4D3XA

The structure of mature legumain from chinese hamster.
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
261
structure length
259
Chain Sequence
GKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIIVMMYDDIANSEDNPTPGIVINRPNGTDVYAGVLKDYTGEDVTPENFLAVLRGDAEAVKGKGSGKVLRSGPQDHVFVYFTHGATGLLVFPNEDLHVKDLNKTIRYMYEHKMYQKMVFYIEAESGSMMNHLPNDINVYATTAANPHESSYACYYDEERNTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKSISTMKVMQFQGMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords LEGUMAIN
publication title A Detailed Look Into Chinese Hamster Legumain Active Site Structure and Exploration of its Function
rcsb
total genus 97
structure length 259
sequence length 261
ec nomenclature ec 3.4.22.34: Legumain.
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01650 Peptidase_C13 Peptidase C13 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d3xA00
2QL9A 5K20A 1RHKA 4NBLA 4EHAA 4IEFB 1F1JA 1K86A 1QDUA 1CP3A 2FP3A 4JR2A 2C2KA 4NOKA 2K7ZA 4QU9A 3UO8B 5LU8A 3DEJA 3R6LA 3R7NA 3P4UA 4ZVRA 5IAEA 2QL7A 1RWVA 2HBQA 4N7MA 3S8EA 4AWAA 3GJTA 3H11B 3PD0A 4NBNA 4QUIA 2J32A 3V6MA 1RWMA 2H54A 4FEAA 5IAGA 4HVAA 4JJ7A 1RHQA 2H48A 3H11A 3IBFA 4JQYA 3V55A 1BMQA 3ITNA 5JFTA 2C1EA 4QU5A 1SHLA 4JR0A 2HBYA 4NOJA 4EHNA 5IAJA 5LUBA 3PCXA 1I4EB 3SIRA 2WDPA 4QTYA 1RWPA 4M9RA 1NMSA 4N5DA 1QTNA 4ZVQA 2DKOA 3R6GA 4N6OA 2CNOA 2H4WA 2QLBA 5IANA 3SIPA 5IBPA 3IBCA 3UOAB 2HBZA 5IASA 1RHMA 4EJFA 3GJRA 3GJQA 5LUAA 2J33A 3S70A 1SC4A 4LSZA 3KJNA 5IAKA 3V4OA 2HBRA 1RWOA 4JR1A 4I1RA 4QU8A 4ZVOA 3V6LA 1NMEA 3DEHA 4JJEA 3V4LA 3KJFA 2NN3C 3R5JA 4I1PA 4AWBA 3H0EA 4JQZA 4ZVPA 3H13A 5IBCA 4QU0A 1GFWA 1JXQA 1NW9B 1RWWA 4D3ZA 1SC1A 4PS0A 3E4CA 2CDRA 5H0IA 4ZVTA 5LU9A 3BIJA 3R7SA 4DCOA 4QUJA 4DCPA 2C2MA 4JJ8A 1I4OA 1ICEA 1I3OA 1RHUA 2XYPA 3EDQA 3V3KA 2AR9A 2J30A 2XZDA 3D6FA 4NBKA 5IC6A 2QLFA 4AW9A 5IARA 2FQQA 1RHJA 4QUDA 1RE1A 2H65A 1QX3A 2QLJA 3EDRA 4N6GA 4QTXA 3NKFA 4ZVSA 5IBRA 2CNKA 2FUNB 1KMCA 2QL5A 4QULA 3NS7A 5I9TA 4HQRA 1RWXA 3P45A 4FGUA 2CJYA 4IYRA 1I51A 3R5KA 2XYHA 2CNLA 1PYOA 4N7JA 3KJQA 1K88A 4QUGA 3QNWA 1NMQA 4ZVUA 2H4YA 1SC3A 3H1PA 3RJMA 4EHDA 1IBCA 1PAUA 3DEIA 4PS1A 4EHLA 4FDLA 4NOMA 4D3YA 2CNNA 5I9BA 4D3XA 1M72A 4PRZA 1SHJA 2Y0BA 3K7EA 4NOLA 5IC4A 3D6MA 2C2OA 2XZTA 4EHKA 4PRYA 3DEKA 3NR2A 2H51A 4QUEA 2P2CA 4QUAA 1RWNA 4QUBA 3R7BA 1RWKA 5IABA 2XYGA 1RHRA 2CJXA 3GJSA 4N6NA 4QUHA 4JB8A 2H5JA 1CVRA 2H5IA 2J31A 4EHHA 3PD1A 1F9EA 3D6HA 2Y1LA 2C2ZA 1GQFA 3OD5A 4EHFA 4DCJA 4HQ0A 4FXOA
chains in the Genus database with same CATH superfamily
2FW9A 3PNKA 1KQPA 4Q3KA 4CRWB 2PJZA 4LBZA 4X94A 4CKBA 1SK9A 4KPFC 3B9RA 3DM5A 4MQEB 2GOYA 5CIQA 3LNTA 4QFCA 5A2QA 3PHBE 4LTDA 1G3MA 4MH0R 1XTKA 3MYYA 3T7SA 3VU8A 3A1UA 4A0GA 1PRYA 1RJ9B 1REQB 2O2HA 1S02A 4YV0A 2RGCA 1C30A 3L9WA 3H1FA 4B4DA 3KD2A 4EL5A 3A32A 4H7IA 2WVAA 1OPRA 1KWGA 2KE5A 4BJ6A 2B4AA 4IMJB 3ABQB 1ZUD1 3LF1A 4BFWA 4QHSA 1T4DA 1TM4E 2DUWA 4NTZA 3TW0A 1RJDA 1K08A 3V1YA 1AZTA 2PZGA 1TUBA 5GJWC 2VA9A 2HYDA 4DIBA 4L78A 5P21A 2GN1A 4C1NA 1K8XB 2DBYA 4YMIA 4AY3A 2QE6A 4B46A 4BLQA 4V0OA 1EE1A 1PZEA 1KE2A 7ABPA 4WLUA 2YQZA 2PTGA 3AUYA 5FCDA 2F00A 2NAFA 1V5IA 1LPMA 1SKYE 2CKDA 3OUTA 4C1BA 1MHTA 3TTSA 4QM7A 1LLUA 2WIFA 3OQHA 4NCHA 2ZZMA 1YR2A 2XRYA 1MC5A 4DB2A 3OOJA 7AT1A 1H4QA 5E3JA 4HRYA 2Q4TA 4RDXA 3UV3A 3KOMA 3HO8A 3FD8A 4R2MA 2O6HA 5F3RA 5DCWA 1K66A 1HE4A 3CKYA 1ONPA 1PD1A 4EZIA 4XH9B 1E0SA 1MJGA 1XCLA 4ND3A 2EC5A 1PJBA 4KW7A 1LPPA 4HMQA 4GWLA 2NSJA 1GPDG 1UPFA 4QT0A 1EVJA 1CKEA 4Q24A 3VJKA 1J9ZA 2XGMA 5BVHB 1AN9A 1UM9B 1PVDA 1IVNA 2CLDX 4PG5A 3TN7A 4R2IA 1PQYA 1NOJA 4Q05A 4Z2YA 1OH5A 3MNFA 4TKUB 3TIXB 3A0UA 1X1AA 2V6MA 3FDIA 2GYVA 2WNHA 3EXG1 2EBHX 3E1GA 4MQFB 5JZSA 1I7DA 1HC7A 1GYQA 3JZIA 5IBRA 1YB7A 1KMCA 2NVUA 1GPMA 1URPA 5CTAA 4JV5B 3I9OA 3UGKA 1KAOA 4FOOA 1NQAO 4REQA 1WXFA 4BFYA 1D2MA 1OKKA 1S4QA 2XOEA 1YR9A 2IITA 2OFOA 5E6SA 1IMOA 4TYYA 3N05A 4JGBA 1UBEA 1W88A 4MICA 3IR7A 5J2TF 3ZWVA 4WXRA 3THSA 2LGJA 4DOMA 2BFPA 3UMGA 3R8CA 2W6OA 2QD3A 1RACA 4WX2B 1NXXA 1YR6A 1J2TA 3WYFA 4W63A 5G40A 4R9SA 3CWQA 3KDSE 1W44A 1Q5PA 1N2ZA 2CCJA 3VU3A 2Q45A 3HB4X 1QAQA 2EYQA 1QV9A 4UBIA 1HRKA 4Q1VA 4DQKA 4TLLB 4KMRA 4JI4B 1E3SA 2AE1A 2EIHA 4X8HA 2J48A 1UBFA 2W2LD 1G59A 4J3FA 4UFPA 5G4KB 1DBIA 1GTG1 3CG0A 1DV2A 1KEVA 4YFVA 4PYQA 1SUPA 3HY6A 1EUDB 5D5HA 3ZLVA 1DO2A 2QZJA 3E9DA 2FETA 3WBJA 4BVLA 2Q5IA 1M10A 3U4QA 2OLEA 1T10A 3E2MA 3OBIA 1T5HX 1GFZA 1U7XA 1YUBA 3OZVA 4UE2A 3STWA 4N3NA 5L3SA 3VR0A 1ST3A 2K4MA 2PMKA 3JARB 3ZNNA 1BD3A 4EG1A 2AR7A 3G7UA 4GC5A 5CW2A 5EJAA 4DA0A 5K0EA 1TKAA 1TYEB 2HBQA 3VPSA 1ODKA 3QHAA 3QWHA 2QRHA 5AVTA 4E15A 4WNIA 5IYZF 1VJTA 2C8KA 1EU1A 3R3YA 2PX0A 1NLUA 2BJWA 2NUPB 4F93B 4RGQA 4PYMA 2C0CA 3TZ6A 3KSUA 1KRXA 2BGWA 3DFUA 2CV1A 4LYHA 1EGQA 5AT1A 4D5GA 1NBME 2E9SA 2IA5A 4YQYA 3P4YA 1KKLA 1GGVA 3FFBA 3M6MD 3MYRA 5CRIA 4CF5A 3F6RA 3TVTA 2BP7A 4MRAA 3OZWA 4KR0A 5FO1A 4JB2A 2OP1A 2C9BA 2CKMA 4I5IA 4XIFA 1I3KA 1I3MA 1QGAA 2GXSA 2CFSA 3AXTA 3QFFA 3IS3A 4G4SO 3LX8A 5DYNA 1OTXA 3EGWA 3QUTA 3NVMB 4TQ9A 3FNGA 4ZU3A 4B34A 4CIDA 3P9ZA 4MS4A 4JHXA 5G0TA 3HXMA 5H7XA 2XRMA 2VPWA 3PA6A 2C9YA 1VC2A 1TEVA 4G07A 1KIAA 1FVFA 4HRXA 1C0KA 2Z43A 1ZRSA 3O1HB 4X62B 4I9FA 2G82A 4FGLA 1T4MA 2WWRA 3EQ9A 4QWWA 3MOGA 4JJEA 5AWFC 3DYIA 3B85A 3GUZA 4UTRA 1FUYB 5KU7A 1ZIYA 1KYIA 5IUKC 1KFEB 1XD2A 1KYZA 4RHYA 3GPBA 1ZOSA 1X1BA 1GGEA 3GH1A 1C9YA 2XMDA 4YRIA 4Y8VA 5AVQA 3SU8A 1ATIA 3E8SA 1G98A 3FTDA 2XNHA 1VE9A 3CRRA 1C0PA 4OJKA 3JV7A 5SY6A 4J8PA 1NZDA 1NUTA 3FCSB 3NTUA 2ZP1A 1T3GA 3O2SB 4J0FA 3FOBA 3QWIA 4PGMA 4RQBA 4UVIA 3IOEA 4XB1A 1XJ0A 3GP3A 1JLSA 3PGLA 1UMCA 4K9KA 5LB2A 2D4AA 2HJ9A 2R9VA 2G63A 2ZCUA 1VJRA 2FW6A 3IEXA 1QCDA 3KR1A 3RR2A 3WC4A 2HHCA 3V8BA 5BY2A 5AKYA 4EPWA 1KO7A 4IDEA 4LRQA 3ZHOA 1JPVA 4RVFA 3ER8A 2IEZA 2FW7A 4KQMA 4RFLA 1MRNA 3ZR4B 3AFNA 3HGMA 1Z29A 2QSUA 2GVDC 5I9IA 4DLVA 2VWHA 2WC1A 1T3SA 4V1CI 5DBEX 3AIKA 3GZNA 4RELA 5F21A 2ZVDA 4WY8A 3ROEA 3VU1A 4TUYA 4WXHA 3TQQA 3CJTA 4C5AA 4LHZA 2Y92A 3T7KA 4PM4A 1M72A 1FYDA 2V55B 4R2KA 2Q6IA 4I2NA 3WBBA 2VF4X 2IHZA 3D6MA 1M0TA 2AYYA 3DKIA 3HLYA 4QZVA 4EG0A 5BQ5A 5LB4A 2ZZKA 2QJFA 5KOIA 3VNUA 3IAS6 1M6HA 1CUSA 3L0PA 4L8FA 3KU4A 4RX1A 5JO9A 2KPOA 3QYFA 1GQFA 1XALA 3RKSA 2FZEA 4XXHA 1US8B 2AXQA 2BFDB 2BHSA 1U3TA 1L1RA 4YP7A 2UXBB 4IEFB 3W8NA 1QB7A 3OZUA 3OQNA 1S7GA 3LK6A 1WBJB 3QYJA 1OLXB 1Z82A 2P79A 4QHYA 3T3DA 2SKEA 1AKWA 1FP7A 1I0LA 1M0WA 2I5PO 3BXEA 1QHSA 1YZTA 2EJVA 3A04A 2X9NA 4KPGA 1GR0A 3EDYA 4LYFA 2Q5FA 4CM9A 4CN9A 4NLLA 4RU1A 3NZEA 5J1TB 1N7GA 1WQ3A 3CUSA 5DHUA 2H1OA 1JKMA 4AU1A 5FBWB 4Q7JB 1DKOA 1YQGA 4G86A 3TIIA 4UBNA 4M8NE 1E8DA 2IK8A 3DXFA 4KN8A 5DHTA 1N5MA 3WLNA 1GM5A 4M1WA 3BL5A 3A9UA 3EWSA 3UWDA 3HY3A 3IQFA 4GBGA 2CXHA 3UVEA 3R8FA 1AB5A 4QU5A 4B3HA 3TOCA 4NMMA 4D41A 3SQXA 2IJGX 2B21A 3HDVA 4J3NA 1LWOA 1LBTA 2X5OA 2XWJI 3T5AA 2Z57A 4FK8A 3RV4A 1QUFA 1Z0FA 2A5DA 1YIDA 3G17A 1KU0A 2W90A 5AM5A 2VT7A 4LJLA 3R3VA 4KSYA 4YRQA 3AF3A 4DJDC 4Q02A 4X8OA 1H93A 1FXUA 3I0ZA 2CEKA 5JCPA 1SB8A 1TL7C 3OC6A 4IL5A 3L0ZA 3MPUA 5F77A 3L18A 3KVVA 1KEWA 1N25A 1T8RA 4S05A 1YJAA 2CWWA 2W2TA 3R0JA 3L1JA 1IXKA 3U56A 5EIXA 3LM8A 4YT8A 4JSTA 2PUBA 1SVNA 3I2KA 1EHIA 4OJNA 9MHTA 1F8FA 1KO4A 2ZWIA 4WECA 3HO6A 4F3TA 3KOOA 1T8UA 1YK0A 4ND7A 5YASA 1JIUA 2YXBA 2ZYVX 5LLTA 4MV0A 3PPVA 2ZRMA 2BCGY 1FMTA 2Q3HA 5H0IA 4MQ4A 1J9GA 3AOGA 4Y9UA 2HB6A 1E99A 2L2QA 4QARA 5FI1B 5FUQA 3VO8A 1ZJJA 2ODQA 2WWWA 1FVOA 4OKNA 2H17A 4EMBA 1RM4A 4RBNA 3SNKA 5GIPE 1L5OA 4J91A 2QN6A 5DE3A 3F67A 4BAGA 1NNEA 2WU4A 5CH3A 4KFSA 5HUJA 2I54A 3OT5A 4RLFA 4A23A 4MQUA 3OFND 3DLBA 1F6WA 2GVZC 2SKCA 4YAKA 2YOFA 2QXUA 5G1PA 2EFCB 2CN1A 2XYHA 4IV8A 2I55A 4EENA 3C7CB 2ZRCA 2AFRA 4M8KA 3WK9A 4UVHA 1NY5A 2H4YA 4LGCA 3W77A 1B0PA 3ZBQA 3C74A 2ZWMA 2O3SA 4Q4HA 1E9EA 5ED0A 3KM0A 1EVLA 2D2IA 1SG6A 4Q47A 4BO0A 2A4KA 3TR5A 2AOTA 3N2GB 1J39A 2MINB 5AHOA 2B0CA 3FOFC 3TQHA 2I33A 1MDBA 4CMEC 2XZTA 3OD1A 1S8AA 1XRQA 2JAHA 3LQYA 5AKLA 2J0EA 1VGVA 5AIAA 2GPWA 3L8ZA 4JROA 1QZTA 2R79A 4G1MB 1NTRA 4LQLA 1AD2A 4OTZA 4TTPA 4F21A 5A04A 5J3JA 1NV9A 1T29A 1ZP6A 4DDMA 4RPGA 1CBUA 3AGQA 1P45A 4H0FA 1N36B 1F9EA 2IYPA 4IIFA 1MX5A 4C05A 1NUPA 3WK8A 1BFKA 1AMNA 3NYWA 3NRCA 2ZIXB 3K9WA 1HO3A 1ZU4A 1WB5A 3A9WA 4EQ6A 1JVSA 3DKVA 5DBOA 1P1IA 3C3PA 4GT1A 2C2KA 3HBNA 4YLGA 5ES3A 2VZ9A 5H3HA 1M8PA 3M6LA 3GJ0A 3RFFA 1HDYA 1WW8A 2XUJA 1YCFA 2R84A 2HWKA 4JQOA 1E79D 4R8SA 3UWSA 4E88A 3B60A 3S4YA 3E81A 3O90A 2EQBA 1DP4A 2ZATA 5H3LA 4FHCA 2Q1WA 1H1LB 1X70A 4JKOA 1T5IA 5JIBA 4YWHA 4TWZA 1R3DA 3I5YA 4OLAA 4WUVA 1NVVQ 4AJJA 5J47A 4K0RA 4OJTA 1D4OA 2Y27A 2J07A 1X7WB 1JDVA 4P82A 3OX2A 5I9LA 3H11A 3N9IA 4K9PA 4DL9A 2WWYA 2WPDD 3UAVA 2XQFA 2NM0A 5MFZA 3QVGB 5T8KC 1YI8A 2I7XA 3HRKA 1MEOA 1ODCA 1PFWA 5TRTA 2A1TR 4HLUA 2QG9A 3H4IA 5DZSA 2QLBA 4R54A 3TZCA 3ZV5A 4L5CA 2AC4A 2QRJA 5E6UB 2DZDA 5CB4B 1MP0A 1KI2A 1T0IA 1YO6A 4NYIQ 3D0OA 1YVDA 1SH7A 4Q00A 1HKUA 1PQUA 2SKDA 3GZTB 4X9XA 4ZI7F 3GP5A 4RJJA 5JD5A 1SBZA 2GPYA 4J0JA 4C0XA 1L5YA 3CZRA 4UTNA 2WIJA 2GH1A 2LRHA 1DTWB 4JL6A 3UJ7A 3M3PA 4O1IA 1P1BA 1X92A 2GD0A 3EN0A 3AK4A 3RAFC 5C52B 4E31A 2IUUA 3W1WA 4TXLA 2OCXA 2JFBA 5J9FA 3IL2A 4KR6A 1E7WA 1V4NA 2MSWA 1FW8A 3E3LA 4JVSB 4O4LB 1BXZA 4EY4A 5HR5A 4ZEXA 3RC1A 1N3YA 2YFYA 1E1YA 3KEMA 4LS3A 4GI2A 1W6UA 4CEIB 3HACA 3T35A 1GD1O 3NBQA 1YFZA 1Q84A 1RKQA 1TU0A 3M1YA 3AHEA 3PFBA 4JNCA 4UPVA 4WA8A 2PGAA 4DLWA 5K8TA 3BSYA 4L3WA 2X9VA 4O25A 1VPWA 1SWVA 1J5PA 4YXWD 5LOVB 4KQ1A 2W9XA 4II2A 4ZV4A 2FSHA 3D1VA 3HCBA 4CNBA 1WMAA 1YA6A 3IA7A 2FPIA 4UHBA 2BGMA 4EHDA 3THXA 2I2FA 2AQIA 2FEWB 1UKVY 2VSNA 3EZGA 4I3GA 5EVJA 3EDMA 1TTTA 3IVAA 4ILEA 3A6JA 3K6SB 3PU6A 4INAA 4AMGA 2Y0PA 3W2TA 1V8ZA 3UJ6A 2O8EA 3Q6NA 1GVNB 1R9JA 4A8PA 1MGOA 2Q4BA 3E18A 5H5JA 1JHDA 3D4NA 3VHXA 1HNZB 2C8LA 2Q41A 1IBKB 1XZAA 1AF7A 3LDAA 1QC5B 2FFJA 3SF8A 1LLDA 1WA5A 2CDNA 1Z33A 4HXYA 4NZOA 1DLIA 1F4LA 3FWPA 4O1MA 1ZONA 4CMHA 3NV7A 1JQLB 4G5GA 3TNYA 4I5GA 3NKVA 1YC2A 3AV3A 3HCEA 5HGJA 3VYVA 2IOFK 4Q03A 3A9VA 1T8YA 3QPUA 3BAZA 1LRJA 1VL6A 1AKTA 1JF8A 4LZNA 4ML3A 2PMBA 2YXDA 4E1VA 2HU8A 1NLYA 5ADWA 1GAQA 3BICA 3B2NA 3UJDA 4U7TB 4UE6A 3UUWA 4LF5B 4DCUA 4J0GA 5BVGB 1SXHA 5JU6A 5L4LA 5FI5A 1PEKE 2GDJA 3NTOA 3NFYA 1XE3A 4YEDA 3VR3A 1ZCZA 4C4SA 3V8NA 1W49A 1ZJ6A 4R1UA 5DOZA 3B70A 5CK4A 3PD0A 1ADGA 1PL6A 5F5XA 2PT9A 1MAVA 2PHZA 1FBTA 4JI2B 1UCFA 1EX7A 3QX8A 4MQ6A 2JHGA 3GGCA 3PUIA 2ET6A 2AN5A 4X1KB 5IAGA 4ZXPA 5HQJA 4H4DA 3IT0A 3VZPA 5HQ3B 4EMUA 1EK6A 1Z5PA 2PKCA 2DRIA 3DV9A 4H4EA 1U9JA 3RJZA 1I3CA 3H5VA 1XZCA 2AN9A 1DHTA 2MSEB 4HWSA 3AHIA 1E3IA 2CXOA 3VPBA 3NXKA 1XRJA 3K6KA 2QE7D 4HQOA 1JUDA 2VJMA 1N7IA 3DL2A 5JRJA 1OWPA 4ZCLA 4XUCA 3BSFA 3IUMA 4Q3AA 4A8HA 3QW4B 1O4VA 3L84A 2JH9A 4US1R 1PLLA 3RT9A 4ZCPA 5BR1A 1ZIOA 3P9XA 3TBHA 4AQ7A 1WXHA 5JCJA 4D8UA 2VIIA 1G5TA 1AQ6A 1B2RA 4E14A 3OAAA 1FP6A 1K6IA 1WVIA 1U7PA 1ZOOA 2HJVA 4IHJB 5KKAA 2IYYA 1EXDA 4QSHA 2X5NA 2HT1A 1KQOA 2PU7A 2NGRA 2AI2A 1GCGA 1KIFA 2HF7A 3UJ9A 4UULA 4LCJA 1FL9A 1WO8A 1HY3A 4TVKA 2G9RA 3NBFA 6ADHA 4TXNA 1SWWA 1GLGA 3FGOA 1CRLA 1PU2A 2OCPA 2ZJFA 4RORA 2YR0A 1BS9A 1YZFA 4QUJA 2ONCA 2ZUVA 5CG1A 1ZUHA 2M6SA 5BO5A 3QPWA 1IU9A 2H7XA 3VDXA 1F0NA 3F71A 2C7QA 1NN5A 1PJQA 2JCXA 1E6KA 2DG2A 5CA1A 2W2KB 2ANCA 2WWTA 5KOHB 1XNRB 3IXMA 4RY8A 4AY2A 1IEVA 4QTXA 1P0CA 3FPLA 3IALA 1NU8A 4KQWA 1HPLA 1AC5A 1KR5A 4JEUA 4OHVA 2GBFA 4UVGA 3F7TA 3NONA 2JIQA 4NYJQ 1JU9A 5D8DA 5AM2A 5ICCA 4Y2TA 2I80A 2VJNA 2IXGA 3ET5A 3DHEA 3TGWA 4Q4CA 1B0UA 5AUNB 4XJSA 1NWCA 3OZ7A 3LVQE 1O9BA 1EKXA 3F5FA 3G8DA 3E9MA 3GRCA 1SPXA 3INYA 2I87A 3EAQA 5AKIA 4G8JA 1M2FA 3REQB 4FXPA 5LR6A 4U2DA 1C29B 1O6CA 2MT9A 2PA0A 4HN2A 2P2CA 1ZD8A 4Z9YA 2QVLA 5KX5B 1TZMA 4W9NA 4PYIA 3NWJA 3QEOA 4M7RA 2C7RA 4CCAA 3QA3E 4IY1A 5FWYA 4HQFA 3ROFA 5KNBD 1WDWB 1DT5A 1N4DA 1RBMA 3WWEA 5A1TA 2QVZX 4CR7A 2J9RA 10MHA 1JB9A 2PYDA 1ZH8A 4P08A 3WGNA 3TZLA 5MGNA 1DKQA 1UC8A 3D6TB 4MVYA 5DSZA 2F9FA 4RY0A 1QIMA 3Q5EA 9GPBA 1UC9A 1RW4A 4C5CA 2ZSBA 4JLJA 5HF5A 5IU6A 1PDWA 4OQDA 3P9QA 1G21A 3LCVB 4G4JA 2RG1A 2Q6LA 1GKYA 5JMWA 3WMWA 2JFFA 4V24A 2P4SA 3KYDA 1GAWA 1W76A 2VZLA 4OH1A 2V4ZA 2PCLA 4UQOA 5EXSA 3RTAA 4F5DA 4GHWA 2FFHA 4GX2A 2WYVA 4ENRA 2ZIAA 5ELXA 1GV1A 2GZRA 1QFXA 1TIBA 2HMWA 2DETA 1CWUA 4FW9A 2NZVG 3L8HA 2RGWA 4NI5A 5DNUA 3RROA 3AI2A 1QVRA 3KUXA 1SCBA 5JTTA 5ALJA 2WW8A 2FN7A 1JJ7A 3U4HA 4PN3A 3RS7A 1ORIA 5AVKA 2GKOA 1N9GA 3KBBA 3M7IA 3I04M 4LXHA 1JDBC 2PRYA 1L8QA 2BR3A 1XMQB 3M8KA 3PHIA 3PGA1 1JECA 2J87A 1QYWA 1C1DB 2CSUA 3LXRA 5E1BA 3SZLA 1U81A 4UM9D 5G0WA 1TIKA 2I1WA 5CM8B 3ZGOA 4Y0VA 1JA1A 5DM60 3NVKI 4JLUA 3UMMA 2FHPA 5E9JA 4UOZA 1CIJA 5I7VA 1K8YB 1XD8A 1QYXA 3MWDA 1YOVA 3ABZA 5BPFA 3ZZ0A 1P7PA 1Z36A 4CMCA 1QG0A 1C4OA 4NBWA 4MOWA 5A3VA 3ETDA 2UUOA 1Z6QA 5EXEA 3TTUA 3KUDA 1Z4QA 3GD5A 4M7WA 4ND8A 3K71B 4KXLA 1KSHA 2NSYA 2QZZA 3G9UA 5LXTF 2A1UA 2O2XA 5C8YF 4RL6A 4UVDA 1THGA 4PF1A 3RUPA 3A9RA 4BBZA 3BFVA 3RAGA 1GFWA 4CLEA 4QPJC 2VDJA 3PNSA 3RBXA 2WF7A 3DFZA 5TSDA 4AJ4A 4LJ6A 2WWGA 3A14A 3ETCA 3G82C 1F14A 3HWRA 1C9EA 4H9GA 3IEIA 3ADDA 4XPIA 3SC2B 4OGWA 1IZ8A 1CUXA 3GA0A 2AC2A 4HNSA 5MF6A 1KQFA 1H5QA 1V43A 1NULA 2Y1XA 3CGGA 5IN4A 3HFGA 1NE7A 2XXBA 1ZXLA 4FZRA 5G41A 5AICA 3BXHA 3ZWOA 4BB5A 2C4TA 2COKA 1W0KA 3QJ5A 5SICE 2H65A 3Q98A 4Z0PA 4ZK2A 4TTAA 5BR8B 1ENYA 1B8PA 1QAMA 1OZHA 2GYWA 1L5HA 4C6TB 2YQ4A 2QUAA 1F5NA 3EJ6A 1SHTX 1BFUA 1V6SA 4WDQA 3ED5A 1QO9A 2QRNA 4EF4A 4GKAA 5A3RA 2QZPA 4ARAA 3ZWKA 2VL7A 1K0FA 4CLOB 2NNLD 3V7WA 4MQ5A 2FOLA 5KWJA 3DDCA 2QRLA 3NOVA 4KXVA 1HFKA 2RSLA 3PTZA 1GQQA 2ISCA 4AD8A 4X7PA 3PF8A 4PW0A 5BWCA 1O1YA 4UCXA 1QFYA 3PI7A 1SVSA 4IJWA 1ONBA 1NC3A 3CIOA 8ABPA 2OZVA 2GJSA 3HCWA 5JAPA 2BGRA 4PCVA 4I3FA 1AQNA 2AN1A 3P8ZA 3LPNA 2XWSA 3ABIA 1FFHA 3LX5A 1PJCA 2AJBA 3L7YA 2JC3A 3MCVA 3VISA 1AHNA 5GIOE 1NUAA 2UZAA 2CYCA 4KAJA 1TVEA 5I48A 1W4BA 5CDGA 1AV7A 3AL0C 4HNQA 1HMPA 3B51X 4TMWA 3W5VA 4HNTA 4K28A 3VJRA 2CMFA 1XLVA 1PFKA 3JZAA 3IT2A 2WTBA 3USES 4KUEA 5EZYA 2WJGA 1XJCA 4FFMA 2DKNA 5DLQC 1FOEB 3L43A 2CZGA 4FDVA 2V6IA 4G3XA 3UYKA 1KY3A 4I4TF 2ATXA 3HU3A 4J0QA 3VR1A 1JG3A 1N6HA 5AQEA 2BSAA 4ITVA 3TRFA 4AG6A 4NNPA 3ML1A 2DP4E 2PKRA 4LQ4A 5KSWB 3PPYA 2J4CA 1NV8A 3QU5A 4PG6A 4WKOA 4HAIA 4RTLA 4RTOA 2PX8A 5HJEA 3ZI0A 2RDMA 4Y67A 1U7OA 4DT1B 4IDCA 4GD3Q 2OK8A 2JFPA 2NVOA 1KAHA 4NZZA 3VH3A 3GLIB 3B48A 4DV5B 2CXXA 1ECFA 1Y8ZA 2PKWA 1QH8B 4DHWA 2XEXA 4XX1A 4HDNA 4YJ3A 3H97A 2B7LA 3N8GA 3DOHA 4FHGA 1IN8A 5EMKA 1L9KA 1W30A 1E6MA 5L7YA 4RW0A 4TX1A 2GA8A 4PQYA 4RIIA 2OO5C 1UP6A 1JQEA 1V3UA 3R0VA 1CZKA 4N8SA 3HBLA 4QOIA 3AF4A 1H2WA 1U0HC 2GO7A 4Z49A 4DR1B 2HRQA 1M2GA 1RPJA 2HRDA 3N0TA 4DUGA 4NZYA 4RVNA 4ZRNA 5IHXA 4BAUA 3AEQB 2XB9A 2I7VA 2RGAA 2G9ZA 4NFHA 3FW1A 3GP8A 4QAJA 4UCWA 2M6RA 4EJSA 2OV1A 1QHEA 1XCMA 4KSCA 3AR7A 1ZJ5A 1CVIA 1WKCA 3RFXA 4P6VF 1YMUA 2VDPB 2MOKA 1K7YA 4S24A 3IP6A 3QLTA 1TOAA 1MF7A 2POCA 4K9NA 4F4JA 5HM8A 1PKXA 2GLTA 2VZ0A 3TTWA 4DVGA 5EQTA 2RC6A 3UQYS 1JAZA 1W4RA 2P2SA 1V1MB 5JNWA 1PGJA 4K8OA 4UHCA 2C7PA 4RIFA 2AOXA 5JJBA 1ISHA 4DYHA 2AOUA 3JSAA 2DTXA 2QW0X 1P2UA 4R2HA 3HB9A 3O2JA 3IB6A 2XSZA 3CZAA 3PNYA 4LXGA 1TYCA 2V5VA 5CK5A 1ADFA 4RHXA 2QLFA 2YJZA 3E9ZA 1U1EA 1MPTA 3OZTA 4OA5A 4EQZA 3WLJA 1HDZA 2FMFA 2PV0A 4L5IA 3JW8A 2ZJ3A 1AKMA 1PFQA 2JAOA 4KMSA 2RKWA 4WN9A 4HUQB 3QKSB 4FDMA 1KGSA 3I04A 1VB3A 1CIVA 2UZ3A 3QOXA 5BSTA 2VHZA 2WD7B 4C30A 1K5GA 1LLCA 3QFRA 3ZE8A 1X2BA 5ESWA 1RM5A 4TLDA 4YP9A 2XKKA 4O2LA 2X6RA 1E0KA 2C7GA 1CUYA 3FOAA 3HXLA 1IOWA 1KJYA 4RKEA 4D4IA 4PZZA 2WK1A 4GFDA 1G3IA 1MW8X 4QXQA 3IH5A 4FOTA 4PHTA 2AH5A 1EK1A 3DF9A 2A84A 1LRLA 1AZLA 1KEEB 2BMDA 2N75A 2X0KA 4OQNA 2IUSA 1PV2A 1U5BB 2P1RA 2IKQA 3L05A 5ER9A 3W5BA 5FBHA 4FGZA 4NDZA 5C1PA 2KB0A 1FUUA 2ZRIA 1RLOA 3GAFA 3W4IA 3OOYA 5DK6A 3FZEA 4B48A 2JGKA 3LLUA 4L8VA 3U31A 3FSEA 4KYVA 5JYBA 5CVTA 4CTJA 4Q48A 3C85A 4JVMA 4G81A 2OXRA 4K40A 4OU5A 1K8RA 1EFTA 2CZCA 2NQ2C 4XASA 4N7BA 5FR2A 4HZUB 1VE7A 4PSDA 4CHGA 3LQQA 2RGDA 1YHZA 1DAEA 1UK8A 1J99A 1PT9A 2Z5GA 2Z1DA 4LRTB 4LZJA 1YDFA 4NMXB 5ELMA 3ILVA 4NCBA 1D6NA 4M8IA 1I7NA 4FIDA 4TS4A 2XNSA 4XFKA 5DWDA 3DL7A 4OSOA 3FF1A 1N2SA 4Y7DA 4AWAA 1QORA 2XNJA 2IYRA 5LDDC 1ILWA 3TKYA 4A2QA 3W5IA 1WKBA 3ELBA 3WLHA 3HMKA 3V7YA 4YHBA 3QUSA 4I08A 1P73A 4HDRA 3QWFA 3BUSA 4ARVA 4JJ7A 2ONJA 1Z0KA 1NSTA 1J8YF 1T2NA 3TBFA 3V1NA 2VHJA 1KEUA 1E2JA 2DFVA 1EGMB 1KA9H 1MUUA 2A9OA 1I0IA 5F76A 3RRFA 1A9XB 1OU0A 1RPAA 3CEPB 1SCKA 1QB8A 1VA4A 3GLHB 4WCFA 2R00C 3TXYA 3LW8A 3C2QA 1ACMA 4QQ8A 2EQ5A 3KLPX 5FBVB 5EJ2A 1XHFA 2EV9A 4IJUA 2E1RA 3V00A 4BQRA 1M34B 2QUHA 3OJXA 1KOJA 1IOLA 1K3FA 1Y6JA 2HF8A 2IH2A 3TR6A 3S44A 2J09A 1MIOB 2D1QA 2G1UA 2QN3A 4IBOA 1CUDA 2WEKA 1FRZA 3EVNA 5JAUA 2VAXA 5BNFA 3RYFA 2P68A 3GFOA 1IN6A 2B61A 3PQ8A 3QLUA 4K9RA 2IELA 3CO5A 2VNJA 2KSQA 2QU7A 2ID7A 2AFVA 2C3PA 2J6CA 4BNFA 4POOA 4DG8A 1E9DA 2P9GA 3ZZNA 1PWEA 4NFLA 2NSHA 4HZGA 2Z3WA 4ZARA 4ZAVA 3REOA 4RD3A 5M3BA 3T9EA 2P8SA 4GMXA 1RYNA 2WG1A 3UHFA 1FNMA 1GG2A 1MXHA 1VSUA 3VAZA 1VGRA 2WAXA 1T9GR 4FYMA 2OAP1 4RGBA 4PS0A 5T6MA 1P1FA 1Y98A 2ETVA 3IHWA 3RYIA 5K8CA 5JG7A 1LDEA 4H18A 1OLUA 4TV9B 2WIKA 2V8BA 1A5BB 1PFUA 3FAZA 4KITB 1GO2A 5IKEA 4QXRA 2R8ZA 3OTIA 4YRBA 2Q1XA 4IGFA 2Z8XA 4JJFA 2PH3A 4CMGA 3ZOZA 3GNTA 4EUFA 4M46A 4ROSA 1XWIA 4F9TA 3QKUA 3LIIA 4GH5A 1OV6A 1HFEL 3QVLA 1ZM7A 5B2ZA 4YCNA 4BC0A 3PQEA 1I4WA 3L4EA 2W2XA 2UXCB 4YROA 2D5LA 5K3AA 1EK0A 2FSPA 3H0KA 4MNTA 4QXPA 4B7XA 5LIPA 5CMLA 3DQZA 2CJYA 2IXEA 5A03A 3V8PA 3ZKAA 3O74A 3X1XA 3DNPA 4EARA 5JZOA 3OTHA 5HK9A 3AB8A 5FFFA 2OD2A 1BW9B 3TLBA 2QL6A 2DKFA 1Y4UA 3C97A 3F78A 5EKTA 1XTBA 2Y4OA 4PSVA 4R9RA 1S4MA 3KQOA 1TPYA 4EELA 4YRAA 3OE5A 3BD6A 2GPAA 3RTGA 2B7BA 2R47A 1BN7A 2W6QA 1L8AA 3RRMA 3QEAZ 2WYUA 4YCAA 3HCNA 2FPPB 1YWGO 1MA0A 3GGOA 4GP9A 3VAAA 3WNDA 3NBKA 3AGPA 5IHPA 2ADOA 3BCHA 3HHPA 4DLNA 5B3KA 3RVSA 1T9AA 1UEJA 3BRCA 3SLGA 2ICAA 3WLMA 1CCWA 2X7JA 1OWNA 3V34A 3WGMA 4IIJF 4KXWA 2ECQA 2X15A 2J41A 3HCDA 4DLSA 4QEKA 3GQVA 5L45A 3EBPA 3STVA 3W3ZB 5CYOA 1L5VA 5B1SA 5ESXA 3W9BA 4K2AA 3VR4A 2FDXA 2GN6A 1UADA 2CYAA 4HL6A 4JR2A 4NESA 1KBZA 5E95A 3RU7A 3SJ7A 3FPCA 1U28C 4ZPXA 2UZ1A 3QBVA 4ZO4A 4MV3A 5AVZA 4RSRA 1E9FA 2ECFA 2DHEA 3KV3O 1RC0A 2B99A 2P5SA 4A92A 2LNDA 4B7UA 1DAKA 1DWUA 3RF6A 5EYPA 4D9BA 3CJQA 4R0MA 1P91A 4X8LA 1SXIA 3Q8XB 2P6OA 4QOGA 3VV3A 1NI4B 2HFJA 3STHA 3X1KA 3RM3A 2OB1A 2IDMA 1M7HA 1XCPA 3U7IA 1K4KA 2I4IA 3QKRA 3U40A 1E1QD 3NHZA 5KYWA 1AQJA 3R3ZA 4J07A 4ZU1X 4IM7A 2CMKA 4DGQA 1TJYA 1P4SA 3QE4A 5CXSA 3QW2A 1D8TA 1SRRA 2ZR8A 3NHKA 1D2CA 1A96A 2GF9A 4G5QA 2F3UA 2BLNA 1JHZA 2AHOA 2ZI7A 4F2GA 1IEWA 2AFHB 4MB6A 1SQ5A 1L7VC 1ZX1A 2AJLI 4KWTA 2ZTMA 4DR4B 5I8WA 3BDAA 1KDRA 1OWMA 1KOFA 1VM6A 2W8BB 3GAAA 5JWRA 1DMRA 1II8A 2DGDA 1Q83A 3QVUA 4C08A 2C57A 3PI6A 4H17A 4B8YA 3NP9A 3OX3A 3VZSA 2M1XA 3R24A 2QRVB 1SVMA 2AF3C 2PYZA 1Y1KE 1BOFA 5C8DA 1ECGA 5JXIA 4DMKA 1GL7A 1G8MA 4J7UA 3GLKA 3ZUGA 4BKMA 1Z34A 3Q88A 3O3MB 3AFGA 1Z39A 5JXGA 2Y2UA 2XUQA 4Y6PA 2YW9A 4Q3DA 2PPVA 2Q1UA 3ETEA 4XCXA 1WBBA 3IHLA 5FPTA 4YQFA 3LJKA 3PHGA 3NDBB 2WQ6A 1MOZA 1UUFA 3LA6A 3SFZA 3RF7A 2PLNA 5IH7A 4WFQA 1C80A 2NYVA 1DXQA 5JYEA 2CVOA 3SQWA 4JLWA 4C3VA 2AEEA 1JH8A 5TDHA 4B43A 2AG0A 3V80A 1YQTA 1Y3CE 2FV8A 4LN1A 5FOWA 4OX9B 1N2EA 1MA3A 4J7AA 3VDMA 1YE8A 5FWDA 5I4CA 1Y7HA 1RLMA 2FK7A 4R6WA 2ZANA 2BC9A 2VK2A 1TYDE 1S6YA 1F8GA 1G20E 1U8FO 4ZGGA 1E4OA 4L28A 4E07A 3U3ZA 1E9BA 1T6YA 1X7ZB 5KO2A 2FKNA 2JJ2A 4GOOD 2FOXA 2WZCA 3RS5A 1E3EA 2BTQB 1FDVA 4RQTA 3WIVA 3E9QA 3WXMA 4ARSA 4OUDA 1QTQA 4PWZA 3DP7A 3W7AA 1XNHA 1HBJA 4PZYA 4Y1RA 2D2FA 5KAMA 3MAGA 5LCXA 2UUCB 5ES4B 1QANA 3K5IA 2Q21A 1TD9A 2WTUA 4L5BA 4HDSA 1AE1A 3FUXA 3O4JA 2IPXA 3E5RA 3TW4A 4KRGA 3ISVA 1IY0A 4GPD1 4L0QA 4FS3A 2V7XA 4F04A 4Y1GA 2XQKA 5KOJB 3UC9A 3WDKA 3T06B 5TGTA 1DC4A 1JKJA 1UPAA 3O4VA 5JS6A 5CITA 2NO1A 1TO6A 3MJTA 4UAUA 4CL3A 3SZMA 3PUXA 4G23A 3E58A 3JTEA 2RHCA 3PDWA 1FDRA 5GONA 4ZMBA 1X19A 3PB3A 4PFSA 4TV8B 2ZSFA 2WMNB 5C7LO 4GZ5A 3T4PA 2AR0A 3ASVA 3EEBA 4MWBA 5CYFA 1U1CA 2BONA 2R1VB 1UFKA 3SBOA 3PD7A 3BGWA 3BGVA 1NX9A 3DXYA 1U4SA 3EIUA 3H2ZA 4FZ5A 1ZK4A 4CXMA 5EWJB 5HOQA 3U13A 2DPHA 3Q9NA 5AW8A 4EW2A 2VXOA 4MW4A 2O6LA 3LQ2A 2RGBA 3QA9A 3S5JA 4II7A 1QUEA 3V4PB 3HBMA 4RDCA 4FNAA 1JQBA 1R0BA 5LWQA 3H3XA 4WIAA 3MUOA 1VBFA 5DRYA 2VUHB 4D9KA 1ZS9A 4KKXB 4K7JA 5SZKB 3ZWPA 5CX1A 5IAJA 1NW8A 3O75A 1XTTA 3F3YA 1WTAA 3OT1B 1M8FA 4AUNA 3ZDYB 4C43A 3F1LA 2R4TA 2AN3A 4MKIA 3SE0A 3PYLA 4P1ZA 2O0KA 3OPYA 3FYUB 4IRUB 1T5BA 2J5XA 1LKZA 3QLJA 4Y6QA 2H7YA 5E6RB 1FFWA 1MABA 2IFTA 4JSYA 4C4TA 5B58T 1EB9A 2QYTA 5IK2A 3LPDA 4K6CA 4MWTA 1MJHA 4YV2A 3HVRA 2VDQB 3DBRB 4K46A 4L8GA 3TAUA 4LSZA 1Z6GA 3JQ8A 2HBRA 5DBIA 3VTZA 4U2KA 2P2YA 3EBOA 4CV0A 3G0OA 4ES6A 1NOIA 4RMNA 1XP5A 2XD9A 3SS8A 4WL0A 2EF1A 5AW7A 3DWGA 1E3JA 1OLSB 3FGPA 1Y4DE 2GARA 4OAPA 3ZYZA 2FSFA 4WESA 1AQIA 4LYYA 3HJRA 5F98A 4EG3A 1IZ9A 4RIHA 1SXJA 2C31A 2P65A 1JA0A 1MAHA 1WZIA 3UQZA 1UWCA 3O8DA 1B1CA 3ANMA 2RK4A 4TT3A 4CT0A 1ICEA 2XHEA 3GEDA 1JI0A 2FLKA 2PLWA 2VSXA 3T99A 2HADA 2RI6A 3EC2A 2HMTA 1C0LA 2FK8A 4X65B 5FUWA 2VZ8A 2Q5QA 4KWIA 1Q1ZA 4R1OA 5B5SA 3GEIA 4NABA 4PNZA 4NIMA 3ZE9A 2OECA 1Y5NA 4FGUA 4KGZA 4H4CA 3OBBA 3FUUA 2QN2A 3T7RA 1IAQA 5JH7A 3FJOA 4AY6A 4D25A 1ZQ1A 1W59A 4HDMB 3PQ6A 4DARA 1E8NA 1ZW1A 4X71A 2Z95A 3MLEA 3NX4A 1CQJB 1AK1A 3TJZA 3GLFE 1YZLA 3W2GA 1UC5B 3DQQA 4ZTZB 1OE0A 4BEVA 1JV2B 5C9ZA 1QCYA 2EP8A 3D3WB 2IPAB 5KVVA 3TGPA 3GEEA 2I1LA 1OIWA 1QO0A 1HTWA 4V0LA 1B8UA 3UT5A 4AN4A 4EPVA 3CY6A 1R66A 4NBVA 5HP4A 3B6ZA 4O8CA 1FXWA 1X9IA 5AW4A 4D8YA 5K0JA 5JADA 2HUNA 4MVJI 3Q0EA 3OQIB 4YAOA 1RI2A 4Q93A 3BE5A 2V5AA 3CO0S 1SIUA 2ADMA 5CT6A 1FDSA 3T7CA 2ASVA 3T4EA 3IPRA 4LK3A 3SIXA 3SKVA 1S0UA 1UK9A 5CLQA 4BMYA 5KNCH 2FP3A 3PSAA 4H0CA 4LHWA 4OLFA 5GJCA 3KL4A 1DLJA 1QCCA 5D3MB 5JCOA 3KPVA 4M60A 4KQXA 2IL1A 3IGFA 5JVDF 2GB4A 3PNPA 4DV3B 1XDBA 1T0HB 5JZ9A 4L57A 1EBFA 4Y9RA 4NH0A 3FDFA 4A2CA 4EM6A 2QJRA 4C3UA 3IQGX 4LHEA 2C4NA 4LHVA 1OYVA 3HCOA 2GNPA 1UPTA 3V9PA 1MC1A 3X0DA 3ZWQA 1WCYA 5GADl 3W5AA 2DQSA 4CLXA 4BGDA 3ZJVA 2G72A 4LDPA 4D4KA 3EDOA 1VXOA 5HPYB 1JE1A 1N1DA 3CX8A 3T1QA 1E5LA 1ZD2P 2OV2A 1ZIXA 3F3KA 4MKRA 2JZCA 4EA9A 3AP2A 1RCFA 3ZXSA 1KK0A 1JG4A 4AMZA 5JRZA 3I6YA 2VBIA 4GR9A 4F97A 5F23A 1SBIA 1ILEA 3GH3A 4LQCA 4BFTA 1CXZA 2XEDA 2R6ZA 4FFRA 3S68A 1T2UA 4ZCSA 3VV2A 4TLCA 3NRJA 3ROXA 5BSRA 4GBJA 2R66A 2YDXA 2ZWPA 3ZN2A 1NVDA 4FR0A 4HR7A 3WIDA 2PU5A 4HYYA 5TQVA 1VMAA 2XMGA 3OZIA 4Y9SA 3L6DA 3MTIA 3MTAA 5HFNA 2FUG1 4QU8A 5BP7A 2C3YA 2IEYA 4AB1A 5JYDA 1GPNA 1X7XB 3R3JA 5CVUA 3TJMA 3F3MA 1ADCA 4N76A 3VZCA 1DKLA 1FQJA 1LK0A 4G1CA 4EUNA 2QD4A 3GAZA 4W7IA 4RXUA 4F1KA 4Z4CA 1U8CB 3X1MA 1ZGBA 1RABA 3IAS1 1TMGE 2LIPA 3IOBA 5A9TA 4YX9A 5IZ4A 3NIDB 1ZK1A 2A3RA 5KEIA 1GKUB 1KTVA 3TZHA 4ZGWA 1QP7A 4PYRA 2IS6A 3DTYA 4HEA1 5INTA 3ZDEA 2K2WA 2Z6VA 4JJ8A 3L7AA 4RK6A 1E6EA 5L6LB 4U9UA 2HV9A 2J3MA 5TX7A 4JI7B 5DM4A 5CB4F 4W5WA 4G4IA 6GPBA 4AW9A 3QF4A 4M1SA 4LXQA 1QGDA 4OK5A 1IEQA 4QLAA 4C7MA 4Q6WA 1HH4A 2YKGA 1K9VF 4A0RA 1VCOA 3OU7A 1CSEE 1B0AA 1IDOA 3OY7A 2I4TA 5G4LA 4C03A 1GL9B 1QH1B 4IMRA 1TMYA 3EVAA 1NR1A 4B3RB 3B89A 1QYIA 2BHLA 4GSLA 4IXWA 2QLMA 1WM1A 1L5KA 1MW9X 2H1VA 2IU4A 3M70A 3KPJA 4QD3A 1DE0A 4OXIA 1G8GA 5IVPA 4IWNA 2WR8A 2C5AA 1PG0A 4MVJP 3GA7A 4PLGA 3ZG6A 4DNOA 2XZPA 1KRHA 4X92A 1ODLA 2PUFA 4M0MA 2X9QA 2WKWA 4GE3A 2GPSA 4O4LF 2FWNA 1I3NA 1SBTA 1Z38A 3F9CA 4YONB 3R0IA 4RLQA 4REMA 1HE3A 2PZEA 2ZI9A 1P7ZA 1G8YA 5FNVA 4MS1B 1GPKA 3ZW7A 4GVPA 2VUTA 3D6HA 3ORQA 1M2OA 5T6BA 1ZD3A 2DY0A 1TK2A 3E2IA 2VEDA 3L1HA 1LD3A 3LXXA 3PC6A 1CUZA 3BCRA 4JZYA 3ZU6A 3S55A 4OFBA 4FE3A 5EJ5A 3DS8A 4B6JA 1GGFA 4M8LA 4DMFA 3SG0A 3RC8A 1CRPA 1GADO 3H1BA 1Y34E 3S2SA 3ZDCA 4MUIA 1ZA2A 1UMDA 4RY2A 4QFMA 3BFPA 1ULAA 1X3SA 3K9LA 5T64A 3CVVA 3PNOA 3C43A 5HJ5A 4IH4A 4NENB 2VXYA 2X8WA 3FF4A 1YD7A 5HOEA 1XTIA 3CUEF 4NCXA 4XB2A 1NPTO 1KF0A 3FFTA 3PGXA 2X13A 1VLVA 1ZUNB 1I10A 3NEJA 3AILA 2HA7A 3JQGA 1EPUA 3P97A 3U7JA 3WL5A 3R23A 4WZBE 1GWNA 4IDHA 5G1NA 3H8VA 5GV8A 1FUIA 4LYJA 2XMPA 4JR0A 3DZHA 1K2VN 3TZKA 3MMZA 1IWBB 4PX3A 2V7EA 3R8XA 3JYQA 3BMNB 3OT4A 1U1FA 4FYIA 1MNAA 3NEPX 2QAGA 1IB0A 5AJUA 4KWCA 4BNWA 2F1RA 2PJRA 1H05A 5KJ6A 1XCOA 1RWQA 2CFRA 1R0CA 1VP3A 2Y0CA 3KXIA 4REOA 3IKTA 1NE2A 2JD1A 2P91A 2ZRKA 3BIXA 3CYFA 1PJZA 3M1IA 5E9WA 3EPJA 4LCBA 3R09A 4JOSA 3UHPA 4U8HA 4WEQA 4PNPA 3SQMA 2VDWA 4YK7A 1EH5A 4ZIRB 2RI0A 2YZMA 1OFIA 1NL3A 3FTEA 3HFRA 3WLPA 4BKOA 3E6AA 4KV9A 1PGNA 3TMKA 4RTQA 2O8BA 2B1QA 3BD9A 1PSWA 5ALYA 1BWRA 1PP4A 2WM8A 2HHAA 2ACEA 4I46A 2XGOA 2QQGA 1G4UR 1K1EA 4FFDA 4L4YA 3ONWA 4ZKEA 2YV5A 1SUSA 3TNFA 5LMUB 4WMLA 3IO5A 4ZU6X 2WTXA 3RBZA 2GJ8A 1CUFA 3PZBA 3Q3IA 4RHEA 3C3WA 3OETA 3HPQA 2I66A 2QT0A 4MMYB 2FUEA 4QAQA 4GM4A 1PWXA 3VM6A 3OWXA 1TEHA 3B6MA 4LOHA 2YICA 4QM6A 1YZKA 3FCAA 1D2HA 2WA2A 1M2HA 3S2FA 5HW0A 1ZNZA 2H29A 2VS1A 4WWHA 5FLXA 4V0ME 1DIAA 3IESA 5F2OA 5TF0A 4LDQA 3OA0A 1LBIA 4EGAA 1CUAA 2SCUA 2WSYB 4H08A 1C4KA 3D5QA 4RANA 3IKMB 2FUNB 2JIMA 2QDKA 4ZOLA 3C6YA 2EQAA 5LBUA 4INJA 1HT0A 1SCAA 3T95A 4NCNA 4RJIA 3W7BA 1P44A 3U0BA 3WHPA 3TKLA 3HCCA 3FM9A 3FCUB 4D02A 4PS1A 2ACWA 4R7ZA 4U2GA 3URMA 5C1BA 1GN9A 4AY4A 1MQAA 1N6PA 3Q0TA 3MERA 2H1HA 4XIJA 3LL7A 2ZS7A 1DKPA 2BGIA 2PA3A 2VCYA 3D2CA 3QOFA 4XDHA 2IOFA 3CM0A 5I9MA 3GLGE 5DX1A 3ICEA 1GARA 5FLEX 2FFAA 3SJBA 5LQCA 2ZDHA 1I7PA 1N5LA 1KNQA 4XJTA 2HF2A 4Y2YA 3D8TA 1CUEA 3LYHA 1IXSB 3FZYA 2FVYA 1NXOA 3ITKA 1DBRA 4FSHA 1P17A 3R77A 3W3AD 1S2MA 4HTFB 2BJHA 1RQ7A 2OFPA 1O0BA 3EG9A 2POQX 4PQGA 2JEOA 3RVKA 2BFCA 3JR3A 4QU9A 3PXBA 3QE9Y 1QNLA 1UKEA 2OWDA 2IU6A 2QYOA 3DFKA 3OA2A 3FNRA 4PLHA 2DHDA 1P6XA 3L2OB 4DNQA 3GNLA 1CR4A 2CLFB 5BSVA 4KK4A 3USZA 2OD7A 3LZDA 2A0WA 3G1UA 3HKCA 4BLVA 1XXHA 1Q20A 4FP9A 4YCDA 2Z3VA 3CUWA 4E3WA 5KHAA 2JD0A 4GBED 1EM8B 1IHOA 4J3JA 2QGZA 4HWTA 6PFKA 4E03A 5LSAA 4N03A 1Z2OX 1DG9A 2PO5A 2ZOSA 5KX5F 5BSMA 1N8SA 2OBBA 3L4SO 4B32A 4IHQA 5B53A 1NLFA 4C7OA 3ZDBA 3MWEA 2OT3B 3G0GA 2NT3A 4GQAA 1XD9A 4I5FA 2Z1MA 2R11A 4WY2A 1ZMRA 4O6VA 4K6HA 5TQ2B 3SC6A 1G8AA 2X77A 4I9HA 2J4FA 1E4EA 3R7FA 3A58B 3Q3CA 2XYVA 4L7QA 4CQMA 4Y2QA 2XDYA 4FZVA 3GWZA 3W8FA 3PDJA 3CNOA 2XWPA 3PZRA 2Q7XA 3ASUA 3U16A 1OD6A 3PPIA 4KLRA 4EKYA 4FVTA 1G2QA 2H1WA 5CNKA 2ZUWA 2R5FA 5FKJA 1DWQA 1X8XA 3A31A 4ZVOA 5BORA 1NMEA 3JATB 4KXMA 4QBFA 4X6XA 4E32A 3R5XA 3VJLA 4I1PA 3RSZA 4BC1A 4BY9E 3J81A 1WMFA 5E38A 2PPLA 5CLHA 4TT8A 5DYYA 2R96A 3RG2A 3Q9UA 2DPGA 4F2HA 4BN4A 4BMOB 3RKUA 1C8LA 2ZYUX 2RG7A 3UF0A 3H9GA 3C3JA 4GZLA 1II9A 1C7RA 6LDHA 4MA4A 1PEDA 2IDKA 1KY2A 4KXXA 1SQGA 5K8LA 1OFHA 2QVXX 1VMEA 2XRFA 1XTUA 3AR4A 4Z7NB 2HSDA 1MOQA 1V3QE 3EQ6A 1Q17A 4D4GA 4ZZ1A 2XCUA 3PL5A 1MZPA 1EJ6A 1VYUA 4DDKA 4C7VA 2BDEA 2FAXA 4YJHA 5J2UA 5H16A 4PG4A 2QD5A 4PO1A 3WGTA 2HSZA 3FNHA 1WF6A 3RVMA 4II3A 3VR5H 3ZCXA 2VTBA 1NA5A 1E2PA 4ABYA 5FPYA 4UXIA 3HY4A 2JIZD 3OESA 4D6XA 3CZQA 5CG2A 2GLXA 1TAGA 4Y2RA 1FFXA 4TVBA 1YQ9A 3OEWA 1YKFA 4YI5A 1QZ3A 1ZFNA 1D0VA 1EZZA 3JQAA 1NAHA 2YQ5A 3GDHA 3KVOA 3IR5A 2LV8A 4MUJA 1YFLA 3OZEA 1EI9A 4N39A 1EDZA 1F12A 1R88A 2XDQA 4ZQIA 3PSHA 1ML3A 4V1CA 3PE3A 4YAEA 3O9VA 3ZBTA 1WUTA 3A2LA 2HL6A 4M0KA 3HUTA 1UT8A 3ZV7A 4XM1A 2VZEA 3O1IC 1V96A 3ILXA 1NIPA 5K05A 2V96A 4R84A 4QQRA 4WZAA 3O82A 5C81A 4FXOA 2ZJ5A 4R5HA 4CIXA 1E2NA 1QWOA 4O59O 2Y99A 2XVYA 2D5AA 4BNUA 4S3MA 4C7KA 3REGA 3KKQA 1XU7A 5KUTA 5CD1A 2ZEJA 2ZJ8A 3L4BA 3PQ2A 3G5UA 3T8YA 5J23A 1YR1A 1C30B 4KLZA 4G37A 3TDKA 2QR2A 4X6LA 3V9AA 2FEAA 2H7CA 3TSYA 2R8EA 3LYLA 1WDMA 3V1MA 3M0EA 4B2LA 3N3AC 1GCUA 2YV1A 1KYTA 1ND6A 2DSTA 3PDIA 3AU9A 2PNFA 3MXTA 4OHOA 3GXOA 1H2AS 1FJHA 1JJVA 1TUBB 4GG1A 4MTLA 5C1IA 1RAAA 1DFHA 2QVBA 4F3YA 2EFHB 3H9QA 1WBDA 5EN4A 2UKDA 4MHSA 3A3KA 3H18A 4ARBA 2DBZA 2ZBPA 2YBEA 4MIYA 4BASA 1TYBE 1A8IA 3T5DA 3OQJA 4WK2B 1IBSA 5KAPA 1V8PA 3I6MA 4Z53A 3LPAA 5EWLA 3LQ4A 1O57A 4YUYA 1UJNA 4ZKDA 3QFHA 4G67A 3C5VA 2HIHA 2VPYA 3DMTA 3DDZX 5I6DA 3ACDA 3ABSB 2H5EA 4GZMA 2DU8A 4NZ9A 3PHLA 3CG4A 4BVGA 1P2SA 3AY3A 4DIUA 1Z0DA 1N6OA 1YA4A 4Q18A 4D57A 3Q2IA 4LZLA 4Q3LA 2CHGA 4UZEA 2WU8A 4AP9A 1TVKA 3SCZA 4RDIA 3U4IA 5LZ2A 3E7FA 1QJCA 4GLJA 5BQFA 2R5NA 1J07A 4FLEA 4R05A 4OHXA 4AN0A 4OL9A 2VFAA 2DHCA 5FHQA 3P0HA 4X1IA 1N2BA 1GZHB 5AJYA 3GPCA 3WSWA 1UINA 3PKJA 1KVQA 4KVFA 1JXQA 2FHSA 4CR8A 4EEKA 4IG9A 1BMTA 1RD4A 1KERA 2VVTA 3G23A 3K31A 3NBAA 4DCCA 1K4MA 2EFYA 1YVRA 2G6TA 3AC0A 3AHHA 5EOVA 1DIGA 2JI7A 3FCEA 1DQSA 1Q0UA 1WHSB 5HMMA 4FFNA 4C9BA 4MUGA 4F38A 3G0HA 3SYLA 4ER3A 3TMYA 4KJXA 4WTOA 5U4XA 1ES9A 5TT0A 2HH9A 4BQEA 1ZM3A 1GL3A 3BB3A 4FOSA 4R41A 2NVUB 4EX7A 1Y3DE 4QQFA 2JARA 4J2OA 1ZN7A 4EJ2A 1Z0JA 1BC5A 3CV3A 3I2IA 4AVYA 3EXIA 1U3WA 2PYIA 4GLFA 2B8JA 3EAFA 3BVPA 4Y6LA 3ERCA 5CLFA 1YQWA 4YFYA 4RK0A 4V0NA 2FMKA 3LP6A 1ZYUA 2NTVA 5E6SB 4HPJB 1DAHA 2P9YA 4Y9DA 1W88B 3R9XB 4ZQBA 2XOXA 1H4VB 5BUSA 3JD1A 2CXNA 4G09A 4MPTA 4S04A 2AD5A 3OQBA 3U7QA 3L46A 3VC7A 4IIVA 3LHIA 1NOKA 2Y9MB 1FFAA 1E9VA 3OOEA 1B23P 2RB5A 1J90A 3JQBC 5DX0A 1Y5MA 1MAAA 4I50A 1EP9A 3PWSA 2HA2A 1E60A 2CK3D 3JX9A 3X1JA 3GW8A 4JI8B 3U0VA 3WHIA 4DWOA 2W6PA 2AWOA 1DKUA 2WJJA 4I5EA 2I6TA 3DE1X 4GM0A 2I78A 1ORDA 3B3JA 5GY7A 3QX9A 4N0DA 5AVJA 2F8MA 2QMZA 2W22A 1ZK2A 3KTOA 4TTVA 3A4TA 5HKAA 1KO1A 2P35A 3TLZA 3U4QB 4RTRA 4EH1A 4OSEA 5KVAA 5IDXA 1QDLB 3TTYA 1F9AA 1SR8A 4Q21A 3ZC3A 3ZK8A 5JROA 5L3SB 1P8JA 4HD8A 3TQFA 4KR7A 1DRKA 2GCIA 4F3CA 5DM0A 3LC7O 1BVHA 1EX6A 2J0UA 4C0BA 5EPEA 3TCNA 3BXGA 2GQ0A 4BOYA 2EZ9A 1U3FA 1YKGA 2WVGA 2FZ4A 1JJFA 4LYDA 1QQ7A 2AYZA 3IJPA 5CJJA 5ICMA 4JP8A 2ZETA 1QZZA 1JVNA 1WUJS 1Z2CA 2OO7A 1NN3A 2DTDA 2Z8YM 3GCWA 1EFUA 1ZM2A 4GR4A 5TQJA 3RLFA 4F72A 1H2HA 1N57A 2FN4A 3FPAA 2RC5A 2UZ0A 3NAZA 1YH3A 2BP7B 5K3CA 2P11A 2B82A 1AXGA 4UPDA 3AG6A 3DW3X 1ZDMA 3K8ZA 1KFKB 2NT4A 4R1TA 2CZQA 2XODA 2RHHA 3I64A 1E3TA 1B42A 4N5HX 2QF7A 5EIBD 4MS4B 4YQEA 3WX0A 2NPOA 3K9FC 1IBRA 5TVGA 1GTVA 5BV1A 3TEJA 2VWGA 3SYRA 4AXBA 3ZJ4A 1XCJA 2EKDA 4MPPA 4WASA 2R3SA 2YJGA 3FOCA 1JP7A 1HMYA 1GUZA 1L7DA 4HHEA 5EP3A 4FB5A 1JFVA 2PM8A 4IO1A 1V26A 3U5ZB 1N2CA 4TLMB 3A3OA 4NSNA 4S12A 4O0MA 4FBLA 4AURA 4HF7A 3ZY6A 2YXNA 1UDCA 3D7MA 1UKAA 3PCRB 1XD2B 1FXSA 3NTQA 5LZ8A 4AZ0A 1Z4OA 3IBSA 5PGMA 2VJAA 2I65A 1RKBA 1O94D 1DPGA 5FORA 5I47A 3KCQA 3SR4A 1ODJA 3ROZA 3DAYA 3ESQA 3W0LB 5EHXA 2FPRA 2BLLA 3VTFA 2FQ1A 1UMCB 4XWWA 1TEZA 1KVTA 4TKZA 1R3UA 2AMFA 1FLDA 1QFMA 2FCRA 3NDPA 2Q1YA 4ZRMA 1P0IA 1UBSB 3WK5A 5A5DA 2PUGA 3PNMA 2BEUA 3PTAA 1LSOA 3T5CA 3KB2A 4PNEA 3D6NB 1EJBA 2JHPA 5TEVA 1MQSA 2DPLA 1RHUA 4HDCA 1XRSB 3ICCA 3ER6A 3N3BC 4FFVA 2AIRA 1U0GA 4PLYA 3LE8A 3O3CA 1K6MA 5F4BA 5IARA 3DWIA 3NALA 2ZIEA 3E61A 3UMRA 2BEKA 3N2KA 1E94E 1DSSG 3I1JA 2ZYDA 3AJ9A 3K53A 1W2WB 2CSXA 4F0JA 5EHNA 2H0RA 2W43A 2YHAA 2ID9A 1ISIA 4OYHA 1K3UB 2JFHA 1CUWA 1VIYA 1ZCBA 4P3NA 3RIHA 1X14A 3W79A 1FFCA 1ZVMA 2W48A 4B7AA 1ZRNA 3D4BA 5D00A 4Z51A 3I76A 5CUQA 2JK1A 2P69A 16PKA 1GVHA 1SMKA 2ZUCA 1AA6A 1OZ0A 3REFA 5HX7A 1XGKA 2EFGA 3HV2A 2EBUA 5TE9A 3PHHA 2WABA 1CE8A 2GCEA 3OKCA 5ALHA 1TK3A 5AW2A 3CFYA 3MIIA 1TF5A 4JLKA 5HS6A 4JASB 4GMHA 5TF4A 2YCLA 1OH8A 2H06A 1L5RA 1VTKA 1D9XA 2P6NA 4PO8A 4OBEA 4NNJA 1WVMA 3TRKA 2ZAOA 3KYBA 3P20A 1ORTA 4EHFA 1V7CA 3BJIC 4LOLA 1JILA 1LGYA 3WIEA 2HO5A 2HQBA 3I05A 4WCVA 4RZ3A 1MCZA 1OBHA 4DS3A 1IJBA 4TM8A 4DCGA 1YBFA 4CNQA 2RAVA 3E7XA 1RWBA 4FZ3A 2IS1A 3UO8B 1ZZEA 1USIA 1S3FA 4BP3A 1H5NA 3LUHA 1DIRA 5CB6A 4G36A 3T3EA 1AKUA 1D6MA 3QU4A 4IF6A 1UKCA 2WLSA 3PQDA 2ZVPX 1KTIA 3EXHC 3O38A 3Q8LA 5AJHA 1YZUA 5IT0A 1HE5A 1G55A 2C9CA 2PUWA 3Q7PA 4DFDA 2HRCA 4B4KA 4FEAA 2MU1A 1DJOA 2G8LA 5IUNC 1L1FA 1T6BY 3IPXA 1F4PA 1J97A 4Q39A 4CU5A 1ONNA 1FQOA 1SHLA 3GT4A 2BN4A 2FQXA 4LBYA 4NQZA 3KT8A 4PQRA 4EFLA 3CUKA 3HZRA 1Z5WA 4E7OA 2WDPA 4NNOA 4G9BA 3MJDA 3HJCA 3OE7D 4MIOA 3WXBA 1A2BA 1DOZA 4BVEA 4EABA 2R8YA 2OGTA 2Y6VA 3T5MA 3EIHA 1AHPA 9ATCA 1POXA 2YMQA 2Z09A 5A1JA 1G3QA 1XAIA 2BFWA 4HRVA 4IZHA 2ZCJA 3ZKWA 3D31A 5AESA 1PX0A 4XOIA 5KTTA 3NUQA 3DE7X 3N2LA 3ROGA 5ALDA 1R9GA 1HQCA 1IE3A 1PW5A 3VAYA 4X7RA 4AJNA 5LDHA 1I7SB 1PI3A 1E1RA 1Y89A 4LNUA 5TPWA 4EHIA 3GFRA 1ICIA 1ZRHA 2PXCA 1E2KA 2HK7A 2RH5A 2ZI6A 3KVRA 1O58A 3PFWO 3QXHA 3RSSA 3OG9A 3GRPA 1K98A 2VBFA 4XTCS 3BJMA 3W5DA 3BG5A 3T4XA 4UDXX 3W6NA 1BNCA 2F1JA 3UK1A 1BX3A 3V1UA 3FBWA 2VP4A 1F06A 3AHDA 4G5YA 2JBAA 3NG1A 1UKBA 4H7JA 4N82A 4XLTA 5EIAA 3UAYA 3LGXA 5EPUA 3PUYA 2IZ5A 1IY8A 2VPPA 3K9BA 5IULC 1NBMA 2XB4A 4PBSA 2IDZA 2HK8A 2MIIA 4H7FA 2D0OB 3D4OA 3MXOA 3V8EA 3I3SR 4GSYA 4ICIA 2QTGA 2WJ4A 4G63A 1G16A 1P7WA 2YTZA 2B2CA 5EE5B 3PVCA 1USKA 5J4VA 1CZLA 5A4KA 4JKIA 4JC5A 5ITZA 5JS7A 1P62B 4RZSA 5A62A 1KFCB 3TD9A 2TMDA 3DLCA 4ZOBA 1SELA 2PSHA 3MJSA 4LRYA 5FP0A 5J4KA 4EI8A 1U0RA 3KXKA 3G9QA 2AHRA 3N2NA 4MRMA 3DFFA 5HIKA 5EVCA 2HW8A 4CL0A 1JR3D 1PYDA 1G38A 1KC1A 5K4HA 4JC8A 3BOSA 2FXIA 1IDN1 2N46A 4Q4HB 1G6OA 2J5RA 3BULA 5AKXA 5EKDA 1NJ8A 3VPGA 4F1WA 8LDHA 2Q0HA 2YWEA 3WTCA 4D4LA 5FQNA 3KBOA 2AOTB 4JC4A 1XLTC 4EPYA 1ISPA 4UUMA 3RO7A 2D13A 3T54A 4A0FA 1LDNA 3UK0A 2KW5A 2JNWA 2C78A 3ICOA 1O97D 2DUNA 5EP1A 2EDAA 4M9ZA 1N4AA 1H6CA 1KR2A 3OTQA 2HPAA 1H8EA 2GEBA 3KG2A 3N5CA 2WA1A 1AIPA 3DVLA 2DFKB 4N40A 2XYGA 2OYRA 5F5NA 1YL6A 2ODPA 3QRWA 4QJ4A 2XDAA 3A6DA 4EQ6B 5I9NA 3E9EA 3P2YA 5FTNA 2X8BA 4IF4A 1UODA 2D62A 4CM3A 5I7RA 1CUJA 3L7OA 4G4SP 2A9PA 3G2KA 1RYZA 4EA8A 1DOAA 1DVRA 2EKQA 4U2BA 4B3DA 1LLQA 3DO8A 4WHMA 2HLHA 1LI7A 4IRXA 5EIWA 2HK6A 2YWJA 3T15A 2OQ2A 3QPAA 2PANA 3LQKA 1PVVA 3TFQA 1CY7A 4HJRA 3M3DA 3BTVA 1PNTA 3RWMB 2QSZA 3TCXB 3IUBA 1ZCJA 1T3TA 2L42A 2QNRA 3H11B 3TNJA 3ZDDA 4X8MA 1F7VA 2B92A 1R5BA 1TT5A 1E64A 2P5YA 1ESCA 3N8IA 3PPXA 4TOIA 3WJ1A 1GNSA 1BHSA 2CXUA 5HA5A 3H2JA 2V8OA 3HRHA 2TYSB 5TV2A 3TOSA 4U5XA 4XGKA 4PC7A 3L7MA 1RI4A 3P2KA 4Y6RA 4ZV9A 4MK4A 3ZY2A 3HYRA 1M2NA 3L92A 4Y30A 4EG5A 4EHNA 4B6PA 4LOIA 3GLIE 2J3LA 1G5FA 2BOVA 5TVKA 5E4TA 3B5IA 3KDAA 1JDJA 3DMNA 1M1NA 4BVAA 4EA7A 4IOJA 2G1PA 4KO4S 5JZMA 5A9RA 1BS1A 3ZWAA 2PRZA 4NS1A 3A9CA 1IHPA 3HI6A 2HJWA 5IC5A 2VH5R 3H8WA 3K9QO 1P4RA 2E4YA 4N4AA 4F5EA 4G0VA 1TO1E 2ONYA 3IVRA 1M2VA 1DL5A 2XBMA 3CKLA 4D99A 4L8YA 4D44A 1F3LA 4MW2A 1FDWA 1PGOA 1RI3A 3NT5A 3LA8A 1TT7A 3I9LA 3KZVA 2AJCA 4QJ5A 5FL3A 2AMLA 2EDCA 4L3OA 4GX5A 1VKZA 1PT5A 3AP3A 721PA 4IPTA 2DLNA 4N18A 1JBKA 4U7PB 4BLPA 1JEQA 1UT6A 1DARA 2HDHA 2EVWX 4BU1A 5G0SA 3ZEIA 4KIWA 2A88A 2VJBA 1IQRA 3KELA 1G42A 1LBSA 1MG0A 2AKAB 1Y3FE 2XYPA 1UQRA 4EF6A 1ADYA 2FPIB 3ZHYA 4TSFA 3THXB 3WFIA 1Q7TA 5DM70 2FMXA 2BRUC 1TAQA 2WAAA 1LSUA 5IEBA 4F5YA 3N8NA 5FOTA 1QYDA 3RFCA 4C88A 3S28A 2O8EB 3BA6A 3ONFA 2ODEA 4FCVA 2BGNA 4FILA 1MV8A 1PYGA 3VHXB 1K88A 3PP8A 4MVJH 4NF2A 3NHAA 3ZDRA 4DLPA 3GZ4A 2FXVA 1H9CA 1CHNA 1BAPA 1Q14A 1NASA 1YULA 4IHKA 3FNBA 4NCJA 1DCTA 4TMVA 3SF8B 1ZM9A 2ZIXA 4BO1A 3AF2A 2YYYA 3SJAA 4YTEA 4S1TA 1D9ZA 4D3YA 1Y63A 1CDEA 3OPVA 3MW8A 1GRCA 2P4QA 5IH3A 4DUYB 1FMFA 3B1VA 2DCUA 3AJEA 4GUAA 4LZZA 4B4OA 4BE7B 4RDHA 4D0LB 3TSZA 4FQ8A 3FLAA 1U0SY 1G3UA 2CJXA 4RE6A 3NNNA 3HEBA 4CKXA 3PBKA 1M6EX 2RE8A 1WP9A 4PZ9A 5EIBC 2C54A 4NMLA 1E2EA 3ILHA 4N9QA 1L7MA 4HB0A 2QENA 1CC1S 1T34A 4QJ3A 3EZ2A 3WL7A 4CIYA 5I7EA 4NE2A 1W5SA 1F2UA 1Q7GA 1WZCA 1A2QA 3CSUA 4GXRA 3AR8A 4MEBA 1FS6A 4D3FA 4E2XA 1P1RA 4J90A 4UHFA 4G65A 5A3SA 4DBLC 1ZI6A 3EMKA 4D2IA 2N9UA 3NPAA 5B4TA 4HYEA 3HR7A 2IHTA 1NWHA 3D81A 3KSZO 3PEFA 4WJZA 2YL2A 1L7XA 1O94C 4HEJA 5E6UA 2CL6X 2QPOA 4G85A 3KJHA 5I7AA 4AX4A 1EK2A 4E5DA 2X8JA 1ZIDA 3K9GA 1XN1A 3FKJA 4EGCB 4BXOA 2H9IA 4Q15A 5CTJA 4TXHA 2C1EA 3SR3A 3X2SA 4DMHA 3OCZA 1T1SA 3ZU5A 4D46A 4DLLA 4ID3A 2H59A 1CZRA 3FUVA 5DX8A 2FQWA 3QG5A 2H4ZA 3DT8A 4ZANA 4XSGA 2VJMB 1NLMA 5FULA 2GEJA 1IRIA 5HFJA 3RK0A 1PK9A 4MW7A 3M6FA 1NXQA 1CF2O 3VSAA 1G8PA 3DXZA 3H5AA 3D6UA 5CBKA 4UEJA 2QTFA 3IERA 3LWZA 1KPIA 1WVGA 4E2YA 4EGJA 5D7NA 2HMUA 2VPXA 5FA8A 2JFXA 4KAAA 5AD1A 1WNFA 3LI2A 3N8DA 4EYKA 2Q0XA 1JEDA 3RV3A 1JG2A 5LFAA 3UMVA 1E6LA 1IONA 4CFYA 1ISGA 4CCWA 3AW9A 1Q0PA 3GFSA 3IILA 1NNLA 2C95A 3CISA 1O5IA 2V65A 2YRXA 1MO4A 4IX1A 1GUFA 2OCIA 4RJLA 1U7ZA 4A03A 4MUXA 5LOVA 1CS0A 5DXAA 4D96A 4BO3A 1AHIA 4A10A 4EHBA 4POAA 1DQYA 1A95A 2ONKA 1VCIA 2VCEA 3IXQA 3BQMB 4LRWA 3U39A 4DPLA 3A6ZA 5CA1B 4ZRDA 1USVA 3QXGA 3O8NA 5A7GA 3DBOB 4BV9A 4ZHSA 1H2BA 3OTOB 4W7HA 4FMDF 3VVCA 2I3ZA 1Z5OA 3WYAA 5LQAA 2F2TA 2RHOA 3WQHA 3ZHVA 1E89A 1FJ2A 1KSJA 4JODA 4PGFA 1GV0A 5A05A 1P4AA 4BP8A 4UU7A 3QEMA 3R75A 1QC5A 1ZD4A 3FPEA 3U2QA 1XPUA 5C3UA 3O73A 1PWZA 3ES9A 3VX4A 3GCGA 2FEPA 3SX0A 1KKMA 1NBOA 2OM6A 1SCQA 4OQQA 1Z2PX 4BNTA 4QNRA 2RH9B 2GPBA 2B5OA 1SCUA 2WE8A 2P6PA 1OBOA 4M0LA 2XR1A 3IBGA 3DDWA 3M5CA 4ZYVA 3L8EA 5FI3A 1X1RA 1U98A 1XC7A 2XA1A 2WIDA 4NPAA 5FWYB 2NYAA 2PXAA 5U9CA 2R0QC 1ZH2A 3TTXA 2QP4A 1EFRD 3WGYA 3CURA 1BEZA 1Y3BE 4C0SA 1E1NA 1BQ3A 4IIDA 2CVPA 2W58A 3Q5DA 4AT1A 4PC1A 1L5GB 4D9MA 3F47A 3J81k 3NM4A 5CVJA 1QIIA 4WOJA 3B7WA 3I6ZA 5BN3A 3L0SA 4UM8B 1KY4A 3BL8A 1U63A 4MV4A 2I62A 1BMFA 1KH1A 1NVTA 1XEWY 1BQEA 4MW1A 5KQGA 1MG5A 3M9XA 3KYDB 1KQNA 2B4YA 4URZR 1DIOB 1RI1A 4NYMQ 2YWXA 1VE3A 1UL1X 1FYEA 4EW3A 2A7QA 4ZAWA 3IEUA 3N53A 3NU1A 1CJKC 4YMVA 4B35A 3O2NA 3DLPX 5KZMB 4IQ4A 3WQSB 4H31A 5K3FB 3AH8A 4Z9BA 2Q2OA 1ZR4A 1H3NA 2IQIA 2E6UX 3OJLA 1JAXA 1UWVA 3FFXA 4M89A 4TTTS 5HE9A 5T3UA 3RSHA 2PGJA 5IYZA 3IJ5A 1QTRA 4P38A 3FXAA 3PV0A 2PKEA 4JJ6A 3PGVA 4UFNA 3ZY4A 4ZJYA 5DN9A 2XTNA 4PYOA 2H2DA 1S2GA 2HFKA 5C1DA 3B1JA 3RSCA 3RQSA 5JCXA 2I6UA 4LFAB 1M54A 1EESA 5BSKA 4NBSA 3ZVMA 2EX0A 2PO7A 4X54A 4NBTA 2OM2A 1AB6A 2WBLC 1ZJZA 3MWDB 3FA2A 3TLKA 5EWMA 3K5WA 3MM4A 3LSTA 1DX4A 2PY6A 4EVRA 3A1VA 3LT4A 4ZO6A 1YQXA 4EITA 1QZXA 5ITWA 3HYLA 4XD7D 1K92A 1ELOA 2OVFA 3KQSA 4ND8B 1EXNA 1ZC3A 4BCDA 4V3BA 5GINE 2XJ4A 4UTVA 2I6GA 2A1UB 1R50A 1WD7A 2IIPA 3NIFB 5LP6C 5AVOA 2WY2D 4CMEA 4L9AA 3F4KA 2V7PA 3OJEA 4CU2A 4OY3A 5BSFA 5IVHA 3IMCA 3IB3A 5DHRA 3V4LA 3EVEA 1Z4LA 4LE2A 4KQGA 1JLHA 2QRKA 1VG9B 2FPMA 3RS2A 5KOHA 1MB9A 1VDMA 1CF4A 3AI3A 3EHEA 1R7RA 2LD4A 4XPIB 3HUEA 1GIAA 3IQXA 2LVBA 2B2XA 1SOUA 2CFCA 2GM5A 2P9BA 2QYSA 3D8NA 4QG7A 1B16A 4NEGA 4RC9A 3RG8A 1DS6A 4BNDA 5A2GA 4KFCA 2A33A 3WNCA 1OB2A 5KDOA 3G7NA 4V39A 2NO7A 4BNGA 4WUTA 5JSHA 1O97C 3KOYA 1RTTA 1VI6A 4UD6A 4LC9A 5E8RA 2A8YA 3CCFA 4LDRA 4W1PA 3SK0A 5EL0A 2IE8A 3K2IA 5DGDA 2IPMA 2NP7A 2WE7A 4L9RA 3GRYA 1X1QA 1Z83A 3F7MA 3LXMA 5J59A 1L5HB 1LTKA 1QQAA 1QF6A 3A70A 3EG5A 3EBLA 3O4HA 4MAAA 2UXDB 2ZRNA 1RE1A 1PS0A 3BC1A 2JBWA 3EXFA 3VDNB 3LUKA 1M73E 2AK3A 2WJIA 1YIAA 2OD9A 3DAOA 4CF3A 3R5KA 4E2FA 3HC7A 4TMZA 1ECLA 3N0VA 2Z2ZA 3M9WA 3Q7RA 4BJ5A 4CR6A 1L5ZA 1P1JA 1PJSA 5FTKA 4LJRA 1I1NA 1TA9A 4UU1A 3G9TA 5T8KA 1YFJA 4GUDA 3JQ7A 4IO0A 4PIVA 1Q16A 5K99A 4F86A 2AWNA 5FD8A 3KB6A 1JSZA 3DZGA 4JXKA 4LNHA 4XIGS 4ZTBA 1CUCA 1WCIA 3ANSA 3EQ7A 2WD8A 1T35A 1Y7IA 2C20A 2NUAA 1LDYA 3M4YA 1KU6A 3RRZA 4IKPA 3ESRA 4FC6A 4P4SA 1BHJA 2QAJA 3X1ZA 4KXFB 2HN9A 4FI3C 4IV5A 4X97A 2VAVA 2Z2IA 1RP7A 4HAYA 1X77A 3VPCA 3S8YA 5HS4A 2X8AA 4TWBA 2HM7A 3FRIA 4HVLA 4OM7A 3CPEA 3Q7IA 5EZYB 2QL9A 1V71A 2G3YA 3GBSA 3T0FA 3MGCA 1F60A 1SZJG 3GVIA 4TLEA 3LDFA 4JJGA 4EHAA 4EZEA 1WXXA 1W73A 2NZXA 4DABA 3E7DA 3GRFA 3MT9A 5K3DA 5JALA 4BKRA 4CGZA 1U04A 3K1YA 4PSKA 2YIVX 2P77A 3YASA 3TRDA 2IXTA 1V11A 2H92A 2MMGA 2X9LA 1J0XO 4RXMA 5HZMA 4DR3B 1IN1A 1V47A 2WP0A 1I36A 2PX4A 3JZFA 3V8RA 4E22A 3C0KA 2PWPA 5FUXA 1KH3A 4LJKA 3ST7A 2UZIR 1GNQA 4M98A 4C6RA 2X76A 2P3SA 4HDNB 4YJ3B 4F85A 3NMUF 1YS1X 2W2LA 3MBOA 1TTPB 2CHVA 2R4UA 3KEOA 4H3KB 4YMGA 4IDAA 3V7NA 4KUGA 4CKEA 1TYAE 4URFA 2VC2B 4GWKA 1P9RA 2C1ZA 4YRMA 4LOKA 5H59A 5I7SA 5K4GA 2PBFA 3KWLA 5FI0B 3VU9A 3W8EA 2MHCA 4OF4A 2B5VA 5BNZA 1FF9A 1RXWA 5AW3A 5DCUA 2CNOA 4JYMA 1J9EA 4CF7A 3HJAA 5JC8A 3BDIA 1GEGA 3E4DA 4P34A 3FROA 1TK9A 1Z9BA 2Q6KA 4XI9A 2B83A 5ETJA 2DVMA 2WSSA 4B83A 4BLRA 4CV2A 1ZH0A 2M2IA 2VUUA 5IKXA 3WGUA 1DXYA 1GP2A 2B25A 4U6SA 2QJWA 1Z7YA 5JYCA 1FNBA 5A7FA 1BDMA 5TIIA 3H2SA 4FYVA 4D9JA 4HNUA 1LPSA 1SURA 2C42A 1DGQA 1RAGA 2AOUB 2X1MA 3BE6A 3IHTA 5LL6P 1LX6A 4RMJA 4E46A 2AW3A 2Q46A 1RLUA 4AJ2A 1RRPA 1RJEA 1ACLA 2Q07A 3FX2A 1R5JA 3MWJA 4FONA 4Z3KA 2O5EA 3WGGA 3T1YB 5EUBA 1GR1A 2JPDA 5BQ3A 4WN9B 2D1YA 3VKUA 3MG9A 1XNJA 1ZVQA 1O6BA 4GYKA 4JIGA 3AT1A 1L7QA 1D03A 1QK5A 2QZ9A 2XXJA 2YRWA 4LBVA 4ME6A 5DNAA 3HSYA 4Q37A 2AMYA 1IZ0A 4YLYA 4O2AB 3IAM6 1L5LA 2BSQA 2VHUA 2JFQA 2J59A 1PT8A 2GMWA 3Q7SA 3VI3B 5FUMA 1U0NA 4XARA 3IMEA 1EG2A 3TSOA 2GN9A 1COWD 3NAQA 4BO4A 1X8KA 3OCCA 5AK0A 4ARZA 4D5EA 3PDHA 4BTVA 5C31A 1T2CA 5CM9C 2P40A 3BE8A 1SUAA 3I83A 4X3PA 1OKKD 4MVCA 3VTKA 5BQOA 4PLZA 3L9XA 3KQQA 4URXR 3OC0A 2DLDA 1KEPA 3KX2A 1FPQA 2ZS9A 3A1CA 3V1TC 3WKDA 5BUZA 2LDXA 2J4DA 5ALFA 2WIAA 4QUBA 4BRZA 3A3YA 5FOUA 2GF2A 3RNLA 4MAFA 3F73A 3S3TA 3DBLA 3M81A 4BECA 2B3DA 1Q7RA 3PDUA 4H60A 1Y5LA 2W2NA 5DMXA 3PG5A 3D59A 2OA0A 4CUKA 3QFTA 3EMDA 1VIVA 1XRLA 5LM3A 1PFVA 4H1HA 1DXHA 2QHXA 2R6GA 1MO3A 3OHSX 3CX3A 1PL7A 1H4TA 2JJ1D 1JIVA 2NXJA 3AF5A 2V7GA 4KK3A 1TMOA 4B3BA 3GR6A 4LJSA 1U0BB 1W5BA 3F8TA 1Q44A 4RK1A 4X0EA 3KKEA 5C37A 2XQGA 2HWWA 1J70A 3EEFA 5FNZA 3FMPB 1PGPA 1SA0A 2JI8A 3FZQA 3JD0A 3K5PA 4HDRB 4OHBA 1CERA 2GD6A 4AS3A 3LC1O 3NH9A 1V5WA 1FTWA 4FE7A 4JA0A 4ZZIA 2PUCA 2ORYA 3BIFA 4GE0A 1BD4A 1Z4MA 4BNIA 3FG9A 2AZTA 4FWIB 4WCFB 5L3ZA 3SM9A 2PKXA 4BO6A 1T8WA 2GDZA 2C84A 1U1IA 1VL8A 3C1TA 1C8BA 1CQXA 2J08A 4BWGA 2EARA 1VL5A 5ADVA 4OXRA 1HX7A 3RYFB 4GPAA 1KEKA 3QJGA 5J63A 4A0SA