3V9AA

Crystal structure of esterase/lipase from uncultured bacterium
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
296
structure length
293
Chain Sequence
AGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Esterase/Lipase from uncultured bacterium
rcsb
source organism Uncultured bacterium
molecule tags Hydrolase activator
molecule keywords Esterase/lipase
total genus 105
structure length 293
sequence length 296
ec nomenclature
pdb deposition date 2011-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v9aA00
4CIAA 1GQSA 5DTIA 4WJLA 4H7FA 2QJWA 3O4IA 2WG1A 3C8HA 5BV7A 1Q0RA 4AX4A 1EB9A 2XI4A 2XUIA 4DSAA 4W1RA 2PUJA 3G0CA 4K6GA 1N5MA 1AURA 2QJRA 5CT8A 1EDDA 3FYTA 2QXTA 1XZKA 1G42A 5E4TA 3STTA 2CBGA 4G1FA 2XDWA 4Y2QA 2B9VA 2DSNA 3WQHA 2HA2A 2OGSA 1EB8A 4Y2RA 2ZJFA 3I2GA 4XJVA 4MQLA 2GZSA 1EXWA 3I1YA 3QVMA 3IUQA 5JD5A 2PSEA 5LKRA 2V98A 2WUEA 3QM1A 2WIKA 3FSGD 2XUAA 2EDCA 1YS2X 3FWHA 1SOMA 1WB6A 5DLPA 3M81A 4GXNA 3STVA 3H18A 4IH4A 5LZ7A 3WWOA 1N8SA 4AO7A 1SFRA 1KEZA 4A5SA 2LIPA 1CUWA 5HKBA 4UUQA 4F0JA 2PVSA 3NWOA 4PSCA 5ALSA 1R3DA 4DMHA 3VKFA 4J0DA 3O4GA 4C4ZA 2VAXA 3OC0A 2XLCA 3AIOA 5JASA 1QONA 4X7BA 2XUJA 4B9EA 3PF9A 3WJ1A 1BS9A 2CB9A 1P0MA 1DU4A 1VOTA 3HZOA 2Y1KA 4L3WA 5HZGA 5HQ3A 4B85A 3R3ZA 4CIBA 3H04A 1Y37A 1F6WA 4J0KA 2DHEA 1UK8A 4AB1A 2VJCA 1QTIA 3DL7A 2QR5A 2B4KA 1LPNA 3IURA 2XB6A 4X85A 4UFNA 4RGYA 3T52A 3H1AA 1SCKA 2PSFA 3BF7A 1A8UA 3WK6A 4OYYA 1W6RA 3WWPA 2GZRA 4JH0A 6YASA 4DM7A 3IUNA 3C43A 2I3DA 2JEYA 1BRTA 3D2CA 1ZI8A 3H1BA 3KOOA 4QDTA 5JALA 5CT4A 1D07A 4H7JA 4UHEA 3D4LA 3EQ7A 4BZWA 5ALZA 1XRNA 1IUNA 3VVMA 3C5VA 3G7NA 2ROQA 1CUJA 3ESAA 4Y2JA 4A16A 2ZYSA 5AOAA 5JAUA 4BRSA 1K6EA 2XUHA 3R3VA 2VSQA 3G02A 1MAHA 3ZI7A 4BAUA 3AZQA 2BUAA 4ZREA 5DTJA 5AK5A 5D3ZA 1TKRA 1MPXA 3V1KA 1XZGA 1ODSA 3OM8A 1H23A 4U2CA 1TCBA 3AILA 3LIIA 2VJBA 1AKNA 1W76A 1N5RA 5C8XA 4OYLA 4Y2XA 1A8SA 4KYVA 4LYEA 2RI6A 5DNVA 2OQVA 5ALIA 5ALKA 3ESCA 5HF9A 2ZYHA 4L0CA 2RHWA 3CXUA 1ZGBA 4H7DA 3BDVA 1G66A 5AM1A 3STXA 4GWLA 2HA7A 5CTAA 3AZPA 3C6XA 2CJPA 2WFZA 3DEAA 4AMYA 2HU7A 3I2FA 2OXEA 3WI7A 3ANTA 1QIJA 2PBLA 4Y2YA 2C0PA 4MQMA 4BP9A 5HK9A 1QE3A 4X90A 3FLBA 1ZI6A 3ICVA 4WCVA 1A8QA 3CCBA 3EIOA 3WKDA 4Y2SA 1QIMA 3GBSA 2CUTA 3QPDA 3R3YA 2OCLA 4B82A 5DWDA 1QJ4A 3HJUA 1BN7A 1EX9A 3WKCA 4C4XA 4KE8A 4FWBA 1WM1A 2WU3A 2WTMA 4EA6A 1B6GA 5AI4A 2NW6A 1ODCA 2WUGA 3W9BA 1GT6A 2W6CX 2WIDA 1LPOA 5ALMA 3RKSA 3HI4A 2HHAA 3B3QA 2RAUA 2Y2UA 3Q8WA 4J0IA 5C8VA 1KU6A 4AN0A 3DKRA 1ORVA 1JU4A 1P0QA 5ALPA 2WJ4A 2H7XA 2YYSA 1EI9A 4KE6A 3C87A 5HFNA 4LHEA 4C6HA 4ZXFA 3RM3A 2I3ZA 2H9YA 2WUFA 1W75A 3BIWA 4UHCA 1DWOA 1XZFA 3FVTA 4Y2TA 5CBKA 4RE6A 3EF3A 5LIPA 4OPMA 4UBJA 3YASA 5K3BA 5AKEA 4Y2UA 1XQVA 1CUIA 2C58A 4L72A 1FFDA 2PU7A 2HFKA 5ESRA 1SCIA 2WIGA 5JAOA 4X3CA 2QT9A 1XZBA 1FFBA 3H2JA 5CMLA 3I2IA 2XQGA 4DLNA 4OD0A 5CXXA 5AKHA 4BVKA 2PUHA 1IMJA 1DX4A 1Y7IA 1LZLA 4PSUA 1KU0A 2GYVA 5AICA 1GXSA 1R50A 4A23A 2DQYA 4U2GA 1S8OA 1JJBA 1RWQA 3MUNA 3PICA 1IZ8A 1QZ3A 1QIDA 1HDEA 3H19A 4G4JA 3G0IA 3V1MA 5EHZA 2VT7A 2H1IA 2XUFA 3DLTA 4J3JA 4UBOA 3WIOA 4FHZA 2G5TA 3C8DA 3C45A 5AKIA 5K5EA 1QIIA 4RPCA 4S0XA 3S2ZA 2HA4A 5EHNA 4K2AA 1H2WA 1HPLA 4E11A 2Y6VA 5ALXA 5HF6A 2RGUA 4OB7A 5AK4A 4FFVA 1EK2A 4NMWA 4AZ0A 2AJBA 1O6FA 2FUKA 2J3QA 1CUVA 1BEZA 3QYJA 3WK5A 5JIBA 3E1GA 2CEKA 5CRIA 2BUCA 4HTAA 4ZV7A 3UUEA 5HK8A 5ALEA 1QIKA 3QMMA 5ALGA 1XQXA 2HDWA 4FMPA 2W22A 5LZ5A 2BCEA 4N5IX 1JT2A 2VQ6A 1LLFA 1XROA 2PU5A 1LPMA 1U2EA 2QXUA 2JGIA 2Z3WA 4LKOA 2QUAA 3LS2A 4X6UA 4G5XA 3DYVA 3IDAA 4BRZA 3DL4A 4Q82A 1R1DA 2PSJA 4B6GA 1YASA 1O6GA 2Y2VA 3R3XA 2OG1A 2I03A 3HSSA 4Q3OA 1QFSA 5AJHA 4ROTA 2ZJ7A 5ALYA 1N1MA 5HF8A 2GYUA 1FFEA 1MU0A 3FAKA 3G9XA 4OSEA 4X94A 1MN6A 3B12A 5CURA 1CQWA 4XIIA 3PF8A 1DT3A 5I7UA 4P93A 3SWWA 4BATA 2JGMA 2XQKA 2VEOA 3FYUB 3ESBA 3W04A 4W63A 4BC0A 4K6KA 1J06A 3A2MA 2ACEA 4CG1A 4BVJA 2P8SA 1C7IA 1CUAA 2VA9A 4GECA 1ZICA 2OAEA 4OU5A 1TIBA 3FVRA 2BKLA 4YX9A 4B80A 4HVTA 4FLMA 4U2DA 1TAHA 4KEAA 1XZCA 2GYWA 5HKAA 5T4BA 5LZ4A 1IUPA 3I1IA 3H2KA 3O0DA 5AIBA 4W9RA 4YASA 1R88A 3QPCA 3G0BA 3BWXA 3EQ9A 2OLEA 2XUOA 4PO3X 2WIJA 1CR6A 3ZLTA 4M0MA 4INZA 3ZLVA 3ED1A 2RIPA 5AKYA 4ARAA 4ZWNA 3WZMA 3PE6A 2WKWA 5AKLA 4Q3LA 4KAAA 4Y2PA 4C88A 5AHXA 4G8BA 4X00A 1K8QA 1CUHA 4DMFA 1CPYA 1UKAA 3HXKA 4DYHA 2WUDA 4DNPA 4UBKA 5ALFA 2ZSIA 1GZ7A 4AXBA 4YPVA 4BE4A 1BE0A 1JMYA 2DQZA 4KJXA 1QFMA 1WOMA 1GGVA 4FLFA 5A2GA 1CUUA 5LKAA 1CUBA 2HU8A 1YR2A 5ALLA 4QDZA 3ANSA 3IULA 2OAGA 4IHAA 2JGLA 4QWWA 3S8YA 4WDQA 4C89A 4OB8A 1E8NA 3F67A 4UHFA 3FCYA 2EDAA 3OURA 4H7HA 5FPQA 1M33A 1U65A 5AIAA 4FOLA 3F9CA 5CH5A 3QPAA 4BVLA 5K3EA 1JKMA 4QDOA 2RONA 1F0PA 3G9UA 2HA0A 4ARBA 5KREA 3D3NA 3DYIA 3WJ2A 4HS9A 1THGA 3L1JA 3VJMA 1BCSA 1YS1X 1UFOA 3TRDA 1GPKA 4CCWA 4HXFB 3DOIA 2AJDA 3EBLA 5AKXA 4ZRDA 2WJ6A 1J1IA 1Q84A 5IVIA 4OU4A 1BU8A 1A88A 3F96A 5K3AA 1DWQA 1I6WA 2BAGA 1A7UA 1HLGA 4CFSA 4DIUA 5A7GA 4GLBA 1H2XA 3SX4A 1W1IA 4F21A 3JWEA 5JZ9A 2IX9A 5AI8A 4U2FA 5K3DA 2YH2A 2JGJA 3OOSA 4WY8A 3RK4A 2AJCA 3HRHA 3I2HA 1XKLA 5EI5A 2R11A 4EY7A 4P92A 3VJLA 2JGFA 4UFPA 1EDBA 1ACJA 1USWA 4JYMA 3R3UA 2HIHA 4JUIA 5LZ2A 1XZLA 2WHPA 5BWBA 3A2NA 4HXEB 1JI3A 1CUYA 1BCRA 4DNFA 3AUKA 3PDCA 5T4EA 1QIGA 1JJIA 1EVQA 4KAFA 4K5QA 3LP5A 2Z8XA 2DCMA 2WHPB 3GZJA 3E4DA 4MEAA 1PFQA 4P08A 4M0FA 3KXPA 1VXOA 5K3CA 3IB3A 4QWMA 2QOEA 4J0JA 1QO9A 4X71A 2IITA 2OQIA 1Z68A 4N8SA 4CCYA 4JEIA 3E3AA 2HL6A 3FLAA 4E46A 3ICWA 5A6VA 1R4ZA 1AQLA 2C5FA 3O9MA 2RHTA 4B9AA 1EDEA 5AI5A 1EA5A 3STUA 1YA8A 2PSDA 3F98A 4B0PA 4E15A 4GDMA 4U2EA 3Q0TA 1RYYA 4H7KA 2WM2A 4P9NA 2AJ8A 3WIBA 1LBSA 3BXPA 4Z49A 3O4HA 1FJ2A 1HKHA 4LXIA 2XQIA 4B83A 2VJDA 1LPBB 4QA9A 2XUKA 3AFIA 3AINA 3ZLUA 4G4IA 4J0CA 1J07A 3D2AA 3UMJA 3BL8A 3JW8A 5T4FA 4MXDA 4CG2A 3WYNA 3CCCA 4EUSA 3V1LA 1EHYA 2PKYX 4I4CA 5A7HA 1VE6A 4AMZA 1XLWA 4BDSA 3MVEA 1VA4A 2ZJ6A 4LXGA 4UFOA 1LPSA 3C6BA 1ZD3A 3GFFA 2YXPX 5I9IA 1VKHA 2XUGA 3F97A 5EGNA 2HRRA 2XQJA 3M82A 1XFDA 4WY5A 1P0PA 5D7BA 5ISMA 1YB7A 2HM7A 1CUSA 5KWIA 1UZAA 4EZIA 2XMDA 4FKBA 4MWSA 4NS4A 3QITA 3GROA 3PUHA 1E8MA 2O2HA 1DWPA 1YAJA 2AJLI 2HRQA 1AX9A 4FBMA 4KACA 4OUKX 1EINA 3NOXA 3CN7A 1E89A 1CLEA 1FFCA 1CUFA 1EVEA 5BOVA 1YA4A 2XMBA 2G63A 5E2IA 1E5TA 5AI6A 4BCCA 3QBJA 2Q0XA 1Y7HA 4H7EA 2QTBA 2XUDA 1E3QA 4QDXA 3WWDA 2G5PA 3AJAA 5K3FB 7YASA 1LPAB 5FPPA 4C01A 4QDUA 5AP9A 4YK7A 5AM5A 5FOQA 4EHBA 1R9NA 4X91A 5ALRA 4IO0A 2HU5A 5LZ9A 4MEBA 1IUOA 1WHTA 1MT3A 2XMQA 3DD5A 2BUBA 1F0NA 1MX9A 2QMQA 5EHQA 1TCCA 5JZBA 1H22A 1XZJA 1YCDA 1ZIXA 3V1NA 1OXMA 4KRXA 3HC7A 1ZGCA 3KD2A 1L7RA 2C0QA 4EY6A 2QS9A 2XMGA 1L7QA 3GA7A 4B7ZA 1UOQA 3G0GA 1J2EA 4KAJA 2HA5A 1QIFA 1XRMA 2X5XA 3WK9A 2ZYRA 3WL5A 4GBGA 1ODTC 2BJHA 4BC1A 1SC9A 3H2IA 3HLKA 1K5PA 5AKZA 5JARA 1QIHA 1QOZA 5EIHA 2WHRA 1T4MA 5ALHA 3G8YA 3WKEA 4XVCA 1YB6A 3M83A 3O95A 3K9BA 4QE3A 4BP8A 5AOCA 2VATA 3MGAA 2OCGA 1QIEA 4BCBA 3FBWA 4MYSA 2AXEA 1UK6A 4RE5A 1VZ3A 3A2LA 5A71A 3OTQA 4IH1A 3WMRA 3W05A 3WWEA 2J3DA 2WFLA 3D2BA 4NVRA 4U2BA 2JGKA 4DNQA 3MUOA 5ALNA 1ZJ5A 1XZAA 5BWCA 4PV7A 2G4LA 2WILA 3E0XA 1LGYA 5JD4A 5KBYA 3D7RA 3VJKA 2O2IA 5ALVA 1BN6A 3I6YA 3G0DA 2Y6UA 3V48A 3WKAA 4HAIA 3DJYA 1ZD2P 3IVMA 2XMZA 1Q83A 4Y2VA 3WA6A 2PM8A 4G4GA 2XUPA 2ZYIA 2WG0A 1XZEA 5FXMA 4UBNA 2HFJA 4N5HX 1CVLA 3AZOA 1HL7A 3DOHA 1ZD5A 1G5FA 4PNZA 1TCAA 4AZ3A 2HA6A 2O7RA 3T4UA 3K2IA 2VTVA 4DMCA 1NX9A 1ZIYA 2PX6A 2JBWA 1GKKA 4WFJA 2OPHA 2PPLA 2H7YA 4DGQA 1VXRA 1LZKA 1WCYA 4ZV9A 3LCRA 3D0KA 5ALDA 5FDFA 5DYYA 2WIFA 1C7JA 1CEXA 3WL8A 4V2IA 4F60A 3WL6A 5AOBA 2ONCA 1B41A 2DFPA 2X76A 1ZI9A 4LIPD 3I6MA 1WHSA 3IIIA 1JJFA 2X8BA 1XRRA 4HZGA 4BTLA 2C7BA 3TEJA 4OCZA 2DR0A 2JEZA 4FBLA 3A70A 4UBMA 5EHXA 1XRPA 1P0IA 3VXKA 4CI9A 3U0VA 1CRLA 2EEPA 1XZDA 1C4XA 4EBBA 4Q05A 4MJ3A 5FRDA 2B20A 2QRUA 3ZV7A 4ITVA 4AN1A 1UK7A 4FDMA 5C7YA 1SCQA 5CXUA 5E4JA 1F8UA 4D9JA 2K2QB 5LP1A 1JU3A 5AM4A 4UHBA 4WFKA 1JMKC 5SYMA 1GPLA 3WLAA 5C81A 4ZGBA 1IZ7A 4BAZA 3I2JA 4FNMA 1BROA 2XE4A 4TGLA 3WA7A 3HEAA 4IH9A 5ALJA 1LPPA 4RNCA 5AM3A 4BAGA 1LNSA 4KE7A 2BGNA 3DDUA 3BJRA 3IA2A 2JF0A 4WDRA 2V96A 1MNAA 5JZSA 1VLQA 1Q0ZA 5EIAA 4BDTA 5D6OA 2QUBA 4CCYB 2XLBA 1ZD4A 1XRLA 2JIDA 2OGTA 5AI0A 5ALTA 2DHDA 5F4ZA 4AQDA 2ECFA 1OCEA 5AH0A 5DYWA 4I3FA 1DINA 2UZ0A 3FCXA 4H0CA 3W06A 3WK8A 1MTZA 3U1TA 4EB0A 4N8DA 1VE7A 2GBFA 4EY8A 2BFNA 4ETWA 5HCUA 1FSSA 1WB4A 2XMCA 1UOPA 1UK9A 4BBZA 1L7AA 2ACKA 4TVKA 2Z3ZA 1ORWA 2VT6A 1ZJ4A 2Z8ZA 5IVDA 2Z5GA 3AIKA 1HBJA 2WG2A 1CUEA 5AM2A 4PQEA 2I78A 5HF5A 4BB0A 4XX1A 1U4NA 4NZZA 4BCDA 4Y9SA 1TQHA 3NGMA 1QLWA 4QZVA 3O9VA 4W1SA 2V97A 4J03A 2E3JA 1AUOA 3WWCA 1DTEA 3L1IA 4DSZA 5FUMA 3GELA 4LXHA 2D0DA 5IKXA 1XRQA 4BYMA 5JD6A 2H7CA 1QTRA 1H2ZA 1NU6A 1DT5A 5JAHA 5AKKA 2O7VA 5ALUA 1MO2A 2ZSHA 2QZPA 2IIVA 1H2YA 2GBGA 5JATA 4J0GA 3TJMA 5CW2A 1CUCA 3H2GA 5A7FA 2OCKA 1ZOIA 4PW0A 4X93A 4X92A 1NU8A 1BEEA 3C5WP 3DQZA 4PF1A 3AIMA 4QEKA 2OGZA 3JYHA 4FFWA 1X2BA 1G4HA 3IBTA 1MAAA 2C5GA 3O4JA 1UKBA 3BE8A 3PFBA 4CG3A 2C4HA 3H17A 4MYDA 2D5LA 1TRHA 2PL5A 5CT9A 2QM0A 3ZWQA 4DMKA 2WU4A 1MJ5A 3A6ZA 3M3DA 5JAPA 1AGYA 4DTCA 1CQZA 5IVHA 1MX5A 3QMWA 3PI6A 5ALQA 5DNUA 2WSLA 4Q1VA 5J3JA 1VA5A 3N0TA 2GBCA 3IUMA 5AO9A 1GKLA 3STWA 2FX5A 5AK3A 4XWGA 3N2ZB 1XQYA 1XZHA 5A62A 1W52X 3TGLA 4X95A 3R3WA 4JNCA 2GBIA 4KE9A 1XZIA 1RP1A 1XKTA 2ORYA 4HRXA 4UBLA 5D3KA 5T4HA 3NUZA 1MNQA 2YASA 5HQ3B 3DKKA 3UUFA 3PUIA 2XT0A 3LIPA 4N8EA 3C70A 1X2EA 2JGEA 3QZUA 4J0HA 3R0VA 3BIXA 5H3HA 2CMFA 5AKJA 5AK6A 5FP0A 4GW3A 4UHDA 1AC5A 2HADA 5IH7A 3QMVA 3D59A 1QO7A 4B81A 4B0OA 1YAHA 4BE9A 3W2TA 1E8DA 4FLEA 3R41A 5FLKA 2J4CA 1CUXA 3WL7A 4G9EA 3HACA 3H2HA 3WYDA 4K6HA 3HABA 2R8BA 2B61A 4L9AA 4X6XA 1XQWA 4KR0A 4W1PA 2WHQA 4B84A 1ETHA 3HYSA 4C4YA 2PSHA 3C6ZA 3F8SA 3FSGA 3FYUA 3LLCA 3V9AA 4FTWA 4O08A 5K3FA 3KSRA 4GHWA 3P2MA 5YASA 3R40A 4QLOA 4H18A 3PFCA 5E4YA 4GEGA 3QH4A 3OPMA 2VF2A 2WFMA 3FLEA 1MX1A 4WFIA 1U8EA 3K6KA 4BZZA 3OG9A 2XQFA 2ES4A 5FKJA 1EH5A 4G8DA 5CH3A 5LLSA 5I8PA 1CUGA 1TK3A 3VDXA 3WZLA 1R9MA 1FFAA 4PSDA 4HXGA 4QNNA 1JFRA 1UOOA 1T2NA 4G9GA 4X97A 3C6YA 4UHHA 2BGRA 1LBTA 1X70A 5JADA 5KWJA 3L1HA 3ILSA 2DHCA 4H77A 4QLAA 2J4FA 5DYTA 4JYPA 3CN9A 2FJPA 4G8CA 4DNOA 4Q3KA 2QVBA 1AZWA 3X3HA 3KWFA 5HFAA 1QGED 3IUJA 4KRYA 5JANA 1UKCA 3DS8A 1CIJA 2O2GA 1UWCA 3FNBA 2WFLB 3STYA 4EY5A 3H0CA 3DCNA 2WLSA 5EFZA 1XLVA 4Y7DA 2XMSA 3BDIA 1GPNA 1WPRA 2V9ZA 4J7AA 5LYYA 3W9UA 3GUUA 2XMRA 1GQRA 2WQZA 4ZI5A 1WPXA 5DNWA 3WK7A 3KWJA 3ZPXA 4I19A 2WTNA 1OILA 3G9TA 3VISA 3G9ZA 3WKBA 5DJ5A 1UXOA 3FOBA 4UPDA 4E14A 3VVLA 3DNMA 5CT6A 5AKGA 4TPKA 3B5EA 1CUZA 4UBIA 1PJAA 5CH8A 2ZVDA 1YSCA 5CT5A 1HQDA 1DQYA 3RARA 1XZMA 1PV1A 1E66A 1K4YA 3BF8A 1W4LA 3EQ8A 4M0EA 3BJMA 5SYNA 5JYCA 3RLIA 4OB6A 3WK4A 4AO6A 5AM0A 4EY4A 1EK1A 4FNGA 4BTVA 1WB5A 1DX6A 1XLUA 4H35A 5C8ZA 2WJ3A 1CUDA 4HRYA 1CFJA 2VJAA 1CV2A 1THTA 4GI1A 5EIEA 4X6YA 2HA3A 1K63A 1UT6A 4MWTA 2QKYA 2VAVA 5FV4A 5LZ8A 4F5ZA 2OCIA 4H7IA 3I28A 4W1QA 3D5EA 1AMNA 1ISPA 4Q34A 5ALOA 4C87A 3SK0A 4IQ4A 1ACLA 2CKMA 5AI9A 2CZQA 3I2KA 5IVKA 2FJ0A 3SC2A 3FYUC 3KDAA 3ESDA 4AO8A 1VJ5A 3I6ZA 5ALWA 1VZ2A 1DQZA 1IVYA 2XUQA 4LYDA
chains in the Genus database with same CATH superfamily
2OZLA 1WQ4A 2FVXA 4JT4A 4WVLA 2D74A 2VYVA 4P7FA 2A0WA 3GLFA 3QUSA 1OFUX 1G8JA 3MWEB 3RYCB 4J6EA 3TOCA 5I7FA 4UDXX 2Y77A 1KQFA 2GPBA 2NT3A 1OOEA 3ZDDA 2P2LA 1QRTA 1V1JA 1ZZEA 3LX6A 2QLJA 2FOIA 3PEEA 1NVMB 4DY6A 4J16A 5IWCA 2VK1A 4MLDA 1GG5A 1W36B 2DWPA 2P65A 4FK8A 4IIFA 2NYVA 4O4LB 5JS6A 1RSZA 2CXUA 1L4UA 2XI4A 5DTMA 3VH1A 1NUTA 2DTEA 1V3QE 3BGOS 3HXTA 5IYZF 4W1RA 5JS8A 1N78A 4S1TA 4NULA 2B2NA 2IZZA 1EP9A 3G0CA 4IJQA 4ZHSA 3NHBA 4CTMA 2C98A 4YRTA 5KOJB 4FP9A 4N6NA 1VRVA 3DW1X 4YDQA 1BD3A 4UEJA 2W2NA 2QX7A 3IHWA 2FPIB 2ODBA 4ZEXA 3F74A 3SQNA 1UP7A 2Z9DA 3PYMA 4JVSB 2VK4A 1WMSA 1EFLA 3F3KA 3AUSA 5U4XA 2X2FA 1EDDA 2ZRIA 4OLFA 4F7WA 3DLIA 3GEBA 4FCVA 1JP7A 3OZVA 5H4HA 2VCEA 1P1HA 2XDWA 4Y2QA 2FCRA 2B9VA 3VR5H 4C7JA 4E2ZA 1J70A 3HMKA 2Z0MA 3MG9A 1EGMB 2RHBA 3DE7X 3NC0C 4BO6A 1ZN2A 2RGBA 4MQLA 4EJFA 2ZB8A 1U0JA 3Q7SA 4NZOA 4IO1A 5LPNA 3T3GA 1RC1A 2GWRA 2W6PA 3IUQA 5JD5A 3FF4A 4U3JA 4YBZA 3HJBA 4O0LA 5CLIA 3KSMA 4WJKB 5HDBB 3UAOA 1WV1A 1E2LA 3FUTA 1YZUA 4LWOA 3UOWA 2ZUSA 4O5OA 4PX5A 1GQFA 4LCBA 5LKRA 5FWXA 2V98A 4XA8A 5CEFA 2XAAA 1AMOA 1MJHA 1NGSA 3OU6A 4BO0A 2DUWA 1IUKA 4U8HA 1M2KA 4REOA 4GMXA 1ST2A 4Q1FA 4D9EA 2IT1A 3H8WA 2XJ9A 4RADA 4CL3A 5JU6A 1A5AB 4LECA 4LVNA 4B33A 1WB6A 1D4FA 1YKFA 3M81A 2VNIA 4NJMA 5DLPA 3GMIA 5BNZA 3EVAA 1R4NA 4YI5A 2ZXEA 4IH4A 5JNUA 1ZVJA 3IPAA 4RCVA 1KAEA 4OJTA 2GVNA 1ZW1A 2VJYA 5EMJA 1UP6A 5LZ7A 4OIMA 2GJ4A 4RX1A 4YRDA 5JWRA 3RFXA 4ILKA 4QO8A 3WIVA 2OK7A 4NMXB 1KEZA 4A5SA 5B1EA 1G6HA 2LIPA 1CUWA 4JAVC 4D9MA 2VZ0A 1TFUA 3P4YA 3WDKA 4US1R 2O19A 3PXDA 3DOFA 1FNCA 4RH3A 1JSRA 4XYMA 2ZBRA 4PSCA 2Z1MA 4ROSA 1II8A 4TKVB 1GPJA 4ZRMA 1R3DA 4DMHA 2QSUA 4ABYA 1SUFA 2GN0A 2OQRA 4A5OA 5LMNB 2X0IA 3THXA 2M2IA 5THQA 3HKBB 5F9FA 3PHJA 4X63A 2A3RA 4JDPA 1B43A 1ZUHA 8OHMA 2C2KA 3INYA 2EKZA 3IP3A 4ALIA 3JQDA 3C4VA 4KVFA 1KR2A 1RE0A 2IYVA 2QLFA 4KMOA 3MELA 4M55A 3RYTC 4DAEA 2PGIA 4OHRA 3WXBA 1L9KA 2A1TS 2PS0A 3G1WA 3EC7A 3PRJA 4C14A 2GD6A 5HBRA 4A73A 4C43A 3WO0A 1X7YB 3IUPA 5IUKC 4P34A 4IIBA 1W5AA 1JHRA 3TL6A 4B9EA 1N7JA 3PF9A 4QGHA 3U44A 3GA0A 4DV2B 2EKDA 3DLCA 2WAOA 5AXBA 4F46A 3QE2A 4K7JA 5F76A 2Y1KA 3NTVA 3PB3A 4L3WA 2R1VA 1ZCZA 2R2GA 3AUXA 4OG2A 4M8LA 1VHJA 3QHQA 5HZGA 3CC8A 3E2MA 3DT8A 5ULLA 1JZQA 1GL3A 1C7QA 1NUSA 1Q14A 3JQQA 1VGVA 1L7PA 2FFAA 2ZI3A 4HAVA 5GM2A 5K45A 4WUTA 3AJ9A 4WI1A 1L4HA 5FI0B 3V4LA 3W7AA 2V6JA 1F6WA 3Q98A 1DVRA 4ZQHA 1PJZA 4ESHA 4AB1A 5FBHA 4R0MA 4MIOA 3E3NA 1QQ5A 1HURA 3DZIA 4GD3Q 4JVMA 2QR5A 2CLLB 4ESVA 3HA3A 3PPWA 4DWJA 2OHVA 1ADGA 1ZXLA 3CSSA 2TRSB 1JTVA 2XSZA 4NR0A 2WKRA 4KCGA 4M1OA 3WGOA 2VVTA 4V03A 3INRA 3WBKA 3ZDQA 3UC9A 1VYHA 3PEFA 3ZI0A 4WECA 3EIFA 1U28C 4LTNA 4X85A 4XJTA 3NBUA 1EGHA 4R9RA 4N6GA 4YB8A 3T52A 3CUTA 3ND8A 1SCKA 3IAUA 4K05A 2NX2A 2IHUA 3KOWA 2O2ZA 2REBA 3R7DA 3ADCA 3O1LA 4MCIA 1VI6A 3Q88A 5GPBA 3VU9B 4D3XA 5AHRA 1W6RA 4N6OA 5EHGA 5HIAA 2FQXA 2A1TR 1NVWQ 2AUNA 2LUOA 1CWUA 3KL2A 5LOVA 3NEPX 5DHTA 6YASA 3BB4A 5CDFA 4PBSA 3CF2A 3DE1X 1HK7A 3IUNA 4GI5A 1ORRA 2FMKA 1J5XA 2NO7A 2W2TA 1NMZA 4QUAA 1HSZA 3MMXA 1ISHA 1BRTA 1AQNA 3OQIB 2J7KA 3FCCA 4O3FA 1XB2A 4IVNA 2VZ9A 4DLBA 5KX5F 3P96A 1ORDA 3IP8A 1OX5A 2CJYA 4YJGA 3ETJA 2GN1A 2WSSD 4UHEA 1GN9A 3D4LA 1IM5A 3OIGA 1IG0A 3AKYA 4FKZA 1GPBA 1XI2A 1Y7LA 1ZMRA 2BEWB 3HYNA 1QANA 3H5RA 1Z6ZA 4J9UE 4WCFA 1VE3A 5EP3A 3LQ2A 4JYAB 2NZUG 3N7UA 3JVDA 2ICAA 4A0HA 3ESAA 2HF7A 1VMKA 5DX0A 3AEKA 3KQNA 4DR6B 1EG7A 1I24A 2W70A 4QBHA 5ECYA 4LRXA 1RRCA 3V7UA 5KHLB 2EX4A 1N7HA 5DI3A 1G0NA 3M2PA 2SCUB 4L07A 4BRSA 4AN4A 4EVQA 1QRUA 3OJOA 1IVNA 3LCVB 3O90A 1KZ7B 1P2BA 3NNSA 4R83A 3UW3A 4B75A 2F3PA 4MUEA 1TTPB 2HTFA 1MAHA 1SQGA 2MINB 4LNUA 4BAUA 1B76A 1ZKMA 4E1AA 2CXOA 3KD3A 2J85A 4ZREA 3WAJA 1GA6A 2QSZA 4RTPA 4V0SA 1S8AA 1TKRA 3T0GA 1MPXA 4QPZA 4D7AA 1F51E 4HDAA 1U0LA 4LK3A 2HUPA 5JCZA 2IY7A 1H23A 3N2LA 4R1UA 4ZC8A 2FMHA 3NIBA 1EIZA 1VGQA 2FZWA 1TCBA 1AUQA 4H4EA 3ZKWA 1F38A 4ND7A 1MZPA 4R3UC 3BKWA 3ZH9B 3T9DA 5C8XA 2HHLA 3UGQA 3OQOA 4G5YA 1W94A 1SBQA 1WB9A 1CZHA 4ZYTA 4A27A 3EDMA 1NOKA 2EBUA 1KMIY 3MGCA 1QDEA 4CL8A 3RVMA 3TPCA 1KF0A 4GE3A 2OAP1 4J0FA 4V0LA 2AFHE 1DPFA 3DM5A 4JD5A 4KYVA 3CTMA 1OWNA 2C42A 3E1SA 5ALIA 5DNVA 3TQQA 2I4TA 2QRKA 3CEJA 2OHIA 5CA1A 3UJNA 3HM9A 5FUWA 1XQ9A 3D6AA 2WV9A 5ALKA 1QO0D 1WOYA 2ZYHA 3CUWA 4JR2A 4L0CA 4XQGA 3NHMA 3CXUA 3UAYA 1ZGBA 1P2SA 5EMLA 1J21A 3SYMA 4YJ3F 3AVVA 5AM1A 1TPZA 1CX9B 3NCHA 4FFOA 5K0LA 3WZ2A 4RMNA 3R7AA 3DO5A 3U9LA 2I6XA 4GPZA 1KYIA 4YGXB 3C6XA 5KWEA 1E0SA 1O1YA 3LP6A 1ZUD1 2HPHA 3K1AA 5T41A 3W4IA 4ZMSA 5LXTB 2BI8A 3MBOA 1RCTE 1AF7A 2HSZA 4BMOB 3WI7A 2AT1A 4ZAFA 2FPUA 3OTIA 5E0OA 5MN6A 4HNAB 3DEYX 2PLRA 2HMVA 3ZE0B 1U5CA 4RK4A 1QIJA 1GTSA 2ODWA 1H05A 4TYPA 3DHEA 3A9TA 1AY0A 3ENQA 3GBVA 5J63A 3WY9A 1UZUA 5AVXA 1OBHA 4DPLA 3IAM1 1D1QA 3BDAA 1YACA 4X90A 5JAQA 2UYCA 2A0FA 2GK3A 5LQMA 2QRQA 1EVJA 4KNVA 3Q5GA 1E5QA 4P6VF 3G0HA 4OQDA 4WCVA 2RARA 3FR8A 4IF6A 1KFKB 5JMOA 4ZOCA 4M9RA 4PBRA 4Y2SA 4CJXA 4FUTA 1JVSA 1UMKA 2IQ5A 3MQFA 3PDHA 2IRWA 4O59O 4H6VA 1FSGA 3QOYA 1YZKA 5C9ZA 2QM3A 2VSNA 2DFDA 1FYFA 5GVRA 5EKSA 4HB2A 3GU3A 3HDJA 4S1WA 4M7WA 2FUG1 1TT7A 1SBNE 5AW3A 4U00A 5DWDA 1A9XB 1BN7A 2PVPA 1XN4A 1FYXA 1CZRA 4C4XA 3RR2A 4ZDWA 4NMMA 2VBFA 4EKEA 2PEZA 3E7FA 2NN3C 1EWKA 3WWYA 4U4AA 4B4UA 2JARA 4BFZA 4Q4AA 2WU3A 4ILEA 3DMPA 3RUCA 2ZE5A 2YYYA 2W4MA 1B6GA 1PK9A 1XWWA 3E5HA 4FE4A 3Q3EA 3AV0B 4PC2A 3I9V1 1FZTA 1ODCA 1YU9A 4XVQA 1XPUA 1USKA 1JT9A 4XWOA 3JPWA 4HWOA 1S2NA 3UG6A 1LPOA 1WF3A 2EAUA 3MWEA 3RYCA 4N5LA 2ZSEA 4RYDA 3E7XA 1NJ8A 3OAAA 3B6ZA 3C39A 2DCUA 1CJMA 3BRSA 3R0IA 1YIOA 1FUKA 1GVHA 3V4FA 4JOSA 3BIJA 5LP6B 4KLRA 1C8VB 2O3RA 5C8VA 2FY8A 2O52A 2IFTA 2CLSA 5IS2A 1PLKA 1ORVA 4B35A 2Y1DA 4CGYA 1W0JD 3NLLA 3WLRA 1JU4A 1PRYA 2AFHB 2H7XA 4MKRA 4LDAA 1VQ1A 2YFKA 2FMFA 1I3CA 2R79A 4DFDA 2P9YA 2IOFK 3E84A 4GSLA 1BHSA 1H42A 4Y7CA 3ZIDA 2H11A 2HHJA 3W8DA 3ZU5A 4HI0E 1J33A 3TLZA 1Q91A 3GRUA 4NQRA 1AU9A 5LNK6 1C3EA 2CDCA 2WC1A 3FOEC 1ZHFA 2YHIA 4C6HA 1J8QA 1E79A 2ZBVA 3MTEA 4INJA 3RM3A 1UIRA 2EJVA 2BSQA 2I3ZA 2L69A 3PCXA 4E5MA 2XAUA 5IWAB 4OJNA 2D06A 3EMDA 2WTAA 3KOUA 1SHKA 3ZK8A 2QAIA 3EAGA 3FFBA 3N5KA 3PR2B 4OQYA 2P6OA 2BH9A 4YO7A 3ZCQA 4Q7KA 4D25A 4JC8A 3ELUA 1LDGA 3BIWA 5GONF 5C1BA 2EEZA 1JHXA 5BORA 3BM5A 2V3VA 1ZCAA 3C97A 1N5IA 5HCIA 4ZCQA 1VLMA 2F1KA 1B8OA 1IDN1 5CBKA 3EF3A 4RC9A 1EFDN 2W7TA 1TJNA 3ECAA 5LIPA 4KPUA 3QKUA 4OPMA 4UBJA 2NUTA 2BP7B 1LFDB 5CBPA 5AHKA 1N36B 2FF5A 1TAUA 4ECAA 1KDTA 3CZ4A 3JWPA 3KKQA 1L1RA 2CL5A 3Q10A 4Y2UA 4YMLA 5LIRA 3EEBA 4HH3C 5BXQC 1OHHA 1XQVA 1CUIA 4PS1A 4GG1A 4M6WA 4DRZA 1DC4A 1GZVA 2FX3A 2HMWA 3RVKA 3S1AB 2P2YA 1Z2CA 1IOLA 2HFKA 1PWXA 3GLKA 1WIWA 4OQMA 1P8AA 3CMMA 4P22A 4PLYA 1E4EA 3H3JA 4M86A 4JLJA 4M1KA 1M7GA 2YY5A 3L8DA 5IVPA 3F5QA 1BS2A 3ZTWA 3HN2A 4MWDA 5CXQA 1XZBA 4I1IA 121PA 3H86A 1UWKA 3I2IA 1JIJA 1HDIA 2P9GA 1A4UA 1J1ZA 5ER6A 4EQ6B 5FOVA 4DLNA 4NYMQ 3ET5A 2QU8A 2OOKA 4FMBB 1SKQA 1T2AA 3WQBA 3WGIA 2XVAA 4R81A 2B0CA 1QB8A 3NEJA 4KSBA 3ZHUA 4YUAA 1Y6GA 4BVKA 3ICEA 1QG6A 4Y18A 4O4HA 1IBSA 2GCNA 2PUHA 3G5AA 2A94A 3DCYA 1JXMA 4JOCA 4DR2B 1UT5A 2KM1A 3VYVA 1IMJA 1DAIA 1DX4A 1LZLA 1YRBA 3G5LA 3GFVA 3AY7A 1C1YA 4LHYA 1KU0A 4C3VA 4F3YA 2ZJ2A 3PLRA 3IQXA 1I3MA 4RS3A 4XPZA 4BO7A 4LGVA 2C04A 3P9CA 4OP1A 2AN1A 3P97A 3DFMA 2C94A 3EXG2 4G8JA 5DBGA 1MBZA 5KQMA 3PICA 3VR6D 3CJQA 3S5JA 5ELXA 3ZY3A 3SHTA 4DG5A 2CV1A 2YJNA 1U9YA 3H19A 3OFNA 4GRIA 4WVFA 3C15C 4ZO6A 3SDSA 3G0IA 2GYYA 4BECA 2UUAB 5EHZA 2VT7A 4GUDA 3EH2A 2HBYA 3E4CA 4W7IA 2E1RA 2AUMA 3F2VA 4IDGA 4J3JA 4UBOA 1XD9A 4YJFA 4ZT3A 5COQA 2G5TA 4F2WA 4QT4A 4Z1MD 2WQ6A 2WTBA 3AB8A 4PFKA 4Q7EA 4B48A 2BI4A 4KBYA 1DEHA 4YRPA 5KTYA 4XDYA 1EFKA 3E22A 3WGQA 2JIPA 2QAGC 2FWJA 1QIIA 4EHHA 4WBSA 1C7ZA 3S2ZA 5EHNA 1GO2A 4Z8XA 4MUHA 4YCJA 1VE5A 2CHVA 2FQWA 4IVRA 1O3YA 1QH0A 2H29A 2VDOB 3GD5A 3H0KA 4JJIA 4NU5A 3ZU3A 3OSUA 4F96A 4M8KA 1EX1A 2I1WA 4JT9A 1SZDA 4NIMA 5D01A 1YIDA 1ORIA 1KI8A 1XAHA 4L4UA 4N3AA 3W8RA 1Y9ZA 2FW8A 3DB2A 5IXJA 1NJ2A 4JJZA 3AVXA 3O82A 1BDHA 1IMOA 1TDJA 2I29A 2PLFA 4KXLA 1PZNA 1QZUA 5DE3A 3P7MA 2O05A 1YZ3A 1OYYA 2G09A 2AJBA 4EL0A 4ISCA 1HG1A 1O6FA 1FLVA 1Z6AA 2RJNA 4H59A 2FUKA 3DDHA 3QELB 3ZV3A 2HYDA 1FYVA 1SB8A 2O8NA 2NO5A 3LSTA 3P2EA 4V1CA 2HSGA 2EL9A 2H4HA 4BWGA 1ZO8A 4TN1A 3LX4A 5FNVB 3BFVA 4F85A 2CNOA 3GEHA 2QGNA 5IFLA 2OO5C 4OKNA 1I4EB 1OGYA 1GADO 3HCPA 3CUEF 3E61A 3OJCA 5TV2A 2F1RA 2YY6A 3AUYA 3IT1A 1JR2A 2GPYA 1BH6A 2C9DA 2OXRA 2YW9A 4J16C 4KO8A 4FINA 4Y3UA 2WJPA 3IELA 4W82A 5CNJA 3ZDFA 4HQRA 2GI4A 1VE9A 2MSDB 5HK8A 3UUEA 2TMDA 4X1IB 5J5VA 4DJFC 5K05A 1ZMBA 4UMFA 2FRDC 3U3JA 3H1EA 3OQHA 3GLSA 3TIFA 1XQXA 2MR6A 2P69A 1NUHA 2W22A 1UKYA 1CYDA 2JFGA 5KU7A 2QG9A 2D3TA 1NVVQ 4GKBA 5MGBA 4MVJE 3FNHA 1PEYA 1G5QA 4Q3NA 4W9NA 1LPMA 5PGMA 4C07A 3C3AA 1PG0A 3TIXB 1AZLA 4P4SB 4DF3A 1OLSB 2FZ4A 2X2EA 1U1FA 1JDBC 1PFVA 3DDWA 4E94A 3QBEA 4B3IA 1ZN9A 4KAXA 3B8EA 2WWHA 3HP4A 1VKJA 3DL4A 1BX3A 2NP6A 3PITA 4U9IS 4MO2A 4AMGA 3PNPA 5J2TF 2H92A 1R1DA 2DGDA 1F0YA 1KRWA 2XDAA 3LU1A 1DKLA 4IVQA 1K6JA 4X84A 3TS1A 1YASA 1T5IA 4WE3A 1FP6A 4PN7A 3K0HA 1KDZA 4NYJQ 1FX1A 2A5FA 2ZREA 4JJ4A 2GM9A 2AOUA 2OG1A 3A3NA 3O9ZA 1K2VN 3A05A 5T8KA 1QGDA 1XU4A 3UT5A 4RCYA 4CTOA 2V7VA 4DDWA 3WV4A 3GCDA 1CBUA 2OECA 4IG4A 2MJLA 3FYCA 4BY9E 1DL5A 4NE9A 3WMXA 4L4ZA 3ZNOA 2Q0HA 3NOOA 1NV8A 5CCEA 4C78A 2H4XA 4RL6A 1X15A 1QFSA 1FS6A 2GTIA 5JD3A 3M1IA 5SV2A 2ZJ7A 2J0VA 5EL0A 3TXAA 5ALYA 5H81A 2F9FA 1N1MA 3S81A 2ZIGA 4Z3KA 1P1FA 3SEFA 2GYUA 4RIHA 1CNFA 2EIHA 3FAKA 4Q6WA 2GEUA 4DMRA 4TLLB 1IL0A 1CK4A 2EU8A 3E3OA 4FZ5A 2CE2X 3WLSA 1HDGO 2A9JA 1SWWA 4RAOA 5B7QA 5CURA 2CFRA 4WFQA 1DT3A 4L74A 1H2HA 1MOZA 3CF0A 1E3WA 1C1XB 3OKAA 5JJBA 2JGMA 3CPEA 3JQBC 2NM0A 3R5KA 2VEOA 2VS1A 3FYUB 1LK0A 3LTNC 1BSVA 3ESBA 1R4AA 3B6MA 3A9RA 5CNIA 3KIPA 3W04A 2IS2A 4ND8A 2WRZA 2IU3A 1MC5A 5TS2A 2CW5A 3G2KA 4NX2A 1J0CA 5CYFA 1DKNA 3MB8A 5GZ6A 4HEA6 4JI0B 1LBIA 1QM5A 3A2MA 1A2OA 1MRZA 1JQKA 2AGVA 3KE8A 2A1UA 2ACEA 3CW8X 4G85A 1IHDA 4YRSA 3DE2X 2PO7A 2P8SA 2P4SA 1C7IA 2UV8A 3IOMA 2NP7A 4E22A 4M9UA 4CQJA 3AIIA 1ULZA 3H75A 5I7WA 2XKKA 2FFQA 2Z6AA 4AULA 1TO2E 3EIUA 3SCZA 4YMTA 3N6RA 2ADMA 2ETXA 4DLZA 1OI4A 1N2CB 1Q21A 5BRAA 2C2YA 2H9AA 4NDNE 1IJFA 1NJ6A 3FVRA 3GRRA 2BKLA 4FYJA 1FBTA 4B80A 5BW8A 1OW3B 2P8JA 4FLMA 3RJTA 4U2DA 3EX7C 4I8IA 2OXCA 1TAHA 3K0KA 2CXSA 3BERA 1RLIA 3HGTA 2GYWA 3TOSA 3D7SA 2Q6OA 2ZRLA 1GD1O 3JWJA 4H3SA 4Y6LA 4HNGA 5TQVA 1DIRA 2QZ4A 3U7IA 4DC1A 1G3UA 3GDOA 1RRGA 3TIGA 3U4AA 2AMFA 1Q7EA 3D8HA 1RMYA 3CLVA 2P91A 2N1BA 4HR7A 3H2KA 2X6TA 1XV5A 5EGSA 4YASA 1R88A 1UBGA 5EFOA 1E58A 4RSRA 1EFHA 1TQ4A 2C2WA 3EJ6A 5CLGA 2PD6A 3ZU6A 4BFWA 4E5SA 1DV1A 1NW6A 2VQSA 1QORA 4YAEA 3VKWA 2OLEA 5HZKA 5LL6P 3E9RA 4LNHA 5K8JB 4U63A 5KYNA 4R8MA 4DJAA 2YZNA 4EUFA 2WIJA 2X4IA 3OEED 3SPXA 3OZCA 2VP3A 4TWIA 3UB2A 3KR9A 4F9FA 3ZLVA 3ED1A 2RIPA 4K87A 3ICCA 5AKYA 1NAHA 4M60A 5SY6A 2YMMA 2V9PA 3BTOA 5C34B 2ZRCA 2VHQA 1VJTA 4W8GA 5AKLA 4LRQA 5HRUA 4Y2PA 5KOIA 3GMSA 4Y1EA 1SU4A 1NJGA 2GBLC 3BE5A 4NENB 2Q2QA 4P1ZA 4X24A 4Q9HA 4AECA 4ZJUA 2FZGA 1M6VB 4HDQB 4DMFA 1RRPA 1UH5A 1X1RA 1BE1A 1UKAA 4RF3A 5KYVA 3SFZA 2BISA 5H59A 1Y63A 1FP7A 2VHUA 2J9FB 4CDNA 4YUWA 4AURA 2Q1WA 2G1AA 3IV7A 1E7RA 1T8YA 3R0JA 4ZVQA 4UM9B 1FU8A 2ONKA 1OVGA 1DELA 2Q4EA 2GCOA 1Z2AA 5DN6D 2WUDA 4EI9A 1ZU5A 2A7QA 5HMLA 5LNK1 5AHOA 4XD7D 3OT1A 1QUFA 3UMSA 3W2GA 1X7XA 2OO5A 5HUQA 3RC3A 3HL0A 1BVRA 1ZNXA 2O3SA 3GLUA 2XH8A 1Z2OX 3K5PA 4MRRA 1O2DA 3PUJA 3LH5A 3K8OE 3VV3A 4A2CA 4PANA 2RHRA 1C0KA 1DE0A 2H4YA 1M6VA 3KVNA 3WQRA 1E2EA 2A9KA 4BRWA 2I2FA 1FOEB 4MV8A 2GZ3A 1ES9A 1Z26A 2QNBA 3KVRA 1LB1B 1CUUA 3TNYA 2H0RA 5E6SB 1GKIA 2E0IA 5A2GA 2VTBA 1CUBA 1N8NA 2Y99A 3OIDA 3V2UA 4UTPA 1Q20A 4BO3A 5ALLA 4QYIA 1MX3A 4MV5A 1Y1PA 3ANSA 2FTKE 3MXTA 3EFHA 1OTHA 4FGWA 3OPQA 4IHAA 2PGXA 1QGAA 1LVHA 4RH1A 4YCSA 4Z6KA 2CVQA 4OQ4A 2QX9A 4C89A 3S8YA 1A0OA 2Q9AA 3HJTA 1UXIA 2QRVA 3L6CA 5KYXB 3OURA 3NB0A 2IELA 5FPQA 1VHQA 1QK3A 1A72A 3FD8A 3DZCA 3KU4A 3P9XA 4FEYA 4Z86A 1U3FA 4NBTA 5D7NA 2C9BA 2QJOA 1HQCA 4R2HA 1T26A 3F9CA 1E9SA 4FOLA 5CH5A 4B4WA 3PZBA 2YRWA 4M7OA 2QLTA 2WJYA 1F20A 3BHMA 3PXAA 3QY9A 3CVVA 4IXWA 4URVR 2QVGA 1ODLA 1Y9AA 1FF9A 1RXYA 2FLKA 1UDAA 3C85A 2ZUTA 1PP4A 4IEFB 5BSFA 4NZYA 4XWWA 3AV3A 3R7SA 1C3LA 5D00A 2HA0A 1YWGO 1P2TA 4XYGA 3F7NA 1E96A 4G0XA 2W2KB 2LCIA 4CKXA 1JU9A 1ZPDA 4H1WA 4R9SA 3TR5A 1N5DA 3V3KA 4AY3A 4ETNA 3ESXA 3K9HA 1F4VA 3THRA 4RDHA 4ALLA 2GUWA 2QP4A 4Q9NA 1JR3A 1BCSA 2ORIA 1VYUA 3P8ZA 3BBPA 4GC9A 4WWHA 4ZOBA 3VBCA 1CTQA 4DSZA 3WGNA 3KOMA 3M70A 2XOKA 4MUGA 4ZEOA 1J0XO 2E4WA 2QTFA 3CH5A 1L3IA 4P81A 2DBYA 4D1YA 3VR0A 1Q84A 2VSOA 1YE8A 1EJ6A 2JAQA 4M4SA 5IVIA 5U4QA 2OBFA 2VOJA 1V9SA 4IUCS 5AW0A 1I3OA 4BPBA 1GTG1 2B4TO 4DA8A 3F96A 3VX3A 1JA1A 1U80A 5A5EA 1DWQA 1QG2A 2IYWA 2GMWA 3AETA 1X80A 3M5DA 3OZRA 3ISVA 2ZCUA 1X9IA 3QLEA 4YEDA 1G9TA 3G2LA 4OAQA 3RU3A 1I6WA 5ADWA 4Z2YA 1DMSA 1FXWF 3GLVA 4M0PA 1QF7A 2YQZA 4N0QA 3C24A 3EXFB 3WAKA 1A7UA 1HLGA 1I51A 4Q4LA 5IF9A 1IHXA 4NNOA 1Z39A 1MIOB 4O2AA 4XGQA 3SQDA 3TRFA 2IX3A 1MHPA 4MI6A 3FTCA 1YBFA 4OJMX 3EEQA 3T5CA 3OI7A 2YJ5A 5AI8A 1HETA 5ESDA 1AGNA 1YE5A 2MOKA 2CSUA 5K3DA 4W5QA 2CUNA 3ZE9A 4DYVA 2H4WA 2I34A 1U0NA 5TMDA 1G3MA 1B0UA 3OOSA 1XNRB 1TQ2A 2NYRA 3TR6A 3KPJA 4AWAA 2VNJA 2IEGA 1XHLA 1DJLA 3LUGA 3G2HA 3HRHA 4I4LA 4RFLA 4RJIA 4WOBA 4XGRA 3O26A 2A2ZA 2ZJ3A 2Y92A 3V46A 2QTMA 4MV3A 1RJGA 4UFPA 1U8CB 1R0SA 2ZUWA 1LX6A 2Q9UA 2QQ5A 1U3TA 2JFVA 2FSIA 2ZTUA 4LQDA 3AXTA 3P1JA 2BFFA 3DC2A 3HDVA 4P4LA 3AESA 7REQA 2BTQA 3BMNB 1USWA 3OY2A 1Y3IA 2WAMA 4JLMA 2B8TA 4JYMA 1N0WA 1Z6PA 4HYYA 1IEQA 3B3GA 3M3PA 2NVWA 1SVMA 2PYDA 3LQKA 1F48A 1J0DA 1XTKA 3M6LA 4PHHA 5B2ZA 1ZGJA 2I2AA 3PLAE 2H5JA 4L9SA 1KXJA 1DTWA 1ZM9A 3EWSA 3UNXA 5IEBA 4DUGA 1EFTA 4GOXA 2Y3IA 4QQFA 1GGJA 2H31A 3QU7A 5DO9A 1YHYA 3GFOA 2XVMA 2CVFA 4DNFA 2QN9A 2VPIA 1O94A 3GT0A 3LF1A 1V7ZA 1YDHA 5DRYA 3TPZA 4D6PA 5HQTA 1H4QA 1AIPA 2B98A 4BVAA 3E27A 3CF4G 1QIGA 2G06A 2KQUA 3CNEA 1HNXB 3FCOA 2JK1A 1Z7WA 2RC6A 2O3QA 5G4KA 1BYUA 2R9VA 3LC2O 4L9WA 1K88A 3ZXIA 5L53A 2R1UA 1F8XA 4FEEA 4R68A 1PDVA 2NSLA 2AZMA 4QBTA 3BXHA 4PEVA 3ZWDA 3FM9A 4M49A 2A88A 3FTDA 2Q6LA 3GZJA 3IA7A 3L06A 3LUCA 3MJHA 1CD5A 4NOJA 3SKYA 8ADHA 3NATA 5IJ9A 3IUEA 3KFLA 3DLAA 4M0FA 4IDFA 2DOKA 3HCAA 3SMVA 3OC6A 2YNMD 2A5LA 5JCPA 2GAIA 4FDLA 1JEEA 2Q0QA 2V8BA 1JG3A 2P2GA 3TSCA 2A14A 3BWEA 3BZUA 1RZRA 2PUTA 1J7JA 4XYEA 4A0SA 4X71A 2OQIA 1ZJJA 3SYRA 4BGDA 5NLLA 4KMSA 5CM2Z 3V6MA 2WABA 1NUUA 1TECE 1IAVA 1G64A 1TT5B 2GPNA 1ZW6A 2AZDA 3M6WA 4JEIA 1EK6A 2QL9A 4QOGA 5DBOA 2BM0A 4PG6A 4DHWA 4DT1A 4MHTA 4L6AA 4MPTA 2LV8A 2BFDA 1WVGA 3A9SA 4E5UA 1KMCA 2AD5A 4F2HA 4MS3A 2C4NA 4MMXB 3BWCA 4OYRA 4D98A 5KJEA 2G77B 4ZVSA 3Q3IA 3MT7A 3OA0A 4I14A 3PTLA 4QVGA 4RJKA 4BV8A 2IS1A 3TQHA 3NKVA 1U6KA 1EA5A 1RYMA 1XP5A 4YWJA 4CKBA 1QMPA 1S01A 2CCJA 4AMBA 1RYBA 3AUTA 3F98A 4GDMA 2G7ZA 1J56A 4EITA 4YRZA 1TLLA 2JH9A 3BHJA 1DAFA 4RFSA 4BZXA 2AI3A 4LV5B 3GFQA 4R7GA 3JWHA 1XTSA 2WHYA 2WM2A 3I39X 4H7KA 4IICA 4LBWA 5DP2A 2NVUB 4BLVA 16PKA 2VYFA 3WIBA 1JIVA 2XIJA 2TSYB 3JVEA 2COUA 4KFUA 2EJBA 2JI4A 3NTXA 1RHJA 1G20A 3KETA 2P3QA 1O95D 1LPBB 2VJDA 2PUBA 2ZRJA 1PGPA 4O4IF 3M4YA 1RP7A 2NQ2C 4QA9A 3TDMA 1JR6A 1TB4A 3PE3A 4IDNA 4MYHA 5CU7A 3R5XA 4J0CA 1WZIA 1QRSA 1U2GA 3PQ8A 1Z0FA 1IWOA 4ZYUA 3FY4A 4HK4A 2PSSA 3S70A 4A1FA 5LLDA 4ZO9A 3W6PA 3TECE 3OQMA 1KYVA 1TZCA 1XF1A 3EIEA 2OCAA 4GXQA 4R40A 3QEAZ 3BWVA 1OLSA 5AVUA 4JI8B 5DSXA 4L2IB 1M1UA 3WYNA 2GA8A 2VJNA 3ILVA 3A4LA 3D3JA 4DMUB 2K2WA 5A5VA 1H0RA 5TF0A 4F3KA 2LE0A 1OZHA 4I4CA 4L5BA 3TTTA 2JKYA 1VC2A 4IGAA 1VE6A 3ZJYA 3SM3A 1GZ4A 1SQ0A 4AMZA 1XLWA 4BDSA 4C0KA 4KFSA 3W0LB 2WD7A 2VYCA 4W5OA 1Z74A 2B92A 2ZB4A 3GGDA 3T1HB 2HQOA 1MQ8B 1D8AA 2C4TA 1LPSA 1M6EX 4NNPA 5COAA 5B3LA 4WK4B 5HMMA 3EVZA 1AHIA 1BNCA 1P61B 1V8ZA 3L4KA 4N5MA 4XFKA 2YHAA 5DV9A 1ZYUA 3GFFA 3LT1A 1JFLA 4W9NC 4CNQA 1ADJA 2FSSA 2FEPA 4CQLB 3T7TA 3OX2A 2WT9A 1MB2A 1K08A 3ETNA 2GXQA 4ED9A 4M38A 3WFZA 1YMUA 2H00A 4IP0A 1Q74A 1E0JA 2VPWA 1CZKA 1G63A 3M82A 1EVIA 2O06A 1XFDA 3MRXA 5D6NA 2FWNA 4AJNA 4RDIA 3VR6A 1NRWA 4JEUA 3EH1A 3EPRA 3WDMA 3F2IA 3DE3X 3VOTA 3GPLA 2HM7A 3HM2A 3MEQA 3O4FA 3NWBA 1UZAA 3QJYA 2PZKA 4HZUB 1W88A 3E58A 4FKBA 4A3SA 4LN1A 1CY7A 1EZ4A 5D5HA 3UB4A 3ZDXB 1RPZA 4J7UA 3GROA 3LOPA 2VH1A 1TD9A 2XR1A 4RO0A 3C3KA 3SZMA 1KEKA 5DHFA 1YAJA 3FDXA 2HRQA 4MEJA 3WFJA 3TQOA 3IILA 4XR4A 2P9EA 1YV9A 2I2CA 4MCAA 5AVYA 5FWXB 5KNBA 3TG8A 3GGJA 4LRWA 1VPLA 1PV2A 3KJQA 3NOXA 3ZX4A 3SR0A 4ZI7A 1PV4A 5KMGA 4M1MA 1AHHA 4B3SB 3ZJUA 2EF1A 1ZLXA 3BSSA 3MTAA 3OTHA 5E7IA 5B5SA 2I4IA 4TUYA 5AW1A 2P1DA 3GPIA 2EBFX 2Z58A 2XMBA 3GHHA 2JGDB 5KJ6A 4HH1A 3HK2A 1ECJA 3EGVA 1V7QA 3OIWA 5AI6A 1XA0A 1W25A 3MWGA 4NQZA 2MT9A 1UBTS 4D4KA 5DASA 2Q0XA 4R8RA 4QU8A 1MZVA 3UK6A 4DAOA 4HDRB 5TNXA 2G36A 2G5PA 3BTSA 4HUTA 2PMCA 3W5JA 4BZPA 1E1RA 4JUFA 5K3FB 1LPAB 4EMBA 1JQDA 1NMSA 3MBIA 2ODNA 3TQTA 3NR2A 1RMTA 3CT6A 4X3PA 5EJ5A 1V26A 1WSAA 2IXDA 3P94A 4PLCA 1ZRMA 4EHBA 4R2WA 1GRQA 3LVRE 3I0ZA 3SYTA 5ALRA 4IO0A 5ILQA 1K7CA 2ZT6A 1V8FA 1Z45A 3PUKA 1Y5MA 1IUOA 3TI7A 4BKPA 1WHTA 4YQZA 5JPIA 3FH0A 3WGYA 5B4VA 3ASZA 2XVZA 3JD0A 1E94E 3OEYA 1A7AA 3D8RA 3R6WA 4ENUA 1L4YA 1M2VB 2D5IA 2R85A 2VDRB 2JCVA 3GMTA 3QW4B 1VFPA 3MJCA 1AK2A 3QPUA 3UMMA 4EVIA 3PC8A 4OQNA 1QTQA 2FN3A 5IM4A 3G1TA 1XJCA 4FQ8A 1GAWA 1H22A 2AW5A 3MIIA 1ZIXA 3HGQA 3P45A 3PVCA 2GA9A 4S05A 3ROKA 2VDJA 3HCEA 1PUXA 3HZZA 4PQFA 1E0DA 2XXJA 1W34A 2O4CA 3HH8A 1XCJA 3NGLA 4QU5A 1K7YA 3BB1A 1U8YA 3QOXA 2G4CA 3MJ4A 2VK8A 3LQFA 4KYTA 4MVJG 4ZOAA 3RGGA 2OFPA 2ZJ4A 4YAGA 1L7RA 1L6IA 2Z8YM 2AN3A 1ICEA 1NVEA 3GGOA 1QS0B 2QS9A 3L79A 2WZQA 3CPSA 2ZRPA 1L7QA 4B2IA 2J5XA 2DJ5A 4C30A 2M1XA 3EARA 3BEDA 3GRPA 3G0GA 3N86A 3CE9A 1R12A 2WDZA 3UHFA 4CYMA 1GZSA 3TFOA 2RE8A 2ZRHA 1TF7A 1KMMA 1SC3A 1XRMA 4L6CA 4RJJA 1SQ6A 4YJDA 5DNCA 1OH6A 2X5XA 2XCUA 3KELA 1UXKA 3VZSA 2J0SA 3C98A 2BR4A 3NWPA 3TIVA 4ZT2A 4F8EA 4PHGA 1KZ6A 2PUVA 5TIIA 2QUKA 1EFVA 4B73A 4C2TA 1Y8CA 3PP8A 1A69A 4K88A 2G9NA 4HWRA 4BNNA 4OAPA 2AOXA 2YMLA 2H85A 1FQOA 2O6HA 3EG9B 4MVJP 3FOFC 4XIGS 4RMIA 3BGWA 1I7LA 2Z1NA 2J9RA 1T6XA 4FEGA 1H9AA 2WHRA 3EDQA 2PN1A 4M7RA 4CDMA 2YOGA 2JLZA 2VKTA 5ALHA 4L57A 1QHHA 3WKEA 4BX8A 3LA6A 4XVCA 1PZEA 4QVIA 4I4IA 2PWZA 2GN6A 5AOCA 4D4GA 1RTKA 2VATA 2OCGA 1AKUA 2QYSA 2R8RA 1CY4A 2XE7A 4OFBA 3FWYA 3KZOA 4BCBA 1B0AA 1O89A 1GR0A 3QLUC 4S2UA 1NE2A 2QLLA 4IXNA 3IUYA 3W78A 3OZSA 3AOEC 1R18A 4HQ6A 1KH1A 4HXYA 1S3IA 1VM6A 3LT2A 3T1NA 3PUYA 4M9SA 4B34A 2H8GA 3WWEA 2CJWB 1KK2A 1YZGA 3IOCA 3NKFA 1UMDB 2E6UX 3VR4A 2J9YB 5COBA 1WA5A 4J4HA 1QCYA 3DFUA 2Q7DA 3D2BA 1N8KA 1SXIA 1U0FA 3ED5A 1P4JA 2IZ0A 2XNDD 2RH4A 3HV0A 4C0QC 2R4TA 1SXQA 5F3WB 4HJXA 1ZJ5A 4LS3A 3WSTA 4Z4EA 3N7TA 2J3IA 3S2SA 4PV7A 1N3IA 2WILA 3HBMA 3E0XA 4CI9A 3OKFA 2PX5A 5JPCA 4F5WA 4EG3A 5TMBA 5ALVA 3ASVA 3G0DA 3S1SA 1J09A 2BYTA 1Z08A 2JFOA 2H8KA 2Y4OA 5GMOA 5CB8A 3DJYA 3JRWA 1GAXA 2IUEA 3WNBA 2FPGA 1ZD2P 2PZAA 1OH7A 1CQXA 1RQGA 2AFIE 1VMDA 4GNRA 3WGUA 2VYND 3CZRA 3OCYA 2XBMA 4GZLA 2XTAA 1XWIA 1J23A 3QYFA 4C6RA 2NU8A 5JQGB 3MCZA 4BJ6A 2IOQA 4OBBA 3M1YA 4BPRA 1Q7TA 2XOXA 4M0DA 1K9SA 1VG9B 1BFKA 3UXMA 3T9EA 1G1MA 4MB0A 4URXR 1O77A 4ZEVA 2OL4A 3OLZA 2XUPA 2MSLA 4RZ3A 4MCJA 4NCIA 4UC0A 5FA8A 2P9BA 2AUTA 2W6JD 2WG0A 1I4LD 3AEKB 1B1AA 1I4OA 1ZJZA 4ZAXA 3VR4D 4JJEA 3CIOA 3CNNA 5DF1A 3PXGA 1RAAA 3QXSA 3BEOA 1RABA 3W6ZA 4ND3A 1XQ6A 5KC9A 1CR0A 2LTAA 1A8PA 1HL7A 4IIDA 1MF7A 1P60A 1QFXA 2P90A 3LUFA 1NBOA 4JYBA 1GRCA 4N7MA 4CM3A 5B58C 5C5DA 3QP9A 5AESA 4EFMA 1HDYA 1NNUA 4C5CA 1ND6A 4PVCA 5TRTA 3FNEA 5LR6A 4PNZA 4LQ4A 1YQTA 1TCAA 1ZC3A 3CVWA 1IBRA 3LRTA 1TM3E 3G79A 3P2JA 3QSGA 4LZJA 2ADOA 3ES9A 4IIUA 2WIAA 2JJYA 2KLBA 5EP1A 3ROXA 3FJYA 3VSBA 4NEHB 5C46F 2BFDB 3NW9A 2E4UA 1KK3A 2NVUA 3HRKA 3LKBA 1L8OA 3L5KA 4FHGA 1U0HC 3K1AB 3ZIAD 4P4NA 2VP9A 3H1TA 2FUG6 2YUIA 3AO0B 1Y9JA 1GSOA 5BSUA 4AIRA 3IODA 3HWWA 1E92A 2XCQA 3A1FA 4GM0A 2BCGY 2XTZA 4JSRA 1OBCA 2VTBB 1P7ZA 4ZV9A 2IEAA 4P31A 2IL1A 4D4LA 4NCXA 4EB3A 5ALDA 4EYQA 1Z0DA 2FPWA 2XCSB 3PFIA 4DV0B 5E8JA 3H8VA 5LYJF 2IXFA 4LTMA 2KE5A 2NAPA 2WIFA 4JA2A 2F55A 1USVA 1WLSA 3OWHA 2R6DA 2UU9B 2CLDX 3NDPA 1W6UA 1ZH4A 3CPJB 4IUBS 3B1YA 3R23A 5AOBA 4HNTA 1QP7A 3DBIA 1W35A 3WTBA 2XWPA 3C3DA 1KEEB 1NI3A 3AHEA 1ZI9A 3MMNA 4A8TA 1WNFA 3D6NB 4OQFA 1PSWA 1DFHA 1WCWA 3OOJA 2YN4A 4H17A 2VPYA 5CFOA 1KI1A 2AF3C 3V8BA 1JJFA 2KS6A 3LO5A 4GMGA 4UUBA 3ZKWB 5JSQA 1P73A 3KVVA 4AFNA 3R0XA 5F2NA 2CLIB 3TEJA 3ABRB 4WKGA 5BW6B 3NHUA 4EY3A 4BKRA 2JEZA 3PHCA 4F5EA 1G7RA 3GRAA 3MTJA 3N0RA 5F1PA 3W7VA 2VAMA 3LFTA 4MV1A 5KTMA 1PNQA 4JX9A 3R6GA 4QAJA 1E5VA 1T9KA 1R66A 4M46A 3MILA 3UAWA 1B0PA 1B2LA 1QH1A 1WDLA 1XRPA 3PWTA 1ZXBA 4B3RB 3T7KA 3VR4H 1YZHA 3L1KA 5IN5A 2O5RA 4Z51A 1TYEB 3C3PA 3PJRA 1ODIA 2B5OA 3Q8XB 2BGLA 5KWVA 1C4XA 1MJGM 1M6NA 1I7DA 1SVWA 2CNDA 2VRCD 3KHKA 3IOYA 4ZVVA 4OI0A 1E9FA 1RYDA 2C5AA 2ZSDA 5FI5A 2GJKA 1Y33E 3G23A 5IW8A 1U28A 2P0EA 3S27A 1OFUA 3DXFA 1Q0PA 1HT0A 2RK4A 3BOSA 4I5DA 5J5AA 1X19A 2AQ8A 1P5RA 1PEAA 4AY4A 2OBNA 5LP1A 3TFWA 1BRMA 2VSXA 3FDFA 3EVCA 3N07A 4WFKA 3W1VA 1ONSA 5JH7A 1O6ZA 1KGSA 3RTEA 5H8WA 1UM8A 1JMKC 2GR9A 4MK4A 4AUNA 4X45A 5FV7A 3WLAA 5G40A 4ZGBA 2V03A 4PLWA 3CF4A 3TE7A 3WJAA 1FNNA 1HR0B 1RC8A 1BROA 2ZIFA 3KT0A 5JJLA 2XE4A 4TMVA 4YCNA 5C1OA 3U6KA 1Y81A 3P5BA 5E6UA 3PXCX 1W5BA 2IE0A 2VUUA 2XWQA 2EKPA 4N65A 2C88A 1DOZA 1U7TA 4QNMA 4NJEB 4BEJA 2J3LA 4IGFA 2Z5VA 1AXRA 1NF9A 1EP2B 1KBOA 4WNIA 1EWVA 3SVZA 2ZI7A 4RM2A 4RNCA 2HCTA 5DM4A 3A11A 4JL6A 3D8TA 4EW6A 1V96A 1ZS9A 5AM3A 4JLDA 1KSGA 4D74A 3OJFA 2WPDA 1SKAA 4KE7A 1X13A 4DLTA 2EJUA 2SKEA 5A3JA 3FPGA 5DN6A 3GLIE 3P9YA 1H5UA 3N74A 4BFLA 3K30A 1LD3A 2FJUA 4Q01A 4G4SP 3SJAA 2BBWA 3DAYA 3LRXA 4P54A 3W3AH 3W5UA 5D6OA 1C7RA 4QXOA 1P4GA 4CCYB 5EUBA 3I45A 4NDAA 2XLBA 1ZD4A 1XRLA 3QX9A 4BJ1A 4RAQA 1WAMA 4R8LA 3LBAA 1VL8A 3V33A 1TVKB 2JLBA 1YZTA 3ENNA 4UDOA 1KJJA 4FMCB 3CG0A 4AQDA 2B4RO 4QUHA 4I50F 4UU8A 5G4LA 5JVDB 1OCEA 2Z5LA 3RS4A 3I83A 2GCEA 1GAEO 1LUAA 2BKVA 3IJEB 4Y30A 5K0CA 3ENWA 4JT8A 4I3FA 2AG6A 1U2GC 1DINA 2PEYA 3VFDA 3VV2A 5CPFA 5F2EA 2UZ0A 3BWMA 1IIBA 1U1EA 5JRDS 1DIGA 5KB3A 3T5MA 1V9LA 2ZPAA 4PLGA 5EWMA 3U1TA 4S0ZA 1S8FA 5DYNA 4EB0A 4N8DA 1VE7A 3FMPB 4DA4A 1R6AA 1DO0A 3AHIA 4NBWA 4WNYA 3TM5A 4DUGD 4OV6B 4E09A 4ETWA 3CW2A 1UQRA 4KGDA 1QYDA 1N6NA 1WB4A 5BW5A 5JHGB 4G37A 3QU5A 3HNOA 5CA1F 3KQTA 2HHCA 2IYZA 3QSYA 1YVEI 3LM8A 1L7MA 4XWTA 4JOQA 1SAYA 3JATA 5IJ9B 4GYJA 2PZLA 4NCNA 2RKOA 3H65A 1ORWA 3OJWA 4PO1A 5FOXA 4CWAA 2HBZA 1VMEA 2PX8A 1JPNA 3BD6A 3L1UA 5BNFA 4ZDJA 3VNVA 2JLCA 3QOWA 3CV3A 2IHTA 3UFXB 4I55B 4PS0A 4EG7A 1ABEA 3TEFA 1QQ6A 1ZQ1A 1F5NA 1M10A 5FBLB 5IVDA 3FYSA 3PPVA 3DMRA 4ZV4A 2X6QA 3OLXA 3P0EA 3WNQA 1PL6A 4F2PA 3AIKA 4YCCA 3K0EA 1O6CA 1SGWA 5AM2A 2UVDA 3DTVA 3HG7A 5DX1A 5EXSA 3IAAA 1C9YA 2GCPA 2AK2A 3R3JA 2JLRA 3FB4A 1TEZA 1C4OA 1U4NA 4BCDA 3MZ0A 5EXPA 1SHLA 1PS8A 1XHEA 3B20A 3LBNA 1KYXA 2RHJA 3PGVA 3QWAA 2J5BA 4MNTA 5DHSA 3L8FA 5EPOA 3SE7A 1E2KA 1SUBA 1VYVA 4GPBA 1NMYA 5CFLA 4RVGA 4TZ0A 1TGVA 1ZGAA 2MMGA 5AXCA 3WWCA 5CB0A 1DTEA 3L1IA 3RBXA 1XUOA 1D0IA 5FUMA 3ZXYA 1MFZA 3VA7A 3AH8A 1DBQA 1DJQA 4WEOA 4LXHA 5IRCD 1ZOLA 2GX6A 5LQSA 2UYOA 3G6KA 1EK0A 3AI1A 3R6TA 5G0VA 2R47A 3CKYA 5JZVA 2QTZA 1QP4A 2Z2YA 1FW6A 2JVJA 2Z4RA 3N76A 3SJ7A 4ZJPA 2RCNA 3GPCA 1L2TA 2D1QA 4MDYA 4XEHA 4MX8A 2XDQA 1QGYA 2GPJA 4BX9A 3A7DA 3NH6A 4C0SA 5JD6A 2RH8A 4HYTA 1RWKA 3D4OA 4L8VA 4KR2A 3L0BA 3O03A 4DARA 4A2QA 2AEEA 4ZGWA 4DIOA 2YVLA 1NZJA 3NZEA 2HRDA 4Q12A 4WLFA 2O7VA 3TDKA 2B6NA 2OB1A 3D3WA 4ZT5A 4GX2A 3UTDA 2QZPA 4UVIA 4AS3A 1Y3CE 1GZHB 1O95A 3TLBA 2QTCA 3KX2A 4MUXA 4FFPA 4H31A 4EYOA 5HEKA 3TJMA 5EIBC 3EZXA 1Y8AA 4HUJA 1CUCA 2HXYA 3BZBA 3K09C 4U3JB 4EENA 4KQXA 2W0SA 2OCKA 2X5KO 2XNSA 4X92A 2NTEA 1FQKA 1BXRB 2J6IA 2FGJA 1NU8A 4K6FA 4ZODA 3UKJA 4AZ3B 3C5WP 4KIUA 2B36A 4PF1A 4B2LA 2GXAA 3IX7A 2WEKA 4NWIA 4QJ5A 3TKLA 4I1YA 4CVNA 3GEPA 1IHUA 3D3EA 1T5LA 5EWMB 3JQ9C 3SYKA 3UAXA 4NZ9A 3JYHA 2A9PA 1X2BA 4LEIA 5HTOA 3VPDA 3IBTA 4PYQA 3V2IA 4TLEA 1RFGE 1QX3A 2QL6A 3IERA 3OHPA 3HFRA 5D5PA 1C80A 4LMPA 4DLWA 1HDXA 2XXAA 2O0MA 2AD1A 4GX1A 2I1LA 3ONWA 1PF7E 3BE8A 1TVKA 3CLRC 3GR6A 2CHFA 3KR1A 1LC0A 1VB5A 3N59A 3FMOB 3TLEA 4QT0A 1MB3A 4HLCA 2G1UA 4NH0A 2JH3A 2D5LA 1NLMA 2BSXA 2P4QA 1PJLA 3CSDA 3RSFA 5KVCA 3NDBB 2XF8A 3IP6A 5I3ZA 3EHDA 5A03A 3IYLW 3DEKA 1QWSA 2QBYB 3ZWQA 4WZZA 4MR8B 3S28A 3NETA 3MD0A 3F73A 1C0LA 1NFFA 3A6ZA 4TTJA 3W9YA 1DCTA 2E5LB 3VDNB 4QX6A 1E1QA 2M6RA 3LTEA 2FN8A 2JJ8A 2QX8A 2R86A 4R2IA 1ID8A 3EZ6A 1AMUA 3FDJA 1JDTA 1G2OA 1PT7A 5L9AA 3K32A 5IVHA 2PUAA 3QMWA 4CM6A 4X44A 5JVDF 3IDZA 2WSLA 1CEQA 3F1LA 2YXDA 3IIEA 4Q1VA 4O25A 1MB0A 1QPBA 5CK5A 4ZVUA 4H7PA 1I4DD 2GLXA 3NANA 4WXPA 3QX7A 3DF9A 5FPSA 2Q6TA 1IXYA 3K2BA 4ZOQI 5IFKA 2ZZNA 1FMLA 3JQAA 1QQTA 2P79A 3N2ZB 4WL0A 3C48A 1YJ5A 4YUZA 4HNRA 1HNNA 2BGIA 3VSCA 1E69A 3I62A 1DP4A 2B4AA 3R7WA 4DCTA 4JNCA 1EUCA 2FPPB 3CWQA 5FEUA 2PH7A 1N2EA 1KDVA 2JGRA 3N8DA 1QVRA 2I99A 1XZIA 3C6MA 1U4SA 2VF8A 1P74A 2WB4A 3I6BA 4W7SA 1R8QA 3CMCO 1JPVA 1SVOA 2YVQA 4HRXA 4UBLA 2FWRA 5D3KA 2YASA 4N7BA 2FUNB 1YL6A 4M0UA 2R6AA 5HQ3B 3DKKA 4OX9B 1KP2A 1SEPA 4LQLA 1RHMA 3IIJA 2ZSUA 4BP1A 2WHXA 1L5OA 1QHHB 1W4AA 5JSUA 4LPKA 1YQQA 1MJFA 2IYPA 2OE2A 2WWGA 1X2EA 2JGEA 1E32A 4JB2A 3KRTA 5H7XA 2QUIA 3IESA 4S1OA 1YBHA 3SFTA 1G4AE 4J0HA 4OMUA 4ARVA 3WSWA 2QTRA 1QF9A 1XL1A 5AKJA 4QOJA 3HCFA 4RIGA 2HPVA 4JJ7A 1NPTO 3GIDA 4O2BB 1NVTA 2FR0A 1WZ2A 3K16A 3I92A 5LYJA 3QU4A 4ALKA 4F4FA 3KZNA 2GJSA 4GBMA 4D8YA 4CF3A 2BMEA 1QO7A 2C20A 2QPLA 4GGOA 4EECA 4B81A 4M89A 4B0OA 1YAHA 3K0AB 5T6MA 3TOZA 5E3JA 1YF3A 3ZZ1A 5IEJA 2C8KA 3GLHA 5FOWA 4P36A 5CUQA 1N5KA 4UOEA 3HVRA 3PDJA 3WL7A 3AU9A 4G9EA 4M22A 3ZE2B 4B40A 4D9FA 1E6LA 4IIJB 3DGFC 2AJTA 3FDIA 4K6HA 3PUVA 1D0SA 1P5JA 5A0FA 4MQEA 1L8LA 4DXHA 2HJWA 1R4NB 1CJUC 1U7ZA 1VIMA 2HPAA 2QYOA 2Q3LA 2X8AA 3FGPA 4V2UA 2WHQA 3GZ4A 3GZNB 1OASA 1YJAA 3KTAB 3HYSA 3R9KA 3L7CA 2PSHA 5E2AA 2LRHA 3FSGA 4IDOA 3VGPA 3LLCA 2EL7A 1IZZA 1V95A 1IRXA 3FZEA 1IN4A 4Q3AA 5K3FA 3HXLA 3KSRA 3OCXA 4B7UA 4I6JA 4LJ5A 1I7PA 3R40A 3ZHBA 1AGXA 5EEHA 1DJPA 2C61A 3OPMA 1DG3A 2WFMA 4LJ7A 5DULA 4TM7A 4DIEA 1LW6E 4Q3DA 4DLKA 3C14C 4IOJA 3WGKA 5JSHA 3P0JA 1RKUA 3EGDA 4ECEA 2OP1A 3B38A 2FZVA 1M34A 1O03A 4NONA 4EX7A 2JGDA 2QLMA 1WS6A 1DIBA 3HFSA 3OG9A 4PQYA 2JHCA 1P7YA 5FKJA 4AJKA 1U0TA 1TD1A 2E4VA 1AQIA 1RI4A 2BZSA 4UM9D 4WX2B 1WXXA 4IHQA 2IODA 2JLSA 1SH7A 5DSTA 5F33A 4DMGA 4AROA 4EEXA 2HREA 1C7EA 3M4XA 1F17A 2IKSA 2QJFA 3NG1A 1CUGA 3G8CA 5CAEB 3VDXA 2J3HA 4OM8A 2PKEA 3GGSA 3VNAA 5EUMA 1RPAA 3VAAA 3JTEA 3WZLA 1FFAA 2CE7A 2FHSA 4A91A 1BDMA 3HDTA 3W79A 4HXGA 3LO8A 4LV8B 1NUPA 1WABA 3EXHA 4I4TA 5CFMA 3GLTA 4I81A 1P3DA 2A8YA 2H54A 1XMIA 2Q2WA 4ZALA 5DBFA 4X97A 3ZVRA 1T5BA 3NJ4A 1RYFA 1DLIA 1I9GA 1Q1BA 2DBZA 3EZGA 4DCVA 3BHNA 1BG6A 1GZDA 2A5JA 2NU8B 4YJ2F 5JQGA 3L1HA 3TTXA 1JLKA 3PXEA 4DM4A 1R3UA 1Z4KA 2A4MA 1WP4A 2YWCA 2DHCA 5LXTA 4D92A 4WTOA 5KUTA 1RWWA 5EP2A 1I1NA 1YK0A 2OBXA 3F5DA 1D3AA 1JG7A 1LNQA 2BN4A 3ZHZA 1K3UB 3HJRA 1LK5A 3TZQA 1JAIA 3KLPX 4FSXA 2EFJA 4Q1CA 2QVBA 4E21A 4EJSA 3X3HA 1TA9A 3RUDA 3IUJA 4OHMA 1N57A 3KTOA 4WKPA 5JANA 5AD1A 1KP3A 4B1FA 4R3WA 4W5HA 1CFZA 2QN7A 3DEIA 2NAFA 3A27A 4OHYA 1CE8B 3AY0A 2WD7B 4EUKA 3QEBZ 1U7OA 2WFLB 4EY5A 3H0CA 3ZGYA 2XCRB 2PYIA 5BR7A 1HOTA 3PRKE 2G1KA 4KXUA 2Y1GA 3D7KA 3MTGA 4IDBA 2IV2X 3ZEIA 5BV1A 5CA0F 2YWJA 1NLZA 2RIRA 5C35A 3QG1A 1XLVA 2QZSA 2G9RA 2XMSA 3BDIA 1C30A 3Q7IA 4Y7DA 3ONNA 4IWNA 3WNDA 4QBFA 5CFNA 3CX7A 1DXQA 2V9ZA 3QE9Y 4LZOA 4M87A 1ZD1A 4J7AA 1CB7A 5K51A 1M6YA 1T36B 3TD6A 1HY3A 3BX1A 1P39A 1TAQA 2N75A 4U9UA 4HRAA 3QK7A 1YJ8A 2G07A 4NE2A 1ZNZA 5F12A 5F3DA 3WG9A 4L8GA 1AKRA 4UE2A 3WLOA 3LX8A 3I42A 1E2HA 5E4FA 3U31A 4NBSA 1PBNA 3TJZA 3HJAA 2OXIA 3IPXA 2AX3A 2CY0A 1S2OA 3I9FA 3LWDA 4YFYA 3G9TA 4L2IA 4CKCA 4B45A 1RKVA 2CCGA 2HWKA 1L1EA 1DXHA 1VLLA 3FWZA 3QEMA 4TTAA 2O8CB 4MUAA 1SXJC 1H5NA 3CEHA 3ADDA 3JQBA 3TZCA 1R8SA 1ENOA 3QIVA 4JKIA 4ZIRA 1QVWA 2AYZA 3D8UA 4RZXA 1Z5NA 1UP4A 2WSSA 3VVLA 5IZ4A 4YCBA 1TX4B 1NRIA 4JI5B 1SBCA 1CZOA 2ODAA 1EUQA 1IJKA 4ZKEA 1XKXA 2ERXA 2BF7A 4XDHA 3SSAA 1B6RA 4ZDIA 5FTLA 3UH0A 4NYIR 1SURA 1ZITA 4X3OA 3ZZ0A 2I1QA 3S3TA 3C3JA 5J4HA 2J0UA 1QYRA 1QH8A 4ZRNA 2QTWB 1NQUA 1PJAA 1H8HA 3K53A 5CAEA 1M2JA 4L76A 4XM0A 5C4MA 2VHZA 3JS5A 1OGIA 4G0MA 1Z6TA 1LH0A 1E9DA 1VE1A 4E12A 1YSCA 1HQKA 4LDJA 1DQYA 1F3OA 3SJBA 1ENZA 4K3UA 3PQFA 1K7FB 1XZMA 2Q5CA 2VHEA 3PHIA 2QG6A 4Y9UA 3QA3E 1O5IA 3MQ4A 3OP4A 2E4YA 1U2QA 1E66A 3J80A 3RFCA 1XCPA 5I7OA 1Z37A 3FPCA 2NZ2A 3EQ8A 3HO6A 2KB0A 3KFVA 1I10A 4YP1A 5TVKA 1VSUA 5JYCA 2ZVPX 1KI9A 5FWAA 5KQPA 3C3EA 4AU1A 5E1DA 1ZCJA 1SVNA 2J9ZB 2Y76A 4EHIA 3W5AA 1PJBA 3NNDA 3J81k 2PX0A 3CR7A 3H7AA 4FX5A 2J7PD 1NBMA 3CO0S 4D57A 3K96A 2QD2A 2V7UA 3COZA 1AKYA 3CZCA 4QULA 5JNRA 3U4MA 4FNGA 4YRGA 1U8AA 4RTOA 4BTVA 2VDVE 1Y3HA 2FEXA 1E9CA 2W9XA 3NHRA 1CJKC 3B2QA 4N3NA 4P7JA 3NV9A 4U5QA 3RS7A 3B53X 1VGRA 4QYTA 5D5QA 5H70A 1P1JA 2AOTB 3V7YA 3F90A 1N2CE 4U7TB 3SG0A 4OHCA 5F51A 4XYLA 4H35A 4LOHA 3F5SA 3EIXA 2DVMA 2WJ3A 3KM0A 1E4EB 4WXHA 2L17A 1RTTA 1I30A 1AO3A 2O48X 2DLDA 2YV1A 3WGJA 3EVEA 2GPWA 1DTWB 1THTA 2CDAA 3AYZB 4GI1A 5FFMA 7GPBA 4UTNA 5EIEA 2HA3A 4PYNA 2OC4A 2Z09A 1L5LA 4F56A 4L3VA 1UT6A 3K0AA 3QBTA 3OF5A 3QIAA 4MWTA 4RK1A 4RLHA 2OTCA 2L19A 1F7UA 1XPRA 3NYIA 2VAVA 2E82A 7REQB 1FIUA 5TARA 3T7CA 3U39A 5HUHA 3AERA 4KX5A 4E2YA 5A4IS 3OFJA 4RTLA 3P9NA 1U90A 2GHRA 4L8YA 5K0BA 1FUEA 1YB5A 2H1WA 2OXFA 3DBHB 1XXHA 1SR8A 5H83A 3HB5X 3FF1A 3IV6A 1YTUA 4IL5A 5TVGA 3SSMA 3IIMA 1Y4DE 4RV4A 1YFJA 4Q7JB 1PUIA 4MV0A 1Y5RA 3HA5A 4L0MA 5ALOA 3TZBA 2C3YA 3OZBA 3FETA 1NSYA 4QJ3A 3DP7A 2X58A 4XB1A 2C7PA 2A1IA 1JDZA 3A31A