3V9AA

Crystal structure of esterase/lipase from uncultured bacterium
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
296
structure length
293
Chain Sequence
AGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase/lipase
publication title Crystal structure of Esterase/Lipase from uncultured bacterium
rcsb
source organism Uncultured bacterium
molecule tags Hydrolase activator
total genus 105
structure length 293
sequence length 296
ec nomenclature
pdb deposition date 2011-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v9aA00
2PBLA 5C8ZA 1JT2A 4N5IX 2V96A 5LKRA 5LZ7A 5AI9A 2AJLI 4HVTA 3RLIA 3WLAA 1VXRA 4OD0A 5LZ5A 4X6YA 2VT7A 1ZOIA 1ZGBA 1IMJA 2XQIA 2OAEA 4AQDA 5K3CA 4AO6A 3DQZA 1LPOA 5DNUA 2H7CA 1QJ4A 5BOVA 3G02A 2HL6A 1A8SA 4U2EA 1HKHA 1CUDA 2ZSIA 3O9VA 1CUIA 1X2EA 1DWOA 2OQIA 5JZ9A 4G9GA 1MNQA 5T4FA 4EY7A 3PI6A 1MJ5A 5AIAA 4E11A 1TIBA 4KE8A 4GXNA 4I4CA 4X94A 3V1MA 2PX6A 3BF8A 5JARA 1MT3A 3H04A 1D07A 4UHCA 3I2FA 4UHBA 5LKAA 3VXKA 1BRTA 1BCSA 2O7RA 1VLQA 2VATA 1QIKA 3X3HA 4Y2TA 3WZMA 3V1KA 2I3DA 1XRMA 1C7IA 1DWQA 2CB9A 2QZPA 1VE6A 3W04A 3G0CA 4AXBA 1BEEA 3PUHA 3W06A 1ZD3A 1VA5A 5DLPA 2BCEA 3D2AA 5K3BA 2V9ZA 1TCCA 5JIBA 3I6MA 4HXFB 4CIBA 1A8UA 4I3FA 4WFIA 3FOBA 1DINA 4L3WA 2AJ8A 3E1GA 3QITA 3A2MA 3HC7A 5E4YA 2OXEA 5CH5A 5KBYA 5FV4A 5AOAA 2EEPA 4WCVA 4P9NA 4XWGA 2Z8ZA 3TEJA 3U0VA 2CZQA 1FFEA 1CV2A 2JEYA 5HQ3B 4WDQA 2XUDA 2WHPB 5DYTA 1GPKA 1ZJ4A 2WHPA 1K6EA 2HA7A 2XMSA 1WPXA 4RE6A 1ZD2P 1ORWA 1XZDA 3M3DA 4IQ4A 2O7VA 4Q34A 4DNOA 1VXOA 4BDTA 1QO7A 2WJ6A 1LLFA 2HU7A 4OCZA 5DJ5A 3IIIA 2VJCA 1JFRA 4GDMA 5AKJA 4Q82A 4ITVA 4QE3A 3Q8WA 3HRHA 4WFJA 1UOPA 3FLAA 3PICA 5K3EA 1ZD4A 2OQVA 4B85A 5LP1A 3OPMA 5CXUA 3RKSA 4EUSA 2BGRA 3WK6A 2BGNA 3D7RA 3AJAA 3STYA 4BAGA 1T2NA 3WQHA 2C0PA 3I1IA 4UFNA 3FLEA 4ZGBA 5FXMA 3A2LA 4CG1A 4W1PA 3A70A 4J0HA 4GLBA 3C8DA 1AZWA 5FPQA 3FBWA 1FJ2A 2D0DA 2AJBA 2QMQA 1CVLA 5CTAA 5LZ9A 2OCKA 2OPHA 1WHTA 1YAHA 1BU8A 3I2JA 2H9YA 4ZRDA 4PW0A 2V98A 3CCBA 3WWCA 4N8DA 3L1HA 1WHSA 4QDOA 6YASA 1BN6A 2HA3A 4UBJA 4X6XA 5A71A 1E3QA 1CUVA 2LIPA 1JKMA 2G4LA 4G5XA 4ROTA 1MX1A 3H17A 4BATA 3DKKA 4BAZA 4G9EA 4KRYA 1CUSA 3T4UA 3MVEA 4G8BA 2QUBA 5IVHA 3AUKA 3RK4A 2ZYSA 5IVKA 1ZICA 2Z8XA 3IUQA 4B7ZA 3C70A 3R3VA 2OCIA 4YK7A 2ZYRA 5ALMA 4UHFA 4BE4A 1LBTA 5AO9A 5AKHA 2I03A 5JASA 1XZMA 4B84A 3DS8A 3H2GA 1ZIXA 4HRYA 3W9UA 3DLTA 4OYLA 4W63A 3WL5A 5AI5A 5ISMA 2IIVA 1QIGA 4H7KA 2ES4A 5A7GA 5EFZA 4BAUA 4W1RA 2O2GA 5EIAA 4BCCA 1IUPA 1UFOA 4HXGA 5ALJA 2XMCA 2WM2A 3AIKA 1Q0ZA 5AI4A 1P0MA 3I2HA 4DTCA 4H7JA 1LPAB 4XIIA 3C6ZA 3I28A 4FWBA 1GQRA 4B6GA 5ALRA 3V1NA 2HA4A 2O2IA 3STXA 2J4CA 1XZJA 4AMYA 2HDWA 4BTLA 4JNCA 3TGLA 2OGZA 5HKBA 3C6BA 3HXKA 4IH9A 5AJHA 1XZBA 5ALZA 2C5FA 5C8VA 3EQ9A 1ODTC 1ZD5A 1HQDA 2JGJA 1XZEA 4K6HA 5E4JA 2BKLA 3LIIA 1QFSA 4CCYB 4BP9A 3PF9A 3SWWA 2RGUA 2VAVA 1J06A 2XQJA 1CUZA 4CCYA 4E14A 2I78A 4EY8A 5HZGA 4NVRA 3L1IA 4RNCA 4BC1A 1XZLA 2WSLA 3BIWA 3DOHA 2H1IA 3V9AA 2CKMA 4C87A 4H7HA 1LNSA 1UWCA 5EI5A 2J3DA 4C01A 2XQGA 5LLSA 1VOTA 1CRLA 4JYMA 2FJ0A 2V97A 3HABA 5IVDA 1YS1X 3MUOA 4B81A 3R41A 5ALNA 1EVQA 2GZRA 2RIPA 1ZI8A 5CURA 1W75A 4JEIA 4NZZA 2R11A 2DFPA 5AK3A 5AKLA 5CH8A 5EHNA 2WILA 1ETHA 3G7NA 1B41A 5KWIA 3IVMA 4BB0A 1N5MA 2BUAA 1Q84A 4G4JA 3WMRA 4AO7A 5AKEA 1E66A 1P0PA 2C58A 1EINA 1QONA 4YPVA 4QDXA 1UOOA 1VE7A 1L7QA 3BJRA 4KAJA 5YASA 1MO2A 1AX9A 1UT6A 1UK6A 3ESCA 4XJVA 4DNFA 2XDWA 1TRHA 4F5ZA 2XI4A 1XROA 4MQMA 1MX5A 2ONCA 4MWTA 3QPDA 4ZREA 3A2NA 1J07A 4Q3OA 4QWMA 1LZLA 5F4ZA 1TKRA 4OU5A 5CXXA 4RE5A 4DGQA 4UHEA 1XQXA 2HIHA 5SYNA 1LZKA 3QMVA 1O6GA 1B6GA 1UKBA 2HA0A 1F8UA 1BS9A 2UZ0A 4CFSA 4CIAA 2RHWA 1XKTA 3IB3A 1FSSA 5DNWA 2WFLB 1U8EA 3O95A 3DYIA 3EF3A 3KOOA 1UXOA 1MX9A 3O4IA 1AKNA 4OSEA 4ZWNA 3DL4A 3WL8A 3VJLA 5LZ2A 3Q0TA 5FP0A 3FWHA 4ZV7A 4XX1A 4FFVA 5E4TA 2DHDA 2PSEA 1QIFA 1X2BA 5AKKA 1JJFA 1XKLA 3KD2A 5ALXA 3GUUA 3OM8A 4OUKX 5AM2A 2PPLA 4MQLA 5HK9A 2WHRA 4Y7DA 1N8SA 3IUJA 2WG2A 4J0DA 4A16A 3DL7A 4BCBA 5AKXA 2EDCA 4Y2SA 5DYWA 2HA2A 4N8EA 1XQWA 5D3ZA 4KEAA 5DTJA 4X93A 5AH0A 2Y2UA 1GQSA 1E8DA 2P8SA 1CUCA 2QVBA 3EQ8A 3MUNA 3N0TA 4C88A 2B9VA 1AURA 1LBSA 1VZ2A 4G8CA 2XUQA 3GA7A 4GW3A 1VJ5A 1UK7A 4C89A 3DJYA 3WK7A 1FFCA 5ALOA 5C81A 3I2GA 4BE9A 4L72A 2J3QA 5K3FB 3HJUA 3F98A 5K3FA 1W76A 4EZIA 3M82A 4BZZA 3DD5A 2JF0A 4KAAA 3KXPA 1KU6A 4RPCA 3FSGA 1FFBA 2PL5A 3CN9A 4ARAA 3F97A 2CMFA 5KWJA 3QMMA 4FNMA 5AOCA 2OGTA 3HLKA 1XZFA 4XVCA 1R1DA 2VT6A 1EB8A 3LP5A 1M33A 5A6VA 2HU5A 4AX4A 2QRUA 3QMWA 4WJLA 2HFJA 4ZV9A 3WIBA 4FHZA 5AM4A 3OC0A 2Y6VA 3FVRA 5FLKA 3MGAA 5JD5A 3R3ZA 4X90A 3W2TA 2HRRA 2PUJA 3STTA 4OB8A 4BVJA 4J0GA 3FNBA 5HCUA 5LIPA 1UK8A 5LYYA 1YB6A 4UFPA 1GKKA 1H22A 5JANA 2DR0A 5IKXA 1NX9A 4H7EA 1IVYA 5I7UA 7YASA 2YH2A 4P92A 3CXUA 1VKHA 2OGSA 4G1FA 4QLAA 5ALFA 4BRZA 1JMKC 3ESAA 4J03A 4KE6A 3DCNA 3TRDA 4EY4A 2ZYIA 4FDMA 4J0CA 4H35A 4Y2UA 1TCBA 1OXMA 2JGIA 1WPRA 2WG0A 2XUIA 3NOXA 3AIMA 3U1TA 4MYSA 1QLWA 5ALDA 5T4HA 4Y9SA 2QM0A 4FKBA 4B0OA 4A5SA 4DYHA 2VJBA 3EQ7A 1ZI6A 3B12A 1F0PA 1XZCA 1XZAA 4J3JA 4A23A 5AM1A 5ALKA 4D9JA 2GBIA 5KREA 3PFCA 1RP1A 3UUFA 3BXPA 1MAHA 2Y1KA 1I6WA 2ZJ6A 5T4BA 1DU4A 3KWJA 4WDRA 4J0IA 2JBWA 4BVLA 5IVIA 1LPPA 5CT4A 3CCCA 3WWOA 4KYVA 3C87A 4Y2RA 1QOZA 3WZLA 3D0KA 2NW6A 1CR6A 5D6OA 2QR5A 4IHAA 3W9BA 2RONA 1F0NA 4X7BA 3DYVA 4X00A 4AZ3A 2HA5A 5DWDA 3GROA 1DWPA 1OCEA 2G5PA 3O4HA 2OCGA 1LPBB 1XRPA 4QEKA 1GPLA 5CRIA 3VISA 3WI7A 5SYMA 5JAPA 2WU3A 3IA2A 1DTEA 4CI9A 5D7BA 3SC2A 2X76A 4X85A 3K6KA 1CUAA 3QH4A 1BE0A 4P08A 1G66A 3S2ZA 4PF1A 2CUTA 3I6ZA 1HPLA 1XZHA 3WK4A 3G9XA 2FX5A 3FVTA 4C6HA 4QNNA 1ZJ5A 2WKWA 4MYDA 3ZLVA 3OURA 2JGMA 3GBSA 1HBJA 2QJWA 1EHYA 3G0GA 4QDZA 1W4LA 1Y7HA 3BJMA 5AI8A 1K8QA 3ESDA 1USWA 2XE4A 5DTIA 3WKCA 1YS2X 1GGVA 1BN7A 2K2QB 3ESBA 2JGFA 2X8BA 3PUIA 4F0JA 5DYYA 1QO9A 3WKDA 5A62A 3D3NA 3GFFA 2WFMA 1CFJA 1QIDA 4K6GA 4B83A 3SK0A 3FCYA 2XUPA 5A7FA 3BDIA 1H2ZA 1UKAA 1Q0RA 2VAXA 1XZKA 2OG1A 3VVLA 2QUAA 3BWXA 2WUFA 3NWOA 1CUHA 4JUIA 1LGYA 1XLUA 2PM8A 1ORVA 3D4LA 3BL8A 4X92A 3VJMA 2XMZA 3BIXA 4F60A 2BAGA 4FLMA 4MEBA 3HZOA 5ALQA 3H0CA 1JI3A 4MXDA 5T4EA 3PE6A 2HU8A 4J0JA 4EBBA 3I6YA 4I19A 5CT9A 1EH5A 3IUMA 2R8BA 5IH7A 4IO0A 2Y2VA 5JZBA 1UK9A 4JYPA 2PKYX 1C7JA 3IULA 2VJAA 3H1BA 4BCDA 5FRDA 1R9MA 5AICA 4GWLA 1ODSA 3G0DA 1SOMA 3K9BA 3C5WP 1E8MA 3H2JA 1MPXA 3W05A 4KR0A 5ALLA 1CPYA 4GHWA 2B61A 3KSRA 3FLBA 3F96A 4MJ3A 1E5TA 3JYHA 3F67A 2WIGA 1XQVA 3WJ2A 1QFMA 1AQLA 2ZVDA 1QGED 2PU7A 3UMJA 4G8DA 1CUBA 3E3AA 4H7FA 3WK5A 1U2EA 1EI9A 5ALEA 4LIPD 4ZI5A 2D5LA 4RGYA 3O0DA 2PSJA 3FYUB 4X6UA 1EB9A 4PSUA 1XZIA 1HDEA 3FYUA 4OB6A 1XLVA 2XMGA 2GBCA 2XLBA 1DX6A 1MNAA 4HZGA 1Y37A 2Z5GA 4FOLA 4G4IA 1GZ7A 4QZVA 2WFZA 4W1SA 3ANTA 1BCRA 3DNMA 2QXTA 5EHXA 1JJIA 1EK2A 2AJCA 4IH1A 3SX4A 1CUWA 4B80A 1K4YA 3BE8A 4X71A 1NU8A 2WLSA 1IUOA 1EA5A 1VA4A 2OLEA 2XUHA 1GT6A 2XUKA 2QS9A 2E3JA 5CBKA 1W52X 4J7AA 4EA6A 4JH0A 1NU6A 1X70A 5HF6A 3R3UA 1N1MA 1VZ3A 4C4ZA 3KDAA 3G9ZA 5J3JA 1LPSA 3A6ZA 5ESRA 5AKZA 3GZJA 5FPPA 3WK9A 2WTMA 4Y2XA 3AIOA 1J1IA 4OPMA 4KAFA 2CJPA 3FYUC 2Y6UA 3JW8A 1SCIA 5A7HA 2ROQA 4FNGA 1YA8A 1W6RA 3BF7A 1BEZA 5FUMA 1LPMA 1EXWA 5ALSA 4KE9A 5ALIA 5CT6A 1L7AA 1AC5A 5AK6A 2XUGA 2DHEA 2AXEA 4B9AA 4B82A 4TGLA 1SCQA 1W1IA 4Q1VA 2C5GA 5E2IA 2B4KA 1EX9A 2WIKA 5HF8A 1YB7A 3ICWA 1Q83A 2ORYA 3O4GA 5ALYA 2JIDA 4UBOA 3WIOA 1JMYA 2GBFA 1TCAA 4LXHA 2GZSA 1R9NA 2I3ZA 4X95A 4UBNA 2DSNA 5JATA 3O4JA 4CCWA 5BV7A 4Y2YA 5ALUA 1EK1A 2OAGA 1IZ7A 3B5EA 3VVMA 1CUXA 1O6FA 4QDUA 4HTAA 2WQZA 5JAUA 3STVA 1TAHA 1CUUA 1J2EA 4TVKA 3VDXA 3WL7A 5BWCA 3HSSA 5BWBA 4FTWA 4CG2A 2RHTA 3FSGD 3FYTA 3I1YA 2W6CX 3LLCA 2XUOA 5EIEA 2G63A 3WWDA 1R3DA 1CLEA 3N2ZB 4Z49A 4NS4A 3IUNA 3OTQA 4EB0A 1CUYA 3WA6A 4BVKA 3V48A 4B0PA 4DM7A 4HXEB 4CG3A 4DNPA 2YYSA 1RYYA 4P93A 1JJBA 5JD6A 4UUQA 4B9EA 1XRLA 2WHQA 3LS2A 2JGEA 1P0IA 5A2GA 1CIJA 4DMHA 2BUBA 5JAHA 4Q05A 1AUOA 2XUJA 4UBIA 4WFKA 5I9IA 3C5VA 3HYSA 4GBGA 4DSZA 4U2GA 1FFDA 3BDVA 5AM0A 1AMNA 2XMBA 1YSCA 2GYVA 4KE7A 4L0CA 1R50A 5K3DA 3R3WA 4OYYA 2XLCA 4AN0A 5AI6A 1XQYA 1CQWA 4ARBA 1HL7A 1GKLA 5LZ4A 1P0QA 1YASA 3ANSA 2RAUA 2YXPX 1BROA 4LXIA 5AIBA 2AJDA 1H2XA 1WOMA 4X3CA 2QOEA 2G5TA 3P2MA 4PQEA 2RI6A 1SCKA 4O08A 4UHHA 1TQHA 1ACLA 2GYUA 3H2KA 4UFOA 5C7YA 3ZWQA 3H19A 2FJPA 1E8NA 3CN7A 3G0IA 5HK8A 2VF2A 2WJ4A 2EDAA 2PU5A 2QKYA 4AN1A 2VTVA 5JZSA 2QXUA 4LXGA 2WJ3A 4M0FA 1EDEA 3HI4A 1A8QA 1H2WA 4GECA 4S0XA 1CUEA 1EVEA 1CUFA 3IURA 3VJKA 1QTRA 4MWSA 5HFAA 2WUEA 2XMDA 2HRQA 1OILA 1F6WA 4K5QA 2QT9A 2WTNA 2PUHA 5HQ3A 3IDAA 1A88A 4YASA 4N5HX 4H18A 4KACA 4KRXA 1WB6A 4LKOA 4DMKA 1UZAA 2PVSA 2ZJFA 4H7IA 1JU3A 1CQZA 1QIJA 4ETWA 4V2IA 4ZXFA 1DX4A 1THGA 3DDUA 2DHCA 2XMQA 5EIHA 3R3YA 1ZGCA 2Q0XA 3ZI7A 2BUCA 3QPCA 3F9CA 1QIMA 4E46A 2DCMA 2IX9A 2VQ6A 2CEKA 2OCLA 5ALGA 1H2YA 1CUJA 3QBJA 2HFKA 1XRNA 2ZJ7A 3TJMA 2QJRA 2CBGA 2FUKA 4GI1A 4QDTA 4Q3LA 5CW2A 5AKYA 3R40A 5DNVA 2WU4A 4LYEA 3V1LA 4DMFA 3EBLA 1JU4A 2HM7A 5I8PA 5HKAA 2HA6A 2Z3WA 3M81A 2C4HA 4INZA 5HFNA 1PJAA 1XLWA 1ZIYA 4FBLA 3VKFA 5AKIA 1S8OA 2IITA 2XQFA 3ILSA 4U2FA 4BTVA 2PSDA 3M83A 1EDBA 1R4ZA 1ISPA 3S8YA 2C7BA 4X97A 3FAKA 3G9UA 3K2IA 4HAIA 4BZWA 1K5PA 3H2IA 5FDFA 3I2IA 2ZYHA 5ALPA 5EGNA 3HEAA 4UHDA 3RARA 1GPNA 1LPNA 3C6YA 3T52A 4U2BA 4BBZA 2WUGA 2ZSHA 5ALTA 5JYCA 4E15A 2HADA 3AZPA 4BYMA 2QTBA 4DIUA 3H2HA 5D3KA 3F8SA 5AM5A 4KJXA 3ICVA 1HLGA 2VEOA 4FFWA 1ZI9A 2H7XA 3AILA 5EHQA 3E4DA 3WL6A 3D59A 4EY5A 1T4MA 2BFNA 4GEGA 5AK5A 5LZ8A 4UBMA 3WKAA 3ED1A 1ODCA 2WIFA 1Z68A 2Z3ZA 1UKCA 3WYNA 3JWEA 4FLEA 4W1QA 4PSCA 3R3XA 1A7UA 4UPDA 2ECFA 2GYWA 4TPKA 3D2CA 3AINA 4BP8A 1WB5A 2ACEA 3QPAA 5AOBA 1YR2A 1SC9A 4FBMA 1YAJA 1XFDA 3ZPXA 3C43A 4QWWA 3WKEA 4K6KA 2XUAA 4C4XA 3G0BA 3QVMA 1G4HA 1G42A 5CH3A 5AM3A 3QM1A 1XRQA 1QIHA 3O9MA 4EHBA 3AZQA 4UBKA 4AB1A 5CT5A 3D5EA 2J4FA 2X5XA 5AK4A 4C4YA 3OOSA 4H0CA 3EIOA 3QYJA 2W22A 4QLOA 4OU4A 1IUNA 1QE3A 1U65A 1TK3A 1GXSA 3G8YA 1WM1A 2PSHA 5AP9A 2XT0A 1DQZA 1CUGA 4FLFA 5K5EA 3HACA 2GBGA 4X91A 4M0EA 4QA9A 3WA7A 1RWQA 2XMRA 1CEXA 1DT5A 5CT8A 2O2HA 3UUEA 2XUFA 4AO8A 4Y2JA 3PFBA 4DLNA 1MU0A 5JALA 3WKBA 5ALVA 3D2BA 3LIPA 4MEAA 4HS9A 4H77A 1N5RA 4J0KA 1DQYA 1MN6A 5JD4A 5EHZA 4DNQA 1UOQA 4F21A 4PSDA 4AMZA 5JADA 4OB7A 2PSFA 3B3QA 4AZ0A 2VA9A 4Y2QA 5FKJA 5JAOA 4WY8A 3L1JA 4U2DA 2WG1A 4N8SA 5AKGA 3WYDA 1IZ8A 2VSQA 2DQZA 4YX9A 3STWA 3ZLUA 4Y2VA 4U2CA 3PF8A 4IH4A 3WWPA 4PV7A 1THTA 3QZUA 1SFRA 1PV1A 4PO3X 3C8HA 3ZV7A 4Y2PA 1K63A 3PDCA 3YASA 3H1AA 2B20A 3DKRA 1Y7IA 1YA4A 3NGMA 4DSAA 4NMWA 2JGKA 1YCDA 4HRXA 5AHXA 1L7RA 4FMPA 4BC0A 3H18A 3RM3A 1ACJA 1QIEA 3DEAA 4W9RA 2ACKA 5ALWA 3NUZA 5AI0A 5C8XA 4EY6A 3DOIA 2XQKA 2H7YA 4PNZA 1MAAA 2C0QA 1E89A 2WFLA 3GELA 5HF9A 1MTZA 1H23A 5FOQA 4BRSA 3AFIA 4L9AA 1WB4A 2XB6A 2VJDA 3C6XA 2HHAA 3E0XA 3OG9A 5K3AA 3ZLTA 1G5FA 4K2AA 1WCYA 4G4GA 2BJHA 3KWFA 5H3HA 3FCXA 1AGYA 3WWEA 1FFAA 3IBTA 1QZ3A 2YASA 2DQYA 1R88A 2JGLA 1QTIA 4LYDA 3STUA 1XRRA 3LCRA 2JEZA 4Q3KA 3WK8A 4DMCA 3I2KA 4WY5A 1DT3A 5HF5A 3C45A 3WJ1A 1KU0A 1U4NA 3G9TA 1QIIA 5CMLA 2WIJA 4LHEA 1EDDA 4M0MA 1C4XA 1KEZA 2WIDA 1XZGA 4H7DA 1PFQA 4UBLA 4BDSA 3R0VA 3AZOA 5ALHA 2WUDA
chains in the Genus database with same CATH superfamily
3GEBA 2AC4A 3Q0IA 4FJ1A 3TE7A 2JFUA 4PHCA 4B74A 2GN1A 4GUDA 5AI9A 5FR2A 4F60A 5KB3A 1NG9A 4M1MA 2MCFA 2Z5LA 3HPRA 4HGYA 3KOZA 4ZAVA 4CL8A 1C0PA 2C5BA 3EBOA 4RWEA 5IC5A 3WGTA 3RLIA 4EG3A 2QJTA 4EZBA 4JV5B 4PGHA 3R7WA 1RXSA 1FFXB 4ZVPA 4XDHA 5TQ2B 2CLMB 2PT5A 3HBJA 5F9FA 5K3CA 1WF3A 1IJBA 3TNJA 3A1WA 1Z0SA 1JLRA 9LDTA 4TTPA 2H7CA 3AW8A 4FW9A 5B6IA 4IDAA 2X13A 3PQ4A 1KBZA 3IXMA 4KDFA 5I8WA 1JEQA 2FG6C 4PSAA 2I2BA 5FPHA 4XYBA 1KE2A 4F4JA 1A8IA 1OJ7A 5EKSA 4FFPA 5DI9A 5HSGA 1CUIA 4W7IA 2NU9B 1NHWA 1M8KA 2PGJA 3NHKA 3VMFA 4CT4B 4D81A 4QJ3A 2QENA 5JZ9A 5JE8A 3MG9A 4CNQA 3Q41A 4PIMA 2XRZA 4JSRA 4ZQHA 4F6LA 2J6IA 1V7CA 1FJXA 1X80A 2EATA 3G5AA 4TXJA 3Q88A 5FWYA 3MCTA 5JLAA 1QAOA 2V6BA 3OCCA 3MIIA 4KE8A 1YZNA 4I4CA 4M0UA 2FW7A 4X94A 4JN6B 3WQBA 4PN7A 4UTPA 1F14A 2FX3A 3MWJA 3CUSA 1Y0BA 4K9NA 1M7BA 3B6IA 4QPZA 4R2IA 2VSXA 2ZUCA 5AWFC 5JJIA 3O4FA 2PX6A 3B60A 3BF8A 1RWKA 3QVWA 4EFMA 2P2LA 3H04A 2R1UA 1UAYA 4HH3C 4NJMB 3VSDA 2WQ7A 1W46A 3EVFA 2CY0A 2VPQA 3VXKA 4BEJA 4KTVE 2VP4A 4EG6A 3DZ8A 3SBDA 2WQ6A 3SHTA 1NUAA 1ZQ1A 3ABQB 1VKZA 4PCAA 2VP5A 2IPLA 2W8BB 2D1FA 4ACAA 3DEKA 1QIKA 4G0PA 5E8RA 3I62A 3IQXA 4PPNA 2IYTA 4DLXA 3JAKB 1SQFA 1UKVY 3VU1A 1AH2A 4FEYA 4CNBA 3R09A 4WNYA 1DWQA 2CHUA 3O8OB 3V42A 1XR3A 2JAOA 4IIDA 4OV6B 3CPJB 1HRKA 5FQOA 3SOZA 4BRUA 5JRZA 5D5QA 2B8JA 2YIDA 4JCCA 2PG3A 4NV1A 5AVVA 2I65A 5ICSA 4AXBA 1GUYA 4MGEA 1I7NA 2AXPA 3L7NA 5DTQA 1BEEA 4JK3A 3W06A 4B4VA 4OY3A 2NOAA 4PICA 4RZIA 2BCEA 1HF3A 1OWMA 1QGDA 2I9KA 3D2AA 3GVXA 1YR8A 2CDAA 1CR0A 1ZEMA 2VJOA 1GSAA 2H59A 3P2JA 5BORA 5BWLA 1CZOA 2OUIA 2HWWA 3UT5A 2F9FA 1P1IA 1MIHA 4D8UA 3FMIA 4HXFB 4CIBA 4EYGA 1SC3A 1A8UA 4F71A 1PYGA 1QOQB 4QQRA 4KVGA 4W5HA 5D00A 2BF7A 3RADC 1RE1A 4L3WA 4UMVA 3SX0A 4UD6A 4BXOA 2ZROA 1Y8RB 2AJ8A 1G64A 5ITWA 2J67A 4CN9A 2F8MA 3QITA 1U7OA 5EERA 5KVQA 4N76A 2H08A 2GCGA 4BX9A 1WQ4A 2RB4A 4AWAA 3MWGA 5E4YA 1VHTA 2J9ZB 5GIPE 2G40A 1DHRA 1P6QA 3DONA 5DN6D 3PFIA 1RT9A 1Z6ZA 2IZ5A 3JXEA 4Y9RA 4DZTA 2XOEA 4DAEA 3BRCA 2GVNA 3Q9UA 2FG5A 4GR5A 2Z8ZA 4HZIA 4BV3A 4D4KA 5B6PA 1KSGA 1UMDA 4V0ME 5A4DA 1CRZA 3PEEA 3DFZA 3IVCA 5HQTA 5CIWA 2OT3B 4ECAA 4UNPA 1EK6A 4LGVA 4KSCA 4CDGA 4OHKA 1J8MF 3UOGA 3CVJA 1WAMA 5JFTA 1ZJ4A 4PWZA 5EVJA 2HA7A 4DDHA 1QB8A 4TMVA 4BJ5A 3WDLA 4ZAXA 3RK1A 3L0PA 2BBWA 1DUSA 2HK7A 3U4QB 1KFEB 3NHPA 3SBEA 2QUZA 1WPXA 3MRVA 1E1QD 1FSZA 5E95A 4NXNB 1TA0A 3WQQA 2ORWA 3KKQA 2G17A 4KIFA 4BN0A 2QD4A 3KQOA 4YV0A 3S7ZA 1ORWA 1PBTA 1X9HA 4F3TA 3DXXA 3G1WA 4IQ4A 4F1JA 5BW6B 2WJ6A 3TSYA 2HU7A 3N8KA 4LC9A 4B3DA 5FEUA 5K0BA 1KQOA 4N01A 1W88B 4OCZA 3A0UA 2W83A 3KQPA 1ATIA 5BN3B 3FG9A 1FDOA 3FMVA 3MQ2A 1N2CA 3CZCA 3P1JA 5F3DA 4GBED 1P1HA 1NVVQ 2PKQO 5H81A 5KTSA 3LPAA 5EAIA 3S29A 3GRYA 2D74A 4WW0A 3PDUA 5KU1A 4O2BF 2BP7B 1NW7A 1Q5PA 4C5AA 5GV7A 3OT4A 1D3AA 4QGBA 4MV8A 1VBKA 4PG6A 3DZBA 4PLTA 4ND2A 4IXMA 4OI0A 4WFJA 2IEZA 1KO1A 1RZVA 1UOPA 1YQGA 3BMQB 3FLAA 3PICA 3N8DA 4QRDA 2BFFA 4KFUA 1KOGA 2XNSA 1ILWA 2OCAA 5LP1A 2OFWA 5CXUA 3SAJA 1QX3A 2Y68A 2ZK7A 4MI3A 3M6AA 2BGNA 5D86A 3K70C 3W5DA 3WQHA 2C0PA 2PT6A 3I1IA 5IBQA 4OHOA 3QA9A 2PIDA 1OYWA 3QQ5A 1OFUA 2A5DA 4UFNA 1QU3A 3SFZA 3FLEA 1E1KA 4MLDA 4G89A 1TZBA 1C9EA 2YJ5A 4Y6LA 3A2LA 1PQ4A 1MV5A 4CG1A 3THYA 3BE6A 4ZI7B 3RROA 5KYWA 1QP4A 4ZOLF 3NDBB 2PKQP 5D3MA 1NN3A 3UKOA 3LF1A 2OSBA 2CFTA 4Z9XA 1F3LA 4MVJH 3C8DA 2OZLA 4CMIA 4QPPA 1RJGA 1YBFA 3DFFA 4Y1GA 1A71A 2OV8A 4QGFA 5EC8A 3F4BA 3OCVA 4H1WA 4AIIA 3GAFA 2CLSA 2XDQA 5KCMA 1V5FA 1SK8A 2AJBA 1HDOA 3VR6D 1Q0TA 2EWMA 2VRCA 1TA9A 5I7OA 2AF3C 2PKCA 2OCKA 3ECAA 3KPUA 4U63A 2E4XA 4ZVLA 2MSNA 1FP4A 1IHUA 3VI4B 2C4WA 2GZ2A 4CF4A 1UP7A 1BU8A 3QW2A 4BV8A 1E6CA 5LQNA 3THWA 3FTQA 3WGNA 3CNBA 3ZWNA 3EZYA 2WYHA 2YHBA 3TLGA 1AUQA 1IK6A 5HZHA 4Q1CA 2XCRB 2V98A 1GG8A 3CCBA 4Y0NA 2O2YA 1ZNZA 3ZS9A 4WK2B 3O2QB 4N8DA 4WSOA 2NVUA 2XZDA 3WWCA 5AJYA 1C7QA 1N2OA 1ZKDA 2VN8A 4P3KA 4BKMA 5KHLB 5FIUA 1J09A 2HDOA 3ROPA 2AVDA 3MB8A 4JJKA 4O4HB 4D57A 4DWWA 4NATA 5E2AA 2FK8A 2XTAA 3QELB 1GTJ1 1XNGA 2I80A 3EMVA 3LA8A 5DHPA 4YMSA 1KYQA 3AF6A 2G4LA 3U13A 2P2ZA 4E09A 2IQ5A 2HT1A 1VG8A 3HJBA 4BPBA 2J9GA 4MH0R 1R8JA 4LZOA 4ZVQA 4QPNA 4YXWD 2AQ8A 4DANA 3EG5A 3ML1A 2Q29A 2D3TA 4MAFA 3RYFB 2JIOA 4BAZA 4P3PA 2HNBA 4G9EA 3MJEA 1M5RA 4B7UA 3KHTA 2ZKLA 4KODA 3U31A 5JASA 3EODA 5IT5A 2AN4A 2QUBA 2VNJA 4K1LA 2ZYSA 4RVOA 3LUJA 4ZN6A 3OT5A 1NLUA 3WB1A 1GFIA 3AT1A 3BSSA 4ESHA 2BEWA 4I5EA 3TIFA 1Q0UA 3ZY2A 3HBLA 3IUQA 3MT7A 2WY2D 4K6FA 4H6WA 4CKCA 1MEEA 5KSYA 4DPKA 3A6KA 2Q5OA 3AM5A 1C9DB 2AMLA 2P2YA 4C5BA 2QPAA 2UDPA 4AKEA 2MHCA 2XZPA 1M34E 2ZYRA 1WS6A 3ZZMA 1YQDA 3EZ2A 5ALMA 1A5SB 5C52B 1SUDA 3S27A 3S0JA 5CLLA 4L7VA 5BSHA 3BRSA 1I7LA 1RBMA 2GD6A 4F92B 5J4YA 3OAAD 4FUTA 5DHFA 3GLHB 3EDOA 2Q5CA 4JXKA 2VYFA 3RABA 4CKBB 1O95C 1Y81A 3EC2A 3ICOA 2IDJA 3VTFA 2WWIA 2C3YA 1E3EA 4UBJA 3UWSA 3K0FA 3ELUA 4LTMA 4WK0B 3TMKA 3TNLA 4B76A 4L3VA 4X45A 1CHNA 5FUQA 2XYQA 4RVUA 5ITZB 5CLJA 5T41A 1BJKA 1RYBA 2OLJA 4RZHA 3W9UA 1JBEA 3KKNA 3QXSA 5AI5A 1QF6A 3RS3A 2IIVA 5AW9A 3V4FA 4BV9A 2HEIA 4DSNA 1ND6A 5JRJA 1Z4OA 2ES4A 5GJVC 3M5CA 6ABPA 2G8LA 1FUUA 5EFZA 1W0KA 4W1RA 2O2GA 3WLRA 2RGBA 4QU0A 2R65A 1IUPA 4HXGA 1QS0B 3ORYA 1JLSA 1FRVA 1AUPA 1MA0A 2VYVA 3GPDG 3PFGA 4R51A 4YJ2B 5I9MA 1ZITA 1J0DA 1STOA 2FPGB 3IP1A 4FX2A 2JPDA 2X1VA 3FD8A 1MRNA 3NAMA 4D4HA 5FBWB 3URKA 2UVPA 4ONEA 5F7JA 1H6CA 1DXYA 3TBHA 2F3UA 7MHTA 4JJ7A 1U8YA 4DTCA 2K87A 4H7JA 1NSFA 2GN0A 3JTEA 4OXXA 1T8YA 1RABA 1CR4A 2OHFA 1N9ZA 3C6ZA 1L1RA 3V1NA 3BGIA 3VO9A 3QVXA 4L9WA 4TKLA 4EG7A 4HYYA 1KH3A 2HA4A 1M74A 4RMNA 1WEKA 2JB9A 3LHIA 1FSGA 2GHRA 3EXHA 4XQEA 2IXDA 4L0MA 5DFAA 4D6XA 1XZJA 1TC1A 4LSWA 4PRLA 1F12A 1WDMA 3EFEA 1CQIB 1RIIA 3A4MA 1L4LA 4JNCA 3RTBA 5HKBA 2EIHA 3C6BA 3HXKA 3ADBA 1S1CA 1QO0D 3F6CA 1LTQA 4XYEA 5CHEA 2Q3JA 1LUAA 3A31A 3GG2A 4MUGA 3IOMA 5ALZA 5C8VA 2ZREA 3C7AA 3LV8A 1RJFA 1NW9B 1XJWA 1QHXA 2P4UA 3KQSA 3QU4A 3PUJA 1M1XB 1ODTC 2Z2KA 3F7NA 4M1TA 4Q93A 5EUQB 3TECE 1SR8A 4Q3AA 1R0WA 3GGSA 4BMZA 1AA9A 3H3JA 4X1IA 4YRSA 3ZHOA 4OJNA 3WP1B 4Z6KA 2AFHB 1L4UA 1HQDA 2PWZA 1QKJA 1XZEA 2G25A 2W2LD 3RVJA 4DRZA 1B93A 1FMJA 1FLAA 5E4JA 4JJEA 4BLPA 3W6UA 4YECA 2CLIB 2P68A 4X63A 4BP9A 4Q7JB 4CF6A 3T15A 2HPZA 1WJGA 1V8ZA 1ZK1A 2CD7A 2CMHA 4QFMA 2O7NA 4CCYA 3LDGA 1PR9A 3GJTA 2I78A 3COYA 3KTFA 2QN8A 4JJFA 4YUWA 3QOXA 4OQMA 4F4DA 4JEMA 4EJMA 2OQ2A 4LHWA 3U9SA 3NIFB 3O2NA 3NRJA 2A5FA 3QE2A 4NVRA 4F56A 1V1JA 3A1VA 3ILVA 4BC1A 4GPAA 4Q7LA 1ILEA 1Z88A 3K20A 5TPZA 3CVWA 3ECCA 2PZMA 3RF7A 3ZXIA 2F8SA 1R5BA 1KJZA 5BV8A 3PJRA 3O47A 4FZRA 2JFOA 2HIAA 2G3YA 4RVFA 1G9TA 2BFEB 3ANMA 1Y8ZA 1KBQA 3DFKA 4UMEA 1DAEA 2AH5A 1X15A 1Z73A 2CKMA 1DELA 2DMRA 3E35A 3LKBA 3L7IA 5DW3A 3CF4A 4QFCA 4UCFA 3VO8A 3ZZ0A 2NSDA 1OB5A 1CNMA 4A26A 5EI5A 3RT7A 2O1WA 2J3DA 4FPXA 4IM7A 5DTMA 4LF4B 1OFIA 4WXYB 1J0XO 3DE6X 4HCJA 3ZWAA 1Z0FA 4RABA 3L8FA 4X20B 5E7JA 2V97A 1RC8A 5IVDA 4M9XA 2YBDA 3MUOA 2ZETA 1C7FA 3R41A 5ALNA 3OICA 3GZTB 1AY0A 5A4KA 1F2VA 2IYSA 2PEZA 1UEJA 2RIPA 3PNYA 4DQXA 1HEYA 3I5UA 1SAYA 1H2FA 4KPUA 4PGFA 4BX0A 1ZVKA 4AZ0B 2QBYB 3FNGA 5A02A 1KI7A 4RCVA 2BEJA 5EYPB 3WB9A 3EXG1 1ESMA 2IU4A 4DV6B 1LNQA 4I4TF 4CJXA 5CH8A 4UQOA 3T38A 5EHNA 5SY4A 1KAQA 2AX3A 2RGYA 3L0CA 4BGIA 2LTAA 2QG6A 2VI5A 1TXGA 2J59A 2GJ8A 2GPWA 4AZVA 3IBSA 4JLNA 4NABA 3U9TA 2JZCA 4LHXA 5C1IA 1SPBS 3L8EA 2GXSA 2OC4A 2QYTA 3OY7A 4BB0A 1NE7A 2JIZA 4WAUA 4BQNA 3JQFA 3ZDZB 2YW9A 1R64A 4JWTA 4AO7A 2IK8A 1ZL0A 3JAWB 5KYVA 4DB2A 1F2TA 3BFVA 4YAOA 3KIPA 4MLPA 2C58A 4AVYA 1NF2A 2P9BA 3DTVA 4HS4A 1XXHB 4C7OB 2FWMX 4FGZA 2ET6A 4QDXA 3VC2A 3H9EO 1B42A 2H4JA 2R751 4LTNA 5AJWA 3EY4A 1ZO8A 4QJBA 4COKA 2HLHA 1M6HA 4GDFA 5IBCA 3CNEA 1MO2A 3MQFA 1SWVA 1UT6A 1UK6A 4YI5A 2I87A 1YK1A 3GT7A 2CZCA 1OXKB 1I3KA 3HCRA 1E98A 1JILA 2DGDA 2EQBA 2XDWA 4G09A 3J80A 3VTZA 5HP4A 1TTTA 1ZA2A 2BJVA 2Q0QA 4IS3A 4RLHA 4UNNA 4YPOA 3DQPA 3KCQA 4FCVA 1SVMA 3C3YA 3O82A 4F84A 4CMJA 3Q3EA 1F8XA 2BHNA 2H8KA 3CEJA 3GUHA 2FSVC 4NONA 2WVAA 1YRYE 3R1IA 5TMEA 4NSNA 2IY7A 3A2NA 4GZ5A 2RGCA 2JLXA 2RMKA 4JHXA 4QWMA 4RZUA 3JAMA 3U9LA 1U6JA 4O4JA 1QC5B 3INYA 3AB8A 1E2KA 1E4OA 1QTNA 1TKRA 2ZR0A 3ITDA 4HH0A 4RE5A 3GJYA 1TYAE 4MYUA 5CXXA 5TGZA 4U0JA 1XQXA 4RNDB 1ZNQO 1UXIA 3WHPA 4Y6PA 4ILEA 1RRMA 5BYKA 1O6GA 1B6GA 2NUPA 5FHQA 2FN7A 1P2VA 3CO0S 3ADDA 3CA8A 3PQ6A 2ORVA 3ZNOA 1XZ8A 2OE2A 1PLJA 1P2GA 1V9LA 2CLEB 1V25A 2W4QA 3B13B 4WLOA 3UJ6A 3ZXXA 1OKKD 1XKTA 2I8CA 1NONA 4K6CA 4P38A 1YQXA 4II3A 4EA7A 1AS0A 4TUYB 3DHNA 4TZ6A 1MD9A 2GGSA 2COKA 4GBJA 1NXTA 3LDAA 4L7QA 4P31A 4W4TA 1FTSA 4FSXA 4Y1RB 1KDYA 1X7YB 4QTTB 4ZZIA 4W5QA 4TVSA 4QIHA 4EDHA 2DY1A 5BUQA 1DAIA 3AEXA 3SF0A 3AEUA 4JVMA 1HQCA 4DV2B 4Z2AA 3DMNA 4F3RA 4NOJA 1XIVA 3U2QA 4P0PB 2JATA 4WESA 2NV2B 1MABA 4OSEA 3M3HA 3DDNA 3QKUA 1N2CE 4OMFG 2XNDD 4TT3A 2WDZA 1ZCJA 1Y4ZA 3Q0TA 4ZWNA 5FP0A 5I7VA 3NH6A 5F52A 4QYMA 3EC7A 5MF6A 3THXB 2PUBA 1K6JA 4XX1A 2FDCA 5EXPA 4DT1B 1T2DA 2XD9A 4KXUA 1ZL2A 2G72A 3MUFA 4KVAA 3N5CA 4GU5A 1JG2A 1FZTA 1QIFA 2PUEA 1K3TA 1X2BA 5AKKA 4KPYA 3KD2A 3CFYA 1KR5A 4G0MA 3GUUA 5IDXA 3G17A 1TO2E 1JAZA 3HZZA 1L7PA 2XY4A 2PPLA 4DCNA 2H16A 1Z36A 2CVZA 3W8EA 4Y7DA 1NQUA 4MQFB 4ZCIA 5I47A 1YVUA 2RGEA 1IAQA 3X44A 5IWCA 1JQBA 2WG2A 2GERA 3JSAA 5KYXA 1YS4A 3AESB 1NNUA 3CS3A 3FUUA 4IF6A 4BO2A 1C8BA 2PA3A 2V7QD 1NF8A 2XIQA 4P5PA 4Y2SA 2HA2A 4RW0A 4WXRA 1LJUA 5EZYA 1K06A 2AUMA 4ZKEA 2Q7DA 2GN6A 3QTTA 2BZSA 4N8EA 1XN4A 4B6JA 3S6JA 1SKUA 4KQJA 1RWBA 2ZIXB 4YRKA 5TEVA 3LVBA 4ABYA 5CLQA 4X93A 3C1UA 5J5AA 3ZGNA 4EP1A 2C2KA 4KGVA 4B8ZA 3PKIA 1SC6A 1N8TA 3FRIA 1RP7A 1UL1X 3KJZA 4H6XA 3TW8A 2NM0A 1GSIA 3NBQA 1E2NA 5AVTA 2O8BB 3E7PA 2DE0X 3EQ8A 3FYCA 4MAMA 4XQGA 4S04A 4YP7A 5C1PA 2XCUA 1R4MB 1QRDA 4PPFA 1U2ZA 3L8ZA 1TO1E 2J9FA 4C88A 2AVNA 5JROA 1S8NA 3UTDA 1ZUNB 3UHJA 4I9UA 2R86A 3VSBA 4HX5A 2P9QA 2M6KA 4R7TA 3FR8A 4ZVUA 4O2RA 2IW1A 1FXUA 5M7EA 3T7SA 1HY3A 1W85B 3UJAA 4ZT5A 3HEMA 3I9FA 4RKWA 1UK7A 5DSZA 1JE0A 1N1DA 4BX3A 1H8HD 1C4WA 2CVPA 3GDWA 3TOVA 3H2BA 1SBCA 1I2MA 3HYNA 4MUIA 4QYIB 4RDIA 4R1UA 3AEKA 3DEFA 4ZOLA 1XWFA 3REQB 3WK7A 5C81A 3PPIA 1NM5A 1I80A 2VTDA 4D7AA 2Y8EA 1P6XA 4KI7A 2PVCA 1QDUA 1R0YA 2HRZA 3SJCA 4BE9A 3R6WA 3VR5A 1TGYA 4B2IA 4E2ZA 1RRFA 3PVCA 1P73A 2J3QA 3WHLA 2HSEA 3I04A 2V6FA 3R23A 4NFHA 1T3TA 3HJUA 3K9LA 2JD0A 4BKUA 5JC1A 2KLHA 1Y5MA 5K0TA 3HJFA 3CCFA 2O2EA 2XA2A 2ZPAA 2O0JA 3OX4A 1K7FB 4QICA 4EZIA 1R0CA 5F7OA 3HWX1 4FQ7A 4B71A 1E3WA 1FFBA 2DTDA 2PL5A 3EZ9A 3CN9A 1YF3A 1EWQA 3CSDA 1D7AA 4XIYA 3W3AD 3KKPA 2XYRA 1SD1A 2OGTA 1QX4A 3HLKA 3RODA 3E9ZA 3JVDA 3U40A 3IEKA 4HNAA 4XVCA 2P40A 5DN9A 3JQDA 3KJHA 4MIEA 1R1DA 1M2VB 1SBQA 3MWFA 1HQYE 4MPPA 3CLRC 1JTVA 3LP5A 2BFMA 1WNTA 2PJUA 3F6BX 2P0EA 5E0KB 5EG5A 1T5BA 3ZBUA 2RB5A 2ZZNA 1PS9A 2Q7XA 4I08A 1QDLB 1VBFA 2ZRDA 4AX4A 3CKLA 3S2FA 3ZHSA 5ADUS 1GARA 4WZ6A 2QRUA 2GJAA 4YNBA 4C2BA 1R4NA 1G6Q1 2Q5EA 1KZ1A 2VZEA 1AE1A 4HWSA 1W7AA 1XD9A 1DIAA 4WJLA 5FOSA 4PRYA 1KXZA 3W6OA 1D0SA 3GYGA 3V7YA 5TGDA 3FGOA 5AM4A 3MN1A 4F72A 4LNAA 3UJCA 2W2VA 4CU5A 4DM3A 3G5LA 5KVSA 3DLPX 1K27A 4Q3NA 4HMOA 1XZQA 3SQLA 3FVRA 1W1UA 4B4KA 2WTBA 2XCTB 5G0SA 4NNJA 3UIEA 4WD3A 2O6HA 3DAYA 3HV2A 2C1XA 3A37A 3FPJA 4UZEA 2Y1GA 1MAWA 1LF0A 2W2PA 1NYLA 4FFBB 2OWDA 121PA 1NUPA 2QRVA 3MEQA 2YVUA 3LLVA 1R0BA 1WSAA 2C5LA 4KWEA 3STTA 1V45E 3BK1A 2YIVX 5E9QA 4BVJA 3SQWA 4MINA 4CT5A 4PR0A 2CHQA 4FJ0A 3V7UA 3LU1A 1DO2A 3I1JA 1JQJC 4CV1A 3KQNA 5IMBA 1I32A 1YDHA 2G9RA 3GRPA 1YB6A 3L82B 4R41A 3U44B 3NH9A 1H22A 1Z6AA 4YGYA 1HMYA 3WISA 5JANA 3PEWA 2B2CA 3K0SA 3SS8A 3CRZA 1NXQA 4ICIA 4NENB 4EIWA 5I7UA 3ZJUA 2ZIEA 1L5QA 1SZDA 1OLUB 4PZEA 4J0FA 1ISIA 1QCYA 5GOZA 1ZESA 4NLLA 4JU9A 4Z99A 4JS0A 1DZIA 4RTMA 1Q11A 2RK6A 3K9GA 5SZKB 5FLXA 5IM5A 4C4RA 1E9DA 1QYIA 4MICA 5ALFA 3ESAA 5FWXA 3IB6A 5HVNA 4L57A 3AJ9A 2IY8A 4PTYA 4PC1A 3WS7A 5B2EA 4BOYA 1HE8B 3A1SA 2V3VA 4WZZA 3DXYA 5LNK1 1AKYA 4WKOA 1ZIPA 1T10A 3OJLA 4LY6A 3RI3A 1FRNA 1YGPA 4ED9A 5IUJC 4MDFA 2O5VA 4YJ3F 5KTPA 3PC7A 1PK7A 3TQTA 1KJIA 1BAPA 3SVLA 1OAOC 1WTCA 3NOXA 4S1TA 1Q50A 4V2UA 3ZGLA 4D82A 4DY6A 2P6NA 1ZG3A 4R9SA 3SM3A 4MYSA 3UMYA 3QBTA 4JJGA 1G7SA 3LQFA 4NYJQ 4RHUA 4PPGA 5TQ2A 4C30A 1YNOA 4Z9FA 2FWRA 4A6XA 5A4IS 1TIKA 4HAWA 3RIEA 1TF7A 2VTBA 1FPMA 4PQFA 5HWSA 1KNXA 1VDMA 2C92A 5ESDA 4F97A 3N3BC 1BYIA 4HDCA 5COAA 1UBCA 2O1EA 2OVBA 4DOMA 4G86A 1A4UA 5TT1A 4JC4A 3EQ7A 1ZI6A 4QYSA 1CF9A 1F0PA 1WXIA 2H1VA 1EZ1A 3GEDA 3L3BA 1QB7A 2NSHA 4HD8A 5FR1A 1T9KA 3D2LA 1XZAA 2W4MA 4R7ZA 1P9LA 1NI3A 3VZPA 4OLBA 1U0JA 4ZGGA 5IBRA 4KTTE 4WOJA 5KYYB 2NSYA 5AW3A 2FMXA 4Q01A 4KR7A 3BXPA 1XUOA 1MAHA 5IM4F 4PO1A 3ER6A 2Y1KA 4UQLA 1I6WA 4HC4A 4D43A 3P4YA 4CTJA 1GPMA 1SEPA 1IY2A 2IE0A 1JEJA 1JU9A 1TCUA 3UMBA 4HEHA 2OHXA 3WGQA 3HHPA 2DB3A 5ER9A 1WXDA 2PPVA 4XASA 1AO0A 5DSTA 1R9GA 4MP6A 4RY2A 1DU4A 2FG7C 1EUCB 2OBNA 3Q6IA 3ZX5A 1IM5A 1KIAA 2FPIA 3UCEA 1FVXA 5B6JA 5BPFA 3CX8A 1QG2A 4V1CB 5I9NA 2JBWA 3L04A 3NT4A 4BVLA 2NNWB 4PYKA 4NCHA 3BE5A 4QOGA 4LFAB 2OM2A 5CT4A 2IU0A 1N9GA 3DZDA 2ECKA 1VGQA 2ECPA 2WU0A 1F8YA 1MQ8B 4KYUA 1H5QA 1GOTA 4XUEA 3T5PA 3UFXA 4PAGA 4MRNA 5CP8A 1CIPA 4L6CA 3MOIA 4K9MA 4JIMA 5GGXA 2IHYA 4GMKA 3WGOA 5CA1F 1E1CB 1K6XA 1PJQA 1EAYA 1GM5A 1CR6A 3KSAC 1Z6PA 5D6OA 4AJEA 3Q8LA 3DR3A 1NVKA 2Q4RA 3DDHA 2IH4A 2JGAA 4TV9F 4IHAA 3W9BA 4BV2A 1JB9A 1FU7A 2O23A 2RONA 4EGCB 1JXMA 4YN3A 3PWTA 3V4OA 1YDFA 3L8CA 4CIAA 1Y6ZA 4X7BA 4B6GA 4IKOA 2NTYC 2FTKE 4DYVA 4QL3A 3VH4A 4AZ3B 3DYVA 1KDPA 1SH7A 4QXAA 2W93A 4B4DA 4ZCSA 1UPAA 2AC7A 2HA5A 3NT5A 3S68A 4ZZ0A 4FZVA 3EMDA 3GROA 1PUJA 1QHHA 4UULA 3RYIB 4NYMQ 4AJJA 1TQ8A 1X1EA 4FDLA 5H3LA 4B3HA 5F1YA 3WG9A 1OCEA 1FP2A 3ITKA 1C8LA 1SVSA 4NAUA 1GZVA 3OJFA 4MZXA 3U4GA 4JR1A 5LN1A 3ZJTA 1ZVMA 4XPZA 4CUKA 1E92A 4NXMB 3UT0A 4OREX 3FKSA 1P9RA 3UHAA 1NW5A 2E4UA 1A50B 4RJTA 4CL2A 5DKFA 2R3SA 1IB6A 2VHZA 5KQSA 3TLEA 4M88A 2WWGA 3G85A 4EJSA 2R5WA 1U2GC 3K6KA 4I4TA 4L5AA 3QY0A 2WAOA 2PD6A 2P11A 3CR3C 3QH4A 3AF2A 1T0UA 3ITEA 3OIUA 3B8EA 1G66A 2PKWA 1P4AA 4OGFA 1JEEA 2IYXA 1I0IA 3KQMA 4OYRA 1XZHA 4M6WB 4AZWA 3ZKWA 3WK4A 2JLCA 2P9YA 4G5GA 4I46A 5I4CA 1J99A 1MO5A 2ZYTX 2D7DA 1PGQA 3LX6A 5IZCA 1I3NA 3QE9Y 4U7DA 2WKWA 4MSUA 1K8RA 1MT0A 4AECA 5C5CA 1ZM3A 3OEHD 5ITSA 1E3IA 1T36B 3A28A 3M6IA 4JSYA 4AS3A 3OM1A 5K4GA 3ILYA 2SKCA 4V0KA 5AW5A 1G17A 5AK4A 1NI4A 3B6MA 1WXEA 2R8ZA 2BDTA 5GQSA 3ZU4A 2OCYC 2OCBA 3CRRA 3ESDA 3HUDA 4C0BA 4ZDJA 1OZGA 4IJUA 2NU8A 1G19A 5E6UB 5ULLA 4CI0B 4URVR 3JWGA 3MRTA 1EQ2A 3DGFC 4RSGA 5DTIA 1SUBA 2RGWA 4IVPA 4ALNA 1QVWA 4QBTA 5EMKA 3P2KA 4E13A 5IASA 1JSLA 1OXVA 1W5EA 1X7HA 2QPLA 3CZ9A 3EXFB 3QVLA 4LDPA 1KZYC 2P3QA 4UVHA 4AURA 1PSDA 1GGVA 2P6OA 1BN7A 5LFAA 1C9KA 3VI3B 4AN4A 5I9TA 4E5NA 2A8YA 2JLAA 3NTUA 2A4KA 3PUIA 4DCSA 2NVWA 5J4HA 1K86A 4PZCA 4DUGD 1AGXA 1RLUA 1DCFA 3NAQA 1OC4A 3L0SA 5EP3A 3G1UA 3GFFA 4R3UC 1GCUA 4HDMA 4IV8A 3WKDA 5A62A 2WKSA 1US8A 4K6GA 4KWCA 2X0DA 4B6FA 2BHRA 1T0PA 2GUWA 4RIIA 1Y4DE 2O14A 2I7XA 3C5EA 5HIJA 3SICE 2XUPA 1QZXA 5FFFA 1BW9B 1ES9A 3BMCA 4F2PA 3BDIA 3IJEB 3HEBA 5BYAA 5ICMA 1J2RA 3W5JA 5A4AA 1P62B 1KGDA 4YRBA 5BQPA 3VTKA 1JZQA 2EBWA 1WXGA 2P2DA 1YVEI 1PO7A 4P0QB 2IP1A 1N0IA 1XZKA 4RMJA 1PJSA 1JHOA 3V80A 4D4GA 3BWXA 3MWKA 3EGXA 3I72A 4CMHA 4KYIB 4EFNA 1N6OA 4NFLA 4ZYUA 3QBVA 4JUIA 1XLUA 2XTZA 3H8VA 1ORVA 3B9RA 4BQIA 1UBOS 1KQ3A 5HS4A 1P77A 2DULA 4NBTA 3HTXA 1B8VA 3GJQA 1E9SA 3T6KA 4XYGA 4INAA 1ZOPA 3A4VA 3KJGA 4D0LB 1HM5A 4NJEB 3DE0X 3G2HA 2D2EA 1EEXB 3VH1A 4AMUA 4C3ZA 2ZWAA 1U90A 4MO2A 4URZR 5IJZA 3R5KA 4CEJB 1Z38A 1TZKA 1NLYA 1XHLA 2IY9A 3F5QA 1DE0A 4I5DA 4PTZA 4A27A 5BWOA 4MV3A 1O94D 2H52A 4HMPA 1NBEA 4FIZA 4H59A 4IOJA 4QYWA 2XW6A 2QUKA 5T4EA 1LB1B 4PHHA 3SYMA 1IU9A 3VR2A 4U3JB 1NNI1 3FDFA 4RS3A 4MW1A 2HU8A 5K6TA 2HW8A 3D81A 3CKMA 4DIOA 5JNLA 3FRHA 2YN2A 4RZ3A 3JQGA 3GK3A 1S96A 3I6YA 3DCYA 4HYQA 1LVHA 2GF0A 2XADA 4RH3A 1UC8A 2GVZC 1XD8A 3DVAA 4ZVNA 2Y2VA 5G2OA 3K6SA 3NNDA 4URWR 1UK9A 4RA9A 1OGYA 2HJVA 4JYPA 3GT4A 1HE1C 3IULA 1PG2A 1AKMA 1VBNA 2JGNA 4LQLA 1KAOA 1ODSA 1SOMA 3K9BA 4NESA 3DLCA 4I8XA 1IXRC 1COZA 4B3JA 2YY5A 3O94A 5BV0A 2HRBA 4GP6A 1MPXA 1L3CA 3JATB 4XM2A 3C2QA 1I7SB 5H82A 3PGA1 1VMAA 2XSZD 4R2KA 5TQJA 1GFSA 4E5PA 4LZJA 5BQ3A 1X8JA 1KFKB 5HBRA 5H4HA 3F96A 4MJ3A 5AK0A 5FUWA 2IX3A 2REXB 3NOQA 4YAFA 1S5PA 1BDBA 221PA 1OTHA 2WB2A 1VJRA 2I1LA 2QN2A 3AJDA 4J91A 2JLYA 1PR6A 1JX6A 1Z0UA 3CLTD 3V46A 5TGTA 4CHTA 2ZUDA 1GTSA 2J0UA 4JBIA 4QECA 5HPYB 3M2PA 1RSZA 5F1OA 1DCMA 4JA2A 2C2GA 4R2WA 5JISA 3CLUD 3ROTA 1PWEA 2ZVDA 1TM1E 3C6KA 1YVRA 2BRUC 2H2DA 2HF7A 1QGED 1NYQA 2YNMA 3O31A 4H3SA 4RJ2A 4LHVA 4MP3A 4RPKA 4ALLA 4BNVA 4Y0VA 4MS3A 4EFKA 1U7WA 4Z9AA 1KZ4A 3A26A 1LBHA 3WADA 2XRMA 4FYKA 3TD6A 1N8KA 2UXCB 2Q3BA 1XPUA 5JEEA 3E3AA 3F71A 3E9MA 3SYNA 3K35A 5KHOC 5MN5A 1UDBA 4MR9A 4TM8A 2J7PA 1GRRA 3VQTA 1M7GA 5HM6A 1N9KA 1LDGA 4CM7A 4GMDA 1EE9A 4MVJG 1QTQA 2VUUA 2AOTB 1HUQA 2JVKA 4ZI5A 1JLLB 4DHEA 3AUYA 5JT1A 1FTGA 1H0KA 2D5LA 2X0EA 4EYKA 3UC9A 1JG4A 1GSHA 2BI8A 1LV7A 1T1JA 3JYPA 3O0DA 4OOFA 2Q49A 4P36A 4WVLA 4X6UA 1EB9A 5EINA 4KHZA 4FINA 4I9GA 4PSUA 1JJ7A 3JQ8B 3ZR4B 1K3FA 3AM4A 1XZIA 5EPOA 1CJKC 3QI7A 1RLJA 3TNDA 3FYUA 2MSWA 1BVRA 3AFNA 3NXSA 4PFKA 1JVNA 1T6BY 5DU2A 2A78A 1OMOA 3AJEA 3HGTA 2X4DA 1XVAA 1PZGA 2CL5A 3A6EA 3B9QA 3OC6A 2R8XA 4KMSA 5BN4B 4GM0A 5C46F 1XLVA 4M22A 4IHJB 1DB3A 2J31A 2XLBA 4J07A 2EYUA 3R0JA 4ZI7F 1MNAA 1X94A 3OX1A 1NQ5A 3T9DA 4P7BA 5B1YA 4FOLA 3C7TA 3FNIA 3FWNA 4PHFA 4C21A 3G5TA 3E2PA 3V8RA 1UBEA 5KKNB 2ZPTX 5KHAA 2I2XB 2HX1A 3MXOA 4JX9A 1OZHA 5G0WA 3VV2A 1A96A 3ANTA 3ZBPA 5JVDA 2YV1A 5JMTA 1J5EB 3UWDA 1BE6A 4OK3A 3FPSA 1VECA 5EEGA 4FE3A 1E32A 3FDXA 1EK2A 3GMDA 5JV5A 5F2NA 1PZHA 3LT1A 4WERA 4R8VA 1LDNA 1XOIA 2Z83A 4E51A 1NQTA 2EKZA 4BNMA 5HTOA 4CIXA 4CLDA 2I4NA 1IZZA 5L9AA 1DDIA 1DKPA 2JH8A 1RVDA 4ZICA 4X71A 3PUVA 3D1JA 4GOXA 2EL7A 3GAMA 3O8RA 1YDMA 1NU8A 2IXGA 4GICA 5IFLA 5JQWA 1UF9A 1DCTA 2IDKA 1D4AA 1SVUA 1WV0A 1L3IA 1EA5A 1VA4A 3FXAA 2XV1A 4K7JA 3FMFA 1RQXA 4O5AA 4EECA 1Y1TA 4O4HF 2B21A 2OLEA 2XUHA 1KBOA 4FGLA 2GDJA 1WSDA 1ACMA 1S89A 3KLMX 1O6BA 3JQAD 4GI7A 4LE2A 4PCVA 4ZZ2A 4RBNA 2ZRJA 4ND8A 1PT7A 1BWRA 2ASVA 2PH7A 1I6LA 3DCJA 3KG2A 4DC1A 3F6EX 1XCGB 4C2UA 4J7AA 4FKMA 3SHQA 3BGSA 2WSBA 5I7RA 2XODA 3RJ9A 4TV8A 4DPMA 4X1OA 2ECOA 2XD4A 3R3UA 4LRQA 3H5RA 5DMXA 1N1MA 2PLFA 3SJZA 2PXCA 4YAKA 1C8VB 2D1SA 4TOIA 1XCOA 3AVPA 2QRPA 1TD1A 5BVGA 1Y7LA 2DVMA 2YRWA 1OTXA 2D00A 3F8WA 2VPWA 3PUXA 1ZN2A 1V5WA 2NO9A 2WIAA 4BUCA 5J3JA 4CXMA 1R6DA 2DETA 1LPSA 2FPXA 5JHHB 1QOPB 3FCUB 3LX4A 5ESRA 1SXJA 3SSAA 3NIWA 5TMDA 5FPPA 4EI2A 3UBTA 1I2BA 3FUTA 1Y9EA 2DT5A 4Y2XA 1XEWX 2O6LA 3SI7A 3T12A 4YJ3A 1C3OB 4YDRA 4PLWA 1ZVQA 1E4EB 3U7HB 4CU2A 3H5LA 3FWKA 2KX7A 3X2SA 3F1KA 2QP4A 4GKVA 1QWSA 3MJ4A 4W9NC 4EJ6A 3CE9A 5L40A 4OP2A 2Y6UA 5TIIA 5DHSA 3KVYA 5H3CA 1UBJS 2XAUA 2Z04A 5LC1A 1LDBA 3WLKX 2ROQA 2BZGA 1QH8A 3QW4B 4K3UA 4PZ0A 5BUCA 2I33A 4KX3A 1AXRA 4UDXX 1KFBB 5J4KA 4OHPA 3K2BA 3T9EA 3U49A 3GCDA 2QA5A 1V7QA 4XLLA 4TLEA 5K0EA 1TPZA 2QV0A 3KPWA 1G20A 1UZNA 5FLEX 1ZD8A 4M9ZA 3HRIA 2CEAA 5A3QA 4EAAA 2GDZA 4I6JA 2DU8A 2P3SA 3VYVA 3SQOA 5ALIA 4PZUA 4Q4AB 3K96A 3PVZA 1U0HC 3PJDA 5CT6A 5AVXA 5F9HA 1AC5A 1CEEA 1SQ0A 3LHSA 4BGEA 4DCTA 1K66A 4DT1A 1JDTA 1M1YA 3MINA 4DSOA 5U1PA 1CP3A 4LBWA 5ICFA 4YJ2F 2NNLD 4IEIA 3EEIA 5IM4A 3NHBA 5E2IA 2DR2A 4U7TB 4CR7A 4E2YA 2GCIA 1GP2A 3D6MA 2RJOA 2FEKA 1SO8A 3CLSC 2WIKA 1UJCA 4HGQA 3IDQA 1HLFA 1ZZEA 4L4YA 1YO6A 1D03A 2G7MC 2ORYA 4G24A 1OT5A 3PDIA 5BURA 1A7KA 3HCNA 1JMYA 4FILA 2BMDA 4OKNA 4YI3A 3AUJB 1P3Y1 3CEMA 4TM7A 2IBSA 1QCCA 2POQX 3EZ6A 2D3WA 3T3DA 3AF0A 5AVKA 4PLGA 5LBTA 2A67A 3PG5A 5L4SA 3RANA 1TCAA 4P86A 1R9NA 3GCZA 4BFSA 1M76A 4HB3A 4WECA 4DLPA 2J3MA 3DH0A 1JT9A 2DSNA 3QX7A 4TWJA 2A58A 4TWBA 2BFAA 4JI3B 1PL8A 1RE0A 3O4JA 3FGNA 1L7NA 5ETJA 4CCWA 1LCIA 2VBCA 4PBTA 4XGNA 5L4NA 1P0CA 1FDWA 2V7BA 3ANXA 2ZQZA 1CY1A 4C6TA 2J5QA 1JUDA 1A8HA 1AXEA 3KJXA 3VHXA 1JGTA 1BJRE 3GFVA 2C54A 4GGMX 3B5EA 2ZRIA 3D0QA 2NSJA 1KQPA 1V9CA 4U7FA 3DWIA 5EE3A 4QDUA 5JAUA 1J22A 1U2PA 1VMEA 4OHXA 3EGVA 4YLGA 4MA0A 3CU5A 5K05A 3HGQA 2JFVA 2ORED 3DM5A 3KTDA 3NTXA 3Q5GA 1IEQA 1GQFA 2PS0A 1POXA 4P7JA 1SCBA 1TUBA 2H4FA 2R97A 2W2KA 2FV8A 3NHRA 1U4OA 5BWCA 3HSSA 3Q2KA 4EHAA 5L3SA 4FTWA 3M5DA 3Q8KA 3AHFA 3PPVA 5TJ9A 2WWXA 3B7PA 3LXUX 1B8PA 3FBGA 3PPXA 3P9SA 4IVNA 3K5WA 1JA9A 4MVJM 1BGWA 1AKEA 1YE5A 1H9BA 1K5GA 2HAEA 2NYRA 1U9IC 2IU3A 2R7LA 2ZCUA 1FXSA 3FSGD 3QOWA 1R00A 3TSWA 5EIEA 1CF4A 2G63A 1XA4A 1E2BA 4M7WA 3G0OA 1SUCA 3UJNA 2CYCA 2W6ID 4NS4A 1K98A 2FLVA 3ND8A 3ZH2A 3UK0A 1V8DA 2ANBA 3EZXA 3G2PA 3ISTA 3IUNA 3LSYA 5F3RA 1CR1A 2IYUA 3M1YA 4AF6A 4LXQA 2AN9A 4EB0A 1PK8A 5JNWA 1DEXA 4QQNA 3UPUA 3LVRE 4D5EA 1FFXA 1ZGZA 2QWXA 2CVFA 4DNPA 4F5EA 2BSXA 3A1CA 4UARA 3IBCA 2O20A 3A10A 1ISRA 2WJJA 3SZRA 5JD6A 3ZOZA 1RWWA 3E7WA 4OGWA 1TT7A 2P41A 1XRLA 1W34A 3LS2A 4JL6A 1P7VA 3EAGA 4LF9B 2EW2A 3FCOA 1C3EA 1XGKA 2JLSA 3C24A 3LGAA 4MVWA 2AF4C 1CIJA 1XTKA 3P20A 1DEAA 1ESNA 2FRVA 1U1CA 2GAAA 4GS5A 4Q05A 5JAHA 5GONB 3G1TA 2X8WA 2I62A 4BASA 1HDXA 1NRIA 3TTUA 1U0BB 2GHTA 3L5KA 5KQMA 3C5VA 4BLVA 2IOFK 4DJJA 2PKXA 4GBGA 4PNEA 2AMFA 3H83A 2X9LA 1K0FA 3QHAA 2ZT7A 1C0EA 1TTQB 2LKCA 4ZCTA 3QLVA 4BFLA 3WLQA 3T3HA 3AEZA 5EOVA 5HRAA 2I6TA 2BKVA 2DH5A 2IHZA 2VDQB 3LUPA 4NJMA 3W4KA 5AM0A 1QF7A 4NMMA 1YSCA 4MJXA 2C3UA 1IN7A 2X14A 3C3BA 1IZ0A 3N1UA 1YHYA 4YC7A 3RO7A 3GLVA 1D04A 3H1PA 5K3DA 4R8SA 3WYFA 3R3WA 3RG8A 3Q11A 3IUSA 2XLCA 3OPYB 2G1UA 4IUBS 1GL7A 4DQKA 2B5OA 3K9QO 3O4VA 4HGZA 3VOBA 5BNZA 1KHTA 5LZ4A 1P33A 2A35A 2W8BA 4UUAA 3ANSA 3AHEA 4WT7A 1GQOA 3L7KA 5BSUA 3ZCQA 1Z5PA 2PWYA 2DPLA 4OATA 5HM8A 1UXKA 4RGVA 3U48A 4TS9A 1JWAB 1LSOA 3FIUA 3JAKA 4X3CA 1DMRA 1U3UA 1CF2O 2OAQ1 4LJKA 3GP8A 3SF8B 4AXXA 3OPVA 1BIFA 1M54A 5CXSA 2AXNA 4AKIA 1V26A 3O8OA 4GLLA 4XWYA 3CM0A 2ODBA 3FFAA 2EARA 3GVIA 2JLZA 2ODWA 3A6JA 4L8GA 1E1RD 1HE2A 2XGSA 3WRYC 1FDSA 1HSOA 4O08A 2GMWA 3A9SA 4X7RA 5FJJA 2OBLA 3IC5A 1PVVA 4ZO7A 5C7YA 3IR5A 2II6A 1PGPA 2X3YA 4L4XA 4CDNA 3ZWQA 1RAHA 1FS5A 3KDPA 2O59A 1Z13A 4G56A 5C7OO 3LKDA 1HX7A 5IDYA 1EP9A 2A59A 2H00A 3S7TA 4RHTA 2CFCA 5C37A 1GA1A 4K87A 2NPFA 2QZSA 1XNRB 2PMWB 1P39A 4NU0A 6REQB 2EG9A 4OA8A 2QKYA 1EGQA 2VTVA 4LWZA 1S8AA 2EZ9A 2WJ3A 4IGIA 1XMIA 3F6PA 5I3ZA 1UEXC 1EDEA 1XVVA 2R66A 1A8QA 3E5MA 3HI4A 3HYRA 3IMKA 4P3OA 2RHGB 4V39A 5CEFA 4RHEA 1KOJA 1N6LA 2P30A 2HUNA 1H2WA 3AWIA 3ET4A 5CDGA 2HF2A 3D4PA 4YVFA 1CUEA 1EVEA 1RWPA 1ZXLA 2C2XA 1CUFA 3E9RA 2RGDA 3G8AA 3IURA 1Z7GA 3M6UA 4JASB 4K1XA 4Y30A 3SBOA 3TUIC 4TYYA 1L5NA 3P2OA 4DZZA 3FTCA 1QGUB 3CURA 4RJIA 5HFAA 2WUEA 4LJSA 2CW5A 3M9WA 3TRFA 2IIPA 3O8QB 3H0EA 4DDWA 5JSUA 5KCZA 3L8YA 2R6GA 2WTNA 4MR7B 1DRVA 2DFDA 1FF9A 3CIOA 2P4QA 4MO9A 1AKTA 3ZY6A 3FOCA 5I5EA 5KEIA 5DP2A 3IDAA 5I9SA 2FMKA 4YASA 3PHCA 3T7KA 3OTOB 1U3CA 4KACA 3NKFA 1CRWG 2JAPA 3ROZA 2BGKA 1U5BB 3UAVA 4AKHA 2JAUA 1DAKA 4M38A 3VU8A 5ABPA 1Q7GA 2AEFA 3BD6A 1B3RA 1D6NA 3DFMA 4UASA 4DMKA 4TQUS 1U3TA 1MIOB 2VF8A 5LL6P 4CR6A 4KQHA 1GPYA 3G49A 4EDFA 1YR7A 1LTKA 2BTQB 4M46A 3AHGA 4WBNB 2Z9BA 3JS5A 1QIJA 4AJ2A 2W00A 4ETWA 3E81A 4H17A 4ISCA 4EGQA 2XWJI 4B2PA 4YT2A 5M3BA 4IDFA 1Y6FA 4KZKA 3H1FA 1O95D 3UAXA 5IKEA 4BQSA 1YR1A 2LNDA 1ECCA 2J3KA 4IX9A 5EIHA 3DMFA 2DUMA 2VF4X 3GQBB 1ZGCA 3N2IA 3R3YA 3DTYA 1RWMA 4IGFA 4EMBA 5BN3A 3L4SO 4FOPA 4PC2A 4RMHA 4NQRA 2ZU6A 3EE6A 4BKPA 4FWTA 2C07A 3F9CA 4HWKA 4IFTA 1Q1GA 2BP7A 5C0OE 4M0PA 3TDMA 1XPRA 2PFGA 2Q6VA 4TTJA 4LNHA 1RPJA 1E4YA 2IX9A 2J6BA 3SQDA 3E23A 5DNUA 3ZCPA 4EG5A 4OLJA 5A2QA 1GY8A 4LZPA 4MR8B 1JDUA 5LQSA 2JI7A 1FW6A 3F78A 1H2YA 4JJ4A 5E6SA 3QBJA 2MOKA 2NO0A 3AR8A 3OEWA 4HLQB 4GYWA 2P7HA 4KRFA 1XRNA 5G1PA 4KN9S 3TOZA 1D09A 3VZSA 3H2SA 3ESZA 3EEBA 3REOA 5JW6A 1FRZA 4DAOA 3AM1A 3F6RA 1BE8A 4GI1A 1T3ZA 4LSZA 4Q3LA 1T6XA 1GKIA 5FULA 3V00A 5A9SA 5AKYA 2W11A 5HRCA 1ZH6A 1C29B 1K6MA 2NZWA 2YMLA 2DYKA 2OCXA 3E03A 1C7ZA 1G0OA 4PLZA 2ID4A 4XOUA 3EBLA 3RYHA 4ZI7A 3RC7A 2B78A 4FYJA 3E9YA 3EXIB 4DARA 3JX9A 4ZD6A 2Z3WA 3RFXA 3ONEA 2BFDB 2C4HA 3RUDA 3W5SA 4CFZA 4D41A 4QRIA 3U4DA 3VKWA 4INZA 1O9GA 5AOVA 5K0CA 5EXTA 4P4TA 3GEHA 1OI4A 2QTVA 1B74A 3TAXA 3I9NA 3VDMA 3HKEB 5L3VA 1XRJA 1P81A 1XF1A 3GEMA 5AKIA 1ZJJA 3P8ZA 3VPCA 1NMQA 3NV9A 4O33A 5CYOA 4E21A 3CZ5A 2ODAA 4J1NA 1K92A 1TA4A 4IDBA 5AXDA 4GPIB 3QU9A 3JQ9C 4IILA 4A2PA 3NM5A 4U2FA 3UUGA 5LU9A 2F67A 3DOFA 3M83A 3RTCA 4RXMA 1F0KA 5H8WA 1JZSA 1U1DA 3ORHA 1EFRD 1U28A 1V2HE 2C7BA 2GJ4A 3KKMA 4RY8A 3GLIA 1FYDA 3KB1A 3Q0EA 3H5AA 2BHTA 4IJMA 3G2OA 1WMDA 4HAIA 3EASA 1GZSA 2BM9A 5CNMA 3JQQA 3OQVA 4RD3A 4DLRA 4RTOA 1UWLA 1RWOA 2I2WA 1K5PA 1G9XA 2J0VA 2Q1WA 4J6FA 5EPEA 2FUEA 2J6CA 4RY9A 5FDFA 3T1HB 2R5NA 3QELA 5ALPA 5LP6B 2OECA 3PD7A 2IWRA 4IMPA 4B48A 4XCXA 1LPNA 2B1QA 2X2OA 2FH5B 2VYCA 3T52A 3TNYA 2GCNA 3MUEA 2WM3A 5LM3A 4YP6A 1RI3A 3TNFA 4BBZA 3FPFA 1OXBB 2ZSHA 1G41A 2OV6A 1Q1BA 3SHOA 4E15A 2PLNA 1F0YA 1TMOA 2W2XA 1G20E 4I5FA 4BYMA 3EW9A 2K2WA 3IP5A 2YV5A 2QYSA 3QKSB 4OSPA 3H2HA 3U61B 1XRSB 3PK0A 1KO8A 5JDCA 1H2BA 2EJTA 2O8FB 2FSUA 1RHQA 2QX7A 3DVSX 3MT0A 3DAGA 1X8LA 4QRHA 4DKXA 3B1YA 4OJKA 5AM5A 3ZIAA 3N2LA 1OW3B 5TV2A 4XPIA 1A9YA 2F3PA 1M1YE 3ZHZA 5FBLB 1T6YA 3SVTA 4IIUA 3E4DA 2SBTA 1XU4A 1K7SN 1OI3A 2F00A 3TVYA 3KQHA 4DCGA 3QVJA 4X65B 2FKNA 2HGZA 3RQIA 3GJ7A 2BFNA 3C4JA 3EIWA 3GLHA 4GEGA 2OB2A 5LZ8A 4TYNA 1DDGA 2FPKA 4A0FA 3X1DA 4ERXA 3DO5A 4IQ0A 5K01A 1QKKA 3OLVA 3CISA 3GLRA 2GN9A 3DZCA 1WPQA 1XDSA 3ZE2B 4RD1A 4Z0PA 4EHLA 3EULA 1XPOA 3OFKA 2P67A 2HXYA 1AHHA 5ITZA 4U6SA 2EP5A 2HK6A 1V4NA 3JWEA 1I6KA 4J8PA 1BQ4A 4R1MA 4W1QA 3ZDEA 1ZA1A 1VMIA 4D97A 1ZGHA 4GWKA 3FNEA 3BORA 3V7NA 4S05A 1PT5A 2Q2QA 1QYXA 5J40A 1WB5A 3Q8MA 3ESQA 1W48A 3AJ8A 3NW9A 4LQCA 4P4UA 4A5OA 1O03A 1TO6A 3WL4A 1FZQA 3HB4X 3U4CA 4J9UE 1QS0A 4YJ2A 1GWNA 1XFDA 1C3JA 2A86A 2XYGA 1UADA 2FPGA 3PXAA 4UAJA 3OCUA 3CMMA 4K6KA 4CWAA 3DOJA 4ZQBA 3G0BA 4Q7QA 4RANA 1QZTA 2XCOA 3N8IA 2C84A 5KQGA 3K4PA 3G7SA 5EQFA 4DCMA 4HWOA 5DOVA 1G42A 3ZWXA 2E55A 3WVNA 4BNWA 4CQLB 1KJ8A 2QROA 1PZEA 2GPAA 1FQKA 4XDYA 1Q95A 3TYXA 3FI0A 3QM1A 3DF9A 4EO7A 4EHBA 1GU0A 4AB1A 3FYDA 2D59A 1CQIA 2Z0MA 4JQCA 4K26A 4LDRA 4X1YB 2IYNA 3AERA 4DG5A 3KS9A 1RJEA 3D6VA 4R1LA 4RD4A 1F2UB 1IHDA 1XEAA 3LKVA 4MI6A 1GLGA 2JJMA 1E1NA 5D01A 2DH6A 2FUCA 2ZS9A 1FNSA 1RFGE 2GWHA 4HLUA 1NJGA 1NLMA 1SOVA 4G0OA 1KARA 2V7GA 4OBWA 5BNTA 3OOSA 4KN8A 3RTDA 3C5CA 3L7YA 5C8YF 5IF3A 4AY6A 2EX4A 3QYJA 1YDWA 4QELA 2RGNC 1UBRS 2OKGA 2PS3A 4B6OA 4QLOA 5FPKA 3DBHA 5DISB 2H1SA 2J07A 3EVDA 4OBEA 4EF4A 4JVOA 3H42B 1SU4A 3RYCB 4KOAA 2B83A 1XI2A 4HUQA 1GXSB 3WGZA 2OA0A 2ZCJA 1QE3A 1D5WA 2JANA 2PN1A 2V0CA 5KDDA 1EFPA 4KU4A 4D8XA 3QG5A 3C6MA 3HMQA 3VR4A 1A3CA 1X1DA 3ZW7A 3G8YA 1KMIY 3ETGA 3N6VA 3QF4A 4UMFA 4OHWA 3ZVRA 1F60A 2OGUA 1JAYA 1X39A 3SYKA 2VDWA 1VHDA 5EWLA 3PRJA 2R1VB 4R2MA 1O58A 2PSHA 2QYHA 2XT0A 2GBLA 1DQZA 2O48X 1VPTA 1OX5A 3ZCSA 2FW1A 4BLOA 3L92A 4EH1A 1EIWA 2YHUA 2A9JA 4FEAA 5BYJA 2VP3A 3SDBA 1UBLS 2AFRA 3KZVA 3LYUA 4X91A 4TLMB 1U3DA 1T0JB 1K2VN 2ZBUA 3AP2A 2XXAA 2XMRA 4Q7EA 3WR5A 3USCS 1DT5A 1SNYA 4LW8A 1Q3KA 3BPSA 1BXKA 3WMEA 1ONPA 5HZKA 4CEHA 1Y7PA 2X1LA 4R3WA 3N74A 4GM1A 1N1GA 3PFBA 3J81k 2Q28A 4YBRA 1OX6A 4Y6RA 4DLNA 2COEA 5H4GA 4NDZA 3U80A 2VRNA 4Q0MA 2GS9A 3NDJA 1AKUA 5HIKA 4B34A 2GEDA 3K32A 3NM4A 4JKIA 4U1RA 4O3MA 3BM5A 3ASYA 4IRMA 1IWPB 2J3EA 3KOUA 1TYDE 4XGKA 1FA9A 4BNGA 1TVEA 5IJ9B 1G8PA 3VR0A 5B2ZA 3RH0A 2F9MA 5HRUA 3UA3A 4GOKA 1BCRB 2QIPA 2PCJA 2C7GA 3HL0A 2A1UB 4H4EA 1I2AA 4WH0A 1DQYA 2NZXA 2YZKA 2ZUSA 3AFHA 3VNQA 4AMBA 4B1FA 3D3JA 2C5SA 2OC9A 4S1WA 1G8SA 2X41A 1DARA 3KHUA 3LXRA 1LA2A 4X1KA 4DNQA 1NIJA 2VJMA 3V9PA 4F21A 3B20A 3OEEA 4M2LA 5JJCA 1TT5B 2NVBA 4AC9A 5BSEA 2HO5A 2R6R1 3TRIA 4AZ0A 2QBYA 4DIDA 1L5HB 2DY0A 5CPFA 4DV7B 2HMUA 4JOBA 2DAPA 2QTAA 3DDSA 4WKGA 1WXQA 1DC8A 1CWUA 1NRJB 1NW4A 3ISJA 1MENA 1T3GA 1E6UA 1ZLYA 4IUYA 4TYQA 5AXBA 1TAUA 1ODKA 1AQJA 2ADMA 1I01A 1KJQA 2FP4A 2NPOA 5CUQA 5E1BA 3RSHA 2FPWA 3HO1A 5BSFA 4FI3F 2ZXUA 5FTNA 4BMSA 1PT9A 1UCFA 3J81A 4UMDA 5A6SA 3UA4A 2OESA 2K7ZA 3C3WA 3E6AA 2OD9A 4EF6A 1N25A 4KKXB 1W9HA 2CXRA 4ZYXA 5IU6A 1W93A 3TR5A 3KHKA 2K7FA 3PF8A 4IH4A 1C5KA 5F51A 1S2LA 1THTA 3FZQA 3JAWA 3IOEA 4P83A 3WWPA 2B4TO 3AM3A 3LH5A 1OQAA 1UBFA 5P8WA 1RHKA 3OZWA 4GRAA 4PO3X 1MJHA 1XXHA 1ORHA 1VIAA 3YASA 2C0CA 1MOQA 4L07A 2X2EA 4WRRA 3LQ1A 1OA0A 4MLCA 1G2QA 1K7XB 2PJDA 4LVCA 4GRDA 4DQ0A 2L69A 2GK4A 1YA4A 4BFCA 1Z5ZA 1N2GA 4IDNA 1T8RA 3QWAA 4DSAA 4ETIA 1YCDA 4ZK6A 3FSJX 4J1SA 1V3UA 1V96A 4MS4B 4DEXA 4K9LA 4ZVKA 5JPCA 3V34A 3WRXC 5T8KA 3D0OA 2PUFA 3P0FA 1BMDA 4FMPA 4XUCA 4C08A 5H9WA 1G6HA 3N7TA 5H16A 4I4NA 3SFVA 2PD3A 3AG6A 3O26A 3OE5A 1IWOA 5FFMA 3Q2OA 2R7KA 1BMFA 3T5GA 1SPXA 2VC2B 4L8LA 2Q46A 4G81A 1QC5A 4LOKA 1YK0A 1NFRA 1KVQA 1T8TA 2A4MA 2XEXA 3SE0A 5LQCA 1O57A 2GYYA 1MRZA 3JARA 2GARA 1O54A 2W0SA 1NR1A 2YC2C 4H60A 5KTRA 1VL0A 1ZMXA 3AEYA 3WFZA 3R9XB 4RTLA 1V4BA 2YXDA 3D3EA 3ZHBA 2IH2A 3QRWA 4HNUA 3UV3A 4LFCB 3U81A 3ZI0A 3QSYA 1WBDA 1RWXA 1WMSA 4HYTA 1IN5A 1FRQA 2QY6A 3P5BA 4A3SA 4EARA 1F5SA 3GCXA 3VC3A 3X1WA 1M34B 3TLXA 1OIVA 3H7IA 4PNZA 3SNHA 3CLRD 2C0QA 3HVJA 3KKZA 1OHHD 3FHCB 5HF9A 1T5HX 1X7YA 3KZXA 3PA6A 4Z1OA 1OV4A 3RUIA 5FOQA 5EHGA 3BFKA 3AFIA 4L9AA 3PEYA 1WB4A 3OSUA 4DJEC 1ZBDA 2C20A 4YLYA 3BZUA 4A2WA 3D7NA 4ZJZA 5TARA 2IS1A 1YRLA 2Q4TA 5ECYA 1HT1E 2BBOA 4ZZ3A 4XD7D 1AA6A 3KNZA 4KO1S 1VSTA 2XNDA 4ZVTA 1ITZA 5BNWA 5I7WA 3THXA 2AE1A 1QGZA 3HKDA 4BFUA 4N12A 3Q3HA 4YXFA 4BFXA 2ZI3A 3ETHA 2RH5A 1U04A 1AGYA 3BCRA 3L8GA 2HV8A 3IBTA 3QX8A 2HRCA 3GJRA 1Q57A 4RF4A 1KDTA 5AHOA 2DQYA 2JGLA 1IEVA 4JOSA 2CWWA 1E2HA 3NYRA 1USKA 2XHEA 5CNIA 1E96A 1Z7WA 4BO1A 1K8YB 3C4QA 1AM4D 4D46A 3NO4A 3PQCA 2HYIC 2IEDA 1F17A 3AVTA 4L27A 3OFSA 2PZLA 3AESA 3S2SA 4F2HA 2UZIR 1TZCA 5THXA 1LDMA 5CAEB 4DMCA 1Y5RA 2ZUFA