5GY7A

X-ray structure of h243i mutant of udp-galactose 4-epimerase from e.coli:evidence for existence of open and closed active site during catalysis.
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
338
structure length
338
Chain Sequence
b'MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSSATVYGDQPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGIVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-glucose 4-epimerase
publication title X-Ray structure of H243I mutant of UDP-Galactose 4-epimerase from E.coli:evidence for existence of open and closed active site during catalysis.
rcsb
source organism Escherichia coli (strain k12)
molecule tags Isomerase
total genus 132
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2016-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5gy7A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 5gy7A02
2B4QA 4FGWA 5FEUA 1H6DA 3GN1A 1QLJA 1V3VA 2TMDA 1SZJG 2X5KO 4S3MA 3PHGA 3AUAA 4J7UA 5CG2A 1P0CA 1XDWA 3NGXA 2AE1A 2QYSA 3WYBA 4BNGA 4YT2A 4PG6A 3FBGA 5A04A 1R4MB 1X7HA 5CDTA 3W8EA 2VTDA 5HWSA 4IIUA 1FMCA 1DIAA 2JAHA 1HDXA 1BVUA 3D4PA 3W6UA 2WTBA 3DFUA 1K6XA 3ONFA 3Q0EA 4RVDA 1EBFA 2Q4BA 3SC4A 1HYEA 1J49A 3RUIA 4CODB 3PIIA 2YYYA 5T8KA 3ADPA 3HADA 5L7WA 1GADO 2GO1A 2HKIA 4R4JA 2QZ9A 4XB2A 3GHYA 2NNLD 1M66A 3C85A 5JCJA 4GH5A 3AWDA 4N5NA 2ZCUA 4B4OA 3GZNA 4E31A 1E6UA 2HMTA 5DCWA 3E5RA 1SAYA 5GMOA 1IZ9A 4K28A 5A5FA 1DOHA 3UFXA 2NM0A 3L9WA 4JK3A 2ZQZA 4J1QA 4E32A 5TJHA 3KYDB 5BQFA 1ENPA 1QXSA 2AEJA 3GEDA 3FCOA 1SB9A 3OA2A 4AJ4A 3QY9A 4WNCA 3E8XA 3WXBA 5K6AC 3BTUA 4CM1A 3RCBA 4BIIA 4QTZA 4RPHA 4WNIA 1U8XX 5L7YA 3UOGA 1R66A 4FFNA 2P9CA 4OSPA 2Y1GA 3W4JA 3MEQA 1OMOA 4D0RA 2PA3A 4J0EA 3KLPX 1O9BA 2VHXA 3ZV3A 4DLAA 1FDWA 2W4QA 4J4BA 1ZZEA 1G1AA 1ZBQA 3SLGA 3K9QO 2HCTA 1E7WA 1WVGA 3TZCA 1PS8A 2Y0DA 5IDWA 4O0LA 1H2HA 5KCZA 4BNUA 1DHRA 2D8AA 3I83A 1DHTA 1HETA 4IBOA 3ICPA 3BTOA 3KLMX 4RZIA 2Z5LA 1PL7A 4DC1A 2RBEA 2YQ5A 3VDRA 4H3VA 1JKJA 1UJMA 1ZSNA 3PYMA 4ND5A 4UUPA 2BFPA 1EZ4A 4E4YA 1B2LA 5L95A 3ZV6A 5TQVA 3KYBA 2X1HA 4W9NA 3RD5A 1Y8QB 2G17A 2AMFA 1Z7EA 1JKFA 3SC6A 3IMFA 4E0BA 1C0LA 2O7QA 3TL3A 2XAAA 3QVWA 1PJQA 2ZTVA 3PGXA 2NWQA 3QLJA 4BO0A 5A06A 3W8FA 3G49A 1NR1A 5IN5A 5AXAA 5JAQA 1BTOA 1UXKA 1GU7A 1YL7A 4CV0A 3ZHXA 4AJOA 3GRPA 4KUHA 1MXHA 4J2HA 5TX7A 4N5LA 5BNIA 3VVCA 1OC2A 1KETA 4YAIA 4FJ2A 3VH3A 1YGYA 2PH3A 1P77A 3IP1A 3V1UA 4RDHA 3KSDO 3V2HA 1B3RA 5JDCA 4GWGA 4NK5A 5DULA 4NJOA 5JAZA 2WD8A 4YJGB 1GEEA 1YONA 3FTNA 2BELA 3SBOA 2ZYDA 2D2IA 3G79A 3KM0A 2PGJA 4E2ZA 1LU9A 4QX6A 1N9GA 4EEZA 1PR3A 2RAFA 2X0JA 3GUYA 4BNWA 1EDZA 2XXBA 1EEHA 1S6YA 2BFOA 3NV9A 1IYZA 1MX3A 1GD1O 4M1QA 1YBVA 5JCJD 5B1YA 1H94A 2D5CA 2PD6A 4XKJA 4OO3A 3E1KA 2J3HA 3G0OA 4JROA 1PWXA 3C3XA 4Y67A 3ZNPA 2QRJA 2X0NA 3CEAA 4TWRA 3ETDA 5AOVA 3RU9A 3PJDA 4XGIA 4AJKA 1UDAA 1UP7A 4CMIB 5B37A 2DPHA 5A5EA 5I7SA 4AJJA 4M8SA 1E7MA 3AI3A 4XR4A 1Y8RB 1E1MA 4FSHA 1PGOA 2VCYA 2VNSA 4NZ9A 4CMCA 4N54A 4AJPA 1U4OA 1ZEMA 1EK6A 3V2UA 1N7GA 3NT5A 2Q2VA 2R6JA 1K6IA 3V1TC 3PZBA 4E5YA 4ALMA 1LBEA 2Q4EA 5L51A 1VRWA 4BV8A 2RH4A 4BNNA 4FOOA 4A0SA 4M89A 4YPOA 3MJTA 4GLLA 2DPGA 1XHLA 4PLGA 3WNQA 2E4AA 3RJ9A 5H83A 5JO0A 3Q11A 3LZ6A 1T1RA 1N1GA 2X6TA 3EZYA 1YQXA 2FSSA 3AM5A 3QWFA 1PL8A 4CM8A 4A10A 1NWCA 4YJDA 3QJ5A 3ZNQA 1ZSVA 3WNVA 3PI7A 5DDIP 3GMDA 5THQA 4RCVA 5AXBA 5IFLA 3WLFA 1I2CA 2P5YA 5B4VA 1UUFA 2YHIB 4O6VA 4Z9FA 4PN3A 2HJSA 3WYCA 1LC0A 1U28A 5EN4A 3GVPA 2DTEA 4F6CA 2O3SA 5ICSA 5JYDA 4MKRA 2WE7A 5F3RA 3AUTA 2Y05A 3L6EA 4GVXA 1WZEA 3INTA 3IDSA 5KIAA 2R00C 3KSZO 2YDYA 2Y1FA 2G82A 4BO8A 5IZCC 3FD8A 4PLHA 5I9MA 2HRBA 4RF2A 4HFMA 1J6UA 5TIIA 4IDFA 2AQHA 4AL4A 1ZJYA 5EIOA 4YAEA 3U9LA 1HEUA 3ENNA 3DB2A 2EW2A 1XQ1A 1S7CA 4KTTE 2AXQA 1P1IA 3WQRA 4R9SA 3ITDA 4CQMB 3ZH2A 1SPXA 1DPGA 2E6UX 3LQFA 2Z95A 4KMSA 3FWZA 5TF4A 2W2LA 2OHXA 2W8ZA 5L40A 1I30A 4DQXA 4E5PA 1O94A 4K26A 2J3KA 4H15A 4OHUA 1DRUA 1VLLA 1GY8A 1R0SA 3L77A 3X2EA 3NDRA 2OBNA 3BZUA 3D5TA 5BSHA 2HLPA 4OIMA 3ANMA 3D3EA 3K2BA 4YQZA 1ZXLA 3VPSA 4UEJA 2JD1A 1HKUA 4TSKA 4WK6A 4CM3A 3AOGA 1GQYA 2GDZA 3HNPA 1MFZA 1NHWA 3N58A 2O7SA 3AFMA 2CY0A 2XPCA 3VH4A 4IINA 3PLRA 2C0CA 3DAPA 1OAAA 3P19A 4R41A 2DC1A 4R51A 4Y98A 3HDJA 1U5AA 2CZCA 2GLXA 3IUSA 2WYUA 4U0KA 1LDNA 3HN2A 3VTZA 1ZO8A 3O8QB 3OH8A 1B15A 3WLEA 4F45A 5LCXA 2EWMA 3GHHA 3EVNA 2ZB8A 2ZQYA 8LDHA 1XWFA 3LLVA 4ALJA 3T4EA 3PWSA 3ST7A 4BNZA 4J7XA 2ZATA 4YJFB 3GC6A 2C59A 1KVUA 3JYQA 1TVEA 4AJLA 2NTNA 1R16A 3D1LA 4CMEC 1C0IA 3E9MA 3VAZA 4HFRA 3WBFA 2GN6A 5KVSA 3L6DA 3DAGA 1QMGA 1VL6A 2YV1A 4IGFA 1N2SA 1B16A 1DIGA 1QLHA 2J3IA 3D64A 3GY0A 3P2YA 4ZGWA 5AQ1A 4W7IA 1RM3A 4LCEA 3ZWPA 3OQ1A 5DN9A 1OC4A 4I5EA 4NBVA 2DKNA 4YACA 4ND2A 1WXDA 4RVGA 4AJHA 2O3JA 4GAEA 3PIDA 2X0IA 1DLIA 1EVZA 2G1UA 2VTEA 4BKUA 3B1KA 1ENOA 4QXMA 3W4KA 3UHAA 1YBMA 3LLSA 4WCFC 1HRDA 4WECA 1Z7BA 1SC6A 4LGVA 6LDHA 3ETGA 3JQGA 3PJFA 2PZMA 4ITUA 3EUWA 2D0IA 2JAPA 3CTMA 4RPLA 2JFFA 3GLQA 2BH9A 4RGBA 1HYGA 2CNBA 3QVOA 3KB6A 1QKIA 4L4XA 2I99A 1LX6A 1PQPA 1RWBA 3CKYA 2VHZA 5JE8A 1C1XA 1E5LA 2EKLA 4Z9YA 2JHGA 1IUKA 2Y99A 4NH4A 5BSFA 1T2DA 1IL0A 1QYWA 4BNIA 4BNXA 3H5RA 4BMVA 3C1TA 3LF2A 3PHLA 3VPXA 3ROKA 4RVFA 2HRZA 3H3JA 4C4OA 3DZJA 4I9NA 1GUFA 1H6CA 2ZKLA 5CDSA 1SEVA 2CSUA 3QWBA 4BNMA 1L7DA 3PP8A 2W2LD 1UDBA 4I9UA 4JNKA 1A9ZA 1P9LA 2YZ7A 1BXZA 2IXAA 2J8ZA 2ZJ1A 4UEOA 1NNUA 3U49A 3RUCA 3P5SA 5L9AA 1NFRA 4YWJA 4OMUA 2NSDA 3SJ7A 3WMWA 4BGIA 1KYQA 4D44A 5EJ2A 5F1OA 1Z75A 1C0PA 5BSGA 3A28A 2OOSA 5A9SB 2BGMA 2Y93A 2E48A 3UGKA 3ORFA 4BO9A 1JU9A 1WNTA 4MP6A 4E2WA 1BHSA 3JD4A 5IZ4A 1XSEA 9LDTA 4I8XA 4EZBA 3S2GA 1R37A 4XYMA 1ISIA 4J6FA 1A71A 2XF8A 3IUPA 4DBZA 5U4QA 3ZNOA 4OH1A 1U7HA 2PKQO 3U4IA 2P2SA 2ZTUA 2GZ1A 5MDHA 3HFGA 4L74A 2WEKA 4LCJA 1GCOA 1GCUA 1HWYA 2B36A 2BFAA 3VPFA 2C2XA 5GY7A 4XIJA 3LC7O 4IDCA 3MOIA 4BO5A 2WYWA 4FFPA 3AY3A 2VWPA 2Q45A 2B69A 2QRLA 2VZ9A 3WICA 3FPCA 2WE8A 4WKGA 4W7HA 2NV6A 3HB5X 2GN9A 2Q46A 1ISGA 1LLCA 2WMDA 4BL5A 2JJYA 4WE3A 1UP6A 1K5HA 6ADHA 2QIOA 4ZQFA 4BMSA 1NQOA 1VJ1A 5IZCA 2CMDA 4HKTA 1M76A 3UICA 4BO7A 4DXHA 1ADGA 4FCCA 3CIFA 3DBLA 3SEFA 4D46A 4ND1A 3JQ9A 3PDUA 4FGSA 4GSLA 4PLPA 1AXEA 1YS4A 1AHHA 3DZGA 4MVJH 5IAAA 1WWKA 3JQ6A 4MP3A 4PRKA 2ZTLA 5TJ9A 1NWHA 1HXHA 4UUOA 4UVGA 5T5QA 2RH8A 1QRRA 3TZ6A 1ENZA 1KEUA 3R6DA 3GDGA 1P1HA 3PDJA 4Y9DA 2VUSA 4J4HA 1QSGA 2Q49A 4PGFA 4BMNA 3GUCA 1E7QA 3GGOA 3WGZA 1RYDA 2I3GA 2VRBA 4TRRA 4CLOA 3PGJA 5A4DA 3WX0A 1OBFO 3DBHB 3JQCA 4O5OA 4BNVA 2X9VA 2IDZA 1KY4A 1V9LA 4ZU3A 4R5MA 3HZZA 1JVSA 3GNSA 3T7EA 5IF3A 3JV7A 3OBBA 1HDRA 4BVAA 1I33A 1DSSG 3KRTA 1I32A 4KDFA 3UF0A 4D41A 1NAHA 3FF4A 1WMAA 3MJSA 2QG4A 5CDYA 1RPNA 4Z6KA 1XELA 4D79A 1ULSA 2OZPA 2DBZA 4S1VA 5FF9A 1ISHA 1Y81A 3TWOA 4PCVA 1HL3A 2D5AA 4B8WA 3I9KA 1H6AA 4F46A 4YYZA 1P33A 3VKUA 5JXWA 2PTGA 4KQXA 1BGVA 3BIOA 1A9YA 3D4OA 2A94A 3VTFA 4RVHA 3DHNA 3K73O 1SNYA 4FS3A 3RBXA 3WSVA 2DBRA 2YDXA 2Q1SA 3D3WB 4MP8A 3KTDA 2DVMA 4MVJG 4ALKA 3SVTA 2D4AA 4EGFA 2VWHA 3WWZA 1PWZA 2HJRA 3WWYA 5T6BA 4P4GA 2GF2A 1A7AA 3ZWXA 5JMWA 4KWIA 3RC2A 2EJVA 1GTMA 4J90A 3WFJA 1ISJA 4Q9NA 4BB5A 1PJ3A 4J43A 5T64A 4GWKA 1NTOA 2HMVA 1FF9A 4EW6A 3B20A 1DIRA 2ILTA 3JQAB 2PH5A 3LDHA 5T57A 1LTHR 2FZWA 2HK8A 2BGLA 1PQUA 3EGOA 3I9NA 3RBZA 2FHSA 5ITVA 4CV3A 1T24A 2W2KB 2QW8A 1C3VA 3A06A 1BXGB 3A4VA 3GVIA 3K30A 4ZQHA 3CH6A 5MGBA 1CQJA 1CJCA 3GT0A 3Q9NA 4R9RA 4RORA 2HUNA 1D4FA 5G0SA 1YO6A 1R6DA 4WCFA 1E7RA 4UVDA 2VN8A 5C3MA 3AOEA 4I9HA 5EQDA 3OETA 4DIFA 4ZQEA 4OOFA 4ZQBA 1MUUA 3I9JA 1ZVMA 3RKRA 2IE0A 3CMCO 3GFGA 2OP1A 1YB4A 1YH3A 3C8MA 3WGYA 5DBGA 3KVOA 1NVTA 4NG5A 4LMRA 3ZGYA 3D0OA 3DFZA 3QVSA 5KVCA 1PJSA 4E5MA 3MJ4A 2GRAA 3EW7A 1K0UA 1WDKA 3NEPX 4DUPA 3AK4A 2VQ3A 4II3A 1EUZA 2DQ4A 1E5QA 1A72A 1U2GA 4BKOA 3QWIA 1UP4A 4BS9A 3LT0A 1YQGA 1IHYA 4RV9A 3RC9A 1O6ZA 1UXIA 3GGGA 3JQ7B 3WR5A 4E12A 1OZAA 3JQBA 1VL0A 3BMNB 2JCXA 4ZD6A 3E82A 5L45A 3JQEA 3PZRA 4LSWA 3RUHA 3BHJA 5EL0A 3CE6A 2B5WA 1Q0HA 4RPJA 2IXBA 1YBAA 4AJ2A 3ZW9A 5I8ZA 4BQRA 2XXJA 2V6FA 4N18A 4L76A 3H65A 4INAA 3DHEA 2Y1CA 5TS3A 1G0OA 4R1SA 3VZQA 4M54A 4E3ZA 2J5KA 3JQDA 4CMGA 4DIBA 4GSKA 4N7RA 3WGOA 4MJLA 4XYEA 1MLDA 4TMFA 5A05A 4MIYA 3UUWA 4BHTA 3S55A 1L7EA 3HDQA 4CQLA 5CPBA 3PQFA 1SOVA 1YB5A 3I1JA 1YDWA 2RHCA 3EY4A 2DUWA 2P5UA 3NGLA 1A4IA 1BDMA 1ZW1A 3EZLA 3ZCXA 4MIOA 5JBIA 4DWVA 3W4IA 3L4BC 4CR8A 4PLFA 2A4KA 2YFQA 2GNAA 1LQUA 4D45A 4BQPA 4Y6SA 1G6KA 4ZJUA 4YAGA 3KXDA 5L4SA 4TZKA 1BW9A 4GPD1 4DBVO 1DC5A 2G0TA 2C29D 3IOYA 3KYCA 2BF7A 3L0DA 4L4RA 4QT0A 4XYBA 1RM5A 4JJFA 2YY7A 3JD0A 2IRWA 3DOOA 4R16A 2HO5A 3GDOA 3S2FA 3SJUA 1UAYA 4R5HA 3Q1LA 5B4TA 1C1DA 1VSUA 3GAZA 2B4TO 2HAEA 3ZI0A 4CMBA 5L4LA 3OSUA 4IDEA 5ER9A 1OFGA 1E1NA 2Q3EA 5FI3A 2PKQP 4NJMA 3QSGA 5TT1A 3RJ5A 4BO6A 4GGPA 1W73A 1DC6A 3PJEA 3GMSA 4QEDA 4XDYA 4I1IA 3LC1O 2BI8A 1K3TA 4R54A 3INGA 4HNHA 4FFLA 2O50A 4IQ8A 3QVTA 3S1LA 1B8PA 4LRTB 4EUEA 2AE2A 3ZU2A 3B1JA 1KC3A 3B1FA 4Q3NA 4A2CA 3H7AA 5FI5A 1FDVA 4IZHA 1CERA 5F5LA 2NADA 5JPIA 1VKOA 2Y1DA 3ICCA 3H9UA 2C5AA 2Z1MA 4BO4A 5KKCA 2DAPA 3DOCA 2IYPA 5I8WA 4CR7A 4D3SA 2X8LA 1FDTA 4XQEA 2O3RA 4Z3DA 3IP3A 3ADOA 3B70A 4R3NA 3ROQA 4GX1A 3F5SA 3MJCA 3ZWWA 4DRYA 1E77A 3LC2O 1E1KA 2Y1EA 1MP0A 3KHUA 4GGOA 3AU9A 3EYWA 2EERA 3K5PA 4XQGA 3E5MA 1I3MA 2FN7A 3LT1A 3TSCA 1H6BA 4EJMA 3UAGA 1D8AA 1Y5RA 1BVRA 3DZBA 1W4ZA 2P91A 2O23A 2Y0CA 3JQ8B 5COAA 2PY6A 3ZWYA 4ND4A 1RM0A 1IE3A 2H9IA 3F9IA 4HADA 2ET6A 4JIGA 3VDQA 3CSDA 4R69A 4XX0A 1PGQA 1T2AA 5CP8A 1NQTA 4DPLA 4TRJA 2PNFA 4YJHB 3RBVA 1W8DA 1PZFA 5EESA 4XIYA 3F4BA 3M1AA 4CUJA 3LVFO 4NBWA 2JD0A 3GOHA 3HJAA 3ON5A 1IHXA 3BYZA 4ESOA 4WOJA 5HBRA 5ICMA 2DFDA 1W6UA 1SBYA 2UV8A 1OOEA 3DBHA 2P68A 1DAPA 4OXNA 3BMCA 3FBTA 3H2SA 1ISMA 3NRCA 4CM5A 2VT3A 3V1YA 3UN1A 2J5RA 4XEHA 5IXSA 4EJ6A 1DEHA 3OICA 3KZVA 1MB4A 1GQ2A 3DC2A 4CR6A 1QYCA 1KBZA 3QE3A 3W8DA 1ENYA 3M2PA 1TT7A 1Y9EA 3RC7A 2DTDA 4NFSA 5I7EA 2BMAA 4U7WA 5JDIC 4WGGA 1CWUA 1PEDA 1ZMOA 3VPGA 1SCUA 5KVVA 3RVDA 2C5EA 2X7HA 4CLRA 5G4LA 3QHAA 1E0DA 2BI7A 4ILKA 2FR0A 2PZJA 4YEDA 3PTZA 2UDPA 1T25A 4LRSB 2PKRA 3UCXA 1ARZA 2A92A 1MGOA 1EE2A 4B4UA 3D5QA 3G17A 4K6FA 3R3JA 1OI7A 4JX8A 2HU2A 5CDGA 4R1UA 1D1TA 2EG9A 5H82A 1FJHA 2WJPA 1O89A 3O03A 5A02A 2D3TA 4PLVA 2CF6A 3D3WA 5JLAA 5CEJA 4AJNA 3RUFA 3I6IA 4YT8A 4NBUA 5L4NA 5JMPA 4CMHA 4Y8VA 1P74A 2WD7A 4JJIA 4CUKA 4A7PA 1RM4A 1C14A 3K2EA 4HUJA 4JXKA 4Q3CA 3S2EA 2JHFA 3DBRA 4CV2A 2A35A 2BKAA 4P38A 4A5OA 3KETA 2VWGA 4IDDA 5G0WA 3BHIA 1Q0LA 1I2ZA 3FPLA 4IDAA 4BKPA 2JFHA 4XRRA 2NTJA 3PHJA 4XR9A 1PZGA 1HF3A 1O5IA 2OMEA 3G1UA 4Q39A 2X58A 2NVUB 4LMPA 1PJ4A 1R4NA 1ONPA 1H9AA 1V35A 4J3FA 1DC4A 1PJLA 5G0UA 1E3WA 2RIRA 3JD3A 5JCXA 5U9CA 3TQHA 3BHMA 3W1VA 1O0SA 5LC1A 3BAZA 4FN4A 5G2OA 4DPMA 3CMMA 1FK8A 1P1RA 3E9QA 4W82A 4CM6A 2YFHA 1KEVA 1KS9A 3MJEA 3AUUA 5KJEA 3D4NA 4HBGA 5G0VA 3RI3A 1F8GA 1WPQA 1EVIA 1NYTA 3TDKA 1F14A 2BHLA 4R01A 3BA1A 5HA5A 1EMDA 4NU5A 1TT5B 3STHA 1A4UA 4O63O 2CVQA 3L4BA 1KEWA 5G4KB 5K6AA 2OL4A 2ZK7A 1PR9A 4J4TA 2YJZA 3OF2A 4WLOA 1Y1PA 4Y6PA 4CM9A 1E92A 4L9RA 3GK3A 1E6EA 3GPDG 3BMOB 1R4MA 3MJVA 5HRUA 3K8ZA 1DJQA 2C20A 3OEYA 3BMQB 4DLBA 4M49A 3KEQA 3NTRA 3ZHZA 5DNAA 3OECA 1PGNA 3QQPA 2OXIA 3P7MA 3OHSX 4Y6RA 1B8VA 5EINA 4AJEA 1VSVA 3H4VA 1TB4A 3FNHA 3VH1A 1NPYA 1UAGA 3AY6A 1MV8A 4CMKA 2NTVA 1A7KA 4U5QA 1BRMA 3KEOA 4A03A 1HSOA 1EFLA 4E33A 2Y68A 1P0FA 4UVEA 5KJFA 2X5OA 2GASA 4F3YA 2YQ4A 4B4WA 3VHRA 4YQYA 2EEZA 3T7CA 1ZK3A 2EW8A 4EITA 3I52A 1PS0A 1YL6A 2O4CA 4FPXA 4KDEA 2AQ8A 5CEEA 1IOLA 3OEWA 4ZQGA 4LK3A 2GPTA 5F21A 4MOWA 4OAQA 3OJ0A 1I5RA 2EP5A 1B3BA 3KYDA 4FDAA 3ZU3A 3UXYA 2IODA 1ZSYA 3VC7A 2PZKA 1WZIA 3NKLA 1JLLA 1P3DA 3DWFA 1X15A 2FPIA 2Q2QA 4KQWA 1DFHA 1RJWA 1QYDA 4Z0HO 1GV1A 5B4UA 1QR6A 2EHDA 3RIHA 4IY1A 3FNGA 1TEHA 1VL8A 2PD3A 2IZZA 3EK2A 2I5PO 4NFYA 4GKVA 2I9PA 1LDGA 1JN0A 4K6CA 1NQAO 2YHUA 1DBVO 1PSDA 1HDZA 3DMTC 1LSSA 3O4RA 4DQUA 2VUUA 4HY3A 4PG8A 3ZWCA 1DIBA 4XQCA 3ZWOA 2G5CA 2P4QA 1HYHA 2OO5A 1VPDA 5CG1A 4WLUA 4RO0A 4MDHA 3NTOA 3ZN2A 1ORRA 5DBIA 1R12A 3L07A 3JTMA 4YRDA 4FJ1A 3TOZA 1M6WA 1M6HA 2Q50A 2Q1TA 4WEOA 4YDRA 4ZVVA 1GUYA 1QG6A 2VHWA 1A27A 4XA8A 1QYXA 4HP8A 3FR8A 2EIHA 4LN1A 3RUDA 4TVBA 3NYWA 4MVJE 3QWAA 3PXXA 5DOVA 1ML3A 3WGQA 2V7PA 1ZK0A 3GR6A 2HQ1A 1XR3A 2ZB7A 2JCVA 1Y8QA 1Q7CA 3WQQA 2DUUA 1ADCA 5ER6A 2VUTA 3GZNB 1X7DA 4ALNA 4J1NA 4OXYA 5EMHA 3LT2A 5L7TA 3CUKA 3S2IA 5FFFA 1XU9A 4TKMA 5L3ZA 3A9WA 3S8MA 5I7FA 1U8FO 2FR8A 3DXFA 1NBOA 2H6EA 4FC6A 3HQ4O 1CYDA 1JAXA 3VOSA 2CFCA 3K6JA 1K2WA 4ZRMA 2OBYA 4JBHA 2X9GA 4MVJF 1DIHA 2P4HX 4XRGA 1K89A 2FRDA 1KY5A 2AQKA 4J49A 1DRWA 3U4DA 4E13A 1T1SA 5C5IA 4NMHA 4Z0TA 1H5QA 4B7XA 4M87A 1AXGA 1WDMA 4IJVA 5FYDA 1CRWG 5JC1A 3IC5A 3NJ8A 4HX5A 3ZV4A 1LQTA 1PX0A 4YJGA 3JQ8A 4TRMA 2GN4A 5ES3A 2C2YA 4IZIA 5JFOA 5T8KC 1D3AA 2NU9A 1RYEA 3JQFC 3QIVA 2YUTA 1Q2XA 2AEFA 4BNTA 3HHPA 5T67A 2O2YA 3PWKA 2VT2A 3NT2A 3U62A 4QFCA 3TOXA 1TI7A 4EEXA 4IMRA 9LDBA 1GYRA 1PIWA 4HFJA 4PIVA 5JAIA 4AJ1A 1GDHA 4Q3DA 1EBUA 1ZNQO 2C82A 4KUGA 1F12A 3TN7A 1UZLA 5BSEA 1T2CA 1AE1A 2B83A 1LLQA 2VYNA 3PEFA 4PLCA 4N5MA 2DU8A 5JNLA 5ILOA 1D7OA 4EYEA 4EDFA 4NFHA 4CMIA 4DL9A 4OM8A 1JVBA 3IJPA 2GGSA 3GRKA 2J6IA 3OA0A 3ZU5A 4EUFA 5I7VA 4UVHA 4CL3A 3K96A 1Y8RA 2R00A 4TKLA 1E1LA 2O3QA 3QP9A 4FD3A 5HTOA 4KZPA 3NTQA 2VZ8A 3HN7A 5AXCA 1DO8A 1Z74A 4IQGA 5ILGA 4KWHA 1BDBA 4FR5A 4HNGA 5TT0A 1E7YA 1HLPA 2HDHA 3GG2A 2GZ2A 1QORA 2FY8A 3OP4A 4RVSA 3SXPA 3WTBA 4ND3A 1YJ8A 4MINA 1PJCA 2AA3A 3DZFA 4OKNA 1XIVA 4B3JA 5AXDA 3WIDA 4FOSA 3WDSA 3PYXA 4A26A 1KVQA 3WGIA 1U3UA 2NU8A 5ENDA 1N1EA 4ZN6A 3KSUA 1B8UA 4BV9A 1NASA 1XU7A 3DONA 1N8KA 4H7PA 4ROSA 2ZYAA 2ZYGA 3DR3A 3PQEA 3BTSA 4PLZA 1GL3A 3TFQA 3HDYA 2AW5A 2YHIA 5H81A 1C0KA 4GMFA 4WJZA 4LISA 3IKTA 4OJNA 5I9LA 3MCVA 5I9NA 1E6WA 1CQIA 1LDBA 1N7HA 3IS3A 5DF1A 4AJIA 4NIMA 1ZJZA 2D59A 2V6GA 1M67A 1P1FA 3DZIA 3WJ7A 5JY1A 3N7UA 4RL6A 1VJTA 3IKVA 2PD4A 3OMLA 3H5NA 3WGHA 2EKQA 5DCUA 4D3DA 3WQSB 1GYQA 4Z3KA 1PS9A 3DO5A 3F46A 1JDJA 3H9QA 5U1PA 4IJUA 5CPFA 3ENKA 4BGEA 4JN6B 1V3UA 3V5NA 2Y67A 3KUXA 3ZW8A 3INRA 5KKAA 3GA0A 1WLYA 4PG4A 4CQMA 3BXXA 4ID9A 4BO3A 1YKFA 3U0BA 2E82A 3WG9A 3R3SA 2B5VA 1HDYA 3VH2A 1GZ6A 1E7SA 3Q3CA 2FR1A 4GI2A 4CMEA 1LXCA 5JDCC 1YVEI 4WUVA 1QP8A 3DEYX 3MWEB 3DZHA 3JD1A 2UUPA 2RHRA 4IS3A 1HE3A 4RF4A 5TRTA 1IB6A 1ID1A 1X1TA 3MTGA 4CM8B 5KNLA 5CDUA 3H6KA 4D43A 4CJXA 1Z82A 4WCDA 1HE4A 2HMSA 3RASA 3ULKA 3PHHA 3BMQA 1EVYA 1P1KA 4YTEA 3JYLA 1YXMA 1ZIDA 4R1TA 1NXQA 1NQ5A 1V6AA 2NVWA 2VYND 3NT4A 3ONEA 4J0FA 4NNJA 3K31A 4AICA 4IGEA 4UUNA 1XG5A 4AG3A 5HM8A 2DBVO 5AVOA 4CLEA 4JP3A 5KOIA 1VC2A 1F8FA 3O8QA 3HSKA 3U4CA 1NAIA 3GGPA 3I4CA 4Z0PA 1QV6A 4OQZA 1YDEA 2GZ3A 2FPGA 3OIGA 5CAEA 3TRIA 1XEAA 2P9EA 5BNFA 2DFVA 2VNAA 1BMDA 3NDIA 2EF1A 1TXGA 1E3LA 1GZ3A 3LT4A 3Q2IA 2QX7A 4RPKA 4YJFA 2DBQA 2ZTMA 3DHYA 4WLEA 1UDCA 1RKXA 3WMXA 2DM6A 2CDCA 1PZHA 4Q3AA 3ZWBA 4MO2A 3TZKA 1Q7BA 4BNKA 3AFNA 2ZB4A 1LLUA 5BT9A 1HSZA 4L75A 4QSMA 4RLHA 5KJ6A 3HB4X 4DREA 3C7CB 1ZKMA 2JKVA 3ITKA 4OL9A 4RZHA 3NAQA 5A9RA 2W90A 3TFOA 3WJAA 4A27A 4R3WA 2BLLA 1IPFA 5DP2A 3QRWA 1L1FA 4NU6A 1F06A 4MKZA 1P1JA 2CVZA 3ONDA 1YOVB 4GL4A 4YRAA 4UUMA 5DOZA 7MDHA 4CUZA 5IDXA 2GUGA 5CFZA 4TROA 2H5LA 4QO7A 1I0ZA 8ADHA 1IY8A 4PZCA 3A14A 2G76A 1PGPA 1ZFNA 3I9LA 5JO9A 2D1YA 4OKIA 1V0JA 3OJEA 3CINA 1DDOA 1E3SA 1J0XO 2B0JA 3GEMA 2I76A 4JGBA 3LYLA 4P22A 3JQFA 1LSUA 3ASVA 3M2TA 1NPDA 4U6SA 2OUIA 1PTJA 4XJTA 1SOWA 2IEDA 2V65A 1Y5MA 1B14A 4U6QA 3AU8A 4E6PA 3TZQA 4E30A 1G0NA 4UVIA 1PL6A 2FZEA 3VPHA 4BNHA 3EAGA 1U3VA 2FMUA 4CMJA 3NX4A 3W6ZA 4BO1A 1Z73A 4QQRA 1UZNA 2EV9A 1T2EA 4K9DA 5A9TA 3U09A 4CQMD 1AGNA 4IMPA 4IDBA 1I10A 3PQDA 1ONNA 2PLAA 4DMLA 2EGGA 1BWSA 4D7AA 1A5ZA 3GAFA 2AG8A 1PQWA 1GYPA 4TZTA 4G5HA 4BNYA 4YB8A 4FC7A 3GQVA 2NQTA 4FFMA 4QECA 5TSDA 3ZHBA 4XGKA 4CPDA 1GQQA 4MPDA 4GQAA 4JBGA 3AY7A 3WB9A 3Q6IA 3PFFA 4DYVA 4F6LA 4AFNA 5A9SA 2R2GA 1U1IA 4I5DA 1UR5A 2PR2A 3O38A 1B7GO 4B79A 4NHEA 3BTVA 1U3WA 1I8TA 1V3TA 3ANLA 1Y7TA 4G2NA 4P4NA 1EQ2A 1LDMA 1LSJA 3K92A 4UAGA 4ZRNA 4BUCA 1NX6A 3ABIA 3Q2KA 3VVBA 4AVYA 4E21A 2IEBA 4YXFA 1EK5A 5LDHA 1ZK1A 2Q99A 5IDYA 3NUGA 4FJ0A 4HXYA 1CETA 1XKQA 4OOEA 3PRJA 3FTPA 5J23A 3DAFA 3JQGB 2W98A 3JD2A 4M86A 3UKOA 4RQTA 3QV1A 3SLKA 4YA6A 1P44A 2SCUA 5K0ZA 5COQA 1JAYA 3I5MA 4J2OA 1CF2O 2O3UA 1QV7A 1YJQA 1BG6A 1Y9AA 3D7LA 1WW8A 1C1XB 1QYVA 1XGKA 5B12A 3EVTA 1WMBA 3OIFA 4BB6A 3GZ4A 3NJ4A 4DQVA 3VZRA 2OGUA 4MKXA 4TRNA 5KJCA 3OJFA 3U4HA 2Z1NA 4YVFA 1I36A 1K6JA 5A03A 3KBOA 2XOXA 5L53A 3GFBA 3WYEA 4ZA2A 5A1TA 5COBA 2B4RO 3H5AA 5C37A 2QYTA 2PV7A 4OGWA 2A9FA 3OJOA 3H9JA 3RFTA 4D0SA 4P4LA 4B3HA 2WWRA 3TJRA 5JY6A 4R1NA 1XCBA 4GVLA 4LVUA 3OFSA 5ITWA 4WLVA 4XD2A 3E18A 1KIFA 2AG5A 3PJGA 4UREA 2WDZA 1KERA 4GKBA 1XLTA 3RAJA 3RROA 4BKQA 3IL2A 1YE3A 1LRLA 3EC7A 3P2OA 4NPCA 1ZCJA 4MIEA 5TC4A 3ZU4A 1YRLA 3OQBA 3U5TA 5AYVA 4EUHA 3M6IA 2PWZA 2FPPA 4CM4B 4YAJA 1WDLA 1PGJA 2DLDA 4JLWA 4E2XA 1PJ2A 5BR7A 2VZ0A 4BNFA 2B35A 1LLDA 5HS6A 4B7UA 4RLSA 1ZXBA 3F5QA 4PZEA 2C54A 1MC5A 1R15A 1H2BA 2HMWA 2GYYA 3WBBA 4MVJI 3FNFA 1X1EA 4D42A 2I67A 3ZDFA 1HE2A 3F1LA 1LRJA 4NBRA 2NU7A 4ALLA 3G1TA 1LSOA 3RSHA 2I6TA 2LDBA 4G81A 4C7KA 4PVCA 3HE3A 5JYEA 3F1KA 1GEGA 3HG7A 3AI2A 1P31A 1JQBA 3CXRA 4XQ9A 5BNTA 4M55A 4BGUA 3RKUA 3AM4A 4NBTA 4CV1A 3VKVA 4CLXA 4DLLA 4IJKA 1T4DA 2OP0A 2NUAA 2BD0A 4IPTA 1ZK4A 1I3LA 3LK7A 3PK0A 1LA2A 1EFKA 1VI2A 3C24A 2GCGA 3DBLB 2AEMA 1LNQA 5IDQA 2O48X 1I01A 5JS6A 2NQ8A 1IULA 2WM3A 1LEHA 4J16A 4C7JA 3FI9A 1X7GA 4EJ0A 1MG0A 1H9BA 2ZJ0A 2I65A 4YCAA 4DPKA 2EP7A 1N92A 1ISFA 2VWQA 3AM3A 4MVJA 2Q2WA 4QFDA 3WSWA 2OORA 1KC1A 4KP7A 3JQAA 4NR0A 1E3EA 2GN8A 1UXHA 3FNEA 4QO8A 3OIDA 4CLOB 3E48A 3ZWAA 3V8BA 3DMYA 3ZWMA 1UXJA 1EUDA 2W2KA 3RFXA 4DIOA 1BXGA 3RC1A 4RPGA 4IUYA 4J1TA 1V8BA 3DDNA 1U5CA 1CIVA 3WTCA 5JW6A 4PLWA 3RWBA 2VYVA 4WLNA 4GX0A 4IJWA 4J9UE 5LDGA 1O8CA 1ULUA 1MC4A 1T2FA 4OYRA 3UVEA 1XA0A 4WASA 3C1OA 2BGKA 4W99A 5C7OO 5GZ3A 4I5GA 3M1LA 5ADHA 1UXGA 1FDUA 5DBFA 3PPIA 2CVOA 2GSDA 3I9MA 1Q0QA 5IG2A 1HLDA 1NVMB 2PK3A 3JQ9C 1EUCA 3E03A 1LUAA 4PG5A 1F17A 1HZJA 3SX2A 4UEKA 1NR7A 1D1SA 4PLYA 1B0AA 2X0RA 1YB1A 2F00A 3KV3O 1WP4A 3I4FA 3UCEA 2H63A 2FP4A 4MVJP 2BFMA 3JQ7A 2POQX 3BMNA 1DFIA 1GPJA 1E3IA 3DOJA 1Z6ZA 3JYOA 5CEFA 3GVCA 2EKPA 4I5FA 5CHEA 3B6ZA 3ROPA 3ZNNA 1YL5A 2FOIA 2VHYA 3GN2A 3QVXA 5KVQA 3ZZNA 2JL1A 4IXTA 1YOVA 4LSMA 4TQGA 4LVCA 2X4GA 5A3JA 4ZHSA 2UVDA 3MTJA 3X2FA 3FRJA 1HDGO 4FFRA 2RCYA 1T4BA 2EGHA 2YW9A 2VHVA 1GUZA 1GZ4A 3C7DB 4G65A 5THKA 4FFOA 5A3VA 3KO8A 4WCFB 2X9NA 1MFPA 5DCYA 3AUSA 1Q1NA 4BO2A 4QUKA 4FW8A 3QA9A 1I3KA 1ADFA 3H3FA 3HUDA 3AI1A 3PFWO 2Y1OA 3ANNA 1ZMTA 4PLTA 3PLNA 4WOKA 3WFIA 1IPEA 3WOHA 3OM9A 4XYLA 2NLOA 2AHRA 3N74A 4KOAA 5GZ6A 3RFVA 4B8ZA 4BKRA 4XJSA 1U3TA 1JWAB 2E37A 4DVJA 3C1AA 2LDXA 1H93A 3CZRA 2CDBA 3PYLA 1I3NA 1UH5A 4HV4A 3ASUA 5F1PA 4DC0A 4P8RA 1U7TA 1F0YA 1X14A 2NU6A 2CDAA 1KEPA 3HDHA 4MVJD 4U0JA 5JSFA 4OXKA 3V2GA 1O95A 2WSBA 3JQAD 1ZK2A 4EBFA 3DZKA 4Z9XA 2EJWA 4W6ZA 3UH1A 3AJRA 4JP2A 2PFGA 4L4SA 3CPSA 3LF1A 1JW9B 1YQDA 2DT5A 1AHIA 4XYGA 3Q9UA 1LRKA 4IDGA 1TLTA 2VOJA 3F3SA 4CL8A 1GPDG 7ADHA 4GX2A 4GBJA 1CEQA 3ROMA 1N5DA 2PGLA 2GERA 3I6QA 1NFQA 4II2A 4XCVA 5EQFA 3AOEC 2P9GA 2VYVD 4Q3BA 3I3OA 4XGNA 2UYYA 5F1KA 5KTKA 1EE9A 3GNTA 5KJ1A 4YRBA 4CQLB 3DL2A 3IAHA 1R0LA 3O26A 4K1LA 5GZ1A 1H0KA 4CLHA 4RJTA 1X13A 1M75A 3H2ZA 1VJ0A 3KOUA 4RF3A 5TGDA 5KWEA 5F5NA 3G3EA 4BNJA 2X5JO 2ZB3A 4ALIA 1NPTO 1GV0A 3NDJA 2JFGA 2QQ5A 1T26A 3FWNA 3GVHA 5TNXA 4BGVA 3DTYA 4KTVE 5JDIA 4CM9D 2J5QA 3FHLA 3TF5A 4IXWA 2UUOA 1LJ8A 1SO8A 4PRLA 3OJLA 4MVJM 1LI4A 1BW9B 1XYGA 4W4TA 4WLFA 2CD9A 3KYCB 5IXYA 4OSOA 3DQPA 2FSVA 2Q1UA 3JQBC 4JJGA 4L0QA 3PWZA 5C7LO 4IM7A 3RQSA 3R1IA 1VKNA 3TL2A 4A73A 2VRCA 4RVUA 1PZEA 1MG5A 1C1DB 1GFSA 4U8GA 2X23A 1HDCA 3PHIA 4PZDA 1U4SA 2E49A 1M2WA 2EXXA 1KVRA 1KVSA 4YJHA 4NJMB 1HDOA 2Y0EA 3F4LA 4RQUA 4DYDA 2C7VA 1FXSA 4ZICA 1X0XA 2FWMX 2GD1O 4WPGA 2YV3A 4CM4A 2JCYA 5IN4A 4NDNE 3JYNA 1R0KA 3EMKA 3OQ6A 1NFFA 3JSAA 3RUEA 2IYOA 1AN9A 1I2BA 4DA9A 4FIZA 4R68A 4L8VA 1Z45A 3GG9A 2Y66A 4J1SA 4JQCA 3TPCA 5K9ZA 2O2SA 1U2DA 1BXKA 1ZEJA 4NI5A 4E2YA 4GX5A 3E6AA 1FDSA 3ZV5A 1EQUA 3O9ZA 2NVBA 3AW9A 1Y6JA 3VZPA 3CZMA 4YR9A 2F1KA 5EPOA 5DT9A 1ZUD1 3FR7A 4YAKA 4FBGA 4XWYA 4BNLA 3GF4A 2YV2A 4YT4A 3COSA 1IZ0A 2GR9A 3GEGA 1XQ6A 2V6MA 1JWBB 1VM6A 2O3TA 3T4XA 3IJRA 3HWRA 1NHGA 2Q1WA 3I23A 4X54A 4PFJA 2BRUA 2DTXA 3TNLA 3FSRA 3WGGA 1JKIA 3DBVO 4PG7A 1J5PA 1LDEA 1DRVA 5ENVA 2HMUA 4FB5A 1AUPA 1I24A 1X0VA 3H9GA 1N9GB 2PZLA 3LU1A 4YBZA 5FWNA 3JYPA 1DXYA 2I66A 3GH3A 2WYVA 3EDMA 1SMKA 4D3FA 3C7AA 1NVGA 4J91A 1JTVA 4XB1A 5DZSA 3IQDB 3ZWNA 3F6YA 2HK9A 2PGDA 4IIVA 4W9NC 4EI2A 4Q3EA 4RF5A 3MOGA 5EERA 4E5NA 2QZZA 4O59O 2UAGA 3WS7A 1MA0A 3ZWVA 4H16A 1PU2A 5DP1A 2JD2A 1DLJA 4JBIA 3BMCB 3QWHA 2NVUA 1KOLA 2QRKA 3R0IA 5HS4A 3L4SO 1HTBA 4PVDA 3L6OO 4IS2A 1DC3A 4NQZA 1BSVA 1DFGA 2TMGA 3UW3A 1E3JA 4UULA 1HE5A 3WIEA 1ADBA 1Q7GA 3E9NA 1UZMA 3RUAA 5G0TA 2ZCVA 1NM5A 1CDOA 3EHEA 3A1NA 3H8VA 4YT5A 4LW8A 4O1MA 1EVJA 1ONOA 4WEQA 1PJTA 1WAMA 4CM7A 4CLRB 4OQYA 1NP3A 1W0CA 5IJZA 1HT0A 4B4VA 2HSDA 1YWGO 4DMMA 1DJNA 1SB8A 1TT5A 2B37A 2C7GA 1VE9A 1B26A 2X86A 4IQ0A 4B3IA 5G4KA 1DAOA 2VRCD 2VOEA 3DTTA 1LDYA 3MWDB 3PVZA 2IZ0A 4GMGA 4HWKA 4URFA 4CMAA 4DTIA 4JCOA 4NK4A 3BMOA 2AQIA 2CUKA 1DB3A 4J9VA 1P45A 5TLSA 3VZSA 3DMTA 1GAEO 3RU7A 3MZ0A 3UCFA 2ZIZA 5JAMA 3HFSA 2WD7B 4DGSA 2CF5A 3GDFA 2J3JA 3GVXA 3H9EO 1KVTA 1U9JA 3DBRB 4RDIA 3F47A 3TZHA 4L73A 5C7IO 3GNQA 1JA9A 2QHXA 1GR0A 3I9OA 2O4UX 1SEPA 2V6BA 3L9XA 4J7CA 3IIEA 3JCZA 4CLDA 4KUEA 4GLOA 1R4NB 4TVOA 5JC8A 3FN4A 2C07A 4XDZA 1E3WB 4ONEA 3U3XA 3ETEA 2I3AA 2X22A 1J4AA 3WGTA 2IZ1A 2HK7A 4HFNA 4E5KA 1LC3A 2NACA 1HZZA 4BOYA 3ZHYA 3QW2A 2H1SA 4FQ8A 1PJBA 4B7CA 1MXFA 3LSYA 1EDOA 4I08A 2OFPA 1TA4A 1ZH8A 4XZ3A 3GPIA
chains in the Genus database with same CATH superfamily
3AF5A 3ZHQA 1CLUA 2VF5X 2G3YA 1U3GA 4ZI5A 1UPCA 4OL0A 1GCGA 1BRTA 1YS2X 2ZVQX 4HI0E 5AD1A 2TMDA 3STWA 1XB2A 1DNPA 4EHAA 3NBAA 4S3MA 5K0JA 1C1HA 2CVFA 3AUAA 3KVNA 4J7UA 4QL3A 1E6MA 5EUBA 1XDWA 4ZYYA 1CEXA 1ETHA 5A04A 2FWPA 4PG6A 3FBGA 1X7HA 4URZR 3IEVA 4MUFA 5C1DA 3OP1A 1EWYA 3RSFA 3C41J 4HK4A 4TLEA 1RQ7A 1HDXA 2HYDA 3D4PA 2GVDC 2WTBA 1HNNA 3DFUA 3ED5A 3Q0EA 1OW3B 4RTRA 1HV8A 3C1UA 2XBUA 1MW8X 3R7NA 1RQ2A 1BIFA 3IAUA 2C7PA 1FYXA 4Z4FA 3PIIA 2YYYA 3OCYA 2C3UA 5T8KA 3ADPA 1CK4A 1N25A 3KFLA 4NMXB 1JG3A 5CHYA 4Z86A 2ONJA 1GADO 3LUPA 1TYBE 5JNWA 3FB4A 2QZ9A 4XB2A 3BFVA 3HJNA 3GHYA 3QG5A 2HU8A 4MKHA 2IY9A 3C85A 1M66A 1QFMA 1ST3A 2J9ZB 1XMQB 5CFRA 1XPJA 2VSQA 3DTNA 1PNVA 2AFHA 3PT9A 4ZDIA 2QJWA 4E31A 1PNOA 3EEIA 3TLMA 4UNQA 1L4LA 3IODA 1TJPB 1XQVA 1E0AA 4B2YA 2QW0X 1JMKC 1DOHA 1L8OA 1N2ZA 3RVRA 4OG2A 4PTLA 3LP8A 5BV8A 1U1EA 4RHEA 3ET4A 5H5JA 2GFIA 1WU8A 2JIDA 4A8JA 2RGCA 1W0KD 2WP0A 2ZSEA 3U7EB 3NNNA 1Z26A 1SB9A 4I1VA 1JEYB 3KYJB 3RIXA 3OA2A 3LPCA 3STTA 4WNCA 4LBYA 1JFRA 5K6AC 5EY5B 2ZRJA 1RTKA 3G2OA 5T3UA 4CM1A 3LBHA 1QHYA 1DV1A 5KWSA 3FG9A 4EFNA 5L7YA 4OSPA 1H69A 1XRSB 2BE9A 5CW2A 3VGJA 1X9GA 1Z5OA 3M5WA 5A7FA 4D0RA 2G9VA 1FFSA 4RPCA 1K3FA 1P9WA 1KDOA 3VR0A 4ZJZA 3ZV3A 1FDWA 1VHLA 3L7OA 4Q4AA 3TNYA 1NY6A 4CVNA 1QQAA 1KIMA 3NASA 4B85A 2X4DA 1QO0A 1WVGA 1VKRA 1PS8A 4M9SA 3N8KA 1CULC 2GM4A 3M1YA 1JJVA 3FAKA 5IDWA 1H2HA 1P91A 2D8AA 2GZHA 3HY3A 1FCJA 1HETA 1CF4A 1P1BA 4I2VA 2AH5A 3TCNA 1U11A 2Z5LA 1O7JA 4BJHB 2Q29A 2RBEA 4LOHA 3VDRA 1R4ZA 2NO1A 1OFHA 1I5OA 3D7MA 1JKJA 1UJMA 5IYZF 4M98A 3PYMA 3PFNA 1JDNA 2PT5A 1K4YA 2ZS8A 3JWEA 1B8OA 3MTDA 4E4YA 1PT8A 4H3SA 3ZV6A 1OB2A 1A1SA 2P78A 1Y8QB 4O4IA 2AMFA 3COYA 4DW8A 3AR4A 3KHTA 4E0BA 4E94A 3OM0A 1C0LA 4EF6A 4US1R 4F0JA 3RTAA 3NHPA 1YHZA 2QLBA 3QVWA 3WKCA 1QGUB 2BTOA 2PKYX 1SVNA 5AKYA 5KQMA 3PGXA 2NWQA 3QLJA 4CTMA 1TTTA 2H29A 3K8OE 3EWSA 2FN3A 4BQQA 1VE5A 5A06A 5KQLA 2DY0A 5CLHA 1NR1A 3W9YA 4ENPA 4R2MA 5I3CA 4KRFA 2ZYTX 3IPYA 4R9UC 5AXAA 3JVVA 5JAQA 3ZLTA 2W5UA 5KOHB 3K9FC 1RRFA 1L1QA 3AVQA 4RMGA 4RJIA 4X20A 1SXGA 4KIJA 4NOMA 2NZ2A 1UXKA 3GMIA 3L8FA 4DNXA 4QNMA 1RJDA 1MXHA 1WSWA 2GAAA 2YZMA 3KLBA 4LGYA 1V25A 2GPSA 4HLCA 5BNIA 4R1MA 1OC2A 2WNHA 4GI3A 2VI5A 4BVBA 1P77A 3IP1A 3V1UA 3T54A 1TO6A 3KR2A 1E5TA 1U8UA 4FMDF 4KSCA 1E69A 4KVAA 4GWGA 4QARA 4RHXA 4NJOA 5KO2A 3EIQA 2OE2A 2IY7A 4HDSA 3DHVA 1E2DA 2XA1A 2IIQA 5AHRA 2IYEA 2XYRA 3K2QA 4MWTA 1XAHA 2PGJA 3T5CA 3D7KA 1BDJA 2P9TA 5EJAA 2NU9B 2FSUA 5CA0A 2RARA 1G291 2LBPA 1G21E 2X0JA 2E1RA 2OHJA 1S6YA 2BFOA 1GZVA 1WXGA 3X2SA 4ZCMA 1NW6A 1AQJA 4JT4A 4AWAA 1LW6E 3T3DA 1H94A 2PD6A 2BJWA 3A6HA 4PXAA 4AURA 5J4LA 5ED4A 1B8NA 1FFYA 3N39C 1WB4A 3EVFA 1T35A 1D0VA 2YNMD 1MENA 5AOVA 3RU9A 4KNWA 4XGIA 1MAUA 1X19A 1UDAA 1U8EA 2BN4A 2MSNA 3JZMA 2Q6OA 4KRXA 2HA2A 3IT0A 5B37A 3V8NA 1Z63A 3HGTA 2XDAA 1QIIA 4HZUB 2K6GA 3LQ4A 2WQ6A 4EHNA 1MO5A 3EVDA 5B3KA 4EQ6B 4NZ9A 3RRZA 4DAOA 4FFDA 3BRQA 3INNA 4LY6A 4AJPA 1U4OA 4OHXA 2CDRA 4U7JA 3V2UA 2B4YA 3ETHA 1D6SA 2JJ1D 4X41A 1Z0SA 4YRRA 1N7GA 3NT5A 2FUG1 4IDQA 4MUXA 1W6RA 2FRDC 2J7PA 1BEZA 3SR0A 4WKPA 4EZEA 1AD2A 3V1TC 1JFFB 4J7AA 1PFVA 5KSZA 4R1OA 3QX9A 1T0JB 1AV7A 5L51A 1QGOA 3DV0B 1CY8A 4UC0A 4BNNA 4Z2AA 2H5EA 2R1VB 3WLPA 3GCDA 1I1QB 3K5IA 4AY2A 3AEXA 4OHCA 1NLYA 3WNQA 5IUKC 3CTPA 1JNXX 4K46A 3R5FA 1THGA 1T1RA 1TCBA 1UK6A 2GFQA 2GKOA 3EZYA 3FNRA 4HGOA 3O90A 3DKKA 2FSSA 4Y2HA 2NU8B 3VKGA 3EY9A 4A10A 4YJDA 3TIGA 1POWA 4UJ3A 2QVBA 2CFRA 4QBIA 4AKEA 2GD2A 3D6FA 5IJ9B 2OECA 3N3BC 1MGPA 1QS0B 2TMYA 4O4HF 3VOBA 2SECE 1W2GA 1PHPA 4N6NA 1QANA 3EIWA 4WZBE 4K9RA 2QPTA 5HIAA 5AXBA 5IFLA 1ZUNB 5ALNA 3WLFA 3FDJA 4C4AA 3DVAA 3VR6A 2YHIB 2OBMA 4XARA 4PN3A 1Q7TA 4P3PA 3IDOA 2OCIA 3S28A 4GI1A 4B5KA 3QUAA 2A1UA 3DOIA 3CH5A 4M8KA 4QNRA 3IKMB 2YR0A 1IWBB 4F6CA 3OIVA 4IJMA 4IXMA 4RUKA 2OG2A 2XYQA 3HBLA 2A88A 4GVXA 5DPMA 3INTA 1G20E 4CF3A 1X74A 3AHCA 2P3QA 2WV9A 1Y4DE 2W2OA 3KSZO 1QH0A 1V4NA 4L0DA 2G82A 3L49A 2AN9A 3AVOA 3BIFA 1QC5A 3PGLA 3HU1A 4H7HA 4BO8A 1GNQA 2PMCA 4B6GA 3KQHA 5F7JA 4HFMA 5JAHA 1MDFA 1PG5A 1WKVA 2BWJA 1J6UA 2CMHA 2FP3A 2IDKA 3FF1A 4IDFA 4ZAWA 3U9TA 5TIIA 5E4FA 2M98A 3NHAA 5K0LA 2PZAA 1Q14A 3IR6A 1E9EA 2CCJA 4C87A 1HUQA 3C0KA 1YHYA 2FWNA 3ENNA 5FEMA 3TTSA 1GLNA 2CXNA 1S7CA 2G6BA 2G9RA 4KTTE 1CVRA 2AXQA 2P2DA 4G0QA 2PKXA 3WL5A 1P9RA 2QI9C 4LJ5A 1GRVA 4CQMB 2FFAA 3KWLA 1DPGA 4TOIA 4PC1A 1A96A 4ZMRA 2WJ4A 1USGA 2JFBA 4GDFA 2O0KA 2DWUA 4V0RA 3DFKA 1RHQA 4NDAA 3OEHD 2W2LA 4TTQA 2C0QA 1FS4A 5KX5F 2XCSB 2VA8A 1PAUA 1LVGA 4DC9A 5EHNA 4DQXA 1Q0PA 4E5PA 1EBBA 3LY9A 1VLLA 1QNFA 3CISA 1R0SA 4ZZ2A 5TR9A 1BGXT 3L77A 2QAGA 4YAWA 3R24A 3T5DA 1AVTA 2VC2B 5BSHA 4BTEA 4EW1A 4BPBA 1U2EA 3ANMA 4RZ3A 4FOTA 3GX1A 3MWFA 1YUMA 3QLTA 4ZVNA 4O4JF 2IE8A 3HDVA 2GDZA 2C1EA 4BLRA 1MFZA 3GP8A 2O7SA 3KJZA 3AL0C 3PC6A 2R6GA 5BVGB 1QWSA 5IBPA 1QG2A 1E3DA 1JKMA 2C0CA 1IM2A 2GZSA 4OY3A 3QXHA 3P19A 4B3CA 1QJCA 2F1IA 1ZMBA 4JGIA 5G3YA 3PQ3A 1KFBB 2IEGA 5BQXA 3UPTA 4J8PA 3SM3A 4MA0A 1U5AA 1RZRA 1FNSA 2CZCA 2X6RA 2WYUA 3I12A 1ZO8A 1ZJ5A 2Q28A 3PEYA 3DUFB 3QSYA 3BIXA 3F2IA 4LGCA 1FW6A 5E1BA 1VI5A 3TKAA 4RH0A 4NTZA 1RJEA 4LTNA 4CTJA 1T6BY 4ALJA 1CUXA 3OG9A 1B93A 1NRXA 2A57A 3GV0A 4QC2A 2FN9A 1UMDB 4X71A 3V55A 3ST7A 4K88A 2DZDA 4H1UA 4MQ4A 5CDFE 4J7XA 2ZATA 3GRRA 5K0SA 2ZRDA 3B2EA 3QMPA 1VA5A 4AJLA 3CRRA 3H4TA 3MXOA 5D5PA 5TMDA 2A3NA 3LK6A 2NTNA 1ATZA 2PJDA 3FKQA 3ETJA 3NWJA 4C07A 1RU3A 1WOMA 4EG8A 1O3YA 5BY2A 5IJWA 3REFA 3IEPA 3QVLA 2YXPX 2Y76A 1DDGA 1OCEA 3CLVA 3DAGA 3A3YA 1VL6A 3A2NA 1L5ZA 1B16A 1RYNA 3GY0A 4ZGWA 3AIOA 2F3RA 1UPUA 3NNSA 4PAMA 3C3AA 2GEVA 5ITZA 4MS3A 1BX3A 1EP2B 3DE3X 5E9AA 3T1OA 3C3EA 4JZKA 3CB2A 4IWYA 3HB7A 5E38A 2ZAIA 5KTMA 3C87A 3PIDA 2Q5HA 4GAEA 5JQGB 3FVWA 3QZUA 5AHXA 2FSFA 2X0IA 2Y1XA 1DLIA 4OB6A 2V7XA 1Z35A 2FU5C 3NXSA 5E2AA 1ENOA 3PD1A 4QXMA 3R8FA 5JJLA 3GXOA 2CVPA 4FDVA 3CZ5A 3UAOA 2JIOA 4LGVA 1XXHB 5EGNA 1EXDA 3JQGA 2FG6C 5ARDA 3EUWA 2I91A 1ZM2A 1DC8A 2JAPA 3LCVB 3Q12A 4RPLA 2J0SA 2R84A 5REQB 2OKGA 2X19A 1G98A 2Q3DA 1HYGA 2CNBA 3NBYC 2MTBA 2PUVA 5A2GA 5EA2A 1Z83A 5CFPA 2W6ZA 3VO9A 3PFHA 2G70A 2I99A 1PQPA 1OWPA 4L4XA 1L3CA 1U0EA 2Z8ZA 1SHTX 1GL6A 5JE8A 3TUIC 2EKLA 3PXEA 3IMCA 1QIHA 5CVJA 1VMKA 2Y99A 1DINA 1T2DA 3CC8A 4BNIA 4QLBA 4REMA 3WZ2A 3I2IA 1Y48E 2W11A 4BNXA 4BMVA 2YJ6A 1AB5A 1OX5A 3PHLA 4HL6A 4AIRA 4OHWA 4RVFA 4CG2A 2HRZA 4M8NE 1TA0A 1U2GC 3A1DA 3WADA 2JA2A 1M7BA 1NX9A 2AFRA 3PNPA 3K1TA 3DDHA 4Q47A 3FFTA 4C04A 4P5DA 2GEKA 1XTKA 4A9AA 1UDBA 1C4KA 1E5XA 2XQKA 2Z04A 3R8XA 1EFHA 1A9XB 4M1OA 2IXAA 3KT0A 1GXSB 4OBEA 2J3LA 3SC2A 5SZIA 2HRRA 4IIDA 4BU1A 2IK8A 4XSHA 4OMUA 1IEWA 1S8FA 2ZIVB 1T4CA 2FA9A 3PNKA 4UMDA 4U9IS 4XD7A 2ZAMA 4ZPJA 2DFPA 4LKRA 5EJ2A 4TM8A 5F1OA 1Z75A 4Y9TA 4W6QA 4KQEA 1Z2OX 2JIPA 1Y82A 1YZNA 2QT9A 3SQMA 1KSGA 4DADA 2Y93A 4K0RA 4WVFA 4DANA 5FKJA 1JU9A 3TCKA 1OE0A 1KDVA 2J0VA 4B9EA 4MP6A 3WYNA 5IS2A 1JG2A 1BHSA 1TZJA 4COKA 3C4VA 2B1GA 2IELA 2HNKA 4MWCA 4N3NA 4DWOA 1PZMA 3CSUA 5IZ4A 1WCV1 4MW2A 4BB0A 4XYMA 3D0RA 2JCSA 2C2ZA 3D2AA 3Q9SA 4Z7QB 4ENRA 3QVGA 2RHWA 3U4IA 1V1RA 1DOZA 1IG0A 2GZ1A 3L92A 2YOFA 4MW9A 4WADA 4KGVA 3IURA 3MW8A 3HSYA 2B36A 3VPFA 5I4IA 2C2XA 1HH4A 2GD0A 5GY7A 4LF6B 4A91A 4HLNA 2PT9A 3RHFA 1E1RA 2YV5A 3MOIA 4Q6BA 5FPTA 4DCVA 1MR3F 2WYWA 5BR4A 1G55A 1YB2A 4FFPA 8GPBA 2Q45A 3PPYA 4BRSA 3MD9A 1H22A 3F6PA 4Q7EA 4IICA 1KQFA 1KY2A 1KEKA 1LV7A 3FPCA 4CDNA 2PQ2A 3SMQA 4WKGA 4W7HA 5B53A 5SZKB 3PWTA 1TIBA 1ISGA 3QA3E 3DCJA 1EUQA 3LHSA 3OT1B 4UPDA 2FOXA 3EA5A 2JJYA 4K81B 1U6IA 4DUGD 2E6KA 2BKUA 3CF4G 4GU5A 1E98A 4EQ6A 4PO9A 2CMDA 5GIOE 1M76A 2ODAA 3T35A 1OLOA 3B38A 1FFXB 4J0HA 2EARA 4FCCA 4XWTA 1XKXA 1DKNA 2PBFA 4XLZA 4PLPA 5HDBB 1YS4A 3WL3A 3CV3A 4LXGA 4HZIA 3VU3A 4ZVKA 5MFPA 1JFFA 2WVGA 1WWKA 3DCYA 4Q4HB 3JQ6A 5B55A 1ZHFA 4NSNA 4BRUA 2R1VA 1DCKA 2I2BA 4BFXA 1DEKA 1ZWLA 3FWYA 4EA9A 1QRRA 2FFRA 1A97A 3TZ6A 3Q0IA 3T34A 1KEUA 2QMZA 3CZ4A 3CZPA 3NLLA 1P1HA 2VP9A 3DQZA 5FBKA 5AVSA 1F2TB 1J2RA 2BMWA 2VUSA 2ZSFA 3DPIA 4PGFA 5KCMA 1V45E 3O1LA 3NGMA 3DV9A 2I3GA 5HFNA 5AIAA 2BGJA 2D1RA 3ZJYA 4BECA 4OJMX 1RWXA 3VISA 2ASEA 3DW3X 2EG5A 4JUIA 4O5OA 3HXTA 3IB6A 5A4DA 2JIMA 2XMZA 1ZA1A 5I8PA 2X9VA 2A5YB 2IUEA 3HUFA 2IDZA 1ZUNA 4G37A 1V9LA 2BL4A 3BA6A 1ZD4A 4Q1BA 3KQNA 4CEJB 2WWHA 4HO1X 3HZZA 4O1IA 5KSYA 1HQDA 4MV6A 3O3CA 5K3OA 2Q2NA 1PEYA 3I09A 5HHTA 3NHLA 5JQWA 4OH7A 1M7HA 1I32A 4KDFA 3UF0A 3K70B 1CT9A 4JVOA 2PLRA 3B6MA 3IESA 1PTKA 4UD6A 2W6PA 5BN5B 1OWNA 4KR0A 4IR7A 1UPBA 4Z6KA 4GBGA 621PA 2XY4A 3MTBA 3P4UA 4DM4A 3IAM6 1U2RA 3VVMA 3KQTA 1FYEA 1QVZA 4BFWA 2ZROA 1E3QA 4OREX 4MYCA 4S1VA 5FF9A 3W34A 1M1XB 3ZDEA 1O5OA 4PCVA 4LYJA 2D5AA 4RVCA 3TVDA 5L3SB 2A5LA 2XUJA 4X66B 4F8JA 4YY3B 3LQ2A 4UBIA 1IAQA 1LS6A 1GCIA 1G5IA 1QVVA 2ZB2A 3AEUA 3ZZTA 5AKGA 4YRGA 3D4OA 5K45A 1H3NA 1OB5A 1IM5A 2MR5A 1SNYA 3CZQA 3KJFA 4FS3A 3GNLA 1QH8A 2DBRA 1ZY2A 3RV4A 4QU9A 3SEZA 5KHLB 2VSYA 2W2PA 3L6BA 4L5BA 2J08A 3PXDA 3WWZA 1BCRB 2VAPA 4P4GA 3EQZA 1J9GA 1JIVA 2GF2A 3ZWXA 5HJEA 1YDHA 3WGKA 1D2NA 4ZIRB 1ISJA 4Q9NA 3TGWA 1CV2A 1PJ3A 1FW8A 5K0CA 4WERA 1NTOA 1JG1A 2PKCA 3F7MA 4IP0A 4R6WA 3SHFA 4HEHA 5IAJA 1QPBA 1FFWA 5CIWA 3FWPA 1XZKA 3CN7A 3D2CA 2ZJ5A 3EDOA 3MA0A 4LRYA 5T57A 5IM4F 1UQUA 1VG1A 2FZWA 4HGQA 4MQLA 3SDZA 4DV0B 2AMVA 1KFCB 1EGAA 3LDAA 4D4LA 1VBFA 5LL6P 2VF8A 2ZRBA 4OYLA 3A06A 1HG0A 1N9ZA 1W94A 2CHQA 2I6FA 2P2NA 3GVIA 4ZQHA 3SNHA 4YV1A 5JJCA 2CV0A 3K16A 4HQOA 5MGBA 3IX7A 1CJCA 3B53X 3GT0A 3Q9NA 4R9RA 1YRHA 3I8OA 3NXKA 4JBYA 3TPZA 3Q8LA 2Q3LA 4WCFA 1E7RA 5C3MA 2CLDX 2VN8A 5EQDA 5GOTA 3OETA 3WLSA 4DIFA 4DS3A 4ER0A 2GKGA 3Q7TA 1E6CA 2I2CA 1T2VA 4OOFA 4Q1FA 5CLIA 1SUBA 3NHMA 5C1BA 1ZVMA 2OFWA 2IE0A 2OP1A 3M1IA 1TUGA 4RZ2A 4DT1B 2FVYA 2QX6A 2QRQA 2XDQB 3H16A 4EMBA 4FWTA 5AVTA 1JQDA 3V00A 3MBKA 3WGYA 5DNUA 5DNWA 4GEGA 1FC0A 1X77A 4WD3A 5DNVA 3U3ZA 3W5UA 1ZP6A 3MGAA 4NOKA 4OHOA 2G25A 1ODJA 2CE7A 2AGVA 3ORHA 4KXWA 4Q03A 3LA6A 1PJSA 4EUSA 4NBKA 2GRAA 3ZE6A 1JHZA 1MOQA 1TO2E 4V2UA 4BEWA 1GKKA 1WDKA 1J25A 4YR7A 4BKOA 1IONA 2JA1A 4QTUB 4TYQA 1JI3A 3KCQA 3ICEA 3H42B 3H5OA 3RC9A 1IHYA 2MYNA 1E2QA 5EE3A 5BN1A 4IG9A 1OFUX 5BW6B 3BRCA 3IR7A 3JQ7B 4E12A 1XMXA 5CB4B 3A25A 4EQZA 1ZUHA 3JQBA 3BMNB 3RYCB 2J41A 3CVYA 1GO2A 4BLOA 4B2IA 1E9SA 3W06A 2P30A 1J2TA 3QV2A 3PZRA 3RUHA 2DWOA 3BHJA 3A1TA 3CE6A 4LZZA 5ALXA 2QPLA 1ZCAA 1M34E 4UTZA 2D5LA 4AJ2A 1GU0A 3K0CC 4YN3A 3KD2A 3DLPX 3HNOA 4PC3A 4KN9S 1M1NB 2DJIA 5I8ZA 5DGDA 2V6FA 4N12A 3TBFA 4WBNF 2A9RA 4INAA 4V0OA 3M3PA 1SXQA 3DHEA 1ZJWA 3COJA 1IC6A 4B7ZA 5HCNA 2OSVA 3VZQA 4M54A 3QKTA 2AN5A 3KL2A 4CMGA 4QKQA 1PR4A 1CUYA 4N7RA 2VIIA 1MLDA 4TMFA 4BHTA 2HU7A 4HX9A 1M5RA 3HA7A 1FRQA 4O4HA 3L02A 2VT6A 2YXBA 1JDPA 1L7EA 3ND7A 1T9AA 1HT3A 1LWNA 4LHWA 1J09A 4ZQIA 4C2BA 5LKAA 1TNDA 4PZ0A 2G4LA 1R3DA 5C31A 3EEOA 5D87A 1IJKA 1RTTA 3G89A 1IY0A 4EL0A 5DRYA 1JLLB 3EZLA 4TTIA 2OAGA 4UAUA 1Z2CA 1DP4A 2P6OA 5LA6F 3L4BC 4UHKA 4V24A 2Q0HA 2YVKA 1E0JA 1R9NA 1EGHA 3GUVA 1TGYA 1SRRA 2GNAA 2I80A 1CJUC 3PQCA 3LCMA 1TF2A 3ELBA 3ZDYB 3JW8A 4Y6SA 3RE1A 2BFFB 5HJ5A 3KXDA 1DO0A 5L4SA 4FQ5A 5FAXA 3L1KA 4NZYA 2Q3CA 1F4VA 2C29D 1DX4A 3IOYA 4L4RA 4LYYA 3E27A 4BQPA 4BYMA 1JHXA 3CT4A 3CLRD 2YY7A 3IELA 4IDHA 2RJ3A 2ZT5A 2QUJA 4XZ3A 3DOOA 4R16A 1E2BA 1MHTA 3TG8A 1KAOA 1U2PA 4K9OA 3SFTA 3R40A 4R5HA 4PM4A 5ICGA 5KNCD 5DLDA 4EG0A 3S70A 1KMIY 2HAEA 3ZI0A 4CMBA 4DSZA 2QRNA 1YMVA 1M72A 3TE6A 4KO2S 3V1MA 3TEJA 1OFGA 4DKJA 1ZD8A 5DTIA 2RAVA 3N05A 2D2XA 3PEEA 4HB3A 4M0MA 4PSDA 2WY2D 5LU8A 3HEBA 2ZXUA 4ZEMA 1YBFA 2XX3A 5TEWA 5KX5A 2MJLA 3RJ5A 4RIFA 2HA4A 4M1TA 4CKEB 5AM2A 2FUKA 1W73A 3D2LA 4M1EA 4P98A 4WA8A 5KOJA 4YROA 3TTVA 4JWTA 3FDZA 4FFLA 1GGJA 2Y1WA 4DWVA 3QVTA 3LG2A 4B4DA 2JLQA 4BTVA 4PYQA 2AE2A 4EGSA 4EUEA 1NBME 1XJCA 2F48A 2GF0A 3OQIB 1W9HA 3SBEA 5AVVA 1KC3A 3B1FA 1DKOA 4M0PA 1SULA 4G0PA 4UM9D 3LA8A 1K97A 1VMIA 1DKMA 3H7AA 1KAGA 4A2CA 1GJRA 4BN4A 4IZHA 3GCXA 5F5LA 5JPIA 1N1DA 5K8JB 3LAWA 1VKOA 2Y1DA 4QU8A 1Q1BA 4BO4A 3T15A 1P7WA 1Z8DA 1Y4ZA 3ICWA 4FCTA 1NUPA 4F1KA 4EMSA 2CGEA 4OHFA 3F5FA 4OK3A 2J1LA 3BKWA 5I8WA 2IYZA 4D3SA 4XQEA 4PANA 1AIPA 3OKAA 3B70A 1P0PA 2E4XA 1V8FA 4GX1A 3ROQA 2BSXA 4W63A 4P6VF 4PXSA 1E77A 1H05A 3LXRA 4HYQA 4DIKA 1SU6A 1YQEA 4B9AA 1RHRA 3IHWA 1SOMA 3DE4X 3HZOA 1AC5A 3HY6A 3I04A 1J8FA 1I2AA 1G5PA 1GPNA 1LVUA 3EYWA 3OTHA 4RK5A 3HC7A 1VPLA 1NQUA 2EERA 2PKEA 2R5FA 3E5MA 3F5MA 1I3MA 3LT1A 3TSCA 4DG9A 4EJMA 5EJ7A 1D8AA 3FFAA 1JHQA 2ZI3A 3RIYA 2RMKA 2WR8A 1J07A 1MJNA 3SYNA 3ND9A 1PCXA 2C9DA 2LV8A 2YTZA 5BWCA 3DL7A 3N2KB 2H9IA 5EE5B 3CUWA 3V3TA 2EFHB 2WK1A 5HQ3A 4HADA 2ET6A 2UUAB 1YZGA 3VDQA 1GDTA 1TDJA 3CSDA 2BGGA 1NQTA 1VPTA 3TNJA 3H5TA 2YMPA 1F38A 2H1IA 3EW9A 1LVHA 3ZE0B 4F84A 3U7HB 2FX5A 3A04A 1Z4PX 2H54A 1PZFA 2VFAA 2YJTD 1IEVA 3AERB 2D0DA 3QG1A 4FBLA 3M8KA 4RHCA 5E4YA 2AI1A 3KOWA 3LVFO 4ZODA 2BOVA 1F2TA 3ORRA 2RKWA 3DNPA 2P9HA 2CHVA 2PXXA 2ZE5A 3BYZA 3IT2A 2O57A 4ESOA 3UPUA 1OOEA 3L3BA 4F71A 1E2KA 5DM4A 1ISMA 3AI7A 4DMGA 2FR8C 2VT3A 3KJHA 4GI5A 3AHJA 1DAHA 2O2IA 2IPOA 1NYQA 3DEFA 4E03A 5BMOA 1F6WA 3DXXA 1GQ2A 5AO9A 2AI3A 3R0QA 1JH9A 5IT9A 1QYCA 1H3FA 3QE3A 5AHOA 1EWTA 4CN8A 4MYDA 2EQ5A 3K09A 5CVCA 3VU8A 1TT7A 3NATA 3BGWA 3MHPA 4GRDA 4NFSA 3L5OA 1E2PA 1KKMA 4PEVA 2C9OA 4F3CA 3ZDAA 1PEDA 2FG7C 4MB0A 4RFLA 1H0HA 3VPGA 1LLFA 5KKNB 5KVVA 4NXNB 1KYTA 3IHTA 1G41A 1Z29A 4JLKA 2PYDA 4MTCA 1CVLA 1MA3A 1WUYA 4L95C 2ZYRA 2H0RA 4BLQA 2ZVDA 1X7ZA 2ODWA 3FMFA 5AKJA 4RKFA 5K51A 3AF3A 3ZXYA 2HIMA 2YHSA 5EMNA 5B64A 1N6RA 1TTQB 1C8BA 2Y2VA 4L15A 4QICA 2V9CA 4LRSB 2P2LA 4AZ0B 3UCXA 7REQB 5EZSA 2A92A 3NH6A 3NHUA 3DYVA 1K5GA 4XM2A 3D6JA 1NUHA 1CUFA 4PSKA 3G17A 4B4UA 4BN0A 3PRHA 1ZD3A 3HB1A 1ZL2A 3OJCA 3OZXA 4UCQA 4AZTA 1YJBA 1SVIA 5AK5A 2EG9A 4GC9A 2B4KA 2VJYA 1SXJE 1QBGA 3IDAA 3IIJA 1HGXA 3O03A 5K6TA 4CQJA 4D9FA 5A02A 1RR6A 3FPGA 1GFIA 3N5KA 3NCTA 5LB2A 3F3MA 1BCRA 2WFMA 2ATIA 2ZE8A 3I6IA 2BJHA 4IFIA 2WI8A 2WAYA 3EBPA 4B6SA 5KEIA 4ZIRA 1JXQA 4XPZA 1P74A 3WLHA 4CUKA 2FMTA 2CMGA 3D4LA 3GO4A 1C14A 4JXKA 1W47A 3JRXA 3FHTA 1N8TA 3T9FA 4P38A 2BKAA 4KAJA 5I9BA 4DWWA 1ICIA 5JCOC 4ARCA 3WDKA 2NYRA 4V3BA 4BKPA 4XRRA 5LLDA 2IHTA 4ETWA 1SURA 2VJBA 1XTTA 3UYKA 2OMEA 3KXLA 3GLFB 1M9NA 1RLOA 2QRZA 2X58A 1VI6A 4G5YA 4URWR 4LMPA 1PJ4A 2OM2A 5CM2Z 4B6QA 4BBZA 1F9AA 4EB6A 2B21A 4AWXA 1IWPB 4BEVA 5HP4A 1E3WA 1FLAA 2C96A 3ENVA 4LDJA 1ZINA 3K1ZA 4QM7A 3OZCA 2JGMA 4X3PA 1BOOA 1YRYE 2JGNA 1IBSA 4G3XA 4V39A 2H8GA 2C77A 3F98A 3AR8A 4X1IA 5LC1A 3MMSA 5G2OA 3W1VA 1F8YA 1FK8A 1CQZA 2VLIA 4YDSA 2I6SA 1JSCA 1KS9A 2EC5A 3AUUA 3MJEA 3T41A 4AZSA 1G66A 1V39A 4HWGA 5G0VA 3RI3A 2ZUSA 4EO7A 2AV6A 1NXOA 3H7IA 3GRYA 2XTMA 2PAAA 1FNMA 4EG6A 2RHDA 2V0GA 4XGQA 3LZDA 1D6MA 4CF7A 4WY2A 3NIBA 4BQEA 5HZKA 1XPRA 3FLBA 1L1RA 2IIVA 2R47A 1R00A 2WYIA 3NI2A 4KPUA 3W0LB 5JVDB 1ZCFA 3TK1A 2YJZA 4C0XA 1Y1PA 1GRNA 3IDZA 4M0EA 3GK3A 4XLLA 3MWJA 3I5XA 4DIEA 1E6EA 1EFVA 2QMHA 4UZEA 5CB8A 1BA2A 3JWHA 1D2CA 1CHDA 1XALA 1MHPA 3AY0A 3BMOB 3MJVA 2AFIB 1FUUA 4KI0A 3U40A 3PG5A 2O7RA 3ZHCA 4ANFA 1J7KA 1T9KA 1KO8A 3FSGA 3HCPA 3IAEA 2JVIA 2HOQA 3JSXA 4G25A 3OECA 1PGNA 1H2XA 2E85A 3QQPA 4HEJA 5DNAA 2OXIA 3SQNA 5CFNA 6YASA 4S0XA 2FQ1A 3H4VA 4AMYA 5M04A 1WPXA 2AF3C 4NZMA 1FSSA 3ACDA 2QE6A 5BPHA 2ONYA 3EXAA 1RI5A 2CC2A 3R6TA 1J22A 2BFDA 1NXTA 2NTVA 4U5QA 3KG2A 1MT3A 5D5HA 2H17A 3TX2A 3ZUPA 2HIAA 4A03A 1TYCA 5KJFA 2X5OA 1DQSA 5H3HA 4F3YA 1QOZA 1GKIA 3ZIUA 4B4WA 1KAHA 2XTZA 3ELDA 3RK0A 2W42A 2HHAA 2OZLA 4EITA 1LTKA 3Q7EA 3JWPA 1PS0A 1F20A 2O4CA 4MVYA 4EG1A 2PSFA 1B23P 3K20A 5HOQA 3OEWA 1FJ2A 1TTHA 2XSZA 4IYRA 3JWJA 4LK3A 3SYKA 5F21A 3TVYA 5JR3A 5A0TA 4FCWA 2FPUA 4WINA 1PW5A 2P9FA 3B89A 2JFZA 2AR7A 1WZNA 1XN1A 3GLKA 3OWXA 3R3VA 3EEQA 1B3BA 1EZZA 1TU0A 4FDAA 3WAKA 3ZU3A 5C53B 2RONA 2HLDA 2HNAA 1BMQA 1WZIA 4V03A 1JLLA 2NZJA 3DWFA 3WLJA 3GRFA 1E64A 2PMBA 2Q2QA 5FBRB 2J0UA 1RJWA 1FP2A 2HQOA 4TKVA 4L8WB 4ARIA 1YTLA 3K6RA 1GV1A 3UV7A 5C4IA 3N70A 3AJEA 2EHDA 2YFKA 1XQXA 1Z36A 5FA5A 4A3SA 4J0JA 3FNGA 1UM9A 3QEKA 4Z2YA 2PD3A 3EK2A 2I5PO 3RJZA 2OR3A 2QLMA 4GKVA 4TYPA 4UEWA 2HH9A 4YRIA 1MJGA 2YCBA 4K6CA 4B71A 2HT1A 2LNDA 1DBVO 2R97A 1PSDA 1HDZA 1ZN2A 1LSSA 2FW9A 3DPSA 3L7LA 3GRCA 3NWBA 5FPPA 3SSAA 3UHOA 3WNBA 1DIBA 4YECA 3ZWCA 1USUA 5I7UA 1AGPA 4JWKA 1HYHA 5FPKA 2VJPA 2WG0A 1W1IA 1OIVA 1HYQA 3AL2A 3DB1A 4RH3A 4WLUA 4OMDA 5A71A 4FB4A 3ZBQA 5JECA 1RXWA 1R12A 2QLJA 3HFJA 5ECWA 4D4IA 1GQSA 5JZBA 2BY4A 3HA2A 3SIXA 1M6WA 5AVWA 3IMGA 1RJ9B 3RM3A 1V16A 1O6FA 1X1SA 1QYXA 2H52A 4LN1A 2EIHA 1JI0A 1HFWA 1KMHA 1ZN8A 3P71T 4NCBA 1WXFA 1GA4A 2TMKA 1XA4A 2RD2A 2V7PA 1U0BB 4YMWA 3DP7A 1QHEA 3UGTA 3G2PA 3QELA 1YUNA 2QM8A 4FHEA 3DGEC 4HJRA 2WZCA 2DUUA 5FUYA 1YQWA 3BXOA 3CPEA 3H87A 1X7DA 3CUSA 1L7BA 4R8LA 3AVYA 2O8VA 4RXUA 4UATA 4N5IX 3IVCA 4FDUA 4IEEA 5DBEX 5EMHA 5BN3A 3KQUA 4W8HA 2FW1A 2M6RA 5BURA 5IM4A 3OZUA 5JROA 5CM8B 2L2QA 5I7FA 3DXFA 3CH4B 3DDCA 3QEJA 2ODQA 1Z6GA 3A8TA 3FTFA 3TQTA 3EGIA 1WX1A 3NTVA 2XTAA 1KMNA 1EB9A 4GOLD 5ERGB 1GUDA 1O6GA 3TE7A 4IKOA 1LWOA 3VOSA 2ZANA 4BFCA 1WP9A 3K6JA 4EPWA 2NTEA 4PGGA 2DCMA 4EHDA 2X9GA 5ECGC 4MVJF 1KZYC 5EPEA 4FU0A 3HABA 1JUDA 4B34A 5IDVA 1E59A 2C03A 4E88A 1K89A 1KJJA 3GLHE 3PTAA 4RC9A 1T1SA 1OHHA 3DZDA 4G5QA 1AXRA 4IL5A 1Z34A 2C5SA 2O2EA 4HQFA 1YC2A 1WDMA 2DP4E 2FW0A 3PDHA 1ZDMA 5FOSA 1M1YE 2EKBA 3TJZA 2IYWA 2B20A 5CVVA 1RWKA 1KJ9A 3QQ5A 2QSJA 5B3JC 5HUHA 2VJDA 3TI9A 2SKCA 2X2FA 3CCBA 3ZV4A 2R25B 4MUKA 4TRMA 2I34A 2FXVA 3ONNA 4ZU6X 2GAOA 2R4UA 2SKEA 3ZOKA 4I50F 4Z49A 5T8KC 4LBWA 1E2HA 1RYEA 3CCFA 1WEHA 2YUTA 2GN0A 2UKDA 2VR1A 3AEQB 1X1BA 5KVAA 4AAYA 1GVNB 2O2YA 2D2EA 1PDWA 3PWKA 4LHVA 3T6KA 1CUJA 3TOXA 1TI7A 1SKYE 4AMGA 3EPPA 9LDBA 2R2AA 3AERA 4MS4B 4HFJA 4KE9A 3U5ZB 1GDHA 3F8SA 4C1NA 4KUGA 2R6FA 4XTCS 1UZLA 2BCGY 1AE1A 3BB1A 3B8EA 3H86A 1XRRA 2ZIGA 3PEFA 4NENA 1H66A 1LPPA 3V33A 4CT0A 1V4VA 1UBNA 1UQTA 3MYYA 4EYSA 1VBKA 3UMRA 2LWIA 3A2MA 4CMIA 2QJTA 3MMNA 1OTYA 2WHRA 3BC1A 3P0RA 2BEJA 2GZRA 2ZJZA 2F67A 3GRKA 2J6IA 3OA0A 1NJ2A 3QUTA 4A8JC 4EUFA 3K0KA 2XWQA 3EAQA 4UDNA 3NHBA 3K96A 1Y8RA 2D0PB 2R00A 4TKLA 2HYIC 1W96A 1JT2A 1W4BA 2I4NA 2VNKA 3QP9A 4FD3A 4KZPA 1SY7A 3NTQA 3HN7A 3OUTA 2ORVA 2HF2A 1HYBA 2JIZA 4K9NA 2DLCX 3ZS8A 3DP9A 4EW3A 2IZ7A 5AI6A 2YWEA 4K03A 1GOTA 2HCRA 1RZ3A 2GVZC 4A6XA 3ZE7A 2FY8A 2EBWA 3UAVA 2PXCA 4WN9A 1UEIA 3R20A 5GP1A 3AZQA 3NALA 4MINA 3SXPA 4C89A 2AA3A 5JEEA 4B3JA 4GKAA 3O0TA 4AUNA 3UM9A 4MDYA 2WZDA 2CXOA 3PYXA 3D1VA 4HDKA 4KSBA 3WI7A 4LS3A 3QNWA 4H77A 1JR6A 4E5SA 1J5EB 5GAJA 3HWSA 3U60B 3EGDB 1BMTA 1OH6A 3UWPA 4BV9A 1NASA 1XU7A 3LQKA 4TXNA 1X2BA 3DONA 4POOA 2DHQA 4H7PA 4HQRA 1UM8A 5HF9A 4DNQA 1M0SA 1FQWA 3DR3A 1DX6A 1ST2A 3KKMA 4BJ6A 3RUPA 4FS8A 2M1ZA 4W5NA 3MB5A 3D8RA 4XI9A 1L9KA 2OFFA 5JG7A 5DM60 3B85A 4L6CA 4PINA 3VZDA 5KQGA 4EKDA 4QTTB 3BOSA 4GMFA 2WA1A 2J4FA 5GGXA 1X8KA 3IQHX 5K4GA 4G5XA 4OJNA 1V48A 5I9NA 1LDBA 1P1CA 4EA6A 5THXA 3HZHA 1OX4A 1ESDA 4XIIA 2V6GA 5FNZA 3WJ7A 1M2OB 3UK7A 1QKKA 4N3CA 4E5DA 5JY1A 3ROTA 1FRFS 1GU1A 1P75A 2C2MA 4UNIA 4YUZA 4TQUS 5B30A 2PD4A 4L3WA 3X1XA 4UARA 3CY6A 4ZYZA 3H5NA 3P9QA 5BWBA 4HAXA 4J1JA 3WNCA 4MRMA 3WQSB 1GYQA 3QLVA 1WDTA 3JS5A 5C1IA 1F7UA 1JDJA 1CDZA 5CW1A 4DCNA 2IZ6A 1OWMA 4C4RA 5IC4A 3S81A 2ORED 1RFGE 3JAMA 1KK0A 1XEFA 3ENKA 3L43A 1ZHHA 4ZOLB 2EZ9A 3V5NA 1XZAA 2Y67A 5EKDA 2BFNA 3GCWA 5HTKA 2EFYA 1U7OA