5GY7A

X-ray structure of h243i mutant of udp-galactose 4-epimerase from e.coli:evidence for existence of open and closed active site during catalysis.
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
338
structure length
338
Chain Sequence
b'MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSSATVYGDQPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGIVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-glucose 4-epimerase
publication title X-Ray structure of H243I mutant of UDP-Galactose 4-epimerase from E.coli:evidence for existence of open and closed active site during catalysis.
rcsb
source organism Escherichia coli (strain k12)
molecule tags Isomerase
total genus 132
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2016-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5gy7A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 5gy7A02
2X22A 3PP8A 1HSZA 2JKVA 3GMDA 4CV2A 1BSVA 5CFZA 4XB1A 3C8MA 3QWFA 5F1PA 3TFOA 3G3EA 3KYCA 3FNFA 4TRJA 2FHSA 3FSRA 3NT4A 3H5AA 2AE2A 4DL9A 4WLUA 3TFQA 1K5HA 4BNLA 1NBOA 4RDHA 4PG8A 1EVJA 4AJEA 4WOJA 5T5QA 3BTOA 3DTYA 3JD0A 3IJPA 4IDDA 4JGBA 1R0SA 5CAEA 4XX0A 4F6CA 2VZ9A 3QQPA 1ZEMA 2GZ3A 2EKLA 3K73O 3B6ZA 3OSUA 3QIVA 1Y8RA 3WYEA 2ZATA 1P0CA 1ZH8A 1HETA 1X15A 1ENZA 2DTDA 3MJ4A 4BO2A 1DSSG 3WMXA 2EJVA 1YBVA 5AYVA 4ALLA 4ALIA 1KETA 4ZRNA 3S2FA 2BKAA 1R15A 2G1UA 1QKIA 1ULUA 2X5JO 1N1GA 1A4IA 3RJ9A 5KVCA 3DBRA 1GPDG 2VUSA 1LA2A 3C3XA 2I99A 3D0OA 1UR5A 2FR0A 2H63A 4OOFA 2OGUA 4D44A 1KERA 3RUCA 2JAHA 3JQEA 4MIOA 1DLIA 1A9ZA 5AXDA 1LQTA 3P2YA 2GERA 3GEMA 4YB8A 5JY6A 4O1MA 1UZLA 1E7WA 5DN9A 2NUAA 2C07A 4GI2A 1P45A 2E48A 3WTBA 4BO1A 1IPFA 2IRWA 2OXIA 3DZKA 4WCFB 2DUWA 3KZVA 1DFIA 3MJTA 4FFLA 3HN7A 3LSYA 1DIRA 3K8ZA 3E9NA 4UAGA 1OOEA 3EYWA 2X86A 4IIVA 4XWYA 2RAFA 1BXGB 4YJFB 4WCDA 5COBA 5AQ1A 4DQUA 2PD4A 2HK9A 2RH4A 2JCYA 3ZH2A 1QV6A 2PKQP 3BMCB 4BNYA 2JD2A 3VH1A 1SO8A 3NDRA 3KYCB 3QVWA 5I7VA 3RJ5A 1K89A 4ROSA 3ZI0A 2JD0A 4D7AA 4MVJH 1R66A 3WB9A 4I5DA 4KUHA 3PHGA 4FR5A 4WASA 5TJHA 2WDZA 1T4BA 2ZB3A 2ZK7A 2QHXA 1JKJA 3GGOA 3KSUA 4WLEA 5IF3A 1T2DA 1YQGA 3WGIA 3A1NA 3H8VA 4ESOA 1ENYA 2GUGA 4CLEA 4LSWA 3Q1LA 2Y93A 5L95A 4NFHA 3FF4A 5G0VA 4ZJUA 1NWCA 4K26A 1XU9A 1A4UA 2C5AA 2B37A 4LISA 5DCWA 2QX7A 1Y8RB 4HKTA 4NDNE 2B36A 1KEUA 3DHYA 3KHUA 3LU1A 3LC2O 4FOSA 3TNLA 5KVQA 1MXHA 3U09A 1Z45A 1T2FA 2I9PA 1YB1A 1M67A 3AWDA 3B20A 4M89A 1I3LA 1SOWA 3QP9A 1I10A 1GUZA 2EKQA 1V3VA 3PHIA 3DBRB 4J7XA 2FMUA 1VSVA 3VKVA 1BW9A 2IYPA 5KJCA 1U2DA 3U4HA 5TT0A 4R68A 4ZGWA 1O94A 1J49A 1S7CA 3KSDO 4IXTA 4DUPA 3DXFA 4AFNA 4M8SA 1P77A 3M1LA 4R3NA 4TRRA 3ZU3A 1WAMA 1IB6A 3W6ZA 4B3HA 5K9ZA 1BWSA 3ETGA 1E6EA 4FN4A 1QXSA 1GUFA 2PH3A 3RUIA 2AQ8A 3V8BA 5KVVA 3B70A 2O3TA 4NJOA 1U1IA 4Q3CA 4CMCA 2Q3EA 4EGFA 1J0XO 2YHUA 3GR6A 3I6QA 1ZXLA 3K6JA 4TKMA 5BSHA 3HZZA 4OO3A 3TZQA 3IDSA 3L4SO 4EEZA 2B69A 3VPXA 3PYMA 2IXAA 1MGOA 4I08A 3PLNA 4Y6SA 1NASA 4O0LA 4A27A 2HMVA 4IDFA 3IOYA 3TWOA 4QTZA 3RC2A 4GQAA 5B4UA 4IJUA 2BLLA 4XIJA 2ZKLA 3AM3A 2G17A 1YONA 5TS3A 1MG0A 2EF1A 1WZIA 1E5LA 1N7HA 3RASA 5KTKA 2O2SA 3KRTA 2VRBA 1O95A 3HB5X 5KCZA 1GD1O 2Y1DA 3K92A 2NU8A 1GZ3A 5T57A 3I6IA 4L4RA 4Z3KA 1FF9A 4O5OA 6LDHA 1UP4A 4OMUA 4Y8VA 1TA4A 4Q3BA 2WYVA 1PWXA 1E3LA 3IP3A 3KLMX 5AXCA 3WWYA 2DPHA 2HDHA 3VZQA 2Y0CA 3ICCA 2Q1UA 4NFSA 5CEFA 5I9LA 1NPDA 4WLFA 3BXXA 1B15A 1TB4A 2X0IA 4DRYA 2Q1SA 2FR8A 3D5QA 2BELA 1GL3A 2JHFA 4W7HA 2NTNA 3A14A 2B5WA 1PZEA 4FFRA 5A04A 3PJFA 4CM4A 4EBFA 2FSVA 1I33A 4TSKA 3DZBA 1BW9B 3ZW8A 5JDCA 3R6DA 5F5LA 3WS7A 1ZSVA 1AUPA 5HBRA 3CXRA 3PIDA 4E6PA 1PSDA 5IFLA 1UDAA 4KUGA 4XYGA 1DJQA 1WVGA 2DPGA 1RM3A 1I2CA 3DAGA 3QWAA 3A9WA 1XYGA 4BO9A 1OAAA 1TVEA 2RCYA 3QA9A 1XLTA 4Q9NA 5COQA 4CL8A 1H2BA 2PZKA 2J3IA 1PGQA 3L6EA 5I7EA 3QVOA 1F8GA 3A28A 3SVTA 3NGXA 3ZGYA 3GDFA 1J5PA 3CIFA 1ZXBA 2ZYGA 1OFGA 4XA8A 2JCXA 1Q1NA 3VTFA 3PZBA 5TJ9A 1VM6A 3H5RA 2OUIA 4IDAA 5JY1A 4DA9A 3NRCA 4RPLA 5JFOA 1L7EA 3PHHA 3GC6A 2OO5A 5LCXA 5G0SA 5IXSA 4ALKA 2GPTA 3CPSA 1ZW1A 1UZMA 4QQRA 4YT8A 3RUDA 3GG2A 3HSKA 3G1UA 4PRKA 2D4AA 4ZU3A 1C0IA 1JVBA 2ILTA 2WE8A 4PG5A 3V1UA 5CG2A 2CMDA 1KBZA 1NQAO 2XOXA 1IHYA 4LGVA 1BVUA 4RVHA 3VZRA 1U3VA 3UCFA 3W4KA 9LDTA 5TLSA 1RM0A 3KYBA 3TZCA 1KS9A 3U5TA 3HG7A 3Q9UA 1Z75A 4XQEA 1FXSA 1KC3A 1SCUA 3FN4A 1WP4A 1M6WA 1GU7A 1I01A 3QHAA 5KJEA 3JYOA 3E48A 3FRJA 3GDOA 4FGSA 4G81A 4I5FA 2HMTA 3ANMA 3NJ8A 3SJ7A 4E5MA 3NTQA 4OIMA 1YJQA 4YBZA 4YT4A 3GNTA 5JDIA 2RH8A 3G17A 4H3VA 1PJCA 3RKUA 3WIEA 2NM0A 1R12A 4AL4A 4L4XA 4GSLA 4CM4B 1F8FA 4H7PA 1N8KA 1LLDA 3C7CB 1QYXA 2B4QA 1X7GA 3GRPA 3ASVA 3HFSA 3ULKA 5DOZA 4FGWA 2Z5LA 2X9NA 1CDOA 4LRSB 1ZK2A 2O7SA 1NPTO 1H6BA 4INAA 3K2EA 3FNHA 4DREA 2Q2QA 4NBVA 3RSHA 1XWFA 1XELA 3AW9A 3U3XA 5DULA 5IAAA 4TZTA 2ZB7A 1EFLA 3E5MA 1PIWA 5H83A 5L4SA 3DFZA 2J3JA 4BNJA 1PGNA 3MOGA 2TMGA 2VYVA 4XYLA 5HTOA 1E1KA 1B3RA 3DMTC 1DLJA 3S2GA 1HDXA 4MPDA 3QE3A 1ONOA 3OJFA 4JBIA 3RBVA 2YJZA 5F1OA 4ZQGA 3ROKA 3AI1A 3CKYA 4DC1A 3ANLA 4Y98A 2UUOA 4CM9D 5IJZA 3OHSX 4BO0A 5BT9A 4BO5A 3P5SA 2BI8A 3H7AA 2IEDA 2YQ5A 3SLGA 4RJTA 2GYYA 4A03A 2O3JA 2XF8A 5IZCA 5A9RA 2DBZA 1B7GO 4BHTA 3DBLA 5L7WA 2YYYA 5EN4A 2OP0A 5L7YA 1NXQA 1JWAB 1YXMA 3MWDB 5DF1A 3PYLA 1IZ9A 4W6ZA 3DHNA 4O63O 3PI7A 3VVBA 3I1JA 2AEMA 4JK3A 3X2FA 1WMAA 1U4SA 5JO9A 3R3JA 4ITUA 1XSEA 1HEUA 4QFCA 4LW8A 3QV1A 3T4EA 4XRGA 3JCZA 4Q3AA 4PZEA 2QRKA 2H6EA 5FI5A 1YJ8A 3E18A 2A4KA 2X0RA 3IQDB 5I9NA 2P9CA 3ZV5A 4QXMA 2D2IA 1FDWA 3C1OA 4BO4A 1E6WA 2EJWA 1JAYA 2NACA 3BMNA 4FD3A 2EW8A 1UXJA 3RUHA 1XA0A 1RM5A 4GAEA 4JX8A 4BL5A 4BMVA 4RF4A 1EDZA 4PG7A 4WCFC 4P4GA 4FFMA 1GCUA 3FPLA 3NEPX 4E5KA 2P2SA 4KWIA 2IXBA 3JD3A 4CM3A 1NHGA 1KY5A 3JQ9C 3G79A 1GPJA 2YV1A 4XRRA 4DLLA 4EZBA 1DFGA 3M6IA 3UICA 1ZSYA 3GF4A 3IKTA 4DYDA 4PGFA 4UREA 4J0FA 1DIHA 3ASUA 4TRNA 1PL8A 4XIYA 4R51A 3L07A 2VWPA 4DBZA 1UXGA 1ZUD1 4HNHA 3VOSA 2QQ5A 3F1KA 4CMIA 2PH5A 1E7YA 1G0OA 3OQBA 3LC1O 4OM8A 1SEVA 3OETA 4HY3A 3UW3A 5K6AA 2ZB4A 4J7UA 1LU9A 3ZNPA 4OXNA 3WJ7A 3DC2A 4YAIA 1GQ2A 1ZBQA 3EMKA 3AUTA 4A7PA 2YHIA 1ZKMA 3LQFA 3PXXA 3JSAA 4L8VA 4BNMA 4JLWA 4MKZA 3Q3CA 3EZYA 3JQ6A 5BNTA 2GN4A 3NT2A 5DBFA 4A0SA 1NQTA 1D4FA 4ND4A 4BV8A 4E2WA 3KO8A 3DBLB 1TT7A 5DCYA 3UF0A 2VUUA 4IDGA 4B7XA 2JFHA 4CR8A 3H2ZA 4D42A 3C85A 2BRUA 2WTBA 2WSBA 3JQ8A 1W4ZA 5T8KA 1E3WA 5ICMA 3GT0A 1U9JA 1B0AA 5TRTA 4F45A 2NU7A 4QO8A 4QECA 4E4YA 2V6BA 4CPDA 4OYRA 2Q45A 1H2HA 4RL6A 1XCBA 1ZCJA 2Q50A 4BNIA 1Q7CA 4JNKA 3UGKA 1PJLA 1SPXA 2Z1MA 4P4LA 1HDGO 4FDAA 3IL2A 1FDSA 2P4QA 2GD1O 3WLFA 2VT2A 3GUYA 3NTOA 4QEDA 4ND1A 1NR7A 4FS3A 2GGSA 2ZYAA 4MINA 2DLDA 3BMNB 3JTMA 4J0EA 3IIEA 2W4QA 2BFAA 1LI4A 2UAGA 5F21A 1VKNA 3MEQA 3DL2A 4BGEA 3IC5A 5ITVA 3ZNQA 1GEGA 1BRMA 1DRWA 3RD5A 4XYMA 3GOHA 2QRLA 1DIGA 1ZK1A 3ZHXA 2HMUA 4IMPA 1BXZA 3PGXA 4ND5A 2HJSA 4FC6A 2FSSA 1GEEA 4AJ1A 2PNFA 5T67A 4IMRA 2C7GA 3L4BA 5JMWA 4YWJA 1GCOA 1K6XA 3PWKA 4F6LA 2IZ0A 1LC0A 3GGGA 4UUPA 5DDIP 1GZ6A 4Y9DA 1X0XA 4EITA 1U7HA 2E49A 2VOJA 2YUTA 2YV3A 4CMIB 4CR7A 1GDHA 2RHCA 4J1TA 5JAQA 1ZFNA 2FR1A 3E5RA 4BGIA 4BIIA 1N7GA 3PHLA 4WECA 1EBFA 1KVUA 1YDEA 3H4VA 2XXBA 1E1NA 1EUZA 4RPJA 1ULSA 5U4QA 2YHIB 3QLJA 1PJ3A 4GGOA 4I1IA 4XJTA 3QVTA 4TROA 2D0IA 2Q46A 2P9GA 4R3WA 4RV9A 3TZ6A 5J23A 3QWIA 4B79A 1HDOA 3EVTA 4EUHA 4ZQEA 1CIVA 3B1FA 1VLLA 1MFPA 4U5QA 1UDBA 3WGQA 4B3IA 4NK4A 1V0JA 4XGIA 4IQGA 2O3QA 4L9RA 3JQ8B 3R3SA 1E3WB 3WNVA 4S3MA 1NVGA 4U0KA 3JQDA 4LMPA 5B1YA 3ZWNA 1P1HA 1E3JA 2Q1TA 4J7CA 4ZD6A 1N5DA 1Y6JA 4AJIA 3RVDA 1DBVO 4TMFA 4AJLA 1U7TA 3HADA 4GWKA 5G4KA 4CMJA 1HLPA 4G2NA 4JP3A 1W6UA 3PHJA 5COAA 1NPYA 4E32A 3MOIA 4OQZA 4CV3A 3ITDA 3LK7A 4IBOA 4OAQA 4K6CA 4DMLA 2E4AA 4H16A 3AM5A 3W8DA 4YDRA 1RKXA 4N5MA 3F6YA 3I23A 4DQXA 5MDHA 1BHSA 1GY8A 3BMCA 4MVJF 1LDGA 2HKIA 3AOEA 5DOVA 3W8EA 5CDUA 1Z74A 2B0JA 3WOHA 4XEHA 3AM4A 1HWYA 4G65A 4IGFA 1A9YA 1HZJA 4IY1A 1KVTA 4R4JA 3ZHBA 2QZZA 4QUKA 4E2XA 2VHXA 5HWSA 3WLEA 2IEBA 3P19A 3WGZA 4FBGA 2NVUB 4BMNA 1BTOA 2DKNA 4RF2A 3GRKA 2Z1NA 4KZPA 2F1KA 4YR9A 4IINA 3WDSA 4Q39A 4DYVA 1EDOA 2GLXA 3DO5A 3PTZA 4B4OA 1YRLA 4L76A 5A03A 1GFSA 1X1TA 3EC7A 1ONNA 3OF2A 1JA9A 2R00C 4R1SA 5AXBA 3DBHA 2QW8A 2PLAA 3QVSA 5DP1A 2HJRA 3GGPA 4A73A 4MVJM 4N7RA 1YL5A 2I66A 3I9MA 4BO8A 3LT2A 5HS4A 2HCTA 2HRBA 2VHZA 3KXDA 4GGPA 1M75A 4FCCA 4IGEA 5KOIA 2BMAA 2JJYA 3W8FA 1A7KA 1BDMA 1PJTA 4W7IA 5T64A 2O4CA 3RBXA 2EGGA 5EQDA 3UH1A 2H9IA 1YDWA 2V6MA 3TSCA 1PR9A 4AJJA 1BGVA 3H9JA 4DLBA 1ZO8A 1EQUA 4RVUA 4NMHA 5TT1A 5ADHA 1KVRA 3I9KA 3RWBA 1NP3A 4NZ9A 4HXYA 1EK6A 5JDCC 3BMQA 1VJ1A 3PDJA 1OI7A 1QR6A 3F4BA 5G4KB 3A4VA 3GEGA 5KNLA 4XZ3A 2D8AA 3UCXA 1ISIA 3NGLA 3OH8A 1O9BA 4UVHA 4GX5A 3EHEA 4BNZA 1GV1A 1EVIA 5CDGA 1GZ4A 5JLAA 2PV7A 1D1SA 2HK7A 1ID1A 3ZV6A 2V6FA 1R4MA 1KY4A 1ISHA 3D1LA 7ADHA 1J4AA 3BTSA 5JAZA 1T4DA 4GLLA 2H1SA 1Y5RA 2VYNA 1XDWA 5G0TA 3L9XA 4Z0HO 3WYCA 2ZTLA 3L77A 5GMOA 2Y1CA 3DBVO 5FFFA 3ZV3A 3FCOA 2QYSA 3RAJA 2BFPA 5DBIA 1DAPA 4QFDA 1Y7TA 4IQ0A 1TEHA 4YAGA 3MZ0A 4KQXA 1QYDA 4DIBA 1JKIA 3WFJA 5A1TA 5CEJA 5KVSA 2NV6A 4NU5A 2V7PA 1LLUA 5JS6A 1WLYA 1H5QA 4R69A 3WGTA 2I3AA 2NSDA 4IDBA 3N7UA 1HYEA 3AI3A 4GKBA 4II2A 5KJFA 1TI7A 1YBMA 4J9UE 4UVDA 3ZN2A 4LCJA 2FWMX 3DBHB 3ROPA 1DXYA 1GV0A 2B35A 1PQPA 4PVDA 3EY4A 2VTDA 1RYDA 3TL3A 1UP6A 2OZPA 4RPGA 1C0PA 4J91A 4MOWA 3D7LA 1PWZA 4U6SA 1TLTA 3PJGA 4YJDA 4CODB 4IJKA 5C7LO 1U4OA 4WK6A 1LLCA 1DJNA 4E33A 2CUKA 3KUXA 5FEUA 4NFYA 3V1TC 1GTMA 4I9UA 2BI7A 4JBHA 5IDXA 1V8BA 3WGOA 3M2PA 2W2LA 3CZMA 4E5NA 2DTEA 2HRZA 3WGHA 5JDIC 1QYCA 1KOLA 3EUWA 1I30A 4U0JA 5ICSA 1ML3A 3FNGA 3WGGA 3PFWO 2YY7A 2G5CA 3G0OA 3BMQB 1E7RA 3AJRA 4YYZA 4CMEA 4JQCA 4UEKA 4DXHA 2YDXA 1CETA 3L6DA 3NJ4A 2VWHA 4FC7A 2PGJA 2VNSA 4YRDA 2UYYA 2C29D 3RU7A 2JFGA 5BSFA 3NTRA 3OEWA 4NHEA 1AGNA 1ZIDA 4R9RA 4DWVA 1R4MB 1YH3A 5B4VA 3JYQA 5K0ZA 1DDOA 1MP0A 4RO0A 5GY7A 1XG5A 5LDGA 3S2EA 1P1JA 4HV4A 4HX5A 4CV1A 2CVOA 1KEPA 1YKFA 4GWGA 4PVCA 4XGNA 3H9UA 2VZ8A 1HDRA 4H15A 4OSOA 5B4TA 2VN8A 1I32A 4EI2A 5DCUA 1NNUA 3GY0A 2EWMA 3OJ0A 3UUWA 1PL6A 1UUFA 2EHDA 2VT3A 2OBYA 4XKJA 3ITKA 4M49A 3MWEB 2ZJ1A 1FJHA 3QW2A 3HWRA 4L74A 4M54A 1HYGA 4D41A 3GZ4A 1YS4A 3V2UA 4UVIA 2PZLA 4XR4A 3ZWOA 3ROQA 2UDPA 4MVJI 1U3TA 1B26A 1J6UA 2NVBA 3DQPA 3ETDA 3LF2A 5CP8A 5A9SA 3VH4A 4AVYA 3JQAA 3BIOA 5C5IA 2FN7A 2DFVA 4ID9A 2DAPA 1PJSA 4E2ZA 5H82A 3WXBA 1C3VA 4R01A 1HLDA 2NNLD 4R1UA 2GZ1A 3JQCA 3RC1A 1D7OA 4OJNA 2OP1A 3VPSA 4BNKA 1PEDA 4R16A 4BGUA 4XQGA 4RVFA 4JROA 4UUOA 1EEHA 5IN5A 3TOZA 3VTZA 4E12A 4FPXA 4W9NA 5DBGA 4YXFA 4E30A 3N58A 2VCYA 4PIVA 3UOGA 1JU9A 4OQYA 2DBRA 2HMSA 3KYDA 2WD8A 2JD1A 2I3GA 1AHIA 4C7KA 3SXPA 1MA0A 3GAZA 5I8ZA 2DUUA 3V2GA 2YDYA 1IPEA 2YQ4A 1EBUA 1HYHA 3D64A 4OOEA 2IZZA 2RIRA 3ROMA 4WLVA 5F3RA 1KVSA 1X13A 4Z9FA 1O5IA 4BNGA 2DC1A 3B1KA 4L75A 1LDNA 1PJQA 1QYWA 3PIIA 3SC4A 3EZLA 3OBBA 2X58A 5DP2A 3RUEA 2GN8A 1ZVMA 1E1LA 1H93A 1Z6ZA 4Y6PA 2X5OA 1DAOA 4RCVA 3UXYA 1NVMB 1MC5A 4PLZA 4EDFA 3FNEA 5A05A 4HFJA 3WTCA 1VC2A 1XKQA 4IQ8A 4N5LA 5G2OA 3G49A 3CTMA 5EESA 3EVNA 3U0BA 1DIAA 4WGGA 2LDBA 4BO3A 4P22A 1Y8QA 2VRCA 2IODA 3L6OO 4YQYA 4JP2A 5T6BA 4ALNA 5JBIA 3M1AA 4RVGA 5CDYA 3O8QA 1FMCA 5TX7A 3VPFA 1ISMA 3KV3O 3ZWVA 3AFNA 1CQJA 5A4DA 5EMHA 1XEAA 4D0SA 2QZ9A 3HN2A 4RVDA 1UXHA 2C5EA 1I2BA 1TXGA 3WFIA 3ETEA 2PGDA 5F1KA 1JDJA 2BH9A 3NV9A 3OMLA 2Y66A 3SBOA 3GDGA 1MX3A 3QSGA 3RFVA 1H6DA 1PJ2A 2W8ZA 3PZRA 3E03A 5A9SB 1D3AA 3JQAB 3RI3A 3VH2A 4P8RA 1I0ZA 1A7AA 4OGWA 4E5PA 3H3FA 5FWNA 1CERA 4RPHA 1EUDA 4R1TA 2NQTA 2O3RA 2GASA 3F4LA 5FYDA 5GZ3A 4WEOA 3DZIA 3GMSA 4IJWA 1ADBA 3GZNA 4NK5A 3OFSA 3UN1A 2B5VA 5HS6A 3WMWA 5CHEA 5TF4A 1UZNA 4CM7A 2EEZA 5C7IO 1A5ZA 3ZU2A 2Y0DA 4RDIA 2O23A 4J1QA 2A94A 1B8PA 3KYDB 3F5QA 2ZTMA 1PU2A 3R0IA 1T24A 3WG9A 4NH4A 3ZWAA 2W2KA 1NVTA 2UUPA 3C1AA 2CFCA 3T7EA 3WNQA 3VPGA 2DTXA 4RF3A 3EDMA 2O4UX 1HTBA 2AE1A 2EERA 2VYVD 4ZQHA 4E31A 4B7UA 3BYZA 3RBZA 1F17A 2B83A 1D8AA 5TNXA 5U1PA 4I5EA 2ZQYA 1YL7A 1E77A 1VRWA 4MJLA 1Y9EA 2OL4A 1DPGA 1NAHA 4FB5A 2O2YA 3JQGA 4CQLA 3VVCA 4E13A 2PK3A 5G0UA 2OORA 1YOVA 2FOIA 5BQFA 1DB3A 4I8XA 2PA3A 1CEQA 3DTTA 4LMRA 1MLDA 4MVJD 5MGBA 2XAAA 3S55A 1YE3A 3KEOA 1Y8QB 3KVOA 4Q3EA 4RORA 3GVIA 4FFPA 3OQ1A 4HBGA 3OA2A 3O8QB 4CR6A 2CSUA 1RWBA 1YWGO 4J4TA 4DIOA 4IDCA 3KOUA 1EVZA 2CDBA 1TT5B 2X9GA 2DBQA 3FWZA 3GHHA 4O59O 3VDRA 4RF5A 3FBGA 4OH1A 4KTVE 2BFOA 4ZQFA 4HWKA 1DIBA 1H6CA 2D5CA 4M86A 7MDHA 4OKIA 3TQHA 1O8CA 5JXWA 4I5GA 3I9OA 2EP5A 3FI9A 3A06A 3H9GA 3PDUA 3H9QA 3WX0A 4BO7A 3KETA 1DRUA 1V35A 1WMBA 3JQBC 3S8MA 3WJAA 4B4UA 1Y81A 5LDHA 3GZNB 1ORRA 2YZ7A 3O9ZA 5EPOA 3S1LA 5HRUA 2BD0A 1V6AA 4BKUA 2ZQZA 3WWZA 3TN7A 2C20A 1HZZA 4NU6A 3TRIA 3FBTA 5EINA 1M6HA 1DOHA 3QWBA 2X6TA 3RUFA 1UAGA 5B37A 1MFZA 4IS3A 3UVEA 3HDJA 2W2KB 4CLOA 4A10A 4CQMA 2NTJA 4TKLA 1KEVA 2ET6A 3GN2A 3TOXA 3TZKA 3DEYX 4PCVA 3AOEC 1QG6A 3OA0A 4RQTA 4DLAA 4J16A 1W0CA 4CMHA 1O89A 1LDEA 4MVJE 3Q6IA 4ALJA 2GSDA 2X4GA 4YJHA 4EJMA 3AI2A 2VUTA 3GA0A 2PWZA 5G4LA 1XIVA 3ONEA 5A02A 1F0YA 1MV8A 3JQGB 3NT5A 3PQFA 3E82A 4CQLB 1YQXA 5A06A 3BZUA 2VZ0A 4EUEA 1B16A 1ADCA 3QWHA 1YOVB 2IZ1A 3I52A 4NNJA 1GQQA 4S1VA 4A26A 1LJ8A 1U3WA 4NBTA 1HE3A 4PLVA 5IDYA 4DPLA 1LRKA 2CDAA 4NR0A 2ZYDA 1CJCA 5JCJA 3LLSA 4P38A 3UCEA 4URFA 1EQ2A 4CUKA 5GZ1A 2DFDA 1C14A 1PGJA 4DPMA 2J8ZA 5JO0A 1ADFA 4I9HA 1XGKA 3DZFA 4NQZA 5EJ2A 5KJ1A 4K6FA 2GR9A 3SLKA 3BHIA 1IOLA 3OM9A 4II3A 3W4IA 1NHWA 3U62A 2IYOA 1P31A 4ILKA 2CVZA 3BHJA 4E2YA 3T4XA 2C0CA 3GH3A 3GK3A 3DR3A 4J4BA 5L7TA 5A5FA 1A72A 1LUAA 1W73A 2C54A 4ZRMA 1F12A 4XDZA 4C4OA 5IG2A 4IXWA 2GDZA 1UP7A 2VHYA 2GF2A 4D3DA 4AICA 4WJZA 4XQCA 4PLWA 1PZHA 3AUSA 5JYDA 1N92A 1DEHA 4J2OA 1ZK4A 1VJ0A 1XU7A 3O26A 3RFTA 1LSSA 3F46A 3NKLA 1LDMA 3KSZO 4K9DA 3WBFA 4W99A 4BQRA 2HAEA 3GUCA 1HRDA 5JC8A 3VDQA 3CUKA 1LBEA 1WDMA 1U5AA 3SJUA 4HFNA 1ARZA 1LDBA 3I9NA 4CLHA 2Y05A 2EIHA 4CLOB 3JQ7A 4L73A 4CQMB 1PS8A 3VC7A 4BNUA 5L45A 4DMMA 4Z9YA 3FHLA 3M2TA 4BNWA 2NVUA 1QLJA 4L4SA 4AJHA 4BV9A 1X14A 3JYNA 3KM0A 3MJCA 3C7DB 5JMPA 3VZSA 1QP8A 4YJHB 4B8ZA 1LNQA 1ZZEA 2QYTA 4LVUA 5JAIA 2PFGA 4U7WA 1G6KA 3OECA 4IIUA 4LVCA 4HUJA 2WYWA 1SNYA 4L0QA 2TMDA 2GZ2A 4J3FA 1SC6A 2V65A 4JN6B 4D0RA 2AQKA 3CMMA 1ADGA 4D46A 3MTJA 1R37A 4KDEA 2OMEA 1R0KA 4K28A 1ISJA 4WLOA 1Y5MA 1VI2A 2PTGA 4BKPA 2Q2VA 3ONDA 2BHLA 4BOYA 2ZB8A 1VKOA 1NM5A 1EE9A 3PVZA 3LLVA 3ZDFA 3IP1A 3MJSA 4CMKA 2W90A 4YEDA 3HDHA 1SB9A 2SCUA 4F3YA 2NU6A 1E7MA 4OXYA 5HM8A 1EE2A 5L40A 3D4OA 4MIEA 2AQHA 1M2WA 3IUPA 3R1IA 3Q11A 4D45A 4FQ8A 3DB2A 3ZWMA 3OJEA 3FTPA 1G1AA 1A27A 1QRRA 4WNIA 5A5EA 1LXCA 3DZGA 1JWBB 4XCVA 4QSMA 1EZ4A 2C59A 2PD6A 3BMOB 1T2EA 4ZHSA 2VWGA 3G1TA 1QSGA 5JPIA 4UEJA 3EW7A 1HDZA 3O03A 3PWZA 4B3JA 1YBAA 1K0UA 1SAYA 4BB5A 1P1FA 4HP8A 3O38A 3TDKA 2LDXA 1V3TA 5C7OO 1DHRA 4Z6KA 4YA6A 2GN9A 1ZMTA 5JC1A 1UJMA 3WQRA 2WEKA 2Y68A 3HDQA 4JBGA 4LRTB 4TVOA 2B4RO 3EK2A 2BF7A 3D5TA 2WMDA 4RZHA 4AG3A 1Q0HA 4RVSA 1B8VA 1GYPA 1MG5A 4WNCA 3JQ7B 4B4WA 1JW9B 2UV8A 5HA5A 1ISFA 5IN4A 3D3WA 1DHTA 1CYDA 2X1HA 5THKA 1VL8A 3ONFA 1C0LA 5KIAA 3JQ9A 2B4TO 4BMSA 3HHPA 2H5LA 4YAEA 2BGKA 4XR9A 3W1VA 1M76A 4CJXA 1U3UA 4BQPA 5EQFA 2BFMA 4WEQA 1X0VA 4BO6A 2P5YA 2DT5A 3ZNNA 3GLQA 4FSHA 5LC1A 3GNSA 5CDTA 1LRJA 1W8DA 1T25A 5JW6A 4AJPA 2A92A 2QIOA 3OQ6A 2X0JA 4A2CA 3ST7A 4N5NA 1I5RA 3DONA 1Q0LA 2JFFA 3Q9NA 4YCAA 2OFPA 4CMGA 5C3MA 1EK5A 2D3TA 4CM8A 1LX6A 3CSDA 3V1YA 3DFUA 3W6UA 4J1SA 4U6QA 4MKRA 1H0KA 3GHYA 4LN1A 3ZZNA 3TF5A 3E9MA 1PZGA 2QRJA 2XPCA 1Y1PA 2P5UA 5A9TA 1U8XX 1PR3A 3RFXA 4CLRA 1E92A 3GNQA 1K6IA 3I4FA 4PZCA 2HMWA 4DPKA 3L9WA 5JNLA 4XGKA 4BNNA 3HNPA 1LLQA 4W9NC 1AE1A 1ZK0A 1QORA 1M66A 3DMYA 1QYVA 1NFFA 2HUNA 2A9FA 4G5HA 3DZHA 1RYEA 3ZWXA 3PPIA 3ADOA 5L53A 3H3JA 1ZSNA 3HUDA 4BKQA 4TZKA 1O6ZA 2YFHA 4CUJA 5JSFA 4HNGA 4LK3A 1HE4A 1QMGA 1Q2XA 1WWKA 3DOCA 2VYND 1C1DA 1ENOA 3OIFA 1DO8A 4BVAA 2YFQA 1E6UA 3MJVA 5KKAA 3RUAA 2RHRA 1WW8A 1ZNQO 4FW8A 4FOOA 4R9SA 1JLLA 3ZW9A 2FPIA 4PN3A 4WPGA 2Y1GA 1T2CA 1H9BA 1P74A 2WD7A 2GN6A 4X54A 2EV9A 1SEPA 3I9JA 3D3WB 5KKCA 3V5NA 3JQFA 9LDBA 2PZJA 1OZAA 3EAGA 1WNTA 4NI5A 4NIMA 2R6JA 4NPCA 1LQUA 1I2ZA 3D3EA 3WGYA 5B12A 1HXHA 1NWHA 2VHWA 4DIFA 4Q3DA 2Z95A 4OKNA 2W98A 4UVEA 4DTIA 4YPOA 1SB8A 1D1TA 3T7CA 1RM4A 4CV0A 2WE7A 3O4RA 2X8LA 1P44A 3LYLA 4AJ4A 4YRAA 3INTA 4RZIA 1NFRA 4OXKA 2X5KO 3PYXA 4J2HA 4CM1A 3RU9A 4CM8B 1SMKA 3RC9A 3RIHA 1VL6A 2W2LD 3ENKA 4KDFA 4YTEA 1I8TA 5CEEA 3PJDA 3C7AA 4RPKA 1BXKA 4Z0TA 1ZMOA 1LEHA 4YACA 4CL3A 3D4PA 2J3KA 4CLRB 5JCXA 2I6TA 2ZCUA 1Z73A 4QX6A 3VAZA 2WJPA 4R5MA 1YB5A 1WPQA 5A3VA 5THQA 4AJKA 3FR8A 1YGYA 6ADHA 2CNBA 4J90A 5JYEA 2AHRA 3N74A 1CQIA 1WDLA 4GVLA 1U8FO 4MIYA 5EERA 1HE5A 1PQWA 4YAKA 5I7FA 2O7QA 2HK8A 2I5PO 4WLNA 2Y1FA 4GLOA 3F5SA 5ENVA 4PFJA 2VQ3A 1E0DA 1NX6A 3AY3A 1C1DB 3COSA 4JXKA 3HFGA 1UXIA 1ISGA 4C7JA 1T2AA 2CVQA 3HJAA 2E37A 1UAYA 2ZTUA 1GUYA 2P4HX 3OEYA 1SZJG 2WD7B 1BDBA 2EP7A 4IJVA 1NQOA 4D3FA 5A3JA 4NJMA 3ZWCA 1C1XA 1IY8A 1ZEJA 4JCOA 1LTHR 2X9VA 3OP4A 3ICPA 3H9EO 3L0DA 2HU2A 4E3ZA 1R0LA 2EKPA 4PZDA 1GYRA 2V6GA 3BTUA 2DU8A 4GL4A 4JJFA 4YT5A 1PGPA 5H81A 1Q0QA 4DGSA 1T26A 3ZWWA 5IZCC 1PZFA 1H94A 1XQ1A 2HO5A 4XD2A 5GZ6A 2ZCVA 2O48X 4J1NA 4BNHA 1ZJZA 3LT4A 1L1FA 3VH3A 3ZWYA 4ZICA 5L9AA 3JYPA 1MC4A 1DC6A 3JQAD 3RKRA 2Q2WA 8ADHA 4CM6A 1FDTA 3U49A 2AQIA 3IUSA 5EL0A 4BB6A 2ZJ0A 5BNIA 1P9LA 5ER9A 4HADA 5TC4A 3ZCXA 1V9LA 3AFMA 1U5CA 3DOJA 2R00A 4AJOA 4FJ2A 2DM6A 1NYTA 3I3OA 4PLFA 3WSVA 1I36A 5ES3A 2OOSA 1H6AA 3OICA 5TIIA 4KWHA 2I67A 4WUVA 4IS2A 2X7HA 3UHAA 3ZV4A 1KIFA 2G82A 3QRWA 1HT0A 2OBNA 3AOGA 4BNXA 2CF6A 3FWNA 2CZCA 3AUUA 3B1JA 5I9MA 3UKOA 1XHLA 4YT2A 2PD3A 3QVXA 1AHHA 1FDUA 3CEAA 5IDQA 1KC1A 2FZWA 1HDCA 4MP6A 3OIDA 1R4NA 2FPGA 1KYQA 1VJTA 2I76A 4R1NA 4BKOA 1KEWA 2Y99A 3PGJA 5AOVA 5TGDA 3I5MA 4D3SA 4RLHA 2BGLA 1VL0A 4J9VA 3ZHZA 3GQVA 2Q99A 2PR2A 3NUGA 3AK4A 4BNVA 4F46A 3K31A 1G0NA 2AA3A 4UUNA 3ON5A 4KQWA 4B4VA 3KTDA 1NQ5A 1X7HA 2JL1A 4ZVVA 3K30A 1AN9A 4Z9XA 4M87A 4CLDA 2VRCD 1MB4A 4NBUA 3HDYA 4AJ2A 1N2SA 1NAIA 4Y6RA 4NJMB 3ZU4A 5K6AC 1C1XB 1DC5A 4CMAA 4IZIA 5L51A 3RQSA 2XXJA 3LT0A 3NDIA 1CWUA 3PK0A 5JE8A 3ZNOA 3JD1A 3NYWA 2EGHA 3WBBA 2J6IA 4GVXA 1YL6A 5I8WA 1P0FA 4EEXA 5G0WA 5JAMA 2POQX 1Z82A 3AY7A 2RBEA 4J6FA 2Y1OA 4JIGA 2Q1WA 4BKRA 3I83A 4CLXA 1TT5A 4XB2A 1E1MA 1I3NA 4OL9A 3FPCA 1I3MA 1K3TA 5BR7A 3GVHA 3PLRA 4D79A 5T8KC 1F06A 4MVJG 3INRA 3RCBA 1DC3A 1I3KA 1IL0A 3PFFA 1A71A 5KJ6A 1HF3A 2VHVA 3U9LA 3VKUA 2AEJA 1L7DA 1YB4A 2FZEA 3S2IA 4DVJA 1T1SA 1JAXA 4FFNA 4XYBA 4DC0A 2NWQA 4GX0A 4PRLA 1WZEA 3TJRA 1EFKA 4ONEA 3WYBA 3CMCO 3ZHYA 2D59A 5CDSA 4IPTA 3UFXA 3ZWBA 1FK8A 1LC3A 1R4NB 1EVYA 1WXDA 3Q0EA 4MO2A 4FJ1A 2O3UA 5AXAA 3PQDA 5CG1A 3GVPA 1R16A 2OHXA 2J3HA 1SOVA 2C2XA 3H6KA 1ENPA 2BGMA 2GO1A 3DAFA 4E0BA 2DBVO 1DFHA 3WICA 4KMSA 1P1KA 2VTEA 5BNFA 3L4BC 1DRVA 4IM7A 1EUCA 1LRLA 5BSEA 1OC2A 1JQBA 1HL3A 1P33A 4B8WA 1EMDA 3HB4X 4JJIA 4K1LA 3OIGA 1HKUA 4FIZA 1NTOA 3ADPA 3BAZA 2VNAA 3ZU5A 4W82A 2CDCA 1VE9A 2JHGA 1XR3A 2Y0EA 2HSDA 2CD9A 2E82A 5I7SA 3JD4A 3IMFA 3DOOA 1PTJA 3U4DA 3E8XA 1IYZA 4TQGA 4W4TA 5EIOA 4RQUA 5IZ4A 4DBVO 3FR7A 3H2SA 2CY0A 1ZK3A 4ND2A 4XYEA 3LT1A 4EJ0A 1JN0A 5FI3A 4UUMA 3KEQA 4NBRA 1NR1A 4I9NA 5C37A 4PLGA 1B8UA 1OMOA 4CM9A 4MVJA 4KTTE 1LSJA 2Q4BA 2Q49A 4YAJA 3WR5A 3NDJA 1LDYA 3K5PA 3E6AA 3EGOA 4M55A 3K96A 3QY9A 1E3IA 2WWRA 1GQYA 2EXXA 3C1TA 3F3SA 2VWQA 1MUUA 4XQ9A 1PJ4A 1ONPA 1QV7A 4YVFA 2X0NA 2Y1EA 3LF1A 3Q2IA 1KVQA 4J49A 3JYLA 4GX1A 4CQMD 1GYQA 1Q7BA 2C82A 3ANNA 4MP3A 4ZA2A 5IDWA 4GKVA 2EW2A 4Y67A 4BUCA 3ABIA 5TSDA 4HFRA 2JCVA 1FDVA 5ILGA 3WIDA 4WE3A 2J5RA 3IAHA 2AG5A 5L4NA 1QLHA 1E5QA 4PG6A 1B3BA 4XJSA 1JKFA 4N18A 2ZIZA 3HE3A 4BGVA 1O0SA 2FRDA 4LSMA 2CF5A 3W4JA 1CRWG 2NLOA 2YV2A 3GG9A 3SX2A 3F9IA 1N1EA 1V3UA 4TWRA 1GADO 2G76A 1GR0A 2DVMA 2PY6A 3LZ6A 1R6DA 2G0TA 4QT0A 3VPHA 3GFGA 5JCJD 1U2GA 1K2WA 1VSUA 3P7MA 4GPD1 1T1RA 3PEFA 1H9AA 4E5YA 5ER6A 4O6VA 2D5AA 3GPIA 4WOKA 2E6UX 1BMDA 1PL7A 4BNTA 1MXFA 2D1YA 1PX0A 4ZN6A 3X2EA 2J5QA 4GMGA 3BHMA 1P3DA 2J5KA 3DWFA 3F47A 5L3ZA 3IS3A 1GAEO 3GVXA 1I24A 3QJ5A 5F5NA 5KWEA 4UEOA 3GEDA 8LDHA 2A35A 2IE0A 1XQ6A 2C7VA 4MVJP 4ND3A 2AW5A 4FFOA 4HFMA 3GFBA 2PGLA 1UXKA 2AEFA 2HLPA 3INGA 4YJGA 3D4NA 3HQ4O 3PJEA 1B14A 1DC4A 3DAPA 4E21A 2VOEA 5DZSA 2X23A 1OC4A 3BMOA 2AG8A 3RC7A 1E3SA 5CPBA 3MCVA 2NVWA 2YW9A 1IHXA 2IDZA 3RROA 3AU8A 3UAGA 4KP7A 3KBOA 3TL2A 3IKVA 5ITWA 4JJGA 4TVBA 2O50A 1RPNA 1PJBA 3JV7A 2PZMA 1BVRA 1F14A 1PS0A 4GX2A 4YQZA 3V2HA 4QO7A 1P1RA 1UH5A 2AMFA 3BA1A 3JD2A 4OSPA 3CINA 2WM3A 2NU9A 1S6YA 4TRMA 1VPDA 1E7SA 5DNAA 3NAQA 5FF9A 2QG4A 1UDCA 1Q7GA 3AU9A 3K2BA 3P2OA 2GNAA 1X7DA 3I4CA 4BS9A 2UVDA 3IJRA 1N9GA 4J43A 3Q2KA 4GMFA 4PLHA 1ZJYA 4EYEA 3LVFO 1PQUA 4M1QA 3TPCA 3SEFA 5L4LA 4ZQBA 4Q3NA 4PLYA 3U4CA 2NTVA 3VHRA 3WQSB 2P91A 4IZHA 3H5NA 3JQFC 3VZPA 1AXEA 5ENDA 4CUZA 4R41A 1HDYA 1PGOA 3BTVA 4PLPA 4R5HA 3GN1A 3ENNA 2I65A 4N54A 4RLSA 3MTGA 2R2GA 3DDNA 3DMTA 4GH5A 2FP4A 1JTVA 1LSOA 2Q4EA 1X1EA 2C2YA 4OHUA 4IDEA 4MP8A 3STHA 1HSOA 2DQ4A 3AUAA 1PS9A 1K6JA 3E1KA 4U8GA 4DQVA 2AXQA 2PKQO 3C24A 3ORFA 1B2LA 4IUYA 3CE6A 3WQQA 3FD8A 1YQDA 3U4IA 1Y9AA 3AY6A 4R54A 5TQVA 1IZ0A 3H65A 2EG9A 2WYUA 3GPDG 4RGBA 4WKGA 3E9QA 4P4NA 1AXGA 4Z3DA 1IUKA 3CZRA 3I9LA 4MKXA 4YJGB 4D43A 2ZTVA 2O3SA 3WSWA 5U9CA 1Z7EA 3NX4A 3TZHA 2P9EA 1E7QA 2JAPA 2HQ1A 2FY8A 1LSUA 5CPFA 2F00A 3OJOA 3PRJA 2GCGA 4ALMA 3F1LA 3ZWPA 1U28A 4UULA 3KLPX 4GSKA 3LDHA 5AVOA 4CMBA 3GAFA 1YO6A 2Y67A 1JVSA 1RJWA 4YRBA 1BG6A 3CH6A 4CMEC 2PKRA 4UVGA 1P1IA 1WDKA 1OBFO 2NQ8A 4KUEA 2P68A 4BNFA 4Z0PA 3JQBA 3KB6A 3LC7O 4EUFA 5ILOA 1YVEI 4NG5A 1E3EA 4A5OA 4B7CA 5DT9A 3SC6A 3GVCA 4CM5A 1SBYA 4NBWA 1IULA 1N9GB 1CF2O 1IE3A 1Z7BA 3FTNA 4PLTA 4WCFA 3DHEA 2NADA 4LCEA 1HE2A 3MJEA 3PWSA 4FJ0A 3DZJA 4PLCA 3OJLA 4AJNA 1NFQA 4EW6A 4YJFA 4MDHA 3PQEA 5IXYA 1BXGA 1C0KA 5BSGA 4XDYA 2GRAA 2FPPA 4EJ6A 4KOAA 4GBJA 4J4HA 4PG4A 3K9QO
chains in the Genus database with same CATH superfamily
1HSZA 2QV0A 3GMDA 3HB9A 4JU9A 1VLMA 3E84A 2C9ZA 5J4KA 5BV8A 5K0CA 3TFOA 3D6HA 2JATA 2FP4B 3HHEA 3NT4A 2JFVA 4YRNA 2IIQA 2ZJ5A 3TFQA 3PUXA 3ZIAA 4BNLA 3K9FC 2IGBA 2XQKA 3LO5A 2LTAA 4WOJA 1IBLB 3OWXA 4E7OA 1BHQ1 4HTFB 1ZVKA 2D7DA 4A0GA 3LAWA 3W2TA 3HACA 3IJPA 3LVRE 4EF5A 2F62A 3QMMA 4XVCA 4JGBA 2H4WA 2HOQA 5GOTA 2CEKA 4KJZA 2OZVA 2GJSA 1O6FA 1H85A 2A59A 1A7JA 2PJDA 1M1NB 4BVJA 4F6CA 3KT0A 3GJ7A 4DHWA 3TRFA 1D2GA 2PUGA 1GPYA 3LT5A 4NL4H 2Z6QA 5JJIA 3E7FA 1Q0TA 4MYHA 4GKJB 2O59A 2Z4TA 3DV9A 1SUEA 3QOXA 3ZY6A 3OSUA 3K9NA 1E1YA 1TM4E 2ZATA 1ULAA 4Z4EA 3WL4A 1ZH8A 5HKLA 1HETA 4I0WB 4MH0R 4I9FA 3MJ4A 4M21A 2FRXA 4WNAA 1RXWA 2X15A 3KUKA 4BO2A 1JZTA 3LBAA 4BQFA 4ALLA 4QEKA 2QPAA 3SQOA 3LGSA 2GLTA 4WVLA 2QRQA 1R15A 1UFQA 1VIDA 1U2ZA 3A36A 1A4IA 3DM5A 1YVDA 3AKYA 4OIFA 2H7YA 5J5VA 3WLPA 2QX9A 4DZRA 5FAKA 3SC3A 1T5HX 2IVFA 1YQQA 4JLUA 2I99A 3TTXA 1Z6YA 2PUJA 2H1WA 2QS9A 4Q3LA 4D44A 3N2YA 4HS9A 2DHEA 2BEJA 3K53A 1ICIA 2PMCA 2JH3A 4Y2SA 2G9NA 3ESZA 3JQEA 5J9FA 4JNGA 5AXDA 1T34A 2JVKA 2XCOA 3H0KA 5ALNA 4Q6WA 1YMVA 3ILHA 4O1MA 3TLMA 3U39A 1E7WA 2ARKA 2OYSA 1F0NA 4UUQA 3IA2A 1KP9A 3B8HA 1WKBA 4KXYA 3TRDA 4BO1A 2OXIA 3A27A 3AIKA 3N07A 2B82A 1JH8A 2DUWA 3RC3A 1CUSA 2ECPA 1G7CA 4IQ4A 4R2XA 3LSYA 4ZQCB 5FAXA 4NZYA 3L04A 2A4MA 3DOFA 4UAJA 1ESZA 4QBKA 4UAGA 5AVSA 2IHNA 2X86A 4IIVA 4XWYA 1HV8A 2X7JA 4L5IA 3OOJA 4RUKA 5HUHA 2BEUA 4QUGA 5ULLA 3ZH2A 1QV6A 1H1TA 2PKQP 3BMCB 3OJXA 1CUEA 4BNYA 1DTSA 3CX3A 3VH1A 3EBOA 2R1TB 1SO8A 3VNSA 2R6CA 1VG8A 3KR0A 2M6RA 1W5SA 3QVWA 4HQLA 4E88A 3GJSA 3SSAA 1RIIA 3ZI0A 1ZAYA 1QK5A 3NDPA 5AVRA 4MR9A 4OVKA 2ZP1A 2PZAA 4WASA 4FR5A 1G3RA 5LB4A 2FN8A 1WY5A 3NBKA 4BEVA 3A1VA 3KSUA 5KNBH 3VX4A 4JZKA 1Z88A 3W06A 3Q1KA 4ESOA 4GLBA 3V4LA 4IXWA 5B3KA 3QA3E 2Y93A 3CUEF 4H18A 4DTCA 1TO6A 2V7WA 3NWPA 4E4RA 2QLTA 4LYDA 4D5EA 5B7PA 1KZGB 1XU9A 2JANA 5LJIA 4M83A 3OESA 1FXWA 2Z0MA 5HIKA 3DVAA 2K7FA 1S9DA 4WHMA 3T3HA 1HFWA 3LLUA 4JB0A 3TMKA 3ZUPA 3WKBA 1FRNA 4LRQA 2R48A 2GRUA 1Q5PA 2JLQA 1I14A 3D7NA 3TNLA 1MXHA 2H65A 2CHEA 2X8BA 5CB4F 3VR1A 3U09A 3OPYB 1T2FA 5AM2A 1YB1A 3B20A 3SEAA 3EVFA 4IG4A 4YUVA 1OTYA 1I10A 1JBEA 1GUZA 1VA4A 3D7KA 3EQ8A 4JI2B 1T4CB 2EKQA 4QGHA 5CA0A 4RY0A 2FMUA 1MTZA 1VSVA 2YN0A 2F1OA 2IYPA 2W6MA 3LA6A 5SY4A 3VKVA 3OLZA 5KJCA 5TT0A 3ABQB 3MTEA 4UDNA 1JJBA 1O94A 2VHEA 1DKPA 4ZGWA 4AFNA 3KSMA 1PT9A 3LPMA 1JIJA 4KE8A 3H4TA 3PGLA 1OA0A 4X91A 2Q5CA 4DMGA 2ERYA 3CTPA 3ZU3A 4CTMA 3SZOA 5K9ZA 4B3HA 1BWSA 2BEKA 3R5XA 4GO1A 5K3CA 5F2EA 5SICE 1QXSA 2CLIB 4X66B 1A95A 2XSZA 2NUAB 3W7AA 4EJSC 2AQ8A 3KC2A 2ZU6A 3G8AA 3NHBA 1RJFA 2AC2A 2QTRA 1M33A 1MGPA 2IJGX 1U1IA 3DMHA 4M9CA 4YRTA 4E1VA 4H4CA 4YV1A 2OORC 1J0XO 4FWBA 5BSTA 3UJPA 1O5OA 3P52A 4TKMA 3MAJA 1R3UA 1JDPA 3AFOA 3R4VA 4RHYA 4TXNA 5T41A 3ZDAA 2WFZA 1GNLA 4IO0A 4JJ8A 3FPAA 3TZQA 4CQJA 3MWGA 4EECA 1OSNA 3ZDEA 5CLFA 1OKKD 2NAFA 3PYMA 4WFQA 2WUDA 4FTWA 4KXMA 4G24A 2IXAA 4M6WB 2PNJA 4G1MB 4M9ZA 4PYIA 4MRPA 2ZBEA 3JYHA 1TUIA 3QXCA 1Q7TA 2IUYA 1E18A 5AKIA 3OIWA 3PNLA 3RHZA 2BCGY 1K4YA 4JJ6A 2ZRCA 2BLLA 3KKZA 4UDXX 4XIJA 2ZKLA 5G1PA 2G17A 1P0MA 3R09A 5LU9A 4F72A 3EZFA 1MG0A 3EF3A 4GPZA 2EF1A 1XVUA 5ALLA 4I55F 5IABA 3RASA 3QFFA 3OSZA 4Z1MA 5HCIA 1T3SA 4X44A 2VRBA 4CF4A 5KCZA 1T3LA 4OJQA 4ESVA 2Y1DA 1JKJB 2NU8A 1GZ3A 3T3OA 1Y33E 4HAUA 5B1HA 4OHZA 4JL8A 5HYVA 3TR0A 1KDYA 2O54A 1FF9A 3DE2X 3D6MA 6LDHA 1B6SA 1J33A 1Z4NA 1UP4A 4Y8VA 3SJZA 3T8YA 3Q3EA 3EMVA 3GP8A 4DXDA 4LUCA 1E3LA 3USCS 3N8GA 5KU7A 2PT7A 3HK2A 2HDHA 4BWFB 5AKYA 2Q1UA 3IAFA 4M0FA 1JHAA 4P3KA 4ZT5A 1T29A 2AWNA 2PZGA 4WLFA 1ECPA 1B15A 2XDQA 4YNBA 1RVV1 3OZDA 2FLVA 4FYIA 3KWFA 2Q1SA 3F5FA 4MTLA 2HLDA 2FR8A 4UQPA 3UA4A 1YZTA 3UZUA 1N25A 5E2IA 4DIMA 1PZEA 3QHPA 2DFTA 1AOXA 1J8YF 2A9OA 4EB3A 3GGCA 1DO0A 1JLHA 2Y3IA 2F55A 2ES4A 2GS9A 2AZDA 3ZW8A 4ZYYA 5DNVA 1AUPA 1TD1A 4I50F 3SK0A 4TMWA 1MTOA 4ON9A 3JTEA 2RH9B 1L8LA 3PHBE 4HCJA 4ZOCA 4HGRA 4YWHA 3VOTA 4B7ZA 3JRWA 4Y2XA 4XYGA 1FZQA 1DJQA 1WVGA 4ZAYA 5BMVF 3DJFA 3MAAC 3OX2A 4G01B 2FPLA 1P7WA 4Z9BA 4BO9A 1OAAA 1FFEA 1TVEA 3A1TA 4ME6A 4CKWB 3M1IA 4Q9NA 3ASZA 5COQA 5IH3A 4CL8A 4DHEA 1A50B 4X64B 5AKEA 2CBXA 1IXRC 4DT1B 4PGHA 5DHTA 1IXYA 3SVTA 4N03A 4B2PA 3CXUA 1S4QA 1ZITA 3GDFA 1U99A 3SQWA 3CIFA 1YUMA 4JJ7A 2ZYGA 3EN0A 1M34B 1KSFX 2R8ZA 4ZEMA 2VEOA 2W6CX 2XTZA 4LBVA 1G63A 1Q1NA 3PDCA 3HS3A 3PZBA 4RM3A 5IMBA 1KSGA 3VTFA 1FRFS 2OUIA 3H5RA 2JGDB 4GM0A 4D92A 3KDSE 5BN5B 1HYBA 5G1OA 5JY1A 3GX1A 4BEWA 3I34X 1BOOA 4Q05A 4KXLA 3OZUA 4MGZR 5LCXA 5G0SA 4Q24A 4D9HA 4GW3A 2R6ZA 1UZMA 2MR5A 3JARB 2V7EA 3GG2A 4P3PA 1VBMA 2JH9A 4NULA 4UHHA 3OT1A 1OT3A 4PRKA 4URHA 1H3FA 4W5TA 4IW3B 4ZU3A 4YP5A 1XFDA 5AOCA 1GKLA 3B9QA 4TWAA 1E20A 3WMGA 4JR2A 5CG2A 4KLAA 2CMDA 3FGPA 4PW0A 2XOXA 1NQAO 3ND6A 1FLVA 1X77A 1WUYA 3GJXC 2IYSA 3QYAA 4LNHA 3VZRA 5JH7B 3K05A 1RM0A 3F98A 3TZCA 2B0CA 3ICEA 1XPRA 4C2TA 2WG0A 5EG5A 2RONA 1FFCA 1FXSA 1KC3A 1L5YA 3NNNA 1WP4A 2DWCA 1M6WA 1Y3BE 4UZSA 4DV5B 1JDSA 1TU4A 1XDBA 4QOIA 3JYOA 3NM5A 4FGSA 3I5YA 2N0SA 1COWA 1HMPA 3D8UA 3DYVA 2CVPA 2GD0A 3BFXA 4B74A 1N4DA 4YT4A 1CR0A 5JDIA 4DV1B 4ZJZA 2GA8A 4H3VA 3A6JA 1TM3E 1N3LA 2GKGA 1NBEA 1V39A 2NM0A 3GO4A 3OZIA 4HQFA 5FCDA 5E0OA 2QD1A 2Z30A 3OJWA 4L4XA 4OH7A 3D59A 4EO7A 1IBKB 4H7PA 1JTEA 2CBGA 2EL7A 3R77A 2Q9BA 3FI0A 4LYJA 2LR0A 2DZDA 2ICAA 4UU7A 4DLVA 2DY0A 2WUGA 1NUAA 2VA8A 2B4QA 3LWBA 1X7GA 1ZM2A 4OQPA 3GRPA 4EHDA 3HFSA 2IH5A 5DOZA 1I5EA 4IDUA 2I29A 1LPSA 1JEQA 1L7PA 1ZG3A 3CE9A 4E46A 2ZZNA 4TYWA 4CFZA 1RXUA 1ZM3A 1MN6A 4KN9S 4JUAA 2ZI5A 1P4RA 1NQXA 1ZK2A 2OB2A 2O7SA 4OA5A 3ZE0B 2QBYA 2XA2A 1O2DA 4BZPA 5BRAA 2PKYX 1AKEA 2GHRA 2IOHA 1YZKA 2A5GA 2DETA 4JL6A 1XWFA 2CEAA 3AW9A 5IAAA 2YKGA 3G8YA 4GWLA 4OJYA 3E5MA 5EMNA 5IS2A 1MZPA 5L4SA 5IUKC 3DFZA 2Q4OA 2J3JA 3DUFA 4RTKA 2DQZA 2TMGA 4XYLA 1FNSA 3ZHUA 2XHEA 1ONSA 1E3QA 4PTYA 1U9IA 3BL5A 3C43A 3KFLA 2Q5LA 3LXMA 1SXJC 4R6XA 3DAHA 4OXXA 2DG2A 2XMGA 4UFPA 4G1VA 2FQWA 2AOUB 5IAKA 2PSDA 5BOVA 4LWOA 5C52B 4DC1A 4WFIA 2UUOA 2BEVA 1SG0A 2GVNA 1GA1A 4BO0A 3BK1A 4F86A 4FINA 3Q6MA 4BVEA 3QGMA 1AA6A 3UAVA 3UGTA 1TYEB 2C78A 2GYYA 3S70A 3L7JA 4JI6B 4G4SP 2CL6X 2AR7A 2NYVA 3DCNA 4AWBA 5LLDA 4TWZA 2ZRNA 1QGOA 3DBLA 3LUGA 3CUYA 1N2EA 2IPOA 2C9BA 1DJMA 3HL0A 1NXQA 2OD7A 2R79A 3L0OA 3MWDB 1GRVA 3PYLA 3R0XA 2XUDA 4Y18A 4UUAA 2XTNA 5D86A 2KMLA 3GFTA 1QYRA 3T5CA 3KXPA 4O63O 3PI7A 3Q85A 3U1BA 3VVBA 1J2TA 3VM6A 4JK3A 2RK3A 4F7WA 1QQBA 1RYFA 3KQVA 1U4SA 4S0XA 3R3JA 3HFRA 4J0IA 5JO9A 4D8TA 1BCSB 5DRYA 3WADA 3UMMA 1W75A 1N5LA 2IHYA 5DIFA 4IIYA 4QFCA 1IBSA 3QV1A 2VF2A 2QE7D 5GVRA 1DTWB 4ND8A 1I2DA 5HKKA 4W5WA 4BMZA 1ZGJA 2H6EA 2J9RA 3O1JC 1FE8A 3T1QA 1PT8A 2ZRMA 5JQGB 2C2WA 1F38A 1I0IA 2E4YA 4URUR 3ELBA 1WABA 3IQDB 4EY8A 2NW6A 3TUZC 3W2FA 1RLOA 2D2IA 1TYZA 1AQNA 2DF8A 1Y3FE 4B3MB 2NACA 1UXJA 3RUHA 1KJWA 3I05A 4GAEA 4BMVA 5J2UA 1RQLA 1KJIA 1XZAA 1QX4A 1WUTA 1EFDN 3Q0IA 2QV7A 3QVJA 2XQVA 4HDNA 4WCFC 2OHVA 4E5KA 1QFZA 1HQKA 1RACA 2P2SA 4ZI7A 3CCCA 3DW1X 4EL0A 4UTNA 4D6YA 1S7GA 4JXZA 5AW9A 3ZJYA 5FBHA 3JQ9C 4MSUA 5IM5A 5A6SA 4DLLA 3EC1A 3ZWQA 1TJ5A 2PBLA 1OIXA 1ZSYA 1QGUB 4YYEA 2DERA 5B64A 1AS0A 2YHAA 2YXPX 3AZQA 1FTGA 4J0FA 4PRZA 4OLBA 3ROZA 3PICA 2YWRA 5TQ2A 1Z0FA 1M8JA 1RWVA 1YKGA 2V3VA 5LXTA 5LQAA 3U9SA 3ICOA 4R51A 3L07A 3SR0A 2XCSB 4UCFA 1UC9A 1X9HA 1TQDA 1UXGA 3MUOA 4BE9A 1NYLA 1TM5E 3Q0TA 4HNHA 4NJEB 4XPZA 3T4PA 4CMIA 2PH5A 2WFLB 4FYXA 4R8KA 3ZX5A 1P29A 4TM7A 3TDNA 3WK8A 3UPUA 3UW3A 4OX9Y 5JHGB 5K6AA 5KYNA 1VLQA 4J7UA 3ESDA 5EQTA 1AMNA 4LOIA 4MEBA 3DC2A 4HNQA 3NNSA 4G1CA 4LF4B 1B2RA 3L7NA 1E9AA 4J0HA 2OHOA 4A7PA 3RYCB 2IYNA 4JI8B 4CVNA 4KR7A 3LQFA 3JSAA 5JRDS 4MKZA 1XALA 5BNTA 5DBFA 5ALIA 2B2NA 3W2EA 1O4VA 4JVOA 4HPXB 1MNAA 1RAEA 4IKEA 3MT7A 5AM3A 4UOEA 4LHVA 3P9ZA 3JQRA 2PIDA 1OXMA 3OU6A 4P3OA 2XKKA 4B7XA 2JFHA 1OLSA 2FPWA 3SEZA 4Z7NB 2FMXA 2WTBA 2WSBA 3W3AH 1QRDA 1TK2A 3U37A 5T8KA 1AS3A 1JQ5A 3SQNA 5E3HA 2CMGA 721PA 5EUMA 2ZSHA 5T3YA 1IONA 1R0ZA 1M2FA 5A4KA 2WWTA 4EB6A 3LMKA 2C96A 2FZKA 4RZQA 4E4YA 1QK3A 2XGSA 4BNIA 1HNWB 1TPZA 2B7LA 1KBOA 3W9SA 4JNKA 1N77A 2JF0A 2XA1A 4P4LA 1YQTA 1FDSA 1C7IA 1TCBA 1A0OA 2BKUA 2QVGA 3IPXA 3WLFA 5EP4A 3K35A 4I4TF 4QEDA 4ND1A 1E2UA 1NR7A 4TLMB 3WYNA 4FS3A 4ARZA 5I4IA 3PXAA 3VR4A 3I1FA 2PPLA 2O2CA 1NF8A 3CUSA 2P6MA 1W29A 3L49A 5BV7A 2H7VA 3B3QA 5DI9A 1GAQA 1A8HA 3JTMA 2HXGA 4I14A 3UK6A 3EXIA 5T3UA 4CIBA 2BFAA 1QPZA 2UAGA 3MEQA 1XMXA 2I2AA 1IY1A 3DL2A 3IC5A 4BGEA 3ZNQA 4BBZA 2H5JA 3RUPA 2JJ1D 1GEGA 4DMKA 4EK9A 5HSGA 1GA4A 5F51A 1K3UB 4FYKA 5AJUA 3SSNA 2LIPA 4JR1A 1J25A 1IXKA 4QDOA 1OB5A 1ZK1A 3DDUA 2HMUA 3KQQA 1BXZA 4MLDA 1SBZA 3IHLA 4FFDA 4C01A 4AZWA 1Z6XA 4O33A 2ERCA 1HEYA 1SXJD 3LUJA 4P4UA 2VTKA 3TQTA 2ATXA 4BEBA 3VC2A 1GHTA 2G06A 1UBCA 1L5LA 4ODIA 3II6X 3SAJA 3L6CA 5JSZA 3NZEA 3QEMA 4YWJA 4YMUA 1F2DA 3KLBA 5EJGA 3V8PA 2Q8NA 2A14A 1E2MA 1X0XA 2QY6A 2ZYHA 4IV8A 4KYUA 1P61B 2EVWX 3TG8A 2YUTA 2FEWB 5C53B 2RHCA 5JAQA 3A05A 2FR1A 1GGHA 4QUHA 4AMZA 2OGWA 1DBWA 2IYEA 4BIIA 1N7GA 2NO0A 1K8QA 3DL4A 3KZOA 2CVFA 4L7VA 4JV5B 1KVUA 3H4VA 2RGCA 1BEEA 3O2JA 1O96A 3PL5A 1LBSA 1EUZA 2P2GA 4G84A 4KVAA 4MDYA 5U4QA 4J3NA 4DMCA 3T3EA 4X6YA 2YYAA 4ZTUB 1OASA 1ZLYA 3F5MA 3GAMA 2CLOB 3N86A 2WF6A 1TA9A 1RD4A 3SZLA 4YMLA 4EPTA 3H6HA 2Q46A 2P9GA 2X3FA 4NOKA 4R3WA 4RV9A 3HCNA 3F8WA 3RU3A 3TLYA 3FPHA 1YIDA 2EKZA 1DJOA 3I73A 4B3TB 4KFCA 1U02A 2PSJA 3CYFA 3EVTA 3NHMA 4EUHA 2B78A 1TQ8A 1U7XA 1JKXA 2BKLA 4GMHA 4MS3B 1UDBA 2EC5A 2XUJA 1WQ3A 5GQSA 2OXTA 3R75A 1E3WB 4AMVA 1NVGA 2XVZA 4KV7A 2P40A 4LJYA 2ZYUX 4U0KA 3G5UA 4RAQA 2J3EA 2B3DA 2NU7B 3T9CA 1U8UA 4MRVA 3ZWNA 1Y5NA 3LYHA 3B7WA 5BVHB 2NQ2C 2IGTA 2O06A 4F3TA 3LCUA 2H29A 1N5DA 4ZD6A 4AJIA 2VQSA 3RVDA 2AI3A 4EAAA 1F7UA 2OXEA 4MPJA 4MKIA 1VE5A 2F64A 1O94C 1P8JA 4GWKA 5G4KA 1HLPA 4ENSA 2YJ6A 1U2TA 3DOEA 1P18A 1P2UA 2VP6A 1S01A 3GLKA 3UMYA 4PYMA 3IH5A 4QU8A 2BR3A 2ZUCA 3GRRA 4OQZA 5D8DA 1WCIB 3ITDA 4CV3A 2JKZA 4OAQA 3NOXA 3ESQA 1VMEA 3OCCA 3OUUA 3DFMA 4K6CA 1E1CB 4Q9AA 3RFCA 5K05A 4MHTA 2QDXA 1CJUC 1U8TA 1KI2A 4YDRA 1X7ZA 5BR1A 3X44A 2FWRA 3PJRA 3FFTA 2GRJA 3GLHA 1LPNA 3TOCA 4D5GA 3F6YA 2JG3A 2HO4A 3I23A 1BHSA 3TQOA 4G5SA 2E87A 2GAAA 3TTTA 2RGYA 4AX4A 2IIVA 3KJIA 3WOHA 1EFPB 4AYXA 3RRYA 3K2IA 1HZJA 2C2BA 1AGYA 2CSXA 2HA7A 3OCXA 4AUKA 4QUKA 2QW1A 4E2XA 4F5ZA 3QH4A 1FEZA 1D6SA 1KEKA 1EGHA 5DNYB 3KQPA 2CB9A 2LCFA 4D9KA 1UCFA 1T36A 3H42B 2RC6A 4BMNA 5CFLA 4RF2A 3DM9B 4JGIA 1U8ZA 5LA6A 3UTCA 4OLHA 4KL8S 4OXIA 4YR9A 5CVVA 1Y1RA 3KHSA 3WDSA 1VJRA 2H59A 3HRKA 2LZ0A 4Q39A 3PTZA 3DO5A 1GKUB 1QX3A 3I0ZA 4FE3A 3RS5A 5K8JB 1XFAA 1C8KA 3HCDA 1MB2A 4LHSA 1DMRA 3DWEX 2I34A 3PR2B 3QLUA 1SXPA 5JNUA 3PEUA 4DDTA 3H4IA 4MWSA 4R1SA 4BVFA 1C29B 5JJ5A 1XJWA 3SYNA 3QVSA 4QLBA 2Q6VA 4EG5A 2HJRA 3GGPA 1NY5A 4KN6A 2BFBB 4HUQB 2FFRA 1O57A 3OM8A 4D97A 3A3NA 4PQFA 1L5QA 3GRUA 2FZ5A 1GTVA 4GGPA 3BH0A 2YVAA 3U5ZB 3F6PA 4ZAVA 1XTKA 3RLIA 2KLHA 4OLJA 3ZJVA 1UDRA 1G8MA 4CTKA 1W5TA 3GT3A 1A7KA 1K7FB 1KY3A 1PDVA 1UPAA 5FTNA 3C6KA 1NXXA 1R0WA 4FEGA 4N9WA 5T64A 4B1FA 1I6MA 2BGWA 4U2FA 2H9IA 2RHOA 2EJCA 4FCWA 1GQRA 4MUYA 3OIYA 4EA8A 3D4IA 1PR9A 1BGVA 2D7CA 5ADHA 4F4HA 2C31A 5M29A 3ZQ6A 1RYZA 3FYDA 1OA1A 2IPNA 3AG5A 4HXYA 1Z7WA 4CEIB 1I7QB 4G6ZA 2I7DA 1OI7A 1BFUA 4KBYA 3PLAE 3KZMA 3A4VA 3BQMB 1SM4A 5E9JA 8AT1A 4XZ3A 2D8AA 3UCXA 1YA8A 3KCQA 3NXKA 3ZGXA 1QVWA 2YBEA 1EVIA 2OR3A 4G0UA 5K0EA 1IWBB 1GGJA 3GJ3A 4HH1A 3CPEA 4TTAA 3GP5A 2W70A 2ACWA 3GEPA 3RREA 3ZYCA 2F4NA 2F1HA 3O31A 4MYTA 4EFDA 1ID1A 4AB1A 3F6CA 1KY4A 7ADHA 3D1LA 4NCKA 1J1IA 2J46A 4BV2A 4BP9A 1PCXA 4NV0A 4CFYA 2E6KA 4V1CA 4QD3A 4RXUA 3OQVA 4BP1A 1XRSB 5JAZA 4LHYA 3T7SA 2I2CA 1Y5RA 2AMJA 2VYNA 2I1LA 2JHCA 1XDWA 5G0TA 3EF1A 3L9XA 3O83A 5I51A 2X0DA 3L77A 4IHJA 5GMOA 1A69A 5ESRA 2BBSA 2MSNA 2QTGA 3B9PA 3L2OB 3ID6C 5FFFA 4BGDA 1TTTA 2E2WA 2O05A 2KBFA 1GOTA 3GJ4A 4H7JA 3VNVA 3G0HA 3N75A 3PQCA 3KZNA 4KQXA 5T4HA 4IHQA 3NOQA 1JKIA 3R3HA 3R76A 3WFJA 4ZK6A 5A1TA 5CEJA 2J4DA 2NV6A 1IM5A 4C7OA 1KMCA 1WLYA 2RMKA 4NZOA 3WP0A 1MQAA 2I3AA 3EXHB 3LFHA 2GAOA 3S1AA 1EJ2A 2PUAA 2Z5VA 1L8AA 1RCFA 4XWTA 2YWBA 3HRIA 1U0HC 3HYTA 2VAWA 2VRWA 4W6QA 1TI7A 1WX1A 3QKIA 4UVDA 1L7MA 1QAMA 2FWMX 3NIFB 1T2NA 4QAJA 3T1VA 1ZL0A 2IF2A 4BE7B 1GV0A 2IYXA 1GL6A 3IVXA 3EY4A 1YJAA 1NW7A 2VTDA 3B3FA 4LDAA 3NVMB 3QV2A 4LWQA 5G41A 4Z7OB 1L4LA 2OZPA 2GZMA 1OJLA 1WBBA 1C0PA 2OBXA 2F3PA 4M1WA 5FR2A 4B6OA 1E2BA 1PWZA 2PX8A 3PJGA 3FZGA 4CODB 1N6KA 2ZIEA 1RQRA 1UM9A 1DJNA 4XPIB 4E33A 2ZJ3A 3IAM1 1XNJA 5CLIA 3KUXA 4LF9B 4RFSA 5FEUA 4C6HA 1P6XA 4FKZA 1O94D 5FOQA 1Z0ZA 2BI7A 3TVYA 4PZ9A 4MUKA 3H2BA 4DJTA 1YAHA 4Z7JA 1EHYA 2RB4A 2W2LA 4ZEXA 5C8YB 2DTEA 2O0KA 2HRZA 2Z3VA 2EJTA 1QYCA 3A7EA 3NC4A 5EYPB 3WGHA 4M8LA 3HU2A 4HRVA 5JDIC 5JQWA 1X80B 2OFXA 1C1YA 1JJ7A 3PQ7A 3QEAZ 2IXDA 1W4AA 2QRGA 4JI7B 3WGGA 4CFSA 1E96A 3QVGA 2XSZD 2G5CA 4PWZA 2B1GA 1R7RA 4YFYA 2VR1A 5D7BA 3W5IA 3BMQB 1E7RA 1PBTA 4AP5A 4V0SA 3RSLA 3G13A 3BWBA 4C22A 1QU3A 1HLFA 3TSYA 3KUCA 1ULBA 5E7IA 4UEKA 3L6DA 1CETA 2JARA 2W2PA 4FC7A 2Y77A 4YRDA 3C70A 2WSYB 3C97A 3JR3A 4HSEA 1P4HA 1IRXA 2UYYA 1JT2A 3NIWA 1R8YA 3R7WA 5JZSA 2VP5A 5IJXA 5AKGA 2O2XA 1SBCA 1Q14A 2AFIA 1AGNA 1KA9H 1CHDA 1XMQB 4DWVA 3DF9A 1DQZA 3R3WA 4WBNA 1QM5A 4IILA 2I6QA 3BC1A 4RO0A 1X19A 3S2EA 3E7DA 3GBVA 4HX5A 4CV1A 2OO7A 2OEPA 1DAEA 3K9CA 2CVOA 1KEPA 4XDGA 5EKXA 1U9IC 1IQUA 4PVCA 4XGNA 2VZ8A 4QLOA 1HDRA 3GFOA 4F4CA 4H15A 1T1JA 2QF7A 4OSOA 1QWSA 1C1HA 2LNDA 3IUEA 3JVUA 2A9VA 4JT2A 5TQJA 4CW7A 4IWNA 1Y63A 3H16A 4BQOA 3TE6A 2AOTA 4KE9A 4HH3C 4IH4A 5FFNA 4HVAA 1PL6A 2AJDA 1U2QA 2GHIA 2XADA 3CT4A 2W0SA 1IWOA 5HDQA 1DWUA 1R8JA 2GTHA 2X0KA 4XKJA 2YNMC 1JZQA 1STOA 4C0JA 5KTYA 5IT9A 4AQ7A 4DLKA 5J43A 2ZJ1A 3SD7A 3LDGA 3BIJA 3G2OA 3OC0A 3ZOKA 3ACDA 3B12A 3WB1A 2YRFA 2Z83A 3V2UA 1OUMA 4DQ0A 3DMFA 3ROQA 4DR4B 1KMNA 4EO9A 1HOTA 5JT1A 3DQPA 2VH5R 2WAXA 3NOOA 2O52A 2Z2JA 1OX4B 2OV4A 3TB6A 3DT8A 2FN7A 2DFVA 2BM0A 4MLCA 1N7IA 4E2ZA 5H82A 1C7ZA 1SR8A 2B3TA 2CLHB 3IUNA 2FKNA 3A6GA 5JEDA 1BEUB 2QMEA 2GZ1A 2ZUTA 5DNDA 3RC1A 4K8RB 2JPDA 2DYKA 2X8JB 1PEDA 2C8LA 1NOKA 2ZRBA 2P4UA 2VF8A 3G0BA 4Q12A 4RVFA 3ROEA 3W90A 5D2CA 3GLVA 2P7HA 4FGLA 4F21A 2MIIA 3R3UA 1JAHA 3VKFA 4NMWA 1K8ZB 5AOBA 1H4QA 4EPYA 4CCAA 2K6GA 2VCYA 4NZPA 3TH5A 1C8BA 4K6GA 1WUIS 4RHFA 4ZYWA 2PGNA 1WNFA 3EGDB 1XRMA 1XXHB 1SA0A 2WD8A 3I0NA 3PE4A 2QRMA 3TAHA 3U44B 4XWWA 4RETA 1G55A 4RPIA 3SXPA 1U0TA 4C7KA 4D3YA 1U3DA 4G63A 4DILA 4DRZA 4B3SB 4U5XA 3V2GA 1IPEA 2FRDC 3GLFE 5B1SA 3D64A 3ENQA 4C88A 5C8ZA 5F3WB 2RIRA 3A32A 4WACA 5F3RA 1K8XB 3OZXA 4F2PA 3DDWA 4QTXA 5KX5B 4X8OA 4Z9FA 1COZA 4UMVA 4BNGA 1PX2A 3HEMA 3PIIA 1I0LA 1KGDA 4I1UA 4X45A 2P6NA 4YMTA 2GN8A 1YTUA 1MHPA 1H93A 2EDAA 4A92A 2JK1A 4RCVA 4MUIA 2QLFA 2Q3FA 5CJJA 4DJFC 3AY0A 4PLZA 1XJQA 5EXEA 2IBMA 4LYFA 4PC3A 5C31A 1QJ4A 1XKQA 3E15A 4N5LA 1ECFA 2QLBA 1VGVA 5DJ5A 3G49A 4A1FA 5EESA 3EVNA 2RHWA 4RY2A 3ILXA 5ITZA 3V3TA 1B1CA 5DHRA 3UWOA 2L42A 4BO3A 1O9HA 4A4DA 1MOPA 4P22A 4YQYA 3THXB 2WSSA 5JBIA 4PXYA 3PE6A 2CW5A 3CKMA 2ZDGA 3N2EA 4US1R 2GOYA 5CDYA 5LQKA 1CVRA 1EWRA 4MV8A 1HKHA 1WTCA 1ISMA 1DOAA 3IKMB 1EHIA 2RGAA 5IFKA 2VBGA 3AFNA 2WJAA 1XEAA 3C3MA 3E3OA 1JQDA 2XNJA 2P5SA 3IBFA 3HN2A 5DYIA 4E51A 2PTHA 1UXHA 3IV7A 3B1XA 3C2QA 1FNMA 4YQFA 3WFIA 2D62A 2WBLC 3ETEA 5F1KA 2OPBA 1JDJA 1WEKA 1XTVA 1FFBA 1N6OA 1QS0A 1W581 4DCVA 3LC0A 2HF9A 1MX3A 4TV8B 1QTIA 3E03A 3IOEA 1Z4QA 4R31A 1YZ3A 1YK0A 3JQAB 1MA3A 1U0FA 5LUAA 4GL2A 3EZ9A 1QGYA 4L6IA 3VH2A 5EQJB 2C1XA 4P8RA 4LGCA 4IGKA 4KO8A 4TTVA 5HIIA 3KS9A 3I3SR 1W52X 3MINB 4E5PA 4ZZIA 4J1GA 3QW4B 4RPHA 3VKWA 1GGFA 3T1TA 3F4LA 1NLFA 1ZD1A 3GYBA 4EG7A 2V9CA 2HDNB 3GMSA 3UN1A 1BE8A 1C9KA 5CR9A 3GMIA 1KE1A 3K16A 2EEZA 3L18A 4QM7A 3SQMA 2XQIA 3J81A 2UYQA 4PO3X 1YU6A 2ZUUA 1BS2A 1J8MF 4GECA 3KYDB 5HNKA 2O8EA 1JEJA 1CULC 3F5QA 2GVDC 1ODCA 1P5FA 1Y1QA 3ZWAA 2PO7A 4PYQA 1QDEA 3KVNA 3C1AA 2G28A 1WCV1 3DPUA 1N3YA 1QIFA 4L07A 2OGSA 4HVTA 2ZUVA 3BKXA 1WF3A 2O4UX 3GT7A 3LGXA 4M9QA 1QP7A 2YVKA 4ZQHA 4E31A 4PICA 2V7UA 4NAHA 4KLRA 2MCFA 1JTFA 1I5OA 2R8OA 1DKQA 1ORTA 5TNXA 5GINE 3P2MA 1AQIA 3JWHA 1E77A 3CB4A 2V4UA 4YRIA 4MJLA 1Y9EA 1EVEA 2GB4A 3ZQUA 5KTSA 2GN0A 2ZDQA 3JQGA 4CQLA 1UJ6A 5K0JA 4KQ2A 4E13A 2CK3A 3L8EA 4L50A 2Y9MB 2XIQA 5G0UA 5SY9A 5A62A 3UT6A 3WGVA 1G6OA 1UBUS 5A4FS 4OQMA 2R6FA 4I8XA 3ZKAA 4YC7A 1NQUA 1HT1E 1FXUA 1YRYE 1ODKA 1ZD8A 2YNMD 5MGBA 4ASUA 2XAAA 1T9GS 1P4AA 1FFDA 4PGAA 3VJKA 1JR3E 3ZHRA 5LQDA 1UOQA 4K9SA 4JYPA 4O4LB 5GONB 1GGVA 4BMDA 1GSIA 4EIWA 2VT7A 4HBGA 4FOLA 3KD3A 3EEIA 2XR1A 1JRLA 2CBZA 2RGDA 4OB7A 3G85A 4JCCA 2CSUA 2EP8A 1K97A 1YWGO 4MAAA 3N2GB 4M4SA 2QM7A 3KOUA 3SVLA 4MUXA 2WSMA 3W8RA 4C2UA 1C3OB 1K7YA 1GG9A 2DBQA 2IPMA 3K7EA 3REOA 3DE4X 3EC2A 2EQBA 2G0NA 1F5NA 2WM2A 3FBGA 4H4DA 1Y7HA 4OH1A 4ZOEA 5FNVA 5SZIA 1ND6A 3OWOA 1F2UB 1NTRA 5KYYA 2JASA 2HSZA 3U6BA 5HF8A 1JIKA 1H5NA 1VSQA 5JXWA 5K4HA 6PFKA 1GAJA 3OLCX 3I9OA 4CRWB 2EP5A 3A06A 3UWDA 3WX0A 5IJWA 2QU8A 1UXOA 5ICFA 1FFXA 1DT3A 3CWCA 3ODPA 4A5SA 1WMBA 3DGFC 1QRSA 4Q1FA 2HA6A 4FWIB 3SS9X 1VE3A 2JIMA 4TTPA 3S8MA 3ZIUA 2QM0A 3E81A 4B4UA 4KODA 3RT7A 2UXBB 3ZTWA 3S1LA 1RXSA 4UM9D 5HRUA 1PSWA 2F9LA 3D3NA 2VYFA 4YIHA 4RE6A 2XDYA 3VHQA 4NU6A 2ZANA 3FBTA 1VIVA 4PAWA 3OPVA 5KQGA 1V43A 4V3CA 4LK2A 3B9RA 1GKIA 1CBUA 3MJRA 2ISCA 5ELMA 1YQWA 2WABA 1FUUA 2VSXA 3O8OB 2B8EA 4RABA 4A10A 1AF7A 4K9OA 4F9EA 4UDYX 3HGTA 1KEVA 4AG6A 1D7AA 1WB9A 3NANA 3QKWA 4GXQA 3IMKA 4EKYA 2UU9B 2WJVA 3G6KA 3UYKA 5JH7F 4IXMA 4CMHA 5JSUA 4ZT2A 2VDKB 4YJHA 4X00A 2PRKA 1VMDA 3DOHA 3AI2A 1SN7A 3GA0A 4H2DA 2O9JA 4L9AA 1V7CA 4NNPA 1FSPA 1NDHA 5KWVA 3ONEA 5A02A 3E82A 4P93A 1YQXA 3MELA 4D4LA 3DV0A 2VZ0A 2DX7A 5GV7A 1B16A 3FDJA 4EUEA 4YX9A 5MN4A 16PKA 1J1UA 1YVUA 3PGMA 1XYVA 2HF7A 3FUTA 2FLKA 4KN5A 4KV9A 2P30A 4S1VA 1ZPDA 2CHUA 5K01A 4JFRA 5D3ZA 1U3WA 1CT9A 4JELA 4FIDA 2F59A 3W5SA 3UW1A 4CG0A 2F9MA 1UF9A 1GG8A 1ZGCA 5ALZA 4NR0A 4F2WA 3QLUC 3LLSA 5H9WA 2JIOA 3A9SA 4MITA 4DV3B 4URFA 1AGPA 3GZJA 1EQ2A 5AM4A 3AF6A 2DFDA 3F49S 4DPMA 1JFRA 3AH8A 1PWEA 4HB2A 5JO0A 2M6SA 1O9GA 3I8XA 5AW0A 1YU9A 3DZFA 1O6GA 4NQZA 1F4LA 1A4RA 3K0KA 3AETB 4HPJB 4AAYA 3BHIA 4JB3A 3SXUA 1U3FA 1ESNA 1U1DA 3W4IA 1V1MA 3QXXA 4PAOA 1CZLA 3QPWA 3IJEB 3LCMA 3EH2A 3EVAA 2CVZA 4OAPA 1O54A 1MRSA 2RKWA 1P80A 4F96A 4MV6A 3GK3A 1TA0A 4BNDA 5L7TA 4C3OB 2ZRIA 1U1EA 2P9BA 5A5FA 1W73A 4ZRMA 4F84A 5EXDA 2JGIA 3VR4D 1CC1S 1XZQA 2JJ2A 2OFOA 4JDUA 2GDZA 2PQ0A 2ZCJA 3DLHA 2WRZA 4D3DA 1Z4IA 4PQGA 4WJZA 3GT4A 3OLWA 1RS0A 4P6VF 2GKOA 4Q4HA 3VBEA 1QHNA 2X4IA 5EIHA 1A1VA 4JJZA 5FL7A 1TTHA 4EWLA 4BLWA 4GUAA 1WXIA 3O26A 5FWYA 5FIUA 3NKLA 4Q0MA 4YCCA 1CVLA 2HYIC 3HVIA 4W99A 4PZPA 4KE6A 4TLBA 3GU3A 2OOKA 1PDOA 1TIPA 1IJBA 5CVEA 3TVTA 3VDQA 3CUKA 1GGEA 5JHHB 5JJBA 1ARZA 1UMDA 2RK4A 4QT4A 3Q3HA 4BN5A 5A3SA 4MRAA 4P84A 4Z9YA 5EJ9A 2XTMA 3IEXA 2NVUA 4L4SA 1GNRA 5CB4A 3WA6A 2VNKA 3NO4A 2Q3DA 3MJCA 3C7DB 3O82A 3OLVA 4NHOA 1QP8A 2CHGA 2IPLA 4B8ZA 1ZGZA 1JECA 1LNQA 3T9DA 4WXHA 3FFWA 4YRSA 3FYUA 4TKZA 4YMIA 1J2YA 4G8BA 3LOPA 4TYMA 5ADUS 1PQYA 2P75A 1U2EA 2VVTA 2I87A 4GD3Q 3BIFA 3G7UA 2TMDA 3IPYA 4HB3A 4QYXA 4BRWA 4LJLA 3U9TA 3JRXA 5H80A 4JN6B 4MKGA 1KFEB 4DFDA 3KJHA 3X1YA 5INTA 5JQGF 1G2IA 1YBHA 2AQKA 3EIEA 5FLEX 8OHMA 2VQEB 3GROA 1QHHB 1R0KA 2WTAA 1TM7E 1BA2A 3CUUA 2R1VB 3FYHA 3OE4A 3OQIA 4GLJA 3HBFA 3M83A 4FXOA 1VKHA 1VI2A 4RGYA 2N42A 5EGSA