5GY7A

X-ray structure of h243i mutant of udp-galactose 4-epimerase from e.coli:evidence for existence of open and closed active site during catalysis.
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
338
structure length
338
Chain Sequence
MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSSATVYGDQPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGIVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords UDP-glucose 4-epimerase
publication title X-Ray structure of H243I mutant of UDP-Galactose 4-epimerase from E.coli:evidence for existence of open and closed active site during catalysis.
rcsb
source organism Escherichia coli (strain k12)
total genus 132
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2016-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5gy7A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 5gy7A02
3WGOA 1M75A 3RUIA 3VPFA 4EJ6A 3BHMA 1B0AA 1Y8QA 4GMGA 3NTRA 4JBGA 3SBOA 1OOEA 3DO5A 1BMDA 2O3UA 1XU9A 4CL8A 4P38A 1I2ZA 2UUPA 2YDYA 5CAEA 2VCYA 5KJ6A 4FOOA 4F45A 3PJEA 4R3NA 3GOHA 3CZMA 2B4QA 3H6KA 4IS2A 3MJCA 1QMGA 2X1HA 3GA0A 4CM9D 1NX6A 4P4LA 3KYCB 3WIEA 3OA2A 4IGEA 4BKQA 3JYQA 4RZHA 1EK5A 1OMOA 3HFSA 1PGOA 4PRKA 3TL3A 3H3JA 3RBVA 3QVOA 2ZB4A 5T64A 5HBRA 5DCYA 4W9NA 2BGLA 2JD0A 4RPJA 4Z6KA 3E9MA 1SO8A 3FPCA 2Y0DA 4E2YA 3PVZA 2BHLA 1NTOA 4O0LA 3RJ9A 2CZCA 4PLTA 4NIMA 2QYTA 4Y6PA 3KSDO 4CMJA 1YRLA 1XDWA 5I9NA 5CDTA 3SLKA 2OBNA 4AJHA 4WLEA 4BNNA 3VZSA 2DUUA 2HK8A 3OH8A 3WGQA 4E5KA 5JC1A 1GV0A 1I10A 2Q49A 3L6EA 4FFNA 3W8EA 3WQRA 3AU9A 2NVUB 3UCXA 2AXQA 1PJQA 2EKPA 4URFA 3ZZNA 2FMUA 4NK5A 2Y66A 3I3OA 4O6VA 3QQPA 4I8XA 4J7CA 3JQFA 3VPXA 1K0UA 1LA2A 5AYVA 2LDBA 2QRJA 2GN8A 4XJTA 1QG6A 1UXHA 2IE0A 2J8ZA 1GUZA 5IG2A 4HWKA 3RASA 2Y1DA 2Y1OA 4NH4A 5T67A 1NPDA 3WFJA 3HDHA 1I30A 3LT4A 3WYCA 3UHAA 3UKOA 2RAFA 4RVHA 4XGKA 5TT0A 1N9GB 3ZV5A 3K30A 3UH1A 4DIFA 2Y99A 2OUIA 2HUNA 3QVSA 4U0JA 4BB5A 3EY4A 2H6EA 4RVSA 3RWBA 4J90A 3RFTA 1A27A 3BMOB 4Z9YA 3ST7A 2HQ1A 1HLPA 1JN0A 4IINA 4RLHA 1TVEA 2X23A 2ZQYA 1YBAA 2O4CA 5TLSA 2PNFA 3JQBC 2C7GA 2FSVA 3OQ1A 2VRCA 5GZ6A 3GEDA 1DC6A 3ZGYA 1WDLA 4CLRA 5JDCC 3GPIA 3FNHA 3DOCA 2DLDA 3F6YA 1NQTA 3JYNA 1KY4A 4YRDA 3SLGA 5FEUA 2I66A 4A0SA 3WG9A 4DQVA 4IJUA 4RF3A 4BNTA 2D3TA 1T4DA 3GT0A 4LCEA 1XKQA 3PYLA 1YBVA 4E21A 3P19A 3U49A 4MVJM 3I9NA 4D0RA 4FCCA 3OFSA 1X1EA 3IL2A 1ZJZA 4OL9A 1RM4A 2P68A 3CSDA 3D7LA 4L76A 3HZZA 4LSWA 4NR0A 5G0TA 9LDBA 5IFLA 4TVOA 1WP4A 1VE9A 4DC0A 3A14A 1QYDA 4NQZA 4JP3A 1HWYA 1ZFNA 3H8VA 4M87A 4DPLA 3SEFA 1NPTO 2VYNA 1GEGA 3JQ6A 3JQ7A 4TROA 2AQIA 5T5QA 1B8UA 5AVOA 1HETA 3I9OA 3WR5A 3LSYA 2DUWA 5JBIA 1LSJA 1ZK0A 2H63A 4M54A 2BLLA 1Y9AA 4RF4A 1EVYA 3ZV4A 4UEJA 3DFUA 3F4LA 1EDOA 4L4SA 4M8SA 4D44A 2IYPA 2B83A 4W4TA 5EQDA 1P0FA 3QP9A 1CDOA 4YAJA 2PD3A 4BUCA 1ADGA 3IQDB 3QWFA 4LGVA 1XELA 4MIEA 4QXMA 1ISHA 4XYBA 3GF4A 5ITVA 2GSDA 2OP0A 4IIVA 3RFVA 5IF3A 2JFFA 4W82A 1Z73A 5I7FA 5ENDA 5K6AC 5COAA 4WCDA 1HDXA 3AOEA 4FJ1A 3KXDA 4AJOA 2W2KB 4HFJA 2DPHA 1ZZEA 4KUEA 2WD7B 3SJ7A 3O8QB 2W8ZA 5CG1A 1N5DA 1B8PA 4MINA 2TMDA 1FDVA 3QHAA 3RU7A 1ZKMA 3LT0A 5L4SA 4BS9A 4CV3A 5COQA 2DAPA 4L4XA 3GFBA 4CMBA 1I3MA 4F6CA 4RL6A 2HKIA 4R41A 5JAZA 1SZJG 3WGHA 3MWDB 3UN1A 3TNLA 2GD1O 3NAQA 3AFMA 1I32A 4FFRA 3VZPA 3I4CA 3OP4A 1LRJA 4PLGA 3E6AA 3PK0A 1EE9A 1A7AA 2P2SA 2RCYA 1MX3A 4IJWA 3AFNA 1PS8A 1KYQA 2AE2A 4WOJA 3OJFA 1RJWA 1ZSYA 5F21A 3ZU3A 1GQ2A 4BGUA 3K5PA 3ZH2A 4DUPA 4IMRA 4J43A 4AVYA 2J6IA 4B7XA 1U3VA 2YDXA 1HLDA 4WNCA 2X58A 4IGFA 3OECA 1KEUA 1CQJA 3DZJA 4OH1A 1B8VA 3FD8A 4Y67A 4PZEA 4ALIA 3FBTA 5COBA 4DWVA 4I5EA 4QTZA 5L40A 3W6UA 3KYBA 1EEHA 4P8RA 4XYGA 3TZ6A 4Q3EA 4CM6A 4E3ZA 2I3GA 1D8AA 3WSVA 3INGA 4CR8A 3DBRB 3T4EA 4M89A 5BSEA 3L9WA 2HDHA 3U3XA 2YQ4A 4BVAA 3GNTA 4EYEA 4CQMB 3PHGA 1UXGA 1DDOA 4XQGA 4UUNA 4NPCA 4X54A 4ALKA 2D8AA 4GGPA 4DLAA 2J5RA 2EGGA 2GZ3A 4R69A 1XHLA 2VUUA 3P7MA 1YQXA 3IDSA 5CPBA 2I6TA 1LDGA 4Y6RA 3I9MA 3LVFO 4CM4A 4EI2A 3D3WB 1JU9A 1AXEA 4G2NA 1ADBA 1YDWA 4YPOA 4XB1A 5JCXA 1J6UA 5JFOA 2FHSA 1PJSA 1G0NA 3ETEA 4OIMA 4OAQA 2Q1SA 1H0KA 4JCOA 2WYWA 1B26A 2Q2WA 5TC4A 4CMGA 3D1LA 1NASA 3LF2A 2GUGA 1GCUA 1HYEA 3WGZA 3LLSA 3ZWPA 4ND2A 1C0KA 4YRAA 2YV3A 1RKXA 4NFSA 5G4KB 4E2ZA 1GPJA 1R4NB 3JQ8B 1P1IA 3E5MA 3LT2A 4WLVA 1O8CA 3Q0EA 1DAPA 3TZKA 4PZCA 3L4BC 3N74A 2DBQA 4IDAA 4CV2A 3C7CB 4H16A 4YT2A 5JCJD 5L53A 1QV6A 3W8DA 2WYVA 3DAPA 2VWHA 4NBRA 5HTOA 3V8BA 1PJ4A 3FNFA 2CDCA 4GBJA 2AG8A 4NZ9A 4RDIA 4YBZA 3KUXA 4B4OA 3UGKA 3WMWA 5TT1A 3G0OA 2O3SA 1HEUA 4Y6SA 5JY6A 1E0DA 4O1MA 3HFGA 3VAZA 1EFLA 5JYEA 2IZZA 3ONEA 1E7QA 3H9UA 3VVBA 4CL3A 3ZW9A 5DT9A 3RUCA 1UZMA 1BXKA 1YJQA 3Q2KA 4Z0PA 5IXSA 3GG9A 2PD4A 3IOYA 4KDFA 2W4QA 4PG4A 2JAPA 1MXHA 3KETA 4GGOA 2B35A 5CG2A 3ZV3A 4GX0A 3JQGB 4J7XA 5B37A 2Y1FA 1I36A 2NV6A 3IP1A 4XB2A 4KQXA 1XIVA 1UR5A 4MO2A 2VYVA 3U09A 2QRLA 1R37A 4J49A 1U7TA 4TWRA 4CLOB 4J2OA 3RU9A 1F12A 1F8GA 5AXBA 1OAAA 1BDMA 1EDZA 2QIOA 3L0DA 3PFFA 1KC3A 1ENOA 2DM6A 4OXYA 4FC6A 5KVQA 1KEWA 4U6QA 1P31A 4D79A 1B2LA 3EZLA 3NTQA 2NWQA 2X0NA 2YQ5A 5BNTA 3DMTC 3OSUA 1VKNA 5KOIA 4MIYA 3T4XA 4RQUA 4GX2A 3UICA 1BHSA 3GVCA 4BO5A 1ONOA 1PGJA 1UH5A 5I7SA 1E5LA 1JLLA 3BTUA 4IXWA 4BNMA 1IYZA 4CMEA 2XOXA 1GAEO 1EVJA 1K6JA 3K9QO 2OMEA 2NU9A 1H6AA 1DRWA 3JQDA 4RCVA 4WCFA 4BO6A 1C1XA 1LBEA 4IDBA 4XR4A 5IXYA 2GLXA 5IZCC 1DJQA 3CINA 1I5RA 1DIHA 1XQ6A 3S2GA 3WQSB 3ZWXA 5ICMA 1VRWA 5T8KA 2WWRA 1G6KA 1NQOA 1QXSA 4M55A 1WXDA 3ZWCA 4BQRA 1G1AA 3EDMA 1XQ1A 4TZTA 5DP2A 5HM8A 4D3DA 3B1JA 4DA9A 3Q1LA 4KTVE 4D42A 2V6BA 2C2YA 4BNWA 1DJNA 1JKJA 1AXGA 4BNKA 3PHLA 3RBXA 1NQ5A 4ROSA 4NJMB 4UVIA 3JQCA 3JSAA 4YACA 2JFGA 3D0OA 1C3VA 2ET6A 3VH4A 4XX0A 3EYWA 5CEEA 1LI4A 5TIIA 1FDWA 4OXNA 5IDYA 1IL0A 4DPMA 2DU8A 1FDSA 2E4AA 3AU8A 3R1IA 1HT0A 1ISIA 3FTPA 5EESA 1KERA 2JD2A 2C07A 2W2LD 3HADA 3NJ8A 3W8FA 4YA6A 1HE4A 1YJ8A 3UOGA 1KS9A 4EUHA 1GEEA 3KLPX 4Q3NA 1IZ0A 2RH8A 1M76A 1ML3A 3PDJA 3UUWA 4XWYA 2GASA 1DB3A 3D4NA 3DONA 2UDPA 4CLXA 1CERA 3WYBA 1PGQA 3JYPA 1I8TA 4Q3AA 1Q7BA 3H9JA 3BMQA 4ID9A 4JX8A 4YQYA 4CPDA 2V6MA 4XRGA 5LC1A 3ZU5A 4BIIA 4YAKA 5ADHA 1Z74A 2HMSA 1Y1PA 2O3RA 1YQDA 1P3DA 1SAYA 2ZJ1A 3L77A 1RM0A 1SOWA 3FWZA 3IUPA 1ZK3A 3ROMA 1SB9A 3QJ5A 3V2GA 3D4PA 3QVXA 1JVBA 1N8KA 4YJFB 2EWMA 5DULA 4BNLA 1NHWA 4Z0TA 3WGGA 5DBFA 1RYDA 1LDYA 1ONPA 1I3KA 2A4KA 5BSGA 4OHUA 3PQDA 3D64A 1NPYA 4BMSA 1MUUA 1GV1A 1UXJA 2HK9A 3NT5A 3JQAA 1PU2A 3H9GA 4P4NA 4XYEA 3DXFA 3AY3A 1Z6ZA 1YKFA 3GH3A 2PKRA 3KYDA 5IDQA 1LRKA 1OFGA 2B4RO 2GZ2A 4QX6A 4CR7A 1Y8QB 5DBGA 3ZWOA 3HDYA 1H6CA 2IRWA 5JSFA 4FQ8A 1IHYA 5F1PA 2PZMA 3PRJA 5JNLA 2HMUA 4AJIA 4DYVA 2E37A 3DBLB 1IHXA 3S2EA 4CM7A 1JAYA 4EW6A 4WLFA 1VKOA 3BTVA 2VOJA 3NEPX 4OSOA 2J5QA 3JD2A 3P2OA 3OIGA 4BNFA 3DC2A 1VL8A 4ZA2A 4YAGA 3IMFA 1T24A 4KZPA 2BH9A 3GG2A 1JKFA 1CRWG 5BSFA 1CEQA 4FFPA 3X2FA 3ZWWA 1ISMA 1BTOA 3ASVA 3C7DB 2HMVA 2XF8A 4RVFA 4LVUA 2JKVA 2IZ0A 2DTDA 4L9RA 5IAAA 1ENYA 3Q9UA 4RJTA 2QZ9A 5BQFA 3JQ9A 3A1NA 2IDZA 1BXGA 1P1FA 3DHEA 3OQBA 1B16A 2F00A 2FRDA 2YYYA 2ZJ0A 3ZHXA 5KJEA 4CQLA 2GN6A 4Q3DA 2VHWA 1DC4A 3FBGA 3ANMA 5AOVA 1PL8A 3IS3A 4JJIA 2B0JA 5IN5A 4U7WA 2GZ1A 2HJRA 2ZCVA 1U5AA 3ORFA 1R15A 2HMTA 3RKRA 3H3FA 2HRBA 3KTDA 4F6LA 5U4QA 5ICSA 4BMVA 3ZN2A 4E31A 1HYHA 1PL7A 4MP3A 3VPSA 1PZEA 3LYLA 3ZI0A 1K6XA 3PXXA 4PLWA 1WMBA 3B1KA 2EW8A 4IDEA 4RF5A 5I8WA 5CDSA 3H5AA 5KVCA 4Z0HO 1PSDA 1VLLA 5DDIP 2FR1A 3DR3A 3HB5X 3QWBA 1BDBA 5J23A 5A06A 3Q6IA 1ZJYA 2GN9A 1NFQA 3V1UA 2UUOA 3RC9A 1V6AA 1P77A 2VRCD 4OQZA 3HB4X 1UXIA 5B4VA 5KKAA 4E33A 4MVJA 1PJTA 3DWFA 4PVDA 1ID1A 3ZW8A 1YB4A 3D5TA 4RV9A 4BNZA 4GWKA 3Q9NA 1DIAA 3GK3A 2QRKA 4TRJA 1QV7A 3EK2A 3OEYA 2WMDA 3E82A 4XQ9A 1QRRA 3WGIA 2Z5LA 4CLRB 1NBOA 3PHIA 2VTEA 3GMSA 4XJSA 3WBFA 2WSBA 3O38A 1T1SA 3HE3A 7MDHA 4QECA 5HS6A 5TS3A 1EK6A 4HFMA 1NP3A 5JDIC 2DVMA 5F3RA 1Q0HA 4TZKA 4ND1A 2Y0CA 2HLPA 3GC6A 4MIOA 2BFMA 4HKTA 3AOGA 4UVHA 2C2XA 4B8WA 3UFXA 5L4NA 4IZHA 1ULSA 1PJLA 2VYND 1A4UA 3F46A 2AMFA 3B1FA 3INRA 3W6ZA 3WB9A 3KM0A 5JAIA 2X5KO 2GCGA 3ENNA 4RQTA 1YBMA 4MPDA 2C0CA 2CDAA 3D3EA 4NBWA 5FFFA 3JQ7B 2Y0EA 2P9EA 1P1RA 2UAGA 3B6ZA 5L45A 4L74A 1GADO 3GVXA 1X7HA 5ITWA 1BVRA 4H7PA 1R6DA 2A9FA 3PYMA 1VSUA 1B3RA 2JL1A 4FIZA 2ZYAA 3DHNA 1KVQA 1Y5RA 1YQGA 1FDUA 3V1YA 1PIWA 4IJKA 3F1KA 2QYSA 4RVDA 3WJAA 3KSUA 2Q4BA 4DVJA 1EQ2A 4J6FA 5CDGA 2AEJA 3ZCXA 1DAOA 1WDKA 3NX4A 2WTBA 1I33A 1PR3A 4MKZA 1DFIA 4M1QA 3K31A 2EERA 3ONDA 2QX7A 2GGSA 3DQPA 1R4MB 4KUHA 1E7MA 2FR8A 1CJCA 2YJZA 3OJEA 4DMLA 2JHGA 4HFRA 1NWHA 1PWZA 1EBFA 1FJHA 1JWAB 3ETGA 3R6DA 1GZ3A 5FI3A 3CE6A 2Q45A 4ND5A 4MVJI 4IPTA 1ZH8A 4XQCA 2GDZA 2R00C 2J3JA 2PH3A 3ZWYA 2X9GA 5A02A 3I4FA 2CUKA 4JP2A 4MDHA 1QSGA 4UUOA 3ZWVA 1BW9B 3KBOA 4MKXA 4R54A 3HN2A 3V1TC 4CMIA 3G79A 1R16A 2CVZA 2Q1UA 3M2PA 4FFLA 3MOGA 1YL5A 4J2HA 3S55A 5TRTA 2RIRA 5B1YA 4H15A 2WEKA 3EMKA 1YOVB 5AXCA 4EJ0A 5TNXA 2FZEA 1PL6A 4DMMA 4P4GA 1Q0QA 2CD9A 2EF1A 4EZBA 4TMFA 1ISFA 4PG5A 3R3JA 4HFNA 2DT5A 1EQUA 5H83A 4BO2A 1IE3A 3E1KA 3GHHA 1J5PA 4LRTB 2IZ1A 4OKIA 3PHJA 4OKNA 3U9LA 5THKA 4A73A 4FBGA 8LDHA 4FPXA 1TT5A 3DZIA 4E32A 1DSSG 5C5IA 4D3FA 4WK6A 3VPGA 4NBUA 3N58A 1ZXBA 2VUSA 1GU7A 2GNAA 3NKLA 2GF2A 2JHFA 2NQTA 3GPDG 4FJ0A 4CR6A 4DGSA 2ZB3A 2UVDA 5TJ9A 2Q2VA 4BMNA 4BNIA 3JD3A 3GDGA 3I52A 4F3YA 5AQ1A 1LDBA 3ZDFA 4J9VA 3OETA 2VT2A 5ILOA 4J91A 4R01A 2V7PA 2BFAA 5I7EA 1Q7GA 5I9LA 3NDJA 3L07A 3Q2IA 3WWYA 5A9RA 4BO4A 2YHIB 4M86A 1EUCA 2C59A 2ZTLA 3OHSX 5EERA 1NWCA 4J1SA 3O9ZA 5BR7A 3WQQA 4CLEA 3DOJA 2ZTMA 4CM4B 3W4IA 1RWBA 2UV8A 2IXAA 1CF2O 4GVXA 3PHHA 4RVGA 3UCFA 1NNUA 1H6BA 4I1IA 5B4TA 4FW8A 3G17A 3DL2A 4OXKA 3C85A 3RAJA 1HYGA 2YUTA 3CXRA 4LN1A 2POQX 7ADHA 1U7HA 3QLJA 2BD0A 2FY8A 3ZWNA 4CUJA 3CMCO 5HRUA 2GO1A 3W4KA 1PQPA 1L7EA 1Y5MA 2D59A 4ND3A 3SX2A 1BGVA 4K6FA 2VQ3A 5DZSA 1U2GA 4PG7A 5G0WA 3CIFA 1BSVA 1SB8A 5JO9A 2OL4A 1ZVMA 4MP6A 4FFOA 1DLJA 3KYCA 4IM7A 1Q7CA 2D4AA 1T2CA 3PTZA 4B79A 4CUKA 2G76A 1J49A 2IODA 3WFIA 3QRWA 1SOVA 1DHTA 3WWZA 1SPXA 3HUDA 1WLYA 1YL6A 1W8DA 2D0IA 4ZQHA 1WZIA 3C3XA 5JAMA 3RI3A 4NU6A 1CETA 2C29D 4BO9A 4IQ8A 1Q1NA 4AJ4A 4G65A 1I3LA 1WWKA 1ARZA 3PI7A 4GQAA 3ICPA 4J4TA 5G4LA 1WZEA 1GCOA 4TRMA 3QV1A 1LJ8A 4L75A 4BNYA 2A35A 4YTEA 4FB5A 2VYVD 4PLPA 1A72A 1P33A 2NVUA 4ALJA 3DB2A 1ISGA 3DBVO 2E82A 1P1HA 4N7RA 1IUKA 1D7OA 4R1TA 2PGLA 4J16A 4B4WA 1U3UA 2EKLA 2ZK7A 4ZHSA 4K9DA 4XYMA 3RUDA 2X9VA 4BV9A 1NHGA 2H1SA 3OA0A 2O2SA 1UDAA 2P4QA 3JQ9C 3VOSA 4UVEA 4DPKA 1Y81A 3ZHYA 4KQWA 3RVDA 2Y93A 2ZTVA 3EGOA 2VWGA 3NT2A 4FSHA 3AM3A 1O9BA 3IJRA 5I9MA 1N7HA 1N9GA 1YS4A 1C14A 1NR7A 4DXHA 3LLVA 3G49A 4RPGA 2NUAA 4AJKA 5A5EA 3VDQA 2AEFA 3WJ7A 1H5QA 4IQGA 1X0VA 2B5WA 2VRBA 2JD1A 5EN4A 3FHLA 3F5QA 1VL6A 3PYXA 4BB6A 4JROA 2O7QA 1PGPA 3U0BA 1XGKA 1XLTA 1HE2A 2EIHA 1M67A 3LQFA 4Q39A 4A2CA 4HUJA 1X15A 1X7DA 4RPHA 2HJSA 5C3MA 4ZVVA 1C1XB 1WAMA 4H3VA 1N92A 5TQVA 4J1QA 2NLOA 2V6FA 1PTJA 3NDRA 5A05A 3VZQA 4HADA 2VHZA 2X6TA 2ZYDA 5H81A 1DIRA 1P0CA 1W73A 3PJGA 3CPSA 1PWXA 1ADCA 1ZK2A 2VZ9A 4BNJA 3I6QA 4B3HA 1PEDA 1ZNQO 2NU6A 4RF2A 3KVOA 3H7AA 3IP3A 1MA0A 4WOKA 2Z95A 4LMRA 1D3AA 2Y05A 1AUPA 3RUAA 3GLQA 1UJMA 3ANNA 3BMNB 2PZLA 3EUWA 3GNQA 3T7EA 4OGWA 2ILTA 2X0JA 3TL2A 1Z7BA 3KEOA 2JCXA 4RPLA 2GERA 3F4BA 2CFCA 3FRJA 5DCUA 2NSDA 3IKTA 4NBVA 4Z9XA 1B15A 3WDSA 3INTA 3HG7A 1VJTA 4AJ1A 2P9GA 2J3KA 3FCOA 4ZN6A 1OC2A 2C54A 2QW8A 4GH5A 3ADOA 4FR5A 3TRIA 3RSHA 4ZJUA 2ZATA 3HQ4O 1LC3A 2C5EA 2B5VA 4WASA 4W6ZA 1FF9A 3AI3A 4Y9DA 3CKYA 4R9SA 1LUAA 4YQZA 1RM5A 2P91A 4LRSB 1UZNA 4E0BA 4D43A 4KWIA 1KETA 3JTMA 5JW6A 3DZKA 1ZW1A 5KCZA 3WS7A 1I01A 5KNLA 1DRUA 4XD2A 4CMHA 4YJHA 1QYWA 4RVUA 5JAQA 4LSMA 1K89A 3AUSA 4AJ2A 4BQPA 5KTKA 3ZWAA 3DZGA 4J3FA 1MP0A 2PA3A 5KKCA 2W2KA 5IDWA 1A7KA 1H9AA 2WD7A 3JQAD 2Q2QA 4XDYA 1HTBA 1LLUA 1LSUA 3CUKA 3GN2A 4XGIA 2HMWA 2PFGA 2R2GA 3U4CA 3PLNA 1A9YA 1QLHA 4W9NC 1ZSNA 2CF5A 1NAHA 3RJ5A 4PCVA 4GI2A 4HNGA 5KJCA 3I23A 4EJMA 1C1DB 2I65A 2X0IA 3JQAB 4QFDA 2PD6A 4BNHA 2HSDA 1Y9EA 1HDCA 3MJSA 4A10A 3KYDB 3QVTA 3GRPA 4RPKA 1L7DA 4S1VA 1F8FA 1UDCA 4BGVA 4MOWA 4FS3A 2EP7A 3UCEA 2VN8A 5KVVA 5TF4A 2C20A 4D45A 3OJOA 3OIFA 3DZFA 4A27A 5AXAA 3AM4A 3L6DA 2P4HX 4HX5A 1R12A 3JQFC 4BKRA 1NM5A 1LDMA 3MEQA 4WPGA 1WDMA 1NQAO 1A9ZA 1K5HA 5KJ1A 2VZ8A 2GRAA 5T57A 3K92A 1UP7A 3V5NA 1ENPA 1HDOA 1L1FA 1LLDA 4DBZA 5A9SB 3D5QA 3STHA 1EMDA 3TOXA 1E1LA 2V6GA 3QW2A 3X2EA 1KVRA 6LDHA 3C1TA 2ZCUA 4NHEA 5L51A 4TRRA 1PX0A 4PG8A 4BNUA 4XKJA 1W6UA 4DIBA 1ZMOA 3JV7A 2JAHA 4MKRA 5FYDA 1BXGB 4CQMA 5A04A 1UDBA 2X5OA 4BO0A 1QYVA 3RUEA 3VH3A 1MG0A 3DHYA 3H5RA 3EC7A 3TN7A 4CV1A 4JIGA 2YY7A 4MVJG 1H6DA 1E92A 1TXGA 4GKVA 3W1VA 1WVGA 4CQLB 1LTHR 1H94A 2CY0A 3PFWO 2YV2A 2VNSA 6ADHA 1V9LA 4XQEA 3GZ4A 3FN4A 4EUFA 5JS6A 4E5MA 4R68A 3I9JA 2OOSA 4OO3A 3TZCA 2B36A 1DIGA 1E3EA 4K1LA 4ZD6A 5ER9A 4NNJA 1P45A 2DBVO 5K9ZA 3K6JA 2FPIA 3GZNA 3LK7A 4IZIA 4HNHA 3ZHZA 5JDCA 1TLTA 3F47A 3LU1A 5CEFA 3EZYA 2WJPA 4UEKA 3D4OA 4FJ2A 4EEZA 5DF1A 1AN9A 1KVSA 1MFZA 5BT9A 1GDHA 3S2FA 1GYQA 4D3SA 3GDOA 1ZXLA 1IY8A 2CMDA 2CF6A 4D41A 3JQ8A 4OM8A 5C7OO 5GZ3A 3NRCA 2JFHA 2IYOA 4E6PA 5IN4A 1YO6A 3VTFA 3H4VA 1LDEA 4INAA 3MWEB 1MB4A 1WPQA 3E03A 4NK4A 4TVBA 3WYEA 4B7CA 5JC8A 4OOFA 2PGJA 4BKUA 1HRDA 5A5FA 3WXBA 3OBBA 3VVCA 3UVEA 3WLFA 2NNLD 2W90A 3TJRA 3BMCB 4E12A 1Y8RB 2XPCA 4ZRNA 4CUZA 2QZZA 3PDUA 1WW8A 1S6YA 1U9JA 4G5HA 2IEBA 1N2SA 1F14A 3ITKA 2Q50A 3JD1A 1DOHA 5DP1A 2O23A 3M2TA 1NVTA 1E3WA 4FGWA 1ZUD1 5IZ4A 5HA5A 1K3TA 2G1UA 1DBVO 4PFJA 5GY7A 5L4LA 2O4UX 4BGIA 2YFHA 2IXBA 4ALLA 2CSUA 4WKGA 1KEVA 2NVWA 4BNVA 1PQWA 2OORA 4D7AA 2VHXA 3SJUA 4CLOA 1MGOA 3AOEC 5U1PA 4DLLA 4EGFA 1ULUA 3BIOA 1PS0A 1KOLA 3GVHA 1RPNA 4E30A 2TMGA 5A3VA 2H5LA 4YT5A 1G0OA 5K6AA 4Z9FA 3MJTA 4D0SA 1T2AA 3BZUA 3PQFA 4OMUA 4B4VA 4FGSA 2FPGA 3F1LA 5F1OA 2DQ4A 2ZKLA 3WICA 5A03A 3PJFA 4GWGA 2DTEA 4U6SA 1XSEA 1OC4A 4PVCA 4W7HA 2WYUA 4XA8A 4BOYA 1MFPA 5GMOA 4BO3A 2DFDA 3C1AA 4A03A 4PG6A 4JNKA 4AJLA 3PQEA 3NV9A 4ZQBA 3SXPA 1LNQA 3O26A 3K8ZA 2X8LA 4YR9A 3TFOA 3DAGA 5EJ2A 3WX0A 3S8MA 4XR9A 4FFMA 4PIVA 1DPGA 3U4IA 1LSOA 3DBHA 3WGYA 5F5NA 2AHRA 3PGXA 1GUFA 4AFNA 3UXYA 4BNGA 1AHHA 2HRZA 4M49A 3WMXA 3AM5A 3FF4A 2Q1WA 3QA9A 4BKPA 3M6IA 4DBVO 1PJCA 2VTDA 1WNTA 3K2EA 3ABIA 3FNEA 4B8ZA 3GEGA 1WMAA 3B70A 1GZ4A 3RD5A 4B3JA 4NJMA 3OJ0A 3GGGA 2PZKA 3VPHA 3OEWA 4DLBA 2V65A 1R0LA 2NTVA 3QWHA 4CMAA 3RQSA 3U5TA 5DCWA 1XU7A 1HE5A 1UP4A 1NFRA 2F1KA 1E1KA 4JLWA 1MG5A 3MJ4A 5AXDA 2DKNA 2JCYA 3PZRA 1AGNA 1DLIA 3MTGA 1O94A 4J9UE 3DZBA 2RHRA 5ES3A 1U8FO 3KO8A 4MJLA 1MC5A 2C7VA 4NU5A 3MJEA 3PP8A 2FN7A 4E2WA 4U5QA 5F5LA 4UUMA 1LDNA 3BHIA 3H9QA 2FPPA 5GZ1A 8ADHA 1TT5B 1DIBA 1X14A 4ALNA 1K6IA 2O3TA 1JW9B 4JJGA 3VHRA 2ZB8A 1ISJA 3U4HA 1VSVA 3KZVA 2AQHA 1KC1A 2I99A 2J3IA 2ZIZA 3IKVA 3RUHA 1ZK1A 5DBIA 1GUYA 2XAAA 2DC1A 5DN9A 4OOEA 2X4GA 4YB8A 1GR0A 3RFXA 4YJFA 4RLSA 2PH5A 4BO7A 5L7WA 1T2EA 2PY6A 2JJYA 1VJ1A 4OSPA 3ZU2A 4IMPA 4IBOA 1LEHA 2NTJA 5KJFA 4PN3A 5MDHA 3KRTA 3PGJA 1D1TA 3R0IA 2WE7A 1M66A 3H2ZA 2BF7A 2E6UX 4GX1A 1UXKA 1FDTA 3L4BA 1P9LA 2I76A 5JPIA 1ORRA 3MJVA 2A92A 5IJZA 3IAHA 4WE3A 5DNAA 5L3ZA 4YAEA 1I0ZA 2DBRA 2GYYA 3ICCA 4FN4A 3UF0A 3CEAA 3JD4A 3WIDA 3K96A 3GUCA 2RHCA 4C7JA 4JXKA 3BTOA 3AWDA 3N7UA 3DBLA 2J3HA 2PR2A 4DQXA 3PPIA 3ITDA 3L4SO 3TOZA 4U8GA 5L7TA 5EIOA 2CDBA 3TSCA 2P5YA 3BYZA 3LC2O 1QYCA 2I9PA 4PLYA 1U4SA 1V8BA 2PZJA 3ZNPA 1IOLA 3I6IA 3OQ6A 4N54A 4O5OA 4I9HA 4KUGA 1PZGA 1PR9A 2NACA 4NJOA 3RC2A 3F9IA 1ZIDA 3BXXA 4UVDA 4YT8A 1YONA 4JBIA 5LCXA 3JYOA 1X7GA 1ZCJA 2E49A 1R0SA 4ONEA 4PLZA 4WNIA 3NYWA 3RBZA 3WSWA 4ITUA 4R1SA 5C7IO 3JQEA 1GQYA 2R6JA 2OGUA 4JJFA 4WEQA 2Q99A 4NI5A 4DIOA 2I67A 1ADFA 4OJNA 3GGPA 4CMEC 5BNIA 3DMTA 3QY9A 3FSRA 2NTNA 1JA9A 1Z7EA 1EE2A 4WCFC 4UREA 4PLCA 3ZWMA 1LRLA 1P44A 3H65A 9LDTA 1QLJA 4DTIA 3S1LA 5KVSA 3SC4A 1F06A 5T8KC 1YDEA 2X9NA 3L6OO 4CM5A 2EXXA 1P74A 4BHTA 1E6EA 2EHDA 3E5RA 5IZCA 4Z3DA 1QYXA 4TQGA 2PGDA 2ZQZA 3P5SA 1E1MA 4NMHA 4BKOA 4CV0A 5L9AA 1AE1A 3FI9A 3W4JA 4CODB 4YYZA 1I2CA 1QR6A 4XDZA 4WJZA 2I5PO 3R3SA 1ZEMA 4WGGA 4DQUA 1CWUA 5JLAA 4XEHA 4D46A 3AI2A 3ETDA 1V3UA 4GVLA 1O6ZA 3ANLA 4GSLA 4ZQGA 3V2UA 4YRBA 4NBTA 3E18A 4UULA 2NM0A 3ZV6A 4XRRA 4W99A 5JMPA 2D5AA 5BSHA 2NVBA 3KEQA 1T2DA 4E4YA 5C37A 2VHYA 1ZBQA 4J1NA 4KWHA 3RIHA 4IIUA 5ER6A 4CM8A 1SEVA 1JKIA 2UYYA 2EKQA 4YJGA 1EVZA 4QO8A 3C1OA 2OHXA 2BRUA 5CFZA 3BAZA 4MP8A 4NG5A 4B3IA 4CMCA 3PEFA 4OYRA 5CEJA 3C8MA 3ZHBA 2XXJA 3H9EO 1JWBB 3JD0A 4R16A 4YCAA 1GY8A 3VKUA 3FR8A 3K2BA 3H2SA 1JTVA 1O89A 3CZRA 3QWIA 3GVPA 4WECA 4EDFA 5JXWA 2NADA 1I24A 3E8XA 2D1YA 1M2WA 5KWEA 3U62A 4AICA 1AHIA 2WD8A 4N5MA 4OQYA 2YHUA 1ZK4A 4IQ0A 1LQTA 1J4AA 3GMDA 1RYEA 1D1SA 1B14A 1PJ2A 3OF2A 1NVMB 1SC6A 1QKIA 3GY0A 3M1AA 4QEDA 1R0KA 3UAGA 4XZ3A 3KSZO 4EBFA 1Z82A 5LDHA 4LCJA 4L8VA 3DAFA 1NAIA 3GNSA 4J4BA 3KHUA 4A5OA 3IJPA 4LISA 2OBYA 1HL3A 3CMMA 1LXCA 2EGHA 4CM9A 4I5FA 2BI7A 2G82A 2GR9A 3PJDA 4HXYA 4Q3CA 5EQFA 1LU9A 5JYDA 3G1TA 3MCVA 3GAZA 4J4HA 1V3TA 4I9UA 1LX6A 2J5KA 3GDFA 3TPCA 4ZQFA 3RC7A 1FMCA 3FPLA 1SNYA 3ROQA 4YJHB 1MC4A 4FD3A 3DOOA 1R4MA 2VHVA 4RGBA 2X7HA 4R5HA 4WLUA 5KIAA 1TA4A 1LSSA 5H82A 5A4DA 2FP4A 3M1LA 2GN4A 1PQUA 4JQCA 3I1JA 2Z1NA 3FTNA 4WLOA 4CM3A 3FWNA 4GKBA 4FC7A 2WDZA 5MGBA 4NDNE 4UUPA 3VH2A 3BHJA 2OZPA 1NR1A 2ZB7A 1W4ZA 4UVGA 3NGXA 4CLHA 2DFVA 2O3QA 1BW9A 2GPTA 1LQUA 3A4VA 2NU8A 1VM6A 1C0LA 3DEYX 2PWZA 1HZJA 2O48X 1UAYA 3B20A 1V35A 3VH1A 3G3EA 1B3BA 5DOZA 2BMAA 1ENZA 1E7RA 3RCBA 1YOVA 2AQKA 3K73O 3RC1A 3VZRA 4YAIA 3GN1A 5C7LO 3A06A 3BMOA 4GLLA 2O3JA 2EV9A 3PIDA 4I08A 5TX7A 1R66A 3QE3A 4A7PA 3LT1A 5JY1A 3ZNQA 1LLCA 1YE3A 4Y98A 3KV3O 5EL0A 3H5NA 3RKUA 5A9TA 4K6CA 4WCFB 1DFHA 4R9RA 3TZHA 5JO0A 1O95A 1LLQA 2EEZA 4CQMD 1Q2XA 1E3SA 4IS3A 1OBFO 2EW2A 2D2IA 3BA1A 1NXQA 1E77A 5FWNA 4E13A 3JCZA 5B4UA 2C82A 4BL5A 3WOHA 4ZICA 3AUTA 2BELA 4MVJF 4WLNA 1HE3A 1U28A 1O5IA 3WLEA 3PLRA 4PLHA 5TJHA 1U5CA 4ZQEA 5L95A 4R3WA 1SBYA 1VL0A 3DZHA 1F17A 5TSDA 1UP6A 2Q4EA 3HDQA 4BNXA 4C4OA 1SEPA 3OICA 1BG6A 1HSZA 1VI2A 4GL4A 3VKVA 2YZ7A 2YHIA 4GMFA 3WGTA 1OI7A 1BRMA 3OM9A 3OMLA 3QIVA 4S3MA 1ZMTA 2HK7A 4E5NA 1KBZA 3COSA 3GUYA 4U0KA 4KMSA 3UW3A 3RUFA 3GZNB 2BGMA 1H2HA 2FSSA 4QFCA 4KOAA 5I7VA 2B4TO 2IEDA 1DRVA 3ZNNA 2NQ8A 4HP8A 1JAXA 5K0ZA 4ND4A 1UUFA 4RORA 3AK4A 4B7UA 4Z3KA 3LF1A 3Q3CA 2OFPA 1H9BA 3BMQB 2FOIA 1B7GO 5JDIA 2RH4A 2BKAA 2ZTUA 4BO1A 1ZO8A 3P2YA 4QSMA 1QP8A 2EJVA 3Q11A 4CM1A 4ESOA 4BV8A 4KDEA 4BGEA 1X1TA 3DTYA 2Y67A 3ZNOA 1PZHA 2G17A 3I83A 4CMKA 1F0YA 4QO7A 4EITA 4L0QA 4RO0A 4R51A 3TF5A 2Y68A 3E48A 3O8QA 4R4JA 4R1NA 4WUVA 4JBHA 1GD1O 1RM3A 1J0XO 3QWAA 4AJNA 4XYLA 4XIYA 1HF3A 4YWJA 1MXFA 1MLDA 1PS9A 3I9LA 2XXBA 1X0XA 2D5CA 3JYLA 3QSGA 5CDYA 5EMHA 1BXZA 1Z75A 4J7UA 1E3WB 1O0SA 4AL4A 3LZ6A 5CPFA 1TEHA 3VC7A 1VC2A 4I9NA 4DRYA 4PLVA 4CJXA 1YB5A 1U4OA 1W0CA 2VWPA 1GQQA 4GPD1 2BFOA 4EUEA 1T2FA 1U8XX 1U3TA 4GLOA 4YDRA 4LW8A 3EVTA 5G0UA 4YXFA 2HAEA 3HSKA 1A5ZA 3SVTA 4NFYA 5I8ZA 3EHEA 3IUSA 1YB1A 2B37A 3LC1O 4Q3BA 3GAFA 1I3NA 2EJWA 3AI1A 3MZ0A 1GZ6A 1HDGO 4WEOA 5HWSA 1E6WA 1HSOA 4IDFA 1V0JA 4XCVA 3TWOA 1GTMA 4LK3A 1M6HA 3NT4A 4QQRA 2AE1A 1YXMA 1YH3A 3L9XA 4IY1A 1KIFA 3C7AA 4IDDA 1JVSA 4DL9A 5HS4A 2PKQP 4P22A 5G0SA 2DBZA 2R00A 3DBRA 2P9CA 2A94A 2X5JO 4KP7A 1HZZA 1ZEJA 3BTSA 5EINA 1DXYA 1XWFA 4J0FA 4R5MA 3IC5A 2Q1TA 1DHRA 3HN7A 4N18A 3ONFA 3WTCA 3AUAA 4PGFA 2HCTA 4FDAA 1T26A 1DC5A 1DO8A 3OIDA 4ILKA 3ROPA 2SCUA 3DBHB 1DEHA 3DTTA 3F3SA 4B4UA 3D3WA 4MVJE 3A9WA 2OXIA 3ZU4A 2YW9A 4O63O 3JQBA 4QT0A 3T7CA 1C0IA 1HDZA 3PWZA 1N7GA 5BNFA 1Q0LA 3NJ4A 3BMNA 4ZU3A 4RZIA 4XIJA 1NVGA 1A4IA 4K28A 3WTBA 4L4RA 4DC1A 1NYTA 1PJ3A 1TT7A 2G0TA 4AJPA 1IPEA 4UEOA 3OJLA 4MVJD 1VPDA 1N1EA 4TKLA 3HJAA 1PGNA 4MVJH 5G4KA 1JDJA 4FOSA 4IJVA 3GVIA 1KVUA 1SCUA 1E7SA 1R4NA 3GEMA 3KOUA 2P5UA 5JE8A 1E5QA 1NFFA 3WNVA 3E9NA 2PV7A 4JGBA 4TRNA 5TGDA 4YEDA 1A71A 2NU7A 3DMYA 4N5NA 3HWRA 3GFGA 4Q9NA 2CNBA 2YV1A 2HU2A 4G81A 2BI8A 4TSKA 1FXSA 3WBBA 2VUTA 3AW9A 1QORA 1ZSVA 5JCJA 4DYDA 4EEXA 1BVUA 2H9IA 1P1JA 2FWMX 1T25A 1GFSA 2C5AA 3VDRA 1HDRA 2EP5A 4R1UA 4AG3A 4HY3A 5ENVA 1YVEI 1E6UA 1IPFA 1TB4A 3KB6A 2LDXA 1KY5A 5CHEA 2AQ8A 2BFPA 2QQ5A 4L73A 5DOVA 2FR0A 1E3JA 1JQBA 3LC7O 1KVTA 4J0EA 1ONNA 3JQGA 2Y1CA 2PK3A 2HO5A 3O03A 1Y7TA 4II3A 3WNQA 3S2IA 4HV4A 1T1RA 5ILGA 2Y1EA 4IUYA 2X0RA 4CLDA 2O2YA 4E5PA 3FNGA 2ZYGA 3NDIA 4QUKA 3ROKA 1C1DA 3CTMA 4DREA 3I5MA 3TDKA 2RBEA 1U1IA 3NUGA 3GRKA 1M6WA 3G1UA 2BGKA 5JMWA 4BO8A 3MOIA 3AJRA 2AEMA 3F5SA 3QVWA 2Y1GA 2B69A 1XYGA 4AJJA 2FZWA 1E1NA 2O7SA 3GGOA 4K26A 3DFZA 5THQA 2WE8A 1CYDA 1E3LA 4GX5A 2DTXA 1U2DA 3NGLA 4YJDA 2PKQO 4ZRMA 4IDGA 3U4DA 2E48A 4YT4A 1PZFA 3ASUA 4ZGWA 3I9KA 3ADPA 5F1KA 3LDHA 4JN6B 4AJEA 3EVNA 4XGNA 1S7CA 1U3WA 2VZ0A 4LVCA 4N5LA 2PLAA 3SC6A 5G2OA 1K2WA 1EUDA 1HKUA 3HNPA 4GSKA 5A3JA 2AA3A 5G0VA 1P1KA 3IIEA 5A9SA 1EZ4A 5CP8A 5L7YA 3VTZA 2Z1MA 3AUUA 1XCBA 1C0PA 3ENKA 4PZDA 3NTOA 3TZQA 4HBGA 3CH6A 3O4RA 1Z45A 5CDUA 1KEPA 4PLFA 5A1TA 1CQIA 1IB6A 2X22A 1E7YA 2OO5A 1GL3A 4II2A 3EAGA 2W98A 1I2BA 3C24A 3GHYA 4PRLA 1DC3A 1HDYA 1FK8A 1N1GA 4MVJP 4YVFA 2YFQA 2Q3EA 1T4BA 1EVIA 5FI5A 1XR3A 4RDHA 4CMIB 3GR6A 1E7WA 4JK3A 1MV8A 1V3VA 4O59O 5U9CA 1GYPA 4LMPA 4TKMA 1TI7A 1OZAA 3DDNA 3A28A 4I5DA 2G5CA 5FF9A 1CIVA 2CVQA 1XA0A 3KLMX 4IXTA 1UZLA 1GYRA 4E5YA 3HHPA 5LDGA 1VJ0A 2JCVA 1IULA 1YL7A 1H93A 2DPGA 2QG4A 1UAGA 3ON5A 2VWQA 3PWKA 5B12A 1GPDG 1LC0A 1H2BA 3ZWBA 2W2LA 3AY7A 1E3IA 2X86A 1Y6JA 4A26A 3TFQA 2CVOA 1X13A 1HXHA 1XG5A 2AW5A 1EFKA 1PJBA 3PWSA 3TQHA 3E9QA 1SMKA 2PTGA 3AY6A 3PZBA 1YWGO 4I5GA 2AG5A 2I3AA 4W7IA 1IZ9A 2VT3A 2EG9A 2Q46A 2QHXA 3FR7A 3V2HA 5IDXA 1D4FA 3RROA 4UAGA 1XEAA 1YGYA 2VOEA 3HDJA 4KTTE 3MTJA 4Y8VA 4F46A 2WM3A 2OP1A 2VNAA 3BMCA 1DFGA 5T6BA 4CM8B 4J1TA 4E2XA 3GQVA 4GAEA 1EBUA 1Y8RA 4NFHA 3EW7A 4YJGB 4IDCA 1EUZA 4ALMA 4C7KA 3PIIA 3ULKA 2O50A 1BWSA 5EPOA
chains in the Genus database with same CATH superfamily
2W0SA 4RHFA 4X24A 2OA0A 4NCIA 1NUHA 3I9FA 3M83A 5BQ5A 3TW8B 3VPFA 4DFDA 2V6JA 3IDZA 4O4HB 2VF2A 4NEHB 5DIFA 2JLUA 3PCXA 4GYKA 4GOLD 3T94A 1YZNA 4DQKA 1ND6A 1TUEA 4ENWA 1TKRA 4YPFA 2EQAA 3T15A 5GJBA 1XU9A 4LSZA 2AN9A 3FWHA 4YP5A 2CV2A 4P38A 5HZGA 1I2ZA 1VMKA 2UZ0A 4OXXA 2VCYA 3SDZA 4FOOA 5LNK6 4Q1VA 1FTWA 3RYFA 4F45A 3VJRA 2QV7A 4V1CI 4ZO8A 4UOEA 2XVMA 1E58A 3H99A 1S0UA 1JDTA 1XEWY 4PSDA 3C7TA 3QBDA 2PZGA 2QLFA 3NONA 2X1HA 4YASA 3Q8LA 4CM9D 2JI9A 3C4QA 1AIPA 3H8SA 4IGEA 4BKQA 3JYQA 2PGIA 3MMZA 4X85A 3OPYI 1QF7A 3IMEA 4MARA 2C7BA 3BF7A 2OCYC 2OZLA 4CVNA 4OBBA 4CHGA 3H3JA 3F98A 3GEHA 4E7PA 2AD1A 5JWOA 4R2LA 5T64A 3DZ8A 4UNNA 5BWOA 2YBDA 1I5OA 10MHA 3A3YA 2QR5A 1VQ1A 2Y0DA 3IAS1 3MWLA 2QSZA 3PVZA 4OCZA 3HKBA 1NTOA 4O0LA 1XD2B 2C0PA 4PLTA 2I3ZA 4A8JB 1DI0A 4NIMA 1Z28A 3KSDO 4N76A 1KDRA 1UOPA 3EVBA 5CDTA 2OBNA 4JLPA 2F62A 1SUFA 4BNNA 4KCGA 3UGJA 3FSEA 3L8HA 4A0QA 5CT9A 2FSGA 3AUKA 3L6EA 1KZ4A 2M32A 2R1TB 5AHXA 2NVUB 4URFA 4E09A 3ZZNA 4NK5A 3SG0A 4RKQA 2VH5R 3DMDA 5DYYA 2KSQA 4Q0MA 1XV5A 3JQFA 1ZD5A 2IZOA 3S1SA 3UWPA 3ZJTA 2QM0A 4RK4A 3HCDA 2ID9A 3V8MA 4PZAA 3TRDA 4R71A 1JFSA 1JQLB 2PEYA 4XVUA 1EXMA 2IE0A 2J8ZA 4ZOEA 3C3CA 3SZRA 4X84A 1LV8A 1GUZA 1JXOA 4Y6GB 4AMZA 4D4MA 4DE5A 5EHXA 5EXTA 5IG2A 1GILA 1OIWA 2CNKA 2Y1DA 5P8WA 4NH4A 4R8RA 3VJLA 4D1YA 1I30A 1AZWA 1JP7A 3WYCA 5FNZA 2NU8B 3UKOA 4CKBB 4ARZB 4Y9SA 3K30A 4GYWA 2BR3A 2OUIA 2BSXA 3CUUA 2K7FA 3KU1A 3QVSA 2FF5A 4U0JA 2C31A 4CDGA 4LK2A 4YJKA 2BFNA 5I9IA 4BN5A 4ND6A 1Q92A 4TV8B 1OHHD 4KR9A 2O4CA 2E0IA 3O0DA 2R86A 1KK1A 1XI2A 1ZRMA 3K0HA 2GEJA 2ONZA 4ECAA 1ULZA 1OAKA 3HKEB 3OQ1A 4K6KA 5E0KB 1TZCA 2VRCA 4FKBA 1GG9A 1PR5A 3DT9A 1G4UR 2C0QA 5GZ6A 1MKYA 4C4TA 1OH5A 4QXQA 1WHSB 3O84A 1ODTC 3BB4A 3A04A 2XNJA 4CKXA 3R8CA 1RI3A 4Z8XA 2VP3A 4FYVA 1YZ3A 3KR9A 1AB5A 3F6YA 4K6OA 4MEJA 3R6TA 4GBMA 4YRDA 5FEUA 3UB3A 1O8BA 3RFCA 4HQ0A 2O0KA 4HXEB 4RF3A 4UUQA 4B3CA 4QT4A 1QH8A 2D3TA 2IS2A 1LX7A 1T4DA 3GT0A 3EH2A 4LHZA 1P7VA 4TUYA 2OVFA 3HYRA 4FFSA 2XBUA 2C2ZA 5CT6A 3VBCA 3LVRE 1Q0TA 4DSAA 5JHHB 1KDVA 2ZUUA 4E21A 2EQ5A 4B3MB 3WLAA 1CJMA 1ECGA 2RKWA 3KYJB 4YV1A 4FCCA 3I32A 4FX2A 4PU0A 4LS3A 3IL2A 5CH3A 3LDUA 1RM4A 1SKYB 3D7LA 3M7IA 1RQ2A 3HZZA 1YIOA 3M89A 5G0TA 1CUGA 5H68A 5LQUA 2VA9A 3BBLA 4YXWD 4F06A 4ZKDA 1G3UA 1NMEA 4G4IA 4JP3A 1XJQA 3M0EA 4OGKA 4BE4A 1XF9A 2QMYA 5AI0A 4ZXPA 4OYYA 1QGUB 1R8YA 3SEFA 2VYNA 3E05A 2HXSA 3JQ7A 1TUGA 2HGSA 4LRYA 4OXRA 3QYPA 1B8UA 3PDHA 4BE9A 5AVOA 1HETA 3Q7PA 5D3MB 5C8DA 4OGGA 4AC9A 1GRCA 1NW6A 1W2GA 1IWBB 1N57A 1USVA 1UBUS 1NQWA 1RHJA 2GHIA 2D1RA 2HIMA 1Y9AA 2Y4OA 3FPJA 5KCMA 3ZIAD 4R2MA 4UEJA 2CVHA 1U1DA 4LGCA 2B7CA 3F4LA 2EW1A 4L4SA 4GRAA 1GSAA 1QK5A 1XAJA 4AJ9A 5BYKA 1DO0A 1TLFA 3RBAA 3REOA 2EF0A 4LWZA 4W4TA 4B71A 4YY3B 3EQ6A 3IR7A 3OAAD 5A3RA 1NKSA 2V7WA 1K4YA 1R9JA 4X44A 3IQDB 1ORDA 3FNQA 4LGVA 4N5HX 3MBKA 3NC1C 5FX2A 3WDKA 4KAAA 1U90A 2ATEA 2X8AA 5DI3B 3VV2A 4WKBA 5T7BA 2GSDA 4US1R 3VA7A 3NLLA 1L7BA 4IIVA 2JFFA 4MGYR 3TOCA 3B9RA 5ENDA 3M6AA 3SLRA 1G8AA 4PFKA 4MUXA 3I0ZA 2YXPX 5TR9A 5HPYB 1APBA 2NPOA 1C1YA 1FUKA 3VR2D 2FFRA 3QEMA 4UTXA 5BYAA 1ZZEA 2WF5A 3C8ZA 2J0UA 4NEQA 1G21B 1GA1A 3VQTA 4MINA 3JAKB 2IIQA 1JSCA 2DFTA 3G2KA 4EKDA 4QUAA 4ZI7A 1IBKB 2FVYA 3F6CA 3QHAA 5EWJA 5DVZA 4LF6B 1HEYA 1ZNWA 2VHUA 5CLLA 2FMIA 3GXOA 3ABOB 4Q3LA 5L4SA 1F6BA 2DAPA 1LI5A 4RK1A 4CMBA 4F6CA 4G8DA 4UARA 4RL6A 4V0QA 4J03A 4R41A 1TQ8A 3BB1A 2V45A 1VGQA 2PJDA 4BVEA 4W1RA 2HK6A 1CHNA 1WPRA 5DTJA 4C07A 4EMUA 5IKOA 2RI1A 5J43A 3AFMA 4FFRA 4CTKA 2WWYA 1EPUA 3I4CA 4JZKA 2FPLA 1KYZA 3IAM6 1LRJA 3T7RA 3JVEA 4C1NA 3GBPA 2VYCA 4BECA 2J32A 4TL8A 1A7AA 4ZAZA 2XUDA 4O4LB 3EAQA 2RCYA 2PO5A 1J07A 1M8JA 1MX3A 4B3DA 4B73A 1Z2PX 4IIJF 4C7XA 1FZQA 3VNUA 1QIFA 1S8NA 2GBLA 2X2PA 1P4RA 3O8BA 4H7EA 3MQ4A 3ZU3A 1PV2A 2IOYA 1M72A 5FAXA 4BGUA 1UJBA 1GR1A 1WKCA 1K8XB 1AUQA 3WSTA 3N2YA 4IGAA 1WVIA 1YKSA 4B7XA 1EUQA 1OLUA 1X8XA 5AM5A 4AU1A 2FK8A 4DUZB 5IVPA 5IKPA 3KAJA 3R0ZA 1EINA 2SBTA 4N48A 1FSGA 1FW8A 3FFTA 2XMBA 2DR2A 4XYGA 1NE2A 4UEWA 4CM6A 5LVAA 2UZIR 4MROA 1D8AA 3QXXA 4GYYA 4FILA 5FRDA 3RTAA 4LJ6A 3FOAA 1U81A 1O94C 4QYTA 1DZIA 1UWVA 2HDHA 4RC9A 4BAZA 3R9XB 4CQMB 1AY0A 4EVRA 4AS1A 1DDOA 4J0JA 4FX5A 2QE7D 3G0GA 1A88A 2D8AA 2HWXA 3L2OB 3HFRA 2VPPA 1NMZA 3GJYA 3RAGA 1XFDA 3VNSA 1RI1A 4OA5A 2Q6KA 3T3DA 1UKEA 3OUZA 4KVAA 3ZWQA 2Z83A 1I80A 2ZT8A 4JC4A 3UG6A 1MIOB 2JARA 3HB1A 2FEMA 3OOSA 2CFRA 4KVFA 1GCAA 1YQXA 3IDSA 1QCYA 1P2GA 2HCFA 1WVMA 3NHUA 1KQFA 1QIGA 1QQ6A 4Y6RA 2QLTA 2W2NA 1Z0AA 2ZSIA 2B4YA 3KVVA 3T1OA 4JU8A 3TG8A 1JU9A 1Z5PA 3R7SA 5DSTA 1G5HA 1ECPA 1N5OX 1Z5NA 2DPLA 3HA2A 1NMYA 4YMVA 3UUGA 1EA7A 3OEEA 1PJSA 3IIIA 4MUIA 4KJXA 5JUWA 4JCOA 3M34A 2OLEA 2SECE 2Z2XA 3D1LA 4JJ8A 4Y2RA 1NASA 1X77A 4F4IA 1I5EA 5C51B 4GR5A 5DYIA 4KLRA 3TBKA 4EJSC 4I9FA 3HJBA 4OG2A 4EY3A 1EFCA 1OD6A 3G7NA 4QHTA 4DNXA 1BH6A 1SOUA 4UEQA 4YRAA 1MPTA 1FMTA 2CLLB 4UMVA 4F86A 4ZAYA 1OV6A 1OXUA 2AWOA 2ASVA 2FUNB 3LX6A 4OB6A 3U31A 4YAUA 1SCUB 1QVZA 1TMYA 3OU7A 2JCGA 2W2MA 1YDHA 3LRXA 3LT2A 1O8CA 4WLVA 2GK7A 3Q0EA 4PAQA 4R1MA 3TZKA 2NSHA 3HDTA 3N74A 4HWRA 3SZUA 3C7CB 4YT2A 3QVUA 5JCJD 1TRHA 1OSNA 4LOAA 2WZQA 5KC9A 4LUCA 1NLYA 2CDCA 2QMUA 3AEXA 3NR2A 3NYQA 4NZ9A 1UJCA 1CPYA 3CNHA 3WMWA 2HT1A 3G0OA 2B9VA 3WNDA 1HEUA 4Y6SA 3K16A 5JY6A 4C0WA 3HFGA 3FYUA 3VAZA 5H9WA 3BERA 1F1JA 1EFLA 1E63A 3TTWA 3ZW9A 2FG5A 3RUCA 1E9CA 1ZRSA 2QB5A 2W83A 1B76A 3HJHA 3KE8A 1UZMA 4IIFA 3QQ5A 1RYNA 4Z0PA 1WJGA 2R8RA 3GG9A 2PD4A 4NZPA 4KIFA 2VDUE 4PCUA 1H1DA 1XN4A 1G8MA 3TZBA 4PG4A 1MXHA 1BD4A 5CG2A 5ALHA 4RXMA 2OHGA 1XMVA 5LP1A 3RHZA 1XIVA 1WBJB 4B1FA 5FIUA 1C8VB 4PYQA 4BFXA 1O9HA 4LRUA 4GI5A 4WZAA 3OE7A 1IEWA 5JARA 2QD5A 3HU5A 3OFND 3M6UA 2VP2A 1BJRE 2VBCA 1JU4A 2ZBDA 3RU9A 1T5DX 3TCXB 2W6NA 2VHQA 3WP1B 3DOFA 3WWOA 1XDSA 3TNYA 1OAAA 3T6KA 1BDMA 3L0DA 4Y0VA 4B83A 3TRKA 1G9TA 1KC3A 1ZBDA 3IO5A 4FS8A 5CK5A 3NMUF 4WV3A 4YUZA 4FC6A 1U8AA 2QW1A 1KY2A 3QPUA 1KJ8A 2XNKA 2XNDD 1QFYA 2I2BA 3BG5A 1K7EB 1Z15A 2JLAA 2Z9BA 3GFSA 3DMTC 3PNLA 3ANYB 1VKNA 2CT8A 1WL8A 3VSBA 2IEIA 2RGXA 3DOEA 4RQUA 1YS2X 3UICA 2E6KA 1BHSA 2IX3A 3U19A 3GVCA 4ND8A 3GJ5A 2ZBPA 1F2TB 3HDGA 3N8GA 1DG3A 3PFIA 3NWPA 3ADBA 1Q83A 5HQTA 1ONOA 2VDOB 2YH2A 1WULS 1N2IA 1JLLA 1QNFA 3M33A 3MPUA 2AFHE 2MMCA 4IXWA 4CYMA 3IPYA 4UW9A 4BBPA 4L8WB 1GAEO 1IBRA 2JEYA 2E1PA 1K6JA 2OWDA 3QH4A 4QVKA 4RCVA 1DRWA 4BO6A 2VQDA 4EG7A 4XR4A 1H65A 1LBEA 1J2EA 1UKBA 4M4SA 5KTTA 5IZCC 4JVOA 2OE2A 1I5RA 3D8NA 3KZMA 1XQ6A 3S2GA 1JG6A 2VAPA 5DWDA 2VSYA 3WQSB 3ZWXA 4AK9A 5M04A 5CXUA 1AS3A 4TVSA 2WWRA 2R8ZA 2X8WA 3LLUA 1DUVG 1EFHA 5FWYA 1QXSA 3A37A 1G42A 1DQSA 3Q8MA 4JI7B 4M55A 4XTRA 5FFMA 2OPBA 4QJBA 2B3DA 4Q02A 3WO1A 1VL2A 1BKSB 2PVCA 1XO1A 1PW7A 4FMDF 5HM8A 1F8YA 1HR0B 1V43A 4L8GA 1A2OA 2DOKA 2OV6A 3FVVA 3T5CA 3IB6A 3Q1LA 2DR0A 4GLFA 4KTVE 2A5GA 3SPXA 3ZWKA 4DA9A 2PS1A 4TLDA 4ZVPA 4RDXA 5FHQA 3STVA 3T8YA 2C8VA 1T91A 3VVMA 4B81A 4G9BA 16PKA 2ZXEA 3LUJA 4EGSA 1WXWA 1EFPB 4DCNA 3MRSA 4YACA 2JFGA 1NL3A 5HJ2A 1FRZA 3D59A 3U4GA 4KR6A 1OXTA 3FYSA 1ZONA 1FLDA 3O82A 3EYWA 3FPKA 3FYDA 4IW3B 5KAPA 5CEEA 1EXVA 1LI4A 4QU8A 1E2PA 1FDWA 4OXNA 5IDYA 3RS7A 3T12A 4BFCA 5K3OA 3R40A 1ORVA 1PT8A 4DCGA 1VPWA 2J4DA 2OBBA 2BRUC 2DU8A 3JZIA 5HG0A 3R1IA 2A78A 5HCUA 3EBPA 3T1NA 3WIOA 5EESA 1KERA 3W8FA 3ZQKA 4KPEC 1IM2A 3U2QA 2D2XA 4YNBA 5DEIA 4WXMA 4ZYVA 1BE0A 3O8RA 3KLPX 4MX8A 4A15A 2EZ8A 4HAUA 3M82A 4RZ3A 4HBZA 5JR3A 2ZJ7A 3CZCA 3TDMA 1PYGA 1BX1A 1V5EA 1WMFA 2GASA 3A7EA 1V8DA 2HDNB 3D4NA 4NE7A 1P9RA 3FB4A 2ZRBA 4CLXA 4TOIA 3VGPA 2J7PA 3WYBA 4HUQA 4GPZA 1QE3A 4LYHA 5EJAA 3IBFA 4OQ4A 3V00A 3TLZA 3P9RA 2V3WA 4K87A 5K99A 1WCIA 4CPDA 2G88A 2V6MA 2GEDA 4PQRA 3RIGA 2KQUA 3ZU5A 5D5HA 2WMNB 1YS9A 2WF8A 2GK6A 4XXHA 4YMSA 4Z7NB 4C3UA 5ITZB 1RRVA 2HMSA 3N8NA 1YMQA 4BKMA 2XRYA 2ZJ1A 4KXYA 5LLSA 2CXUA 4NZNA 4D2IA 2JA1A 3ROMA 3V2GA 4DAOA 2PU7A 3QJ5A 4Q93A 1NXOA 3A2LA 4LZZA 4YJFB 3VJMA 1SCQA 3PQ8A 1RYDA 1LDYA 2YVAA 1ZUHA 1XTRA 5CT4A 5BSGA 3OC6A 1EFRA 1PR2A 1XRQA 4GC9A 4R2XA 3T7AA 3UMCA 1JDZA 4CQNA 5F78A 3E35A 3MS7A 3COPA 3D64A 4UTRA 2IEAA 3O5AA 5SY6A 1MUUA 3QXGA 4XM0A 4YJ3B 1UXJA 4QD3A 2ZYHA 4YP9A 2YYSA 4M0LA 2FN9A 3DFIA 3UWMA 2XUAA 4CRWB 3DXFA 5HMMA 2IPNA 2FB9A 3ZD7A 1A8SA 3WOVA 3SZOA 3RRBA 4A4DA 4RIGA 5AJZA 1GNPA 1LRKA 2VUHB 2R1VB 3S2ZA 1GPBA 2B4RO 4LDPA 2XKBA 4CR7A 4P7BA 4CW7A 1BEUB 2KMLA 2F8MA 2FSHA 1VPLA 4Q1BA 2O0LA 3AL3A 4D98A 4B6OA 5JSFA 3DVAA 3I05A 2GTHA 2PZMA 4HGNA 5JNLA 5TPZA 1R6XA 4DYVA 2VPWA 2F4NA 3BIXA 1AV7A 4FI3C 2QRVB 3S2EA 4DC9A 2DUMA 4NAHA 1JAYA 1Z5GA 1DO2A 3ANTA 1X1RA 3AR3A 1YJBA 3BTVA 2GN1A 3C41J 3HZHA 3NEPX 3DUWA 3M9XA 4UCXA 3THXB 3A27A 3JD2A 3M4XA 3CLTC 4ZA2A 1G6OA 2CLHB 3P2EA 2PWBA 2YNMC 2BH9A 4PNPA 3O74A 1JKFA 3AETA 3PUKA 4B7ZA 3M6MD 3RJZA 3IUMA 5GINE 4FWTA 3N87A 3G8AA 1D07A 4R2IA 1IZ8A 3LFUA 1UOQA 1UBFA 4N7BA 4RIFA 4RVFA 1VLHA 4L9RA 5JAOA 5JIBA 1Y3HA 1OWLA 2PKYX 4O2RA 2IITA 1B23P 2QZ9A 4U2DA 4C14A 1M8GA 2PX8A 4IG9A 2GCPA 2EFEB 4KQHA 1U0NA 2VJLA 4NMLA 1TKBA 3M6FA 1E66A 2ONCA 3IVXA 4YCNA 2WIDA 4L6IA 4R1PA 2JLXA 5C7YA 1N34B 3DVRX 1T4CA 3E3NA 2W2TA 4UPEA 3ZHXA 2HU8A 5C4MA 2R11A 4EO4A 3I42A 4Q3DA 2F17A 3IPLA 4JI5B 1LB1B 4LOHA 2H5JA 3UAZA 4E5SA 4PWZA 1Q3HA 2IXEA 3C0KA 4JJIA 2X2EA 1VCNA 2IYTA 2IVFA 1WZUA 3EWSA 4U7WA 3SYKA 2P62A 4V38A 1TCUA 1VHLA 3ORFA 1FQWA 1R8JA 2E5WA 4LHXA 3W9YA 1DWPA 4M22A 1OFIA 1ZM2A 1O95C 3O3OB 5ECDA 5D1NA 5DNYB 1OAOC 2FWPA 2VBGA 4TMTA 1DXHA 5U4QA 1SIOA 4G1BA 3RABA 5ICSA 4QOHA 4WW0A 2Q8NA 4BMVA 3MUNA 4JDPA 3IXMA 3VPSA 1KU6A 1PZEA 4X3OA 3ZI0A 1K6XA 4CCAA 1JHXA 2O7NA 1VZ3A 1ZLYA 5AJHA 2WYIA 3IOEA 3L84A 1QO0A 1BGWA 1E4EA 2EW8A 2YJ5A 4RF5A 4LNUA 2GJAA 4FB4A 2WRZA 3H5AA 2RD2A 1NVVQ 1MEJA 1PSDA 4MJXA 3IV7A 3RR2A 3MC1A 4RY0A 2HTFA 3K94A 1UBKS 2PLWA 3QWBA 3NIGB 3Q6IA 2H08A 1L1FA 2QX4A 2DKOA 2ZW9A 1WBBA 3V1UA 4RA6B 2FMTA 1RVDA 2UUOA 2Y27A 3UT6A 1SCBA 2W6MA 3VM6A 4Q7LA 2AF3C 5BV8A 4X8MA 1SXJB 3IX7A 4S1PA 1PJTA 3DWFA 1ZA1A 1CY8A 1M1YB 1S4QA 3HMQA 4LJAA 1XE3A 2WMOB 4UE6A 4ZVTA 3STUA 1GL9B 1I4EB 3MT7A 4BNZA 4D3XA 2VTBB 1RRCA 2IYZA 2LCFA 4P7JA 3TI9A 2QTLA 3ENZA 2WC1A 2HH9A 3C3AA 1ZGZA 1QV7A 1EGVB 4RAOA 1U1EA 3MCZA 5KNCA 2F3PA 3T3MB 1U5BA 4I1VA 1V3QE 1N2BA 3H5TA 3J7TA 5CYFA 5B7QA 2IOFA 4KLCA 2Q4OA 2ZE7A 4HDNB 4MO9A 4RNCA 3AUFA 3ICOA 1JPVA 3MBIA 1MO2A 2YZ2A 3HE3A 3W06A 7MDHA 1RS0A 2YWHA 5EJ7A 5TS3A 4HFMA 4FYYA 4M0FA 4RFSA 5IEBA 1YHNA 1WXXA 2DVMA 5E7JA 4B80A 1M5TA 3ID6C 4TN5A 4ND1A 2Y0CA 4HQRA 2OYSA 3GC6A 1QLWA 2C2XA 1NR5A 2FQQA 5LB2A 3SMQA 2XZTA 3BWBA 2BDUA 4IZHA 1PJLA 5JXJA 4C20A 2I8AA 3RRYA 2R5FA 2R6R1 3F46A 4JUIA 2AMFA 3B1FA 3INRA 3W6ZA 3TVDA 5HDBB 5JAIA 1CD5A 2GCGA 3M4JA 2AG6A 4FR0A 4HNQA 4RQAA 4URZR 2CDAA 1U9IC 3VHLB 5M29A 3D3EA 1B6TA 2Y0EA 3OZVA 3FMGA 3EYAA 3PX2A 4KL8S 3FUUA 3K32A 4HEQA 3O2SB 4OQXA 1GADO 1YQUA 2MSNA 3EULA 4UM8B 4X63A 3UANA 3W2IA 5ITWA 1BVRA 3CRW1 3R3UA 2NP6A 3IJ5A 1ZKDA 2C97A 3HXPA 3PYMA 4L5YA 4OGFA 5CB6A 5HP4A 4M0DA 1DTWA 1RABA 2JL1A 3PGMA 4HPWA 3RYHA 2J4CA 2ZI7A 2ABWA 1PQ4A 5ALXA 3OCWA 3AKZA 2QYSA 4RVDA 3WYNA 4FWIB 4YCDA 2WHYA 3RB8A 4HVAA 3D6UA 3KQWA 1QIEA 2H65A 3ASZA 3DWEX 3T7JA 5CDGA 2VDVE 2HA6A 1WDKA 2XYPA 2R0QC 1J25A 1ZVQA 2AR9A 2FETA 2WTBA 3B89A 1F9EA 3PSHA 4MS1B 4MQUA 2PMEA 2HLDA 5DHQA 1R6AA 3E53A 4GECA 1YUNA 3EQ7A 5A4FS 3LUKA 3MOSA 2WILA 5IWCA 4FEEA 2EERA 4OU4A 3ONDA 2Q3JA 2QX7A 5AK4A 1IBCA 1BMFA 3I2GA 5E9AA 1E7MA 1A8UA 2I33A 1TDJA 3UKJA 1SRQA 2JHGA 5HQ3B 4QXRA 2V0CA 1NWHA 2YYAA 1EBFA 1GA6A 1TAHA 2UYCA 1K1EA 1M34A 4RX1A 1SWWA 4PPGA 3QOFA 4DA4A 4B8YA 4ND5A 1QK3A 1RTKA 2J48A 2MSCB 2A9JA 1Y82A 2WINI 4HEJA 4IPTA 1J0AA 1PUJA 1T6XA 1ZH8A 4MUBA 4ZZ2A 2P67A 1YIAA 2J3JA 1Y9DA 2ODNA 5A02A 5B36A 1A04A 2REBA 3MYYA 2QDXA 3H1PA 4H4EA 3GFFA 2W8BA 1QSGA 3ZWVA 3E0XA 5IHPA 1YB7A 2PX3A 2CVZA 2PA0A 3ETCA 3M2PA 2CFIA 1YL5A 1G17A 3NTLA 3QELA 4J2HA 3E2MA 3R5TA 3SXUA 3TIVA 1CZKA 5F9FA 4B3FX 5EHZA 4CN9A 2AMJA 2WEKA 2W48A 3AKYA 1UC5B 4QGBA 2QR2A 4EJ0A 3EXFB 2BHTA 4U7DA 1JEQA 1ULAA 2FZEA 4MGHA 2IUTA 3TGLA 2IS1A 1IDOA 1JSXA 5JH7A 3IDOA 3GJ6A 3PT9A 2ZITA 3N59A 1ISFA 3R3JA 4ZTZB 4NMXB 2NO4A 4UNSA 1M8PA 1FFCA 1T9KA 1ZY2A 1Q1BA 2H2GA 4K86A 4OKIA 2XYQA 1FU4A 2J45A 3F7OA 3KQPA 4OKNA 4AT1A 1R5BA 5EXDA 4WFJA 4KRYA 3DE0X 4JENA 4FPXA 2LV8A 3UHFA 2H1LA 2IOHA 3GOQA 3HBJA 5GONF 4GWLA 4QG7A 1W0JA 4AG6A 4BFWA 4D3FA 4WK6A 1W9MA 3D43A 3N58A 3GFVA 1DT5A 1UC8A 4IFEA 3SYRA 2GNAA 5ERGB 2NQTA 1C5KA 4CR6A 1JJIA 1PZXA 2VDLB 2IU3A 3ECSA 3EXHA 4QEZA 2IKSA 3I52A 2B98A 2YBEA 3ED1A 1GO2A 1WXQA 4FXOA 1LDBA 1UOOA 3UK0A 3ZDFA 4B7AA 5BUQA 3MT9A 3ENQA 4J91A 2VAWA 1SY7A 2BFAA 4DUYB 3AHHA 4N7JA 3H2JA 4OVKA 5I9LA 1EGQA 5DU2A 1VRVA 5B3KA 3O91A 2H4YA 4QGHA 4BO4A 2YHIB 2XBLA 3NBUA 2ZTLA 2C59A 3AESB 1KXZA 3WL6A 1LPMA 5I7UA 1SC4A 1U1FA 5K3BA 2CHGA 2E5LB 4NX2A 3TTVA 2C98A 2KBFA 4JT2A 1OROA 2JCSA 1WUTA 1NVVR 3F5FA 5DRYA 3TKYA 3WQQA 4CM4B 4CLEA 4D9CA 1RWBA 2CD7A 3WZ2A 1CF2O 1E59A 4DQ0A 3A1TA 3UCFA 1H6BA 1RPJA 3S8YA 1ZNYA 2BGRA 3W04A 1KPHA 1FDRA 3NTXA 3DL2A 4OXKA 4EPRA 4C0AC 2YUTA 1Q7RA 5TARA 2POQX 1U7HA 2FY8A 4EGCB 2FZCA 3DULA 4PQFA 2JHPA 5D3KA 1P7ZA 3ADCA 4NCJA 2YOFA 2ODTX 3NI2A 1Y5MA 4MB0A 1TMKA 2PO7A 3P26A 3SX2A 5DZSA 2VSNA 2ZRFA 4FU0A 1G4HA 2ZQ5A 2ZB2A 2FWRA 3TEJA 5JO9A 3AYXB 3GEEA 4KQIA 3TVTA 5KTPA 4OHWA 5AUPB 3JU3A 1RI2A 2PFSA 2J31A 2EL7A 2HV9A 3DW3X 3L8YA 3DKPA 1X92A 3STWA 1X7YB 3CXUA 2XCUA 1YD7A 2NXNA 4PHTA 3IO3A 4CUKA 4WVFA 3WFIA 3QRWA 2JLWA 1CVIA 3T5AA 2GNPA 2BPOA 3V8EA 3LH5A 1Z2NX 4LV8B 1D4AA 4H6WA 4BJ1A 1TD9A 3GLFE 1WLYA 3NNSA 3IJEB 3ANXA 3EG9A 2DFKB 1BFDA 2XECA 1CETA 3E2IA 5KQLA 1Q44A 1XQYA 1CE8A 3A9RA 4IWXA 4O8ZA 3A2NA 4TSRA 5C4GB 4CEJB 1U2DC 2C9OA 4KN9S 1JR6A 5J40A 1CDDA 2W2QA 4FDMA 4G65A 4COOA 2A0WA 4GQAA 4PC6A 3CLUC 2GT1A 4MWZA 1DKRA 3PNSA 4YECA 1Z6QA 4H59A 1XVIA 3ER8A 4L75A 1I7QB 4H1TA 2F8LA 4YTEA 4A6XA 4FB5A 1KZ7B 2FX5A 4C21A 3W7VA 4C2TA 3ZBTA 3DB2A 1ISGA 3DFFA 3NC0C 3DBVO 2C4WA 2X0EA 4F60A 4IUBS 1ZD2P 4YMWA 1D7OA 1CU1A 4J16A 4LF9B 2BTOA 3JARB 4P9NA 5LXTA 4EUKA 3LOPA 2EKLA 4ZEOA 1CT9A 1CQZA 3PF8A 2O1SA 5DGCA 2O5VA 1LK0A 1VMIA 2X9VA 6AT1A 1NHGA 1UODA 1H2FA 4PGGA 4D9NA 2IH2A 1H2YA 3FB1A 4M2LA 5DXFA 5SYMA 3TPFA 2P4QA 1HE1C 3D02A 2G9QA 3KEMA 4FLMA 4UVEA 1FFXA 5EHQA 2OO5C 4RHCA 3O1HB 2Y93A 3RVDA 4HAWA 1T6NA 3NT2A 2PSSA 2ZBGA 2D1QA 1SCIA 5I9MA 1N7HA 1N9GA 2PUFA 4DXHA 1DEOA 1JSRA 1P9OA 1ZGCA 3FXAA 2I9KA 5E3JA 2AEFA 3BSWA 1PFUA 2DGDA 3BUSA 2HU7A 3M5CA 1YRWA 2VRBA 1QG2A 4QOSA 5EN4A 2M6RA 1AGXA 1XZLA 3F96A 4P7GA 3USES 1VLZA 1OY1A 4XE5A 1TMOA 3UA4A 2J6HA 2O7QA 1PGPA 3U0BA 1XGKA 1UDWA 3UMVA 2I62A 4NOMA 5A4MS 1M67A 1IUPA 2ID7A 3LQFA 3ROZA 3M6WA 5FUMA 4W8OA 1RI4A 4FWBA 1XPUA 1JX6A 2Y0BA 2H1HA 3GCXA 5LA6B 4CIVA 2QRHA 5EIWA 4H3VA 1N92A 1K5PA 2HSJA 3HJNA 4J1QA 4AXXA 2NUTB 5EMLA 5I9SA 4AYTA 4ENSA 2VHZA 4FFVA 2RJ3A 2X6TA 3QLUA 1DIRA 1FFBA 1P0CA 1QANA 1W73A 3MJHA 5H81A 3FCEA 1FVOA 3CPSA 4I66A 3MHTA 5F2OA 3HM9A 4ETIA 4BNJA 4DGQA 4EB8A 4IZOA 2RHLA 4WY8A 4P98A 1PEDA 2QUHA 2DY1A 1SKBA 2P3LA 1H22A 3DYBA 4ZCTA 5L40A 3HACA 3IP3A 4ECEA 4WOKA 2Z95A 2RE8A 4JAVC 1D3AA 1EX6A 6NULA 2QQ0A 1P2VA 4A2PA 3KKKA 4F4DA 3GLQA 1UBHS 4O5AA 4U7GA 5CBKA 4HDKB 1RZRA 2FA9A 2X0JA 3SDSA 2VP6A 3RTGA 3ZVMA 1YR9A 1Z7BA 2JCXA 4RPLA 5E2BA 1Z4KA 1KEZA 1MH1A 4AMBA 3KWJA 5FTLA 2G06A 2OFWA 3VMMA 3CLSD 1I4TD 1TM1E 3VC3A 3WDSA 2RBKA 3SX4A 3U13A 4Q66C 1VE6A 1VJTA 2P9GA 1J9ZA 2XHZA 4Q21A 2HPAA 1H8ED 4NESA 5EJ8A 4F72A 1F8XA 4OK3A 4BGDA 2C5LA 1HV8A 3A2MA 2ZATA 5I4BA 3KTOA 3T0FA 1USIA 1YR8A 3UXMA 1KS2A 2QAIA 2B5VA 2P6UA 1H4SA 1Y34E 2CDRA 4RADA 4DKXA 3LUDA 3GYBA 4MUJA 3JXEA 1EH5A 3CKYA 4JI3B 2R7MA 5AIAA 5BSKA 4YQZA 2IEYA 4LRSB 4QOEA 1COWD 1Z83A 4MRSA 2AJLI 4EG6A 5LP6B 5KDDA 1RSZA 3L7AA 1UKAA 5CDFA 2XKKA 5BMVB 2H2AA 2UVPA 3TD9A 1ZW1A 4DMKA 3QTTA 3WS7A 5KNLA 1YFZA 2CZGA 2NN3C 7REQB 2M6SA 4RSHA 5BSVA 3EBLA 1A9OA 1QYWA 3T52A 4BQPA 2V8OA 1K89A 3KE9A 2JKZA 2WG1A 4PE5B 5FLXA 5KTKA 1NSTA 1G66A 3OY2A 2OG2A 2P6RA 4OFZA 4R40A 2QOEA 1P9NA 1UFQA 1USGA 3AR8A 4PQGA 2J9GA 5KKCA 2FX2A 1A98A 1JDPA 4XDYA 3MCTA 2PWPA 1LSUA 1WSBA 2DERA 2R2GA 2IC5A 2PFGA 3ELUA 2ZRNA 2HJWA 1A9YA 1MTOA 2ERCA 3SHVA 2YXEA 1QLHA 2A88A 4FCWA 3F3MA 1BMTA 3K7EA 1NAHA 1R64A 2PZBA 2FPWA 4HNGA 4WY5A 4C2BA 3V8NA 3EXIA 1C7ZA 1J33A 2FPKA 3I23A 1C1DB 3LHKA 5AMXA 2EZ9A 1WB6A 4QFDA 3V80A 4AP9A 3QE2A 4BNHA 5AVWA 1QVWA 3C6QA 5LQCA 3QLVC 3P20A 4R7GA 1P0QA 4A10A 3KYDB 4JR0A 4A92A 1AKYA 1U02A 4MUGA 4S1VA 2HQBA 5WRFA 1F8FA 3VR3A 2ZSHA 3QYFA 3TW0A 2J9FB 2H92A 4FS3A 3PWTA 1K5DA 4MOWA 4V0KA 4AZVA 3BFPA 3D9QX 2QBYA 1J42A 5KVVA 2C20A 3FG9A 3FOWA 3P4YA 4JJ7A 4ZVSA 4MCJA 4R1LA 3WE7A 4GKKB 2J09A 4A27A 1RI5A 3OZFA 3Q1KA 4HX5A 3GYGA 4JHXA 1R12A 4RTQA 5HIMA 3EUFA 1BZYA 1NM5A 2OBMA 6Q21A 1LDMA 3QX8A 1NDHA 2E89A 2PLRA 4WPGA 3S27A 4X92A 2WAYA 1K5HA 5FLYA 3JZMA 5T57A 1VTKA 5DM4A 3V5NA 3KJEA 1HDOA 2V7QA 3D6TB 3LUFA 5A9SB 3D5QA 4NV3A 4BWGA 1EMDA 2VLIA 3WL8A 3QJGA 4BYGA 2D3WA 5EGNA 1KVRA 1KEEA 2J9ZB 4CI9A 1NW9B 4PG8A 1L7OA 3IIMA 2RIPA 1NLFA 2PUAA 2CL0X 1EWYA 2GPJA 2ADMA 3CF4A 4INZA 4XKJA 1ZMOA 3V8RA 4MKRA 2VEDA 1QCCA 4C04A 4V1CB 2DF8A 421PA 5IF9A 4BO0A 4C5CA 3KQLA 1PSZA 4U7PB 1QYVA 5CGQB 4UD2A 3H5RA 3P9NA 2FDRA 1UPUA 2R60A 4JIGA 1WCWA 2HHJA 4KQGA 4O2BB 3F71A 1TXGA 1Y5LA 2FSVC 3BFJA 3ZLUA 5F33A 1LTHR 1O57A 2OAGA 1SVUA 4JSYA 4CNQA 2CY0A 2QGZA 4AF8A 4NEGA 4DIMA 1N2CB 2QORA 4NAUA 3L18A 1DAFA 1BH2A 1EJ2A 1V9LA 4JEMA 4M1YA 3HI6A 2WTUA 2JI7A 3FN4A 4FN5A 1MF7A 1WF3A 3TZCA 4TUYF 1Z4JA 4L22A 4XM1A 5KU7A 1GN9A 4LXUA 1KYVA 3BGWA 5CH5A 4W5RA 4QPNA 5FP0A 2DBVO 2W2OA 3K6JA 1UK8A 4IZIA 4D9JA 5KWVA 4HNHA 3TQTA 5GVSA 4B2LA 3ZHZA 5JDCA 3KB2A 1H0RA 2AVNA 5CEFA 2PMFA 1PZNA 2G71A 1UWKA 5T3UA 1AH2A 3J7AC 1MFZA 1VPTA 3PX7A 2BM8A 4LMAA 1J8MF 2JRLA 1YQEA 4G0PA 4B46A 2ORYA 5SYNA 4D9GA 1CJVC 2JGIA 2YWGA 2AOTA 1XMXA 4BX9A 1IY8A 3HABA 4HDMA 3RFFA 3TBHA 1X1SA 1M2FA 4BN4A 1W4CA 4D41A 5C7OO 5GZ3A 5IN4A 5KYYA 4MWSA 3TAHA 3EFOA 1BKYA 3GFQA 4EHKA 2VF8A 1PJZA 2PH1A 1SG0A 1ZW6A 3CFYA 4I1YA 5D1HA 4OOFA 4AMGA 2FGJA 5IABA 1ZDMA 2ACVA 2QRMA 5A5FA 4XCXA 2GCEA 3UVEA 3ZY2A 2NNLD 1E9DA 3M5PA 1OBVA 4IDQA 2Z56A 3KT0A 1HYQA 2QZPA 3LK6A 3LP8A 5DTEA 3JR3A 3W3AD 2X77A 1B0ZA 2XPCA 4ZRNA 2QZZA 2M98A 3JASB 4L78A 1VE7A 4Z4FA 1R0XA 3MHPA 2F48A 2BUCA 1X2BA 4H7DA 5PNTA 3AC0A 5BR4A 4OLFA 2QTWB 4LHVA 2XCOA 2F6RA 3AERB 1FP6A 3T3GA 4ZYYA 3M2TA 2O1WA 5KINB 5KSWB 1E3WA 1TVKA 1ZUD1 2R8PA 4NZZA 4ZDKA 1TTQB 4G0MA 5DTQA 5L4LA 1XXHB 4QAJA 1RYZA 1FS5A 1B41A 4RY8A 5AIBA 3KJNA 4DG5A 4P4SB 1L4UA 2CSUA 3GFRA 1PQWA 1V5IA 2BMJA 5H3LA 5B1SA 5I5GA 3A4MA 3SJUA 1PV1A 5KMGB 2MSDB 1P5HA 1MGOA 4CETA 1M8FA 3M9WA 4EGFA 5IBRA 2AMYA 3E3AA 3PFGA 3FETA 1VBFA 1RPNA 2EWWA 3HTXA 1WB4A 3NWJA 5BY2A 1U0GA 3P8ZA 1G0OA 1W93A 4L2IB 4GVPA 3K70C 5A2QA 3KSBC 4Q37A 5E4YA 3PQFA 1NC1A 3D7NA 2WYOA 2XGSA 3ITEA 4D0LB 1IRIA 4LHSA 2FPGA 1NI5A 1UANA 5CT5A 1WCV1 4JQYA 1B42A 3HKDA 3ZUPA 1JF8A 2DTEA 4U6SA 5TPWB 5CTJA 3P94A 2AG0A 4W7HA 4J16C 5AW7A 4NOKA 4BOYA 3TAUA 1GGJA 3GLVA 1YGPA 1W4RA 1X87A 3NHJA 4Q82A 2XTJA 4NBNA 1QCZA 1USUA 3PC2A 1E6KA 3BJEA 1RWMA 3A9VA 3DLAA 5HKAA 1NF3A 1QRAA 4L16A 3SXPA 1LNQA 4DOMA 3O26A 2Z5GA 3K8ZA 3JWIA 4K9LA 2X8LA 5ELMA 4Y2HA 2GTIA 4B44A 4KAXA 5SYAA 2QTAA 2B82A 2P9FA 2R6DA 4LJSA 1QGAA 4CHTA 2P40A 2JGDA 1L9KA 1E1CA 1GL6A 1LSOA 1THTA 2O07A 2WJ6A 2ZZKA 3DBHA 3I37X 2XHEA 3I39X 4AFNA 3UXYA 3TE7A 4DRXB 2O0HA 4M49A 2Z8XA 3B7WA 3KJGA 2L69A 3JY6A