3RGWS

Crystal structure at 1.5 a resolution of an h2-reduced, o2-tolerant hydrogenase from ralstonia eutropha unmasks a novel iron-sulfur cluster
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
270
structure length
270
Chain Sequence
PRTPVLWLHGLECTCCSESFIRSAHPLAKDVVLSMISLDYDDTLMAAAGHQAEAILEEIMTKYKGNYILAVEGNPPLNQDGMSCIIGGRPFIEQLKYVAKDAKAIISWGSCASWGCVQAAKPNPTQATPVHKVITDKPIIKVPGCPPIAEVMTGVITYMLTFDRIPELDRQGRPKMFYSQRIHDKCYRRPHFDAGQFVEEWDDESARKGFCLYKMGCKGPTTYNACSTTRWNEGTSFPIQSGHGCIGCSEDGFWDKGSFYDRLTGISQFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Membrane-bound hydrogenase (NIFE) large subunit HOXG
publication title The crystal structure of an oxygen-tolerant hydrogenase uncovers a novel iron-sulphur centre.
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase
total genus 79
structure length 270
sequence length 270
ec nomenclature ec 1.12.99.6: Hydrogenase (acceptor).
pdb deposition date 2011-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
S PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 3rgwS01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 3rgwS02
3H3XA 3ZE7A 4UQPA 2FRVA 4CI0B 4KO2S 4KO1S 4UCXA 1H2AS 1UBUS 3CURA 4KL8S 4UQLA 4KN9S 2WPNA 4UPEA 3AYZB 4U9IS 1UBRS 1UBKS 4IUCS 3ZE6A 5JSYA 3ZE9A 3MYRA 1UBJS 5JSHA 1WUKS 1UBMS 1WUHS 3CUSA 1YQWA 1H2RS 4UCQA 4UE2A 1UBHS 5A4FS 1FRVA 1E3DA 4KO3S 4UD2A 5A4MS 4GD3Q 1FRFS 4OMFG 4TTTS 4URHA 1UBLS 1UBOS 3USCS 4C3OB 1WUJS 5JSKA 3RGWS 4KO4S 1WUIS 4UEWA 5JT1A 4IUDS 4UE6A 4UE3S 4UEQA 3AYXB 3ZE8A 3ZEAA 4U9HS 1CC1S 5JRDS 3USES 5A4IS 1YQ9A 5JSUA 4UD6A 3UQYS 4IUBS 4UPVA 5D51S 4UCWA 5ADUS 1UBTS 1WULS 1YRQA
chains in the Genus database with same CATH superfamily
2HXGA 4F7DA 1B26A 3CONA 3QKRB 2JH9A 4RTJA 2XJ4A 3ZPXA 3PNSA 5EIWA 1ZC4A 1CY4A 1TU4A 3WWOA 3QXGA 4L51A 2ZANA 2PQ2A 1P8JA 4Q05A 5LBUA 3WWDA 4D99A 1M76A 3V1UA 1L7BA 2C7QA 1ZXXA 3MINA 2CDCA 4LJ7A 3BWEA 2QZ4A 4EGCB 4CKBB 1OXTA 3G5UA 4QFDA 2CNWD 2IE0A 3LL4A 3BGDA 2QTTA 1UBEA 3GB9A 4R40A 3BEDA 5AKKA 3SS8A 2HXSA 2IW1A 3AQIA 3O8LA 1O6FA 2A35A 1B0UA 2VWHA 4Q02A 3W6PA 1EHCA 2W11A 3QFSA 4M1MA 3X2EA 4EGSA 2XSZD 4BE7B 5CK5A 3SZGA 5BRNA 2QN7A 2JAOA 4K9MA 1EG7A 4FZVA 1D8TA 5K3DA 3ZCPA 3IDAA 4KMMA 1JKXA 1GQRA 4BB0A 3EPJA 4JUFA 3SS7X 3HXOA 3I2YX 2PM8A 4O4IB 3D59A 2H5LA 2K6GA 4RACA 4JSTA 4NJMB 3T0FA 2A0UA 2WAMA 2ZI5A 3ZGOA 4Z2AA 2PR7A 3RKSA 2GOYA 4NBKA 1YL6A 2WZBA 1E3TA 3IDZA 4TQUS 3JQGA 1EFPB 4Z4GA 3FOCA 3NWOA 1RXYA 5LUBA 1ISSA 2Q2NA 4NSNA 2O48X 3WLJA 1OUMA 1N2OA 1SCKA 3LDAA 3OCCA 3UCXA 1YGYA 2W00A 5E4FA 4PLGA 4JX8A 2ZJZA 2D2VA 1NDUA 3AZOA 3GFBA 3EA5A 5AJVB 4Z7QB 1G8HA 2VUSA 1VSTA 2Z5VA 4JCCA 4XYGA 1JJFA 2C8KA 1YWGO 821PA 1E8MA 1EK0A 3JTMA 1E3SA 4ETNA 1L8QA 1DQNA 2IUYA 3I9JA 1PGOA 4R83A 4H31A 1CUXA 2RH4A 2WVGA 3RSOA 3UATA 4EKYA 3QE4A 2YWGA 3HV2A 3NWJA 2X3UA 3UA3A 3W8FA 2XB9A 5CB4F 5LXTA 1OWPA 1P3Y1 2GKOA 2Z8ZA 2AEJA 4RVGA 2XR1A 4FFMA 4GVXA 2QP4A 2CXTA 2FGJA 4UEWA 3WLMA 1H4QA 3THWB 1NAIA 4L2IA 4QUBA 1GTVA 4RAOA 4B87A 2OM6A 2I62A 2JFOA 1BWSA 1C9NA 4QBHA 3QFHA 3FG9A 4X65B 5C1IA 3ZLTA 4HGPA 4TYPA 1OASA 3IQDB 4U9HS 5HIMA 2ZTLA 4AJKA 1HKHA 2NZVG 1TQ4A 3AU9A 1CRQA 1WLSA 3WO1A 1WSBA 5T4HA 3CLTC 1JH9A 3JD0A 2JL1A 1L4MA 3AGQA 4FDUA 1GRCA 4C76A 3B38A 4EUSA 2LP4Y 4DV1B 1U2EA 1NVAA 2AX4A 2ACKA 2FPIA 2JEOA 2RGYA 4GOND 4PZLA 1DJOA 1AN9A 4KH0A 1R0YA 2CF5A 2I0FA 2MSLA 2IL1A 1I4EB 4UREA 1HPLA 2C3MA 2V7QD 2ZYGA 4LMPA 4QQFA 1E98A 3SQOA 3PFGA 3TFOA 3M7IA 1KI4A 3GAMA 2UZAA 1F3OA 2WNIA 4OUDA 3P52A 3MD0A 4D80A 3LX4A 4TMWA 1I7DA 2JLAA 1TCVA 4LJRA 2DKNA 1SBYA 1W5FA 2FSVA 3ZDQA 5AW6A 5IWAB 2NU7B 1K63A 3TIIA 2EZUA 4GNKA 5BT9A 4E32A 4K87A 4AS3A 1KIAA 2OB1A 1PL8A 4V0OA 1KXJA 1IQ0A 2J1LA 3U5ZB 1WW3A 2XHZA 3CPHA 3OE4A 3TJMA 2G06A 2MYPA 2C99A 4B74A 2V4ZA 3CY6A 4B7ZA 3ZCXA 4C5CA 3WL4A 2OECA 2PZBA 5B6IA 2JD0A 4NHOA 2F17A 3WGQA 1ULBA 3K8YA 2OTCA 4X63A 5FBLB 5KHLB 4WADA 4H27A 4NZ9A 2GF2A 4JJIA 1ULUA 4C87A 3HCRA 3BRQA 1FLNA 4B2YA 3GY0A 4MUGA 1GYRA 1YAJA 3GMSA 5LDGA 1N2IA 1P9LA 2OK7A 2FQ1A 2PX6A 5LOVF 4RTOA 3RYCB 4M99A 5A4KA 5C8ZA 4II7A 3H5LA 1Z7GA 3JVEA 2OHHA 1ZY2A 3EVZA 4ARZB 3QI2A 1X7HA 5J2UF 3U26A 2TS1A 3NUGA 1ISHA 1FP2A 2FLVA 3G82C 2C5AA 4JLNA 1U0NA 3BKXA 2C3PA 2D0DA 4YV7A 1TZBA 4F1KA 2ES4A 1DADA 4LC9A 4DMUB 5IN4A 5ICMA 3EG5A 4NS4A 2NX2A 5JFTA 3SOPA 1I4WA 3ETGA 1M6VA 4DSTA 3KCQA 4AS1A 2XUGA 1W87A 1WXDA 2CC2A 2PLAA 1UP7A 2Q5EA 3P8ZA 3ADKA 4UM8B 1JVNA 2H7XA 3RW9A 4KFSA 2Q2OA 2OHOA 2WC1A 4II3A 1QOQB 2OUIA 3JQAB 4LRTB 4UHDA 2QTZA 3W7AA 1QU3A 3U7IA 3G1WA 1FFCA 3OOJA 2D5BA 1CZKA 4QRHA 4YT4A 1FTWA 2P4HX 4F6LA 3N07A 1E63A 5I7SA 2EKDA 5I51A 3INGA 2IITA 1AKUA 1NMZA 2V3VA 5ALOA 2DG2A 3BL6A 4B48A 3MWFA 2YWDA 2HZ7A 3A1FA 2BBOA 2Y9MB 3MMSA 3PGLA 4HQ6A 4R3WA 2F59A 2I3BA 3DPIA 1CJVC 1SCBA 1TVKB 2RSLA 3UC9A 2F8SA 1V96A 4RMJA 2WSSD 4WXHA 2J09A 4MLCA 5CB4A 3B60A 1CEQA 4XWAA 1IBLB 4HZIA 5EJ2A 1QF7A 2HADA 1XAGA 4DA8A 1I36A 2B1GA 1QF6A 5E4YA 5E4TA 4LE0A 4EPVA 3F5MA 5CEFA 3EJWA 5L4LA 2AF4C 4RVOA 1C4OA 2ZDHA 3HB4X 2RG1A 2EBWA 3BC1A 1ATIA 2C2HA 1JN0A 1C0EA 1EFVA 3NCTA 4LBZA 2BFDA 1Q1GA 2ESRA 3MGGA 4I5DA 3SN6A 1RBMA 2QGNA 3IP7A 3AR3A 2Q3BA 1W36D 1K8RA 1HNZB 2BM9A 1MKYA 2BOVA 2VDWB 4DF3A 4ARIA 2C31A 4LJ6A 2B1IA 3A27A 4C1BA 2BYTA 1G38A 3W5AA 4Y7DA 1DIBA 1NR7A 2FW1A 1RJGA 3IT1A 2HJSA 4D0SA 2H4FA 4MYDA 1RBZA 2R5FA 1NU6A 3MJVA 1AUXA 4ENSA 4EJ2A 1KK3A 3BWBA 3ZGNA 2X0DA 1YZVA 1UUFA 3CVJA 3ENVA 1R16A 2F3SA 3OWOA 5IDQA 1KAMA 1NF2A 3AY3A 4KWEA 5BP7A 4BFYA 1E2QA 3DT9A 2Z2ZA 3GT7A 4MWBA 3RUAA 1CYDA 1I1OA 3QJYA 2A86A 4P2GA 1E4YA 4WKGA 3FRIA 1Z0DA 4CDMA 3GP3A 1GOTA 4W1SA 3WLRA 2AFIB 1QHHA 4IRMA 1AXGA 3CBQA 1WPXA 3ILXA 2Y1GA 1BNCA 4PZEA 4Q9IA 4IDGA 2IS4A 3IODA 4EYQA 3MNFA 3LUKA 3E2PA 4D2IA 1ZK4A 3RU3A 5B7GA 1HV8A 1LI5A 2C2MA 4MV0A 3I9OA 3OZCA 4JKYA 3L1UA 3PJRA 3TOXA 3MTEA 3W7VA 1TF7A 1CS0A 1UBRS 2BJHA 2VRCD 3M1AA 5DULA 5GOZA 4EWLA 3PDCA 1EGMB 1KKLA 1VI5A 4ZT4A 2OAGA 3K0AA 5B2EA 5LOVA 1SRQA 3NM6B 1KZ4A 3CH4B 3IIIA 3M2TA 1G2QA 5EXTA 4HAVA 1R8XA 3I32A 2IZ1A 3JD2A 4GL4A 3NOXA 1U2SA 3FW1A 4UZFA 3EDOA 4Y8VA 5HG0A 1S4QA 2BFPA 3M3DA 2HRDA 3RUFA 4ER0A 3R2JA 1E1YA 2IODA 3PQ4A 3U4CA 3WG9A 1NNI1 5J2UA 4TT8A 3QEAZ 3HZZA 1JG6A 4XIGS 3O8QA 3G0DA 1FUUA 4CN8A 4YO7A 2HK7A 3ZWKA 1N78A 1Y3DE 4K0RA 3ECAA 4ON9A 3GMTA 2VEOA 4KVGA 4TZTA 4X8HA 1KOGA 5M5BA 3HUFA 4RIIA 2IBSA 3G5AA 3H87A 1P0QA 2HBZA 2OCBA 5B3JC 3IBYA 5AK4A 4MVJD 5B3KA 1N2ZA 1OJLA 2D7CA 4IHJB 4TXNA 3JQ7A 2NU8A 4MB2A 2AN9A 1DTSA 2X9NA 1F48A 5K8VA 2D74A 1J70A 1PJTA 4YREA 2IYEA 2O8NA 3I6MA 3KOWA 3ZYCA 1XN4A 3PNMA 3G0BA 2F3UA 4O2BF 4PX9A 5F5NA 1G6KA 2EHJA 2A8YA 1NLYA 4C3OB 1U31A 3CLHA 3R9WA 3VM6A 3K94A 1Z0KA 3H9QA 4Q9HA 3SM3A 3VJLA 5BV0A 1BEEA 1QHYA 1PU2A 4UVEA 3LW8A 3R9IA 4U7GA 4YMIA 2W2LA 3DGFC 2OE2A 1XRMA 3BGIA 4I1OA 1XDDA 2AQKA 1SZDA 3LOUA 4ODIA 3RTCA 1QMGA 2GUGA 1XPJA 6REQA 1PGJA 2OBLA 1E1DA 1KZ9A 1G6HA 3QVMA 2LBPA 4LZAA 3ULKA 3RANA 4B8WA 4KQ9A 4C7JA 1OT3A 1QVAA 1RAHA 2P40A 3KB6A 1XMJA 1HNWB 3DG9A 1A4XA 2IOQA 1M0WA 1VMKA 4OFZA 2WSMA 2RBGA 4XARA 2DHQA 1AQIA 2NTYC 1CC1S 1QS0B 4ACAA 1S0UA 4QVIA 1RYDA 3MMNA 2JHAA 4JI7B 5B30A 1HSZA 1ZIDA 2Q5IA 4AJ2A 4KC0A 2P3LA 3OKPA 1QFXA 1S8NA 4QNMA 4Y2GA 1JUDA 1P9RA 2X3FA 5A1JA 1ZD3A 1M67A 1D2HA 3KC2A 1G3IA 1IB6A 4LWQA 3UENA 4C30A 4IF4A 3VNQA 4Y1FA 3RYHB 1QIKA 1JECA 3FVRA 3HY4A 2ECKA 2WJAA 3PRJA 1PFWA 3MUNA 4Z3DA 5JADA 3ZDCA 4B8YA 3QVOA 1L4KA 2NAFA 2V6MA 2E4YA 1T5BA 2ZOSA 2O0MA 4G5RA 1WZNA 2I6GA 2PAAA 5K0NA 3ZUGA 4YCDA 3ZX5A 4CKZA 2D2XA 1EFDN 1JEOA 1QLJA 1DPGA 2J41A 2OV3A 3OLYA 1CRZA 1LVUA 4O2RA 1X1EA 4R2LA 1VSUA 3UJ9A 5JC1A 2X0NA 1NN1A 4QFBA 5IDVA 4AVYA 1N8SA 1YIAA 3NIBA 2IHYA 3AKEA 4P4SB 3E0XA 1Z75A 1YZLA 3NIFB 4CKEB 2H7VA 2KB0A 3B52X 2GFHA 3C3PA 2HA5A 4NIMA 1JTVA 1A71A 1EE9A 1X1DA 2Q1YA 1ZVJA 2ANBA 2QDXA 4O0MA 4RJKA 1U0EA 1XHLA 3EWNA 4LNAA 2JJQA 1NXXA 4EY6A 3MWDA 4G67A 2C7PA 4XYLA 4X92A 2P62A 1KE2A 3E58A 4CFYA 4GLFA 4G86A 2FW6A 4JZYA 1YVEI 2QRHA 2WIJA 3SKVA 5I45A 1SEVA 4TMZA 1EAMA 4BNZA 1U3VA 2BSAA 3NBZC 3LVBA 3IAAA 3F78A 4J0JA 3SZRA 1NQUA 3CRNA 3M6AA 1CUVA 2W6IA 3GDWA 3SEAA 1B6RA 1M6YA 2JBAB 3T9DA 3W1WA 5DMXA 2D1QA 4ALNA 2ZYUX 4JXJA 3ZXSA 5P8WA 3F7TA 1EVZA 1B73A 4BQQA 4Z1MD 4QGBA 1I8TA 1U9JA 4QE3A 1XJQA 4H1UA 3D3KA 1KYYA 3Q98A 3RD5A 5AJUA 1V39A 3IBGA 1X0XA 2R8PA 1NVFA 2W2VA 3IHWA 3NTXA 4KNYA 3LHDA 4YAEA 2HBYA 4NDAA 1P6UA 4LVNA 1E3DA 2FUNB 1ZK3A 2Q5LA 2RHHA 5KQLA 1W0JD 3EA0A 2BFEB 3ZX4A 1RE1A 5LD2C 3U4QB 3E1KA 3IELA 3MWYW 1DKQA 3DXXA 2C83A 2UVQA 4ID9A 3VU9B 2RMKA 4QFCA 2GEUA 1ZK1A 1FTYA 2EOAA 4XGNA 4E5PA 1HSOA 3MSCA 4PO9A 3RS4A 1XDSA 4Q7LA 4O2BA 4H3HB 4YPVA 5BVHA 2HPHA 3PGA1 1XMPA 3BSWA 4P4LA 2ACWA 2VAPA 3PXCX 3V1KA 3RWOA 2A7XA 2H52A 4R2HA 4EGFA 3TPCA 1PJAA 3U62A 5D3ZA 1ND5A 1AGNA 1A97A 3A04A 1E9FA 1XLVA 2G6BA 1A4IA 2E4AA 1H2YA 2WD7B 1GKLA 2EL7A 4HGZA 2IYYA 4LV6A 4I6EA 4K5QA 5H83A 4ZEWA 4D3YA 1FQJA 1DBWA 5EJ6A 1UDXA 1DC6A 2D8MA 3GHHA 1ZD1A 2GA9A 2GKSA 2R1UA 3BULA 4BMXA 4JB0A 4EQ6A 5HCIA 4ENWA 3ZCTA 1KEVA 1TLLA 3QJ5A 5BXYA 1OC2A 1OA1A 1CULC 1MT0A 2RGBA 2AD1A 2V5VA 4WCFB 5EE3A 5I7OA 3PF9A 4MW6A 4C20A 5KDDA 1XCLA 1GCGA 1PWXA 3SQDA 4IDFA 3VNRA 3BM5A 1VE6A 2IT1A 3OVMA 1VKOA 1PK8A 1XRNA 1R66A 2GRUA 3ZJ4A 2UZIR 3FE2A 4TTAA 2A0FA 2JRCA 5B1YA 3WYFA 4UU0A 3U4HA 5JS1A 1CX9B 5IW8A 1H69A 5FADA 2OAEA 4EA9A 1IHUA 5LWQA 4B17A 4Y1RA 4UFNA 2PX8A 421PA 2Q9BA 3HU2A 3E9CA 5LC1A 1JLRA 1S96A 3ADPA 1Z62A 2W22A 3B6IA 4IXNA 4TMVA 2O1EA 1GUYA 4XA8A 4YAFA 1PV1A 3TAXA 3ND5A 2HHJA 4HNAB 5LKRA 1G5TA 1KFCB 2FFAA 2VBGA 1UBFA 2Q62A 2XUKA 4FGUA 3T5MA 5CFNA 5J4HA 3BOSA 1C8BA 1A9YA 1JVSA 1L5RA 1E3QA 1V6CA 1ZX1A 2HDHA 2PLNA 4MS4A 1VL6A 4B6RA 4PY2A 2OBFA 1Y7HA 2VATA 4TKLA 4BX2A 4LE1A 4LOAA 2QUAA 3CR7A 4BQNA 3ORQA 4CTOA 4PO8A 3A2MA 4CCSA 2ZR9A 3GZ4A 3JYHA 1ZIXA 4EKDA 2D54A 2XNHA 3LXUX 4PXYA 3T9FA 3ZCVA 2QY6A 3T1QA 1SCDA 2JFXA 4PZCA 3T3GA 1QGAA 2Z09A 2ATXA 5I47A 1U7OA 4ZT5A 2VQSA 3KL4A 3PUZA 3RABA 4CL2A 1RRGA 5JMPA 1H1LB 3SSNA 3GLFA 3EZLA 3GBSA 1SGWA 2ZULA 3IIMA 4CQMD 5K6TA 3NHWA 4MWEA 4S35A 4JQYA 4XW2A 3R77A 4I66A 3P97A 5A9TA 1E4OA 2Q6KA 3OCJA 3W3AD 3TIFA 3BHJA 4JLDA 4MR9B 3ZZTA 3TNLA 4E5SA 1OTXA 2FSSA 2P2SA 2DBRA 1DAMA 1P5JA 2PKRA 2ZJ3A 2XVAA 3QEMB 1ZDMA 4MA4A 3KYIB 3RKUA 2UU9B 1COWA 3DBRB 1QYVA 3U0BA 1YD7A 3H7IA 1NXSA 5EFZA 3LC1O 1VC2A 4HN9A 4OKSA 1MZPA 1T2CA 2CHGA 1Q22A 3LO8A 4U63A 4CLOA 1ESNA 4XD7A 2IRWA 3M5WA 2PVPA 4XUGB 1QE0A 4I99A 3KX2A 5AVYA 4LW8A 1N1DA 1SZCA 3H2BA 1UZMA 4NK4A 5A4FS 1UC8A 5C32A 2Z6AA 1CZRA 1V41E 1W2GA 4M54A 3RO7A 3UV6A 1MC8A 4OL9A 3OMLA 3I04A 1YR9A 5ALNA 2I2DA 2IW3A 5LM3A 4C04A 2ZCJA 2V7WA 2VZ0A 2ZRNA 4N8SA 1MJHA 5KTPA 3WRYC 3ABOB 4LGMA 3ZXUB 4W5NA 4WE3A 1JEAA 3DOEA 3ORFA 4W82A 4Y2QA 1WXXA 2H9YA 5DK6A 1ISGA 1UPBA 2C5HA 4HDRB 2XOEA 3B2QA 3SFVA 4U3JA 1XSEA 4BVGA 5LKAA 1UADA 3CJRA 1ZGJA 4DADA 2NGRA 4DUZB 2VO1A 2YZGA 5DW3A 4A3SA 4BNHA 2FPPA 1XYGA 2WFZA 1NE2A 1U3WA 1UXOA 3BB1A 4IO0A 1B1CA 4ATNA 1OI7A 1W29A 2R7LA 1PLJA 1UQUA 4RPGA 4B45A 4YX9A 1R6VA 2PGJA 4R2JA 1EM6A 1GVHA 2FPXA 3KR1A 4PG5A 4BV9A 5TPZA 3MN1A 4HNSA 4PXAA 1HMYA 2P0YA 2IGTA 4IIUA 1UQTA 4BJ5A 1XRRA 1H5UA 2JH8A 2P9FA 1RNLA 3QSGA 4D9JA 3G8CA 4Q4AB 4DS3A 3FPLA 2IY8A 4OU4A 2FU5C 3KV3O 5JJCA 1P9NA 4MEAA 1QNLA 1WSDA 2PCLA 2X22A 5JLJA 1A9TA 3TL2A 1BRMA 4MARA 2FHPA 3IUMA 3OQJA 3W5UA 1A5SB 1W85A 3D3JA 4D25A 3IIKA 5I8PA 2FVXA 1CG6A 4Q6WA 4ZYYA 1G0NA 3Q3EA 5I48A 1F7UA 2C82A 1ODKA 1ESEA 3DEAA 2FPKA 3QUCA 4HQLA 3B8HA 2VDQB 1NU8A 1N2EA 1P18A 4WI1A 4JI2B 1JIQA 5ADUS 4KPYA 1Z8HA 4GVPA 4GQBA 4ZVNA 1YAHA 3HP1A 3WQQA 2AXPA 5AIBA 6AT1A 1YMUA 2DUMA 3RVQA 2QX7A 2V6FA 1OXSC 4AJ9A 1JAYA 4H4DA 2VNSA 4Q16A 3OIWA 4B3FX 4J0EA 5IT4A 3P2KA 2PJZA 2VQFB 1V8ZA 1HT1E 4PYLA 5EWMB 5JO9A 4PG8A 4PSKA 2JFQA 2I99A 4BOYA 3GW8A 4C6HA 1KMHA 1U81A 2EBFX 1DC7A 2OBBA 4YUYA 4K6KA 3FNFA 3U4IA 1EVLA 4RFVA 3TM5A 3L8DA 2I4TA 1WDWB 4IMJB 1ADGA 1BG6A 2A94A 1QH1A 3EBLA 1W35A 1GNRA 1GSOA 1MIOB 1PWYE 3DE4X 2WTUA 3ZZ0A 5JY1A 4XVUA 5B2FA 1IBCA 1YHYA 4QFMA 3VRHA 4EL5A 2YHBA 4CN9A 1KYQA 3SZLA 5J43A 1X7YB 1ZU4A 1N3BA 4QUDA 3WHKA 4ZHQB 3EY4A 4TS9A 5T5QA 3M1LA 4LMRA 5SZJA 4L8YA 3CRMA 3PTAA 3KZXA 4ENTA 2FWRA 3VVBA 1RRKA 2CHFA 4X6LA 1PJRA 4PFQA 5FAKA 1G66A 1XQXA 1JBQA 1XEFA 1Z0JA 3U9TA 3ZG6A 3NHBA 4JYPA 2VHEA 2XVXA 5IVIA 3UJCA 1J23A 1QWSA 1XZNA 3O4RA 3FOBA 4V02A 3QWHA 1NUUA 2F6RA 4EAAA 2C0QA 4DLZA 4L8GA 2AWOA 4YJ2B 3CRVA 1L7MA 5T4FA 3L2OB 2FN4A 2OHIA 1N5JA 3GVPA 3QLUC 5G41A 3KOOA 1OOEA 3N0RA 3EVAA 5ALLA 1Z0IA 3I83A 3OOWA 4KDCA 4KFCA 2PMDA 4LF5B 2QAJA 3OE7A 4QQ8A 2Z58A 3DMDA 2C61A 2JCXA 1WZ2A 1LSJA 3IKTA 2FMTA 3P2OA 2YFQA 3EEOA 2WILA 3H3FA 2WAYA 4W7HA 3S1AA 5JR3A 4MS1A 1E7QA 3CLSC 2Q2VA 3E6AA 1FP4A 2WWFA 2QUBA 5FWXB 1J22A 3EIHA 1VSBA 5CFMA 4A8JC 3PVZA 3ZNNA 4QPZA 5HZKA 2G0TA 4P5PA 4D8YA 5THQA 4YR9A 5IFLA 4QUGA 3FCCA 3I2KA 4O33A 5HF6A 3EXFA 2ZRMA 5F73A 4DNPA 4J0DA 2GFIA 4AMBA 3TPFA 4OA5A 3UF0A 3KQUA 1KYVA 5KHAA 4UAVA 4AL4A 3O4FA 4UZEA 1XMOB 2WVHA 1PJQA 4JBWA 3PJFA 2W6OA 4MOWA 3TF5A 3RAGA 1IJFA 2GLTA 2BTQA 4TMKA 3DULA 3B85A 5JWHA 2VL7A 3H6HA 1BN6A 1E3IA 1USUA 1XXHE 2I54A 3N6XA 3CUEF 1AE1A 1WAMA 1O97C 2FE4A 1C9KA 2WLTA 3ICCA 3L7NA 1LPAB 1KFKB 4FFRA 4RIGA 2XQGA 3ORRA 4WW0A 3ZE1B 3RV4A 1RLTA 2DH6A 1LK0A 1X39A 1U8AA 3BHNA 2QVLA 3CZ4A 1BMDA 3O5AA 4JT9A 2VSOA 3PNKA 2C03A 1RFGE 4PYMA 1KC1A 1RQXA 2XIJA 1QIIA 3DVAB 2Q0HA 3R44A 4OBXA 3WJ1A 3HR4A 4Q4DA 5T6BA 5J23A 4MPPA 1GYQA 2OM2A 2P77A 1SVSA 4FFDA 4IFTA 1HE5A 3FMVA 1TAHA 1E1RA 1VYUA 4K2HA 4E2WA 2XYRA 2ZS7A 3D8RA 1QCCA 3NEAA 5H0IA 5BSGA 2ZJ1A 3CFYA 1ZH6A 4N6NA 2POQX 3KWJA 2PD6A 3HZHA 1ZMTA 4IX9A 5AKEA 5HUQA 4NH4A 2BZGA 3OZSA 1DV2A 3ICQB 3QEOA 4J0CA 5C8YF 3E61A 5JO0A 1O6GA 1PT7A 3HO8A 1ZGHA 3ABRB 1OX4B 3FUCA 3F8WA 3HU3A 4FN5A 3AIOA 3S44A 1N6PA 2XJ9A 3GELA 5EWJB 2NU6A 2V5UA 4GOMD 3UMRA 3DGEC 3NCHA 3TTSA 1NV8A 4XDHA 2OBYA 1XTKA 4NCHA 3HKDA 1U0OC 3HA3A 2NOAA 5JISA 4ZEOA 2WUEA 1E9CA 4A0HA 3B78A 2PH3A 1ZMRA 3IPXA 4HL6A 5COBA 5IBQA 1PR0A 3R5SA 1EX6A 3OLVA 4P7FA 1DTWB 5C5DA 4KW7A 5CX1A 5F5XA 3F6BX 1D03A 3VHXA 3L8GA 3V4SA 4Q9DA 4NCAA 1WZIA 5CDYA 5FEUA 2BR5A 1NSTA 2P4EA 4TRMA 3GUHA 4J29A 1L7DA 1I7QB 1SFRA 2CXPA 1JLSA 2ZTUA 4M21A 4XGIA 2EJBA 5I9LA 4H7PA 1SC9A 3IAHA 3N2IA 4MUHA 2A1TS 3OPXA 1I6KA 5FWYB 3QPWA 2QUZA 5EUQB 1SUBA 3OH8A 4NXMB 3AFHA 1Y1LA 1R6BX 2TYSB 2RHRA 2XVZA 2H57A 4EQZA 2NYVA 1E1CA 1SG6A 3D0OA 1GTZA 1Z2OX 4JEUA 3HV0A 5LUAA 1QUEA 4RPHA 1X1QA 4J2HA 1SCUA 3ENKA 4NAVA 3ZYZA 4HH4A 3T41A 1T1JA 4FZ5A 4G65A 3RFFA 1UMCB 1ZN8A 4HO1X 3B36A 4WCVA 1MB3A 2NUAA 2Z2XA 2DTXA 4I4CA 1LDNA 4OJQA 3F0TA 3TQHA 4C4XA 1URPA 1SKAA 1SWWA 1EAYA 3ELBA 4U7TB 3VDRA 5A5VA 5C7OO 5MN5A 4G0WA 1ZINA 4Q34A 4MI6A 2G71A 3NDIA 4MCIA 4DDKA 2XH8A 1MT3A 1GY8A 2I66A 4F8EA 5CDFE 4QUAA 4RA9B 3DYIA 1S4MA 2ZRPA 3O2SB 4MKFA 4NV1A 3H18A 3GJZA 2F1RA 2FI1A 3KKPA 1MR3F 1R4ZA 2ONCA 3LYLA 4GE0A 4AX8A 3PK0A 1P33A 3KFVA 3ZY2A 4RZIA 3IQGX 1PN3A 3NGMA 1WXQA 2CEAA 2YVAA 3RU9A 5DOVA 2UUOA 4ZVSA 1Z06A 3O8DA 3FHCB 3LZCA 4RPJA 2O2HA 3V46A 3WHLA 1RHUA 4J1TC 3SQXA 1KI6A 3OZDA 2OV1A 3AUTA 1IEVA 1K4YA 3COSA 1ECLA 1C80A 4RX1A 3AVOA 1ECJA 1QO0A 3HCWA 1YCGA 1PRYA 1EINA 4X9XA 5T64A 4BMYA 4Q1FA 2B0JA 2X9VA 1DGQA 1VLJA 1XWWA 1UXGA 2GN1A 1P2GA 2JLBA 3Q41A 3AONB 3QVGB 3ZV7A 4QLOA 3HWX1 5FH9A 5C8YA 2QE6A 1SRRA 4M0DA 5ARBA 2RGRA 1H8HD 3RGGA 3LI2A 3THRA 1JTFA 3V1MA 4C6TB 1J2YA 4B4WA 3KSRA 1AKRA 1MQ9A 2GEJA 3PE4A 4IWNA 1FXWF 1HBJA 5LWHA 3DCJA 3LYUA 4UQOA 5DTMA 1YXMA 4LHZA 4AZ0B 1TB4A 1M2VB 2R6AA 1UPUA 2ZIWB 4YUAA 1DS6A 2C7GA 4OH1A 4D02A 3FZEA 5JOQA 4R1NA 5CIYA 2Q29A 1CHDA 1G7TA 2EAUA 1UWKA 3MIZA 3UA4A 5L3SA 1QVWA 3LY7A 2UYOA 2ATIA 2E1PA 1Q0UA 3FH0A 1RZ3A 4UFOA 1EFLA 4EKGA 3G68A 3U3XA 1SA0A 1OU0A 4QYXA 4DUGA 4JBHA 4JFRA 1L2TA 4MW5A 4TRNA 3R09A 1T29A 4JUIA 1QX4A 1SG0A 2EW1A 2VHVA 3LKZA 3E23A 4KHZA 3M70A 3BORA 4ZVQA 2A3NA 4FFWA 1XHEA 1TJ4A 3PDHA 4HTAA 4I9FA 1RCFA 2FLKA 4BZZA 3EEFA 4FEGA 1NUHA 4BKUA 1Y0BA 1VL8A 4LECA 4TUYA 1R4NA 1V6SA 4FOSA 3RTGA 2CZCA 3T7SA 1T8YA 1NN0A 4B4VA 1GZ3A 2O8BB 1GA6A 4DB2A 2V4UA 4M1KA 4RXTA 1TUGA 5F1OA 4MYSA 3LAWA 4UBJA 3RWMB 1VE9A 3L4BC 3B3GA 4RLHA 2WOOA 3A6GA 1QNFA 5IKPA 4OG2A 2FH5B 4W9RA 4XVHA 3N74A 3UW3A 4UTXA 3DV0B 3IR7A 1N0HA 4PSCA 1XDBA 1P7WA 1LFDB 3HB5X 5ELMA 2F8MA 2YW2A 2FTKE 3E0QA 1TFRA 1CB0A 1QHGA 1XXLA 2W2KA 1YCDA 4W1RA 1KTIA 3Q1KA 5HE8A 1MFZA 3B5IA 4DUYB 3HQ4O 4EJFA 3LIPA 5E1BA 4MICA 5TVKA 1G8YA 3T3EA 5GTDA 1MNQA 2IYAA 1WQ4A 3TL6A 4JL5A 4DLPA 2BUCA 2XWPA 1QG2A 3A1SA 4IX1A 3CQ9A 4K8OA 4RZSA 1A04A 3FPBA 4XFDA 2Y0EA 3THYA 3LX5A 1WTCA 4FS3A 1BC5A 3S68A 2XEDA 1MX5A 3ZTWA 5D86A 3K0BA 4ZOEA 3PPYA 3RVLA 5E1DA 4Y2XA 5I5EA 2YWFA 4FCCA 5AOVA 1Z08A 3GH1A 2MWMA 3G9ZA 4IL5A 3STUA 1KS9A 3IS3A 3GLTA 4RKYA 3RFCA 5F3DA 5IULC 1NJFA 3PYXA 1HLDA 1YDHA 1H3FA 3QLUA 5C1BA 3QH4A 3KKLA 3LQKA 2O2XA 5BORA 3LNTA 2PVSA 2OGTA 5TJHA 3TNYA 3VKFA 3EIFA 3FKQA 3IUBA 4G0QA 5FBZA 5FNVB 3T1YB 4YROA 3PV0A 4DAOA 4YMWA 3V48A 1XTSA 1XCGB 1ZM9A 1T4MA 1L4EA 4IV8A 4MUEA 3EUEA 1NF3A 1NM5C 1IFXA 1NY6A 1WU8A 2A4KA 2Q3DA 3ONNA 2L17A 2GN6A 2N47A 3HCEA 3JRWA 1WXWA 4QJBA 1ZM4A 4NMLA 3WYGA 3L7LA 4A8JA 3OT1A 1FU7A 3TAHA 1VCMA 3TRHA 4UOQA 1IJEA 3WK4A 3HN2A 4O6VA 4Q3CA 4D1YA 3IHLA 1YT5A 2OEPA 3NP9A 4I1SA 1CEXA 2LIPA 1FXWA 2ZB2A 4IW3B 1PJZA 4MWOA 2J3MA 4H3KB 2PN1A 4HAWA 3IVMA 4LUCA 3ANLA 4QOGA 5E4JA 4AJLA 4AN4A 4RPIA 4AUMA 7MDHA 1ADBA 5HKAA 4A03A 1VKRA 3DD1A 3NAGA 4IMIB 3COPA 4UMVA 3GD7A 2PT5A 4QTTB 2GERA 3TLGB 3I9NA 4F38A 1YB4A 4FX2A 2WU4A 2PIDA 2IYQA 2Q5HA 3OAAA 4OPMA 2HJHA 1KHHA 2FMKA 2QI9C 1YOBA 2BKLA 3X1MA 3N58A 3CWQA 3T9AA 4D5EA 3KUDA 3SIXA 2IZ5A 4C7OA 1TYAE 4IOKA 2BTEA 3E9DA 4RHTA 3SSMA 1H2EA 3I39X 4X1IA 4QDKA 4QA9A 2CK3A 1KH3A 2IP2A 1OYWA 1XQ9A 3H4IA 4KO8A 1DC8A 4MSUA 4TKZA 3TXAA 5C51B 1FDVA 4AB1A 4CV1A 1P60A 4DWOA 1OWMA 1C41A 3EWSA 4G56A 4PCLA 1A7UA 3LQRA 3H2ZA 4N0EA 2NSDA 3I0ZA 4A2QA 3GAZA 2DT5A 2R6FA 5KWJA 1OI2A 3FGNA 3S3TA 3B51X 4YV2A 4PG6A 3VNUA 2HU2A 1KI2A 1HDXA 1PR6A 2X5NA 3O93A 3OUZA 3M3PA 1D0VA 1GN9A 5D3MB 5G1PA 3JQFC 3W6OA 2ORYA 4E4TA 3CWZA 3PUKA 1SQ0A 2P75A 4PC1A 2QAGB 4KPUB 3CNBA 4LRWA 2SCUB 5BSRA 2M1XA 3NI2A 8ABPA 2SICE 1YZHA 3VISA 1KJYA 1TKAA 4D4KA 4ZVLA 1F9AA 4M0CA 3D3EA 5E2IA 4FNMA 3E9MA 5E1MA 1V1RA 2HNAA 3PSAA 1E6MA 1N6KA 2Q9UA 1X86B 3IP6A 4W6ZA 3P26A 4B2LA 1RE0A 1ENZA 3CX4A 1EE1A 1DZIA 2P7HA 2QKYA 3A8TA 1PYOA 1J6UA 1TJ3A 3WLLA 4NH0A 1RAIA 1OT5A 1Z4JA 1F06A 3O9VA 1E3WB 2A59A 4AZ3B 3FKJA 1KQGA 2V7GA 5BR4A 1QQ5A 3OTIA 1ZJWA 1TQ2A 3FNBA 3KQWA 3NBAA 4PR3A 3HVIA 121PA 3AUYA 1US8B 1YR1A 1M1UA 1WUIS 2YQ4A 2QRPA 3TE7A 2QLJA 4R9UC 2X8JB 5K8JB 5HQ3B 2Q99A 2Q3CA 4PYKA 2VC2B 1EPUA 2J9YB 3BSYA 3DZCA 5H1YA 3ZQ4A 3N6VA 5FD8A 3GNTA 3RCBA 1E5LA 1E7MA 4Z9XA 5CBKA 1ESCA 3EDYA 4PINA 2GXUA 1U3DA 4CBVA 5AI5A 2RHOA 4R71A 4DT1A 1HQCA 4RK6A 3BMCB 3WGNA 2OV4A 1TCCA 5CCBA 2R47A 2FUCA 5JASA 2YNMD 4V3BA 3VH3A 3WHIA 2GYUA 3GT0A 4R1OA 1G6OA 2I6SA 3PQ8A 1Z38A 4DREA 1LX7A 2PIAA 1ZMBA 2ZE5A 5F7OA 5YASA 4M9CA 4ZI7B 1N5RA 3U60B 2W7TA 3MINB 2DT8A 4WSOA 3FUXA 1KVQA 4WRRA 4GZMA 3GA5A 5TX7A 1SXPA 1Z5NA 3ZQ6A 3F73A 1L7VC 3PR1A 1QRAA 2V6JA 1K6XA 2YXBA 3R3ZA 1U7DA 5JC8A 2KLHA 2F55A 2YY6A 2PX4A 1KK0A 1RJ9A 1THTA 1ES9A 4IOMA 2QPLA 2AHOA 2AIRA 1RJDA 1W5SA 1H2AS 1RQRA 5CH3A 5FPQA 4UUOA 4JLPA 4TXMA 4C7VA 1BW9B 1NOKA 5EJ9A 1E1QA 5DHSA 1VL0A 3HE3A 3L4SO 3OG9A 4L50A 1CUYA 1WCIA 4M0KA 3S7TA 3VPFA 3LTNC 1Q83A 1A5AB 1UJ6A 3AJDA 1UAGA 1OIWA 2PZFA 2GN0A 4XYMA 5K01A 3VKUA 5G4KB 2Z08A 4G0YA 2VA8A 1I13A 2CL0X 4EJSC 4KR6A 4ND1A 4XASA 3FDIA 5CVTA 4V1CA 1MC1A 4DR2B 1ULAA 2G4CA 2YMLA 4INOA 5CVJA 4RULA 1SD1A 4H15A 3EEBA 2PUFA 4PGGA 1Y8QA 3S2ZA 1OROA 4J76A 4NBSA 4R5MA 1KH1A 1BHO1 5L3ZA 1XTBA 1XP5A 3IEVA 2FP4A 3ISTA 2DM6A 3JASB 2CB9A 2DLNA 3IA2A 1LPPA 3K0EA 2B61A 2L42A 4EDFA 4TYNA 2GCOB 1WDTA 2I55A 1NDQA 3QVLA 2DP4E 3EGDA 1D4OA 1H3NA 1UPXA 2GPNA 2UVDA 3DTVD 3W0LB 2JW5A 3ST7A 2CFCA 4AWAA 5MF6A 4C7MA 4EGAA 1KYIA 3QX7A 4XUCA 1COZA 3REFA 1CS4C 1U7TA 3IDQA 4N7JA 5LVAA 5CVCA 2QI9F 3VR2A 1TAUA 1JAZA 1UBOS 2O0JA 4YVFA 3GJ3A 2B8NA 1W7AA 4RD6A 1UXKA 2ERYA 2YV4A 2XMCA 3O0TA 4YYEA 4PE5B 3HR7A 4FMDB 2DX7A 1OVMA 2LDXA 3E35A 1PJ4A 1A3CA 5KCMA 4QJ4A 3AO0B 4RTLA 1YH3A 2AMYA 1E0KA 2BEUB 3B2NA 3COYA 3II6X 3TW4A 5A5GA 4AFNA 3O2NA 3HP7A 4HEHA 2CFIA 2PD4A 4C0LA 1L4UA 3U1TA 1JKJB 2AZ4A 4MR7A 2IU4A 3VH1A 1BXZA 1WS6A 2CHQA 2A7QA 3BZBA 1N92A 1WBBA 1GL9B 1XZEA 3G2LA 2FETA 3KU1A 4PAWA 3T5BA 3UB2A 1NTOA 1HE2A 3IVCA 3P32A 2MJLA 2O7RA 3SZMA 1DKUA 3E9QA 2PSJA 4S1OA 3R7WB 3SX2A 4BMCA 5BQ3A 2HHHB 4QOSA 3LLCA 4AF6A 4YLGA 2P9JA 2UUAB 4JEIA 1FP6A 1PQUA 2H92A 2ZVJA 1CUDA 2AMLA 2H4YA 2TMDA 2GX6A 2SHKA 3GROA 1PEDA 2GI4A 1ZNXA 1TM3E 1UFKA 2ZRQA 3BXHA 3ICOA 4GXTA 3T54A 4X3OA 3UPTA 1ZGCA 4CQJA 5H4GA 1UWVA 3QF4A 4FGKA 1N57A 1K5PA 4J1SA 1P1CA 1ZSVA 4TZ0A 4HB0A 5ITZA 3HP4A 1ZKMA 3KZ1E 5BSMA 1RYBA 2ZE7A 3TCNA 1KJ9A 1B16A 4US2R 1CKEA 1PSDA 3QGMA 1BWPA 5KTMA 1JQ3A 1H2HA 3PDUA 3NHLA 4B8ZA 4H1TA 4CF5A 4EBFA 1YBVA 4LX8A 2VXBA 2VFAA 4RTNA 4EZIA 3CR3C 4CQLA 3U7RA 5CYPA 1VP3A 3U3JA 3HDQA 4OQ4A 3H2IA 4H7EA 1GKKA 1FSGA 2PT7A 5ALVA 2DMRA 3H5IA 4FSDA 3KPVA 5JG7A 3JQPA 3T4XA 4AROA 1D2MA 2C4NA 4TQGA 4ECAA 4F4IA 4TWIA 3C8UA 3QU2A 4JWTA 4Q39A 5FQNA 4LHVA 3O9ZA 3M6FA 3EGXB 2X8WA 2XRMA 1XL0A 3CRW1 1DQPA 5JWRA 3TSZA 1ORVA 4RD2A 1K86A 1MO2A 4O4LA 5DK4A 2NQ2C 4BU1A 1NTRA 4Z6KA 5ANRB 2FPUA 3DDWA 1BFUA 2O2ZA 1HDIA 2Z3VA 3OICA 3Q2OA 2G9ZA 1NM5A 2A9PA 2IQIA 1G9XA 2Q6VA 1R7RA 4JOQA 1XTVA 4K9PA 2EHDA 4CIVA 1W4CA 4PFSA 3DCIA 4AD8A 4U7DA 2D2FA 2XTMA 3FA2A 1Y6QA 2J7PA 3SPXA 4AIRA 4DJFC 1GSAA 2J32A 1QYWA 3LT5A 1T24A 4MAMA 2ACVA 2IK8A 2JFZA 7REQB 2J0EA 2BEWB 1QQTA 2AQIA 2J45A 3AZQA 3MOIA 4L8WB 3DLHA 3TQIA 5G3YA 1DEXA 2BLLA 1BHJA 3TEMA 4O5AA 1C30B 1QP4A 2R7KA 4KX3A 5A02A 1KFJB 5H9WA 5JSFA 4UXIA 5JARA 4U7HA 1X8JA 4XDYA 3KTAB 3NATA 3OIUA 4ZVMA 2WDZA 1JR2A 1TKCA 3MMZA 3NKVA 4CTNA 5J59A 3FFTA 1AGYA 1PFQA 4B6FA 2D2IA 2GVZC 2KI5A 3ZWXA 5HR5A 1MO3A 1MB4A 3GLGE 3U56A 3HG7A 1GXSB 2C5BA 2EZ8A 2AOTA 3EJ6A 3EYWA 3VYVA 1AQJA 3LHSA 2AI1A 5DYTA 4R9VA 2GVDC 1MLDA 1ATZA 1XLTC 2BGRA 5TS3A 4D43A 2W70A 4JOCA 2GM9A 5JEEA 3STVA 2UYCA 2LIVA 1DNPA 4YAIA 1IE3A 1OE0A 5H4HA 3OEHA 1YCFA 2NADA 2RB5A 4RF3A 3GP5A 2BV3A 4FFOA 3UAZA 2M2IA 2OV8A 1JF8A 3JQFA 2QJRA 5I9TA 3L06A 3RT9A 4EABA 5KOJB 1KO5A 3AF0A 5K03A 5A4IS 5FFMA 4YWJA 2EQBA 4ZDKA 1NLUA 1KZYC 3UVEA 4TM7A 2ZWVA 2DLCX 1JEQB 3C3JA 1KL7A 1H1DA 1UDAA 1SXIA 2YXNA 3MD9A 4YT8A 5D6OA 5EIBD 2YMMA 4Q19A 4TS1A 1A96A 1JR3E 2ANCA 5CEEA 2HO5A 4W5QA 1DFGA 2QU8A 3KTFA 4HFRA 1TKBA 3I30X 1NKTA 4YHHB 1JG7A 2G76A 4MRMB 5LA6F 1KOFA 2XCOA 3WKBA 1EFUA 4PC3A 2VOEA 4HAIA 1NT4A 4RD1A 1V71A 1XT6A 3MT9A 4RF2A 2PUTA 3AP2A 2H5EA 3SQLA 3D7NA 3WK8A 1X2BA 2XMZA 3LGXA 4KH1A 1YBAA 4E3WA 3KYCB 3WJ2A 2PT6A 1RQ7A 4L9SA 1OR8A 4DMFA 3MTQA 4Q21A 3N76A 4N65A 5H3CA 1QRDA 2C1XA 3Q3CA 2ZI9A 4LJ4A 4WAUA 2GJAA 1V45E 2IYPA 4X24A 5I9BA 2ERXA 2Z30A 4NESA 3TLAA 3VZSA 2MT9A 3ZDYB 1HG1A 1C1YA 4TSFD 1ZK0A 3UICA 2YMQA 1GT91 2ICAA 3KPWA 4DCJA 1YR3A 1KQPA 4DHWA 3CC8A 2YRWA 1GAJA 2ZYDA 4LK2A 1L1FA 3S7ZA 5COAA 2W8ZA 3PNOA 4HS9A 1JR3A 2XODA 3IFSA 1DIHA 1NYLA 1Z7EA 4MPRA 1X15A 3IAXA 4FZRA 4LY3A 4WXPA 4BLSA 1J42A 3C43A 3NEYA 3VAYA 2W9XA 1D2AA 3OD1A 4X45A 5MN4A 1B3BA 1CR4A 1JHOA 1GARA 2NTJA 1R4MA 2G1KA 1UAAA 3A6EA 3LA6A 2HPVA 5CA0F 2JKYA 1ZESA 4NFYA 3MCZA 2JLZA 1EFPA 4H7FA 4LZOA 2YDXA 2H11A 3E4CA 1Z0ZA 4HYTA 2A2ZA 2OBMA 5A3VA 1PBNA 1I4LD 1ZD9A 1QH9A 1U9ZA 2FSHA 1IOWA 2HQ1A 2VJOA 3EFEA 3PDJA 1D2GA 4KX5A 5FOXA 4E94A 4TGLA 2FJ0A 3AOEC 3C1AA 3M6MD 3EPRA 1P44A 4N82A 3TD9A 1H6BA 2XGSA 1M34A 3DKKA 5ERYA 2BCGY 2QP9X 3ZTTA 1DC3A 4KN6A 2NYRA 5EJ7A 1ZI8A 1XL1A 5TNXA 4UBLA 3OQPA 3BE4A 1K2WA 4I4TB 2P9EA 5DLYA 1WV1A 3RRFA 5KJ6A 4U39A 2B2CA 2HD4A 1KK1A 1TO2E 4G4GA 5K5EA 3VU8A 1C1XA 3RUCA 3FVTA 1UXHA 5TQ0B 1G2PA 1GPNA 2HJRA 4K6OA 4UZSA 2XNDD 3RIEA 5CPFA 3TMKA 3AVXA 2HF8A 1WL8A 3KJQA 3SFZA 2GEVA 4S3MA 1XZDA 4KRFA 2FNAA 1GV0A 2CXQA 3NHKA 1D0IA 1O9HA 3PLRA 4RWZA 4RVDA 2X4GA 3AL2A 1AXEA 4KQIA 4LE2A 4JJEA 2J0SA 3PCXA 4XM0A 1M2EA 1Z5VA 3UGQA 4NBUA 1TUBB 4J03A 1C1HA 5G02A 1T5HX 1T9AA 4KUGA 4Y2TA 4JI4B 4UNQA 4YV0A 4YNBA 2YJ3A 4QECA 1LC3A 4QDTA 1P4AA 1Y9JA 3I1FA 1RWNA 4EJSA 4IXDA 2YHIB 3GLHB 2GB4A 1MHPA 3BIFA 3PUXA 2PTHA 3ZHRA 2I4OA 4NAHA 2FW0A 5I9SA 3TB4A 5L8VA 2ZE8A 4GI5A 3WAJA 4REOA 2GTHA 2ZSIA 2PKYX 1DHTA 1JIIA 5HMLA 3SYLA 3Q8LA 1AK9A 1JQAA 2IYSA 1NYQA 2TSYB 2VK8A 1NPTO 3GLHE 3P71T 3QWFA 4G0OA 4IR7A 4JGIA 2FEWB 4C43A 4Y3UA 3NPAA 3QOYA 4RSRA 3KDAA 5L3VA 3OC0A 1JSRA 3EMDA 3U4MA 3JQEA 4XR9A 5COQA 5C31A 5EXDA 3RC9A 3I12A 5BWBA 1H0HA 2RI6A 4AP9A 4F5WA 2HU7A 1SC3A 2OPBA 3M5CA 2H48A 2BFCB 2WPDD 3WNZA 2FEAA 1N2JA 1QQ7A 2Y4NA 4A0SA 1QTQA 3ILSA 4UVDA 2WWHA 1JLKA 4EPTA 2P9HA 3IKMB 3I9V1 4MZDA 2AC7A 4OO3A 4PGFA 3HDVA 1KQOA 5FBHA 5AW5A 5CXUA 3U16A 3SC4A 2GNPA 4M0PA 5LA6A 3MBKA 2WLSA 4U8HA 3I37X 3I2JA 1SULA 5T4BA 3CF4A 1KRHA 4LYDA 1VLMA 1UP4A 3JAWB 4Z99A 2HMSA 4J7XA 5EKSA 3WA6A 3RC3A 4KLZA 2ECOA 3WSTA 4EEZA 4FPXA 1CR6A 4Y2HA 2J5QA 2ZJFA 4XWGA 3R7AA 2P9GA 3AY7A 1A8HA 1GL6A 1EBFA 3D5TA 1DWUA 3DCNA 1CERA 4NZNA 1XZLA 3H11B 2OO3A 4QX6A 5DLPA 3TLZA 4YRKA 4MROA 3N87A 4A0FA 1P75A 3QELA 4RKEA 3SFTA 4ZJUA 3H5TA 3NP7A 3OY7A 3DMRA 3N0WA 4D56A 3B20A 2JI6A 4V24A 5HJ7A 3GPDG 4M7OA 1CJMA 4CNBA 2KM1A 1TIBA 5DM60 2PSEA 4GW3A 1E2HA 2YWJA 3FPSA 4LY9A 2WT9A 4LZPA 3T7JA 3HLKA 5CA0A 4EJMA 1YOVA 2BM0A 4KR3A 3VR6D 2NTVA 3QPUA 4HR7A 3JRNA 3QMPA 5JI2E 3JQAA 1T1SA 2BM1A 2M6LA 3AVUA 2OO5A 1HQDA 2RGUA 4DY4A 4EFNA 1ONOA 4YP9A 3WLKX 1O7JA 3ND8A 1S01A 3WK9A 1RKUA 1FLVA 3UEOA 5AM0A 2QSJA 2VJLA 3KQVA 4IEEA 2ZPUA 2IHZA 2QZSA 1R0LA 4HC4A 4ZFNA 1L5SA 3D0KA 3I23A 4MWZA 2WA2A 4ZOBA 4JEHA 5CLGA 2R65A 2E3JA 1EUDB 2JJ1A 3H1TA 3G2PA 2YOGA 3IMGA 3EQ6A 4LYEA 4N5MA 1V16B 4P92A 5FLXA 3BB4A 1HX7A 2AKYA 5JJLA 4KODA 2ZBEA 2W37A 4Q6BA 1JJAA 1MJ5A 2CLOB 4OMFG 2ZGVA 4KSCA 1P6QA 1AZWA 1QHXA 4URHA 4YC7A 5CR9A 2ZUDA 2H1SA 1VE1A 3VQTA 4BKPA 2JGEA 3AJ9A 3R5FA 4GXNA 4EYEA 2QOEA 3OOHA 2PBRA 4KGZA 4ZJZA 5I7VA 1IXSB 1PNQA 4Q15A 4KZKA 1FTSA 5ELLA 1G8SA 1ZCBA 3WGHA 2HCJB 4B3HA 4G5SA 1PD1A 2GBPA 2HK8A 3C8ZA 4KFTA 2JAPA 2KS6A 4FBMA 4OVKA 3ZNPA 5HHTA 4AQYB 4UE6A 5BQ5A 4JWKA 5DJ5A 4NNPA 4D82A 4N9QA 1F2DA 1NVVQ 4UJ3A 4M76B 2O3UA 4Q66C 4ZI2A 1NW9B 1IM5A 5E9JA 1VPVA 3CNLA 4XPIB 3ZE8A 3HUDA 3OQ6A 4UC0A 1NURA 3H86A 1R6TA 2DFVA 3AESB 4OQXA 1U0LA 2CXNA 5LZ7A 4I55B 3GRAA 4WN9A 2Z9BA 5EIOA 4Q01A 4KPFC 4WVLA 1OZ0A 4HBZA 3TLJA 1E58A 1YS6A 1MC4A 1PFKA 1R0KA 4C1NA 1XEWX 2AX3A 4YXFA 1BA3A 4B0PA 3L0IB 3MQ2A 3QMWA 1K3UB 3IUJA 2G25A 3KFXA 5AJYA 2ON6A 1WXEA 1SKBA 3DUFA 4HFMA 3ZGYA 1ZUWA 3LX6A 5KTNA 1IN1A 2OGUA 1JAIA 2NT4A 2ZIUB 1GCOA 1EJ6A 2EEPA 3HXPA 4KMSA 3AR7A 2IV3A 2VF2A 4GC5A 2Q3LA 5DVZA 5JZ9A 1N34B 3KD3A 2I8LA 4B1FA 5A3SA 3QLVC 4XQ0A 5DYYA 3N8NA 1DOHA 1X8KA 1N6RA 2I29A 4JC5A 3HABA 3WR5A 5EWLA 1IWOA 2V6IA 4DV3B 1A76A 4ROSA 1BCRA 4ZQIA 3DBLB 3AEQA 2WUVA 2GBLC 1T5SA 2HDNB 3VR4A 4WKNA 3TO5A 3WP1B 4U7JA 4R0MA 4CVNA 4LF9B 3KAKA 4MLDA 1I2DA 3F8TA 3O1HB 4I9NA 4OLAA 4C4SA 4AZVA 3KD2A 1WMDA 2R7NA 4RQAA 4CCYB 4CI0B 2AOUA 4W5HA 4EATA 5IK2A 1U11A 2FB9A 1XZHA 4AY4A 5BPHA 4M6WA 3V4OA 5CLHA 2D0IA 2X15A 4X91A 2CBGA 3MLBA 4YCSA 4ZREA 4DG5A 4ZT6A 2CT8A 3H7AA 1MDFA 2J07A 3VKHA 5ALDA 3TFWA 2WHQA 1XF9A 2DYKA 3HSSA 4ZU6X 3AJEA 3VTKA 5JYDA 3QVSA 3AB8A 1MMFB 1O87A 2ODWA 5FBQB 4P35A 3OBIA 3KJNA 3TNDA 3ASYA 1WP9A 1HXHA 1PFGA 3MAJA 1NFRA 2IBMA 3RHZA 1XDWA 1UBJS 3KDPA 2CCJA 3KKKA 3VO9A 3MBOA 3DAHA 4NX2A 2WUGA 2YYAA 4WZ6A 4L1KA 3WBBA 3S2SA 3R24A 1P7VA 1W9MA 3BQ9A 1FNBA 5G2OA 1XE3A 1W96A 3BXFA 3D6TB 3KKQA 4QXPA 4DC1A 2JBWA 2I2BA 2YIJA 5IJ9A 1Z83A 1NW4A 4GGPA 4M1QA 2C2WA 1EUCB 2G9UA 3QKUA 3K16A 4HRVA 2JANA 5CVVA 2H2WA 1AHHA 2YCBA 4AKSA 1BQEA 4D4MA 2HT1A 4IGAA 1Z7WA 1JNXX 1VKJA 1W46A 2BMWA 3BD7A 1NOJA 5IRCD 2O19A 4RF4A 2DOKA 2VHJA 5ALSA 1KO8A 2WTNA 1Z13A 1JA0A 3JRXA 4I1YA 4X5OA 3VR6H 3OM0A 4RELA 3REGA 1L5YA 4EW3A 2DR3A 1X8XA 4HN4B 3OOSA 1UBLS 1WY5A 4F9GA 4F3KA 1AQLA 1Q0RA 5H59A 1KGSA 1UFVA 2QM0A 3EH1A 4QPCA 1V1MB 3GVHA 1FXSA 3RI3A 1SHUX 3UAXA 1X3LA 1D7OA 2F67A 1U6IA 3MHPA 3SDBA 1E0SA 2ZAYA 3FZNA 3LA8A 2PZGA 4KUHA 3HACA 2C57A 1DUIA 4Y2YA 1ZR2A 1YKSA 2YS6A 4I50F 4NHEA 5JNLA 5DIFA 4A26A 4C6SA 3PX7A 3JVDA 3KHUA 3L6CA 4FDTA 3PZBA 4YRLA 5A6SB 4KIGA 5EHQA 1PW7A 5DGDA 3T52A 3PPIA 1OWLA 2X6RA 4FE3A 1H9CA 3QVKA 4LJ8A 3AOEA 3LVRE 4YTEA 5ES4B 2NUTA 2P2ZA 3CM0A 5KYUA 2IHBA 3WY9A 1Y7PA 1YQTA 2QX8A 2RC5A 5CHEA 3ADOA 1PIWA 1Y33E 4EPWA 5FOVA 5TQVA 1G98A 3K1AB 3EVBA 3GWZA 3RUPA 4GZ3A 1SKMA 2HQRA 1O4VA 3PDIB 1A9OA 3IERA 3P9XA 4N7MA 4KLRA 4NG4A 2CVHA 3L8MA 3OQHA 1L5NA 4XKJA 3IE1A 3MAGA 5KYVA 4LHEA 4TLEA 3KSAC 1ELOA 2YHUA 4Q1AA 1KKUA 2B8JA 5FFNA 3QKSA 1GYPA 1HL3A 5I5GA 3ZDDA 4ZZ1A 1TDJA 4X7RA 4G4JA 4CG0A 5EKUA 5BNTA 3P0HA 1RYHA 3AUAA 5DEIA 5JXJA 1Z17A 3A7DA 3EG9A 1UMBB 2GJ8A 3MOSA 3PUHA 3VPSA 2V8BA 3ETDA 2FN9A 3G2NA 4PQYA 5BYAA 4PIPA 1T9ZA 3GF4A 2B37A 2CFTA 2VNJA 3R3JA 1ZU5A 4R41A 2UYHA 3GVIA 3NJRA 3TE6A 3UCFA 2VS1A 4KMRA 1XA4A 3VR1A 5M04A 2YFKA 1YRHA 4H18A 2C7VA 2XMRA 1UOPA 3A70A 3PJDA 4GO1A 4OTZA 4MX8A 3E7FA 3DYBA 2N3ZA 1GUFA 3FIUA 4HDKB 1DOAA 4BVEA 3JD4A 1ZM7A 3JVVA 4FFBB 3ZEIA 2ZUFA 1OV6A 1P0MA 3KZMA 2X6QA 3FUVA 1ZD4A 2ZBVA 3CZ9A 4B80A 5JCJA 2QT9A 3GLIB 1I6WA 3T4PA 2OQIA 5DYIA 1FFEA 3AWDA 5UKDA 1DQYA 4MV3A 3PKJA 1NXQA 4G84A 1C7ZA 3U4QA 3TZQA 1IN6A 1I33A 4GOLD 3JAKA 1W6UA 3VU9A 3AVYA 3WXBA 1R0WA 2VNAA 4WCDA 3AKYA 1LGYA 1WKCA 5LP6C 4C0HA 2HZBA 2F4NA 1UMKA 2ADFA 2VT3A 3O74A 1GGNA 3GDGA 1F0KA 2YUIA 1XI2A 1QGZA 4HWPA 3O75A 4LJLA 5B3AA 3PB3A 4Z7NB 1ZCZA 2PWZA 5CLQA 1RLOA 5AM1A 4F04A 1SBCA 4B3DA 1K8XB 1ZBQA 2FLWA 2E48A 1OPXA 2FZ4A 2P5YA 3L43A 3G89A 3OSUA 4Q1CA 5AM2A 4DCSA 3FGOA 4WUTA 3GJ7A 4YIKA 4PW0A 4JJ4A 5IYZF 1LS1A 2WSIA 3R9XA 3RH0A 4L75A 2WAXA 4ZEMA 2AC4A 3B8EA 4IIHA 5LMCA 2QTBA 3JD3A 4ETMA 3DBVO 1N2CB 1UMDA 1XZAA 4GOXA 4U9UA 4AJHA 4NY1A 5IM4F 1KP9A 1TPZA 3FWYA 2GK4A 1GL3A 3L1HA 4LAFA 5JD6A 4YQZA 1E20A 1T2FA 1N2CE 1R5OA 1YQGA 4I50A 3OLZA 3BQNB 3NAQA 2QX9A 3GGGA 1RM3A 1PKXA 3IQZA 1UKYA 2Q3EA 3CZ5A 4EB6B 3PXAA 4GRDA 1CP3A 3HYCA 1UT6A 2D62A 2Q8QA 2O3RA 4RSMA 5C7IO 3PGVA 3V80A 2ZJ0A 3NEJA 4N39A 4JXXA 5DMHA 1CT9A 1WKVA 3GGPA 5DTRA 1R0XA 2A9VA 2B35A 2ZJ7A 5HCNA 4UDXX 1X7ZB 4IV5A 2Y71A 4U0KA 2IEIA 4UUPA 3S2GA 3K9FC 3IP8A 1M1YE 4RV5A 5EZ6B 2J0UB 1DBRA 1FS5A 1M33A 1IY0A 3OQIA 3SBDA 4X60A 3DXYA 4R7GA 4NZPA 2FX3A 2QZZA 1OLSB 3VR3D 2O1WA 5KTKA 4GE3A 3UIEA 5DNUA 2JZOA 3SSAA 5D3QA 3HKBB 1FOEB 2C0PA 1GLGA 1W59A 4QU9A 1MZVA 1NBWB 4DLNA 5CMLA 1O6BA 3DFUA 1DOZA 1K7SN 5BW5A 2CBXA 2JFUA 1DRKA 2VYQA 3L8CA 4TT3D 2D1RA 2NNLD 5HA5A 2LZ0A 3AKZA 8LDHA 1H1LA 1K97A 2I4IA 4FNAA 4HXEB 3EPHA 2VSYA 4BMOB 4BNFA 1JW9B 3L7KA 4P0QB 1X1BA 4RQTA 3A10A 3C3CA 4PWZA 4D41A 1L7PA 2ETXA 2Q6TA 1T2DA 4FTWA 2G67A 1WD5A 3O91A 1NE7A 1M1YA 2CDAA 5FBKA 3GJ6A 1W49A 1SCQA 3C8MA 3W5HA 2RCNA 3EDQA 5BMVF 3DBRA 4ERXA 2H31A 3LHIA 3GCGA 2QTGA 4OSEA 3ZBQA 2BF7A 4DCOA 3ZY5A 5J1TB 2BONA 4AF8A 2CUNA 2OQ2A 1MG5A 2C4HA 2FZGA 3P4UA 3FPGA 4C5BA 4WBSA 3WDLA 5JSYA 1XTTA 4L5AA 3ZS9A 3NB0A 2P9BA 3WMRA 1YK0A 3ZKWA 3N5CA 3H9BA 1BD4A 1GU1A 3L01A 1FRZA 1W88B 4KBGA 1BVHA 2MMCA 2GVNA 4ZYUA 2W4MA 4I5EA 3M34A 4QG7A 4TLMB 3V4ZA 1WUKS 5K0BA 2F43B 1DV1A 2G70A 3U81A 2GZRA 2O8FB 2PMCA 4MGHA 4KPEC 3PIIA 4L07A 3VOSA 4YALA 1QANA 3ISVA 1N0IA 3LK6A 3QFCA 4XX1A 3VZDA 3TGPA 1RZRA 3ZVKA 5H70A 1RJEA 1WP4A 2WEKA 5DBFA 4EPXA 3BWDD 3Q8MA 5LN1A 1JFVA 3Q11A 3PRHA 1AB5A 1NSFA 2CL7X 2JVJA 4KVFA 3LVQE 1ZYUA 1G8AA 3ODGA 4LMBA 4WT7A 4B7AA 5I7FA 3M89A 4JGBA 3D7RA 5BNIA 2O5EA 1ONSA 2Q45A 3OIYA 2YJ5A 1J0CA 1DRUA 3FNRA 5I9NA 1JKFA 1LV7A 3EVCA 1JIXA 4JCOA 2FWJA 4WOKA 4C05A 4NL4H 4NF2A 3CR8A 4RE6A 1JDVA 1XZJA 2VLBA 3UT5B 5IYZA 4RLSA 1JP7A 2XKKA 1VBKA 2ZW9A 1ZO8A 4X3CA 2OFOA 3W6ZA 5CH8A 2XLBA 3EODA 5IM4A 1QC5B 1E2DA 1O1YA 2GHIA 2ZRAA 4LYJA 3ZK8A 3FSGD 3KHTA 4PQRA 1M0SA 1W44A 1DCTA 4WX2B 5DKFA 1G3UA 1LF5A 3MTIA 1RHMA 4Q4AA 2YIMA 4LNUB 1KMIY 3TI7A 1G41A 1Y5RA 5EJIA 1JJ7A 4EITA 1L7AA 3H0EA 4KXLA 3KTDA 4S1WA 1XTPA 2QG9A 3P9KA 3H65A 3QX3A 1E6CA 4L16A 1LI7A 2N0SA 3BKWA 4YRBA 1R74A 1J20A 5CB6A 5KOYA 3R7NA 1FVXA 2JBHA 2P6NA 2XUHA 4F3NA 1WY7A 2ZYTX 1C3VA 3PU6A 4NCBA 3ETCA 5T4EA 4FOLA 4RKWA 5F52A 1KJWA 5LP6F 2ZVPX 5BQPA 3H9UA 3ADCA 2PUWA 5A9SA 3U6BA 1XVTA 3W5BA 5ALQA 1N4AA 2ZCUA 4RK4A 3RVSA 3O4IA 2VP4A 4REQA 2OFWA 3GYBA 2PMBA 1RR6A 2J4FA 3C7KA 2PRZA 3C39A 1QDUA 2BDUA 2Q1XA 2PUDA 2G8NA 5I7AA 1O6ZA 1PEYA 4UW9A 1Z36A 1NLMA 4HTFB 4GKJB 1MRZA 4JBGA 5IF3A 2ONYA 2VH1A 4P4UA 5GGYA 1WD7A 3BZUA 3U37A 1OFTA 4JVMA 1B2RA 2B2NA 4LRUA 2HSWA 5JD4A 5JXGA 4E1VA 4ZHQA 4FC6A 3DPUA 4B3CA 3NANA 4ZZIA 1SKUA 4HHEA 4LIPD 4CM9D 1FCJA 4YRQA 4HWRA 4EY8A 4Y0VA 3AY0A 4K9DA 3NV9A 3RHSA 4UUBA 3JYLA 4HY3A 5GM2A 5BMVA 2HIAA 4JLMA 4AMYA 4LNHA 1P7YA 4Q4JB 2AD5A 3QTLA 2OORC 4YAJA 3G02A 2BFFB 2FZVA 4LFBB 5EHGA 1F0YA 3TRDA 4BTVA 4D57A 4CG3A 2NU9B 3N5KA 4G41A 5ICSA 2F3TA 1RRCA 4EENA 3KQYA 5JQGB 2WNSA 3FPCA 2LE0A 4HXYA 3G49A 3CW9A 5C3MA 4KTVE 2O14A 4J1QA 2MMGA 3WAKA 4KE8A 4L4ZA 5L4SA 2QBYB 5AVVA 1LPSA 1C4WA 4PCAA 3VTFA 1MOQA 2DECA 2C2OA 4FNOA 2D5CA 1QLWA 2A5FA 5FWXA 2VUUA 2WG0A 3HYNA 2QQFA 2CY0A 3PDWA 3CLRD 1RIFA 1MG0A 3HB1A 4GWKA 1M2OA 4B2PA 1VYVA 1GT6A 4BIIA 2IX9A 1RYEA 4J0QA 2VXOA 1KMCA 3N8DA 4FHFA 3B1JA 3GFOA 4MO9A 4Z8YA 5BYJA 3RYFB 1JQEA 1NUQA 4B5KA 4DBLC 2Q1TA 5B55A 2GTIA 2LCFA 3U2QA 4WEQA 2MOKA 5J47A 2FZLA 2VRNA 5JMWA 3D0RA 2PSDA 4WJKB 5U4XA 1MW8X 5ER6A 3ZGVA 2G72A 2WJGA 2PNFA 5CLJA 4LSWA 1Q74A 1RWPA 2OCLA 3SWWA 1ADYA 4UUNA 4BKOA 1W36C 3CNOA 4ITUA 2QD3A 3ZH9B 5H5JA 3QNUA 1LJUA 3CRQA 3ENQA 4EFMA 3E27A 3CNNA 2VF4X 4UEOA 1H6AA 1EP2B 2IPXA 2VP9A 1VKNA 3GJRA 4R2MA 4RSHA 5ALPA 5FORA 4DDMA 1C5KA 4BWYA 2C7RA 5AKJA 2AFHB 2J4CA 1YR2A 3FMOB 4WZAB 4RLFA 4OKNA 5DWDA 4DANA 3KJHA 2DZDA 1AB6A 1EEHA 1XDGA 3HWWA 1GNPA 5AM5A 2AFHE 4Y2RA 1UJBA 1YBHA 4BKMA 1N75A 3DDUA 4FYKA 4Z51A 3O7WA 4ER3A 1ZNWA 5CG1A 1IQUA 3E7XA 4OHWA 2LR0A 1G20E 4GGMX 4YP5A 3E2IA 2R1VB 3RC1A 5LP6A 3QUBA 1Z29A 2YJ6A 3HKEB 4BO4A 1MOPA 3VR5H 3VDMA 1NW6A 1ST3A 3W5DA 5ALEA 5JBIA 4O29A 1ZI9A 1KI1A 1JWAB 3IEPA 5TIIA 3PQFA 1E2IA 2KJQA 3IAFA 4FZ3A 2AQ8A 1VHLA 3O84A 1E9EA 4CKWB 1F6DA 3FWNA 3MS7A 1NHGA 5EEGA 3OU2A 2VDLB 1Z8DA 1RHKA 3AC0A 4L6AA 3TQOA 1MVOA 1JE1A 1UEJA 1W47A 1TK2A 1W25A 2JASA 4G1VA 4G5GA 4D4JA 2JARA 4C3ZA 4DC9A 1TTHA 3ZH2A 4ENPA 5BRAA 5CITA 4R16A 3FPJA 3LF1A 5CVUA 3QQ5A 5IJAA 4LZNA 1L5KA 2NO1A 5FHRA 2VKTA 1QK4A 3F6YA 3NG1A 3MRXA 4XCVA 3TW0A 3H1GA 1TPYA 3OJEA 4YMUA 3WA7A 1G20A 2QYOA 4TKVA 1E62A 3FGZA 3ZIAA 3UBTA 4WHMA 3EQZA 3EULA 4I46A 1SXGA 3AHGA 5JSZA 4C9BA 4DSOA 3NGLA 1EHYA 3W8NA 1A9XB 1E79D 1TRKA 5IM5A 2W43A 4I3FA 5FWYA 1Q1EA 1ID1A 3D2CA 5FA6A 1I3MA 1MTOA 2GD0A 5E3JA 1N77A 5EQTA 1NF8A 1LJLA 3ME5A 4DSNA 5J2TF 1ISIA 2BCEA 1M83A 4LHSA 3NETA 3WZ2A 2G17A 1XU9A 5EVCA 1NQOA 2EW2A 1R8QA 2DPHA 2OYSA 3ZWNA 3OTOB 4GYYA 4RADA 2CNWA 1F5SA 4GICA 4ND4A 3T9BA 4WOCA 1EK2A 3EXEA 1TD9A 2F1HA 1GUBA 2H1RA 3CCBA 3DL2A 1O95C 3F6CA 1LRJA 1WMBA 5FUYA 5LPNA 4RIFA 2Z4SA 1C1DB 3QPCA 1KOLA 1UT8A 3NM4A 1PVVA 2GETA 2JGRA 4YMVA 5B58T 4ZQFA 4HGNA 2V65A 2XSZA 1U2TA 2VIIA 3L0SA 1U2ZA 3QP9A 1QB7A 2NXEA 1Q95A 3D9QX 3ELUA 1HDOA 1GUAA 3EBPA 1F2VA 1OA0A 2HV9A 2VJBA 3HDGA 4MS3B 4QATA 4BLVA 4RCZA 4OQMA 1VDZA 2J33A 2VQDA 3FPHA 4RDXA 1JFTA 4QXAA 2PKXA 4I4IA 1PYGA 1SXJD 2FSIA 3QFRA 1Y4DE 1DAIA 3M6IA 5AQ1A 1F3LA 1R8YA 3VYSB 3UMFA 2OPHA 4NG5A 5ETJA 5AVZA 2H1FA 5JVDF 1QG6A 4HX2A 4O8CA 4RUKA 5LDDC 3SDZA 5A4AA 1MABB 4BCCA 3ITDA 3E9NA 4HWSA 4BP3A 5CBPB 2PJRA 2IYTA 3AHHA 2PXXA 3C3BA 2DQ4A 1I24A 5K09A 4HH3C 3B2EA 3D6AA 1MW9X 2D59A 3OX1A 5FWAA 4Q82A 3W90A 3QPVA 2IEBA 3THXB 5C2JB 2PANA 2VNHA 1RTTA 5JAHA 4YJHA 1G55A 1K3FA 1RXEA 4JA0A 3RYIB 5AESA 2DY1A 2WF7A 1SBTA 2ZWOA 4JP8A 4C0SA 4CU2A 3CVOA 3SLKA 1XLWA 2BMDA 1U1IA 4K3UA 4IDQA 4Q1BA 2VDMB 2NACA 1DJQA 4X85A 4JL6A 2H85A 2P2GA 2RFLA 3GRUA 3ASUA 5CK4A 1AUOA 1RLIA 4MQFA 4YJFB 2YJ4A 3IULA 1GIAA 2NPIA 4MQ6A 2O8DA 3BHMA 3UO8B 1XKTA 4JR0A 4L4UA 1TU3A 1MEJA 1R5BA 1XNHA 4NABA 1KVTA 5D5HA 1SVOA 5ALZA 4NQRA 1J09A 1LDMA 1IVNA 1PZGA 2WP8J 2NNWB 5E7IA 5JECA 4CM4B 4ZAGA 3W8DA 2JA1A 3P9PA 3VSEA 3F46A 3KALA 3RC7A 4YRFA 4J91A 1OHHD 1U8CB 2JGLA 2YY7A 3BRWD 4IUYA 2FWMX 2FXVA 4J7CA 5MGBA 4UEJA 4JC8A 1UM9A 3NWEA 4DA9A 4B40A 5IBRA 2E7ZA 1ZVKA 5IAEA 1IEXA 1ZONA 2V7QA 3O92A 4PHTA 5GZ6A 3TM4A 3CH5A 1NN5A 1ULZA 1FX0B 1XTUA 2PWAA 2QPAA 2VT7A 4KIWA 4HZUB 3HXQA 1LLUA 4CEHB 1D6NA 3UB4A 2DQZA 3RFXA 4BNYA 2BE9A 4KGXA 5BWOA 1XPOA 3NDJA 3VO2A 4TSKA 5KYXB 3MG9A 1RJWA 2PV7A 3ETJA 2QRVB 2OXTA 1BU5A 2F48A 4XJXA 1RHQA 1ICIA 5DYGA 1KJIA 4R6XA 4EEKA 1CEYA 5D5PA 4NBVA 4PONA 2C4WA 3OJXA 1ZUD1 2FZKA 3KPYA 1AM4D 3QNWA 3GUUA 2AZMA 3R3XA 3SYNA 2JFWA 2W42A 3UOWA 2RHMA 1Q17A 3KYDB 4FMCB 4KPGA 1WG8A 5LMZA 5IXYA 1V7ZA 4PBRA 4ENQA 2FE1A 2HCFA 4JLBA 1P2UA 4NMXB 5HF8A 4WD3A 1OYOA 4WXEA 1M74A 4GX0A 2LKDA 1ZXBA 3O3MB 2PLFA 3F98A 3TKYA 4DRXB 2Z3ZA 3AGPA 4YFVA 3C5HA 4I9GA 2YC2C 4P1ZA 3E8MA 4WEOA 3T4UA 4B09A 1CFJA 3AM5A 2QMYA 3LPAA 3PEEA 4X8LA 4E46A 4MEBA 1KZ6A 3AV0B 2XGJA 5BSKA 1BRTA 3IPAA 2Z2JA 4MV5A 4B85A 1WPRA 4NE9A 3QYFA 3KKMA 4ZOCA 5AKYA 3SR0A 4EY7A 1FSZA 5KVSA 1C8KA 2OVBA 2OHVA 2PU7A 1U2QA 3ZNQA 2UVPB 3VZPA 1N6HA 5JVDA 3GI1A 3DZJA 2ORIA 4BO3A 1HLPA 4MVJF 3BBPA 3G2QA 4DQDA 2OORA 1MAAA 2QA5A 5C53B 4DBLE 3LFTA 4IIJF 2GZMA 2ZITA 3ZE0B 1EXDA 4WGFA 3T3PB 3GUZA 4HKTA 1ANKA 1JG4A 3BEOA 2PJDA 2YOHA 1XZQA 2PPLA 3AOGA 3GCDA 2QUHA 3GEGA 3HR8A 1WZCA 4PLCA 2WW8A 3OQBA 2QMZA 3NKLA 3VTZA 3IQXA 3H9CA 4DRZA 1WX1A 2QROA 1SQGA 5K4AA 3CEAA 5DCLA 1XEXB 2OGWA 4DVGA 2WSSA 3A6JA 1KO4A 2XKAA 5EHNA 1T36B 1EJBA 2YFYA 1REQA 2XE7A 1B8PA 2V7BA 3P5BA 1LW6E 2ORED 3T5GA 3A4NA 5INTA 1ZRNA 4F2HA 3N3AC 4IZHA 2BGUA 3WL6A 1E2JA 1ZH4A 4DIDA 4XWTA 3IVXA 1KYZA 3D8SA 3KLBA 4LTDA 4M9XA 4Y2JA 5CUQA 5CVDA 2CMHA 1SQFA 1RQNA 2PL9A 1P1KA 2XKJE 5GIOE 3LY8A 5L6MB 2QQGA 1TTPB 4EG6A 3WZLA 1V8PA 1I14A 4FCVA 5DGTA 3TZCA 4NE7A 4MVJI 4GR4A 2W0SA 3REQA 3A1TA 1I80A 3TR6A 2PGOA 2WYWA 1FEZA 1PT8A 4RJIA 2BVNA 1PTJC 2FRVA 2Z2KA 2Z56A 3BBLA 2LDBA 4QSMA 4GDFA 4DWWA 1RVV1 2JJMA 2R6R1 2OBNA 3LRPA 3PD1A 4JR1A 3TLYA 3K1TA 2P79A 3ZWVA 4R1SA 2CZGA 5AJWA 3EZ2A 1SKYE 2QB5A 1X77A 3O1LA 1CUFA 4L5JA 4EBBA 4KN9S 1U3TA 4YJ3F 2VHXA 5L95A 5LIRA 4I8XA 4NOJA 4EAQA 2QVCA 3CIOA 3OCUA 3KQKA 1F4LA 3GK3A 1D4FA 2J4DA 4LHYA 5KU1A 5JATA 1PWZA 1G19A 1W8DA 5CA1B 1EWTA 3GZNB 2HEGA 4EDHA 2C04A 2VEDA 2SCUA 4QDZA 4ZTZB 1N9GB 1WEKA 2JJ8A 2UUPA 3QJGA 5IAJA 3V7NA 4Z4IA 1I5RA 3GUVA 4MVJE 4WK4B 5JNUA 3Q1LA 2VRCA 1L6IA 3E7WA 1B8NA 3PTZA 4NFSA 4RA6A 1JWBB 1K98A 4TXHA 3ZV6A 3BMOA 1AMNA 3W9SA 2GT1A 1J9GA 4RY2A 1II9A 1IK4A 2FUKA 3B48A 1E4EA 5F4ZA 3L0DA 4AI6A 1VE5A 4XIFA 3UM9A 4RZHA 3G9QA 3LUFA 4OGFA 4CL0A 4RW0A 4EPYA 5AM3A 1O0CA 2QZ9A 1FFWA 1LVHA 1EXWA 1TNDA 2NZUG 2RB4A 4JX9A 5FB3A 3R3HA 3MJ4A 3UJ3X 1CY1A 2C98A 3ILVA 2AJTA 3DOOA 2QL9A 4GD3Q 3JALB 2IHNA 2RAUA 3C7AA 4Q9JA 1PS0A 2PS0A 4XSHA 4X62B 2PRSA 3O73A 3AIKA 4DQXA 3AERA 1PD0A 4R7ZA 3HZRA 1BFKA 4RE5A 3QPDA 1O2DA 3CTPA 4MVJA 2A0YA 3SYMA 3MTAA 2X1LA 2PZ8A 3DHWC 3DKRA 4IIJA 1GZHB 4NZMA 1NUAA 3BMCA 3PC8C 4D9BA 4F60A 1Q7EA 1ARZA 3NVAA 1OAOC 4GX5A 4TYQA 4BFXA 3RB8A 3Q15C 2A3RA 1IHOA 2GH1A 3IT2A 2RGAA 5JAPA 4H08A 3R6GA 2FA9A 521PA 1T9KA 1XOIA 2RKWA 3OIVA 4HGRA 3EXAA 4Q18A 1SC1A 3E3AA 2DPMA 1DAEA 1KSFX 1RPAA 4HLDA 4TL6A 4WMLA 4F6RB 4RJTA 1VJ1A 3T7EA 4F45A 4BV3A 3Q6MA 1JHYA 4KR2A 1XA0A 1CZOA 2VJKA 2HPAA 3TIGA 3ZOKA 1SBQA 3K35A 5CFRA 1U7UA 4FYPA 3G9TA 4G3XA 1BOFA 3M2PA 5AIAA 5EXXA 2QT1A 2YFHA 3K73O 2PY6A 4YYZA 2B2XA 3PNYA 5DXFA 3OTGA 1M1NA 2JGFA 1AKVA 1PQWA 2P6MA 1KU6A 4J6FA 2GJKA 3PYLA 1JDNA 4MA0A 2OHGA 4URUR 4B6OA 1JJVA 9LDTA 1K3TA 1QONA 4TV9F 4EARA 2PMWB 3K1JA 2AJBA 1IXRC 3DOJA 4PAMA 5DM2A 3N8KA 3ER6A 4Q3OA 1LI4A 1BW9A 3MW8A 4OGGA 4WA7A 4AJIA 1XD2B 3SXJA 1Y3BE 2C8VA 1L5ZA 2NLOA 2WVAA 3L0OA 3UMVA 1O54A 2JGDA 5ERXA 1C7JA 3HJCA 1Z6YA 4HPJB 5BMOA 1JDSA 3CPJB 2UV8A 3H1BA 3TDKA 1I2CA 2VUTA 3SLGA 3ZD7A 4B6QA 4E3ZA 4G5FA 4L27A 3G1TA 4RVHA 1CY0A 4BNJA 5JS7A 4OYLA 4BYMA 4MUBA 2G0NA 1O96A 4LV5B 3D4NA 1EWYA 4K9RA 4MK4A 3G0IA 3IVRA 1TM4E 2V7EA 1O94D 3EFHA 2XGMA 3V2UA 2Z5FA 4DLBA 4YJ3A 3M9LA 4LRXA 5D3KA 1WQ1R 1TYDE 2CFRA 1W581 5EHZA 1GDDA 2DBZA 4Q9KA 2PDAA 1Z5UA 2D00A 2WQZA 3JASA 3EX7C 2C5FA 4OHCA 3B3JA 1N7HA 5DTIA 2M98A 3OJOA 2XUDA 2AFRA 1J0BA 3ONDA 3N0XA 4MRRA 5K0LA 4MVWA 1NBMD 2WBLC 3LKDA 1CZHA 1LSOA 3RWBA 4CCAA 1KEUA 3ZLVA 5DCWA 2KBFA 1GG5A 1B0ZA 3NWPA 1HLGA 3EMVA 4O4HB 4PXSA 2XKBA 3K8OE 5HRUA 1C3OB 1E9SA 1KXZA 1LF0A 2WV9A 1J33A 3VPBA 2FN7A 1WDKA 5KYUB 1O9GA 3TTYA 3KEGA 3DQQA 1GZDA 3W2FA 1GTRA 3IOYA 2TMKA 1L3IA 3A11A 4CRWB 3LQYA 1JU3A 4RMIA 3ZZUA 3NO4A 3CX7A 4Z1MA 5FV4A 3WHPA 1SO8A 3H8VA 3R5KA 2COKA 1SOMA 2ZE6A 3PPXA 3CF0A 3R0IA 2O3JA 5JZVA 2HYIC 1H3EA 1YVPA 4CIXA 2ZYWX 4DHEA 3IILA 4FHGA 1SM4A 3WRXA 1W5BA 1X7XB 2QLNA 1JQJC 2WZDA 4MV8A 3ND7A 1Z37A 2GTPA 2XQVA 3GAAA 2GILA 4YGXB 2XBUA 4UAUA 5ITSA 4JI8B 1W0JA 2HWXA 3JWPA 2R2GA 3MTBA 5CXQA 2O1XA 4JT2A 4H4EA 4ZALA 4LK3A 3GP8A 5EKDA 1Y5MA 3ZIDA 3C1TA 3EIUA 4JODA 3F4KA 2YZMA 2OCAA 1WUYA 4U00A 2WJPA 4GOJA 1MF7A 4CE6A 4U2FA 2TECE 4HJRA 3OZVA 2C2KA 5ES3A 3WKCA 4C4AA 5M2QA 3OHPA 4HQRA 3KSBC 1OBOA 3M5PA 4B5LA 2WMNB 4IIBA 5TLSA 1BKYA 3D1LA 3D7LA 2P3SA 3BDAA 3T99A 4EMUA 2X86A 3V7WA 2PKEA 1GZ4A 2Z83A 4FXOA 3ENZA 5L7TA 4ZO6A 4NBWA 3GPCA 4IS3A 4BATA 4QAJA 4V0MA 1BAPA 1VQ1A 4NOKA 3AEKA 3O31A 3WGUA 1LRKA 4I5FA 4NMHA 3TXXA 3AXSA 4CM8A 5EMLA 5HX7A 1M8GA 2V1XA 4C7XA 4ZICA 4WXYB 4JC4A 4ER5A 2FKNA 3CINA 4NJEA 1XF1A 3DLIA 5AICA 4TV9A 4JYMA 2YMPA 3GFSA 2BKEA 1BD3A 4G5OA 2DJ5A 3G8AA 4K88A 4LOJA 2HMYB 4MWSA 1YZGA 4BE9A 2R68A 2BHLA 1NFFA 4FD3A 3HL4A 4UXHA 2FN8A 3D6JA 4KDEA 1CP2A 4XEUA 2JGNA 3A1NA 2AEMA 1E9DA 4ACBA 4ESHA