4D3XA

The structure of mature legumain from chinese hamster.
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
261
structure length
259
Chain Sequence
GKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIIVMMYDDIANSEDNPTPGIVINRPNGTDVYAGVLKDYTGEDVTPENFLAVLRGDAEAVKGKGSGKVLRSGPQDHVFVYFTHGATGLLVFPNEDLHVKDLNKTIRYMYEHKMYQKMVFYIEAESGSMMNHLPNDINVYATTAANPHESSYACYYDEERNTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKSISTMKVMQFQGMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEGUMAIN
publication title A Detailed Look Into Chinese Hamster Legumain Active Site Structure and Exploration of its Function
rcsb
molecule tags Hydrolase
total genus 97
structure length 259
sequence length 261
ec nomenclature ec 3.4.22.34: Legumain.
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01650 Peptidase_C13 Peptidase C13 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d3xA00
4QU0A 3IBFA 2QL5A 4N6GA 2J32A 4QULA 3PD0A 5IAGA 4D3ZA 2J30A 4EJFA 2HBYA 2XZDA 1RWPA 3D6FA 4DCOA 1RHUA 2J31A 3R6GA 1QTNA 2DKOA 4JQZA 4N5DA 1I4EB 4NOKA 4QUEA 4QUDA 1K88A 1RWVA 4QU8A 4DCPA 2CNKA 3GJRA 3H11A 1KMCA 4JR2A 2QLBA 4JJEA 2C2OA 3EDQA 2FQQA 4N6OA 4FDLA 3V6LA 4I1PA 2H51A 3IBCA 1QX3A 1SHJA 4NOMA 4EHFA 4IYRA 4AWAA 2CNOA 4EHKA 3V4OA 2XYHA 3R7BA 5IARA 4DCJA 1RHMA 2H5IA 3R5KA 4AWBA 4PRZA 2J33A 4FEAA 1RWOA 2XYPA 1I3OA 3R6LA 3DEJA 1I4OA 4QUJA 5I9BA 4D3XA 5IC4A 2XZTA 3NR2A 3H11B 2Y0BA 4QTXA 1RWMA 4QUBA 1NW9B 2CNNA 2HBQA 3UOAB 5IAJA 4QTYA 3DEKA 1GQFA 3KJNA 3QNWA 4JB8A 4FXOA 5I9TA 4ZVPA 1RWNA 4N7MA 1NMQA 4QUIA 5LU8A 2H54A 5LU9A 2C1EA 2QLFA 3V3KA 4ZVTA 2CJYA 2HBRA 4ZVSA 4NBNA 4EHNA 3P45A 3D6HA 1RHRA 3DEHA 1K86A 1JXQA 2K7ZA 4JJ8A 5LUBA 4D3YA 5JFTA 5IANA 2C2MA 2H48A 1NMEA 4IEFB 5IAEA 2C2KA 1F1JA 2H5JA 1RWKA 2Y1LA 4N6NA 4NOJA 2AR9A 1RHJA 2FUNB 3H13A 3E4CA 1I51A 3ITNA 1IBCA 1RWXA 2CJXA 1SC4A 1F9EA 3PD1A 3GJTA 1NMSA 1PYOA 1SC1A 4QU5A 5H0IA 3S70A 4PS0A 3DEIA 4QUHA 1M72A 2WDPA 5IBCA 1PAUA 4QUGA 4EHHA 5IABA 3BIJA 3K7EA 3V6MA 4AW9A 2QL7A 3H0EA 1BMQA 2QLJA 3P4UA 4QU9A 2FP3A 3SIPA 4N7JA 3D6MA 1RHQA 3R5JA 4JR1A 4NBLA 3H1PA 3SIRA 1QDUA 5IASA 2NN3C 2P2CA 4PRYA 4NOLA 4JQYA 3V55A 4ZVUA 2H4YA 3R7NA 4LSZA 4QUAA 4M9RA 1CVRA 4JR0A 1SC3A 2C2ZA 1RE1A 3NS7A 3S8EA 4NBKA 3KJQA 5IAKA 1CP3A 4FGUA 5IBRA 3EDRA 1SHLA 4HQ0A 4JJ7A 3PCXA 3RJMA 5LUAA 3NKFA 1RHKA 5IBPA 1GFWA 2CNLA 3R7SA 2XYGA 3UO8B 2QL9A 4EHLA 4EHDA 4ZVOA 2CDRA 3OD5A 3KJFA 4EHAA 3GJQA 3GJSA 1ICEA 4PS1A 1RWWA 3V4LA 2HBZA 4HQRA 2H65A 4ZVQA 2H4WA 5IC6A 5K20A 4I1RA 4ZVRA 4HVAA
chains in the Genus database with same CATH superfamily
1Z2AA 1NFQA 2E1PA 3B3GA 4PSDA 1Z4PX 4IWYA 1Z0DA 4WUVA 2ZYVX 4W5NA 2FP4A 3O8LA 4NESA 1W0JA 1NUUA 4OYLA 3PYXA 1U2RA 4XVUA 1M1NA 1JBQA 1WO8A 3IAS1 4OFXA 2JD1A 1LI4A 4RKWA 1II8B 1R9NA 3WLAA 3E1SA 2YZ7A 5EMNA 2RHMA 3MQFA 3GA5A 4M1EA 1NLYA 5DYTA 3T1OA 1DOZA 1E1NA 1Y33E 1IBKB 1TYEB 3TQSA 1YV9A 4B3JA 4CI0B 3P96A 2DR0A 2FLKA 3O2JA 1DAHA 4M8SA 4TZTA 1UK7A 3ZXUB 5L6LB 2HWXA 3OSUA 3U61B 4OQFA 4Z7OB 4EJSA 3STYA 1ENYA 4RHYA 4E2ZA 5C18A 1GCAA 1SG9A 3FUUA 1YUBA 3KPWA 4NDZA 4X6YA 5LZ8A 1JPJA 2BI4A 4OQLA 3GJYA 5DGCA 4OI1A 4MQBA 4EY7A 5BUCA 4RTSA 3KYDB 2O2YA 4MDFA 4NNOA 1EJ0A 1TW2A 3EGEA 4OHXA 1XDDA 3EDMA 2C2YA 4DWWA 2Q5LA 4R9VA 3G6KA 1J33A 3RI3A 4JXZA 3Q5GA 1P0IA 4EKYA 3I8OA 3D3WB 4MV5A 2JDIA 4IO0A 4D79A 5GZ3A 3FPCA 1VBNA 3TCXB 4OFWA 2GXAA 2XCLA 1MD9A 2EIXA 4GYWA 5HF9A 1OHHA 4JJ8A 2FI1A 5ISMA 1QQ6A 1THMA 4X65B 5I9SA 5HRCA 1YFJA 3AEKB 1UFRA 4AZ0A 2RGGA 3FHLA 4UDYX 2AR9A 1OFHA 1U7OA 1TUEA 2H8KA 3UM9A 4K2HA 1XVIA 4AKTA 4RK7A 1X70A 2NLOA 4MWOA 3NT2A 5LOVA 1YZ3A 2H4XA 3GUYA 4BVHA 2QPOA 1ZA1A 4MVJD 1KPHA 1TX4B 4PLWA 3U48A 2JEZA 2YRFA 5KJ1A 4MWTA 3NHWA 1XMPA 3KFLA 4GKBA 3SHOA 1HZZC 2CXXA 2NXCA 2R6HA 3H5IA 5T3UA 1I4WA 1QFXA 3M34A 1TU0A 1GGVA 3BSWA 2OZLB 2J85A 3IEXA 3KXDA 2ZIXA 3A28A 4L9RA 4RF3A 3TO5A 3FYDA 2OYRA 4YY3B 1VIVA 5G41A 5A1TA 2LDXA 1WDMA 1A9PA 4Z8XA 4MCAA 3UW1A 4UXHA 5K6AC 1PP4A 5BSMA 1J9ZA 5JQGB 3MWFA 4JODA 4MS1B 4C4ZA 2LDBA 1ZO8A 5GADl 4OFZA 5LQUA 1LRKA 1ZUWA 3CSDA 3IIKA 3ESAA 4CPDA 5KYUA 4R8LA 5TR9A 2REQA 4BTLA 1GGJA 5AKGA 1SB9A 3E48A 3OJCA 4EI7A 4Z6KA 4RK1A 1NVFA 3L1IA 4B3IA 2V0NA 3A1EA 4CQLB 2A5FA 3DNMA 2G0TA 3B60A 1NBAA 5EE5B 1GWNA 5FWYB 2XWJI 1QIJA 5A3VA 3ILHA 4J49A 4ZK2A 1N5DA 1O08A 1VB3A 1ZWLA 3I01A 3TQHA 2OAP1 2CF5A 2NZUG 3ENNA 4N18A 4ILEA 4N5IX 4MRAA 5TPWB 2R8PA 4FGSA 1GL7A 1VE9A 4KXMA 1X1SA 1D4OA 3SFVA 1AQNA 1Y9EA 3W3AA 5AW0A 1X7YA 3GFVA 4DA8A 2YRWA 9ATCA 3FOCA 1U2PA 4GDMA 5JPCA 2Q1XA 3P32A 1QOZA 5DLEA 3UHJA 4P5EA 4YEDA 4IGEA 4QA9A 1TMGE 1TU3A 3M2PA 4FOTA 1T2UA 3FI9A 2OM2A 3HKDA 3IT2A 3HDVA 4WZBE 4RWEA 3TX6A 3ZU2A 2AZTA 3A32A 2YINC 4UBIA 3E18A 2FMFA 1RBQA 1PFWA 2FFRA 3I1YA 1DIRA 2VP6A 1XKQA 2YNMA 2FNAA 3EIXA 2I2WA 4IYRA 4ARUA 3KR2A 3FVWA 3CFYA 1KQPA 5IH3A 4OI0A 4DOMA 1QQ7A 3ASZA 3NWEA 4NP6A 4JYCA 1DEOA 1DO0A 1QBKC 3ZI0A 5JAMA 4JN6B 2CWDA 2FEOA 1UANA 2JKVA 3QBTA 4YV0A 1U8XX 3WIDA 3P0HA 4KAFA 4RMJA 3USCS 4KR6A 1UZMA 2DPGA 1Q7TA 1J00A 3HP4A 1RXYA 4OGGA 5FOXA 4J3FA 3RS9A 1E2NA 2XZOA 3L8ZA 4KGVA 5CM9C 3W2IA 4OG2A 1PNTA 1XRPA 4YCCA 3DKIA 5M5BA 3L46A 3OJXA 3ROZA 3L18A 3NIDB 4E7OA 2RK6A 4HOYA 1Z0ZA 3WRXC 4MQFB 1P3JA 2V7PA 1RAFA 3HRIA 4C1NA 3FROA 4JGIA 4QOSA 5BN4B 2L2QA 2ZSFA 3TTWA 3UGJA 1H93A 3TECE 3G9TA 2XRZA 3WGYA 2PMKA 1NSTA 1QRDA 1KBQA 1U99A 4QDTA 3VA7A 5ESXA 3BEDA 4BE4A 4V38A 1ISFA 2KBFA 2V6FA 1JG4A 1FOEB 4WKPA 2AGVA 3QEAZ 1DELA 1U0OC 5LOVF 4UMDA 1KJIA 3EFHA 4ED9A 4F6RB 1M5RA 4R6WA 5AVYA 2R1VB 3ETCA 4LISA 4WLFA 2GR9A 2X42A 2PY6A 2FPUA 2MSDB 3BKWA 3HJAA 1Y8ZA 1AHHA 3A6LA 2TMKA 4DPKA 3G5LA 5DNWA 3GCGA 4WFIA 3AZOA 3AONB 1SUBA 5K0CA 3MCZA 2G17A 3Q7QA 2YMQA 3RTAA 4BXOB 1KK3A 1ZGZA 4PNHA 2PKRA 2B34A 2Z1DA 1CDZA 3KKLA 4KO2S 1PDWA 3AHCA 4O0MA 1QDUA 1MA0A 3KKKA 1OW3B 3IR7A 3SQDA 4GRIA 3O4JA 4BUZA 1XA0A 1OV6A 4X20B 5DFAA 3OCCA 4NJMB 1P5RA 1FJHA 2XW6A 3AUJB 1N0IA 1Z5PA 4NK5A 3TSZA 3W4KA 3F9CA 4EVQA 4YCSA 4AQ7A 2VYVA 1KY4A 3FDXA 2LXNA 3DCIA 1X77A 4MZXA 4L1KA 3QEOA 1AB5A 1DJQA 4FYYA 4XDZA 3GG9A 4XWTA 2IXBA 1XPRA 3DKRA 2J3MA 3GNSA 3SZMA 3U81A 4ACAA 2AUTA 3WKCA 1XFDA 3VPCA 3VZRA 5KHLB 2ZE6A 3FTDA 3SBEA 1Y3AA 1XCGB 2BBOA 3OURA 1EUCA 3ISTA 3L07A 4DXDA 4L8VA 3HCWA 3NTVA 4BRUA 2J0QA 3OHSX 3S5JA 1TUBA 1JHVA 1WL8A 1ODKA 3KJFA 4NC9A 2WICA 1V5EA 5F2EA 2GPJA 3C4QA 1KTVA 2CLOB 1FP4B 5IKXA 4HVAA 2EJTA 1EFLA 1HFKA 4URUR 1QM5A 5FBVB 2GN2A 3LP5A 2HBYA 3GG2A 2FX2A 3KU4A 3P26A 4YV1A 5LJLA 1XPUA 3NBKA 2JBAA 1Z0SA 4F1WA 3UT6A 5B4UA 3TR0A 2ZUSA 1ULHA 1CE8A 3MT8A 3K09A 5FV4A 1V4VA 3RC7A 3CLHA 5DT2A 1F2VA 3WLFA 1QHFA 1LH0A 3E03A 5LYJA 2FQ1A 1X42A 3TE6A 4OIMA 5TT0A 4BBAA 1PVVA 2FCAA 2O3TA 4E09A 1GZVA 2JFOA 3QJ5A 2P4QA 5FTMA 2AKEA 2EKQA 1YIOA 2GD0A 3GRZA 3H2IA 3KB1A 3QUAA 4TS9A 1OV4A 4LWZA 3S2EA 3BHMA 1N1DA 4GX0A 4N0MA 4ZCMA 4RDXA 4MRPA 7GPBA 1ZSVA 4I9GA 4L9SA 1Z5ZA 1E8MA 4ZOQI 1N5MA 1U8UA 3L79A 3QQPA 3K96A 2EKBA 2ZCVA 1DC7A 1YA4A 3HN2A 3QFSA 4N0PA 4ONEA 1WP4A 1NMXA 3GHHA 1Q0HA 3AHIA 5H1YA 1EJBA 3CLSD 2A9JA 4YRPA 1GL6A 1XQ6A 2BZ0A 4K9SA 3I6IA 3T9BA 3VDMA 1QQ5A 4CM7A 2M6KA 2NVWA 1HFJA 4DRYA 1FXUA 5AICA 1HTWA 2Z30A 2GCOB 1Y34E 3BHIA 1E2BA 5I9LA 4M88A 3A6JA 3S40A 4BNTA 3N5KA 5GWXA 3I5XA 4RD2A 1HF3A 4BCCA 3FMVA 4BX2A 1Z39A 4X7PA 1AKNA 3ESRA 1A7KA 2DY0A 4LC9A 2A1TS 3ZZNA 1OXSC 1WF6A 4LKRA 3WLTA 4I3HA 2P62A 2VP3A 1ULAA 2XNSA 5CTJA 3ZH2A 4ZT3A 4YRGA 3LY7A 4E11A 1F1JA 1R4NB 2G28A 1UMBA 2W6IA 3CN9A 1OUMA 3HDJA 4GM0A 4CTKA 2CFSA 2CJWA 3EWNA 4QECA 5ECYA 3D2AA 1LRJA 1T3GA 3HVKA 4LZNA 4TLDA 4QKQA 2JI4A 2PFKA 5JD3A 3HO1A 4D25A 3TK1A 4LVCA 2ZIWB 1UXJA 5LD2C 5EE1A 2H08A 2L69A 2D1RA 3FNGA 4V0SA 1M72A 4YLEA 3T9DA 2PJZA 1AQ6A 4I9NA 3TCKA 1Q12A 3ESCA 1VLHA 1I4LD 4QQNA 1XNQB 6REQA 2ZRNA 3M1YA 1RPJA 2P3QA 2PX5A 3OG9A 4YJGA 2F3UA 3SSNA 3ZEAA 2ACKA 3S7ZA 2HJVA 3F2IA 1HTBA 1EE2A 5JS1A 4G81A 2JA2A 5DXFA 1KP2A 4CMEC 1Z4QA 3TZHA 1KMIY 3FSGA 1V95A 2BGIA 2G0AA 2IYFA 4KU4A 3I34X 4WDRA 4NQRA 5HF6A 4JLMA 5HZHA 4AY6A 5JFOA 1M67A 2P9JA 3WISA 1UPAA 1OASA 1AGNA 3G9QA 4HQLA 4PPFA 3SQNA 2QPTA 4ZTUB 2Q0HA 3DEFA 3FF4A 1XU4A 2ENWA 4X6UA 3AHDA 4JLPA 5GV8A 5KTYA 4TMKA 3QSGA 2V7BA 3HJFA 4NK4A 4HJXA 2VP4A 3OZVA 4B6GA 4KVFA 1Y37A 3AP3A 3T9CA 3H9UA 4S3MA 3VR5H 2XE6A 4CGZA 3DNFA 1LVUA 1GZ3A 4XCVA 4B81A 3D81A 5IVKA 1DBQA 2ON6A 3BMCA 4GWKA 2WB2A 2O2HA 2PRIA 3DMHA 1HT3A 4J07A 4J1QA 2A0YA 5U1PA 3RAEC 2QYTA 3BKXA 4X85A 4QPNA 3ZU4A 4KIJA 4KOEC 3U7IA 4ND1A 1IQPA 5E95A 4ZARA 4CM4A 5CJPA 3VZBA 2X40A 3B89A 3CEJA 1EUYA 1DAPA 1W96A 1VE3A 1RKVA 2PMDA 2ZKIA 2CLDX 2J30A 1J70A 3N2KB 5J4LA 3TD2A 2ZT7A 1YFZA 4IH1A 5KC8A 2QTAA 1JVNA 4DCPA 4LX8A 1EFTA 3RSOA 2C9MA 5KKAA 3L8DA 4JJEA 5LYJF 1YQTA 1FRZA 2X4LA 4Q18A 4Y1EA 4F1JA 4EUNA 4GICA 4YR7A 3I9OA 3RG8A 5JTUA 2H1FA 2OHHA 1XUOA 5C8YA 3ETDA 4C89A 5JEDA 1ZM2A 4DNPA 1RBZA 1NW3A 1KAOA 3ER6A 5EVCA 3RHZA 4B4OA 2O8EA 4Y7CA 3R5KA 2JI8A 2O4CA 1E2LA 2VNKA 2NOAA 2JATA 2WSSA 3EULA 1SUEA 8GPBA 5MN4A 3ND5A 4IXMA 2GTHA 4EF5A 3LBHA 1U7WA 3JQGB 1QE3A 2Y6UA 5C81A 4Q4AA 1W0CA 4TZ6A 3IUEA 3F8TA 3I6ZA 4RGBA 4JB8A 3KKOA 2IU0A 2YIVX 3TRKA 2BSQA 4R6XA 3D4LA 4Y2GA 2O0JA 5IYZB 1H6CA 4AF8A 3FW1A 4L0QA 4YJKA 2PQ0A 3C6BA 4K5QA 1I1HA 2Q99A 3KL2A 2BFEB 4Y6OA 1U2DA 3A4IA 4O3MA 1ETUA 3JQRA 1U0LA 4L3OA 3HWRA 4LC1A 1K86A 1YOVB 3IUJA 2X9VA 2ZG6A 4AUNA 4D3YA 5JH7A 1JKXA 5DOZA 2O54A 2WJIA 2QR5A 3IEIA 5KOHA 3R0VA 2FUG6 5AW8A 5KX5A 4PICA 3GLFA 1T5LA 4OHVA 4YMIA 5A7HA 3ZHSA 4OXIA 2GM3A 1Z7YA 2V7QD 1NJGA 1PGOA 2UVDA 3CV3A 5A3JA 2F90A 5JT1A 1KKMA 1Z29A 2ODPA 5KYYA 3IQEA 1X7DA 2I9KA 3OF3A 1VSUA 3ZJ4A 2ACEA 4LFBB 2D2FA 4KK3A 1ORIA 1RYFA 3DTVD 3BCHA 3OQBA 3V6MA 1FFAA 3O94A 4JL5A 1Q1EA 2PS1A 3BRWD 3NP9A 4GGMX 4ISCA 4M6WA 2FEXA 3OLXA 2ADFA 4DMUB 2WKSA 3F97A 3OCZA 3T8YA 5K3FA 2PS9A 2V97A 5FPYA 1T9HA 3B9QA 4DRZA 2FEAA 2P9EA 4HN9A 1M34B 1OXMA 3O8DA 3DM9B 3C2QA 1DX9A 3THSA 4WZAB 1JHMA 4KLRA 4R1QA 5A3SA 5GZ6A 1K9SA 1OYOA 1X2BA 4X24A 5FTLA 1J2TA 1Q1QA 3COSA 2ZIAA 4C04A 4HRVA 5KSZA 1Z75A 4IEEA 4CKEB 1L7OA 1LGYA 1U6KA 5K0ZA 3M6MD 3TBFA 1HDCA 3OLZA 4B44A 2UUCB 2YW9A 1OLSB 1UBCA 2ZJ4A 3DSRA 2P77A 1S0UA 3H6KA 3RB8A 4GKJB 2EHJA 5EP3A 2Z56A 1XMQB 2Z98A 1A88A 2HSWA 1TRHA 1AHNA 4ES6A 2XJ9A 1CP2A 1F8YA 3E3NA 1N34B 1ECCA 1R4MB 3K8ZA 4YJFB 2IGTA 4E21A 1XTKA 1TYCA 2F8MA 3OT4A 4HAIA 4BFCA 5LDDC 1EXMA 2JHPA 2XKBA 5EINA 5JNTA 1OH5A 1AGRA 3GBPA 4YQYA 1N25A 5LYYA 1RCUA 2WU0A 1NVVR 2DQKA 4GPD1 1WE2A 3OT1B 1ORHA 3F73A 1RYDA 3S99A 3SG0A 1N5OX 2ZCJA 4J1SA 3S4YA 3UUWA 3W2FA 5LQAA 2FR8A 1NVUQ 4V1CA 5C8YF 1DIHA 1TJ3A 4I0WB 4M98A 5DBGA 1DIGA 4ZQIA 4KUGA 2DULA 1JSCA 3HL4A 4PLGA 1QH0A 1UZAA 3SC6A 4C3UA 2FPPB 2KMLA 3WLNA 1C81A 4J0HA 4EB8A 3MNFA 1BX0A 3DOIA 3TEJA 3I04A 3KT8A 3VDXA 3ZGYA 4Q9JA 4H7FA 4C2UA 4NCXA 1KBOA 2WOOA 2W00A 1KRHA 4AMBA 2HCJB 2IXEA 4JLOA 1P5FA 3KJNA 4PLZA 4TMWA 3IMCA 4B6JA 5LFAA 4HSGA 2HU2A 3N75A 4FHCA 4L8GA 1LA2A 2O1WA 5KOIA 1GEEA 4DG5A 3E61A 1QP8A 1V5GA 4X90A 1J99A 3CU5A 1CJKC 2FWNA 4MHSA 5BSUA 4KMMA 3X0DA 3ZD6A 1RRFA 1OLUA 3OIVA 5CFRA 4HEA1 1EU1A 1JEDA 1MTZA 2XXAA 5JI3E 3WK9A 2QN6A 1P19A 2Y67A 1RWQA 1JS1X 5KX5F 1CIPA 1TOAA 1UM9B 2Q4OA 4X3PA 2OFPA 2YVQA 1ZRHA 4HH0A 3A1FA 4YT5A 3QFCA 2C95A 2BEKA 3DLCA 3ROQA 3BRSA 2VDPB 2IYSA 2WJGA 2NSJA 3JD4A 1L5FA 4HJRA 4IDEA 2WTXA 3PD1A 4DIEA 2PUAA 2RCYA 4LV5B 3WRYC 4HXEB 3KOOA 4KG7A 4FHEA 2JAOA 4OP2A 1MKYA 5JG7A 1WX1A 4RE6A 3L02A 2Q5FA 3I1FA 4CLXA 1ORRA 1I7SB 3WLIA 3HBJA 3PXAA 2C77A 1CZUA 3SPXA 1U4OA 1J5PA 1CY4A 3I45A 3NANA 3OWOA 5DH9A 2I7VA 1OA1A 1TKBA 2VHTA 2ZYTX 3HSYA 4JQCA 3SU8A 3Q3JB 3ZJTA 2X13A 4OA8A 5TPZD 2C03A 4BE9A 1KR2A 5C35A 1HDXA 2XNCA 3EXG1 2HK9A 3DYIA 5EGNA 4Z2AA 1PSDA 1KFJB 4CR7A 4UU8A 1KHHA 1A5ZA 3WBBA 4N8SA 4BFWA 4CE6A 4JR0A 4RLQA 3TOVA 2DB3A 4LTMA 3WNQA 2NSHA 3WSVA 4UCXA 3CJQA 3P7MA 1Z35A 2EC5A 2H63A 1GUAA 3LT5A 4JH0A 3OQIB 5THQA 3EIUA 3ROTA 3Q2KA 3WICA 3MSXA 5JC1A 3VX4A 3IVAA 3QLVA 1BQEA 5LQNA 3TXAA 4Z8YA 4P54A 2C7QA 2H1HA 3RQIA 3UYKA 3V48A 3FMIA 3NEYA 2E82A 3A3YA 3HVIA 3V4LA 1AA9A 1HG0A 3DXYA 2CYAA 5FEUA 3DG9A 1X74A 3O0DA 1XQWA 5D8DA 4LQ4A 5FBZA 4P33A 1LC3A 1OT3A 2GJ4A 3L04A 1JU3A 1S2LA 5AHXA 4P4NA 2GBPA 1V96A 1PL8A 3HB1A 2J32A 3HJCA 1ZP6A 2O48X 3KDPA 3AX6A 2AOWA 4EJFA 3RWOA 3D6FA 2WDZA 4HDMA 4ZANA 2MSLA 3F67A 1AVTA 3OUUA 4G86A 3HBAA 5EWMA 3D2BA 4OUKX 4ZVKA 3QPVA 4COOA 5HUHA 1MEJA 1XDZA 3D6UA 5E9QA 3TG2A 1DMRA 1SHUX 1W36B 3HR7A 2R7LA 3ORSA 4I4LA 1ORWA 2H51A 3AHGA 4IAOA 5LLDA 1JDTA 1XMVA 2XUOA 3LHSA 3B6ZA 2VDMB 3W4IA 1PR5A 4NYJR 3KAJA 4MYHA 4EZIA 4R71A 2ZKLA 5IT4A 2DSNA 4QPJC 3DHWC 4EA6A 5DNCA 1RJ9A 4HNHA 2ETVA 1F6WA 4JEMA 2CUNA 1ZQ1A 1E2MA 2GAFA 4LBYA 4QYWA 3TM4A 2XUGA 5HK8A 1UJ2A 4MNTA 3ZX5A 1USKA 1UBSB 4DEYA 4E15A 1A98A 2II6A 4G6ZA 2Q1WA 3IUYA 1XTIA 1DLIA 2F62A 3UK0A 2YXBA 3L7BA 4JOSA 3ZWVA 3ORQA 5B3JA 2JLUA 1Y5NA 5FO1A 3WGIA 1E4EA 3F7TA 3WRVA 1XD8A 1RE0A 2CCJA 2GLTA 3PXGA 3T41A 3D3NA 1A0OA 3LK7A 3R7WB 5I3ZA 4LK3A 3DP9A 1XZCA 2ZI4A 2VDUE 4WE3A 3JQBA 3LBAA 5TGDA 4EFKA 3BB3A 1GTRA 1HKUA 2VKQA 2CXHA 3KQVA 4HFNA 3O8CA 1GQSA 4HDCA 3GRAA 5CLJA 5IANA 3UUGA 4IH9A 3KOWA 3WDKA 3AVWA 2EV9A 1FNBA 1RWKA 3MFYA 3SC2B 2JCGA 1QIKA 3H5WA 1YT5A 5FEMA 3GEBA 4QXOA 3REQB 4CM8A 5MN5A 1HZJA 5TLSA 2GZ1A 4EM6A 3TQFA 1ZY2A 2ODTX 2YHSA 5I5GA 4EW2A 2D6FA 3OHMA 2G09A 3RSGA 2BDTA 2H1SA 3L0IB 1HL7A 1BVUA 2FUKA 5HQ3B 3MF4A 1R88A 1GPYA 3FFTA 1C3OB 3ICPA 2WEKA 4C2TA 4JL8A 1FJGB 1HURA 2CXNA 5JXWA 2RHTA 2JGIA 2GX6A 2XKKA 4F85A 5JS8A 3UTCA 1X7ZB 3O1JC 1VHQA 4HDKA 2CDBA 1QH1B 1NVVQ 2VHZA 2OCBA 1WSAA 2N47A 1GL3A 3DOJA 1DLJA 2HIHA 3E7DA 1JQJC 2FW7A 4J3NA 1XJQA 3UN1A 4OLAA 4P3NA 4B82A 4PFSA 1YQDA 1X0VA 3DL7A 4MROA 4OKNA 4ZGWA 4EB6B 1TUGA 3RAFC 1NPDA 2SKDA 1DADA 1Z4NA 4GZ6A 4RHEA 3NBQA 2GXSA 2HSDA 5FFFA 2PEZA 4YCAA 3GRKA 2GCEA 5DBIA 4ZT7A 3ZD8A 1RP7A 1SVOA 2O23A 3FCSB 3MUNA 1W19A 2HLDA 2C54A 1FPQA 2PL1A 3LIPA 3BC1A 4WLNA 5AKXA 3DUFA 3V7FA 3OD5A 3OU6A 1IVNA 4JJZA 3UWDA 3QTBA 2B2CA 3ZV7A 2DFDA 2MTBA 4X8OA 1UBLS 4ARVA 4WZ6A 1DI0A 1GCGA 2Z6VA 3NKVA 1GAWA 3H5NA 2PZKA 3PRYA 4AKGA 3DC2A 3D6VA 4Y1FA 4S1NA 2MMCA 5TQ2A 2YX1A 5LZ7A 3T1HB 1ZESA 3QG1A 4A10A 2VPQA 1Z17A 2ZAGA 1Z6AA 2A9KA 5ILGA 3CKYA 3E3MA 4QLOA 4MI3A 2TRSB 5JPIA 4ZYVA 5EIAA 1ZNWA 1S1CA 4AQDA 5B55A 2C5HA 4N47A 1X8KA 4EUSA 3O2QB 2IYAA 2DFKB 3DE0X 3WAKA 2QLLA 5J1SB 1R0BA 3E3OA 4K40A 1CULC 5EJ5A 2AG6A 5AKYA 1W0JD 1XJ0A 4K81B 1M1YE 5HTOA 5A5DA 4XZ3A 5HDBB 3RRYA 4F5DA 4JC8A 1SWVA 2ET6A 5HJ5A 2BZ1A 3WGLA 4E14A 1P8JA 3RU9A 3EVGA 3HTXA 3DEYX 2A57A 1OBCA 1MT0A 4BP3A 4MAMA 3FTNA 3HY3A 3K9CA 5E6SB 2OCDA 2HDWA 2YXDA 3NASA 3OZFA 4UBLA 3EX7C 3ENZA 4BB5A 3HUDA 1PQ4A 1WNTA 4KR7A 1ST2A 4BTVA 1RLJA 4ZQHA 3V34A 4OVKA 3QU5A 1C7FA 3LY5A 1AS2A 5CX1B 3HL0A 1EXDA 4PZ0A 2NWQA 4FNMA 1MCZA 4MUXA 2O8DA 1XCJA 2Q7DA 3DBOB 4ZQCB 2X5OA 3AHJA 5DGIA 5K01A 2B9EA 1NV8A 4PLCA 2QA5A 4CHTA 1C9JA 3ZPXA 4N41A 4NYMQ 2HQBA 2QE7A 3R40A 4MWEA 3MWGA 4ON9A 3FXAA 2GAIA 1U2EA 5DLPA 5GQSA 2JDID 4HWOA 3C70A 2J41A 4FNGA 5CU7A 3HO8A 1P17A 1RZVA 4XDYA 1Q0PA 5EP4A 1OHHD 3ROPA 1SNYA 1ULSA 2CYCA 2VA9A 3CKKA 4IIBA 5LU9A 3EZLA 4Y6SA 4N48A 1F8UA 3N2GA 5D2CA 3M3DA 4TKMA 4R31A 2VQFB 3ZWXA 2CW5A 5FX2A 2AWOA 4JVMA 2OHXA 2UZ4A 5ALIA 2G0NA 4EMTA 3OPMA 2QL7A 1XYYA 2O14A 3G2OA 1TZCA 4N3AA 2QK4A 1A5TA 2GK4A 4PCVA 2O5CA 3SJUA 3S1SA 2PL3A 5CJJA 1V16B 3AY7A 1TADA 2QZJA 3H1AA 3JAWA 2PX4A 5HFJA 4RQBA 2PUFA 4G24A 2DTEA 5FUMA 5EZYA 2X86A 1PTJC 3KBOA 1C7RA 5EFZA 4QNRA 1G8KA 1PWXA 2HDNB 3BA1A 3K8OE 1JXAA 4XJSA 3FPGA 2I67A 4RZQA 4D7AA 1C30B 1FJ2A 1W73A 5TS2A 3LY9A 2EVWX 4E2XA 3KJQA 4KYVA 1TJ4A 4HNRA 1NXWA 4RABA 1C1XB 3S44A 2OM6A 1KJWA 2JIBA 1DKLA 1K63A 2PWAA 3OPYB 4NYJQ 4D4JA 1M6VB 5FH9A 2HJSA 5LMZA 2AOTB 3LZDA 4KXQA 1J24A 3ZCTA 4BIMA 1NRIA 5JSZB 3SSMA 3O84A 2XA9A 3GT3A 3KZMA 1RAAA 3RVRA 4E3ZA 2HJRA 3L49A 2A35A 2AC7A 2H65A 2O3QA 4QT4A 2BGKA 3V4OA 1SZCA 1LSJA 1R6DA 2FZGA 1GOTA 2GS9A 1C7QA 2EWWA 2FY8A 5D6OA 5AW6A 3AU8A 3RYHA 2QN8A 1L5VA 5FA5A 5K3BA 1NVDA 1ZXXA 2AW3A 3NX4A 5DEIA 5KNCA 2GJ9A 4CLRA 1OVGA 4MJ3A 1M2NA 1Y98A 2DBZA 3KOYA 5E3JA 3HM9A 5I3CA 4NS1A 2ENUA 2SCUA 5DWVA 2PZAA 1WZUA 4MYSA 5EQTA 3VMFA 5GJBA 3W3AD 2XEXA 2EERA 3IOEA 4FYXA 4RXUA 4EUHA 2V9ZA 3BQNB 4TRNA 2KE5A 4JUCA 1WVMA 4CT4B 2BZSA 1RI2A 5C8ZA 1B6RA 5AM5A 5DP1A 5FOVA 2Q6VA 1EUDA 1NHGA 1AZLA 2REBA 4ZALA 5JNWA 1L1FA 2ZRHA 4E1VA 1PJTA 1S7CA 2FWAA 4IRXA 2ZM5A 3GZTB 2R6ZA 4K9NA 4Q4DA 3GJ6A 1ZOLA 4K26A 1G20B 2D4HA 2HJWA 3TIGA 2Q5JA 4Y2RA 2EF0A 3AJEA 1EIWA 3W2EA 2YNMD 1M74A 2NGRA 3WRWA 4CEJA 3KJGA 4RVUA 1SH7A 3TBKA 3LHDA 1YULA 3CCBA 1U7UA 1EWKA 3L1UA 1OB2A 1VJGA 4CV2A 2W2KA 1I13A 2WBLC 2C58A 1YVEI 5J2TF 3R5HA 1G8AA 1JQLB 4CTNA 5HGJA 4JB2A 3N28A 2IUUA 1A3CA 3E5HA 3U19A 2X4IA 4JI0B 4BRSA 3ZC3A 3FWZA 3Q40A 2H31A 2PXAA 1QBGA 4RL4A 2QW1A 4AU1A 4R2MA 1F8GA 4BMPB 3KYCB 4U4AA 1LLDA 1GITA 1YZVA 2PAAA 1Z8NA 1DFIA 2HA3A 5HDQA 4G0UA 4LWQA 1NY6A 1OI4A 3U31A 1Y8CA 2JLZA 3Q15C 2AOUA 3GDHA 2WVGA 2IV3A 5JHGB 4PX3A 4YP6A 3THYA 1DEXA 2YFHA 4NULA 2FRDA 3ESYA 4EK9A 1IVYA 1IY0A 2Z2ZA 4R1SA 4ZD6A 2IZ7A 4D9MA 2FPWA 1NMSA 1OZGA 1YKGA 1OXUA 2FZ5A 3N5CA 2WU3A 1MB2A 1FLDA 3GGSA 2QTTA 4KH0A 4NPHA 4XFJA 4C05A 2ZB4A 6YASA 2J7KA 2WSMA 2P0EA 4GVLA 1N32B 4IHAA 2F7SA 2NZXA 3A2LA 2RI0A 3OPVA 5IJ9A 1IRXA 2I80A 3KNZA 3SMQA 5KSOA 5GM1A 3N3BC 5LP6A 4E51A 1QQAA 1XEWX 1W29A 2Q27A 5EZYF 3QU4A 5FBKA 2QD4A 3MJVA 3D3JA 4NICA 1R10A 5JXJA 5KPJA 2JZOA 5D00A 3EDOA 4M3NA 1D0VA 4MV0A 4XFDA 3EEBA 4ND2A 1ATIA 3DONA 4X84A 3CZCA 2GN9A 1JEQB 2DFTA 1SKAA 4PTLA 2EZUA 2ZT5A 4HB0A 1FZQA 1SKMA 3C16C 4IQ8A 5JUWA 4LOJA 5J4KA 4PCAA 2NADA 4JKOA 4GOLD 2GEVA 2ZYAA 4RY0A 2AWNA 3N6XA 5HIIA 4KR9A 2OXIA 2VYVD 4EARA 4EOGA 4W7SA 1TAGA 4QBFA 3JSXA 1DWQA 1XVAA 3NOXA 1Z63A 2R2GA 3JVIA 4WZBB 4E12A 1ECFA 1UXOA 1SQSA 1T2EA 5EMHA 1IFXA 5H5JA 4D8WA 5KUTA 4YACA 3AF2A 4KFTA 3HVJA 2IPOA 2O19A 1F0KA 3FG9A 1K27A 4L2IA 1I3CA 3CR3C 3DKVA 5BSEA 4Y9RA 4D6XA 3LBFA 3OZDA 4UEOA 1K68A 2P30A 4UU1A 5EJ7A 1ZC4A 3Q8MA 3V8BA 3IUMA 4YT4A 1C9KA 1H94A 2XUDA 2Q07A 1BIFA 3L7YA 1KKLA 4RTLA 3LLSA 2D5LA 1E9CA 3K0HA 2J9FB 2VP2A 3NBXX 1HNNA 3W6OA 1K75A 4DEVA 1X8JA 3NJ4A 4M9QA 1XRLA 4FFNA 3VYSB 4F06A 2A92A 5T8KC 4US2R 3U3KA 2HB6A 3BREA 1MJFA 3ANSA 3AY0A 3OQ6A 4BFUA 2G40A 3OOEA 2O9JA 4LI3X 3GUUA 4EF6A 2ZW9A 1U3CA 1LQTA 2RAFA 2LTAA 3GCDA 1V1MA 4DV7B 2B8TA 2J3EA 3CX7A 3NFYA 1Y8RB 4PPQA 3UOWA 1ZM3A 4B6PA 2A58A 1F2DA 3LC7O 3SOPA 3BD7A 1YKFA 3I42A 2GLXA 4M1YA 5I7OA 4KJXA 3ILSA 2VDNB 4BZXA 1PL7A 2A0KA 1GGNA 2OQIA 1KO8A 1SFRA 1NZJA 2BFCA 1IK4A 3MCTA 1NVBA 3ZNOA 3L43A 4AULA 3QLJA 3KQNA 4TWAA 3AHEA 5A4JA 2CV1A 3VNVA 4MB0A 3KXLA 4YFVA 2E4WA 3O75A 2P8SA 3B9BA 3O8QA 3PJEA 1D3AA 3PV0A 3ETLA 3FYUA 3N0XA 1Z6YA 4I46A 2W8BA 3W6UA 1UC8A 1WCWA 3AF5A 2PKCA 4NVRA 1SCJA 1EM8A 1VYVA 3OMWA 4N6NA 4RD1A 3EQ7A 3GMIA 4JJ6A 4M8IA 4W1QA 2M6RA 4MMYB 1GCUA 1XXHA 4XVRA 4F84A 3AV0B 3DTTA 3EVZA 4LCEA 4YRBA 2VJNA 2DUWA 2NSLA 4XE5A 2EFGA 3G8CA 3IMGA 4KX3A 1E3MA 3QKSB 1C4WA 4MDEA 2P3OA 5DHUA 5KJ6A 1I10A 1NZDA 3IDSA 4Q7MB 2W6ID 1PGNA 1KERA 5EJFA 5C5DA 4BZQA 1Y1QA 3NCTA 5CDSA 5AVQA 4BNGA 1G3MA 1W48A 4OXXA 4Q1AA 3Q88A 2FSVA 16PKA 1J8DA 4NE9A 3ON5A 4FJ1A 4R54A 5FA8A 3U7QA 3P4UA 4KBFA 5LP6F 3IKTA 1YTUA 3UWPA 3R8FA 2IYRA 3IKJA 1NBME 3H6GA 4M0CA 4Z0PA 3HFJA 1JLRA 2WVAA 2YUIA 2FZLA 4ZAXA 3SX2A 1THGA 1TZBA 4KNVA 2OFXA 2B4QA 3OZIA 2V9CA 4O02B 1AHPA 4L75A 5BT8A 3DVAA 5HIAA 2PWPA 5AOBA 4E32A 3NDIA 4HEJA 4RKQA 4HZIA 4CIWA 1IONA 1EG2A 3HMQA 3FSGD 3I9MA 4O4IB 3IP5A 2P6UA 1QNFA 3G59A 1NJFA 4I1VA 2DHQA 1J2JA 2HH9A 2G1UA 2HWYA 4RTKA 4HZUB 1GFWA 1D7AA 2WT8A 1XZDA 5E0OA 4DV4B 1ENPA 3BE5A 1XEWY 4W63A 4XGNA 4HHEA 4Q9AA 4W9NC 5IXJA 4NXNB 3WIOA 4KXLA 2PNJA 2QDKA 1KARA 2R79A 1DG1G 1XNRB 4J0CA 3N74A 1EHCA 3HDYA 2NT4A 2R97A 4EW1A 2HRCA 3ROKA 3BGVA 3UWKA 4CKYA 3JQ8A 4Q3BA 1UDAA 5KCMA 2B1RA 2BFDB 4D81A 3INNA 3KPYA 3DO6A 2P79A 4L50A 5FAXA 1YQEA 3LCVB 3VKHA 4BLRA 2ZSAA 4ENQA 1M2VB 4X93A 1K5DA 1CY8A 3WDMA 5DPMA 1SB8A 3GDGA 2C7GA 3Q2IA 3QX9A 2YQZA 2O1XA 1LBSA 3W5VA 3WC4A 4G5OA 3GN1A 3O47A 4FHGA 1TIPA 3AETB 3OC6A 2PGNA 3OZRA 3M4XA 4YMHA 5IMBA 2EYUA 2HLHA 1NC1A 3DMTA 1M9NA 3NHMA 3L41A 4GBED 3SZOA 1ZZGA 2PZ8A 4TSRA 1KSGA 4QQRA 1L9XA 4BBJA 1QIEA 1IN7A 4TTAA 4ZZIA 3T4XA 1LPAB 3ND9A 3ICQB 1NBEA 1A7AA 2VDOB 4YVFA 5CCBA 4BNLA 1SVIA 4OJMX 5F5XA 4JELA 2GT1A 2B8WA 4D0SA 1P1KA 1M5UA 3ANMA 2HV9A 4FTWA 2Y68A 4HAZA 3WFZA 3UH0A 4BVGA 2WSSD 1YAHA 1XCPA 5AIAA 1E60A 5HYVA 3SLKA 2J7PA 1U0JA 2VPTA 3INYA 2WUDA 4R51A 1EJ2A 4OOFA 1U7ZA 3QPAA 2HN9A 1EB9A 2PL9A 3G0OA 4PC6A 5GP1A 2GPYA 2YOGA 3P9RA 1D6MA 2Y1DA 4LVOA 3DT6A 1FRFS 2ZATA 3ZV3A 1GZ6A 4U9IS 2XSZA 4FQ5A 1KK2A 2G04A 2JS7A 3GGGA 4O2RA 5EE0A 3RODA 3TAUA 2LD4A 3CJRA 2CL6X 3GPIA 2GQ0A 3K0FA 4AKSA 3P2YA 5F35A 5I8WA 3JAKB 2I7TA 4JY7A 4DF3A 2K7FA 3E22B 1C8KA 3ACBA 2AUNA 2UYHA 2XZLA 2BSAA 2A88A 2J3IA 3KUKA 3JV7A 3VSEA 3DEIA 1WWKA 4DMKA 3VR0A 1T8WA 1WABA 3T94A 4X8MA 5A6VA 2YN4A 2BIFA 2Y92A 5BSRA 4LJRA 4JHXA 3D3EA 4URHA 3L3BA 3HXOA 4DIKA 4U1RA 3H0EA 3M4JA 2IJGX 2Z5LA 1CJMA 4GFDA 4YC7A 2HGZA 3C1UA 3NBUA 1MG0A 4YO7A 2PX0A 4MW7A 4BX3A 5B6JA 4ZQGA 2JLVA 3UBTA 5F4BA 2BL4A 4XYLA 2BTEA 2ZXEA 5IN5A 3K15A 1I0LA 1OYWA 2PZGA 1P3DA 2ZEJA 3PQ7A 4Q4CA 1JWLA 2WHXA 1BVHA 3THXA 1W47A 1Y1TA 3GAMA 3ZK8A 1E5DA 4E6PA 2O57A 3IIJA 1NWHA 3E9EA 3BFXA 5B37A 1XGKA 1OMOA 2V5UA 3FGZA 1XHEA 4ZQBA 4DLWA 2QN9A 3NIFB 3JYPA 4H27A 1U1DA 4E94A 2ISSD 2SKCA 4K6MA 4DSTA 1Q3KA 4JEIA 3WK6A 3FDJA 2OGZA 2RJ3A 1EFPB 3OE7A 4MUIA 1H0RA 4TKVB 1NXTA 1UBFA 3TZEA 4I3FA 1IXYA 1W46A 1BFDA 1TZ2A 1VI2A 3HCFA 4KB5A 4MRMA 5FORA 3RNOA 1JXMA 2B25A 1PX2A 4O2AB 5A9RA 3HK2A 1Y4SA 2A7XA 4ZVQA 4GMKA 1XMSA 2WLTA 1K7SN 2YIMA 2ZYIA 2O6LA 3C5VA 4I1RA 4KPUB 4KV7A 1A9RA 4PVCA 5DN6A 1EUQA 3AH8A 1RJGA 3A3NA 2DH6A 2OKGA 3ADPA 4K88A 3RKRA 5CB4B 5ICCA 1JAZA 1TF7A 2A67A 2RI1A 2E4VA 1K0UA 3LP6A 4FILA 2BRUC 3MRXA 4G8CA 4MINA 4RZIA 4ZAFA 3T54A 3JW8A 1CJSA 1E1CA 3U5TA 1OPXA 5EEGA 2GZ3A 2HSGA 3TZLA 3KSZO 3ZZ1A 5KOYA 4Z2YA 1WEKA 4XPZA 3UH1A 2IX9A 1WETA 1S6YA 2ZWAA 4QPZA 4NMWA 4P3PA 1KQ3A 2RH5A 2I3DA 1I01A 4YMVA 5GTDA 2CV2A 4KR3A 4R1LA 3DZCA 5ALPA 5DYIA 5IF9A 2V55B 1CUJA 1P0FA 1GKIA 1B23P 1C2TA 5JAPA 2XF2A 1V7QA 2XBUA 4YBRA 2NACA 5KPDA 3EUEA 3NVMB 4TRMA 3L5KA 1RAEA 2N42A 4MUBA 4ZOEA 5B36A 1CR4A 1I2BA 1SHKA 1T3TA 2A2ZA 2VHXA 3GELA 2XGJA 1PEKE 1GQFA 2FOLA 2YOFA 4MRRA 4Z99A 5AJYA 2NVUB 1O96B 1QVAA 1XAHA 4TWZA 3ZZUA 4B6QA 1HH4A 4RH1A 4TTPA 5JCXA 1DRJA 5AK0A 2PG3A 1F2UA 1T1EA 1DB3A 3I3OA 3UJ6A 4FLFA 4BKUA 3IL2A 5KOJA 4GMHA 1GPH1 3CY6A 4KAJA 2OORA 4NECA 4EVSA 1Z08A 2MCFA 1Y4UA 3PEEA 7MDHA 2Y05A 1RKUA 4LXYA 5EJIA 3TSAA 1NDHA 4YGXB 4X61A 3GVCA 4BNHA 1R0YA 4G1CA 1M75A 3R5XA 1CNMA 3EY9A 3FMOB 1R6TA 4UU7A 5FB3A 4F2GA 4Q21A 1OAKA 4TTTS 2Z1MA 3WLSA 3VDRA 2Q9AA 1I51A 1UZLA 2G82A 4H59A 3ZDBA 4I5IA 4DHWA 4IIVA 1E2KA 4ZIRB 5B2ZA 4U2EA 1VHDA 2WJWA 4KVZA 3WQBA 5F4ZA 2ZAIA 2BY4A 2WF9A 3UICA 4BNKA 1EYZA 2WWIA 3U40A 4KREA 3KZXA 4GX2A 1DDIA 4YQZA 1B8VA 5IK2A 1K66A 1SU8A 2AEFA 2DUMA 2FPRA 3GJ5A 2X5KO 2CBGA 2ZAOA 4J4TA 4P2GA 4WK0B 3GLGA 3JVUA 4KSYA 1O7JA 1PZNA 3S2GA 4YAGA 1IC6A 2Q5IA 1SUWA 5D3QA 3LTNC 1DC6A 2ZTLA 4D9CA 4HGPA 3SEQA 2WG1A 3TW0A 1PG5A 1NOJA 1PRYA 2O2CA 1ZR2A 1RFGE 1PJ4A 3NBZC 4QNMA 3CX4A 3EK2A 5A9SA 1RC0A 4MIYA 5BNZA 2V45A 5AHKA 2F1KA 1HBJA 2GF2A 2IU4A 1V45E 3EXFB 4II2A 4GP9A 2WRZA 2WHEA 4DLBA 1IWBB 3GGOA 2L18A 1TPZA 1EB8A 1GTSA 1Z83A 4ZU6X 5L53A 1ISGA 3RSFA 3NS7A 2G4VA 2I4TA 2FZVA 2OXFA 1Q1AA 4R4JA 1C50A 4JL6A 3SEAA 1ABBA 3Q12A 1QG4A 1UDBA 1GA1A 1QV7A 1YDFA 2DTDA 2HX1A 5COBA 4ZKEA 3OX1A 4RZXA 4NWIA 3UKOA 3FOZA 1C3EA 4CDMA 1UC9A 2OLKA 2BVNA 1NVAA 1II8A 4O8CA 2JB9A 1GG5A 1SD5A 4EH1A 1SOAA 1NSYA 4M49A 4XIFA 4ARIA 1YBAA 3P9NA 4EENA 2ZBUA 3LUAA 2VDLB 3AR9A 4WTOA 4HDOB 4FT2A 1R8JA 2ZROA 5L3SB 1SWWA 2G7MC 3PTZA 4UDNA 3LZCA 5KQMA 3AR6A 4JOBA 4MUAA 5E9WA 4XQCA 2AW5A 2AXPA 3C4VA 3ECAA 3CUSA 3FWHA 3AFOA 3H8VA 3TJZA 4EGQA 5JJLA 1NLZA 3QY9A 4ADSG 1WXDA 3OM1A 4BLVA 3I28A 4O4HF 1CUCA 5E1BA 2G8NA 4DR4B 1AF4A 3URKA 4GYJA 1OH7A 1SBIA 4J9VA 4L5IA 5AFSA 3V8NA 3PNOA 3FGOA 1FK8A 4BGUA 2VS1A 3HP7A 3D3WA 5AVXA 3LSYA 2DH5A 2SICE 5HS4A 2PZBA 4PLFA 4OGWA 2ZJYA 2H29A 1EI9A 3Q9LA 4UOQA 4FUQA 3T7EA 4B4DA 5B57C 3SWWA 1HL3A 2TSYB 2JI9A 1Z36A 1PNQA 2H9AA 1KAEA 2R00A 3L8YA 4HAVA 2QG4A 5ICMA 2DF8A 4F3TA 2QLNA 2ZRFA 4CEIB 1ODCA 2XMPA 3CUKA 4IIXA 1AMOA 3KYBA 1VIAA 5J43A 5DK6A 2ETXA 4JK3A 5GGXA 3RDPA 1P9WA 4TLLB 1T8TA 1S2DA 2HSZA 1X8LA 1B00A 2P9CA 1YJ5A 3IT0A 2AYZA 3MELA 4RJJA 3ZD7A 1TM3E 2ZS9A 1I24A 3SJAA 1Z25A 2AE2A 3C8MA 4BATA 4CCYB 3R6WA 3SHWA 3K4HA 3X1DA 3QVTA 1QR6A 3RFVA 3DEHA 3H18A 4EAAA 3RVQA 3GRFA 3RS7A 1PZEA 3F7OA 1PR6A 4YXWD 1JLLA 3NC1C 4XVCA 2GSDA 2HUPA 3C3CA 2FR0A 3QPBA 4LS3A 4JLUA 5BR4A 2VHEA 3RW9A 5KNLA 1UBTS 1ZCJA 4KH1A 1MRZA 1RHJA 4Y6GB 4MHTA 3ZLVA 5K0BA 1FLNA 1RQ2A 2GDZA 3EZ6A 3LGSA 3TLYA 3MWDA 4LYEA 4QOEA 5JEEA 4ARCA 1LU9A 1N9ZA 2QL6A 3HI6A 4W1RA 4QHTA 4MZDA 2D8MA 3AL3A 3LDFA 4HQFA 2A33A 2XA1A 3BERA 4P5DA 5CB0A 2EKDA 4NCKA 4KAAA 3S81A 4UM5A 1YZGA 3QVWA 5EIEA 4UHEA 1KEWA 4HWTA 3QBEA 4L8FA 1QAOA 4Q1VA 4UE3S 2XHZA 3L93A 3A1NA 4HT3B 5LM3A 1VPLA 4BE7B 1KSJA 2B20A 3GFGA 4GPAA 4ANFA 1IZ7A 3VJLA 4WFJA 1JEOA 5ICEA 2ZJ1A 4JR1A 3MERA 1Q0SA 4RK6A 4Y0NA 5FV7A 3O0TA 1FX0B 4AECA 1MAUA 1U0HC 3SBOA 3UKDA 5KVAA 3ADDA 4D57A 5EUBA 2QT9A 2YMPA 3FLEA 3R9KA 3OJWA 1LS1A 3VPXA 2ZULA 1L9KA 4EZBA 2AEEA 4U2CA 5A9TA 1PFKA 5KYWB 3I73A 2QUKA 5CGZA 3B1WA 1Z68A 4M4SA 3DZKA 2DFLA 4Z86A 4ENVA 2J9YB 4LJYA 2EZ9A 3N05A 1EVEA 4PV7A 4ECEA 2YJZA 1JIKA 3FJOA 1GPWB 2JCVA 3PGJA 3DLPX 3HXKA 1V3QE 1JSLA 4L4ZA 3U3XA 2ZZKA 5AP9A 4DG8A 1RRVA 2YW2A 2XODA 3IUPA 1J8YF 2OEPA 2Z3WA 2ACWA 2O2SA 2I1WA 3S1AA 4EKGA 3D8BA 3PQ6A 4Y3UA 3FFWA 5LDGA 3L6UA 4C08A 1RBYA 3GLIB 3HEAA 2H4WA 3L8HA 2R6GA 4ZI3A 1WR8A 1PL6A 2RKOA 3L9WA 1I2MA 1Z4IA 2ZU0C 4RKEA 3L5OA 3CLSC 1M7GA 3DYBA 4U5QA 4HFRA 1ODIA 2HLDD 3R3ZA 2UV8A 2ZB8A 2UUAB 3IPAA 3SEFA 1X92A 3WJ7A 4XVHA 3WNVA 1SKQA 4CKCB 1JEAA 1L5HB 1I4EB 2V5AA 1YZHA 4OHFA 1VCMA 1OA0A 4MYUA 1GFIA 2CNBA 3O93A 1C0EA 5F3DA 5IDQA 2VNAA 4RKRA 1FTNA 1QGUB 3BFKA 2IIBA 4NAHA 4QDZA 1N2BA 4KK4A 2Q5HA 2FRVA 1W4RA 4RKYA 1QLWA 2WD7B 3HGQA 3QTLA 5A6SB 5CAEB 5CDFE 1BHQ1 2D5CA 3EAQA 3HKEA 2PLNA 3FDZB 4IM7A 4OP3A 4FWTA 4IEIA 2I71A 5ALQA 4ARBA 1ND6A 3SF0A 4CZ2A 5BYJA 1EP9A 5BNTA 1MZPA 3OBBA 4UULA 3QU2A 4FZJA 1A9XB 2PQ2A 4Q4JB 1UBHS 4KN9S 1VIYA 4OD0A 2JARA 3S8MA 4BLPA 1CZNA 1OC4A 3ZGOA 4Y7DA 2HPHA 4JI5B 3AVVA 2GBCA 4C4OA 2I54A 4O08A 2JASA 2R1VA 3IAM6 1KMHB 1C1HA 2B5OA 2E48A 3MMSA 1LDGA 4WLVA 5KS2A 1LRLA 4XD7A 2XLCA 3CNLA 3IR5A 4M0KA 4ZC1A 3SQMA 5I7SA 4XM1A 4EABA 2P11A 3QOXA 5IW8A 4B6FA 4U00A 2PJRA 2HHLA 3FCUB 2C2MA 4NEQA 5J5AA 4BXOA 3EIHA 2XMCA 4ZPJA 2WI8A 1E98A 3P20A 5ENZA 5JYDA 4F4HA 3DD1A 3SEZA 3A1VA 1K3UB 5LZ5A 5CT6A 4PYLA 4XUEA 5IT9A 2Q62A 2J8ZA 4UHKA 4UUAA 4LXIA 2PU7A 3WA7A 1P1HA 4NJMA 4YI3A 2QUZA 3GLFE 1VLZA 1XN4A 2GUWA 4EL0A 5DYYA 4JSRA 3OLQA 3E5MA 2AYXA 3WQHA 10MHA 3A6DA 2QE7D 1PAUA 1Z6PA 2I22A 2RC5A 5CMLA 3LFHA 5CX4A 1C4OA 2N46A 1MV5A 3DLIA 1EBBA 3OZXA 3PFBA 4P92A 3OIDA 4LXHA 4Q93A 3I9V1 2VCEA 3WKDA 5G1OA 4E5SA 3SIPA 1X7GA 2W93A 3RFFA 1JHOA 1KO7A 1XQVA 1LPBB 4UVEA 4A8JB 5HS6A 3UXYA 3EPPA 3ETEA 5FCDA 1THTA 2GEDA 3PICA 2QAIA 3IUNA 3PBKA 3DE1X 4IINA 3VU3A 2QX4A 2I6FA 3KHUA 4XQGA 3R3WA 5I9NA 1SPBS 2QI9F 4QBTA 3LX4A 5JADA 2VK2A 4JYZA 2AHRA 5F52A 1YHYA 2Q4EA 3D1JA 2Q6TA 1JQKA 3GUVA 4XAQA 1JDVA 4A73A 3U09A 2J48A 2Q2QA 1H0SA 3G2KA 1Z6XA 4BLUA 2AFIE 3AIKA 2D4AA 3COWA 3DV0B 3QI7A 5JHHB 4OQDA 5KTNA 1T1GA 4KGDA 1N4AA 3GA7A 4NATA 2GZMA 3GQBB 3VI4B 3VNQA 2OQVA 2F67A 1JDJA 2KS6A 2YJTD 3INRA 3FY4A 3RJTA 2G1JA 4W6ZA 3WNDA 4PBTA 1ISPA 4KC0A 1V6CA 4ZYLA 4BDSA 2YZ2A 3O4VA 3DFFA 4D97A 4DV6B 4YA6A 3L4BA 3B1KA 3PP8A 3NAZA 1G8JA 2GB4A 2X0RA 4TL9A 2FFBA 1OTXA 3GD7A 3AM5A 1M1YB 4F8YA 3PGA1 3V4SA 1TVKA 5EZ6B 1GN8A 1ZWKA 4B2LA 1NN3A 4X0EA 3RFXA 4REMA 1UOQA 4AROA 1GGFA 4C4TA 2YHUA 5LZ9A 3BXFA 4CXMA 1L3CA 1LPNA 4HX2A 2LBPA 1VOTA 5ALEA 3JD2A 1AQYA 5JDCC 4UTPA 3C8ZA 5KNCD 2DPXA 2GCOA 3RRXA 3PNPA 4R3UC 4G26A 3QOWA 4A6XA 4LBZA 2HV8A 2NV2B 5AI0A 4UATA 4KEAA 3JWEA 1WBDA 1D2NA 4ZHSA 1L7QA 1JYEA 2ZCUA 1HLGA 1C0KA 2HK7A 2QOEA 3NR2A 4OMUA 1YHNA 3KTOA 3X1JA 3DBRA 1F6DA 4KWEA 1NW9B 2FEMA 4L8LA 2J87A 2DPHA 1HRKA 1OX5A 2QJRA 1RC8A 1TF5A 5B7GA 1NPTO 1RAHA 3OX3A 3SS7X 3HGTA 2BBWA 2FF7A 2ADMA 3AHFA 1QH9A 4DYVA 1KEEB 4HXYA 2O7VA 4N76A 4WH0A 1R5JA 1TCUA 2O06A 4J16C 4JC5A 1R74A 1HYHA 4RA6A 4PAWA 1OBFO 4ZQEA 3WWOA 4BP9A 2VPZA 1IY1A 2B21A 2XWQA 3VU8A 5C7OO 3UMJA 1U8FO 1ZYUA 2Q9CA 1BW9B 1EQ2A 2Y1LA 3MJRA 1JZTA 3ZXYA 2YTZA 3RUPA 1YQGA 4OCZA 1G0OA 2JIMA 3FB1A 2PTHA 4TMXA 4G9EA 4X1IA 4WERA 1KQGA 1M6WA 5FADA 3ZCSA 3KT3A 3CPEA 5L40A 2DBQA 1NZFA 4FMDF 4KR2A 3HXMA 5B3KA 3VU9A 4E0BA 1U1EA 3R5SA 4DGSA 1FIUA 3GL9A 5GJVC 3GROA 5A7FA 2H85A 3U4GA 4WXMA 1V8FA 3DQZA 3F6SA 1TIKA 2EBUA 2HREA 3AERB 2VP5A 4HDSA 3H42B 1REQA 4DILA 4F45A 3AXTA 1WDWB 2WMNB 3ABQB 1JE1A 3M5WA 4PO8A 2NUPB 2QM7A 1AGYA 3ELUA 4UNRA 4PGAA 1GQYA 4AMZA 1BJKA 1T9KA 3F6BX 2H1RA 2QRMA 1C3XA 3MBKA 5A4IS 4LBVA 2QZZA 4LSZA 3RSQA 3PEFA 3WVNA 3JALB 4IDFA 4XLTA 5IPFA 1I1NA 1KETA 2I9PA 4XASA 1ZMXA 2IPAB 2AQIA 3HJGA 1SELA 2DFPA 4DY4A 2IY7A 3ETJA 1IZ0A 1N6NA 1CWUA 1E6LA 3KVVA 3L2OB 2GEUA 5FWXB 5IEJA 5KTRA 4JJ4A 1YB5A 4X45A 5E4JA 3PQ4A 3HHEA 1HM5A 4PHTA 2NVOA 2X1LA 3OY2A 1DRWA 1Y81A 2AMYA 4EHLA 2VWGA 4XWYA 4M76B 3HB4X 3ZJUA 1P91A 2BM8A 2ZR9A 1WLYA 4GR5A 3SMVA 4Z7JA 3IO5A 3U7RA 4K9QA 3GRYA 5CLHA 3OFNA 3V1MA 4NV0A 3SE0A 1KC3A 4ZYYA 1A76A 4NARA 1UH5A 1CBUA 4PZ9A 2G25A 2GZRA 5D7NA 4EGCB 1HNZB 3L7LA 1G9XA 1E5TA 5KNBH 3JYLA 4R5MA 2W2LA 4QJ4A 4LXTA 3I1JA 3R6GA 4LYJA 2OC9A 2AG5A 2YJ6A 3WYGA 2VEDA 5DM1A 4UEWA 5A03A 3USES 1BDHA 4WOCA 2IFTA 4KXWA 2GBLA 4IZHA 2CXQA 1GPMA 2X5NA 3LOPA 2F1JA 3NBMA 2QPLA 2V03A 2H8GA 1Q7GA 3G0DA 2L17A 1P2BA 1R5NA 4U7JA 5IYZA 2H00A 3E8MA 1FFHA 1EVYA 3KHKA 1TZJA 5LPNA 2W0SA 2IHBA 1X1EA 2YIDA 3JVVA 3DPUA 4TL6A 5BR7A 4FZ3A 3VKUA 1C7ZA 2PCJA 4HDNB 4JKIA 2ZI7A 3KQYA 1U98A 2XXJA 4RD0A 1LPOA 1XMJA 3V1YA 3VOSA 4G5RA 4BAUA 2GPTA 2HLPA 3KFXA 2CLSA 4KR0A 4E4RA 1BS1A 3Q9UA 2FK7A 3OEHA 5SYNA 3A6FA 2ZUEA 5FOSA 2EKZA 2YV5A 2YFQA 4U7DA 1PWHA 3UEOA 4CF5A 2JJ2A 3K72B 2WJHA 1ZK3A 4I08A 5AHOA 4PU0A 1M7HA 3MCUA 1IZYA 1U9CA 2ZK7A 3O83A 3WGJA 2KX7A 4L27A 4A9AA 4MLPA 4QLAA 2Z2JA 2WFLA 3BZUA 3GLKA 4PSAA 1TVCA 3L8FA 3MINB 3UK7A 4MJLA 6AT1A 3P4XA 4CEHA 1JF8A 1KNXA 2OV6A 4ZYZA 5DZSA 3C6YA 1JWAB 2QAGB 2WJ3A 2I8CA 1K5HA 2ZITA 3OQMA 1AUVA 5EHQA 2VHUA 1JU9A 1RI4A 1VCIA 2AD1A 5EXEA 5KVQA 2UVPB 3GUCA 4CG0A 1LTQA 3BE6A 3KOMA 2WM8A 1OBHA 1RM3A 3W1EA 4F4DA 4GT1A 4Y2YA 4LNUB 3T5MA 5IZCA 3EVBA 3UAYA 1S8OA 1XYGA 1SKUA 5DCLA 4CL8A 4J7UA 2PGIA 5HKLA 3ZWBA 4HUTA 1H23A 2XYQA 3D8SA 3WGGA 1QVZA 2PV0A 4I5EA 4BQSA 4M0UA 4QUGA 2PX8A 2BH2A 4FWIB 1MO6A 3U6KA 3LXMA 5HBRA 1MPXA 1W581 2J9GA 3HRKA 3OU2A 3PI7A 5H3CA 1HMYA 4B7ZA 4HLUA 1FFBA 4GQBA 4JLKA 2FEKA 3EISA 3PC6A 3LWDA 4DMFA 1HNWB 1RMTA 3K9NA 421PA 4D4GA 4CKEA 2GO1A 2JNWA 4OQZA 4P82A 5HW0A 3SJ7A 2WC1A 3G5MA 3HVHA 3V55A 1SKYE 1OLSA 1HO3A 2EP7A 3QFFA 2J08A 4KLCA 4QRIA 5KJEA 5CYGA 5FOWA 4B76A 4FGLA 1NBWB 1FNMA 3W6NA 1XZBA 2PUHA 2JGDA 2VJMA 3D4NA 4ID9A 2OA0A 4BU0A 4YJFA 1GR0A 3EXIB 1KZ4A 1KXJA 1U7PA 1BHO1 2D2EA 5BSKA 2P9TA 1G98A 1U8AA 4EPYA 2OHIA 3OT1A 1YHZA 1YR1A 3H3JA 4IPTA 4KXYA 4DDHA 1EQUA 1NM5A 4AY5A 1E2IA 4L4UA 4TTRA 3P5SA 4TV9A 2PD6A 4D9IA 4EFDA 3FFAA 2XV1A 4XWAA 1I6KA 4IS2A 5JNUA 4WW0A 1VKHA 1I7DA 1ZRSA 1BCRA 4DXAA 5HSGA 1E3LA 5BY2A 2MR6A 3LMKA 4IJKA 1FUYB 4JB3A 2B30A 4UBKA 2FPPA 3A1CA 3KEQA 4PC7A 2YS7A 4QULA 4BPBA 1EFVB 1WQ3A 4FJ0A 2CVOA 1PF7E 2G6TA 1C7JA 1Y82A 3CW8X 3BCUA 1X38A 4P4UA 2AG1A 1DGQA 1DAFA 1R6AA 2KPOA 1NQTA 2Q5EA 3OQ1A 2UZAA 4BNMA 1BXGB 2C3OA 2P35A 4HATA 4NABA 1OBVA 3RARA 4ZJYA 1GLNA 4DLVA 2WWFA 1NBIA 5CT9A 1UDRA 1X86B 2X5JO 2ZYGA 2HKIA 5IYZF 4R9RA 2I4LA 4RS4A 4Q3LA 1ZD8A 3VPDA 2VTVA 1KY2A 1SGWA 3HHPA 1ZOPA 2D2XA 6Q21A 5SICE 4DSZA 5JS7A 5B3AA 1JIIA 4WDQA 5K3AA 2VPWA 3G23A 3STHA 5FUVA 5KWEA 2BKAA 3E0XA 4PLTA 5K0TA 4DB2A 3IFSA 4RQAA 2JFNA 3FTPA 2FFJA 4C20A 4D9GA 1KDRA 2X1HA 3IR6A 5D5PA 3SC3A 1C80A 1MW9X 2JHAA 1GLVA 4IUBS 2XMSA 1Y9DA 4C88A 3FAZA 4YRSA 3KUXA 3WJ2A 4NDNE 1O97D 1QONA 4J1NA 1SBTA 2P4EA 4L9WA 3ZCPA 4CMJA 2NAFA 3EXEB 2C99A 3DF9A 4CUJA 5KTPA 1JR3A 4MGIR 1FQOA 1GPLA 1TVMA 3FTQA 2HPAA 2YVKA 1BE1A 4BFZA 2JZNA 2XNJA 3NRJA 2PSEA 1BDMA 4AWXA 2BEWB 1QV9A 4U6QA 5HKKA 4NU8X 2XCOA 4ZEVA 4WK6A 4PWYA 3R7FA 3G2LA 4KWIA 4MW2A 4C6TA 1MJGA 1NVEA 1FSGA 1SU4A 1ES9A 2W2TA 1JDBB 2WABA 3F4KA 1TLTA 3QWHA 4J7CA 4OSPA 3FF1A 1G2PA 4WACA 4GAEA 1S1MA 1GUFA 1ADGA 3T06B 1W5FA 3DTNA 1WBBA 1ZX1A 5F64A 1GN9A 1YSCA 4Z3KA 2QTMA 1Z0IA 1YIAA 3QLUC 1QO9A 3HJBA 4GECA 5LQSA 2ZRGA 2J7PD 3F6CA 1NQWA 3OFKA 4Z7NB 1KAQA 1RJDA 1J25A 2BKEA 2O7RA 3G9XA 4K46A 1BHSA 2CHEA 2JJQA 2I65A 2IHUA 3K0KA 1T3LA 4J4HA 4V1CI 3CVVA 3UMCA 4RM2A 2C83A 4ZO4A 3T52A 2VKTA 3NV9A 2XSZD 2K2WA 2NT3A 5DW3A 3ETGA 1VQ1A 2IVFA 1QGAA 2QP4A 2H7VA 3UAWA 1T34A 5FQNA 2DWCA 3UT5B 4RO0A 4QJBA 2C07A 1AC5A 3CVWA 1LDMA 2IHYA 3RRFA 3BD8A 1FMLA 1Z34A 3VM6A 1WBJB 4A82A 4BYMA 3UA4A 3FCOA 5IASA 3HCBA 5FP0A 3F8WA 1DXHA 1UBEA 4UAVA 2VF5X 4UJ3A 4H6XA 5TIIA 1ENOA 3TZBA 5E7JA 1HOXA 2PWZA 2WE8A 3S29A 2FX3A 2XNKA 3K2QA 1PSWA 1P0MA 1FUKA 1PLJA 2R0QC 1JTEA 3IB3A 1HMPA 4L74A 4BQNA 3BGIA 4ZOLA 1Y3HA 1QCYA 3VAYA 4K9PA 4UUMA 3RVSA 2RD2A 1AS0A 4FFPA 4F2HA 1AMNA 3T3DA 3QGMA 1ONBA 1E59A 1CZLA 3OCXA 1A8PA 5T4HA 3NG1A 4Q6BA 4OHMA 3GXOA 3KVOA 4HYQA 3FN4A 4PW0A 4ERNA 1OWMA 5E6RB 3A9SA 3BTVA 4RD4A 1DPGA 5CFQA 1IZ8A 1I7PA 1AZWA 3D7LA 1WB6A 1P2GA 3K1TA 3NHFA 1TCBA 3PI6A 4IR7A 3HJHA 3MK31 1SCQA 3OPNA 1M1NB 3LPLA 3Q3IA 5C46F 3N87A 4OQ4A 1SXJC 2WLSA 2CEKA 3OE7D 5INTA 3HPRA 4QYXA 2ROQA 2NZJA 4E5MA 4EJSC 1UBOS 1ZG3A 3QPCA 3DLHA 2CHUA 4LYFA 1YB7A 4KOAA 4YPOA 1E7MA 2VNHA 4BNZA 1FW8A 4HS9A 2SNIE 2ZJ3A 2A9PA 2YYSA 3RSZA 5DN6D 1VLJA 1CJUC 3H5RA 2GD1O 2I62A 4M0MA 3TMYA 3E2PA 4L07A 4CM5A 5HUQA 4ZRDA 1YUNA 2R66A 1LW7A 3UJDA 1A2QA 3V8QA 4B80A 3K70B 3R7WA 4QGHA 3AG6A 1DOHA 1MNQA 4YH1A 1WTCA 3QMVA 1Z45A 4UJ5A 4Q9NA 1IM5A 1O57A 1OZAA 3DL2A 4GZMA 1GRVA 2BF7A 3SZGA 5BV7A 5EEHA 1BE8A 1DCFA 3W5BA 3NVAA 2QN2A 3WWYA 4F93B 2A4KA 3BXOA 3CUVA 1GIAA 2Q3BA 1QZXA 3REQA 5HRAA 3V3KA 4ENTA 4OQXA 4X62B 1U0SY 4G4SP 4J03A 3FHJA 3N1UA 4TTJA 1S02A 4HF7A 4YUYA 3N07A 4BJ1A 2X58A 3OFJA 5BUSA 1V2HE 2VUIB 3EA0A 3OIFA 3R5TA 4DV2B 1COZA 2RC6A 5JAUA 3W7VA 4ZYTA 2ECKA 1MR3F 4PYIA 1UJNA 4JYAB 4A6DA 4IIGA 4BZWA 2PKWA 3IDAA 2VXBA 5LOVB 1W5TA 4YMGA 4IDHA 3WMFA 4WEQA 1NVMB 4KRGA 1QDEA 2VSOA 4WCFB 4FFVA 5H4HA 4YLYA 4ESHA 4RPGA 4J76A 4C07A 4E2WA 1NURA 4IP0A 2AJLI 5AVKA 3LVFO 3I8SA 2WHRA 1SC9A 3GFQA 2ZIXB 4DA6A 4FCCA 1T5DX 1Y3DE 4CUZA 2F00A 5EXXA 1H5UA 1Z88A 1JJFA 4LI0A 1N0WA 4MVJP 4QNNA 4BCBA 3EPJA 1Z0FA 2HTFA 2V3WA 2O1SA 4GO1A 4RJIA 4BC1A 4PRKA 4DLPA 3LGAA 4EB6A 5BV0A 5CHEA 3H2SA 1MOQA 2JIOA 3NYIA 2I4NA 4LZJA 2E89A 4NBLA 3BWMA 5KYUB 1QIDA 2REQB 1SO8A 2CVHA 4O4JB 4QJ5A 5IK2D 3M8KA 5IMSA 4XJVA 1DAGA 4HG2A 4ZVUA 1OPRA 2HD4A 1G64A 1YDMA 3ZU3A 4GPIB 4MV4A 4ZOLF 4AD8A 3L0OA 2JD0A 3Q5DA 3TLGA 4E22A 3K71B 1D4AA 3DM5A 3PX7A 3I53A 6ABPA 1YZLA 2N1BA 1VTKA 4WNAA 4FGUA 2HPVA 5F51A 1KI8A 2YY7A 3M3PA 1GG8A 3SC4A 1QHHA 3GLRA 1Y6GA 2XQIA 1IEVA 4V0ME 1WNFA 1CR1A 1F7UA 4PR3A 4ZVOA 1CG6A 1HE1C 3O31A 2WF5A 4MW5A 4F92B 2BM0A 1ONOA 4E4YA 4JYBA 1LLUA 2YNMC 1U81A 5FOTA 2VRBA 4IIEA 3OICA 3T5GA 3UJAA 4HADA 2XX3A 3VGJA 5H81A 3HKDB 4N3NA 2UXDB 4IDNA 4LMAA 1E2HA 4X54A 2BR4A 1T1RA 2P6MA 4RZ2A 2ZPTX 2PBRA 4G97A 5D51S 1TEXA 3WKEA 2JVIA 3MMZA 4C6RA 1G63A 1CQPA 3IA2A 1U2QA 4GIBA 2WWVD 4D98A 3GLQA 3LQRA 4EI9A 1Z12A 2OYCA 3WWEA 4YQFA 1Z0JA 4B2PA 1NUAA 1IB0A 1RQNA 5CA1B 1PE0A 1X39A 2HCFA 2I4IA 1HXHA 4ZEXA 1ONSA 2KLHA 4WI1A 4RHUA 4BU1A 2C57A 3KETA 4C0HA 4X00A 1JR2A 2ZIUB 2AXEA 1GAQA 5DGTA 1Q91A 2PRSA 1X0XA 2AQKA 4ZTZB 3JXEA 1NW6A 1TA0A 1Y6RA 2R25B 3B2EA 2FR1A 1O6BA 1Y1KE 2NZWA 2PKYX 3A25A 4YRJA 4Y98A 1RAIA 3V1KA 4H08A 1HT0A 3QKUA 4NU5A 1A9QA 2BBSA 4QFDA 3HBNA 3PA6A 1HQKA 1PR9A 3MUEA 3PHIA 3TOZA 3KDSE 2J67A 5DHSA 2P1DA 4B7AA 5K7SA 3T7IA 1QZTA 4Z49A 1JDUA 2X3FA 1DMSA 3VC3A 4BO0A 3A1TA 2R65A 3M1LA 4MVJG 5TQ0B 5JQWA 4F71A 2Z5VA 4KE7A 2F3RA 4MVWA 2F1HA 3CBGA 1F60A 4KLZA 1VKZA 1KSFX 2EJUA 4RDIA 2NUTA 1N36B 1S2IA 1NA5A 2PT5A 2QM8A 1UQUA 2QQ0A 2Y76A 1RJEA 4EUKA 5BSVA 3NNDA 2AVNA 2APJA 1U3GA 2ZAYA 3RRMA 3NH9A 1VLLA 1XIVA 2JGJA 4JBNA 2IXFA 3HNRA 4JLBA 1O9HA 1XMOB 1VXRA 3M6VA 3PQ5A 4INOA 2ZREA 3B5EA 3H5VA 1YVPA 1MVNA 3TX2A 3BH6A 3LL4A 3PNLA 1ZH2A 1P4AA 3DT9A 4AN4A 1WEHA 3DAOA 1TPYA 3ICEA 3QXHA 2JI6A 3A6ZA 3DO5A 1NT2A 2BEVA 3SSAA 1AURA 1G19A 3QYFA 1C1XA 2Y27A 3MRTA 4PZLA 4R1MA 1G60A 3V4ZA 5A06A 1P6UA 2ZR8A 4IQ0A 4MKGA 4JT2A 3R5JA 4LMRA 5BQFA 3AY3A 2AOTA 4OAOA 2B83A 5L8VA 3SZ3A 1MHTA 1G41A 1SA0B 3EZ7A 3PC8A 5JSZA 4BJ3A 4RJTA 3ABRB 3NBAA 3T9FA 1DBSA 3WLQA 1L1QA 1E0AA 1YCFA 4YASA 4FNAA 4ZI2A 1QZZA 4OJTA 5KSPA 3PJRA 1TUBB 5BWCA 2AEMA 3O2NA 1E7SA 5BNFA 4QDKA 2XT6A 4MUEA 1XVUA 3CPSA 4CMAA 1XZAA 3BSFA 2HHAA 4IVNA 1JA0A 2IQIA 2EHDA 4NMXB 4Q9IA 3QX8A 5KHAA 2IYYA 4AJOA 1W85A 4DARA 5LN1A 4S1VA 1YD7A 1Z6ZA 2EBWA 1ZIYA 2GAJA 3PNQA 4N03A 4LYGA 2V1UA 3V2GA 4FYWA 2HA2A 1UMDB 3D6TB 4HRAA 4R2KA 1T4CB 2CDNA 2P78A 3AVTA 2JBAB 2RGNA 4I50A 4C7OB 3QP9A 3H1TA 1P60A 3ELBA 1SVWA 3N0RA 2ZRAA 4CDNA 3RYIA 3IQDB 1BYIA 1DAIA 2H5EA 3B70A 5TQJA 1HQCA 1L8XA 3I8XA 1CJVC 5LYJB 1TM1E 2QY6A 2YWBA 3IE2A 3GIDA 1Y1RA 2W8ZA 2GWHA 2XWSA 2QJTA 2SHKA 3W8RA 4D3FA 3RAPR 3CRMA 4H3VA 2FYTA 1FQKA 2ZIVB 3ZCQA 3AL2A 4JBIA 3D0KA 1AM4D 1QHSA 2C88A 4RTMA 3UG6A 2DXIA 5CW1A 1ZC3A 2JJYA 1DUIA 3D0QA 3LX8A 3ZS9A 4L4XA 4DANA 4W5OA 3VNSA 1G291 4NSNA 2CVZA 4ESOA 4MWDA 4DKJA 4RMGA 2FLVA 3EWAA 1QHNA 1S3IA 3FUXA 3GFPA 4NV1A 4CM1A 1AKRA 1KIMA 2H5IA 3P2MA 3T99A 1CUYA 3W9YA 2AMFA 2BYTA 1KIFA 3HDQA 1XALA 5AJVB 1XTSA 2OENG 3VRHA 5HRUA 3T3MB 2VJBA 1AGPA 3KYCA 5DLQC 1L8AA 2GOYA 1P7ZA 2NU9A 3A9UA 3W1VA 2ID7A 1TKCA 3QVXA 4I8IA 3TLMA 3VJMA 2MT9A 5T4FA 4TYYA 1NBHA 2WKQA 3KXIA 3N53A 3SF8B 2A1IA 5JWOA 3ERCA 1G3QA 1JALA 4RYDA 1SXQA 2ZVPX 2VZ9A 1O95A 3IERA 2XOKA 1VHTA 2FWBA 1Y9JA 2VF8A 2VP9A 1M33A 2HXYA 2Y66A 3WLRA 2WFMA 1K9VF 2V7UA 2V7VA 3NGLA 4NL4H 1H2EA 2CJWB 5HWSA 4MQ5A 3KZOA 3FNRA 4D9NA 5A4DA 3E2MA 1KWKA 1X7HA 1I5EA 4WD3A 1XZNA 1R8SA 3EJWA 1C29B 1NLUA 2YWDA 4FMCF 4OO3A 4WJZA 1T8SA 2B8JA 1O9GA 1W36D 5TVGA 4BNDB 4EJ6A 4XD7D 1DJMA 2GXUA 3C3KA 3X43A 2ZRJA 1S7GA 2IYVA 2WU1A 4LXQA 3D4PA 3HC7A 4V0QA 1Q17A 1UODA 4N7BA 5DIFA 4ZEOA 2HQSA 3V1LA 2QBYA 1NQVA 1UKAA 3CZAA 1LBIA 3DFUA 2IIQA 4P6VF 5AW5A 1H9CA 3Q6IA 1WS6A 3KSRA 4QBHA 1ACLA 3C1AA 3D02A 4K9MA 1IPFA 1JEQA 1MQSA 3AXSA 1MAHA 3QEKA 1Q84A 4LJLA 4W4TA 1V37A 3WIBA 4CFZA 3MJHA 1LKZA 3SHQA 1XTQA 5KVSA 1YRHA 4QEKA 1Y5MA 1YQWA 3JWGA 3UHOA 3G2IA 5CK5A 2Q4DA 4MWGA 1N4DA 4FKBA 2ODNA 3CXUA 3OQNA 4DCVA 1BKDR 2UZ1A 5KAMA 1D2AA 3AB7A 4GX5A 4JT8A 1OAOA 5BQXA 2YV2A 1ZJ4A 2ID4A 1ISSA 4JP2A 3RBZA 1U7XA 5ARDA 2QRUA 5JZSA 3KR0A 2ZBQA 3BHJA 3IRVA 1CDDA 1P39A 2YHBA 2GF9A 3BQ9A 3MWEA 2R8RA 4KBGA 4EECA 1BS2A 4MW9A 1IUNA 3JQAA 4OBEA 3FYTA 2VAWA 4I6JA 3QFHA 4JMPA 2H92A 3Q6NA 5ED0A 4CM4B 2WSYB 2DUUA 2VL7A 3JQFA 1PSZA 4TLAA 1XLTA 1U7HA 4I50F 4NMMA 3QWAA 3E84A 5KMGB 1ULBA 4IF6A 2IXDA 3ZW8A 3DE7X 1JPVA 1TA4A 1JKMA 3BL6A 5G1NA 4CIDA 3I61A 2P2GA 4NONA 1GRCA 4P35A 3B3QA 1WUTA 4EL5A 5IAGA 3L6BA 2PRZA 1C9MA 1T6ZA 2JRCA 4KGZA 5C53B 1SCDA 4D26A 3K5PA 3K2IA 5EKTA 3I5MA 4XUCA 5BR1A 1Q7CA 5E1OA 1XRRA 1E64A 1O4VA 2XMGA 1Y8RA 4M86A 1DQNA 2OAGA 1NI4A 2OWEA 1FRQA 2XMRA 1W8IA 1VA4A 1YRLA 2IHTA 3HZRA 3JSAA 2GTIA 2OILA 4ZT2A 2XTAA 4OQMA 4A0QA 4YCBA 3Q7TA 1U0NA 2C78A 1T35A 2C31A 1DWPA 2J6CA 1GKYA 2LWIA 1ID8A 5LB2A 4R8KA 3F1KA 2DBRA 5BV1A 1QQTA 3WADA 1RLIA 1XMXA 4RVSA 1OH6A 3I6MA 2DHRA 2VK1A 3H4VA 3O8OB 1P1JA 2P4UA 3OTWA 1CFJA 2AD5A 4K9DA 5IC4A 2J9RA 4D0RA 1Q20A 2VR1A 1OREA 5FI3A 3WOHA 4P58A 4B2IA 4RELA 4MGHA 4FGKA 3ZVMA 5LP1A 1LFDB 3Q9NA 4FGJA 2IPLA 3UCXA 3KKZA 3X2FA 3PUHA 5JH7B 3H2ZA 3G8BA 5M04A 4OYRA 1I33A 1XELA 2B35A 4FYHA 3OH8A 2CD9A 4D42A 4DCGA 3QKSA 4G9GA 4MICA 5ESDA 1JIXA 1ZD2P 4LF9B 4HWRA 5ER6A 5KOHB 2FDRA 3HB5X 2Z6UA 3UA3A 1Y7IA 3VH4A 5KX5B 4QPCA 1NMYA 5JZ9A 2GKGA 3GLFB 3ETNA 5G1PA 1WZEA 2AZXA 2YJ3A 2OFFA 1DTSA 4A5SA 5B7QA 4P86A 3MG9A 3T7SA 4UW9A 1V3VA 3OM9A 1SIOA 4H1VA 1Z62A 1F9EA 1L7XA 1GNQA 1KI4A 1IBRA 1RLTA 4L7QA 4M6WB 4O2BA 2GMWA 3DHVA 2CXOA 2NZ2A 1YUMA 2Z09A 4FJ2A 4V24A 5HG0A 3VUEA 1T8RA 4EI2A 5JTTA 1UM8A 5K3FB 3RHFA 1NQOA 1C2YA 1E3DA 1F2TB 5H9VA 5DSTA 2WV7A 3WGHA 5EN4A 1L5SA 4J4BA 5AOVA 4CMIB 2XDYA 2LCQA 4JLNA 1J4AA 2O5EA 4Q66C 4Q48A 4HZUA 3TW8B 2QB5A 4NCHA 4RACA 4ZV7A 4DVGA 4E4TA 1BG6A 2B4YA 3RRZA 3ZY6A 4XIGS 5JNLA 1GHTA 4PAGA 1ZI9A 2VDVE 3VC7A 4A8PA 2G7ZA 4EEZA 3QXXA 3TSWA 4ZDIA 1SXJE 5L6MB 1B74A 3KZCA 3BJIC 4URFA 3ZV6A 4W6QA 4Z7QB 2AE1A 1WSDA 2CN1A 2H2WA 1KJYA 3DL4A 4C0SA 1M2JA 3J7AC 3LCRA 4XYMA 1IU9A 5KNDH 1UDWA 2G63A 4MWZA 1F20A 1FMTA 2VPPA 2M6SA 2EJCA 4QQKA 3HWX1 3WL7A 4J0QA 5B64A 3SQXA 1B8PA 3PNVA 4HB4A 5F2KA 3W8DA 3CNEA 3GR6A 3L8GA 4QYTA 2CHVA 2CUTA 2A78A 2FR8C 3ONWA 5EHIA 1G2QA 5CDHA 5CXXA 3T7TA 2FSPA 3NUZA 1RYBA 1R0WA 3O82A 1KOFA 3H2HA 4G0OA 3WLJA 5SZIA 1OCEA 3AETA 4PO1A 2ONCA 4X94A 5H70A 4P7BA 3KG2A 4EEKA 4F4IA 1ZD5A 2PMBA 1R9MA 1AKYA 2BPOA 3M3HA 1ZJ5A 4AT1A 4V1CB 3U44A 1EDDA 2B4TO 5L45A 3K92A 4Y2XA 5B2EA 2FETA 1ZGCA 3ABOB 2YH2A 2WKPA 3S0JA 2BWJA 4PGHA 2V6IA 3OFND 4D3SA 4IIYA 3LOUA 1IL0A 1OZHA 2OR3A 1XDGA 5D5HA 1KOLA 5YASA 3L82B 1OWPA 3IP3A 3NYRA 4ZYUA 3VQTA 4DW8A 1JQ5A 3PUZA 2W2LD 4AZTA 4CF6A 3FCYA 2O5RA 3K53A 2IW3A 4RFSA 1F12A 1L4KA 3KQMA 3MN1A 3EE6A 3F0TA 1AZSC 2EP8A