3RGWS

Crystal structure at 1.5 a resolution of an h2-reduced, o2-tolerant hydrogenase from ralstonia eutropha unmasks a novel iron-sulfur cluster
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
270
structure length
270
Chain Sequence
b'PRTPVLWLHGLECTCCSESFIRSAHPLAKDVVLSMISLDYDDTLMAAAGHQAEAILEEIMTKYKGNYILAVEGNPPLNQDGMSCIIGGRPFIEQLKYVAKDAKAIISWGSCASWGCVQAAKPNPTQATPVHKVITDKPIIKVPGCPPIAEVMTGVITYMLTFDRIPELDRQGRPKMFYSQRIHDKCYRRPHFDAGQFVEEWDDESARKGFCLYKMGCKGPTTYNACSTTRWNEGTSFPIQSGHGCIGCSEDGFWDKGSFYDRLTGISQFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Membrane-bound hydrogenase (NIFE) large subunit HOXG
publication title The crystal structure of an oxygen-tolerant hydrogenase uncovers a novel iron-sulphur centre.
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase
total genus 79
structure length 270
sequence length 270
ec nomenclature ec 1.12.99.6: Hydrogenase (acceptor).
pdb deposition date 2011-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
S PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 3rgwS01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 3rgwS02
1UBHS 4UD2A 4C3OB 4URHA 5JSKA 1H2AS 1UBLS 4IUDS 1E3DA 1FRVA 1WUKS 3UQYS 1UBRS 2WPNA 4KL8S 4U9IS 1WULS 4UCWA 1WUHS 4UQPA 3USCS 4UD6A 4CI0B 3CURA 3CUSA 3ZE8A 4U9HS 1YQWA 4UEQA 5JT1A 4UEWA 5A4MS 3H3XA 1CC1S 5A4IS 4UCQA 1WUJS 3AYZB 4UE6A 1H2RS 4KO1S 1UBUS 5D51S 3RGWS 4TTTS 3ZEAA 4KO4S 3ZE7A 1YRQA 2FRVA 4OMFG 4UQLA 1FRFS 4UPEA 4KO2S 4UE2A 3USES 1UBMS 3MYRA 5JSUA 4UPVA 4KO3S 5JRDS 1UBKS 1UBJS 3AYXB 5ADUS 5A4FS 1YQ9A 4GD3Q 1UBOS 4UE3S 4KN9S 3ZE6A 1UBTS 5JSYA 4IUBS 5JSHA 4UCXA 1WUIS 3ZE9A 4IUCS
chains in the Genus database with same CATH superfamily
5MGBA 2LXNA 3E7PA 2Q5FA 5AW3A 5K8LA 3GCWA 4RZ3A 1FSGA 1WB5A 2A78A 4W99A 4KCGA 4HRYA 5EZ5A 3RYIB 4F91B 1JB1A 3A1VA 1P1JA 4QPZA 3ESQA 1BOFA 1JB9A 1K4KA 1FYVA 1OI4A 4GKJB 4KVAA 3OLQA 4L75A 1SCJA 3IALA 4QLAA 1TGYA 1A5TA 2O3QA 4L57A 4RWEA 4L5JA 5EMHA 3HHEA 4BO6A 1KOFA 3M6MD 2IOYA 2P5UA 1S01A 3FHTA 3WYDA 4PONA 3IULA 5TJHA 3RK1A 4MUXA 2PH5A 2XYRA 4IYRA 1UBRS 4B6GA 5EOVA 4NYMR 2J3DA 4DQKA 2EC5A 4FU0A 4O4LA 1VFPA 1P2GA 1ENYA 1YC2A 4UAUA 1UK6A 2IP2A 4LGCA 2ZYGA 4X44A 3W1WA 3BM5A 5KOHA 4WEQA 4MCJA 2OAP1 2I6QA 4HEHA 2LGJA 2I7VA 3QMVA 3N3BC 5CXXA 1M0WA 3SGLA 4FBGA 1J1UA 3L82B 3ZK8A 4ZYXA 1NI4A 2CNNA 3QVLA 1M2WA 3MS2A 3SHFA 1MCZA 1NMZA 4MWZA 2A0YA 2ILVA 2CLSA 5FFNA 5L4NA 3OU6A 3FH0A 4MVJG 4U0KA 4F1KA 4AI6A 1VYHA 4ZOCA 2DH5A 4FFSA 2ZQ5A 4LG1A 3EA4A 4N0MA 2ZZMA 4DV7B 4DMLA 3UXMA 5GWXA 1Z82A 4PZYA 2KJQA 5AJZA 1QFZA 2XYGA 2ZETA 4R0NA 3ZU3A 3MHTA 4LJ5A 1NA5A 1P1CA 1ZD9A 4RVCA 4JJGA 4XB6B 3SZOA 3FDIA 1I1OA 4UHEA 4AX4A 1ITZA 1KYYA 3R5TA 1RLIA 4M8KA 2BI4A 3LU1A 4EG7A 1U7OA 3UGTA 4M98A 1KNXA 3ETLA 3MS4A 2AFIE 1IMOA 1NGSA 2QE6A 3KLOA 3AGQA 3F9IA 2Q6KA 3VYRB 3FSJX 3HB4X 4X1OA 5HF6A 1IHUA 3ELWA 3HVKA 3MJ4A 2B94A 2ZUUA 4UDNA 2BOVA 2RSLA 3A36A 1SXQA 1VPTA 2NZJA 1XZNA 4BO3A 1E4YA 1B8NA 4H18A 2IXAA 3TQTA 4LVOA 5DT2A 1AG9A 5GTDA 1JQ3A 3B1JA 3EAGA 1QGZA 2GJ8A 3VC1A 4RJKA 4ZYYA 4ENQA 1HH4A 1XBTA 4I4IA 3PXAA 3AR3A 4J94A 4KTVE 4MVJA 5DX8A 4BOYA 4S04A 1OBVA 3DOUA 3ENNA 4KMMA 1XPOA 1JG7A 421PA 3G23A 3AP2A 2B4AA 4BBPA 4RPCA 3HDHA 4Y0NA 4FDMA 5HS6A 2Q0XA 3ZTWA 4ND6A 5M5BA 1H2ZA 1T1IA 4MQFA 4J4BA 2QU8A 1QGUA 1YU6A 2A5YB 2FG7C 4O0LA 5CVUA 3LTEA 4MVXA 3ZY6A 3K73O 1V3TA 3L8ZA 1U0LA 3RFTA 3L05A 3RE1A 3X1MA 1Z6XA 1P7CA 4XVCA 3WGOA 3IE0A 2IEYA 2V7PA 1W44A 3WBKA 1YZNA 4FYIA 1DEAA 4JUFA 2Y66A 3BAFA 2ZS9A 2ZAGA 3CNQS 3GDOA 1UZUA 3HNRA 1I6KA 2A9KA 3WDMA 4P35A 3GLIA 2E5LB 2GM3A 2HMWA 1DIBA 1WW3A 1I5OA 5BN1A 1WVGA 2OFWA 2J87A 3OTGA 3ROXA 3J81k 4FSHA 4MWGA 1TT5B 4GOND 5D6OA 4ODIA 4G09A 5FR1A 3FWYA 4Z9BA 1N7HA 4NZ9A 1FFDA 1H1DA 3B1ZA 3DAPA 1BCSB 1X7YB 3RW9A 5E1BA 4XIFA 2D1SA 2DHDA 1WV0A 2WZQA 3KCQA 1BDJA 1MEJA 4O4JA 5IXYA 4J4TA 2H2WA 1NW8A 1I1NA 2V1XA 1B0UA 3K0FA 5HRAA 1FC0A 3R8CA 4TKVB 2C59A 5G02A 221PA 4RDIA 4E2WA 2XD9A 4HF7A 1OBHA 2RJNA 3AI1A 4XWYA 4ZU3A 2VZLA 3AUKA 3E1KA 4N8EA 1MQAA 1Z74A 4WFKA 1E5XA 2VXOA 3L0DA 5HA5A 4FLEA 3VSAA 3NCHA 5BSUA 1SVUA 2W6CX 5EINA 3U7QA 1AQNA 2FPGB 4Q1BA 4J03A 4OHRA 2P9GA 5EKTA 2D7DA 3ZYZA 4RA6A 1QORA 3R3WA 4R1SA 5FEMA 1ABFA 3CWZA 2XKBA 3K6SA 3LOQA 1DL5A 3TG2A 3AERA 1KL7A 3WL6A 2TMYA 2P6MA 1NYRA 3T3MB 1M76A 1FJHA 2BGNA 3GEBA 1E7YA 2F9FA 1EM8B 2GN1A 5ESRA 4BX9A 4J0KA 3Q98A 1E3WB 3ELUA 1EDOA 3HP1A 4L28A 1COZA 2OSBA 2W2KA 1NJ2A 3ZE8A 4B3BA 4XX1A 4R54A 1TTPB 4F2HA 2PVPA 5LMNB 1HDZA 4NCIA 4H7JA 2X0JA 3L6DA 5JT1A 3R0XA 4BFWA 2HF9A 1ZM4A 5AVVA 2Q5CA 4WZBB 1Q57A 1N8TA 4LWPA 5DE3A 3K70B 3OZGA 2PMKA 4WQMA 4IDNA 5AK3A 1T5TA 3WK9A 5LP6B 1K66A 1G3RA 1T2CA 3A9UA 5ECWA 1Y34E 3LAWA 1ZJ5A 3AR6A 4QU9A 4CE6A 1KI6A 1N75A 3DZJA 2AFIB 3F8WA 4CLDA 2FZ5A 4HYEA 1M2HA 4YLYA 4ZPXA 1CF4A 1QWOA 4TTTS 4L08A 1T6NA 2X19A 3T3OA 2W2OA 2Y8EA 4B75A 3WHPA 2PMFA 3JXEA 3PL5A 2XEXA 5IUKC 1MO3A 2PRJA 4ZMBA 4A3SA 3QW2A 1JG3A 4FYVA 3VH3A 2FFHA 4E6PA 1P0CA 3AM3A 4X1IA 3LCVB 1THGA 1JQBA 3EBLA 5HCUA 2TMGA 4DNQA 4FS3A 2GF0A 3CY6A 2GESA 2IELA 4IDBA 1JPJA 3MJEA 4J6FA 3IBYA 1FX0A 4KWEA 1RBMA 4RV9A 3RSHA 4C7MA 4TYYA 5JCXA 2CFCA 3JQAA 4N9WA 4BE9A 3MBOA 5ICSA 1YAJA 3B1XA 4IJUA 3ZGOA 3K0KA 3KR0A 4MGKR 3IEUA 1SKUA 2OD9A 3JQFA 4PPQA 4AS1A 3L7LA 1QG4A 1E9BA 3QOFA 4YBZA 1OPRA 4Z86A 1QVVA 4UTVA 2VUUA 3RV3A 4ZEWA 3TUJC 4M87A 5J4HA 4IXWA 1CJMA 1P0PA 1X2BA 3JS5A 3PD0A 1CEEA 5LIPA 4FKBA 1C4KA 1UOQA 3IOYA 3VPHA 1PJZA 3OKFA 3B9QA 3L7BA 3PENA 1RJGA 1WZIA 3OIFA 4WTOA 2YH2A 2QTNA 4WFIA 4CMKA 1ZL0A 3IUMA 4BATA 3BSWA 1UZNA 3ZE6A 2RGEA 1ZJ6A 4J0HA 1G0NA 4G5SA 4BWGA 5IHPA 1GGEA 2O2SA 1WUTA 2XUQA 1J06A 3HDYA 5EHIA 2KW5A 4I1UA 1RAAA 1ZGGA 2QRGA 3WRYA 3F67A 1UMCA 2C78A 4KLZA 1R74A 2PX6A 2GD2A 1G1AA 1I33A 3A3NA 3UWOA 4EWLA 1X14A 3G2OA 3I0NA 3WWYA 2RIRA 5K3AA 3ZZTA 5LR6A 3BRWA 4JGIA 1K8XB 1UUFA 3QF4A 1QNLA 2MSWA 4LV6A 4V1CB 2ZE8A 5K6RA 4HRAA 2A0XA 3F2IA 3K9LA 4OLHA 5H5JA 1R12A 1AMNA 1G2PA 3KZKA 4PBRA 2VK4A 4H7DA 3WL7A 1XKQA 4ZEOA 2J3HA 1NVUQ 4K6HA 3U81A 1RWQA 1U1EA 4XVRA 5CJ2A 3GDFA 3VX3A 1TUBB 1UC4B 4PSCA 4Y7CA 4Z3OA 3TMYA 3ZBUA 5ER6A 3PWTA 4ND4A 1D2GA 3ELBA 3KLMX 3M4YA 4GT1A 3RVQA 3SS9X 3UAYA 3IQDB 3GG2A 4L02A 5AUNB 2PWYA 4CVNA 5CA0A 1PFGA 3FAZA 5MF6A 5AW8A 1W0CA 1N5IA 4QREA 5DTEA 1GUYA 1IBRA 3K6RA 1CZOA 1KO7A 1XQ1A 4JOSA 4IX9A 2AZTA 3ODPA 4N03A 2XT9A 1ODCA 3AR5A 5C1DA 4NBVA 4XCVA 4D8YA 3KJFA 3ZOZA 1LDBA 2N9UA 3KSZO 4QARA 3U7EB 1N1DA 4ZT2A 2EGGA 5KTNA 4YY3B 5JSQA 1G98A 1NXPA 2PKQP 4IIGA 2AG1A 3U26A 1G64A 1RYBA 4A82A 2ZUTA 5DI3B 1TJ4A 3I76A 3E0QA 1E9DA 3D8NA 3HGTA 3H5WA 4AS2A 3TSAA 1USGA 1T6XA 1T8WA 1W34A 2HPZA 2HREA 2RAVA 4TWRA 2V1UA 2Q7OE 4XDYA 3TQIA 1HE2A 4TKLA 5G40A 2PXHA 1L7DA 4K9DA 4RULA 2VRCA 3FHLA 4MUJA 5AJYA 1JLLA 3FKSD 2DWCA 1WEHA 5TF0A 1A8IA 1MPXA 1PT5A 3FUXA 5C2JB 2IIBA 1N92A 4CMGA 3ORHA 4RQTA 4J0DA 4LZAA 3EZFA 4YRQA 2QTFA 1GLGA 1MORA 4MO2A 1ZWLA 1EGQA 3BIFA 3F5DA 3UICA 3UYKA 3AFIA 1N6HA 1Z39A 3EAFA 4O4IA 5BPFA 3KKQA 4I9FA 2CF5A 1FLAA 4DJDC 1EE9A 4S35A 1EBUA 2QX6A 3W6NA 5EZYA 1UM8A 4IEEA 2OV4A 4LOHA 2Z3ZA 3D43A 4HNUA 1ZLXA 2CD7A 1VLHA 2XITA 3K9HA 1JR3D 2VPYA 4WADA 2ZP1A 2ZYTX 3MYRA 5KNLA 4NICA 4HFNA 4N76A 2QX7A 5A7GA 3A9CA 3BHJA 3EWNA 4C0QC 2ZB3A 5JROA 4G4GA 2QY9A 2C2MA 3W5AA 3A58B 3N6XA 4CU5A 1DTWA 1ZN8A 1XEAA 2PLRA 1WZCA 3IMCA 4KN8A 4DZRA 4ZYTA 4DR2B 4JLNA 1EB9A 1MA3A 3DAFA 3UG6A 3NW9A 1NVTA 2P65A 1TUEA 4FHDA 5A9RA 3OQOA 4MI1A 4EW2A 3SPXA 1E9FA 2LUOA 3THWA 2O8NA 2PRKA 4EBFA 2JJYA 1ADFA 1IOLA 3IDFA 5K05A 5BVHA 2JJMA 1MPTA 2VJNA 1QOQB 4JXJA 3WJ7A 1DIGA 1Y98A 5IKXA 3RGGA 1JJVA 2GRAA 3G1TA 4C7JA 3L41A 2V7QA 3OJCA 4FX2A 3SLKA 1KPGA 2XMGA 1QF7A 2C2ZA 4I8IA 4KJXA 4O59O 1U7HA 1XU9A 1ZDMA 1CZNA 4E0BA 4EIWA 4OHYA 3AZPA 1Y80A 3QEOA 1ELOA 4QFBA 5BSMA 4MDEA 1OJLA 2VDLB 2YNMC 3RRZA 2VBIA 3FJYA 4WK4B 4H35A 3VR6A 4F56A 4Z51A 4YCMA 3ZWOA 5B1EA 3EG9A 4AN1A 1ISJA 1MT0A 1CKEA 3UHPA 4DG9A 4OXKA 2MINB 2X4GA 1I2AA 2P78A 2XNJA 1YV9A 4UMDA 5A9TA 3OOEA 2CHQA 1LW6E 1QGED 1SCUA 2ONKA 1Q19A 4NG5A 4X6LA 3TVTA 5JO0A 1WUKS 2GN6A 4BLOA 2DECA 2I4IA 3ZH2A 4E30A 2ZE6A 2EX4A 5CB0A 3AY0A 1YIAA 1NPDA 5B6IA 2AZMA 5L53A 3WG9A 5IXJA 5A04A 1QFSA 4K7JA 2BM1A 2I3BA 3R9XA 2WE8A 4L8WB 2ZPAA 3PNKA 1T4BA 1YZFA 4NECA 4O1MA 1SKYE 4NI5A 4V03A 3TEJA 2J0EA 1F0YA 1RI5A 2B7CA 3NAZA 5BRAA 5JASA 2BC9A 3H5OA 4GU5A 1XZCA 2JHGA 3S28A 2MYPA 4NZPA 3EEOA 4PNPA 3Q8KA 2Y1FA 4DBLC 1XJ0A 3TCKA 4M0PA 3HFJA 4FFLA 1RI3A 3BMXA 4IJ5A 4ZTUB 3LWBA 4PXAA 2SICE 1JWAB 2CMHA 2QI9F 3HNOA 4LSMA 4P0PB 2MDTA 3VKHA 1VYUA 5B6PA 3ZHRA 4DV0B 1E4VA 1PO7A 3L7OA 2HMVA 4LYAA 4BEBA 2JDIA 1Q14A 4M0FA 1CFZA 1F3OA 3IUEA 4X00A 1D2AA 4XSHA 4RQBA 5KX5B 1LXCA 4EA7A 1LDYA 2BKXA 1C0PA 1ND6A 3TBKA 1LLDA 2PJRA 1OWOA 4YRSA 3SK0A 4DYDA 5CBPA 2DFVA 2HJ9A 2WWWA 3NBFA 3WV5A 4OQLA 5CDHA 1TKAA 2KM1A 3L8CA 3M1IA 1WXQA 4LJ4A 3ZHVA 2OFXA 3RODA 5JXGA 4K6GA 5DLPA 3TDKA 2G72A 1HQCA 1UPTA 2FDCA 5KU7A 4EI7A 3KX2A 3K92A 4BVAA 1UP7A 4TMFA 3ZCQA 4OLJA 4LJYA 3O4GA 1TF7A 3CWCA 5L95A 7ABPA 1GZ3A 4CM7A 1E2BA 3AOEC 4W5TA 3C7TA 4Y9TA 1DCKA 1UXGA 4TS9A 3BWBA 3FNQA 5KOIA 2EBUA 2W11A 2JJ1D 4P7KA 2QXYA 4BAUA 2Q5QA 2Z1DA 3V7FA 5ENDA 3IV7A 1QG6A 3QZUA 1ZRNA 3K0AA 3O83A 5E1DA 5AUOB 1IEQA 4F93B 2PGJA 2GNAA 2G0TA 3QPCA 4PR3A 3SNHA 5HZKA 1KZYC 2WZBA 4LRUA 3C6MA 3W7VA 1QTRA 4L4XA 5H83A 1HE5A 1L5LA 2R6DA 2QTBA 2QXUA 1AB6A 3JZAA 1K75A 4NPHA 2VDWB 3NGXA 3PNLA 1B6RA 2IF0A 4COOA 4YAUA 1P9NA 3U7GA 3TSWA 2GYYA 1RRVA 3PUKA 4OQQA 5EJMA 2FZLA 3BBPA 3OEHA 1BKDR 1RLJA 2R60A 3NC4A 5AKLA 3JARA 1ISSA 5ER9A 4EHDA 2P91A 3SIRA 3ZKWA 4CG0A 5FPKA 3OJOA 4LPKA 3U1BA 1KFBB 5ARBA 4C2TA 3R3XA 2B1IA 3ZR4B 3VBEA 5GIOE 2H18A 3PA6A 4Q6BA 1RE1A 1SU7A 5C7IO 5GONA 2AA3A 2VF2A 3NHYA 3C24A 3H2ZA 1TEVA 1KGDA 3ZV3A 3ONEA 2DEUA 4C78A 1C0EA 5HP4A 2QLLA 2ZJ4A 4OO3A 5FL7D 1U9IA 1WXFA 1G55A 3OU2A 3RTAA 3U4MA 2VZ8A 1OH5A 2E4WA 2R6AA 1VXOA 2O0JA 3MWDA 3OEED 1UWVA 3AM4A 4QPNA 4F5DA 1BFUA 2FLWA 2Y0DA 2HWYA 4X7PA 3G8BA 1ULAA 4YTEA 1YBHA 3SP1A 2PZEA 3TFOA 1DFGA 4Y2TA 3RVRA 4DR6B 1PYDA 2AS0A 1OLSB 2XVAA 1SKYB 1YFZA 3NATA 2COUA 2WVAA 3LOUA 4MJXA 5I8WA 2ZIEA 3SJCA 2E87A 1V1MB 4LF9B 4FHEA 1E3EA 4PU0A 3H1EA 3CURA 4DV1B 4IVPA 2Q3FA 5FNZA 4IFTA 1SIOA 2C5GA 1ZJJA 4RM3A 1IFXA 1X7ZB 3RIMA 1B8UA 2WB4A 3MOIA 3L1VA 3OPYI 4D8TA 3ABIA 3IE1A 2WWTA 4HPXB 1NF3A 1RYYA 4YASA 1TB4A 3DFKA 4U2BA 3VZRA 2D1RA 3SG0A 1BWQA 1KU6A 1HDXA 2QVYX 4ILEA 2SBTA 2PMBA 4J07A 4QPCA 1UMDA 3IT2A 4NCKA 3OX1A 2JAHA 1PWXA 4LOIA 1K3FA 4H7FA 4MPJA 4D6XA 4PQFA 2QL7A 3SLRA 3NTXA 4Y9DA 1DWUA 1K7YA 3RRJA 1YZTA 1L5RA 3I6IA 1MW9X 2IYUA 5E4TA 5BYBA 3EIHA 4LZWA 3NFRA 4J2HA 1G4HA 3ASYA 3KETA 3N1UA 3O8OA 3A9VA 3QK7A 2X5KO 3VAAA 5KQGA 4QYXA 3FZQA 3SXPA 4XCQA 2QR3A 3RUCA 2X9QA 4MCAA 1RRKA 3LRXA 2IWRA 1BD3A 4MEJA 2OOKA 1N5JA 4I5EA 4L4ZA 4H3KB 2A5DA 3I2IA 3AKYA 4G81A 3IBFA 4E1VA 5CM9C 1SC6A 3IA7A 1YQXA 4FONA 4ZT6A 2C4NA 3USES 1Q7GA 3NOOA 3T12A 2IEAA 4AO8A 1DU4A 1WHTB 4MR7A 4FQ7A 5TQ0B 1Z26A 5JLAA 3O82A 3DPUA 4O8CA 3EVFA 5LQDA 1ZJZA 4XTCS 2Y0CA 2ZIGA 2XQGA 1RWVA 3WLMA 3D6TB 1E6KA 1KXZA 3T0GA 2FSVC 4Y2VA 2R65A 4JXXA 3HBNA 4GGPA 4DA4A 2VJCA 4WESA 5C8VA 1Z0KA 2H4FA 3OWXA 5AVRA 3ZN2A 3UHJA 2A4KA 4DM7A 3HI6A 3BWXA 1JWBB 4YUXA 3WQQA 2BHTA 3NO4A 1O6FA 3FPKA 4Z2YA 1COWA 1ODFA 2YCLA 3QBJA 4KODA 3L4BA 1YOVA 2DQYA 2QX4A 3QOYA 4II3A 4KYTA 1S7CA 2C5SA 3CUVA 4D9EA 3ANMA 1SBTA 1TLTA 2H0QA 3V1MA 1S3SA 2RBGA 1O5OA 2SCUA 3T3NA 5DSXA 3R7AA 3DFFA 2Q46A 2OZEA 2W5UA 3HACA 4YA6A 1I36A 1JDVA 2X9NA 4HTFB 5EMMA 4A6PA 4IHJA 4WFQA 3A31A 2H5LA 3P9NA 5PGMA 5CTAA 2NU9B 4D9MA 5DU2A 3D8TA 5C46F 4TSKA 3P27A 1ZG3A 2AVNA 3I5UA 3OJ0A 4JY7A 3UJ7A 1DMSA 1JR2A 2C04A 3FHOA 3CLSC 4TMWA 4TWAA 4WH0A 1AK1A 3R0QA 3SHWA 3W2GA 2ZYDA 2WHPB 2PDAA 1VB3A 1XLTA 1CVIA 4IUDS 2H65A 2IUUA 1EUQA 3GVHA 3M1LA 4IJMA 4YHBA 1GNVA 3U16A 3FVTA 5PNTA 3SYMA 4X1YB 2XQVA 4XD7D 5TPZD 1IHYA 1N4AA 1Z38A 3AINA 3MWKA 3JQCA 1II8A 1ZIYA 3V1TC 1JLSA 2VHUA 4O2BA 2QUIA 3M6FA 4ZV7A 2WF5A 3VV2A 2I62A 5AKZA 3BJRA 1WLYA 1CQZA 1GL9B 5EP2A 1HBJA 3L0YA 1YJQA 1IIRA 4IBOA 1TT7A 3BWCA 2PRSA 4RJJA 4B17A 4TQUS 4EFDA 4AWBA 1ZRSA 2I78A 2VF5X 3D6FA 2NQTA 4DLAA 2MIIA 1FSPA 4XX0B 2AFHA 5E6RA 3X3HA 1MB9A 1ZYUA 3NEPX 3TL2A 2D2IA 1GG9A 1DAMA 1U3UA 3RSQA 3VHRA 821PA 2PTHA 5JR3A 3KT0A 2YXEA 4AU1A 1QK4A 4Z1OA 3HCEA 1AU9A 4NEGA 1HR0B 3JVVA 3NG1A 3OQIB 1KC3A 1IATA 1QR6A 1XVVA 3HFRA 4KQXA 4C7KA 4DCVA 2AW3A 2YV3A 4GBJA 4BMOB 3T15A 2OFPA 5B57C 4IOJA 3O93A 1KE2A 1QHHA 1JRLA 2RJOA 1AZTA 2YXPX 1SZJG 5LUBA 2PCJA 1IZ8A 4ZIRA 5TY0A 3U48A 4LYJA 4UHCA 3W06A 5JQGB 3HZRA 4OKNA 2H85A 4CKBA 1SQ0A 4I1SA 2NAFA 3SMQA 5BNWA 2I22A 4MKXA 1U5CA 1ZIOA 3MGBA 3WQHA 2GPAA 1GPMA 5ELXA 1U7PA 2HLHA 2ORIA 1TLFA 3O90A 1DIAA 1X7XB 1KC1A 2P9ZA 4D4LA 1MIOB 2RHOA 2O7VA 1UPFA 3JYLA 5JTTA 3CXUA 3LS2A 3ABOB 3EPPA 3OC6A 2YHAA 3RDPA 2A59A 3VC2A 2Z4TA 5ALIA 3TTUA 3UAXA 2QLTA 1YL5A 2OP1A 2WA2A 3H19A 4ZRDA 1DO8A 3H13A 4AO6A 3LKVA 4BJHB 1A9ZA 2A30A 2WYUA 4L0QA 1A4RA 1GPBA 3MTIA 4R84A 1MVOA 5EHNA 4OA8A 4OJMX 4YC7A 1XYYA 5CA1B 3T5TA 2EHJA 4MV1A 2FW9A 2IHVA 1FTNA 3OHMA 3RLIA 1E1CA 1H2XA 2IOFA 2XCTB 1YHZA 1Z2AA 3MWFA 5HF9A 2F9MA 3DDNA 4X6UA 1EAYA 4KVFA 3V9PA 5JAOA 4WBNA 1EK2A 3DB2A 1EFTA 3WS7A 2W2PA 3MAAC 5FORA 1OWNA 3AVVA 1AXGA 3P9RA 4CKCB 3IC5A 4HLQB 4HXEB 3OTHA 4EQ6A 2XB8A 3FM9A 1KMHA 3ND9A 1SY7A 1NHWA 1CK4A 1Z3CA 1KMIY 1X9IA 2O3RA 2ZJ0A 1P19A 2H3EA 1ZKDA 1D0SA 2B8TA 4LBYA 4PQYA 2IBTA 1KZGB 4JA2A 2DG2A 2QIOA 2PKCA 4TVBA 3D2AA 1NDHA 3RC9A 3G2LA 3BD6A 1MH1A 3JQGB 4IXNA 4TKUA 1VI5A 3ZD8A 4EY3A 5JXWA 1A8UA 1UR5A 3BD9A 4G0YA 3C43A 3WIBA 2DSTA 4ZV4A 5DOVA 4LE2A 4L4UA 1ML3A 1TAQA 3KUUA 1VKHA 1QCDA 2FP4A 3KSMA 1LJUA 4FZRA 1QTQA 2WVJA 1V5WA 3Q88A 3IYLW 4W5QA 2BGRA 3L79A 3B6EA 3BD7A 2XWJI 4O4HF 3VPCA 2D0IA 5DBOA 2ZDGA 4C0WA 2BTEA 5AVKA 2Z8ZA 5ITZA 3GL9A 4FMCB 4CCYA 4HVCA 4URVR 4MDYA 2ODNA 3LBIA 4HBGA 4C3VA 5IX8A 1EKXA 4HNVA 1IN1A 1W9HA 2PWAA 3GJ5A 4B7AA 1W49A 1YZUA 3FYDA 1PV1A 1RWWA 4ZVTA 1X0XA 3WYCA 2WNIA 2JFPA 2WMNB 3ZWWA 4QM7A 5GJBA 4MB6A 2C07A 3NHMA 1BCRB 2PR2A 4JJAA 1BNCA 1SQ6A 3OX2A 2E1PA 5T67A 2JC3A 1OH7A 6YASA 3ESXA 2CUKA 1GNPA 2QSJA 2R4QA 2J3QA 4R2IA 1NTOA 5AM1A 4RA9A 3ZW9A 4GOOD 2PQ2A 1EVKA 4YRZA 2VO1A 1CX9B 1JDBB 1QO0D 3EFOB 2JAXA 3IILA 2E4YA 2IY9A 3K6KA 4PTLA 1ADYA 1FDWA 2WMDA 5DWQA 1B0PA 3I8XA 1MG0A 2HGZA 2Z9CA 3WWZA 1KRHA 4ZVRA 1F6DA 1OASA 2VSQA 5D3ZA 1PKEA 2IPLA 5KCMA 1HT0A 3CCBA 2ONJA 3IAHA 4XLTA 4WECA 1K88A 4A91A 2O2CA 3OC0A 4QFCA 1Y1QA 1YRQA 3PXGA 2PL3A 4XDGA 4DPKA 4EHJA 2AYZA 5K0EA 1TRKA 2WWRA 3L49A 1VIDA 4IFEA 1R3DA 3SKVA 3UKOA 1U2ZA 1W0JD 2OORC 4X3PA 5TQ2A 1JHAA 1LJLA 2W58A 1TNDA 3EIWA 2PRYA 1KDVA 1ID1A 2B8EA 1FJ2A 2HDNB 2F8MA 2ZJ3A 3GGPA 1G8JA 4RJIA 3ZU4A 1DCMA 2K7ZA 1QC5A 2BHRA 1V3QE 2RG1A 4HVAA 4TPKA 2AD5A 3M89A 3KVNA 5EI5A 1R4NB 3UFXB 4LHVA 4QFDA 5F9FA 2PX0A 3AT1A 4KO8A 4KI7A 2JFVA 3B5IA 2EKDA 1KETA 1JBKA 2EDAA 4MV0A 4E5PA 2VC2B 5BV0A 1DEHA 2QPOA 5KYWB 1NOKA 3DC2A 2KBFA 4B5KA 3FZYA 1R18A 3AUUA 3PKZA 3DDSA 4LKOA 2YVLA 3FXAA 2ZT8A 4OIFA 4XGRA 4TYNA 2WUWE 3VSDA 4BVHA 2OO5C 4DIMA 3FRJA 3K8QA 3W7AA 1NONA 3GPBA 1EDEA 3D54D 1NOIA 2BFPA 4INPA 2ZYVX 4IS2A 4WLVA 1G8PA 3PXDA 1YZYA 5A3RA 1ODKA 3FKSA 4KFCA 1UBHS 3O31A 4PANA 3SZLA 5IC4A 1EZ1A 3ED1A 3A4IA 5D84A 3CNEA 3P9ZA 1UBLS 2ZWAA 3OOHA 1SA0B 4Q00A 4WLFA 5JEDA 3OKCA 3LKBA 1DIHA 3H75A 1I2CA 2VDKB 2YJ3A 3KKNA 4PLFA 5P8WA 4CUZA 1DKUA 4O2AF 2PLNA 5JS8A 2IVZA 1VMIA 4G0ZA 3COYA 1QKIA 4IY1A 5EE3A 1FYWA 5DTIA 4DHWA 1J8QA 1C4WA 1JMYA 1O5TA 1P45A 3M83A 1KK3A 4OXXA 5HJEA 2VXCA 1JR3A 4PBSA 4UFOA 1NXXA 5BT9A 1TKCA 1LTQA 5JJLA 5AXBA 4BLUA 2NO1A 5IU6A 4TXJA 4KYIB 4KLRA 4P84A 2VJPA 4TOIA 3SKYA 1SQGA 2QRJA 3EF1A 3PGLA 3W2FA 4LRQA 5ADWA 4NCAA 3TJRA 2CXRA 2P27A 2EJBA 3HZHA 4I1IA 3D3WB 3IAXA 3JWHA 2QUBA 1NVWQ 4NJEB 3GGOA 3PCRB 4DG8A 2HJGA 4BRWA 4DDUA 2OG2A 3BB1A 2EZ4A 2DPXA 1WNTA 3U2QA 1X1BA 4ITRC 4C14A 3ELYA 2NQ2C 1QK5A 1SVKA 3HO8A 3PHIA 2QRNA 3I4LA 4ZI7B 3T5AA 5F7ZA 3N87A 4KXFB 4QXPA 2B20A 1KBZA 1Z17A 4RC9A 4IF4A 2VT2A 3EGIA 5AT1A 3EN0A 2HNKA 3WWOA 4KN6A 2R8BA 1QU3A 4KE7A 4R3NA 4Y2PA 1NOJA 1T2EA 3WFJA 5DHAA 5IZCA 2XXAA 3SD7A 1XZKA 4WXPA 3IP1A 2AIRA 4C4OA 1DC5A 2WM8A 2WNSA 2I80A 4ZYZA 3FR7A 5AK6A 3K3PA 1GAJA 2Y2UA 1ZOSA 2QUAA 3AF4A 3Q3IA 3HJAA 4HEJA 5EXSA 1JDUA 1MV5A 1GKKA 1U0GA 3W6OA 3PEWA 5CYOA 3UVEA 4UHJA 4WA7A 3SBOA 1I0ZA 5JRJA 3DL2A 3I37X 1P5FA 4IVNA 1ML4A 5AKYA 4RF4A 3ZEIA 5KTKA 3QA3E 4MV6A 3FZNA 3SHTA 2J07A 4BY9E 2QM7A 3STTA 4YRGA 3LHDA 1DT3A 3PUXA 3WFZA 3OJFA 3BSFA 1FBNA 3QUCA 4QNRA 2VTBB 1WNFA 3BXOA 1IL0A 3WIOA 2ACVA 3Q0TA 3A3YA 1PG0A 2B99A 2BMDA 4P36A 3SX4A 3O84A 4C07A 1YDMA 2HFKA 4UMFA 4YROA 4CV3A 4CEJA 3HJRA 2H52A 5AIBA 1YRAA 4JODA 1EINA 2OCGA 2YWBA 4B7UA 4XWOA 5C8XA 1ZKMA 5ADUS 2DSNA 2GPWA 5CH5A 1EP1B 1L5QA 3W2TA 1HO3A 3INTA 5LYJA 3KL2A 1M5TA 3A7DA 3D4NA 4ONEA 3F71A 2Q27A 3R3ZA 2GJSA 3WI7A 2JBAA 4RTQA 1T9ZA 5IBRA 1SZPA 1Z3IX 4UTZA 4NS1A 3ADKA 1H94A 1A82A 5L3SB 2O8BB 3H1PA 2RK3A 3OE1A 1Z2OX 4HDRB 3EXEB 4N0DA 2FLVA 1T8TA 2VTVA 4I9NA 4CTOA 3LLUA 3K31A 1BQEA 2H2DA 2WJIA 2HJVA 3A4MA 2ZQYA 4GZMA 2ZIAA 1NASA 2EW2A 4M7PA 4DEXA 4JI0B 2ZS7A 2PUHA 3DEFA 3KXLA 4YONB 3KOOA 4Q24A 1T3TA 4W5HA 5EN4A 2CXTA 2ABWA 1P33A 4A2QA 1P81A 4BDSA 1HE4A 1GEEA 5HZMA 1XXHA 1HYBA 4QL3A 4B6SA 5JCJD 2O6LA 5LUAA 2O20A 2BBSA 4JYCA 5DVZA 5J5VA 4R1UA 1TYEB 1QYRA 2C83A 2A7XA 2UVPB 1K89A 2ZKIA 1RM3A 5T8KC 5T41A 3ZWKA 5ENVA 4E31A 3O95A 4QA9A 3EGXB 4GF5A 4INOA 4IINA 1G2QA 2A5JA 3JYQA 3ZI4A 2B37A 4ARZB 3TW8B 1TFUA 1XVTA 2ISQA 2JBWA 3QU9A 4NBWA 4Y1RB 1IJEA 5EFZA 2JJ1A 3DZBA 4CIBA 1I7LA 1DUSA 3KZVA 4WKOA 4DCMA 1VCNA 2XB9A 4GBMA 4IMJB 5DXFA 3KQWA 4RD1A 2X40A 2CXQA 2Z5GA 4W1PA 3V2IA 1L5HA 1QHYA 4DCOA 1GRVA 4B8WA 4M8LA 2XUAA 5A9SA 2P2GA 3QWAA 5C18A 3C14C 1J1IA 2B6NA 4UVGA 1YR8A 2DR2A 3GGDA 2UZ1B 2MTBA 4TLLB 3QGMA 2R79A 5KVSA 3RG2A 5F2NA 4BNVA 2B9EA 4GL2A 3O4HA 2ZGVA 2AW5A 1A96A 2XEDA 3TZLA 3UA3A 3ZK9A 5KC8A 1ZHOA 3IXLA 4YJ2F 5G1OA 3RVOA 3R3VA 4R9RA 3W6UA 4HDQB 3ZH9B 3VNQA 1TO1E 1DPGA 4N7JA 3IKTA 4UASA 3QUBA 4LGYA 3J7TA 3LBNA 1ZXLA 3WE7A 4AT1A 3KKKA 1L8QA 3KP1A 4BO9A 3O8CA 4IH9A 4BN0A 4K6MA 4OHMA 4OYYA 2JLAA 2WVGA 3GLTA 5BMVA 2CMKA 3BERA 4FFNA 4NAHA 3T1QA 1K27A 1VGVA 2HA3A 2OXRA 2F1RA 1OILA 5FL7A 3W8FA 5J3JA 1QH8A 1DS6A 4LDQA 4CCSA 4OGKA 1FRFS 1IN4A 1C9DB 2YV5A 3I9NA 4HRXA 2WIBA 3D2BA 3GZTB 4KO2S 3D5QA 4EUEA 2HMSA 2HZBA 3MUOA 4KWTA 2QJFA 2WUEA 4D25A 1R50A 3REOA 1QAOA 3FTFA 4BFYA 2FJPA 1V6SA 1NUUA 4B4KA 5FHRA 1G5IA 1IXKA 1X9GA 1WXHA 3FB4A 4RGYA 1PCXA 3QJGA 3TW6A 3WK6A 5K03A 3MB5A 2I29A 5EIOA 5FQOA 1DGQA 1QIGA 2QSZA 1UBKS 3GJ3A 2BISA 5GAJA 2GR9A 1RU3A 3N2KA 2IIVA 2D5BA 1YGYA 1ZH6A 1XD9A 1O2DA 3CYFA 4I8XA 2R0QC 3OETA 2FEOA 2PZFA 1L6RA 3GDGA 1U7UA 4EGCB 4YUYA 5K0BA 3OHPA 4ZT7A 3KAJA 1HUQA 4BXOA 2YWDA 3BCRA 3U44A 3TTYA 2XDAA 4GD3Q 3DJYA 1ZBDA 2X9LA 1J39A 2E5FA 2VF8A 4WJZA 5IUJC 2YOHA 1O94C 2WG0A 4ATNA 4ZI7F 2JAPA 3QI7A 5AESA 4GQBA 2C54A 2VTBA 3Q7IA 4DWWA 3PX7A 5AHKA 1H6DA 3EZGA 2JFYA 3X1KA 1L5SA 2EEZA 1DRVA 2QMYA 2Z8XA 2ZVDA 3FOWA 2VWPA 3QXJA 4DG5A 4BPBA 4ZCPA 4WDRA 2CC2A 4GI1A 3A04A 1DVRA 2R6JA 1E1LA 4II7A 4TWJA 2WJ3A 1R37A 2EKBA 2PLAA 5ICFA 5JCPA 5JI2E 3LKZA 2JGNA 5TE9A 3TSYA 5I51A 4EUNA 5AM3A 2DLCX 2C77A 1MRZA 2NU6B 5DZSA 3TQFA 1D1SA 3JQBA 2K2QB 4RIEA 1OFTA 1K7FB 3A06A 4JEIA 3COVA 5ALXA 2J6IA 3TLZA 2FR8C 5CK4A 2H4JA 8LDHA 3AVOA 1LA2A 5H4HA 2G9RA 4IIJF 3ZX5A 1GCUA 5J59A 3DVSX 1U3DA 1XU7A 4BNXA 1AHPA 3P4XA 2BFBB 2Q1XA 1XDWA 4X65B 1U3CA 4NZMA 5EUCA 3TNFA 5CBKA 2NN3C 3PIIA 4BRUA 2ZBVA 1N8SA 4BNJA 4EAQA 3RAFC 2EL7A 2GZRA 2ZJAA 4Q02A 1DG3A 2E4AA 1KU0A 4MARA 1ESCA 2JKVA 2OVFA 2B5VA 4WNAB 4A15A 4U3JA 4BNYA 1FQWA 5EMKA 2GK6A 3NEAA 2YN0A 2W90A 5JDCA 4C7XA 3GFTA 3CM0A 3CLUC 1GPWB 3O26A 1XMJA 3TLGA 3R41A 4X94A 2Y2VA 4CDGA 2OBFA 4NBLA 7REQA 4OLBA 2ROQA 1OXUA 3MQFA 4E07A 2XE7A 4JDPA 2WK1A 3TWOA 2HIAA 2IX3A 1YVEI 4D4MA 3VJRA 3DV0A 4JLBA 4WN9A 1R6BX 2Z9DA 3SMVA 4ISBA 2NU8A 5K3EA 1C7FA 1IQ0A 4LXUA 4H9GA 1JHVA 3H3JA 2M6RA 1IK6A 4N3GA 3T3GA 2H2FA 4CLOB 5E6UB 1E6CA 3ZI0A 1WTAA 4GQIA 1TF5A 1D7AA 1CDZA 2R68A 4CF3A 4ZYLA 1PKXA 4YIKA 4M3NA 4GZ3A 3S2IA 4OQXA 4KXYA 1F2DA 1H05A 5BN3B 4DC0A 1OV6A 2Q3LA 4I99A 4UNSA 4ZVUA 1V6AA 2NG1A 2ZUDA 2GPNA 1WZNA 3WIUA 4XD7A 5TPZA 3FUVA 1QPZA 1E3MA 3LX6A 4D9HA 4Q15A 5I7SA 2IOQA 2AFVA 1XEFA 2I1VB 2IDJA 3IQFA 3OSUA 4QBTA 3SYNA 5JXJA 2X5JO 2RHHA 1AC5A 5BSFA 2P2YA 8GPBA 4URZR 5KYYA 2R00C 1V8BA 1HDEA 2I2XB 1GG5A 3OM8A 3OU7A 2VDQB 5AO9A 1U9ZA 3SHQA 1YJCA 3B48A 2O50A 3ZZNA 2Q6OA 4FQ8A 4K2HA 2HUNA 4IDHA 3WYNA 4LC9A 4XARA 1NU6A 7YASA 1N2EA 4KN9S 3BT7A 1CD5A 4XE5A 3SY8A 4R8VA 3PEYA 4G5FA 3MW8A 4Q47A 4JIGA 4TN1A 3U0VA 4N5DA 3KKEA 3WB2A 3H6HA 4UZFA 2JAOA 2Q9AA 3AQIA 3VAZA 3PTLA 2CL7X 4NV0A 4R83A 2R7AA 3QFTA 3LUHA 4R1LA 4KGXA 4PYNA 3DLBA 1BMFD 2Q3MA 4EELA 3U62A 3F96A 3BJIC 4N5HX 2BCJQ 3ELDA 4OCZA 1RXCA 4OSPA 1P29A 1EFAA 1KEEA 4CMEA 2X5NA 1XDBA 4BP9A 2RONA 1KQNA 4CQMD 4DMRA 3IL2A 4MYRA 4GC5A 3I2HA 4D3SA 2FPPA 3U80A 5H3LA 4L8GA 2E7ZA 3O1LA 3NNDA 1L1FA 4FB5A 1O97C 3FROA 3NBKA 4XLLA 4EY7A 4QWWA 1R8JA 1UMKA 2ZPUA 3OQJA 3QI2A 4PC2A 4HS9A 2E49A 3X43A 4DLRA 1JA1A 1U0FA 3HYTA 5H3CA 1O9BA 4GUAA 4FZVA 1CY6A 4N3NA 4EB6A 5AW7A 2XCLA 2Q0SA 3V42A 1CUCA 1URPA 1CW2B 1LPOA 1Y3CE 3P0FA 4Q18A 4EI8A 4OHVA 1F60A 4P22A 4TL9A 4DMHA 4EJFA 1NN1A 1JI0A 1S8AA 2WFLA 3F5SA 3PX2A 2ZWMA 4ENWA 2IPNA 2V45A 3OCYA 1WZEA 5B3JA 4Q4LA 1L1RA 1RPJA 2Q0QA 4QG3A 2PXCA 2F8SA 3EDQA 5A05A 3UUFA 1Q1ZA 3WLEA 4NKRA 4O1IA 3QBVA 2EX0A 1UCFA 2G88A 3OO1A 2O1EA 4OH7A 4HQRA 4QOSA 4RPIA 4S1OA 4J16A 4TN5A 1CQJB 3ACCA 2R5FA 5LDDC 4DDWA 4OB8A 2AOXA 2AX3A 1OR8A 1Q0RA 2C7OA 4I1YA 5C81A 1IG3A 1EBFA 3EBOA 3E2IA 3R6LA 1JJBA 1AGPA 1UFOA 2WUDA 3QVTA 7AT1A 3IOMA 3PDCA 1OTYA 1MB2A 2ZBUA 4KGZA 1P18A 1EK6A 1M1YB 1VA4A 5LD2C 1OFHA 3B85A 1VE9A 3CRMA 1MA0A 2WZDA 3DBOB 2EBWA 3GG9A 4W82A 1PNRA 3QF7A 1FU8A 3ONFA 4UBJA 3QFRA 3O2QB 4PS1A 2GBIA 5FPPA 3TMKA 1JHYA 3WNCA 5F1KA 1Y1SA 5LDGA 2DWOA 3B6IA 1ODSA 3INRA 4EG8A 1X1SA 3C74A 3D8UA 3PKIA 4CGYA 2YINC 4PHTA 5BN4B 1WSBA 1R15A 5FO1A 1JEOA 1GJRA 4YP0A 1VMAA 2HHCA 1AA6A 2JIPA 2PGDA 5SY6A 2ODQA 3WGLA 2YZ7A 5JHHB 2QYSA 1QAQA 5JO9A 2ACKA 1VBMA 1W2GA 3KYDB 4LUCA 1H1LB 4J0QA 3QXXA 3IPYA 2ERCA 4QEDA 3MLAA 1PJSA 1K6EA 2KMLA 2Q4BA 1FA9A 3AKDA 3KXPA 1FS5A 4MQEB 4UUBA 1RYEA 2ZB4A 5FI5A 1M8FA 2APJA 1ORHA 1XHFA 1XHLA 1XTQA 4XWAA 1KOLA 4HX9A 5ICCA 2BI8A 2R7LA 3P9CA 1D03A 1EFDN 4G4SO 5FWDA 3G9XA 4DPMA 3TB6A 4W5NA 1SHLA 1UANA 1E9RA 5C5CA 1XRPA 3OESA 3ZLUA 4BMCA 5EHZA 4JVLA 5CIYA 4Z7NB 1R16A 3AOGA 3B6KA 3HEBA 3QYPA 5H4GA 2ZRQA 2RHBA 5LB4A 1XTJA 4U7DA 1K08A 5LMUB 1OLXA 1VYTA 2V5AA 3D8HA 1KYTA 1QO0A 4KB5A 4NFHA 5DGDA 1D6NA 1M2EA 4IUCS 4JR2A 2HRQA 4B6QA 3UJNA 2IBSA 1QHSA 3U49A 4DL9A 4HSEA 2Q7DA 3ACDA 3MNFA 3BG5A 2YNMD 3NVAA 5JNVA 2WTAA 3ZD7A 3MJVA 4GPTA 5JD4A 3CF6R 3C7DB 3E5MA 4CJXA 2GFHA 3CLHA 4X8OA 2VWQA 4U7FA 4BB9A 3AEKB 3V8EA 1B7GO 1GLNA 1LQUA 1NFRA 4L73A 5CDYA 2ASVA 1JTEA 1W0JA 3N6VA 1P3Y1 3T8YA 3OZAA 3VJKA 4F4DA 2MSCB 2VI5A 2X8JB 3E7FA 4FK8A 1FQOA 5AKEA 3OQ1A 5FNVB 2CMFA 1WD7A 2COKA 2HRBA 3Q3JB 3B6ZA 3QLUA 4Z0PA 1MB3A 1G66A 3IP5A 4HX2A 4KQFA 2VYQA 1DJMA 1CJSA 2WJPA 4CDRA 3N8DA 4HJXA 1H2BA 4R9SA 5TMPA 3EPKA 5CT8A 1T5DX 1QYVA 1Y9AA 4HOYA 4H17A 1C1DA 3S8EA 1WDTA 2DHEA 3OPQA 4MWDA 3HDGA 1KZ6A 1SD1A 1EP2B 3REQA 2XCRB 1ONNA 3P0EA 3LPLA 4QVKA 1PJ3A 2FX2A 1STOA 3VHXB 4V39A 1UDAA 5A4IS 1YQGA 4UCQA 3PTAA 1C81A 4O33A 2HMUA 5FPHA 3Q41A 4CN9A 1WETA 3SXJA 4UUNA 1HM5A 3R75A 1U8ZA 5SZJA 3H0EA 1IH8A 3X1XA 5C8ZA 1OPXA 1K5DA 4QUIA 5B53A 1KH3A 5D51S 3DTVB 4BO1A 1H0RA 1L1EA 2HSWA 4KSYA 3S2SA 1DFHA 2H9IA 1JVSA 4K9KA 4ZO7A 5BT8A 3PNQA 3QM1A 4G89A 2AWNA 4C0BA 3OKAA 2AMJA 1TM5E 2RBKA 3PI7A 2E0IA 2GK7A 4MUGA 1RWBA 4IR7A 2F62A 2YIJA 3IT3A 3N7UA 4X95A 5HE9A 1CXZA 1XZPA 2DXIA 1L8XA 1NBOA 2W4MA 5TR9A 3IQXA 2O07A 4NMHA 3LL4A 2YWGA 4QASA 1BMTA 4X63A 3ZU2A 5JNLA 2JS7A 2ZS8A 2Q0HA 5A6VA 1JHOA 2YWFA 1Q6ZA 2SKCA 3W5VA 4XI9A 2Q4OA 1GZ4A 2C92A 4ZZ2A 2Z56A 3H5LA 3KE9A 2CLLB 3T52A 3OY7A 1NBHA 1R6DA 2DWUA 3KLBA 3UATA 6AT1A 1P5ZB 2ODEA 3K5HA 1JEEA 2HNAA 2W9XA 2B82A 4GL4A 1NP3A 1DX4A 1R8QA 2NVOA 2P40A 2YL2A 2VQ3A 3P8ZA 5DASA 3PJEA 3J80A 4CM3A 1NVDA 4TWBA 4NENA 1JZSA 3DWEX 4OJYA 1R64A 3QKRB 2CKDA 3PLAE 1E7SA 4CUKA 2C4MA 3LGSA 3RNOA 4DIKA 1P1BA 3ERCA 2J30A 1J42A 1IAQA 2RGDA 4WZZA 4Y7DA 3JYPA 4DA6A 5K0GA 3JYNA 5A5DA 1AUXA 2R8YA 1TCVA 3N8NA 4ABYA 1ZK1A 4BAZA 4C7OB 2QLNA 2IHBA 1QIHA 2AJTA 2JFFA 4V3BA 5BV8A 2R8EA 3HCOA 4LHYA 2YHIA 2N46A 4PPGA 4BFVA 4C3UA 1ZP6A 1O96A 3N5KA 1H65A 5IMSA 4FCVA 4K03A 2FY8A 1NW4A 2VP3A 2AKAB 1QQ5A 1O08A 4KE6A 4R4JA 3GLVA 1HI9A 1U04A 1RKBA 5DI9A 5HSGA 3TXAA 1QTNA 1PR6A 3M9LA 4CQJA 1JFSA 1CE8A 3ISVA 1UM9B 1A72A 2C2BA 3LH5A 5HCNA 5JD5A 4AJLA 3W9BA 5LZ5A 4N6NA 1F20A 2IYWA 4KQHA 1NW9B 3JQ9A 4I9UA 2VSOA 3NHSA 5C7LO 3SOPA 3KELA 3LDFA 4AKHA 4RQUA 2JLVA 1S8NA 2Q2QA 4FZ3A 4PC7A 5TMBA 1MDFA 3R5SA 3QRWA 1TU4A 2JH3A 2FJ0A 3KKOA 1L5FA 1JDJA 2QLMA 1GCAA 2QG4A 2XOXA 4L22A 1MJHA 5JJIA 5HQ3A 4KBGA 4ZMRA 3PQ2A 3PF9A 4HGNA 1T24A 4WD3A 4MRMA 1M8GA 1B3RA 3OI7A 2JBHA 4HC4A 3W3ZB 4AF6A 3IRUA 4AF8A 5IN4A 1SXJB 2PJDA 1XCBA 4FFPA 4RELA 5AOAA 1NQOA 3D9QX 4FKZA 4DDHA 4YAJA 3QMPA 4F1WA 4RYDA 4ABTA 1GL6A 5DWVA 3WLKX 2H5IA 2ZITA 1DC8A 2R87A 1SVSA 3NOXA 3C5CA 4HI0E 2XDQB 1XZGA 3S1LA 2ZRGA 3N28A 3K0HA 4Y98A 1R6UA 1HEIA 1UFQA 3L1UA 1GGHA 2AG0A 3AIOA 4Y3UA 1R0YA 4MPTA 1O6ZA 2GAOA 4RSGA 3GA0A 2H31A 1OX4A 1XNGA 1YUMA 2W0SA 1OOEA 3HWRA 4QUBA 1N0IA 5E9QA 1BQ4A 3PFCA 5BVGA 3HR7A 2X9GA 4HWKA 2GKSA 2YWRA 2G6TA 2X14A 3LT4A 4YCNA 1R5JA 2UVQA 1O3YA 2ZB8A 3L0PA 4IIEA 4ENVA 3CF4A 3E58A 3HRKA 5DB4A 3KO8A 4WLOA 2VF4X 2WA1A 3F6SA 1GZ6A 3FMFA 4JI5B 4UTOA 3KTOA 4ESEA 3V8MA 1UKBA 3M5DA 3DBHB 1M6VB 1G20A 1WA5A 1N6RA 1XZAA 2XTMA 2ZWPA 3IVCA 4HDKA 3MJSA 5JCJA 5K0NA 3HDJA 3UCXA 2CBZA 4EKNB 5KWJA 2G40A 1PT6A 3TQCA 2FW1A 3BWMA 4P83A 1DWPA 3HL4A 1FU7A 4P3YA 5TXGA 1JPUA 2H92A 4I55A 5BRNA 2QD3A 1ZCFA 4R31A 2FXIA 1RQ7A 1YQUA 2ZYUX 4ZCQA 1JIJA 3DLTA 4ON9A 3TPFA 3GJYA 3AYXB 3HCAA 4CLXA 1CJUC 4PGHA 4ZC1A 3O4FA 3PFNA 1BGXT 3ZCUA 3NC1C 3QTLA 4YGYA 4WZAA 3RHSA 3KYIB 2F1IA 1W9MA 3OCWA 4TX1A 3VZPA 5LZ2A 1H4QA 3SIPA 2BKVA 4BFSA 1XCGB 2MR6A 3KQMA 3UBTA 1N2ZA 2G0AA 1NQUA 4QTTB 2XCSB 2Z04A 1GPNA 1U8CB 4FE4A 1P1RA 5FBZA 1KH2A 1NRWA 5I9BA 3T6KA 3VU9B 3ZKAA 3OP1A 4MUNA 4JROA 1L3BA 4GGOA 3OPVA 3VPDA 4B3HA 5CB6A 1W5AA 2GCGA 3LX4A 1N2CA 3Q9UA 4B3CA 4CF6A 3TOSA 2V8BA 4BN4A 2PBLA 4CMIB 4JI8B 5HHTA 2DRIA 4YVFA 2C00A 4LEIA 1Y1TA 2ATVA 4HQFA 1EVZA 5DIZA 2XMRA 5FR2A 3ZQ6A 4BZPA 4CKYA 5JOQA 1JALA 3AM1A 1VECA 2XRYA 1MJGA 3G0GA 5EWLB 4KPFC 3SZMA 3GT3A 6PFKA 3RVNA 2UXDB 1H9CA 3QLEA 4A1FA 3AG5A 4ZHQA 2HIGA 3CLSD 1PJAA 4AYXA 3RT7A 4B79A 4KRFA 2NTNA 1K8ZB 4CMCA 3DEAA 2P8JA 4LE0A 2XJ4A 4Q9AA 2CF6A 2UYCA 3HUUA 5FXMA 3I1JA 1R8XA 2AB0A 3W3AH 1CUZA 3MK31 4PIVA 4OXIA 3AGPA 4E7OA 1P8JA 1Z6YA 1YI8A 5C8YB 1QJ4A 1FYXA 2C4TA 2X2PA 4WOCA 3ANTA 3KJGA 4PV7A 4O02B 4JUIA 1QV6A 1XU4A 1B6TA 4LNUB 4HEA6 1EH5A 5EYPB 2A9PA 3HB5X 3TVDA 4LFAB 4E5MA 1C7ZA 3G0BA 2RHJA 2VYND 4ES6A 2CMDA 4WNYA 5HXAA 1O0BA 4Q4CA 3TD2A 4B1FA 4D42A 3E9NA 3M6XA 1QF9A 5CM8B 1HYGA 2CL6X 3EDYA 5B36A 5BQ3A 1D5CA 1Z4LA 2FG5A 2JIDA 1PAUA 1O0CA 2NPFA 1Y1KE 1RVDA 4A6EA 1T4GA 1Z2EA 2XADA 3MRSA 4YQEA 5IC5A 2BSXA 3H17A 1YS1X 3BK2A 3FFWA 3U4HA 3IKLA 4LA4A 4HUTA 1R0ZA 3SM9A 4KI0A 1MBZA 4FHCA 2WD7B 4UAGA 4D82A 1GIAA 4DREA 1GPAA 4EJSB 4D26A 3A9WA 4MO9A 3IV9A 1DO2A 4G37A 4D4HA 3L02A 2CYCA 2WSBA 3K05A 3LQRA 4DSTA 1XQ9A 1UJMA 1PR2A 1HTWA 2QPTA 4JSTA 5AKHA 3DCJA 1C1YA 5HTOA 1WKVA 1ZM9A 1XF9A 1UJ4A 1CY0A 1DARA 1A5AB 2G1JA 2ZSKA 2D3TA 3AESB 3DSRA 4ZJPA 3R5HA 9LDBA 1JV2B 1W29A 3HVIA 3KWMA 3M6IA 1UXKA 4GQAA 4OQFA 4ZVPA 3RTBA 4MPDA 1ZC3A 3LLSA 1ZMXA 4W6QA 2I2AA 1NUPA 2GF9A 2IRWA 4G9EA 2Z2XA 3AEQB 5ADHA 1N9GA 4HLCA 3AV3A 3COWA 1N3IA 3KDSE 2XW6A 4ZXFA 3ONDA 2IHYA 3WMEA 5MGNA 1NDQA 2DY0A 2EP7A 3T1VA 1FXSA 1L5YA 2NO4A 3I5MA 4OK5A 3H2BA 4Z3DA 4F3CA 4FZ5A 2MYUA 3DVAA 3WADA 2BUBA 1Z25A 1JYEA 3WMGA 2C3UA 1BHQ1 8AT1A 4EY6A 1JFRA 3OQ6A 1GL3A 4J0EA 4NULA 2ODTX 4PNZA 4R8RA 1A76A 2NADA 3PNOA 4AZ0A 4K8OA 2ZRAA 3E7DA 5B58C 4RDXA 3PS9A 2KHZA 1KYQA 3BXGA 4M9XA 4ETNA 1LUAA 2CFRA 1M2VA 3KVOA 1XE3A 1E61A 1CS4C 4LMRA 1O58A 2FQWA 5AOCA 3ZGYA 5HBRA 5EKDA 1QFYA 2BCEA 1TOAA 1NM5C 1RHJA 2E89A 3A4VA 5D87A 3VNBA 1KYXA 1SUSA 2O8DB 1ZH0A 4ZAVA 3BXFA 5FRDA 2JJ8A 1H2FA 3C87A 1A9RA 4I6EA 4EYQA 4QT4A 2OV6A 5JYEA 4PTZA 4RPGA 2H7YA 4BWYA 4DM3A 3CO5A 2H1HA 3CX6A 3I09A 1JQ5A 1Z62A 4NE9A 3TQOA 2PG3A 1FFXB 1ZGHA 1VL5A 1U0SY 2D2FA 2BZGA 1Q0UA 2GMWA 4A8JC 2BRUC 3COPA 1MHPA 2PO5A 2WICA 1K0FA 3SFVA 1TW2A 1FZTA 5FEUA 4CEHA 3EZLA 3GFPA 1IOWA 4QU0A 9LDTA 4P3NA 1SC1A 3G5MA 1QKJA 5JI3E 3DA8A 3G2JA 1CR6A 1JBQA 2OR3A 2POQX 2VT3A 5CFQA 2QTMA 5D86A 4MX8A 1TQHA 2J33A 3N39C 4Y6LA 4F38A 5ED0A 2JEOA 3QKWA 2R66A 2QQ0A 2W6IA 3GRYA 4NDAA 5J2TF 4IV0A 2JH8A 1CUVA 1WULS 3P26A 1UBFA 3AV0B 3KJQA 2J6BA 3PI6A 2X9VA 1PT7A 3ZHUA 4EO7A 2J7KA 1CQIA 4RZ2A 2ZSBA 4CM6A 3B2EA 1YVUA 4A0FA 4BRZA 5JZBA 5K6AC 1MW8X 1DQPA 1VJ5A 4HQLA 3MINB 3R0ZA 1R66A 3BH7A 5T7BA 3U4QA 3ZJVA 1NUHA 1ZGAA 3BMCB 3LIIA 3DAGA 3BFKA 1XNRB 2GEJA 2BFWA 4ZVQA 2OMEA 2R25B 4KV9A 4XFKA 4BB6A 3FX2A 3MMZA 2C0PA 4MVJP 5HW0A 3RVBA 3AFMA 1OE0A 2Q1SA 4IRXA 1T25A 5KYWA 3L18A 3LCMA 4ERNA 4MICA 2B69A 3LX8A 4Q12A 4DEVA 1J8YF 4EKYA 4DV2B 1NIPA 3EQ9A 3GHHA 3IS3A 3OOYA 2HQOA 4A5SA 1LSJA 3A9TA 2W22A 3AONB 2NO9A 4L78A 1LWOA 2WSSD 3U4IA 2POCA 2O8FA 2WTEA 4CIDA 3M70A 3ILHA 3QNMA 5A1TA 4WMLA 2CJXA 3K7EA 1DC4A 4QAQA 4I50F 4D45A 1F14A 4Q9LA 4XSGA 5FUVA 4OI0A 4DA7A 4CQMA 4UOZA 4A0SA 2ST1A 2JD2A 4YK7A 5K0CA 5KQPA 4K2AA 1KI4A 3V32A 5HUQA 5EJ8A 4Q7MB 4ZVMA 2ZJ1A 4UULA 3IKMB 3PC4A 4R71A 1T3ZA 4EKGA 1VRVA 5H7XA 4OY3A 5KYXB 1YVDA 4KVGA 3HO6A 5KO2A 1UMBB 3O75A 2QS9A 1B43A 3NETA 3GY0A 3QJYA 1DCTA 3RYHB 4EY5A 2AWOA 3VNUA 3M7IA 1UBJS 1SKMA 2LW7A 2Y0PA 4K3UA 3HG7A 1AD2A 4H27A 4M0KA 1JTVA 2EIHA 4ZAWA 3D5TA 3I73A 3P2JA 3ZWQA 1W5SA 4BL5A 3HTXA 2HL6A 2Q4TA 3N05A 4MVCA 2D1QA 1I3NA 1N2IA 1B0ZA 3HRHA 3LWZA 5BN5A 3EOBI 2BGWA 3IDZA 3X44A 3Q2IA 1L7MA 1W35A 2QF7A 3H6GA 1D1TA 1L4YA 1QR2A 3DNFA 1XWFA 2HKIA 4UU1A 2EX1A 3AF2A 4M49A 4MMXB 3E9MA 2AEMA 3X1WA 1T0JB 5FULA 5HMMA 3WL4A 1VSVA 1XTKA 3TCNA 1TJ5A 2YY6A 3UTDA 1HDCA 3KXIA 1W36C 3D8RA 2Z3VA 3E53A 4L2IA 4V0NA 2BZ1A 4DMMA 3ZJUA 2F8TA 3O8LA 4FUQA 3QVVA 1X1AA 1XDDA 4PHGA 2WWHA 2J6HA 4QECA 3VO1A 4ANFA 1PL8A 3FFXA 3KZOA 1R1DA 1VCIA 3H65A 2QAJA 1FFWA 4QJBA 1QKKA 3EGCA 1J33A 4HCJA 1C4OA 2V6GA 1CJVC 3TINA 3FYCA 1E2FA 3O73A 121PA 3NP7A 4D81A 1D9ZA 4V0MA 3G82C 3MCTA 2FOXA 4YCBA 3VI4B 4ZALA 2NV0A 5KEIA 4YJ2A 4PVDA 1KI8A 1T36A 2IPAB 3GJQA 3JWEA 3GFBA 4ESHA 3GNLA 5AI8A 2PQ6A 1KH1A 3BL6A 3DS8A 5FOSA 4D0RA 5A02A 4KE8A 5KSZA 3UPUA 2X7HA 4CI0B 2WT8A 2O19A 1R9NA 1QS0A 4G0QA 1Q91A 5CX4A 4DA0A 4MYTA 1PIWA 3ND5A 4BQIA 3SWWA 2GA8A 1QHXA 1J9ZA 1VMEA 2O3TA 3ODGA 4V0SA 3RS2A 3ZGVA 5KDOA 4ZAXA 2NXCA 4C0XA 1QZZA 2ZIXA 1JAYA 4M0DA 4UPDA 4TZTA 4LVCA 3OF5A 2H8GA 5DLEA 2OXEA 4BMDA 4WDQA 2AC7A 3RQSA 4E6EA 1YWGO 1KDOA 1RFGE 1I3KA 2HZ7A 3A6FA 1C8BA 4IUYA 1W46A 1A2QA 4YUWA 4MV9A 1KARA 2PD4A 2WYIA 1BDBA 2EW8A 2ZJ5A 2CNOA 2NUTA 3OLWA 3UN1A 3BN3A 2G36A 3IIEA 3HV2A 3E4CA 4KKVA 1P2FA 1JNYA 4NDNE 1YC5A 2AOVA 5I9IA 3O8QA 1XMQB 2NVBA 2BLNA 4MUEA 2ZYWX 4E2FA 1MABA 1UWKA 1ESMA 2AG6A 2YNMA 5EEHA 5GPBA 3BL8A 5CAEA 4ZFNA 4Q6WA 4PRYA 4FLMA 2A86A 1Z0ZA 2OCPA 3F98A 4B32A 1B93A 2QMHA 1R0CA 1JVBA 4QU5A 5JD6A 4L8FA 4BMSA 2XZPA 2MHCA 5FUXA 4HGPA 1P5HA 3PYXA 1PP4A 1W4LA 4XYEA 2DP4E 1LBQA 4MA4A 2X2EA 2Y1KA 3EZ2A 3KRTA 3A3KA 3D7SA 4GKBA 4EZEA 5B7PA 3EMVA 1P80A 1F2TB 4G5QA 1Y7TA 3UH1A 1Q0PA 3DKRA 4LJAA 4AKTA 4YPVA 3FHJA 4IGKA 1QPGA 5FOVA 2XDYA 5CCEA 4CCAA 3GCDA 5G0VA 2PHZA 1P31A 3RU9A 3IQHX 3QNWA 3G85A 1OB2A 3GJSA 1PL7A 4A92A 4NYIQ 2P68A 3HRIA 5EIFA 5IJ9B 5BW4A 3GLFE 2REBA 5EE9A 4OX9Y 4OHXA 2JRCA 3L3BA 1L4FA 4MULA 4IICA 3JQFC 4DJEC 4S24A 3DWFA 3OTWA 2X0EA 2BM9A 2RAPA 1KDRA 3W77A 2OWEA 4L9SA 4ZVOA 1S02A 1FSFA 1BMDA 3AHIA 1JDTA 2W6ZA 3CKLA 3MOGA 1R6TA 4FW8A 2DWPA 4C0AC 4LTNA 5ESDA 1DAPA 4LYGA 4FWTA 1JIKA 2O7QA 3LQKA 3O4IA 2IUFA 4PG8A 5HM8A 4G0XA 5K3SA 3TKLA 1PZMA 4X8MA 4BLVA 2EJWA 1TAGA 3GDHA 4JB0A 4W9NC 3F6YA 3TQRA 4DW8A 4RTRA 2JAQA 2OGZA 1ORWA 1D0IA 4JL6A 3V1KA 4HVLA 4B3MB 1B2RA 1GOTA 2EWVA 1GAWA 2JGLA 3VR2D 5B4TA 3NMUF 1EZZA 4BU0A 1OVMA 2CV1A 3WKDA 1NVVR 3F8TA 4J7AA 3DLIA 4PVCA 4B34A 4BJ1A 1Y3DE 3KFXA 2ZR7A 2RHMA 2LV8A 4YJHA 1N3YA 4M0UA 4LDPA 4BB0A 1T1SA 2HHHB 4GMHA 1UT6A 4FDTA 4W7HA 3KSDO 2DUMA 3MJTA 3NTUA 4PXSA 2C20A 2VHTA 4HGRA 1EVIA 4CDMA 3AOEA 3RUPA 3QVMA 3CPSA 2L0XA 1C2TA 4U9HS 5DYYA 4G0OA 5ERXA 1JEYB 4HWPA 3PFIA 3R4CA 3X1DA 1EG7A 1Q1NA 3WYGA 4PCUA 1E2KA 1VL6A 4CTMA 3E9QA 1WZ2A 1W88A 3F6PA 4AUKA 2XXJA 4ZQGA 3AHCA 3I32A 3JQEA 4A26A 4H0CA 2PNJA 1TAHA 1LQ2A 4RDCA 3OECA 4RNCA 3CR8A 3U1VA 1VSTA 2YWCA 4ZKEA 5K5EA 5COBA 4C87A 5BW6B 4LJRA 5KTYA 3DUWA 2AN5A 4JVNA 5K6TA 2LP4Y 5KUTA 4A8TA 3HEAA 3SAJA 1ZGCA 2EOAA 5IT9A 1PG5A 1Q21A 2FN4A 2PZJA 1E64A 3QVOA 3ZDEA 4F4IA 5CDFE 4F9EA 4NV1A 1MOQA 2AR0A 1G19A 1JJAA 2I54A 4UBOA 5ALZA 2VHQA 2O2GA 3EE6A 1M66A 1EXDA 2PX3A 1DQNA 1JKMA 2Q3CA 4AZTA 1NJ6A 2QYOA 3ROZA 4QNNA 3DYVA 4K9SA 1FDUA 2XUGA 3D1LA 4S3MA 1XZJA 5AM4A 4GM4A 4YRIA 4O3MA 1NQAO 3IHKA 1NLFA 3IPLA 3CCCA 3LPDA 1U28C 2GS9A 1ACLA 1L3IA 3LW8A 4UE2A 5SYAA 4IJQA 3EWSA 2AZ4A 3BA6A 1TM7E 3HKBA 4YJ3B 1X7YA 3GLGA 1NYQA 1DBIA 1VGQA 4NU6A 5BYAA 3FMIA 3OO0A 2R4TA 4I5FA 5AW4A 1XROA 3GLFB 5CPFA 4Q1DA 3NQ41 1Y48E 2Q6TA 3LFHA 1ABBA 2OXIA 2AV6A 3GAAA 3JWPA 3CR7A 5JVDF 4PLYA 1YTUA 1K7CA 4QYSA 1ZMTA 5FTJA 1E0SA 2XX3A 5A4FS 4NYMQ 5LBTA 2OGWA 4CM4A 2OO3A 3TIIA 1FMCA 1I13A 1B00A 5DBHX 3H11A 3S2GA 1BHJA 1MKYA 2GBCA 4Z6KA 2CDAA 1O94D 3FA2A 1U99A 3MJRA 3ONNA 1NLZA 3FUTA 4G3XA 3B60A 5BY2A 5CT4A 4CMJA 2X0IA 1Q2XA 3CNNA 4AD8A 4B7ZA 1EM8A 3MCAA 4RHXA 1E3WA 4FMDF 2DPMA 3OWOA 1T3HA 3EVDA 3ZXXA 1U2TA 1H93A 2C3OA 2H2HA 4MB0A 2LCFA 4NHEA 4Z1MD 5AVXA 3QKSA 1XDGA 2YICA 3ZZ0A 2JA2A 1Y8CA 1ZXBA 1P3DA 3M33A 3VO9A 4A36A 5MFZA 4FPXA 4RMGA 3HXMA 3IDSA 3NVMB 3LY5A 2BEVB 1BJRE 2C0CA 3UAWA 1F0PA 3KS9A 3QNUA 1XLVA 2D2XA 5SYNA 3WNVA 3C5EA 2FKNA 1P1KA 4FYPA 1SBCA 3B3JA 3I9V1 3NAGA 1R9MA 1TQ2A 2HJRA 1NJSA 1WU8A 2PPLA 2BFEA 4HNHA 3UOGA 4BBZA 4RPLA 4ACBA 4ITUA 5CFLA 1AKTA 3AF5A 2GTPA 3WWDA 2P8SA 4K5QA 2YMQA 3DZHA 5DYIA 3TVYA 2IXFA 5FYDA 4IM7A 3B2QA 4DIFA 3VGJA 3D0OA 3IXQA 1QX4A 2DU8A 1U5BA 1HLFA 4UHBA 4DTCA 4MQBA 4X91A 3X2EA 4B7XA 3VO8A 1WSWA 1EXNA 2C03A 1KJJA 3EQ6A 2FSVA 1SBIA 3I4FA 2EZ9A 1QMPA 2HWKA 1DKLA 2IYAA 4KNWA 5IWCA 1JKFA 1I7PA 3EVBA 3KKMA 1QDUA 1XC7A 1M67A 4YUVA 1O0SA 3CLUD 4EHIA 5EZ6B 1G3IA 3E7WA 1NMEA 1WXGA 3AETB 4D3XA 4YP6A 2XTNA 2EGUA 4YT2A 2W6NA 2PUGA 3E82A 4HAIA 3NEYA 1DG9A 4PSVA 2R751 1QVWA 1SBQA 1B3BA 1ESEA 2F48A 2JGRA 4U5XA 1NNI1 4CKWB 2ZLBA 1HG1A 1B73A 2PGLA 2H57A 2B36A 4ZI2A 1O5IA 1YZQA 2MSKA 3OA2A 3DAYA 3QBTA 2PXXA 2L17A 3Q3HA 3WGZA 3WLNA 2Q5LA 1K6XA 1F1BA 1K8RA 3LYUA 2PMCA 4B3DA 3HS3A 3MCVA 4D9JA 4TV8A 3FBTA 2DPGA 3FWNA 4P80A 5LMZA 3TZBA 2PYZA 3GN2A 3K16A 4I3GA 1XWIA 1CUDA 2G4LA 4BQRA 3ZV6A 1QXSA 3JALB 5AVYA 1GFWA 4FNOA 3U9LA 1OI2A 1VPLA 1Z5VA 4MAFA 3HNPA 3T3EA 5AJVB 1KAGA 3VC7A 1C8VB 3KR2A 2BEKA 1EWRA 2DERA 1Z4MA 2FE1A 3R3JA 3ZHXA 5BV7A 4O0MA 3IP9A 4UARA 1NYLA 2X5XA 1PS8A 1GXSB 4PO3X 5EERA 4BNKA 4V1CA 4YRNA 2B4KA 2D2EA 3N2EA 4NH0A 2D5LA 4JLAA 1TUIA 1B14A 2Y99A 1JNXX 3P2IA 3PFKA 1BD4A 1N2HA 3D6HA 3S1AB 4C2AA 1YFLA 2DB3A 1XTVA 5JIBA 3KQOA 2AH5A 1VRCA 4HP8A 2A58A 1NXQA 4PZCA 3B9PA 2AJLI 1R88A 4MCHA 1TUBA 1ZS9A 5CYPA 4DLLA 4RZUA 3RVMA 2JVKA 4O08A 1Y7IA 2IS6A 1ADGA 4XGKA 3ROKA 5IJ0B 2FSFA 4JBYA 3K9GA 4URUR 2Z0MA 3EZ6A 3GFFA 5FV7A 1DXOA 4OYHA 2NUAB 3UT5B 3UQZA 1X3SA 2W4IA 2Q29A 4J0FA 1UAAA 4UBKA 1GT6A 3MN1A 3PQCA 3TBFA 2Z2YA 2CUTA 1DC3A 3H18A 3DFZA 4NQRA 4TTAA 2PX4A 4Q1VA 1RPTA 2AMVA 1B42A 4ROSA 4YACA 4EA6A 2ONYA 5KNBA 1I32A 1JKIA 2H1CA 4JU9A 4DGSA 1GU0A 5BURA 4R8MA 1OC4A 4NATA 3UAGA 3WA6A 1VYVA 4LI3X 1H5QA 4G5GA 5DI3A 2FE4A 1EEHA 2CJYA 2QRZA 1KO1A 4JOBA 4WW0A 1Y6GA 3DEIA 2RB5A 4OM7A 2ZBQA 4J49A 4OUKX 4W7SA 1E5LA 2YW2A 2OLEA 1BFKA 3QWHA 1Z6TA 3RQIA 3W6PA 1YL6A 1ZFNA 2O48X 3Q0EA 1PJBA 5DTMA 1SVOA 4Q7QA 4R69A 5MDHA 1O97D 5J58A 2V6MA 5A4KA 2BY4A 4JUAA 3KOUA 5EMLA 3TLYA 4NCNA 1DE0A 3OBBA 1CS0B 3QQ5A 3CUSA 4KXWA 4DWJA 3OIUA 4FMPA 1X86B 2QZ4A 4CV0A 2ZAIA 3IKJA 1N5LA 2OENG 4YR9A 1UIMA 2H7XA 5T4EA 4OBEA 1IN5A 2CB9A 5BOSA 4EHBA 3AJDA 3LQQA 1UFKA 1XUOA 1S3FA 3NJRA 4NCXA 1NU8A 2VPZA 2YWJA 1KFCB 3HA3A 5TEWA 3JYOA 3SDBA 2E2WA 4GSYA 4F2WA 2HQSA 2PS9A 4OI2A 1GT91 4G63A 1EI9A 4IQ8A 5F2KA 4O25A 4BFCA 5IVDA 1RXIA 2XE4A 4LC0A 3L6OO 1WV1A 5D8DA 1N34B 1LDMA 4JSRA 1E3IA 1KSHA 3C6BA 3PFGA 1SB9A 1V45E 2G6BA 2IZ5A 2NPIA 3GZNA 1GSIA 2I2WA 2A0KA 1Z2PX 4OB6A 4XW2A 5E6SB 4ZVNA 3OCJA 3MGAA 4RY9A 4RPJA 1YDWA 1TQ4A 2ECFA 2YIVX 3D59A 1AUQA 2AFRA 2V9ZA 1PJTA 521PA 2R1UA 1TC2A 2WHXA 1TIPA 4FOSA 5EHQA 1T35A 1T6BY 3AF3A 3KR9A 1LDEA 4MJLA 5JEEA 5MN6A 2ENUA 3I83A 5FJJA 3L92A 3EIEA 3GQVA 4JJEA 1VE6A 2IITA 3T7KA 4FUTA 2B4QA 1MAUA 1ORRA 5A5FA 1U6KA 1NPYA 3KQNA 1E6EA 1NQXA 3TECE 1H4SA 2EFDB 2CCKA 4DSOA 1VG8A 1H0HA 2I4LA 1TTTA 4BYGA 3EFHA 4C0KA 1Q17A 1W85B 2ECPA 2QJOA 1LX6A 2XVMA 1NE7A 3DLPX 4JB3A 1DRWA 2HA5A 2WINI 3GRUA 5EPEA 4BLSA 4XRGA 1VBKA 4K26A 4OG2A 5DHRA 4XOIA 3D3JA 4DB2A 5H68A 2BM8A 2GEKA 2Y1GA 1CYDA 4JZYA 4Q21A 1GR1A 4B5LA 1GRRA 4TMVA 2FXVA 3ZDXB 2V0GA 5KJFA 2GYWA 3B7GA 3SSNA 4ZICA 2JLCA 3C3CA 3G9ZA 2J0UB 1V8ZA 1TJPB 2Q9UA 3BXZA 1H2WA 3JPYA 4GFDA 4M0CA 1INLA 3F0TA 4N8DA 2PKWA 3BHMA 4AJ1A 1R2QA 4HK4A 3ZHYA 4B44A 1W4ZA 1EVLA 1WPXA 4L9AA 2RIPA 2YN4A 3CH4B 3U31A 3WXBA 5HIAA 5IEJA 2C9OA 1K98A 3GV0A 4EJ2A 2F00A 2WSSA 1YACA 3IMKA 5HK9A 4FILA 2IP1A 4W8GA 5DYGA 4RTKA 5FUYA 1W73A 1C3OB 2OY0A 4CWAA 3Q2OA 1RBYA 1YRYE 4TTVA 4OJTA 3L40A 5LB2A 2ADMA 1LLQA 2FMTA 1XA4A 1YBVA 4OKIA 1F48A 4XQCA 5C31A 1H0KA 5JH7F 6NULA 4INJA 3K1ZA 3DT6A 1Z7WA 3QHAA 5M2QA 1Z5ZA 1D7OA 1VKNA 3PC8C 4JQZA 4DA8A 4TQAA 4LF7B 1OBCA 4MWSA 3PYMA 2OORA 4QYIB 3I42A 4BGEA 2QX8A 3OIVA 5EMNA 2X13A 3RAGA 5KX5A 2XKAA 4B2LA 3GB9A 5ARDA 1E96A 4Q9IA 2FU5C 4H7HA 3L0BA 1ZN2A 3QV2A 4Z4QA 4KIFA 4LDAA 5K3CA 1LI4A 3GT4A 3B1YA 5FOWA 5KMGB 4QJIA 2XGMA 1SH7A 4BTVA 2J5KA 4LJKA 2C5LA 3S7ZA 1U4OA 1P8AA 3ZW7A 3OG9A 1A69A 1NN0A 5H3HA 5L7TA 3IQGX 1RFLA 4DSNA 4W9MC 1D2MA 3Q6NA 4I5GA 4L7QA 4KAAA 2IXEA 5AW1A 5JDIC 5F98A 4BU1A 1HDIA 1QZUA 5EWJA 4EYOA 3B3AA 1JMVA 3FPHA 3OE5A 4FYYA 4J7XA 3S2UA 1KIMA 2P2SA 3SYKA 1V7PC 4PSAA 3TGWA 4KITB 3OT1B 1VCOA 1D1QA 3HCFA 4L9RA 3R6TA 3TKAA 1Z33A 3UIEA 1AHNA 1HY3A 9GPBA 1UF9A 4E3ZA 2OO5A 1I6LA 4HGQA 4ESOA 4S0ZA 3J7AC 5DP1A 2Q28A 1JU9A 4GO1A 2XGOA 3JZFA 5HOQA 2FR1A 3CO0S 2BF4A 3HUDA 2B8NA 1OIWA 1X80B 1LLCA 1KEWA 3BK1A 3H6KA 4LN1A 3E1GA 1NF9A 3G3EA 2WJGA 3HMKA 5E38A 4GPIB 4UBMA 3N8HA 1BX1A 4FIZA 3L7AA 3FBWA 2X2OA 3KM0A 3P20A 2P79A 2RCYA 3EVAA 2ZG6A 5EVJA 1C3JA 1HL7A 1OTXA 5J2UB 4NAUA 3QPWA 2X8WA 1J70A 1QYCA 5KI6A 1TXGA 3VKWA 5B1YA 5I7UA 1GUZA 3MF4A 2CFTA 2GO7A 3V8VA 3D5EA 2I7XA 3BGSA 1E1NA 3BWYA 1UJ6A 2GBGA 3RM3A 4FI3F 4UVDA 3SQLA 3ZHOA 4XUEA 1SPXA 1U8AA 2WPDD 3AC0A 3U4CA 4OX9B 1QIEA 3IPCA 1M6WA 2DM6A 5GZ1A 1H8HD 5CXSA 4PLVA 3SBXA 3V2GA 3FOEC 4X54A 3NB0A 4TT8A 3JD2A 3C8UA 4FVTA 4J8PA 3TLJA 2BELA 2QD5A 4D6PA 2ID9A 2RGCA 5LXTB 1ZVVA 1M3SA 2BI7A 1J90A 2R48A 4G1FA 2AMLA 4JP1A 5J5AA 2GN9A 2YCBA 1XZ8A 3CRNA 4OM8A 3N9IA 2LKCA 1EGVB 2JGEA 4YO7A 3UHOA 3CBGA 5HKOA 2QZZA 4FFBA 4D4KA 3H5NA 1YB2A 5LZ8A 4LFBB 5BQ5A 3UMCA 4R3UC 5F52A 4ALNA 1A9QA 4B6RA 4DRXB 4P4TA 4B87A 2FEKA 4CT4B 1OLSA 1OFVA 4IKOA 2OKGA 1J0EA 4Y2HA 1OFIA 3EH1A 5AI5A 3TEFA 4CQNA 4PHCA 3VHQA 4TUYB 1SB8A 2H8KA 5CX1B 3QWIA 3A1DA 5BUQA 1YVRA 1UOOA 1RYNA 3R9WA 2V0NA 3TTSA 2WHRA 3PGXA 2CNLA 4MROA 4RK5A 3OTOB 1XEWY 3CVJA 1HDOA 1B4DA 2B35A 2YXDA 4Z8XA 4CV2A 3DDCA 4RK7A 2PK3A 4EA9A 3UM9A 3PSHA 2VXBA 3GOQA 1ANKA 3KV1A 4C05A 3FLEA 3FMGA 4OMUA 1IK4A 2W2QA 3PBKA 2J9RA 3HWX1 4LTMA 1SXIA 1BS1A 3HLYA 4LRYA 4LW8A 1GGKA 1SOAA 1V16B 2H2GA 4O4LF 1WW2A 1JF8A 4LXIA 5IH7A 1Q6YA 3DOJA 3HXKA 4W1SA 3ZUGA 2AXNA 3ZDAA 4F04A 4QXMA 4BWVA 1J8FA 3CZRA 1GA4A 2AF4C 3PHGA 1PU2A 2B30A 3RRBA 3DOFA 1L7VC 4TYWA 3MAGA 2NSJA 3EA0A 4ERXA 5AW6A 1CEYA 4S1WA 5CLIA 4N9QA 3S2ZA 4UHHA 3L43A 3Q3CA 4FYKA 1RXSA 1ZNWA 3PRKE 4JFRA 4K9LA 3U7FB 4RH3A 3NIDB 1WMBA 1E7WA 2H54A 4UVEA 3RBZA 5JMOA 2BE9A 3HY4A 4YB8A 4EFNA 2CHVA 4NYJR 4QODA 4G5RA 1E3JA 5DYWA 3TK1A 3OZEA 4U8GA 4DR7B 2D1TA 5ALHA 1PVVA 1PUIA 3IEMA 3PLRA 4M36A 5K2MA 2NPOA 4C4SA 4DEYA 1NC3A 1TYZA 3T54A 3H99A 1PK9A 3C85A 1PQPA 1BG6A 2OZPA 3LXXA 4ND1A 3UKDA 2RGAA 3ZI7A 4YMWA 4W1RA 5JPCA 1P1HA 2C8VA 2HSEA 4X20B 3A2MA 1ZD3A 3E22A 1LH0A 1WO8A 1U3WA 1Y63A 3B1VA 1XQWA 3EGVA 2VCEA 3OM9A 3NAMA 4RFVA 1V4NA 4MCIA 1JL3A 16PKA 1Y8RB 2GN2A 1G41A 3GBVA 4UEKA 4NG4A 3VZQA 1L7OA 3Q9NA 4B0OA 1X74A 1Z0FA 5ITZB 2OCIA 4E4TA 3KJNA 2CLEB 3E6AA 1KP2A 5FADA 2CXXA 3O0TA 4HAOA 4LCJA 3W2HA 1YI0A 4QTXA 4HTFA 5DRTA 3FPFA 4K9PA 4AY3A 1Y3AA 2P2CA 1E1KA 4JNKA 4L9WA 4IKEA 2WOOA 1OLUB 5HJ7A 3L84A 1U63A 5T8KA 2NU9A 3PDUA 5ES3A 4N48A 1A9XB 1TL7C 1KPHA 4PO1A 3TLXA 1ZISA 1S0UA 1ICIA 3FY4A 3AVPA 1E7QA 4ARBA 5L8VA 2X8LA 1ZQ9A 1HFJA 4LX8A 1VIMA 3KJZA 3R7WB 3TDNA 3BC1A 2REQB 2X58A 4HATA 1OWMA 4X6XA 3CUWA 3JX9A 3W3AD 3LVBA 1JE0A 3ZWNA 1JIQA 4AWXA 5JZVA 1N3BA 3C70A 3RAJA 4UM7A 5J2TA 2FWNA 3MEQA 1W5BA 2YZGA 1BW9A 3TGLA 1Z08A 1KGSA 4BQEA 3FD8A 4JU8A 2BLLA 1IUOA 4MP8A 4P81A 3KQUA 2P1ZA 3OE7A 1CQWA 5FFMA 3UV3A 5KWVA 1E77A 3TFWA 4FNAA 4RY8A 3VA7A 5FLXA 1G3QA 5IG2A 1A77A 2WJYA 1L4HA 1GZ5A 2FSSA 3F6CA 4XX0A 1P7WA 1YZGA 5JAIA 3UGQA 2JLXA 2Y05A 2QSYA 4QUDA 3UW1A 3ZZ1A 1ECGA 4YGXB 5L7WA 3O2JA 4UMEA 4HUQA 1OXBB 1WMEA 1VOTA 2FSUA 1NVMB 4FFWA 4GX2A 4I66A 4QGFA 1K86A 2CK3D 4IH1A 4ETIA