3RGWS

Crystal structure at 1.5 a resolution of an h2-reduced, o2-tolerant hydrogenase from ralstonia eutropha unmasks a novel iron-sulfur cluster
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
270
structure length
270
Chain Sequence
PRTPVLWLHGLECTCCSESFIRSAHPLAKDVVLSMISLDYDDTLMAAAGHQAEAILEEIMTKYKGNYILAVEGNPPLNQDGMSCIIGGRPFIEQLKYVAKDAKAIISWGSCASWGCVQAAKPNPTQATPVHKVITDKPIIKVPGCPPIAEVMTGVITYMLTFDRIPELDRQGRPKMFYSQRIHDKCYRRPHFDAGQFVEEWDDESARKGFCLYKMGCKGPTTYNACSTTRWNEGTSFPIQSGHGCIGCSEDGFWDKGSFYDRLTGISQFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Membrane-bound hydrogenase (NIFE) large subunit HOXG
publication title The crystal structure of an oxygen-tolerant hydrogenase uncovers a novel iron-sulphur centre.
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase
total genus 79
structure length 270
sequence length 270
ec nomenclature ec 1.12.99.6: Hydrogenase (acceptor).
pdb deposition date 2011-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
S PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 3rgwS01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 3rgwS02
2WPNA 1UBJS 3ZE6A 3UQYS 1WULS 1UBKS 3USES 4KL8S 1FRVA 1H2RS 1E3DA 4UPVA 3USCS 4UE6A 3RGWS 4CI0B 3CUSA 4UEQA 1YQ9A 3H3XA 5JSYA 1WUIS 4IUCS 4UE3S 5A4IS 5ADUS 4IUBS 1UBLS 1UBTS 4URHA 4IUDS 4UQLA 3AYXB 1UBOS 1UBMS 5JT1A 1UBRS 4TTTS 4UQPA 1UBUS 5A4MS 4KO4S 3ZEAA 5JSUA 3AYZB 3ZE9A 1YQWA 1H2AS 5A4FS 5JSHA 1WUHS 4OMFG 4UCXA 4GD3Q 1FRFS 3ZE8A 4UD6A 1YRQA 4UD2A 5JSKA 4UCQA 3CURA 4UCWA 1WUJS 5D51S 1UBHS 1CC1S 4UE2A 3MYRA 4KO2S 4U9HS 4KO1S 4UPEA 5JRDS 1WUKS 4U9IS 2FRVA 4KO3S 4C3OB 4KN9S 3ZE7A 4UEWA
chains in the Genus database with same CATH superfamily
5K0FA 3K0KA 4Y2VA 3W5IA 4F4UA 1N8KA 3I09A 2JGDB 1M8PA 4F8YA 2E89A 1YAJA 3EFOA 4WKNA 5TT0A 3HI6A 3WLJA 2JGNA 2AD1A 4Q24A 3VZBA 3USES 1YU6A 1Z8NA 2CXSA 3DB1A 1LWOA 4NP6A 3SXUB 4YMHA 2RJ3A 3FWZA 3IAFA 5K03A 1MZVA 3PC8A 1NF3A 4B34A 3LDFA 2RHDA 1FU4A 1XZKA 4XEUA 3GAAA 1EX7A 5L45A 3L0SA 3KVYA 2IOFA 4ITVA 1SH7A 1TTQB 4E5UA 1ZJYA 1XA3A 2X7HA 3MGAA 1J1ZA 1W2WB 1IB6A 2H4JA 3BL6A 4P33A 2C78A 3GJZA 5J4HA 2IBTA 8MHTA 4WLEA 5T57A 2DFNA 2D7JA 3HFGA 3WLFA 3M1YA 1FRNA 5FKJA 3NFYA 3H3XA 4WA8A 4EPVA 1E3EA 1RIIA 4D82A 4FMBB 2E87A 3PUHA 5DHPA 1D4FA 5ULLA 3AR9A 2QR5A 3B20A 4UHEA 1J97A 1IUKA 4CG3A 4F4IA 3EXFB 5TEVA 3I1FA 1IDOA 3ER6A 2ZOSA 2QTFA 2EJVA 3WLIA 1QGZA 5EPEA 3HJCA 2C3PA 3QMWA 1WCYA 1ILEA 1F8YA 3MLBA 4IV5A 5F4ZA 2GZDA 4R0NA 5AKZA 2V03A 4DEXA 5EWJB 1JIUA 1TT5A 4TPKA 2VO1A 2B98A 4B4UA 5KZMB 1X77A 4YP1A 1CJSA 1U3GA 1TF2A 2B3DA 2MOKA 2A35A 2EAUA 2OCLA 2JJ8A 3TFWA 3W7AA 3ZX5A 5IK2D 1NJ6A 4O4IA 1PLJA 4JI6B 1VBMA 3DZBA 3FJOA 3ZCUA 1AH2A 2IW3A 1ZO8A 2A1TS 2FPIB 3BCHA 2BWJA 4OKSA 1P9OA 3RIMA 4CLHA 4E30A 1XD9A 3I9NA 3PXEA 3RC2A 4F3YA 2VRBA 3BUSA 1FZQA 3K9LA 2C42A 4CNQA 5K8LA 2H06A 1MH1A 4LXYA 1I5EA 3B9QA 4II3A 2UZAA 5L3SB 2NZXA 4W5QA 1M2EA 3C3JA 1WKBA 3ETLA 2ZE6A 3IQEA 4HBZA 4PC6A 4WPGA 4Z0HO 3AVVA 4KPFC 2J5BA 3D8NA 3LV8A 4RA9B 1U8YA 2I6FA 5A3SA 1L5YA 1THMA 4RHXA 1J2UA 1M66A 3HYRA 2P0YA 1LDNA 1ECGA 2ZBPA 3RQIA 1CJUC 3I04A 3LVQE 5K8IA 3ASZA 2R8PA 3UGQA 3BEOA 4CLRA 2PT9A 5KOJA 2YJGA 2EKDA 4HLDA 3QENA 4N5NA 5HK8A 3KEOA 4OQDA 4C1BA 1DHTA 1U6IA 3N3AC 5CDTA 4YP5A 1DJNA 4MQFA 3ZQUA 5CB0A 1PYOA 2PY6A 1XHEA 3G3EA 1XELA 3U39A 5L8VA 2PDAA 3CMCO 3R7DA 1GWNA 3PFIA 4TV8B 5KPDA 1GPH1 3HCPA 1ZXXA 4JNKA 4XDGA 3KZCA 3LOQA 4A03A 4TYQA 3PUXA 4NYIR 3I30X 1QB8A 5EPOA 1XKTA 5F3DA 4P3NA 1WAMA 2P27A 2XGSA 3LD9A 3O82A 4TS9A 3FZYA 2ZYRA 2GGSA 2WIJA 1BW9B 2X9LA 5ELLA 3GAMA 3VJLA 1AMUA 2D5IA 1LTKA 1MHTA 3PT9A 1RWPA 3SKYA 3B1FA 4UM8B 4TXJA 4L4UA 2QV7A 5AKHA 1TU3A 3EH1A 1N4AA 4I50B 2PK3A 3O4JA 4G5XA 1W4AA 3F5QA 2DHEA 4R9UC 4CKBB 1UOPA 4E5KA 1QFXA 2O52A 3E61A 4RZQA 2V7UA 1X1TA 5E7QA 3VVCA 3OFJA 2PUCA 1QGUA 5AHXA 2DH5A 5ETJA 5IXJA 3N75A 1IBKB 2CFSA 1T5HX 1U2RA 4TN1A 2IXDA 4LRXA 1MEJA 1SUEA 1HQDA 2P5UA 4MA0A 5DIZA 4FX5A 1YIOA 5K0ZA 1ISIA 2Y1DA 1NXWA 3U3RA 4ITUA 4FYHA 5B1HA 4J1SA 1Z68A 5TC4A 2EVWX 3H1EA 1BJTA 4L9WA 4U7PB 4V2UA 3CLTC 3MILA 2VJPA 3TTSA 1KMHB 1XMQB 1UJ5A 1YDWA 2IDZA 4LQDA 1U3VA 1YVUA 2IP2A 4RKFA 1E9DA 5HKOA 4Z49A 4DV5B 1WOMA 2BGLA 2JD2A 1RHJA 3LWBA 4L72A 1YB4A 3MMXA 3C6ZA 3VHLB 3WMEA 1EWKA 4Q1CA 1L8QA 5LIRA 1ZRHA 1RYZA 2PD6A 3ZHCA 3MFYA 1T0IA 3K73O 1U0HC 3OCYA 4XJTA 1OFVA 1UBTS 1YXMA 2Z2KA 1VLLA 4ALKA 3RG8A 1N6KA 2FX3A 1OXVA 1H6CA 5KYXB 3FTPA 3COSA 4ASUD 5IJ0B 5JUWA 3GPLA 1X1AA 4NEGA 2J4CA 2PYIA 3II6X 2Q7OE 3ZW9A 3FLAA 3FYSA 4F6LA 1H8EA 4WVLA 4M83A 5CM2Z 1TCCA 5FWXA 2P2SA 1S3IA 1BE1A 3LT0A 2QLJA 2H1LA 1IBLB 4K0RA 2IYSA 1KYVA 1NVMB 4BO4A 4JLMA 4ZAZA 2Y1XA 2YVLA 1XCJA 2OGSA 2VXOA 2LBPA 4BN4A 2DM6A 2DLDA 1O58A 1T9HA 2XB6A 1Q16A 2ZIFA 4D9IA 2YZGA 2BP7A 3ZE9A 2AJ8A 5AKYA 3N07A 2FSVC 3K1AB 5F2NA 1XXHA 2QMHA 4GOXA 5T67A 1OI2A 3CZMA 3QKRA 1SXJC 1WDWB 2GN2A 4O4IF 2CYBA 2HBRA 2JJ1D 1HDYA 4LZOA 2CLIB 3DQZA 5HNKA 1TC1A 3WK7A 1DLJA 2Q49A 3WWOA 3OT1A 4QJ3A 1CG6A 5CCBA 3VZSA 5JBNA 4J0EA 2V6GA 4E2ZA 5AI9A 1ZKDA 2A9FA 1I1HA 1PD1A 2FCAA 3C8UA 3NP7A 4KQMA 2OAQ1 5CGQB 1A76A 1M2GA 3INYA 1FTYA 1L4YA 1LEHA 3ENZA 5EKUA 3BD9A 3ASUA 3LP8A 4AUEA 4NATA 4OLFA 4IDOA 1YQUA 1BHSA 1NGSA 3HBAA 1B0UA 3CX6A 2C0CA 1G7RA 3NC4A 4LXTA 5EEHA 4YT2A 5DM2A 4L9RA 1OIWA 1MF7A 1YVEI 3ETDA 3TAHA 1CUEA 1IY2A 3ISJA 1Z6XA 3FDIA 1SJ9A 3I92A 4H9GA 2ZRLA 3UJNA 3VPAA 2IV3A 3TPCA 1V16B 4AF7A 5REQB 4AURA 4PAGA 4YRJA 5FORA 2IXGA 2PSFA 3GDFA 4J2HA 4J7XA 3X1KA 4F7WA 5LP6B 3HVRA 4UDXX 1WQ4A 1HKUA 2C4HA 4BKUA 4HNUA 1GZ7A 1E0JA 1EVKA 3WO0A 2ST1A 1J9EA 1UBKS 4R51A 4WZBA 4QHTA 3SZMA 3LUGA 1Z4LA 3E3LA 3NETA 5DO9A 3TQHA 4KIUA 4PO8A 1IQPA 2YVUA 1L3BA 2WOJA 3A9WA 3TJZA 3B89A 4WOJA 1QHXA 5EE5B 3G9ZA 2Z9CA 2W2TA 4K28A 3C7TA 2VT3A 4EL0A 1IRIA 1S4QA 1CUWA 1SVIA 4K2AA 1UZUA 3IMKA 3ZIAA 4G0VA 4TT8A 4FIDA 2F48A 3DDSA 4W5JA 1NY6A 2UXCB 5B57C 2KWIA 1DKMA 1JTEA 1XMPA 2H7YA 1PX2A 2YS6A 3ANMA 3M1LA 1IPFA 2DHQA 3KETA 4P3PA 1RAHA 7MDHA 4PWZA 4OGFA 3KTAB 5A5FA 3BRSA 3H0KA 3FYUA 4FYMA 1XE3A 3KR0A 4XD2A 1ZGHA 4RJIA 5AJYA 5J47A 5H1YA 4B3DA 4OJNA 4QBHA 3NT4A 4OIFA 1GT91 2EDCA 3F7MA 4IUBS 3TRDA 3VO2A 4R83A 3NHZA 1Y9ZA 1PNQA 3A25A 4LAFA 4I9FA 1CUIA 3GPCA 4NBSA 1TYAE 2PZMA 2CFIA 1WTCA 5BT8A 4ZDIA 4DCMA 4BY9E 2Q0HA 3OPYI 1N2GA 2WF6A 2H7XA 4E46A 5JRZA 1E1QD 2Z08A 3NM4A 2QX6A 1NBWB 1SKBA 3UWKA 2YNMD 2O8DA 3T3DA 2B9EA 3HKBA 1GCOA 3GO4A 4O3FA 5DK6A 4N6NA 3WL8A 2X0KA 4PICA 2YMPA 3IXQA 1HDIA 2NVWA 2ZW9A 2O8BB 4DCUA 1EUCA 2QL9A 3HUDA 3I0MA 4M8LA 4AZ3A 1ZC3A 2GJ8A 5E9JA 5EIEA 5LDDC 2JLWA 2B25A 1GZDA 1RRGA 1T8WA 2DWCA 4GQAA 4X1YB 4IIVA 3K0FA 4FJ0A 4DY4A 1ZEMA 4HEHA 1P6UA 1RZ3A 3KR9A 2FMHA 3GXOA 1R4NB 4H1UA 4MH0R 1DKNA 1GPNA 3QJ5A 4OQ4A 5BRNA 3KR1A 5KIAA 3ZLBA 5LQRA 3RVLA 1BQEA 5HZMA 4MGYR 4QG3A 1T6ZA 3GF4A 1GQSA 4TMWA 4MIKA 5FL7D 4UTRA 3KYCA 3BTUA 4BO9A 2ZSUA 2GPTA 4G0XA 421PA 3PEWA 2IYOA 3I8XA 1XLVA 2O1WA 3MXTA 4X85A 5JPCA 2FWJA 2VI5A 1NP3A 1P9NA 2ZYHA 3BB4A 4GI1A 4HAWA 4E1VA 1RYDA 3ORYA 5TMDA 3GN1A 4Z99A 3P5SA 2KSQA 4GNKA 5TSDA 1H1LA 4P0TA 1HLGA 3PQ2A 3D6FA 4B6PA 1N34B 1V7CA 3JWEA 2JDID 1GRVA 2OCKA 1YGPA 4UAJA 5B7NA 2PRSA 2EQAA 3A1CA 3GUHA 4LRSB 3IOYA 4LWPA 3QVLA 5FIUA 5CDFA 5AM5A 3FW1A 1GY8A 5BN5B 1P91A 2ZR7A 1GPJA 3N7TA 2G07A 2LCFA 1EX6A 1DWPA 1G17A 3ETHA 4QU8A 2QPTA 3VYSB 1FTWA 5DLYA 3TRJA 1OI4A 1H2YA 4PLHA 1RWQA 2WU4A 3L41A 2XODA 1W0KD 1AGRA 5IHPA 3PR1A 5CEJA 3WAGA 4ZODA 2PD4A 2CB9A 2YWFA 3DT9A 4UBJA 1IC6A 3DW3X 4CQNA 4WN3A 1PG2A 3OLYA 3U3OA 5K3SA 2OGTA 4RMGA 3YASA 2Q5EA 3OFKA 2BGNA 2O05A 2FX2A 3D2AA 3P2MA 4RELA 4ZCPA 5A6SA 1AMOA 1E3TA 2FPUA 4HDNB 2IEGA 3RREA 3RU2A 2GN8A 1BNCA 2HXGA 4MLZA 5DH9A 5EIBC 1AJEA 3G7SA 3M5CA 3QLTA 4MHSA 1XSEA 1CR1A 1HQCA 1MJGM 2IA5A 3G1WA 4QDZA 5DSZA 5KTYA 3BSFA 3OOHA 2IYTA 2WWRA 2JLYA 4X3OA 5LD2B 3VO1A 3QUCA 4NICA 4NCKA 1OLUB 2HK7A 2MHCA 1D2HA 1BZYA 1X7DA 2AEFA 2GM5A 3MTJA 3QHQA 4FFLA 1NSTA 1ZS9A 1BYIA 4D7AA 5IDVA 2P5TB 3KVOA 1X42A 1YV9A 2VYNA 2YUIA 3BJZA 1F6DA 3N6VA 3L7LA 4F60A 1FFSA 1HNXB 1CEYA 1VLMA 2ZZNA 4BO6A 2UDPA 2Q1XA 3GBVA 1R0LA 1S3FA 2DQKA 2W22A 3QPDA 1VM6A 4R2HA 4R8VA 1Z6QA 2X5NA 4FP9A 5AP9A 5LSAA 2RKOA 2ZE7A 1EFRD 4ZQEA 1AKQA 3WWCA 4PLZA 1JH8A 3CTMA 2XD4A 1QUFA 2IHYA 4JBGA 5A4JA 1D0SA 4G8DA 1O4WA 3WL5A 3ER8A 3OOEA 5I4BA 1AT1A 1OYVA 3OEHA 1K4YA 4DIBA 4OTZA 2PSDA 2BR3A 1P73A 2QJTA 3KAQA 3P0FA 3HJBA 4C6TA 1G4UR 1NPTO 2ENWA 3T1YB 4PSUA 3HLKA 1H4TA 3HKEA 1XB2A 4LYFA 4URZR 4BRWA 5DSXA 3UK6A 2KE5A 1C4KA 1Z0JA 2W11A 4OFWA 1B93A 4J8PA 4MB2A 4O0MA 3UUEA 2JLZA 2IYFA 4DDUA 1TLLA 5LNK6 1TQ2A 1F9AA 3IV6A 5E6RB 1MRNA 3H18A 1KHHA 2HSEA 3UG6A 1ISRA 2QUAA 3A28A 3FLEA 4MB0A 3X1DA 4BQSA 3PNOA 3NV9A 1RJWA 3CH7A 1E4VA 3OFVA 4UATA 1ZQ9A 2OWEA 1WZ2A 5JC1A 3PZBA 4EW1A 3OZGA 4OV6B 3ZYCA 4AI6A 3GFPA 1XOIA 4MGIR 1D1TA 4MR7A 5K6AA 3GY0A 1XMSA 1N2XA 2FEXA 2WUDA 1XZJA 3PNYA 4IFTA 3FMOB 1CQWA 4MW5A 1AKEA 2XXBA 3JWIA 3L8MA 3C87A 9GPBA 1FDTA 1J8YF 1TF7A 2BTQB 2SNIE 3KYJB 4GXQA 3H3FA 2PO5A 4WESB 4F1WA 1P0FA 2HRQA 3CX8A 4J1TA 5FRDA 1A7UA 4HGYA 3IB6A 3IERA 1JBQA 3MW8A 2IV2X 4JP1A 3EWNA 2GFHA 2E55A 1QB7A 3D4BA 4UE2A 2DBZA 1DKOA 3AF2A 4NBKA 1NW4A 3KQLA 1TUIA 4JCOA 3NORA 1U0EA 5TPWB 3RK0A 1GD1O 3M3PA 5L7YA 3NM6B 1D8AA 1CU1A 2OG2A 4R01A 4YJ3A 5EMNA 4BTEA 4DM4A 3HUEA 2XKJE 5FBLB 4E51A 3ZD7A 1DIAA 1PHPA 3E3NA 4CDNA 4DEYA 5PGMA 3EZGA 1U98A 3SKVA 5HKBA 4ETWA 1TL7C 1IRXA 1VOTA 4GKBA 4GOKA 5GGXA 4UEWA 4QHSA 2C8KA 3TZ6A 4XUEA 3MWEB 5G40A 1PSZA 3ANNA 1KBQA 1ZUD1 4A0RA 3HXTA 2PEYA 2O3UA 4Y2TA 1AS0A 3F1KA 5IU6A 3V6LA 1I3CA 1X2BA 1V3QE 1YZTA 1U9IC 4B3GA 5FAKA 1ODSA 1YZVA 1ZEJA 5AD1A 4OSPA 4QPZA 2J48A 1WB9A 4CT4B 4B6JA 3LLSA 3SK0A 3VSBA 2XEDA 5TMEA 4BHTA 5DYGA 2V3VA 4LX0A 2ISSD 4M0UA 5CB4A 3KKKA 1PEDA 1L9XA 4FSDA 5IDWA 1NNUA 1YJQA 1XX6A 2KLBA 5TQJA 3ZV4A 1L5SA 1Q0SA 2VWGA 2RIRA 4RM2A 2XZLA 2WU1A 1ZVJA 3EGOA 5G4KB 5KYUA 4AWXA 2EJBA 4FKBA 2QPLA 1VLHA 3MWYW 3QHAA 4ETIA 3D43A 3N70A 4W5NA 5T4FA 5C1OA 4P4NA 2FW9A 2B1QA 4TLEA 5AYVA 4KC0A 1Y7TA 1A98A 5A0VA 2ZUVA 2C97A 4LDPA 2QDKA 3JYNA 4JEIA 4TWAA 1EDEA 3TB6A 4XM2A 5IJAA 4AJNA 3K70B 1A8UA 2OXRA 3DAOA 3KE9A 4HH0A 1HO3A 2NZUG 2QY9A 2X9QA 4LW8A 2VZLA 3LUFA 3V2IA 2NQ8A 5F3WB 1KDZA 3FCSB 4I5FA 5DB4A 3EQ2A 3R5FA 1NURA 3CF4G 2DY1A 4H0FA 4KDEA 5IH3A 3ZZMA 3FSEA 2NTYC 1BWPA 2O0KA 1JHMA 3JQ9C 5DTJA 2P90A 2OORC 4YCSA 4ZZ0A 1YJAA 3K92A 3STYA 3DSRA 5KEIA 2PN1A 2F59A 4CLDA 1GUDA 3U1BA 3AWIA 4RDHA 1DTWA 1UP4A 4Q47A 1CUZA 4R1MA 3ITKA 3AY6A 3OQPA 1IN6A 1NYQA 3H3JA 2VAXA 1T5BA 3K0AB 4BP8A 3LWDA 1XWWA 3B6KA 2HXSA 2TECE 3IP6A 4PZPA 5EFOA 1XDUA 3VU0A 3RYFB 5ICMA 2WU0A 1RXVA 3P20A 5H59A 1CF4A 3K94A 1Q6ZA 1XDDA 2BLLA 3OIGA 4QDJA 2NO5A 4OI4A 5CXSA 3I58A 1WUTA 2FETA 5JS2A 4RPCA 2WAXA 1GTL1 3PC7A 4KHZA 1NKVA 2Z8XA 3VR4H 4RAQA 2WWWA 2MJLA 4LBWA 4BTLA 1WHSB 4IX1A 4EZBA 4D0NA 3SU8A 1G55A 3PQ4A 4FGLA 1OW3B 4B3HA 3MJRA 3BK7A 5JIBA 3AUXA 1TXGA 4E5PA 1REQA 3Q5EA 3C4JA 3U1VA 1HG1A 1N7HA 5G53C 1TKCA 2DQZA 1FQOA 4INJA 3RYIA 3K6SA 2YZMA 4IDFA 5K0JA 2Z6QA 4Q9NA 1AO3A 1CZUA 2ZQYA 1Z4IA 2FZWA 2G6TA 3CVOA 5J43A 4RJKA 5IK2A 3P4XA 1TU4A 1WSDA 2VQEB 2DSTA 3PS9A 3BXEA 2X1MA 2D1YA 3IODA 3LQKA 2C94A 1ML3A 1W8IA 3NPMA 1P6QA 1GFWA 2YJ4A 4WACA 4YWJA 1E8DA 2VSYA 1Q1NA 1WOYA 3L8EA 4FI3F 1B43A 1II0A 4V0NA 3GVPA 2BKXA 2H59A 4ATNA 3MWGA 5D7NA 3IRVA 5GIOE 5HWSA 1PNOA 2HPAA 1I2MA 3EPPA 1EBFA 3V8QA 1X87A 2UZ1A 4UBNA 5DTMA 5JNSA 2HBQA 4RIFA 1AZWA 1H9BA 2PBZA 1TPYA 1M1YE 5C8ZA 4YJ3F 2WUWE 2CMHA 3Q2OA 4M3NA 3QG1A 5JD4A 1Y3CE 1ZI9A 4YMIA 2RDMA 3TD6A 1N6HA 4GMGA 1KR5A 3TTYA 4IPTA 2LIPA 3FFTA 4B47A 1J5EB 1W8DA 4LSMA 2NPFA 1V6SA 3I6QA 5ADVA 3BE6A 2ZI4A 6LDHA 1N5RA 3EVZA 1P5JA 3QW2A 3EODA 4WE3A 1EUDB 1ZGBA 3NHWA 3TIGA 3COVA 1I01A 1K5GA 2DYKA 2XT6A 1JPUA 2HSGA 4RIHA 1T15A 1KQ3A 2X5KO 4F2DA 4MQEB 2OCPA 2Y6UA 1DQYA 1HKHA 2AN3A 2O2YA 3O83A 4MVYA 5F78A 4EGAA 5TGTA 2RE8A 3QKWA 1X0VA 1RPTA 2YWJA 5CB4F 5KHLB 3CEHA 5E6SA 5F52A 1VL0A 1HGXA 4LTNA 2POQX 3FHOA 2IV7A 1AHPA 5C81A 2ODQA 1JDBC 1AF4A 3TGLA 1N8NA 3PGJA 1K5HA 2ZTVA 2QTGA 2FCRA 3GPIA 4CN9A 1UBMS 4F4HA 1MQAA 5E2AA 3N8KA 3KLPX 2FH5B 4HEA1 4PAQA 4LNUA 2XYPA 5C7OO 2PWYA 5B3JC 5BUCA 5A9TA 1Z25A 2A3RA 4F3KA 1CP2A 2JJQA 1YA6A 4PVCA 3DLTA 4XB6B 1UK8A 4CMKA 1LF0A 2L69A 4J0IA 4IGAA 5T41A 1WBBA 3LGSA 3CLRD 3CLUD 3H9EO 3MJ4A 2Q8PA 4K9DA 3SIWA 3I62A 5BSKA 2GD1O 3DC7A 4N18A 1L0BA 3WKDA 1F8UA 1NPDA 1YK1A 2H9IA 3WSWA 2Z43A 2HGSA 4F3CA 1KRXA 4BLVA 1ZN8A 3BMNA 4LBZA 3IJ5A 1LDMA 4NYJR 2QSZA 4JOSA 5J5CA 3V46A 5BSFA 3ZZUA 3M4ZA 4LRUA 1DNPA 1ZBQA 3GCXA 2HF9A 4WLFA 4RF2A 4B7XA 2WHXA 3AKDA 5D3MB 2ZBFA 3HXPA 1JXAA 3ROQA 3K8YA 1IXRC 1CF9A 1U8TA 2HU2A 4MCHA 1T13A 4BCDA 3NBKA 3RHZA 2BKAA 3WVNA 1XPRA 4P36A 1QVRA 3M34A 1SG0A 5LKRA 4N0PA 4DT1B 3KQPA 2AQIA 1C3EA 1O4VA 1UH5A 2BHTA 2H2WA 2ZRCA 3OSZA 4DKXA 3Q87B 5AK6A 2HSDA 4ASUA 4UU8A 5DNDA 2H2DA 2ZT8A 1RC0A 2E82A 2J0UA 4JQZA 4W8OA 1NIPA 1T9BA 2NXNA 1EXWA 1OFUX 4MW2A 4OBXA 2QD1A 3O84A 4WIAA 3ZY5A 1OU4A 2EW8A 1YQXA 3IPLA 1OJLA 1XTUA 3FI9A 4U9HS 4ALLA 2QBYA 2DPXA 2H08A 2XMBA 1VHJA 2VT6A 1AQLA 2JH8A 5WRFA 4DJJA 3WGNA 3QI7A 1IBCA 4Z0PA 4N8DA 1L5QA 1L5MA 2PLWA 4W1RA 1ZIOA 4QUJA 3DT6A 3E6AA 3KHKA 4KQWA 3ZE7A 1H22A 1YAHA 1X3LA 2Q6TA 1MNQA 3N6XA 2WPNA 4KVFA 3RHTA 4GRIA 3AP2A 4F3RA 1SHKA 3DOJA 3BIXA 2W7TA 3GCZA 4ZALA 3LY8A 4FEAA 4BYMA 4EOGA 2AOUB 4RZ2A 3ZOZA 3OHMA 1F3LA 5EJGA 2ZUUA 2YWEA 4L51A 4D74A 2JJ1A 2I6UA 4TMYA 3SFVA 1H2RS 4HX5A 1XNRB 5EJIA 3EWIA 3N0VA 4EDFA 1QHYA 1GYQA 1G16A 1RXIA 4NAHA 2P8JA 4Q1AA 4QJ5A 5IARA 4Z2YA 3TD9A 1KK3A 4LF6B 3SVZA 4BNLA 1IN7A 2W6MA 3G9QA 5EESA 1NNEA 1A4RA 4NQZA 4UEQA 3UJ8A 6ADHA 3EXG1 2QJFA 3G0DA 4ZCMA 1E9AA 2GBFA 2GJ4A 3H86A 4DCTA 2BONA 4EG3A 2OBFA 4FJ2A 3CY6A 1GYPA 1KFBB 3B3QA 4HP8A 2GCOB 3O7MA 4TVSA 2GO7A 5DASA 4CTOA 2G1KA 4RGQA 1H2BA 3UG7A 1OILA 2MSKA 4MI6A 3E9EA 2TMGA 5DTIA 3OCWA 5CJ2A 4ZDJA 2Q46A 2QB5A 4KQCA 4X6UA 3SJUA 4JELA 2C4VA 2ANBA 4ZO4A 3QG5A 4CM4A 1UBOS 3H97A 3WYGA 4KDRA 4U2DA 3WWEA 1AKYA 3WFJA 1UT6A 5HF8A 1OFGA 4OATA 2DPLA 1YRBA 2DMRA 3O3OB 1PTKA 4P1ZA 4P8RA 4PZLA 4WY5A 4QOHA 2O48X 2FSSA 4EX6A 3LI2A 2EP5A 4U7GA 3W9UA 1KU0A 1C8BA 5CMLA 3CNEA 2MYPA 1QIGA 4O08A 1G9SA 2G70A 3KDSE 2CHUA 2R6JA 5T6BA 3FVVA 4I36A 4TWRA 2GD6A 1WVMA 2H9YA 2VHWA 1IQ0A 3EXEB 4MWCA 4XARA 3WDMA 4EGSA 4F9GA 4WFIA 1YSCA 3Q5GA 4C6TB 3S0JA 5C1PA 4M36A 2WYOA 3RFTA 4TV9B 3TLBA 3WMFA 3EUWA 1VBNA 1W19A 3JWPA 4BE9A 1WY7A 2C98A 4YV1A 4MW4A 4OMFG 1HNWB 3ABRB 3H42B 1J70A 4M1EA 4PYIA 5DX0A 3TL6A 5AXAA 1IHDA 1X80A 4DSNA 2V9ZA 2BGRA 1AM4D 4JFAA 1CS0A 4WMLA 4EYKA 2F8SA 1R5OA 2GK3A 4YR7A 3S40A 2AN4A 3RHSA 2EFDB 3O8BA 1GA4A 4ZXPA 1EU1A 2I29A 2X9GA 1MU0A 3OZIA 4MYDA 1E1QA 1RHQA 1V4VA 3QGMA 4QYWA 3U81A 1NBME 3WNQA 5I4CA 2YNMA 2VDMB 3F97A 1P75A 3GLIA 2LKDA 1CQIB 1JQ5A 1BDBA 2EQBA 2F8LA 1Z9BA 3SYNA 5FOVA 3K4PA 2I4OA 2N0SA 3NT2A 5CVDA 1XPJA 3LZCA 5GVSA 4MI1A 5A4KA 1AIPA 1Q7CA 4M9ZA 3ZBUA 4U39A 3I1IA 4X20A 3TRFA 2QTCA 3K5PA 1L9KA 2QMYA 4AN0A 4EF5A 3ZWNA 3PKZA 1P1RA 2I6GA 3OLQA 3QLUA 1IWOA 3KZOA 4WDRA 4AP5A 2P35A 2X4LA 4BV2A 3OX1A 4CWAA 5DF1A 2YVQA 4HKTA 3L0YA 5TQ2A 1UKEA 4HUQA 5KVSA 1JTVA 2GZRA 2M1ZA 3C97A 4HFMA 4J0KA 2QTBA 5HIAA 4LWOA 1TJ3A 5FL7A 3D2CA 4X1IA 1EQUA 2W4MA 1HM5A 1K7EB 4UHCA 4JXZA 3U7JA 3WB1A 4G0PA 5I7RA 1NR1A 4YRNA 2OD2A 3T94A 1C4WA 1SU6A 4O2AA 3WGIA 4FXOA 4WSOA 2VUHB 1G3UA 2ZI5A 5GONA 1U28C 1BX1A 1YB7A 3OQJA 4HDSB 1U9CA 1OV4A 4C20A 1E9EA 2BFEA 2YXEA 3PCTA 3UMGA 3E05A 3B1VA 4DIDA 1OH6A 2WJPA 2ERCA 4BMDA 2LCQA 3DDUA 2J0EA 5AWFC 1LS1A 3N2LA 1KYZA 4RPHA 2C7OA 2JDIA 2YH2A 3WXBA 1RCUA 5LDGA 1OPRA 2R8EA 2BFBB 1E3IA 2WJ6A 2ZSAA 4ZO8A 3OE1A 3SJ7A 1AHIA 1NHWA 5C8DA 2PQ6A 2WM8A 4ZI7B 5JH7A 1N2CB 3MGBA 3PD7A 2FFAA 1VIMA 4A8PA 4C0QC 2V6JA 5HPYB 4I3HA 3FHJA 2BJWA 2OP1A 1WZCA 1HZJA 5AW2A 5HJEA 3O8RA 1LQUA 1XLTC 2PMDA 1W0KA 3ESXA 4IDHA 3A4VA 3ZCVA 5KVAA 1OV6A 3PYLA 3DQQA 1P2SA 1KBZA 4BWFB 2VCEA 3U4HA 1MB3A 1I6LA 3DP7A 3ENQA 4I7EA 4LCBA 3G1UA 5M7EA 2IYVA 4M1QA 2DBVO 4FYWA 1HYBA 1WXGA 3CX4A 1R0KA 1AGNA 2AJCA 1U8ZA 2FQXA 2P2LA 2W6QA 1PT5A 1ZBDA 2BM1A 2G1JA 2OOKA 2H2GA 2K4MA 2JIMA 3MBIA 3B70A 4U2BA 2ZRGA 4YREA 3Q8KA 3R0XA 4MUEA 3RYCA 3B52X 5K3FA 1IUNA 1DFHA 3NBZC 4GSYA 3GNSA 3PFFA 1A9YA 5L53A 2A2ZA 3RRYA 5K7SA 3BGVA 4XGNA 1H66A 5A2QA 5DHAA 4TUYA 3ZCQA 3DM9B 1XMJA 1Z83A 1YACA 2FZGA 2QTHA 5EUQB 1GYRA 3DHVA 5IAOA 2KPOA 2HJHA 3D6MA 3OLVA 4OQLA 5JMTA 1YZUA 4MZDA 1U5AA 1QMPA 1U8FO 2BGMA 3V7YA 2EF1A 5FLXA 3ZU6A 3AFMA 1ZVMA 4BEJA 4BUZA 1TOAA 3QWIA 1R2QA 4GYWA 3U61B 4RKYA 1OCEA 2ORED 1EFRA 1IFXA 1MTZA 1PJ8A 2A0KA 2DRIA 4AM8A 4U8HA 1AQJA 1SKYB 2PPVA 1F20A 5DTEA 1QLHA 1EE9A 1NV8A 4IIUA 4ED9A 3BWEA 4BLQA 4U02A 3W5AA 2LPMA 2NUTA 1P2GA 4KMOA 1KAMA 1VC2A 3RKRA 1GM5A 4LJ9A 4MQ5A 5I51A 1CR0A 2HA4A 3DUFA 4HFNA 1DC7A 1E9BA 1GCIA 1R6DA 3IKVA 4IV8A 1WDMA 2G1PA 2GLUA 3DL0A 4N5MA 3N0RA 3TLMA 4CG1A 5BW4A 1ZW1A 1TLTA 1FSFA 3UAZA 1QUEA 1UOQA 1XTQA 4FYIA 2XCSB 1A82A 3T3HA 4G41A 3L6CA 3DMFA 4UOZA 3C5WP 5HQ3B 4ZCLA 4BCBA 1C3VA 3HWWA 3HABA 4PEVA 1DKPA 3OJEA 4D4HA 2JANA 2Y3IA 3ONNA 4YUXA 5BWMA 5HZKA 3PXGA 2OO5C 1X7XA 3T0IA 2QLLA 3Q10A 3E9DA 1J90A 1GPWB 1Q0LA 4OI2A 3Q3IA 3LWZA 4AMGA 2QUKA 4B71A 2JFPA 4XRGA 3CKYA 3TTUA 1KJQA 1UIRA 4WBNB 1Z6GA 2E5FA 2HK6A 5A7GA 4DANA 3UJ3X 5KNCD 1U7UA 1EWQA 3SQOA 3VR5D 1NV9A 1I3NA 3EE6A 4R5MA 4FFSA 1JLLA 4TL8A 2J5RA 5LQNA 3DBLA 2JCVA 2Q4BA 4GSKA 4MRMB 4RZUA 3BJEA 4ZD6A 3H2YA 2R1VB 3MQ2A 4OAPA 4N3NA 4MI9A 1V5GA 1IWBB 4RTLA 3RC8A 3B1YA 3C0KA 1JR3E 1Z4MA 5ALQA 3AUFA 4RTPA 1JKXA 5C5IA 5KYYB 3GMTA 2C2MA 3VSEA 4KFCA 2VJDA 3ACBA 4JSRA 4LQCA 3LWNA 3VR4D 1FFCA 1W5EA 4LUCA 1H3NA 4D8VA 1E7RA 2D2EA 3E9MA 4UM9B 4CM8A 3R7SA 3R3WA 3QE4A 4O2AF 4M7PA 5LWHA 4LTDA 3EN0A 5GONF 4EH1A 2BKLA 1V3TA 1VECA 3O73A 3U3KA 1VMIA 4KIGA 4R8SA 2YOGA 4QXAA 3CRZA 3WK5A 5T4EA 2GF2A 1U0SY 4MIOA 2FP4A 5B7QA 4RHTA 3K70D 4GWGA 5EXDA 4IXDA 1UM9B 4NJOA 3QNMA 1XMOB 1Q0PA 2AXPA 4LE0A 3QFRA 1OZGA 4LECA 4BFLA 1DIHA 2I3GA 4MV9A 5JH7F 1USKA 1JIQA 1TAHA 2JAPA 4WK2B 4V0QA 2QU7A 1XAIA 2R7MA 4W82A 5EMHA 5I7AA 3RVQA 2JGDA 5HYVA 5IHXA 2WP0A 3U7GA 3B9PA 3Q8XB 4CCWA 1J2YA 4LOJA 1IHOA 3ONEA 3UV6A 2KBFA 3SXUA 3LHIA 1I24A 3B8HA 3HVJA 2R48A 4M22A 2XF2A 3RVOA 4AICA 1C9EA 1F2UB 1R66A 1ZXBA 3E0XA 1RIFA 2JFFA 3HH8A 2I2DA 4UHHA 3GH3A 4X90A 2K2QB 3DZDA 3F73A 1G18A 1NU6A 4FQ8A 4GD3Q 4CJXA 1WEHA 1E59A 3NTVA 1KDRA 4AJKA 3CUUA 4BUJA 3PXUA 1MX5A 2I8LA 3WGYA 4D4IA 8LDHA 5DDIP 1O7JA 1B4DA 1P1KA 1I4DD 3N28A 1PW5A 1BE6A 1XEAA 4ZZ2A 3AJ9A 3KUKA 1QLJA 5MF6A 2H2FA 4DW8A 4P9NA 1GQYA 4DYVA 4ZJZA 2HJRA 2Z2YA 1KY4A 4MUBA 5DYYA 3IT0A 2X86A 4XEHA 1SPBS 4AY6A 3MT9A 4MVJE 3G2IA 3EXFA 4PW0A 2VH5R 2F1RA 3FN4A 4HDKB 3KKPA 3LCJA 2WM3A 1IY1A 3KQMA 5EJEA 3KJHA 4YCMA 4GU5A 1JHVA 3SQXA 2F1OA 3EAQA 3PPWA 1KYYA 4JUCA 1U8AA 1Y6QA 2FSGA 5EWJA 3WBKA 4DLTA 2DQ4A 2XSZD 1N5KA 5L3RA 1UPBA 4ENPA 2PJRA 1GADO 3LFTA 3WL6A 3IUEA 4C5BA 3WYBA 1OFUA 2CXOA 1F2TB 2X0EA 1L7XA 2FG6C 4LZJA 4W8HA 1KGDA 2FPIA 2GETA 3UPUA 4NZ9A 5CTAA 3OBIA 3RYCB 1AD2A 1H2FA 1JQAA 3JARB 4AC9A 2XUKA 4K9QA 3ND6A 5F12A 1JIXA 4R3UC 1HG0A 4XUDA 2ZIXB 5L3SA 5HTKA 4EITA 3CZCA 5I5EA 1H65A 1U2DC 3FPEA 4XX1A 4B3BA 2AG5A 1UJ6A 1B2RA 5E3HA 2N3ZA 4PLGA 4E03A 1Q0TA 3IEPA 3R5KA 4RA9A 2JFZA 4UCFA 5J4YA 1ZISA 1Z7GA 3B48A 4MZXA 5F3RA 3RBAA 1JHAA 3OQ1A 4B84A 4CIVA 3MSCA 1A5ZA 2AQHA 5F1YA 1EXMA 4ZCSA 3HJTA 5DWQA 5HKKD 4XGQA 4CTNA 4MP8A 3ZDCA 2A59A 2OG1A 1K6EA 2NO4A 4XDZA 2AX4A 3ENKA 4ARBA 1YZFA 3L7YA 1CUGA 4UHFA 4DMGA 2J9GA 4G0ZA 1HQKA 2VAVA 1E96A 3SE7A 3FKJA 4M60A 1IK4A 2PL1A 1NVAA 3P96A 4I5DA 5J5VA 3FPLA 4MOWA 1M76A 5I5GA 4TV8A 3NH9A 4ZV4A 1M7BA 1GLGA 1BAPA 5I4KA 1E6MA 2BMJA 1COZA 1Z8DA 4R2WA 4DMRA 4HEQA 3G0HA 1T26A 1KYTA 2JH9A 3JQDA 1PFKA 3NEJA 4NBTA 1R0BA 2B34A 5D6NA 1R8QA 1BW9A 1PR5A 4HPJB 3OUTA 1G7SA 3ONDA 3RSZA 3TI7A 4ER7A 2W2MA 1OT3A 4BV9A 4F2GA 1AURA 5BOSB 1GTSA 1VGVA 2F62A 1Z12A 3AU8A 3IVCA 1EM6A 3URKA 4L4XA 1F7VA 1O94D 4RV4A 4I50A 5HF9A 1GIAA 1MABB 3WL4A 3VKUA 1L4UA 3QV1A 4AZSA 4OHXA 4UQOA 4YC7A 4CKBA 4RZSA 4D81A 4CU5A 2LDXA 3PC8C 1SHJA 3SG0A 3W8NA 4B31A 4DV7B 1UMBB 1FNCA 2GF9A 2GFQA 2INGX 3MFQA 4QBIA 4DWJA 5JD6A 4Z4EA 2IRWA 5TX7A 5JEEA 4WNYA 2V7XA 4CW7A 4PNPA 5LJLA 4KW7A 1TGYA 1GNLA 3OLWA 3CHYA 1ZGAA 4L4YA 5G1NA 5ICEA 1UJMA 4TGLA 5JZMA 1ESNA 4CKZA 1BVRA 1C80A 5KNLA 3VR6H 4NU8X 3Q3JB 2PTGA 3H8WA 1O9GA 1R6VA 2GD2A 4RLFA 1KMHA 3LUBA 3RG2A 4NBWA 5MHTA 3ZHRA 4HG2A 4D9EA 2CHFA 3WHKA 1K75A 2EFHB 3GG9A 3WQQA 5LQMA 1DQNA 3F6EX 4DDVA 4KSBA 2WNIA 1J8VA 1SOWA 5KNDD 4O4HB 4JYZA 4CMBA 1UKAA 2GBIA 4YMGA 3ORFA 5FNZA 2EGGA 3GPBA 4CFZA 1TCBA 5KTRA 2JFHA 1U9ZA 4V24A 1RHMA 3HCEA 4EFLA 2QW1A 5KYXA 3LX5A 4QOEA 1J2RA 3B36A 5EERA 2DZDA 5B1DA 5IJ0A 2RAVA 3N76A 1YL5A 4MPRA 3TG2A 2JZOA 4TTRA 3M5WA 3OD5A 2NSHA 1MJGA 5G3ZA 1YIDA 5L51A 4EKNB 1R8SA 2OYCA 2FGKA 2GM3A 3CUKA 3I6MA 3PTAA 4H7FA 3M49A 1C41A 4D4KA 1ECPA 3C4VA 2PMCA 3RS5A 4Y2SA 2IP4A 4PXAA 5FPPA 4DLUA 2CLHB 4UEOA 2Z5FA 4MS3B 1UEIA 4OB6A 1TMGE 3RBZA 3OA2A 1ZOSA 3BG5A 2R7LA 1QIJA 2HT6A 2I62A 4H7HA 4ER3A 1N9GB 2XR1A 2PGDA 4LDAA 4RABA 1Y9AA 2WSLA 5KOIA 2VJKA 3LSYA 2ENUA 1Q19A 3AIMA 4B40A 4YS6A 2P9BA 3AFHA 1NASA 5ALGA 2B8WA 5TQ0B 1SD5A 2XXJA 1GKKA 2HDNB 2D3TA 3KPWA 3SJBA 4CVNA 4DV4B 3RVKA 1UPUA 3CISA 1E4OA 4BMXA 5HOQA 3VU9B 2F4VB 4WLNA 4IDEA 2VH2A 5P8WA 2Z6VA 2H2IA 3CA8A 4NMHA 1US8B 2V6MA 1NBOA 4YCCA 4KNVA 4L4RA 3PSHA 1DLIA 4IXNA 3HZRA 4PYLA 3HU5A 3PR3A 2OWDA 4BNYA 5IUNC 1TVKB 3KBBA 4HYQA 2CLSA 4N03A 1FRZA 2NU7B 2IH4A 1BXRB 1IEQA 1L7BA 2BM9A 2XCQA 3QBTA 2HNAA 5KKCA 1BJRE 3GX1A 3WRVA 1JDJA 4AZVA 4U7DA 3LCVB 4TZ0A 4C0HA 1P31A 4YJ2B 3CQ9A 4EAAA 1V16A 2I4TA 5REQA 2A5LA 4TZ6A 3FTQA 4HNHA 4RNDB 5LP6A 3P32A 5GJWC 1Q84A 3IALA 3I28A 1IMJA 2CLOB 3SHTA 5JMWA 2HF8A 1QG0A 3A9RA 4AQ7A 1Z39A 1LW7A 4A0GA 2VPZA 3IT3A 1H9CA 3ROPA 2VNKA 3IQZA 2HREA 4ZOAA 3Q7QA 3S1SA 3R0ZA 2O54A 2M98A 4E5SA 1XHLA 2ZCUA 4XVCA 4P34A 3Q88A 1XTPA 1JHRA 2JIZD 3WMWA 1MH9A 5IBRA 1M1NB 4HNGA 4G0MA 4YX9A 5A9RA 3HCOA 4I50F 1D3AA 1YDFA 4NHOA 2PX5A 2ZIEA 4YV2A 5AHWA 3AIOA 3G0BA 2CV1A 3KTAA 3HCCA 1HYQA 4X3CA 3M1AA 4IR7A 1OB5A 3H5TA 5AVKA 3OHPA 3SM9A 3CBGA 3WRYA 1S4MA 2G7MC 1M0WA 2QM8A 2RB4A 4FR2A 5IJWA 3T0FA 1TTTA 1PBTA 2PFKA 3FPAA 1FTGA 1FL9A 1YQQA 4RY2A 3H1GA 1QTNA 1I7NA 3V1MA 4PCVA 1S2IA 1WVGA 5A4AA 4KVGA 1L4EA 4G81A 3KKEA 2H1WA 1J0BA 5BNWA 4QGHA 1K3UB 3U62A 3GA7A 3SN6A 3AR5A 1DT3A 4CQMD 3FNFA 2E4YA 3WYDA 4WXMA 4NYJQ 4TWBA 3BK1A 3GFTA 3QA9A 4KQ1A 1WPGA 1V48A 2RGUA 3LKZA 2H1CA 3SP1A 4BMNA 3W5CA 4CXMA 3O1LA 1G20B 4LRTB 5G1PA 3OQOA 3JYLA 2I8AA 5ECYA 1KQNA 1HORA 3HFSA 1ABFA 3R3JA 4MMZB 3VVMA 5MGBA 1VI6A 3OP1A 3OP4A 3NBMA 2HPVA 1X92A 4X1YA 5KJ1A 5KPJA 3M6IA 4K40A 3TZCA 5KREA 1ABBA 1RFGE 5IAGA 1GA6A 4PPQA 3QSGA 3GP5A 1ATZA 4BAGA 1KY3A 1R4NA 2FX5A 3RIGA 4Q1EA 4E07A 3OD1A 1X7GA 3NYIA 2WNSA 1QG2A 3AWDA 4Q4JA 2O2DA 3IAAA 1V8PA 1J21A 2Q2QA 4BGIA 4E31A 1ILWA 3CRVA 2EFCB 4YMVA 4XLZA 3TSYA 1W6UA 2ORYA 4BMOB 1S7CA 2QG9A 1SBQA 4AZWA 2XE7A 3BJIC 4QQFA 1FUYB 4BLTA 5LZ4A 4RK0A 3P9YA 4U4AA 3OF3A 3D6HA 2W0MA 4RH0A 4UTNA 1MUUA 5BUQA 3O9ZA 1UR5A 1FQWA 4JH0A 3IMCA 2Q2NA 3KAPA 3OG9A 3R23A 2JCYA 3GRAA 4QTUB 1P2VA 2BCGY 2XPCA 4FDMA 5F7ZA 1W48A 3V1LA 1IM8A 1T9ZA 2AVDA 4Z8XA 4GF5A 4JB8A 3UT5B 3UMFA 2OD7A 4BP9A 1CUBA 3OIUA 5BN5A 3OPNA 4I9NA 2FW8A 3IJRA 2O5CA 2FG7C 4LS3A 5J58A 1I80A 1U1DA 2AOXA 2KI5A 2VCYA 2WG2A 2JFWA 3IT1A 2CUZA 3EEFA 4P84A 5JVDB 4FOLA 1W2GA 4M1OA 1RWWA 4Q66C 3TBHA 2RHJA 4H16A 1JEQB 1FMCA 2ATIA 2QL7A 3OCZA 1KWGA 4AS2A 2ZIAA 3SX0A 1F8XA 5CX1B 1DWOA 1UC9A 1VYTA 1LLQA 4IY1A 4E4YA 4K6FA 4OH1A 4HDNA 5GOZA 2RHRA 5IMSA 3I3OA 5CB8A 4MS1A 5JJ5A 1EHIA 3HEMA 1E7MA 1G19A 1GRNA 1NM5A 3SSOA 1WF3A 3BM5A 1Q7RA 2R7KA 1J0EA 5AKKA 4WFKA 3PWTA 1TMOA 4J0FA 4KIJA 1R12A 2QORA 1ZUIA 3GOQA 2XNCA 1MC5A 3F6PA 1BKDR 1BGXT 1KJIA 1QO0D 5ERGB 4UOEA 4CIAA 5LP6F 3P19A 2PWPA 1OLUA 1H3EA 3VYRB 1DC6A 2J6IA 4CDMA 3FYUC 3OMXA 2CUKA 4YT4A 3CF6R 5FV7A 1LJLA 3PFBA 1C3XA 1NBEA 2IITA 4B8YA 1K98A 4RY8A 2ZI3A 3BE8A 1Z18A 1NNI1 2BEWB 3FF4A 3TL3A 4M37A 2JIOA 4BPBA 1VKNA 4FYYA 1YC5A 3HSYA 5EVJA 1RQGA 2P77A 4X8OA 3QP9A 5AOVA 2PUVA 3D0OA 3VSAA 4W9MC 1X1CA 4FHEA 3IUPA 4JU8A 1P60A 1BGWA 4XKJA 2GXUA 5EHNA 1P4GA 1CZHA 2Y2VA 3HB4X 1KQGA 2JFNA 2O8EB 1ZU4A 5H3HA 2C5AA 5LUBA 3V3TA 7GPBA 1W6RA 1G1MA 1VIDA 1RM4A 2FRVA 2O2SA 2CHQA 4X64B 3F7NA 5IABA 4HRXA 3N2KB 4B3FX 2GA9A 2Z09A 4N0QA 3HRIA 3RS4A 4MYTA 3R74A 2BT4A 1R5JA 2WU3A 2Q62A 2WSMA 4N7RA 3I1YA 3OFND 3ROEA 3FJ1A 1NG1A 1OUMA 1TJPB 2X8BA 3CEAA 4Y6SA 3P1JA 4B74A 2PTHA 4IYRA 2P3LA 2IEYA 4KFSA 2WNHA 5LB2A 1BC5A 3VU1A 5E6RA 4EHNA 1XYVA 5AJUA 1RKVA 1Y4SA 2QE6A 3HBMA 1Z26A 2N1MA 5HUQA 4JJ6A 1OVMA 3PKJA 3PDCA 3DMGA 4DM7A 2ZKLA 1N36B 2WM2A 5AO9A 5G1OA 3FDFA 5DHQA 2LZ0A 1OX4B 3CEJA 3NTUA 2VYCA 3NX4A 1EHYA 1Y8RB 1P72A 2ZS9A 3GVCA 4IDNA 4BO7A 4IDCA 2B1JA 2FFHA 2ZLBA 5DOVA 4UZSA 3D6NB 5M04A 4Q9IA 2OBXA 3WOHA 1YNOA 3F6CA 3F8TA 1W1WA 2WB2A 2YW9A 2BTQA 1U0FA 1RJFA 2IHTA 4WESA 4CIYA 4E14A 5CBPB 3A7EA 1P2TA 2FK7A 2H1RA 3AHJA 3G2QA 3S5JA 4EFMA 1UKYA 1BYUA 3IUYA 4K26A 4NCHA 3DE5X 3UOWA 3VDXA 5EWLB 4CNBA 2V7BA 5TPWA 3RSOA 5JC8A 1XP8A 1UJ2A 3QX9A 4E2WA 4KOAA 2UUOA 4RSRA 1XQXA 5FFFA 1UAAA 4D3YA 1UBRS 1R64A 2GT1A 1DCMA 2DF8A 3DO5A 3QIVA 4URWR 1JPNA 2BCEA 3PPIA 2OY0A 2D54A 3WDLA 1ZGCA 2WWHA 2IP1A 1L2TA 4AJEA 2QTNA 5KNCA 2OP0A 2RK3A 3KEFA 4NR0A 3MWEA 3V8MA 3K4QA 4R2LA 2BFDA 1P1CA 2DSNA 1E89A 1WP4A 1NI3A 2FI1A 2O3QA 1WV0A 2JK0A 3LFUA 1V3VA 2ZJ3A 5KHAA 1HDGO 1GT6A 4BQPA 2ZRJA 4N40A 2HWUA 1YMVA 1GQRA 1QK4A 4F2PA 2JVIA 4AJ4A 1EESA 2ZROA 3VR4A 4IO1A 4BRSA 4YPVA 2WJIA 4OIMA 4DLNA 1QH0A 2XWJI 4M7RA 5G4KA 3E7PA 2QMQA 4OK6A 2FE1A 3UJHA 4F86A 1L8XA 1NUUA 2I1LA 2MT9A 3X44A 5JFTA 5B2FA 4N1AA 1L3CA 4KLZA 2EJWA 5CT5A 3PNBA 3RSHA 4ZYWA 1RPZA 4QQKA 1BVHA 2FUNB 3HYTA 4AP6A 4DG8A 3UK1A 4ZTUB 3Q7SA 1IULA 2OFXA 1D5CA 4LPSA 2BBTA 5C34B 3UBMA 3ZS8A 4ME6A 2CXUA 1WXDA 4PO9A 5NULA 2N9UA 1A1VA 3QU4A 1NHGA 5IPFA 4NBUA 2AR7A 5AHOA 3W2TA 2LP4Y 1I4OA 5H5JA 1KP3A 2AQ8A 2Z4TA 5HUHA 1BS1A 1KI6B 4CM3A 3JQQA 2D1QA 3A6GA 4PRYA 2IX9A 2XT9A 2O2HA 2GH1A 4HWKA 5TS3A 4EG6A 4ZJYA 2EU8A 4QEZA 3EQ9A 1IWPB 2JLVA 2IFTA 3PHJA 5JADA 2ZWAA 1QFJA 3JPWA 4R7GA 5LWQA 2HT1A 4HAUA 4W4TA 1PQPA 4PG5A 1Z7EA 4CR7A 4J49A 2XNKA 2C2BA 2W43A 3JYPA 1RQXA 4F92B 2XCUA 1JGTA 3GDOA 3G5UA 3K0AA 1PR4A 3PXAA 1MG0A 4ND1A 2A8YA 3CZ9A 5T4BA 3VAYA 5IT0A 2QLMA 1I6MA 2GAIA 2H54A 1BHO1 1YR2A 2B9VA 4OU4A 4PSAA 2G0AA 3RYFA 1BE8A 4OLAA 4NNOA 3DM5A 3UGJA 5JMPA 4GM0A 1OT5A 5K6AC 4AG3A 1DC3A 2R66A 1ZLXA 3L05A 2D1RA 3GLGB 2BCJQ 3JX9A 4EIWA 2W8ZA 4L02A 3DYBA 3ROGA 4D8XA 2FPPB 4FI3C 4YP9A 4DIMA 1WHSA 3ND9A 2H3HA 4C3UA 4J1TC 4EMTA 4EVQA 4JK3A 4Q3CA 3E9QA 1GAWA 3VR6D 3T8YA 5DBGA 1OX6A 5KAPA 1GL9B 3PR2B 1XNJA 4LNHA 2ODAA 1JYFA 2WJWA 1OH7A 4ZPJA 1GDHA 2Z9DA 1O89A 2XSZA 5IAEA 4DC0A 2UYGA 3HYSA 4Q3KA 1A8SA 1NUHA 2UXDB 4RWZA 2E3JA 3VTFA 3FPKA 1VL2A 3ILVA 2VUUA 4KGZA 3VO8A 1UK6A 4Y6LA 4YPOA 3ZIDA 2JIBA 1LZLA 2X0FA 2AFHE 2X5OA 3GFRA 3SD7A 2OFPA 1GRCA 1QWOA 5KINB 3VNAA 1DDIA 3V8BA 1YONA 2CJYA 1QBGA 2MSNA 3AR4A 1YRYE 1CZLA 3E9NA 3P9QA 2M2IA 3VR3D 4DWWA 1I36A 4X5OA 5BUZA 2P9QA 1ND6A 3R4VA 2X0JA 1U4SA 3EZYA 3RVBA 4EB3A 5C7YA 1V7QA 5AJXA 1WZEA 5HRCA 5JFGA 1W76A 5TRTA 1G21B 3PITA 5HKKA 3A3PA 2YWDA 1U1FA 1ZIDA 4LRQA 1AO0A 2IT1A 3WA7A 2LE0A 2HU7A 3AF6A 2UVPB 5B3LA 4LY0A 2JAUA 2YXDA 2ZPTX 4G63A 1OVGA 2G82A 3LT5A 1FXUA 4G9BA 2C2YA 4FGSA 4NAVA 2Z8ZA 1JFRA 1UQRA 4GMFA 3TLEA 4HQ6A 1EUDA 3RS3A 4RZ3A 4CE6A 3CWCA 3CVJA 2RHTA 4UCWA 1K2WA 2VJNA 1WWKA 3VV3A 2XMRA 3TPZA 4MQEA 5D51S 1KZ4A 1N9KA 2XUQA 3DE7X 2GXQA 4M54A 2XCTB 4WZ6A 2Y1GA 3CFYA 4FC6A 2QAGB 4KFUA 4YUAA 3RUCA 2VDRB 1MQ8B 2GEFA 2GKOA 3ESDA 4MRSA 5EP4A 2BW0A 2LRHA 2Y4OA 1RAGA 3EFHA 3HWSA 2J32A 5LDHA 4D0SA 5KWVA 5ICGA 1W0JD 3A1DA 3QOYA 4YWHA 1O94A 2XY4A 4Q1DA 3DS8A 4ROTA 3UJAA 4GZ3A 4TX1A 3JD2A 1V47A 1GUZA 3GB9A 3OECA 1N4DA 3HJRA 4JI1B 3H17A 1NX9A 1OTYA 2XE6A 4KQGA 4A8TA 1DBWA 5EE3A 3R7BA 2R4QA 2GK4A 4DZTA 4XDYA 3A2NA 3V00A 1KI9A 1QHGA 4RVUA 4UMDA 4PE5B 1AK1A 3R6LA 3CLTD 4JEHA 1G3QA 3IUSA 4DQKA 1VJTA 1FDWA 2QPOA 4UEJA 5BSGA 5K0GA 3FFXA 4Q5IA 1L1QA 4HZGA 5ERYA 5LMCA 3FMVA 3B3JA 1M1XB 2VJYA 1N5MA 1IL0A 3CWQA 1SUPA 1NOKA 1PR0A 2R1ZA 5D3MA 3FG9A 5FTWA 2DWOA 4YYEA 4AJ9A 1T1JA 1A72A 5G0WA 1XVAA 3VMFA 2I91A 3OHSX 1BQ4A 4EJ6A 3U4QB 2CCKA 3IVXA 1WE2A 3PFGA 5IT9A 1AG9A 5KNDA 4DV0B 3FGOA 4NK5A 2ZXEA 1G9TA 2CVPA 5FBKA 3DEKA 3NV7A 5CIQA 1N5JA 1H0SA 5AHKA 3B12A 4DT1A 3IAHA 3HM9A 3FOEC 2P1RA 5A4IS 1VTKA 2GN6A 1ZM3A 2ROQA 4BFYA 1KETA 3AEZA 2J31A 3L49A 1EHCA 1N32B 2XITA 1Q12A 1A88A 2W93A 1RWBA 3ICOA 3Q7PA 3KJZA 4MRNA 5JPIA 1XU7A 3VH1A 5K5EA 2P9EA 3SYTA 4AUNA 3DVRX 2NXJA 4OXXA 5FQNA 3DD5A 3QE3A 4U7HA 2N42A 1T4DA 3BSSA 5DLPA 1AF7A 2XUZA 3IP8A 2QN2A 4JR0A 4QUIA 1QU2A 1A9QA 1KTIA 5EMKA 3KOOA 2J0VA 1DRUA 2WYWA 3ECAA 2P6UA 3EY4A 1NVGA 2JFVA 3MWFA 4TLCA 4A4DA 2CNOA 2P2DA 2WWIA 2WTUA 5FI3A 1Q2XA 2VOEA 1QHHB 1WVIA 2QVBA 3TQTA 3DOCA 2FW0A 2XRMA 2AOUA 4C14A 1J1IA 4P93A 1V2GA 3VNUA 3KS9A 4XGIA 3WDSA 3U4MA 1TIBA 4IJ5A 1UFQA 1CJBA 1VYUA 3HU3A 3JD1A 2OPBA 4LDZA 2JKZA 1I0ZA 4ZGWA 2I22A 3E5MA 5EE9A 1LPPA 3GEIA 1SKQA 2YFHA 3E8MA 4KQIA 5EZYB 5CVTA 2VL7A 3D2BA 3GRZA 3D6VA 3FDXA 3JQFA 2AR0A 1Y4ZA 2DUJA 3BOSA 3FAZA 4P3YA 1TTHA 4I1UA 3IEVA 1CYEA 4UDOA 4PZYA 4DA7A 3FCYA 4CTJA 3TLGA 4IS2A 1PJCA 2ZJ0A 2HNKA 1NJ5A 4GZ5A 4DSUA 1Z4QA 3PNLA 1E9CA 2GCOA 1J2JA 5SY9A 1N33B 4YRAA 3UBTA 2B94A 4OMCA 3TLKA 5IDQA 3GFOA 4DA0A 1KZGB 3AR7A 4L8WB 4UJ3A 5CT4A 1G0NA 1XCLA 1Y7IA 3R7WB 2BTOA 2C92A 2NPIA 2C61A 3K1JA 4R1LA 3NFRA 1HYEA 2D13A 4L08A 3F90A 1TI7A 4FMDB 4KRXA 4WOCA 4YJFB 3N05A 5AJVB 5A05A 3RW9A 2PVSA 4QDOA 1NJGA 2I6XA 1QGED 3B2EA 4L76A 3SS9X 2YL2A 3HCAA 1R8JA 2DP4E 3DZFA 5ALNA 4ARSA 5JISA 4L3OA 4M7OA 3WGMA 1AU9A 3KV1A 2E4XA 3VU8A 1VJ1A 2FMTA 3AGQA 4DLSA 1TAGA 3DJYA 4H17A 5DM60 3ZI4A 5I7SA 2JCXA 1U1GA 1NN3A 3DE6X 4OFXA 4D42A 2FU5C 1LS6A 2WOOA 3GR6A 4B87A 1UWCA 3LY5A 3PLAE 1N7IA 3WGKA 1VYVA 1PZNA 1ZA1A 1GPMA 4H7JA 5A5GA 3C8ZA 4KB5A 3EMKA 1G3IA 2JIZA 1E98A 3K0HA 1MA3A 2QNBA 3EXEA 3LE8A 4V03A 1I7DA 3AW9A 3O9MA 3DXYA 1EFKA 3JQ7B 2GZHA 3A6ZA 4N49A 4TV9A 1KF0A 1R4ZA 3G8BA 4XZ3A 4HNSA 4PFSA 4QTTB 1NW7A 1L5LA 4BQRA 2A78A 2L18A 1M3SA 2R62A 4BCCA 2WSIA 3X1WA 2NUBA 2VLBA 4QVIA 3DEZA 4EHKA 1WXQA 1N2IA 2DOKA 5H3LA 4F9TA 1J49A 3MHPA 4WNIA 4YV0A 4MUIA 4MIYA 2FEWB 5E4JA 1DC8A 1TYEB 3HNOA 4YCJA 5IKEA 1C7RA 5EJMA 3ODGA 1ORHA 1YCGA 3LP6A 4M0MA 3KQWA 3HGMA 2IXTA 2R60A 4E1BA 2PGIA 3IVMA 1KEEB 4X62B 5DBIA 3B2QA 3RCBA 3AK4A 4CQMA 3CLHA 3HCWA 3IPCA 4Y2YA 4EGFA 5LU9A 4D9CA 4A23A 2NACA 3MD0A 3RGGA 2G09A 2MYNA 4WLOA 1IPHA 1G8AA 3G0OA 1CQIA 4R98A 1IZZA 1UKBA 2IEZA 1OYWA 2V5AA 5CTJA 4GRAA 5ALUA 3BSWA 1ORTA 3DDHA 5LL6P 2DQYA 3DBVO 1OR8A 2IELA 4LKRA 4ER5A 3M6VA 4ER6A 2JARA 1MO6A 2QN7A 3Q7RA 3W7BA 4ZGBA 4KV7A 2QROA 2V4ZA 2R6ZA 3DXXA 2FB9A 1P9WA 2E37A 3HL0A 5GM2A 4XPIB 4CUZA 2EWMA 2PUEA 2ZUSA 3FFAA 4LJKA 1W9HA 3R3VA 3ETGA 3L4KA 4HLUA 1KSGA 4NVRA 3EVCA 1LSSA 1TGVA 3UHOA 5FHRA 5C8XA 2IYNA 4DXHA 5J4VA 4O29A 1IJEA 1FP7A 2B7BA 3ENWA 4RCYA 4I6GA 4OUKX 2NX2A 3VOAA 3CX3A 3DHNA 3UFXB 4CF5A 4DDHA 4GDFA 1K86A 4RTRA 1EB8A 4YAEA 4S05A 1G291 3ZI7A 2AXQA 4LZAA 2ACWA 4HDSA 4ZRMA 4UARA 4HQKA 1ZMRA 4YAFA 4GYKA 3K32A 5JALA 2H57A 5HE9A 4RPIA 1ABEA 4OQFA 4JYBA 2ABWA 4DZZA 4PX2A 3LBAA 2FZ5A 4JI0B 4AJOA 2Q07A 1EDDA 4IZ6A 3NC0C 4GPTA 1YA8A 2TMYA 4KSYA 2BFBA 4UUOA 1QPZA 1IIBA 4NCIA 1RXCA 3LLVA 3N74A 4L9SA 3AFIA 2OQVA 4ZI7A 3H6HA 4FLFA 5C2JB 1N2CA 3E22B 4RVOA 4ZRDA 3ZDXB 1EP2B 4OJYA 3T7EA 1AKUA 4WWHA 2XF8A 5FBQB 3NRBA 3C43A 3T06B 3DMRA 2PUFA 4LCJA 2ZRDA 3F6BX 5EXSA 1NVFA 1BEEA 1ZD2P 3LQFA 1CZKA 2AHRA 3T7TA 1PJQA 1Y4UA 3A1WA 3G2KA 5ALJA 2HZ7A 3N2ZB 4ZU6X 3IMFA 3QNUA 4HLCA 2G9NA 1LQTA 1MEEA 3JY6A 3LDGA 4GIBA 5EHIA 1Z4NA 4KXVA 1DG1G 1RBZA 5C80A 4Q7JB 2PLNA 1BIFA 1WXWA 5DCUA 3DZ8A 3KQKA 3VZQA 4NZNA 2FHPA 1WO8A 3AOEA 1QNLA 1GP2A 1EGHA 4HQNA 4R8KA 1QO0A 3LC2O 5EE1A 5CLJA 2WSBA 5EIFA 3DAFA 5LOVB 3QY9A 1IHXA 3PC4A 3HLTA 3WHPA 3KK0A 4DVJA 3C3KA 3H0EA 2QVLA 3GGOA 1XCPA 4TLLB 1Q91A 2G6BA 1T3GA 2QYTA 3JV7A 4Y2UA 3I8SA 5JNUA 1C0IA 3DV2A 3P2IA 1Y3IA 2FMXA 1M7HA 1YRLA 5EQDA 2ANCA 1ENOA 2CDAA 3H2KA 5CFPA 1DG9A 2WR8A 4GZMA 4URXR 1XAGA 2C4KA 4HWOA 5AXDA 3GJ8A 1LPNA 2NZ2A 2Q1WA 4TV9F 2AA3A 2YNMC 5CA1B 2PKRA 4NARA 1YCFA 4XYEA 5LC1A 1H4VB 1YOBA 2C84A 4QUBA 4HRAA 1PGPA 3RKUA 3SC3A 5AUNB 3C6YA 4BXOB 4P32A 3K35A 1DUVG 1UBFA 2DT5A 3OFNA 4HXEB 1IY0A 5JT1A 4ZAYA 3RJZA 5AXBA 3URMA 3DCNA 1C4XA 3NHJA 4EWLA 2ONKA 5CW1A 3U4CA 5HQ3A 1D7OA 2VOJA 5KU7A 4L57A 1IAVA 1LSUA 3QLUC 3IQIX 4EJ2A 3QVWA 4UBMA 2YV4A 1CKEA 2HQSA 2CKMA 3KDPA 4JV5B 2WF5A 2X22A 4DOMA 1W9MA 3H2ZA 4DB4A 3HP1A 1B73A 2A1UB 4DMUB 4PZ9A 2PZLA 1EVEA 2DFKB 2Q5FA 3BXOA 2OA0A 1N57A 3NIDB 4JLUA 3QH4A 4XD7D 5EPUA 4BLWA 5AVTA 4WXRA 2HU8A 4WBNA 5C4GB 3TUIC 1UPXA 3LUKA 4A6DA 5KDDA 1M2WA 2IS2A 4MDHA 4CCAA 2GHRA 3KL2A 5FA8A 3SLKA 4RVCA 3TBFA 3CV3A 1LI7A 4DV2B 3D7SA 4Q7EA 3J80A 2PBFA 4MRMA 1HT2E 5FOTA 1AN0A 1JWBB 2R1VA 1PFWA 3NIBA 4UKDA 3V80A 3ZKWB 5J23A 4HT3B 4ICIA 2JZCA 4M9QA 4B81A 5BORA 2QP4A 2QMZA 4L5CA 3BHIA 3O0TA 1QIKA 3VA7A 5KYYA 1GXSB 1M83A 3QFTA 5KYNA 3R6TA 1OKKD 2QD4A 1M72A 4I4LA 4WQMA 4DAOA 1EI9A 2JFQA 2AN5A 2ZRFA 3GA0A 4KIWA 3ETCA 4CIBA 4GBMA 1GAXA 1OIVA 1KYXA 3AIKA 1CC1S 4OUDB 2BFAA 2GYYA 4X7MA 2W00A 2ECPA 4JQCA 1QTIA 4OHUA 5FJIA 1BVUA 1Z08A 2W6CX 2ZSFA 3U3MA 1NW3A 2C5HA 1XA4A 1B16A 1T2VA 3DZIA 3MB8A 2JLSA 1NJ8A 3LLUA 3A26A 3ZWDA 5EJ4A 3TNJA 5KTSA 2I55A 4G8JA 3WLKX 5A5VA 1ISHA 3C3BA 2C57A 4KXMA 4ZWNA 4Y2HA 4IFEA 4XWAA 4DMMA 1XZMA 1UM9A 2G1UA 4ZAGA 3F47A 5DYIA 3P9NA 5HQJA 5BSUA 2W6JD 2FEMA 1KZHA 4WERA 1ZMBA 2IPOA 4JN6B 2PH1A 4ZI7F 5F23A 1P62B 4UXJA 5DP2A 1JUDA 5SZIA 2JRCA 1XEXA 2GJ9A 4XE5A 5K3FB 1C29B 2YHUA 2R96A 3M33A 4DQUA 3QZUA 2BM0A 4F5DA 2BVNA 2JZNA 3NHAA 4IWXA 4WXEA 5AXCA 4RORA 3GRKA 3Q12A 121PA 1SIUA 4EVIA 2VAMA 3HJNA 4V0LA 4JJAA 5EP3A 1F2UA 4HNVA 3X1MA 2QTMA 3L8ZA 4IMIB 4UVDA 3WGQA 2KBEA 2PU7A 5FJJA 4QREA 3RO7A 5JZBA 2OECA 4IIGA 5L6LB 3GU3A 2R8XA 5JCPA 1CERA 2YHSA 4EHAA 4G5QA 4JUAA 1RMTA 3ICEA 4BZQA 4MLDA 2EZ8A 1G8HA 2I4LA 1IATA 3I72A 2J07A 1Q0HA 3D3JA 4YXWD 2VHXA 4KZKA 4YLGA 4C01A 2LDBA 4P4SB 5JAUA 2XWBF 5DFAA 4FN5A 4GWKA 1U0RA 2QM0A 1E5VA 4QDUA 5JO9A 2ID4A 3CNNA 3UXEA 5J40A 5EOVA 2VHJA 3GLVA 3ZTTA 4WCDA 2BKVA 3VJRA 3PFCA 2AMFA 4HDKA 4DADA 4LSWA 4ZOLB 4UNQA 3VYWA 4DR5B 2O50A 3MAAC 4BZXA 4MVJG 1FZTA 3ME5A 3W05A 1P44A 1G6OA 3CINA 2FRDA 3IAM6 4ZVLA 4C22A 1Y1LA 4ZI5A 4YAKA 4IDPA 4RHYA 3K6SB 2ZUTA 1SUIA 2HADA 1FX0B 1QDLB 5CYFA 2D0OB 5CVJA 4CG0A 2VWHA 3LL7A 1J5XA 5CBKA 4ZU3A 2AFIB 3TX2A 1F2TA 4PN3A 4HWSA 2VRNA 1PNVA 1JX6A 1PWYE 2C9CA 1YH3A 1RWKA 3JARA 3OX3A 4JZYA 3OESA 2IS1A 4XOIA 1Z36A 5FWAA 4Z1MD 3LBYA 1LBHA 3F6RA 4RWEA 4DCSA 4X63A 3NKFA 1P4SA 2ZIXA 4QOGA 1FDOA 1KYQA 2OFOA 3ZHBA 1WMDA 4LZWA 2DJIA 2ZSIA 3EC1A 4FONA 3HL4A 2R7AA 3A2LA 3ZX4A 2H52A 1G3RA 3GJ5A 4X6LA 4F46A 4YMUA 4KR7A 3INTA 1JEAA 4LGCA 4PFKA 2G5GX 5AVJA 3VR6A 3K8ZA 4DLAA 2H4XA 3H7IA 4WINA 1OXXK 2NT4A 2JIRA 4IRUB 1E0KA 3EA5A 3NHYA 4YUWA 4QDTA 5K3BA 1PV4A 4KBFA 4UDYX 4WBNF 4HL6A 1SUFA 3OM8A 5L7TA 2R68A 4K9SA 5KQPA 3KAJA 5F73A 2EEZA 3O9VA 3S2ZA 3ZDDA 4MULA 4OVKA 4PLPA 4IINA 1JJIA 3OCJA 1VJ0A 2ZULA 1BDIA 4IWYA 1SVNA 3AFOA 3PRYA 3WL3A 2CBZA 3HSSA 4P5PA 3O8NA 5ICFA 4HUTA 4J91A 2XQIA 4JBHA 2AKAB 1SIOA 1VRVA 2YXBA 2A4KA 2PQ2A 3ZCSA 3L9WA 1QRRA 2IXFA 2XUAA 3VR3A 3ROMA 3CB2A 1OYOA 3QTBA 4CR6A 1U9JA 3GJXC 3V8PA 2REQA 1R0XA 4JHLA 1PKXA 3DD1A 4P0PB 4C4XA 1X8XA 3D8SA 1P1BA 5BOSA 2A0WA 2M6LA 4OFBA 4HH1A 4YAGA 3TF5A 5E6UB 1SXPA 3L6RA 3N1UA 3QPCA 1J8FA 1U2PA 3CO5A 3JS5A 3OQVA 1Q83A 4RHEA 1LKZA 1MABA 4B2IA 1YT5A 4HVCA 2NYVA 4PFQA 2F9FA 3KFVA 4EYEA 1ZZEA 1HPLA 3A4TA 2XDQB 4OBBA 5CG1A 1UMBA 3CNHA 4TLMB 3KPVA 3GROA 3OZDA 1N3IA 1GQFA 1GU0A 1ZMXA 2G25A 2O2EA 3DR3A 3FOWA 3GWZA 3K53A 4BKQA 1RNLA 4DNXA 1QONA 3WL7A 4JJIA 4J3NA 2ZBDA 2XNHA 1QFZA 4BMVA 1N0IA 3W9BA 1S2LA 3JR7A 2CEAA 4NV3A 1NVKA 1A2QA 1I2CA 4NMLA 1ADYA 3JZMA 5JD5A 5EJFA 5AVSA 3GLHB 4P53A 1J6UA 5B5SA 1OXUA 1WUIS 3IILA 4D4LA 3X43A 1DAKA 2A57A 3HVKA 1DT5A 3ZDEA 4Q18A 1W0JA 3R1IA 4K9OA 1SHLA 2CZQA 2BUCA 3VM6A 3PJFA 1VJDA 3FSJX 3T15A 3PXCX 3ZWAA 5ALZA 3QF4B 5COAA 1QV9A 4O4HA 2QR3A 1Q1BA 4ARVA 3M6AA 3PQ3A 4Y2JA 4YUYA 3KEQA 1EZ4A 4B35A 1Q0QA 1T2DA 1IXKA 2BGKA 1ZN2A 4IQ4A 3UC5A 4DRXA 3E3OA 4I9GA 3GK3A 1EVZA 2A0XA 3IIJA 4OX9B 3WKBA 4EUFA 1TZCA 3EVAA 4QATA 1Y6GA 1QKKA 2OHXA 2IHZA 2YYSA 4ZMSA 2P11A 3TNDA 1XRNA 1DO8A 3D1JA 5CDGA 1LCIA 3IHLA 3EA0A 2HTEA 3LXRA 4P98A 4RVNA 1AKTA 3MUOA 4S0XA 2WKQA 4MV4A 1UANA 1W88B 2FUEA 2Y71A 2AC2A 5JI2E 3A6EA 4W5OA 2P1ZA 1QP0A 4HGRA 2O23A 2C1ZA 4MS3A 4IOLA 4R0MA 1BKSB 3NYRA 5DIFA 1JAIA 4LV8B 2BN4A 4UULA 2EOAA 4LOHA 1UXHA 13PKA 1Z5GA 1N9GA 5KDOA 5LNK1 4C4RA 2SCUB 5EZSA 5GZ1A 3IX7A 1NDHA 2VEOA 2CMFA 1FDIA 1K8QA 4AMUA 2CVFA 3JQ6A 2PAFA 4B32A 2IF0A 4MQLA 5TQ0A 4MNTA 2CXNA 1M74A 2ZRIA 4Q3LA 3HUTA 3OLXA 1ZVQA 1XDBA 2WB4A 2PA3A 1H2HA 3UWDA 2P8SA 5I6DA 1RBYA 4QHYA 3LK6A 3PRKE 4FT4A 1VB3A 3VU9A 4CKYA 5KTOA 3U7IA 5C52B 2AFRA 2BFFB 1IZ8A 3BF8A 3REQB 1US8A 2A9PA 2W71A 4W5WA 3RM3A 3TIIA 1JVNA 4ZTZB 1E6UA 2FSVA 4G37A 4XJSA 3RFCA 4XYBA 3SZRA 3U1TA 1L5HB 2XLBA 1NUQA 4AB1A 4EB6B 1TVKA 5I8ZA 3GNTA 2NU7A 2UUAB 2ID7A 1BXRA 3WSVA 3EMBA 1U5CA 1Y5RA 3NHUA 3PHBE 4WK6A 5FADA 4I1VA 4FBGA 5GPBA 3AY7A 3ZS9A 4ISBA 3R7AA 2IL1A 4PQEA 2PH7A 3H1FA 1I2DA 1NQTA 2GCIA 5IUKC 4EY8A 4FFBB 5F35A 5BY2A 4ENTA 5E4TA 4YJ2A 1EFCA 1DMRA 3G59A 4E5NA 3WLSA 5HDBB 4BVKA 2R25B 4RH1A 4DTIA 1QAOA 1D2GA 4CF7A 4DNPA 3IQWA 5BO5A 1DZ3A 1RPJA 2J33A 4XFKA 5BSMA 2A4MA 5EJ7A 4O1IA 5IYZB 3EWAA 3T4UA 3JZFA 4O4LB 3ZUPA 1D9ZA 1L1RA 2H1IA 4TXLA 5CVVA 3TCKA 4X00A 3UWSA 4JS0A 4IGFA 4R2MA 1JMKC 1MA0A 4MVCA 1ESCA 4PR3A 3QVJA 4RGVA 3UOGA 2WICA 1JDSA 2IJGX 1E6EA 2VPQA 1PVVA 2ZCVA 3MQ4A 1M1NA 4W5HA 5JJCA 2BHRA 2Z8YM 1J2EA 2AL7A 2HJVA 1U3CA 2JHCA 1X3SA 2J67A 2NV2B 2QD3A 2XWPA 2L82A 3KZ1E 4G26A 4GR9A 3ZHYA 5EJ9A 2WA1A 1P5HA 1K8XB 3KSMA 1WUYA 1G5HA 2HA0A 4DNFA 4JLKA 5LIPA 3VYTB 4PX3A 2OKCA 4JYCA 1L7QA 2X7XA 2F4NA 4TLBA 2B4YA 2SHKA 2JLAA 5J63A 1E58A 2F1HA 1YDEA 1U7WA 1JSCA 1SR8A 1AKWA 2FWMX 4ECEA 4DA6A 3W34A 4BVGA 2ZTUA 3C3EA 1PT6A 1XTRA 1H2EA 3QJYA 4KMSA 4LJ6A 3WB0A 5I8PA 3DV0B 3FZGA 1Q5PA 3Q41A 4X1KB 2F6RA 3FMGA 3CLRC 3CLUC 3SYRA 3IUNA 2C04A 1CK4A 3O2SB 4HLNA 4XVHA 3UO8B 5GINE 5AH0A 1AKVA 1RWMA 5L4SA 5JDCA 4EJMA 3O8OB 2OXCA 1NFQA 4MAAA 1MRZA 3RTBA 1OF1A 4EY6A 4YRQA 3STTA 2CB0A 1N6LA 1XTSA 4D9NA 4BAZA 2ICAA 5I9SA 2LV8A 3B7WA 1HI9A 3C6BA 2AOWA 4XUGB 2QU8A 3WGTA 4EA7A 4I08A 1G20A 2WVJA 1P6XA 3DGEC 3AUSA 4WA7A 4QC2A 2LGJA 5IKOA 3RPEA 3GDHA 5KSOA 4KYIB 2HUNA 4P08A 1UMCB 1XFAA 2YINC 3VHXB 4DB2A 3JXEA 4MW6A 1ULUA 2AEJA 3E5NA 3LY9A 3FKQA 4J1NA 5JSHA 2B2NA 3EZ6A 4U2EA 2BR5A 5EJ6A 1KS2A 5G41A 1CUUA 1DI0A 4E6PA 5FBHA 2XQKA 1E18A 1YNSA 2CLFB 1NE7A 3AJDA 3FA2A 2ZI9A 3DT8A 2KW5A 1A8PA 4PX5A 5T7BA 3H04A 1NXVA 3E9RA 3LUJA 3R0IA 4LYGA 5TNXA 3AJRA 3EK2A 3K2EA 3L0PA 4Z86A 1E69A 5U1PA 3ZU3A 3L7JA 2HGZA 2R86A 3PI7A 1JHUA 3VDRA 1MB4A 1M34E 2IKQA 3D3EA 4EFDA 2GZMA 3N0TA 4FDVA 4KK3A 4MRVA 1WD7A 1GZ4A 4J7AA 4RU1A 1AUQA 1UZAA 3TRIA 4TWJA 1JHZA 1FNMA 2M9MA 5G3YA 1Y1QA 2FDCA 3ROZA 2DR3A 1NLYA 1JLRA 4LJ5A 1QQ7A 4XQCA 3ITEA 1KAOA 5FYDA 1QNFA 2YKGA 3M89A 3UT5A 3KD2A 1Y81A 2OO7A 1L1FA 3NWEA 1AUVA 2ADOA 2O1XA 2G9UA 2HSJA 1RQ7A 3GVXA 2O0HA 1C0LA 3JD0A 3DGFC 5LP6C 1RR6A 3W5BA 1U6JA 1WP9A 2C20A 4K46A 2GTIA 4HDRB 3SF8B 5JVDA 1NW5A 1VE1A 1W96A 2ZBVA 4OXQA 4L8GA 3PA6A 4V3BA 3SZUA 1F4PA 1FXWA 1JEQA 2XOXA 2BEVB 5IANA 2QRZA 3SX4A 2JFUA 3UT6A 4Z7QB 5AW7A 2W58A 3ITDA 4EMUA 2BMEA 1OTXA 1A7AA 5HKLA 1UEJA 2W98A 2ZWMA 3ZVLA 1T10A 2X0NA 3E27A 3KCNA 2VSXA 5ALIA 2F17A 3GLKA 4PS1A 4PIVA 5EA2A 3W2EA 1FFHA 4BLRA 1U2QA 4YJ2F 2O2XA 4QGFA 4L5IA 4LN1A 1RYBA 2GAOA 2C2GA 5FWDA 4BEBA 1LTQA 3SY8A 4DQXA 1TRHA 1YQDA 1YL7A 2VT7A 3CG4A 4W6QA 3PJGA 1WS6A 3BS4A 1HUQA 1YVRA 2B4KA 3IP3A 3P0JA 4KUHA 2OXTA 1RQ2A 2I1VB 3SHVA 1Z22A 4L8YA 2DFLA 3E4DA 1BXGB 1Z88A 2QS9A 3EZXA 3IS3A 3T5DA 2ZBQA 2BEWA 1SXJE 1L5ZA 2A9KA 4ZK2A 3EQ6A 4AWBA 1FW8A 5DW0A 2CVOA 1QKJA 5FR2A 4B4DA 1IONA 3BT7A 1NVBA 4RK4A 4TL9A 1A9ZA 2DCUA 2RAPA 4PYMA 2QN8A 3AF5A 3M70A 2NSDA 4IM7A 4E5VA 3AVTA 2O8EA 2ONYA 5C35A 2RH5A 2JGMA 4NOKA 2NOAA 5GJBA 3A06A 1GCUA 3N2KA 5CVUA 1SVLA 1VSTA 2CSUA 5EXPA 4CV3A 1MJFA 3ADCA 2DETA 2FP3A 2P78A 4F2HA 3WP0A 2GN1A 2JASA 2IUYA 1RVDA 2EJCA 3DDOA 4OQEA 4BB0A 3I9V6 1NW9B 5DKFA 1U8EA 2BC9A 4YDHB 1ODKA 2YDXA 3BIOA 4R1UA 1KK2A 3W2GA 2NU8B 1ZI8A 5FOWA 1VG8A 1RYHA 3GQVA 4ZQCB 3FTCA 1GG8A 2WC1A 3T7JA 2ZPAA 1OX4A 2GBPA 3UXHA 3KUDA 2R65A 1THZA 4KYVA 1Y8RA 1YE8A 3S28A 2IHKA 2JLQA 5AICA 1MIHA 5GMOA 1SBTA 3DVLA 4WNCA 1QG4A 2JBWA 2JA2A 2NADA 4LJ7A 3KSDO 4J1QA 5DHSA 3CUYA 5LR6A 3VSDA 4EA6A 5IASA 2A14A 3SM3A 2DG2A 4NL4H 1NIJA 3C8MA 1BG6A 4JY7A 1R10A 1F5NA 4ZT7A 4B33A 5CNMA 4US1R 4DFDA 2BDUA 1RT9A 3CUEF 5CBPA 4PG8A 2PXHA 2Z83A 3ZNNA 5BWOA 4ZT5A 5KVVA 3NO4A 2ZRMA 2BGJA 4ARUA 3AVQA 3QEMB 5L3QB 2PYZA 1JJFA 3QYAA 3VUFA 3T54A 5EWLA 2O1SA 2ZIUB 4M88A 1NXSA 2WLSA 3LZDA 3DAPA 1SQGA 3OICA 1NQXA 1IM2A 1OA0A 1P74A 1JHYA 4XD7A 3FLMA 3UPDA 1PZEA 2CV0A 3CT6A 1TIPA 2XKAA 4LI0A 4PVDA 5JS6A 2I2WA 2HX1A 4JP2A 4HFRA 3BRQA 3RUEA 2FE4A 2Z5GA 3RB8A 4J75A 2J7PD 4J29A 3U7FB 4HB0A 1F3OA 1IOWA 2UXBB 1WG8A 4OA5A 5BWBA 2ZU0C 2YR0A 5BQFA 5GVRA 4R16A 2G9ZA 3OOWA 4JJGA 3V33A 2FZCA 4QGBA 4HDCA 1EA7A 4A0SA 3VJKA 5CPBA 4ZQHA 4QNRA 5FO0A 4F21A 1YS9A 2GYUA 4BL5A 2EGUA 1NM5C 3REFA 1U6KA 2IHBA 4OLJA 4TLAA 3W2HA 3A1NA 5JAIA 2BDTA 3PHGA 5HIIA 1BMQA 4RH3A 1OKKA 4EY4A 2WHEA 3NUZA 4C2TA 1T0HB 3DE1X 4FW9A 3HFJA 4JI5B 5LD2C 4NG5A 3JD4A 2HHHB 2EYUA 2QL6A 3P9KA 4NZYA 5JVDF 3HA2A 2FUKA 3EDRA 3I0ZA 1RRPA 2QTWB 5BQOA 3W6NA 1FXWF 1E9VA 5HUJA 1T8PA 4Q3NA 3T3OA 1SZCA 2EFGA 1U9IA