3V9AA

Crystal structure of esterase/lipase from uncultured bacterium
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
296
structure length
293
Chain Sequence
AGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase/lipase
publication title Crystal structure of Esterase/Lipase from uncultured bacterium
rcsb
source organism Uncultured bacterium
molecule tags Hydrolase activator
total genus 105
structure length 293
sequence length 296
ec nomenclature
pdb deposition date 2011-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v9aA00
5K3BA 1WHTA 4WFKA 3AJAA 1RYYA 1CUSA 3X3HA 3T52A 1MX9A 3H04A 4B0OA 1JJIA 2D5LA 3BE8A 4GBGA 2WG2A 4B82A 2BUBA 1CFJA 1K4YA 2HIHA 1AQLA 2XMQA 4U2DA 5DWDA 1R9MA 3BL8A 3H17A 4W1RA 3TGLA 3K6KA 4KJXA 5AKGA 5FDFA 4BDSA 3O0DA 5HK9A 3D2BA 3C6ZA 4GI1A 2BUCA 2O2IA 1FSSA 1UKCA 2CZQA 2WLSA 4YK7A 2VQ6A 3I2FA 3E4DA 1YCDA 4OYLA 3K2IA 1RWQA 2JGLA 1ZGCA 1E8DA 1BS9A 1QOZA 3EQ7A 3ICWA 2D0DA 3FNBA 1W75A 2GZSA 1D07A 3C6BA 3W04A 3A2LA 1A8UA 1QE3A 2O2HA 1THTA 1WB6A 1EDDA 2WHRA 4PO3X 3WKAA 5AK5A 3NOXA 2G4LA 3V1KA 4J0HA 4G1FA 4Q05A 4NZZA 4MXDA 5A62A 2JEYA 5ALZA 3FBWA 5CH5A 3H2HA 5LZ7A 1W4LA 1QIEA 1GT6A 4OB8A 1BU8A 1CVLA 5AK3A 1AZWA 1ODTC 5HF8A 4IH1A 3DNMA 1S8OA 5BWCA 1E8NA 4UBIA 1Q83A 1OILA 3H2KA 2J4FA 4G8BA 4G9GA 4FLFA 4C4YA 1XQVA 3ZLTA 4EHBA 1QLWA 2JGIA 1CUEA 2WHPB 4J0JA 2WKWA 5AOAA 1Y7IA 3DYVA 4PW0A 2WIKA 2X76A 3F9CA 5A7HA 3WWOA 3D59A 1H23A 1EX9A 2BJHA 3FWHA 1ZJ4A 3WL5A 4A23A 1FFAA 3AFIA 3EQ9A 2OGZA 3R3ZA 3A70A 4UFNA 2WFLB 3VDXA 2EDCA 1YS2X 3WIOA 4B80A 4X93A 4J03A 1IMJA 1XQYA 3DKKA 3W2TA 1EB9A 3IIIA 5BOVA 1NU8A 2B9VA 1LPSA 3ESBA 2Y1KA 1LPOA 5D3KA 4YPVA 4MQLA 5AIAA 3Q0TA 5K3FB 5AICA 1R50A 3IURA 4M0MA 5ALVA 1QIIA 1EINA 4DLNA 1VA5A 2WJ6A 5T4EA 3DDUA 5IKXA 2HDWA 3HLKA 1W76A 1YASA 2GBCA 5BWBA 4KE6A 4NVRA 1SCQA 1DWPA 2WU4A 3R3VA 4HXFB 4O08A 1X70A 1DINA 4UBLA 1U2EA 2VAVA 1MN6A 3LIIA 4Y2SA 4FLEA 3FLEA 2HRRA 1VZ3A 4UPDA 3DL4A 4B9AA 1TCAA 2V96A 4ZWNA 4L9AA 5JALA 4FWBA 3STUA 3FYUA 5ALMA 5HCUA 2DFPA 1HBJA 2GYVA 5AHXA 3R41A 2JGKA 3DQZA 4P92A 3C8HA 1TAHA 4MQMA 5AI5A 3WJ1A 1VLQA 4HRXA 1WPXA 3R3UA 3DCNA 5A2GA 2ZYSA 4C01A 2ACKA 5DYWA 4WDQA 3C45A 2XQFA 2VTVA 4C4XA 3C70A 5ALNA 3ESCA 4Y2TA 3ZLVA 1VXOA 4BZWA 4PV7A 4BTVA 5CRIA 3WL8A 5IVIA 5EIEA 3PF9A 3AZPA 1YAHA 4BC1A 4OCZA 5IVHA 2PPLA 1JT2A 3OPMA 2XUAA 1XKTA 3LCRA 4D9JA 5T4FA 4GXNA 1TRHA 1LPPA 4DNFA 4GW3A 4Y2JA 5HFNA 2XT0A 1AC5A 2XMRA 2BFNA 3E1GA 1JMYA 2DQZA 4QDOA 3OURA 3G9ZA 1LPNA 4XX1A 4Y2PA 1JJFA 3VVLA 1E89A 4AO7A 1MX5A 4QZVA 3O4HA 3IUMA 2O2GA 4AXBA 2AJBA 3F96A 4BAUA 1U65A 3IDAA 2G63A 1GQRA 4BP9A 2WU3A 1IVYA 4BDTA 5LKRA 3DJYA 2HL6A 4K6GA 1AX9A 1GGVA 3H18A 2HA7A 1ETHA 2AJ8A 3EBLA 3W06A 5ALIA 1G5FA 3RARA 1R88A 3JWEA 1LNSA 4UBMA 1CUFA 5C7YA 3UMJA 2Z3WA 1UT6A 1F0NA 2J3QA 1IUOA 2HA0A 1YB7A 3H2JA 2V9ZA 1K6EA 3V48A 4IHAA 1TCBA 4F60A 4AMYA 3I6MA 1A7UA 3HC7A 4L0CA 4L3WA 4H7HA 4TPKA 3WQHA 5AI9A 4DSZA 1LPMA 5SYNA 3AZOA 4W9RA 5CH3A 3FCYA 3WA6A 4BAGA 5JD5A 1FFEA 3WKEA 5HKBA 5FOQA 4BP8A 5DNWA 1LGYA 2WIFA 2OG1A 3IB3A 3G0DA 4NMWA 3STXA 1EDEA 2GYWA 4CIAA 1XRNA 4X6UA 5HF9A 1LZLA 4INZA 1UXOA 5E4TA 1K5PA 3G9UA 5AK4A 1LLFA 4RE5A 2HFJA 2W6CX 2VT7A 2PSFA 5AI0A 1GZ7A 4XWGA 4A16A 1SCKA 4IQ4A 1DX6A 1A8QA 4K2AA 1XRRA 1EK2A 4G5XA 3PICA 3G0BA 3MGAA 4AN1A 4RNCA 4AQDA 1GPNA 1JI3A 2HA5A 1XZIA 1YB6A 2XUDA 4P93A 5JASA 4J0GA 1E8MA 2ZJFA 3HEAA 3WK7A 4H18A 1F8UA 3BDVA 3FSGA 3IVMA 5EHQA 4E15A 5AKXA 4GLBA 1YSCA 1ZGBA 4B0PA 2RHTA 4ZRDA 1UOQA 3VXKA 3I2GA 3KD2A 2QR5A 1J06A 2OQVA 2Y6UA 4X97A 3C43A 5KWIA 3H19A 1CQZA 1UWCA 5ALYA 3SX4A 5E4YA 4EY6A 4QDUA 1ACJA 1CUVA 2HM7A 4AMZA 4E46A 2ZYRA 2VSQA 5AKYA 4OPMA 4PSDA 2QOEA 3OM8A 5T4HA 3C5VA 1UZAA 5BV7A 1QTRA 2WIGA 5I7UA 1XZDA 2E3JA 3TRDA 2H9YA 3GELA 5CT9A 5CXXA 5ALEA 1XRLA 2WIJA 4G8DA 4MEBA 3KXPA 4QA9A 1CPYA 1VJ5A 4JH0A 1ZI9A 4X71A 1F0PA 3I6ZA 3F97A 4LYDA 2J3DA 2ZJ7A 2ZJ6A 1NX9A 5DTIA 4DTCA 4KAJA 3I2JA 1BN6A 2AJDA 4CCYA 3WIBA 3QMVA 3PF8A 4H7KA 1ISPA 5JZ9A 7YASA 1BCSA 2WFMA 5AK6A 4X92A 5AH0A 1XZMA 4Y2QA 5CT8A 4DNOA 5D7BA 2CEKA 2Y6VA 4GDMA 1U4NA 3BIXA 4HZGA 2ACEA 3C8DA 4LIPD 2QMQA 2WTNA 1SC9A 1ZI8A 2VA9A 2XUKA 1E5TA 3OOSA 3C6XA 5ALOA 3L1IA 1MX1A 4V2IA 5DLPA 4C88A 3HZOA 3I2IA 1FFDA 1EI9A 4W1SA 3H0CA 3RKSA 5FPPA 3C6YA 4B81A 1USWA 2ZSIA 5LZ2A 5IVKA 5ALFA 1C7IA 1ZIXA 4AN0A 3DKRA 1QIFA 4KACA 3D0KA 2DR0A 4F21A 1XZEA 3LS2A 1VKHA 5AKIA 4CI9A 3R3XA 5A7FA 3GBSA 4H7EA 5FV4A 2BGNA 1C4XA 3EIOA 5ALXA 2ES4A 2YXPX 1QONA 3WWDA 1L7QA 1QO9A 5LLSA 2DSNA 2QJWA 3I1YA 3DOHA 4HTAA 2CB9A 2P8SA 2WJ3A 1CUWA 2WILA 2YYSA 3G9TA 1SOMA 2JGEA 2ECFA 1G4HA 3G02A 1JU4A 1XLWA 1J1IA 4J3JA 4PSUA 3NWOA 5AM1A 4QDTA 3O95A 2VF2A 2YASA 2OCGA 3M3DA 4J0CA 4N8SA 5AKKA 5HFAA 4EUSA 4Z49A 3G0IA 1ZD3A 1MNQA 1EVQA 4CFSA 1UK7A 4RE6A 3CN9A 4X90A 3FYUB 4BVJA 2JBWA 4UFPA 2PBLA 4XIIA 1UKBA 2VEOA 3QYJA 4X7BA 2OGSA 4JYPA 4G4IA 4KAFA 1GPLA 3H1AA 1UK6A 5EGNA 4ZV7A 4BCCA 4AX4A 2BUAA 2GBFA 2QT9A 4KR0A 1QIMA 1L7AA 1WM1A 1ODSA 2WTMA 1JJBA 5I9IA 5EIHA 4WCVA 2OCLA 4OU5A 3V9AA 3KOOA 2XLCA 2R8BA 5A7GA 1QIHA 4K6HA 4MWTA 5JAPA 2QKYA 3U0VA 1WB5A 2V97A 3GROA 3IUNA 2AXEA 3T4UA 2XUOA 4B9EA 4Y2VA 3QBJA 2OCIA 4CIBA 3WL7A 1QO7A 2JF0A 1XZCA 5CXUA 4FFVA 2JEZA 4OB7A 3H2IA 2G5PA 4AZ0A 3HI4A 3WYDA 1TKRA 2FUKA 1Y7HA 3AZQA 2I78A 1T4MA 2JGJA 3ILSA 2RIPA 2C5GA 4ZI5A 1XRMA 2RI6A 4QEKA 5DNUA 4KYVA 4QWWA 4U2FA 2HU8A 1SCIA 5LYYA 3STTA 1HLGA 4H77A 3QPCA 2VJCA 5C8ZA 1QIGA 4N8EA 5D6OA 3V1LA 1JU3A 1XLVA 4QNNA 3RLIA 1OXMA 3FSGD 1XQWA 1K63A 3AINA 4UBNA 3V1MA 2QXTA 3BWXA 5DTJA 5DJ5A 1O6GA 4X95A 3RM3A 4GWLA 2VJBA 3NUZA 2EDAA 1ZD4A 2CBGA 4OD0A 2OAEA 1ZD5A 1E3QA 2QXUA 4FKBA 5ALPA 5H3HA 5LZ4A 4UHBA 3R40A 1Q0RA 3E0XA 1DQZA 3ZPXA 1U8EA 1MAHA 2QZPA 4X3CA 2XB6A 2PUJA 4Y2XA 5JAOA 2WUDA 5FLKA 2ZVDA 4DMHA 6YASA 2WHPA 3BJRA 5E2IA 3TEJA 4FBMA 5HQ3A 3F67A 4G8CA 5K3DA 3A2MA 3OG9A 5C8XA 1BROA 2CJPA 2FJPA 2OCKA 3L1JA 2XUQA 4N8DA 2X8BA 3AILA 3KDAA 1JKMA 4MWSA 1IZ8A 4UHCA 1R9NA 2HA3A 4BBZA 1CUUA 1Q0ZA 3GA7A 1FFBA 1BN7A 4EY4A 2DHEA 3KSRA 1ZJ5A 1BEEA 1UOPA 2PSHA 2PU7A 2QS9A 3ESAA 5AKEA 4C89A 4DMCA 4DYHA 5K3EA 4KEAA 4ZREA 3F8SA 3RK4A 2WUGA 2Q0XA 5AM0A 3C87A 2ZYIA 3MVEA 5AI4A 3HXKA 4S0XA 2PSEA 3G7NA 4BYMA 2IITA 4UBKA 3PFCA 4JEIA 1QZ3A 4FHZA 3D5EA 1EDBA 4UBOA 2XMSA 2ORYA 3CCBA 4B6GA 2XMZA 1CUBA 3FYTA 3WKBA 3FVTA 4Y7DA 4BB0A 3PDCA 1HL7A 2C0QA 4J0KA 4I19A 1CUGA 4BVKA 4GHWA 1AMNA 1CUZA 1B41A 5IVDA 1EH5A 3I1IA 1CEXA 4Y2RA 2HFKA 4LYEA 2IIVA 2PSDA 3BJMA 3PUHA 4B83A 4FLMA 4I3FA 3ZWQA 4E14A 1HDEA 1RP1A 5CTAA 3R3YA 5FRDA 3PUIA 3K9BA 2BKLA 1UFOA 1ZICA 4ZGBA 5JATA 1YA4A 5JADA 4IO0A 1JFRA 5JARA 3SWWA 4CCYB 1H2YA 4BCDA 3KWFA 5ALLA 3D2CA 3AIKA 1XZJA 1HPLA 3WWEA 2VJDA 3LLCA 4DIUA 3DD5A 1DT5A 3QMWA 2GYUA 4UUQA 3VJKA 2PKYX 2Z8ZA 4BTLA 1CUYA 4J0DA 3EF3A 4BC0A 3SK0A 1MPXA 2WJ4A 2I3ZA 3D4LA 2I3DA 4YASA 4X6YA 1PJAA 2K2QB 1CUHA 2ROQA 3HSSA 1BEZA 3FOBA 5ISMA 3P2MA 4CG2A 4Q1VA 1H2XA 4Q34A 3Q8WA 3ZV7A 3F98A 1GKKA 1WPRA 5LIPA 2O7VA 3UUEA 5FUMA 4M0FA 4EY8A 1XZAA 5AM5A 3WK6A 3L1HA 3PI6A 5LZ9A 2VJAA 4HAIA 1UOOA 3WWCA 3ESDA 3MUOA 5LZ5A 2XUPA 4X85A 2XMCA 1QFSA 4DM7A 1QGED 3D2AA 3H2GA 1CUJA 2UZ0A 2QTBA 1KU0A 4U2EA 3LIPA 3ICVA 5FXMA 4WFJA 1XZHA 1CIJA 2OAGA 1MAAA 1WB4A 1PFQA 1PV1A 2X5XA 4BCBA 3WZMA 3S8YA 1M33A 3I2KA 2RAUA 3MUNA 1VXRA 5EHNA 2HA4A 1CRLA 5LP1A 3AIOA 3B3QA 3CN7A 3D7RA 3U1TA 1T2NA 2WHQA 5E4JA 4P08A 3HACA 4J0IA 1C7JA 4FDMA 1QIKA 3IBTA 4UHFA 4BVLA 1XZGA 1R1DA 5EFZA 3BIWA 1YS1X 2WQZA 1GQSA 3GZJA 4FOLA 1THGA 3WK4A 1R3DA 3D3NA 1W1IA 4BRZA 2C5FA 2CUTA 3VKFA 3QPAA 1EK1A 1KU6A 5CMLA 1WHSA 1W6RA 2Z3ZA 2IX9A 2XQJA 4LXHA 1Q84A 3JYHA 1WOMA 1Z68A 1Y37A 1UK8A 2HA2A 1GXSA 3WZLA 1CR6A 2AJCA 1EHYA 3G9XA 1HKHA 5ESRA 2B20A 2Z5GA 3HRHA 4RPCA 5LKAA 4FNMA 4UBJA 5HF6A 3CCCA 1KEZA 1ZI6A 2Z8XA 1BRTA 1CV2A 4BAZA 2XMGA 5FP0A 3WI7A 3O4JA 3FCXA 3HJUA 1IZ7A 3QMMA 3STYA 2V98A 4FMPA 4KRXA 1VOTA 5I8PA 4Y2YA 2H7CA 3B5EA 2C7BA 4M0EA 4AZ3A 1ORWA 3C5WP 1DTEA 5T4BA 1XRPA 1BE0A 2NW6A 5YASA 4Q82A 4H7DA 5ALRA 3ZI7A 2Y2UA 4TGLA 1TQHA 1XRQA 3W9BA 1YAJA 2FX5A 3W05A 5JAHA 2G5TA 5AM3A 3O4GA 4DGQA 4W63A 3DOIA 1TK3A 2H7XA 1X2BA 1ZD2P 4NS4A 3PFBA 1FJ2A 4WY5A 4TVKA 2R11A 3VISA 1MU0A 5A71A 4AO8A 2CMFA 4F0JA 3PE6A 1ZIYA 4H7JA 3DEAA 5J3JA 5AKJA 2DQYA 2Y2VA 5KREA 1XFDA 2ONCA 3HYSA 1BCRA 1ODCA 2WFZA 3M81A 4UFOA 5ALTA 4GEGA 2QJRA 3N0TA 5AI8A 1AKNA 2WM2A 2WG1A 4B85A 1H2WA 3SC2A 4A5SA 1XZFA 4YX9A 1AUOA 2BCEA 3VJMA 3A2NA 1R4ZA 1DX4A 3WKDA 1QIJA 2BAGA 5AOCA 1XQXA 5ALKA 4OUKX 2OPHA 4DMKA 2C58A 4QDXA 4PSCA 5JZSA 3FVRA 4IH9A 3WLAA 5HQ3B 3QVMA 4C87A 3ZLUA 4DSAA 1A88A 1MO2A 5JZBA 1DU4A 1TIBA 1CUDA 2PX6A 4BATA 4OU4A 4L72A 4KE7A 2RHWA 1XZBA 4X6XA 4MJ3A 3I2HA 4MYDA 4KRYA 3FLBA 3R0VA 3CXUA 1A8SA 4BZZA 3GFFA 1G66A 4ARAA 3QM1A 3VVMA 4EB0A 2PVSA 5JD4A 3QPDA 2H1IA 4IH4A 1LBTA 1VZ2A 4N5HX 4PF1A 3G0CA 1QIDA 2PU5A 2RONA 2DHDA 3R3WA 1I6WA 2HU7A 3TJMA 5EI5A 2BGRA 1E66A 2XI4A 5AKHA 3ED1A 2C4HA 5HKAA 1WCYA 3IA2A 5LZ8A 1LPBB 3S2ZA 1CLEA 3QZUA 5JIBA 4FNGA 5CT4A 4LHEA 5ALDA 3IUJA 1NU6A 4X91A 4UHEA 4ROTA 5K3AA 1QTIA 4Q3LA 4EY7A 2XQGA 2WIDA 1HQDA 1N8SA 4G4JA 2PL5A 3DYIA 1IUPA 1VE7A 1H2ZA 2JIDA 5ALWA 1CUIA 3WYNA 3O9VA 3WL6A 2OXEA 2XLBA 1DT3A 1UKAA 2VATA 1O6FA 2JGFA 4HXGA 4N5IX 3DLTA 3WK8A 3O9MA 3OTQA 3WWPA 1JMKC 5ALJA 4WJLA 1DQYA 5DYYA 1QJ4A 4EBBA 5CT5A 5JAUA 1L7RA 2QRUA 2ZSHA 5AP9A 1XROA 3STVA 3QITA 4H7IA 2VAXA 5JYCA 2O7RA 4HVTA 4EA6A 1J07A 5AKLA 4ARBA 4X94A 1MJ5A 5DYTA 3IULA 5JD6A 4CG1A 3BF7A 5CBKA 1SFRA 1ACLA 2LIPA 4ETWA 2B4KA 2QVBA 4B7ZA 4AO6A 5A6VA 1G42A 3O4IA 4BRSA 2WFLA 3NGMA 4FBLA 5SYMA 2ZYHA 5AM4A 5IH7A 1K8QA 3ANTA 3VJLA 2XQIA 2CKMA 4G9EA 1CQWA 4QLAA 4J7AA 3WA7A 1XKLA 2HA6A 2XE4A 2WUFA 4Y2UA 5C81A 4MEAA 4MYSA 5ALUA 4G4GA 5CW2A 5K3FA 1XZLA 4QWMA 1P0IA 4LKOA 3WK5A 2WG0A 3M82A 4E11A 4Y9SA 2XUFA 3WJ2A 4UHDA 1H22A 1GKLA 3BDIA 3I6YA 3BXPA 4KE9A 2PSJA 1FFCA 2W22A 5KWJA 4PQEA 3QH4A 1TCCA 2AJLI 4W1QA 4Q3OA 2PM8A 4U2GA 5AOBA 4X00A 3DS8A 1AGYA 5KBYA 4OYYA 1YA8A 2I03A 1MNAA 1DWQA 5K3CA 3HABA 3LP5A 1EXWA 1X2EA 4I4CA 2XDWA 4B84A 5AKZA 1XZKA 5CH8A 4FTWA 3W9UA 4DNQA 5ALSA 5DNVA 1VA4A 2JGMA 3STWA 4EZIA 3M83A 3GUUA 5AJHA 5JANA 5EIAA 3B12A 2YH2A 3YASA 4OB6A 2HADA 3BF8A 1QFMA 4OSEA 2OQIA 4WDRA 2XQKA 4H0CA 5HF5A 3I28A 4KAAA 4ZXFA 1ORVA 4EY5A 5D3ZA 3WKCA 2HU5A 4DMFA 2RGUA 5AM2A 1P0MA 5ALGA 1LPAB 5HK8A 4QE3A 2FJ0A 2HHAA 5EHZA 4W1PA 2XUIA 5ALHA 3G8YA 5C8VA 3IUQA 1N5MA 1MT3A 4C4ZA 1AURA 5FPQA 2EEPA 2WSLA 4AB1A 1CUCA 3FAKA 4P9NA 2DCMA 5CT6A 3UUFA 4QLOA 4UHHA 2GBGA 3EQ8A 2WUEA 3FLAA 3N2ZB 2HRQA 2J4CA 1OCEA 1YR2A 5K5EA 1IUNA 4HS9A 2QM0A 2XMDA 1XLUA 1F6WA 2PUHA 3WMRA 2OLEA 3AIMA 2DHCA 4QDZA 1ZOIA 1EVEA 3FYUC 4HXEB 5AO9A 3AUKA 4DNPA 1P0QA 3ANSA 4JYMA 3KWJA 4PNZA 1EA5A 3V1NA 4ZV9A 2GBIA 4LXIA 2H7YA 3E3AA 4CG3A 3A6ZA 1GPKA 5ALQA 4RGYA 4XJVA 4LXGA 4BE4A 3WK9A 1N1MA 4H7FA 2QUBA 3OC0A 1P0PA 4FFWA 5EHXA 4F5ZA 3DL7A 5CURA 4JNCA 2B61A 4C6HA 4GECA 4WY8A 2QUAA 1DWOA 4Q3KA 4BE9A 4HRYA 4XVCA 1LZKA 2XMBA 3H1BA 4ITVA 1CUAA 2GZRA 1UK9A 3JW8A 5FKJA 1VE6A 4H35A 1MTZA 1LBSA 4K5QA 4U2CA 5AIBA 2XUJA 3G0GA 4JUIA 1W52X 5F4ZA 4K6KA 4CCWA 1N5RA 2XUHA 1J2EA 1B6GA 2XUGA 5AI6A 4WFIA 5HZGA 2C0PA 2VT6A 4U2BA 1CUXA 1EB8A 4KE8A 2OGTA
chains in the Genus database with same CATH superfamily
2FFRA 1U02A 4XUCA 5E6UA 1JKJB 2BM0A 4BX9A 1XC7A 3R2JA 1MO5A 4IVRA 2HMSA 2NTNA 1Q44A 3PRHA 2DPMA 2G71A 2I29A 3B1KA 5EP2A 2FLWA 3SZUA 1UPXA 4ALIA 3M4XA 1CULC 2GAAA 5EJFA 2G82A 1SPXA 3GLHB 5K0EA 3CISA 4OJYA 4EYQA 3DE1X 3FDFA 2HJHA 4RC9A 4B0OA 5IM4F 1JJIA 5BN3B 1VB5A 3PDJA 4GQBA 4GBGA 3D1LA 3PTZA 2O07A 3HYCA 3KPJA 1Y8AA 1U8FO 3TRHA 2BUBA 4DWOA 1CFJA 1AS0A 2W58A 2UZAA 2Y8EA 3RAEC 2BH2A 5BV0A 2WA1A 1YR9A 5M04A 3N2IA 2YCLA 3PZBA 5DKFA 4CTMA 3RH0A 1DEKA 4H1UA 1PJZA 3E7WA 3HLYA 2X9QA 4JVOA 4NY1A 3KEGA 3GV0A 4UXIA 1M5RA 4U2DA 5L95A 4NSNA 3DV2A 1CTQA 4M9SA 4GXRA 3L84A 4CM5A 1WNTA 3GWGA 4BKMA 5HDQA 4YYEA 4OBBA 4KJXA 4O63O 1HGXA 1EFPA 3BYZA 1ZJWA 4A6XA 4BHTA 4MQ6A 4GPEA 4KX5A 4NP6A 4Q7JB 5FPYA 5HZHA 1FP1D 2CBXA 2JFVA 3NCHA 2BPOA 2QP3A 5J9FA 2CXXA 3QFCA 1YQTA 4ND4A 1NW5A 2A5LA 5KYXB 2IV2X 2R87A 3CF4G 4OQEA 3ANXA 3SMQA 4ZMRA 5TB5A 1L3BA 4RA9B 5ECDA 4Z4HA 5J2TB 3ZVMA 2VQ6A 2P2DA 3PP8A 3BTUA 2IUFA 1PWZA 1RFGE 4C21A 3AB8A 2JFWA 3IPXA 5AUQA 2GEDA 3U3XA 1TF7A 1Y82A 3LCCA 5DOVA 5T67A 1E9VA 1WUYA 4QBHA 1O8BA 3LBAA 5EJ5A 2YXBA 3GUYA 3AHGA 2E85A 1X7DA 4XVHA 3PQ3A 3QUTA 4Y9UA 3KXKA 1T1GA 5JSFA 4J16C 1XTJA 2J59A 2F4VB 5LLTA 2FX3A 3JQ8B 1LY1A 3K0CA 2IHKA 1Z47A 3OJFA 3OUUA 4EFDA 1W75A 2O8BA 2GZSA 3I05A 1NUTA 3GRVA 1GTZA 1USIA 4IM7A 2OFPA 3E9EA 3OLZA 4IIVA 3ISTA 1JW9B 1WB6A 3L8MA 4NBVA 4RKQA 4WINA 2GH1A 4D4JA 4YR9A 3TSZA 5CEEA 5FA8A 1QU2A 2VRWA 5CPFA 1SK8A 3I72A 1KIFA 3BFKA 3HEMA 3JQRA 4EJSC 5BSKA 5JS1A 1ZH8A 1HR0B 3KQOA 1D4ZA 1AZTA 1H94A 2YIJA 3E5NA 5K6TA 1C7ZA 2VUSA 3G1UA 4EGJA 1T2DA 1Z5WA 1CC1S 2W2QA 2HT1A 1Y1QA 2V55B 3T9DA 5CW1A 4GT1A 5A62A 1HRDA 5ITSA 4CKXA 3FBWA 1YE3A 2OSBA 3UG7A 1T0JB 3HL0A 1G5IA 2W6JA 2WR8A 3A6JA 1BH6A 4NMHA 4OHXA 4YRTA 1HF3A 2Q2VA 3LECA 1NBMD 1QIEA 3SS8A 3BK7A 4YO8A 2GUGA 1M7GA 3A4IA 3OTGA 1WY5A 4FOPA 1QV9A 3AV0B 2PTHA 3IPYA 4G5FA 4RHFA 2X0EA 5L4SA 3VR4D 2VN8A 4G5SA 1WZNA 3I9MA 4L4XA 3TI7A 1CVLA 2HWUA 2EU8A 4PO8A 1MXHA 3D6VA 2OEPA 5JXIA 3LP8A 4DWJA 3AU9A 2YICA 1XWIA 3H8JA 3USES 3EIXA 1S8OA 2E18A 4IJVA 4RM2A 3EIUA 4UBIA 4BYGA 4ENTA 5H9WA 2H00A 4HQKA 3KHSA 1OR8A 3PX2A 3H2KA 4K86A 4NQZA 4Y1FA 4LZOA 1R5OA 2C83A 2IXFA 3PFIA 4OHRA 4GBMA 1MEJA 2AK3A 3CIOA 5BYJA 3GGOA 2SKDA 4EHBA 3JZFA 4LVOA 3UAYA 2WKWA 521PA 3QF4A 1XP5A 3PPVA 1J6UA 5AOAA 3CUWA 4OBEA 3BT7A 3LX4A 4GI5A 2HQSA 4YRLA 5FEMA 3QWBA 2J6HA 1G8SA 5IUJC 4I55F 2P9HA 4JDUA 4Q01A 2F1RA 2XSZD 3EHDA 4AY5A 3EFOB 2DFKB 2ZK7A 3F9CA 1TQ2A 5A7HA 3SLGA 3D59A 4TLMB 2G9RA 2J08A 2BEVB 2FN3A 2R5FA 1N8TA 3OM9A 4MCAA 5GOTA 3ZE6A 1BU5A 5EVCA 2R6JA 1XYGA 2QROA 4BNIA 1E4VA 3JASB 4KQMA 4PLFA 3I8XA 5BUCA 2CHEA 4OHBA 3AFIA 1ZCAA 3T7SA 4BL5A 3TW4A 1JA9A 3AM1A 4B6EA 1PL7A 1UWVA 3A70A 1LNZA 4HAUA 4OHYA 4AS1A 1DG3A 2IEAA 3FGZA 2IVZA 2FQWA 4N5LA 1F8GA 4DW8A 1ZINA 3EGDA 1T8SA 1U8UA 2Z9DA 2BFEA 1DKPA 2E4ZA 2QG4A 3B36A 3NTVA 4R41A 1V26A 4GYWA 4IXDA 3T9BA 1XTTA 1YS2X 4NCXA 4DIFA 4IW3B 2FG6C 1R74A 3JZMA 4IX1A 3TWOA 3R5JA 1II9A 5PGMA 4X1IB 1OREA 2AG1A 3AK4A 3DOCA 2OZLA 5ABPA 4J03A 5CDTA 1P18A 4UUNA 1UBRS 3K73O 2BF4A 4U7HA 3LZCA 1RRVA 1XQYA 2PTGA 4PXAA 5KYVA 3DKKA 4Z9YA 5BSRA 3Q5DA 5CB6A 3W2TA 5DVZA 3OTHA 3GD5A 3ZGVA 3WE7A 4ZZIA 2IH5A 3NP9A 4RGBA 2JLCA 5JJLA 4DCJA 2WFAA 4MS1A 1N0IA 2CLHB 1ZKDA 3OIWA 4WKCA 4TLAA 1GZ6A 1MAWA 4X1KA 4A2WA 5L9AA 3SEZA 1BHSA 3OOYA 4TWJA 2GFQA 1Q7BA 2NYAA 4CHGA 1B2RA 1R5NA 1UAYA 3GP8A 4ZAZA 1N7JA 5AIAA 1H4TA 3Q0TA 1SXJD 4PCUA 4F4FA 1X8KA 4DCTA 3M2PA 2CK3A 1N2CA 1RXCA 2IU3A 3QENA 4EI8A 1WW8A 1IIRA 2BHRA 5DT9A 2JLQA 2PZEA 3JALB 3Q7TA 4QX6A 1EINA 3KJQA 3VR3D 2HMUA 4DLNA 5MF6A 1H4QA 1W35A 1N5DA 2VXYA 3GQVA 3L41A 5IH3A 4C0AC 1JHXA 3N9IA 2MTBA 4OUDA 4KP7A 1MHPA 4YRQA 3TTVA 4BIIA 5T4EA 4Q3CA 1B6TA 4MGYR 1V41E 2ZBGA 3OHSX 4I9GA 5IUKC 3IPRA 4DYVA 3C3YA 5IKXA 2HDWA 3TLMA 1OWOA 1FSGA 3I01A 1ZD1A 1A27A 2PUAA 1T9KA 4MW7A 2R6DA 1JWAB 4RYDA 2HR1A 5KVCA 4FR0A 5A3RA 3R09A 1RHQA 3KUCA 1U8XX 5DHFA 4OQFA 1U2SA 1SC4A 1KI2A 3KKOA 3VOTA 5DASA 4V0LA 4YAKA 3DH0A 2GHIA 4M1SA 1SBYA 4Z4CA 3NRCA 4C4SA 1GLGA 5FYDA 5CFRA 5FBWB 1MVOA 1X80B 4WHMA 3PFGA 1EK0A 1RD4A 3D4OA 4O2AF 4S1WA 2QZ4A 2VHVA 4BP3A 3N2KA 3GCZA 3OH8A 4EA8A 1Z0ZA 4A15A 1POWA 1U3WA 1TX4B 1MN6A 1P73A 3AKDA 5EJ8A 2ZI9A 3OETA 3JYOA 5K8UA 4D0NA 2QLNA 2C42A 3A37A 2VKQA 3T7RA 4UCXA 2CLCX 3VC1A 1YFLA 3QX3A 4B9AA 1G2OA 5ESXA 2O8NA 5FPKA 1D5WA 2HQ1A 3LPLA 2HPAA 4BB5A 3C6QA 2B78A 1DAMA 2X7XA 3O6VA 1TAQA 5H83A 2C94A 5LA6F 1GUDA 2XEXA 3HHEA 2Q4RA 4DG9A 1S6YA 1T4GA 3G17A 5AHXA 5FOTA 3CURA 3D3KA 2YX1A 1KPHA 4XUDA 1E61A 2JGKA 1X13A 3MHPA 3CR3C 1UXKA 1NR7A 4URHA 2K7ZA 3P0HA 5H3CA 1E1YA 4PINA 4B4OA 1Z6GA 3MZ0A 5IW8A 4BMSA 3ZG6A 1TAHA 4M36A 5CIYA 1EUDB 5AI5A 3WJ1A 4W5JA 3GMIA 3ONDA 4QJIA 5GZ6A 4ESHA 1D4OA 1WPXA 4HN2A 4LTDA 4PPFA 4IDGA 5F9FA 2PNFA 3QJ5A 6ABPA 4IPTA 5ICSA 4YJKA 5BP7A 5A1TA 5LU9A 2I6XA 2ZYSA 4C01A 2ACKA 2HK6A 1Q3TA 1ZSVA 2WF8A 3OIUA 4WDQA 3KB6A 4LN1A 1CJVC 4Q3BA 2X7HA 1EK5A 2NZ2A 5ALNA 4Y2TA 1E1CA 1RI2A 2F48A 3TE7A 4GPZA 4BZWA 4PV7A 2HK9A 2WSSD 1KDZA 2V9CA 4HEJA 3TD2A 4CLOA 1F6DA 3C7AA 3NBQA 1JFFA 1SU7A 1DKNA 3ZCPA 3CVYA 1VRVA 5LMZA 5EIEA 1Z75A 3PF9A 1QMGA 1V71A 1YAHA 5DYNA 3L9XA 3HVJA 3NV9A 3QG5A 1YDFA 3IFSA 3EXIB 4WCDA 2YC2C 2I1LA 4V0NA 1ZJJA 3OPMA 3ZCUA 1Y5NA 5B3LA 3LCRA 2J5QA 3NEYA 1SBTA 5EG5A 5T4FA 3VC7A 1G1AA 1TRHA 3TOZA 4L74A 1LPPA 4IYRA 4ME6A 3L7IA 4DNFA 1X1SA 3W5HA 1QFZA 1SXJB 2NSHA 1DKQA 1O0BA 5JHHB 1DTSA 4HLUA 1WS6A 2VBCA 3ZE0B 1VE5A 2FPWA 3LQRA 4OGLA 3F5QA 4KR9A 1AC5A 3SKXA 2IH2A 5C37A 3D6FA 1QYWA 2XMRA 1QNFA 2BGIA 3E1GA 5LXTF 4QDOA 3UH0A 1LTQA 1M6NA 3OURA 3PIRA 1TJNA 3O82A 4P32A 5BN1A 3FWPA 1OLSB 4DJDC 3RTBA 1C8KA 3F74A 4ZTUB 5LQRA 3VV3A 2G9ZA 2FMTA 2B37A 3OJXA 1MX5A 3G3EA 4BNUA 4DILA 2YXLA 3PXAA 3O4HA 4RVHA 2O2GA 3TZBA 3AVYA 3EEBA 4AXBA 4PC1A 3PFHA 3QBVA 4MNTA 1SHZA 1B7GO 2GEBA 1SG9A 4UMVA 5JFOA 2O20A 3FH0A 2CNNA 2EKLA 1EP3B 3JD3A 4EB6B 1HNZB 5AVTA 4P83A 1M2VA 2BZGA 2OUKA 4WEQA 4WK4B 3TRJA 1RT9A 5B4UA 1FTWA 4F2PA 1PZGA 2FB9A 1IVYA 2ZBVA 3JQQA 4CKWB 1D4AA 4V3BA 3OQNA 2IUUA 3DJYA 3H5RA 1ACMA 5HS6A 3AO0B 3RF7A 1V4BA 1GGVA 4NHEA 2PZAA 1JZQA 1WXGA 3H18A 3AHDA 3IBGA 3J7AC 5REQB 2NIPA 4O4JB 5KMGB 2ZPUA 1U9JA 4YREA 3KLNA 1X1AA 4NZOA 5IHPA 2GEUA 2HA7A 4YUZA 2F1KA 3EBLA 4MTLA 4YP5A 1GQ2A 2C4TA 5KWVA 4FHCA 4EYOA 3EEIA 4C5AA 2OO3A 2YYAA 5IT0A 4O3FA 4TLEA 3HJCA 5DX0A 3E7XA 4ENQA 1CUFA 3FI0A 2JJ1A 1JKFA 2ZUTA 5ICGA 2G5CA 2OLJA 4P81A 1AKTA 1LNQA 3RRZA 3FZEA 3OOHA 1SZCA 3PVZA 1DUIA 1UT6A 2B99A 4HNRA 3KVVA 1BW9B 4R5MA 3CRQA 4RSHA 1FMLA 2J3QA 3PUJA 3ZLBA 1RWVA 3IBSA 3KP1A 3QMPA 2CLKB 1F0KA 2Y77A 3RWBA 3BVPA 3NAGA 2V9ZA 2ZT7A 3AU8A 1DRJA 3V48A 4RPKA 1JALA 1EDOA 4EX7A 3NHJA 1REQA 1TCBA 3SE7A 1IN8A 4A91A 4Q21A 5BYBA 5LJLA 2IQ5A 4J07A 1V8ZA 4AMYA 4BMNA 4QSMA 1Y33E 1TYBE 3PYMA 1PT9A 1WSAA 3DFZA 1A7UA 1JBQA 2AYYA 2WF7A 4KFTA 4EVSA 1ORIA 4L3WA 1GARA 5BSUA 4GRIA 1H2HA 3WQHA 3UJCA 3I8OA 5AI9A 4MMZB 4DSZA 2D06A 1SWWA 4P38A 2YZMA 4TYYA 4M89A 1DJOA 4W9RA 1PVVA 4KQFA 1E3JA 4BAGA 1DWUA 4JP8A 4O6VA 1TQ8A 3EZFA 5GONF 4JI2B 4M0CA 4Y1GA 1HYQA 2XYHA 3EXHA 3L7OA 5DM0A 4F86A 1CRPA 2HPZA 1PSWA 5J2UA 2OHOA 3TKYA 1EWQA 1RDFA 1NONA 3P26A 2RGBA 2YNMC 3NKLA 1P61B 3UT6A 3NBZC 4HWRA 4M9RA 4FYKA 2BKEA 1BO6A 1CHDA 9ABPA 2Q5QA 121PA 3A1UA 3KZVA 4XUEA 2XCSB 2OG1A 3LRXA 1QAQA 1L6RA 1PFUA 1YJ5A 3G0DA 3L04A 1E69A 4NMWA 1UADA 3QWIA 3STXA 4EKGA 2PJRA 4XDHA 2OO7A 1ESNA 1KDTA 1FRVA 4MP8A 3R76A 1JZSA 4HRAA 4UEOA 1FXWF 3GOQA 4XSVA 1GPBA 2NO7A 1NBWB 2KPOA 2BMAA 3VC2A 1Z2PX 3GAZA 2DB3A 4G5QA 2QZZA 2XQVA 4TXHA 3IVCA 1LLFA 3GLHE 3K96A 2GZ1A 1CNMA 2CYCA 2C97A 2HFJA 2BGTA 3ORSA 3OAAA 1P2GA 3P9XA 4DCGA 1JGTA 4U7JA 4Q47A 2RG1A 3B1XA 5AI0A 2PMDA 5C1IA 2QRVB 4I7EA 1DLIA 2QDKA 3VNBA 4A16A 1YIDA 3PGLA 4IQ4A 2IV3A 4NCAA 3GQBB 3VR5D 1OOEA 4D4GA 1K6XA 3E48A 1I7NA 4FFRA 2Y27A 3AHJA 4UNSA 3JQAD 4CU2A 3PICA 3VDNB 4PZ9A 2YYYA 3D2LA 1D2AA 4JJFA 2JI4A 2PJDA 4AQDA 2PZ8A 3WRXA 5CDFE 4DT1A 1JQAA 5CBPA 3WSVA 4MUMA 4C0SA 1KMHA 3L8FA 5KU1A 1K7YA 1OVGA 3IALA 1WV1A 3IKLA 1OWPA 3QNUA 4PQYA 1TCUA 2RB4A 2H48A 2ZJFA 1ZC4A 4IV0A 4TV9F 1IE3A 1RJFA 3IOEA 4EUEA 4E94A 4MI6A 3TO5A 4HQFA 3O1HB 4N5DA 4FM9A 5AVXA 4EPTA 4AP9A 4RULA 1TQ4A 1MIOA 1ND6A 3RR2A 3SS9X 2I4TA 3FSGA 1HSZA 5GVRA 1EJ0A 3ZS9A 1NUQA 1X7XA 2RHLA 3IMCA 1N6PA 1RPJA 2VZ0A 3RG2A 4ALNA 3FCSB 5KYUA 1NM5C 3E05A 1YSCA 1AGRA 3CLTD 4YPFA 3TFWA 3LYLA 1E9DA 4IFIA 1QQAA 4WZAB 1HE3A 2WWTA 3O8NA 5LFAA 3QU7A 3VXKA 1OI3A 3GLFA 3I39X 2GFHA 3KD2A 1WXQA 1U8CB 2HTFA 4M1QA 4YJDA 5ILQA 2PGAA 2VDWB 3AVXA 2A84A 2AUMA 4OX9B 2NYVA 1H65A 2JBAA 4JYCA 5E3JA 5I7OA 3LXMA 4AZTA 2JCVA 5H02A 1YJAA 3QPUA 4OH7A 2ZUEA 2Y6UA 5AW2A 3S28A 1XB2A 2CNDA 3ZWBA 2NUTA 1JV2B 1Y5RA 3C43A 1G98A 1GAJA 3H19A 4F1WA 1UWCA 3VPFA 1SPBS 5ALYA 1L8OA 3RFFA 1G38A 4QDUA 4F9GA 4RLFA 3AHEA 3H2ZA 1S7CA 3RD5A 5J40A 1SULA 5G4KA 2HM7A 4DL9A 4ECEA 3T7TA 4B3GA 5KC8A 1U7ZA 1KR2A 5K0NA 2CMGA 4HYEA 2F2TA 4LW8A 5JAQA 4ZU1X 1CVRA 3P20A 2WSBA 3UQYS 4RMGA 2A0FA 2QOEA 2C7RA 3IMFA 5T4HA 3ZD9A 1QMPA 1RXYA 1O95D 5FULA 4FILA 1L5HB 1X38A 2GN8A 1UZAA 3NHUA 1IXSB 3HKEA 3OA0A 1GNQA 4P22A 1PV4A 2D1RA 1K08A 1N3LA 4DDKA 1UBTS 5CA0F 1R00A 2W2LA 2H9YA 3CJQA 3LDUA 2UVQA 3BULA 4O5OA 1N2XA 1V2GA 4G8DA 1E1KA 4YP6A 5SYAA 3DLPX 1TAGA 3LDFA 5HGXA 3MOSA 3KXPA 3VNVA 3WLKX 4JH0A 4JLWA 1JPUA 5A0VA 4ND3A 3O8LA 3N5CA 1EZ4A 2K5UA 3TEFA 1XK6A 1Z6PA 1RPTA 6REQA 4NENA 3ELBA 3O2NA 3G5UA 1DRKA 4CDMA 3K94A 1GV1A 4ZOLA 2NZUG 1ULHA 5FWYB 1AHHA 4G36A 5DBEX 3W2GA 3ZCVA 2QTGA 4YYZA 3MMPA 4DTCA 3DHWC 3FOCA 3R9IA 1VCHA 5IAAA 3FFBA 1BN6A 3O83A 3PT5A 2X0JA 5IUNC 2C3UA 5I9LA 4U9UA 1RHMA 4PEVA 2PZLA 2WWWA 1RSZA 3ONEA 3F8WA 3NYWA 5G3ZA 3H9EO 3JQAB 4C7XA 1E1MA 4AMGA 4P58A 3UGJA 3ZU6A 4BQIA 1ISPA 4QUEA 2OHHA 3CYFA 5KWEA 2B92A 5LP6B 1QQ7A 3HGMA 1BCSA 1FMFA 4HR7A 4QQ8A 2B2NA 1XVTA 2NXEA 3GAMA 1ITZA 1QG2A 1XZMA 1WWKA 4UNNA 5BQ3A 1PNTA 2I65A 5D7BA 1E2UA 3GBPA 1IY2A 5ECGC 3HCFA 3HMQA 4TMZA 3OCJA 3OA2A 1SD1A 3ASYA 1NV9A 4JU9A 4RZIA 4YWJA 2II6A 2BR3A 1KZYC 4GVPA 2IY8A 2PRIA 2XKBA 1XZQA 3CJTA 1PD0A 1QC5A 4FGSA 3JU3A 2AN3A 1RQPA 1XRJA 1Z7GA 4HZGA 4DLSA 4XVRA 1Z5GA 2K2WA 2JD2A 5G0WA 1DXHA 1G8HA 3DFFA 2QMQA 4KX3A 1HDIA 1TZ2A 4G26A 3A4TA 4I5DA 2R1VA 1JHDA 5BSEA 2YWEA 3UOWA 2X15A 2CVQA 1RXSA 3EG9B 3V34A 1PZEA 2XUKA 4C6RA 4O2BA 1CZLA 1K2WA 5AQ1A 2H4HA 4A8JB 1PUJA 1Q20A 1Z0IA 1BH2A 1XEWX 2JRLA 4PBSA 2Q7DA 2EGHA 2R8XA 3BREA 1PHPA 1V35A 3SQNA 4D3DA 1X7YA 1A9ZA 2J9FB 3A3PA 3L3BA 5FLYA 4ND6A 3BMCB 3DLCA 1WVGA 1OH7A 4WBXC 4X7MA 2CDNA 3M4NA 1XF9A 4PVCA 2QWXA 3BXXA 2LD4A 3MS7A 4WBNB 2BHSA 2YOHA 1B3RA 4H3VA 1G20E 2VAWA 1ZMBA 2OGWA 2XDAA 3PQ2A 1A5BB 3D6UA 1MTOA 2BFCA 1BWPA 5AHOA 4NKRA 2YXDA 3CLRC 1BJRE 2GHRA 3KYCB 4IS3A 3WBJA 2ZSIA 4KGDA 1DBIA 1MGPA 2R1TB 5H9VA 1KH3A 2C7QA 2BBTA 4REQB 4FHDA 3M4ZA 4QU0A 1O58A 3RUCA 3AVUA 3ADKA 4ILKA 4IHQA 5J58A 3V7WA 1C7IA 1UPTA 4LE1A 4MK4A 2PT5A 1YV9A 5K0JA 2V45A 1U1DA 3TH5A 1DELA 4HLCA 4DQ0A 2GPBA 3IUEA 1CJSA 1BVHA 4U6QA 3HWWA 3AUTA 4QPZA 1XZEA 3LS2A 4CI9A 4ZI7F 4R8VA 4E13A 5KJCA 3UMMA 1R2QA 3KPVA 1GAWA 2FUCA 2HNBA 5FV4A 5I01A 1N33B 4ER5A 3ZWMA 1K7FB 4A6PA 4HPXB 4O4IB 4ZPXA 4C0KA 1P2UA 2WK1A 1QONA 2V74B 1D0VA 3BGIA 1NBME 4NWIA 3WWDA 1BYUA 4F8YA 4Q9JA 3ES9A 4MVYA 5DYGA 2P30A 5CB4B 4FZJA 1UQRA 2H0AA 3U5TA 3KZKA 1CX9B 2B5WA 2O59A 3BA6A 3I1YA 4HF7A 1CG6A 5BWOA 1ORTA 1P7PA 2AG0A 4HTAA 4OGWA 2RSLA 3UKJA 6GPBA 2PYIA 2BM9A 3VZBA 4RDCA 1C7RA 2GZHA 2WILA 2YYSA 3DVQX 4UOQA 3SJZA 4D0RA 3G9TA 4ZVNA 2WUWE 4PYIA 4DDVA 5IYZA 4B47A 5GGXA 4DYDA 1XXHA 1ADYA 3I5XA 3UBTA 1NAHA 1L7OA 1J0BA 1XXLA 3EUEA 1S2NA 3G02A 1RWKA 2NU6B 1AKVA 1WDTA 2OCPA 1JU4A 2AWNA 4II2A 1QH0A 4R2LA 1XLWA 1V37A 5CGQB 1LBEA 4J3JA 3WLMA 3JD4A 2QVCA 3DM5A 1E7SA 2EC5A 4US0R 3O95A 5F64A 5KYGA 4OK5A 1YVEI 2C3YA 3ILYA 3VSBA 1OKKD 1NSFA 2OUIA 4GLFA 3M3DA 4F5DA 1C0EA 4JQOA 4J0CA 4N8SA 5F7OA 1UIRA 4YJ3A 4RS4A 1ZW6A 1JILA 2IZOA 3KAKA 4AFNA 1A69A 4TKZA 1LV8A 2ZJOA 3ENZA 5KS2A 2WBLC 1GA1A 5LNK6 2Z0MA 1ZD3A 1MNQA 1CDZA 2LP4Y 4Z9BA 4F9FA 2ORWA 4JEUA 4DANA 3JAKA 1Z12A 4LOAA 1VMAA 1YFZA 2O50A 3FYUB 4FD3A 4GR9A 5L40A 1E5VA 4JIGA 1ZZEA 3MPOA 2WAXA 4TRJA 3QYJA 1Q1BA 3JATB 4XIIA 3OZDA 3SXUA 3RODA 3VNQA 1V5EA 5FBZA 4GI7A 1RWMA 1T2UA 3G8DA 2PZMA 4GX5A 3B52X 3H1AA 3ZTTA 1OLUB 5EQTA 3HCNA 4QOHA 4BCCA 5ITZB 4KWHA 2ID9A 2RGDA 2IYSA 4Q03A 3VDQA 2QVGA 2GESA 2ZUSA 3BFJA 3U7RA 3ZWXA 3O3CA 4NJEA 3EXEB 5KTYA 3RC2A 4KPEC 3SQMA 3HB1A 4GYKA 4KR0A 1L7AA 1WM1A 3IKJA 1O5IA 2WTMA 2QLBA 3GJ0A 4B3TB 1E0JA 5IF3A 3G2IA 3X1YA 2J9YB 4K3VA 5J4VA 3TE6A 4YUWA 4JZKA 1VLZA 3ASZA 1MV8A 3NR2A 3VR2D 2IPAB 3X1MA 3THSA 2QN2A 1Z2CA 1KI4A 2G9QA 3KKZA 4M1OA 4PBRA 2XLCA 1LV7A 4HQNA 1EFHA 1UDCA 4KLNA 3TX2A 4D9KA 2O0MA 2DLCX 3QHPA 1E64A 4QBIA 4RIGA 1JIJA 2EFGA 2NZVG 2PAFA 3QVJA 2ONZA 3UYLA 5BORA 4TL8A 1JDNA 4CLEA 3S55A 2C2WA 3KRTA 1R5JA 4MV1A 2XDQB 5H82A 2WOOA 1SXJE 2BEUB 3A4LA 1I4DD 4BPBA 1Y5MA 3ZTWA 2XA9A 1CHNA 3BERA 3C41J 5DO9A 1V96A 1BEUB 2V97A 3ETCA 2PYDA 5TGZA 3GROA 1SU4A 2A5YB 4I5GA 3KZNA 2C29D 1C3JA 1DZ3A 3EZLA 3T4UA 3VYSB 1BHO1 1Z0FA 1KP3A 4B7CA 4EVIA 4YLYA 5F51A 3H9JA 4BECA 5B1IA 3WL7A 5K01A 2FDRA 3A2KA 3OUZA 3MUFA 3GH1A 3JQFC 3M33A 3MTDA 3TL3A 3JAWB 1S9DA 3AV3A 4HB3A 4IIDA 3SQWA 1G3QA 1Z36A 3IE1A 1NXOA 2XD4A 4ZVPA 3FPGA 4OI2A 1L5LA 1RPZA 2QBYB 4H0FA 2JEZA 3L0ZA 4OB7A 2GERA 1Y3IA 3F6CA 4KZKA 3RHFA 3H2IA 5L7TA 3DHNA 1XZNA 1EVJA 1R6VA 4IP0A 4KYUA 3TTUA 1Y80A 2A4KA 1TKRA 3I3SR 4CKBB 1XVVA 3CH5A 4OL0A 4EMSA 3WFJA 4AZ0A 1YF3A 2FUKA 1PJ3A 4FDVA 4YB8A 5BV1A 2IHYA 2ZTSA 3HVKA 1NSTA 1AUPA 2I78A 3WMFA 4ZAVA 2JVJA 1PI3A 2JGJA 3E7DA 3OJ0A 3FMIA 5JCJA 1C5KA 2JJQA 3T1NA 4UVEA 4PRYA 1CBUA 4FSXA 4BMYA 3AETA 3JX9A 4KYTA 1NNSA 1WX1A 4MW6A 2RI6A 2GK6A 2LRHA 2REQB 5DNUA 4CPDA 1LQTA 2IKSA 2BFBB 1OXSC 2HU8A 1L7NA 2BI7A 1SCIA 4TM8A 5LYYA 2QMZA 4A27A 4CM9D 4H77A 1UKZA 2H7VA 2O7SA 4HGOA 4N8EA 3N74A 2OB1A 2EFYA 1LLDA 3DDNA 1JU3A 3LOUA 5MDHA 3R7WB 1ODFA 1ZKMA 5A5VA 2Q1TA 4MA0A 1ISMA 1H85A 2HLHA 2RGEA 4QNNA 4UTOA 3K0SA 2BELA 2O3JA 3RLIA 3G2NA 3KVNA 1VL1A 1KXJA 1U9IA 1GPWB 2R6AA 1HTTA 1PS0A 4XGIA 1EFLA 5D1NA 2BGJA 4WLFA 3DZIA 1ZONA 3HO1A 2CNKA 1FDIA 4FCVA 4JLUA 2Y0DA 3BWXA 3CBQA 1PAUA 1JWBB 2VYVA 5D1HA 2JW5A 5LD2C 3O92A 4ZICA 3RM3A 1JR3D 4GWLA 4D8TA 1JR4A 2C57A 2QPTA 3ZDQA 2TSYB 1RP7A 4A2QA 3R7SA 4F8JA 1HQCA 1PL0A 1J97A 2LCFA 2X4IA 1ABEA 1SVIA 3IO3A 5JCZA 2VBFA 3WTBA 1B1CA 1DBRA 2Y76A 2NU7B 2YDYA 3KZXA 3PHLA 3LW8A 3PGA1 1VG0B 5HW0A 1UJNA 3W8EA 2ZIXB 4OD0A 2OAEA 3RFCA 1OBVA 5EKXA 9LDTA 4JNKA 1GZ4A 1DO0A 2QXUA 4FKBA 5ALPA 3E5HA 1E2FA 1FMJA 4YIKA 1R27A 1DAOA 3BXOA 2L42A 1I14A 1KZ7B 5EUBA 3EY4A 5FADA 3QIVA 1A82A 4GOMD 4HYTA 5TQVA 1RBZA 3CSSA 1W4ZA 3IODA 3ZD8A 1P4JA 3K6SA 1FPQA 1VIDA 1MOZA 5EWMB 4JUFA 1YU9A 5AVSA 3LQFA 3JV7A 2XB6A 4MJ7A 3HK2A 1N9ZA 3PUWA 4IY1A 1LH0A 1FRNA 3ZIAD 4DIBA 3VZDA 3ER8A 3DR5A 4Y2XA 3E22B 1YVUA 5AHRA 4G1CA 1NXVA 1GTRA 4F9TA 1DGQA 4F5EA 4WZBA 1K97A 1CKEA 3O4VA 4GM0A 4QXAA 2FK8A 1VPVA 3T5MA 2OZEA 1FP4A 1HC7A 4QOEA 2YBEA 3BJRA 2OWEA 4IYJA 3MT7A 5P21A 3WDKA 4INOA 8GPBA 1PGOA 4WQMA 2YOFA 4X9XA 4LJSA 5L6MB 3ZHCA 1Z8DA 2AQKA 3H1TA 2QX4A 3PXBA 2CBZA 2I3GA 2R4QA 2XZPA 3A2MA 3LLUA 4JT4A 5HFJA 3URKA 4BQNA 3DMTC 4P3KA 1VSBA 2CJPA 3HJAA 4RCYA 3EXFA 3LXRA 4LSWA 5ARDA 5THXA 4HDNA 2WB2A 2WJVA 4RXUA 1Z28A 4FKZA 2CXOA 3S8MA 4EJSB 5I9SA 1O08A 4MWSA 5KOJB 3U44A 1DSSG 4GQAA 4L7VA 3VRHA 2WWYA 1Y8CA 3H5NA 2YFYA 2GCNA 2YUTA 3N05A 3M6LA 4LX0A 1L7EA 3MWJA 2WKPA 4BBZA 1R16A 1HE5A 4IIJA 1CUUA 2GTPA 3D3WB 1Q0ZA 1P5HA 1G18A 1FFBA 3N7UA 2AVNA 1BN7A 1KMQA 1LA2A 4ZIRB 1FTGA 1XJWA 3VA7A 3TD9A 5BSWA 4L8YA 1XAHA 2IHTA 3GLKA 4MVXA 1VFNA 1FE8A 2P7IA 2QS9A 1SZPA 3RTDA 5FL7A 5TF0A 4DMCA 4G89A 3GT3A 4NOLA 2LW7A 5T6BA 3DAFA 3WB2A 1BMQA 4ZREA 1TF2A 3AR7A 2JCBA 4JI1B 1RTTA 1TAUA 4FCWA 1ZQ1A 3HDYA 4LRXA 1JDJA 4MPTA 1YBMA 5JNWA 3OO0A 1QKJA 1SUIA 5B7GA 1NVKA 3PB3A 3PQCA 2AXNA 4XI9A 5AM0A 2ISCA 3C87A 3R9XB 1T4DA 3VYWA 2DWUA 2HCJB 3MVEA 5AI4A 3VTAA 1II8B 3MMXA 2YMLA 1CEQA 3HBFA 1XTKA 4S0XA 1BNCA 1QYIA 4GM4A 4WZAE 1GU0A 3IE0A 4BYMA 3RPEA 2D2VA 2VDRB 3ZDXB 3JWHA 1KFKB 1IEXA 4HUJA 3NGXA 3KAQA 3PRJA 3IMKA 1EDBA 3QXXA 1DZIA 4ZZ2A 1U31A 2C00A 5KYTA 4MUBA 2YIDA 5HG0A 2BZSA 2MMGA 4YRAA 3VH4A 2ORYA 1YK0A 3KHKA 2VNIA 4OY3A 2B8EA 5E7JA 3R7LA 3CCBA 1ADFA 1SKYE 3ETEA 3BL6A 4E51A 3INTA 1UEIA 4URWR 1AUVA 2A57A 3S0JA 4CI0B 5KNLA 4YHBA 3KZCA 1Q91A 1FSPA 4FE4A 4Y7DA 2V1UA 2ODTX 1NQVA 3AJDA 2YWGA 3MXTA 5CNKA 1MABA 4QGFA 4DA8A 2Z5LA 4K6OA 4Z3KA 1K7EB 5IKEA 4BVKA 3H5IA 4I4TB 5B3JA 3RIEA 2CL5A 3QELB 1DKMA 2HLNA 3ASVA 4FVTA 3GWZA 3B5JA 4NMMA 1OYWA 1PZXA 1ZMRA 5JDIA 2EJWA 4JD5A 1N5LA 2YRFA 4DMLA 3TUIC 3B6JA 2JVKA 1Z2OX 4IDPA 3ESYA 4TWRA 3FPBA 1EESA 5G1OA 5TGTA 1E6MA 4R1QA 3S99A 4Z1OA 1FDOA 3OEHD 2BSQA 1DQNA 3A0UA 3BIOA 2HFKA 1AKWA 3FW1A 5KYYB 3ZDDA 2X6RA 2XTNA 5L4LA 1NXWA 1RXEA 3R20A 3BTVA 3RROA 4Q4AB 4PGAA 3PUHA 4ZT4A 3GRYA 2H07A 4R1NA 3DULA 2BBSA 3O0TA 4BV3A 4ZVQA 1WZEA 2R00A 4E5NA 2IDKA 2C1ZA 1TUBA 3G5LA 4RMJA 4EI9A 3GAAA 5FHQA 1VSVA 4BUCA 4TUYB 2CL6X 1LW7A 3NMUF 3HL4A 3I76A 2IPOA 5FRDA 2WJAA 5LUAA 3K9BA 4DAEA 5I7EA 3KG2A 3VR5H 5CVTA 2FFHA 1UFOA 5EJEA 5TQ2B 2B0JA 1PVDA 1W5EA 3RRMA 3L1KA 5J5VA 2QAGC 2Z56A 1Y6JA 3GDWA 2DT5A 4IRUB 4KJZA 4MQBA 4YJGB 2F9MA 4YAOA 5J63A 4EUNA 4ZGBA 2IHJA 4JP1A 2V8OA 4FDAA 3ZCTA 1RHJA 4IO0A 3SWWA 2O23A 1J1UA 3T7KA 3KJEA 3CB4A 1O4VA 4PFJA 4MKZA 1USUA 4QQNA 1GYPA 3MWLA 3TB4A 3CNNA 3PIIA 5BW4A 2VBIA 3CSUA 2A14A 2DFVA 5C8YA 4DLWA 2V6GA 1MB3A 4ZC8A 1J2YA 4L2IB 4PQRA 2B36A 2VZ8A 4ENWA 1N6KA 4RHTA 1SMKA 4J4HA 2Z6UA 4PR3A 3CINA 4DQDA 3UUWA 1YRQA 3L43A 2XD9A 3HYNA 1RAIA 4GO1A 2HGSA 3U3MA 4B44A 3OX1A 1NIJA 1FTQA 3IBFA 3KQMA 4UUQA 5TPZD 2PKYX 2YWFA 4E33A 4OKSA 1U2DA 1CUYA 2OMEA 4QFBA 5EJ2A 3KSBC 4AJIA 4BC0A 4JB2A 4J75A 2I5PO 1UF9A 3U0BA 1B2LA 3D4LA 1W1UA 3L7BA 4YASA 3UQZA 4X6YA 3W1WA 2K2QB 1CUHA 3E81A 5CEJA 2Q45A 2EATA 3C16C 4WK0B 5FAKA 4PX9A 4CLRB 4EDHA 5KTRA 1T9GR 1NMSA 5H5JA 4NE2A 1TQ6A 3TD6A 3FOBA 5DNDA 5CXSA 5E6SA 5JV5A 4NDAA 1KK2A 4E5SA 5C3MA 4UOZA 2FMKA 4G0NA 4R31A 2C9ZA 2QM3A 4CE6A 4ZYZA 3FRHA 2JLWA 3IBYA 1JLLB 2HV8A 3JRWA 3L1UA 2R7LA 1C7EA 1WPRA 3R5KA 3NPAA 4FXPA 3UT0A 5ADVA 5LIPA 1Q17A 2WA2A 1WO8A 1YQWA 1U3CA 3GEEA 3I23A 4KOAA 5EMHA 3UUEA 4ERXA 2QTVB 2VK2A 4Q93A 4YJ2B 1AK1A 2BOVA 5KC9A 2TMKA 3K1AB 5DX1A 1P6XA 2AN5A 3OX3A 4EY8A 3I9LA 4CKCA 3V33A 3L4JA 2OVFA 3QLVA 2FWPA 2OORC 4KIFA 3ZVLA 2DJ5A 3W5VA 5LZ9A 1ZC3A 3Q11A 5AJZA 1E99A 5B1DA 1T6ZA 1UOOA 3DBHA 4KN6A 1ULAA 3WWCA 3MUOA 5DGCA 1H1TA 3HUUA 3R9KA 2XUPA 1RZUA 4GSLA 4N0EA 2J4DA 3F4LA 3E82A 3EW9A 1JNXX 1E79A 3HJRA 4XEUA 5JEEA 1E9CA 5GV8A 3BCRA 1GT91 5B1HA 4RLSA 1VHJA 3MLAA 4YRPA 5JTTA 3A6LA 1L4BA 2RGRA 3CKMA 4FK8A 3LA8A 3KJGA 2GZ2A 4IJ5A 4IL5A 4J6FA 4CR8A 5K0FA 5JWRA 4AUMA 1GG8A 3FPLA 3NBFA 3V46A 4PX5A 1JAZA 1IFXA 1XT6A 4HJXA 4R6XA 5TVGA 3SN6A 4LCEA 4KG7A 4RPJA 1MFZA 4COOA 1TEZA 4ZC1A 7ABPA 1KORA 1E2DA 1GJRA 1ZEMA 4BO4A 4B33A 3TPZA 4KNWA 4M60A 2CVPA 4WA7A 3EZ2A 3AG5A 3LIPA 3LUPA 2EGUA 3Q41A 1MB9A 2CXHA 3GRRA 3IYLW 1XZHA 3R6GA 1CIJA 1ADCA 2RAVA 2ALJA 3EAFA 3KQLA 2XTMA 1A8HA 2BI4A 2YNMD 4CGZA 1PV1A 2WJJA 3DYBA 3H83A 4DLTA 1QCDA 2JFXA 2UVPA 3PQ4A 3OJLA 3OKCA 2OFXA 3NT5A 1QHEA 4P1ZA 4M7OA 2JLUA 1EK6A 1SIWA 1ULTA 1USVA 2MOKA 5H1YA 3SSAA 3LUJA 3ZWCA 4MHOA 5EHNA 2HA4A 1ONPA 1EVZA 2WINI 4NMXB 1GV0A 2IT1A 4HDKB 4OHUA 1OJLA 3D7RA 3T0IA 4UCWA 3WGMA 2R6CA 3CNLA 1PLJA 4DLYA 5A03A 5E4JA 3WQSB 3W6NA 2VZEA 2AVDA 4QOFA 3A3OA 4FDMA 3F6BX 1VIMA 3EDQA 4XM2A 4ZU3A 4N54A 1NF9A 2C2MA 3TAHA 1M8JA 1RRPA 2ZVPX 1RMYA 3OT5A 4A36A 1N6NA 2NWQA 4YALA 1KVSA 3UAOA 4D25A 4FKMA 1DJQA 4ZOEA 5EFZA 3RAPR 4P7GA 1YS1X 3W5DA 3CZCA 1TVKA 1GQSA 2XGGA 2F59A 3QVGB 4MDHA 2J0UB 3HDHA 3PFKA 4Y67A 3T7IA 1G5PA 3MIIA 3WGUA 3VO8A 4UTRA 1E63A 2QLLA 3SFZA 1FW6A 3AR4A 3Q1LA 4ONEA 2P11A 2PIAA 1HNWB 3D3NA 4YXFA 3EGWA 3CIFA 1IJKA 1D9XA 1YULA 9ATCA 1PV2A 1U0TA 4PO9A 4W5WA 1A8IA 3CHYA 1CR2A 1DE0A 4DLXA 2OILA 3H9QA 1W6RA 4MW1A 4PLZA 4GYJA 1KBZA 4LFBB 2B30A 4OX9Y 1IHPA 3EMVA 3K0BA 5C1OA 3GIDA 5HIKA 2F3RA 4QYIB 4UZFA 4DG8A 4NABA 4K6CA 4NLLA 2NU8B 1Y37A 1AQJA 3QXGA 4IINA 4YVFA 3TOVA 1H8HD 2FMFA 1LJLA 4QOGA 2JIMA 3KOXA 4D43A 1H4SA 4RACA 1Y8QB 3SXPA 4CQLA 4DIOA 1QRSA 5DRYA 2H2IA 1FU7A 3H16A 3FTNA 1Z4IA 1W25A 2CFRA 3OX4A 4D8UA 1P8AA 3IO5A 3V4LA 2GDJA 3MRXA 3BBPA 5FTNA 4ABYA 1N2OA 4U7WA 2MDTA 2RGGA 2P0YA 1RYHA 2PA0A 1K7XB 2GAJA 5HF6A 1DRVA 2H5EA 5U4QA 2C84A 4FFDA 4F46A 4ZGWA 1G6KA 4LHZA 1W0KA 4LV6A 1NQWA 4DS3A 2WF6A 3F6SA 5I5GA 1RQXA 4Q7EA 4DMGA 4KB5A 5FL3A 5JY1A 4UE6A 3QYFA 1CZUA 3PSHA 3KSUA 3D4BA 2E4YA 1KMMA 3FCXA 3O4JA 5SZIA 1OHHD 2KMLA 3HJUA 4I4IA 1RKVA 4NCJA 5TMDA 4OL9A 3SHOA 3DZ8A 1N2EA 3TLZA 2C5EA 4BFZA 3K9GA 4GS5A 4KRXA 5BR4A 2WD9A 2CLMB 1N4AA 2W6NA 3BN3A 5DM60 5G40A 3GDGA 5A5FA 1H2FA 2V7BA 2J0VA 4OO3A 1QAOA 1V7ZA 2B1QA 2BFOA 1M1NB 2CYAA 4ZFNA 3N2GA 1L8LA 4BV2A 3ENVA 1ORWA 3C5WP 1DTEA 4BO5A 5JXHA 3B1JA 3KOMA 1ZK2A 2VSNA 4NBKA 4PC6A 4AP6A 4QU5A 1ILWA 1TJ4A 1GAQA 1I4WA 2JEOA 4D9MA 1CNEA 1Z5VA 4N4AA 1VI6A 3UJ9A 5YASA 5BV2P 1WUTA 1J0AA 3C3MA 4JBIA 3RVJA 1LRJA 3T1VA 4JBGA 5ADWA 1X77A 4HX9A 1XSEA 1DI0A 4EYKA 4TGLA 4P3OA 4XYGA 3F73A 2ONJA 4A2CA 3UHFA 1TQHA 1YMQA 3W9BA 1SK9A 4IIYA 2XYGA 3T5DA 4BIMA 1D1TA 3QP9A 2A0WA 4JI6B 2QUZA 2VPXA 4L3VA 3Q7RA 1OFUX 3ZYCA 3IEXA 1PNVA 5F1YA 4AUKA 1NVAA 2FPUA 1ZGAA 3IAXA 5EMKA 4AYWA 3K8ZA 3H9GA 1O9GA 2HSWA 3PC3A 3E4CA 1CQJA 4L8LA 3HNPA 4RZQA 3WNDA 4EGCB 3U7GA 2XRZA 5DSXA 1TK3A 3HWRA 1SEVA 1X2BA 3UHJA 3D6AA 4BN5A 4OEHA 4MQFB 2UKDA 1G4AE 3M0EA 4UVGA 3B1WA 2ZBPA 3WYCA 5BSTA 4E5DA 5BQXA 1H3NA 1U2TA 2HTEA 5KB3A 1HE4A 4M8SA 5A2QA 2GNAA 4LF5B 1EWRA 1FNSA 3RG8A 5F2NA 4JSYA 3SLRA 1XVAA 3ZHSA 1MU0A 1I5OA 4BX2A 4G1VA 2CMFA 1LVUA 1OAOC 1UMBA 4AO8A 4E2ZA 2G4CA 4TQAA 4JBYA 3TDNA 4TZKA 1IH8A 1ZIYA 3CRMA 2GGSA 4HDMB 5IEBA 1YR3A 2VAMA 3DEAA 3PX7A 4GWGA 4CM4B 1P0CA 1JTEA 2EZ9A 2YHBA 4LDPA 4EYGA 1HDRA 5KREA 2IWRA 4ILEA 3EPJA 3MTAA 1CYEA 4GGMX 2VYNA 1Z35A 2ZM6B 1OWLA 3Q85A 1WD5A 4Y7CA 2PQ6A 5CFZA 4BFLA 3NVDA 3LPAA 1IWBB 1V5WA 3RUEA 1BCRA 1PYDA 3RAGA 3SCZA 4A4DA 3N8KA 3FUVA 4E6EA 2QORA 3SHVA 4ZCIA 1DAHA 2HZ7A 2RAPA 4UUOA 4OLHA 2QJRA 4EHIA 2YHIA 1TZJA 1AKNA 2M98A 1NKSA 1JHUA 3NHWA 3EZGA 2PZFA 3P0RA 4OHFA 2OC9A 2G77B 4US2R 4B3SB 3J7TA 2CCJA 2B7BA 3RYCA 5CYFA 3FTCA 4QYXA 1U3FA 4YQZA 1XZFA 4KL8S 3SR0A 1QH8A 4YX9A 2Y0PA 2A1TR 2J3IA 3CEPB 1VP3A 3A1NA 1PGJA 2H18A 3CM0A 4M9CA 4TWZA 3WRXC 3TSOA 4EAQA 3P2JA 3IAM6 1R4ZA 1UDRA 3NU1A 4L4UA 2FWMX 2PL9A 4L4YA 3IQIX 1QIJA 2H57A 3SZMA 5B64A 2RKOA 1LBHA 5BMVA 1TM1E 5K9ZA 4C0HA 1ZS9A 3ONWA 2AKEA 1Z0UA 3BX1A 3BD9A 1XQXA 2VKTA 2Q4EA 3EUWA 2PL3A 4WERA 4UDNA 2W98A 1O97C 2OPHA 4LTNA 1C0LA 2OM2A 2HLDD 2OKGA 2C58A 3CLRD 3RWOA 5BR7A 1KGSA 4D8VA 4RS3A 4EEKA 3DPSA 4G4SO 1NUSA 4PG8A 1W8DA 4LSMA 2GD1O 4LOKA 1Q2XA 1M8GA 2H2HA 3TZEA 4CL2A 3KIPA 5HQ3B 1MB0A 1FX1A 3M4JA 1W5FA 1IVSA 3CPHA 1M6HA 3KUDA 2VYQA 2DETA 1EWYA 1I4TD 3G85A 4KMRA 2VJMB 3ZLUA 4E5MA 1U04A 4IUDS 4OKIA 4ZVTA 3MJHA 3EISA 3PE4A 2IU6A 2GPWA 2G1UA 3GLHA 3ZD6A 4WJKB 2JARA 1LC0A 1EEXB 1TIBA 3IR6A 4R8RA 3QTBA 5ARCA 3FVWA 4L72A 3TS1A 5BN3A 4DIDA 1XTIA 2RHWA 1AKMA 3HXPA 1DEXA 3KXDA 1VG9B 2ZYWX 4MJ3A 4QM6A 3NTQA 5G3YA 4RVSA 3OHPA 2E87A 2FUEA 4L95C 4I55B 4MYDA 4CW7A 2IOFA 1RZRA 2ZWVA 4AJ1A 4QICA 3O8CA 2A8YA 3R0VA 3S8YA 4A7PA 1SKBA 1ZLXA 3CXUA 5F5NA 2HO5A 3LC2O 4BNJA 1KYZA 2E7ZA 1TUGA 2XY4A 1H3EA 1VJ1A 3ILVA 4HVLA 1Y1SA 4W8OA 3WHIA 3WX0A 1OA1A 3M9LA 4PIPA 4MI1A 1E3SA 2CYBA 1E9SA 4UZSA 5G02A 3VVMA 3N75A 1WSBA 5FIUA 3WR5A 3W9SA 3W6ZA 4DQVA 3PG5A 2V0GA 3AR3A 2JLZA 1DUSA 2ZSJA 3N28A 4KLCA 3OZSA 1L5WA 2QK4A 4QXMA 3U3OA 3OT1B 4YMGA 3SEQA 1KI3A 4WXYB 3TBKA 1XMSA 1LBTA 4W5OA 3D1JA 3KVRA 3OP4A 3UGQA 3HCPA 4MO9A 1LI5A 4N5HX 4TKLA 4PF1A 4TV8F 1M5UA 5BSHA 2PRKA 3SDBA 3G0CA 1D6MA 5A6SB 4DJEC 3NIWA 1WULS 2CWDA 2M1XA 4D6PA 1OROA 4I8XA 4RA9A 3N7AA 5J2TA 2QRKA 1WUHS 3HI6A 4EFLA 2IH4A 2I7XA 2WD7B 4M55A 4EIWA 1TM2A 1P9RA 2W11A 3RJMA 2I2WA 2OXCA 3OWHA 4GF5A 1UT5A 1PK7A 1TDJA 2VH5R 3HVRA 1GIAA 2Q0HA 3EXAA 3M5CA 4R9VA 3U37A 3ZYZA 4CUZA 3ZI4A 4E32A 4E5PA 5HKAA 4UNIA 4EFKA 2AWOA 4ZDWA 4W9MC 5CNMA 3PYXA 4HGZA 3U60B 5CVCA 4Z3DA 4BQFA 1U7UA 3M4YA 2G09A 1GR0A 3PWTA 1ID1A 3GMTA 2DUJA 5F21A 2WRZA 4DA4A 3JQ8A 2AZDA 3BSSA 1NU6A 2C82A 5EZQA 1UDBA 2VZ9A 1ZXBA 3DBIA 4FMCF 4KU4A 2P1DA 1M2FA 4LMPA 4UHEA 4CU5A 2YV1A 2WNHA 3L8ZA 1UBNA 2IYRA 5K3AA 1PVOA 2D1QA 2RHMA 3UJAA 1DG1G 2PL1A 4Q3LA 1QAMA 5A9TA 1EX7A 2CV0A 3MMZA 4IIHA 4KDCA 1L4NA 1WTCA 4RD4A 1U0GA 1QHNA 2A3NA 5A1JA 2WTAA 4NBWA 1O77A 1IN6A 4N40A 2B4RO 3DYIA 3UJPA 3CG4A 4N9QA 3DZHA 3ND5A 4BLTA 3I52A 2K6GA 3DP7A 3KKQA 4LYAA 3A27A 4MS4A 3V3TA 1FK8A 4XFDA 1J7KA 1H2ZA 1YDWA 3D7MA 3PCRB 5B5SA 3AJ8A 3FN4A 4GP7A 1VGQA 5CLGA 4Z0PA 3FPJA 4PN7A 2R65A 1LK0A 1CUIA 1QX4A 3O9VA 5LQDA 4X1YB 2FNAA 1E2BA 3AUUA 2SKEA 2XLBA 1DT3A 3AL2A 1VI2A 4N6OA 1BHQ1 3IIKA 2VATA 5HTKA 2IS4A 1T5TA 8ADHA 2BTQB 3Q3IA 4N5IX 1JECA 1L5RA 3WK8A 3C24A 3IVGA 3PQ7A 3CNQS 3KKLA 5H68A 2J0QA 1IB6A 2C5BA 4BFSA 1Y8RB 4ZYXA 4WJLA 1E62A 3IL2A 1R64A 2H4FA 4GOND 1ZOLA 3NHZA 1P4SA 3WLSA 1G1MA 4DLAA 5DYYA 3GFOA 1R9GA 4XXHA 4UATA 1N1GA 1QJ4A 1YOVB 1Z3IX 1T4BA 5CT5A 4EBBA 1DBSA 1ZW1A 4AULA 1QDEA 4G0PA 1SCUB 2QRUA 2ZSHA 4Q4CA 5CU7A 1Z6XA 1F20A 1HE1C 5TE9A 1JG3A 2DZDA 3QITA 4B4VA 3AKZA 2LIVA 3UXMA 4H7IA 3RUIA 1ZISA 1TD9A 1ZMTA 3EFOA 3ZWYA 4QPDA 4YR7A 1TRKA 1XTBA 2YN2A 4G1MB 4LHVA 3HA2A 5DBHX 4ARBA 3P5BA 2COUA 4JFRA 4EGAA 3MGCA 1N3IA 2C99A 3DEYX 2HHCA 3IULA 4KZPA 1KEPA 1ZNWA 3KKNA 3Q8KA 4K88A 1AF7A 3BF7A 4MV4A 5AFSA 1SFRA 2R8OA 3IEIA 3JASA 4URXR 4JUDX 3FMVA 3P96A 4O4HB 1LDYA 4F45A 1JHPA 2ZFUA 3LI2A 4JJ8A 2ZI6A 1L7VC 4RK5A 4BKQA 1XD2B 1MHTA 4B7ZA 2UYCA 2VP0A 3UXYA 1SCBA 4FZVA 1NC3A 4RH1A 4F2GA 4QLBA 4WNIA 1Q11A 5D51S 3G8BA 4BRSA 1QBKC 1JDPA 1RW4A 1LX6A 4ZQBA 5C7LO 4NXMB 5SZHB 4TSKA 1IDN1 1RXVA 2GD0A 3BCHA 2UDPA 5IH7A 4JJZA 1Q16A 1YS4A 2C9OA 3NJ8A 4M8LA 4LYJA 4NEQA 4UTNA 4ENSA 4X1IA 1HNXB 4FE3A 4RD6A 3ZTYA 2G07A 4M86A 1JIVA 3N76A 1D1QA 3QUCA 1Q7GA 3AEKB 3EDYA 3TNJA 2ZXEA 3W6OA 4KQXA 5LNK1 4LJRA 2Y1XA 1NBOA 3F7OA 2IYTA 4O59O 1Z2EA 4BZXA 5AHKA 2XECA 3VU1A 3FYHA 1G20A 1NGSA 3A9UA 4J7AA 3O2JA 2ZSKA 4RV4A 1U7WA 3DDZX 5GY7A 2MR5A 2Z57A 3V3KA 1PIWA 4MYRA 3KHUA 4I36A 3IT3A 3PIDA 5L51A 3ZIDA 5FNVF 3P94A 2ZRJA 1JJAA 2D5BA 4XDZA 5ALUA 4G4GA 3K72B 2PXCA 4IXNA 4K9QA 3L93A 3LPCA 4LJYA 2JIPA 3C1OA 1NVMB 1XZLA 3DFMA 3H11B 3QUSA 2Z58A 4NBLA 4UXHA 2C9MA 1HA3A 3PNQA 2FW0A 1NQTA 1U94A 5AW8A 4O8CA 1T8TA 3JALA 4GMXA 1YZFA 2VRBA 3DXYA 3FOEC 5JPDA 1BMDA 2P3QA 2ZRHA 3LY5A 1D2NA 1X15A 1G9TA 1FYFA 1NF2A 3D7LA 3M82A 1TMKA 1SXGA 2ZBDA 4I1RA 4R3NA 2CLLB 5BNWA 2F4NA 1TFUA 3QBEA 4TKVB 5EOVA 1NBMA 1N6OA 4PBTA 4ZI2A 1JIUA 1GGHA 2RHBA 2F9LA 1F2TB 2C96A 2V6IA 2V7WA 3VR4A 2FA9A 3QVSA 4KDFA 2XNHA 5J47A 4PQEA 4MWGA 1NJ5A 1TCCA 4TXJA 5AJYA 2ZE6A 4RDIA 3ZZ1A 2HYIC 1RMTA 3CPEA 1ECLA 4C06A 2NVOA 4W1QA 3PHCA 1TVEA 4DLLA 4B2LA 1FZTA 1JSXA 1IZ0A 3HFRA 3CUTA 4W9NC 1DPGA 4YBRA 5DGDA 3V4FA 4BUJA 4D3FA 5ERXA 1I80A 1E32A 3HN6A 2RKBA 4TTSA 1X80A 3WNCA 1JU9A 3M3PA 1I2ZA 4KR3A 2PUDA 2C77A 2HMTA 1DWQA 3HU1A 1DV1A 4M37A 1H6AA 2Q2OA 4NATA 1QLJA 3S3TA 3A1FA 3LP5A 4AM8A 4DA9A 1EXWA 4DRXB 1X2EA 1G3IA 1YS6A 2M6LA 5AKZA 4BNXA 1FUKA 2HEGA 3P2IA 4LJLA 2AF4C 2Q0QA 1DKRA 5CH8A 1J21A 3GYGA 4OAOA 4A0HA 2XSZA 4FTWA 2UXDB 4WFQA 2G0TA 5J5CA 3IQHX 2NU9B 3MS4A 2XDYA 4G5OA 1T9DA 4WASA 1FBTA 1YS9A 1VA4A 2ACVA 1VHWA 1XPJA 1WDMA 1AF4A 2IYYA 2LWIA 3GLUA 3ZZ0A 4JXXA 1HORA 4GX0A 4AK9A 1TI7A 1ES9A 3M83A 4LGMA 3VPDA 5C5IA 3WAGA 5FLXA 3LDGA 4MVCA 1QR6A 2E55A 5BV8A 2COKA 4PLHA 5EIAA 2O6HA 2Z4TA 3CE6A 3LNTA 1UKVY 3A1TA 2AL7A 1Y1TA 3RE1A 4B2YA 4NTZA 2HADA 3JR7A 2OQRA 3UB3A 4OSEA 1LQ2A 1QFMA 2WICA 3AR8A 1FBNA 3QUBA 1BX1A 3SZRA 3W4IA 1I30A 1EUDA 3WWYA 5IFKA 3UG6A 1HQYE 4C6SA 3AOEA 4Z0TA 2XGOA 1WHSB 4Y6PA 1V1RB 4KUGA 4H1WA 1E9FA 2Q3HA 3QXJA 3UKDA 1KSGA 1ORVA 3ON5A 5D3ZA 3R5FA 4N9WA 1J5PA 1WMBA 3O84A 3IDSA 3QVWA 2X8LA 2F64A 4PYOA 3VMMA 3G2KA 1DXQA 2VR1A 3INYA 4Q37A 4B35A 5FX2A 1WCWA 4CEIB 3EAQA 5GONB 4TTRA 1ZK1A 5ALGA 4GGPA 2NPFA 1FTSA 4EW2A 2PJZA 2PKQO 1GXSB 2FSFA 2P9QA 2POCA 3KLBA 5EHZA 3WMWA 3FZYA 3I42A 1JHRA 4P4NA 1EHCA 2H4WA 4EG3A 4MIYA 1JAYA 3KL2A 1OPXA 2X13A 1YZVA 1PT5A 2FX2A 1PZNA 2D1YA 3K15A 4OV6B 5DHTA 2BSXA 4C4ZA 1N3YA 4YMLA 2B98A 5F7XA 2ADMA 2P2NA 1VIVA 3EXIA 1Z22A 5TJHA 1MRZA 1W0JD 1CZOA 3KQPA 4FX2A 4I50B 2HNAA 2ZOSA 3U3JA 2BR5A 1BS1A 1EBBA 1V4VA 3FAKA 5H8WA 3UUFA 4D26A 4POOA 4MRVA 5IJWA 4H4CA 4GC5A 1SXJA 4RF2A 4LJ5A 3V4OA 2NT4A 1ODIA 3N2ZB 5KQSA 1PTJA 2J4CA 3DHYA 1U9IC 1OCEA 2FWRA 3MWFA 1OLSA 5CFMA 1CIPA 1E7WA 5KJ6A 1T6NA 2XMDA 4OLAA 2FOIA 1RXUA 2CMDA 1NZJA 3WRVA 1L7BA 4ZYUA 4AZ3B 2ZPAA 3I9V6 2IWHA 2PHZA 1AXGA 3SYMA 4F92B 4DKXA 4LF9B 5HNKA 3DKPA 1ZOIA 4AKIA 1UC8A 4EB6A 2WTXA 1F8XA 5FUYA 4JJ7A 4MUNA 3DBLB 1GTMA 4L4SA 5K0BA 3FHTA 1Z4LA 1NN1A 1Q14A 1G5RA 1V5IA 3ZW8A 4CKWA 3B9BA 3TECE 2RGWA 4PRLA 3DO6A 4YT2A 5AO9A 1MJGM 4X54A 1IDOA 3AUKA 3HP4A 4PO1A 3K30A 1G21B 2PLAA 2V6BA 1FNBA 1N2BA 3ANSA 4JYMA 2EFEB 5REQA 4O4JA 3C3EA 1B8PA 1J0CA 4XW2A 1PEDA 1NQ5A 1YJ8A 1NJ8A 1Y1PA 2W43A 4NYIQ 5CX1B 3DVLA 3TYXA 3DQQA 5TX7A 3V1NA 1EFRA 1UMDB 1JFLA 3L6EA 1KY4A 2OZKA 4LXIA 4XJTA 4OHPA 4CEHB 2OOKA 3IIEA 4Y2GA 1UT8A 4QECA 4HOYA 1ST3A 4U0JA 4QDJA 1A8PA 4KKXB 3IAEA 5K3SA 4HDOB 3REOA 1T3ZA 5T5QA 4JBLA 4JSTA 4EHKA 2OGUA 2KLHA 2ZJ8A 2LXNA 4EFNA 3BMXA 5M2QA 1ZCFA 1Q95A 1SELA 4RX1A 3RKUA 3GUHA 1B74A 4POAA 1W5SA 2NVUB 2DBYA 4IFBA 5THKA 3A6FA 1AM4D 3OC0A 1P0PA 3QLTA 4JYBA 4D7AA 3FHCB 4IX9A 1E5DA 1ESCA 1BW9A 3KYBA 3D8SA 3K0AB 4FFWA 4TOIA 1CR4A 1H1LB 1UXJA 4II7A 4CR7A 4YIHA 1P80A 5EJ9A 4JNCA 1CJUC 4LDRA 2VK4A 3AGPA 4MPDA 2JFBA 4C6HA 2YZ2A 3PXEA 4MKFA 2P69A 1AUQA 2FE4A 1EKXA 4FFBB 4F1KA 1AZSC 4NFSA 5B4TA 1WPQA 3NHLA 3AY3A 3I4CA 1GA6A 1YKSA 3HN2A 4HRYA 4XVCA 4F3TA 4WNAB 3GLGB 2HCTA 2O19A 3TINA 1UBHS 3QY9A 4LXXA 3CNBA 3RABA 1UK9A 1M6WA 2EW1A 2O1XA 3JW8A 2VCHA 3VSAA 1W7AA 1ZIPA 1V8DA