5GY7A

X-ray structure of h243i mutant of udp-galactose 4-epimerase from e.coli:evidence for existence of open and closed active site during catalysis.
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
338
structure length
338
Chain Sequence
MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSSATVYGDQPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGIVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-glucose 4-epimerase
publication title X-Ray structure of H243I mutant of UDP-Galactose 4-epimerase from E.coli:evidence for existence of open and closed active site during catalysis.
rcsb
source organism Escherichia coli (strain k12)
molecule tags Isomerase
total genus 132
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2016-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5gy7A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 5gy7A02
4IPTA 3DWFA 5F21A 3TJRA 1C1XB 4KQXA 3KLMX 2E49A 4DQUA 3L6DA 4FQ8A 4HKTA 1I32A 4AJNA 3R0IA 2XXJA 4I1IA 2YDXA 1O94A 1QMGA 2PZKA 3A06A 4MVJG 1V0JA 3W8FA 2EG9A 2I5PO 4NFYA 2FP4A 4PLTA 4C4OA 4LSMA 1GEGA 4ZN6A 5ENDA 4YJHB 4ALKA 1YL6A 5TGDA 1TT5A 4XGIA 2VRBA 4X54A 3KO8A 2WD8A 3ONEA 1KVUA 4E3ZA 2X5OA 1YB5A 4QO7A 4IIUA 3K2EA 4FOOA 2WTBA 4E30A 2YDYA 4RF5A 2QRJA 3K30A 3FPLA 4DPKA 3ONFA 1O6ZA 4RVGA 1ZCJA 4RQUA 1DOHA 2E48A 2W8ZA 1HE3A 4YJGB 3V2HA 3CZMA 4OH1A 5DN9A 2VNSA 1ZFNA 3WGOA 2CDCA 3SXPA 3CSDA 1NHGA 3FI9A 4AG3A 4F45A 5JY1A 4UVIA 2HRBA 2G76A 4ALLA 2IZ1A 1PZGA 4RCVA 2O3RA 2WM3A 1KEUA 1YE3A 1Q7BA 3COSA 2OUIA 1K6JA 4GKVA 4MDHA 4A03A 1E6WA 5KNLA 2HUNA 1R12A 3G1TA 3PDUA 3PQEA 2X0RA 1JKIA 5L45A 2V6MA 4XRRA 5B12A 2D5CA 3ENNA 4RZIA 2NQ8A 3GUCA 3IP1A 3A28A 3JYQA 3CH6A 2QG4A 3GDFA 2BD0A 4R51A 1YS4A 3QVTA 4DQXA 4P38A 5CG1A 3AY3A 1JA9A 4RVDA 1JKJA 2VUSA 3U9LA 3RUDA 1DC6A 4L76A 4EEZA 4PZCA 3U3XA 3LU1A 4YVFA 4XA8A 4XR9A 3Q9UA 3G49A 1F06A 1DPGA 2GZ2A 3DQPA 3LQFA 1AHIA 3OFSA 1GL3A 2VYVA 4J1TA 3PYLA 4E33A 2HJSA 6LDHA 3X2EA 3V5NA 3PJFA 4RPHA 4I8XA 3H9UA 4YQYA 5JO9A 5BSEA 5ICMA 2ZTLA 3I3OA 1HRDA 4ND1A 1KEVA 1PJ2A 4D42A 3WQQA 4BNLA 1Q0QA 3D3WA 2EJVA 4CQMD 4RF2A 1T25A 3GR6A 4HFJA 4KTTE 1EQUA 1Z75A 4EJ0A 2Y1GA 2HMWA 1ZSVA 1F8FA 3I4CA 2Y93A 3JSAA 2D4AA 4Y67A 1NQOA 1WP4A 1U2DA 2IZZA 4A2CA 5L40A 1DIBA 4BO6A 1B3BA 1ISHA 1E7YA 1W6UA 2GGSA 1GUFA 2VOJA 2PZJA 1BXZA 1R0LA 1T1SA 1JLLA 3BZUA 3DZGA 3PVZA 4OGWA 1GV1A 3I6QA 1VLLA 4IDDA 4LGVA 3ZU3A 2P9EA 1E3SA 4BO7A 1ZUD1 3KEQA 3JQAB 1MV8A 1E3JA 1DC5A 4J1NA 2W2LD 2B69A 2NTNA 1CDOA 3NDIA 2YHIA 4NU6A 5DF1A 3BXXA 4AFNA 3JCZA 2Q1WA 1ZVMA 3F9IA 4NK4A 4WKGA 4L0QA 5JYDA 3JQBC 2EKLA 5IN5A 1O9BA 4D41A 2GN9A 4R1TA 3WSWA 4W6ZA 3WIEA 2EHDA 3G0OA 3INRA 3JD1A 3BMQA 1SC6A 1HE5A 2UDPA 4HV4A 2I76A 3JD4A 4M54A 2EKPA 1LC0A 3LC2O 1T2CA 3GVPA 3I83A 1EVYA 1HLPA 4BKQA 4N54A 2NUAA 5J23A 2AG5A 3EVNA 4PIVA 2HU2A 1ZBQA 3NGLA 3QWFA 1QYXA 3AY7A 4BNIA 3QWBA 4HY3A 4A10A 5C7IO 3V2GA 1BMDA 3TFOA 1P1IA 5LDHA 1LLCA 1I24A 2WD7B 2Y1FA 4OSPA 4FFRA 5L4NA 1Z45A 3AUSA 2EGHA 1E77A 4IS2A 1NQAO 1P74A 1H0KA 4UUNA 3D0OA 5KVSA 1A7AA 3QJ5A 4F6LA 3SC6A 4CMIB 3HDYA 4XB2A 3RSHA 3VPHA 2E6UX 1I30A 3OJFA 3OSUA 4J3FA 1A7KA 5TT0A 4YWJA 4AJ4A 3ABIA 4MVJF 3C3XA 3DBVO 2HMTA 3VH4A 4ND4A 2VCYA 4WJZA 4BGIA 3WXBA 1CRWG 1DFHA 1E3WA 2P2SA 1PL6A 4TKMA 3GN1A 4J49A 3SJ7A 2FWMX 4N5LA 3VZRA 1E3IA 3PHLA 1DXYA 3K73O 1Y8RB 4KUHA 1D7OA 2A35A 3TN7A 2DQ4A 3UCXA 4EDFA 1QLJA 2VUTA 1T26A 2B4RO 3W8EA 4AJJA 1HETA 4E2XA 4NHEA 3C7CB 4BGVA 5CEFA 5CDGA 1B3RA 2P68A 2VWQA 1GD1O 3LC1O 3F6YA 3LT2A 3NAQA 3U09A 1EK5A 2DT5A 2VZ8A 4OKIA 3WJ7A 2X58A 1RM3A 4XZ3A 5AQ1A 1PJBA 1UDCA 1DRUA 4J9UE 1JWBB 4PZEA 4UREA 1O8CA 3K9QO 1KC1A 2PZLA 1M76A 4MP8A 4MP6A 4BIIA 5B4VA 2P4HX 4GMGA 1X7HA 1GYQA 3DBHB 3TZ6A 4BNKA 4K6CA 4ZQBA 2OORA 1Z6ZA 3GRPA 4NJMB 3RCBA 3DZIA 1K0UA 2Z1NA 1OMOA 3HJAA 1NM5A 1RYEA 3JQAD 1D1SA 4NQZA 4U5QA 5TC4A 4DYDA 4ITUA 4OKNA 3Q11A 2E82A 1F14A 1PJQA 1RJWA 3RFVA 8ADHA 2XF8A 5DBGA 2RHRA 3DC2A 1DAOA 3DTTA 2BHLA 2PKQP 2HK8A 2DUWA 1VE9A 4Z0TA 2D59A 4PN3A 1K5HA 2FPIA 4DYVA 3W6ZA 1GEEA 4K1LA 3KLPX 3JQBA 3WBFA 3I23A 4K26A 2PA3A 4YRAA 2QX7A 4YJGA 1XHLA 4PG4A 2X9GA 4RO0A 4CV3A 3FPCA 2BFOA 1NWCA 5THQA 4RV9A 3DBLB 1ONPA 1IY8A 6ADHA 3P2YA 2AE2A 3PLRA 4FD3A 3L07A 4CLXA 2H6EA 3HFGA 3KZVA 4Q3AA 4DL9A 1UR5A 2DKNA 1WLYA 2Y0EA 3OEYA 4RVHA 4Z0HO 4GAEA 1D8AA 3HDQA 5G0WA 2BGKA 2VOEA 1R37A 1WPQA 4XEHA 2X86A 4M55A 4O63O 2RH4A 2F00A 3GVIA 3JQ8A 4AJIA 1IHXA 5COBA 1DRWA 4L4SA 3ULKA 5HS6A 3V1YA 3DHEA 4ND5A 4MPDA 3PFFA 4IJVA 3WMWA 2X0IA 4BO0A 4WLEA 3FCOA 3OIDA 3WGQA 1H5QA 3ZWAA 4AJ1A 4BOYA 1RM5A 5KTKA 1SB9A 4YRBA 1XQ6A 5KJ1A 1E7QA 4HBGA 3R6DA 4BNMA 2UYYA 1YRLA 5ICSA 3N7UA 3FNHA 4BUCA 3VTFA 5F3RA 5ITVA 2C07A 4XYGA 5IDWA 1V3TA 1WDLA 1YH3A 2RH8A 3ZU4A 3GDGA 2W90A 3PYXA 5G2OA 3IJPA 2JCXA 2Y1OA 3TL2A 2GRAA 2YJZA 2RAFA 4XDZA 4RDHA 4C7JA 5HBRA 2J3IA 3AUUA 1CWUA 5JFOA 1PSDA 4E21A 3TL3A 2YY7A 2PLAA 2YV1A 4PLZA 1GCUA 2VHZA 4AJKA 4JQCA 3WWZA 3UW3A 4KWIA 4KOAA 2YV2A 1XYGA 3JQ6A 4YDRA 3RC2A 3AUTA 4DA9A 1LXCA 3BYZA 4CMAA 1B7GO 2YYYA 1ONNA 1ZK1A 4XYEA 4Q3BA 2BFAA 1JAXA 3ETDA 3KM0A 4CM9A 4IINA 3NTOA 4Z6KA 5JO0A 1SMKA 3Q3CA 1IHYA 3E03A 4C7KA 5KVVA 3I9OA 2PH3A 4XYMA 5A9RA 3PZRA 1ZSNA 3KYCA 4JIGA 4J43A 4CV2A 1E3LA 3D4OA 3KRTA 2W2KB 3CMMA 4M89A 1ZK2A 1QYCA 2YFQA 5CG2A 5HM8A 4GX2A 3A9WA 4YJFA 3K8ZA 2Q46A 3N58A 3RASA 5JY6A 3EUWA 1VC2A 5KVQA 3WNQA 4PRLA 4R1SA 2GZ1A 2OP0A 3DMYA 1GCOA 2HO5A 1ZEMA 3ZWPA 2VYND 4EYEA 3I4FA 3OH8A 4GSLA 1ZK4A 1PZEA 1U4OA 1X1EA 3KYDA 4CLDA 2VRCA 4Y6RA 1LDGA 2R6JA 4NZ9A 2DC1A 1DC4A 4RPKA 3JQEA 1G6KA 1H2BA 4FC6A 1TXGA 2D1YA 1ZW1A 3GFBA 1O0SA 2P5UA 3W6UA 1YQDA 2HQ1A 3MOGA 1ISJA 4TRRA 1TT5B 1ADGA 3IP3A 1U5CA 2HMSA 5K6AC 3PTZA 3FNEA 2YW9A 5JS6A 3JTMA 4CL3A 4TQGA 3ZWBA 2JCYA 4IJKA 4O1MA 1S7CA 3H9QA 3K96A 2QQ5A 3CPSA 4P22A 1G0OA 1GU7A 3EDMA 4HADA 1D4FA 1TA4A 5G4LA 5EJ2A 1BWSA 4FFMA 3KUXA 4N5NA 4BO2A 1YBVA 2DU8A 4IQ8A 2CNBA 2NQTA 4M87A 3PHHA 1Y81A 4B7XA 4YT5A 3RVDA 4AL4A 2WYUA 4BGEA 2WE7A 5GMOA 2O50A 4DPMA 3NV9A 2Q1UA 4ZVVA 2UUOA 3KYBA 2XXBA 3L4BC 4HFNA 1I10A 5IDXA 4G2NA 2X23A 4AJEA 4E6PA 2J8ZA 5JPIA 1DHRA 1RWBA 4O5OA 1LLDA 3FR7A 3DTYA 4DMLA 5C3MA 2ZYAA 3TNLA 1U3UA 5C37A 1LSSA 3EVTA 1YJ8A 3BMOA 2VN8A 2Q4BA 3GF4A 5DCWA 1UXIA 4GI2A 2OMEA 5U4QA 1PIWA 3HWRA 4FR5A 4JJGA 3TOZA 1N9GB 4PLGA 4RJTA 1EK6A 1GZ4A 2UUPA 3ZV4A 1LDYA 3UICA 1GUYA 4INAA 3WOHA 1K2WA 3MCVA 3WQRA 1NAIA 4BO9A 1N7HA 2AHRA 4FS3A 3FR8A 4ZQEA 3RD5A 2X4GA 3OMLA 1DSSG 5IDYA 1EE2A 3Q2IA 3BA1A 4BL5A 5L4SA 5KOIA 3SBOA 4PLVA 3VVBA 3HNPA 3D5QA 2DTEA 3UAGA 4I9NA 1YB1A 1YL5A 3D3WB 5ITWA 3OJEA 5MGBA 3DAFA 2A9FA 3V2UA 4YYZA 5KJ6A 1SEVA 4OOEA 1H9AA 4NG5A 3H9GA 1HT0A 2AQKA 3C8MA 2HSDA 3V1UA 2J3KA 1ISMA 4L75A 4AICA 1OBFO 4Y98A 2RIRA 3AFMA 2C5EA 1NWHA 4R4JA 4W7IA 1N1EA 2VNAA 4IMRA 2C82A 4UVHA 1E7MA 3HN2A 1QYWA 5ER9A 4NIMA 2HKIA 3D7LA 4MKXA 3H2ZA 5JNLA 1WAMA 1PGQA 1ZKMA 3IMFA 2GF2A 4I5DA 1X14A 3MJEA 4WLVA 3IOYA 4B4UA 2Q2VA 5EERA 1V9LA 3UH1A 4D43A 3ZU5A 4YCAA 3WS7A 4TZKA 2EERA 5CFZA 1R4NA 2V6FA 2Z5LA 1XDWA 4ONEA 4OO3A 4IQ0A 2PGJA 4I9HA 2YHIB 2IXBA 2JKVA 3QW2A 4TROA 2P9GA 3W1VA 2OO5A 2QYTA 3WIDA 1SZJG 3B1FA 3RROA 1KEPA 2H5LA 3S2GA 3BMQB 1DO8A 3H3FA 2EP7A 4CV1A 1QLHA 1WDMA 4FBGA 3O4RA 4NFHA 3KV3O 1NR7A 1HDRA 3DO5A 1O5IA 3ZV5A 4F3YA 2CVZA 4ZGWA 1M6WA 3LDHA 3DL2A 3CXRA 3M1LA 4MVJH 5COQA 3GT0A 1DLJA 2EW2A 5DCUA 1KEWA 5ENVA 4B3IA 4UUMA 2B5WA 2NU7A 3RQSA 2O23A 2FSSA 1WDKA 1KC3A 3O03A 3JD2A 1HYEA 3AM4A 1QRRA 3GH3A 4J91A 3VPXA 4CM6A 1KETA 2D2IA 3AWDA 1YQXA 3L4BA 1ZJYA 4YT2A 4DBZA 4ZJUA 2VT2A 1J49A 3C1TA 4E2YA 4U6QA 1WZIA 1YBMA 4BQPA 4J4TA 4Z9XA 4IXTA 4ZA2A 3ZWOA 4NFSA 1KBZA 2XPCA 2FPGA 3VH3A 4BO3A 4TWRA 4GGOA 4I08A 2VYVD 4OXNA 4BO5A 3QWHA 1A27A 4IDAA 1V8BA 1PR3A 3I9LA 4CM3A 3ORFA 3HE3A 3PYMA 5MDHA 3H9EO 5HA5A 4CPDA 4JNKA 4NBVA 5JBIA 3U62A 1CQIA 3ZWMA 2NV6A 3E9NA 1LSOA 5G0SA 3OJ0A 1ISIA 4FIZA 1J4AA 1UJMA 4P4GA 1NVTA 4TVOA 4H3VA 3R1IA 2GN6A 1PL8A 3FRJA 3PIDA 4U8GA 4XQEA 1Q7CA 3LLSA 3RUFA 4OYRA 5U1PA 3RAJA 5KVCA 5U9CA 4Q3EA 3EK2A 2O7SA 3GAZA 1EMDA 3W8DA 4BV9A 2NACA 3PGJA 2JJYA 4JP2A 2IYOA 4QFCA 3CTMA 5I8ZA 4LCJA 3NDJA 3JQGA 2X22A 1B8VA 3ZWNA 2E4AA 1EVZA 3AU8A 4LVUA 1LC3A 3HDHA 1U3VA 1C0LA 3L0DA 2CMDA 1ARZA 3S55A 2C59A 4BO1A 4D3FA 1UP4A 2ZYDA 2AEFA 2G1UA 4MIOA 4OMUA 2QRKA 3DMTC 1KVTA 4MJLA 4E13A 4DTIA 1B26A 2G82A 4LVCA 3VDRA 3U5TA 1X0XA 4BMSA 4YB8A 4XCVA 1MGOA 4J4BA 5A3VA 4FCCA 4OIMA 2Q1SA 3JQFA 4G81A 3WQSB 2HK7A 3D64A 2CUKA 2HDHA 3UF0A 1EE9A 2O4CA 5BQFA 4KDFA 1Q1NA 3BHMA 4IM7A 1JDJA 3BTVA 1JW9B 1XELA 1AUPA 4IMPA 1B8PA 2I66A 2CZCA 4L73A 1L7DA 3GZNB 2NVUA 1T24A 3VZQA 5BNIA 1SNYA 5IDQA 1U5AA 4S3MA 3HDJA 3OQBA 3K5PA 1U8XX 1GY8A 1MX3A 2H1SA 1HDXA 1I2BA 3GOHA 3JQ8B 5A04A 4YQZA 2FN7A 3BHIA 4R1NA 2GZ3A 1Y5MA 4GMFA 3NJ8A 1HZZA 3DR3A 3M2TA 1IB6A 3JD0A 3MJTA 4WCFB 1Y9EA 5L9AA 3GGPA 4CMKA 4YACA 4R3NA 1N9GA 2GERA 1CETA 5TT1A 3HFSA 1NASA 1ZMTA 3OJOA 1G0NA 5A9SA 2NLOA 4KZPA 3O8QA 1NTOA 3BMNA 4D7AA 3PLNA 3LF1A 5F1OA 4G5HA 3PJDA 4M86A 3RI3A 3A4VA 4E5NA 2BFPA 1IL0A 3LYLA 4YAGA 1ZJZA 4PVDA 5T67A 4J0EA 1IZ0A 4BMVA 3A1NA 4A26A 1PJSA 3RU7A 4J16A 3DZFA 5CEJA 4BKUA 1T1RA 3IUSA 4GX5A 1GQQA 4J7UA 2V65A 2HMVA 4TSKA 1V3VA 4GLLA 3KHUA 5AYVA 4WE3A 1OOEA 4HXYA 3NTRA 3ZWWA 1LRLA 1ADCA 2VUUA 4ZQGA 1R4MA 3VHRA 2TMDA 1PX0A 4A73A 4DC1A 4TRJA 2OGUA 2RCYA 2V6GA 3EW7A 4GPD1 2WWRA 1GAEO 4G65A 3O38A 2V6BA 3KYCB 3GZ4A 3F5SA 4U0JA 3KB6A 1HDGO 1F8GA 5CDTA 3FTPA 4WLNA 1HF3A 3EAGA 4YJFB 4MVJE 3PFWO 4J9VA 4FN4A 1NBOA 2OBNA 1QSGA 3AFNA 4F6CA 1YBAA 1NPDA 3IKVA 1YOVA 3DMTA 1H9BA 5DBIA 4BNNA 2PWZA 1YONA 2Y99A 4FB5A 4LK3A 5CHEA 4QEDA 3O9ZA 3VC7A 1R15A 1N7GA 2O3TA 1MXHA 3D4PA 3KYDB 2J3HA 2QRLA 4RL6A 3KSUA 3STHA 4D3DA 3WGTA 3PHGA 1ZK0A 4W7HA 3WWYA 4QTZA 2CFCA 4BNVA 2JFGA 5K0ZA 1GYPA 3R3JA 3GDOA 2HCTA 5JMPA 2VHVA 3IDSA 2JHFA 4L4RA 3WTCA 7ADHA 3ANNA 5HS4A 4DWVA 2PD4A 4MIEA 3WGGA 1M6HA 5LC1A 1P0CA 1HDCA 3SEFA 1VKOA 1JVBA 5G0TA 3OIGA 3GHHA 5EN4A 4OOFA 2X8LA 3D3EA 4Z0PA 4XQGA 4XGKA 4WCFC 3TOXA 2IDZA 2ZTVA 1CERA 2Y0CA 4CM8A 4DREA 1CQJA 1KVQA 5T6BA 4CR7A 5L7TA 4PZDA 1U7HA 1C0IA 2LDBA 1VRWA 2F1KA 5KKAA 3JD3A 3PPIA 1W4ZA 2PD3A 1MC4A 4ALIA 3ZN2A 3QVWA 2NVBA 3UGKA 1T2FA 3ONDA 3E6AA 4HFRA 3ZNOA 4WK6A 3I1JA 2DM6A 4H15A 1WZEA 3DZJA 4CMHA 4HNGA 2I65A 5HTOA 3I5MA 3AU9A 5JAQA 3GEGA 1X15A 3ROQA 3OA2A 3RUIA 3VOSA 1Y7TA 5JDIC 4CODB 3QE3A 4EJMA 3AJRA 2JCVA 1WMAA 3WB9A 1J0XO 2GASA 3AW9A 3NJ4A 1HL3A 1NP3A 2ET6A 3GLQA 3QIVA 3WFIA 3IKTA 1RM0A 4PRKA 1LLQA 3CIFA 2BGLA 3LT4A 5JYEA 1BGVA 4CM9D 3BMOB 3GQVA 1QKIA 2C0CA 3ITDA 3ROMA 3KSDO 1UXKA 2VWPA 4R68A 2I99A 3PQDA 3RFTA 1SB8A 5EESA 3VTZA 1M67A 3GEDA 2O3UA 1IE3A 4XGNA 5A4DA 2X9NA 1QYDA 3P7MA 1B2LA 3HQ4O 1B15A 2PFGA 1Y8QA 2BMAA 3OQ1A 4OSOA 1XIVA 5T64A 3SVTA 2DBVO 2Y66A 2W98A 3MTGA 3KETA 4GGPA 1F0YA 5JC1A 3FSRA 2VRCD 1YGYA 7MDHA 3UKOA 3CE6A 1UAYA 1C3VA 4HNHA 5KKCA 4I5EA 1B0AA 3LT1A 3U4IA 2BI8A 4YT8A 1HYHA 3OICA 1T2AA 3G79A 3B20A 1PTJA 4XB1A 3S1LA 1DRVA 4E2WA 2OL4A 4CLRA 4CM4A 4KWHA 5KIAA 3GZNA 4FW8A 2C29D 2EGGA 2AW5A 3C7DB 1D3AA 1MC5A 1N92A 1R4NB 5F5NA 2NU8A 3INGA 4RZHA 3V1TC 5F5LA 5C7LO 1LX6A 4YAJA 3ZWVA 4JJFA 4DGSA 1ZH8A 1H2HA 1QORA 1EEHA 1H94A 2EIHA 3DDNA 3WLEA 1V6AA 4WCFA 3ZV3A 4EGFA 2TMGA 5JC8A 4RPLA 3G1UA 4IDEA 2A4KA 4XRGA 4ID9A 1K6IA 1P1RA 4W9NC 1VJ1A 3H8VA 4II2A 3QA9A 1OZAA 4UVGA 4CMBA 3JYNA 1BDMA 2LDXA 4AJPA 4WEOA 2O4UX 2DBQA 5ILOA 4JBHA 1IOLA 1I3NA 2Z95A 3DOOA 2UAGA 2WDZA 3QHAA 5FF9A 3TPCA 3U0BA 1LSJA 2WYVA 5B4UA 3E82A 5EQDA 2X9VA 2AQHA 1DIHA 3ZDFA 1LRJA 2ZATA 3CZRA 3NTQA 1CYDA 1T2EA 4II3A 4LW8A 5IZCC 1EDZA 1SPXA 3RUHA 5JDIA 5G0VA 3CKYA 3OJLA 5TF4A 1Y6JA 2ZQZA 4GSKA 2O3QA 4IXWA 4R01A 5ADHA 5HWSA 1LLUA 4P4LA 4JX8A 2NWQA 3W4KA 2Y1DA 1RYDA 3DBRA 1NFQA 1WVGA 4RLHA 4PFJA 4UUPA 2BFMA 3E48A 4U7WA 3TZKA 3E9MA 4FOSA 2JHGA 5JCJA 1ONOA 1R0SA 1IPFA 3OQ6A 3P19A 1N8KA 3GUYA 4MVJP 3TZQA 1UP7A 1HSOA 4R5HA 3ZHBA 1W73A 3IL2A 3I6IA 3FWZA 3PWKA 1MG0A 4BKRA 4I5GA 1AE1A 5ER6A 4GLOA 1SBYA 1YKFA 4OL9A 1X7DA 2AQ8A 3EC7A 8LDHA 4LISA 1N5DA 2AMFA 2IZ0A 1I01A 2CVOA 3N74A 5AOVA 1VJTA 3A14A 4J90A 2AXQA 4QECA 4IQGA 1P1FA 2EXXA 3TZHA 4DLBA 1Z82A 1E1MA 4WOJA 5TSDA 3RIHA 1DIGA 4O0LA 3CMCO 4J1SA 4JBIA 4QQRA 5HRUA 3QV1A 2QHXA 5TRTA 1XCBA 4IDGA 1NHWA 4CUJA 3VH2A 2CVQA 5A3JA 2GD1O 1BRMA 3JQGB 2Q49A 1ISFA 1E1NA 2G0TA 3NYWA 4FFPA 2Q3EA 4K9DA 1LBEA 2JD1A 3FBGA 1P44A 4S1VA 1FDSA 1P45A 3FN4A 3ZW8A 2ZCVA 2VT3A 4TRNA 3ZU2A 1EQ2A 4NR0A 2NSDA 1PZFA 4CQLB 5A03A 4NBRA 3JQ7A 1WMBA 4MKZA 3TZCA 4YAEA 1P1HA 1A71A 1GZ3A 4CMCA 1P1KA 3RUCA 4WNCA 2DBRA 4H7PA 3OA0A 2B4QA 1NYTA 4IY1A 1OFGA 1XA0A 3WNVA 1TEHA 1XWFA 3UN1A 3U4CA 1E5LA 3GEMA 3D1LA 1P77A 4M8SA 4E5MA 4ESOA 4GX1A 1F12A 1L7EA 2OXIA 1GPDG 1YL7A 1RKXA 4EUHA 1CJCA 4XR4A 3C24A 3DAGA 4W9NA 5H81A 3OEWA 1BTOA 3ITKA 1LJ8A 1LNQA 2X1HA 1I8TA 1PGPA 1I33A 5F1KA 3DFZA 4ZHSA 3ZHYA 3T7EA 3RC9A 1ZZEA 1PJLA 3LZ6A 2NVUB 2WYWA 4U0KA 4KUGA 2B4TO 1WXDA 2X7HA 3GC6A 4LMRA 4MVJM 4RPGA 5CPBA 3HUDA 1LI4A 1HSZA 1FMCA 4J2OA 5T57A 5COAA 1P31A 1LQUA 4KMSA 3CINA 2Y1EA 4BKOA 5IZCA 1KVSA 3RUEA 2FY8A 4MINA 3S2EA 3NUGA 3V8BA 4ND2A 5I9LA 4J0FA 1PL7A 3ZCXA 2CD9A 2O2SA 1Y1PA 3BHJA 4B7CA 3P2OA 3PGXA 3H5NA 4A7PA 3GMSA 5EPOA 3C1AA 2Q50A 1QV6A 4D3SA 2BELA 3ASVA 3LC7O 4JBGA 3U49A 4RDIA 3S2FA 5JXWA 1N2SA 3PIIA 1LEHA 4RF4A 5DBFA 3RC1A 5A9SB 3KEOA 1X0VA 3O8QB 4OXYA 2YUTA 1R6DA 3BMNB 4O59O 4ZQFA 2H63A 4RF3A 4BNWA 3HG7A 4QFDA 3MZ0A 1JN0A 3QVSA 1YWGO 5L3ZA 1VI2A 3WDSA 2NNLD 1UUFA 3GHYA 3F1LA 1DB3A 3PJEA 5H82A 4BV8A 4MVJA 1ENPA 4DBVO 5FEUA 3NKLA 3WYEA 3H4VA 4B3HA 4BQRA 3ZWCA 1XR3A 1E1LA 1E7SA 3WSVA 4B4VA 1PJ3A 1QR6A 3PDJA 4PG6A 1BXGA 1OC4A 3GVXA 2OHXA 1R4MB 2G5CA 1MFZA 3H5AA 3IJRA 2O48X 3VH1A 2I3AA 3F5QA 4HP8A 4EITA 2I6TA 4ZRNA 3ENKA 4L8VA 3MJVA 3DOJA 1JKFA 4D0RA 4A27A 1NQTA 1AHHA 2FR1A 5IF3A 3FWNA 5DNAA 4EI2A 4XWYA 5GY7A 1XGKA 1B8UA 5JDCC 1P9LA 3JQFC 1NVMB 2O2YA 1YOVB 3DHNA 1PQWA 1SO8A 1ID1A 1ZK3A 3RBXA 2C7GA 4E2ZA 3VPGA 3I9MA 4PLCA 1KERA 3RKRA 2RHCA 2VHYA 3M6IA 1TB4A 1CEQA 4WECA 1QG6A 1ADFA 1NNUA 5TIIA 2GUGA 3DZHA 2VTDA 4GWKA 4UEJA 4WLOA 4AJHA 3PHIA 1F17A 3AOEC 2O3SA 4PG8A 3RBVA 3ASUA 3L9XA 5CAEA 1JU9A 4F46A 4IZHA 3PQFA 3WLFA 1I3MA 1U28A 3Q9NA 3WJAA 5CEEA 3SLKA 4FDAA 1I2CA 3IS3A 4NU5A 4PLHA 4WPGA 1A5ZA 2FZWA 4A5OA 2J6IA 3C7AA 1PWZA 1DHTA 2PGDA 1I5RA 2UV8A 1MFPA 4CM8B 2D8AA 5DDIP 1MUUA 3EHEA 3ZV6A 4DVJA 3RU9A 4R69A 5FWNA 4RLSA 5FYDA 3K31A 1BDBA 3WGYA 2D5AA 4E31A 3GPIA 1CF2O 4W4TA 2BKAA 5FI3A 3MTJA 3ZWYA 5L53A 2OP1A 3HADA 1C0KA 4GBJA 4Q9NA 3ZZNA 3GG9A 2HLPA 2OZPA 1TI7A 4WNIA 1KIFA 1ZSYA 3PWSA 5GZ6A 4ALJA 4CUKA 3H5RA 4IZIA 3INTA 1PJCA 4XQCA 1ZO8A 2GYYA 3GRKA 3H2SA 2HJRA 3IUPA 4NBUA 9LDTA 3WGIA 1H6BA 4EUFA 4EZBA 2QW8A 1FDUA 1LDNA 5G4KA 3KXDA 4DLAA 4E12A 3NX4A 5BNTA 4NBWA 1U3TA 2VHXA 2XAAA 3QP9A 1A4IA 3KVOA 4HWKA 1N1GA 1PU2A 5DP2A 1E7RA 2CDBA 4CR6A 1DFGA 3GY0A 2FR0A 5H83A 3I52A 2B35A 1YQGA 2A94A 4NMHA 1FK8A 1E92A 4EBFA 3ZW9A 3WTBA 3QY9A 3WBBA 3WGZA 5L4LA 2HRZA 1I36A 4TRMA 3NEPX 4LSWA 3FF4A 2AA3A 1Q0HA 2JD2A 3KOUA 4WOKA 2DBZA 3NT4A 5CDSA 2Y1CA 4CQLA 1MG5A 2Y05A 2NADA 4FFOA 5JW6A 3VPFA 3FTNA 3LF2A 2IRWA 2YZ7A 1Y8QB 4Z3DA 3JV7A 4BNYA 5JAZA 1NFRA 1A4UA 1H93A 3E18A 3RBZA 3DEYX 5JDCA 1GADO 2YHUA 3DONA 3F1KA 3I9KA 4YJDA 3AK4A 3M1AA 1U8FO 1GTMA 4FC7A 5AXAA 1ENOA 1KVRA 5TS3A 3QWAA 4OHUA 3TFQA 4B4WA 4IDCA 1UAGA 1Q7GA 1YXMA 1VPDA 1DLIA 5B37A 4B79A 4PLWA 2WEKA 4CLRB 1HKUA 3HB5X 4CM4B 4JP3A 1X1TA 3AOEA 4BS9A 1LA2A 1I0ZA 4QUKA 4URFA 4BNGA 1BW9A 4BNXA 5I7EA 2PTGA 4BB6A 2Q4EA 5DOVA 2G17A 2JFFA 4AJOA 1PQUA 2X6TA 5AVOA 2NTVA 1V35A 4B4OA 2BLLA 2ZTUA 4OQYA 4R16A 1EVIA 4OXKA 3HHPA 3UCFA 4CM1A 4M1QA 3WX0A 4D0SA 2R2GA 1X7GA 1QV7A 1SOWA 2JD0A 3BTUA 1ADBA 4FFNA 9LDBA 1EUCA 1Z73A 3E1KA 4RGBA 4B7UA 1M75A 5AXBA 3ST7A 3Q1LA 1X13A 1G1AA 2PZMA 3DHYA 3WR5A 2C54A 4E5KA 3EYWA 1GV0A 4FGWA 5BSFA 3QWIA 5AXDA 3OECA 5IG2A 1VM6A 1A9YA 4YRDA 3ZH2A 2C2YA 3E9QA 3M2PA 1HLDA 4N7RA 4IBOA 4IJUA 2IE0A 2HMUA 4BGUA 3GAFA 3JQ9A 2PKRA 4GKBA 4PCVA 4XKJA 1E1KA 2B37A 3OP4A 4YAKA 4YT4A 1E0DA 3ZNQA 4E4YA 1EBUA 1ULSA 5JMWA 5KJEA 3LLVA 4NK5A 1NXQA 4E5YA 1NX6A 2AEMA 4PLYA 2FRDA 3MEQA 2YQ5A 3AI3A 4NPCA 3DBRB 1Z7BA 3UCEA 4WLUA 3FHLA 4EJ6A 2NVWA 1Z7EA 2AQIA 4TZTA 2Q1TA 1WW8A 4LMPA 2Z1MA 1BG6A 4ALMA 2DFDA 5I7FA 2V7PA 1K3TA 1GFSA 4GL4A 4RVFA 2GO1A 1VSUA 1I2ZA 4BNFA 4Z9FA 4XIJA 1GPJA 2QIOA 3S2IA 1FJHA 4TKLA 4WCDA 4J6FA 4DIFA 4Q3NA 3LVFO 3QLJA 5KCZA 5THKA 3SC4A 1LDBA 4BO4A 1XSEA 1NPYA 4QXMA 1DBVO 3H65A 4KQWA 2Q45A 4BO8A 3DZBA 3F47A 3GFGA 1P1JA 1UH5A 4DIOA 3KSZO 3Q0EA 4ZICA 1ENYA 5LDGA 1A9ZA 3F46A 1PJ4A 1VSVA 2VWHA 2CY0A 2VZ0A 3AM5A 3WFJA 3TWOA 1TVEA 2GLXA 1LQTA 3ICCA 3SJUA 5B1YA 2IEBA 1R16A 4R41A 1C1DA 3NT2A 1LUAA 1AXGA 4O6VA 1LU9A 3RUAA 4B8WA 4BNJA 5JLAA 3ZI0A 1BXKA 2VQ3A 4DRYA 4FSHA 4YAIA 5I8WA 5T8KC 3RJ9A 4XD2A 2ZCUA 4BHTA 3FNGA 2WSBA 1WNTA 3JQ7B 3FNFA 5IJZA 1UZLA 3I9NA 4CMJA 1FXSA 2ZB3A 2OOSA 4QT0A 1ORRA 2GSDA 4AJ2A 3LSYA 3B1JA 2DAPA 4R54A 2XOXA 4CJXA 1HDOA 1PR9A 1Q0LA 2EV9A 2PNFA 5TX7A 2X5JO 4FGSA 4YTEA 1E7WA 1I3LA 1ZNQO 5L7YA 1MP0A 4EEXA 2P5YA 1TT7A 2P4QA 4Q3CA 3BMCB 2A92A 2CF5A 3Q2KA 4QSMA 2PGLA 4PG5A 5T5QA 3VKUA 1SAYA 2DFVA 2NU9A 4IDBA 5IFLA 1NVGA 5A06A 4OAQA 4OJNA 3S8MA 2J5RA 2Y68A 4TMFA 3UXYA 1T2DA 2B36A 1EUDA 1U9JA 3PHJA 3LT0A 1Y5RA 4Y9DA 4NI5A 4BKPA 4KUEA 4GWGA 4JJIA 4R1UA 4BNHA 1AXEA 3UVEA 4GVLA 5JE8A 3IAHA 5TNXA 4CV0A 1TLTA 2YV3A 5JCJD 3JYPA 1E6EA 1QP8A 2CDAA 3IQDB 4WGGA 3KBOA 4CQMA 3ZGYA 1XLTA 3B1KA 3WGHA 1EFLA 4XX0A 3GVHA 4Z3KA 3L9WA 1E6UA 1NFFA 3E8XA 1LDEA 4IIVA 4L74A 1W0CA 1C1XA 3P5SA 3PP8A 1YB4A 3OETA 4WUVA 1J6UA 3O26A 1PGJA 3H7AA 3VAZA 4D44A 1FDTA 5TQVA 3VKVA 2C2XA 4JXKA 1W8DA 5DULA 3MWEB 1EUZA 2POQX 3HN7A 1KOLA 2JAHA 5IXYA 2DLDA 2ZYGA 1V3UA 3HZZA 2X0NA 4UVEA 4YJHA 4D45A 3VVCA 4XQ9A 4FJ2A 3VZSA 2JFHA 4E32A 2FHSA 1LTHR 4R3WA 1LRKA 5I7VA 5DZSA 3AI2A 4ZD6A 4W99A 1HDYA 1BXGB 3EY4A 4N18A 2W2LA 4IJWA 3PJGA 3BIOA 3JQCA 1H6AA 2DTXA 3G17A 1NPTO 4BNZA 1BVRA 1Y9AA 2GN8A 2J3JA 1PEDA 1IUKA 1PQPA 2O7QA 3FD8A 4UVDA 4BMNA 5BSHA 1GQ2A 4HFMA 3UFXA 4MP3A 5TLSA 5I7SA 3D5TA 3QVOA 5IZ4A 2D3TA 1S6YA 4MOWA 3GVCA 3GGGA 3PXXA 1JAYA 2P9CA 2RBEA 2ZKLA 3H3JA 3WG9A 3PWZA 3AOGA 3GN2A 4P8RA 5EQFA 1DEHA 5T8KA 4K28A 4JGBA 1P0FA 4YA6A 3ON5A 1KY4A 1UDAA 2ILTA 2P91A 3CUKA 2ZB4A 2O3JA 3OBBA 1EVJA 4Q3DA 3NRCA 5BT9A 1HE4A 1DJNA 5TJ9A 5EL0A 1KYQA 4R9SA 1EZ4A 4GQAA 4FFLA 1M66A 4CLOB 1PS9A 1EDOA 2BH9A 1IYZA 5DCYA 4IGEA 4K6FA 4W82A 1PJTA 3ZNNA 1B14A 3ZNPA 1EBFA 1VJ0A 4RPJA 2I67A 2PD6A 3GGOA 2FOIA 2YQ4A 4I9UA 4ILKA 3EMKA 5ES3A 3U4DA 4ZQHA 2DPGA 1C14A 1JWAB 1XQ1A 2OFPA 2IXAA 3C85A 4J2HA 2I3GA 3IIEA 5B4TA 2B5VA 3QRWA 1R66A 3ROKA 1OI7A 1ML3A 1GZ6A 3TSCA 1NQ5A 5KJFA 1HEUA 3RFXA 3B70A 3X2FA 4DXHA 3DXFA 5FFFA 5FI5A 1PS0A 4XIYA 4J7CA 1VL0A 5EIOA 1BHSA 2PK3A 2B0JA 3FBTA 5K9ZA 3GA0A 1MB4A 2CF6A 1UZNA 2FSVA 4CL8A 2DTDA 5I9NA 3F3SA 1O95A 3I9JA 5GZ3A 2NTJA 2C7VA 3DFUA 1O89A 1ZXBA 3T4XA 3DAPA 4JROA 4XYBA 1U2GA 3VZPA 2H9IA 3QQPA 1BSVA 2ZB7A 4QO8A 5F1PA 2VHWA 1SOVA 1HWYA 2JL1A 4WEQA 2SCUA 4BNTA 5JAMA 1VL8A 4MVJD 3QVXA 1OAAA 3F4BA 4YXFA 1MA0A 4J1QA 4I5FA 5G4KB 4MO2A 2R00C 2EP5A 4J4HA 4CUZA 4JN6B 2HK9A 2ZK7A 3GMDA 4DC0A 1XKQA 3JQAA 3NGXA 2BI7A 3ANMA 3UOGA 3E5MA 3C1OA 2WJPA 3LK7A 4FJ1A 4R5MA 3TRIA 1DIAA 3DZKA 3PZBA 1IPEA 3L6EA 3WYCA 3ANLA 5LCXA 5G0UA 5ILGA 4XDYA 3G3EA 4BVAA 3K92A 4XJSA 1SEPA 1XEAA 1A72A 1GQYA 2NM0A 4UUOA 1VKNA 3U4HA 1ZIDA 4P4NA 1E5QA 3ICPA 4ND3A 1UZMA 5A5FA 2ZQYA 3W4JA 1YJQA 2VWGA 3ETGA 2W4QA 1ENZA 4PVCA 1U7TA 4CMEC 3VDQA 2EJWA 4CMGA 4OQZA 4CM7A 2WMDA 2X5KO 3PEFA 4WASA 3AI1A 1YO6A 1HDZA 1XG5A 1IZ9A 5DP1A 2AEJA 2WD7A 1YDWA 2ZJ0A 3D4NA 1UXJA 1DFIA 3EGOA 4LRSB 3KTDA 1K6XA 1Z74A 4L9RA 3L77A 2GR9A 1HZJA 3OIFA 3BMCA 3CEAA 3MJCA 4PGFA 4B8ZA 4CMIA 3ZWXA 5BSGA 3IC5A 5EINA 1ZEJA 3NT5A 4CLHA 3PRJA 2PKQO 4Y6SA 2ZB8A 4EUEA 3B6ZA 3DB2A 4YEDA 4DIBA 3PK0A 1AN9A 4NDNE 3RJ5A 3Q6IA 3TDKA 3ADOA 3MWDB 3HB4X 3NDRA 4YBZA 2C5AA 3AM3A 2VZ9A 3WICA 1P3DA 4RORA 1K89A 1PS8A 4BNUA 1BW9B 1C0PA 4A0SA 3R3SA 4KTVE 5IAAA 1PGOA 3GK3A 1GR0A 1E3EA 3JQDA 1Y8RA 3SLGA 2D0IA 4RQTA 4Z9YA 1DAPA 4NH4A 4UEKA 3ROPA 2I9PA 1SCUA 3DOCA 1R0KA 1LSUA 5A05A 4DMMA 1EFKA 3H9JA 5L7WA 5I9MA 5BNFA 3TQHA 1DIRA 1UXGA 1UXHA 2GNAA 4TVBA 4JLWA 5AXCA 4AVYA 5CPFA 2EWMA 2Y67A 1I3KA 1NAHA 3GNQA 2DPHA 4XJTA 4R9RA 4IS3A 4EW6A 2FR8A 4CM5A 3PI7A 1U4SA 2GN4A 3DBHA 4MIYA 1JQBA 5A9TA 3RC7A 1AGNA 1GYRA 4NJMA 4ZRMA 3EZLA 5DT9A 1PZHA 3T7CA 1FF9A 2CSUA 5DOZA 3RWBA 4D79A 1NR1A 3HSKA 4Q39A 1ZXLA 3GNTA 4UULA 5CP8A 3BTSA 2PH5A 1DC3A 1M2WA 2GPTA 3BTOA 4JK3A 4PG7A 2R00A 3AUAA 1VL6A 4L4XA 4WLFA 3F4LA 4AJLA 2DVMA 2J5QA 3QSGA 4KDEA 4E5PA 5GZ1A 1UP6A 1D1TA 4NBTA 4PLPA 2IEDA 3AY6A 5CDYA 4NNJA 1KY5A 5IN4A 1JVSA 2QYSA 1Q2XA 2ZIZA 1UDBA 5IXSA 1DDOA 2VYNA 4E0BA 4DLLA 2YFHA 2VTEA 3GNSA 1WWKA 3T4EA 4ALNA 4LCEA 3DBLA 1U1IA 1J5PA 4QX6A 3UHAA 5C5IA 3ETEA 4CMEA 3L6OO 4B3JA 3L4SO 2PV7A 1T4BA 3TF5A 1IULA 1ZMOA 5A02A 4UAGA 3VPSA 2EEZA 1XU7A 1YDEA 5A5EA 2Q99A 1XU9A 2IYPA 3RKUA 5JCXA 4CLOA 4Y6PA 1PGNA 2IODA 4GX0A 1HTBA 1YVEI 4Y8VA 3H6KA 4DQVA 1DJQA 2UVDA 3GG2A 1P33A 1C1DB 4FJ0A 5K6AA 4CLEA 4D46A 3ZHZA 5BR7A 2EW8A 4M49A 4ZU3A 2OBYA 3EZYA 2ZTMA 4HUJA 1ISGA 2E37A 3W4IA 1QXSA 3OF2A 3MJ4A 1BVUA 2QZ9A 1FDVA 2EKQA 3ADPA 3E5RA 4OM8A 4DPLA 2BF7A 4ROSA 1CIVA 2HAEA 3JYOA 3K6JA 3JYLA 2AG8A 1MLDA 4YR9A 5JSFA 2B83A 4LN1A 4RVSA 5TJHA 2QZZA 2ZJ1A 4GH5A 2Q2QA 5EMHA 4XYLA 5KWEA 2NU6A 2PY6A 1MXFA 3OHSX 1L1FA 1QYVA 3OM9A 3BAZA 2J5KA 5C7OO 1PWXA 3K2BA 4N5MA 5A1TA 5KJCA 3WMXA 4LRTB 3SX2A 5JAIA 4HX5A 1JTVA 3ZHXA 3JQ9C 3WYBA 1GDHA 1LDMA 1OC2A 2BRUA 4PLFA 4MKRA 4RVUA 1FDWA 4NJOA 1HE2A 1U3WA 2DUUA 4J7XA 1RM4A 4IUYA 2AE1A 4IGFA 1HYGA 4KP7A 1E3WB 1H6DA 4IDFA 5L51A 4CR8A 2FPPA 2WE8A 3MOIA 5L95A 1GUZA 2BGMA 2C20A 4BB5A 4GVXA 2GCGA 2FZEA 3GPDG 2W2KA 1ULUA 4FPXA 4H16A 4UEOA 1B16A 4DUPA 1KS9A 2X0JA 4MVJI 1H6CA 2EF1A 2PR2A 4YPOA 2Y0DA 2GDZA 3MJSA 5CDUA 1T4DA 1HXHA 1RPNA 4U6SA 4CQMB 4JCOA 2Q2WA 2FMUA 3UUWA 2JAPA
chains in the Genus database with same CATH superfamily
3SFTA 4IPTA 3TRDA 4G0WA 5F21A 4DBLC 1C1XB 4IGIA 4KQXA 5C52B 3LHFA 3MMNA 2ZJ5A 4UARA 4WTOA 1YS2X 3L6DA 5JNSA 3UG7A 2HIHA 4GKAA 1I32A 1I4LD 4AJNA 2FSFA 4DE5A 2ZBRA 4AP9A 1AZWA 1KPIA 1O94A 1QMGA 3BBPA 2YXLA 3LM8A 4BJ5A 3SQXA 4ZI7B 2EG9A 4AZ0B 2W2TA 4HWOA 4DB2A 4UU7A 4QWWA 3RRFA 3V4OA 4NFYA 4C4OA 1CD5A 3CLRC 3C14C 2QL9A 221PA 1YDHA 3SYLA 3ZYCA 5LP1A 2VJLA 5ENDA 2OCPA 5AVQA 1IZ8A 2CDRA 2C2MA 4JBNA 2XB4A 3EMVA 4GMDA 4OL0A 4KPFC 1MO6A 1R6XA 1SVSA 4HCJA 4Q4HB 5TGDA 4AQYB 4XGIA 4FT2A 4FINA 1Z4IA 2ZBDA 3T7IA 5JPDA 3KL4A 3UK2A 4ICIA 4DLSA 3L84A 1TOAA 3EUEA 3KO8A 1M2GA 3ONEA 5IM4F 1KVUA 4NU0A 4WA7A 2YNMC 2QTZA 3C6MA 1GTVA 3FZQA 3K2EA 4QO7A 1ZGHA 5E9JA 2WTBA 4RSHA 1G38A 1N6HA 3FHTA 4JT4A 1QIHA 4RF5A 2QRJA 4DPKA 3D2LA 2IEAA 2WABA 4ZIRA 4RVGA 4KFCA 1KDTA 3G82C 5FNVA 2FSPA 2O8EB 3NCTA 3JVVA 3GEEA 4XUEA 3RFFA 1O6FA 1XU4A 1HE3A 1RFGE 3H5WA 3V2HA 1CR1A 1CUGA 3G85A 5DN9A 2C7QA 2O54A 3IR5A 2H11A 3RS4A 4LOAA 2XXAA 4CF4A 4F45A 1Z16A 3ISJA 3QUBA 1NLFA 4W63A 5K3OA 4CHGA 4Q3KA 3T7SA 1JHZA 4ALLA 1L8OA 4RCVA 3V4RA 1EWRA 3U81A 4UZFA 2VJCA 3U7GA 1KEUA 3VYVA 3REQA 4G1FA 1OH8A 4HF7A 3LQ1A 1IMJA 4DWOA 1FUEA 2QV0A 1SZDA 1G63A 3GA5A 4IDXA 4LE2A 1XZQA 3IX7A 3NGMA 4GKVA 5FB3A 3CY6A 4G8DA 4A03A 1ZOOA 5F7OA 2HUNA 1J8DA 1R12A 4NRDA 1JKIA 5L45A 3PUWA 2D5CA 3ENNA 4RZIA 4Z4HA 1RHQA 2WYHA 4KQMA 3I42A 2NZUG 3EAQA 3P9PA 4LQDA 1YS4A 3IPLA 2CEKA 5KU1A 1X9HA 4M1MA 2GEDA 3LZDA 1AZLA 5F7XA 5K8IA 4A8PA 4UTNA 5JAHA 4KN9S 4S04A 2WFLA 4IRXA 1BHQ1 1KK1A 2AVDA 4LJ9A 1J0AA 1PWHA 4PZCA 2HGZA 4OQMA 1NXPA 2W8BA 4XA8A 1N57A 4XR9A 4YVFA 5I7AA 3LUKA 1W1UA 2XY4A 4QDUA 5D5QA 5JZSA 3G49A 5K8LA 4LJRA 3GRFA 3JRNA 1F06A 1O2DA 1ZIYA 2GZ2A 4PNPA 1AHIA 3P2MA 1GA6A 1GL3A 3IV7A 4J1TA 4AECA 4LC1A 3K94A 2HJSA 2YIJA 3X2EA 2WB2A 1FYDA 5ALZA 2HWUA 1N4DA 5FOVA 3VNRA 2XNDD 2ZTLA 4MV9A 4CKXA 3KB1A 2LIPA 3SVZA 1D0VA 2GZSA 3ABRB 3M7IA 1Q0QA 3PC8C 3V7FA 2OQRA 4AZ3B 2E7ZA 5GIPE 2WG1A 3WLLA 4KTTE 2HIAA 4B35A 5EUCA 2KLBA 1ZSVA 5K3AA 4RA6B 4R7ZA 1FFCA 2HLNA 2XRMA 1JLKA 2D4AA 3OZWA 2XE7A 3I28A 1EPUA 2PV0A 4BO6A 1L7QA 4HAUA 4EZEA 1KQFA 4AMUA 2XBUA 2YXDA 2ZT7A 4Y1RA 1GUFA 2PZJA 3R5XA 2KBEA 1CRPA 2SCUB 4MEAA 2YVAA 4X85A 4N3AA 4OQNA 3BZUA 5AVJA 2H2FA 521PA 4B31A 4CG1A 1NIPA 3DZGA 3PVZA 4ZOLF 1Y3FE 1VLLA 3K5HA 1E4YA 4G0ZA 2P9EA 2XR1A 5A6SB 1E3SA 1WBJB 1ECBA 1KORA 1VE1A 2AI1A 2PM8A 3B2QA 5NULA 1RBMA 3WDKA 1XJQA 3KEQA 4ZHQA 8MHTA 5FA6A 1COZA 1E3JA 2HSGA 1Z4QA 2VDWA 4ATNA 2R85A 4ZVTA 3SYNA 4Q9AA 4RGQA 2NTNA 1CDOA 2QPOA 3B85A 3H18A 3K15A 4WFIA 5U4XA 2EZUA 2AG6A 3EHDA 1P2SA 4C6TA 1RRFA 2Q1WA 2XNKA 2WTAA 2Z09A 3U7EB 4U7FA 2F3UA 1O9BA 1AN0A 2CD7A 4YJ2F 2GN9A 4R1TA 3WSWA 4EKGA 1KR2A 2FXIA 2FZKA 4FP9A 1IXSB 4RGYA 2J87A 3N2KB 1HE5A 4MWBA 3VR6A 5IKOA 1GTSA 4JR2A 4M54A 3LC2O 3W2EA 3I83A 4HQLA 3OU2A 4B44A 3L46A 2AG5A 3GMIA 1X8KA 1ZBQA 1P4JA 1KXJA 2HK6A 1QYXA 2Y8EA 1CZNA 2J59A 2X3FA 3NGLA 1USGA 1FX1A 3QWBA 5HKAA 2BP7A 3NWEA 2B1IA 1GDTA 1N5MA 3TFOA 2MHCA 3CNBA 1PG2A 2WD7B 2Y1FA 5JH7A 4TMKA 2VT6A 4OSPA 3AUSA 4R2LA 1EM8B 3SC2A 2JRLA 4GWLA 1Y63A 4IS2A 3MW8A 2B5OA 1E6MA 1H0KA 3QENA 1XEFA 4ISBA 1E2UA 4MLCA 4UUNA 4Y2QA 5IJAA 3WP1B 1ZC4A 5IVDA 3IYLW 1K75A 2Q9CA 3D6VA 3SC6A 4AX8A 3GLFA 5EWMB 3TOVA 1RAFA 1YZGA 3FPBA 3MFYA 2ZJ2A 2E6UX 4NYMR 8ABPA 3DB1A 3OJFA 2XTJA 3OSUA 4PIMA 4RK7A 4ETMA 4DILA 3QLUA 4YWJA 1ZGGA 3ZOZA 5HSGA 4JFAA 3IV6A 4K8OA 2Q6KA 4RPCA 3VH4A 1RMYA 2Z4SA 4PAOA 1AV7A 5HQTA 1CCWA 3QFCA 3QTBA 2XHZA 4QARA 4ZO8A 3TTWA 1PL6A 1TMGE 3HPQA 3QXGA 4EO9A 4J49A 1Z37A 2FWMX 2YXPX 4OM7A 2I6FA 4TL8A 1W4LA 4ISCA 1XXLA 3PHLA 3OPNA 4Y7CA 1GGEA 2HO4A 1Y8RB 2P9HA 2R6HA 2DQ4A 5F33A 1DELA 1VBMA 5CLHA 3LI2A 2NO6A 4DR5B 3JWHA 3PNLA 1PFVA 2OGSA 1SK8A 3SF0A 3ZD8A 1MV5A 4AJJA 1S8NA 3PICA 1CP2A 1SCUB 2QL6A 1GTJ1 1O97C 1NNI1 1M1YB 1Z2EA 3S4YA 3VU1A 1B3RA 1O95D 2P68A 3QU7A 2RHDA 3ZX5A 1DJLA 3QOFA 3PNYA 3YASA 3RVLA 3WJ7A 4OKIA 3FRHA 4P6VF 5BPFA 1IN4A 2R8RA 1UDCA 3W79A 4F5ZA 4UTXA 2G9NA 4MQ5A 4OK6A 5JYCA 2UUBB 1T9CA 5BMOA 2HY7A 3JASA 4JJ7A 5E2IA 1TJ5A 1TW2A 4F2PA 4U9HS 1X7HA 1H5NA 1MRNA 2JFYA 3TZ6A 4QJ3A 2H07A 3DE1X 4PFKA 4RWZA 1Z6ZA 3RCBA 2XV1A 4EB6A 1K0UA 2WSSD 3B7GA 4YIKA 1OMOA 3RTDA 3HJAA 2XKJE 2ZPTX 4ER7A 1D1SA 4RKWA 3CN9A 3V6MA 4ZVOA 1F2DA 5JZ9A 1PBTA 4W5OA 4ITUA 4LJ5A 3L7YA 1J20A 4IXNA 4OKNA 3Q11A 2H1VA 4EK9A 4EUNA 3AL2A 3DNPA 2RJ3A 4I50F 1GLVA 3G88A 1TJYA 2PLFA 4Y2TA 4ACAA 3HXOA 3LPAA 1JDNA 1G21A 5HKBA 5DBGA 3DC2A 3T35A 1OU0A 4OX9B 3TZLA 2A86A 2Z04A 4G0QA 4MVWA 3EFOA 1TW3A 2D59A 4PN3A 1K5HA 1DWQA 3AEUA 5J63A 1KH1A 4DYVA 4DJEC 5H9VA 4KXQA 5D6OA 3H1BA 1Y7LA 2OCLA 2ZWPA 3I23A 2PA3A 4K26A 4YRAA 3OKCA 1XHLA 4PG4A 4ZDKA 1VBKA 1N6RA 2BFOA 2Q2NA 2QG6A 3O2QB 4F8JA 4TV8A 4MR8A 2J0UA 1NWCA 3L7JA 3QF4A 2BMWA 2JPDA 4P80A 5LUBA 5JHHB 2XH8A 4A2WA 1ONPA 3FPGA 4FXPA 2YIVX 3RU2A 3W05A 3KZMA 3O8OB 4FD3A 4ZV9A 3EZ6A 3U7QA 2H6EA 3KZVA 3OEYA 4Y2UA 4GAEA 3HDQA 4F93B 3B2NA 3IAM1 1QQ6A 2PS9A 1LI7A 4DM3A 2NZJA 3IBYA 1WPQA 3W0LB 1LPNA 5ALPA 5FHRA 2G70A 3KQHA 1BX1A 4KR3A 1JSZA 4ZPJA 1P2DA 3FOWA 3PL5A 1JZSA 2R68A 3CX4A 3EWNA 1FP4B 3JQ8A 4AJIA 1DRWA 4CKBA 2EYUA 3X1KA 3DHEA 3PUIA 4FX2A 4WWHA 4BFWA 4IJVA 3WMWA 4RTOA 3OUTA 4WLEA 1EVQA 3OIDA 3WGQA 3ZWAA 5IT4A 1W48A 4LZPA 2CHUA 4YASA 4YMVA 3T34A 1SB9A 2OEPA 2XGOA 1D2HA 1O0CA 3R9KA 5FOXA 2P69A 2WJHA 1YRLA 3PEVA 2P9ZA 3FNHA 4MB0A 4OA8A 4BUCA 1X3SA 1PX2A 1T1GA 1ODTC 2FJUA 3CONA 3O90A 2H92A 5EXSA 1X19A 3D54D 4FUQA 1RIIA 1QMPA 3EXIA 1RC8A 1TU3A 5CFQA 5IM4A 2N9UA 1YH3A 2ZM5A 5FBZA 3NOXA 2ZDQA 1F7UA 4CFYA 1KH2A 3GDGA 2W90A 3PNSA 5JISA 3IJPA 2XSZD 1DT3A 2ZR0A 4KFTA 3K4HA 1N2IA 2YJZA 4B6FA 4EG8A 2YRFA 4GZLA 4BUZA 4RDHA 2FR8C 2XGSA 4IYJA 2J3IA 5JFOA 3ACDA 2BBSA 3MILA 1YVRA 1UBUS 3DOIA 3IUYA 3R09A 1YTUA 4MS3B 2JBAB 4OGFA 5JIBA 1EG7A 4KVZA 4UHFA 3UW3A 5DWQA 4KOAA 4XCQA 4FK8A 5DNYB 2YV2A 1XYGA 3UATA 3AUTA 3LHSA 4DA9A 2B99A 2JASA 2MSCB 3EG9B 3JVEA 5HIJA 4D1YA 3KR0A 3C2QA 4Q3BA 4M1KA 4R98A 1ZN7A 5G1OA 4E4RA 1MBZA 3OLYA 4IINA 5LJLA 2ZE8A 1JH9A 3LCMA 4AO6A 2QN7A 3MIZA 3Q3CA 4V02A 3I9OA 1AUQA 5BN3A 1YKGA 3B51X 4M9XA 5HF6A 3ROXA 2EWWA 1SVNA 4F9TA 4ODIA 1JQAA 3KYCA 1OFUX 1GKYA 1MIHA 1TFRA 2FQ1A 4AYXA 4CKZA 1ZK2A 2WTXA 5CG2A 2YWRA 5I9TA 2HZBA 3K4QA 2O2XA 5CM2Z 2AZDA 4ANFA 2HREA 2PMBA 2PVCA 4ACBA 3KZOA 1K8QA 1GPYA 1JHMA 1SRQA 1FTNA 1U81A 3FYUA 3JATB 5KVQA 3SQDA 3WNQA 2DETA 3CFYA 2XOKA 5FBLB 1MDBA 4QXAA 4BP9A 2JKZA 4URVR 4B6JA 4EYEA 1OLUA 2VYND 4BPBA 1SCJA 3CUWA 3OH8A 3PDHA 4GSLA 5ERGB 2PGNA 1UDWA 1DEKA 3FVTA 3FIJA 3IRUA 3RYHA 1PZEA 4AMGA 3T12A 1U4OA 1X1EA 1DBSA 1YKSA 4NZ9A 1KIMA 2BC9A 4PC2A 1XYVA 1P1CA 3TDNA 4TSRA 2QNIA 3HNRA 1FFDA 2CVFA 1BFKA 3DEZA 3LGXA 3TMYA 2VDJA 1TXGA 1RYYA 4OJQA 3GFBA 4NV1A 1KQNA 1IOZA 2QVXX 2H57A 2ZOSA 3GFSA 2C5BA 1MHTA 1JZTA 4NMXB 4QRIA 1MQ8B 2JAXA 1CIJA 3KZCA 3MOGA 3ZUPA 2ZZNA 2VP6A 2VQSA 3KZ1E 1N78A 5LM3A 1XMVA 2PKWA 3IP3A 2B25A 5EXEA 3TBFA 3PTZA 2GX6A 3FNEA 5LMZA 4MQEB 2B34A 1U8TA 2D74A 4G6ZA 3Q7RA 5M5BA 2FFBA 1P0PA 3D8UA 4CIDA 1WCV1 3H9QA 4J03A 4L57A 2QQ5A 3ISVA 3JR3A 4IRMA 1KBQA 3IHTA 2OBLA 1GU7A 3IV9A 3N7TA 2GPAA 3R5KA 1XQYA 5FNVB 421PA 2AN3A 3AO0B 4WIAA 1BWSA 2JIMA 4ZOLA 1DKPA 4BO2A 4DDWA 1YBVA 4FGUA 2DU8A 5FTWA 2WJGA 3FFAA 3STVA 1MZPA 3W7VA 2CNBA 5CXSA 2XXAB 3I64A 3PHHA 4UM9D 4B7XA 4YT5A 3RVDA 3QPVA 4KXVA 2OFXA 3QNMA 5AKYA 2WYUA 4AL4A 3Q3VA 3CCCA 4EWLA 5KOHA 4IHAA 2F1HA 3P9NA 5T6MA 3NV9A 3LK6A 3WYNA 2Q1UA 4DPMA 4MGHA 2VI5A 4ZVVA 5LJIA 2X9QA 3WL8A 4GQIA 3ZLBA 1JFVA 1U8AA 2AXNA 2P90A 1I10A 4H1VA 4TXMA 4G2NA 4YDHB 4D4KA 5K8CA 1YA6A 4D25A 1Q6ZA 1MIOA 3ZZ1A 4A0FA 4AJEA 3DHVA 5JPIA 3LAWA 4Z7NB 1CDEA 4OGKA 1DHRA 2QZSA 4O5OA 1RAAA 3FR7A 1FCJA 3DTYA 5CH3A 5A7HA 4DMLA 5CXQA 4BVJA 2ZYAA 5J5VA 1U3UA 3D5EA 5C37A 1LSSA 4QQ8A 5P21A 3BMOA 3FTEA 4JLMA 2Q4BA 4E08A 4RYDA 3GF4A 2PAFA 3MT8A 1U6JA 4LYEA 4B32A 2WFLB 1X87A 5BUCA 3HY6A 1X7XA 4CGZA 1PIWA 3TQIA 3DE2X 4PLGA 4RJTA 2W8BB 3VZBA 4WKBA 3UICA 1GUYA 1K2WA 2C8LA 4LDZA 4GRIA 1Q0RA 1N4AA 1L4UA 1PBNA 1XJ0A 2ZS8A 1Z4MA 2QY6A 4ZVLA 2C5FA 1P5ZB 2AHRA 4FS3A 1SCNE 3RD5A 3HV2A 4GU5A 2QVCA 5D6NA 2B2XA 1DSSG 3RVSA 1J1UA 3T3GA 3R9IA 2UYGA 2FPMA 4PZAA 4UZSA 1N5KA 3ZJYA 3SBOA 3VVBA 4EBBA 1RXYA 3HJCA 5TGZA 2BGGA 4K1XA 1RAHA 3LBYA 2O2CA 3W5UA 4ZOQI 3FZYA 1YACA 2W0MA 4UNQA 4WFJA 2A9FA 4B80A 3Q7SA 1A2OA 5K6TA 5EPUA 1RLTA 5KQRA 2H31A 1YR9A 3NHBA 1ZUHA 2XMPA 1GPLA 1H9AA 1RXSA 3P8ZA 2GHQA 2I2XB 1OKKD 4GE0A 4A8JC 3CRVA 1TM1E 3SZUA 1I6KA 4URXR 3U1VA 2J3KA 4E7OA 2IA5A 2QRVA 2VSNA 4JYMA 4L75A 4X8LA 1E1RA 3B1VA 5AJZA 4LQLA 4R4JA 4Q9IA 4KG7A 4Y1RB 1N1EA 4FOLA 4M9SA 4QOSA 4YRFA 4A1FA 4UVHA 4E1BA 1E7MA 5A7FA 1KHTA 3FZEA 1TF7A 4JC5A 4MRPA 2HKIA 2W6OA 3A1SA 5EFZA 4LA4A 5BORA 3FJYA 2QX8A 4MKXA 3K0BA 2IOQA 4YCCA 4LXGA 4A6DA 1ORHA 2JIQA 2WPDA 3DKVA 3IOYA 4O2LA 4TMVA 3ZU5A 4ZOAA 2XHEA 4ZHQB 4D8WA 4Z2AA 2EERA 4RTLA 2QN1A 3VDXA 1EVEA 4HVLA 1R4NA 2VDWB 1JQ3A 5J5CA 5CFZA 5DGDA 4IQ0A 1J0EA 4JKOA 4NARA 2P11A 1Q3KA 4MI9A 2IXBA 5J4HA 3QW2A 4NV0A 4C6TB 1L9KA 3V8QA 1W4RA 5E1OA 2V98A 4HQFA 4WRRA 5CYFA 1FS6A 2PS1A 1FTYA 4AJ9A 1MQAA 2N46A 3B1FA 1DCTA 1UKEA 1CB0A 2CXPA 1KEPA 3S2GA 1Z2CA 3KKPA 4LJ8A 4CU5A 2ROQA 1Z0KA 3ELBA 1DO8A 2EP7A 3D6AA 1A8QA 4MI1A 1BX0A 4FBGA 2P2NA 1K7FB 3DO5A 5DIFA 4LDAA 4FKBA 1EAMA 4K2HA 4XOUA 1SHLA 1M6WA 3LDHA 2D1FA 1T6YA 2ZWAA 3DL2A 4MVJH 5COQA 5AJYA 4X91A 1OXBB 2BP7B 2ZRCA 4KB5A 5JNTA 5DSZA 1XDBA 5E4YA 2V8BA 2VXBA 4B3IA 3NU1A 4G1EB 4ZEMA 2NU7A 4F9FA 2G7ZA 4BBAA 5JH7B 1CJUC 1U1FA 1GGKA 4QUIA 3SC2B 1WDKA 1KC3A 1NX9A 1ZH0A 3AM4A 3HH8A 1QRRA 4CM6A 3VPXA 4M0MA 3N75A 4N6OA 2J6CA 1HMPA 2HA7A 2IOFA 3WV5A 3LCUA 1KRHA 3ZHOA 3FSGD 5LMUB 3GLFB 3WB1A 3ZK7A 3B60A 2FLVA 2YRXA 1J49A 2DG2A 4EARA 2IQIA 3GU3A 3NPAA 1C7EA 2H5JA 4ASUA 1QE3A 2HXSA 4E2YA 4GOXA 3NIFB 3RSQA 4BQPA 3K1TA 5HR5A 4C0WA 3CF2A 4ZA2A 4EPTA 2P9BA 4NFSA 7ABPA 1KBZA 4JB2A 1ACLA 4DHEA 2GKSA 2ZIGA 1EJ0A 4MWEA 3T3NA 1IOWA 2ODTX 4OXNA 3LA8A 3QWHA 1B8NA 4FDMA 3I9LA 1PR3A 4D5EA 4RHUA 3ORFA 3R0ZA 4NAVA 4OYYA 4Q03A 3PYMA 3RSCA 3QTLA 2MYTA 4C05A 4FMDB 3AGPA 2BFFA 2H1HA 3I1YA 3OIUA 3WMFA 3JQPA 4X00A 3IXQA 4H1UA 1QVRA 4RH3A 1QGDA 2EC5A 3ZZUA 1VDMA 3E9NA 1KAEA 2ECPA 2UXCB 1JKMA 5G0SA 4LHEA 2JLVA 1NJFA 2NTEA 1WXFA 1J4AA 1UJMA 1FY2A 1RVV1 2R5WA 3KVVA 4K7JA 3TFWA 4M0EA 4Y2GA 3R1IA 2GN6A 2XUKA 2G06A 2C4KA 1Y42X 3PIDA 2B4KA 4U8GA 3SZMA 2PR7A 1PQYA 3LLSA 3KQOA 4OYRA 2FZCA 3QBEA 4MQMA 5E0KB 3EK2A 5U1PA 3RS8A 4EFLA 3RT1A 2IELA 1V9SA 4P5DA 3JASB 1YSCA 1ISPA 1L5OA 1R1DA 4C3ZA 4QFCA 2CT8A 4TTIA 4OH7A 4RELA 2NT3A 4EB6B 3CVYA 3V34A 2PBFA 1TDJA 5CDHA 3P2KA 4BYGA 2AFIA 4FEAA 1J09A 1C50A 1U3VA 3OY7A 4EIWA 4LJAA 2CMDA 1PVVA 4BO1A 5I7RA 3O21A 1UP4A 1VKZA 2H4HA 1YR3A 2G1UA 4MIOA 2FPOA 3MS4A 3WNZA 5IWCA 3DMTC 1BJKA 1LBSA 1Q22A 3MTDA 5JADA 1B26A 2G82A 4LVCA 3VGJA 1G21B 5JPCA 4PC6A 1C7IA 3PLAE 4X6UA 3NTVA 3L7MA 4YP7A 1S4MA 4M36A 4HWGA 1T8YA 2INGX 4YB8A 5J5AA 1M2OA 4HN4B 3EFOB 5AVYA 2XI4A 3AEUB 5A3VA 1I7QB 4OFZA 2JH3A 4KV9A 1AZTA 4CN9A 4GGMX 5JMTA 2XUZA 2IL1A 2CUKA 4KGDA 1EE9A 5JXJA 3QPBA 3O74A 3G7SA 5BQFA 1U8UA 4MR8B 2J0UB 4TV8B 3QF4B 4J76A 1PLJA 1Q1NA 4II7A 1NU8A 1JDJA 4AUEA 3M81A 1N2HA 1RPJA 3EEOA 2GETA 1XELA 1A8UA 1NURA 3L8GA 4L7VA 5BW8A 3U7QB 3G59A 1N34B 3NIGB 2H59A 1B8PA 4IMPA 4JOBA 3RAPR 3UC9A 2ZWVA 4P08A 4X62B 1S2NA 3T0IA 1WY7A 2C4WA 2QWXA 1V11A 2C9ZA 2Q0XA 3FWYA 2CZCA 3KQQA 1L7DA 3Q8WA 2EX4A 4G26A 4L73A 5ALQA 3KCQA 1SNYA 5IDQA 5HDBB 3SX0A 1TQ6A 4B3FX 3UK7A 4RTSA 4R8MA 2J9ZB 4P7KA 1F2TA 1RC1A 5IEBA 1ZNZA 3B38A 5B3LA 2NU8B 3G2IA 3VFDA 1YMQA 5GVSA 4YRIA 4G1VA 2RI6A 3NM5A 4FYYA 3CNNA 3FPAA 3JQ8B 3OM8A 4HTFA 1W46A 5HP4A 2DH5A 4YQZA 1RMQA 4ZO4A 4CKBB 1KYZA 4R1NA 2EFYA 3NJ8A 2I6XA 1HZZA 1Z83A 4D0GA 3M2TA 9ATCA 2C57A 2FN3A 2ZBVA 1DAEA 3QI7A 1JI3A 2BKVA 2HL6A 2X8AA 3MWLA 4PPNA 2C88A 2GERA 5BN4A 3C97A 1GTRA 4ENWA 1C30A 4XM0A 4DV6B 1G8AA 3U3DA 1NASA 1JQLB 2HNAA 4Q7EA 4JVNA 2M32A 3FVVA 3ZE7A 3N76A 2CKDA 4G86A 3MT7A 1T91A 4H60A 4YP1A 5HEKA 4AG6A 2WZDA 3USZA 3U60B 3M1IA 4M8NE 3AVTA 3C5VA 4TLEA 5C2JB 5F1OA 1RHMA 5G02A 4GRDA 621PA 1D2AA 1Z06A 2ISQA 3EXIB 4HVCA 3DC7A 3P1JA 3LYLA 4OBBA 2A5LA 3WK4A 2QX4A 1GZSA 2ZYIA 4J0EA 5J2UF 5KTOA 3V4LA 3LL7A 1BE1A 2XCQA 5CB6A 2XVMA 2VHCA 3EVDA 2QMZA 1PJSA 3HWSA 4J16A 1J07A 3DZFA 2HBRA 4RMGA 1E79D 3SQMA 3COPA 1NXXA 2FQWA 2HIGA 3LBAA 1D6MA 2NG1A 3L7CA 1DBQA 1J8MF 3ISTA 1ECGA 1EFPA 1WL8A 2D1RA 3ZY6A 4TSKA 1R50A 3M5WA 1M0SA 4F3KA 2Z98A 3NH6A 1CZLA 4LCBA 3UV6A 4GKKB 1ADCA 2EF0A 2R8XA 3T6KA 4ZQGA 1FLNA 2C9OA 1DKMA 3EMBA 1WB5A 3TOCA 1PEYA 2C8JA 3DR5A 2BR4A 2OD9A 3GWGA 2IEZA 2OGUA 2RCYA 2YN4A 5C31A 5BR8B 2V6GA 5EZQA 3EW7A 2YMQA 2CLMB 1GRRA 1GAEO 4G65A 3DAOA 4EF4A 3O38A 3KYCB 1QHSA 5IBPA 3A2LA 2JK0A 3GZ4A 4ZV7A 4KSBA 5CDTA 1K7CA 1F9AA 3K5IA 3ZHCA 3KDSE 3QXJA 4J9VA 2REQA 1P8JA 1QSGA 4F6CA 2I3BA 1YBAA 1II8A 2Z3ZA 3S44A 1NPDA 2QMEA 1IRIA 2EAUA 1BWQA 3TE7A 3QYPA 5ELXA 1H9BA 2ISSD 5E0OA 4C0SA 5L6MB 5B3JC 1OLUB 2A30A 2PZ8A 3HYRA 4LF8B 4QEDA 1U5BA 1MXHA 1A77A 3RYHB 1K8RA 4LPSA 4GS5A 1W2WB 3SZRA 3VV2A 1WS6A 2QRLA 4LYDA 4LXXA 3U5ZB 3STHA 4MQFA 4D3DA 2IPAB 1NYQA 4EAAA 4YP5A 1YE5A 4W7HA 3WWYA 3ZQKA 2CFCA 2GVZC 5FJIA 3TX2A 4BNVA 2VJMA 4PQFA 4ENVA 1SVOA 3EIOA 4C7MA 2FMHA 3QKRA 4G9EA 5K0ZA 3R3JA 1RRCA 1CUWA 5JMPA 1NBMD 2VHVA 1K4MA 4JI5B 3SBEA 2JHFA 4DIKA 1MZVA 1JDVA 3ANNA 1OFTA 1LK7A 2PD4A 3WGGA 1OFIA 4EF6A 1M6HA 2GLUA 1L7NA 1KQ3A 1EWKA 2Q5LA 4TL6A 2DHDA 3RHFA 2PUJA 2WU0A 3LDUA 3N3BC 4OJYA 2FPWA 5ERYA 3SEFA 3OIGA 1D6NA 3TCKA 3A6GA 2G9VA 3ML1A 2UZ0A 3LPCA 2X8LA 3D3EA 1DO2A 2DQKA 2DJ5A 4XGKA 4XQGA 3M0EA 3TOXA 4Q9JA 3BFKA 2ZTVA 4OXXA 1CQJA 5A71A 4V0QA 2GCOA 5T6BA 4D3XA 5L7TA 1KDOA 2DWUA 3BWVA 4K6KA 4B1FA 4EPYA 1C0IA 3KT0A 1VRWA 1P7WA 2F1KA 1HFWA 2ILVA 4C5AA 2BBWA 4DLXA 2W6ID 3PPIA 2VTBB 1XNGA 3AHIA 1K86A 4ZOLB 1O03A 4OLBA 3P0IA 3BICA 4RCYA 4Y9TA 3TMAA 3UGKA 1SBQA 4HFRA 3ZNOA 1EDDA 3CF4G 4OFBA 3UAOA 1WZEA 1SQ0A 2A3RA 3S6JA 4CMHA 4HNGA 5SV2A 5LA6A 4B85A 5KOHB 4QBGB 1U3DA 5JQGB 1R00A 3CUVA 3AU9A 1JB1A 3GEGA 2ENUA 3VOSA 2ADOA 4WHMA 4CI9A 2GMWA 5F4BA 4UPEA 5HZGA 3AJRA 3IPXA 1HV8A 3KQVA 1FSGA 1WMAA 1AKTA 1MVOA 2PEYA 5SZIA 1H8HA 1MIOB 2D2VA 2GASA 2OCBA 3NJ4A 4H7HA 1LBHA 2VQDA 2Y1KA 3TNYA 1ZJ6A 2XMDA 2ET6A 2AZTA 3EARA 2PMCA 2BGLA 3CIFA 2RB5A 4V0OA 1BGVA 4I4CA 2LBPA 5K3SA 4Z5XA 1CZKA 3R7AA 2J9GA 2ZRLA 3BMOB 4CM9D 1DKNA 1A82A 2IYEA 3MJHA 5ECDA 4CZ2A 2QBYA 2OCXA 3IH5A 1DPFA 3GP5A 1X7XB 4OBEA 2OGWA 4YJKA 3UA3A 4LHXA 4M8KA 1UXKA 1QGZA 3A8TA 1MB0A 3GP3A 4KIJA 4D80A 1WM1A 2JIZD 5FD8A 2PT7A 1M67A 3E53A 2R87A 4L08A 1NG9A 3GEDA 2O3UA 4MV1A 1IE3A 2QPAA 4EHNA 4L6CA 2Z2IA 3BCRA 5TDHA 1QYDA 1L5YA 1B2LA 2X40A 2CLKB 2QZ4A 3B3JA 4AUMA 1IN1A 1PT7A 2DE0X 2ICAA 4XI9A 4WBXC 3TLZA 1OV6A 1E8DA 1T1JA 2B3DA 3OQ1A 3Q12A 1ZMRA 1FP7A 2ZE6A 3MTGA 2A9VA 1Q1QA 3D2AA 2WM9B 3KETA 2O05A 2XA9A 1L5FA 3W5SA 3PDIA 1H3EA 4KO1S 3RSLA 3UKOA 1OH6A 1XO1A 3DW1X 3QLVA 1UAYA 1C3VA 1TRKA 1YQEA 3IVAA 5JAPA 1UDXA 2R5FA 2WUDA 2QRVB 2CDNA 4RNDB 4MB2A 4HB0A 3O4FA 1B0AA 1UL1X 1MO4A 1SVIA 1L5LA 1NVUQ 1HYHA 2ETVA 1SXJE 4FYJA 4LHVA 4XWOA 4XB1A 3S1LA 1DRVA 2JKYA 4KWCA 3IAUA 4KYUA 1AUXA 3TIGA 4CQNA 2QMYA 4XUGB 5EKXA 1NKSA 3K09A 5EMKA 2VHTA 4GZ3A 2AW5A 5BP7A 1F3OA 2O20A 3M9WA 1R4NB 4EX6A 1P7CA 4A9AA 3EWSA 1UCFA 3IKJA 3V7UA 3TB6A 4BQNA 4ZK6A 3ZV7A 1ZVQA 3H17A 2GTHA 2XECA 1WVIA 4IUBS 1XHEA 2GK4A 1ZVKA 4JJFA 1G98A 4S2UA 4Z2YA 5KHLB 4UDXX 1ZH8A 1QORA 1EEHA 1H94A 2XA1A 2C8VA 4YAUA 3R44A 3ICEA 1IJFA 1V6AA 1G6Q1 4WCFA 3U6KA 2I34A 1XAHA 4DMGA 1I14A 2VJAA 1NF3A 1UK6A 3K0KA 1XTTA 4OBXA 3DE7X 1E2DA 1F2VA 1TPZA 1XVTA 1VJRA 2C4TA 3DG9A 4IDEA 5E2AA 4BJ1A 1J2EA 1VJ1A 3H8VA 4KWTA 1OX6A 3G6WA 2AYXA 1AKEA 2ODBA 3CRZA 1KO5A 3QA9A 4MUGA 9MHTA 3MXTA 2X8JA 3X1XA 3DULA 4N9QA 3BK7A 4WEOA 1NW9B 3L0CA 3CVUA 1K5GA 2V7GA 1HNWB 3JU3A 3NAZA 4WBNF 1C4XA 4JBHA 1I3NA 4RCZA 1NF8A 2NU7B 2NVOA 3DBOB 5GOTA 3M34A 2RHBA 1XTSA 1WUYA 3QKWA 4L95C 2YC4C 4QOFA 1D7AA 1E58A 2H0QA 5DM4A 5EQDA 1LRJA 2ZATA 5GINE 1TLFA 4II3A 4ZYVA 1QOQB 3AR8A 3OZEA 3H42B 4X63A 5JDIA 5ECYA 3LBFA 4HEA6 1I0LA 4FGZA 4UTZA 4URWR 1Y6JA 5DWDA 2VBIA 1XA4A 2G5GX 3UWDA 2AOXA 2UZ1A 1C2YA 5HOQA 3W4KA 3QU5A 2YWHA 5EQJB 4H1WA 3K1AA 3LX8A 4PFJA 5C8XA 2FFQA 3OE7D 3IQEA 3SZ3A 1JHVA 2Y4NA 4P3NA 2MDTA 1BMFA 3JPYA 1WTCA 5LXTA 3CA8A 4D4GA 4DFDA 1ONOA 3OQ6A 4K3UA 4KAFA 3D8BA 4UU8A 3TZQA 1AKVA 3HDGA 4LY6A 2FMFA 5EI5A 3EVFA 1W73A 3BVPA 4ZAWA 5EY5B 1QIEA 1CY6A 2OBFA 2VF2A 1ZM7A 4V1CI 3IL2A 3FWZA 1MG0A 2JAOA 4CNBA 1PNVA 4OA5A 3Q7QA 2BFFB 4O02B 1SBYA 3ZQ4A 1YKFA 3PUJA 1Z6XA 5BOSA 1ZGJA 3KHTA 4N5HX 3AVYA 1AK9A 3FYSA 4GYYA 3PE3A 1PK9A 1JHQA 1U0OC 2CCGA 5EE1A 2AMFA 3GW8A 2IZ0A 2Q9UA 4GP9A 1I01A 1NC3A 1T13A 3OEED 1YA8A 3T5TA 3W6OA 2A9RA 3BL8A 2VR1A 1TIKA 4C07A 1EXVA 2WP0A 2QP3A 3VKFA 1VZ2A 4HVTA 2ISCA 5A3SA 3IA7A 2CSXA 3GUVA 3V33A 2FG5A 4H2DA 3ROEA 1NG1A 1A88A 4O0LA 1M83A 1Q0ZA 1TF2A 4G0NA 1Z13A 2CMFA 3KBBA 3P9CA 4JBIA 3QV1A 4LY0A 3E9ZA 1YR8A 2CKMA 2KHZA 3M49A 3IPCA 2QPLA 1NHWA 4JH0A 4CRWB 4EX7A 3K72B 1YAJA 2BN4A 3A9VA 1BRMA 1GKLA 4FT4A 2Q49A 1JR3E 4PAQA 1K3FA 3I04M 1ZWKA 3G68A 2AFIB 3UY4A 2PZEA 3N7AA 1LBEA 2JD1A 2W0SA 3G5TA 1FDSA 1P45A 1VQ1A 3FN4A 5FOWA 1IEXA 4HGZA 3R7SA 3SBXA 2HQRA 1QIJA 4BVHA 2NSDA 5HIMA 5MFZA 1Z4OA 4AROA 4CQLB 4NBRA 2K7ZA 3JQ7A 4BQFA 1P1HA 2XT6A 2WQ6A 1GZ3A 1SBTA 2O7VA 1P1KA 2FZGA 2B1QA 1KY3A 3IIMA 1WQ4A 4QUAA 2B4QA 2XGGA 2RAPA 4D9BA 1M2OB 3UXEA 4EI8A 2G80A 2Z43A 2ECOA 1IM5A 1US8A 3T99A 4IDHA 4L3OA 4QQNA 4XFKA 3JWEA 4GX1A 1P2UA 2IXEA 2VVTA 3T3HA 4QOIA 1IFXA 1ZGAA 4AXBA 1KYWA 5HRCA 1DDIA 2YH2A 3W78A 1QTRA 1QC5A 1RKXA 2VPYA 1Z2PX 2BISA 1F4PA 1EXNA 3AGQA 3I6YA 4KXMA 4RH1A 5EJIA 1R10A 5H81A 3PRYA 1OWOA 4ETNA 4F86A 4CE6A 1FZQA 2VO1A 1LJ8A 1LNQA 1N8SA 1I8TA 3ITKA 3MMPA 5DMHA 2OM6A 1DV2A 5F1KA 1F48A 4OB7A 2WWFA 4JJ6A 3ZHYA 2OPHA 3T7EA 1GILA 1V11B 2HCRA 2YY5A 3SSNA 1ZZEA 2WYWA 4U0KA 5LWQA 4LBYA 1WXDA 4LMRA 4MVJM 3VR4A 4ZFNA 4US2R 5CPBA 1PDVA 2JHPA 3JX9A 2R3SA 4RWEA 1X2EA 1I1QB 2BR3A 2ODEA 1LQUA 1YR6A 4HDSB 5AI6A 3VSDA 4LC9A 3Q8KA 2I91A 2XAUA 1MJGM 4B3XA 2ADFA 3F5MA 5IZCA 4HTFB 4JLOA 4TXJA 1Q0UA 5IK2D 2A0KA 1KMHB 5EJGA 4D9IA 4K0KB 3TRFA 3U0BA 3SXUA 1EP1B 5F23A 5KC8A 4BEBA 4OI4A 3GFRA 2AB0A 2O2SA 4D9CA 2UXDB 2PL1A 3THYA 4WZAA 2H0AA 4RTMA 1QF6A 5EPOA 4C4RA 4CG2A 2Q50A 5BN4B 4D3SA 1KO7A 1C30B 3U1TA 2QN8A 1QGOA 3WRXA 4RDIA 1BRTA 3MCTA 5IBRA 1LEHA 4RF4A 3RC1A 3I1FA 4OXYA 1CNEA 1R6DA 3QM1A 4O59O 4PBTA 16PKA 3SGLA 4BNWA 1X7ZA 3MZ0A 4TL7A 1JN0A 5DE3A 1Z7YA 3IQIX 2F3TA 5EQTA 4QM6A 2CJXA 2O7NA 2D54A 3OFND 5CCEA 2Z08A 2NNLD 1Y9JA 4XWTA 5AM5A 1O3YA 3PJEA 5H82A 4GDFA 2HA2A 2VG8A 3WYEA 1J70A 4YMWA 4AYWA 4JHLA 4M6WA 1QIFA 2R5NA 2C3UA 4B3HA 2FWNA 3W1WA 1EFPB 5ALGA 2VQFB 2GJ4A 1DQPA 3H16A 2BSAA 3JS5A 2RBKA 4AMYA 2TMYA 4TTAA 4PG6A 1X80A 4X24A 5FA5A 2G0NA 2YVKA 1I4WA 1MFZA 1R0ZA 1QFSA 2E3JA 1SXJC 2OAQ1 3IJRA 2X77A 4NNOA 2QOEA 3EA5A 3NS7A 3F5QA 5C32A 2PVSA 3EXEA 4EKNB 2RHJA 1FS4A 2I9KA 1NXOA 2PL5A 3HR4A 3IR6A 4HP8A 4HAVA 5JEDA 2FJPA 2WIJA 1E20A 4IZ6A 3IRVA 3RSZA 2QTBA 4DMFA 2W00A 4DJDC 2ESRA 2FR1A 4NBLA 3VQTA 3A3NA 4L8YA 1FTQA 4EI2A 5K8JB 1GPNA 1RYHA 4FONA 2REQB 4TM8A 1MN6A 3Q3HA 2ZUVA 5K2MA 1II8B 5BSKA 1LQ2A 3FOAA 5EEHA 2ZUWA 2VXOA 4D6PA 4KPEC 3ZZMA 2C7GA 3I9MA 3QVVA 1DKRA 4AC9A 2XUPA 3UUGA 2HF9A 4MWDA 2WUWE 3B13B 2JW5A 3E9DA 1C2TA 1KK2A 4MQFB 3V8NA 1KU6A 1QG6A 3M6FA 2OM2A 5F2NA 4F4FA 5TIIA 4UEJA 1NQUA 4FHZA 2VJMB 2QF7A 1K2VN 3ENVA 2VBCA 3PHIA 3QKRB 1RJFA 1DQRA 4OMCA 4ZXPA 4EELA 1VHWA 3JVIA 4LJ6A 3PXDA