3RGWS

Crystal structure at 1.5 a resolution of an h2-reduced, o2-tolerant hydrogenase from ralstonia eutropha unmasks a novel iron-sulfur cluster
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
270
structure length
270
Chain Sequence
PRTPVLWLHGLECTCCSESFIRSAHPLAKDVVLSMISLDYDDTLMAAAGHQAEAILEEIMTKYKGNYILAVEGNPPLNQDGMSCIIGGRPFIEQLKYVAKDAKAIISWGSCASWGCVQAAKPNPTQATPVHKVITDKPIIKVPGCPPIAEVMTGVITYMLTFDRIPELDRQGRPKMFYSQRIHDKCYRRPHFDAGQFVEEWDDESARKGFCLYKMGCKGPTTYNACSTTRWNEGTSFPIQSGHGCIGCSEDGFWDKGSFYDRLTGISQFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of an oxygen-tolerant hydrogenase uncovers a novel iron-sulphur centre.
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase
molecule keywords Membrane-bound hydrogenase (NIFE) large subunit HOXG
total genus 79
structure length 270
sequence length 270
ec nomenclature ec 1.12.99.6: Hydrogenase (acceptor).
pdb deposition date 2011-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
S PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 3rgwS01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 3rgwS02
4UCQA 4KO4S 5A4FS 1WUKS 4UD6A 3USES 5JSHA 4U9IS 1UBUS 4UCWA 2WPNA 3RGWS 3ZE6A 3ZE9A 4UE3S 4UEWA 4KN9S 1YRQA 1UBJS 3MYRA 1UBMS 3CURA 4KO3S 1YQ9A 5JRDS 5JSUA 4UEQA 1YQWA 5A4MS 1E3DA 1WULS 3ZE7A 4UE2A 1H2RS 4UPVA 4TTTS 4UPEA 5D51S 4UQPA 3UQYS 5JT1A 4U9HS 5JSYA 1FRFS 3ZE8A 4UQLA 4OMFG 3H3XA 4KO1S 3AYXB 1H2AS 4KO2S 5JSKA 4CI0B 4UD2A 5ADUS 2FRVA 1UBOS 3AYZB 4IUDS 4KL8S 1UBTS 4UCXA 1FRVA 4IUCS 1CC1S 4URHA 1UBRS 1UBHS 3CUSA 4UE6A 3ZEAA 4C3OB 1UBLS 1UBKS 1WUJS 1WUIS 4IUBS 1WUHS 4GD3Q 5A4IS 3USCS
chains in the Genus database with same CATH superfamily
1ZIPA 3TM4A 4IIXA 2L17A 5BRAA 2QPTA 4Y6GB 3UV7A 4BO2A 4EJSA 2AN5A 3W5AA 1TU0A 4FEGA 2BFPA 2GPJA 4E03A 1ETHA 4NCHA 2UVPA 2RAVA 2WWHA 4OHXA 3A9CA 2RGGA 4EL5A 3NVDA 3J7AC 3B6ZA 5KYNA 5BW4A 4BAGA 4M7PA 2BFOA 3RBVA 1D2AA 1DQNA 1EE2A 1YQEA 2CJXA 1DRKA 1L4FA 5EWMA 3TJZA 2XNHA 3TNLA 4DXHA 5IWCA 4RD4A 4JB8A 2JC3A 3QMMA 4P2GA 2BGUA 4FFVA 4WZZA 1NATA 1F3OA 2QG4A 1ISFA 2P6NA 4EHLA 3OLVA 4BEJA 2IWHA 4M7OA 4RHYA 1U2SA 4ETMA 3TSOA 2XXJA 3G8CA 4HEHA 2F1RA 1XJWA 4RLHA 4DR6B 1LSSA 3GCWA 2WTNA 4K05A 5F78A 1ZCAA 5AW5A 2VJNA 3B78A 4AJOA 4CM8B 3TG2A 5FBWB 2QBYA 1ZC4A 4R5HA 5JS7A 1WJGA 2IEDA 4XDGA 2H7XA 1CP3A 3TXYA 2VPIA 5CYGA 3ZJVA 1XO1A 2PJRA 2Q6IA 4PRYA 3E0QA 4E2FA 1KVSA 2PQ6A 2VPQA 2VTVA 3I6QA 3LAWA 3PQ3A 1P5ZB 4K81B 4EW6A 4F4CA 4N7RA 1G8YA 2FPWA 2HLNA 1MEOA 4BNWA 4ZVLA 3E70C 1JSZA 4QTUB 4DR5B 3NHMA 5AW7A 2FR0A 3F67A 3RSSA 5JCXA 4JI4B 4EO7A 3OJXA 2FMHA 5K3FB 4DLVA 3DMPA 2TS1A 3AWIA 5KJCA 5KX5B 3H4TA 5K3SA 3PNLA 2VA9A 2O3RA 5TQ0B 3VMMA 4C2BA 3EVEA 3V4FA 5L3QB 3KPVA 3U44B 4QPZA 4L72A 1KFJB 3IODA 5FDFA 2IOFA 4M76B 1HKHA 1ZINA 3KT8A 4OHRA 2R62A 1YBHA 1VHLA 2NUAB 1R0ZA 5E9JA 1QBGA 2H8KA 2XMZA 3QUQA 3R7DA 1IY2A 4DM3A 1V3UA 3AVQA 1Z13A 5GM2A 1C7ZA 1SUEA 3B85A 2BUCA 5FT9A 1PJSA 4QWMA 1N3LA 3U4HA 4OB7A 4NRDA 5CVUA 4UKDA 3TQHA 1P2GA 2P9CA 3B20A 2C42A 1U9IA 5EI5A 2OBBA 4RMJA 1MMFB 4IIHA 1V25A 2EGUA 4B3SB 1BGWA 3CLHA 5DB4A 1R0BA 3GG9A 3HR4A 2VSOA 1B73A 3CCFA 1OA1A 1Y34E 1ZD3A 4D02A 3ZS8A 1GP2A 3HPRA 1HT0A 1PK9A 1T43A 2HBZA 2FSSA 1FQKA 4P7BA 4BE4A 4JHLA 1A1VA 5HQ3A 5K20A 1SVIA 1AMUA 4PYNA 1A9PA 3N5KA 1U7PA 3WYAA 1EFTA 2C07A 3VC1A 2I7XA 4IX1A 4BCDA 1HDCA 4GEGA 5FUXA 2NU9B 4M83A 2YJ5A 1O0CA 3D6MA 1A2OA 5D1HA 1QRRA 4QUGA 1CJKC 4JT2A 3B1ZA 4KAJA 3OJWA 4NABA 3WYDA 4W1RA 2O3QA 3I8XA 3L9WA 2ZE6A 2O20A 5A3RA 2NYRA 1NAHA 1G20E 1J2UA 2EF0A 4BX9A 3U16A 1FQOA 1QTNA 1DDOA 3CF4A 4JEUA 5EVJA 4ZV7A 4ESOA 1E7RA 4IOMA 5I9IA 3LUKA 1Z08A 3S28A 3UVEA 2GUWA 4AMVA 2H1HA 4RSMA 5LN1A 2N75A 3I2GA 3ME5A 4X61A 1ZONA 1BS9A 1L5MA 2I80A 1KXJA 3IJEB 3K5PA 2FW8A 4JI7B 3INGA 2AMFA 4KAFA 4QASA 4FYWA 3WE7A 2G8LA 3STUA 3V97A 2PZAA 3HABA 4URWR 4ITUA 4PLWA 3PHGA 4FR5A 3FWYA 4MI9A 3UFXB 1G16A 4YRAA 3RBAA 2BGRA 3IEIA 1E1QD 1NMQA 1GKLA 3HCNA 3OCCA 1JKMA 2PEYA 3PUXA 5A05A 1IK4A 4JT8A 4R8VA 3LDGA 5ALLA 2AYXA 5JRZA 2WWVD 3T1TA 2XMSA 4AJIA 1U1FA 16PKA 2Q3MA 3RVBA 3U48A 3UHAA 3GMDA 1FW6A 2WYHA 1RM5A 1UJ6A 1ONOA 3PS9A 3T6KA 4WJKB 4QOHA 1HTTA 4MUFA 2VH5R 5FAXA 4L08A 2GN2A 3OHSX 4L0CA 3K9GA 3SPXA 3VPDA 1JEYA 1GRCA 3FF4A 2RH4A 4L75A 4HGOA 1DUVG 5FWNA 3GGOA 4R3UC 4YV0A 3CCCA 3JQBA 3UT6A 4HLNA 5FOXA 4YJKA 3WIEA 3RS4A 1BE6A 1DFHA 1MJ5A 3ZCQA 5F7OA 1A88A 2WFLB 3HWSA 2ZR7A 4XSHA 5D00A 1Q20A 4BWYA 3COVA 3W2TA 2WICA 1QHHB 3E53A 2IBTA 1BQ3A 4X97A 5MGBA 1G41A 1WXIA 4L27A 2ISCA 5FBHA 3LX6A 4L73A 4LS3A 4LWQA 3VV2A 1JL3A 4A73A 4A1OA 4ADSG 2CZQA 4PNEA 2UZ1B 1CYDA 3LPMA 3UV3A 3BFPA 3UC9A 1EFKA 5TGZA 3P2MA 4I4TA 2FSVA 2QM3A 1KAMA 3HA7A 3OFNA 2DE0X 3PJDA 3E9DA 4GXTA 4NBLA 4QLOA 4W5OA 2P9GA 4O4HA 4OH1A 3PVSA 5BOSB 3QHAA 1D1PA 3HCFA 3BS4A 3IJPA 1UXOA 1ONNA 3NASA 3QLJA 2NPFA 4B81A 4KXXA 1P77A 1YRWA 1Z25A 3F5SA 3KD3A 3GRAA 4Y0VA 1BG6A 3L1JA 5EMKA 1KKLA 1FNSA 4BN4A 3ND9A 1V8FA 3L4BC 4Y6QA 2NU8B 5DSZA 2VCYA 4C78A 1SKAA 4HEJA 2XEXA 4QU9A 4RU1A 3WWPA 3ZW7A 4EB6A 1DEKA 2CKDA 1EEXB 3UJDA 2E89A 2JLUA 2ZRLA 2PMFA 2RIRA 1IEVA 2DSNA 2W93A 3LNTA 3ORSA 4X1KA 1KO1A 5ALZA 2V5VA 3CH5A 3RIXA 1W47A 2XDAA 2P2ZA 3BSYA 5ERXA 2OTCA 2EBFX 3AUKA 2WFAA 1FYVA 2HNAA 3FMIA 4BBPA 1C1DB 1FP4B 1O94D 3L0ZA 1NWCA 3BCRA 3MJDA 3MCTA 3CXUA 2PUEA 1JEYB 1RHMA 3BIXA 4KNYA 1KP3A 4U2KA 4FSXA 1Z0UA 2H00A 3PLNA 2WJPA 4NXNB 1D1SA 3BCHA 4ZQFA 2I76A 3PXGA 4BASA 5DT2A 4W63A 4R7GA 3WWOA 4WKPA 1FPMA 4HV4A 1L8OA 5DO9A 2OAQ1 3FPAA 1X9IA 1AK2A 3QYJA 4C01A 2X9QA 3BIJA 4RY8A 1RJWA 3VR0A 1KOJA 4RMNA 4EZIA 5EJ8A 2HHHB 3PYMA 1JHRA 3G7NA 3KAQA 3QH4A 2VBIA 1W4BA 3EASA 3SHOA 3SKXA 4MVJM 4BNKA 4EZEA 1W19A 3H2GA 3PR1A 1E6UA 4QGSA 1A8IA 1XD8A 4AULA 1RHKA 1Z5ZA 1N33B 4AN1A 2AWOA 1IPEA 1NQVA 1QANA 2Y1DA 5U4XA 1AZTA 3Q2IA 4NSNA 5DMXA 5JISA 3MMSA 2PVSA 2QVCA 4OAOA 3CKLA 3K0BA 2LDBA 2QX8A 1M6EX 3H6KA 5HKAA 5JXIA 5C0OE 3T7JA 3FCEA 4A26A 4B47A 3FMFA 3FZQA 3I9JA 1W5AA 1OBCA 2V4ZA 1HT1E 4GXRA 4MW1A 4HT3B 1RS0A 1DAFA 1LW7A 2I0FA 1E2DA 3ACBA 2BDTA 3I9OA 3IP9A 4IH1A 4HXEB 4NY1A 4Z1OA 4KFCA 1G63A 4BZXA 3OFSA 4XSVA 2RI1A 1NPDA 1WMBA 3HYNA 3W9YA 1I2BA 5MGNA 2J59A 1U1EA 5EKTA 1QV9A 3TW4A 3C3WA 5GY7A 2EW8A 4Y2UA 5DYNA 3G88A 1R5OA 2XUOA 4U7FA 4KPFC 4BNZA 4MJ3A 3T1VA 3IOBA 1A5ZA 1H0RA 2G07A 1HQKA 4L4ZA 4Q03A 5KI6A 3TTYA 3FNGA 1E6KA 1Q1EA 1U0EA 3JAKB 4BNFA 2RE8A 4X00A 1PYDA 4MB2A 3JR7A 3B1JA 1UBEA 4P08A 1YJQA 2PLWA 1JALA 1JAHA 4H7IA 1FDUA 5I9MA 4AQDA 4E5KA 5IABA 2OAP1 3TUJC 5I51A 1P1FA 1E2JA 3NJ8A 4QAJA 1BS1A 2X76A 3NTXA 1Z26A 3WMEA 5JWHA 1OROA 1M2OB 1RJ9A 1XI2A 3G5LA 1FY2A 1QIDA 1JA9A 2A9RA 3LPAA 2ORWA 2PZEA 3I9LA 2VP3A 4FHDA 4HTFB 3UAOA 3WGOA 4CL2A 2GRJA 1QS0B 1QFJA 4PCLA 5EIOA 2GCPA 2WPNA 3IDFA 4GX5A 4IDCA 3TRFA 1SIUA 1WBJB 1XMSA 3LCJA 1OH5A 3A6LA 3GUCA 1T0PA 2HTEA 2ETVA 1GKKA 1UMDA 2V5UA 4BKRA 2HIAA 3O4HA 1YE8A 5I7EA 1V8PA 3F96A 1Z8NA 3PKJA 1PYGA 4JR2A 4N3AA 1JLHA 1U1IA 2F1IA 4X6LA 2OGSA 4Z4CA 1V8ZA 2GFIA 2DU8A 2I99A 3V4OA 1U6IA 1TAGA 2BBOA 5TF4A 1SIBE 2EW1A 2V1XA 3DT8A 3N75A 4TWRA 3GRYA 3TFWA 1SIWA 1PJAA 1QJCA 1TNDA 2WUDA 5C4MA 3GPLA 3EB9A 1X8KA 5B55A 4AMZA 1HLGA 1MAAA 3DDWA 4WY8A 1XAIA 1K0FA 4MP8A 1MZVA 1FX1A 3K30A 2H8GA 3O4VA 2HLPA 2YWDA 5EZSA 3VKHA 1EWVA 5HGJA 3DZCA 3GEGA 4RETA 2IA5A 3RJTA 3ZVKA 5JO0A 4D8UA 3PI6A 1S3SA 2OWEA 1VDMA 1JFFB 2EL7A 5L6LB 1O96B 3G89A 1OXVA 1JZSA 4UNRA 2HRRA 5HILA 1M67A 1E9EA 2RGUA 1VJRA 2YHAA 2AFRA 3GJ7A 4IHAA 4G0OA 4LPSA 2QHXA 4R1SA 3V1UA 3IAFA 3EEFA 2A84A 4HGYA 1Y4SA 2JHGA 1NG9A 4MINA 2OCDA 4RCZA 3RVSA 3T1NA 4R7ZA 1FFYA 2CXUA 1R8YA 1OHHD 3TGPA 4YCMA 3NTRA 4NU8X 3ZXXA 2ZRNA 3FB1A 4UTZA 4EVIA 1D4AA 2ONCA 3CE6A 3JX9A 4DIBA 4IXMA 3OKAA 4U0KA 3GJ0A 4OQXA 3AW9A 1WHTB 1TO6A 4JXZA 4MQEA 1KZ6A 2YW2A 1XDUA 3B38A 1RM0A 4D4LA 1XZHA 1YS1X 1XEXA 2V6BA 4FT2A 2YV5A 5GAJA 1NQ5A 4ARIA 3AVWA 3MINA 1Z2NX 4U1RA 1VQ1A 3KX2A 2XYPA 1B3RA 5EP1A 2ZIGA 1T9DA 4UARA 5AVOA 3LYLA 1CUHA 3IVMA 4Y3UA 2PX3A 3QU5A 4JNCA 2OPHA 4DJFC 2ZJ4A 1RJGA 1C4KA 2PNFA 4RHTA 3OE1A 4X71A 3QWBA 4RV5A 5DI3B 1EZZA 3FZNA 1DXOA 2RGYA 1QHFA 3OTGA 2IOFK 3TBFA 3WHLA 3A70A 3TW8B 2UU9B 1XFDA 2EERA 1ISIA 3OPVA 2AG0A 4OQ4A 2P9FA 2CJYA 2WJJA 3IAHA 4KK4A 4YJ2F 4HB2A 2HO4A 2P91A 2SCUA 4ZOLB 5DTRA 3RGWS 3VR6H 5EJ9A 1GQYA 3F4BA 5KQLA 3AXTA 5EE5B 3Q8MA 4DUYB 1NWHA 4A10A 2GCIA 1GHTA 1HV8A 1JW9B 3LRTA 4K6GA 4X24A 4ZT3A 3DEFA 1KY3A 1QONA 1TF7A 2JAHA 4TQGA 2IEAA 4KXNA 2VAPA 3ZV7A 4H7PA 3C6BA 5I7OA 4RJLA 4MHSA 1V4VA 3DR5A 2PAAA 3HFSA 2LXNA 4LTMA 5CT6A 2H3HA 4FYVA 3A1VA 4NYJR 4C5AA 2PSSA 1SFRA 4LMAA 3JASB 2FSIA 3W6OA 3VGJA 3VNUA 1ECJA 4CMEA 3IEMA 1XZEA 4FXOA 1YXMA 4MV6A 4A0SA 2UUPA 3MTBA 4HJRA 4IHKA 4OHUA 1HY3A 2WHRA 3ZXSA 1DRWA 3RVNA 1K4YA 4BMVA 4L7QA 1OJLA 2C0PA 1A96A 1P60A 1RBZA 3AKCA 4ZCTA 3ESYA 2QW0X 2R47A 1SVSA 3IYLW 4LECA 5LQDA 4REQB 4XVRA 2PUFA 3BQMB 1DC6A 4PX3A 3C8ZA 3MA0A 3ZHYA 4ZYZA 4BNNA 1HT2E 1XLWA 2E4ZA 1K9SA 3FVTA 5I5GA 1KS2A 5CK4A 1NNUA 3NO4A 1FDSA 2Q3FA 5CB4F 2GAFA 3KQOA 2HRDA 2VK8A 4Z1MA 1Z4JA 3Q41A 2CLFB 3A26A 4I1RA 5TC4A 2OYCA 4DWJA 1PG2A 2P1ZA 3AUSA 2CMFA 1L3IA 1DCFA 2NWQA 2P30A 4U6SA 5IPFA 1G18A 3G9XA 2B8WA 4HDMB 2WZDA 2Y99A 1QCZA 1JG6A 3QKRA 3O4JA 4ZKDA 3PQFA 3GWZA 1YR7A 5FTLA 2AR7A 4XX0A 5L3SA 2HCFA 1GPLA 3NB0A 3V7YA 1NBME 3ZZ0A 5MDHA 3S2UA 2QP4A 3HRHA 3K2QA 5AICA 4AZSA 2ZCUA 4CPDA 4F86A 3N8DA 4TM8A 2IZ0A 1Z8FA 3GJ4A 5CPFA 2X15A 3ENVA 1EK6A 2O7VA 4KAXA 3GGDA 4G8BA 2O8EA 5EIWA 4CEHA 4EA6A 2IT1A 5EJIA 3R3UA 4HZUA 5HRAA 1QX4A 1VXOA 1UOOA 1VIMA 4KMSA 1CZNA 3PJFA 5T7BA 2I87A 1EVZA 2OECA 2VNKA 1H2EA 1JDUA 1YACA 5H3HA 3RC7A 1OFVA 1ZVKA 3PK0A 1RBYA 2FH5B 4P22A 1ZMXA 2UV8A 4MRNA 2RHTA 5CVVA 4QQ8A 4AX4A 2QJRA 3ACCA 5CDSA 4MQFB 5BW8A 2MHCA 3GW8A 3L0CA 3NTQA 1U7TA 2RHRA 5CCEA 4KITB 4RJTA 1EUCA 1D1QA 5JMOA 2QROA 3TEJA 2Q5QA 1RPZA 1EH5A 3SZOA 5HKBA 2FQ1A 2FX3A 3I2HA 3U31A 4AZ3A 1XQWA 3P9CA 5HNKA 1K98A 5GGXA 1BDIA 4WZAE 3L01A 1L4EA 2C2GA 4M8SA 5TGDA 3FUUA 1ENOA 2PJDA 2V7BA 1D7AA 3ASYA 4XUGB 4NDNE 3ACDA 3SJBA 5AYVA 5JPIA 3ZWMA 4DDHA 3NBXX 4CIAA 5LYJF 5CFNA 1SUDA 1UXKA 1XQXA 2W2XA 1YS2X 3MB5A 2FGJA 1AGRA 3T0IA 3GLFB 2YFKA 2HCTA 1TCBA 3PQ5A 4US2R 2F8LA 3QXGA 2R7NA 3KZXA 1RZRA 4FFBA 4ND7A 1WQ3A 4LZOA 1I1OA 4HDNB 2YKGA 2FZVA 3MERA 1U3TA 4KEAA 1L4BA 3AUUA 1SU6A 5LA6B 4ALKA 2Y1FA 2Z6AA 4UU0A 1ES9A 3KOYA 1TRKA 2I7CA 3OE5A 2PLFA 4JJFA 4U7GA 3ROMA 3SX2A 5LMCA 1K0UA 2J4FA 2X5OA 3UOGA 4PNHA 2UXCB 2BKUA 1HC7A 3LCCA 1Z6TA 1EGMB 4YK7A 3LDFA 3BFVA 4KV7A 3BJZA 2GDJA 4RFSB 4E5YA 5BYAA 4MPRA 3UOWA 4FMCB 3RS5A 3CLRC 1WUHS 3BCUA 5JYEA 2W6ZA 4D79A 1FFHA 1XL1A 5LNK6 1Q2XA 3BRQA 5IDVA 4IX9A 3ZIAA 2VSQA 3KJFA 4XVQA 1D5WA 3M83A 2FZLA 1HOXA 3ZWVA 3KTAB 2FDXA 4BVEA 2ATIA 4MCIA 1J06A 3FJYA 2ZBPA 4KIJA 1N1GA 2XDYA 4WADA 5K03A 2VAMA 1NYLA 4ZZ3A 4NCKA 5EMLA 1ABFA 3L0PA 5ALFA 1QH1A 2DHQA 5IS2A 2JLRA 4P0TA 1TU3A 2R0QC 1P45A 5K3EA 1GPBA 1O77A 2JGEA 2PXCA 2YVAA 3BD6A 4NARA 1MX5A 5SY9A 1J7JA 1LFAA 1R0RE 2XEDA 3G5MA 3KE9A 4KP7A 1WSAA 2Y0PA 4WVLA 5DWDA 3VU8A 2QLJA 1KOGA 1YCHA 3FPSA 4AZ3B 3IAM1 4OV6B 1YZHA 3MT8A 3BL8A 4DUZB 1ZNQO 3DVAA 4WI1A 3T7EA 2Q29A 3WWCA 2QGFA 1IU9A 5BPFA 1PG5A 1KE1A 3I61A 1ZGAA 4M0MA 2XE6A 4AP5A 1ISGA 1B6GA 1QB8A 1WXWA 3Q6NA 1DTWA 1XUOA 1H8HD 2Q41A 1ZH0A 4Q4HA 2HIHA 4I1YA 1U0LA 3AFNA 1QE5A 2O2YA 3N6RA 4MVJD 1ZGZA 5DSTA 1M54A 3DOHA 5MN4A 2VPPA 4FGZA 5T4FA 4DDVA 4QUKA 2YINC 4JOSA 1A9SA 3IMKA 2PH3A 3OFVA 4HADA 4X20A 4F5WA 2VRWA 5KNCA 1D5CA 4NBKA 1VRWA 3V55A 2JFFA 5EUMA 1ZOPA 2QRHA 1NI3A 3U7IA 3VH2A 4E88A 3P19A 3DE7X 4WERA 3HU1A 2JRCA 5DH9A 4LXYA 2OQVA 3U4QA 4JP1A 4WZAB 1MTZA 3RNOA 2F62A 4LOLA 3M3HA 1E89A 3PCTA 5T4EA 1SD2A 1V5FA 2FRDA 2IEIA 1DNPA 2ST1A 2Z2KA 3BRSA 4A6PA 4YC7A 1G8HA 4TV8A 4BGVA 4HUQB 4K7JA 3AEZA 4ZPJA 4D4GA 4I99A 1E98A 3HCCA 4KPUB 1XB2A 2OXCA 2DT8A 3ABIA 4NJEA 4ZAYA 1EM6A 1FQWA 3VTFA 3EXEA 4DUGA 4RSGA 4ON9A 4P92A 1PNVA 1VL1A 2G0NA 1JVBA 3CNNA 2G5TA 4UHKA 4LYYA 3S7TA 1FNDA 5F1KA 3M49A 5KYWB 2KS6A 1R6UA 3U7EB 5C1IA 4XOUA 2LWIA 3H5IA 3AF5A 5A1JA 1SCNE 5BYBA 3WJAA 3Q88A 4GX2A 2B1JA 4BO0A 5CB4A 4BO7A 4HN4B 4K9PA 3G2OA 4UW9A 5AK5A 2ZVQX 4K9SA 4UVHA 1R0KA 1CQPA 4B80A 5CLQA 3EISA 3E82A 3IAM6 4P80A 4F3TA 5A5DA 4DRYA 2BCEA 2YS7A 1OZ0A 1RCTE 5H81A 5A4JA 1I36A 3E1KA 1TUBA 1PHPA 2DECA 4I55A 5EJ7A 3WGIA 3HRKA 4JY7A 1W49A 4G2TA 2HMVA 1QZTA 2C4MA 4G67A 1J99A 1WCWA 5C18A 3OM9A 2WVJA 3CMCO 3IUMA 1HT3A 4U3JB 5FBQB 5C31A 4MWSA 4PR3A 3WNBA 5KTKA 5AW4A 5JV5A 2F64A 3KUKA 4KGVA 3TRJA 1PR0A 1NC3A 1NVTA 4QTXA 1NUAA 3W8DA 1FUEA 2KJQA 3T5MA 2VPXA 4TS4A 5D6NA 1K6JA 4EG0A 1Z83A 2FPKA 5FO1A 3PC8A 1SC6A 2OHXA 4YFVA 4CTMA 1V9CA 2FW9A 3VYTB 4EF6A 5FNVF 5IJZA 4REQA 2GXSA 3PX2A 3FHTA 1AO0A 4U2FA 3PGMA 2ATCA 4TT3A 1CR1A 2VEDA 5PNTA 2PT5A 3HDQA 2CLLB 4DANA 5IU6A 4UQOA 1LVUA 1NW5A 1VJGA 1KQPA 2I3AA 2JATA 4UNIA 3R7FA 1ISJA 2ZBUA 3D2BA 3A3OA 5AW6A 4XASA 3PJGA 3I3SR 3KYJB 5GZ3A 4O1IA 4N54A 2QW8A 4PSAA 4QSMA 3I04A 4V0NA 4CQJA 4D9GA 4AY2A 2DP4E 1NXOA 4PPYA 4DMHA 4NPCA 4RTMA 2QKYA 4HDKB 3WZLA 2FPXA 1EFVA 4O4HF 1C0PA 3ZHBA 2JFUA 2OQIA 5JYCA 3DFFA 5C53B 4RPKA 2G17A 1DAKA 4C0BA 2BZSA 4KLNA 5JSZA 5BVGB 4CDMA 3DV0A 2PU7A 4FP9A 1SAYA 4PY2A 5A3JA 6CHYA 1MDFA 1MIOB 4RULA 2IDMA 1WF3A 4FHEA 1K7CA 1OX6A 4NONA 3QFTA 1L5KA 3GDGA 1JPVA 4UFOA 1DBVO 5F3RA 4YPOA 4Q3CA 4S1VA 4X8LA 3LFTA 4F2GA 1IBMB 2N46A 4NE9A 4BVFA 4RK4A 1GV0A 4D57A 4JKYA 3G5TA 2OM6A 3ISVA 4KN8A 2ZUTA 4LWZA 3N2ZB 2X8BA 1VIVA 2HJHA 5DNEA 5JAHA 1QQ7A 4AX8A 1TZ2A 3D4BA 4YRFA 3IOMA 3EMBA 4BXOB 1S2LA 2O1XA 1RLMA 3OZGA 5EQTA 3MLEA 2F1HA 4L50A 3IIKA 3E9ZA 4J0KA 4XYEA 3THRA 5IXJA 2Y1CA 3A8TA 3G13A 5FNVB 4NMLA 1DOZA 3W3ZB 2HMAA 3P2JA 2IYVA 3OCJA 5JSHA 3NHRA 1L5YA 1OIVA 3GMIA 4KQ9A 1SBZA 1O6BA 1UQRA 2GJ4A 1MC4A 1YE5A 5L4SA 3AMVA 3DMHA 2PLNA 3RSHA 3DMGA 1U65A 5GWXA 1K27A 3WQHA 4YCNA 2DPLA 2IP1A 4NZZA 3PNBA 2GUGA 1CBUA 3L1KA 3R5TA 2PV0A 3KELA 3KR9A 3DFIA 4HDKA 4KV9A 1E5DA 4P4UA 3SQOA 1GTMA 3GD5A 1SBQA 1Z0JA 3AY6A 2X1LA 3LK7A 1CHNA 1X42A 4J29A 3E7PA 3LY5A 1E1DA 3G7SA 1JLKA 2QN1A 1RZRD 2I55A 2GYVA 4GVPA 5IC6A 4KH0A 4TTRA 5TSDA 4GKVA 1NX6A 1L5HB 4OA5A 2G36A 3I9NA 4Q9KA 1LKZA 3SBDA 3NT2A 3OCXA 1TM5E 1OYYA 2XVXA 3GJ3A 3TUZC 4GVLA 1B6TA 4MP6A 2JLZA 5JECA 1KI7A 1SOMA 3DEKA 5J5VA 1KIAA 1N5IA 3ELUA 3T3MB 1FDRA 3ZY5A 1OY1A 1HLPA 1DXQA 5FLKA 3HKBB 1WY5A 5DASA 2P6PA 3WK5A 3ZPXA 4BUJA 4W6ZA 5JC8A 3MAJA 3PF8A 1L4MA 4GZ6A 2D3TA 4DSZA 1VDZA 4YMSA 1XCOA 2AX4A 2ZB3A 3VC7A 2YN0A 2BFWA 4PGHA 3UUFA 3KG2A 5IK2D 1N3BA 5BV1A 2JFZA 3ZR4B 1M0EA 1Z4NA 4TVBA 3LTNC 3LBHA 3G2QA 2D8AA 1SUIA 2EATA 4JWTA 2BEWB 4YQFA 2DFVA 1SB9A 5JCOA 3WA7A 4FWTA 3Q8KA 1P8JA 3KR1A 2YBEA 1OTYA 5C52B 1MD9A 3RG8A 4FJ1A 1U5CA 2FZEA 4B8YA 2VS1A 3HKCB 3W9UA 5P8WA 4RD2A 4BCBA 3A10A 4ZI7A 1U0OC 3SQWA 3TCNA 1DVRA 2KW5A 3GEDA 5E9WA 4A8JC 4I5IA 3HB4X 1JWAB 2IGTA 4AIRA 4BV9A 4K88A 3SDSA 3DDUA 2YHBA 1IIRA 2QV7A 5DXAA 5LQNA 1BH2A 3QVKA 1ZUNB 3G9TA 1QYIA 2XX3A 3LQKA 4DZTA 3S6JA 1VHDA 2FY8A 4IH9A 1ORIA 2Y4NA 1X6VA 1M2WA 1E79A 1MOSA 3MWDA 4QAQA 4RD3A 3BIFA 5DN9A 4JUBA 4COOA 4BQFA 1L8QA 2A0XA 2J5KA 2RSLA 2JGDB 2PRYA 3FA2A 3MFYA 4XR9A 3RJ5A 4BVLA 2H1OA 4M9RA 2XCLA 1Y80A 1GTZA 1RLTA 4UM9D 4TXLA 3L5KA 4JB0A 4NZYA 4GE3A 5HKKD 3V46A 5H4GA 4LOJA 3RU3A 3F3SA 4F91B 3KKQA 5IHXA 5DEIA 2XTNA 1B8OA 3W8EA 1RM4A 2YMPA 3KEFA 3X44A 2J32A 2ZAMA 4WT7A 1N0IA 4R68A 3TQCA 5AOBA 1EGHA 3SICE 4XB2A 3K1JA 3DBRA 1S8OA 3BE5A 2Z9BA 1YHNA 4KVAA 4MRSA 4YRQA 1GQ2A 2C7VA 3FOCA 3JR3A 4LZPA 4Z86A 4C0LA 3B1XA 3HXMA 4JVNA 4WZBB 1PWEA 2IH4A 1X9HA 2XCIA 2QP9X 4GMGA 5T5QA 4QUJA 1U3WA 2O0HA 1VMDA 5AM4A 4U2EA 3T9AA 1ETUA 3EZFA 2AN1A 1Z4OA 1SO8A 2CSXA 2HOQA 1R4NB 4W9RA 3P1JA 3NHKA 5HJ5A 2Q2QA 3VVBA 3IQIX 1CSEE 2BDUA 3DHEA 4LYDA 3N8IA 4TQAA 2NUTA 5THQA 2L42A 1JR4A 5ICCA 4K0KB 221PA 1GGHA 4HDSA 1RQPA 2NO6A 4JVMA 1EXDA 4Z0PA 2AJ8A 1LPAB 3KLNA 2IYTA 4PSUA 3OZSA 3KE8A 5MHTA 4IG4A 2CL6X 2MSKA 4ZCSA 1HL3A 2HLHA 2NQTA 1L8XA 1O6GA 5E1OA 5FUYA 4TUYB 4EGSA 4MPJA 4AT1A 2XF8A 2FWPA 3H5RA 1Z4IA 3CBQA 3N5CA 4LF9B 5JW6A 3OQPA 4R0MA 2X8LA 4NCIA 5FO0A 3E3LA 1BWPA 1GPNA 2QRKA 1OBVA 2Z5FA 3P0FA 4NH4A 2A5YB 2QUHA 1TYBE 1GM5A 4F38A 3H1BA 2CVZA 1EFAA 1C9JA 2NT4A 4QC2A 1AKMA 1IE3A 1QAMA 1UBGA 3PPWA 2PLRA 3UQYS 2J0UA 1RYEA 4GNKA 2GH1A 3E23A 4ND1A 3F2VA 1RC8A 2PTGA 1XDZA 1NW4A 1PR5A 2QXUA 2Q6OA 1RWXA 1LLQA 2QRNA 4FLFA 4M0EA 5A4AA 4I1PA 5KC9A 2OUKA 1E92A 3G3EA 1XNRB 5A06A 3DLHA 4JOQA 4ED9A 3BDAA 1KEKA 5KWIA 3INTA 1IRIA 5GJWC 1D2CA 1RWVA 1EIWA 4KXVA 4RHCA 1MO6A 4E32A 1PR3A 4Y2HA 4DABA 5HJEA 3B7GA 3NYQA 1DJPA 4G1CA 4QGGA 4NCXA 1MQAA 2AEFA 4H27A 4PZPA 5FA6A 2NXJA 2RI6A 1JRLA 3DBOB 4YAJA 3W4KA 4Z7NB 1H1LA 3L07A 3HU2A 1DLJA 3UB2A 1W1UA 1ORHA 5IUKC 1YDFA 5IKOA 4I4TB 2Q49A 4EKYA 1XJ0A 1RFGE 2E4AA 2P69A 4B6EA 4YRBA 1SRQA 3CJRA 1P44A 1NMXA 1LUAA 1KK2A 2HCBA 1FDVA 1R5NA 3IQDB 4QUEA 4C07A 2AFHA 3NFYA 3T95A 3R9XA 3PNQA 3H4IA 2Q6VA 2QT0A 4LVOA 4QODA 3EGVA 3JS5A 2FFHA 1R10A 3KR0A 4RYLA 3D1VA 4OPMA 4B32A 1MDBA 5JVDA 4M2LA 3V34A 4RESA 2O07A 1FMLA 2R7AA 3R5JA 1NLMA 2YV1A 4XXHA 4LWOA 1R8JA 1VIYA 3R44A 1T2DA 1C1XA 2VWPA 3FLBA 3W5SA 4MKZA 1GLVA 6Q21A 1U8AA 4WKOA 4AIIA 4RPIA 5AKGA 3TLXA 3T7IA 3LQQA 4AJ4A 4XLLA 4D5GA 1TEHA 1GGEA 4M38A 1E99A 1IJBA 3AFGA 3CGWA 3C45A 4ECAA 3N9IA 4WBNA 1OX4B 1TDJA 3OJOA 3AM1A 1AQNA 2GVZC 5T6MA 3AP3A 1R74A 5DZSA 3KZKA 3GLFA 1ZW6A 1UJ5A 4EHDA 4NESA 3ZGLA 3MTQA 1EUZA 6GPBA 1NLYA 1PT9A 1ZX1A 3A3PA 3OA0A 4WLVA 4MA4A 1C9DB 2DWPA 3KZOA 2C20A 4M0FA 4GI2A 4RKRA 1UC8A 1SUWA 2C5BA 2QQ0A 1CHDA 5JALA 2BFBA 3M3PA 4UEWA 4LISA 3NIGB 3S2GA 5KIAA 4IIJF 4OBEA 1F0PA 3RVPA 4IGKA 1XRRA 3REOA 4BNMA 2H2IA 1W30A 4J2TA 2ZZMA 4G07A 1ZNXA 3OEHA 3OOJA 3WK6A 4CLHA 5ENDA 4C22A 1NV9A 1U0BB 1LI7A 1MGOA 1OBFO 1OTXA 1T8YA 4RCVA 5E2BA 1RE0A 1FYFA 1RYHA 3QF4A 1V1RB 3QW2A 3R77A 1A4RA 4Q6BA 4ZEVA 1DPFA 4B3MB 4Y8VA 2ZUCA 3AEYA 2DTXA 3GCGA 2O0KA 5CNJA 4ZC8A 1VGQA 3BCSA 2AFIA 1KAHA 2JJYA 1VP9A 5E4TA 1EB8A 1T15A 1YB4A 1ZA1A 2ZBDA 3BWDD 3NW9A 1QOPB 4TVKA 3E4DA 4LV8B 3E2MA 3U4DA 4ARAA 5EEHA 4BNHA 5FBVB 2FW6A 2WVHA 4LNHA 1KPIA 2II6A 3DEAA 4AKSA 1L4GA 3R6GA 4BQRA 4M6WB 3RS8A 3RAEC 1W6RA 2XUDA 1FP2A 4BU1A 3GEHA 1YUBA 4JJ7A 5ILQA 2I8AA 4Q3KA 4KU4A 4RH1A 2ZROA 4E4TA 1NJ5A 2COKA 2CNWA 1V6AA 1Y4UA 3P9ZA 4YPVA 1UPUA 4UDNA 2F17A 1G5RA 1AK9A 1GTL1 2G3YA 3LT5A 5JATA 3GFVA 1DJMA 4CLDA 4OIMA 1MC5A 4MQLA 1YUMA 3FYCA 3T1OA 4CKBA 5A9SB 2C4NA 1QYRA 4J3JA 5SY4A 2ZUDA 3IKJA 1L7VC 1E32A 3PF9A 1J22A 1X1QA 1MO2A 1HF3A 5LQAA 2A2ZA 5HTOA 5KJ6A 4FZ5A 3P20A 3TIIA 4LFAB 2X0RA 2FZ4A 2GSWA 1E9BA 1W5SA 1PR2A 2HZBA 2JK1A 1N6OA 4WVFA 4MMYB 5A7HA 3RRBA 2P7IA 3SYMA 3KQLA 1F2VA 1M2NA 4Y6RA 5JASA 3KHKA 3CN7A 4JQZA 1UBCA 2C7QA 1ZVQA 4WJZA 4C7KA 2JKZA 2ADOA 3I4LA 3QFSA 5KPDA 5H80A 1FNNA 2WSBA 4WWHA 3EUAA 2YW9A 4KXLA 3W4IA 3LDUA 4CCYB 4NU6A 1KRWA 5AXAA 2VAVA 1AH2A 2IXDA 2DLDA 2ZATA 1PJZA 3B3GA 4CE6A 1JBKA 2EJTA 1LTKA 3GPDG 3NKVA 4MPTA 3DBVO 4RANA 1XHFA 3Q5DA 4DKXA 2ZSEA 2AE1A 4CM5A 3LWNA 4XUEA 5IWAB 5B1IA 1OE0A 4EH1A 2ZJZA 3O8CA 1Q17A 2WLTA 4MHTA 1Z5OA 3F98A 4DG9A 3OAAA 3JD1A 1T4CA 4KN9S 3T7SA 4HRAA 4BUZA 1Z47A 1NR7A 2XVZA 5A7GA 1ITZA 3JARA 2AFVA 3WMFA 1T6ZA 1DIOB 4PZAA 1YR9A 5E7QA 1CUJA 3QI7A 1A71A 2AW5A 3OTOB 1Y6FA 5ARCA 1NRIA 1XRSB 4G4SP 2CYCA 1SM4A 2ZZNA 4PC3A 1SKMA 5IVIA 5JAZA 4R5MA 1YO6A 2CFOA 4FSHA 4UPDA 3O92A 7AT1A 3KQUA 2RAFA 4QUDA 3SJ7A 2IX3A 2DWCA 2PX4A 4EA9A 2D59A 2HLDA 2JI4A 2Z43A 3RC2A 2R2GA 4RS4A 1NHWA 4FGWA 3TLCA 2Q3EA 4NKRA 2NO1A 4ML3A 4Q24A 3H19A 4K26A 1CY0A 1QG2A 1L6IA 2Z0MA 3K72B 1UXIA 4ZEMA 3O9VA 1O94C 5EA2A 3WHKA 1M1XB 4YRJA 4RF4A 2IDZA 5FPQA 5KSPA 2HMWA 3OJCA 4EDHA 3EC7A 1PL0A 3KUXA 1K8RA 1Y3FE 2BBTA 4LDJA 5LQCA 1WXFA 2V6IA 3GDOA 2VZLA 3WGTA 4DB2A 1WETA 4E4YA 4RORA 3IXQA 4ARVA 1WEKA 1VG8A 3GEEA 2RHGB 3PGJA 3I45A 4MGEA 3VDMA 3VU1A 4RTSA 2FJ0A 3BJEA 1MVLA 3CX7A 5CA0B 4O5OA 3DGFC 5I9TA 1ATZA 1E1QA 1VSTA 3RYFA 2EYQA 3RFVA 1F4LA 2I6SA 2GBGA 3EGEA 1WB5A 4UMDA 1K5PA 1H8ED 4CLEA 2O2DA 4DJJA 5B2ZA 2YJGA 1TJ5A 1XLTA 3PXDA 1S1MA 5GQSA 3RFFA 2GSDA 4E11A 4IJVA 1CUFA 3QE9Y 3KT6A 1MFZA 4D9JA 2XSZD 3QGMA 3PQEA 3M6AA 4P4SB 4INPA 3UIEA 4PWYA 2QAJA 4KR0A 4LQ4A 4AJNA 3EARA 5LBIA 4LHVA 3QOXA 3H8JA 4R71A 2JFWA 3A2LA 2WEKA 4KVZA 1UT5A 1L5VA 4JXXA 1CW2B 1ZM3A 4IGFA 2JJQA 1PUIA 1JJIA 1PX2A 2JGIA 2WUGA 2Q3JA 3QU2A 4G8DA 4MRPA 1ZRHA 1VJ5A 3UG6A 5JTTA 2CJPA 2LIVA 1QH8B 3R7WA 4I9GA 5MF6A 3KLPX 3Q72A 4N8SA 2FQYA 3OC0A 3V32A 1OYWA 4GYKA 4ZAWA 4BFZA 5J2TA 2QG9A 3UJ9A 2CXSA 3THXA 5K3OA 4EHAA 2NV6A 1XF1A 2EWVA 1BD3A 3IO3A 3KKKA 4M21A 1ST3A 4QXMA 1KDOA 5CH8A 1I24A 4D96A 3U3RA 1YMVA 1BCSA 1O9GA 2BV3A 1EJBA 2W2LD 5IAGA 4JI3B 3H18A 2X40A 4IMRA 1IH8A 1K3FA 2PT9A 4LY6A 3RKSA 4HX2A 4YJ3F 3WGLA 4RKFA 2BE7A 3M5PA 3QPCA 4K40A 2IUSA 4XCVA 1L7BA 5GMOA 1LNSA 3GARA 4X64B 2JA2A 2A6PA 4U7WA 4UREA 5DP1A 4BEBA 3L2OB 5CGZA 3G0CA 3NUGA 1NVAA 1JHYA 4H77A 1NVVR 2DJ5A 2LKCA 2XNSA 5D5PA 1IZ9A 4YJHA 1MQ9A 1KF0A 1AS3A 2H17A 4MQUA 5AVVA 2X8AA 2XNDD 5C5IA 1SURA 1WUKS 2W6JA 4P58A 5TDHA 3HXTA 1L3CA 2QU7A 4GM1A 4BB9A 4FDAA 4PO3X 1M9NA 1UMBA 5DP2A 1JG7A 1O6FA 2H31A 1M2JA 4S0ZA 1WVIA 4KQEA 5SV2A 3S70A 2W2TA 2W2MA 1X8XA 4MS4B 1SZPA 1O08A 2VSXA 4TTTS 4H15A 5NLLA 5FL7D 1Y3IA 2FI1A 3L6OO 2VI5A 1KS9A 2QLBA 2Z8YM 5FUVA 4R51A 4POOA 4MW7A 5FUMA 3X1XA 3IE0A 1MRNA 4YRGA 4OYRA 4XGRA 1J6UA 1ZHFA 4QU8A 3AERA 3FDFA 2HKIA 5HG0A 2GFHA 3RUCA 1W0JD 1E1LA 4LTDA 4YMVA 4G1UC 4PLZA 3CRZA 4ZK6A 5KNDD 4TKVA 4TTAA 4HWRA 2F9LA 1C1DA 1SXJD 3PDUA 3AVYA 2J3JA 1YR6A 1RWQA 1S96A 2WI8A 1GG9A 3PNVA 1Z7BA 2BRUA 4IDAA 1SZCA 4UEOA 2AN4A 3NTOA 5CIQA 5AHXA 4DAEA 2FPGA 5H83A 1TZKA 2W00A 3A6PC 2RK3A 1CJBA 1G4UR 4C4ZA 2QTVB 3SIXA 2R87A 3B12A 3PUVA 4CYMA 4BMSA 2BJWA 3EDMA 2BFBB 3G0BA 3NOOA 2FDRA 4RVGA 1EU1A 5E0OA 3VH4A 5ISMA 1J9EA 4PR0A 4DKJA 4MVXA 5IZCC 3TL3A 1PJ8A 4WN3A 3IT2A 2YWGA 4UTXA 4W7IA 2B7BA 2PBLA 3SHWA 4N40A 3TS1A 2W6QA 4H1WA 1R50A 4FSDA 5AKXA 1BW9A 3K9NA 1VJTA 3UXYA 2AHRA 1N1MA 821PA 5JZ9A 4BKMA 2C2BA 2Q4DA 3QX8A 1CIPA 2EKBA 2HJGA 3DHYA 5EQDA 4F9FA 2YZGA 2VF8A 3EK2A 3C15C 5E2AA 1KMMA 5G1PA 3VO9A 3A9UA 1BVUA 3DONA 4R84A 5KX5F 1NXTA 2AFIB 1Z6ZA 5FOTA 3X43A 5CB0A 3PDJA 2PRKA 5AKHA 5T57A 1ZD8A 1JHMA 2IOHA 3CR8A 4J2HA 3R3HA 1VCHA 2D5CA 2GK3A 1XLUA 5DYWA 3UJAA 3X1JA 1XMVA 1EE9A 3EZXA 2YWCA 1YSCA 1QC5A 4WNAB 4GM4A 5J59A 2XT6A 3GFTA 2J46A 3D4OA 4UTPA 2E21A 5FLEX 1BEUB 4C1NA 4JJZA 4DA9A 4DC0A 1T9GS 3EMVA 3KVOA 3TTTA 3T4EA 2ID8A 2FNAA 3O3OB 2QQ5A 1S8NA 1CS4C 3H11A 3IAAA 5DHFA 3JWEA 2BR3A 4AY4A 5B3JC 2Z98A 3COPA 3D6FA 5A9SA 1JAYA 1BXRB 1Q3TA 5AUNB 2P8JA 1CLUA 5TRTA 3HJUA 3LVFO 4M8NE 4X84A 4DCVA 1E8DA 3AETB 5BN1A 2GPAA 3CGGA 3I23A 1GUAA 4K9MA 4U2GA 4O1MA 4WCDA 4BNXA 1VYVA 1WKVA 2IHZA 1FDIA 2CFCA 1G42A 1QNLA 2A4KA 4PGMA 4TWAA 1UT8A 2WB2A 1UJ2A 4HH1A 5KTMA 2B1RA 4YRMA 1B15A 2WJYA 3OQIA 1OU0A 3ABZA 2PU5A 4BMYA 5KWSA 4C0KA 4O4JB 1JAZA 1LK5A 3KUDA 1CQJA 2A0FA 4JYPA 4PXYA 1KO7A 4HWGA 5CXSA 4MKIA 3GEBA 3ZDBA 4CKEA 3TTXA 1U7HA 2YIVX 1XTIA 3H6HA 5THKA 1YDHA 3CLRD 4R8LA 4ZREA 1PLKA 1QPZA 4IXWA 4P5EA 5IXSA 3BICA 5K0FA 2P9HA 1Q0LA 2XUPA 4A92A 1Z4LA 4ZMRA 3WRXC 1YRQA 3NEPX 3VSAA 1TPYA 1T2FA 2QVGA 1S7GA 3CZRA 1QZUA 4AJLA 2LCIA 3EDOA 4XWYA 4LBYA 1KVTA 1QU3A 3KM0A 1IY1A 2EXXA 4YB8A 1RXEA 3LC7O 2OP0A 2DHEA 1YZGA 2VXCA 2PR2A 3JPYA 4BJHB 4EAQA 3QEOA 4M54A 3OIGA 5CFQA 5JPDA 3K0FB 4JLKA 3DOUA 3JQDA 5FFNA 4DCMA 1E3EA 2FHSA 1E5VA 3H5AA 2DF8A 3M5WA 1N3YA 3H9EO 4JP8A 1ML4A 1EUDA 1V5IA 1P4SA 3RRYA 3FCXA 4RQTA 1YBFA 1GLGA 4MJ7A 2C57A 4Q15A 2QRZA 1YGYA 3RK0A 3WHPA 5BNTA 2CLKB 1U7OA 3LBFA 4L5AA 4LX0A 1CUIA 1AN0A 1G3IA 4GPEA 4RNDB 5T8KA 4QYIB 5TS2A 3HUUA 1JHQA 3EGXA 2E4UA 1QVVA 2ZRBA 1FRQA 1XZKA 2QRGA 3RT9A 3RB8A 4F3KA 3HP4A 4OHFA 2A92A 4U6QA 3QBDA 1P6QA 5IYZF 4B2IA 3AI1A 1E5QA 4OQFA 1D6MA 1NBWB 3D6JA 5FLYA 5LBTA 1OFGA 1UT6A 2VNHA 3NDPA 3U9TA 4BLUA 1UQTA 3L6RA 3RHSA 4UBMA 3D7NA 3OQVA 4BMXA 8OHMA 1B4DA 1F2DA 3E5HA 1JT9A 1BDBA 1Z6XA 1KO5A 1ZIXA 1PO7A 4FFLA 1PEDA 1SA0A 4N48A 3OTHA 3NOQA 2D2VA 2PCLA 3MWKA 1F7UA 5IAJA 3FWHA 3RR2A 5FFMA 2Z2JA 2IGBA 1PWXA 1E2UA 4Z9FA 4HB0A 4KPUA 3D3KA 3SR0A 2YN2A 3UK6A 1XE3A 1WX1A 2LNDA 2WM3A 4R6WA 4Z3DA 3ABSB 2BFCA 1IWPB 2NNWB 3DE0X 4O02B 1YA6A 3A27A 3COSA 1ZO8A 2V0CA 3F5MA 5B57C 1CJMA 3CPJB 3T35A 3AR6A 2JHAA 3UMGA 2JEOA 3HVRA 3TDNA 3EDYA 4IFTA 4X7MA 3SHQA 2ZYTX 3ADDA 3PQDA 1YZ3A 3U49A 3GEMA 5A5GA 4MIYA 3RHTA 1RPTA 2WIFA 1CR0A 3CLUD 3U3DA 3DM9B 5JNUA 1Y7PA 2V97A 1QQ5A 3WYFA 3KSBC 1B93A 1DJLA 3R0JA 4KODA 1IQRA 2QY9A 4OQYA 3TRKA 1EBUA 2MDTA 4H17A 5HFNA 3ZXYA 3K7EA 2F3PA 2XWPA 4UUOA 1ZL0A 4YJDA 4EY6A 3PC2A 4TV9B 2DVMA 2G1KA 1M34B 5G0WA 2HA0A 4A9AA 4RM2A 4WXMA 3AFHA 3CA8A 1GTRA 1GV1A 3OC6A 2IU3A 2R1TB 4JVOA 4UASA 3K8YA 1U8EA 4LJ9A 1GYRA 1J0BA 4DLKA 4RO0A 5HK9A 2P2NA 1LBTA 4WKNA 1D09A 2E5WA 5LYYA 1LB1B 2FPOA 1C3JA 1D6NA 1EG7A 3WNVA 2R00A 1QDUA 4E21A 5CAEA 1NVVQ 3AVPA 2JD0A 1AE1A 4ZJYA 4RH3A 3CUWA 4EM6A 2H4FA 1A69A 4MQFA 5GVRA 4C2AA 5B64A 1LEHA 5J63A 3C8UA 5BW5A 5DIFA 2XKAA 2OMKA 2YWXA 1Q22A 3A6EA 1SH7A 3L04A 4NR0A 4HNAB 3UMBA 2CLOB 2PFSA 5IFLA 3OZ7A 3ZCTA 3OX4A 4I08A 2G6BA 5CEJA 1JVNA 1SUCA 1G7SA 3F8WA 1A9RA 1PZXA 3VKGA 1EPUA 5BUCA 1L7NA 1Z7EA 3A1EA 3HQ4O 4EPRA 3DJYA 3E6AA 4MYTA 2ZW9A 3K0HA 4AWAA 2DR2A 5TVGA 4BFWA 1E96A 1MJGM 1XKTA 1MW9X 4K6CA 1T3ZA 3A11A 4PYRA 3RGGA 3ZWKA 4EWLA 4RTOA 1J2RA 3ES9A 1RXVA 1TPZA 4OJKA 4GOXA 1MJGA 4DA8A 2C2YA 5GONF 1MXFA 2HY7A 4NE7A 5BR8B 1F0NA 3FHCB 1WDLA 4FQ5A 4IOLA 2XAAA 1FP4A 3ZDXB 4DQ0A 2ZRJA 1DKQA 3X1MA 3EZ2A 3O47A 3PE6A 2ZBQA 4P54A 2FEMA 4O6VA 2Q9BA 4QQFA 3SC3A 2C2ZA 3BMOB 3SG0A 1PZGA 2H52A 4FNOA 5AW0A 5JVDF 1AV7A 3HA2A 2P65A 1R0YA 1UM9B 3KAKA 3QW4B 2YCLA 3E05A 4R9UC 4YT5A 4A2WA 4ESEA 1GOTA 3L93A 2BI7A 1HORA 3U56A 1SUBA 1M2VA 4OP1A 3C3PA 3NBMA 4JJKA 4BEWA 2IBSA 1EWQA 1RLOA 1LLFA 1NFQA 5ITZA 2X86A 4YECA 3WQRA 2CNBA 2O7RA 2LDXA 3DNFA 3DWFA 3LPNA 3U3KA 1JSCA 4GGPA 1CUZA 4TL6A 5ALNA 4D41A 1U6KA 1VSUA 3VYVA 3DCYA 3V8NA 2JLCA 3MJVA 4DA6A 4HS9A 2GWHA 3LYHA 5BSMA 3HJFA 2LV8A 5CA1F 1R00A 5BNIA 4BDSA 3F47A 3R3SA 2IF2A 5M34A 3FYHA 5JJKA 1W2WB 1IZ8A 3QKTA 2OHOA 4JB2A 3DV2A 3T52A 1NR1A 1B7GO 4MDYA 5I4BA 3E9EA 4DM4A 2PGLA 3NALA 1XRNA 4XJSA 4A23A 1OX4A 2EG5A 2JAOA 4XPIB 3E35A 3PVCA 4GX1A 5KAPA 2R5FA 4EPTA 2PUDA 2OBXA 3KV1A 3DKIA 4J90A 3L8FA 1AQ6A 4LG1A 3T1YB 4NXMB 2C59A 4ZYTA 1P2FA 3AF6A 2XJ9A 4L4YA 4DV1B 3UAVA 2FWJA 5FHRA 3KAPA 3H9GA 4RHUA 3X0DA 4GQBA 1FS4A 2OC4A 3QWFA 2PKWA 3H2YA 3C87A 1SQ6A 3HB7A 4MP3A 4U2BA 1KK1A 4C06A 4CRWB 1AB5A 4V0RA 2DQKA 4D8YA 1GU1A 4DLPA 1QCCA 1U2RA 2ZU6A 1X1CA 3WGMA 1F2TA 1ZICA 2GO1A 3AHFA 1IVYA 2GD6A 5HPYB 3LCVB 2C3PA 2W2NA 1BDMA 3SIRA 4ZVNA 2HA3A 1U1CA 5KAMA 4AP6A 4JV5B 2HPHA 1TCUA 5EG5A 4C5CA 3KHTA 5HUQA 3TCXB 1FLAA 1G20A 1NQXA 4ZARA 1AQLA 1IATA 4MXDA 3Q7QA 5K8LA 2WYVA 2I1QA 5ESWA 4CKEB 4ZYVA 1DHTA 1KIFA 3I2FA 4IQ4A 1A98A 3ILYA 2CZGA 1VE3A 1E79D 1JKJA 1MAVA 1RU3A 2AWNA 1M2KA 3Q3JB 4GRAA 4H6WA 4BO6A 1N7IA 1PGNA 1HQDA 1A0OA 1E2HA 1XTQA 2QX7A 1S2OA 3A4LA 3PXBA 4EPYA 3GLRA 4HVTA 4DBVO 4NK4A 2JGNA 2GK7A 3PUHA 3UW1A 1XEAA 5F4ZA 1TTTA 3UB3A 2QUIA 3G5UA 3F6BX 4PRLA 3WYBA 1RC1A 1UKBA 1QIIA 1PE0A 3GFGA 4OLHA 4TL8A 1LQUA 4N5IX 3HUEA 1UXJA 1I7LA 2DRIA 3H42B 3DQPA 4WN9B 4HNTA 2ZI4A 1JEDA 2QNIA 3F3KA 4CQLA 3HXPA 4JJ8A 5K99A 5JNSA 1I2MA 1K4MA 4RACA 4WBXC 5HF6A 3CEHA 3VPBA 1X19A 2I65A 1PD0A 2IELA 1HDZA 2R85A 2WV9A 2PTHA 4HLUA 2C88A 1GNLA 2J09A 4PCAA 2QVXX 3UGKA 3EGXB 1Y5NA 1Z82A 2OK7A 3FY4A 3K6JA 4B3JA 1E1KA 2C3UA 5AJVB 4DSOA 5M7EA 1L5LA 3JQRA 3TH5A 3K1AA 4M8KA 4O3MA 3GA0A 1BVHA 3GRCA 2ODBA 1KQFA 1GG2A 2IPLA 1ZH8A 2ODWA 3VC2A 4P81A 4BLTA 4DBZA 3UA3A 1XMPA 4RIIA 4DWWA 2AL7A 3P2YA 4O33A 3V3KA 2JNWA 2WDPA 1JWLA 4CEJA 3I92A 4RZQA 3FFWA 3ZDDA 3GLVA 1J8FA 5LC1A 3U3ZA 4G56A 1I51A 3I9V1 4DB4A 4NYJQ 4JLNA 1UWCA 1WVGA 3SSOA 4UE2A 2Q5JA 3F1LA 1F9AA 3TQSA 4K6HA 4CR8A 1N36B 4A36A 3MRTA 2DGDA 2EBWA 1QRDA 4BP8A 3L0OA 3AHIA 4OI1A 3IEVA 2R6R1 1W75A 3I5XA 1CUUA 1WB4A 2IYPA 3GFSA 2D3WA 3O21A 4R69A 1U2EA 1THMA 3T9BA 1HPLA 2F3SA 4KWIA 5EIBD 1YMUA 1YVEI 4LJ8A 5ECGC 5JBIA 1B43A 1VGVA 3P2OA 2RG1A 1CWUA 1L4LA 2X0IA 3K5IA 3T9DA 3WKEA 3CVVA 3UAYA 2WTBA 2NT3A 2W83A 3B2QA 3ZK9A 3DE5X 2VN8A 4D99A 4RDXA 5KZMB 1DT3A 1EFUA 4ENTA 2CFTA 3UC5A 3WBBA 4PONA 2O7QA 2B6HA 4C76A 1CVRA 1E58A 1XZGA 3CUEF 4R40A 3TTVA 3SC6A 3L3BA 3LFUA 2YMMA 3R0VA 1G2OA 4EHNA 3ROFA 2QJFA 4LV5B 4QJBA 1F7VA 4M1ZA 2PSHA 3JYQA 1NLZA 5JT1A 4GR9A 4IZ6A 5JARA 1IZ0A 2XUKA 2I66A 1FU4A 2LCQA 4HQOA 1FTGA 3QTBA 2OVBA 4LDNA 4QYWA 3ZU3A 2UUBB 4WA7A 4ZTZB 1YDWA 2O5VA 3A6DA 5JXWA 2HF8A 1NXVA 1SXIA 3PC7A 5ALYA 1IUPA 3ZWAA 2PYZA 3ODPA 2C7BA 3WTCA 3I2KA 3A32A 5TXGA 1D6JA 3EBOA 4XA8A 2BI4A 4RD0A 5DBEX 4BGUA 4DG5A 4H1HA 3FMVA 1PQUA 2GETA 1NVDA 1OAAA 2OEPA 3IVAA 1WNTA 3QLVA 1QZ3A 2VTEA 1SCQA 4MQ4A 1XLVA 1F0YA 4FYXA 4FZVA 4FOPA 3TMAA 3UHJA 4JZYA 1Y37A 2JH3A 1AA9A 1T9CA 1TKBA 2WAOA 4MYSA 4NOKA 1B76A 1YZKA 1CY6A 4GBED 3U39A 3DAPA 4JCOA 5IC4A 2R5NA 2RGCA 1UPCA 1DC4A 3P9PA 4MUYA 2MWMA 1Y1QA 1EXWA 3C5WP 1T2VA 4IM7A 3PC4A 1F8GA 1J20A 1NUHA 2NPOA 2YJNA 3BYZA 4W1SA 4ZKEA 3WISA 3IMGA 1ZPDA 2J0UB 2W8ZA 3K70D 2QL6A 4PX5A 2ZXUA 3FRIA 1RQ7A 1I33A 1RCUA 3EN0A 1KTIA 1UEJA 3G8AA 3KOMA 3DCNA 3TLKA 3V5NA 2NO5A 4FMPA 3QENA 5HEKA 1OI4A 2HM7A 5C34B 3ZCSA 4C43A 1H93A 3FSJX 2QTVA 3VYUB 4DLYA 3UENA 4IJ6A 4DLLA 3IRVA 2WFMA 3W7VA 2I6GA 1ESDA 1PRYA 5DX1A 5C1DA 3ZVLA 4HXYA 3IGFA 5CFLA 3PITA 1F38A 3GGJA 4QA9A 2K2WA 2XQIA 3CU5A 3LQRA 4MICA 1XEFA 3B7WA 5DHAA 3RYHB 4Z4FA 4YJ3B 2GCEA 3HO8A 5IJ0B 2UZ4A 9GPBA 3QYFA 1JG3A 1YT5A 3WMWA 5I45A 3OUUA 3QUSA 2CT8A 3GDFA 3DUWA 5GZ1A 5H68A 2JBAB 1N2CE 4TQUS 4TXMA 3ZLTA 3GLSA 4N0DA 3VPCA 2IYXA 5DHTA 4DJEC 4X65B 2W6MA 1V3QE 4KPYA 4F11A 5CDHA 5IJ9A 2QOEA 5IEBA 3D5EA 3MCVA 4NBWA 3DPUA 2B5VA 2IC5A 4DWVA 4LK2A 3B70A 3HDYA 3BX1A 1SG0A 2BF4A 3M4ZA 1E0DA 3NTVA 4I7EA 4M7RA 3T06B 5BUZA 1GL6A 2OV4A 1OI2A 1S2DA 1JYEA 1U2TA 4WEOA 3U9SA 1V2GA 1V47A 3H5VA 1PX0A 3KD2A 3EBLA 2IUEA 3OEYA 1OLUB 3TZQA 1LK0A 4CCAA 3GLGE 2BGWA 4RE6A 1T1RA 2QMHA 4KO2S 3PJRA 3LUJA 1CRZA 3NWPA 5FTNA 1D4OA 3OQBA 4ZN6A 2CF5A 1URPA 2YX1A 1ZH2A 3A4MA 1VL2A 2IZ7A 2DFNA 4G4GA 2HREA 3C3AA 5IP5A 4JKIA 1JFLA 4BFVA 1Y5LA 2QEQA 1L7EA 3H83A 3HUDA 4O2AB 3V7UA 1Z18A 1NZDA 3LA8A 4JX8A 3ZJYA 3L02A 2Q1YA 5K0LA 1D2EA 3A1WA 2QE7D 4U7PB 5HQJA 1SCUA 4M1WA 3QXSA 4DXAA 3HB9A 4B3XA 2JD2A 5JO9A 3HDTA 2CFIA 3Q7EA 2PGJA 4YQEA 1KE2A 4KE7A 2JDIA 1KC1A 4OXNA 1I7DA 1KRHA 4YWHA 4L8GA 2X6QA 2JJ2A 3ANLA 2J3LA 2P0EA 4MWGA 4BC1A 1N25A 1Q7TA 3SQDA 3CF6R 3T7CA 4BRWA 2H06A 4INAA 4DEYA 5DGCA 3DDZX 1BIFA 2HPVA 2C31A 1KSGA 2GF2A 3UOAB 4ZDKA 4HMQA 5KX5A 4FBGA 3RYHA 5CPBA 1CDDA 3IVCA 1QOZA 4TN5A 2HEGA 3R76A 3FG9A 4YMGA 2RHHA 2PX8A 3K0CC 2IIPA 3MZ0A 3UGTA 5F52A 4G0UA 1D7OA 2QVYX 3D54D 1JKFA 5FA5A 3SYRA 4U0JA 3CNQS 3DC7A 1C4WA 3BXFA 3TD2A 1TMOA 3F90A 4E7PA 3E84A 1XCGB 2UKDA 3O84A 3ZHOA 4IJ5A 3CYFA 1Z5VA 2WJIA 4RLQA 1Y6GA 2O5EA 5B3JA 3LCMA 2QM8A 2EIHA 3QVMA 5H0IA 3K9CA 2GN4A 1U3CA 3TFQA 1C9NA 1QGUA 2YFHA 1V43A 4O4IF 5JZBA 1NNSA 4HPXB 3WLTA 2XOEA 2DKOA 3E9YA 3H1EA 4W5WA 4B84A 4BQOA 5KTRA 1PSZA 4FWBA 4LC1A 4H3VA 4RVDA 3I5AA 1YJCA 1J97A 1QLWA 1ZGHA 3KS9A 3MTAA 3QE2A 2JLYA 2D1YA 5EYPB 1YJ8A 5CYOA 3ZH2A 5B3KA 4NAVA 1DAOA 4HN9A 3SQNA 1Y8CA 1T91A 4WDQA 1DOHA 2YIJA 1MABB 2AF4C 3DHVA 3L8GA 4CDGA 1LJ8A 4CVNA 1RAAA 1NVEA 2WAMA 3ENNA 2HEIA 5M29A 3TDKA 1H85A 3S2EA 1GCGA 4Z49A 3RARA 1GG5A 1PL6A 2IHVA 3TUIC 4ZYLA 2ZSJA 2VP0A 1NZFA 4WCVA 1VECA 1AZWA 1VZ2A 3ND8A 5GPBA 3EQ9A 4JUIA 2B69A 2HRQA 4JJGA 4P3NA 2D8MA 5DNDA 2RHOA 2PGDA 4OFXA 2HQ1A 3Q40A 2P35A 2GM9A 3H9UA 4IV0A 5D85A 2ZI6A 1IEQA 3UMRA 3ESQA 2NVBA 1IONA 4F6LA 2PO5A 2HFJA 1YFKA 3DAOA 5LQSA 1N0VC 3U7GA 3L7MA 2P9BA 5F7ZA 1R6DA 5CURA 3H9BA 3QE3A 1KK3A 3AZPA 5GJBA 5EMJA 1U9ZA 4HC4A 2VXYA 1POWA 1R3DA 2E37A 3BD8A 3E22A 4PTZA 4TYPA 3G5AA 4ZVPA 4JT4A 3U7JA 4G5XA 4EDFA 1BTOA 4BKQA 4EA7A 1GTG1 1GZDA 4IQGA 3PL5A 1M1ZA 3NGXA 4BO8A 1QF6A 1O9HA 1FMCA 1HZJA 2NVOA 2SICE 4HDOB 4KDFA 4OMUA 4TS1A 2HXGA 4AZVA 5H82A 1JHZA 2NVWA 4OTZA 2M9MA 1GNTA 3DVLA 4QPPA 5K9ZA 2JFNA 5B1EA 2GZ2A 3M1AA 5KSYA 1QGAA 2D2XA 2GILA 1R2QA 2ZIWB 2RI0A 4I8XA 2WQZA 3BFXA 2A5GA 2G1AA 3ONWA 4UTVA 3C74A 2W2KA 2GYWA 2XB2A 1TYZA 5B7PA 4II7A 1EFVB 2GRAA 1KL7A 4I36A 5CFMA 3ADCA 4XKJA 4YYEA 3NETA 3EPJA 1KAEA 4P6VF 3RNLA 4QSHA 1GNVA 1WPXA 1GTJ1 2FLWA 1XCMA 3JD3A 1V6SA 3IHKA 5DTEA 1R15A 3OZRA 5B1SA 1MHTA 1XA3A 4YLGA 2FEPA 2PVCA 4GRIA 4OXIA 2I2WA 3H1TA 4RTRA 2FPPB 3LVQE 2FG7C 2O3UA 5CH5A 4EUFA 4X1OA 2EJUA 3HA5A 3Q7IA 2NO0A 3T8YA 5FPYA 1IHOA 3OEHD 5FD8A 4LOKA 1CUBA 2VC2B 4DEXA 3D59A 2QNBA 4NZOA 2OHJA 3H04A 3P94A 4RKWA 4UBJA 1NVUQ 2WY2D 4J0QA 3L6EA 2WU0A 2IV7A 2RJOA 4H3KB 4IOKA 5CDFA 4ETIA 5A5FA 4Q9AA 1Y63A 3UYLA 3VRHA 2JFQA 3PFGA 1HYBA 1R6TA 3LPLA 3D6HA 4GOOD 1YZQA 1MNAA 3AL2A 1E2EA 1NDHA 1LX6A 2NXNA 1JMYA 1LFDB 1MO5A 4MWOA 1E3WA 5AKZA 3O8BA 4L4XA 5F2KA 4XEHA 3V1LA 1Q7BA 3MBKA 1GARA 1VGRA 4C7VA 2CW5A 3RE1A 2A8YA 4X90A 4GX0A 3M4YA 3E2PA 4MZXA 2OBLA 4TLCA 1JDJA 1YA8A 1DC7A 2I78A 4HXGA 3QITA 2C5FA 5ED0A 2XWJI 5EKXA 2DPYA 3KQYA 3SZ3A 2V7XA 1Z07A 4GMDA 4JFAA 5FQNA 2P1DA 2X9LA 2EOAA 5EFZA 1I10A 1VBFA 3EUEA 2EW2A 4JBHA 4RVSA 1Q74A 1NYTA 1QYVA 5BV8A 5KPJA 2GNOA 3L7LA 3JVDA 3DHNA 3LJKA 1CD5A 3OQMA 1U7XA 5E0KB 2PGXA 2VNIA 2YV3A 4IJQA 2HR1A 1M8FA 4EW2A 1EGQA 2WMDA 5GADl 1ARZA 1JBEA 2VSFA 1M8GA 1RRFA 3FPHA 3VUEA 1IDN1 4ANFA 3OZCA 4D0NA 1NJ6A 2FPSA 4NNPA 3VPHA 2XMDA 1X3LA 2Q1WA 3H65A 1X14A 2IBMA 4RZIA 3DD5A 1L7PA 1YL6A 2VHEA 1KZ4A 5DN6A 5JCJD 3I52A 4PGAA 1EZ1A 4FDUA 2JIMA 1GL9B 3IBSA 3IKVA 1HXHA 3DMTA 4MUJA 5BMVF 1T5IA 2BGNA 2BGLA 3ORQA 1EJ0A 2ZYIA 3M70A 2JFBA 1OKKD 1W76A 4IDFA 4MW0A 4NHOA 4EUHA 4KN6A 2R9VA 1EVKA 4KSCA 2OV2A 3VZPA 5DNCA 1BMDA 2TECE 3EEQA 4Y7CA 1LJLA 2BYTA 1XQ1A 3FLEA 3FD8A 1W94A 4KO1S 3ZS9A 5LL6P 4FKBA 2J3IA 3JYLA 2BHNA 3DZ8A 4LXGA 3AUXA 4TKVB 2G1PA 3KJIA 4BE7B 1UXHA 3RYTC 3KSMA 3VR2A 5TJHA 3BE4A 1PKXA 1Y33E 3OWXA 3VO1A 3UT5A 2VQEB 1RC0A 4C03A 5LIRA 4AUNA 3FWPA 2ZRKA 4L8LA 4OBBA 5KJFA 3BPSA 5LM3A 1YFJA 1PP4A 1X8LA 2NU7A 1Z0IA 4EK9A 1A9XB 1NRWA 2O8CA 1KI8A 2WWTA 1M6NA 4CI9A 3KETA 1X2BA 1GU7A 1QE0A 3V7NA 4AZTA 2YV4A 1EIZA 2MJLA 3BRWA 4IOJA 1A95A 4DYDA 1M2EA 4HOYA 5IVDA 2ZUSA 4EMSA 3ZD7A 1NW3A 1ZXXA 5C8ZA 4JU9A 2BEVB 3G59A 5FPPA 4ZVMA 2CVOA 3GLHA 4O2AF 3FHOA 2EIXA 3DA8A 3NYIA 1FUUA 2FPLA 2I2DA 4UUPA 4G84A 4ZQIA 3STXA 3FFTA 2C7OA 1CZLA 3MF4A 1O89A 3SZLA 5J2UA 1E5XA 2H6EA 4ENVA 1ODLA 2ZRHA 5DOZA 1YR1A 4TSFA 1FPQA 2KYRA 4XLZA 3QA3E 4B6QA 1C29B 2Q8PA 4IAOA 2IYNA 3DAGA 2I2XB 1Y7LA 2CFRA 3QQPA 1HX7A 3JQ7A 3B1WA 3LY7A 4KW7A 3RVOA 1U8UA 2MR5A 3L8YA 5CCXA 2CDNA 1ZD1A 2OZLB 5CVDA 1DZIA 1HEIA 1A7JA 1L5ZA 3S0JA 3U80A 2IHYA 4U4AA 2ZBGA 4EUNA 4O2BA 5A9TA 1F0KA 2J0SA 2O05A 2W2QA 2OXEA 1Y9JA 3L0IB 1J70A 3I9V6 2SKCA 3CPEA 1KY5A 3FZGA 3ZDYB 2WF7A 1GPUA 1W93A 3K92A 4M4SA 1QUFA 3DOFA 3WLFA 1AGYA 4B79A 3E4CA 2FP4B 3ENQA 1YFLA 1PL8A 2F3RA 4HNVA 1NV8A 2HCRA 4TSRA 5LOVA 1KBZA 1CUXA 1Z7YA 3C2QA 5EP4A 3BA1A 5TB5A 4JI0B 1V9LA 4NJOA 4JUFA 3LF2A 2PY6A 3ZJTA 4UHJA 1JXAA 1XMQB 5CX1A 1PTKA 4Q7QA 2HF2A 1NW9B 1V3TA 2GPWA 3N3AC 1QIHA 1DXYA 1GFIA 2HSWA 3HV2A 4D81A 4DSAA 4U5QA 3U13A 3LC1O 4BNIA 2BEJA 4D0SA 4G01B 3UUEA 5FHQA 1HOTA 1FTYA 1GSIA 4C3VA 3C8HA 4PZCA 4FIZA 3T5GA 2GERA 3VJKA 1M8PA 3OWOA 4MRMA 4E5UA 2BFEB 3FHLA 5AXDA 4WK0B 3K4HA 3PRKE 3VR6A 2JI8A 3C1AA 5DGHA 2G1UA 2Z30A 2QAIA 2WD7A 3DMYA 4JL6A 1DIBA 2P3QA 1C3OA 2R6GA 5CLHA 1S5PA 2BTOA 4RPGA 2PSJA 5JJLA 1ST2A 3EULA 3DDNA 4XD7D 1KOLA 2ECPA 3FMGA 3GELA 3ZHSA 2PBZA 2YVUA 1L7MA 2ZUFA 5LA6F 4PLTA 3GFPA 3HGMA 2O1EA 3L1VA 4QOIA 5ITVA 2DUUA 3ZVNA 1IL0A 1C0EA 3KZ1E 4Y6OA 5EE1A 1UH5A 4ZD6A 3RK1A 4RPJA 4HTFA 1LWNA 3T4PA 1IG0A 1G3RA 1JXQA 1OILA 4PZYA 1NUQA 1XKLA 4N12A 1N6NA 3HDJA 3LVBA 5I8WA 1LVGA 2BFCB 2DWOA 1CQXA 1VHJA 2UYOA 3DLIA 1LW6E 1RRCA 4I4NA 4DIMA 3GRZA 1W8IA 4KLCA 1EXNA 2YNMD 4UFNA 3I58A 2WHYA 4JBLA 3DTVD 2VT3A 2GN8A 4CETA 3IIMA 5P21A 3RABA 4E15A 2UZIR 2Y76A 4FHZA 4JYZA 1ZGGA 4MULA 1F5NA 1ZZGA 2ENWA 2J6HA 3VUFA 3DB1A 5AI8A 4D4KA 1ZR4A 5FV4A 2OKCA 2QR3A 4R1MA 2MTBA 2CHUA 4MCJA 5DHPA 4COKA 2FMTA 2BP7A 4WAUA 2QL7A 4RC9A 3WGVA 5LUAA 1JI0A 5TIIA 1Z74A 3I72A 4ID3A 1QWOA 2A9JA 2ZJBA 1CDOA 3GXBA 3CZPA 5JADA 2ZIVB 2FHPA 1HYEA 5ICMA 3HVHA 2PUVA 1QO9A 1SR8A 3FWNA 1CKEA 1E9AA 1JF8A 1LSOA 1U4OA 2LW7A 3G23A 4BAUA 3IAS1 3WL6A 2GVNA 2R1TA 3ZU6A 3IBCA 5DF1A 4IL5A 4MJXA 1WZIA 1E7WA 4H0FA 1ZKMA 2OBYA 3GN1A 2C95A 2BKXA 2F9FA 5K8CA 3JQ9A 3E8XA 1LBHA 4MS4A 2R7KA 2AXPA 3KZNA 4LV6A 3MC1A 5I3CA 3QVWA 4IDDA 5CVTA 3EOBI 3SHTA 3NVAA 1SOVA 4KACA 3RRMA 2RD2A 1MAUA 1X38A 2X9VA 3E3MA 4I6JA 4E5PA 1LPPA 3N0XA 3OU2A 3C7DB 3NWOA 1P18A 2VTKA 1JTEA 4Q4JA 3FDIA 4QOFA 1QVRA 3JQAD 1DIGA 4EKDA 4WBNB 2XITA 3H5TA 3LIPA 4V39A 3B2NA 3MINB 1CEXA 2NZYA 3G85A 1JR3D 2AE2A 2G04A 3BEDA 1EDOA 5LPNA 4IO1A 2WAAA 4O63O 3QF7A 1EFDN 2RBKA 1HFJA 1YV9A 1JLLA 4DJAA 5EFOA 1D2MA 3L8ZA 4MRVA 5BT9A 1XQ9A 4XIYA 5EWLA 1FC0A 1APBA 1IHXA 2NYAA 3R6LA 4OQLA 4BU0A 3AVOA 2ZT8A 5F3DA 2B78A 4BHTA 3T9FA 4HQNA 2ODNA 2ROQA 1Y98A 1A9TA 1QVWA 5LBUA 4ESHA 4A8HA 4XYLA 3KZCA 2H5IA 3LQ4A 3DXZA 1ZAYA 2FG5A 2EYUA 3ROEA 4QG3A 1UJMA 4F2HA 2C77A 4OHYA 1BHJA 1N2CA 1YWGO 4UZEA 1NVXQ 3D6UA 4C7OA 1UPFA 2EKDA 4LGCA 4Y9DA 1DAPA 1E63A 2YH2A 2QTZA 4H7EA 3EVTA 2WA1A 4S35A 4PLPA 2V3WA 4E08A 2ZUBA 4XRGA 2VP5A 1UKZA 2R8RA 4J7AA 2V9CA 1P2BA 4G0NA 4PBTA 1RW4A 4CU5A 3E3OA 3MT7A 2OYRA 3S99A 1JTVA 4RABA 3TR0A 3OU6A 4QOEA 4W7SA 3KHUA 5GV7A 3TOVA 3OHPA 2PD3A 4O8ZA 2R6JA 2AFIE 2YOFA 2PG3A 4ZEOA 2J5BA 3KU4A 1FS6A 4JBXA 4C7BA 2IITA 3X2EA 4V1CA 1Q44A 4L5BA 4J7UA 2G25A 3AJDA 4P8RA 1RFLA 4R16A 4WZBE 1AIPA 3K09C 1SXHA 1O87A 3M2PA 4UD2A 4A6DA 2FRVA 2Q4BA 1B42A 4URXR 2O8FB 4E5MA 4OG2A 4QTYA 1Z68A 3G9UA 4FN4A 1VKJA 4KUGA 4PCVA 5REQB 1SKBA 1L5GB 4BMZA 3IL2A 1TK9A 3OPYA 2DX7A 3P2KA 4K9OA 4BNUA 2M1XA 1JFRA 2YQ4A 1RLJA 4WXPA 3WLAA 3FYSA 2DEUA 1U04A 5HCNA 5U4QA 5KDOA 3VU9A 5CIYA 1BXGA 1J8YF 3PEWA 1Q7RA 4MCAA 5ES4B 5HOEA 4QYSA 4E7OA 2ABWA 4DHEA 4D56A 5B1HA 5DTQA 3R41A 3LZ6A 3O9MA 1SQ5A 5CVJA 4II3A 4N3GA 3QVOA 2QN3A 2CV1A 4RF5A 4YMLA 3ZZTA 1V16A 3G2IA 3KK0A 3HBMA 4IVNA 2VDKB 3AG6A 3K35A 3D8NA 2FN9A 2K2QB 4YROA 3H1GA 4DZRA 1BW9B 2HDHA 1EMDA 2GTIA 2JBHA 2WG1A 4E46A 5JD6A 4GYYA 4RTJA 1UADA 1X7XA 1JJBA 2B82A 2I4OA 1DEXA 3RRJA 4DLSA 3RS7A 4P0PB 3VPXA 2VRCA 1G20B 4HI0E 3DYBA 4NYIQ 5ITZB 2NZXA 2V3VA 3JXEA 1WMSA 2PS1A 2ZRMA 5G1OA 2IFTA 2A9FA 4IS3A 4V2IA 3QEMB 5C7LO 2V03A 5KKCA 1TVEA 3R23A 2CC2A 4IDEA 4PQRA 2BD0A 2WOJA 1IQ0A 1TUIA 3NCHA 3HUTA 4H31A 5KQRA 2X5NA 1I4WA 3CRW1 1UC5B 1V96A 3PLRA 3OPXA 3NHUA 1CQIA 4F06A 3FI9A 2QZJA 3D3WB 3C6ZA 5ADUS 1FU8A 4NENB 4DQKA 5JY1A 4GQIA 4BB5A 2C04A 1R8SA 5HCUA 1EP2B 3MG9A 4M1SA 5JLJA 1HUQA 2YY5A 3CSSA 1RYYA 1Y9ZA 5DPMA 4AROA 1ID8A 1UR5A 5HX7A 3NU1A 3O5AA 3AY7A 2ODQA 4QTTB 4C7JA 2Q99A 1ADGA 3EPPA 5C8VA 4DA4A 2EBHX 1MT0A 2V7QA 4N0QA 4NEQA 3CEPB 5E6UA 4DDTA 2X1VA 4RELA 4MUNA 3DOJA 2X0FA 5FCDA 5LXTA 3CVUA 1QHYA 4PO1A 4U2CA 4C7MA 4F3YA 3GH3A 3F6PA 5FI1B 1R4NA 1T1EA 2UYYA 2IYAA 2JCXA 1KGSA 4QYIA 2NUBA 1VL5A 2CUTA 3P52A 2PS3A 2HJ9A 3PFKA 4D9HA 1G4HA 4MWTA 1FSGA 1ZYUA 4UM8B 2YUIA 1Q5PA 2VIIA 3PCXA 5K05A 1K8XB 3OP4A 3BHMA 4MO9A 4XUDA 1EXVA 1H1TA 3MUEA 1F4VA 4EFNA 1JEJA 4CR6A 1UK8A 1JILA 3NR2A 1IFXA 1KYVA 1UWLA 4JA0A 4JR1A 4MTLA 3HADA 4OI4A 3BAZA 3FXAA 4TMZA 2DBZA 1OCEA 3HE3A 5JEDA 3MNFA 3HCPA 4R1OA 4JDUA 5JNRA 4TTIA 3U3OA 4ZDIA 5L3ZA 4G37A 4PZEA 4DR1B 1JR2A 3K4QA 2E49A 3E0XA 1JHPA 1Y1KE 3CW2A 1D9XA 1GVNB 1VIAA 1BS2A 2Z83A 4BNVA 5K8UA 3BKWA 4O2LA 1XZQA 4A91A 4CMAA 3VNQA 3RFCA 2XUZA 3U62A 1TD9A 2AHOA 4PO9A 4WEQA 4X6XA 5E7JA 4OYHA 2O4UX 4EPWA 2G7ZA 3B6JA 4G0PA 1HNNA 4JGBA 4WECA 3V8QA 421PA 5AR1A 2OO3A 3WMXA 2IWRA 5J2TB 1SD1A 4JGGA 4M1OA 4R3NA 5AI5A 3M6UA 2ZVPX 1TF5A 3VNSA 3GFBA 4ZRMA 3V6MA 1BGVA 1U0NA 1AB6A 2BMJA 3BZWA 1M7BA 1PT5A 2Y3IA 3ZKWB 4A8JA 4DZZA 5LP1A 3I28A 4QVGA 1M34A 1T8SA 3QBVA 2C2HA 3HHPA 2Q46A 3E1GA 3MILA 4DLZA 4YXWD 2BSXA 2VHVA 2GBCA 4AZ0B 3UANA 4CKCA 1YQWA 3ANSA 4CODB 3M4JA 1H8EA 1JG1A 2QWXA 2WM9B 2WMOB 1YI0A 2Z9DA 3WLPA 3I5MA 4JP2A 2ANCA 2REQB 3OZEA 4IDHA 1RIIA 4ZOEA 2WJAA 1JEQA 4JVSB 1W36D 4KG7A 4KIUA 3O7WA 2IF0A 5BUSA 3OCWA 1G2PA 1PEAA 2CWDA 1WMAA 2D5LA 2E85A 2SKEA 3IBYA 4DIOA 5BYKA 1N4DA 3N58A 4OMDA 3MN1A 4CL8A 4FMBB 2Z8ZA 3AR9A 3GQVA 3QY9A 3KLOA 4GMHA 2IPAB 1NF2A 1Z5NA 4FI3C 1RKQA 3JTMA 4HQFA 4V0SA 2GX6A 3VKUA 4D8VA 3FPEA 1VPLA 4MMXB 5KVAA 2AD5A 4PC2A 2XH8A 2WKPA 4HS4A 2XGGA 1ODJA 2PCJA 1N2EA 3WB0A 4DW8A 4AJ9A 3R7BA 3WIUA 4XIFA 4WZ6A 3TKYA 4YY3B 3PEUA 1LRJA 3ZEIA 1IXSB 4YIHA 3H99A 3ICWA 3K5WA 3S2FA 1QR2A 3B48A 1H6BA 2BMDA 1XVAA 2WJ6A 3O26A 4BCCA 4MVCA 1VMKA 1VCNA 1TAQA 2JFOA 4IUDS 1ULSA 1NN3A 3VISA 4A16A 2JFHA 1UOPA 4W5QA 5AXCA 2AOWA 4UU1A 2X19A 3ESCA 3HJRA 4FQ8A 2QLTA 2CWWA 4L8FA 1QTIA 4WQMA 5EXXA 1II8B 1G0NA 1HGXA 1E9SA 4OLFA 5AUOB 3A6KA 3AFOA 5LU8A 2I3BA 1YNOA 3TEMA 3HWRA 3ETHA 2QAGB 4YAGA 3P96A 3OLXA 1PZHA 1NOJA 4DRZA 3QU9A 5LWQA 5KTTA 4UVIA 1ZOLA 4OLJA 4YCDA 1AXGA 8ADHA 4B48A 5IT5A 4GKKB 3JQAA 4EG8A 5E6SA 3EEBA 3GOQA 1QHHA 5IKMA 1XTPA 3COJA 1G8SA 1TTPB 1RCFA 2YJTD 1OFIA 1Z15A 2JAXA 1RQGA 2C4WA 2I54A 3EVCA 3T94A 3IC5A 3RI3A 2JFYA 5L3SB 3HYRA 1VBNA 2EX0A 4ARZB 5FUQA 3VOAA 1TYAE 5B4UA 3JD2A 1QH9A 1V1MA 4HPWA 1L5HA 1SKYE 3DO6A 3OBBA 3ABOB 2RH9B 2ZBEA 4NMHA 3WGYA 3PD0A 3TIXB 4HLCA 3PTLA 4JC5A 4WK2B 1NPTO 4ZO9A 3WTBA 5L7TA 3KJNA 4TMWA 2I2CA 5DI9A 4F3RA 1MG5A 3PDIA 4ENPA 3L8DA 5TPZA 1ILEA 2UUAB 3OICA 4LHEA 4S2UA 2FU5C 2G09A 3WIDA 4CCSA 4PSDA 4YDHB 2JFGA 1IHDA 3LC0A 5EP3A 5IXYA 3ZH9B 5GOTA 3RO7A 4WPGA 4OHKA 3NTUA 3W04A 1G8GA 2R8PA 2P77A 3H86A 1LI5A 4EGJA 1OBHA 1K6EA 3BMNB 3KKNA 3PA8A 4CT4B 1MVOA 4J4HA 1N2GA 3H1PA 4ISBA 4EFKA 2ZYRA 2XZPA 2O8FA 3OLQA 2FR1A 2BM0A 4FGJA 4CEIB 3P5SA 3BK7A 5IC5A 2QD5A 1FTQA 4HWPA 4RMIA 5BN3B 1G7RA 5ALOA 4S05A 5B7GA