3V9AA

Crystal structure of esterase/lipase from uncultured bacterium
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
296
structure length
293
Chain Sequence
b'AGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase/lipase
molecule tags Hydrolase activator
source organism Uncultured bacterium
publication title Crystal structure of Esterase/Lipase from uncultured bacterium
rcsb
total genus 105
structure length 293
sequence length 296
ec nomenclature
pdb deposition date 2011-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v9aA00
1TAHA 2XUJA 5FDFA 2CMFA 1K6EA 1CUEA 4AO7A 2WHPB 3STVA 1O6FA 2ZYIA 1EH5A 4XJVA 1MAAA 3R40A 4GDMA 1JI3A 1JT2A 2YXPX 1N1MA 4KAAA 3IB3A 1ODCA 1UT6A 3WL5A 1NU6A 4UBMA 4JNCA 3K6KA 1FFEA 2IX9A 1VE6A 4DNPA 1TRHA 3W9UA 1E66A 4HZGA 1SOMA 2XQJA 2JGMA 4BCCA 2JGKA 3Q8WA 1EDDA 2B9VA 3G8YA 3G9UA 5LKAA 4OCZA 5ALYA 3W06A 3WKCA 4IH4A 4HXEB 3KSRA 2RONA 4TGLA 2WQZA 3KDAA 2HDWA 4B83A 3WIOA 5K5EA 2ECFA 3B3QA 1LGYA 3R41A 3NWOA 4N5HX 4FNMA 1YS2X 3HC7A 5BOVA 4H7EA 4KAFA 5CH5A 3QPCA 2WHRA 2Z8ZA 3WWEA 5AI9A 4AMZA 2JGJA 3G0BA 3F8SA 2JEZA 2PUHA 5LZ9A 3AIOA 4O08A 1GGVA 1MN6A 4G5XA 3I2FA 1K8QA 2LIPA 2XE4A 1U4NA 1MTZA 1YA8A 4QEKA 3WK9A 1QIFA 4K2AA 3E1GA 4P92A 5ALGA 2BUBA 4NMWA 2YH2A 5JZBA 3V48A 1MT3A 1IMJA 2Y6UA 1CV2A 1WM1A 2JIDA 3ANSA 2Y2VA 4PSDA 4V2IA 3IIIA 4CFSA 3K2IA 2V9ZA 2VSQA 4QDUA 4G4GA 2VJDA 1ISPA 3RARA 2QOEA 1CR6A 3H2HA 1BN6A 2VT7A 1ETHA 2O2IA 3VJMA 4ZREA 4QZVA 2PU5A 5IKXA 3R3YA 2DHEA 3PE6A 2XUHA 1OXMA 3WKBA 3T4UA 2XLBA 3H2KA 5ALWA 1OCEA 1YR2A 1ZI8A 3PFBA 1P0MA 1GPKA 3ZLUA 4Y9SA 4PSCA 4KYVA 4FHZA 5CT4A 4X00A 1QO9A 5JADA 3LCRA 5AIAA 3D2CA 3IUMA 1R88A 1MNQA 2JGIA 5AOCA 1GPNA 1UK6A 4MQMA 1WOMA 1CUUA 4RNCA 3F98A 3HJUA 1XZKA 2HRQA 5FV4A 4G8CA 4QDOA 3ESAA 1J07A 1QIEA 3BF7A 3QPDA 3E0XA 2WFLA 3L1JA 4DM7A 3NGMA 2Y2UA 3CCCA 1ORVA 2HHAA 5ALEA 4W63A 1GKLA 5HKAA 1EDBA 3S2ZA 2WIKA 3BL8A 1I6WA 3M82A 5AM1A 1XZHA 5HCUA 3C45A 4KAJA 4X97A 5ALTA 3SWWA 4AZ3A 4NZZA 3FSGA 1YAJA 2OCGA 5AO9A 1TKRA 4CG3A 2ROQA 4C6HA 5HF6A 3Q0TA 5JAPA 1MNAA 1EDEA 4CCWA 4FDMA 1FSSA 2CEKA 4FLFA 1W6RA 4C01A 1XZDA 3FLBA 5BWCA 4UBKA 4K6HA 4W1PA 1XQVA 3B5EA 1DINA 3QH4A 2ACKA 3O9MA 4MWTA 1BN7A 3MVEA 3MUNA 3AJAA 3VISA 3DLTA 2I3ZA 5A2GA 1S8OA 5ALKA 3NOXA 4TPKA 5DNVA 5EHNA 2EEPA 5CT8A 1Q0ZA 2OGSA 4P9NA 4J3JA 2OCLA 2WUEA 4M0EA 7YASA 4ZV9A 2JBWA 4AB1A 4LXIA 1EHYA 3RM3A 4BAZA 4Y2XA 4ZXFA 4J0IA 5IVIA 4Y2QA 3AINA 2GYUA 2J4CA 2ZYRA 3HRHA 3EQ7A 4EA6A 3DJYA 3FOBA 4LXHA 3EF3A 1MO2A 3G0GA 4GW3A 3WJ1A 1ZGBA 4MEBA 1GZ7A 5HFNA 5ALNA 4ETWA 5DYTA 1AGYA 1QTRA 3O4JA 1DT3A 1GQRA 3IURA 5SYNA 4WJLA 3R3ZA 1RWQA 3ZLTA 2AJ8A 4W1SA 4JYMA 5ALHA 1UWCA 1QTIA 4LIPD 5FRDA 2DFPA 2HU7A 5JASA 2DQYA 1BE0A 4S0XA 3BJMA 4FBMA 4J0GA 2QJWA 5AHXA 3IA2A 1H23A 1EK1A 3P2MA 1XZCA 3F9CA 4J03A 3G9TA 3H2GA 5LZ4A 1XZBA 1R9NA 1E89A 4Z49A 3VJLA 1F8UA 1QIHA 1VXOA 3R3VA 5AM4A 3O4GA 3GZJA 3AZPA 5FOQA 3D7RA 5HF8A 2QR5A 3W2TA 5KWJA 4F5ZA 5CT9A 3F67A 3ZWQA 3DEAA 1CUVA 1XZFA 4BDSA 2XUIA 1TK3A 4GECA 4YASA 5ALRA 5FP0A 1SCQA 1RYYA 5HK8A 2PSEA 1KEZA 2RHTA 5DNWA 1JFRA 4FTWA 1AURA 1W1IA 2VJBA 5FPQA 3WZLA 1R3DA 1QFSA 2VA9A 3G9ZA 1XZAA 2HA4A 3SX4A 5A71A 1AQLA 3I2HA 1G42A 1E3QA 4QA9A 5J3JA 1K63A 5T4BA 4N8EA 1A7UA 4E14A 4LYEA 2WJ4A 1G5FA 3IDAA 2VAVA 3ZV7A 1OILA 4BDTA 2J3QA 3DKKA 5E2IA 1IUOA 5D3KA 3WA6A 3FLEA 4U2EA 2R11A 3ZPXA 1CUIA 1HQDA 4ROTA 3LP5A 1DT5A 1MX5A 3I6MA 4UHDA 1LPOA 2PBLA 2XMQA 1ZJ5A 1AMNA 2Z5GA 1AC5A 5CTAA 4B0OA 4JH0A 2W22A 2PSJA 2QJRA 3DNMA 2C58A 3FYUB 4WY8A 2Z8XA 3X3HA 1VZ2A 2IIVA 1PV1A 2ZSIA 4OPMA 4B0PA 4DIUA 5HQ3A 3O9VA 4F60A 3W9BA 4GEGA 3KWFA 3IULA 4LXGA 1ODSA 2WG2A 4ZRDA 3WK6A 1FFCA 4AN1A 4P08A 2EDCA 5AK6A 1TCAA 5FXMA 1F6WA 4CIAA 1ODTC 2HA6A 4DMHA 1JJIA 3F97A 1XFDA 2C0PA 2BAGA 3D59A 3WWPA 1BS9A 4Y2UA 4KJXA 1A8SA 3QPAA 4AQDA 4KR0A 4MJ3A 1MPXA 3R3WA 4UFOA 5I9IA 1XLWA 2HU5A 2DCMA 1XZLA 1AZWA 4DTCA 3DOIA 3DYVA 4B7ZA 4KE9A 2HA0A 3FAKA 1X2BA 1YB6A 4OU5A 5EIEA 1LPNA 2QXUA 4CIBA 2B4KA 1LPMA 2RIPA 2HM7A 3WWCA 4WDRA 2XMDA 1BEZA 2ZJ7A 1ZIXA 3PF9A 5JARA 5EI5A 4FMPA 1FFDA 5JD4A 5ALFA 1L7RA 3ZLVA 2W6CX 1CUCA 5AH0A 4BP9A 5ALMA 2WJ3A 3PF8A 3C6YA 4MXDA 2HRRA 3CN9A 2JGFA 1KU0A 3WL6A 3R0VA 3STXA 5KWIA 3PICA 2QUAA 4UHBA 3V1KA 5ESRA 4WY5A 5JATA 2OG1A 2WM2A 3DOHA 1C7IA 1MAHA 2BGNA 2VATA 1U2EA 2HA3A 4H7IA 2HA2A 2ZYSA 3AZOA 4TVKA 4BE4A 4C89A 2XMCA 2QRUA 1CUXA 5JD6A 4I3FA 4XX1A 3W05A 4XIIA 2ZJ6A 4L0CA 4AZ0A 3I2KA 3HACA 2OCKA 4DMFA 2HFKA 1THTA 4IQ4A 4OB6A 4K5QA 3PDCA 1CRLA 3WYDA 3D5EA 1WCYA 1LPPA 4Q3LA 2VT6A 4X6XA 3BXPA 4CCYB 1CUHA 3LS2A 1WHTA 2QMQA 1UK8A 2AJCA 3U1TA 4BVLA 5D3ZA 5AP9A 3QVMA 4Y2SA 2BJHA 5AI4A 4J0KA 3QMMA 3WJ2A 1Z68A 4DMCA 3RLIA 4GHWA 3FLAA 2DQZA 4UBIA 1UXOA 2OAEA 2GBIA 4ARBA 2WIFA 1ZOIA 1QIDA 2GYVA 3DS8A 3WL7A 4YPVA 1W4LA 1E8DA 1CUJA 2XUAA 1XQYA 2RAUA 2WIGA 5ALDA 2I3DA 2H1IA 2WTNA 4H7DA 1USWA 4IH9A 3M81A 3ILSA 2VTVA 3VVLA 5LZ5A 3ED1A 4PQEA 1XRLA 3A2NA 3OURA 1X2EA 3C8HA 2WUFA 1H2YA 1VXRA 3SK0A 3BIXA 1R4ZA 4OSEA 2PKYX 5IVKA 2C0QA 5JALA 5H3HA 5K3AA 4B9AA 3VXKA 1UK7A 1YA4A 2WKWA 2Y1KA 4EY8A 4PSUA 1LPAB 4KACA 1IUPA 1H22A 5AM3A 2BUCA 3WKAA 1P0IA 4A23A 3QYJA 3U0VA 5CH3A 3ANTA 4Q3KA 4U2FA 4DNOA 5K3FA 4PV7A 4PNZA 3WI7A 3IUJA 4Y7DA 2FJPA 4QWMA 3DYIA 3VVMA 5KREA 4MEAA 2ZJFA 3R3XA 1CEXA 3ESBA 3A2MA 4J0HA 1YS1X 4ZV7A 4G4JA 1QIMA 1AKNA 1KU6A 3IUQA 6YASA 3D3NA 3WL8A 3BE8A 2G5TA 3QMVA 1UKCA 3BF8A 2G4LA 1JKMA 1Q84A 4M0FA 3G7NA 1ZD2P 3AIMA 1IZ8A 1BU8A 2XUOA 1X70A 4WDQA 5JYCA 1GXSA 4BP8A 1ZJ4A 2GYWA 2FUKA 3N0TA 3A70A 5EGNA 1SC9A 3H18A 2G5PA 3OOSA 5DJ5A 5ALIA 4XWGA 1XQXA 2JEYA 2XMBA 4WCVA 5DTJA 2BKLA 4UHHA 3TRDA 1XKTA 1U8EA 5D6OA 4B80A 2E3JA 4UFNA 1YSCA 2DHCA 4G4IA 4BRSA 2PSFA 2CBGA 3C8DA 4GXNA 3MUOA 1F0NA 4X91A 3WQHA 4FFWA 3DDUA 2FJ0A 1CUAA 1TCCA 2BCEA 4BC1A 1N5MA 2X8BA 2ZVDA 2PM8A 5A7FA 2XQKA 4M0MA 2V98A 5SYMA 4DNQA 4BCDA 2QZPA 1BEEA 4FFVA 3GROA 2OQIA 1QZ3A 4E46A 1L7QA 1CVLA 1ACJA 1D07A 4OYYA 1EA5A 4UBJA 2HA7A 3OTQA 2JF0A 1DX4A 4X94A 2X5XA 4DSAA 3C87A 2ONCA 5HQ3B 4FNGA 4F21A 1ZD5A 5JAUA 3D2BA 1F0PA 5AKIA 5ALJA 4C87A 5JD5A 4FBLA 5ALXA 4PF1A 4K6KA 1JMYA 1W52X 2D0DA 5ALOA 5CMLA 4U2CA 4F0JA 4FLMA 3C5VA 3H2IA 3YASA 5LP1A 4HRXA 2R8BA 3PFCA 2PU7A 4Q82A 5DWDA 4BVJA 5AM0A 1LBSA 4I4CA 3V9AA 2C4HA 2WFZA 3H2JA 5ALSA 3T52A 3D4LA 4CG1A 4HS9A 3H17A 5K3FB 3O95A 4RE6A 1FFBA 3LLCA 3L1IA 4C88A 1QE3A 2PUJA 3WKDA 4W1QA 4MQLA 1LPSA 3HSSA 4UHCA 1K5PA 3UUFA 3C6BA 5EIHA 4LKOA 4BB0A 5DTIA 4MYSA 3L1HA 5BWBA 1QLWA 4OYLA 4X6UA 1P0PA 4CCYA 2XMZA 2VQ6A 4E15A 1GPLA 3S8YA 4UUQA 1AX9A 3AUKA 3OG9A 3PUIA 5YASA 3RK4A 3UUEA 1BROA 1U65A 3LIPA 4W1RA 4B82A 4YX9A 2RGUA 4J7AA 5CBKA 3I6YA 4X6YA 5FPPA 4X7BA 4OB7A 3WK4A 5C8ZA 1O6GA 5LLSA 2NW6A 3A6ZA 1P0QA 2HA5A 5AIBA 4NVRA 5LZ8A 4B6GA 4J0CA 3DKRA 5C8XA 4FWBA 5AKLA 4KEAA 3I1IA 1EVQA 1XLUA 5ISMA 1XRRA 2WUGA 2YASA 2PVSA 1JJBA 1TCBA 5AI6A 1LZKA 5LIPA 3TJMA 4Q1VA 2PPLA 2ZSHA 1DX6A 1G66A 1MJ5A 2QM0A 3ZI7A 4QLAA 1HBJA 2OGZA 3C6ZA 1BCSA 4Y2JA 1WPRA 1ZD4A 1ZGCA 3H1AA 1CUWA 3A2LA 5AI5A 5CT5A 5JANA 1J2EA 2C7BA 2I03A 1E8NA 4BVKA 3G02A 2D5LA 1CIJA 3FSGD 4X95A 1Q83A 1YAHA 3ESDA 1UKBA 4C4XA 3FCYA 3G9XA 2WJ6A 4Q3OA 4UBOA 1UZAA 4BYMA 4HVTA 4WFJA 1GQSA 1C7JA 4EUSA 1JU3A 2XQGA 4Y2TA 2WG1A 5AKKA 3I6ZA 2GBGA 1QFMA 4G1FA 2H7CA 5HF5A 1VA4A 1W76A 4ZI5A 2XUKA 5HK9A 2XUDA 3HZOA 1J06A 4PW0A 5KBYA 4X90A 1Q0RA 3JWEA 5HZGA 4UFPA 1LLFA 4INZA 1ZIYA 3GFFA 5CW2A 5AKGA 5BV7A 4B81A 2XB6A 2OCIA 4JYPA 2CUTA 5DYWA 1ZD3A 4UBNA 5LYYA 1XRNA 4UHFA 1SFRA 4BCBA 2OLEA 2O7VA 4BAGA 3FYUC 1N8SA 4WFIA 2HADA 4UBLA 1M33A 1XQWA 4Y2RA 4CG2A 2VF2A 2XUGA 4QDXA 1B6GA 2XMGA 5E4TA 3C70A 1B41A 3M83A 5AI8A 1FJ2A 2VJAA 3HXKA 1AUOA 2K2QB 4GWLA 4KE8A 2QXTA 4X71A 3WWOA 3QM1A 4N8SA 2H7YA 4QWWA 1VKHA 5HF9A 4KE7A 2XMRA 3I2GA 4KRXA 4EY5A 1Y7HA 3N2ZB 3EQ9A 1H2ZA 1E5TA 3HYSA 5T4EA 4RGYA 4BTVA 4G9EA 4B85A 3ICWA 5T4HA 4H0CA 1H2XA 5ALUA 3WIBA 3H04A 2Y6VA 4DMKA 3MGAA 2ES4A 1EB8A 5CXXA 5AKEA 5C8VA 4D9JA 2XI4A 3QMWA 5F4ZA 1LZLA 1NX9A 3STWA 4JEIA 2WFLB 3GA7A 5E4YA 2PX6A 2XLCA 3PI6A 3WKEA 4N5IX 2ACEA 2IITA 2QT9A 3VDXA 4RPCA 1ACLA 3G0IA 5AKYA 1H2WA 1Y37A 1C4XA 4GLBA 3BDVA 5EHQA 2C5GA 4W9RA 3EIOA 1CUDA 2QUBA 4X85A 5AOAA 3GBSA 3QBJA 1R1DA 4GI1A 2AXEA 4HAIA 3TEJA 4IH1A 4WFKA 3CXUA 2OPHA 2DSNA 2RHWA 3WMRA 1Y7IA 2WU3A 3ICVA 5AKZA 3EQ8A 5ALPA 2O2GA 5A7HA 3JYHA 1GT6A 3K9BA 5K3DA 1WB4A 2JGLA 2G63A 1SCIA 2XMSA 3IBTA 1CLEA 4EB0A 3WYNA 4ARAA 4AMYA 2YYSA 3AZQA 1XROA 1RP1A 3DL4A 2JGEA 4NS4A 1QIKA 5CRIA 3E4DA 4OD0A 3FYUA 1MU0A 2H7XA 1IUNA 1IZ7A 5FLKA 4OB8A 4ZGBA 4FKBA 5AK5A 2V96A 2QVBA 2QTBA 1UK9A 2Z3ZA 1XRQA 4X93A 3ESCA 2XQFA 5A7GA 1WHSA 1CQWA 4EY4A 4OU4A 4B84A 4KRYA 4LYDA 4RE5A 4U2GA 5C81A 2WHQA 2WIDA 2X76A 5ALZA 1HDEA 3M3DA 5JZ9A 1DWQA 2GZSA 2AJLI 5AJHA 3H19A 4YK7A 3RKSA 4BE9A 1R50A 5IH7A 2OQVA 5CH8A 1QIGA 4BAUA 4DLNA 4BC0A 1VA5A 5A6VA 1FFAA 5ALVA 4FLEA 3HEAA 4H18A 2OXEA 2I78A 2C5FA 2XUFA 3V1MA 1CUSA 3DCNA 4H7JA 4EY7A 2BUAA 2O7RA 4BZZA 5JAOA 2QKYA 4EZIA 1PFQA 2WTMA 3AFIA 4HXGA 4N8DA 5AKXA 2H9YA 2J3DA 1DU4A 4MYDA 5IVDA 1MX9A 4B9EA 1QJ4A 1QIIA 2CB9A 4Q34A 1GKKA 4BTLA 3W04A 3AILA 4GBGA 5D7BA 1YB7A 5JZSA 3UMJA 1JJFA 3FCXA 3BJRA 3G0DA 5DNUA 4MWSA 5CXUA 4DYHA 1XZJA 4L9AA 4J0JA 1EB9A 2EDAA 3B12A 1CPYA 1EI9A 1JU4A 3VJKA 2HFJA 3HABA 1A8UA 5AK4A 1N5RA 2CZQA 3AIKA 4IHAA 5AI0A 5JAHA 5K3CA 1CUYA 4Y2YA 3D2AA 3E3AA 5DLPA 2O2HA 3H1BA 1G4HA 1W75A 2WILA 4EBBA 4JUIA 4IO0A 1ZI9A 3I2JA 2PL5A 4HXFB 4A5SA 4ITVA 4P93A 3QZUA 2B61A 3KWJA 4CI9A 1XRMA 3LIIA 2XDWA 1ZI6A 4QNNA 1CQZA 3V1NA 3DL7A 1BRTA 2HU8A 3STTA 4QLOA 1YCDA 3F96A 4L3WA 5HKBA 1CFJA 1QO7A 4UPDA 5DYYA 4BZWA 1HLGA 2CKMA 4H77A 3WA7A 3C43A 1JMKC 4AXBA 2WFMA 3OC0A 2BFNA 1QONA 1HL7A 5HFAA 4BATA 5IVHA 1DWOA 4X3CA 2OAGA 1VZ3A 4G8DA 5JIBA 4LHEA 5CT6A 3HLKA 2WIJA 1EINA 5AICA 5ALLA 4DGQA 4K6GA 2Z3WA 2XUQA 1R9MA 4ZWNA 2ZYHA 5FUMA 4KE6A 1THGA 5A62A 4BRZA 1TQHA 1CUBA 4H35A 3FYTA 3CCBA 1UOOA 4J0DA 4QE3A 1XZGA 2ORYA 1A8QA 3R3UA 2WHPA 2XT0A 2AJDA 4FOLA 3EBLA 5I8PA 3O0DA 1CUZA 3I1YA 3KD2A 3BDIA 3DQZA 3O4HA 5FKJA 5EHXA 2QS9A 3VKFA 5K3BA 3GUUA 5AK3A 1LNSA 1VJ5A 3OM8A 4AO8A 3SC2A 1BCRA 4BBZA 1TIBA 2WU4A 3GELA 3IVMA 3NUZA 2RI6A 3BIWA 3O4IA 4QDZA 3G0CA 3STYA 1K4YA 2Q0XA 1WPXA 2XUPA 2PSDA 1DWPA 2WLSA 1CUGA 5I7UA 5ALQA 3WK8A 3BWXA 1EVEA 3FNBA 1XKLA 5AM5A 1QIJA 1UFOA 4X92A 4Q05A 1DQZA 3PUHA 4Y2VA 2PSHA 3FWHA 3FBWA 1NU8A 2V97A 4DSZA 4HTAA 3CN7A 1VOTA 3STUA 4AX4A 3QITA 1EX9A 1PJAA 4G9GA 2OGTA 2VEOA 1HPLA 4Y2PA 1T4MA 1T2NA 1IVYA 1XLVA 1ORWA 5LZ2A 1HKHA 3KOOA 2B20A 2GZRA 1EXWA 4U2BA 1XZMA 1XZIA 3OPMA 3I2IA 4AO6A 3V1LA 4G8BA 1QGED 1LPBB 2CJPA 2J4FA 5K3EA 5E4JA 2VJCA 1XZEA 5AM2A 2VAXA 3KXPA 2XQIA 1WB6A 4PO3X 5T4FA 1MX1A 5EFZA 3WLAA 2GBCA 5LKRA 4A16A 1SCKA 1L7AA 1UKAA 4E11A 4AN0A 3WK5A 4OUKX 1XRPA 2DR0A 5C7YA 3FVRA 4H7KA 3WK7A 4I19A 1VE7A 4UHEA 4H7FA 1DQYA 1J1IA 3IUNA 3JW8A 4EY6A 3C5WP 4H7HA 1UOQA 4QDTA 2HIHA 5EIAA 3WWDA 4C4YA 1ZICA 1A88A 5AKJA 3H0CA 2WSLA 3HI4A 1E8MA 2WG0A 3C6XA 1EK2A 3WZMA 1WB5A 5AKHA 1DTEA 2BGRA 4L72A 2GBFA 3TGLA 2FX5A 3I28A 1LBTA 4C4ZA 2AJBA 1UOPA 5AOBA 2HL6A 5CURA 2P8SA 3DD5A 4EHBA 5LZ7A 1VLQA 2WUDA 5EHZA 4U2DA 3D0KA 2DHDA 4DNFA 1CUFA 4HRYA 3FVTA 4XVCA 1QOZA 2UZ0A 1YASA
chains in the Genus database with same CATH superfamily
1JMVA 1E6KA 3P4UA 3IJRA 3ZWAA 5J4KA 1JEYA 5JJLA 3KQTA 2X9VA 2APJA 3VHQA 1DEHA 2DT8A 2NXWA 1CUEA 3MTBA 1UZUA 4QAQA 4AO7A 4BLVA 2HMUA 2P2CA 2VUTA 4W8OA 3PUVA 2ZAYA 2ZR8A 4YI3A 1KHTA 4DHWA 3TG8A 1J2YA 1JJVA 3DDZX 1G16A 3B3JA 1IEXA 3TCKA 4KW7A 1JI3A 1T3ZA 1VYHA 1YQGA 1J0DA 1FTNA 1V6AA 1XL0A 2PWZA 2R4UA 3FA2A 5HRCA 4KAAA 4CIXA 1U7PA 3ZCXA 1F48A 3M3PA 1BE1A 3OQMA 1ODCA 2VWHA 4UBMA 2FV8A 2P9FA 4IIVA 3NAZA 1C7RA 1FFEA 1KYYA 2P6OA 1DDOA 3NWEA 4JNCA 4LMRA 1YD7A 3GAAA 4NOMA 2P0AA 2QTMA 4QBIA 1JDPA 3TLGA 1VE6A 1UFVA 1A5TA 3W9SA 1TAQA 4RCYA 4QQRA 5GIOE 1A2OA 4GLFA 1F5NA 2I71A 3U9TA 3LDHA 4D8WA 1YBHA 1ZK1A 1E66A 1U9JA 2A9VA 4HZGA 4LJ6A 4UM8B 3MOSA 2XQJA 3PC2A 3T7EA 5A1JA 2GEFA 1JDUA 1MVOA 2JGKA 2PV0A 3FYHA 1U0TA 1TYBE 5JD3A 5K1ZA 1R0RE 1QVRA 1EDDA 1PQPA 4WK6A 3D5TA 3W8RA 5GJWC 4UVHA 1TTQB 221PA 3S2YA 4DLXA 4KXVA 3KM0A 2WYOA 4R8RA 3SDSA 4E5NA 5LKAA 2XCQA 2B98A 4MRMB 1M8PA 2V55B 1CK4A 3WKCA 3K70C 1BWPA 4H4DA 4EOGA 3KSRA 1NVKA 5JXWA 1BFKA 1XQ6A 4DILA 4HLUC 2BM1A 3RSOA 4XLZA 2XADA 2FGKA 2C20A 2O0JA 4YMIA 5FOSA 1A4RA 3OKPA 3M6XA 3A27A 4K03A 4YV0A 3KDAA 1S2NA 1YR6A 4TS9A 3TNJA 1H2RS 3V55A 3LAWA 4B83A 1Q0LA 4DWJA 2FLWA 2IYQA 4MVJF 3VU3A 1NOKA 1G20B 2X0KA 1LGYA 4HGZA 4LCBA 4LTNA 4NK4A 2V8BA 1GZDA 3GD7A 2BEJA 3CIOA 1N3BA 2PZAA 1AK1A 3PC4A 3K9FC 1BX1A 1GU0A 1K98A 4S2EA 3HC7A 1P4GA 3JAMA 3CUKA 4HD8A 4UAJA 4KAFA 5LPNA 1GZ4A 2XZDA 3ELUA 1G20E 2Y77A 4IL5A 1C8BA 1W0KD 3KB8A 1KWKA 2QORA 2WHYA 2CXHA 4NL4H 2CFIA 4K9KA 3T3GA 1RXWA 3PNVA 3F8SA 3H4MA 2P6PA 2PGNA 3M4ZA 4QBKA 1YFZA 4QPPA 3VR1A 3VYUB 2X9QA 2VLBA 3BFKA 1U7ZA 3BM5A 2DYKA 5ILQA 4RY2A 3D5QA 1Y6QA 4X24A 2H4HA 1TA0A 5LZ9A 1BW9B 1NGSA 2HWYA 4OXRA 3VYWA 1K8ZB 3GCDA 1K75A 1RADA 2ZI6A 3L0YA 4EG8A 4F97A 1X3LA 3PXEA 4M83A 2VN8A 4ASUD 3FNGA 4XE5A 3TDKA 4BYGA 3P27A 2LIPA 1BGVA 2XE4A 2NSJA 4R81A 1YA8A 5LNK1 1ODJA 1ZOSA 1IN5A 1DXQA 2OWDA 5E6UA 5AVKA 1I7DA 1CYEA 2WD9A 1FW8A 3EWAA 3GJ0A 1QIFA 5EZYB 3I9V1 4GI5A 1U2DC 2FHPA 4KRGA 1FU8A 2EBWA 4LCJA 2BUBA 1IONA 2FRXA 2ZRKA 1DG1G 4YJHB 5ALGA 4AUEA 3EPPA 1S7CA 5JZBA 3V48A 3KAKA 1IMJA 1I3OA 1D9XA 2JGNA 4GSYA 2XNSA 5F73A 2JS7A 3E7XA 3W7AA 1A98A 2JIDA 4M8IA 1ZK3A 2Y2VA 4AK9A 5ICMA 1ONSA 1Y3HA 2RHDA 1UINA 1YS9A 4CFSA 2A88A 2C9YA 5LP6C 1OROA 3LCMA 3U4IA 2BONA 3QPVA 2NSLA 3W8DA 4V0OA 2VSQA 1FU7A 3CUEF 3EFHA 4OFBA 4G4GA 1W96A 4LYHA 4U7TB 1FMLA 1ISPA 4QU0A 4WXHA 5JH7B 4DDHA 2G9RA 5AJTA 4LEIA 3DTVB 5J4VA 3WTCA 4ARZB 1O94D 3EC1A 4IV8A 1NWHA 4P4SB 2Q28A 4RK0A 4L57A 1GA6A 2C2XA 4O25A 2QW8A 3RTEA 4EA8A 3LP8A 4A6DA 1O4WA 4CMCA 3A6JA 2RGCA 1XEXB 5DWQA 4Z1OA 2H07A 4DDVA 1DLJA 3IEUA 2WIBA 1FVFA 3ZK7A 2ATVA 3TQSA 3NP7A 3OPYB 4OXYA 1OB5A 2DHEA 3UC5A 1JX6A 1H4TA 1YONA 1Y1TA 1IB0A 2XUHA 3A6EA 4IUBS 2ID4A 3DMTC 3X1XA 3JQRA 3MWJA 3WKBA 5MN4A 1KK2A 2FW9A 2QL7A 3GH1A 4NMXB 4YJHA 4ER5A 4XARA 2VNHA 4HRVA 3FWKA 1NMZA 4PG5A 1KSHA 2A0UA 2RGGA 4OQEA 4QU8A 2MSWA 2Q8QA 2VTEA 3AEUB 3CMMA 5ALWA 3LYUA 2Q5EA 4CM4A 3IYLW 4BNNA 2IU4A 2DUNA 4JOCA 4OIMA 2D4AA 1KJYA 2M6LA 1YJXA 2H9IA 2X0FA 1Z15A 2Q0QA 1B3RA 3C6KA 3KQNA 4U7WA 4YJ3F 4QGFA 3P8ZA 4PSCA 4A0SA 4KYVA 1LRKA 2G0AA 4WHMA 2G88A 3C7CB 2PS9A 3KFLA 4YVFA 3AESB 3RSLA 4CL3A 4YT5A 5CT4A 1WXEA 2GJAA 1TF7A 3DOFA 4IMPA 5JADA 4UCWA 2HNBA 1A96A 2VF8A 3BG5A 2AMJA 4PLPA 3T15A 1PS8A 3OPYA 4A92A 4WIAA 2QQFA 1R88A 3TVTA 3PQ5A 5FORA 1JA0A 1KVRA 1MNQA 3HMQA 5BVGA 1BE8A 3LP6A 2DERA 1B93A 2A30A 3IEXA 3VPSA 2ZBEA 5AOCA 5C32A 4EHDA 1GPNA 4DC1A 4XUCA 5BWLA 2R6DA 1I6KA 4GYKA 3I1JA 4YJ2A 3Q8MA 4D5EA 3KQLA 3QJGA 3VU9B 3ZDEA 5I7SA 3F98A 4QDJA 5F21A 1DOZA 1L6RA 2HRQA 5FV4A 1RRPA 3CX8A 3G5LA 2XXBA 2WD8A 1QIEA 1J0BA 3GEPA 4Z9AA 3FX2A 3WLMA 4DM7A 3TR6A 3AFGA 4M99A 4O4LA 1Z28A 4DDTA 4KV7A 3G5UA 4TV8B 4LF9B 3ZGZA 4YMLA 3NHRA 3L9WA 5HDBB 3L4KA 3E7WA 1EAMA 5DXFA 4S04A 4L73A 4D8XA 5LJIA 5LWHA 2FEKA 1JLMA 4ZU1X 2ZZKA 2QN2A 3L6RA 1OWPA 3GLFB 3TMYA 2XECA 4G5YA 4W63A 3TLXA 3U3KA 3KU1A 3W90A 2IYAA 4NATA 4BWVA 3PKJA 1S2OA 4P1ZA 1EDBA 1KVSA 4FGZA 4MS1B 4WXMA 5HTOA 1Z8HA 2BBTA 5BVGB 3P9CA 1UMDB 2JFNA 2PEZA 2Z3VA 4M7WA 3A3PA 5EXDA 3M82A 4DB2A 2OXRA 4TMXA 4ZARA 2HQ1A 5B3KA 1HR0B 2C54A 2ZR7A 4TZKA 5GOTA 4YREA 2NT4A 3LX8A 1FC0A 2KWIA 2R8RA 1DRWA 2I87A 3N9IA 4FNOA 4WBNF 1LQUA 1YAJA 1C0IA 4L0MA 4ND8B 5AO9A 4LRQA 5GVRA 2AOUB 3GRVA 3RS2A 4CG3A 3R4VA 3NATA 4OHMA 3PRYA 4HVCA 5FOXA 4MCAA 2B8EA 2PUVA 5HF6A 3IT2A 7ABPA 2YIMA 3ZWVA 3TFOA 1VRCA 4X3OA 4U6NA 1IB6A 4BMOB 4TL7A 1IL0A 1U1EA 4JC0A 4GGPA 2V9CA 1J22A 4COOA 1EDEA 2EGHA 3QWAA 2A5JA 3EMBA 1FSSA 1PNTA 4HGYA 2IH5A 2CEKA 4WK0B 2GEKA 4A8JB 2XH8A 4XQCA 5JS8A 1RQLA 3LQRA 1XZDA 1HOXA 1ECFA 3KZXA 4PZEA 2W8BA 3HN7A 5AOVA 3ZW7A 4ZYVA 4RFSB 4UBKA 5FUWA 3H65A 1NW4A 4IIJA 1OH7A 3JZIA 3OHPA 4RJKA 1RXSA 1MG5A 4L4ZA 4LHVA 4QXAA 3RVMA 5KTRA 2QV0A 5REQB 1RPNA 3SJUA 1KZ1A 1R0KA 3OX2A 4G85A 3OCZA 3O9MA 3USZA 4C20A 4DCPA 5M29A 3MVEA 4Z1MA 1WABA 1ZGGA 2GM3A 3JQCA 4W7HA 5T7BA 2I3ZA 2Z4SA 3KT0A 4NZOA 1JV2B 2ZRFA 1S8OA 2O7SA 3QF4A 3SLRA 1Z6TA 1YK0A 5ALKA 3PP8A 4C2AA 5KNLA 3VHRA 1FYEA 7MHTA 3H1PA 3EOBI 1GAXA 2RC5A 5G3ZA 1QRRA 2NWQA 2DFTA 3CG4A 4KK3A 4C7OA 3FDFA 4L2IA 3PZBA 1XHFA 2HGSA 5FOUA 1Q0ZA 5I7AA 4ZKEA 3SKVA 1V5IA 5J4LA 5C51B 1KOJA 3AXTA 3TEMA 2OCLA 3UPUA 7YASA 1SGWA 4PHFA 4LTMA 3SX0A 1TRKA 1NJ1A 4W6QA 2R6ZA 3E0QA 2JFPA 4LY9A 1Z35A 5F35A 4O3MA 2HWWA 4ZYXA 1TXGA 1P5JA 4IPTA 4TROA 4O4LF 3SC3A 2PYDA 5KWEA 3RM3A 3ZCUA 4BAZA 2L2QA 4ZO4A 1K7CA 3NV9A 5TGDA 1Z5VA 1VI6A 1DIHA 2QU8A 1KOLA 3CRVA 1YHNA 3ZDZB 2EG9A 4FDLA 1II8B 2IHZA 2Z2IA 4AG3A 3GD5A 4J0IA 3W1EA 3BWDD 2F1KA 3AINA 2GYUA 2OMKA 2VZ8A 1ZK0A 3R75A 4KIUA 2ZDHA 4RGBA 3FR8A 1Y7PA 2N1MA 3FOBA 1S5PA 2ETVA 4EMUA 2F62A 3KT6A 2GUGA 3WP0A 4I6EA 1AZTA 2H85A 2PN1A 4EVQA 1W87A 3J7AC 2COKA 2OGUA 4GW3A 3RRBA 5KSZA 4AI6A 4MEBA 5FLEX 1EQ2A 1VMKA 2GTPA 1Z4OA 4UDOA 4JLVA 5HFNA 1OH6A 4BY9E 4O2RA 3H5OA 4K86A 5E1MA 5I7OA 1KETA 1QYXA 3Q9UA 1PDWA 1GZ3A 4FDVA 4OKIA 5DYTA 3JZDA 4ETWA 2VTBB 1QTRA 2VJNA 1YVDA 3OMWA 4PSAA 1DT3A 2FW8A 2X2EA 1GQRA 4I4TF 3ET5A 2AUMA 2HMSA 1UL1X 4DIEA 4DLWA 4JX8A 1EUDB 4E1AA 5BO5A 1KSGA 2NVWA 4MGHA 3U7JA 5JMWA 2JB9A 3CW8X 4UULA 3ZLTA 1M2VB 4B3MB 3O2NA 3FGZA 5DM0A 3VZPA 2F64A 1SCUB 3L7JA 1HM5A 2QMHA 4Q00A 1Z13A 3SAJA 3TL3A 2GI4A 2ONJA 1E2IA 2WPNA 5LNK6 3W2IA 3GA5A 2DFPA 4Q39A 2IZ7A 5JASA 2DQYA 1T13A 4X20B 3KYCA 3C8MA 4LSMA 3E18A 5FEMA 1BS1A 2ZITA 3DXYA 4ID3A 4NAVA 5DTEA 3K5HA 5GPBA 4CTKA 3AVYA 1EP1B 3BJMA 2ID8A 1Q92A 1VJ1A 1DMRA 2GN6A 3GRUA 4JT4A 1SM4A 5C0OE 3RSHA 3K31A 1VL8A 3Q7SA 1SVOA 5EZQA 1EK1A 2VH5R 2VTBA 3ZY3A 1CQPA 2W4IA 3H2GA 4N3CA 3G8BA 3CUVA 2W2TA 1U2SA 4GRDA 2NAFA 1E0JA 3RAJA 2UDPA 2OA0A 3H84A 1RIIA 3GLKA 4PC2A 3WRVA 3VNRA 3HXQA 5CX1B 3VJLA 3GNLA 2O5EA 2GM5A 2C9ZA 3HU2A 4G84A 1VXOA 3R3VA 4RKQA 4F45A 3CRZA 3VO8A 1NW9B 2NVOA 5AM4A 2BZGA 4LX8A 1W30A 5BN4A 5AW1A 4CLRB 4D26A 3E22B 5JS2A 3F6RA 3FOWA 3U3RA 1R64A 5K8IA 4FX5A 1RI2A 1KK1A 1CJUC 2BRUC 3W2TA 3GC6A 2PRKA 4G0OA 1N7GA 4GG1A 3T5TA 2Y99A 3RQIA 1S1CA 3QFRA 1FTSA 1F6DA 2Q3CA 3RSSA 1KZGB 4FDAA 3F67A 4BUZA 1AO0A 1OZGA 1GCIA 4FGUA 4M1WA 2EJBA 3FDXA 1P5ZB 4A0GA 4C6TA 2Q5FA 3OP4A 2BYTA 1WL8A 3L7OA 4HGNA 3UKOA 4P84A 3X1YA 1EWRA 1XZFA 1YBVA 2M2IA 4OHCA 1G41A 1OC2A 2R87A 3BYZA 4YFVA 1TK3A 3QVUA 3O8LA 4GECA 4YASA 1Y9DA 5L3RA 4B33A 2AQIA 5FTLA 1GGHA 3I5XA 1UJ2A 2HK8A 1CJVC 1XAIA 1O5OA 2IZ0A 2H92A 4UUAA 2ZQZA 5M2QA 2WFAA 5HK8A 1PX2A 4QQFA 5LQUA 2CLLB 4EGJA 3B2QA 3ED5A 3HCAA 2PWBA 1VE3A 5DEOA 3FPHA 2GB4A 1MZVA 4FTWA 3RABA 4XYMA 3FCAA 1W1IA 4BNZA 1N57A 1QS0B 1ZHFA 2IDKA 5JU6A 1JKIA 2J9YB 3G2HA 1FXSA 1XV5A 3AM1A 4BJ6A 2VA9A 1E2PA 3O38A 4J90A 1OIWA 4QUGA 3A32A 1OIVA 2OV2A 3V2HA 2OORA 2WWWA 1PK8A 3GRCA 4KXWA 4LYYA 3GFGA 3WAJA 2IYSA 3NETA 2QAGC 4QA9A 4ZMRA 4IJVA 4URUR 4G5FA 3K1YA 4U5XA 2H16A 2B8JA 3UATA 3E03A 2ZW9A 4M6WA 1G5FA 4FOTA 2VAVA 2VDNB 2GS9A 5JSZB 1OILA 4TMFA 1YQDA 4BDTA 4ZC1A 4E7OA 1W35A 3DKKA 3KQKA 1YT5A 1IUOA 2J07A 3O6VA 4EFMA 1VKNA 2EFYA 3KOMA 1ST2A 1KO5A 3CPSA 2P62A 1PF7E 4U2EA 1AT1A 1QRSA 1Y6ZA 4GR5A 3LOQA 4YAIA 5BQ5A 3VC2A 1E59A 2RHBA 1UFKA 4YN3A 2ZIFA 3JYLA 1P4JA 2NUTB 3UHJA 4II2A 1MX5A 4FWIB 1C41A 2C4VA 2ORVA 3JXEA 3TUJC 5A04A 1X9HA 4IDEA 2YMLA 2G67A 4I8IA 4L51A 5DX8A 2D8MA 1WMBA 2XMQA 3LQFA 1OBOA 3BBLA 3F6CA 4KX3A 5J2TF 5B1EA 1T2DA 1Q7GA 2OZPA 3EEOA 3I34X 2Z5GA 4C0WA 5KNDD 3NB0A 1RS0A 3E5HA 4B4VA 5CIWA 3U4MA 1EJBA 4L0DA 1XP8A 3DLBA 2PSJA 3FYUB 2VG8A 4L8YA 2V6GA 1MH1A 1SHLA 3T9BA 2IA5A 2Z8XA 4FS8A 4MQEA 3TX6A 4R2KA 4M9XA 3X2SA 4E07A 5G0UA 1VZ2A 3BAZA 4S3MA 3P2JA 4B0PA 4DIUA 2IUTA 3O9VA 5EZSA 2PX8A 1GU7A 3TQRA 1VYUA 5B1DA 4G0VA 5KTMA 3K7EA 4LXGA 1NF9A 4XFJA 4KR7A 4MS4B 1GY8A 4ZRDA 4LJRA 5DGIA 1HDIA 3QSYA 1QGZA 4AN1A 2FUEA 4XSGA 3DEYX 4P08A 2QTVA 4K1XA 4MB6A 1XA0A 2D1QA 1CIPA 1MLDA 1T3GA 1TCAA 4FS3A 4OHUA 5FXMA 4CIAA 1THZA 4ZCTA 4D43A 1ODTC 2FZKA 3E27A 1YRQA 1HEIA 3PFNA 3NT4A 3B2EA 3NM4A 1RMTA 2TMKA 2B0JA 3R24A 2JD0A 3QVOA 3WLQA 2C4MA 3DOCA 2VDKB 1QG4A 1R5BA 1TZMA 1M7HA 3G13A 3ICQB 3NEYA 1A8SA 1QUEA 3QV1A 1NJFA 4YYEA 2CV2A 1E0AA 3WSWA 5K45A 3BRSA 3K9CA 4MJ3A 2GA8A 4BQEA 3R3WA 1N4DA 3I01M 1NC3A 3IEMA 4TLLB 1ZVMA 3DHEA 3ZNNA 3UBTA 3T7SA 3ZX4A 2HU5A 2MHCA 3G2QA 1USIA 1P81A 1QHHA 1OZ0A 5F4BA 2X19A 3DHYA 2B4AA 4DTCA 5JNRA 1C81A 3PQ4A 3DOIA 3U09A 3FYSA 1RC0A 3V1YA 5COBA 1V1RB 2V3VA 4CKBB 1IZ0A 4ZCIA 1BU5A 3HXLA 2H54A 1UMCA 1L7OA 3GLQA 1YB6A 4J7CA 5AVSA 1JFTA 1LPNA 2ZRPA 1VJRA 1RHJA 1RI5A 4ZP1A 2HTFA 4CIBA 3BFVA 5J23A 3WYAA 1ZMOA 2B4KA 2IYXA 4ZU6X 3QTTA 2HM7A 2OBXA 2NYVA 5BSUA 3S3TA 4CF5A 4WT7A 1B8NA 1H1LB 5CNJA 4L5AA 4KITB 2MIIA 4YUWA 5CAEB 3TD9A 2AZ4A 4OAPA 2XY4A 4BGUA 1BEZA 2RBKA 5BOSA 3THXA 3LUCA 5G1PA 4F85A 4EG3A 1NW5A 3PF9A 2X0IA 3CKLA 3GEHA 4XD2A 4PPGA 5JARA 4D2IA 5DXJA 4ZD6A 1DAGA 3E9NA 4UE3S 1ZVVA 3BE5A 2PX5A 2WP8J 4JQSA 2Q7XA 4UM7A 2I4MA 3C7AA 3ZLVA 4Q47A 3AHFA 4L9RA 3FTCA 5I9LA 1RKVA 3B60A 4NP6A 4FYXA 4ZAZA 1M2NA 5ALMA 2A1UA 4OJKA 4RJIA 3C6YA 4EP1A 3TVYA 1KIMA 1ZCZA 2EZ9A 4KYTA 3KVVA 4TYWA 1D2GA 1TZ2A 3IP1A 1D1TA 2B2CA 1FMCA 2VWQA 3A4VA 4N65A 2DLNA 5EP2A 5DGXA 1H2EA 3H2ZA 3I12A 3IKTA 2DXIA 1CF4A 3SJZA 3ENVA 1V95A 4WN3A 1RJ9A 1M0TA 1QGUA 3T5GA 3IQFA 4NC9A 1L5NA 2HWUA 4NQRA 2IDZA 4AG6A 1CNMA 4ZCPA 2OSVA 3TUIC 2IV2X 5JATA 4WI1A 3B3FA 3OUTA 4HX2A 4B75A 2P6MA 3CINA 1P7ZA 3FHOA 2VATA 4LYAA 2VWPA 4ZAXA 1X7WA 2DY1A 1I1QB 2ZUDA 5B1HA 4EGFA 1X7YA 3HDJA 1HZZC 4H7IA 4EGQA 1L4UA 2ZYSA 3BTVA 4TUYA 4TVKA 3OT5A 3SR4A 4IOLA 4C89A 2H4FA 3K6SB 4GNRA 4CDMA 1EWYA 4TWRA 5EAIA 3ROXA 1XU7A 3FPSA 3I05A 3KEMA 1CUXA 4I81A 4PAQA 5EIXA 1T2AA 2XHEA 1O1YA 1ZONA 2XGMA 3MZ0A 4ZFNA 2A5FA 3WQSB 3CSDA 4HLNA 1EGVB 4CUKA 4HDRB 3T7CA 4EUKA 5KQSA 3EISA 1FNMA 3A1UA 2C3UA 3FUXA 1JHOA 2G83A 4D0GA 1RM4A 4JUBA 1YDEA 4RVSA 4NYIR 4B44A 2HHHB 2ZJ6A 1QX3A 2C2GA 4ZQBA 5GIPE 1JZSA 4Z2YA 1JQLB 2NSDA 1A4XA 3NS7A 4RZ2A 3RT9A 2WD7B 2R1VB 3USCS 4RKEA 4F2GA 1PS0A 4XWOA 2QE7A 4WFQA 3VH2A 1P7PA 4DV1B 3LV8A 2XE7A 4RKRA 3KJNA 1WKVA 3DE7X 4KMOA 3RJMA 4M60A 3WS7A 4AUMA 1G2OA 4LGMA 2DKNA 2RJNA 5TVKA 3WGTA 1QVWA 3OJLA 1NW7A 1D0VA 1ZJZA 1J7JA 3JWJA 3Q7IA 4M7OA 4Y6LA 2A67A 3EAGA 4AD8A 4CQMB 2IX3A 4TUYB 2UVQA 1BOOA 1SXJE 4Q3LA 1LI7A 2VT6A 3JR7A 3O1LA 2GARA 4GXQA 2UVDA 4X6XA 1NX6A 2ZRBA 3CEPB 1D2NA 1ZP6A 1CUHA 1NW6A 3LS2A 3GFOA 2M98A 3OCJA 4M38A 3T7IA 1L4NA 3W4IA 2R8XA 4EI2A 4YLYA 1EM6A 1NSYA 4CFZA 1X8KA 4EG5A 5LR6A 4JJIA 4D80A 5ANRB 4HYEA 5BXYA 1K0UA 3HA2A 1T8UA 2XKBA 1AO3A 3EC7A 1PNRA 4CGYA 4XKJA 4WL0A 2CDCA 5TE9A 4Y2SA 3TBKA 3TS1A 5AI4A 1XWFA 3WJ2A 5CVDA 2R1VA 1ODLA 1L9XA 1IFXA 4K26A 3RLIA 4PHHA 3E84A 2AZDA 2QRPA 5C5IA 5ENVA 3F4LA 5G4LA 3FLAA 1I32A 2PBFA 2DQZA 3TD2A 4DLTA 3GQBA 3TSYA 3I4LA 1RP7A 4LW8A 3ND6A 5JCOA 1GEGA 2GBIA 5J2UF 4Q7MB 2JH8A 4DKXA 4EGAA 3K0HA 1ZNXA 3DS8A 2GLXA 1W4LA 3UT0A 1PTJC 2Z9DA 4PICA 1NF3A 2A58A 2VPWA 1E18A 3H4IA 3WG9A 1C0LA 4S2UA 3VJRA 1UZLA 3D3WA 2NO5A 2WHEA 1EGAA 4GIBA 4H7DA 3ETEA 4R69A 4YCJA 5D51S 2V6FA 2VTVA 3VVLA 4DOMA 4HNAB 1KY2A 1GNTA 3OJ0A 1XTBA 3E2IA 4XUEA 4EGCB 2PLAA 1P2UA 2QGZA 3ED1A 5IXSA 4ZPXA 1XRLA 5DLQC 3PLAE 2BSAA 1NYTA 1ZVJA 4GBJA 3IKLA 1Q6ZA 1X2EA 2VK1A 4GZ6A 3TG2A 3QXGA 4BV2A 2GD6A 3ZNQA 2EWWA 4OLBA 1XU9A 2WY2D 3QX3A 1JSLA 1H2YA 3ETLA 3FPBA 4JOBA 4LBVA 3TOSA 2CJWA 4ECEA 4ZN6A 1YQUA 2HQRA 5EWLA 2LCQA 3U7QA 2F1HA 2J6CA 3EIHA 1XU4A 5IVKA 5FFMA 4EJ0A 1YOBA 3I0ZA 2O3RA 4PY2A 4QUAA 2C0QA 2J30A 5JALA 2WKSA 3QNUA 4TKUB 4B9AA 4Z7OB 1FJGB 2AOTB 3Q12A 4R05A 1LQ2A 1FFSA 1QB7A 3C1OA 4P81A 1BGXT 4R16A 3VXKA 5HSGA 3N0XA 1F0KA 2CBZA 1UDXA 2BT4A 1O58A 3PHGA 2R00A 1MB9A 3IP3A 1B15A 1DRUA 3F73A 1P72A 1WVGA 3ZUPA 3CIFA 3NXSA 3WHLA 4A8JA 1IUPA 2NGRA 1EK5A 3GJZA 1A3CA 2CL7X 3ME5A 1ZBQA 2YINC 1FFXA 4HRAA 5AM3A 3KETA 1H9AA 2HF9A 3VI4B 4QO8A 4B6JA 1Y4SA 4O29A 5EJEA 3EPHA 2HJRA 2Z9BA 1VM6A 3GT3A 3U0VA 3ANTA 1CS0B 4JY7A 3ZGOA 1R0XA 4D3ZA 1V7ZA 4RF5A 1QAQA 5E7QA 1GR1A 3I92A 3TZKA 5F23A 3LD9A 4A27A 2BKAA 1CJSA 2OHJA 3IUJA 3TDNA 4DIFA 2D5IA 1UANA 2H1CA 3DYIA 1CQXA 3VVMA 2RGEA 1EQAA 1ENZA 4P54A 3A04A 4MEAA 5K05A 1F17A 1P75A 3DE3X 4D44A 3SQOA 3NDJA 3N2KB 2IT1A 4TKUA 4UNPA 3U7QB 3IT0A 1Q21A 4LRYA 2FU5C 4JJZA 1UC4B 4IGFA 4PCAA 3TQIA 4TV8A 1QK3A 1SK8A 1UBUS 3LQKA 2P0EA 1OI7A 4JZYA 2W58A 5DASA 1BQ3A 1GDHA 1FZQA 3C2QA 4LRXA 5ITZB 4JX9A 1YS1X 1Q14A 2IYTA 4QRDA 1E0DA 4JAVC 2D13A 1THMA 1SVKA 3NOVA 3AR3A 1EJ6A 2ZSFA 4EYGA 4WUVA 1NPTO 4GBMA 1GPWB 3I6QA 3AW8A 1QHGA 3OT1B 5KNCD 1MOPA 2HI0A 4K1LA 4MV6A 4JKYA 5J58A 2RCYA 5HYVA 2QYSA 3CUSA 4PYOA 2EV9A 1LLUA 2W11A 3OM0A 2AXPA 1XSEA 2X0RA 3TECE 3BE8A 2LR0A 3U7EB 3OE4A 5BWMA 4FC6A 5MN6A 2DETA 3BF8A 1KERA 2IZZA 2ZIGA 1NTRA 3QE3A 1TJYA 9ABPA 3H75A 1JKMA 4ZI7A 5LU8A 3C7KA 1UP4A 4XQGA 1Q84A 1RTKA 2FQQA 3P9ZA 1DO2A 2VOJA 4M0FA 3C15C 4JA2A 2GSWA 3O91A 5M7EA 3T1HB 3NIDB 2WWXA 1G8GA 2PZEA 1VL6A 3PFHA 3AIMA 4M8SA 2JI6A 4LISA 1ULBA 5B58T 4CWAA 1MAWA 4F93B 1LWNA 3PPXA 1NXTA 3PEEA 1P2VA 1X70A 3PUZA 4MPJA 3V3TA 3PR1A 1E3WB 4X62B 3NONA 1CY0A 1GXSA 4Y6OA 1C7FA 3ASZA 1HDOA 1IJEA 2N0SA 3H4TA 3N0TA 4A15A 1HI9A 5AVTA 4F06A 5J43A 1V5EA 3LBHA 3G82C 2YZMA 3E58A 1RQNA 3EXEA 4ZCRA 2P4SA 2POQX 3KZVA 4FYWA 1R6AA 4KWHA 4RD3A 4C5BA 5A0VA 3LY7A 3GPIA 4GMGA 2A0KA 4Z3DA 5TRTA 3WGLA 1EEXB 1K2WA 3EA0A 2JNWA 4XGRA 4YHHB 4PIVA 2HKIA 5BMVA 4Z4EA 3BH0A 1G5IA 4FSXA 1XPJA 2FZGA 3IBGA 4ZA2A 3HDGA 2V1UA 2V7GA 2O6HA 4NTZA 2GN1A 2Z56A 3ACDA 2IYEA 4R71A 3MTDA 2E3JA 1WQ3A 3OIDA 4HUQB 3CFYA 3UJ6A 2V8OA 4HEQA 1J9ZA 4IFBA 4I0WB 1YSCA 1XD2A 3ELBA 1V8FA 3TTUA 3V7YA 1Z7EA 1GZHB 1XEWX 1BVYF 3H42B 1PYGA 1E58A 2AW5A 4Q1EA 2VDVE 4XR4A 4OLAA 1URPA 2PSFA 3DBOB 3GP3A 2FN9A 5ECYA 2XJ9A 3H87A 1C3OB 5EUBA 2JD1A 3IESA 4OP2A 3HV2A 4X91A 3DW1X 3N2GA 3WQHA 5K6TA 1EDZA 2QV7A 3E22A 1MV8A 2FJ0A 3ZU3A 1TCCA 2Q2WA 4EG4A 3RHZA 1UQRA 4G4SO 1XZNA 2OKCA 5K8LA 3HHEA 2X7XA 2QQEA 3BGIA 2GESA 3RR2A 4YP6A 1U5AA 4D92A 2XQKA 3FB4A 4M0MA 3UICA 3P4YA 3UC9A 4KHPB 1J21A 3AL0C 2P75A 3V9PA 3F90A 8MHTA 2B37A 5THQA 3U7HB 2QMZA 2YOFA 2AC4A 2QZPA 1ATZA 1T2FA 3GY0A 1W0JA 1F3OA 3B78A 2UUAB 3GROA 5GOZA 4FONA 2OQIA 5FFFA 1QZ3A 4AZ0B 3SZOA 3N6RA 4HGPA 3EH2A 4WBNB 4M21A 1ACJA 1GZ6A 1BDBA 1GN9A 1VIAA 4FZ5A 2HCTA 3DBLA 4Y0NA 3I6BA 5IU6A 3K71B 1SH7A 3AJEA 2UZ4A 3R7BA 2BISA 1KXJA 3ZK8A 3CO5A 4C4AA 1XN1A 2JF0A 5EE3A 5EOVA 4YUYA 1TM2A 1JPVA 4JJAA 2QVXX 4OH1A 5TQ0A 1PR0A 5P21A 4X94A 1NJSA 2VDOB 4JIGA 4PSKA 1M2VA 1MDFA 2JAXA 2R2GA 2ZIZA 3ILXA 4NHOA 4RMIA 4KQ6A 4YECA 3U3JA 1PFWA 4EF6A 5A4AA 3IIKA 3E15A 2ONCA 2J6IA 2WSBA 4ILEA 3T7DA 4FNGA 5FHRA 1Q1ZA 2PKXA 1NJ8A 3GLGB 2ON6A 1P29A 4AP5A 1I4WA 4PO1A 2WSYB 5CVJA 3D2BA 1L7DA 2H0QA 3PJEA 2H51A 5EJ9A 1T0BA 2VHVA 3DOOA 5CX4A 4ARUA 4JUCA 4JFRA 2HMAA 3S2IA 4YH1A 4C0JA 1WR8A 2Q50A 1F0PA 4JQZA 4XB6B 1XQ1A 1NUHA 3EVCA 1JS1X 1OH5A 3EDMA 3EY9A 2Y1DA 3H86A 3R1IA 1TTTA 4MWOA 3CRW1 1AG9A 1J8QA 1CQIA 5JD5A 3W5DA 3I5YA 2XGJA 1Q2XA 2WVAA 4LNHA 4BX8A 2AKEA 3HMKA 1XTUA 3TZHA 4KLAA 3ZHVA 1UKYA 2AZXA 3CV3A 4GXRA 1ULSA 2NXEA 1H6AA 4K6KA 2D0DA 2KBEA 3TDMA 3IDZA 2QLJA 3GCGA 2QVGA 5L3QB 1AMUA 3MJFA 3LUPA 5ALOA 5FTMA 3VDNB 2O52A 2XEXA 2BP7B 4RMNA 4JI3B 4F0JA 2J8ZA 3TPZA 3FCEA 1T9GR 2WI8A 3BXEA 4QPJC 3VZDA 5J59A 3MS2A 3H2IA 4L74A 4AX8A 1BJKA 2O20A 1OZAA 3PFCA 3V8VA 1O77A 1NQWA 4D6YA 3PPIA 5B58C 4HAYA 3FHCB 1M1NB 2YZGA 5L7TA 3Q2OA 5C1BA 2CJYA 3HDHA 6REQA 3SVTA 5TXGA 3KTOA 3BRCA 4BVJA 5IYZF 3IJ5A 4MQUA 2H18A 3CUTA 4LBWA 2YHUA 4OG2A 1MC8A 1TNDA 4HGRA 4Q3EA 3KQMA 4RPLA 3SYKA 3DP9A 5NULA 3B8HA 3M5PA 4RZUA 4JXXA 4LZZA 2PH5A 4P38A 4DFDA 3X43A 4TOIA 1OFUA 3OFVA 2GAOA 3DNPA 4KQIA 4IIEA 5D2CA 1KJ9A 3NYIA 3C6MA 2NP6A 3BMQA 1I24A 3WKDA 4YRAA 1UBOS 2A4MA 4MQLA 1RRGA 3VC1A 1CQIB 2JLYA 3DZKA 2J59A 2IUUA 4UHCA 1DHRA 2O7NA 4JGGA 1E2UA 4LK2A 2O5RA 1JHRA 4NY1A 1JH9A 1G8SA 2QD2A 2ZSAA 3K32A 4V38A 2PUAA 3UUFA 3C6BA 1X1EA 2PTHA 1QUFA 3AHEA 3BMNB 3C1UA 4LE1A 3AL2A 4LKOA 2Z5FA 5EIHA 2Z6VA 4EL5A 2QQGA 5DTIA 1GQOA 1DMSA 1XTZA 3E3OA 4RSMA 4Z4HA 3PXXA 2K87A 3K1AB 4OI1A 3IILA 2FDXA 5JJBA 3QMPA 4Q7EA 1JALA 1QLWA 5EFOA 3F8TA 1P0PA 1TW3A 4BRUA 1U9ZA 5BN3A 2QNIA 4RV5A 3PQ7A 2O0KA 3F6YA 2GMWA 2VQ6A 1MRZA 4BMVA 4MGKR 2V7XA 4BFCA 2W6JA 3S8YA 1ESEA 821PA 3MBOA 5TC4A 1LVGA 2GRAA 3PFGA 3AVQA 1F8GA 1E1KA 4IDPA 1PR4A 3CWZA 1LX6A 5SY6A 3ZD6A 1KO7A 1LH0A 3MUFA 3PUIA 1WDLA 2R8PA 4O4IF 3UCFA 4I2VA 1XDWA 1XMPA 2DWOA 4ZICA 4Z0NA 2G0TA 1J0AA 2JKZA 4BV3A 3H9GA 1BROA 2VCHA 1N0UA 2X6QA 2YMQA 3QWBA 4TKMA 3LIPA 4OA5A 2C1EA 1M76A 3B1XA 3HR8A 1LSOA 4BX0A 4EBFA 2O6LA 3AL3A 5J2UA 4UUPA 4FR2A 4H15A 2YIVX 1WWKA 5CB4B 3TTSA 3W34A 4R1QA 4MB0A 2ASEA 3BTSA 4BNWA 1PJSA 3ZTTA 2IYZA 3NYWA 1ZMXA 2ADOA 3RTAA 2E85A 3WK4A 3KVRA 1BYUA 3BQ9A 4PHCA 1UQTA 3TTXA 5KOJB 4GOXA 4N0QA 1JJAA 1WEHA 3W4KA 3OKAA 5C80A 4QXOA 4O02B 2HRCA 2NW6A 2A14A 3LZCA 3R5KA 3ZY4A 2FCRA 1MD9A 4BO1A 2JBAA 1MAUA 4EF4A 3A6ZA 4FOSA 4O5OA 4D6XA 3KQUA 1NV9A 3PDUA 4LRWA 1OE0A 1W1UA 2GEVA 1XK6A 4K9LA 1DC5A 4ZV4A 3HJBA 2H3HA 5IHXA 1TEVA 1N25A 3CLKA 4YIKA 4LKRA 2I7DA 3DAYA 5T41A 1AXRA 1RM3A 2IOYA 1TEZA 3O26A 1XMJA 2D1RA 4J0CA 1T9BA 4EPVA 2E5LB 2YJ4A 3QUQA 4B43A 3SE0A 3TRIA 2YN0A 5H70A 3OEYA 2EZTA 3F5QA 5K03A 5EJ8A 4ND3A 3AI2A 6ADHA 5J1SB 2WUGA 1SKYB 3FD8A 5DHTA 1YR1A 1W4BA 4A82A 5IKOA 4R7TA 4HWSA 4JEMA 3I3OA 2B9EA 3HLTA 3LWZA 3PKZA 4PEVA 1JJBA 2R2AA 3N5KA 1TCBA 4JVMA 5DIFA 1T29A 1BC5A 1LU9A 1SRQA 9ATCA 2EEZA 1ECBA 5AI6A 4DN6A 4EUNA 2EFJA 4RKFA 2Q2NA 1IOWA 1TJ5A 1SKYE 4CT5A 2ZSHA 5T57A 5FT9A 3RC1A 1DX6A 2RHLA 3CH5A 4AJ9A 3EHEA 3RKUA 3CUUA 3B6EA 2HJGA 4H08A 2CD7A 1Z6XA 2IPLA 5B4TA 1QP4A 1NF2A 1GPYA 3ZHQA 2QRVA 4CJXA 4PU0A 1QGOA 1SOUA 1H2AS 2V7EA 1I3NA 2VPXA 2Z2JA 3I4FA 4I9NA 4MAAA 3TZCA 1ZUNB 3ORYA 3U31A 2PQ2A 1DWUA 2VNAA 1L9KA 2FMTA 3W3AA 4ML3A 4R84A 3R5TA 4F04A 4H3VA 2OGZA 1PVVA 1WTCA 4DM3A 1AKEA 1BCSA 2Q6TA 3PDWA 4PLFA 5DT2A 3FWPA 2QLTA 1I5OA 1ZD4A 1ZGCA 4KYUA 5B2ZA 2LKCA 4RA6A 3ZU4A 2YY6A 3TVDA 3MMZA 4EELA 4IOMA 2J09A 1H5NA 4LGYA 2O2EA 5BSHA 5KJCA 4K7JA 2DMRA 2P9QA 1RRKA 4QGBA 4B3RB 4H17A 4IHJF 2XOXA 2B35A 2I7VA 4XIYA 3LDFA 3T8YA 1NP6A 3NRCA 1LK7A 5KQRA 1G60A 5CUQA 1E8NA 2YWRA 1V11B 2D5LA 4WZ6A 2FN4A 4LECA 1I2MA 4M3NA 1IQUA 4MVJP 5A5FA 1N33B 3GI1A 1CIJA 5C1IA 2OYCA 4DCUA 1ONBA 1W88B 1GUZA 1FS6A 1Q83A 3DUFB 3H11B 3LJKA 4B73A 1GKUB 4XGIA 2UAGA 1FIUA 2EJCA 2ZI9A 3PDJA 4QREA 5CLLA 4L5BA 4EARA 4XLTA 4J1TC 1MB3A 1SIUA 3AP3A 1UKBA 1R9GA 4RK5A 1TVCA 4TM8A 2IUEA 3UUWA 1HDYA 1UT5A 2W6PA 4UPVA 4URVR 2EF0A 3UBMA 4V2UA 1DO0A 3P0JA 4ND1A 3GCZA 4UBOA 2L19A 2BH9A 3LT2A 4M46A 5JSQA 4RM3A 4TVOA 4HZUB 2PCLA 3FETA 2A94A 4B17A 1I4DD 5HRAA 3SR0A 1OFHA 5CDYA 2FPIB 4QFMA 1D7AA 4CRWB 2AG0A 2J9RA 3V8QA 1NBWB 1JU3A 4EUSA 1QSGA 2JGAA 3FM9A 3AKDA 4A2WA 4GLLA 5A2QA 2J87A 4H59A 4KPUA 4ZGGA 2JK1A 5CXQA 5EE9A 5FFNA 2Z83A 4G1FA 3K2EA 4QEDA 2H7CA 3ZU2A 1FDIA 2OR3A 4ISBA 4XWTA 5BQOA 3TI9A 2E49A 1IY9A 1CHNA 1W76A 3TTTA 2V3CC 3DZBA 2D5BA 3PHIA 3J81k 1EVLA 2ZVPX 5FA5A 2J3EA 3AFNA 3V46A 1J9GA 4NPHA 3JR3A 3TLGB 1J06A 3IH5A 4XH9B 3V1MA 4BP3A 4X90A 2NZUG 3GA0A 2ZYAA 1FUEA 4QUBA 4RVUA 1UWKA 3ULKA 2I55A 4C4TA 1T5DX 2GXAA 1LLFA 1QV7A 4YALA 1YGPA 2QUKA 2CHGA 2XF2A 3S2UA 1ZM4A 1CS4C 1XVVA 4F1KA 5AKGA 1U6JA 1Q11A 1ZVKA 1ULTA 2FK7A 2OCIA 1UBGA 3MLAA 4JYPA 2CUTA 3V4ZA 4OO3A 1SXPA 1DKQA 1ZD3A 1AKVA 2BR4A 3WNCA 1YHZA 1T2VA 1SU7A 1GUAA 1HMYA 3L7IA 1OKKA 4O8ZA 4YMUA 1B74A 2OLEA 4TRMA 4L85A 2V6JA 1QP0A 1PCXA 3OQ6A 1WZ2A 1Z34A 1AUXA 3LNCA 2XD4A 2ZUCA 4TM7A 4TT8A 3UY4A 3VZBA 4D4LA 3NHPA 4ZJZA 3AVWA 2GPYA 4OGFA 2VJMA 2I6TA 1LDYA 1NXQA 3QKRB 4HTFB 3EZNA 3EARA 4FD2A 4O63O 1R5NA 4R1LA 3TO5A 3U17A 2BCGY 2PZLA 4PPFA 4F92B 2IZOA 3LYLA 1ZM3A 4CG2A 3IUSA 4WKOA 4I9UA 3CLSC 2GR9A 2VXBA 4WACA 1L7EA 2XUGA 2PY6A 3I9NA 2DQKA 1J49A 1WMSA 1F06A 5L4NA 1E60A 4JBGA 3QI2A 3DFZA 1QDEA 2P68A 3O1JC 1X1RA 5AI8A 4CF6A 2MSEB 2P69A 1NBOA 2RB5A 3NALA 5B4VA 3K53A 5IFKA 3MD9A 2J9GA 2K2QB 3AYZB 2JARA 4QYTA 5DHRA 2QXTA 5EJIA 1V3VA 3DDOA 3WWOA 3X1JA 4ENVA 4YR9A 1Z0KA 1GYPA 2A6PA 1A7KA 4FGLA 4N8SA 1BTOA 5KQMA 1US8A 2CXPA 1CS0A 1S2LA 1PLKA 1VL2A 2CMKA 4UJ5A 3T1QA 3OEEA 1HH4A 1Y7HA 1SCAA 3OOEA 3OF5A 1MC5A 3GGCA 4I5DA 2YFHA 4GBED 4PWYA 2JFYA 5IAEA 1RYBA 3C5CA 3RDPA 3T06B 1E5TA 1Q74A 3SOPA 1FDWA 1OAOC 2OCDA 1L7PA 2J7PD 2OOSA 3A4TA 3CLVA 4V3BA 5T4EA 3U2QA 4HTFA 2QHXA 5A9TA 3OHMA 4WJZA 4NICA 5BQPA 1VC2A 4KIWA 5JYDA 2XZTA 3N2KA 1XJWA 1L4HA 3NHWA 3NC1C 1DV2A 4RHCA 1TJ4A 2YV3A 4P4SA 4MYCA 2VDWB 5ALUA 1V71A 3JZAA 3KT8A 2XITA 1G4AE 1H69A 3KLBA 2FXVA 3JRXA 4Q48A 3UWKA 4DMKA 1EBUA 3LI2A 4D9FA 3N8DA 1S4QA 1EB8A 2I1QA 2JZOA 4IZOA 5JJKA 2ZP1A 3ZUGA 1X7ZB 3QVGA 4NCKA 3JQ6A 4D9JA 1T8RA 5JAZA 1H1DA 1NX9A 1DBPA 3ZXUB 3H7AA 4RSHA 2GN9A 2K6GA 2NZWA 4JEIA 1XELA 1DC7A 4MUGA 1QDUA 4H31A 4G24A 2CNWA 5JZMA 2C2ZA 4Y9DA 5E4YA 3LDGA 4DBVO 1IC6A 4OM8A 1OFVA 4JOSA 3H2SA 3FWZA 4JHXA 1NF8A 2W93A 3GMTA 3JASB 4RPCA 1ACLA 4J1NA 1FP1D 2QI9C 3M6MD 3GLRA 4M9CA 1ZR2A 2BJWA 4PLCA 1RXVA 4DY4A 4GLBA 4C0XA 1TTPB 2H65A 3B9PA 1TMOA 2A0FA 3FUCA 4P82A 3ILVA 1U2DA 1ZK2A 4F72A 1CUDA 3KEOA 3NPAA 2RG7A 3OZXA 3TOZA 1DBQA 3GBSA 2PRYA 1W34A 3DMTA 3JVDA 1NY5A 3RWBA 1ARZA 2KW5A 1NYQA 3OZTA 4GI1A 1X92A 1SUIA 2OESA 2P78A 2QN9A 3NTRA 3RREA 3S5UA 4BE7B 2ZKIA 4IDGA 1XTRA 2ZAGA 1XJ5A 2GPTA 4EPWA 5DVZA 2I7TA 4DR2B 2AKYA 2XXAA 1TMYA 4D9EA 3TEJA 1ZGAA 3T3NA 4EB8A 2FPKA 3CT4A 4WLNA 4LSZA 4DARA 3EZFA 2DSNA 1IIBA 2FH5B 2RHWA 3WMRA 2R751 2C4NA 3V8PA 2DUUA 4N5MA 2WF6A 4BWYA 5LDGA 1NR5A 3U4QA 3RFFA 2O2GA 2HSEA 1Q22A 3I04A 2XPCA 2ZJYA 4RVOA 7MDHA 3QQ5A 1PKXA 3G2LA 1JIXA 2WVHA 2PPVA 3GZTB 2G63A 2VJPA 2YS6A 4XOIA 3PDHA 2C5SA 5LP6A 3IBTA 4RJ2A 4HNTA 4UD6A 1YB5A 4UXHA 1DPGA 1L4LA 4IYJA 4N4AA 4N3AA 4I46A 3S2GA 3K0AB 4ZCMA 2YIJA 5C4IA 3AZQA 2VPTA 4HATA 4IJQA 4FHGA 4YFYA 2EAUA 4HSEA 4TV9F 5HILA 3JYNA 2OUIA 2VLIA 3GEMA 3BICA 4MS1A 1TYZA 4Q3AA 2OCAA 2JGEA 2H1WA 1Q77A 4DLRA 3QELA 4R1TA 2XDQA 2GO7A 4KXMA 2QA5A 3MCAA 3O31A 3QHAA 1QNFA 3E4DA 4O1MA 5AD1A 2DFVA 5BURA 2ZJ5A 4P0TA 4HAWA 1PT8A 1IZ7A 1AOXA 1Y1KE 2ZJOA 3L6EA 1GLVA 4XW2A 5FLKA 1YVEI 2A9JA 1RYEA 4Y1GA 1M1UA 3OT1A 1KMCA 2JRLA 3MNFA 5BQ3A 4BFSA 4OB8A 3LQYA 3IELA 1HE2A 2CVHA 4FKBA 4ZGBA 3NOOA 1G2IA 1WXXA 1JYSA 3HR7A 3QENA 3B5JA 4LE0A 2QTBA 3O7WA 4MVYA 2Z3ZA 4NS1A 4UZEA 1YCFA 2QE6A 2X15A 2O2CA 1USUA 4NAUA 4UVEA 4X93A 5B1SA 3B1JA 1RI1A 2B5OA 3SC6A 3K8OE 2WAYA 2XQFA 3SEZA 4BGVA 4M0LA 5A3SA 1D8TA 4KPGA 2VRWA 2OBFA 4JLWA 4KSBA 3VOTA 1LC3A 2G8LA 2GLTA 4S05A 5LYJF 2VYQA 4EY4A 4PYJA 3RTBA 5BW5A 4J7XA 1UMDA 3BRWA 3FW1A 3KIPA 5TS3A 1X87A 3D31A 3W6ZA 1ZIDA 4HEA6 4TKVB 1C0PA 1LB1B 3R44A 1CEQA 4LYDA 2AOXA 3M2TA 2JI9A 3R8XA 2CSXA 1VLMA 2JW5A 1W0JD 2XRFA 1N4AA 2WHQA 1TM5E 3BDAA 4MGIR 2C31A 3AFOA 2QUJA 4RS4A 1M5TA 2VP4A 3DKVA 3JALB 3VX3A 5BSVA 5FUQA 2WTUA 1K9VF 1MBZA 5G0SA 3DLHA 4DYDA 1Z6YA 2PCJA 5IZ4A 5KKNB 3ZDCA 4DVGA 2NSYA 4XB1A 3MTIA 4MAFA 1V4BA 1HDEA 3M3DA 5JZ9A 1DWQA 4FOPA 2NZ8A 3FVWA 3LX4A 2AE2A 3GIDA 1GUYA 1NPDA 2IP1A 2XBUA 4KO2S 4Q02A 2PFKA 3ANYB 2I80A 4PYLA 1ZEJA 1V6CA 2CF5A 4BKRA 4CKYA 4PLZA 2ZG6A 2QSYA 5K8VA 3EIEA 1Q1EA 3O7MA 4OGLA 5AW2A 3FOEC 3FCOA 3MYRA 3KPUA 2IUSA 1NN1A 4K6CA 4BFYA 4B2IA 4BC0A 5DWVA 5F3DA 1P9RA 2VHCA 1GDTA 3TE7A 1LBQA 2B5VA 1EDOA 3EBOA 2PMEA 2I78A 3UMVA 4MHSA 1GT91 1GKYA 1JLKA 3DV9A 4DUPA 1RYZA 4DR3B 1BVHA 1RJGA 4QELA 3KZMA 5J5AA 4LOHA 1EX7A 2AMYA 3E9EA 1CUSA 1UT8A 1PUIA 4JP8A 3RV3A 2DFNA 4B3DA 2OD9A 1IN6A 3DE1X 4P80A 1JVBA 1E2DA 2CFTA 4KR3A 2VZLA 1V16B 3WXBA 1NW3A 1YIDA 1QG0A 4O2BB 3N70A 2ZM5A 4FX2A 2WTMA 1QOPB 1WA5A 3AFIA 3OPQA 1B2RA 2H9YA 4R1MA 2GK4A 1LJ8A 2K7ZA 4MYDA 5IF3A 5FQNA 3C85A 2A3RA 4B9EA 3GPCA 4B3HA 2P3OA 1I0ZA 1A76A 1QJ4A 3ABZA 4CIVA 5A9SB 5C1PA 3T5CA 2FPGA 2P4QA 1YZVA 3FLMA 3MS4A 4G07A 3TLYA 3I61A 4EL0A 4NENA 3AKZA 3W04A 2CUZA 1OV6A 1GQ2A 2CHQA 2IEGA 4GBGA 3NHKA 4R68A 5D85A 2J4DA 3DLIA 5D7BA 5HVNA 1K1EA 1YB7A 4QYWA 3FJYA 4WOKA 5FNVB 2QUHA 2RAPA 3WGVA 3IMFA 1P61B 13PKA 1EBBA 1SCUA 2F1OA 4UOEA 4Y9RA 3LLMA 1RBZA 3CLSD 3QTLA 1YQXA 4MWSA 3IBFA 2CDRA 4TMZA 2EZUA 1XZJA 5DCWA 3ZWNA 1GTG1 2IODA 1VKJA 4HMQA 3FIJA 1ZIPA 2JFBA 3GFQA 1X7XA 4J4HA 4REOA 4JUDX 2QSJA 3SMVA 1U7XA 3C41J 5IAJA 4EPYA 1UXGA 3VH3A 1JU4A 4F2HA 1GHTA 4I1OA 2B5WA 4DBZA 4TRRA 5EP4A 2O07A 1EFUA 3KG2A 5D1NA 3A1SA 4C6RA 4D9GA 1XCJA 3HABA 1A8UA 1OI2A 4JSRA 3GUVA 4ZDWA 3R9IA 3LHFA 4BBAA 2COUA 2YHIA 3AIKA 4POAA 3BIJA 4MVJA 4OXNA 4I1PA 2BBSA 3Q3EA 2OBMA 3DDHA 1ZXLA 4DV0B 2DG2A 1JR3E 1VHWA 1Z18A 1S3IA 3BK1A 5CX1A 2AK2A 1PR1A 3E3AA 3HG7A 3JQFC 1GLGA 2LUOA 3DO5A 4IFTA 4YRQA 3CKMA 5EQDA 4B76A 4OBWA 5TV2A 3RBVA 1KBOA 3ORQA 1G7SA 2X4GA 3D8TA 4ZOEA 2AG5A 3SXPA 4I3GA 2RGNC 4HI0E 4JUIA 3FPEA 2A1IA 5F98A 4IO0A 2NU8B 4DUGA 2W6IA 4B35A 3GPDG 2VVTA 4I50A 4ZC8A 3A6HA 2C29D 3S1LA 2F8SA 2NTEA 4IKOA 1JKJB 1I0LA 4WZZA 4YONB 2Q7OE 2OEPA 4P93A 3I39X 4TWBA 4YDRA 5IM4A 4DT1B 2B61A 3FAZA 3KWJA 4MW5A 3A7DA 3LIIA 1BYIA 2VBCA 2VQSA 4WWHA 5ED4A 1KR2A 1PK9A 1U9IA 1M2OB 1DBIA 3T0IA 1E0SA 1X7XB 2WJIA 4P22A 4F9EA 3ZI4A 1BMFD 3HSYA 3B89A 3R23A 4JDPA 4QBFA 3W5AA 2X22A 5LL6P 2LW7A 4OFZA 3EOZA 2B21A 3RVOA 1HRKA 2X5KO 2HU8A 2YXNA 2Z5VA 4TLCA 3KXLA 1YCDA 4QLOA 3CEJA 1HWYA 4L3WA 1NN3A 3LOUA 3OJFA 4G1BA 2YCBA 1KI8A 4FNAA 4U7GA 3V34A 4UPDA 4WY2A 4O59O 4M7RA 4LSGA 5DYYA 4DXDA 1P9LA 3OE1A 3C43A 2UZ1B 2WPDD 2GXQA 4A73A 2WFMA 1HLDA 2M32A 1O97D 4RDIA 2QY6A 2BFNA 4CKCB 1QONA 2BFCA 3S8MA 4IVNA 1NKTA 2EFGA 3E7DA 1PJ4A 3NBKA 1UR5A 3C3JA 3GG2A 5E2AA 4BATA 4DA6A 5CDFE 3DTVD 3O3NB 1QM5A 4WV3A 3RH0A 1ZO8A 2BGWA 3VR5D 1LFDB 4IBOA 2E55A 4NG4A 2ZBVA 4RQTA 2UVPB 1Q6YA 1YR7A 1FB5A 1ZVQA 1PSZA 2WUWE 3TQOA 3R7DA 3QNMA 5CT6A 3AF0A 4A8PA 1LC0A 5IJZA 1L7XA 1TQ2A 2QNBA 4PR3A 1T5HX 2VBIA 5TPZA 1GRCA 3DVQX 4FEGA 4UMEA 1JPNA 4C05A 4DGQA 5LIRA 1TO1E 4CMBA 3NG1A 5JCXA 3HYLA 1O97C 1T9DA 2XBLA 4RD1A 6GPBA 3LWDA 1XPOA 4BPRA 4ZWNA 5IN4A 2XJ4A 5AJWA 1SZDA 3BD7A 1EIZA 4ENQA 1THGA 1KKMA 4BRZA 1TQHA 1TECE 4F4CA 2OV8A 4CFYA 1H6CA 1ZPDA 2PO5A 3ROZA 1A9XA 1E32A 4YP1A 5K20A 5CG2A 5JTTA 1TM1E 4GPAA 2WSSD 2PRSA 3PT9A 3KR9A 3QU2A 2O4CA 3E35A 2F3PA 3FB1A 2FHSA 3EZ2A 3PGXA 4QE3A 4H6XA 1II9A 2ENUA 1XZGA 1ZCJA 3KO8A 5IMBA 3V7FA 4E5DA 1T5LA 4DS3A 2XT0A 2WQ6A 2QAIA 1ZUD1 5EQTA 1DCKA 3D6VA 2G36A 3OPXA 1OBHA 2WHXA 4IUCS 4PPQA 4N47A 1F20A 2XRMA 4YRMA 4AY3A 2FW1A 3BK7A 1CQJA 3O0DA 1Y6FA 1AV7A 4ZVTA 1CUZA 1E1QD 5IAKA 2OV4A 4GZLA 3BDIA 3DQZA 1CG6A 3O4HA 4N5DA 3TZEA 2XX3A 3ZU6A 1NYRA 2CZCA 1G63A 3O74A 3GGDA 4P4TA 4RHTA 4Y30A 3OJEA 3IMEA 3KSZO 3IEIA 3VKFA 3B1KA 4WA7A 3RK1A 5KUTA 2JLUA 3DAFA 3OM8A 2GCNA 5GONA 1SWVA 3LT4A 1T8WA 4MVWA 1C7EA 4XAQA 1BMFA 5IBPA 4YC7A 1YQQA 4KH0A 4EKGA 3GELA 1DAEA 3BHJA 3IVMA 2QG9A 2ZU6A 3IEKA 4KLRA 4ZVQA 4CKBA 4AWAA 3KYJB 4HFNA 4C43A 2RI6A 3BIWA 4FSHA 5CDUA 4PR0A 1DO8A 4XCXA 5B57C 3RBZA 4RQAA 2VHUA 4NG5A 3G0CA 3AV3A 5ADHA 1K4YA 2P4HX 4CT0A 1A9XB 2HU2A 2Q0XA 1DP4A 4LVCA 2RARA 3D6TB 2UYHA 2WF7A 2BEVB 1XYVA 3FRIA 1NNEA 3I9V6 2KS6A 1E2FA 2HMTA 1IVNA 1TUBA 1WUIS 2QN6A 4HYQA 4PRYA 4C7VA 2O9JA 1FXWF 1YUBA 1GAWA 5EXEA 5BOSB 2G77B 2V4MA 3FOFC 3QW2A 3HHPA 1KE1A 2OC4A 3IJEB 3RTCA 4REQB 1XVTA 1QIJA 2HJ9A 3H9QA 4OI4A 5JG7A 1VLVA 1OYWA 4GQBA 4Q05A 4DQVA 3PUHA 2VEDA 3GW8A 5JXHA 3FBWA 1Z0JA 2WV7A 4BU1A 5JLAA 1QLHA 5IAOA 4Q19A 2P90A 3HWSA 1IG0A 3DHNA 1PQ4A 3FFAA 4BP1A 5F51A 3T5DA 4MUKA 2WU0A 4INOA 2GRJA 3DPSA 4M1ZA 3TIXB 1G5HA 4C3OB 3FMOB 4IEEA 2P2GA 3STUA 1V8ZA 2H5IA 2NTJA 1OLSB 1NVFA 3CLRD 4ETNA 1PJAA 5BNZA 4OQMA 3U19A 2VEOA 1L1QA 4I55A 4QM6A 1E6WA 2ZU0C 1U04A 2G28A 2QGNA 4IF4A 3VYTB 1YDMA 3A26A 1UEIA 2XNCA 1S02A 3S2SA 3TJRA 5D5QA 2WB2A 1Y33E 1SVWA 2A9RA 1Y1LA 2HLDA 2HXSA 1AKYA 3E81A 3OUUA 1IVYA 5B7QA 2ZUEA 1XLVA 1I9GA 2FSSA 4DADA 2LDXA 3NHUA 5I7RA 5KKCA 1T8SA 3NIWA 3Q9SA 4NX2A 3PCRB 1JQEA 1NR7A 2JGDB 3NC0C 2B20A 3JQ7A 3RRMA 3D7NA 3I01A 1E7YA 8AT1A 1A27A 2Z58A 1W581 2IRWA 2VJMB 1L5MA 1U81A 2N47A 5FTNA 2UYCA 2O06A 3VVCA 1WXIA 1YH3A 4FKZA 4TXHA 1IEQA 3I2IA 4QQ8A 4XWYA 1QHHB 4OXQA 5EPUA 2PVCA 3PXDA 3MWLA 1GZVA 5LXTF 3RE1A 4AO6A 4Z8XA 4ZOBA 2FSPA 4GZ3A 2QD4A 2O3QA 2O59A 4WGGA 3ZDXB 3ZYZA 2J4FA 2WA1A 2BFWA 2VH2A 4PPNA 3HJGA 4IDOA 3V1UA 2YIDA 3RUEA 1JF8A 1OBCA 2A1UB 1TDJA 4DY6A 3MWGA 3JWHA 1KEKA 2GF9A 2W2NA 2M6RA 3S55A 3OFSA 4FE4A 4IXTA 3N2NA 4PO3X 4UM5A 1EFAA 5T4FA 1H1LA 3UOAB 2I6XA 5EFZA 2C9CA 3OIWA 2Y68A 2W2PA 4NJEB 5SYAA 2XR1A 1CSEE 1FLDA 3F7MA 3PXCX 1W19A 2NPOA 2C88A 2XNHA 4PO9A 4MVJD 4JHLA 4S1WA 5IK2D 3I09A 5IANA 2EKBA 2B1IA 4I9HA 3RRXA 5DNDA 5DBEX 2MYPA 3O03A 4RF3A 1D2HA 1WEKA 5CLIA 2I2WA 1N0WA 2IPXA 3SZGA 3JQBA 3K1ZA 3WK5A 4OUKX 1E4OA 3CLHA 1P80A 1HSOA 4WRRA 4XGKA 4Y3UA 4EABA 1U5CA 1YJQA 3GJ4A 4N3BA 3NDBB 2VR1A 2PBRA 1W8DA 1T9CA 2IIBA 2ZWIA 3IJPA 5DDIP 1ICIA 1U28A 2B2XA 2ZIXA 4WZBB 2DB3A 5JNVA 3D64A 2RGNA 1E7QA 4ND5A 4E12A 4BTEA 2X40A 4GMXA 4BMYA 5KSYA 5ETJA 5BV1A 1N2GA 3D6AA 4RUKA 1IAQA 1MMFB 3ZD9A 1Y1QA 3IUNA 2O5VA 5IFLA 1F5SA 5AHWA 2QL9A 2GWHA 3KQYA 1KTVA 1NTOA 1L7BA 2Q1YA 3GFPA 4MYTA 1GTSA 1FYVA 3LVFO 4C78A 1I0IA 2HIHA 1PJ3A 3VHXB 4KVGA 2GBLC 2X3YA 1Z83A 1QU3A 3QLTA 2EJUA 3OZRA 1UOEA 4NFYA 2B69A 4AC9A 1KPIA 1M2FA 4CMIA 3DTVA 3H0CA 3UJ8A 5ITSA