3V9AA

Crystal structure of esterase/lipase from uncultured bacterium
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
296
structure length
293
Chain Sequence
AGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase activator
molecule keywords Esterase/lipase
publication title Crystal structure of Esterase/Lipase from uncultured bacterium
rcsb
source organism Uncultured bacterium
total genus 105
structure length 293
sequence length 296
ec nomenclature
pdb deposition date 2011-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v9aA00
4BP9A 4EY6A 3K6KA 1H23A 1XZJA 1Q83A 4HRYA 2ZYIA 3WZMA 2XMBA 3OTQA 3R3UA 1ZGBA 3AZQA 1NU8A 4UFPA 1TAHA 1L7QA 2QS9A 3AIOA 4W9RA 4KE7A 3O95A 2XQIA 4W1RA 4BCDA 4H7EA 4FDMA 4X71A 3RK4A 3FAKA 4UFOA 2QXUA 2WKWA 3BDVA 3BF7A 1Z68A 2YYSA 4A5SA 1L7AA 1LPBB 3I6YA 1EDBA 4X97A 1LZLA 2VAXA 5DNUA 3STXA 3LLCA 2XUIA 3FWHA 5J3JA 3H0CA 4Y2UA 5JAOA 4MWSA 1LBSA 3WIBA 4WFKA 5A62A 1WM1A 3GROA 3WL5A 2QUBA 2WFLB 2OLEA 1YAHA 1QIHA 1KU6A 1F0PA 3O9MA 3TEJA 4I4CA 2CMFA 2PSFA 4X00A 2OG1A 1VA5A 4V2IA 5JAPA 4X85A 1A8QA 4CG2A 1QONA 1MNAA 2QR5A 5FXMA 2BCEA 4IH9A 4HS9A 2XUDA 1ZD2P 4IHAA 1QJ4A 2QJRA 1FFBA 5DWDA 4Q1VA 1XROA 1MPXA 2VEOA 2JEYA 1ZGCA 4PW0A 4ZV9A 1YASA 5HQ3A 4CCWA 1XZMA 4B81A 1UT6A 3FYUB 3LIPA 3E0XA 2QUAA 4QA9A 4MWTA 5AM3A 1LGYA 3G0CA 4OUKX 2ECFA 1AC5A 2XMGA 1HPLA 4FHZA 1GZ7A 4AO6A 5KREA 2Z5GA 4K6HA 4Q3KA 2ZSHA 3G8YA 2G5TA 1R1DA 3WWOA 1GQSA 1BROA 2OAEA 1H2WA 3ZLUA 4MYDA 3IUQA 3R3ZA 3A2MA 1VLQA 2X5XA 4NVRA 5K3AA 1CRLA 1WPRA 5EI5A 1VE6A 1BN6A 4X90A 5JZ9A 1XZBA 2WU4A 1R50A 2G4LA 3GUUA 3FBWA 4P08A 1UFOA 3WYDA 5HF9A 1ZI8A 3D4LA 4OB6A 1WHSA 4M0FA 2OCGA 5ALTA 1SCIA 2DQYA 2H7XA 5EGNA 5AKEA 2B4KA 4UHDA 4B82A 4WCVA 3CN7A 1W75A 1PV1A 3FSGD 4J0GA 3PFCA 3A70A 2HL6A 5AKKA 4G4JA 2PSDA 1SCKA 5LLSA 3G02A 3V1LA 3KDAA 1ETHA 2XMSA 1LPSA 3WK4A 1Y37A 6YASA 2XB6A 4QWWA 1LPMA 1J07A 4KEAA 4B6GA 4DMHA 5H3HA 3I2GA 4UBNA 3WA6A 3T4UA 2RONA 2GBCA 1L7RA 4Y2QA 5ALNA 1TCAA 3DKKA 5JD5A 5ALGA 3PFBA 3F97A 2JGEA 4AO7A 4B80A 1DWQA 3L1JA 3SWWA 1ZD5A 4CIBA 4BB0A 2WUEA 1LPNA 1CUBA 3C8HA 4C4YA 4E11A 1CV2A 4FTWA 2DHDA 2RHTA 3EF3A 3FLBA 5IVHA 4G4GA 3STTA 3HYSA 4AMZA 3RLIA 2B61A 1E66A 4GW3A 3I28A 2ROQA 4D9JA 4XJVA 2JF0A 3OM8A 1CUGA 4G1FA 5FRDA 2XMDA 4P92A 2QRUA 5T4FA 1Q84A 5HCUA 3NWOA 5HKBA 2BFNA 1GT6A 3M3DA 1TKRA 5HF5A 3H2JA 3STVA 1XLUA 3I2KA 4U2FA 2WQZA 4J7AA 1FJ2A 2WHRA 5DJ5A 1QIFA 1T4MA 3IULA 2IX9A 3VJLA 4W1SA 1GKKA 3E4DA 5FPQA 5AKHA 4FBLA 4BCBA 2DQZA 4W1PA 5C8ZA 1QOZA 4HXEB 4H7JA 1XRQA 1K63A 4AO8A 1PJAA 3OOSA 3W06A 5JZBA 3VISA 2WHPA 3CXUA 5HFNA 2WUGA 5D6OA 2OCLA 4F60A 3A6ZA 2XUAA 5DNVA 4DMCA 1G66A 2VA9A 3H1BA 2WU3A 5DNWA 4N8EA 4M0EA 1VJ5A 4XIIA 4RGYA 3WL7A 4A23A 2C0QA 5LIPA 3BF8A 5F4ZA 1OXMA 4C89A 4GLBA 4EY7A 4IH4A 3FVTA 4AB1A 2Y6UA 5ALFA 2HU7A 4Y7DA 3STWA 1AGYA 5JIBA 3IVMA 1XRMA 1AZWA 5IKXA 1EDDA 4MEBA 4QE3A 2PSJA 1TIBA 1DINA 2ZYSA 1Y7HA 1X2EA 1N1MA 3FYUA 4UBJA 3HC7A 3LS2A 2JGIA 3V1MA 3WK9A 4PSDA 1VXOA 1UOPA 2R11A 1IZ8A 2H9YA 5HK8A 2WFMA 5AOBA 4X3CA 3PF8A 4Z49A 4BAUA 2BJHA 4AXBA 5ALJA 4CG3A 3ZLVA 1ODSA 1ZICA 4BBZA 3QPCA 1IMJA 4ZWNA 3CN9A 4OYLA 4LHEA 4EBBA 4G8BA 5FPPA 4Y2JA 1HQDA 3AUKA 4BDTA 1WOMA 3C87A 2RGUA 4EHBA 4F21A 5E4YA 1VZ3A 2CUTA 2PU5A 2QJWA 3SK0A 1WPXA 5JAHA 4B85A 1Q0RA 1CUDA 3WI7A 4U2EA 4M0MA 1FFCA 1E5TA 5AM2A 3EQ7A 3DL4A 3N2ZB 2XLBA 4KAFA 3KWJA 3NUZA 1LLFA 1SFRA 5FOQA 3KD2A 1B41A 1P0IA 1A88A 5KWIA 2OPHA 4MJ3A 3AJAA 2GYWA 4TVKA 3ESDA 1QIMA 3HI4A 3F9CA 5AKGA 4DMFA 4HXFB 3HZOA 5AKYA 2XMZA 5KWJA 1CUSA 2Y6VA 4CCYB 2WLSA 4J0IA 5K5EA 3G0GA 4RPCA 1O6GA 5DTIA 1C4XA 4JNCA 2C7BA 2BGNA 1K5PA 2O2GA 3VVLA 4GBGA 4Q05A 2D0DA 2OGSA 2HA4A 4FNGA 4H7IA 3W05A 3I1IA 2C58A 1GXSA 4BATA 3YASA 2HFJA 3DOIA 1W6RA 1GGVA 1ACJA 1LPAB 2YH2A 5SYMA 2WUDA 2BGRA 5ALUA 2ZYRA 1CQZA 4KRXA 1QTRA 4KAJA 2I3ZA 3DLTA 3GZJA 4X95A 2HFKA 3FSGA 5BWBA 1SOMA 3WK7A 2JGFA 2Q0XA 4BE9A 5K3BA 2G5PA 2WIJA 5ALHA 5I8PA 4K6KA 4BTVA 1K4YA 3KXPA 5AOAA 4FLEA 2HA6A 4G4IA 3WK5A 1WHTA 2HU8A 1T2NA 2XUHA 1CUUA 3F67A 5CT9A 3DYVA 4RE6A 4E14A 3ILSA 1QO9A 4B7ZA 5HFAA 2WIGA 4WFJA 2HHAA 5E4JA 1DX4A 1QFSA 1ZOIA 2AJDA 3ZWQA 3G9UA 4FMPA 4Q3OA 1MX5A 2VT6A 3U0VA 4N5IX 1R88A 1DX6A 3ED1A 3G0BA 5HZGA 3GFFA 4PNZA 2HIHA 1CUFA 1H2YA 1QE3A 2WSLA 4J0JA 2GZSA 2Z3WA 2LIPA 2XMRA 2XUGA 3VJKA 3G7NA 1BU8A 3VVMA 2OQIA 2WM2A 1QZ3A 3WJ1A 5DYYA 4E15A 4LXHA 1XZGA 1JJFA 5CXXA 2HRQA 1DWPA 4XWGA 2XDWA 5K3FB 1XKLA 3GBSA 4X94A 1GKLA 2AJCA 5LZ5A 4UHFA 4YX9A 4J0HA 3V48A 5AK4A 1IUOA 3VDXA 1FFEA 1QGED 2QZPA 1P0QA 1QIDA 1XFDA 4X92A 5AJHA 3O4JA 2J4CA 4EUSA 2VATA 1S8OA 3CCCA 3GELA 2AJ8A 4YASA 4DNFA 3BIWA 1AQLA 1XZHA 5AK6A 5ALXA 4G9GA 1A8UA 1VZ2A 1YAJA 3SC2A 4BTLA 2C5GA 2PU7A 3HACA 1JU4A 5LZ7A 1MTZA 3H1AA 4OB8A 4L72A 1EB8A 4X91A 2OQVA 4C88A 4FOLA 2ORYA 2VJAA 2GYVA 4A16A 2WG0A 3P2MA 1O6FA 5K3EA 1M33A 3O4HA 5YASA 5AI5A 4UBOA 4RE5A 4AN1A 2XLCA 1GPNA 5AI8A 1MO2A 1E8DA 3R3YA 3ESCA 5FLKA 1QIEA 3BXPA 3FYTA 4J0CA 1I6WA 3A2NA 3HABA 4TPKA 2PUJA 3WWEA 2IITA 5ISMA 5HK9A 3H18A 3O9VA 3G0DA 4EY8A 1CEXA 2EDCA 1N5RA 5CTAA 5LKAA 3VXKA 1R9NA 3BJRA 2XI4A 1DT3A 1DQZA 2H7CA 3B5EA 3EQ8A 3M82A 3W04A 5DLPA 1QIGA 3C6ZA 4ZI5A 3S8YA 1QIKA 1A8SA 1HLGA 4KAAA 5FDFA 4IH1A 4J3JA 1U8EA 3WKAA 2CEKA 3D2AA 1FSSA 1YB6A 4H7KA 4HAIA 4FWBA 4DIUA 4EY5A 3IURA 1UKBA 2JIDA 2XE4A 2QM0A 3BIXA 1CFJA 1EX9A 3D2BA 3C8DA 3EBLA 3IB3A 4H77A 4ARBA 4BYMA 3H2HA 1IUPA 2HA5A 3G9TA 5ALYA 1D07A 4DNPA 1MT3A 2YXPX 4QWMA 3ZI7A 2CJPA 1W4LA 1WCYA 3ZPXA 1OILA 4FNMA 1OCEA 3IIIA 4LIPD 3WL6A 3PDCA 3Q0TA 2GBFA 3JYHA 4B9AA 3BJMA 4QLOA 1ODTC 4PSCA 3RKSA 2WILA 1J2EA 2Y2UA 1JT2A 3K2IA 5C81A 1DWOA 3OG9A 1X2BA 1RYYA 5HF6A 2QXTA 1VE7A 3AZOA 1UK8A 1CUWA 1FFDA 1E3QA 4AMYA 3UUFA 1EA5A 4WY8A 1F0NA 1THTA 2I03A 3D7RA 1XRRA 3FLAA 2VJCA 4QDXA 3WWDA 3JW8A 1CUAA 3T52A 2AJLI 1CQWA 3SX4A 4DLNA 2O2HA 4XX1A 5IVKA 5ALSA 3C45A 2PSEA 4CIAA 1BS9A 4YPVA 3QBJA 2PKYX 5DTJA 1YR2A 3EQ9A 1UK9A 2BAGA 1W76A 1VKHA 2ONCA 3IUNA 2RI6A 3EIOA 4C01A 1CUYA 1E8MA 2HA2A 4WDRA 4BZWA 1XQXA 1UXOA 1R9MA 2H1IA 4WFIA 2WFLA 1NU6A 3QMVA 2AXEA 3V1NA 2BUCA 5K3FA 2Y1KA 4Y2XA 2Z3ZA 3M81A 3NOXA 3DQZA 3OURA 4HZGA 1LZKA 4DSZA 1XLVA 2WTMA 3HLKA 2CB9A 3CCBA 1W1IA 4FFVA 1KU0A 5KBYA 4QNNA 1ZJ4A 1WB6A 4Y2SA 2QOEA 4HRXA 5AIAA 3H19A 2P8SA 2VF2A 4FFWA 3E1GA 4Q82A 5T4EA 1UZAA 1YSCA 1VOTA 1CUEA 5A7FA 2V9ZA 1CUJA 2WFZA 1USWA 1XRNA 2Z8XA 2XQKA 3DKRA 2B9VA 4X6YA 3UMJA 4UBLA 5EHQA 2PBLA 4LYEA 5AM0A 3GA7A 5ALPA 5T4BA 4Y2YA 4OU4A 4Q3LA 3WQHA 1GPKA 4QEKA 5AI9A 5CT6A 2E3JA 1ZD4A 1K8QA 1IUNA 4FKBA 4KACA 4AX4A 5EIEA 3C5VA 1WB5A 4DGQA 4Y2VA 2FUKA 3G0IA 2G63A 3V9AA 2PPLA 4ITVA 5EIAA 1EVEA 1BCSA 2VQ6A 3AIKA 2XQFA 1E89A 3PICA 3DD5A 4UUQA 3LP5A 2VT7A 3FLEA 4ZV7A 2WJ4A 3I2IA 1ACLA 1DU4A 2O2IA 5JD4A 1ORVA 5FKJA 3AILA 4MQLA 5C7YA 5FP0A 1A7UA 1WB4A 3U1TA 4MQMA 1LBTA 2Y2VA 3X3HA 3WKCA 4J0DA 4OPMA 1C7JA 4C6HA 4CFSA 5HQ3B 2B20A 5AHXA 3C5WP 2ZVDA 3RM3A 4BE4A 3A2LA 4GXNA 3WL8A 3C43A 2DFPA 1XZKA 1HBJA 4PF1A 4WDQA 5ALRA 4K2AA 4FBMA 2XUFA 5ALVA 1CUXA 3WA7A 3KWFA 4W1QA 2BUBA 2DCMA 4BC1A 1BEZA 2WJ6A 2QKYA 5EHXA 4P93A 1SC9A 3LCRA 4LXGA 4F0JA 3PI6A 3W9UA 5LYYA 1X70A 2HA7A 3IDAA 3WWCA 1YS1X 4AZ3A 3BE8A 4OCZA 3PE6A 3H17A 1KEZA 4EA6A 4KRYA 4ZRDA 3WLAA 1CPYA 3V1KA 5JALA 4MXDA 2WIDA 4JYMA 4WY5A 5BOVA 2VJBA 1ORWA 1QIJA 1QO7A 5DYTA 3FNBA 4DNOA 4PO3X 1YB7A 4L0CA 1G4HA 5E4TA 4CI9A 3D59A 4GWLA 4N8DA 1F6WA 1Y7IA 3PF9A 3QMWA 4DNQA 2PL5A 4U2CA 3MUNA 1K6EA 1P0MA 2JGJA 2WIKA 1JJBA 2QT9A 4N5HX 2I78A 2GYUA 4U2DA 2HA3A 2XUQA 2J3DA 4B0PA 3OPMA 4H35A 4O08A 4IQ4A 1EHYA 3B3QA 3BL8A 4X7BA 3VKFA 4BZZA 3MGAA 1XLWA 4LKOA 5A71A 1CUHA 2O7RA 3TRDA 5AM4A 1YCDA 5CRIA 1JKMA 1G5FA 5ALZA 4BRZA 2QMQA 3B12A 2FX5A 1JMKC 1CR6A 3JWEA 1ZIXA 4PQEA 4I19A 4KE8A 5AI6A 4JH0A 5LP1A 4Y2PA 1MAHA 3QPAA 2D5LA 2PX6A 3I6MA 2ACKA 1YS2X 4KR0A 2VJDA 3L1IA 4AN0A 4DYHA 2XUPA 2PVSA 1LPPA 2X76A 3W2TA 2DR0A 1RWQA 3HXKA 1ZI6A 5A6VA 4G5XA 5EIHA 4X6XA 3G9ZA 5BWCA 1XRLA 1FFAA 3M83A 2R8BA 3QMMA 4UFNA 5FV4A 2WHQA 4DTCA 1BE0A 1DTEA 1YA8A 5AK3A 4HTAA 5AKLA 4L9AA 1ZIYA 2V97A 2O7VA 4DMKA 2HRRA 2VSQA 3F96A 1AX9A 1N8SA 4Y2RA 4K5QA 2DHEA 2CBGA 1TCCA 5T4HA 1MJ5A 2WHPB 5JATA 4E46A 4MYSA 2ZJ6A 5HKAA 1G42A 4NMWA 3G9XA 2JBWA 4N8SA 2JEZA 2ZYHA 5BV7A 1QIIA 4DSAA 3QITA 3STUA 4QDZA 1J06A 3ESAA 3S2ZA 1B6GA 3I2HA 1EI9A 1P0PA 3UUEA 4KJXA 5CBKA 1EXWA 2JGLA 4H7FA 1MU0A 5AH0A 4JUIA 3H2KA 1W52X 3MUOA 2X8BA 4JYPA 5AO9A 2DHCA 3PUHA 2OCIA 1AURA 1DT5A 1XZDA 3FYUC 5CH3A 1Q0ZA 3KOOA 2CKMA 1YA4A 1MNQA 3VJMA 4OB7A 1XQYA 4U2BA 2WTNA 4F5ZA 3W9BA 1BRTA 4QLAA 2ZJFA 4QDTA 3I1YA 1CUIA 5ALKA 1J1IA 4BCCA 1JI3A 3DDUA 5CH5A 2EDAA 4GECA 5JASA 4J0KA 4CCYA 2WIFA 3STYA 2DSNA 3DOHA 4QZVA 2FJPA 2C4HA 4UBIA 3HRHA 3D0KA 2XUOA 5IVIA 3AINA 4AQDA 1JFRA 4H0CA 3TGLA 1MAAA 3AIMA 2ES4A 4FLFA 2HDWA 4C4ZA 3WWPA 1THGA 1HKHA 1H2XA 5AKZA 5AIBA 3K9BA 5ALIA 4UHCA 5A7HA 4BP8A 1EH5A 1JMYA 3N0TA 5D3ZA 1R4ZA 3I6ZA 5EHNA 3ZV7A 1PFQA 4BDSA 3PUIA 5LZ2A 1U2EA 1UWCA 3IUJA 2PM8A 4G8CA 1N5MA 4YK7A 1LPOA 1TCBA 3F98A 1BEEA 4K6GA 2I3DA 4IO0A 5ALLA 4BC0A 4H7DA 2JGKA 1ZD3A 5ALQA 5LZ4A 4GDMA 5JANA 1CUCA 2GBGA 4B0OA 4KE9A 3WK8A 2PSHA 1U4NA 4ZREA 3I2FA 1XZAA 4EZIA 1E8NA 4U2GA 1XQWA 3AZPA 5IVDA 2ZJ7A 3L1HA 3R3WA 4KE6A 5LKRA 5CT4A 4UBKA 1BCRA 2XQGA 3OC0A 2WG2A 2OAGA 2J4FA 1QFMA 1EVQA 3R40A 5LZ8A 2NW6A 5C8VA 1ODCA 5AP9A 3QYJA 3C6YA 4UHBA 5AOCA 1QLWA 4H7HA 1ISPA 4I3FA 5ALMA 5CMLA 2XUKA 3ANSA 4MEAA 4J03A 1SCQA 2HADA 3D3NA 1CUVA 4BAGA 1UK7A 1XQVA 2C5FA 5AM1A 4XVCA 2OXEA 5JZSA 5K3DA 2XMQA 5CURA 1HDEA 2QTBA 4PSUA 5ALOA 2WUFA 2Z8ZA 1UKCA 1UK6A 2JGMA 2HU5A 5FUMA 4B83A 4PV7A 1XZFA 3DCNA 5K3CA 3ICWA 4UHEA 3DS8A 4FLMA 5JARA 5CXUA 2OGZA 2V98A 4LYDA 2ZSIA 4GHWA 5EHZA 3WJ2A 1VXRA 2WG1A 3WKDA 3IA2A 1XZIA 3QZUA 2K2QB 3BWXA 4ARAA 2BKLA 4Q34A 4QDOA 1LNSA 3AFIA 3ESBA 1AKNA 5D7BA 5AM5A 3WKEA 3WKBA 1GQRA 2PUHA 4EB0A 4BVLA 5JYCA 3F8SA 1R3DA 3KSRA 2BUAA 1EB9A 2IIVA 2AJBA 3H04A 5JADA 2RHWA 2XQJA 5DYWA 5CT5A 5I9IA 3C6BA 2OGTA 5D3KA 1ZI9A 1CVLA 4BAZA 1XZLA 4X93A 2XMCA 5AICA 2GZRA 4Y9SA 4UHHA 3O0DA 4G9EA 3R3XA 2C0PA 1UOOA 4BVJA 3Q8WA 2OCKA 3QM1A 3TJMA 2GBIA 4W63A 2UZ0A 4ROTA 3O4IA 5ESRA 1CIJA 3D5EA 1XZEA 4P9NA 3FCXA 3WZLA 1QTIA 1UOQA 3ANTA 3E3AA 5A7GA 4OD0A 4BRSA 4DM7A 4HVTA 5JAUA 3D2CA 4ZGBA 5AI4A 3H2GA 4EY4A 4L3WA 3R3VA 4B84A 5E2IA 2QVBA 3FOBA 3LIIA 5A2GA 1CLEA 1MN6A 5ALWA 1F8UA 4RNCA 1JJIA 2WJ3A 4C87A 4ETWA 3FVRA 1H2ZA 2V96A 4B9EA 1XKTA 1UKAA 1AMNA 1DQYA 2ACEA 2XUJA 4GEGA 1C7IA 3MVEA 1HL7A 3ICVA 4GI1A 4OSEA 4HXGA 2H7YA 2EEPA 3BDIA 5AKJA 1IZ7A 1GPLA 4X6UA 4INZA 1MX1A 3R0VA 3IBTA 4NS4A 5C8XA 3FCYA 4OYYA 5IH7A 3H2IA 2XT0A 5AKIA 4Y2TA 3I2JA 5AK5A 3DEAA 4CG1A 2J3QA 2VAVA 5LZ9A 4LXIA 4OU5A 1XZCA 2RAUA 3O4GA 7YASA 4NZZA 2VTVA 5CT8A 1U65A 3NGMA 3WYNA 5AI0A 3QH4A 1ZJ5A 5ALDA 4C4XA 5HF8A 1TK3A 3DL7A 4KYVA 5I7UA 4TGLA 5CW2A 1CUZA 3C70A 1MX9A 3IUMA 2FJ0A 5EFZA 4UPDA 3QVMA 4AZ0A 2YASA 5CH8A 1TRHA 2HA0A 2W6CX 1TQHA 2RIPA 3WK6A 3WIOA 4JEIA 1EK2A 1VA4A 1NX9A 1EDEA 1EINA 1RP1A 1BN7A 3QPDA 4ZXFA 5ALEA 1JU3A 4WJLA 3DNMA 5AKXA 3HSSA 1AUOA 4QDUA 3R41A 5SYNA 1XRPA 3DJYA 3WMRA 5JD6A 1IVYA 2HM7A 3C6XA 3HJUA 4S0XA 1H22A 2W22A 1EK1A 3RARA 3HEAA 3DYIA 2CZQA 3ZLTA 4H18A 4G8DA 4BVKA 4UBMA
chains in the Genus database with same CATH superfamily
2VJLA 3VC1A 4BNGA 2CNNA 4BP9A 4EY6A 3L8GA 2Z4SA 4EK9A 4K9RA 2ZQYA 4L6CA 4LW8A 2E5LB 1NXQA 1M2OB 3PDUA 4BNZA 2P3LA 2VFAA 3T1HB 4RANA 2PVCA 3GJ7A 1PO7A 3KVVA 4V0OA 1O0CA 3T9FA 3WZMA 4AJ1A 4CMGA 1AG9A 1IQPA 2VP5A 2NZ8A 2J33A 4KH1A 2IQIA 4KB5A 4KMMA 2P5YA 3R44A 4BO6A 4LSWA 3D9QX 3PPIA 1H8ED 4G67A 3SJCA 3C7DB 3HO8A 5F9MA 4FYPA 1XMOB 3VTAA 2GJKA 2QQ5A 1LK7A 1TAHA 3I9OA 3JQ7A 3R0IA 1L7QA 3TMKA 3AIOA 4ENWA 3X43A 1WIWA 3DDOA 1MEOA 4AQ7A 1G3IA 3VU1A 2II6A 3K8YA 3ZYZA 1QZTA 2XQIA 4IJMA 3CWCA 4W1RA 4CT4B 4H7EA 3SQLA 5KSWB 2OENG 2OXIA 3UHAA 4BFZA 4JBNA 5C2JB 3RK4A 4AF8A 3FAKA 3GGOA 2QXUA 3DPIA 3N2GB 1DVRA 4R8MA 4WKNA 3IQIX 3THYB 4YRJA 2P9ZA 2GEFA 5BPHA 1NVDA 2OV4A 2XW6A 3L6DA 5H16A 2IEZA 4CUZA 1Z4JA 1G98A 1L7AA 3I76A 1D0IA 1MV8A 1NJGA 3I6YA 3GP8A 3GNQA 3IE0A 4FZ5A 5GOTA 5F2EA 5DK4A 3CG0A 4D4HA 4ZEXA 4OGLA 4A0QA 2FPMA 1CY1A 3R5FA 1V2GA 3ZCTA 4BX0A 3HDGA 4Q6WA 5L3QA 3NM6B 2IV2X 3O5AA 2AVNA 3PXEA 1N32B 2B37A 3EUAA 3ELUA 3H0CA 3D8RA 4R9RA 4ZCQA 2WMNB 3DA8A 1ZOSA 4MWSA 4Q9JA 3MCUA 3O2QB 5FLXA 3KSBC 1MIOA 1JDPA 4YJ2A 1S2IA 1SU4A 2P9QA 3GJ6A 2EWMA 5EIWA 1T3LA 3GROA 4V24A 5JH7B 2PAAA 4DIOA 4KL8S 5LU9A 4CUKA 5BSEA 3J81k 2PFKA 3P2JA 4ZDKA 2NM0A 2WMOB 3ANLA 2WNHA 4MVJG 3CRNA 2Q8PA 4NBVA 4TV9B 4KP7A 5IBQA 5B2EA 1WXFA 3QBVA 2Q62A 3M4JA 1VA5A 3E2MA 1Z4LA 1E1KA 3L0PA 4WKCA 4YO7A 1EUDA 1RWWA 2VBFA 2C2WA 1UM9B 2WYHA 4MJLA 3I9V6 3M6XA 4CG2A 3QKUA 2YJNA 4YALA 3A4MA 3H3FA 4N6NA 3E8SA 2QROA 2OSBA 5JJCA 1T2CA 3SS7X 4HBGA 5FXMA 2DBYA 1O94D 2BCEA 3FF4A 2HIGA 3I2YX 4IH9A 3UWPA 3T5PA 1NMXA 1MZPA 1OI2A 3GVHA 3QHPA 3BXXA 4YMHA 2QJRA 3VMFA 3R0ZA 4G26A 4JI0B 2Q3HA 1XTZA 4ZCMA 2OORC 1XROA 4IUDS 4OLFA 3J80A 3R9XA 1UR5A 1DJOA 1WB9A 1J0BA 2VRCA 4FW9A 1NURA 3OEEA 2ZB7A 1H2HA 1NUTA 4WZ6A 1IXKA 4AJJA 5BQOA 3G2JA 4OUDB 1TTHA 4XQ0A 1JWBB 3VV2A 2GKGA 4AFNA 1IYZA 2GCOB 2AS0A 1T6NA 2VHCA 1DPGA 5HQ3A 2FQ1A 3U60B 1NZDA 4DM3A 1JG1A 3LUBA 1OJLA 3GQVA 1SBNE 1YE8A 1SXJA 4LDNA 5ENVA 3KTAA 2VDKB 2Y1FA 1L7NA 5IABA 1QC5A 3BDAA 4JQSA 3I0MA 4EGCB 2G5CA 3ZNNA 2QUAA 3NNDA 4I9UA 2VIIA 3N0WA 1X7GA 4QJ4A 2B2XA 4DR4B 4QA9A 1DKUA 2CSXA 4ALIA 2Q3CA 1GGJA 2I3BA 3FRIA 3IMEA 2HBYA 1JHZA 1HE1C 1JI0A 2YIVX 3FCUB 2LZ0A 4IGIA 4ZJUA 1NQ5A 3C41J 3U4IA 1I36A 2XVMA 3HPQA 2RFLA 2PWYA 4WX2B 5CVTA 3HE3A 4P7GA 4GMKA 5FUBA 3R3HA 2EIHA 2J9ZB 3ONDA 2D1TA 3FDZA 3R5XA 1JR3A 2ZI5A 1S1CA 3G8YA 4R3UC 3DEHA 4LF8B 2G5TA 1R1DA 3RRZA 5DGIA 4K8OA 4NSNA 2A6PA 3EPLA 1S2OA 4M1TA 1LH0A 2O3SA 2DOKA 3D1LA 2H2DA 2X0JA 5EE3A 1USVA 4JYBA 1R0BA 3QLVA 3KQKA 1P75A 2CXUA 4ABYA 4NXNB 1GFSA 3L18A 3IBCA 3KSDO 4KLRA 3AUJB 2DR3A 3JARA 1GV0A 1P1JA 4NVRA 2JVKA 3GNTA 1ZCZA 3ZS9A 5MN5A 1CJMA 2H4JA 4DPMA 1Y5IA 1A8HA 3FBGA 2C20A 3HCNA 1OT5A 1RDFA 3HEBA 4P08A 1YQXA 1RZUA 2D1FA 3A1TA 2RARA 1O6BA 2A86A 2Y3IA 3FBWA 3FVVA 4XLZA 4ZOLA 4CLEA 4AJ4A 1ULHA 1M6VA 2YS6A 1L5MA 1VE1A 4L02A 4MVJD 1FP1D 4BWFB 2J0EA 5AK0A 3ZHYA 2C9OA 2R2GA 3Q7EA 5F4BA 1GDDA 1CNFA 4FEGA 4PBSA 4IKOA 4M0FA 3RABA 1WL8A 5JLJA 4B4UA 2PH1A 3ETDA 1SBIA 4WKGA 4MO9A 4XD7A 5CW1A 1IIRA 1DIAA 2FG5A 2RGEA 3EXFB 2PZKA 1I9GA 3KZCA 2F17A 3RK1A 4UREA 1EJ0A 1ZESA 1Z16A 3BWCA 3KQPA 3QKRB 4FCVA 4J6FA 2JGAA 4PZEA 4HFMA 3LUKA 2OZLA 4ZOEA 1O2DA 2VAMA 3H87A 3LPCA 5AXCA 3B89A 2OM2A 4KZKA 3RRJA 3UJ8A 4QDJA 7MHTA 3CN7A 4HQKA 5T8KC 1W75A 1HTTA 4ALKA 3GFGA 1YRHA 1PV1A 3GUCA 2Q8NA 4HYEA 3W5AA 1S3GA 2EARA 5DOZA 3FSGD 4XPIB 3A70A 3NW9A 3GRRA 2K7ZA 4GOOD 4RGVA 5CDFA 2QT0A 5I7RA 1PR2A 2NO7A 2QU7A 5JSZA 2D2FA 3TQTA 2PSDA 3TAXA 2V65A 3UMMA 2M6LA 3WICA 2AFHE 4MUBA 1KEPA 3RKRA 2EJBA 3V1LA 1GVNB 3KDAA 5FLYA 3TFQA 3LX4A 4D9CA 3HXQA 1AQIA 1ETHA 4U9UA 4Y98A 2D7JA 1KETA 1Y80A 2FZEA 2O4UX 4Z1OA 5L8VA 4GE0A 1R16A 4NMHA 4ZTBA 2JD1A 2PX8A 3RSLA 3CGGA 3C74A 1OLUB 3KEGA 2XB6A 3KIPA 3GLKA 2FEKA 2BMAA 4I6GA 3VZCA 3KSUA 2PUCA 2XVZA 1TVKB 4DMHA 1Z5ZA 1EZ4A 3H8SA 4UBNA 4ZO9A 1U4SA 1ZUWA 2F7SA 2HUPA 2WU1A 3K9NA 3FX2A 5EE5B 3T4UA 4BMYA 3I64A 2RONA 1DJLA 1Z82A 3DWEX 3PYLA 3NT5A 5H59A 4WFKA 3CWQA 3K7EA 1WCXA 1E3EA 5ALNA 1TPYA 2BYTA 2FU5C 1TCAA 4ILEA 3ILYA 3ABSB 2IOFA 5E1MA 2Q7DA 1P5FA 3MTDA 2NV6A 2O05A 3PFBA 4LPKA 3U7QB 4L5BA 3KP1A 3IHWA 3UHFA 1DC7A 1I3CA 1MB2A 1PD0A 3AONB 4F5WA 1DWQA 1U2ZA 2WJPA 3M2TA 3D6TB 2OKCA 3AF1A 3L1JA 1UQUA 3PG5A 3KNZA 3SWWA 1ZD5A 1SKYB 4CIBA 3MRTA 4GM1A 2DWOA 5EQDA 3BILA 3R8CA 1RHKA 1KTIA 3OWOA 1A76A 3C8HA 4ZC1A 1Q74A 4EITA 4ER6A 4FTWA 3RVDA 3LBAA 2IDKA 4TMXA 3IKJA 4IFIA 5K6AC 1ZIPA 2JKVA 1XO1A 2GZ1A 5GP1A 1SHUX 4H9GA 4YIKA 4G4GA 4NFHA 3HYSA 4MVWA 3CKMA 3EPPA 1AQNA 3RRXA 3ZKWB 2B61A 3ZS8A 1VMDA 3PPXA 3KSZO 1WXHA 2V5UA 1E66A 1OZAA 2DUUA 3CX8A 4GW3A 3V8BA 2C77A 5BWLA 2O7NA 3ETCA 1U7HA 3CZQA 1GXSB 1JE0A 2KS6A 3IVCA 4KXNA 1IEVA 1T5DX 1OKKA 4M46A 5HIIA 3ZJYA 2RGXA 1E2JA 1OC2A 1WDLA 2WJHA 4R3WA 2C9YA 4DJAA 5JTUA 4HAOA 2HRZA 4E22A 721PA 4KPUB 1G9TA 1CUGA 1ML4A 3IAAA 3RSFA 5PGMA 3SYNA 2FAXA 2HOQA 4G1FA 4BS9A 5FRDA 2GN9A 4P92A 1QKIA 1RRFA 4EVSA 5IUKC 4AY4A 2WF9A 4F46A 2VTBB 3ONVA 3OM9A 4UXIA 2HCRA 3VO1A 4CL8A 4DBZA 1MKYA 1HT2E 3KKLA 3NWOA 5BSWA 4MX8A 1GPH1 2ZIAA 3L43A 5HKBA 4OHFA 4UM7A 5C3MA 2JD0A 3SXUA 1GT6A 2JA1A 3T7DA 4YLYA 1RJEA 1NMQA 2LD4A 4FDTA 4QPJC 4MW1A 5HF5A 2UUAB 3H2JA 5TEWA 4AUKA 3UBTA 1XLUA 4U2FA 1RBZA 5EN4A 4D4IA 4XCQA 4J7AA 4WQMA 1KJWA 1XGKA 2JI4A 2B8EA 1ECJA 4LRQA 5DJ5A 2C61A 2W4QA 3RUEA 1C7RA 3TLGA 3TQRA 1T4MA 3KQUA 1QXSA 1FVXA 4GR5A 3HL4A 1MABB 2QW8A 3L8MA 3NHLA 5DFAA 3GWZA 1F6DA 3TVYA 2XZLA 3A1EA 4W1SA 4BCBA 3E4DA 3IV9A 3DBVO 4BWVA 2CT8A 2DQZA 2IA5A 1H0HA 5KHLB 1RXYA 1SUAA 4RUKA 3CZAA 4HXEB 1EBFA 2FW9A 5KTTA 1Z26A 1IMOA 1F17A 3PKJA 4L78A 4AO8A 1LC0A 5J1SB 1PZMA 3DNFA 4HOYA 3GLTA 1YR8A 4B34A 2VZEA 3QXHA 1V3QE 4EM6A 5TE9A 1I1HA 1J8YF 3KL4A 4F60A 2JIBA 2DTXA 2BZ0A 4R2IA 5KPJA 3E18A 4AK9A 4N76A 5DMHA 4EHKA 3V8MA 1K75A 3GVCA 1NV9A 3DMYA 5FO0A 1U63A 3RSOA 5CFMA 3K05A 3QLTA 4B5LA 5FA5A 1D2CA 3IHTA 3IILA 1BTOA 5TF0A 4PO1A 2O8CB 2XBMA 1WNFA 2FE1A 4N8EA 3WJ7A 2DETA 3IPRA 4V1CA 4L08A 3MWGA 4O4JB 1L1QA 2PX0A 1UKZA 3N28A 5GAJA 1JIXA 1GAWA 2JRLA 5AXDA 3EC7A 1EK5A 4HWKA 5LIPA 3BF8A 1L8XA 3MZ0A 4FT4A 3THOA 2FA9A 1DEAA 5ICEA 4IH4A 2C29D 2JFUA 1MGOA 4HLCA 3K2BA 5BYJA 1Q7GA 5LP6F 1ENPA 3KEOA 1CR2A 1TQ6A 1RZVA 3ABRB 3IAS1 3UZUA 1WG8A 2EIXA 2VNKA 3JZIA 3N3BC 1NMEA 4NH4A 2Q50A 2FUCA 4YJHA 3STWA 3L6UA 1AGYA 1PZXA 1FNBA 2JJQA 2CYBA 3FJYA 4ZCSA 1A5SB 1TE2A 3LI2A 3MIIA 1KZHA 1FRFS 2B3TA 2QTCA 3GAAA 3PX3A 4LRYA 1FQKA 1JLLB 2A9PA 4Q3CA 4G63A 3ZJTA 1TIBA 2ZYSA 5SY4A 3ABIA 4H3SA 1QVVA 2JCVA 3CZ5A 3DTVB 3Q3CA 2FZCA 2JGIA 1DAMA 2OQ2A 3HMQA 3KFLA 3L0SA 3QVVA 3UKDA 1Y5MA 3V1MA 1UOPA 1XWIA 1VI2A 1ISJA 1U11A 3R09A 1IZ8A 1S02A 4J1TA 2H9YA 3DEYX 3LXXA 1XQ6A 4Y6QA 4DG8A 1HUQA 5HK8A 8ABPA 3CF4G 1B76A 1C8VB 3HR8A 1N6HA 5AOBA 1SKBA 2R6GA 3BAFA 4NEHB 4FK8A 4UTOA 1RLJA 3GGGA 1SC4A 2ZRLA 3KJGA 4MW6A 4HQ0A 4NBRA 3D4BA 2ADFA 2BJHA 1KQPA 3JR7A 5H0IA 2XCLA 2NU9A 1X9GA 4KSBA 3UOWA 2OCDA 3I34X 3IKVA 5B12A 1OWOA 1ODSA 1T8WA 4RZHA 2VP4A 4DY4A 5D3MB 4JITA 2AQHA 4C06A 2VZ9A 4LZPA 5SZKB 4E07A 3PITA 1HDIA 1ADYA 1L5QA 2I4LA 1AUPA 1WUJS 2RBEA 5FUYA 1ZUNA 3OQOA 2GBLC 2W6NA 5A1TA 2WEKA 1IHDA 3M5PA 2YMQA 3H5WA 3HXOA 2QNBA 1XF9A 3LQ1A 4MCIA 4IMRA 4XGIA 2XWQA 4N7JA 4YRZA 2MYPA 4ZQIA 1G4AE 2SCUB 1QYRA 2RSLA 2FNAA 2CD7A 1YU6A 1FXUA 3NHAA 3QKSA 4NTZA 3UK2A 3ZIAA 2I2CA 2V6GA 3AETA 3D4NA 1OGIA 4CKZA 4NLLA 5M5BA 4X62B 3LSYA 4TYNA 1OYOA 4YRIA 4CI0B 3UG6A 1AD2A 3RAJA 4RA6B 2FQYA 4RVGA 3PKZA 2RKWA 4IQ8A 3TI9A 2QZSA 3CJTA 1UBOS 3QNMA 4JAVC 2J09A 5JAHA 1ZOPA 3GQBA 3OUTA 1Q0RA 3DZKA 5AJZA 3WI7A 3FCOA 4U2EA 4MS3A 4M0MA 4ZZ0A 1N2ZA 1E5TA 3KQNA 3I6QA 1E2QA 3EQ7A 3DL4A 4TLLB 3RVQA 4D98A 1JGTA 1LV7A 3GG9A 3D6AA 1ZYUA 4KAFA 5J4YA 4JYZA 2DPGA 4EJSC 4CKWB 4K87A 1GDTA 4TSFD 4EF6A 3NOVA 5HE9A 1SG0A 1YDWA 2BW0A 1EFRD 1DAKA 1EP3B 1LLFA 4LA4A 3KWMA 1LJ8A 3RVNA 1BGWA 1JIJA 1FRZA 4K3VA 3GAFA 3UAZA 2C7PA 4HNQA 5KOIA 2BEUA 1B41A 4TQUS 3IEUA 3TUJC 9ABPA 2D13A 1QFZA 1QV9A 3PUXA 4B7XA 4BMDA 4X1KB 1V1MA 5EEGA 3QE2A 3ZTTA 2PH3A 4MPJA 4PTLA 4I46A 4ETIA 1YZFA 3RUHA 3K0KA 4RQAA 5EWMA 4F4IA 5E3JA 2WYVA 1T25A 3NWBA 4AG5A 1D1QA 2BPOA 4UTRA 1M67A 1Y48E 4HXFB 5D85A 3HZOA 1DL5A 3ORSA 4P4SB 5BORA 4XJTA 2P2NA 4LXQA 1SIWA 4AROA 2WKPA 3PB3A 4B3SB 4IAOA 1QRDA 1UAGA 1RXIA 4EFDA 3QG1A 1L4YA 2B0CA 2DWUA 3DBLB 1PI3A 4OXXA 2ZRCA 1R6AA 1L5HA 3C97A 2WW8A 3VR3D 1CUSA 2NTYC 4CTJA 4DKXA 2FPKA 2DVMA 4E1BA 2C83A 4RQBA 3O94A 5HIKA 5IF3A 3R0XA 5JR3A 1QE5A 4F4FA 2F1HA 2I55A 3ESQA 2UZ4A 1CC1S 2H5JA 4RF4A 2W9XA 1OX4B 3BQMB 2R3SA 3UUGA 5BNIA 2FYTA 1VJTA 3SEFA 5A4MS 3VHRA 3G0GA 3PR2B 4Y9RA 1V5FA 5C32A 3TTWA 1XE3A 2VHJA 2IYQA 3GXBA 5DTIA 3MBKA 1TZCA 3U49A 2DMRA 3ZK8A 4EG8A 2C4WA 4I6JA 1Y3CE 3K09C 4YJ3F 1B0PA 2C7BA 1X1AA 2VDLB 3B6IA 3BE5A 1FXWA 2BGNA 2FRDC 3QFHA 4OXRA 3MRVA 4PSKA 3TQQA 4R2KA 1E3MA 2DQKA 2WJIA 2HB6A 1OU0A 1P7PA 1EWQA 2D0DA 3ID6C 4Z0TA 3EWNA 1M6WA 1PHPA 1Z36A 2R48A 2DPLA 2ZVJA 4HTFA 4GLFA 4XM0A 1EIWA 1QH1B 3MCVA 4DDKA 1NTOA 1N9ZA 1NY5A 3JATA 3DLCA 3CVYA 2R6HA 3JTMA 1I7DA 5CFNA 2I4NA 3KPJA 1GUAA 3CVXA 4QXOA 1LI4A 1WABA 1COZA 4HRAA 3SZGA 4E08A 3PNQA 3NQ41 1Y98A 2BL4A 2HZBA 1L5LA 3TOZA 2C58A 4EW2A 3RT9A 4DRZA 3YASA 3ZK7A 4F9EA 5BWMA 3GX1A 1X1CA 4CV2A 5BSKA 1DGQA 1OA1A 2HEGA 1W36C 1GGVA 1U28C 1ACJA 2BGJA 2GM3A 4FSHA 3KJEA 4DLLA 3JQAA 3G2LA 5SYMA 4DEXA 3AQ4A 4OLAA 5J4LA 4WOPA 4Q47A 4Z9YA 2WUDA 4WINA 1X9IA 1G5HA 1KRHA 3D7KA 3GPIA 1E5VA 4G0OA 1UXGA 3DLBA 2PT6A 1RKVA 2VYQA 2G77B 4N0MA 5KVSA 4PZCA 1CQZA 1V16A 4G6ZA 4G84A 5JDIA 2ZYWX 3FJOA 4KRXA 5FI0B 1QTRA 1UH5A 1E79D 4O59O 3PD7A 1PZGA 2HAEA 1YMQA 1EFHA 4K0RA 3JALA 1RRPA 4Y9DA 2N42A 1ZAKA 4JXXA 4MQEA 3GEBA 3IVAA 5CPFA 4EHLA 1NR7A 1JZSA 3DWGA 3UAVA 1W1UA 1SOMA 4HQOA 3WK7A 3BTOA 1XCJA 3PC4A 2VEDA 3UMYA 2G1PA 3DDSA 1U9ZA 3KZ1E 5IT4A 2Q0XA 4OH1A 1R15A 1OX6A 1YDGA 1QF9A 2H16A 1OGYA 4XH9B 4R6WA 1PX0A 5I8PA 3RDPA 1ODKA 2Y0CA 3OUZA 3VOBA 3KXPA 3RUPA 3A1DA 1MIHA 3HVKA 2C9MA 2Z2JA 1Y33E 1FLVA 2R86A 1GZ4A 3ROGA 3IP1A 3E35A 1T34A 3KJZA 1VYVA 2QE7D 2HA6A 4BNLA 3TR5A 1L8OA 4QNRA 5B4TA 3Q8MA 3PUZA 4G4IA 1E2BA 2W8BA 4IIJF 5JSUA 4ZHSA 1HRDA 2CHFA 3N3AC 3O1IC 3PVCA 5AW9A 4LWQA 1PL8A 3BXFA 4HXYA 5ES4B 5CT9A 2H5IA 5THKA 5JW6A 4D4GA 3GLIA 1PT5A 3L5KA 4G56A 4GQBA 4RE6A 5E0KB 2YZKA 4X6LA 4JN6B 3IBFA 3TRIA 3ZH9B 3F49S 2PTHA 2GDZA 1COWA 3PE4A 3LNTA 3ZD7A 5LFAA 4N5LA 4IVRA 4M86A 2BMJA 2CWDA 4PFJA 1BCRB 4TOIA 4EEZA 5BNTA 4NQRA 4B7ZA 1L3IA 1EVLA 1C1YA 3ZGXA 4EUNA 3P4XA 2GETA 1FMFA 1P18A 6ADHA 1T36B 2HHAA 1DX4A 4PRYA 1W0JA 3MXOA 3WDKA 1ZRMA 2QMZA 1TECE 1GUYA 2IHVA 2VJQA 2YQ4A 5DGDA 3LUHA 1MX3A 2GVNA 4MGHA 1Z7YA 2PD3A 3EGXB 2PMEA 1SOAA 3U7FB 2XZDA 4HFRA 5CVUA 2I2WA 5I9NA 1YZVA 3G13A 1LLCA 2ZUVA 4H3HB 5L7WA 4KO8A 4Q4JB 2P62A 1XVVA 1B3RA 3ED1A 4KWEA 4BVFA 5BSTA 1UJ5A 3IX7A 4PNZA 3BICA 2BM9A 2X8LA 3ZEIA 5LQDA 1G5TA 1T5TA 4M87A 3X1MA 1NW5A 2WHEA 3ZLBA 4G1VA 1XTVA 4J29A 3D3WB 1RNLA 1BU8A 3TBFA 3NDBB 5I8ZA 2XNDA 2OQIA 1AKVA 1KSGA 2HF9A 3VKWA 2VTEA 2O50A 3F7OA 2F3RA 3ETJA 3IJ5A 5DYYA 4MI6A 2CD9A 1M1NA 4IIGA 2HI0A 3MAAC 4O2BF 5CXXA 2ATCA 4L2IA 2PXCA 4AVYA 2R8YA 2HRQA 4US2R 1QHYA 5K3FB 4FHFA 4ID9A 2A84A 1XKLA 1BDJA 1LWNA 4OHUA 4NNJA 1ZL0A 2QVGA 1VMEA 3L7AA 1GKLA 4WLEA 1JDTA 1EMDA 3L0DA 5BNZA 3RHZA 2AJCA 5LZ5A 3G0HA 2VK2A 4MUMA 4J0HA 5JXHA 1PSDA 3VDXA 2VCEA 1XTQA 4CR7A 3MGBA 5EP2A 3CT4A 4X1YA 2YHIB 4DCUA 1EXDA 3O4JA 4MZXA 3UATA 3W78A 9LDBA 1UEXC 5TQ2B 1N78A 2MYNA 2REOA 1HDRA 4IJ5A 1QGAA 1N0UA 1WQ4A 3RUAA 2OFXA 5BMOA 1N9GB 4AD8A 3HCCA 2W2LD 1DC3A 4PSVA 1TM2A 4WLNA 4DKJA 1IJEA 1QHIA 1AN9A 4U63A 1P1HA 4B4KA 5DGCA 1S8OA 4F1JA 4XM1A 1IQUA 2ZVQX 1I0LA 2GH1A 1E3TA 4NCIA 4D3FA 4BO9A 2B30A 2AJ8A 2OT3B 3BHMA 4YASA 1QGOA 1AQLA 1XZHA 4CKCA 1K7FB 3OOHA 4MI1A 4MUGA 1UAYA 3PBKA 4ZZIA 5JFTA 4LYFA 1U0HC 2H2GA 5DNAA 2F3SA 4HR7A 3EQ6A 2E6KA 2O14A 4BGVA 1KGDA 5BPFA 4HDNB 1YAJA 4Q4AA 1PIWA 4IIUA 1BMTA 4NAVA 2BSXA 3SC2A 3I9V1 4BTLA 4WA7A 1KL7A 1KA9H 1R4MB 4AF6A 2A33A 5B3KA 3BGDA 5EWLA 1XZ8A 4DWJA 4H1HA 4GFDA 1XUOA 3CPEA 1E6CA 2CHUA 4ZAGA 3TIVA 1MTZA 1DBWA 3OZGA 2ZR8A 1K5GA 3ECAA 4LNAA 1ISMA 1E2FA 4OKIA 1TPZA 4MIKA 4BFTA 1MD9A 3FJ1A 2IYYA 1EB8A 2CXNA 1E1RA 4FOLA 1Y7PA 2JLQA 3K1TA 4JSRA 3NHFA 3ND8A 3SE7A 5ANRB 4D1YA 2X4LA 1CP3A 4QDKA 4X7MA 4N48A 2YY6A 1CR1A 3TJRA 3VVBA 4TKLA 4A16A 3BMCB 3P2MA 4CQLB 3ZDAA 5CX4A 3OMWA 2MSCB 1PWYE 1ZHHA 1M33A 3QY9A 2E4YA 1KH1A 5B1SA 3IODA 1KOGA 3NV7A 3SC4A 2R62A 4ZRMA 3TDKA 3QBDA 3QFFA 1GAQA 1GLGA 3OQ6A 3PGVA 4RE5A 2BM8A 2XLCA 4JXKA 1CU1A 4G2NA 3J7AC 4W7SA 5BQ3A 1P19A 1FUEA 4ETMA 2N3ZA 3ESCA 1UQTA 4E5NA 3A6PC 1PJ2A 4J4HA 4DF3A 2AFRA 1JYSA 2P2DA 3ZI4A 1E9BA 1PAUA 2DC1A 3H97A 3FYTA 4J0CA 3RSSA 4J7XA 3A2NA 3G88A 1E0SA 1JNYA 3WWEA 5LD2C 4AS1A 1JLHA 1R4NB 3B85A 4WADA 5HK9A 3FRJA 3H18A 4CF3A 4D5EA 5M04A 4XPZA 1OVMA 1GTMA 1X19A 4EKEA 3NHYA 3O9VA 1RYBA 3MWLA 4Q3EA 5K8JB 4NJOA 4TTSA 1SA0A 2G76A 4RTKA 2ZE5A 1CZNA 3KQVA 5FR2A 4NYIR 1JW9B 3EW9A 2FWIA 3ASZA 5JAMA 2YNMC 1NIJA 1ZRNA 1H93A 1HY3A 5LKAA 2OFWA 2CMDA 4FOOA 6NULA 1VSVA 3VXKA 3BXZA 4UTVA 3I32A 1P5HA 1QRTA 3U7JA 5LYJF 2OHVA 3UJ7A 3C3MA 4ND8A 3RUIA 3HV0A 4IHJB 1PLJA 3B5EA 1T5HX 3EQ8A 3EWSA 3MTEA 4Y1RA 2IZ6A 3PPYA 4OQMA 4GZ6A 1WKBA 1QIGA 4G5HA 4NYJQ 1ESMA 2EYQA 3Q5DA 3V42A 1T4GA 4EHIA 1ZK1A 3C5EA 1MQ8B 1A8SA 1MG5A 1ZMRA 3VQTA 1W7AA 3R1IA 3HKCB 5DXFA 2K4MA 1QRRA 3MTQA 4IH1A 4J3JA 3UCXA 5FDFA 5K0SA 4LVUA 2NZYA 3P96A 2B3DA 4WKOA 3WHKA 3RYFB 2B4TO 2Q5HA 4MP8A 3UN1A 4TKVA 4D26A 3KE8A 1R0ZA 4QPPA 4H7KA 2XE8A 1C3OB 3LRTA 1CK4A 1GGFA 3OTHA 4QOEA 4YIHA 4PAQA 4RZIA 1BS2A 1H4VB 3VR6A 2FQQA 3WB9A 2DB3A 4G4SO 4LK3A 1Y8RA 3K0HA 1CJSA 1MW9X 2EF0A 7MDHA 3PRYA 2XE4A 1KO8A 1BHO1 3ZVMA 1CS0B 4D3YA 1W581 2WMYA 4TMKA 5BYKA 1GY8A 1Y5RA 2EX4A 3I5UA 1P4SA 3K1AA 3WV5A 4EARA 4RGBA 5HRAA 2YV5A 4NZMA 1BJRE 1A4UA 1CQJB 1NR1A 3WNZA 4TKZA 3Q0IA 4K26A 1ST2A 4N0QA 1LD3A 1RLOA 2DUMA 3AI3A 4EKIA 1TC1A 2AH5A 2F1KA 5JXGA 1R6XA 2KI5A 3H84A 5F21A 3NBQA 4YRBA 2JNWA 3RC3A 1EFVB 5JISA 4KXVA 1KORA 1R6UA 1YZ3A 2C99A 3EYWA 4A1OA 1X94A 3S1LA 1OXKB 2KSQA 1OAOA 2F8TA 4BVGA 1E3IA 2C97A 5FTKA 4FNMA 3A6HA 2UKDA 3W9YA 1FTNA 1E3DA 5DCUA 4YCCA 2FJUA 3IIIA 1S5PA 3NAQA 4LIPD 3PDCA 1ILWA 4PQFA 3WGLA 3D7MA 2NZJA 3CF2A 4FS3A 2GERA 2WILA 3QE3A 2Y2UA 5C0OE 3EGWA 5IEJA 1T15A 2KB0A 4MKXA 1I2MA 3UG7A 1UWKA 4PNHA 2QLTA 3VSDA 2RGWA 4IMPA 1A2OA 2PMKA 4F3KA 4DMRA 2Q5LA 1S0UA 4FBGA 1NL3A 4LF9B 1M76A 4G37A 5EJAA 3U9TA 4P5DA 2GWHA 2EG5A 5EJ2A 2ARKA 1ZK0A 1I80A 1VKJA 4NBKA 1KQOA 1R7RA 2FFHA 3R0JA 5J59A 5CDUA 4RK7A 4ZFNA 3LZDA 2B1QA 3O92A 4FR0A 1UK8A 4IDDA 1LDEA 1FFDA 3EVAA 4IYJA 5KYWB 1YS4A 4LY0A 1SEPA 1GAEO 2CCKA 2CXXA 2VDPB 2ABWA 3Q2OA 4PYIA 3TI7A 3QX3A 1Q50A 3L6BA 4IIVA 4DZZA 4Q4HA 5I7FA 5KJEA 1THTA 1Z22A 4LX0A 4DSNA 2QD3A 2YN4A 1J99A 2GKSA 1SHZA 1XRRA 3ODGA 4GOKA 2HUNA 4QOGA 1RKQA 1DJNA 3WWDA 1UAAA 4XCXA 5CJJA 3GH1A 2RC5A 3ADPA 2ODTX 4CV3A 1RPJA 1FYWA 2CXRA 4M8KA 5HIMA 5EKXA 4AZTA 4F93B 1O77A 4P86A 1HEIA 3P27A 3E48A 4DLNA 1OQAA 2D3WA 4MITA 1KVRA 2O2HA 3U7IA 1HG0A 5IZCC 1SXPA 5DNEA 1V43A 2ZRGA 5F7XA 3V8VA 1M7BA 1P2DA 4W7HA 1YBAA 4FE7A 4CIAA 2OV2A 1BWSA 1X3LA 2YC2C 4IMIB 1OI7A 2XF2A 4GMGA 4MV3A 4EYOA 1PTJC 3DR3A 4OATA 2A0XA 2H4FA 2XYGA 3IXLA 2FDXA 3IQDB 5CA1A 1VI5A 1ST3A 1UK9A 3IAUA 1RM3A 1QHFA 3GCWA 5KWSA 1UKYA 2ZI9A 2HGSA 5KVCA 1T8UA 4B2YA 1CVIA 1TZBA 3DBIA 1CUYA 1BOFA 1WZUA 3DD1A 1E8MA 3OCJA 3V2GA 2BDTA 3I52A 2XYVA 2E1RA 3L1UA 4O4HB 4UEQA 4CM9D 1XQXA 3DXXA 1R9MA 3ZXUB 4L7QA 4CCAA 3NU1A 1RHJA 4NULA 1XTPA 2H5LA 1AF4A 4J9VA 3WSWA 1D4ZA 4NJEB 1SZCA 1EVYA 3ETEA 2WYIA 1C0IA 5A1JA 4N03A 2Y1KA 2YHSA 3E9EA 1FU7A 4FFDA 4TWJA 4Y2XA 5AJWA 3JPYA 2EZ4A 5BOSB 2X86A 2Z3ZA 2VN8A 4HZGA 4RK0A 1LZKA 4DSZA 1QGUB 4WUTA 4CT0A 1TGVA 2NSYA 2ZTSA 4ZYWA 3CLUD 2GCEA 2X8JB 3HLKA 4LCEA 4NF2A 3CCBA 4MR8A 3L79A 2LTAA 5FR1A 3VKHA 3T38A 4OKSA 3DXFA 2Q3MA 4MV0A 4L8GA 1KU0A 1NF9A 5DMXA 5KBYA 1X1QA 1WB6A 1E2LA 2QOEA 2KHZA 3C0KA 2GPBA 2C1ZA 4XSGA 5EZSA 3F46A 5G3YA 3CR7A 4HRXA 2H1SA 3TB6A 3K9GA 3OLVA 1SVOA 1ELOA 2VDWB 2FP4B 2Q5IA 2COUA 4KXYA 4PZAA 5AIAA 4KQIA 4MKZA 5BSUA 1UJ6A 3NBMA 2P8SA 3IAFA 5MGBA 2ZRKA 1X14A 3P20A 3Q0EA 2V6IA 4B47A 3HXPA 2VDVE 4PGHA 2OORA 1VOTA 4PPNA 1JPJA 4KITB 3ZZMA 2E2WA 1M2JA 3PWTA 4N9QA 2WFZA 2HSWA 5IK2D 1YS9A 1TM4E 1EM8B 2XQKA 5D1HA 1U3DA 1XP8A 3DKRA 3FNGA 4NK5A 1G7SA 1E1CA 1ZIDA 1PQUA 1ZUIA 3LRXA 2XY4A 4M88A 2QSUA 3G79A 4DCMA 2ZZNA 4UBLA 5EHQA 1Z13A 2G28A 4R98A 2G6TA 1P1IA 3GY0A 4V0NA 5JIBA 1BOOA 4AWAA 1Y8QA 3N05A 4G25A 2F8MA 4XWYA 1OGJA 4LOKA 2VYFA 1S89A 1LQUA 4OXIA 4W5OA 1F51E 4IBOA 4MTLA 2CV2A 4WAUA 1K88A 1IEXA 2O19A 2XBLA 1GCOA 2V6JA 3NIFB 5IAKA 3SQWA 3GLGB 3TK1A 1TW3A 1DCMA 4Q3LA 4FUTA 5AI9A 5G4KB 5CT6A 2H4HA 1GGKA 1K8QA 1P7VA 3GLSA 4W8GA 4MR9B 2O8BB 1X1BA 3C5VA 2AG0A 1GFWA 3LAWA 9MHTA 3K0BA 1DO2A 4XUEA 1C0KA 3BGOS 3ZXIA 4YI3A 5JOQA 3NMUF 1MZVA 3TLXA 3P2YA 5K9ZA 2B9EA 3G0IA 3RAFC 5TEVA 3R9KA 1F20A 3G7SA 3A10A 3F5DA 4FDVA 3F78A 3OCUA 3PSHA 5ESDA 1M34A 2Q6VA 4P7KA 2I4OA 3MJEA 1OAKA 4MP3A 2Y1XA 4GVPA 4V0SA 5D86A 1JHXA 1FFSA 1GU7A 4WNCA 1R9JA 1EVEA 1NVKA 3ZD6A 1V48A 5JCJD 3LKZA 1E89A 3ZTWA 1NKSA 4O4IF 2YVLA 5BQFA 2AA3A 2AR0A 3DD5A 1ISIA 5TV2A 2XGGA 3N2NA 4E13A 2O8DB 3LP5A 3LUCA 4ENPA 2VT7A 3FOCA 4AMBA 3F73A 1L9XA 4RJKA 1KK3A 2R7NA 1VG9B 2P67A 4KBYA 1T6XA 3I2IA 4QPZA 3RASA 4DCVA 3ZQKA 2EC5A 1W4BA 3JD0A 3OT1A 1NSYA 1IM8A 1KZ7B 3C4JA 1TM1E 1XRSB 1I4EB 1WUYA 5C7YA 3FPBA 1G8AA 3R6DA 1QZUA 3U1TA 2QU8A 5LA6F 3ZW9A 2CY0A 4BLPA 2HKIA 3BMOB 3VC2A 1GWNA 1T4DA 1MXHA 1WKVA 2W2XA 1M75A 3KELA 1UBKS 1ZXBA 2CFOA 2QQGA 2FOXA 3X3HA 5K6RA 1ECBA 2QK4A 2G25A 3ND9A 4JJIA 3MS7A 5E7QA 4CFSA 1YQ9A 1T8YA 5T8KA 1UJ4A 3PNPA 2WF6A 3H9GA 2Q6OA 2ZVDA 3KKKA 4NRDA 5HZKA 3IRUA 3VC7A 1O6ZA 2NMVA 1J49A 1SO8A 4S2EA 1I94B 4BFXA 3A2LA 1WXIA 2YYAA 2GZMA 4AIRA 4PF1A 2DFPA 2VLBA 2YVKA 4QXPA 5ALRA 4NMLA 5DTMA 3RPEA 1AZLA 3T9DA 4ZYVA 2IXEA 3LSTA 4FBMA 1B15A 2CLDX 4L4UA 4ER3A 2P6RA 1B14A 5LQSA 4W1QA 1RWBA 2CLFB 4BC1A 5A4JA 2J3EA 1O3YA 4LXUA 3FPFA 1NX6A 2WJ6A 3S40A 4L74A 4GNKA 4XYGA 4HSEA 4ZDWA 3RS3A 4S1PA 4DLTA 4BL5A 2ORVA 2EJTA 5BSRA 3DB2A 3LCRA 4CLRB 2QZZA 1JMVA 5KYNA 5LN1A 3IKTA 4F0JA 2DY0A 3PI6A 1Y3AA 3FFAA 3W9UA 4YWJA 3BRWA 5LYYA 2ZJ1A 3L02A 3IP6A 1DBQA 1X70A 2O2YA 2NO0A 3N2KA 4O2AA 2YUIA 3N8NA 5ITWA 4C4OA 2YY5A 1I4TD 1YKSA 2CVOA 3LUJA 1OOEA 1TLTA 3PE6A 2X1MA 1KEZA 3EGEA 3OPYI 1OBHA 1DQPA 3AWIA 4OQQA 4Q1BA 4KRYA 3DH0A 5CUQA 4DT1B 2J9FA 4W8HA 2NVUB 4KIWA 1CJUC 5BQPA 3K71B 3KYDB 5A02A 4BIMA 1S7CA 4IEEA 4CZ2A 2OMKA 1D0VA 3A37A 1P4JA 1L5NA 2F67A 3W3AH 5JALA 3U62A 3H7IA 2IY7A 4F6RB 2YBEA 5BRAA 4YCLA 1LXCA 4MXDA 4PS0A 3F4BA 3MW8A 3E7DA 4IXTA 4JYMA 1U0BB 4MI3A 1WHSB 3OAAD 1G2OA 1O5TA 4N0EA 3LG2A 4IVNA 2VJBA 4N54A 2B34A 1REQA 2WV9A 1S96A 4XWAA 3OCXA 5DYTA 4LHVA 5EXSA 1JR6A 1AK9A 2WP8J 3OE7D 2JFHA 3SFTA 1RXVA 2I6FA 3K9QO 5F5NA 1C50A 1N6PA 2AJTA 2QEQA 3PC6A 4G81A 5FYDA 3U3JA 1XQ1A 5J43A 5H81A 3N0RA 5K6AA 1AMUA 2JBHA 4KXWA 5F9HA 4F56A 1BE8A 4LJLA 5TS3A 1BMDA 1RIFA 4L0CA 4DMLA 4B3RB 1L6RA 5JAIA 1WV1A 1P77A 4N8DA 5D2CA 2H1FA 2OD2A 1K86A 2A67A 1I0IA 1SUIA 2VWPA 3CLKA 4P4GA 3EPRA 5CVJA 4LQCA 5DCYA 1RWOA 1CIPA 1JFFB 1PR3A 4HD8A 1SD2A 4MGEA 3NP9A 4CGYA 4BIIA 4U2CA 3UV7A 1O9GA 1PFWA 4MVCA 1U04A 4BNDA 2H1VA 2ZRQA 1P0MA 1SKYE 3TTXA 4C0WA 4OEHA 3ENWA 2JGJA 4QSMA 3EUFA 3DC2A 2WUWE 1G1MA 2OHFA 1E94E 4KWTA 4EGJA 5LLTA 4XASA 3KXIA 2WF8A 3ETHA 4PS1A 5FBWB 3RTDA 4CM4B 1PV2A 4IF6A 4NXMB 1PQYA 2BONA 1SG6A 2GYUA 2OV3A 4BEBA 3IB6A 2X0DA 2HA3A 3HNRA 3IV7A 3MIZA 2F1RA 4H35A 1XWFA 2CYCA 1POXA 4WEOA 3ZD8A 4MPPA 3AM5A 4E03A 3DVAB 5TPZA 5LB2A 2O5VA 4GMXA 1PP4A 4UAVA 3SIXA 3W9SA 2HJHA 4OXQA 1S2DA 3PCTA 4NNOA 1Z3CA 621PA 4MLPA 1C30B 2OCYC 5CFPA 2HBZA 5CG2A 5A71A 3QE0A 4LSMA 2EV9A 2HBRA 4HWTA 4MVJE 9ATCA 2QI9F 4KUEA 3EMBA 4WTOA 3AVOA 2R66A 1D9XA 4PAMA 2O2CA 1A5AB 1WMBA 3AEQB 1V7PC 3BA1A 3FGOA 4MQ6A 2APJA 2ZWAA 4S2UA 4LXTA 1P1CA 3LWDA 4KTVE 4MP6A 4AKIA 4MVJH 3UT5B 3KDSE 1MDFA 5KJCA 1BE6A 3ZZUA 3U13A 3ZDZB 4BRZA 2QMQA 3B12A 2BFEA 1JMKC 1KDOA 4KO2S 2DECA 4GYYA 5JWOA 2I6TA 2F3PA 4I19A 5CIWA 3PCRB 1KKMA 5BW8A 2D8AA 4HPJB 4QPDA 5TMDA 1X8LA 5KC8A 2POQX 1SN7A 1C5KA 1ZMTA 5KMGA 2HREA 2VT3A 2NU7B 2DT5A 4JR2A 4AN4A 1UM8A 1G41A 5CDSA 2H8KA 2OL4A 2ODWA 4BBJA 1MAHA 3AX6A 5TQJA 3WZ2A 1P7ZA 2Q1WA 1ADCA 1VHDA 3QPAA 4ERXA 2DERA 1SVKA 3KBOA 4UHJA 5ICMA 4XR4A 3S4YA 5KVAA 1IBMB 2PIDA 4CEJB 1KHHA 1W87A 1U0NA 4XTRA 3ZOKA 4MWCA 2P0AA 2ZJBA 4DB2A 4WKBA 4Z4FA 5JCXA 2YZMA 1DIRA 1H6DA 1SU6A 3IC5A 5BUZA 2XCSB 4DWWA 1ZI6A 4KWIA 1GLVA 4HDAA 4JT8A 3RF7A 4EUFA 4RULA 3OZUA 3X1XA 3DLIA 2HLDD 3H3XA 2M9MA 2Q41A 1Q1BA 4D0RA 2JVJA 3WGVA 4TLMB 5COQA 4AMUA 4F04A 5BWCA 1ULSA 4CUJA 3L92A 3MINA 4O4LA 2ZJZA 4TV8A 5LVAA 2JJ2A 2CNDA 3UV6A 5BWNA 3QMMA 3FM9A 1ZXLA 3V4LA 5FV4A 2NUAA 5CNMA 3AOEC 1BE0A 2PX2A 2Y4OA 4KV7A 1DTEA 1CBUA 4JIGA 4TRMA 4A36A 2FY8A 1JB9A 3AEUA 3N9IA 4HJRA 4WESB 5JZOA 1N3LA 2A14A 4Z53A 3UK6A 1NN3A 3TZCA 3L82B 2O3TA 4GZ3A 4J7CA 1KE2A 3UWDA 4ENUA 2O7VA 3G2PA 4LY6A 2A5GA 4DC0A 1NHWA 2PUFA 2CXHA 4R2WA 2FFJA 2J85A 1ONBA 2V55B 1AX9A 2GNOA 5JS2A 1GPBA 4KX5A 5LP6B 2JASA 5K2OA 3EEOA 1ZA2A 4BX2A 5FA8A 4EYEA 5H8WA 1TUGA 4TVBA 2IHBA 2CLSA 3KSMA 4QO7A 2BTQA 4LPSA 4XOIA 4WY2A 5T41A 4UQPA 5KDDA 2AX3A 3CLRC 1T0JB 4BPRA 3PEYA 1Z39A 5I4BA 4TWIA 3UMVA 4C22A 4RDXA 2ZJ6A 4XJSA 5HKAA 4JI8B 4DIEA 1JFVA 4L27A 2WVJA 1YR1A 4MGKR 2GK3A 3BHNA 4NMWA 5KYYB 4CF4A 2NO5A 4Q7EA 2ZCVA 4YAWA 3NIWA 3NPAA 2BR3A 4YP7A 1SUPA 4YACA 2GBLA 1QIIA 3HYRA 2H29A 4MLZA 4NH0A 1KMCA 4OM8A 4XDZA 3IQWA 3STUA 1M6EX 5A3VA 3RE1A 3NGLA 2XVXA 4I3GA 2NADA 3ESAA 4RHXA 5DHUA 3W3ZB 1W25A 3ACDA 1PS8A 3LD9A 4L9SA 1P0PA 2PUWA 4BLWA 3RVSA 3LX8A 4KQHA 3HYCA 1KY5A 1Y81A 3QLEA 1V45E 2GEDA 1YZYA 3QQPA 3U31A 2JJ1A 3ZVNA 4LTNA 4KQ6A 2AD5A 3GT0A 3RU9A 1W52X 3JYLA 5JTTA 3G23A 4NBLA 1JDVA 4JYPA 4FFRA 1A9RA 4ODIA 3X1DA 2OZEA 4IMJB 1AURA 4BLRA 3OTOB 1FCJA 3TPFA 4CNBA 1XZDA 3THWB 2I3GA 3LP8A 3TB4A 4GGPA 4MW5A 5CR9A 1Q0ZA 5BR4A 1N2XA 1QHSA 2OR3A 3JAKA 1VJRA 3BB1A 4HN4B 3ZU4A 1DTSA 1AHNA 1O95C 2GFIA 4B6SA 5JJ5A 3EXHC 2FPIB 2OHJA 2EATA 1P7WA 4J76A 1FTWA 3RODA 4B48A 1PL7A 1DMSA 1RD4A 3OQHA 1UPAA 1FRQA 1KVSA 5HSGA 2YTZA 1EUCB 3AJEA 4OB7A 1M2NA 4PXYA 3OX2A 1WO8A 3A6FA 4FFNA 3QVSA 2Z2YA 3W9BA 2D00A 1U8YA 2YWGA 4MV6A 4RK6A 1DXHA 2XTJA 5GM1A 3JQGA 7GPBA 5JCZA 2IS4A 1VFNA 4XWWA 4RTRA 4ETNA 4IHQA 2VYNA 4TKMA 2JFQA 4ISCA 4A0GA 3MD9A 1HLFA 3VPAA 2ZJ2A 3JSXA 4TLDA 3UK1A 4LAFA 2Z9DA 4BCCA 5BUQA 3UA4A 1PR6A 1DS6A 2XCIA 4HADA 4WOCA 5BSFA 1GTSA 3H11B 2W70A 1VSTA 3AVQA 2J5BA 2EDAA 3HCPA 5EEHA 3W2GA 3K8ZA 4K86A 3REQB 2FSVC 4UPEA 3WQRA 4P3XA 2BI8A 4M98A 4U7FA 2BMVA 2C4HA 1H42A 3QW4B 5IDYA 3TYXA 4EDFA 3IUBA 4GI5A 4OF4A 2IKSA 1UP6A 3HRHA 3K5HA 4JBYA 4ZC8A 1TYBE 2XB2A 4MB6A 2GNPA 3KJHA 4MZDA 4RLHA 1T8SA 4TTTS 5IVIA 3GI1A 1QFXA 3AINA 1KEKA 1TNDA 4Q7JB 3HFRA 1HE4A 4R41A 1DAGA 4Z4EA 2Q5EA 3LXUX 4DBLE 4KR9A 2DJIA 1I7LA 4OBWA 3WMWA 2O1WA 2HYIC 1MAAA 3AIMA 3MHPA 2ES4A 1TM5E 3I37X 1ATZA 1WDKA 2CV0A 4X41A 3B2QA 3OHMA 4OJMX 1YE5A 2FI1A 3K09A 4I1YA 4TL8A 4YNBA 4WUVA 3LFTA 1DXQA 3PXGA 1E3WB 3REFA 4QJ3A 2LKDA 2FRDA 2NQTA 1UFKA 5AW0A 1FDIA 5FOWA 4KUGA 4FZVA 4YCMA 3NHRA 1TAUA 2PXHA 1QH8B 2Q6IA 4IL5A 2Q2VA 2X9QA 1VGQA 1VJDA 3BKWA 4UEOA 4D7AA 1TUBB 3LVQE 1RXWA 4PCAA 3S8EA 2ZJAA 4D96A 3NTLA 5FHQA 3G2QA 3PC3A 2HIMA 4UU1A 1DJMA 1Z0UA 3G5AA 4N01A 3UW1A 2CLLB 4UE2A 4OHKA 1VDMA 3UAWA 1YZNA 5BRNA 2GBPA 4OHMA 3Q72A 3ZHBA 3CVJA 4NCXA 1FDSA 3SIRA 2DH6A 3L7LA 4ENRA 1XJ5A 5EHNA 1ECFA 1XTKA 4J2OA 4KXXA 4N7RA 2DKOA 2NU8A 3QU5A 1EP9A 4C1BA 2FMTA 1FVOA 1EVJA 4WK2B 3C2QA 1U28A 3EEIA 3UKJA 3VHLB 1PNOA 2I65A 1JG7A 1M8GA 3RHFA 4BDSA 4W5QA 1E7WA 4OMCA 5LZ2A 5K0FA 3IUJA 2PM8A 2PKCA 3QNWA 4YJ3B 1KOJA 1LPOA 3NHSA 2P41A 2V6BA 3AF0A 3FTCA 1O5OA 3L6EA 2BJWA 4NY1A 3SEAA 2XXAA 3FHOA 2WJAA 4HB4A 3OLZA 2NVWA 2Q7OE 3V33A 2JGKA 1B6TA 5H9WA 5ALQA 2BFAA 1PK9A 2XOXA 4KYIB 1UC5B 5D51S 2FSGA 4DDTA 5J47A 1UBJS 1DRJA 4QQNA 2XDYA 3BMNB 4RFSB 3RFFA 5E6SA 2D7CA 4B0OA 3FTFA 1L7XA 1XG5A 1ZGGA 2Q46A 3WK8A 1NI3A 3COWA 1GUFA 1I6LA 1QHHB 4ZREA 2GPNA 3I2FA 4PYJA 2GRJA 3BB3A 5GGXA 4XSVA 2YRWA 1G21A 4HLDA 4QU0A 5KNCA 1UMBA 4R1OA 3P0HA 3DE0X 2C7GA 2GLTA 3RVOA 2JCXA 3NWEA 2AX4A 3ZX4A 1PWXA 2PKXA 5EAIA 3TFWA 3PXCX 3KYJB 4HNTA 1EBBA 1PT6A 3KJQA 5A3JA 5E8RA 821PA 3R3WA 2C7QA 1RQ7A 3KL2A 3ER8A 1CJKC 1H2BA 1K92A 3AR9A 1JA1A 1HZJA 3AFGA 3LPMA 4QVGA 4EJ6A 4QTXA 1XHEA 3NHPA 1QPGA 1QANA 2HMSA 1TF2A 221PA 2OAGA 4K9DA 2D4AA 2P40A 3ABOB 3A9SA 1N8NA 1FYFA 2GMWA 3CWZA 1CS4C 3QF4A 1Q0TA 1B6RA 5ULLA 3T94A 4IPTA 4RVUA 1Z38A 2QN1A 4JA2A 5F23A 2F48A 1Z33A 1EHIA 3QVKA 2V6FA 1QF6A 2OHOA 5I3ZA 1XDBA 2X5NA 2BISA 3CGWA 3LVRE 3DDHA 2UUCB 4ENSA 4NCJA 3DUFA 1ODCA 2X2FA 1DELA 3GFVA 3NH6A 4K40A 3QYJA 4LTDA 2X2PA 4ZALA 1ONPA 4BU1A 4F1KA 1AV6A 1YGPA 2YWXA 2Z56A 4QPCA 3VUFA 1KVUA 3IIJA 2AIRA 1CNMA 3PS9A 3WLKX 4UU0A 4GS5A 2A35A 1L4UA 2QRVB 1EVIA 1Y89A 4RTQA 3OU6A 1DAPA 3ZXYA 4J0EA 4J03A 2G8LA 1JWAB 3WGNA 1WMEA 1NUAA 3I23A 1EDZA 4MS4B 2ZROA 3EXEB 5SY9A 2VC2B 1WXQA 1CUVA 2WVHA 3HKDA 4CM7A 5A5FA 5BV0A 1GNRA 4BKUA 5DSZA 1RJGA 2DX7A 4I55B 1NC3A 3M9LA 3WTBA 4DBVO 3P7MA 2I54A 4FFBA 5EP3A 2Z5VA 2QL9A 4I4TB 4ZT7A 1ZKDA 3M3PA 1UBFA 1YRQA 5AM1A 4CKEB 4YRAA 4CHGA 1FNCA 1TM3E 1QP8A 3RUDA 5CB4F 3FN4A 4ND3A 5JDCC 2QTBA 5ALOA 5AQEA 2GD6A 4FOSA 2BGMA 1PVVA 4B3DA 2W98A 2NTJA 3JRNA 4K03A 5KTYA 3CUVA 4R2XA 4EPXA 1UK6A 1FJGB 1E2EA 4QFBA 4ZAVA 2VRCD 1IWBB 1FNDA 4AKEA 3OEED 2AYXA 4GKAA 1Z7GA 3I5YA 3H2SA 1TEVA 3PUJA 3JWJA 4BNJA 4R2LA 1ZD1A 3HMKA 1P39A 1QFYA 4AM8A 1QX4A 2J9RA 3DCNA 2REQA 3PZRA 5ETJA 3TW8B 2BFFB 2CBZA 5IU6A 5CLHA 4WLVA 1ZJ6A 4Q18A 5JARA 5D1NA 1K8RA 1WHTB 1PVDA 5KUTA 1KZ9A 1DG1G 4RXTA 4MCJA 2QB5A 4ENQA 5L3SA 4BLOA 3LBFA 2OCAA 4HN9A 2ESRA 2A9OA 2I7XA 2WG1A 4JLBA 5H82A 3T3GA 2Z30A 3T61A 1E1DA 1VBNA 2F43B 3EEYA 4TXLA 5T6MA 5KQMA 2BBTA 3DBHA 3GAZA 4JL8A 3BVPA 2AN4A 4Y67A 3SU8A 4C3UA 3JQ7B 4ZMBA 3KG2A 4EI7A 4ZI2A 2GLXA 2BEWA 2XF8A 3LY8A 1E99A 4YN3A 4HNUA 3O2NA 1Z83A 1IHUA 3KHUA 4J0FA 4P53A 2DJ5A 4YCAA 1AKNA 2ZB4A 3IP8A 2J6IA 2BOVA 3I72A 3R5KA 1J2RA 1DFIA 4RK1A 2BIFA 3GBPA 3DF7A 4O2BB 5DU2A 6AT1A 4NU5A 4O0MA 4OLBA 1KP9A 4BVLA 2EFHB 4NENA 3F8SA 1L7BA 3QFCA 5TC4A 2NPFA 2YR0A 5BUSA 2BUAA 3VO9A 1U2DA 5HOEA 1EB9A 2H57A 2HHJA 2VK1A 4RS3A 3VBCA 3EIHA 2AJBA 5AW7A 5JADA 3RBXA 3UAXA 1XVUA 4UVGA 4O63O 4Y0VA 4E2ZA 4GX1A 2ZE6A 2PMDA 1N1DA 4MWGA 3FPGA 1U2RA 2QVLA 3GHYA 1GPUA 1JFLA 5DYWA 1M6HA 4BVHA 2JFYA 2Q0HA 3V4FA 3B1YA 5I9IA 3H16A 1NVUQ 3LUFA 3UCEA 4DPLA 5DBIA 1M0SA 5D3KA 2ORIA 5ENDA 1DO8A 2XHEA 1D0SA 4NK4A 3H4TA 1AS3A 1NYTA 1YC2A 4URWR 4K0KB 1J9GA 2GSDA 4K6FA 4LE2A 3W79A 1T9ZA 1UDBA 3WGGA 4DJEC 1Z5OA 1X7WA 4X54A 3N2IA 2YWEA 3AKEA 4GXRA 4MR7B 2NPOA 1MIOB 2IUEA 4YJ2B 4XD7D 2C0PA 4V38A 2IYUA 4ZEVA 1XQ9A 5DX1A 5JRDS 1J5EB 2GXUA 1YZGA 4PNEA 2B1JA 4NCKA 1AGPA 2IF0A 1JDNA 4LECA 3VNRA 1EFDN 3MJHA 3BFVA 3FHCB 3TJMA 4RTNA 4DXAA 4UZSA 4P5EA 2Z5FA 4ZQGA 4CM6A 3M5DA 2QYTA 3MPOA 4BY9E 3OF5A 1UXKA 2UYYA 2IOFK 5BYBA 3O4IA 4JC5A 1CIJA 1K2VN 2VI5A 2V5VA 1FS4A 2AG6A 3BH0A 4P9NA 2QBYA 4G97A 1Q2XA 3GEDA 3LK7A 4U9HS 5TMEA 1JPUA 3P0RA 4RPIA 4C3VA 2WPDA 2HRCA 1YFLA 2COKA 3EIXA 2Y1DA 3E3LA 1TT5B 1QTIA 1NP7A 1II9A 3GFBA 3WLFA 1IZZA 1SELA 3SZ3A 1ZNQO 3QQ5A 1YK1A 1KC3A 3K1ZA 1QLJA 3R9XB 1TJ4A 3M4YA 3M1IA 2NWQA 4FMCF 3K9HA 2MSNA 2B82A 4G1MB 5LNK6 3T7KA 1N2CB 5ICSA 3FOAA 2YNMA 4IXMA 2ZYVX 5TQ0A 4UD6A 3LDHA 3ZE2B 5JV5A 5AI4A 3W7AA 4UDYX 1VP9A 2DULA 4L3WA 4C29A 4EY4A 1DRKA 2QUIA 3K5WA 2EP5A 1ZK2A 1ZNXA 1SCNE 2YHBA 4L5AA 5FFFA 4CMCA 1KVTA 4V0KA 3ZR4B 1JR2A 5H02A 3NUGA 2QVBA 3F3KA 3KTAB 4HUQA 2GPJA 4H3VA 4I8IA 1CLEA 1J56A 1MN6A 3PR1A 2CNWA 4INJA 3K6SB 5ALWA 1J24A 4ANFA 2GN8A 2NOAA 4C87A 1FF9A 1VL8A 4LBVA 1G7RA 3FVRA 4KYUA 4LNUA 4D56A 5J5AA 1SRRA 1A27A 2GJAA 4EO7A 5LJLA 2X0FA 3U17A 3C3JA 1D4AA 3SF8A 5EJIA 2JW5A 3Q6NA 4EKYA 1XKTA 1UKAA 1E7YA 2FLKA 1DQYA 4JROA 3PX7A 3QKWA 4MYUA 5FUVA 2QN2A 5DNDA 2ACEA 2XUJA 1ODLA 1LC3A 4ICIA 4JC0A 1EJ2A 4H59A 1E98A 1AT1A 1DUIA 3D7NA 3FSRA 3FDZB 1C1XA 3W3AA 4DMMA 2VUTA 1EWVA 3IVGA 3OIGA 3TGWA 4RAOA 1WPGA 4OSEA 3QOWA 3KLBA 2YDYA 4YDHB 1TVEA 2VS1A 1JHDA 1OV6A 3GDOA 3K8OE 1R8SA 3C7TA 1IZ7A 2EP7A 2FZKA 3HJRA 4EHNA 1G2QA 5IXJA 3WHPA 5B6PA 5EIXA 4R1PA 4WXRA 3F1LA 3VH1A 4H1WA 4PX9A 3H1EA 4G5YA 1KRWA 2ERCA 1GG8A 3GJ3A 5HTOA 3NM5A 1FQWA 1RHQA 3DOUA 3EGOA 3A0RB 5IH7A 1ZQ1A 4OYRA 5H5JA 1WKCA 2P9JA 5EYPA 1TMOA 3H2IA 3PNLA 5F77A 1T5SA 1BE1A 1ZGHA 2PV7A 3T95A 1F1JA 4HDRB 2BN4A 4D74A 2C5AA 2ZIWB 1YUNA 2EQAA 2O4CA 3DEAA 2PKRA 4CG1A 1I24A 2ANCA 2VAVA 2C7RA 2QVCA 3OJCA 4O3MA 1M2WA 1VFPA 3D3QA 4OU5A 5FTMA 1GCGA 1T9HA 4D9EA 1QF7A 4FQ8A 3V5NA 5B4UA 3O4GA 3CUUA 4NZZA 3I5MA 5CT8A 1R5OA 3NGMA 3GCXA 1GZ5A 2REBA 4P3NA 2GCIA 4RO0A 2GXQA 1ZJ5A 4JUBA 1I5EA 2YDXA 1RRMA 3EJWA 3KUUA 4YJDA 5BURA 4A73A 4CKBA 1B0ZA 1Z6GA 4TXNA 5G40A 3T99A 5KKNB 4QYIB 3SQNA 1NE7A 5K0JA 1P33A 2Q9BA 3DHNA 4H4EA 4HRVA 1P3JA 2ERXA 4Q9AA 4WBNB 5LXTA 2HDHA 1L8AA 2KE5A 2XD4A 3RYCB 1PKEA 5EE1A 4TGLA 4HDMB 3C70A 3HSYA 2FZWA 4IUBS 4KIJA 4QHSA 4JXZA 2DBZA 4KGDA 2VJNA 2FJ0A 3BRQA 4PGGA 4TLAA 3GLFA 4LQDA 4UPDA 2ZB3A 3ZWAA 1AU9A 1D2NA 1RCUA 1KI9A 1NVTA 2YASA 2OYCA 3ZDRA 1VCNA 2IH2A 1SVMA 4D8WA 2JFNA 3UHPA 1LBEA 2B78A 3QXSA 3RJZA 5J4VA 7ADHA 1BSVA 2RIPA 1AZTA 3WK6A 1ABFA 3UENA 1KOLA 3EXIA 4H60A 3DOOA 3L4BC 3N8KA 1VA4A 2JANA 4M9RA 5IH3A 3ZQ4A 5B5SA 1FFXA 4NEGA 1DKNA 4RF2A 1EINA 1RP1A 3AGQA 3QPDA 1TX4B 4ZXFA 4A0HA 3AHFA 1XZPA 3DMGA 1MO5A 2V7UA 3BIOA 1W59A 4JR0A 4Y1GA 4YMLA 2X0IA 8MHTA 3BCHA 1UIRA 1JVNA 1XCMA 2OZKA 4OHZA 4PYQA 5IZCA 4IRXA 5EP1A 4MRAA 1X7YA 3HN6A 1U5BA 2C4KA 3NXSA 4OQPA 4DUZB 3GFRA 2VDNB 3HSSA 1AKUA 1NJ2A 2YJ4A 3R41A 5FIUA 3HHPA 3SKYA 4DJ5X 3Q1KA 3DW3X 3WMRA 4EVQA 2XECA 4K28A 3EMKA 3SLGA 4D43A 1XDSA 1M1YA 3UFBA 5JD6A 5JU6A 1PTJA 1I14A 3AVPA 4ZO7A 3PJRA 1NI4A 1XTSA 2K5UA 2J9XB 3IAEA 4C5CA 2HM7A 1BIFA 4S0XA 3PTAA 1Z74A 4LGCA 4C4SA 4RDIA 1EK1A 2ZDGA 1J20A 4DHEA 5L7TA 4AECA 4ENVA 4M8LA 2ST1A