3V9AA

Crystal structure of esterase/lipase from uncultured bacterium
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
296
structure length
293
Chain Sequence
AGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Esterase/Lipase from uncultured bacterium
rcsb
source organism Uncultured bacterium
molecule tags Hydrolase activator
molecule keywords Esterase/lipase
total genus 105
structure length 293
sequence length 296
ec nomenclature
pdb deposition date 2011-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v9aA00
1CUCA 2JEYA 1GPKA 4E46A 3IBTA 4RE5A 1Z68A 3BDVA 4KYVA 3PFCA 5K3DA 4C4ZA 4X00A 6YASA 1XLVA 5C8XA 5CXXA 3I1IA 5AKIA 4ZGBA 4BVKA 4MEBA 2HL6A 1ZD5A 2WLSA 4LXGA 2HHAA 5AI4A 4FNMA 4NVRA 4DIUA 1QLWA 1CUWA 1FJ2A 3D0KA 2WKWA 2HADA 2VT7A 1XQVA 3RARA 2BGRA 1QFSA 1TIBA 2OLEA 5T4BA 1EB9A 4AO8A 3HACA 5EGNA 2ZJ7A 4PSCA 3X3HA 3O0DA 1HPLA 5LYYA 1YA4A 2XDWA 3ZLVA 4RGYA 3G9UA 4CCWA 4KAFA 4CFSA 3R3UA 5ALLA 3WIOA 4X6UA 2ECFA 3TGLA 1ZIXA 1WHTA 3EQ9A 1K8QA 3R3WA 1UWCA 2WJ6A 1G42A 3DOHA 2XB6A 1LPOA 2G5PA 4L9AA 2OGTA 3EQ8A 4BE4A 2XUHA 4J03A 5FOQA 3FCXA 3BL8A 3I2GA 5CT8A 5ALGA 4AZ0A 2Z3WA 4J0KA 3G02A 1BCRA 4JYPA 1JU3A 1UOOA 1ODCA 2BAGA 3WA7A 1MNQA 5K3FA 3G9ZA 5FP0A 4KR0A 4QA9A 5FXMA 4J0HA 2QR5A 4LYEA 2VEOA 4H77A 4MEAA 3AIMA 5EIEA 1LPMA 2XMZA 1T4MA 4EZIA 4HZGA 2ZJFA 5DYWA 5HF8A 4OYLA 2XQFA 1ACLA 1LLFA 2WQZA 2W6CX 3BIWA 5KWIA 4UFPA 4QNNA 2JGLA 2XQJA 3AIKA 3AZPA 2XUFA 4ZRDA 4OYYA 4ZV9A 4AZ3A 4Q3OA 2Z3ZA 3QH4A 4XVCA 4U2BA 5LZ9A 2BUAA 3I2KA 3ZV7A 1XLWA 3WK6A 3C6YA 1ZI6A 5AH0A 4OUKX 4CG2A 4ZI5A 3DL7A 3W2TA 2HA2A 4ZXFA 5CH5A 3IUJA 1CQWA 5ALEA 3ANTA 4FLEA 2G5TA 2Y1KA 1OILA 4AXBA 4H7KA 1SCKA 5LZ8A 3BWXA 4Y2JA 1BRTA 3I28A 5EFZA 4IH4A 1CVLA 3QMWA 4FWBA 5AK4A 4WY5A 1ZOIA 5JAUA 4ZV7A 4B6GA 2B9VA 3QPAA 2HA4A 4Y2XA 3DOIA 2PSDA 3QMMA 4FBMA 3AZQA 5DWDA 2PUHA 3FNBA 4AO7A 2PBLA 2WSLA 4J0JA 4QDOA 2PPLA 4WCVA 3ILSA 2JEZA 5AI0A 3LP5A 5CRIA 1QIKA 1ZGCA 1Q84A 1CUJA 5HF9A 1FFDA 1LBSA 1GT6A 2WFLA 2HFJA 4X97A 3C8HA 5AICA 4WFJA 2DHEA 5ALKA 5AKEA 4QLOA 3HYSA 4Q1VA 1HQDA 2GBFA 2Y2UA 1UFOA 4AN1A 4WDRA 5JAPA 4X3CA 4X94A 2BFNA 3W9UA 3MVEA 5CT4A 3FAKA 3HABA 4J0GA 5ALOA 3W04A 5ALRA 1ODSA 2GBCA 1BU8A 4BYMA 3F97A 1YR2A 4W1PA 4AMZA 4LXIA 2AXEA 1E8NA 4UBOA 3C45A 4Q05A 3V48A 4N8SA 2XE4A 1MAHA 4U2DA 4EUSA 4BRSA 1ZGBA 3R40A 1H2XA 3HXKA 5LZ4A 4OU5A 3F98A 4HRXA 1CUSA 2DHDA 1AZWA 4U2EA 4ETWA 3EBLA 1VKHA 3GZJA 3VDXA 1QOZA 3A2LA 1ZD2P 3CXUA 3WKCA 5BV7A 3NGMA 2Z8XA 5AM1A 5AKXA 1BN7A 5AI9A 1TAHA 3D2CA 1ISPA 4X6XA 5IVHA 1R4ZA 1XRMA 3EF3A 4MWTA 3L1HA 1DWPA 2QM0A 1K5PA 4J0CA 4BB0A 1SC9A 4A23A 4N5HX 4DSZA 1A7UA 2WUGA 2ZYRA 4WY8A 2IX9A 5AKKA 2CEKA 4GXNA 5ALQA 5BWBA 5IKXA 3M81A 3STUA 1JJIA 1J06A 4OPMA 2QZPA 1FFCA 2QXUA 3ANSA 1XZEA 2EDAA 2OCGA 1GXSA 3B12A 1GZ7A 4UHFA 3VJKA 3CN9A 3F8SA 5HK9A 2PUJA 2DCMA 1MNAA 3O4JA 3NUZA 2K2QB 1QIHA 2Q0XA 4FHZA 5CH8A 4WFKA 5LP1A 2WHPB 5AOCA 2RGUA 3AIOA 5ALPA 5ALJA 2XMSA 1PFQA 5JASA 1EH5A 2JGMA 3DYIA 1VJ5A 1U65A 4OB8A 5CXUA 1W6RA 4HAIA 4Y2TA 1XZFA 2HIHA 3FVRA 3DKRA 4KEAA 4D9JA 2XUJA 1WB4A 3DKKA 3HLKA 2QMQA 1AQLA 1CUEA 2WG2A 3STVA 3HRHA 5HF6A 3BJRA 1DX6A 5DYYA 4PNZA 4H7JA 4QLAA 2GYUA 1DWQA 4Q34A 4E14A 5DJ5A 1K6EA 4H7IA 5D7BA 5AM0A 3C6ZA 1QONA 3DNMA 1HL7A 4X85A 2XLCA 2DR0A 2BUBA 4C87A 3IURA 2C5FA 4RE6A 4W1RA 1VOTA 2QJWA 3SX4A 3DYVA 1MN6A 2WTMA 2IIVA 5CT6A 4F0JA 2J4CA 1K63A 3C5WP 3WLAA 4XIIA 1N8SA 2QVBA 5AI8A 5T4HA 5AO9A 2GYVA 4C4YA 1OXMA 2JF0A 4KAJA 3I2IA 1BS9A 3WWCA 2O2IA 4MQLA 3F67A 1C7JA 5KREA 3FVTA 1EVEA 4I19A 3IVMA 5JADA 1JJFA 2PSEA 4KE8A 2QT9A 4BVJA 2JIDA 1DQZA 1QIEA 3I2HA 3QYJA 4J0IA 2WM2A 3WYNA 1UK7A 1AC5A 4L3WA 1JKMA 3QPCA 1IZ8A 3AJAA 4UBKA 1E5TA 4BCCA 4KE7A 3AFIA 2ACKA 1QTIA 4O08A 4DLNA 1PV1A 4QE3A 3HZOA 1XQYA 1D07A 2I78A 2AJLI 2ZYHA 1YB6A 4I3FA 1QO9A 4X6YA 1J2EA 2H1IA 1R3DA 3U0VA 4BZWA 1WB5A 4GDMA 2ORYA 1LPBB 1HLGA 2WG1A 1TQHA 4N8DA 1CUYA 1MX9A 1YCDA 2FJ0A 1XRQA 3D59A 2GZRA 4PQEA 3MUOA 1TKRA 1KU6A 4H18A 2CMFA 5AI5A 3WKEA 5JD5A 2VAXA 2VJAA 1ZI9A 3KXPA 2WJ3A 3C6BA 1G5FA 4L72A 4J3JA 2XUQA 1RP1A 3V1LA 1YS2X 1Y7IA 2J3DA 3PF9A 4KACA 5JYCA 1CUIA 2WIKA 3M82A 3WJ1A 4C6HA 4UHBA 1A8QA 2HA5A 1EK1A 4AN0A 3O9VA 2O2HA 4AQDA 1DINA 5EHZA 2XT0A 3H04A 5C81A 5IVIA 3IIIA 1QIIA 1IUNA 3MGAA 4Y2PA 3BDIA 1H2YA 4S0XA 5KWJA 1G66A 4EB0A 4GECA 4W1SA 3D3NA 4OB6A 3FYTA 1F8UA 3IA2A 4J0DA 1LBTA 3PFBA 1UXOA 4TVKA 4OSEA 1F0PA 1ZICA 2WHQA 5JATA 2EEPA 1ODTC 1VZ2A 3PI6A 1EVQA 5ALFA 5A7GA 3R3YA 2PU5A 4B82A 3KWFA 4DGQA 2W22A 1VXRA 1U4NA 1XZHA 4GW3A 3FSGD 3FWHA 4CG3A 5AM3A 5HFNA 1YA8A 5FRDA 3Q8WA 5FPQA 3BF7A 3FCYA 4EY7A 5H3HA 2PU7A 4BAUA 4DM7A 2RAUA 4UHEA 3D4LA 3UUEA 4AMYA 5FPPA 3N0TA 4UFNA 1EI9A 1XKTA 1SOMA 1XKLA 5I8PA 3QPDA 2V96A 4CI9A 5ISMA 2JGKA 5AIBA 4W9RA 4P92A 1IVYA 1THGA 4U2CA 5HCUA 3WI7A 2VT6A 1E8DA 3H2GA 5AOAA 3KD2A 4UBMA 3AZOA 3FLBA 4A16A 5KBYA 3GELA 5K3CA 5DNWA 1GKKA 1XFDA 1TRHA 1QIMA 1QE3A 1VE6A 4LIPD 2XQGA 5DTIA 4HXGA 3DQZA 2VJCA 2PL5A 1AUOA 1CUZA 1DT3A 5AM4A 2PSJA 4LYDA 1UKCA 2Z5GA 2WUDA 3E0XA 1XZDA 3WWDA 3S2ZA 2R8BA 3HSSA 1W76A 3JWEA 4QWWA 4UBIA 1THTA 1HBJA 3FLEA 3WA6A 4CG1A 1WOMA 4QDXA 5AKGA 3H2JA 2H9YA 1ZJ5A 3PUIA 3I6MA 4K6GA 4MXDA 1MAAA 3SC2A 2DSNA 2BGNA 2WG0A 4CIBA 2BCEA 1TCAA 3STTA 2XMDA 4ZWNA 4F21A 3R3ZA 1JI3A 3WK9A 5AJHA 2RI6A 1XRLA 1LPSA 5LZ7A 5ALVA 4BRZA 4DSAA 3MUNA 1SCQA 4YK7A 4DNPA 3A70A 2C7BA 5LKRA 3D2AA 3DS8A 2JGJA 2C5GA 4BCBA 2X76A 4BTVA 3WK4A 2WJ4A 5ALWA 3A2MA 4UHCA 4FMPA 4H0CA 2ZYSA 3OPMA 3KOOA 4HS9A 3SWWA 4FTWA 3WL5A 5JAHA 2PX6A 3VXKA 5ESRA 4G9GA 4EA6A 3CN7A 4W1QA 1U8EA 2DFPA 5CTAA 1B6GA 1JJBA 1X2BA 3QM1A 1QZ3A 2WIDA 4BBZA 4YPVA 1ZIYA 3O4GA 3QMVA 1KU0A 2Y6VA 5JD6A 3VISA 1L7QA 5CT5A 4G4IA 4PF1A 1XZLA 4FFWA 1UK6A 1WPRA 1MX1A 5SYNA 1L7RA 5ALMA 4G9EA 4ARAA 5A62A 1X2EA 2QKYA 3RLIA 3G0DA 4GWLA 1QFMA 1IUPA 4E15A 3KDAA 2HU7A 2GBGA 1MT3A 4DNOA 5HZGA 4BDTA 1O6GA 1USWA 3V1KA 1RWQA 4AO6A 4CCYA 2XQKA 1X70A 4C89A 2ZSHA 1B41A 3PUHA 4KRYA 4UBNA 3QVMA 1E3QA 1J1IA 1GQRA 1P0PA 1FSSA 4F5ZA 4KAAA 3D2BA 3PDCA 3GUUA 4QDTA 1XZAA 4A5SA 5ALIA 4G5XA 4RPCA 3W05A 1TK3A 5F4ZA 2XI4A 4X91A 2OQVA 3M83A 1WHSA 4KE9A 4BC1A 3G0CA 2HDWA 4UUQA 5AK3A 2X8BA 1DU4A 3LIIA 4ZREA 4G4GA 5HF5A 2E3JA 2OAGA 2AJ8A 1J07A 3R0VA 5DNUA 2D5LA 3JW8A 4UPDA 2XLBA 3OM8A 3IB3A 3O95A 5A71A 1W52X 3WKBA 4GBGA 4OU4A 5ALNA 5EHQA 3DEAA 5AOBA 1UK8A 1A8UA 4QDZA 2OGSA 3FBWA 4LHEA 4JYMA 4OD0A 1Q83A 3H2HA 2VQ6A 2VJBA 1XZIA 4BZZA 5AM5A 3K2IA 5I9IA 2I03A 1BE0A 3QZUA 3ZLUA 5LZ5A 1UOPA 4UFOA 1DQYA 1MO2A 1XZMA 1CQZA 5ALDA 4M0EA 1XZCA 4DNQA 5JIBA 4FLMA 3C70A 1FFBA 1WM1A 1Q0ZA 1CPYA 4J7AA 5C8ZA 3G8YA 3STWA 1WCYA 3BF8A 1F0NA 2H7CA 5C7YA 7YASA 2I3DA 1AMNA 4Y7DA 1EHYA 2WFMA 3R3VA 3K9BA 1GPLA 3H2IA 2XQIA 2VSQA 2HU8A 3STXA 5BOVA 4HXEB 4IH9A 3PE6A 1HDEA 3E4DA 3C8DA 2VAVA 3L1IA 5T4FA 3ED1A 1XRPA 3RKSA 5K3FB 5E4YA 3G0BA 5CURA 2PSHA 1C4XA 4FBLA 3P2MA 3ZLTA 1XRNA 1VE7A 3WK8A 2YH2A 1WB6A 2XUGA 1ORVA 2QJRA 1QJ4A 5AKHA 3H1BA 4UBLA 1UKAA 4QZVA 1VLQA 4X7BA 2VA9A 2HM7A 3BIXA 5LIPA 2RHWA 2WHRA 4B81A 4BTLA 2J4FA 3QBJA 1RYYA 3BXPA 2WIFA 4EY6A 1EXWA 5J3JA 1N5RA 1AX9A 5IVDA 5D6OA 4MWSA 1IMJA 3OOSA 5EHXA 4AX4A 1XZJA 3WMRA 3WYDA 4X90A 1BROA 2AJBA 2QS9A 4HXFB 2PSFA 3R41A 2OCLA 5BWCA 1TCBA 1QIFA 1P0IA 4FOLA 5LLSA 4N8EA 4GLBA 3O9MA 3AINA 3FOBA 2WFZA 2H7XA 4K2AA 1NX9A 1CUDA 3Q0TA 4B80A 5AP9A 1DX4A 1CEXA 1QIJA 1YAJA 3H17A 1BCSA 2VF2A 1XZKA 4JNCA 3TEJA 4EY4A 3WK5A 1QO7A 5ALSA 1IUOA 2CB9A 5K5EA 2WIGA 1QIDA 5JZBA 3ICWA 1LPAB 1TCCA 1XLUA 2ONCA 2OAEA 3M3DA 2J3QA 4B9EA 2QRUA 2XUKA 3C87A 4B9AA 4DMFA 4Q3KA 4TPKA 4Y2SA 2IITA 4DTCA 4BAZA 2QUAA 1CRLA 4GI1A 2ZVDA 4CIAA 1H22A 2V97A 1AURA 4FFVA 1ZD3A 1L7AA 2HA7A 4B83A 4ROTA 5ALTA 3WWEA 4X92A 1P0MA 3F9CA 2PKYX 5ALUA 1ZJ4A 1JFRA 3SK0A 3T52A 2XUIA 5E4JA 2WU4A 5YASA 5FKJA 2WILA 4H35A 1QIGA 4DNFA 3O4IA 4K6KA 1YASA 5HFAA 2OG1A 3G9XA 1XZGA 4Y2UA 4C01A 2XMBA 1Q0RA 1T2NA 4E11A 1MTZA 5JZSA 2C58A 1Y7HA 4B0OA 3ESCA 2ROQA 5FV4A 5DTJA 4EHBA 1LPNA 2JGIA 4XWGA 2CUTA 1U2EA 2VTVA 3YASA 3DLTA 2WFLB 4HVTA 2UZ0A 3H0CA 2XUPA 5D3ZA 1E89A 5DNVA 1CUXA 2AJDA 3L1JA 1HKHA 1IZ7A 1EDEA 4PO3X 3LS2A 4BC0A 4W63A 2OPHA 3PICA 5HQ3B 3W06A 2BKLA 5JANA 2CJPA 2ZSIA 2YYSA 3FYUA 2VJDA 4L0CA 2RHTA 3B3QA 2CZQA 4WFIA 5AM2A 3VVLA 1ETHA 2G63A 3D7RA 3NOXA 4RNCA 1QGED 4WDQA 3NWOA 4P08A 4EY8A 5JAOA 4BVLA 2XMQA 2AJCA 2HU5A 3VJLA 1JMKC 1LZLA 4X93A 1NU6A 3I6YA 2EDCA 4BDSA 1OCEA 4MJ3A 3HEAA 3WWPA 1H23A 2HA6A 4IQ4A 3WKAA 4BE9A 2Y2VA 4PW0A 1W75A 4H7DA 5DLPA 4FKBA 2C0QA 2HRQA 4OB7A 1A88A 1R88A 1UT6A 4G4JA 5CBKA 4WJLA 2FX5A 2RONA 5AKZA 2PVSA 3HJUA 3JYHA 4GEGA 3C6XA 1QTRA 3BE8A 4B0PA 3WWOA 4UHHA 5FUMA 2YASA 4TGLA 1CR6A 3H19A 4KRXA 2FJPA 2FUKA 3E3AA 1CFJA 5AK6A 3IUMA 1VA5A 3IDAA 2BUCA 4P93A 1MX5A 1UK9A 1SCIA 4BATA 4M0FA 3DJYA 3GBSA 5AI6A 3LLCA 1VZ3A 1AGYA 2CKMA 1JT2A 2ES4A 2JBWA 3I6ZA 4MYSA 3FSGA 2QOEA 3FLAA 1XROA 2WIJA 3WZLA 1I6WA 3D5EA 1EA5A 5FDFA 4MYDA 1EINA 4YASA 1BEZA 3GROA 4JUIA 3RK4A 2DQZA 5HQ3A 1CUAA 1NU8A 1VA4A 2CBGA 2QUBA 1LZKA 3HI4A 1CUHA 1F6WA 1XZBA 1P0QA 3DD5A 3WIBA 4G1FA 1G4HA 3GA7A 1MU0A 2OGZA 1N5MA 5FLKA 1E8MA 3V1MA 3H1AA 4G8DA 1CIJA 3A2NA 3G7NA 3V1NA 1MJ5A 1R9MA 3I2JA 4YX9A 2O7RA 3STYA 1AKNA 1KEZA 2Y6UA 3B5EA 1FFEA 4NS4A 4H7HA 2ZJ6A 4F60A 1PJAA 2OXEA 2XUDA 3E1GA 2C0PA 3KWJA 4DMKA 3ZWQA 3FYUB 4M0MA 3S8YA 4H7FA 3ZPXA 1EX9A 4Y2YA 3VVMA 1BEEA 3GFFA 4GHWA 5CH3A 3DCNA 2Z8ZA 1CUBA 1GKLA 4C4XA 2B61A 1R50A 4G8BA 1GGVA 4LXHA 2HFKA 3QITA 2XUAA 5ALZA 5A7FA 2GZSA 4IHAA 1W4LA 4BCDA 4Y2QA 5JD4A 4LKOA 1LPPA 4BAGA 5HKAA 5DYTA 2WHPA 4P9NA 3EQ7A 1A8SA 1YS1X 1GQSA 4QDUA 5E4TA 3KSRA 3IULA 2HRRA 4FNGA 3WQHA 4FLFA 2R11A 2ACEA 5ALYA 4QEKA 1DT5A 1UZAA 4BP8A 4N5IX 5C8VA 4IH1A 3H2KA 3LIPA 1XQWA 4INZA 4JH0A 3VJMA 2V9ZA 4DMHA 4C88A 3WL7A 5K3AA 3ESDA 5ALXA 2VATA 3C5VA 5EIAA 2H7YA 1Y37A 3IUNA 4Y2RA 3TJMA 1SFRA 2ZYIA 1S8OA 3W9BA 3UUFA 5ALHA 5AKLA 4CCYB 5HK8A 3BJMA 2WUEA 5I7UA 3C43A 2JGFA 5AKJA 5K3BA 5A7HA 2C4HA 1R9NA 1EDDA 2GYWA 2V98A 3LCRA 4EBBA 5SYMA 2HA3A 3N2ZB 1CV2A 4EY5A 2WUFA 3IUQA 5A2GA 5T4EA 4UBJA 4Y9SA 3U1TA 5JALA 4H7EA 3I1YA 3EIOA 4IO0A 5LKAA 5CT9A 2XMRA 1GPNA 1EB8A 1VXOA 1CUGA 4U2FA 4JEIA 1ZD4A 5CW2A 3PF8A 4BP9A 3AILA 1H2WA 3K6KA 1XQXA 1EDBA 2QTBA 4PSUA 3VKFA 3F96A 4Z49A 5JZ9A 3WJ2A 5EIHA 2NW6A 3T4UA 2I3ZA 5AHXA 5K3EA 1YB7A 1DWOA 3HC7A 2XMCA 4KE6A 1ACJA 2OCKA 3G9TA 5AKYA 4B7ZA 1EK2A 2WU3A 1WPXA 2HA0A 4XX1A 5CMLA 3OG9A 4NZZA 3G0IA 1BN6A 3WL6A 3TRDA 4OCZA 3R3XA 2OCIA 4PSDA 3O4HA 2B4KA 1XRRA 2DHCA 5AK5A 1N1MA 2GBIA 4ARBA 4QWMA 3I2FA 3WL8A 1E66A 5E2IA 3RM3A 1CUUA 1LGYA 3ESAA 3OURA 2B20A 4DYHA 4X71A 3V9AA 2O2GA 1DTEA 1LNSA 1ZI8A 3H18A 4KJXA 4B84A 3DDUA 4DMCA 1YAHA 4Y2VA 5HKBA 1JU4A 2YXPX 4PV7A 3FYUC 2OQIA 3DL4A 2X5XA 3OTQA 4MQMA 1UOQA 4B85A 2P8SA 3ZI7A 1W1IA 1O6FA 2QXTA 3UMJA 1M33A 3CCBA 5JARA 1ORWA 5EHNA 1H2ZA 1JMYA 3ICVA 4FDMA 4Q3LA 4V2IA 4HRYA 1FFAA 1UKBA 4K6HA 5A6VA 2LIPA 4NMWA 4I4CA 1YSCA 2JGEA 1CUFA 1K4YA 1CUVA 5AIAA 4ITVA 4HTAA 2RIPA 5EI5A 2D0DA 4G8CA 2WTNA 5D3KA 4K5QA 4X95A 3OC0A 4Q82A 2O7VA 3WK7A 2BJHA 5IVKA 5IH7A 4UHDA 4AB1A 4XJVA 1MPXA 2XUOA 3WZMA 3CCCA 5LZ2A 1R1DA 3G0GA 1C7IA 3A6ZA 2PM8A 3AUKA 3WKDA 1CLEA 2DQYA 3ESBA 2XMGA 4U2GA 2G4LA
chains in the Genus database with same CATH superfamily
3NTQA 2JEYA 4HB3A 4KGXA 4EABA 4B87A 5K3OA 3VH1A 3AB3A 1Z68A 4F2WA 4GAEA 4KYVA 3FVQA 5K3DA 5BQPA 2BI8A 1V3TA 4X00A 4J3NA 5DNAA 4C03A 1XLVA 4AULA 4YXWD 3ACDA 1PR0A 4M0DA 1U9CA 3KLPX 3I1IA 4QICA 3C7KA 5FOUA 1V3UA 3PCTA 4M88A 1FNBA 1UUFA 1GJRA 1SB8A 3GGGA 2HL6A 4G0NA 1I4WA 2GWHA 2P1ZA 2W2XA 1KZ6A 2QLJA 4UAJA 2Y76A 1XMJA 4MULA 1NVMB 1TA9A 2IF0A 2HHAA 2ZIZA 4QBHA 2KYRA 1P4GA 5JNLA 4IUCS 3AJEA 4PONA 3JQ8B 3OU2A 1Z3IX 5EPUA 3AM1A 4OKSA 3W3AH 1JILA 1OUMA 2J59A 4FILA 1XP5A 2CLDX 1KP2A 3U6BA 1NUHA 1BWSA 2HJSA 2ZWVA 2HADA 1XQVA 3ETGA 1H85A 4G1UC 4WXMA 3L7KA 3MJHA 3PUVA 2QYOA 2R00A 4ZCTA 3U81A 1Y8RB 3T7EA 4YDQA 4Q6WA 3IBFA 1KYTA 1MB2A 4AO8A 5FNVA 3UC9A 3WGOA 4QBTA 3DH0A 3E61A 3HY4A 2R7AA 2XB8A 4J4HA 2QVCA 2XWQA 1EWQA 3X3HA 1WR8A 1HPLA 1SKAA 1UBLS 1JAXA 4H6WA 1ECJA 4O2AA 1I6KA 4M36A 5D7NA 4ZQBA 2XDWA 3HRIA 3UAGA 5KOHB 1Q11A 4HRAA 1IY9A 1DAHA 1HK7A 3WO1A 2HMUA 4MKIA 4DSTA 4NBTA 1HLDA 1RZ3A 4X5OA 3FB4A 5FEUA 2WFAA 1C9NA 2KLBA 4LJ7A 4EA9A 1XQ6A 1NXXA 2O05A 1M6WA 4FSHA 1S2OA 3IKMB 4IIUA 3R3UA 4Y2VA 2W2VA 5ALLA 2C4NA 4X6UA 5A5EA 5FX2A 4ZZIA 1ZIXA 1JL3A 1WHTA 1DTWA 1L2TA 1J0EA 3GRCA 3MOSA 5LQNA 2OP1A 1K8QA 1R4NA 3CB4A 2XEXA 2MR5A 4XX0B 3F7TA 4D0NA 2MSEB 1PEAA 3IPCA 4UOQA 1R0ZA 1Q7GA 3QE3A 4AFNA 2SKDA 4HYYA 5FAXA 2H48A 4YJHA 2JLZA 3L7DA 4DRZA 2P0YA 4M1TA 4B74A 1HWYA 1EP1B 1S89A 1E1RA 2QVLA 2NACA 2ZLBA 3EDCA 5FORA 3SYTA 1ZCZA 2FZGA 1OBHA 1D09A 1MG5A 3K05A 3E5MA 1T6BY 5ALGA 4AZ0A 3U6KA 3G13A 4KXFB 2BFAA 2WOOA 1VL2A 4QJIA 1RI4A 1EXVA 4JYPA 3PWTA 2K7FA 2R1TB 1GKYA 1IYZA 3C3MA 1EFRA 5EJFA 2N75A 1PNVA 2F4NA 4K0RA 2ZTHA 4QD3A 2QPLA 2XCRB 1PFYA 1L5QA 1ZGGA 4KR0A 4HOYA 5FP0A 4QA9A 5BQFA 3LC2O 2GN0A 1PR5A 1RWMA 2HWYA 2PANA 4TXNA 1GU7A 4X7RA 3IS3A 2VEOA 4B47A 3RC3A 2QPTA 4RK4A 1SXGA 2V7BA 2XMZA 3BA6A 3QXGA 1JHOA 3BKXA 2I76A 4KQIA 2UYYA 3VYTB 4BQNA 2VJMB 3JQBC 1OQAA 1Z5ZA 1UCFA 3GDHA 3W9SA 3O8DA 4EGAA 2VYCA 2L0XA 2PLNA 4KKXB 1Z29A 4X3OA 5FJIA 2NO6A 2NWQA 3N5KA 2FRXA 2XQFA 3PNSA 4DVGA 4KYUA 5CB4B 1PL8A 1ZINA 1DJPA 2JBAA 4TX1A 1M5UA 4EUFA 3K71B 2AKYA 2ZBUA 5LMUB 1MIOB 3U4AA 4QNNA 2F43A 1EM6A 1HZJA 1SUWA 3KV1A 4US2R 1C3XA 2RHHA 8MHTA 5TQ0A 4ACAA 4PTYA 4DDVA 2GPWA 2C98A 3AWDA 3L46A 5L3RA 4ZRDA 4JR0A 1ATZA 4ZJUA 2YXDA 2QHXA 2YV1A 1FJHA 2OC9A 4PHGA 1UKYA 5LPNA 3IAS1 4BVAA 3HJHA 3NHBA 1RR6A 4IQGA 3L0PA 4U6QA 4XVCA 4FGZA 3TW8B 1XVTA 3CF4A 4GR9A 4X1OA 2BFMA 2BUAA 2QRHA 3UWPA 5AW1A 5ARCA 5HJEA 2QGNA 4Z53A 2DJ5A 4CF6A 4UAUA 3D6TB 1YKSA 1JWAB 2CHVA 5B55A 2YUIA 4JSYA 4GOKA 2H17A 3BTUA 3SKYA 4BY9E 2J7KA 2C8VA 3QUTA 1PK9A 2AKAB 5AH0A 1JHDA 1UADA 5BUCA 2NP7A 1BQ4A 3GLFA 4MV0A 4WZBB 2GF2A 2UZ1A 4P4UA 4HTFB 3AKEA 5ESXA 1TMYA 2H63A 4FP9A 1I8TA 4IIGA 4ZI5A 2X2FA 3KLBA 1SIUA 4NBLA 1N4DA 2ZS9A 1T1GA 1WBJB 3BQMB 3R5FA 2PUTA 1ZH2A 3MCVA 3IUJA 4BMOB 3ZBPA 2ECKA 3ZKWA 2IZ1A 4Q1BA 2XTZA 4DV2B 1SBHA 2IU4A 1ESEA 4HH4A 1CK4A 2I6SA 4Z4FA 3ETLA 3FJ1A 4WGFA 721PA 1C7RA 1Y4SA 2AYYA 1XXHE 5EY5B 2R87A 2J31A 3L7AA 4KO2S 4P7FA 4BMDA 3NPMA 2G5TA 4FI3F 1YDMA 3NVKI 1BFUA 2P67A 1OILA 2XB9A 3NEAA 1S3IA 1KMNA 1V16A 3OTHA 8ATCA 2PZFA 3ECAA 3F5MA 5K0LA 2LWIA 4FHDA 2QGZA 3QWHA 4QU0A 4TMXA 4POOA 1TQ2A 2AN4A 3FSRA 1BRTA 1EKXA 1QO0D 2IP2A 2IF2A 3TXYA 4DLSA 3OPXA 1WXWA 4NYMQ 4POAA 2Q4TA 2PLWA 5AK4A 1UMCB 1YFZA 1N2IA 3LRPA 4JI1B 1WW2A 3K1AA 5SICE 2UXCB 2GM4A 2GOYA 2NO5A 8LDHA 4B3MB 4FSDA 1NQOA 3A25A 4L5AA 1ZOIA 2WMYA 1V4BA 4PX5A 1VBNA 3HA2A 3N6RA 1J00A 4DSUA 4EJSB 1BMDA 2QRNA 4FBMA 4XQEA 3ZDXB 5F9MA 5FL3A 4KDFA 2R2AA 1UPXA 1P1IA 3W6UA 3HO1A 3UWDA 3TCKA 2NUAB 2WSLA 4KXYA 2FZ5A 4MITA 1W44A 3JWIA 2VSYA 4Q9AA 4WCVA 3LLUA 2JEZA 2YHIA 4A2PA 3IFSA 5A3VA 3REQB 3GJQA 1N34B 1KVRA 2EQ5A 5FEMA 3VR1A 2YS6A 4FC6A 1VMIA 3O2JA 3I0ZA 4J1QA 4GPTA 2AYZA 2OBFA 2WU8A 3AR9A 4KQ2A 3NWBA 4HC4A 4MI3A 4PHHA 5GZ6A 4A1FA 1MOZA 1IJEA 3M6UA 3G68A 5JV5A 2NG1A 1FFDA 1TAUA 3I4LA 4DIKA 5F4BA 2EC5A 2GPAA 3TMYA 1XKXA 5LDHA 2WFLA 3VZSA 2HCJB 1EVJA 1APBA 4OO3A 1YDEA 4D4LA 2PX2A 5IC5A 2VSOA 1JJVA 5IZ4A 1LNQA 5AICA 1A2QA 3A9RA 3HR8A 4GWGA 1JA1A 4LJ6A 2DHEA 4DJ5X 6GPBA 2O2YA 5IT5A 1Y63A 1A2KC 4Q1VA 2H8GA 1HQDA 2VI5A 1Q0LA 3O3MB 5EUMA 4BNZA 4W99A 1WTCA 2GCNA 2CVFA 3GO4A 1C3EA 1PDOA 3TRJA 1VPVA 2FSGA 3TXXA 4YUYA 5J5AA 4BNJA 2BFNA 5TT0A 2OYRA 2E48A 3W9UA 4L5JA 3B2NA 4U7WA 2P4UA 4AUKA 4DCVA 4DUPA 2ZAGA 1ZC3A 4BVGA 1HEYA 2NUTA 2QG6A 3EMKA 2R8ZA 1OYYA 1MXHA 4I8IA 4M7RA 4J0GA 5KYXA 4WOPA 3ZWDA 2JLVA 3ZXSA 1TQ8A 4CM9A 4C6TA 2ZYAA 4KLZA 5ALRA 4B32A 1Y1RA 3H1FA 3IBYA 3GV0A 1TZBA 3QLVC 1GFSA 4DM7A 1DTSA 1GV1A 1YR2A 2A14A 3F97A 4W1PA 4AYXA 4PG6A 5B2ZA 1GTSA 2J3KA 1NQXA 1RC8A 1E8NA 3DAFA 2V6GA 3DPUA 3CVVA 2WSBA 2PKCA 1Z47A 2E4AA 4ZAFA 3ZE8A 3W5BA 5E6UB 4Z0NA 4TQ9A 2WJGA 3Q40A 1A1VA 4RKRA 4BLSA 2XADA 4G5YA 3W5CA 1P9LA 4G65A 4QELA 4LE2A 3TWOA 4U2DA 4EUSA 2G0TA 2I2AA 2RH5A 2PL9A 2VHTA 3BGVA 3OLWA 4NC9A 5REQA 5JPDA 1PJLA 3GJZA 3H65A 1RW4A 3PQ3A 3EGOA 4BTEA 3UJBA 4HUQA 2PL1A 4UEQA 4YT4A 3RTAA 4GXTA 5F2OA 1G8GA 2UU9B 3UMYA 3OTIA 3MD0A 1WWKA 4Y1EA 5H9VA 3HXKA 5K05A 3E2MA 2VC2B 3MBIA 2C9YA 4MK4A 2ZYUX 4TTJA 4FGSA 5B1IA 4EBFA 2EFYA 1O94C 5DXAA 2ZE6A 4AJ9A 2DP4E 4FFMA 4HDNA 3KB8A 4RVGA 1YV9A 2Q4DA 3DTNA 5DX1A 3UMBA 4G0XA 1COZA 2AG8A 4IG9A 4DBVO 2XCTB 3DLHA 1X6VA 2HWWA 2ZTSA 1DBWA 3EBLA 3PK0A 4TUYB 4U8GA 5EINA 4BNGA 3RC8A 2P3OA 3A2LA 5IJ9A 1N2GA 3QUQA 5COQA 1XMOB 2REBA 3KB1A 3NGMA 3QWAA 3WKCA 4DXDA 1YU6A 5AKXA 5JROA 2B5OA 2Y3IA 1M2VA 3Q6NA 3IB6A 5HZMA 2VUIB 1QMPA 3B60A 3GVCA 1TYZA 3BCUA 4FM9A 3D2CA 3R74A 3NUQA 1T35A 4KFUA 5IVHA 1W1UA 5TVGA 4DNXA 4RM3A 5ESWA 1ZCFA 2RHLA 4KWTA 4M60A 1MJFA 4ZI7B 3L1HA 1Z2PX 2ZRNA 2TMDA 1VB5A 1SVIA 2ZIWB 1Q6YA 1RKQA 4RLHA 4BQIA 3HCFA 4NX2A 3HCCA 4LHVA 4BB0A 2VHXA 4RTPA 1HI9A 3RTGA 3COWA 1DBQA 221PA 2PKQP 1SZCA 2I2WA 3D6VA 2HJGA 3EXFB 3MJEA 4TROA 3ZD8A 4KP7A 2YJTD 2FLWA 3EVEA 3R7NA 3VFDA 3QHAA 2FWJA 2P9EA 1ZONA 2ADMA 3WRYC 3STUA 3D8BA 3U1VA 2E5FA 4GPD1 4NXMB 3IEXA 3CRVA 4OPMA 3R9XA 2QZPA 3ORQA 1H3NA 1JBEA 1TZ2A 1Z2CA 4WXPA 2R8XA 3AQIA 2VJYA 2XGOA 3TM5A 2HYIC 2JGDB 2ILTA 4FUQA 1ZRMA 3CKKA 3E9EA 5ED4A 1GZ7A 2IDJA 4Y8VA 4D02A 1TT5A 1WZNA 5A0TA 1LVHA 4YT5A 4YS6A 4BO3A 2VQEB 3F8SA 3DPIA 3N53A 4HJRA 4J75A 1GTMA 3FDIA 3C3CA 1E6KA 2GCOB 2PX0A 3K92A 1GKUB 3LU1A 4I55B 1XEXA 1ZU4A 3O4JA 4PCUA 5MGNA 4LRWA 1MIOA 3I8SA 4M99A 2FUG6 2V9PA 1NYRA 3M4YA 1AIPA 2K2QB 1EFVA 1MB3A 4FGJA 4HVAA 1OTHA 2C57A 2Q0XA 4CEJB 3WWZA 1RHMA 4INPA 3U7FB 1G3UA 2UVPB 2GS9A 3HA7A 4JCCA 1W7AA 3N05A 3WLFA 3RUEA 3FOWA 2MYPA 2E2WA 3RJTA 1X7YB 2P3SA 5B2EA 2FY8A 1ST3A 1QHIA 1U8AA 4FXPA 4MR8B 3WRVA 1UZNA 3LY5A 4KMSA 4BE7B 3AIOA 4DM3A 5ALPA 3PQ2A 3U3KA 4HL6A 2AG0A 4CETA 3K0FB 1XIVA 2XMSA 1SIWA 1WZCA 2V3CC 1R10A 3AERA 2JGMA 3DYIA 4Q3CA 3R75A 2ZB8A 2O8CB 2WU1A 1I01A 3DTYA 3FTDA 4RHEA 3K0AA 2BRUA 2BL4A 4YVFA 4BX8A 2R1TA 3LUKA 3IMFA 4H2DA 4NFSA 3X1YA 2H3EA 4J2TA 4LVUA 4R2MA 2R84A 5J2TA 1OLOA 5CXUA 2GCGA 3EQ2A 2ZG6A 1UC5B 4DMLA 1AO3A 2ZW9A 1QF6A 3DKRA 4OK3A 4KEAA 2JIRA 2ZRGA 2IKQA 3EWSA 3HU1A 3HLKA 2YJGA 4OKNA 1UXKA 4IRXA 2QMQA 1TM1E 2D62A 5BSFA 4ZOBA 1ZL2A 2ZUUA 3STVA 3EZ9A 3HRHA 3S4YA 4N7MA 3F1KA 1ULSA 1QZXA 3C3AA 4A8JA 4NJEA 1G20E 1SB9A 1SUPA 2PWBA 5ITVA 1SULA 3SIXA 3QF7A 4H7JA 5KQRA 1NA5A 4NMMA 1N92A 1Q7CA 5C4IA 2PLAA 3DDWA 2JFHA 3A6KA 3F8TA 4HWOA 1CF2O 3ILVA 5K6AA 1W88A 4Q34A 1GPH1 1IJBA 1E1MA 5EZYA 3IEVA 2NXCA 5DJ5A 1RIIA 1Y1KE 5E7MA 5KJ1A 4LF5B 1LV7A 5D7BA 4YDRA 4I2VA 5AM0A 4DM4A 2VWHA 2G09A 1FYEA 1QONA 2P2YA 3DNMA 5F23A 4C7OA 4F71A 4B6JA 3A36A 3JZMA 3RYIB 1GPJA 3ORYA 4UNRA 2DWCA 3Q41A 2V5AA 3TZHA 3ENWA 2XLCA 4CN8A 1PAUA 3BZUA 4C87A 1DAMA 1LRKA 3L41A 2I6GA 2PFGA 1Q3TA 1TZJA 1JEEA 4II2A 5FA8A 5K2OA 2GBLA 1ADCA 3FMFA 1SCJA 3QUSA 3LQ1A 3SDBA 1G6OA 3GUYA 3CV3A 2DFVA 1P1KA 1U0FA 5E8RA 5EAIA 2WTMA 3HV0A 4QTZA 2P3LA 3IRUA 3C4JA 5I45A 3ZCTA 2JJ1A 4F0JA 4W5QA 1Z4MA 5CFPA 5EIWA 4EAAA 1ULHA 2I3GA 3DLPX 5JVDF 4PIPA 5DEOA 3WLAA 2BV3A 4XWYA 4ZDKA 1QBKC 3VNQA 1TMOA 4ZZ2A 4XR9A 4V1CI 2YY6A 5GM2A 2W2TA 2GPSA 1TQDA 3BXFA 4HGOA 3OTOB 1NV9A 2YFHA 5CNKA 4BZQA 3CNBA 2HJHA 3PGMA 4C4YA 3K5WA 4DQ0A 2A33A 4ZPJA 2YHSA 3A6DA 1M34A 2GHRA 1GPAA 1U7OA 3RUIA 5LOVA 1QP4A 4NCBA 2NVWA 1JXQA 3M8KA 4BWYA 3FUTA 4YI3A 5IW8A 5LOVF 3FPSA 1C3LA 1H69A 2YJ4A 5JCJD 3ZY4A 1AK9A 2OZKA 2R44A 3O38A 4CIDA 4E13A 3OFND 3PLNA 4MQLA 2EBHX 1SUIA 2WNHA 3ZHBA 1ZLXA 5KJCA 1IM5A 2X9GA 3F67A 1W88B 4GBMA 1TYEB 3EGDB 4LMBA 5DT2A 2IWRA 1VHLA 1Y9DA 2WKPA 3KPJA 4RBNA 3TECE 4UM5A 1FZQA 4RIIA 1EVEA 2KMLA 3PDIB 4EIWA 3EYAA 5FQOA 3BFPA 4R2LA 2R86A 4K1LA 1JV2B 2FE1A 3IVMA 5EQDA 3P9QA 4RD0A 1YDGA 2DF8A 1MMFB 3C8UA 4KE8A 1SNYA 3IXLA 3VOBA 3IEPA 3IKVA 4C7MA 1FQWA 3NBZC 2CN1A 1DQZA 4IEEA 1QIEA 4BNTA 3UH0A 1D6NA 4C20A 4ESHA 3F5SA 2PFSA 3IT0A 2O3UA 2J41A 4QFDA 1ZNYA 4PAOA 4J0IA 4RS4A 3LYHA 4XUCA 2HMWA 1NN1A 2WM2A 4GXRA 2P6RA 3T35A 2JB9A 3TJZA 3KAJA 1UK7A 3NEYA 3WYNA 4EEZA 1I7LA 1QH9A 3QNMA 3EVFA 1HNNA 2J3HA 4TLLB 3PUXA 4JB2A 2ACKA 4YJ3B 2PIAA 3V42A 4GZ6A 4OLFA 3PQFA 3W6NA 2BR3A 1QH0A 4LPKA 5IF9A 3R09A 5F7XA 3N2YA 4MDEA 1UBJS 3IIMA 1WAMA 2I66A 2B37A 2BJVA 3OZEA 4F6LA 4ML3A 3CJTA 5M29A 1K75A 1NVVQ 1WTAA 1G5RA 2IGBA 3BSYA 3ZI4A 4U02A 1YB6A 3W3ZB 4G24A 1QO9A 2EFDB 2Q99A 1L3CA 3VPBA 4W6QA 2FR8C 4BZWA 2EU8A 1CVIA 3U0VA 1VYTA 4AVYA 4B3CA 1WB5A 4GDMA 3TDNA 1QK4A 1KYWA 4J0FA 1QBGA 4A92A 1EUYA 1HLGA 1S02A 3ETHA 9GPBA 2ZI4A 2WG1A 4RHTA 4HNVA 3TQFA 1TQHA 5AVSA 4RH0A 1U0GA 2GBPA 3KQHA 1R12A 3K9LA 4QGSA 1D2HA 3OX2A 2IYNA 8ABPA 1EUCB 3BILA 4HYQA 5B7QA 2CSXA 1DEKA 2J0UB 1L6RA 1G41A 4ZCQA 4KZPA 4URVR 3MUOA 2J6BA 4NFHA 2IE8A 3BK2A 4H18A 1BX0A 4A7PA 3M0EA 4A8TA 1IBLB 4KIJA 1WY7A 2VAXA 5A9SB 1J70A 3H6GA 1ZI9A 4OHYA 4GH5A 3KXPA 3GCWA 4YXFA 1QRTA 4CLXA 2PYIA 3ZXUB 1Q1BA 4KGVA 4MJ7A 2IUFA 4MEJA 4Z7QB 2O7QA 5AVXA 4AS2A 1BIFA 2FMHA 1KI1A 3NETA 1RP1A 4LBWA 5REQB 2BYTA 4INAA 3GJ6A 4Z9XA 1PZEA 4MV7A 3OQOA 1XPOA 2AOTA 5EZ5A 1Z83A 1KJJA 1T0BA 1US8A 2O3TA 3B1ZA 4HQLA 3V1YA 3VHQA 4C5BA 1YS2X 2C7QA 1IIRA 2AZTA 1PBTA 1VCHA 1AB5A 2VL7A 3FFAA 4KW7A 1CR4A 3PSAA 2E1RA 4QUDA 5JY6A 1JVNA 1WU7A 3M4NA 3PF9A 1FVOA 4H1UA 4YP5A 4KACA 4US1R 4E5PA 1JYFA 3W6ZA 4XYLA 5L4NA 1CUIA 3FNFA 1VSTA 3DAPA 2ESRA 4OHWA 3SZ3A 4EY3A 1NUUA 4PPNA 3K9HA 3CNNA 1SVSA 4UMEA 1M2JA 2Q3EA 3WJ1A 1ONNA 2YBEA 4UMVA 4UHBA 4C6HA 5JQWA 4N03A 5H8WA 2V7VA 4HGQA 3DFMA 3FROA 5HJ2A 1PT9A 1ABEA 1M76A 4PPYA 2A30A 1PI3A 3B53X 5I51A 1OV4A 3RE1A 1E59A 1JEQA 5EZQA 4AQDA 3RTDA 1DINA 2ICAA 3DCYA 3H04A 1XA3A 4JOSA 2ZUFA 3ANMA 1FMJA 2EZ8A 4IOMA 1HE5A 2P90A 4RJLA 5JAIA 5KSPA 2GSDA 2P0EA 3DEYX 2WKRA 2WABA 4OQPA 4B6RA 4D9HA 3WHPA 1KH1A 2TRSB 3MGAA 3KE9A 2JH9A 3UJDA 1F7UA 4JP5A 4JUBA 4EL5A 2IXBA 3QBEA 3PVSA 2P7HA 1J8DA 5D1HA 1H2YA 3L5OA 5JXGA 5TR9A 3JY6A 3MRXA 4HDOB 2FWAA 3KQSA 4WX2B 5KWJA 1G66A 4EB0A 1SKQA 1YZFA 3HCAA 3N2LA 1PNOA 4W1SA 5TY0A 3SICE 3T3NA 1B23P 3G89A 3DDNA 3GLFE 1G20A 4C6SA 3OFVA 1MENA 3FYTA 1UFQA 4CYMA 5JNWA 3D4PA 3BWBA 1LBIA 5C4GB 3IXQA 3PFBA 4LN1A 2JCYA 2PMEA 1GNSA 1MXFA 4D9IA 3SYNA 1KAQA 1ZSYA 4Z0TA 3ZCUA 5HKKA 4TVKA 4O1MA 2OD7A 3GLHE 4JLBA 1E9CA 4FYIA 3UBMA 1F0PA 2ZUCA 3JS5A 4A73A 1ZICA 3F8WA 1OXTA 3C5EA 3M3HA 1BCSB 1GTZA 3BB4A 1OVGA 4OKIA 5DH9A 4RY2A 3FOZA 1H8HA 3KLNA 2YYYA 1U7XA 5ALFA 3DVAA 4HQKA 3NXKA 3KPYA 2QUIA 4B8ZA 5EHZA 2UZIR 3QVGB 2W22A 1VXRA 2Z2XA 5EESA 3V7FA 1FA9A 3IJEB 5JSYA 4KTVE 1NW8A 3SMVA 3W90A 1XZHA 1XJQA 2X5NA 3D3WB 3D4OA 5AYVA 3PPIA 5JE8A 4MHOA 3FSGD 1DIAA 4IRMA 4G07A 4KWEA 3SX0A 5AM3A 1YA8A 1P7PA 1UEIA 3TS1A 3QPBA 5CDGA 2J5RA 1BQEA 1QFYA 5L53A 2G80A 3AJRA 3K09A 5H3HA 2L2QA 2PU7A 2JJ2D 3KR0A 2CVZA 1FTNA 1JQBA 4ZT3A 3D4LA 5B1HA 1C7QA 3SS8A 5KNBD 4K3UA 3ZOKA 6NULA 2IUSA 2A0KA 4IYRA 4N3NA 1FDOA 3ND6A 3N0TA 3CNQS 3IOMA 2RGRA 3OKFA 2WAYA 1T2VA 1ZYUA 2LKDA 4TTPA 4ALIA 4TZ0A 4PRYA 3NMUF 4XLLA 5LA6A 4N0MA 5H82A 1RYMA 2ZJ3A 4AJIA 5BSHA 3KM0A 5LXTA 2D54A 1VGQA 1U1EA 4GVXA 1I5RA 1Z3CA 5A9SA 1BJTA 2JGKA 1IEQA 2WICA 5AIBA 4KC0A 2G06A 1EZ4A 4HBZA 4W9RA 9ATCA 4ZIRA 4L2IA 1THGA 4HV4A 2ZBRA 4HLDA 3RYFA 1E8DA 1XZPA 5AOAA 2HMSA 5IT0A 2GETA 3FZEA 4BL5A 4UBMA 1ILWA 1WKBA 4QJ4A 4LI3X 5A1TA 4CKEB 4NU8X 3SHQA 2J0EA 3GBPA 4Q7MB 2A1TS 3KKEA 4C14A 5DNWA 2MR6A 1D4AA 1XFDA 5KYKA 4KSYA 4YV0A 3DTTA 1F2TB 2W8BB 2HCFA 1JF8A 1QE3A 4NJEB 1G6HA 3X1KA 5DTIA 3KD3A 2B6NA 3WTBA 3AR8A 3PXEA 2WF9A 3GFQA 3DT6A 2XNKA 2FGKA 3MJDA 4A10A 5LP6F 1FS4A 3GZNB 1Z5NA 2P9QA 4YO7A 2XGMA 3HTXA 4FHEA 2PH3A 2QN6A 4KB5A 4F8JA 3CUKA 3R9XB 2O3SA 1ADBA 1GR0A 3N8GA 1UKCA 4KLCA 4MI6A 5TJ9A 5KNBA 4U00A 2C77A 3N75A 1DS6A 1XZDA 1VBFA 5F3RA 4BOYA 2X86A 5J5VA 1ZOPA 5C53B 2W6MA 3HSSA 3ZWYA 3UWSA 4JSRA 1Z4OA 1RI1A 3JWEA 4RMNA 4TT3D 3V2UA 1NUSA 4M83A 4UBIA 3AC0A 4DABA 1N0UA 1XTVA 1P1CA 3D1LA 4BLPA 2PRZA 2Q5HA 2PXHA 3WA6A 3HG7A 2YXBA 4XRRA 4W5JA 5JH7F 4S2EA 1US8B 1JJ7A 1FDSA 5ADVA 3GFTA 1E7MA 1E2UA 2HU2A 3HKBB 5CFLA 2OZEA 3IAS6 1SBCA 2YMPA 1VG1A 4GP7A 1G63A 4OL9A 3CEAA 3L4BC 1RPTA 3ROGA 4V1CB 4LRQA 3ZDQA 3SYLA 3TGWA 4FXOA 4N7JA 2IA5A 2H9IA 3WISA 4DQVA 4JI7B 3PUIA 3V00A 4D41A 3EVAA 4ZMRA 3LPLA 3OCCA 3I6MA 1DC5A 3PIIA 3VSAA 5FHQA 4LRTB 2B2CA 2GPYA 3BX1A 1CERA 2A57A 2I4LA 2P77A 2GEVA 2XCLA 2GTHA 3AP2A 2WG0A 2PZBA 4W6ZA 4EB6B 4CIBA 2JGRA 3OT4A 2RI1A 1NLYA 1FLDA 3IEKA 1EUCA 3KZXA 4FYJA 5BV0A 4Q9HA 2VNHA 4WASA 4ZWNA 4F21A 1WABA 3OM9A 3DMTA 4QJ3A 1KETA 1Z18A 2RI6A 5HIKA 5JLJA 1I7QB 1V5WA 1K3TA 1FUEA 2FFJA 2QMEA 3C8ZA 3LGSA 4CBVA 4CLHA 4MW2A 3MB5A 2NYUA 3DAHA 1TEXA 1ML4A 3K6JA 1NLZA 2BKXA 2I1VB 3IJRA 2WK1A 3KQYA 3CBQA 4PTZA 1LSSA 3K72B 5LB2A 5SZKB 5DCWA 2XITA 3I37X 3VR3A 5JEEA 3HJFA 5JSHA 3RVKA 4BRZA 4DSAA 3CLTD 2QSJA 3MUNA 3QY0A 4YK7A 1I1OA 2JRLA 1I3CA 2X77A 4DNPA 4DDWA 5EJ6A 3HJGA 4Q15A 2C9MA 2NU8B 3U49A 2CL6X 3LK7A 4RF3A 4ZVQA 4AS1A 2O7NA 4KKVA 2EHDA 4RESA 3PNKA 1ZGAA 4F4JA 2A0XA 1A8IA 5I7EA 2V1XA 1QYRA 1JXOA 3LA8A 4PZEA 2E7ZA 3WGHA 1KEUA 1FBNA 2AUTA 3KU4A 4CM6A 5CYPA 4DCNA 5CX4A 1CDZA 3WK4A 5DN6D 3MINB 3TSWA 1I32A 3W9YA 1QV9A 5ALWA 3WYGA 4BLVA 2W2NA 3A9VA 5IJXA 3RVOA 4QQKA 2QVGA 3O7MA 4H4EA 4R1NA 4LTNA 1IK4A 3B7PA 1TK9A 4FMDF 4CLEA 3TW6A 2QP4A 4B3IA 5HRAA 4PGHA 1V8ZA 2H2FA 1ZK4A 3RKRA 2ZYSA 2YMQA 4MARA 5F5LA 2AMYA 1EX6A 2WJZB 1C2YA 1V5GA 1GU1A 3ZZUA 2CJYA 4Y98A 2DFDA 4AIRA 2O0KA 3I09A 3DV0B 1G3MA 3G2OA 1Y1QA 4NYMR 4Q4HB 5LLDA 2XVXA 3KFVA 2IYOA 4Y67A 1ZH8A 2AT1A 5JAHA 5JMOA 1AS2A 2PX6A 2VQFB 5CB4F 1Y6GA 3HWWA 5IM5A 4MQ4A 3VMFA 4UVGA 4G9GA 1PR1A 3JD4A 3NXSA 4FE7A 2O3QA 3QKRB 1ORIA 1QAOA 4J43A 2BLNA 4RD1A 4AW9A 3TM4A 2CEAA 4X62B 5CTAA 1PSZA 2GNOA 4XQ9A 5IARA 5DBIA 1VL5A 2EIHA 3QM1A 1QQAA 1KDYA 2H1OA 3PFIA 1SKBA 4MVWA 1MDFA 3DO8A 3TJRA 2YV5A 4L08A 4NECA 3CG0A 1PQ4A 2FFRA 2ZITA 1ZIYA 3QBVA 3QMVA 2A59A 4NAHA 5FUVA 4D3XA 4HB0A 5KYWA 3TIFA 4BFUA 3UMMA 2IBTA 5IRCD 2E18A 5BW5A 1Z2OX 3LL4A 3KVYA 4PC1A 2Y6VA 2YJZA 1RRMA 2BELA 4Q19A 4BMYA 4G4IA 4JBYA 1Y8RA 5GAJA 4EVIA 1OBFO 1HT0A 2YCLA 3ESXA 2A9FA 2F3TA 3ESYA 1U1CA 2HJRA 3KV3O 4ESEA 4FFWA 4ZV4A 2EJTA 1B93A 2DWQA 1IHDA 1A5TA 3KKQA 1GIAA 5CK4A 4Z4IA 4BIIA 4D4GA 1WLSA 4RIGA 1K2VN 1PL7A 1SJ9A 5SYNA 2AQIA 2G72A 3T38A 4B8YA 5JAMA 3FTNA 4YGXB 4MW9A 5FIUA 4EI2A 4G9EA 4MLZA 1GL7A 3SHOA 4BFWA 1HNXB 3H5VA 4S2UA 3ZY5A 1KP3A 3IA7A 1MAUA 1UH5A 3AG5A 3G0DA 5DM2A 3EPPA 4PZDA 3R7DA 5I3ZA 5IJ0A 5E1DA 1H1LA 1LUAA 1NRWA 1QFMA 2NZJA 1IPFA 2PRIA 3T3MB 3WGVA 4IV8A 1WZ2A 3D6NB 1Z56C 5BO5A 3VYRB 1K5GA 1ZU5A 3CRRA 5SY4A 2QEQA 4E15A 1OKKD 1E2BA 1A95A 4EJSA 1LWOA 2G1UA 3RHSA 4Z3DA 1W36B 1KK3A 4PZUA 4XH9B 4DUGA 1GQ2A 2XIJA 3A32A 1USWA 4BDTA 1Z4KA 1AKEA 3V1KA 4I36A 2D5IA 2IV3A 3BGSA 2ZXFA 1G8FA 2AFIE 2K7ZA 2P78A 2XQKA 4HN9A 4TLMB 4EF6A 5KYGA 4N01A 4CKYA 4GRAA 4FK8A 3OZBA 1E5XA 3LQRA 3M4XA 3NIDB 1T13A 3TLJA 3WLHA 1ZR4A 3PUHA 2R5FA 4EG3A 4UBNA 3FMGA 3NV9A 1TUEA 4N0DA 3GLFB 4OXRA 1EK5A 2VTDA 2BHTA 5EJIA 4D4MA 4MDYA 3P0HA 1C7FA 4PYRA 3BH0A 5EI5A 3BJEA 1DDOA 3RVJA 4ARZB 2UYCA 2K6GA 5HGXA 2I2BA 4MLDA 1J8YF 4QFBA 1ZD9A 4PLZA 4W8HA 5K2MA 2O2EA 3KSUA 4C76A 5JBQA 2FFBA 1PJCA 3JQDA 4QDTA 1AUXA 1VC2A 1IMOA 2QMUA 4MYTA 4R1MA 5ALIA 5IDQA 1TK3A 1RYFA 4J1SA 4M0LA 1CQIB 3CURA 4M6WA 4N7BA 1T9DA 4L3VA 1YC2A 5EXPA 1RWXA 4ND3A 3M83A 4YRDA 2QIOA 3PGVA 5ERXA 4CGZA 3BQ9A 1Q7TA 2B92A 2HDWA 2HSJA 3M9XA 5AXBA 5JXIA 1FDIA 1IK6A 1GFZA 1XJWA 2WPNA 4N9QA 2OY0A 1DU4A 3R0ZA 4UUQA 4QHSA 4F1WA 1LQ2A 3PDHA 2OBBA 3LIIA 4ZREA 1F8YA 4KWCA 5DI9A 5HF5A 1LF0A 5MFPA 3MT0A 4C7VA 5G4KB 4LYAA 1FDWA 2ISQA 2AJ8A 1J07A 1XXLA 5DNUA 2IYEA 4KLNA 4UPDA 1J7JA 3NHAA 1XUOA 2PG3A 3PX7A 4O2BB 1SQ5A 2XLBA 3IP9A 4NMHA 2CVQA 1MG0A 2WAMA 2Z98A 3GN1A 3IB3A 5A71A 2EWVA 3UNXA 2FZVA 2OXTA 2AZXA 4GBGA 1YE3A 2DSTA 5LP6C 2DQKA 4OX9Y 1J2YA 4XCXA 4PWZA 2ATXA 1SY7A 2H85A 3FDXA 3DEAA 4ZRMA 3OIUA 1H9BA 4HAYA 5AOBA 3DHVA 3FGZA 4LGCA 4Q3NA 3UAZA 1SN7A 1A8UA 4LPSA 3FW1A 4ZYUA 4JQOA 1BQ3A 3FBWA 4LHEA 4HDKA 3JQAA 3BGIA 2ZPTX 4OMDA 3TSAA 4NNJA 1HDOA 3TVDA 1UJNA 3V7NA 4KQEA 3H2HA 2VQ6A 2XR1A 3NB0A 2VJBA 1GADO 1XZIA 3MINA 5AM5A 3SJ7A 4EJMA 1IC6A 1PF7E 5DFAA 5I9IA 3LHIA 1BFDA 2CXXA 4RSHA 1ABBA 3QZUA 3ZLUA 3I72A 4WLOA 1UOPA 1URPA 3C1AA 1S2LA 4MCAA 4DQLA 3OP1A 1N1EA 2DBYA 2DE0X 3GLSA 5EUBA 5LQSA 4OAQA 4ARUA 1ZM4A 1UDWA 3IVCA 4D43A 2HO4A 4YJHB 4BRUA 1XZMA 3HM9A 2ARKA 3KDSE 3IQGX 4IZOA 3V8RA 4ACBA 2H5IA 4BX2A 1QP8A 2RGBA 4M0EA 4FGUA 4LBZA 4MO2A 1CB0A 1KI7A 1II9A 2Y1OA 1SXJB 4ZCLA 5BNFA 3LBIA 4UNNA 4DNQA 5BP7A 2OCPA 5FOTA 1M2VB 2V7GA 2G67A 1CIVA 4Y6OA 4FIDA 2I4TA 1JBQA 1FFBA 1EGAA 2XSZD 3E9QA 2A8YA 4D9NA 4H7PA 3QVSA 5L3QB 1JQ3A 3C5HA 3AW8A 4ND4A 1CPYA 3RSSA 1J33A 4J7AA 1MGOA 5D00A 1L5KA 4BEVA 4OREX 4TSFA 5EE0A 3RADC 3UUWA 4R6WA 4P33A 5CM9C 3MJSA 4A5OA 4I50F 5K8JB 1SZDA 1YB1A 5MDHA 4Y7DA 5AD1A 2D8MA 5CDSA 1EHYA 4MTLA 3EVCA 3VR3D 1T9ZA 1ULBA 2XJ9A 5FTWA 1OA1A 4BGUA 2ZBDA 2VSQA 3ZTYA 1VBMA 2A0UA 2HQRA 3LX4A 4E2FA 3STXA 1DADA 2W6JA 4XE5A 3IRVA 4RA6B 4G0ZA 3RYIA 3LYLA 3I04A 1IAVA 2X9NA 1LD3A 1HDEA 1JYSA 1O8BA 3S44A 2IHTA 3VKWA 3VZPA 4EKIA 4HAVA 3M1AA 1KPHA 3C8DA 2IEZA 4LZJA 2B0JA 1GSOA 3L1IA 5T4FA 2HNKA 3FF4A 5BN3B 1RCUA 1XRPA 3ED1A 5JWHA 1HGXA 2GD0A 4O02B 1YFLA 2Q45A 4B35A 3HJBA 1VDMA 2OO5C 1L4UA 3G0BA 4PAGA 4ECAA 2X5KO 4XI9A 2VCEA 1NV8A 5KQPA 4JLKA 1RC1A 4YJ2A 3N9IA 2PSHA 4D79A 1XAGA 3AT1A 2BEWB 5J5CA 4QSHA 2X15A 4PRZA 3CW8X 2O06A 3ILXA 4RADA 4CL8A 2FE4A 2YMMA 1WB6A 2RCYA 2XUGA 3AHCA 4Z7JA 4NJMB 2ZJOA 2HGZA 3NHKA 4WUVA 4NH4A 2A1UA 3PUKA 4PIMA 3W6OA 3OQHA 3ZHUA 4DMMA 2UVPA 4TLEA 5EUCA 1NW7A 2FEMA 4FDAA 1G8AA 2FZCA 4LXXA 5AKHA 1Z0ZA 2QUHA 4DYVA 5JS6A 2CL7X 2N42A 4YAIA 5CLFA 4RK5A 3DO5A 4QZVA 2DQSA 2A9OA 4MWDA 4FR5A 2I54A 4X7BA 2UVDA 1W87A 3ONFA 1MO6A 2CHFA 2RHWA 4B43A 4H15A 3LUHA 5EUQB 2YN0A 1IOWA 2QE6A 3HMKA 3KSAC 2O52A 3DBLB 1DXYA 2PUCA 3F47A 1EHIA 2IPAB 3A58B 3EXG2 1W5TA 3T3IA 1M1ZA 4OF4A 1RSZA 4OQDA 2W7TA 1IHXA 1A9QA 1WNTA 3OF5A 5FBRB 4E2ZA 2P6UA 4ROSA 3MIZA 4GD3Q 4XLTA 5IC4A 4KQ1A 2P4QA 5D6OA 2WE7A 1QYCA 1LK5A 1JH9A 1R18A 4E51A 1AD2A 1Y5LA 5EHXA 3HDGA 3BB3A 1KHTA 1NUPA 4Y3UA 3UENA 2P2GA 1M2EA 3WMRA 2Q21A 1KFCB 1QR2A 2WP8J 4UQPA 3LDHA 2IP1A 3C6QA 3ZW8A 4RFSB 2WSSA 3LQFA 1BROA 1TVKA 2YWEA 4JNKA 4LG1A 5C37A 2HR1A 4PZAA 5GPBA 1JPJA 3G2MA 2Q27A 4J1TC 2QT0A 4XVRA 4LUCA 1YE8A 1N8KA 3TX6A 2EBUA 4D3YA 3L2OB 4V0MA 3DWGA 3R7BA 5GQSA 3I30X 3BXXA 2FWIA 2W9XA 4FNAA 1ITZA 4TRNA 2VHYA 3AH8A 3GJ3A 3NBYC 3MJFA 4WBNF 2YKGA 4G0WA 2QU7A 1O87A 5DBOA 1KS2A 3I5MA 4GLBA 5EGSA 2P9ZA 1LBEA 3RIYA 4BP1A 2I4NA 1LSUA 3HXMA 3O9MA 2H31A 2VPTA 3HJNA 2WFZA 1ZM9A 4PLFA 2CV1A 4P80A 2H7XA 4Y6GB 3PQ4A 2JLWA 5F7ZA 5KKNB 1UF9A 1HDRA 5LQKA 1IJKA 1CEXA 4AQYB 5JEDA 3PQEA 3MG9A 3PEYA 2B4RO 3CKLA 3EXHB 4GPBA 4P3KA 3A3PA 3M6MD 4O25A 4ZDIA 3FZNA 5EKDA 3ABRB 1XZKA 4FFNA 4UJ3A 3RHFA 2ZROA 5AJXA 3RAEC 1OYOA 3ND9A 4WK0B 4YWHA 4AF8A 3FDJA 4LHXA 5GV8A 1B00A 5ALSA 2FMXA 1GVNB 5A02A 3H5AA 2X2EA 1G5QA 3CUSA 3W4KA 1UM9A 3VUEA 3QUAA 3UV3A 4GZ5A 4ZVNA 4MO9A 5LXTB 2HCRA 3D5QA 1KZYC 3NM4A 2CB9A 2VVTA 1QTQA 3NHRA 5CCDA 1VHQA 3W8EA 3FE2A 4MZDA 1X7XA 4XUDA 1NQAO 2DWOA 3R3SA 3AV0B 2Z04A 3WB0A 3QSYA 1RFGE 4MVJG 4NFYA 3ZDZB 1BC5A 1PQPA 5BT8A 1E2NA 2QZ4A 1ANKA 3G1UA 4U0JA 4B9AA 3C87A 2O8FB 3I6IA 1Q77A 1JAHA 4TYQA 3TB6A 4BVEA 2HPVA 1ELOA 5EYPB 3OEWA 3AB8A 3R9KA 2QUAA 4OUDA 5L51A 3CLKA 3DBVO 5CFMA 2P11A 2ORVA 5KX5A 1QG0A 3MYRA 2PUFA 1JA0A 4XDHA 1Q3HA 4ZOLA 4CLOB 2J07A 2JI6A 1RJWA 3EQ6A 3I39X 4XIFA 4H59A 2O8DB 2ZVDA 1B6TA 1L1RA 2H0RA 2REOA 4HQ0A 5ENZA 1AB6A 4MPTA 3IIEA 1H22A 2V97A 1U8ZA 2CKDA 2R7NA 1SHUX 2MWMA 4RXMA 4WXHA 2NVUB 4BUZA 2NT4A 2ZWAA 3LOPA 5DHSA 4YCLA 1N78A 4LX0A 3BD6A 1XCPA 4RENA 1HEIA 1LRLA 4F4DA 3SYKA 1F8FA 1FNMA 2EYUA 2OHOA 4GI2A 4X92A 4HYEA 5CHEA 1KIAA 3Q3CA 4DLUA 4IG4A 1ZW1A 3LQYA 1YZGA 1OKKA 1K92A 1P0MA 2HF7A 5FL7D 2VXOA 5H3CA 1ULUA 3H87A 2CDNA 4ZCPA 1G2OA 1ZJ4A 3BCRA 4KQCA 4R6XA 4E2XA 1PUJA 2QG9A 3CISA 3DE1X 3LD9A 3V97A 3LCUA 2FSUA 1B16A 1C4WA 4RZ2A 3RU9A 2PQ0A 1UOEA 1JIVA 4LMAA 4YRJA 3ZWAA 2FN7A 1ORDA 4E4TA 5DSTA 4NZ9A 3S29A 5JLAA 3WMGA 4X66B 5IZCA 3K09C 1BX1A 2SCUA 1JZQA 3GRKA 1LC3A 1UPUA 3NAGA 3RBAA 1I24A 4MUBA 4B17A 4KN6A 4ZMSA 4K6KA 4P31A 5BURA 1ZUHA 4B3HA 3PR3A 5BY2A 3T3OA 4YQZA 4LDPA 3FNHA 4IDCA 1EG7A 4Y2UA 1U2RA 3E3OA 4QXOA 5ECWA 4EG4A 3HEMA 3PIDA 3RROA 3CZCA 3WBJA 2QXYA 1T2NA 2R4QA 3CH5A 5UKDA 1W85A 3RSHA 4YRTA 1H9CA 4D98A 2IJGX 1IWOA 4GE3A 2AYXA 4XB2A 3SYRA 3H9QA 4BNMA 6REQB 2OM6A 2YXEA 3VPCA 1PZGA 2H1RA 1VPEA 1UIRA 2C58A 1DCKA 2YV2A 3B3JA 3TRHA 4CQJA 4DDUA 4MR7A 5KIAA 5LD2C 3QKUA 2CFSA 3ASUA 7REQB 1HSOA 2XNHA 4N40A 3Q3JB 1N1DA 2JVJA 3D31A 2P75A 5B1SA 2ROQA 1UDCA 5DNCA 2RC6A 4U5XA 5DTJA 1N2EA 5BSMA 4K9PA 3REGA 3WLJA 5D5QA 1SXJD 1LPNA 4MH0R 4TS1A 4XWGA 5FTKA 5CEEA 1U2EA 3D4BA 1EVKA 2PKWA 2VTVA 5H7XA 3DLTA 3YASA 1LBHA 3KRTA 3C14C 2H1FA 1CT9A 4NG5A 3OPYB 1WMBA 1E7YA 4HVTA 4WWHA 1FFGA 2QTAA 5GOTA 2XBLA 4EK9A 1VMAA 3G88A 2OESA 2WWVD 1ZVKA 4AURA 2XUPA 5D3ZA 1E89A 4HEA6 4QYMA 2P6PA 2LIVA 4GBJA 5E8JA 3SC3A 4WESA 2F2TA 1V11B 2JS7A 4I99A 2GNAA 2QLMA 1JQLB 3IO5A 1W19A 4P36A 1PR4A 2XTNA 3IHWA 5H59A 2YW9A 3DONA 4YBZA 3L4KA 3DP9A 3DOJA 1KQPA 2GAOA 2AK2A 3AY6A 3GOHA 4B40A 5CCEA 4G0QA 5HQ3B 3OWHA 1GLGA 1IZ9A 1XLTA 1F5SA 1PZXA 1PD0A 1ZIDA 1IXSB 3FSJX 1K9VF 1D0VA 1E6LA 3AW9A 5JANA 3GLIA 2ZU6A 4WD3A 5AWFC 4C5CA 1R7RA 2ZSIA 2YYSA 1EZZA 3I92A 3QEJA 4DKXA 3TLXA 1VECA 4PCVA 3NNDA 3RNOA 3GMSA 1OHHD 2GQ0A 4X1IB 5HMMA 3RRMA 1H4QA 2LNDA 5BNWA 3NIFB 3QXHA 1J2RA 4FYMA 1YR7A 2QF7A 2JA2A 2O07A 1VLJA 3FLMA 1CY4A 2XGJA 4QU5A 1EP2B 4Q9JA 5L95A 3AVTA 4Q3BA 4F97A 3O84A 3IH5A 3SQWA 1ZHHA 1SXJC 3L18A 4H6VA 5DBFA 4FZ5A 1QGED 5IAAA 1EE2A 1QB8A 3K8QA 4BNYA 5B3LA 3Q8KA 1ZUNB 5L3VA 5CW1A 4JYCA 4RHUA 5FBVB 3CNEA 1KY2A 2BGJA 2PZMA 1KEPA 2ZUTA 2G6TA 2O6LA 5JAOA 1J2TA 2ZB3A 3L0ZA 2C1EA 1Y7TA 4PZCA 3E9CA 5DOVA 2CXHA 3FB1A 3QYAA 3ETJA 2AJCA 2EP8A 3G6WA 5CEJA 1TC2A 3GOQA 3SC2B 4C7BA 3U3DA 2Q5JA 3DCIA 1F5NA 1XHEA 2C5HA 2Q0SA 4RFVA 2C5AA 1YS4A 2AXQA 3OFNA 4X93A 4BQPA 1Z6TA 3U44B 1XALA 2HEGA 3ZVRA 4DA4A 4M37A 1ISJA 1JEDA 5HIMA 5EP4A 3ZD9A 5KPDA 1ORHA 2GM3A 1FOEB 3R6LA 3WV4A 3KKLA 3C98A 3T9DA 2CT8A 2M2IA 3CG4A 3HEAA 3OZFA 2EZUA 5LNK6 2VUUA 1E9RA 2PJZA 1TT7A 1CXZA 1VPLA 4BE9A 2LD4A 2FR1A 4N82A 2YHIB 4PYMA 5EOVA 4TYNA 3VNSA 1G9XA 1XL1A 1M8GA 1TJYA 2H4HA 3FFTA 2XT9A 1W75A 1O9HA 5DLPA 2XRFA 2HF8A 5CG1A 2BSAA 2DUWA 3AVYA 2C0QA 3OKAA 4JELA 5KJFA 2BGUA 2CXPA 2VBFA 5AJUA 4ZN6A 3A1WA 5E9WA 1A2OA 5K45A 1W4AA 3CU5A 1GPWB 4Q03A 3ZQJA 2F9LA 4GC9A 3PI7A 5AW4A 4OVKA 1FLAA 2P9GA 1JEOA 1HRKA 4QODA 3ROFA 1W581 3KJNA 3KB2A 3VTKA 5CBKA 5PNTA 5G0SA 1MC8A 3EDRA 4M1YA 5EKSA 3TNLA 2PVSA 3LBFA 1OFHA 5EKTA 3SFTA 3NDBB 4C3OB 3FI9A 1EBUA 3PX3A 5JSKA 4KDRA 4ER6A 3MGCA 2ZXEA 2E5WA 5EEGA 1XEFA 2FDCA 5K1ZA 2NAPA 4JUCA 3TOVA 2F1RA 4EP1A 5HW0A 3THXA 2P41A 1GDHA 1WCXA 2HK6A 2DPHA 5DYGA 2Q3CA 5GONB 1KNXA 5KTRA 2CV0A 5T3UA 4OI0A 1OWNA 2FSVC 2QD5A 4WZAA 4PPQA 3OM1A 2V03A 3NBMA 4FFOA 1RZRA 1ZQ9A 2J7PD 2WOJA 5FUMA 1KAMA 1G19A 1W48A 1EFLA 3NZEA 1VI2A 3U4IA 4QYTA 5B1DA 1M0SA 5ECYA 2RMKA 1OBCA 3IV7A 1VE1A 3PYXA 4P2BA 1IDOA 1M0EA 1U04A 4KRXA 4HPWA 2PWYA 4OJKA 5TGDA 4E22A 4MV4A 4B75A 3MCAA 4K28A 5BR8B 1QFXA 3V2HA 3VUFA 3TFWA 1D2MA 4XA8A 4HNSA 1JEYA 1TO2E 4OHOA 1N7JA 2AW5A 3I1FA 3GRPA 2YHBA 1FYDA 3K0KA 3GEGA 3OVMA 3LW7A 4M0PA 1SCIA 3T1OA 1QKKA 2I65A 2O4CA 2QMOA 1BMFA 1HE2A 2VK2A 4DUZB 1CE8B 3T4XA 5FPKA 1L4NA 1LLQA 1N25A 4M0FA 4RJKA 4TOIA 5A4MS 2HMVA 1IY0A 1M6VB 1GTG1 1YZYA 4QBFA 2XJ4A 4C0BA 3QELA 3ROKA 4O2BA 3CR8A 1YHZA 2FLKA 1ZK0A 2CKMA 3VA7A 1JT2A 1LW7A 2AG5A 4YCBA 3DXFA 3ZY2A 4CDMA 9MHTA 4LGMA 5K0FA 1KDRA 3MQFA 4BGEA 1YR1A 3FLAA 4G9BA 5G2OA 1YIDA 2EFEB 2FW6A 2RBEA 2WIJA 1KBQA 3FNGA 4V0NA 1JZTA 2NV0A 2X19A 3BJIC 3KOXA 4OA5A 2A2ZA 3PRKE 5L45A 1ESZA 1ZM7A 4E4YA 1P5FA 1YB2A 1WEKA 3B7WA 5JC8A 5A4JA 3K2QA 1TQ4A 2UUCB 2O9JA 2XE6A 1EINA 4N6NA 1BEZA 4O4IA 5BRAA 5F98A 4KFSA 5EMKA 1DUSA 1Y34E 2CZCA 4NYIR 1K8RA 2ZJYA 4NHOA 3TEFA 4DCPA 4DHEA 3LRTA 4OK6A 3KZMA 3R7LA 3T61A 1DRWA 2OQRA 4DXHA 1PBNA 4D80A 5HQ3A 1KOFA 4TWJA 2ZRDA 3EARA 4E12A 4EDHA 4YLGA 3HBMA 4MVJM 3IE1A 1RQRA 2QR3A 3KQKA 2AF4C 1YR9A 3RH0A 4BX0A 3DAOA 3AJ9A 3PD0A 1BWPA 3S1SA 1U8TA 4BQFA 1JW9B 1PJZA 2M32A 4Z86A 3QX3A 1P0QA 2G71A 2JIQA 2OFXA 2W6PA 3HN6A 4L8LA 4GVLA 5JSUA 4CV2A 4H6XA 1J25A 4MPPA 4ZYVA 4TL6A 3X1ZA 4LNAA 2GKSA 5MHTA 3D02A 3GA7A 3L6BA 2DJIA 4D5EA 5AHWA 4M38A 1JKXA 4OP1A 1MU0A 1Q95A 2PUDA 3NO4A 1RAHA 3CZ4A 3HGTA 3ZGYA 1F48A 2OP0A 4DA7A 3NVMB 4EF4A 1Y8QB 3U4QB 1T1IA 4LMPA 3HXLA 7REQA 1CIJA 3WIVA 4AJ4A 2H9AA 1F12A 2PUVA 3V1NA 4MKZA 4HDAA 5AW3A 3N39C 4NBWA 2MSNA 3U2QA 2JAQA 4PSAA 1V11A 4RF4A 2P9HA 3A26A 4RVHA 4AY3A 3RAPR 5BMOA 2GFQA 2D2XA 1P77A 2B34A 2YL2A 3STYA 1NBMA 1YULA 4D0LB 5E3JA 4GFDA 3WHKA 1FFEA 1UC8A 3BCHA 3F4BA 3TD6A 2GB4A 4H7HA 5LUBA 3IUPA 3LQ4A 1XB2A 2P68A 2PRYA 3O31A 3SMQA 3ZGNA 1OJ7A 1RAFA 3B8EA 4N65A 4ER5A 2FEOA 2XUDA 4DMKA 3ZWQA 2QZSA 3HSKA 2UUPA 1CNFA 4IDGA 1G4UR 4G0PA 4OFWA 4WINA 4LZAA 3GNTA 3O90A 4Y2YA 1UP4A 2P2SA 5DGTA 3DR5A 4K81B 1M34E 1ZGZA 3PHIA 1B6SA 4L6IA 3PXCX 4UTXA 3S1AB 4FI3C 1CP3A 1QYDA 4GRDA 3ODGA 4JVLA 4G0MA 4RFLA 4EHFA 2JHFA 1T8PA 3JR3A 4JJAA 4HZIA 4B09A 4BQSA 4DLWA 1GKLA 4EZBA 1KTIA 1A4RA 1GZ4A 3V7YA 1BKSB 3H8JA 4G8BA 1SVMA 1ENZA 4NENB 2GN6A 1GGVA 1PEYA 1DFHA 2XOEA 1QE5A 3K1AB 4AICA 1E1KA 3OO0A 2JCSA 4R0NA 2HFKA 3I6QA 3MAGA 1J22A 3VR6A 2G1KA 3DOCA 3EZLA 2MIIA 2HCTA 4A36A 2JFZA 2D5CA 2VPYA 3CLSC 3PNOA 2Y0EA 2C97A 5JD3A 3WLEA 4CF7A 3CE9A 1Q44A 1T5HX 2NO7A 5EJGA 5ICGA 3UFXA 1TUIA 1W94A 2YVQA 2AR9A 2MSDB 4IBOA 4CM9D 1A8SA 1NMSA 2FUEA 2NO1A 3D8HA 1JQDA 1W46A 4U39A 1GQSA 1KYZA 4KRGA 3MZ0A 5HGJA 1WDLA 4L8VA 3ZDDA 3GJ5A 2DHQA 4I6EA 2HDHA 3ORSA 4DARA 5JMTA 1AZSC 1IG0A 2BE9A 1ZZGA 1CWUA 1V2GA 4IGEA 5H4GA 5TQ2B 3RYCA 5K6AC 4CMAA 4F9FA 1B42A 1TF5A 3EUWA 4LJKA 2YVUA 1KL7A 3KJFA 3PXDA 4GWKA 2I91A 3WYFA 4R1UA 2CJFA 3K1YA 3NBKA 4IVQA 5A0FA 3IUSA 5TS2A 2D7DA 4BP8A 4D8XA 3L5KA 4RV9A 1QYXA 5SY9A 1NFQA 4G86A 2C1ZA 1ISMA 1NKTA 1PGQA 1EEHA 3BMCA 1DKOA 1X42A 3LRXA 5EMLA 5L3ZA 2V9ZA 4BHTA 4Z7OB 3NVAA 4QNMA 2WSIA 3ER6A 1IOVA 2R7LA 4D3SA 4IOJA 3A4TA 3AU9A 5ED0A 1WNFA 1DI0A 3EZ7A 2YHAA 4C0QC 1U5BA 5EIAA 5CD1A 1QHFA 1VJCA 1DP4A 4BU0A 4NBSA 3PUWA 1Y37A 3IUNA 1KK2A 3N2KB 2FPLA 4E5KA 3H5RA 2C7RA 2IDZA 3Q2KA 4F5DA 4IJVA 2NSHA 1HDYA 4M21A 3TIVA 4EI8A 2BW0A 3E1KA 4G0OA 2D0OB 3MWYW 2FDRA 2IP4A 2ZYIA 3NDRA 3P9KA 4CEIB 5I4IA 4ZYTA 3UUFA 5I7WA 4JWKA 5ALHA 1RYEA 5AKLA 3E5RA 3PFNA 2VDMB 2C9DA 1KDOA 4JB8A 5CVEA 2L69A 2QLLA 3BWMA 5HK8A 4DCOA 4FFBA 5BXQC 4ZI7A 5AVUA 4P4LA 3M49A 5HJ7A 3C43A 2HV9A 2JGFA 4NF2A 3RREA 4XQ0A 4JB0A 5A7HA 4ZVSA 1SOUA 1R9NA 1EDDA 2FEWB 3LCRA 3NAZA 1U28C 4FFLA 3RRYA 3HLTA 1SWVA 1PL6A 2RC5A 2TSYB 5GMOA 4L02A 1Y4DE 2YZNA 1JYEA 2QA5A 1QKIA 3OQVA 3CH6A 4IJWA 4TKUA 3KSBC 4MWCA 2EFCB 1VG8A 4UMDA 5P8WA 3P0FA 3S27A 5CB6A 1G20B 1CV2A 3OJOA 1DAGA 2F1KA 4K9SA 1S2NA 1Y6ZA 3KK0A 2IUYA 2WUFA 2IY7A 2B1QA 3WLSA 4EY5A 3ADBA 1I4TD 1GO2A 5EIFA 3DMHA 2YWGA 1BD4A 1RXIA 2EERA 4MWOA 1D7OA 8OHMA 1X8XA 3U1TA 1S9DA 3PQ5A 1A9RA 1Q12A 2UYHA 2FEPA 4IQ8A 1LQTA 3AI7A 2DB3A 3QKSA 1C14A 1XJCA 3OX1A 3S2UA 3LZCA 3BFXA 3ABIA 3EIOA 4KPFC 1PG5A 2ODEA 3PQCA 3BTVA 5CT9A 5KNDA 2XMRA 1GPNA 4Z3KA 1DAFA 4P58A 1EB8A 5J1TB 4ALMA 3I9OA 4LF9B 2XBMA 2AE1A 3BM5A 1CUGA 3KTAB 3TNJA 1CZRA 1N8NA 3PPWA 2A1UB 2O7SA 2WUWE 4P32A 3L8ZA 4ZTBA 2EX4A 1H2FA 3KYDB 5A3JA 4O4LF 1P3DA 4CLRA 2B8JA 4LHZA 2ZYTX 1S8FA 4BP9A 1K8XB 2B7BA 3EIQA 3PUYA 4B5KA 2NU7A 2FX3A 4U63A 2CF6A 4K9LA 2FVXA 1NUAA 3PZRA 1IHOA 3EG9A 3A1DA 4O2LA 1U2PA 2GK7A 1XQXA 4GS5A 4XXHA 1P91A 5JZ9A 3C41J 1II8B 4JC5A 4CM4B 2PWAA 1ZA2A 1B73A 1N6OA 3QU2A 4MKGA 4ZVOA 1J2UA 2NW6A 2G36A 3L01A 4ZOEA 5FI0B 4U7DA 3U62A 2YRFA 4KVFA 1Y5MA 5AHXA 1CZLA 1U1GA 2DPLA 1VFPA 4A82A 4FMCF 3UGQA 3FPJA 2ZB2A 3FPKA 1E20A 3AVXA 1XDSA 3HJCA 1C8LA 1ZNXA 4Q47A 4GC5A 1XVLA 2OYCA 2A94A 4QTTB 3IX7A 3TQIA 3ETEA 3G9TA 3GH3A 5H16A 4I6JA 4DF3A 4NYJR 1QB7A 3NKVA 2FW8A 3QJGA 3FHTA 2YOFA 4QYWA 4XW2A 5DGXA 2FKAA 4OLBA 1VP9A 2RB4A 1C2TA 3JTMA 1DX9A 2HBYA 3DOFA 3O2NA 3SOZA 1JIKA 5B2FA 1T8UA 3OG9A 4M49A 3G0IA 3V7WA 4MW4A 1FRQA 2IZ5A 3L7LA 3ZY3A 1BN6A 1MF7A 3L8CA 3L0YA 2OUIA 4TKVA 4PSDA 3O4HA 3I01A 1N7IA 4Z9AA 3CLVA 1IZ0A 1X7YA 1V6AA 2HK7A 3FKSD 3OZTA 4NV0A 5HWSA 5I01A 4MGZR 1VL8A 4Y30A 1DHTA 2NSDA 1P0FA 2NXEA 3NJ8A 5JQGB 3QLUA 1KQOA 2WTEA 3IO3A 3KJZA 1MOQA 4QWMA 4UQOA 4XIGS 4Q7QA 1S3GA 4NRDA 3WL8A 2IKSA 4MP3A 1E66A 5HSGA 3RAGA 3H3XA 2ZUSA 4LKRA 4NK5A 3LY7A 4JXKA 1VJRA 4PYJA 4W9MC 4U2KA 3TR6A 3E84A 4A27A 2UVQA 3V2IA 5CGZA 2XYVA 4JDUA 5E6SA 3FOFC 2RH4A 5I9MA 2AL7A 5DGHA 4KFRA 1NY6A 3CJQA 4X71A 4IGKA 3V9AA 2C0CA 1XAHA 3DF9A 3MW8A 1KGDA 3GL9A 4KQHA 4RKYA 5JI2E 3AETA 1U02A 1IE3A 4LWZA 5DGIA 1VJ0A 4DMCA 1NF2A 1YB5A 2RHCA 3MQ2A 2JFBA 3GG2A 3GIWA 1YAHA 4AJEA 2ET6A 1JU4A 5HKBA 1SD1A 5ANRB 2A86A 1RZUA 1NXSA 2X5XA 5AOVA 1UOQA 4I9UA 4B85A 1IQPA 1P39A 2RD2A 2JLXA 1M74A 4JC4A 1YZKA 3R3HA 3Q10A 4IKPA 4OXQA 4BRSA 2P8SA 4BNXA 3J7AC 5I9SA 3FOCA 1JKIA 4FCVA 4B3TB 1PTJC 1QVRA 3NHFA 3UMJA 2I4IA 5EHNA 3NH6A 5FWXA 3ZV3A 1SUAA 1UBGA 4G5HA 1FZTA 3EK2A 2P2DA 4Q3LA