGCA 4UFNA 2HA5A 2XLCA 4OCZA 2YASA 4L3WA 2PL5A 2WTMA 4N5HX 5KBYA 4X00A 1ZI6A 4X92A 3DKKA 1NX9A 4BP8A 4QLOA 4C01A 4WDRA 1I6WA 4JEIA 2JBWA 1UK9A 5E4YA 1AZWA 1BCRA 3OURA 2WJ4A 1U4NA 4WY8A 2GBFA 1QOZA 2RI6A 3WK5A 3C6YA 3QPAA 3I28A 4BYMA 3M3DA 2HA0A 2H1IA 3H2KA 1XRRA 1ACJA 1MTZA 3FCYA 1EB9A 3H2GA 3I6MA 3G0BA 4UUQA 2XT0A 3C8HA 2IX9A 4AN1A 1F6WA 2OXEA 1X2BA 2GYVA 4EZIA 5EHQA 3LIIA 1H2WA 1XRNA 5EIHA 2OCIA 4OSEA 4FMPA 1YSCA 2ZSHA 3BJRA 1MAAA 1J2EA 2X8BA 3WMRA 3DQZA 5BV7A 1GXSA 2Y1KA 3SWWA 5ALDA 4DMFA 1AGYA 1UFOA 3H0CA 3OTQA 5A7FA 3E4DA 2QR5A 3HEAA 5CT5A 3QPDA 1UKAA 1VLQA 1BS9A 4S0XA 4KAJA 4BDTA 1AURA 3G9ZA 2VJBA 5ALLA 3AZPA 1TKRA 5AKJA 1XZKA 3I1IA 4AXBA 2HDWA 5CT6A 1W6RA 2XUKA 2GZRA 1N5RA 2VEOA 4LHEA 3Q8WA 4RE5A 4YX9A 3ANSA 5AI0A 1IUOA 2Z5GA 4PV7A 4BDSA 5D3ZA 2AJLI 3R0VA 1Y7IA 1R3DA 2J3QA 3T4UA 7YASA 4HRXA 1DWOA 5LP1A 1UWCA 3EQ7A 5BWBA 3WZLA 3W9BA 2ZJFA 5LZ8A 1Q83A 1Q0RA 2J4FA 3PUIA 2OCKA 3C8DA 5JZSA 3WWCA 5EI5A 4J0KA 4W1PA 1QIGA 5K3EA 1CQWA 5FPPA 3QYJA 3KWJA 4FHZA 4C4XA 1VKHA 3UMJA 4UBNA 1J07A 4PNZA 2QOEA 2VJCA 5ALRA 1KEZA 4P92A 5AKHA 3IULA 4BAZA 3BIWA 2WHPB 3AIMA 2JF0A 3DOHA 3WIBA 4BC1A 5K3DA 4C88A 2ES4A 1HL7A 1QIFA 5FPQA 1YASA 3PFBA 2WG2A 1K63A 3R3WA 3WLAA 4B81A 1L7AA 4U2CA 1J06A 3HC7A 5JAHA 4X95A 3WK6A 5C7YA 3I2HA 1ZD5A 2E3JA 5CT8A 1KU0A 4RNCA 4TPKA 5AM3A 4WJLA 1CUJA 4OU5A 4QWMA 3WKEA 4P08A 4ZV7A 1XZCA 3WIOA 4H7DA 3FSGD 3WKCA 3A2MA 5AKZA 3H17A 3HRHA 5IVHA 4PSDA 4QDOA 2WUDA 3VJKA 1XQYA 3K2IA 4FKBA 2WSLA 1W75A 4U2BA 3OM8A 4X97A 3LIPA 4XX1A 4UPDA 4H0CA 2H7CA 1QGED 4FLMA 1CUAA 2DSNA 3PE6A 5H3HA 2D5LA 1VXRA 1CUHA 3MGAA 4FBMA 3RKSA 3TRDA 2PPLA 2G4LA 1W76A 1WPXA 4QWWA 1THGA 3IUNA 5LIPA 4J0HA 3CCCA 1W52X 3FVTA 2ACEA 4E14A 3R41A 1H2ZA 1XZEA 4BC0A 2WIKA 1RP1A 4BVKA 2BJHA 6YASA 1LPPA 2H7XA 1EDBA 3DJYA 3G0IA 1ZD2P 3D2BA 3WJ1A 2XUIA 4UHEA 4KACA 2J4CA 4H7KA 1XZAA 4ITVA 1K8QA 1K4YA 4EUSA 5EHXA 1VA4A 3ICWA 4KE9A 5AIAA 4ROTA 4IH9A 4QDZA 4Y2YA 4ZI5A 5DTIA 4J0DA 5EIAA 3HJUA 2OCGA 3ED1A 3D2AA 2I03A 1QO9A 4L0CA 3FYUC 3N0TA 5LZ4A 4CFSA 1ZICA 4FTWA 1SCQA 2H7YA 2QMQA 5JARA 1PJAA 4X94A 1MO2A 5CMLA 2FUKA 2WIFA 3F67A 1UOQA 2K2QB 4ZREA 4J0CA 5HQ3A 2O2GA 2OG1A 4AO8A 4BVJA 5AP9A 2BUCA 1UK7A 1GQSA 3KDAA 4HXFB 1ZIYA 4YK7A 4CCYB 2OGZA 2WFLA 4M0FA 5AK4A 2ONCA 5FDFA 4K6GA 1E89A 1XKTA 1JI3A 2WTNA 3ZLTA 2ROQA 5HF8A 1A8QA 1QTRA 4G8DA 2WM2A 1JT2A 5AK6A 1GZ7A 2ZYSA 3I2GA 2GYUA 3DYVA 1JU4A 2CUTA 3STYA 3WWEA 1YAJA 2CB9A 3AZQA 2UZ0A 3DCNA 2YH2A 4YPVA 3WYDA 2XMDA 5FXMA 4ZWNA 3WK4A 4FDMA 1R50A 5IH7A 4H35A 1SC9A 5EIEA 4ETWA 3WA7A 4MJ3A 2BGRA 5ALNA 1CUFA 4X6YA 2XLBA 2WIJA 3C6XA 1UKCA 2PSDA 4CG3A 2C4HA 5FLKA 3BF8A 1QIHA 2G5TA 4NZZA 3DYIA 3HZOA 2FX5A 2PU7A 5D6OA 1LBSA 3GROA 4G1FA 2ZYHA 2G63A 1H23A 5IVDA 1WM1A 5D3KA 2O2IA 4GWLA 4GDMA 1Y7HA 4W1SA 4U2GA 5AO9A 5A62A 3F97A 1BCSA 2PM8A 5CRIA 4B6GA 4B80A 2DFPA 1C7IA 3G0CA 5CXUA 1XRQA 1FFDA 1EB8A 4PQEA 2C58A 2CMFA 2HU7A 4Y2UA 3DL7A 4UBKA 1XLWA 3BDVA 5HF5A 3ZLVA 1QJ4A 5AHXA 1WHSA 3GELA 4EA6A 5ALGA 5DYTA 2OPHA 4KEAA 3P2MA 2WHQA 3C43A 3AZOA 2VF2A 1M33A 1QZ3A 4EB0A 4W1QA 4Y2JA 4LKOA 5AOBA 1B6GA 3KSRA 4UHCA 5AI8A 4E46A 1FJ2A 3QMVA 2JEZA 2G5PA 3Q0TA 1EH5A 4X85A 2XE4A 5JAOA 4J0GA 1XZLA 1ZJ5A 2HA4A 3VVLA 2GYWA 2PX6A 4OPMA 4XIIA 5AM4A 3PUHA 3FLAA 4OB6A 2GZSA 2QKYA 2WU4A 1WB6A 5LKAA 4Y2PA 1O6FA 2NW6A 1JKMA 2OQIA 3FYUB 5CURA 5KWJA 3G0DA 2DHCA 4DMHA 1VXOA 5T4EA 3VISA 2PKYX 1Q0ZA 2XUAA 3ZI7A 4GBGA 1LLFA 3IIIA 1DWQA 4L72A 3I2FA 3L1JA 1MX1A 2PVSA 4OB7A 2PSJA 1XZHA 5AKIA 3OPMA 5DWDA 2BUBA 2C5GA 4WY5A 4K5QA 2WUFA 5FRDA 3O9MA 5K3FB 4Q3OA 3WYNA 1U65A 3EIOA 3QBJA 4Y2SA 1R1DA 4YASA 5AKYA 3STTA 4DMKA 3G8YA 4OYLA 1BU8A 4ARBA 5DYWA 5LZ5A 2WIDA 1VZ2A 3TJMA 1MX9A 5DJ5A 4BCDA 3CXUA 3X3HA 1W1IA 1OXMA 4EY5A 1THTA 1QTIA 1TK3A 3B3QA 1SFRA 3VJLA 1UT6A 1EVQA 1UOOA 3R3YA 2ACKA 1ISPA 3FWHA 1P0MA 5I7UA 3W06A 5T4FA 2RAUA 4BAGA 1MN6A 4P93A 3U1TA 4EY6A 4JNCA 5ALIA 1A88A 2WUGA 1QIMA 4DYHA 1MT3A 2XUHA 2XUGA 1XQVA 3R3VA 4PSCA 4WFKA 2HRRA 3AINA 1SCIA 3BXPA 3VDXA 1E5TA 3V1LA 1TRHA 4BZZA 2JGEA 3G02A 1GKLA 5IKXA 5A71A 1VJ5A 5JADA 4BVLA 3K6KA 2XQIA 3WK7A 5AJHA 1YAHA 2JEYA 5HKBA 5ESRA 1EXWA 4GEGA 4Q05A 1XLVA 2WLSA 1LGYA 2VAXA 3W05A 2DHDA 1KU6A 1DT3A 5C8ZA 4MEBA 1CUBA 2XQGA 1P0IA 3KWFA 4DLNA 1IZ8A 2QUBA 4G4GA 1GPLA 5ISMA 5FV4A 1R9NA 1BN7A 3C70A 2ZYRA 4XVCA 2WHRA 1QE3A 2PBLA 4LXIA 5ALWA 3VKFA 5CW2A 3AJAA 1E8NA 3CN7A 4Q1VA 5HK8A 3WL5A 1TCBA 4IO0A 3S2ZA 3G9XA 3G9UA 5JATA 1XZMA 3DLTA 2OAEA 1D07A 5IVKA 2C5FA 4HS9A 1CLEA 3HXKA 2I78A 2IITA 3HYSA 2HADA 5AKKA 4B84A 2VT6A 1LPOA 2V96A 2R11A 5AOCA 1LPBB 5HFAA 3ZPXA 3WZMA 3MUNA 4JYMA 1MJ5A 3D5EA 3JW8A 1AQLA 2WG0A 2JGKA 2V98A 3AILA 4Q82A 4N5IX 5AK5A 3H19A 4OU4A 3MUOA 3G7NA 4DTCA 1Z68A 3C45A 3WI7A 3QH4A 2XB6A 4JUIA 3W2TA 4BE9A 3GZJA 5LYYA 3NUZA 3DD5A 3RM3A 2OAGA 5K3AA 2D0DA 5ALQA 3QMWA 4QEKA 5I8PA 1N1MA 1LZLA 1G5FA 1CUXA 1E8DA 5JYCA 1U8EA 5CT4A 1UZAA 1BN6A 4DNOA 2XMGA 1ORVA 2BKLA 4J0IA 2I3ZA 3LS2A 5A2GA 3OOSA 2ECFA 5D7BA 2HM7A 3QMMA 4I3FA 2RGUA 4B82A 1JMKC 3WA6A 1TCAA 1VE6A 2HIHA 2DR0A 3VVMA 2RONA 3IBTA 4AMZA 1K6EA 3WKAA 1MNQA 2I3DA 2XMSA 4AO7A 1VE7A 5LZ7A 2WFLB 1ODSA 4OUKX 1CPYA 4RGYA 2HRQA 4G4IA 4ZRDA 3W04A 1WPRA 4DIUA 3DL4A 1C4XA 5CBKA 5DLPA 4Y2VA 2HL6A 2QTBA 5AI9A 3FBWA 4WFJA 5SYMA 5AKLA 3R3UA 5AKXA 1EK1A 2ZJ6A 2HA3A 2EDCA 2ZYIA 3H2JA 2QS9A 4PW0A 3H2HA 1TAHA 5IVIA 1E3QA 3A6ZA 3PF8A 3FVRA 4EY8A 4KE6A 4C4ZA 4HXEB 3IDAA 4C6HA 1YA4A 4D9JA 1RWQA 4Q3LA 2Z3WA 4UBJA 3DDUA 5C8XA 2W6CX 2OGSA 1ZGBA 4KYVA 4EHBA 5ALPA 4BB0A 5C8VA 1CR6A 1XZGA 1CUYA 5JZ9A 1UKBA 1CUEA 1TQHA 4BAUA 5BWCA 3DEAA 3H18A 4BP9A 1QIKA 5I9IA 2O2HA 1EI9A 1OCEA 1GPNA 1DTEA 3PI6A 5AH0A 3F9CA 1F0NA 5JASA 1WB4A 3ILSA 4Q34A 2PSEA 2RHTA 3D7RA 5E4JA 2Z8XA 4AX4A 1AKNA 2WG1A 3DNMA 5DNWA 4J3JA 1NU6A 4QA9A 3BDIA 3O4IA 3A70A 5DNUA 4QDTA 4QE3A 4RE6A 5CH8A 4UFPA 3IVMA 2HU5A 5J3JA 2VJDA 2AXEA 5HF6A 1FFCA 3ESAA 2Z3ZA 3YASA 1DT5A 4X93A 5ALSA 1NU8A 5AM0A 1CUWA 3EQ9A 4B9AA 1CQZA 1EDDA 2J3DA 2Y2VA 3HI4A 2O7VA 2XMQA 3CCBA 1YS1X 5EHZA 4MWTA 5F4ZA 1ZI8A 3F98A 4U2DA 3PF9A 1YA8A 4FNMA 1IZ7A 5CT9A 5ALFA 1O6GA 3BE8A 2QJRA 3WKBA 4TVKA 5JIBA 1YB6A 4AMYA 1CUCA 2LIPA 1GT6A 4GECA 4WCVA 4NVRA 1WB5A 2VT7A 4KJXA 3BWXA 4H7FA 1W4LA 1FFAA 1C7JA 1XZJA 1PV1A 4WDQA 5AI4A 1ZD4A 5T4BA 1CUUA 1LZKA 3SK0A 1SCKA 1CUVA 1UK8A 1L7QA 4AQDA 2VA9A 5SYNA 4MYDA 2CKMA 5AIBA 4PO3X 5K3CA 4HZGA 3I2IA 4CIAA 2R8BA 3WKDA 2B9VA 3D3NA 1QIDA 5ALOA 4AZ3A 5K3BA 3V1MA 1VZ3A 1UXOA 1ODTC 1JJIA 1R88A 1BEZA 1UK6A 3E1GA 2WKWA 2CBGA 1JFRA 4C4YA 1XZFA 3V48A 4FFVA 4JH0A 1GKKA 5FOQA 1P0PA 1CV2A 5ALXA 5JD4A 4A16A 3KOOA 3C6ZA 1H22A 1EX9A 1H2XA 1A8UA 3C6BA 2V97A 3G9TA 3V9AA 2WIGA 1TIBA 2PU5A 4UBLA 3ZV7A 1ODCA 3FLBA 2XUFA 3L1IA 1N8SA 3ANTA 1LBTA 2YXPX 4FFWA 1P0QA 4X71A 1LNSA 2GBCA 5BOVA 2DHEA 3WWPA 1QIJA 2BCEA 3C87A 4LIPD 2C7BA 1MNAA 4G5XA 5EHNA 4G8CA 5JALA 1LPMA 4Y9SA 3WK8A 2CJPA 4W9RA 1QONA 2WJ3A 1GPKA 4G8BA 4B7ZA 5ALYA 4BZWA 4KE8A 4MQMA 3I2KA 1XROA 4GXNA 3GUUA 2P8SA 1ORWA 3U0VA 1USWA 4MYSA 4J0JA 4INZA 2FJPA 2DCMA 1K5PA 3KXPA 1JJFA 2OQVA 1BROA 2WQZA 3I6YA 4B83A 3VJMA 5ALTA 4BCCA 3F96A 4B9EA 1ACLA 4HRYA 3NGMA 2GBGA 5T4HA 4L9AA 4FBLA 3DS8A 1RYYA 2HU8A 2C0QA 4E15A 4DM7A 2CZQA 1B41A 2V9ZA 1CUGA 1MX5A 2AJ8A 4UHFA 2X76A 3H2IA 2PSHA 2WU3A 3M81A 2VATA 4UBIA 3UUFA 1HKHA 4M0MA 4X90A 1DU4A 4X6UA 1TCCA 5ALJA 2O7RA 5ALUA 3B5EA 5FKJA 5HKAA 4OD0A 3ESDA 4W1RA 2Q0XA 5A7GA 4H77A 3RLIA 4UHDA 4F5ZA 1DQYA 1DX4A 4K2AA 3HLKA 2RHWA 3FYUA 1YCDA 4UHHA 4QDUA 3SC2A 1CVLA 2XI4A 3NWOA 1AX9A 4X3CA 1E8MA 3WL8A 3NOXA 1YS2X 1G4HA 4KE7A 5JAUA 1L7RA 5EGNA 3O9VA 5ALVA 2VSQA 1XLUA 3O4HA 3A2NA 2QXUA 1XZBA 1YB7A 3V1NA 3E0XA 3O4JA 1J1IA 3WL7A 5K3FA 4DSZA 4XJVA 2Y6UA 2WILA 4QZVA 5LKRA 1QIIA 4DNQA 1XRMA 1MAHA 3PDCA 4HTAA 4PSUA 1ZOIA 2XMZA 2B61A 1EVEA 5AI6A 2QRUA 3FOBA 4E11A 3QITA 3M82A 3ZWQA 4EBBA 1F8UA 2OGTA 1H2YA 1XRPA 1UOPA 3IUMA 3O0DA 3JYHA 4F0JA 4ZGBA 1EK2A 5KREA 5CH3A 4PF1A 2XQFA 4HXGA 2XDWA 4F21A 2JGJA 5AKGA 3A2LA 4A5SA 1G66A 3JWEA 4MXDA 3V1KA 5AI5A 3S8YA 5HZGA 3STXA 2JGLA 3M83A 4IH1A 5JD5A 3VXKA 4GI1A 2C0PA 3BIXA 4IQ4A 3AIKA 4BRZA 3IB3A 1EDEA 3WQHA 2JGIA 2EEPA 5DNVA 4C89A 3GFFA 1HQDA 3STUA 3FYTA 2Z8ZA 1WHTA 3I1YA 3LLCA 5E2IA 1XQWA 1DINA 2DQYA 4BTLA 2W22A 3WJ2A 5KWIA 4KAAA 1WOMA 2WFZA 3MVEA 2ZVDA 1GQRA 5HK9A 5FP0A 3B12A 2AJCA 5AM1A 3QZUA 3BL8A 4U2FA 4B0PA 1A8SA 3AFIA 4CCWA 4Y2TA 1BE0A 2H9YA 2AJDA 4CI9A 1Q84A 3O95A 4N8SA 3KD2A 5LZ2A 5AKEA 1HLGA 4CIBA 2WUEA 1CIJA 1WCYA 4Y2XA 1FSSA 2XMCA 4FOLA 2PUJA 1EA5A 4P9NA 4X6XA 5DTJA 3R40A 5FUMA 1FFEA 3E3AA 3G0GA 4QLAA 2XMBA 4BATA 4FLFA 1YR2A 4LXHA 2VAVA 3QVMA 2ORYA 1VOTA 3HABA 3FCXA 5HQ3B 2XUPA 3H1BA 4CG2A 2OCLA 5LZ9A 4EY4A 2WHPA 4O08A 4X7BA 3IUJA 2BGNA 3AIOA 3H1AA 1JJBA 3HSSA 1DWPA 4B0OA 5JANA 1ETHA 2QUAA 4H7HA 2PUHA 3IUQA 4KAFA 3LCRA 3O4GA 2Y2UA 4AZ0A 1N5MA 3OG9A 1CUIA 5JAPA 3QPCA 4IHAA 4Y7DA 1G42A 1XRLA 1E66A 3WK9A 2XMRA 3WWDA 5C81A 1IUPA 1JMYA 4KR0A 4H7JA 1XKLA 4Y2QA 4C87A 4BRSA 1QFSA 4ARAA 4GHWA 2FJ0A 1VA5A 3D2CA 1T4MA 1CUDA 2JGFA 2RIPA 1IVYA 4LXGA 1S8OA 1T2NA 4G4JA 2XUDA 3RARA 2XUOA 1BRTA 4N8EA 2AJBA 5ALZA 1IMJA 4FWBA 3R3ZA 1ZI9A 5CTAA 2JGMA 1IUNA 1JU3A 3EBLA 2BFNA 3N2ZB 4K6KA 1QFMA 4K6HA 4EY7A 1U2EA 1A7UA 2WJ6A 4OB8A 1PFQA 4X91A 1OILA 4UHBA 2XUQA 1F0PA 1XQXA 4AO6A 4IH4A 2HHAA 3WL6A 1ZD3A 1Y37A 3C5WP 3R3XA 5AK3A 4OYYA 4Y2RA 4AB1A 4DNFA 4CG1A 4XWGA 4MEAA 2X5XA 4DGQA 3GBSA 4G9GA 1LPSA 5HFNA 1AMNA 3L1HA 2QT9A 4GW3A 4NS4A 3FNBA 5AICA 5LLSA 1HBJA 1MU0A 5K5EA 1CFJA 2QJWA 4B85A 2QXTA 5A6VA 4AN0A 4W63A 2EDAA 3FAKA 3DOIA 4U2EA 4I4CA 5AOAA 2DQZA 4DSAA 4QDXA 3ICVA 2BUAA 4ZXFA 2YYSA 2HFKA 4H7EA 2XQJA 3T52A 3ESBA 1LPNA 3STWA 3C5VA 1SOMA 4LYDA 1AUOA 4H7IA 4KRXA 5HF9A 5YASA 4Z49A 2B4KA 2GBIA 2QZPA 1DX6A 4H18A 4ZV9A 4BE4A 4FNGA 2B20A 2HFJA 3BF7A 4J7AA 1EINA 3HACA 1AC5A 5E4TA 4MQLA 5CXXA 1MPXA 3FSGA 4Q3KA 3STVA 5JD6A 4CCYA 1BEEA 4JYPA 3DKRA 3QM1A 3ESCA 1HDEA 1QIEA 4A23A 2JIDA 1GGVA 1X2EA 5ALKA
chains in the Genus database with same CATH superfamily
2NO4A 2AC7A 4G8JA 4J94A 1WDLA 2HA6A 4IIDA 4UARA 3B1XA 5JCXA 2YWFA 1CEXA 1KJNA 4PLFA 3AUKA 4BFXA 1D0IA 4BMDA 4B3RB 4HPWA 3LX4A 4HWPA 5D87A 3RK4A 4R5HA 1AH2A 4AS3A 2YC2C 5DP1A 3LQYA 2Q07A 4D0RA 2HA7A 1ZKDA 2HT6A 4HDMB 2AEJA 1Z73A 3EXFA 5HIKA 2VXCA 4JEMA 4LJ6A 4RMGA 3N53A 4UM7A 3SC4A 1NE2A 4CEHB 4JODA 4FB4A 4XGNA 3I53A 3F4BA 2QVBA 4ZAYA 4G26A 5JPCA 3A6EA 3SHTA 1QRTA 3OQJA 2R62A 3HV0A 3QOYA 3RJ5A 3CN9A 3NV9A 4G1EB 4H1UA 4UEOA 5E4FA 4NENB 1Z56C 1R9MA 1P7CA 2LNDA 4ZQIA 3WNQA 1SB8A 4ABTA 4LJ9A 4NCAA 1OBHA 2HRCA 5HM8A 1A9XB 3GA7A 3NETA 2Y6VA 2HKIA 3H04A 3RBZA 2X40A 3T4XA 3EGEA 2ZE5A 4BMOB 1ZFNA 1LXCA 2FEXA 2GPWA 5BP7A 5KYWB 4N8DA 5JSUA 1FXUA 1OOEA 2R44A 4JWTA 4EI7A 4XQ0A 1R16A 4AUNA 3KCNA 4K81B 3TAXA 4TYYA 3E1KA 4PYMA 2Q3FA 4B87A 3L6CA 2PCLA 1H4QA 4LISA 5AVKA 5LJLA 2CCKA 3WSWA 2IUTA 2WF9A 4NYMQ 4RU1A 4ZOLA 3ZGLA 1TTPB 5K8VA 2D59A 2VKTA 1N7HA 2GCOB 1Y7LA 4EI2A 4I19A 1Q1GA 4QGGA 3A3OA 4JUBA 5ALHA 4YMVA 4V2IA 7GPBA 1VPEA 4EJFA 3GR6A 4MQFB 4ND1A 1BWRA 2M1ZA 3GDWA 3L92A 4HQNA 4QQKA 3THXA 1EDOA 1DXQA 3FLEA 1EHYA 1JI0A 4JASB 1JHDA 3OP1A 5BUQA 4YJHB 5D85A 3QIAA 4KXQA 5EJIA 1HPLA 1LPAB 2VK4A 3NV7A 1DQZA 2G72A 2VJMA 3GZTB 3I12A 4FD2A 4C0KA 4L8LA 2P6MA 3GEDA 2BR3A 4HEA6 5JSZB 4MO2A 4Q4JB 2ZFUA 1FRVA 3KEQA 1CF2O 1Z4JA 4J9UE 2ZRBA 2AOTA 3W2FA 4RZIA 1CUZA 4TGLA 1RYBA 3EVBA 1SEPA 3LGSA 1G16A 1GPMA 3AMVA 1V2HE 1JS1X 1VPWA 4UAUA 1PFKA 2D00A 3RVQA 4JLAA 4OKIA 1ULBA 1LRLA 5ENZA 2IPNA 2VTEA 4QNMA 3SZGA 3UUEA 2YXLA 3DKPA 1KEPA 1SA0B 4GI5A 3TLGB 1RRMA 3ZLUA 4URYR 4Q9DA 5IRCD 1QO7A 1M2GA 3C7KA 2RGYA 1GA4A 2KI5A 5LNK1 1J09A 2B92A 2F1HA 3LZDA 3FMFA 3PEUA 1HFEL 4EYGA 5K4HA 4YUVA 3U4QB 2IYAA 1N9GA 4TWAA 2BI4A 4JXKA 3T3MB 3FHLA 4OXIA 5E6UB 1ZGCA 2XIQA 4IQ0A 2GMWA 1JQDA 4LJ4A 2IS6A 2V6GA 4D0NA 2JFNA 4GKVA 4DR5B 1JFLA 1WRBA 2YINC 2XLCA 3T5TA 5B6PA 5EJ6A 2DPGA 3R0XA 5FBZA 1A5SB 1EWYA 3RYFB 5CX1A 5EUBA 4CPDA 1SHJA 1OFHA 4YXFA 3B13B 1M0SA 3GJRA 1Z36A 3FJ1A 4X7PA 3R7WA 3F6PA 4L4YA 2X9VA 4NV3A 2I87A 3UGJA 4LMRA 1Z6XA 1WD5A 3MT0A 1UP4A 1PDOA 1K08A 2LRHA 6GPBA 1P4AA 3SQNA 3THRA 3UAGA 2P5SA 3OD5A 3ONEA 4PC1A 4AYTA 3CVVA 3W2GA 1YHNA 2JBWA 5MN6A 4PXAA 4YR9A 1AZWA 2II6A 2IYUA 1YJAA 2HBRA 3O7WA 1C3EA 2QR3A 3UJCA 3V1UA 3FW1A 1BCRA 2Y3IA 4J1TA 4L7QA 4RLQA 2WJ4A 1V41E 1U4NA 5AUQA 4WY8A 3TXXA 2GBFA 1CNFA 2H2GA 2QUKA 4EMBA 2RSLA 2RI6A 2R8OA 3HKEA 4IHQA 3C6YA 3EBOA 1F5NA 4YN3A 1E0DA 1WB9A 3NBMA 3M3DA 4A27A 3IL2A 5T7BA 3BCSA 2OZPA 3DDNA 2YVAA 3TLKA 1TA4A 3H2KA 4MR8A 4QYIB 3D7MA 1AGPA 4EB3A 1M0TA 3KFXA 3NEJA 4UMEA 1RQPA 1ACJA 1GEGA 1I7LA 1M1NB 3AB7A 3FCYA 4EEXA 3U9LA 3WV4A 2ZE7A 4G5HA 3CH6A 4R4JA 121PA 1EB9A 2YWDA 2CJWA 4I9HA 2RHHA 4NK5A 3FCSB 5JFOA 3G0BA 3PUXA 5HRCA 4UUQA 1ZQ9A 3GLUA 2JJ2A 3OHPA 1EFKA 4HRVA 4WIAA 4C6SA 5FTLA 2XT0A 4KWHA 2GTIA 3I01M 2XPCA 3DDWA 2H92A 1ENYA 5J9FA 1HA3A 4QFCA 1SKBA 3HKBA 1FDTA 2EZ8A 4HNTA 4KREA 1ID8A 4KWTA 3ABQB 3AR3A 4GT1A 4US0R 4CNBA 3J80A 2QP9X 3INYA 1ZU4A 1HTTA 2E1RA 2OXEA 2XB2A 1W4RA 3RDPA 4Q7QA 2DVMA 3JWIA 3FDXA 1C8VB 3THYA 2OK8A 1H2WA 1XRNA 2WHXA 2H2IA 3TG8A 5LPNA 4NJEA 1YSCA 2FXVA 5SZKB 3ZV5A 1J9GA 2WA1A 2X0EA 5BV7A 5CU7A 4OIMA 2BZGA 1P2SA 3PPYA 2VO1A 1EGHA 2Y1KA 4P3OA 5ALDA 3A11A 4XKJA 3SWWA 1RC1A 2UXDB 4JITA 1MQ8B 1OUMA 4IIJF 3S68A 4TMXA 5L40A 3CSDA 4PIPA 3QFRA 1U4OA 4GS5A 1C0IA 2CSUA 1OC4A 1ZCJA 2C2BA 3DMNA 5L7WA 4LXYA 2FN3A 5CT5A 2XSZD 1I1NA 3PQ6A 1O4WA 3BXFA 1EFLA 1BWQA 2QEQA 1FB5A 4TTRA 4OLBA 4X44A 2MSCB 1SEVA 3HEMA 3PK0A 3B82A 5HFJA 3KJXA 1F8FA 3WYAA 4TWIA 2VJBA 4YHHB 3C6QA 4D3ZA 5ALLA 4AFNA 3I2YX 1NIPA 1WHTB 2NVUA 3AFGA 3PQDA 3R3SA 3F73A 1F9AA 5DXAA 3RRFA 2BMDA 2HJRA 4RDHA 1ISFA 1UEJA 2KWIA 3ZWMA 2D3WA 3R9IA 4EL5A 2D0OB 2H8KA 2G1AA 4JQOA 3U4DA 4I1IA 2H9IA 3EYWA 5HTKA 3EEOA 4BX2A 2XB8A 1H42A 1WV1A 4AW9A 2IBTA 1XZPA 5EXDA 3ADBA 1W1UA 4OOFA 1W44A 2GZRA 1REQB 2O2YA 4PYNA 1N5RA 1YJ5A 5CFZA 3AEUB 1JHQA 1AUVA 4LHEA 3EIFA 4ZT6A 3VRHA 1LJLA 5AVRA 4ZJYA 2G1KA 1DDGA 1CF4A 4ZPJA 3ZNPA 1ELOA 2REOA 4JJ8A 2C54A 3A25A 5FWYA 2NXCA 2Z5GA 1SHTX 4QJ5A 1N2BA 2FR1A 1P8JA 1T8RA 1PLJA 3BE6A 3ZWKA 1ABFA 4DL9A 4BFZA 1E4EA 1WUYA 5D3ZA 5FPYA 2GCPA 3R0VA 3CIFA 2YWXA 4RMHA 1RLTA 1ODKA 1YQEA 2O2DA 4F6LA 3NDBB 1M2NA 2CLKB 3IMFA 1URPA 3CR3C 2WWGA 1L7BA 1Y7IA 1R3DA 3DLHA 1WVGA 3NM5A 2W6JA 2FX3A 5FH9A 4C2UA 1H2HA 1S2NA 4RVOA 3ZOZA 1G5HA 1U0RA 4RGBA 5IDXA 3EQ7A 3WZLA 6NULA 5JFTA 3NB0A 4C7BA 4WXEA 5LA6F 2Q6KA 3EZYA 1M2VA 1Q83A 2GESA 2EBWA 1W47A 1G21A 2O3JA 3QWFA 4Y0VA 1BX1A 1JR3A 3PUIA 1QZXA 3C8DA 4XYLA 3F2VA 5BMVF 5IANA 5JZSA 3H4VA 3ROTA 1I3OA 3O21A 4W1PA 5JC8A 2X9LA 9MHTA 5F7OA 2ZRDA 3R7FA 4XVRA 1C3VA 1AXGA 3FUUA 2GPSA 4Y6QA 2NXNA 1WU7A 2OV3A 4RPGA 4DKXA 1DBVO 4A0HA 1WEKA 4QIHA 3QYJA 1ZINA 2J0VA 1V47A 3BXHA 4M89A 3CV3A 3H1PA 3JRNA 4Q02A 1HSZA 1SB9A 1ZMXA 2C00A 3LWZA 1MB2A 5BV8A 2NTNA 5ICSA 3P27A 3EPPA 3AM4A 5JLJA 1SXPA 3P9RA 3T7EA 1AXEA 3RVRA 1RT9A 4FGKA 4EX7A 1MGPA 3B7GA 1EWKA 1KEZA 4HNAA 3CLSC 3HBNA 4YJGA 4GQAA 4Z0HO 3ESZA 3EW9A 3GFSA 1YB4A 3LBFA 4KH0A 4EYKA 5BQ3A 3B6IA 3BIWA 5JAIA 2FQWA 3ND8A 3ZWXA 2HY7A 3JAWB 2E7ZA 3WIBA 4PZ9A 4BC1A 1OREA 2HSDA 2P4QA 3MMNA 5C9ZA 3A6JA 1JLLB 5K3DA 1PSDA 3VSDA 1I7SB 5B1DA 2OECA 4MUMA 4C0XA 3CGWA 2Q27A 4WK6A 4XUGB 5EJMA 4C88A 1XMOB 3SXUB 4Q12A 1VLHA 2D7JA 5A3SA 5K09A 1WCXA 3I30X 1QIFA 4P4NA 4RH1A 4JHLA 1UIMA 3PFBA 4DVJA 2ZETA 3TB6A 4CIVA 4BWFB 2O0MA 3B6KA 4EUFA 4YFYA 3WLAA 5TGTA 1Y8QB 1ZRNA 3OT1A 5FWNA 4EG0A 4P31A 1I2DA 4U2CA 3PKJA 4LDAA 4AZWA 5E6SA 2G4VA 2XZTA 3HC7A 4LW8A 4Z3KA 5K8TA 3B60A 4X1IB 3M2TA 1OBOA 5HUHA 1NR7A 3IPRA 1B15A 4FT4A 4TYPA 1E6LA 3GJQA 3AM3A 3I2HA 1KVUA 2C7VA 1BOOA 3KSUA 1GRCA 1ZD5A 4MWDA 3O4VA 2QRNA 4EW2A 4Z4EA 4HZUB 1L8AA 3AF5A 5IYZF 2YNMD 2CK3D 1JA1A 4IIUA 2J5BA 4BGDA 5EGSA 1O54A 4K9PA 3KKNA 4REMA 1FCJA 4FW9A 3RIEA 3SFVA 3QSYA 4RTPA 2H2FA 1H0SA 1U0TA 4H7DA 3N39C 1W0KD 3LVFO 3WIOA 1A2BA 2NWQA 3WKCA 4EPWA 2BEWA 3DPSA 3IDSA 5IBCA 3X0DA 2QL6A 1UH5A 1SD1A 3H17A 4MUNA 2C59A 3GJ8A 3OZWA 3M9LA 2ZRAA 4Y30A 1ESMA 3OU2A 2RBKA 1WU8A 5TE9A 1W35A 1C0PA 3W77A 1ZR2A 4KFCA 4HFNA 4PSDA 3HU2A 3I9V1 3LY7A 2WUDA 4I50F 4O5AA 4QOSA 4Y18A 4RGVA 2XE6A 3ZDEA 3OBBA 2XJ9A 3PNOA 3NNDA 4EW3A 4RA6B 1XMQB 3VJKA 3W1WA 3NFRA 2BFBB 4WCFC 5C35A 2QI9C 3P7MA 4QATA 2XHZA 3JU3A 4QAJA 4CL3A 2GZ2A 1A5TA 4URHA 2GQ0A 4RK5A 2ZM5A 3RASA 3COSA 5JCOA 2JPDA 2A94A 3QU4A 3U48A 2HJ9A 3BXXA 4D0GA 3PZBA 3FOFC 2P3QA 1ENPA 4XX1A 5C80A 4UPDA 3EEFA 4H0CA 2O3TA 2YUTA 4M0UA 1PFYA 1QGED 4IIFA 1O9HA 2OSVA 5CHYA 3VMMA 1UDAA 1M5RA 2AL7A 3G7UA 1HNZB 1E9BA 4M6WA 3EIUA 1PGNA 2QZ9A 1P9WA 2G40A 5A6SB 4C9BA 3NNSA 5GIPE 4MQ4A 1U0SY 2D5LA 4MS4B 3FTEA 5JMOA 4C14A 5ECWA 3E15A 3HTXA 2QD3A 2YWJA 1WSBA 2OMEA 3MGAA 1IBSA 3RKSA 3HXPA 2CDCA 3AY3A 3DMHA 3H05A 3NTLA 3X44A 2MOKA 4TV9A 2QWXA 4WZ6A 4AKIA 4E30A 4QWWA 1E6UA 2QJTA 3QF4B 1FYXA 1U1EA 4KGZA 1U3UA 3ZGOA 1ADBA 2FP4B 1OAOC 2H2AA 4WX2B 3UHOA 1X7XA 1G6KA 4LOIA 3THWA 1ZH6A 2FG6C 4QHTA 2IWRA 2ACEA 4HOYA 1RZ3A 5HIAA 2YVKA 5AUNB 1XDZA 4FXPA 5BNZA 3MJTA 1H0HA 4F4IA 4DLLA 4BC0A 2J5QA 3GEBA 4KWEA 3M6LA 1Z15A 3WQQA 3H75A 2BELA 2XE7A 1T9HA 2CHVA 2I4OA 2ONYA 3D8RA 4QJBA 4KMSA 3B3AA 3GOQA 5AJXA 1HORA 5H5JA 1EDBA 4NYIR 1N92A 3G0IA 1PWXA 1ZD2P 1T3SA 1TZCA 2P2CA 2X13A 2YIMA 3ETJA 3AKEA 3HUTA 1RXUA 2XUIA 1EGVB 3D0OA 4JCCA 4KSCA 1MJHA 4UHEA 1HI9A 1F8YA 3UGTA 3W2HA 4OMUA 3DA8A 3T3GA 2WF6A 1HYHA 3CCFA 4WY2A 3X43A 1E1LA 3EW7A 4P3PA 3V1YA 4H7KA 3JVVA 3QPBA 2HD4A 5KTYA 1K8QA 1P45A 2PD3A 2CMKA 3CX8A 2QB5A 1E5DA 1Y3DE 2WNSA 2CFSA 1FPQA 3KOZA 2R7KA 3RFTA 5F5XA 1KZ9A 4LWOA 3KEMA 1ZCFA 3O8DA 2P9EA 2ID7A 3A7EA 1U1GA 1V6CA 3PHBE 1K2WA 4LYJA 1ZAYA 1C1XA 4BNYA 4I14A 1XAIA 4F3KA 4DA7A 3T1NA 3NEAA 4LBYA 4ZI5A 3EXHA 3L4EA 3ZI4A 5MN4A 3KZMA 4Q3CA 4QT0A 2CYBA 4RKQA 3CGGA 3AOEC 4FSDA 1VFPA 5EIAA 5FJIA 3HJUA 3WJ7A 2BGIA 2V8OA 3V7NA 4U7GA 2I03A 1EUDB 3GCZA 2OO3A 5D86A 3FYUC 5DX0A 4C78A 1IK6A 1A95A 5LP6A 1FDSA 3HMQA 1T4DA 1Z6ZA 1PWEA 1UT5A 1XO1A 1CZUA 3CBQA 3DZHA 4I6EA 4R2WA 4CFSA 4FTWA 1J8FA 2BCJQ 3BFPA 2QMQA 3F8TA 3M49A 4RQUA 1P7ZA 5KKAA 5JARA 2Y8EA 1AD2A 1UXJA 1V1RB 1KJZA 3LLVA 2RKOA 4X94A 5FOXA 3WGOA 4D41A 1KH2A 1X38A 1T1RA 2J0UA 5CMLA 2GPAA 2A5YB 5HJ2A 3WMFA 2FUKA 1X0XA 2MSEB 2AWNA 5LBTA 2WIFA 3CLUD 4EGSA 3DWFA 2GJKA 3BORA 2JVJA 3H5IA 2Z8YM 4ZVPA 1HOXA 1QQ5A 1SG0A 2XCIA 2PKEA 3E23A 5FFMA 4AVYA 2PUCA 3AKYA 4DIDA 1PD1A 3NVDA 4CCAA 2O6LA 1RYNA 4MEJA 1L7MA 1X80A 1YULA 1T25A 2P0EA 5KNDD 3OFVA 4WCDA 4YJ3F 1RYHA 2GKOA 4AROA 4LJ7A 3EOZA 4HXFB 2DBYA 1W59A 4YK7A 2QZZA 2R84A 2OGZA 4CCYB 5J5AA 4NV0A 4PFSA 1RD4A 3DC7A 3QJ5A 4D6XA 5K99A 1AZLA 3EZLA 5AK4A 1OROA 1H3EA 1YGPA 2ASVA 2P7HA 4KQEA 4XSGA 1DBIA 1OWPA 4HH1A 4QU9A 1YV9A 4HNUA 2FFQA 4B5LA 3JVDA 3MCVA 1V7ZA 4K6GA 1E89A 1MA0A 1TU0A 1P7PA 1XKTA 2JAOA 2Z6VA 1C7RA 3LQ2A 1R10A 4Z0PA 5I9LA 3AL3A 3L1KA 2J6IA 3MT8A 1QNFA 1LTQA 4BMXA 3MJFA 1VHJA 1TQ6A 1T9GS 3D7SA 1D09A 1T9KA 4Z0TA 4G8DA 3IAM6 1Q2UA 4GVXA 4E6PA 1JT2A 1GZ7A 2P30A 3T7RA 3U7JA 2R8EA 1O89A 4ZANA 2O20A 1OU0A 1I0IA 2I80A 2IKQA 3DYVA 4RCZA 5E9AA 4CF5A 4KX5A 3OTOB 3STYA 1P1BA 2YHBA 4HDQB 3NP7A 2DY1A 1FTWA 3AZQA 2UZ0A 2OCPA 3I8OA 2JJ2D 4C0HA 2B5OA 2YH2A 3UJBA 2B9EA 1VM6A 3GD5A 1ISGA 1QGUA 1J23A 1Z0JA 3WYDA 2WM9B 3GNTA 1PGOA 1EUZA 4ESOA 3QQPA 4QBFA 1ZD1A 2FF7A 3TKAA 1IQRA 1G5QA 4PLVA 2HDOA 3HZRA 2NU8A 1EE1A 3ITKA 1R7RA 3Q7QA 4EGCB 1Z5WA 1KEEB 3LCJA 4ETWA 3EGVA 4YBZA 3PNBA 1YDHA 3A3NA 4GOJA 4UDNA 1GL6A 1ICIA 1JHZA 3GDHA 5FOVA 5HCNA 1JDPA 1IK4A 1F2UA 2WB4A 1N5LA 3UYKA 3IVRA 4CQMB 3U44A 1EQUA 1SQ0A 1KTVA 1RC0A 3JVUA 2C99A 3EPLA 1QHHB 1A3CA 3AM1A 2VH1A 3C7TA 3V97A 2E9SA 1Z45A 4JWKA 3PGMA 3ZHXA 3TIXB 5B7PA 2VPPA 2WIJA 3C6XA 3O90A 3UNXA 5D5QA 1UKCA 2NNWB 1HT1E 1KO4A 4OHXA 1H65A 3UKJA 1QIHA 3F49S 3RAPR 1ZG3A 4NZZA 4JEHA 3EGXA 4QGSA 3VA7A 1ETUA 4YP1A 4EFKA 1RHJA 4LDRA 1D8AA 2R2AA 5JW6A 4G1VA 3GLGA 2IHBA 1M1UA 1JE1A 1G5TA 2FPMA 2LBPA 3FSRA 4KIFA 3IUPA 4DMUB 1Z2DA 2FGKA 2GEBA 5FQOA 2HMWA 4UKDA 3OIWA 4X1YA 3JY6A 3MJEA 3PA8A 3L18A 5BUCA 1M8KA 1LBSA 1NN0A 2XCRB 1RI5A 4K05A 4PRZA 2ZDGA 3RRBA 3FPAA 2VLIA 1EVZA 2POQX 2G63A 3EQ6A 3PXDA 5F76A 4B46A 2XXBA 1LJ8A 2CHGA 3EGCA 2N0SA 2OSBA 4R81A 3TI7A 2B98A 3AQIA 4ZOQI 1H23A 1J2UA 1UBTS 4C4PA 2ZSEA 3Q3VA 2EERA 1UPCA 1G9SA 1SBIA 2O57A 5LB2A 2FETA 2V7GA 4U2GA 5AO9A 2FI1A 1U94A 4XLZA 4RDCA 3F2IA 3PEYA 3JQ9A 4F93B 2PM8A 1Z7EA 2C3YA 3KTAB 4HF7A 4QQFA 4ANFA 4B80A 1KDZA 2QTTA 3GLRA 1NXSA 3G0CA 1T3TA 3SF8A 3CLVA 1CEYA 2F67A 2GERA 3MM4A 1N25A 3NM4A 5CXUA 3NGXA 5JH7A 2MDTA 2OD9A 3PJEA 3PGLA 2BJVA 2A0UA 2VYND 1N2SA 1ZIOA 3B1YA 2NUTB 4E3ZA 3CE6A 3IX7A 4CTNA 1XPUA 3RO7A 2C3MA 1RXSA 3QEKA 1Y4AE 2QDXA 5AFSA 4HDRB 4EKDA 4WBNB 3RBAA 1GLVA 1CS4C 2WAXA 1L5RA 3C39A 2W6JD 5B6JA 4DCCA 2FUG6 3HU3A 2HH9A 3ZWVA 1G3QA 4OQEA 3VU3A 3COYA 3V4LA 3FPHA 3IDFA 3FZEA 3OA2A 3OZSA 4PR0A 5AHXA 2PE5A 2DETA 1WSAA 2IE8A 5KYVA 4OBWA 4OHCA 1L4EA 3GELA 4RELA 3PQ8A 5JWOA 4NESA 2NSDA 1JIKA 1FA9A 1V48A 2FJUA 2I4TA 3O73A 1JR3D 2QR2A 2ZSAA 2Z57A 4JFAA 5DYTA 5JSYA 2JCXA 3D7NA 2OPHA 4KEAA 5E8JA 5FTMA 1BQ4A 1GKYA 2HN9A 1LSSA 2VDWA 1BW9A 4JL5A 5CXQA 4EY8A 1ZLXA 3C43A 3U39A 4TSRA 3AZOA 1TM1E 4PZYA 3VSAA 2GN1A 4F1JA 4Z51A 1SU4A 1Z4KA 5JWRA 3KSBC 5A0VA 4MKXA 4Y0AA 4CTOA 3R09A 1MQAA 4NCKA 2K6GA 1ZR4A 3LL4A 2AYXA 4GMGA 3ZTYA 2HBYA 5IJ0A 4D4KA 2H48A 3SC3A 1WUTA 1TUBB 1DRKA 1YE8A 3ENNA 3R1IA 3G0HA 3VKHA 4PCUA 1BVRA 4CL8A 1EVKA 1Z74A 1Z5UA 1DKOA 1SURA 4PICA 2X4GA 4LKOA 1YZQA 3KSRA 2R4UA 4UHCA 1Z28A 1I1QB 3W4KA 2CXRA 2G0TA 3WVNA 1ZSVA 1G20E 4N0DA 2XTAA 3AJRA 1C50A 3CSSA 4DREA 3T3PB 1BG6A 1O96B 1FJ2A 4WQMA 1J5PA 4R9RA 3KALA 3CUEF 1N7IA 1KOFA 1NVMB 2DKNA 3Q0TA 4D80A 3CVJA 4MVJI 4RD3A 2XE4A 3AL2A 3HGMA 3LC1O 4M1KA 4RW0A 1JBKA 3TXYA 3VR2A 3OP4A 4J0GA 1ZJ5A 4ZTUB 1RVDA 3E4CA 3S7TA 3VVLA 1JDUA 2L19A 1CQIB 3MWDB 1U28C 2Q21A 2IYLD 3TW0A 4EATA 3VTAA 4QTXA 2PBRA 4JLDA 4OB6A 1HLPA 4UAGA 1XMJA 2QTGA 5DBEX 1J0BA 3KP1A 3Q72A 3AL0C 1G2QA 2E0IA 1FDUA 2PSSA 3K73O 1XN1A 4OM7A 1QS0B 3ZE0B 1O94C 3U7GA 3FPLA 2R8XA 4G4SP 3K0FA 4R98A 4BBPA 3E22B 3TX6A 4TV8B 4EF5A 4TZ6A 5FJJA 2E4XA 1KY2A 2GN6A 3VU9B 2R0QC 2B7CA 4IGIA 2HO5A 2JATA 3AHIA 3IMCA 4A8JA 2P41A 2LGJA 1FNSA 1HQYE 2OQIA 3MJDA 2J87A 4MV8A 4PPYA 4EB8A 2H4XA 4INPA 4ML3A 2J33A 3T7DA 1UBRS 4K9LA 4CKWA 4JQYA 2N75A 4V3BA 2GEKA 3WX0A 2DHCA 4HAOA 5TQ0B 1CB0A 2H54A 3WHLA 4RTRA 1VJCA 1KZYC 5TQJA 1VXOA 2I76A 5T4EA 1Q20A 3VISA 4HDKB 4D4LA 1EFVA 1RABA 4M8SA 5HXAA 2VHEA 2HUNA 3F5MA 2O8CB 1OHHD 3QE0A 2E85A 4RLSA 5JDCC 4GBGA 4JI3B 3SGLA 1U2QA 3VSCA 3WXBA 4YV2A 1WV0A 2C5LA 4GPD1 4UULA 4L72A 2C42A 3I2FA 1NVGA 1LWNA 2GCEA 2PVSA 4C7KA 4IVNA 2G80A 2H3HA 1KOJA 3ASUA 3WGTA 2ODAA 1CS0A 3FWYA 3INGA 1W96A 1QHIA 2PGOA 5BUZA 1U5BA 2VDMB 2B30A 3KYBA 4HX5A 1DHRA 4PYRA 2XVZA 4HX2A 4D7AA 3PLAE 5I6DA 3A6HA 2GJ4A 1GRVA 4G0ZA 5J4LA 3SHQA 2J30A 1KPIA 3HVIA 4TLBA 4G63A 1NVFA 4I99A 1Y4DE 1OX4B 4TKVA 5FRDA 5K3FB 1GHTA 2VS1A 1HQCA 1BXRA 5JYDA 4DEYA 3PFNA 2CJYA 1U65A 1N6RA 1VLMA 2FDXA 3FZYA 3OOWA 5DXFA 2Q5FA 5EL0A 3VH2A 2PGDA 2BYTA 4FI3F 1B2LA 4QO7A 3O8QB 4B6OA 1I4DD 5JBQA 1KA9H 3G79A 1NR5A 4MVJP 4NMLA 4YASA 5AKYA 4HMQA 2EBUA 1GVNB 4HJXA 4N0PA 4FDLA 3STTA 3UKDA 3DMDA 2NZWA 3RT9A 4MUYA 2FUCA 4R1OA 3N7AA 2XDQB 5E0KB 1JWBB 1BU8A 2WDPA 4OGKA 3QFHA 1VYTA 1C3XA 2VOEA 4CIXA 5K0ZA 1GQOA 4AX8A 5K0EA 3IQWA 4NZ9A 2QQGA 1A5AB 3H99A 1JEOA 1W6UA 4YRZA 4ZI2A 4ZQHA 3ZIUA 4AJKA 1KSFX 3PWSA 2UZ1B 4B43A 4MI1A 4C0AC 4KPEC 1G8GA 2ET6A 4L28A 2DHRA 3WGLA 1H2FA 1JKJA 5BOSB 1W1IA 1YBMA 2DFTA 2UZ3A 2ZSBA 3PBKA 3D4PA 4XQ9A 4BRUA 4D5EA 4HLQB 2I91A 1OXMA 1PO7A 3AC0A 4E33A 3KQNA 3RUHA 2X3YA 4A91A 2QN9A 3RAFC 5IU6A 2OAQ1 1PWHA 3TFOA 1EK6A 1QVVA 1TK3A 2P5TB 3PIRA 5DW0A 5E95A 3ZU2A 1S5PA 4MVJG 2QX8A 3HYNA 1I51A 3OCCA 3AJEA 1SELA 5BWOA 2O8NA 1XD2B 3A1UA 1TYAE 3OTHA 5DH9A 3P9XA 1Z0AA 5JS2A 2Z2KA 3C74A 4QHYA 1T1JA 3ZE1B 3AVOA 4I55A 4LEIA 3Q12A 4GXRA 4TTJA 5BNWA 3ER8A 1HRKA 5T4FA 4N5DA 3TRJA 5JQGA 1NJ5A 1YK0A 3ZY4A 1UM9A 1SM4A 2HCFA 4JJ4A 4EHAA 4CMCA 5A5GA 1XQ9A 5G0SA 1DJLA 3G5TA 5IZCC 1MFZA 5IAJA 1VMEA 1JEAA 4D3FA 4MI3A 2R6HA 3VH3A 4MYTA 4H6WA 2CLMB 1U6KA 1E3TA 1JLKA 1A88A 2VYFA 1TC1A 4I9GA 2C4NA 2VTBA 2A9OA 1ZESA 4JVMA 1LFAA 1G1AA 3NKLA 4B71A 2WOJA 4DRXA 1MT3A 1L0BA 2LR0A 3ADPA 2Z5FA 3F71A 3PCTA 2HWWA 4NR0A 4MGHA 1T9GR 4HADA 4WZBA 5FTNA 3SM3A 1QFYA 1K8XB 3R3VA 4RHXA 4PSCA 4X0EA 1U02A 2J0SA 2HRRA 1ZUNB 3BXPA 3GLKA 1ZHHA 3NALA 4FYIA 4HCJA 3U37A 3V1LA 2GPBA 2QUJA 5KAMA 3ZK9A 2KBFA 4BZZA 1QYIA 3NC4A 4NXMB 5BN5A 3DV2A 1G8KA 2DG2A 3PKIA 4DC1A 4QDJA 2FOXA 3TDMA 1OH5A 5BW4A 3D8SA 2I4IA 2JLAA 1QR6A 2RH9B 2YZKA 3BD8A 4LRSB 1C3OA 1THZA 2ATXA 3NTQA 3GT0A 4G67A 4IOKA 5GGYA 3KZ1E 1M6YA 4GQIA 5HKBA 4PYQA 1NBME 4PLTA 4DDMA 5BXYA 1LNQA 3SLRA 3EXG1 4NPHA 3H1EA 4EG8A 1T6ZA 2G09A 3L0YA 4IDOA 2WLSA 2OXRA 4BWVA 2J4DA 3E9EA 3UA4A 1GM5A 1OGJA 2VAXA 5CJ2A 2HSGA 3PFWO 1X1EA 2DTEA 3AR8A 3L6OO 1ORHA 4TTSA 4WLOA 4ZT3A 4IHKA 3MMZA 1KU6A 5IXSA 2VHTA 3FPBA 1DUIA 4C21A 3TLCA 1W73A 4OA8A 1CUBA 1T2FA 4MAMA 1P0IA 4KXMA 1W4CA 1CG6A 2P1RA 4DLNA 1GCOA 4ESVA 2BJWA 1IZ8A 4WESA 2XRZA 4FT2A 5ISMA 4ECEA 4Z2AA 1BN7A 1FVHA 3C70A 2ZYRA 1OU4A 3QXGA 3X2SA 4B6QA 4XVCA 2I99A 2YZNA 821PA 3EPJA 3GAZA 4PZAA 1FZTA 1QE3A 2GXSA 3RRJA 1XZNA 1RPZA 5IJ9A 1M1YB 1WVMA 4YJFB 4OK3A 5A2QA 2JIQA 1GLGA 3AEXA 1W0CA 4JSYA 4CMHA 4IJQA 1NYLA 4KNYA 2N42A 3D1LA 3DEZA 1J56A 3IAXA 4V3CA 3BX1A 5F73A 1C30A 2W6QA 1F9EA 4NARA 4YHBA 2JHPA 3DAPA 4ZCQA 2BDUA 1B0ZA 3G9UA 2D06A 2QM7A 5C46F 2LIVA 3DLTA 2X1HA 3KAPA 5ICFA 1D07A 2BMEA 3UWKA 3RC9A 1RU3A 1QZTA 3UAOA 1FUIA 1CY8A 2QPLA 4XYBA 4ZVNA 3T7IA 4YDSA 4HNQA 1OIVA 3HYSA 4HP8A 5E3JA 1L5VA 2DUMA 1OT3A 5TXGA 5FL7D 1CJVC 4M9RA 3TQTA 1L9XA 3GQBB 3P19A 4E5VA 1ZGJA 3T3DA 1VE3A 1YVEI 1QORA 2Q5LA 5AOCA 2WY2D 1G5PA 5HFAA 2JFYA 3ZPXA 3C3YA 3WZMA 3KQUA 4JYMA 4K3VA 3GVIA 4DIBA 2GB4A 1JX6A 3WADA 1XXLA 1XT6A 1QHXA 3AI1A 3R76A 4KITB 1PAUA 2IEYA 2WG0A 4WOPA 3FYSA 1C7ZA 2V98A 3AILA 3COZA 4OTZA 4QM6A 4AD8A 4KODA 1UAGA 3A27A 1X13A 4Z1OA 2IYQA 4FCVA 3ZGVA 3UK7A 3ZY6A 4KFUA 1EGAA 1SUIA 3GF4A 2F55A 1Z68A 5JEDA 4TQAA 1S4QA 3C45A 1WDMA 4IUDS 4QXMA 4LJLA 1FS5A 1NNI1 3QH4A 2ORVA 2QTVB 4LHVA 3KOYA 1NVXQ 1HTBA 3W2TA 1NMZA 3AETB 3S2IA 4L22A 1OLOA 2UZAA 4BE9A 1U7XA 5JV5A 1PD0A 2NZUG 3AEKA 1DEXA 4G24A 3DD5A 1SMKA 5HM6A 2VYCA 1IHDA 3V4RA 1C80A 2GF9A 3S4YA 5K3AA 2DH6A 4TLDA 3A10A 4PHFA 2F48A 2ZXFA 3TL3A 1H69A 5LNK6 3P5SA 1DEAA 2RD2A 5ALQA 4U9UA 3QEMA 3ZJ4A 3BMNA 1JQEA 1TL7C 2YBDA 4ZOAA 1N1MA 4UZEA 5LUAA 3BB3A 2C2HA 3COWA 1DQPA 3KNZA 3KM0A 3LBIA 4KUEA 3CX4A 4R54A 1I24A 1D5WA 4CVNA 3LUCA 1CT9A 1CZLA 1U8EA 1BN6A 3LOPA 4B40A 4FEAA 4B17A 4BX8A 4DNOA 4ZYYA 4JSRA 5KJ1A 1KO1A 1ADYA 1B8UA 3HB1A 4CDRA 5EEGA 5REQA 2GO1A 3II6X 2EWWA 4LYYA 4P5PA 4URUR 5A03A 5BQ5A 4TS4A 2VJQA 3TSYA 1TAQA 1P2UA 3VUFA 1M72A 3PC8C 1JVNA 4TLAA 2JLXA 1RXVA 3GFVA 2CBXA 2A33A 3QMMA 2Q8NA 2R7AA 3RV4A 4ZA2A 4I3FA 1TUIA 3FAZA 1V11A 4EY3A 1PW5A 4B82A 4RYDA 5F9MA 1TCAA 3FZGA 4FQ5A 4YMHA 1VE6A 4YRBA 2A0WA 3CRZA 5SICE 4BBJA 2I66A 1LX6A 1D3AA 2B3TA 4N7MA 1EWRA 4F3RA 1YRLA 3T3HA 1I6KA 3IBTA 4AMZA 1QJCA 2HRZA 3CF6R 4LDJA 1JAZA 2OUKA 1OH7A 2AT1A 4QBKA 4D8UA 2I3DA 2Y1OA 1V9SA 5DVZA 3CG4A 3CLSD 2B99A 5HZMA 1VE7A 1G19A 2WFLB 3Q0EA 4B2YA 4OREX 1SH7A 1YTLA 1DBWA 3AF4A 4F6RB 1Q95A 2G71A 4ZRDA 3WGIA 3T5BA 5AVQA 3KELA 1WPRA 3RQSA 1TU4A 5SZIA 4MLCA 4ZI7A 2YVLA 4TWJA 2FSUA 3UV3A 3LX5A 1GUAA 1HK7A 2H1VA 4QRDA 5DGXA 3GJYA 1ZVMA 2VHJA 4ZVLA 1SXJA 1Z5GA 1U1DA 1SBQA 2EHDA 3N2LA 1DC8A 1C5KA 3N2EA 1A2QA 4J4TA 3USES 1Y63A 2ZTMA 2I67A 1GPAA 3D6AA 4PS1A 1K3FA 2EG5A 2G0AA 2H5EA 4GOXA 5AI9A 4DUGA 1PZEA 5KPJA 4G0NA 1NF9A 1SOAA 4YA6A 2NZXA 1CZKA 5AKLA 1DL5A 2HK8A 5DHQA 4BKUA 5K01A 2YW9A 2FK8A 1E79A 2W4MA 4HLDA 5FOUA 3ZBQA 4DJDC 1VRVA 2CZGA 3QVOA 4RTSA 1EK1A 4OAPA 3B38A 3TSWA 3H2ZA 4BQRA 1M75A 1ZK4A 2WM8A 2WF8A 2HA3A 3AF3A 1LSJA 3KXIA 3VR2D 5KYYA 2ZYIA 4HYTA 4MKIA 4ZC1A 4DA8A 3E7XA 3H2JA 1R6VA 3JZFA 3L41A 3OEHA 3UWOA 3L4JA 2QS9A 3R24A 2NG1A 4KO2S 3ORFA 5EWJA 3I6BA 4GPEA 2JFFA 1AMUA 3ACCA 4HD8A 1DPFA 1PR2A 2Q28A 4PW0A 1D9XA 4WOJA 3T34A 4DLTA 1X7ZA 1J8MF 1XTIA 2QPOA 3GIWA 5D2CA 1Q21A 1TAHA 1K75A 2Q0SA 3OTWA 3V4VB 1IN1A 2NLOA 3N8DA 3BJIC 4C1NA 2AMFA 3A4MA 1FNDA 3FWNA 4MCHA 3I5AA 3QP9A 5KSOA 2XTJA 1XD8A 4BZPA 3ZV4A 1K5HA 1TT5A 3JQBA 3UOGA 4DM3A 3IDAA 4C6HA 1JIXA 2AXNA 3JASA 5C7LO 4PRLA 3R7AA 1YZUA 4BLTA 2DUWA 4CLHA 1H0KA 1NHGA 4NV1A 3MNFA 4QG7A 4DQVA 4HNVA 3EIQA 4DIEA 4UBJA 2EARA 3TKLA 3DDUA 1IEXA 2C88A 4EITA 3CJRA 2PIAA 4CF4A 3WLIA 1H05A 2W6CX 1FIUA 2G06A 2BW0A 3KYJB 5HRUA 2CVQA 1MR3F 1U2ZA 1ZGBA 2QX6A 3O8OA 4A7PA 2B4TO 4MIYA 3LC0A 3INTA 1UBGA 3DZKA 1FDWA 2GX6A 4G6ZA 1XZGA 2JGNA 4DLRA 4B6EA 4CM1A 3L7BA 5EIBC 3BWEA 4KZKA 4RSGA 4EW1A 4PAQA 5D7NA 1W85B 5ESWA 5IBQA 1ORRA 5BWCA 1L1EA 4DYVA 3PD1A 1K3UB 5ERGB 4YONB 2LKDA 5AMXA 1EUYA 1XB2A 4ZI3A 4BP9A 2QN3A 1KXZA 3PQCA 5I9IA 3ULKA 4B8YA 3ZWNA 3LHDA 2YUIA 1DCTA 2W2TA 1I01A 1GPNA 3HB7A 2ATVA 3TBHA 3BWMA 1W46A 1XDBA 3F9CA 5TEVA 3EA5A 2B5WA 3BH7A 1EG7A 4EGAA 4BQSA 3ILSA 1QYCA 5F9FA 4Q34A 3PJGA 4MV6A 4P38A 3NC0C 3EXFB 2IWHA 1GAJA 2D13A 3D7RA 3OCXA 5E4JA 2NGRA 1EBFA 1G6OA 2Z8XA 2P2LA 3T1QA 4AKEA 1Y98A 1B2RA 4MGYR 1JB9A 1C9YA 2W2LD 4MPJA 1XNQB 3T35A 1CJTC 3DNMA 4HFJA 3MILA 3QY0A 4OKSA 5DNWA 3F0TA 3TAHA 5KKNB 3HEBA 1NU6A 1TF5A 1I2ZA 3RUDA 1Q1AA 3O4IA 2ID9A 4WVLA 4RKEA 3AHDA 4HLCA 2YHIA 4N76A 4WN9B 4B4OA 4MUEA 3IVMA 2HU5A 2HYIC 3OC6A 4PYJA 5AVSA 2V4MA 2C29D 2Q45A 2VJDA 3HR8A 3TPZA 4X45A 2HK6A 4TYNA 2BEVA 5HF6A 4B2IA 1F3LA 3ESAA 4BNFA 3OH8A 5A5DA 4O33A 3HK2A 4N6GA 1P9RA 3YASA 2C5AA 2GK3A 1XFAA 3ZZ1A 2B83A 1DT5A 2B8WA 3O84A 5GIOE 4MJ7A 1A76A 4L07A 3RSSA 5AUOB 3S29A 3E18A 4LFCB 3DF7A 3VNUA 4XVUA 5IASA 4YO8A 5LUBA 2DUUA 1ABBA 4WK4B 2J3DA 5KNBH 2IDZA 4RYLA 1GP2A 2O7VA 2XMQA 1CY1A 3CCBA 4NP6A 1YS1X 2NP6A 4ZQGA 3U7RA 1YDFA 3CU5A 4DBVO 5EHZA 3F1LA 2B2CA 3ETHA 9LDTA 4KO4S 1ZI8A 4C2AA 4I9UA 2IZ5A 3PF9A 1YA8A 1MX3A 4U2DA 4NHEA 2RGXA 1XDWA 3LKDA 4WK0B 3VTFA 3TTWA 4ZQFA 1OSNA 1E2PA 3VO9A 1GGNA 5I3ZA 2VJMB 4JYAB 2AFVA 5TVGA 3ECSA 2P9JA 3PRJA 1SU7A 5TF4A 1T0HB 2REBA 1YR7A 1U0HC 2CJXA 4N03A 4B8WA 2QJRA 1TQ8A 4B2LA 1NZFA 2AOTB 4G0XA 5GJCA 4B5KA 1DAMA 3HDJA 3LYAA 3RK0A 3V1TC 1M6NA 4BO4A 2Z9CA 5EJ9A 2XHEA 1KHHA 1D0VA 2RKBA 3DL0A 1CUCA 4RM2A 3OX3A 4KHPB 4M8NE 3IVCA 1KMNA 3FZQA 4NDZA 1FSPA 3BWXA 3SYLA 1GV1A 4D6YA 3B1VA 1XU9A 4B4UA 2G36A 2I4LA 2K87A 3OQHA 3QTBA 5GY7A 4OMDA 2JKZA 5L4LA 1Y3AA 2H2HA 2YHSA 4YCDA 5EFOA 1T8SA 3TR5A 3W7AA 1DAGA 3RNLA 1G17A 1CUUA 3BCHA 2CMHA 4NAHA 4BNKA 1FMFA 1GVHA 2Z2JA 5GV7A 3DZ8A 3ZHZA 1ZOPA 3RWOA 3PUZA 5AJWA 1QHEA 1V39A 1H9AA 1CR1A 4L95C 5BN4B 4WBNF 5MN5A 3CR7A 1GITA 4QU0A 3LUFA 1IQPA 5CX1B 1XCGB 4IDGA 1JECA 2VA9A 1Y3CE 3L1UA 1NASA 2BMAA 1TA9A 1R0CA 4AQDA 1VDMA 2WR8A 2W2QA 4TKUA 3KZXA 3ZN2A 2CKMA 5HX7A 5KC9A 1DJNA 2VQEB 2VRCD 5AIBA 3U7QB 3L7LA 5DNCA 3AK4A 2OBLA 1ZK2A 4QXRA 5A05A 4EF4A 4CIAA 4CW7A 4QBIA 4RK6A 1D2AA 5IT9A 1OKKA 4MWCA 2B4YA 4DR3B 2DBRA 1B0AA 3MT7A 4X66B 2B9VA 1FMLA 4Y1RA 3D3NA 3Q2OA 3RSZA 2XBUA 1GQYA 4QGAA 4FP9A 2AR9A 1N33B 1G7TA 3BWVA 3TLMA 1ZU5A 4FPXA 2FWMX 2IU4A 4MJXA 2BKEA 3CUUA 3HDYA 1G0NA 1K8ZB 2QX7A 1UXOA 2XKBA 1NLFA 3O47A 3U19A 3HKEB 4YVFA 3EDQA 4NU8X 2I54A 2Z4RA 1SU8A 4BX3A 1E7RA 3K4QA 2DQ4A 4PLHA 2PLWA 1NBAA 1NW6A 4M1EA 4IVRA 4MR8B 4OK6A 3EPRA 1RKQA 3D3QA 1W2HA 3D64A 3AVUA 2DT5A 1D1TA 2RHLA 1SBHA 3S2SA 1Z4LA 4NOLA 3RBXA 1IRXA 5FOQA 3PJDA 3U6BA 1RRVA 5ANRB 4EO4A 5CX4A 1S96A 4KB5A 1L7XA 2W98A 3VGJA 4MS3B 3MSCA 4ND3A 1IXRC 3H2BA 1COZA 4C0BA 4Q39A 3GRAA 4RA9B 3KWLA 5H7XA 1E3EA 1J1ZA 5B1HA 2FKNA 3KOOA 2G1JA 4I7EA 2DM6A 3HKBB 4KXYA 1PV2A 3PQ2A 4D45A 2RJOA 2EYQA 3P96A 2J9YB 2DC1A 4P86A 4TTAA 1H2XA 5CFMA 3OPQA 2NUPA 3HPRA 5AHWA 4XUDA 3UHPA 2E6UX 3EDYA 5BSVA 1BDMA 2ODEA 4JQZA 3THYB 4UBLA 5AQEA 1RQ7A 2NXJA 3L1IA 4LX0A 1N8SA 5EMNA 4DXHA 2UZIR 1T5SA 2MMGA 2OV2A 3J7AC 1LBTA 2WPNA 3TVYA 1Z0FA 1UWVA 1WX1A 1PG5A 3JR7A 2ISCA 2GBCA 3UTCA 1JW9B 3ZDBA 4KK4A 4MZDA 1ZUIA 1ICEA 4RIHA 5BOVA 3WWPA 3LYLA 1T3LA 1TJYA 1K5DA 2LDXA 2WU8A 1CRWG 2BCEA 3ZKAA 3GGCA 1A7JA 1OX5A 1E3SA 1IJKA 5DSZA 3EAQA 3DLAA 4LIPD 1D04A 2D62A 3DO5A 3VU1A 3LQQA 1J24A 2C7BA 2O2SA 1MNAA 1E9CA 2P5YA 3KR0A 2ZYAA 5HS4A 3NDPA 4LN1A 4OQPA 1LPMA 4Y9SA 2P6PA 3WDKA 2CJPA 5IX8A 3SDSA 3ZCXA 4BWGA 1QONA 2WJ3A 4KKXB 1TZBA 1XWFA 1FXWF 3GLSA 4CM8A 1DFGA 1IATA 2JLVA 1XMXA 1TNDA 1T24A 4L76A 5ALYA 3UV7A 4B7ZA 5AESA 1A82A 2W6NA 5C1OA 5JYEA 1DAHA 1KC3A 4KOAA 1GPWB 3WICA 5CLLA 3E7DA 1GADO 3DMFA 4CM9A 2ENUA 1XROA 4MMXB 1U9ZA 3GUUA 4YDQA 3C5CA 2CXTA 2Q1YA 4LMBA 3AFHA 5AW6A 4RTLA 4KRFA 2BPOA 4NG4A 4J0JA 1L5ZA 2NYAA 5KYUA 2FJPA 2W71A 1B14A 2O3SA 2X0RA 2C8KA 2X4DA 1TAGA 1K5PA 5C1PA 4IPTA 2WVAA 3WFIA 1QZUA 1RMQA 2H2DA 1RPNA 1RYDA 3B5JA 2XZOA 2CBZA 2YY5A 1ZMTA 3B6MA 2R4QA 3IYLW 3R9XB 2R9VA 1VKOA 4BO5A 5C8YF 2ODTX 2BRUA 5EG5A 3NHZA 2DY0A 1EP9A 1E4EB 2IP2A 4G1BA 3PFHA 1Q0PA 1ACLA 1SKMA 2P2ZA 1L5OA 1N6NA 2DUJA 1V5GA 2O52A 3T15A 1HZZC 2J5XA 5KZMB 1Y6ZA 1RM3A 3B51X 4FYHA 1HMPA 1IBCA 1NBOA 2C1XA 4GMXA 4L9AA 5FLXA 1FFYA 3MRVA 3EA4A 4IICA 4LNUB 4R9SA 1CJSA 4RTOA 1O08A 5H9WA 1WDWB 2AXPA 5L4NA 1UCFA 2C9MA 4Z4QA 4WLFA 3WHKA 4NS1A 4ENRA 4JV5B 4RC9A 1T6BY 1XYVA 1TM5E 1M2VB 2HJSA 4LQLA 4PLCA 1LI5A 4XYEA 3S7ZA 4YJ2A 2CV2A 1CUGA 1IAVA 2I6FA 3HBAA 3UUGA 4YALA 1OAAA 1SBTA 5HHTA 2FEMA 4G0UA 3MTQA 3WLPA 1KORA 3H11A 4BOYA 4GUDA 1W581 1JP7A 5BUSA 2C4MA 3UUFA 1PHPA 2UAGA 2WC1A 3B53X 1MB4A 1E9RA 4D4JA 2FWAA 3KOMA 1A97A 3C14C 2Z6UA 4IVQA 5I48A 1K88A 2DLNA 4A2WA 4BMZA 1VSBA 3K1TA 1TCCA 2IJGX 4XAQA 1YO6A 1JVSA 1TEXA 2A5JA 4OQFA 5ALJA 2NPIA 4B3TB 3ZHVA 3WGUA 5ALUA 2V58A 1L7PA 3ANXA 4YRNA 1NRXA 3HR7A 5C34B 4AJJA 4WGFA 3DO6A 5JPIA 4OD0A 4ZVRA 1QQ7A 4HYQA 4YJGB 2XZDA 3ESDA 4W1RA 2JFWA 2O2JA 4F5ZA 2KE5A 1VE9A 3OOYA 3SR3A 1YT5A 4O8ZA 3WRWA 1SBZA 1DX4A 3E9QA 3G88A 1N4DA 2RHWA 3VZDA 1FC0A 1DARA 4BKOA 2PVPA 3OEHD 3U13A 4EG4A 3TBFA 2IEDA 1D03A 1R74A 3PR1A 3OIDA 4KIUA 2C2MA 2XI4A 3M0EA 3HJBA 1LRKA 4Z9XA 1VI5A 4R9UC 3RU9A 1NATA 1AX9A 1Z4MA 3NQ41 2HSEA 3HWSA 4IILA 1L7EA 4PY2A 4EHNA 3VO8A 2ATIA 3FFAA 4MNTA 3NOXA 2BI8A 1SCJA 1P3Y1 4MV5A 1RHKA 4P4UA 2JBAA 4Y1FA 3SR0A 1NLUA 5J4HA 3KYDA 5JSFA 3D3EA 3OT1B 4I3GA 1X7DA 3DBHB 4BGEA 4LDNA 4TT3A 4LF6B 3OEWA 2ZG6A 4IFIA 3GCXA 3GHYA 2PZGA 3O1JC 2FR8A 4FFBB 3O9VA 5EWMA 1G21E 2IK8A 5L51A 2VSQA 1BX0A 4ZVUA 3LPAA 1R0SA 4W4TA 5JE8A 4L02A 1O97C 1AF7A 3VV2A 4YB8A 5EZSA 4GMDA 1Z22A 2NV0A 2P4SA 3VHLB 4U1RA 2JIOA 3TKYA 2C9OA 2OHOA 4HWOA 5GJBA 3E0XA 3O4JA 3IP8A 3WJ1A 3OQ1A 4C7OB 4GLLA 5JXGA 1O3YA 1GRQA 4NECA 5CNIA 3UJ6A 3V42A 1H9BA 3WQSB 1OPXA 4F56A 4HLUC 4PTLA 3DCJA 5DT2A 1QOQB 3KC2A 2Y6UA 1GNPA 2BEWB 2WILA 4XJVA 4UC0A 4QZVA 3NJ8A 4OBXA 4D9KA 4TRNA 1XK7A 2X4IA 1MAHA 4WN3A 4PSUA 4UOEA 2HPHA 3KTDA 1PZFA 4QXPA 2Y27A 1NWCA 1NL3A 2R47A 3CX6A 3LX6A 1U98A 3H84A 1J5XA 1RJEA 1S89A 2CD9A 2HZ7A 4GKBA 4LPKA 3L84A 5JBIA 1FFGA 2JH9A 1OTYA 1VIAA 2FWRA 1F8UA 3KPUA 5EJ2A 4EBBA 1SUEA 3IEXA 1SU6A 2UYQA 5DCWA 1PSZA 3AVVA 1Z7WA 2GILA 4L15A 2EP8A 3KHKA 1UJ4A 5CVDA 3V8VA 1Z0ZA 3WQRA 2ZRJA 3GWGA 4DIFA 3QE2A 5AUPB 2VSYA 3LP6A 2X8JA 3NT2A 4F0JA 4JOQA 4JROA 3OX1A 1ZH0A 3P9CA 1UADA 4DN6A 4YYZA 1NM5C 4NU5A 5B3JC 2PO7A 2WMYA 4BLPA 1YR3A 3FTCA 1TD9A 3BA6A 2XDWA 4HXGA 5G2OA 2JGJA 2VHQA 4F21A 2X8LA 1HFWA 3O91A 1NI4A 5KNBA 4ZAGA 2FZWA 4M6WB 5AKGA 3A2LA 1E0KA 1G66A 1SZJG 3JWEA 3QBVA 4H16A 5D51S 3PFKA 4E1BA 4HN4B 1P1FA 4HTFA 1GGJA 2VBIA 1XWIA 1GDTA 3UHFA 5AI5A 1Y1QA 3ANNA 5ITZB 3EXIA 5LXTA 4E2FA 2OD2A 3DPIA 1DOZA 5AQ1A 4DAEA 1C29B 1NNSA 1QF9A 1SIBE 1SIOA 4MITA 1R0XA 3Q5EA 1I1OA 1XJQA 1W36C 1NBHA 1D2GA 1X7XB 1F4PA 4FSXA 1P5RA 2HLDA 2XVMA 1TQ4A 3WE7A 1XDGA 3THWB 1KAOA 3KG2A 3VAYA 4BRZA 1EDEA 1JTEA 1SIUA 2AD1A 5HKOA 4B2PA 3OD1A 1C4KA 1JHXA 1K8YB 3CB4A 5LVAA 2OZLA 1E3WA 4C89A 4YRRA 4XWAA 3GFFA 4RTNA 1HQDA 1GQFA 3ZGYA 3ZZTA 3TSOA 3FYTA 3G3EA 2YZ2A 4NCHA 4BVEA 2EFDB 2HRDA 2QD2A 3UCFA 2IOFA 3CTPA 4XFKA 1DRJA 2A2ZA 1XDSA 1JKXA 3IAFA 3TBKA 5IM4A 3UT5A 2JAXA 2JHFA 4BTLA 4NL4H 1DEHA 2W22A 2ON6A 4J43A 4HGYA 1X8XA 4BP3A 4YLGA 1WSDA 3PDIB 1DKMA 3L0PA 1EFTA 2F1KA 4R2JA 1X1AA 3MVEA 3TTVA 5FP0A 5IJAA 5BSUA 3LP8A 3I23A 2O3UA 4PO9A 4AQ7A 5TB5A 2W2OA 3MD0A 1N75A 2FQXA 3FVVA 3FXAA 2AJCA 3V5NA 3OPNA 5JPDA 4QUHA 1NW4A 3R6DA 2VJPA 3W3AD 1I2MA 2C9ZA 2GM5A 4B0PA 3ICQB 1A8SA 2IUEA 3HB9A 4QBHA 3HDQA 3EXHB 1BFUA 4Y2TA 5DCYA 4NCIA 2RHJA 5CVUA 4B09A 4KPFC 1GQQA 2BZSA 2ZIVB 4PYIA 1ISRA 1NX6A 2FPIB 3KD2A 3Q3CA 4N8SA 5AKEA 1F5SA 5A4FS 2OEPA 5AXAA 1WCYA 2VPXA 4Y2XA 1QTQA 2XMCA 5DWVA 4P22A 4EBFA 1RYMA 1SUDA 3PVZA 1RQNA 3A26A 4POAA 1YBAA 4PRKA 3B7PA 4X6XA 5EQTA 1H5UA 3CJTA 2W2NA 1MGOA 1CC1S 2VVTA 1WMFA 3GCDA 3G0GA 1KQNA 4AF6A 3HCOA 3LA8A 1J9ZA 2VYVA 4KR2A 4URZR 2OO5A 4O6VA 2XEDA 1WXEA 4G5FA 4B3BA 4PYLA 2K7ZA 3GDGA 3QX7A 4JU8A 2ZR9A 4FLFA 1YQTA 2BC9A 4NFSA 1OXXK 3TXAA 3QVMA 1M76A 2AMLA 3RGWS 5JISA 1AHPA 1BGVA 2B78A 1T9ZA 1JHVA 2E2WA 4IXMA 4KCGA 2RHDA 4DC9A 3KS9A 1A9QA 1X80B 3H9QA 3RVKA 1AKTA 3PHJA 4RF4A 5EJEA 2JD1A 1FTQA 3GGPA 4IDPA 3USZA 4CG2A 1OKKD 4J6EA 4M8LA 1RDFA 3MEQA 1PJRA 3WHIA 4MQEA 9ATCA 2JLYA 4EY4A 1KI1A 1M3SA 4DW8A 1U0LA 2NVWA 5KMGA 1C1YA 4K26A 2BVNA 4A82A 2QZJA 4JT2A 4D56A 3UV6A 3KBBA 4GP7A 5C37A 4DCVA 5B30A 1JSLA 3RKRA 1ML4A 4H1HA 2F9MA 4E94A 3C8MA 1NIJA 3KQSA 5EUMA 2XF2A 1ZCAA 3R0JA 3SOZA 4BNWA 2WP0A 5CYPA 1CERA 4QREA 2XITA 2RGRA 3FPEA 3ETCA 2ZSJA 1BU5A 3GLTA 3PUJA 1SWVA 3IBYA 4CQJA 1ETHA 3MJCA 2D0IA 4LV5B 3OE5A 5GJWC 5EZQA 1OBVA 1P6QA 3SSNA 4ICIA 2I7VA 1AKEA 1II8B 2Y4OA 3IUQA 4KAFA 1XI2A 2EFYA 4CLDA 5E2AA 3PEFA 3FPSA 2YWHA 2AH5A 1D9ZA 1VYHA 2GVDC 2IOYA 1W88B 3DH0A 4MV1A 2C98A 4EFMA 5AW3A 2VF4X 5ARCA 1YF3A 2XNKA 3DE3X 1QGUB 1SCAA 1CUIA 2J6CA 3C7CB 4BIMA 5FF9A 2PV0A 4HXYA 4ZD6A 3U5TA 1G42A 1KI8A 4C30A 3RH0A 2G04A 5DULA 1PIWA 2BHLA 5L3ZA 1EMDA 5JO9A 2NU8B 3RS7A 2IE0A 2XMRA 3PJRA 1KAGA 1PJ2A 3EXEA 4G97A 3WWDA 1A9PA 221PA 4OQNA 5C81A 1JMYA 1O6BA 1TMGE 5BO5A 1P1KA 4F45A 3VHRA 3TFWA 3G6WA 4LHSA 2JKYA 2N9UA 3L46A 1P2DA 3OQ6A 1N0HA 2FJ0A 3CZMA 3D2CA 5JCJA 3GJ3A 2BWJA 2JGFA 4HQLA 1FDVA 3AHGA 4K1LA 3FDZA 5ENVA 1D0SA 1IVYA 3ZNQA 2BHNA 4IW3B 3HVUA 4Z1MA 1S8OA 5AWFC 1C9KA 4G4JA 5J5CA 3BTVA 2XA2A 4S1PA 3O31A 1YU9A 1BRTA 1R6XA 4TWZA 4E7PA 4N8EA 4E0BA 3BWYA 1ZHOA 1MC8A 4KKVA 1F1BA 4LWZA 1TECE 3BERA 4MCAA 1BYIA 1ZI9A 2N1BA 3AI3A 2RI1A 3L7MA 3M6XA 1H1LA 5EP2A 5F1PA 5LBIA 1NUSA 2BFNA 3HO1A 2YN0A 4D8TA 1J42A 2XRMA 3DMRA 4MQBA 1QFMA 1NKSA 1JZSA 1DCFA 2MINB 2VR1A 3LLUA 4WEOA 2XT9A 2RAVA 1AN0A 2RG7A 3CLTD 4CMAA 3AVWA 1Z3CA 4K86A 3NRBA 5I5EA 2X1LA 2IBSA 1XVTA 5BV2P 4J1SA 4XSVA 3E2IA 1WMDA 1LBQA 1RVV1 3C6KA 1Q50A 2PUGA 3DL2A 3G49A 2A5GA 4Y67A 2J8ZA 1X7HA 4D81A 3NYWA 3HUFA 2HQRA 4CMIA 3PGVA 1ZQ1A 3FFXA 4CM9D 1JVBA 4R3UC 3EAGA 4HNRA 1RQRA 2Q0QA 5CIYA 1X92A 2X7JA 2YWCA 3D02A 2H85A 3LQFA 1BTOA 2F3RA 2ZXEA 2O2CA 1DG9A 1ZD3A 4Q9NA 5E7JA 4BLRA 5B3KA 3C5WP 3G68A 1ISIA 1NQUA 3R3XA 3SYMA 1TIPA 3WHPA 2Q6VA 3FPCA 5TPZA 1AJEA 4OLHA 2E49A 3SF8B 4K8RB 2I2CA 2LD4A 1E6KA 2J45A 2VPYA 5JH7B 1NOJA 3EZXA 5FUBA 1PT5A 4CG1A 3H6GA 4EVRA 1HY3A 1SCUA 2JJ1A 2IYFA 1Z63A 4P0TA 4KR3A 1VFNA 3VHQA 1NDUA 2PA0A 3SM9A 3LFUA 5JAMA 3PTAA 3IQEA 5HCIA 3ZDRA 3C3EA 4HB4A 1PR9A 5KOHA 1AMNA 2RCYA 1PR6A 4A5OA 2CVHA 4Q24A 2QT9A 1IPFA 5CAEB 1F48A 4NE2A 1YI0A 4NS4A 5E6RB 4A6XA 1WZUA 2HF8A 2XZPA 3FNBA 4RL6A 2O54A 4RFVA 1STOA 5LLSA 2A5DA 3ABIA 1R0BA 2QQ0A 4JHXA 4QRIA 4NHOA 4CKEA 3OEYA 2QJWA 4B85A 2QXTA 1ONSA 3LVRE 4H0NA 2XAUA 5FTJA 5F9HA 4G1MB 3KRTA 1BW9B 2ANBA 1QQ6A 5KNCH 5LM3A 2PVCA 1MIOA 2IF2A 3G5AA 2FPLA 5AOAA 3P9NA 3PC3A 1UMBA 3VZPA 4F2PA 5H82A 2B25A 3JSAA 2OORA 4X63A 3SLKA 2ZRPA 2CXOA 4U00A 4AY6A 3CH7A 3SVZA 3ZR4B 1NUUA 3VKVA 3HB5X 2BEJA 1CEEA 4PQYA 1BA3A 4EAAA 1RRPA 3WAKA 1AHHA 1LH0A 3F74A 4KDCA 1GAWA 1T5TA 2OZKA 1XMPA 3NIGB 3REFA 1UFRA 1SXHA 2QQ5A 2PK3A 3UAXA 1N78A 1VLZA 2OQ2A 1ZSNA 1VIDA 1Q0QA 2CWDA 4GI7A 4JGBA 3T52A 1U7DA 1UJCA 2KPOA 1FSFA 2HPZA 2XCLA 3SDZA 1PS0A 2QUHA 3C5VA 3STWA 4JA2A