1GXSA

Crystal structure of hydroxynitrile lyase from sorghum bicolor in complex with inhibitor benzoic acid: a novel cyanogenic enzyme
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
267
structure length
267
Chain Sequence
QQEDDRILGLPGQPNGVAFGMYGGYVTIDDNNGRALYYWFQEADTADPAAAPLVLWLNGGPGCSSIGLGAMQELGAFRVHTNGESLLLNEYAWNKAANILFAESPAGVGFSYSNTSSDLSMGDDKMAQDTYTFLVKWFERFPHYNYREFYIAGESGHFIPQLSQVVYRNRNNSPFINFQGLLVSSGLTNDHEDMIGMFESWWHHGLISDETRDSGLKVCPGTSFMHPTPECTEVWNKALAEQGNINPYTIYTPTCDREPSPYQRRFW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords P-(S)-HYDROXYMANDELONITRILE LYASE CHAIN A
publication title Crystal Structure of Hydroxynitrile Lyase from Sorghum Bicolor in Complex with the Inhibitor Benzoic Acid: A Novel Cyanogenic Enzyme
pubmed doi rcsb
total genus 77
structure length 267
sequence length 267
chains with identical sequence C
ec nomenclature ec 4.1.2.11: Hydroxymandelonitrile lyase.
pdb deposition date 2002-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1gxsA00
5AO9A 2HA0A 1T2NA 2WU4A 4JYPA 4B7ZA 5AIAA 5EFZA 3YASA 2DHCA 5H3HA 1CIJA 4JH0A 1GPNA 5ALXA 2JEZA 3X3HA 2C0QA 1YASA 1X70A 2XUFA 3O95A 2VJDA 2QM0A 1B6GA 3I2KA 4KAJA 4LYDA 1E8NA 1VXRA 3QBJA 4JUIA 4Y2PA 2RHTA 3GELA 4J7AA 2JEYA 4KEAA 5CH5A 4FLFA 4UBMA 5I9IA 5LZ8A 1UOQA 4ROTA 4BP9A 3WKCA 5I8PA 2PUHA 2J3QA 3WA6A 2ECFA 1GKLA 2VAVA 3KSRA 1GGVA 4G5XA 2QJRA 3H2IA 2XLBA 2VJCA 2I03A 5SYMA 5FRDA 5JZ9A 2RGUA 1JMKC 4BVLA 5LZ9A 3HABA 1D07A 1GXSA 5BWCA 2QRUA 5JIBA 5A7GA 3C70A 2H1IA 2NW6A 1A8UA 1GQRA 1HLGA 3AILA 4UHBA 1CUSA 4BRZA 4W63A 3LLCA 1FJ2A 2OCLA 2WHPA 3C6YA 2WM2A 5ALJA 1CUXA 5CTAA 5KWIA 1ZI6A 4N5HX 2LIPA 2VATA 3FYTA 1QLWA 5HFNA 3G02A 4LXIA 1P0IA 3V1MA 2UZ0A 3T52A 4PW0A 1K8QA 5AM0A 1DX4A 1TCCA 1CUIA 1YSCA 5K5EA 3IIIA 5ALSA 1FFCA 4H7JA 2OGZA 5AI5A 1HL7A 2X8BA 3C8DA 3RARA 4YPVA 2XMGA 1AUOA 1TRHA 1MN6A 3VJLA 2PUJA 2QR5A 4FDMA 5IVDA 3I28A 1C7JA 5JYCA 4Y7DA 4X93A 1G4HA 3DDUA 4B85A 1W52X 1GKKA 3EF3A 4P08A 1AQLA 4Y2VA 5AKIA 1JKMA 2WG0A 3WK5A 5HFAA 5DLPA 4W9RA 4AXBA 4K2AA 5JAPA 2O2IA 3D2AA 4EY6A 4V2IA 3BL8A 3QYJA 4QLOA 3S2ZA 5JANA 4BE4A 3IURA 4AO6A 3RM3A 5T4EA 1ZI8A 3AZQA 4BC1A 1N1MA 5K3DA 3H19A 3D2BA 2XUIA 4QLAA 2HA3A 1JJFA 1BROA 3JYHA 1HQDA 2VJBA 3PDCA 1VA5A 5JATA 2QTBA 3AZOA 5AM2A 4X94A 4PSDA 2DQZA 3DOIA 5AKZA 4G1FA 4BVJA 3D59A 2HRRA 4PSCA 3N2ZB 4UFNA 5CBKA 4CG1A 2VSQA 2C0PA 4A23A 3FLEA 3WK9A 1R50A 1ZGCA 5AKYA 2RAUA 5JASA 1XZFA 3SK0A 4JNCA 4WY5A 5AI0A 3DKRA 2HU7A 3WK6A 1ZD2P 4CCYB 5JD5A 2QKYA 4YK7A 2JGKA 5CT4A 4U2GA 2OPHA 1CUGA 2AJDA 3DYIA 4ZGBA 1CUFA 2X76A 4GW3A 3KWJA 1SCQA 2FUKA 3E3AA 4QWWA 5CH8A 1MPXA 1USWA 2WHRA 2VA9A 3U1TA 1JI3A 5T4BA 3C43A 3GA7A 4QDTA 4DNQA 2HL6A 1CQWA 3WQHA 1UXOA 1X2BA 2ZYHA 3R3YA 3FLBA 3LIIA 4KACA 3WZLA 2H7YA 4UBKA 1DWOA 2XUQA 4U2FA 1LGYA 5IVIA 4OUKX 3I6ZA 1CUJA 3E4DA 3R0VA 3PICA 4CG2A 1IUPA 7YASA 3WA7A 2H7XA 4H7HA 4JEIA 1EHYA 4XX1A 1XZEA 3W9UA 1H2XA 5ALMA 4J0JA 1EX9A 4N8SA 4W1PA 1X2EA 2C5GA 3A2LA 3VJMA 1XFDA 3LIPA 1T4MA 5HKBA 1KEZA 5LYYA 2XQFA 1EVEA 3R3XA 1YCDA 3OPMA 1WB6A 2WJ6A 5IKXA 1J06A 3AIKA 5A7HA 2XUKA 4RNCA 3E0XA 4BATA 4G4JA 5C8XA 3W2TA 1CUWA 1P0QA 1QIGA 3BIWA 2JGLA 1WOMA 5E4TA 4GWLA 3ZI7A 1ZJ5A 4FMPA 4U2DA 1CQZA 4X3CA 1AC5A 3CXUA 3FSGA 1U4NA 2V98A 4H0CA 3RLIA 4GHWA 2VQ6A 2VAXA 2JBWA 2RIPA 1EK2A 1VE7A 3NUZA 3AUKA 2PSJA 5ALWA 4HRYA 4J3JA 1UKBA 2RHWA 5ALIA 2B4KA 1U2EA 1WM1A 2O2HA 5HCUA 1GPKA 2BJHA 1EK1A 1UK9A 1I6WA 2DCMA 1LPNA 1GZ7A 1XRPA 3V1LA 2XLCA 5EHQA 4BBZA 1DWQA 4OB8A 1UK8A 3H17A 1BU8A 1XZMA 4FFVA 3I2HA 3L1HA 4GXNA 4MEBA 4J0DA 4EA6A 1ZD4A 4GLBA 1CFJA 4TGLA 1P0MA 4KAAA 1ISPA 4QDOA 3BE8A 3UUEA 5JAHA 1CV2A 4BDSA 3ICWA 1ZI9A 3HLKA 4BC0A 1W75A 2PSDA 1CUDA 1MO2A 4IH1A 3WMRA 5T4FA 1XRLA 4PF1A 4RPCA 5AK5A 2G4LA 3QPCA 2WKWA 1XRNA 3KOOA 4DTCA 2HA7A 1YS1X 5AKKA 3STWA 4GECA 4DYHA 1CVLA 2QT9A 3EBLA 4HXFB 2FJPA 5ALNA 5K3FB 2XQIA 1AX9A 3QVMA 4ZV9A 5ALOA 4DGQA 3HXKA 1MNAA 5T4HA 2Q0XA 3WKEA 1EH5A 4S0XA 3C87A 2CUTA 5FP0A 4F60A 4QA9A 4OYYA 4BAGA 2WILA 5EHZA 5F4ZA 4X90A 4K5QA 3FYUB 1XZCA 1ORVA 5HZGA 2XMCA 3EIOA 1QIDA 1UOPA 3QITA 4DLNA 3EQ8A 2V96A 3F96A 3GZJA 1XRQA 4E15A 5C81A 4IH9A 4C01A 1QIIA 4KE9A 3VVMA 3H1AA 2QXUA 1B41A 4IO0A 4XWGA 5A6VA 1QO9A 4Y2UA 2XUOA 4B83A 4B0OA 3H2GA 2ZYIA 1DINA 3DS8A 1K63A 4B9EA 1U65A 3AJAA 2BUBA 1FFAA 4EHBA 2QS9A 2HA4A 2FX5A 4AZ0A 5DNWA 4UHHA 2PVSA 3WJ2A 2WTNA 1R1DA 3I2JA 1ZIYA 4IHAA 3VDXA 1XRRA 5ALKA 4WFIA 5CT9A 2WG2A 3K6KA 4LXGA 2I3DA 2WIGA 1QONA 2AJ8A 2J3DA 4K6KA 4H77A 3M3DA 4L0CA 1XQVA 3DEAA 5LKAA 3D2CA 5KBYA 4ZRDA 5KWJA 5E4JA 1EDDA 5HKAA 3DKKA 4M0MA 3WWEA 1Y37A 3C45A 5EGNA 4HAIA 1C7IA 4PSUA 3G0BA 4ITVA 2ZJFA 3KXPA 1TCAA 5JZSA 2XUPA 2XMQA 4J03A 3WWOA 1G42A 3RK4A 2PU5A 4EY5A 2HFKA 1SCKA 2R8BA 1NX9A 3P2MA 4B80A 4BTVA 3H1BA 3D3NA 4F5ZA 1VZ2A 3AZPA 5AM4A 1K4YA 5DNVA 2WHPB 2CEKA 1DWPA 1Q84A 5LLSA 3HJUA 3AIOA 3AINA 4Z49A 4UFPA 1TKRA 4H7IA 1CEXA 2HA2A 1YB6A 4O08A 5EHNA 3DYVA 1QE3A 3OC0A 2VEOA 4WFJA 2O2GA 4RE5A 1JMYA 2VJAA 3F97A 2HDWA 5FOQA 4I3FA 1WB4A 2V97A 4AO8A 4L9AA 1UZAA 2GBFA 1F8UA 4W1QA 2J4FA 4MQLA 1YB7A 5HF5A 2PSHA 1QJ4A 3TRDA 2BGRA 4D9JA 1UFOA 1Q83A 1THTA 4Q3OA 2G5PA 3LS2A 1C4XA 3LCRA 5DNUA 3FSGD 3WL6A 3PF8A 1LZKA 2XMDA 4H7EA 1EI9A 3E1GA 3DL7A 2VTVA 3C6XA 4Y2YA 1BCRA 1OCEA 1UK6A 4JYMA 4CIBA 2OCIA 3ED1A 1QTRA 2OQIA 5A62A 2WFLA 1XLVA 4NVRA 2QXTA 4PNZA 3HYSA 3RKSA 3H04A 4QWMA 1EB9A 4AN1A 4U2BA 1LZLA 2B9VA 3QZUA 1W76A 2WFMA 4HXGA 2GBGA 1A88A 3A2MA 1TQHA 4HXEB 2QUBA 3WWPA 1JJIA 3ESCA 4PQEA 1Y7HA 3STTA 2DHEA 1E8DA 4WY8A 2PPLA 3PE6A 5AI9A 4H18A 4FNMA 5FXMA 5ALZA 3C8HA 1BE0A 5DWDA 1ZIXA 1J07A 1RWQA 3B3QA 4HS9A 4OB6A 4BCDA 2OG1A 3A70A 1DQZA 3STXA 2I3ZA 1LLFA 2WUGA 4YX9A 2XMBA 5AI4A 5LP1A 4X97A 4B9AA 5FUMA 5HQ3A 3NOXA 2JGMA 3TJMA 1TK3A 1OXMA 1AZWA 1WPRA 2DSNA 5ALGA 2B20A 4TVKA 5AM5A 3WL7A 4DSZA 5A2GA 1H23A 3IUNA 5JALA 1A8QA 2Z8ZA 4MYSA 2XUAA 4UBJA 2XUDA 1DT5A 3BIXA 3MGAA 1XQXA 5DYWA 4WDRA 3NWOA 2XB6A 4W1SA 1J2EA 3QMVA 3DNMA 4NS4A 2DR0A 5C8ZA 2O7RA 3G8YA 3PUHA 3DCNA 5AP9A 3VXKA 3O4IA 3WIBA 2JGIA 1SC9A 1QTIA 3V9AA 1XKLA 4FFWA 1XZIA 3F9CA 5CW2A 5AKJA 6YASA 1OILA 1XZBA 1ZOIA 3U0VA 4EY4A 2PSEA 1W1IA 3WYDA 4AN0A 3A6ZA 2ORYA 2XUGA 4PV7A 2HRQA 4MQMA 1E8MA 3W05A 1MX1A 1WB5A 2HHAA 3NGMA 4GDMA 2EEPA 3FWHA 4QDZA 5ALQA 3O4HA 3M81A 3R3ZA 3QPDA 3HZOA 3QM1A 5EI5A 4RGYA 4MWTA 3Q0TA 1SOMA 4LYEA 1LNSA 1JU4A 1RYYA 3FVTA 3S8YA 3WKDA 2HFJA 4N8DA 2D0DA 1FFBA 4AX4A 5D3ZA 5HF9A 1ZD3A 4B6GA 1AGYA 1L7RA 3WK4A 2DQYA 4XVCA 2FJ0A 4G8DA 4J0CA 1ACLA 3GFFA 4C88A 5AKHA 1H2ZA 4G8CA 1F0PA 1VLQA 3STVA 4N8EA 4OYLA 2G63A 3TEJA 1EVQA 2XT0A 1R88A 5AK6A 3UUFA 3EQ7A 5IH7A 5IVKA 1NU8A 1JT2A 2RONA 1UKAA 3I6MA 4KJXA 2BFNA 4A16A 4U2EA 4UHDA 2ZJ7A 3WKBA 2XMRA 5CMLA 2BCEA 5E4YA 5EHXA 2GYUA 2VT6A 3W04A 2PU7A 2CZQA 3HI4A 5CRIA 1M33A 3PFBA 1U8EA 4UBOA 1Y7IA 2GZRA 3HSSA 3WL8A 4DMFA 5CURA 2W22A 5ALRA 5D7BA 2ZSHA 4Q1VA 4RE6A 2GBCA 1P0PA 2Y6UA 4KE7A 1E89A 4C4YA 1XZLA 5AK4A 3AIMA 2EDCA 2OCKA 3H18A 4E11A 4WCVA 3G9UA 1FSSA 2BUCA 2WG1A 1QIHA 1WHTA 4G8BA 1MAHA 3MUNA 1H22A 3ZPXA 3H2HA 4X6YA 1IZ7A 3HEAA 5FV4A 4K6GA 4LIPD 2WHQA 1HKHA 3ANTA 4BB0A 2B61A 1PJAA 2O7VA 5AKXA 5LZ5A 1XZKA 2HM7A 3FAKA 1VOTA 3O9VA 4F21A 5DTIA 1J1IA 4DMCA 2ES4A 4IQ4A 1EDBA 1NU6A 4UBLA 5C7YA 5ALHA 1BS9A 2WIKA 2WQZA 1CUAA 4J0HA 3WK8A 5AIBA 5LZ4A 1E3QA 4DM7A 5EIEA 1JFRA 5AI6A 4EY8A 1JJBA 4BAUA 4F0JA 5JZBA 4I4CA 3V1KA 5AKEA 2XI4A 2X5XA 3ZWQA 1QZ3A 3ICVA 1W4LA 1VJ5A 4C4XA 1QIMA 1HDEA 5DJ5A 2K2QB 5AHXA 1YA8A 1XKTA 1GQSA 3WJ1A 1CUBA 1EINA 2C5FA 3DD5A 2YH2A 3FVRA 2OQVA 4BDTA 4DNPA 5LIPA 4P93A 1O6GA 1ZJ4A 2AJCA 1G5FA 3ESDA 4AO7A 4I19A 1CUYA 5SYNA 4ZI5A 4BAZA 3QMWA 4Y2TA 5K3BA 2E3JA 3C5WP 5HK9A 5AM3A 4UHFA 4K6HA 4KYVA 3WI7A 4DIUA 1K6EA 4QEKA 5AOAA 4H7FA 3V48A 2Z3ZA 3F67A 3OG9A 3ZLTA 1Q0ZA 3BWXA 3KD2A 5ALVA 4Y2JA 1XZHA 1BRTA 4MEAA 1BEZA 1YS2X 1CUUA 2WIFA 4C89A 1HBJA 2ACKA 2H7CA 1K5PA 3I2GA 3OURA 5CXXA 2PBLA 2ACEA 4OPMA 1VE6A 4AB1A 2VF2A 2WJ3A 2G5TA 2IX9A 5D3KA 2HA5A 1XLWA 3MUOA 5CT6A 2BKLA 3KDAA 1F6WA 5ALEA 4DSAA 4WJLA 4BVKA 4HTAA 1UKCA 1QFSA 4ARBA 5K3FA 4QNNA 1AURA 2ZJ6A 1BEEA 2WTMA 4QE3A 1KU6A 3VVLA 1ZGBA 1YAJA 5ESRA 3HRHA 1XZJA 4MJ3A 2WIDA 5KREA 5AKGA 5K3AA 2RI6A 1HPLA 5FKJA 1EA5A 3F8SA 1LPSA 2BAGA 3SX4A 4H7KA 4EZIA 4E14A 2C7BA 3FNBA 2PX6A 1SCIA 2CBGA 3WK7A 4Q82A 4KE8A 2WFLB 2H9YA 2C58A 4OU4A 1DU4A 1QO7A 2ZSIA 1R4ZA 5HF6A 4Y2SA 5AK3A 3R40A 4GEGA 4X6UA 3ANSA 2QMQA 4B81A 4C4ZA 1XZGA 1FFDA 1IMJA 3B5EA 3O0DA 2OAGA 1CRLA 4INZA 2CJPA 1FFEA 3ZV7A 5LZ7A 2OAEA 1WPXA 2JGFA 3M82A 4CCWA 5JAUA 3QMMA 4TPKA 5IVHA 2WUDA 3PUIA 2I78A 1YR2A 2EDAA 4UPDA 4P9NA 2Y1KA 3SWWA 2WIJA 3B12A 4FWBA 1CUZA 2HIHA 3G0CA 3V1NA 3FOBA 5ISMA 5HQ3B 2WJ4A 5FLKA 4EB0A 4XJVA 3UMJA 3O4GA 2HU5A 2QVBA 4ZWNA 4B84A 1G66A 5I7UA 3WWCA 1TAHA 1H2WA 2YYSA 2OCGA 5ALLA 5CXUA 3IULA 1CUEA 2AJBA 4Y2RA 4BRSA 2D5LA 2AJLI 2HADA 1XROA 1BN7A 4ZXFA 2C4HA 3PFCA 4MYDA 3OM8A 4UHEA 1BCSA 1TIBA 5K3EA 2XQGA 2CMFA 4FTWA 3G9TA 4BZWA 2WUEA 1XQYA 3LP5A 3ZLUA 5AKLA 1LPOA 2R11A 3L1IA 4UBNA 4AMZA 4GBGA 3OOSA 4Q05A 2XDWA 2CB9A 3FYUC 1W6RA 1ETHA 3IUMA 1Z68A 4H35A 4G4GA 2XMZA 4OU5A 5E2IA 1S8OA 3SC2A 3TGLA 1IZ8A 3T4UA 3BDIA 1DQYA 2Y2UA 3L1JA 2VT7A 4KE6A 1MU0A 1CUVA 2ZVDA 1CUCA 4BYMA 1GT6A 1LBTA 5CT8A 3VISA 3ESAA 3JWEA 5BV7A 2JIDA 5DTJA 3R3UA 4X95A 4FBMA 3WL5A 1ODTC 1XQWA 4BCBA 2YASA 3DQZA 4DNFA 3WWDA 3I2FA 1A7UA 1O6FA 4FKBA 3W9BA 1RP1A 4Q34A 2QJWA 4LXHA 1CUHA 4EY7A 5D6OA 1QFMA 4FNGA 4X85A 4KRYA 1R9NA 4Y2QA 1IUNA 3I6YA 4C6HA 4HRXA 1QOZA 4CG3A 4FBLA 2WFZA 5AOCA 2XE4A 3FCYA 3EQ9A 1YAHA 3D4LA 4HVTA 5FDFA 3BF8A 2PL5A 1L7AA 1ODSA 3IUJA 2GYVA 1QIKA 4FLMA 3O4JA 4FHZA 3I2IA 3C5VA 3IDAA 3R41A 3Q8WA 5YASA 2ZYRA 3O9MA 4B82A 1LBSA 4NMWA 2OGSA 2QOEA 1E5TA 5AM1A 1DTEA 1ZD5A 1DT3A 3WYNA 3FCXA 4CIAA 1WHSA 3GROA 4OB7A 3BF7A 4OD0A 1VXOA 1L7QA 4L3WA 1LPBB 2PM8A 4GI1A 1VZ3A 3C6ZA 4DNOA 4Q3KA 3CCCA 1XZAA 5ALDA 5AICA 1LPAB 2BGNA 2Y2VA 1VKHA 3G0GA 4ETWA 1UT6A 3G9XA 2OLEA 3QH4A 2ROQA 1CR6A 5EIHA 4KAFA 1ZICA 2AXEA 4X6XA 5J3JA 2YXPX 2WSLA 3VJKA 2ZYSA 2WUFA 2WLSA 3G0DA 2PSFA 1UOOA 3W06A 2JF0A 3IB3A 5FPPA 2XQJA 1CLEA 4U2CA 3WKAA 4UBIA 3GBSA 5K3CA 3IUQA 2PKYX 4BTLA 5AOBA 2OXEA 1LPPA 1E66A 5BOVA 3IBTA 2IIVA 5A71A 3A2NA 3HACA 4CCYA 1QIFA 1ACJA 1A8SA 4KR0A 1DX6A 1PV1A 2DFPA 3ZLVA 4QDXA 3FLAA 3ILSA 5EIAA 5ALTA 4X91A 3PI6A 4Y2XA 4C87A 2QUAA 1QGED 3G9ZA 4X7BA 4BZZA 4YASA 3DL4A 3I1YA 3D7RA 2XQKA 1R3DA 4CFSA 5AJHA 4L72A 3DJYA 4ARAA 5DYTA 3DLTA 1WCYA 5DYYA 3K9BA 4EUSA 4BCCA 1N5MA 4FOLA 1IUOA 2HA6A 3OTQA 4XIIA 1VA4A 4G9EA 2P8SA 3KWFA 1JU3A 3K2IA 3AFIA 4MXDA 1Q0RA 3FBWA 4M0FA 4LKOA 5HF8A 5C8VA 3WLAA 1XZDA 1GPLA 3BJMA 2GYWA 4P92A 4QZVA 5JD6A 2XUHA 3QPAA 2W6CX 4ZREA 4BP8A 4UHCA 3H2JA 1PFQA 1N8SA 4HZGA 4A5SA 2GZSA 5CH3A 4G4IA 5LZ2A 5ALFA 2XUJA 1QIEA 1THGA 4J0IA 3MVEA 1XRMA 4Y9SA 2GBIA 3STYA 5JD4A 2Z3WA 4MWSA 3PF9A 4B0PA 2JGJA 3ESBA 4KRXA 4ZV7A 3IVMA 4X00A 5AH0A 1EDEA 4X92A 3BXPA 1UWCA 5BWBA 5LKRA 3CCBA 3R3WA 5ALYA 5JAOA 5JADA 1R9MA 2WU3A 4X71A 4W1RA 4EBBA 1LPMA 1TCBA 3I1IA 4LHEA 4BE9A 4WDQA 4E46A 4WFKA 2CKMA 3CN7A 5A7FA 4DMKA 3G7NA 1IVYA 1MAAA 1YA4A 3STUA 3G0IA 5JARA 4UFOA 3BJRA 1EXWA 4QDUA 3DOHA 4FLEA 1MX5A 2ONCA 3N0TA 1MNQA 3IA2A 3H2KA 1F0NA 2IITA 1UK7A 5ALUA 1ODCA 1MJ5A 4OSEA 1ORWA 4Q3LA 2QZPA 1CPYA 2BUAA 1EB8A 4N5IX 3WZMA 1H2YA 1KU0A 1N5RA 4AMYA 5FPQA 4H7DA 4DMHA 2JGEA 1AMNA 1MT3A 5HK8A 3BDVA 3F98A 5ALPA 2Z5GA 4J0GA 5AI8A 3GUUA 4NZZA 2Z8XA 3M83A 1BN6A 1XLUA 2Y6VA 4AZ3A 1QIJA 2XMSA 4IH4A 1MTZA 3CN9A 3R3VA 3HC7A 3D5EA 3FYUA 2OGTA 3JW8A 4PO3X 3D0KA 4J0KA 4AQDA 2DHDA 1SFRA 1MX9A 5CT5A 4OCZA 2HU8A 4G9GA 4CI9A 3WIOA 1AKNA 4UUQA 3C6BA 4M0EA 2V9ZA 3H0CA 3VKFA 2J4CA
chains in the Genus database with same CATH superfamily
1E92A 2R1VB 5F76A 2XGSA 4FFPA 3K8YA 4Q9IA 2OXIA 2P27A 3T6KA 4B7ZA 1HKUA 1AH2A 2GEJA 4WK2B 4JCCA 2BL4A 5EFOA 2GNPA 2ZFUA 5BUZA 3QJYA 4EG6A 3LX6A 3OEWA 4JLOA 2FPGA 1S96A 1CIJA 1Y8RB 3L4BA 3FHTA 2XB2A 3VKGA 1RC0A 4NMHA 2JEZA 4FKZA 1IXSB 4R31A 1SXPA 3B60A 5EY5B 2JK0A 5BMVB 4TL8A 2HQRA 5E7JA 1CZKA 2K2WA 2A9PA 2GHIA 2NTYC 5TDHA 3BBPA 3I2KA 4E5VA 4RTNA 3HCOA 1LUAA 3LHKA 4ZCSA 1I6KA 3X0DA 4LRQA 3O8LA 1OXTA 1AE1A 1TVKB 3CR3C 4AKEA 4B6EA 3I52A 3QBJA 4WZAE 5DNEA 1GA1A 4E2XA 5TY0A 3NBYC 2QTLA 3V00A 1XK7A 5EE9A 1QAOA 1PX2A 1NLYA 2G5GX 8ABPA 3SIRA 4X1OA 2RHTA 3GELA 1XP8A 2IYYA 3KUXA 3W1WA 1HZZA 4LX8A 2EJUA 3SXJA 3FMFA 1LKZA 3DC2A 2BM0A 3K31A 2XDQB 2YOFA 3GCGA 3VO9A 5JNRA 5CH5A 3MPUA 1P33A 4FLFA 3GMTA 5TQ0A 4QUDA 3GAFA 1E9SA 1E18A 1ULAA 3PXGA 5I9IA 3UV6A 5EE3A 2W0SA 4GPTA 4BP9A 3WKCA 1N2JA 4UXHA 2WJAA 4CKBB 2E85A 1JILA 2FOXA 4CEIA 3JD0A 1N6OA 3LQFA 3PC3A 5TT0A 5FL7A 5FTLA 1D9XA 3BE5A 3UPDA 4BQOA 5KNBA 4IWYA 1YBVA 1C3EA 1CJTC 2FFQA 2JFFA 1ZMBA 1WIWA 3T54A 3LY9A 4ARIA 1EX1A 2D2EA 5TC4A 5KI6A 1YB5A 4P3NA 1P2VA 3B1JA 4U6QA 4NCNA 4ENQA 2AG1A 4G5XA 4J8PA 3H2IA 4BVHA 4IIDA 1CZNA 5ARBA 2QMZA 3PVSA 1EXDA 5G40A 1AXRA 1II8A 1M7BA 2GLUA 4M8LA 4P86A 5SYMA 4PNHA 2UXCB 1SVIA 2IEAA 3T1QA 2Y9PB 3UTCA 5LZ9A 1T3SA 4DKJA 3PL1A 4V24A 5BWCA 2QRUA 3OZCA 4OXQA 2DMRA 1ORRA 1OI4A 5HIMA 4R5MA 2QI9C 4YALA 5I7WA 3RAFC 1XTRA 2K6GA 2P7HA 2AF3C 3BCUA 2B8NA 4MS4B 1XDBA 3IYLW 2D1YA 3IMEA 3MWDB 3VHRA 1W59A 1DBIA 1PQYA 3KU1A 3N3AC 3JRNA 4GMHA 3CEJA 2NT3A 3DMYA 5HA5A 3HXQA 5EYPB 1CUSA 2VHWA 4ADSG 4D4MA 2FK7A 4WSOA 1KO1A 2C97A 1RWVA 1SIBE 5I9BA 2JA2A 3LLCA 2F1IA 1VMDA 2OCLA 2JAQA 4FZJA 4R1UA 4R71A 2FF7A 1FS5A 4KBFA 4D1YA 4JI8B 3K6SB 4I50B 3M4YA 4CHGA 3S1AA 3W4KA 4DVJA 1ARZA 2AD1A 4HRVA 4A1OA 3RF7A 1IOZA 3QELA 5E1MA 2ZM6B 3S8MA 3ZQKA 2JNWA 4E4YA 5HFNA 4F8YA 5JWOA 2FEPA 4CM4B 1GYQA 2ALJA 1PJCA 4LXIA 1B74A 2VSXA 1P73A 1EP9A 1SG9A 2O0MA 5SYAA 3V7NA 3AOEC 4RXTA 4GQAA 5TGZA 2VUSA 2QLLA 3HKDA 5FULA 1JDBC 3G79A 4OQLA 1DEKA 4PW0A 4ZGWA 3QU4A 1GYRA 4TTVA 1FUYB 1PSWA 1YU9A 5CXQA 1I32A 1VHTA 3ZY2A 2BMJA 2DHQA 1SQ5A 2O2CA 5BSEA 1FDOA 3BQMB 3HCWA 2ICAA 2QA5A 2CHEA 1JIKA 4MYHA 3WGGA 3DBOB 5BSFA 2E18A 1NUSA 4W5NA 4JP5A 3SSOA 4RQTA 4QG7A 1TCVA 4F56A 4K0KB 1Q6ZA 1QHYA 2C4WA 2IXEA 2OGZA 3EJ6A 4E4RA 1PLKA 1T5HX 3QSGA 2BTEA 4NYJQ 2QTTA 1IUKA 3L01A 5D8DA 5FT9A 4YPVA 4PQGA 4WLNA 4H15A 1O5OA 1FRVA 1WKVA 4BXOB 1TRHA 2D0OB 1MN6A 3IAUA 1P1BA 1YS9A 1JHPA 2DR3A 2OG2A 1KFKB 3M1AA 4MVXA 4PLTA 2PUJA 4RJ2A 5ENZA 4FDMA 4O33A 3CFYA 3QBVA 5H9VA 3RB8A 2AGVA 4CL2A 4MHTA 5JYCA 5IKPA 3FTNA 4B85A 5DNYB 2R86A 5FPTA 4C3ZA 5DCUA 3IQFA 4M22A 1T10A 1IVSA 2ZBPA 1T1RA 4QYMA 3N2GB 1NXQA 4Y2VA 5CDFA 4E4TA 3URKA 2ONJA 2GNOA 2YFHA 2AUTA 2CE7A 8AT1A 3WVNA 1AKTA 4WWHA 2P11A 4EW2A 2BGWA 4PGGA 2DM6A 3JQFC 2RBGA 4BWGA 2VJQA 3KJQA 2PGAA 1KMQA 4I6GA 2QTVB 4PSKA 5DH9A 4EL0A 4X1IB 3TI7A 4JIMA 2PX2A 2XVYA 5SY4A 4JX8A 3D2AA 3GWGA 1YQWA 2GT1A 2X2PA 4Q3CA 5T5QA 4DCGA 4CIYA 3HK2A 2Z1MA 4ZCPA 4QLOA 3IILA 7AT1A 2WJWA 3WGNA 1P72A 3E58A 1IPFA 2FR0A 1R6DA 1D5CA 1ZRSA 1A69A 2W70A 4CQMA 1K66A 3PGA1 4BGVA 1R6AA 4C7OA 4BECA 4AO6A 4R69A 1YB4A 2QD2A 4ZDIA 2AOWA 3BFXA 1ZI8A 2GAAA 2YWJA 5HZKA 2INGX 5H1YA 1H4SA 2IYRA 1EM6A 1BRMA 1U1GA 2BKUA 9MHTA 4W9NA 5DCYA 3ILYA 1YACA 3KR9A 3RE1A 4G56A 1JJFA 5LJLA 1USIA 3NEYA 3TZQA 4FCWA 4P53A 3AXTA 4FMBB 3Q0EA 2G0TA 5CEEA 1HTTA 3PDCA 4YLGA 2XAUA 3BH6A 3HU3A 2XAAA 5D5QA 1L9KA 3QUQA 1J25A 4P83A 4PSDA 1R8JA 4GG1A 1XCBA 4V0MA 3DOIA 2RJ3A 5KSOA 1NXVA 2AMVA 3C6QA 3FTQA 4G1FA 4U0KA 3II6X 4WE3A 3GV0A 3QXJA 5CXSA 2W2KB 1BXRB 3AUYA 2A5JA 2IELA 3P9QA 1YRAA 2ZPAA 1RWPA 5PGMA 1AUVA 7REQB 5FH9A 3TSOA 1VGRA 3I34X 4UFNA 3EDYA 1R0LA 1E3MA 1PN3A 1W6UA 4QJIA 3CR7A 5I7RA 3KQLA 4U02A 4YCJA 4YRPA 3V3KA 1LJ8A 2VSQA 5AJXA 3RVLA 4FZ5A 3ISVA 1THMA 5AUOB 2OBYA 1H6CA 2OFWA 4A23A 3P19A 1GHTA 3OZXA 2XRZA 3L82B 3LQQA 4KN5A 4UNNA 3F3SA 2HLDA 2CFCA 3ANYB 4TLCA 5CLHA 4MGIR 4I66A 5CVCA 5DLYA 4EB6A 5IJZA 5IULC 2CJWA 1CRZA 4QYXA 2I5PO 3SK0A 3JALA 1EEXB 3ZQ4A 3DKRA 1U0TA 3ABOB 1JIUA 1RNLA 4RKFA 4UMVA 4XYBA 3WK6A 1M2OA 2H52A 2AN4A 3SZLA 3UXHA 2C2BA 4TXJA 5CT4A 1JEYA 4E5SA 1PDVA 3GF4A 3MCVA 4RA6A 1BDHA 3DFFA 2J9GA 2HQOA 4FB4A 1LWNA 2J9FB 2B2NA 2OFPA 2Y1GA 4YUYA 4OOFA 1O94C 4ZGBA 3KT6A 4V0LA 4PLYA 2A35A 3A4TA 3KWJA 1YMQA 4IG4A 3U39A 5JI2E 1C2YA 1JAIA 1E79A 1SCQA 1U7WA 1V4VA 3JPWA 4UPEA 2FUKA 4QWWA 5EJ8A 4UD6A 4JC5A 5HKOA 5CH8A 1Q1GA 3E3MA 1KO4A 1UEJA 2GRUA 4XZ3A 5LBUA 2HMWA 1IIRA 1DXYA 2FZLA 4DHWA 1LRLA 3C43A 2NV0A 3TNJA 3V8EA 3WYCA 2X1LA 3SYTA 2WP0A 4DNQA 2IVZA 3QP9A 3IHKA 5WRFA 4ETMA 1CK4A 2I22A 4XX0B 2EZTA 2WICA 2RI1A 4CKEA 2VG8A 5FORA 3RS3A 3G88A 1FEZA 4B31A 1SUEA 3IAHA 2VDUE 4JN6B 3LHFA 4TMWA 1JPVA 1GO2A 3DP9A 1DAOA 1M2GA 3CHYA 1LGYA 3IE1A 2MJLA 4FFNA 2AXNA 1YL5A 4QJ5A 4LVCA 1UMBB 1H8ED 4UCFA 3H9GA 5A1TA 5KVCA 3CRNA 2WYWA 3MJVA 3SBEA 1ABFA 2ZRDA 4LYAA 3WA7A 3I8XA 4LI0A 5K6AC 2XITA 3PR3A 1QG2A 5CBPB 4WGFA 1BU5A 3P2JA 3DXXA 3KZCA 3W9UA 5EZ5A 1E99A 3TLEA 4LOLA 3S81A 4Q9KA 4UDNA 2Y0PA 4PZAA 4W1PA 1NMSA 1X2EA 2VF4X 1XVTA 2XWPA 2EL9A 1XFDA 1CRPA 3C4JA 5JXGA 1YR7A 3OICA 4FE3A 2O59A 3LIPA 4UJ3A 3HSKA 3UJBA 8GPBA 1KEZA 5LYYA 2YIVX 4G5HA 4HVAA 3GFQA 4Y2GA 3LO5A 2GB4A 4CF6A 4TQAA 1B00A 4PAOA 4MGHA 3DVSX 1EG2A 2WJ6A 1BH2A 3GX1A 1QM5A 1N5KA 2VF5X 3IBCA 1WKCA 3OTIA 4W99A 1TKCA 1FP6A 1JR3E 2XUKA 3R2JA 4FD2A 4TN1A 2NU8B 4YYEA 3AESB 4ND5A 2BFAA 3E0XA 1BWPA 2OHOA 2OR3A 5C8XA 5CDGA 1ZNXA 2DFTA 2WJPA 3I8OA 4KQFA 4UTPA 2PA3A 4BMDA 1HT0A 1P0QA 4WY2A 2C8JA 2CJYA 4BQNA 1DG3A 3WYFA 1FU4A 4YJ2F 3HCNA 5IJ0B 3D1JA 1JDNA 4WK4B 2DEUA 2BGIA 3S1SA 5E4TA 4ZEMA 4GWLA 4O4IF 1I0LA 2ON6A 3L2OB 1Y9AA 1DO2A 3FBGA 2BBTA 4MV6A 3USZA 4NCBA 2B35A 2RAVA 3CXUA 2C88A 2V98A 3SX2A 4H0CA 5C8DA 1NG1A 1Y42X 3BMNB 1K4MA 2CDBA 2VQ6A 3B9RA 3COZA 3QE4A 4RD3A 3COWA 5IN5A 2IOFA 1IDN1 2O1XA 3FI0A 4ZQIA 8LDHA 1HE8B 5AW2A 2FWBA 5K8LA 4BO8A 1MC1A 2JBWA 2RIPA 1EK2A 2GEUA 3PEWA 1O5IA 1BC5A 2NUPA 2YW9A 2XE7A 4DDUA 3IEKA 4NYMR 5JCXA 3NUZA 1IY9A 1HE3A 2OC9A 4CCAA 3MJHA 4Z7QB 4JITA 2QW1A 3VR3A 1NSTA 3L4JA 2QI9F 4HRYA 1K2VN 1UKBA 4DA7A 2Q5EA 5LDDC 1NVBA 2COEA 2D1TA 4ZTUB 1REQA 4JT9A 1MZPA 3JQBA 4ISCA 2Q27A 1XI2A 3SLKA 4JI5B 2B4KA 2WKQA 3L0IB 3ND5A 3O8OB 4B3XA 2PE5A 4QYTA 3SSMA 5FPHA 2W5UA 4TKZA 4JROA 5TR9A 3G8DA 4POOA 4U7TB 1HDCA 3E8MA 3QG5A 4Z3KA 1Q3KA 3UMSA 1T35A 1TO2E 3BMQB 3FNHA 3UAZA 3ZU2A 2JANA 1GTMA 1I6WA 1BX3A 4KN9S 2ZR8A 1T9HA 2K4MA 2Y27A 5LC1A 4LE1A 1ULUA 2XNCA 2O57A 5C1OA 5I01A 1W9MA 3OM0A 3V1LA 4LPSA 3ZIAD 2Z9DA 3WS7A 2QENA 3L92A 1DWQA 3ZWPA 4EI9A 4A36A 3PUVA 4OJNA 1YHYA 1GCUA 4L4ZA 3SI7A 3BPSA 2J59A 3OPXA 4LNUB 1RI4A 1W5SA 4C05A 3CX7A 4BNJA 3T0GA 4D3XA 5JXHA 2ZYWX 1I2ZA 3TPCA 3IODA 4GXNA 5DM60 2D7DA 3IEXA 4J0DA 3GVCA 2VR1A 3NUGA 3OU2A 4QVGA 1IBKB 4PYIA 4IHJF 2CHQA 2R6AA 5D5HA 1S89A 5FYDA 4CKCB 3FPFA 1CV2A 1IEQA 2IDKA 5EESA 4BDSA 3T3NA 3JAWA 1ZM2A 1HYQA 1SHZA 2OEPA 4TTPA 4TUYF 4ZAVA 2ZAOA 1IEVA 3RPEA 1ATIA 1PG0A 3TNFA 4YRQA 1X0VA 2WP8J 3FCEA 2XD4A 5KTNA 1N3YA 1VE1A 2AA3A 4DWJA 2IYWA 5MFPA 3TM5A 4ZI7F 4GYKA 4DLLA 1FIUA 5EWJB 2AZDA 1KJ8A 1FX0A 3P27A 5JXWA 4OI2A 5L3RA 4HAVA 5AK5A 2G4LA 3R6LA 1WBDA 3LK6A 3GZ4A 1RW4A 2Q3LA 2I2AA 4YWJA 2IEZA 3LLMA 4DJFC 1FRFS 3DYBA 3AEQA 1TECE 4TYQA 4UNIA 1XYVA 2G70A 2C99A 1WE2A 2HA7A 2YJGA 1RFLA 2WDZA 4WZAB 2RHHA 5AKKA 4X20B 4HOYA 3U26A 1IYZA 3O92A 1ZJ6A 1TKAA 3MMNA 5E38A 1RHMA 2FMFA 2HKIA 1A9XB 1SHKA 3ZGLA 1Q7GA 2J7PA 2V7WA 1HDYA 2FJPA 2PD6A 4DPLA 4IOMA 1FX1A 5D1NA 4EMBA 2LNDA 4KJZA 1WW3A 3MBOA 1M67A 4M38A 5MF6A 2CXSA 1IEWA 3QUBA 5AMXA 2C54A 2A0XA 3UWMA 1QRUA 1NDUA 3ZDEA 2EG9A 4QOGA 2VCEA 1DJOA 3UB3A 5LP6F 1C8KA 2OO5C 5FPSA 4MQFB 2G0NA 3CZMA 4GOLD 3QVVA 4MW7A 3VZPA 1ONSA 4TMFA 2PYDA 2CXQA 5B1IA 1X77A 4ZHQF 5K6RA 5C8YB 3HYNA 1GV1A 5HDQA 1E1QA 3FNQA 4KQWA 4L7VA 4BNIA 4KBYA 1R37A 2PLWA 1GFSA 2SKDA 4OYYA 3NVDA 1WW8A 3KBBA 4X90A 2WQ7A 1F12A 1F5NA 3SHVA 4YJ2A 4RGVA 1GLVA 1BW9A 2MT9A 2NQ2C 3FYUB 4C06A 5ITVA 4O4IA 2R79A 3AF1A 4RY9A 5JMTA 2A9FA 2IKSA 1T8YA 2HR1A 3TLGB 1WCIB 1TPYA 2OYSA 4BJ1A 4G0OA 3AB8A 4DLNA 5L8VA 3EQ8A 4YMWA 1NVKA 1GUZA 1IBSA 2BY4A 2VNAA 3A9WA 3EHEA 1SBZA 1JH8A 3QEMB 4IH9A 3IOYA 1SUSA 4EPYA 1HX7A 4KODA 3KUCA 2ZRLA 5MGNA 1YIOA 1X8LA 3X1WA 2CLIB 2AMJA 1GQFA 3VVMA 3SE0A 1P9NA 3H1AA 2QXUA 1B41A 1P4AA 4IO0A 4IMJB 2A1UA 1N1EA 3GRUA 1DZIA 4H7PA 5EP1A 4EHFA 1QO9A 1XVVA 3D3WB 3LCVB 5TVGA 2O1SA 5IABA 1J5EB 3RYCA 4B83A 5IF9A 4AWAA 2PRKA 5KTMA 3TLYA 1ZEMA 5JJKA 2JRCA 5DTMA 1K63A 3AR4A 4QREA 2CV0A 6LDHA 4D9EA 5P8WA 2X77A 4CIVA 2QS9A 2QN7A 3B7GA 2HA4A 2IEBA 1YC5A 3RYIB 4AZ0A 1E3TA 4UHHA 1V11A 3T9CA 2AX4A 4LWPA 1XZQA 2WTNA 2CXOA 1FJGB 4IHAA 2O8FA 3M5DA 2YUTA 5LIRA 3LF1A 4G0QA 5ALKA 5BOSB 1J2UA 4QOEA 5CT9A 2AK2A 1OWPA 1GILA 2H63A 3K6KA 3QIVA 3TW4A 1FUKA 4RKEA 1JE0A 4EL5A 2AMYA 1LBEA 4MR8A 1OE0A 4FFLA 3I12A 1VJGA 3HXTA 1NATA 1DUVG 2J6BA 4LXGA 4PBTA 4PO8A 2I3DA 4D8UA 1MGPA 2WIGA 4MVJF 4YRRA 1P19A 4BFCA 2IYPA 5LA6B 1NYLA 1QJCA 1ZK0A 3AOEA 4TMYA 3GLSA 4ZICA 1VMEA 3UA4A 1PTKA 2J3DA 1V1RB 3GHHA 3L6BA 4KKXB 5CB4F 3PGXA 5CVTA 4CQLA 3GJ3A 1LBHA 5TEVA 3VV3A 4YAIA 3BM5A 1ABBA 3MYYA 4DV1B 2D2IA 4MDFA 3M3DA 4CM9D 3IRUA 4B7AA 1PR6A 3N0VA 2NUTB 4IHJA 5LMNB 1J23A 1JR3D 5A3QA 3O93A 5LKAA 3KVVA 4GF5A 4K1XA 2F9LA 2OFOA 3D2CA 3VNRA 5KBYA 3S27A 1V8DA 4ZRDA 4TUYA 5DLEA 1I24A 4PG6A 2YWRA 3OFKA 4MKXA 3UQZA 4B79A 5HXAA 4QHSA 5E4JA 4YDRA 3D1VA 4I5IA 2R7MA 4UE3S 4MDEA 1ZWKA 2CNOA 2AOUB 2BRUC 1C5KA 1PSDA 2JRLA 2QPAA 3DKKA 1RMYA 1RBZA 3ED5A 5IU6A 1Y1TA 4G5GA 3SKVA 3C4QA 3T0IA 1P0FA 2AC2A 4ZI7A 5FBLB 1XV5A 3C45A 1OJ7A 3IAM6 4ZZ0A 4TL9A 4FK8A 1AKWA 1WY7A 3AJ8A 3KZVA 1LLUA 4ITVA 3DWEX 1EVKA 4Z0TA 4RIGA 3RC1A 1JLKA 5JO9A 1IBRA 2EU8A 3CTMA 1X15A 2AXPA 5JZSA 2RGAA 1GXSB 2XUPA 4NXMB 1BXZA 2FWRA 1FVOA 3B48A 3E2MA 1PO7A 3AKZA 2GTIA 2BFBA 3GBPA 4ZCRA 3OJCA 3P0JA 5E7IA 1L5NA 3UAYA 2UVDA 3F49S 5EJIA 3GDWA 1GPWB 2HRDA 1EBBA 1VQ1A 4EY5A 3MWKA 1USVA 4HWTA 2ID8A 3VOTA 1QQBA 3DCIA 1JVNA 4R0NA 4B80A 3X1MA 3GRVA 3VKVA 3DO5A 1QQ5A 3G9QA 3H1BA 3JQFA 5J40A 4M4SA 3VV2A 1FPMA 2PRSA 3RCBA 1ST2A 3K8OE 1EUDB 2AG0A 2ZXUA 2A67A 2WHPB 5IC6A 1QOQB 2CEAA 2Y0DA 4EG1A 3VZDA 2AYYA 1HFEL 4JJEA 2OSVA 4LHYA 4XVQA 3ZEIA 4QOSA 3HJHA 4LDAA 3ZS8A 5FEUA 1I7SB 3QBTA 2VJYA 4IQ0A 3CYFA 1QS0A 3EZ2A 3OPYB 2UXDB 2F9MA 4RIEA 4R84A 3RS8A 4ZHQA 3AIOA 3AINA 2LIVA 1C3JA 1QHGA 3AETA 6ABPA 5ELXA 3PC6A 4IRMA 1JNXX 1CEXA 2HJRA 3KTAB 4HLCA 2HA2A 2I7TA 2OM6A 2RBEA 1IPHA 4JUAA 1JX6A 4AW9A 1L7XA 1L7VC 2AEEA 1XXHA 4GZ3A 3WB0A 4EX7A 1Q7EA 2YXNA 2VQDA 1R9GA 3DYVA 4LY6A 4G0XA 2ZKLA 4E3ZA 3E5NA 4OQDA 5K4HA 2NO7A 5H3CA 5EE1A 3T7IA 1I1OA 2I9KA 4KZKA 4R68A 1VL8A 1ZD1A 2B25A 3KJEA 4WFJA 4GP6A 1IC6A 3JYOA 3ZCRA 2OLKA 4BO0A 4DVGA 2JLWA 5FWDA 2VJAA 3MEQA 2SCUA 1AMOA 4N0EA 2AEMA 2P0EA 1AS2A 4MI1A 4AURA 2FSUA 3WNQA 1BE1A 2OV3A 4WCFB 3KU4A 2OZEA 1Z4MA 3GEBA 4DGSA 4JXKA 1YZYA 2HV9A 4EJSB 1WMAA 2HUPA 4IIVA 1GAJA 1K5HA 1MMFB 3RC2A 3L18A 1C4OA 3WX0A 3URMA 5DBGA 2W11A 3CVUA 1OHHD 2JHFA 3VH2A 4AO8A 2CVHA 2FFAA 3EDCA 4L9AA 2YV2A 3B1KA 3E2PA 3IS3A 3GWZA 3K9HA 4RTKA 2IUUA 1E0SA 1G8HA 2ZTSA 2VHUA 1TVEA 2FDXA 1E7QA 3W2GA 1D6MA 5ICGA 4WAUA 1I4OA 3OSUA 1YB2A 3C7CB 1WVGA 2VAPA 4CN9A 2EP8A 2B8TA 4XGKA 3A1UA 3JZIA 4KXWA 1AO3A 4MQLA 3IOCA 5LNK1 3ZVRA 2V59A 5HF5A 4INAA 1E6LA 2CLKB 2P9ZA 4OI4A 4IMPA 5D5PA 4EIWA 2GK4A 1VKZA 5CYOA 2GFQA 3TRDA 4C2TA 4K9KA 1WCXA 2M32A 4A6PA 4BLOA 1G1MA 1KDYA 3KDSE 4KMMA 4MUYA 2V7PA 4V0NA 5GM2A 3UMYA 3F2IA 5E9JA 3H8VA 3E8XA 1LZKA 3TUIC 5JNTA 2ZRIA 3PHLA 1AIPA 4H7EA 4I8IA 1EI9A 1O94A 3SIXA 1LSJA 3LBYA 3MCZA 4CF5A 1NJ2A 2XMPA 2CCKA 4MVJA 1NKVA 1V71A 2VTVA 3A3PA 3PDWA 4BMNA 3C6XA 1JHRA 5CB4A 3K0FA 2C5EA 3W3AA 2DF8A 2I65A 4D8VA 2ZZMA 3HGQA 3SZOA 4RDHA 2GPWA 3D0OA 2QORA 5REQB 3U4CA 1UK6A 3F71A 2HWUA 4O2BF 4QJ4A 3QVLA 4CIBA 3ED1A 3GZNA 1QTRA 3GCWA 2D59A 3TMAA 4ZD6A 2YYAA 4OXXA 2VCYA 1T9ZA 1YZUA 4HGYA 4GZ6A 1NDHA 2BF7A 4NVRA 4FDAA 2XIQA 4YRLA 3PX3A 2NP6A 4BZQA 1R0RE 3D7MA 1QP8A 3H4VA 4MZXA 3JSXA 1CQXA 4NYIR 5JBNA 2HK6A 1JIXA 1U8ZA 2WFMA 1WW2A 3LQKA 2ZQZA 2FUCA 4HXGA 4L16A 3FMIA 3TOSA 2GBGA 4GC9A 3N07A 3TTWA 4D45A 3TFOA 3VMFA 4DT1B 3UAWA 2VBGA 3TNDA 1Z0FA 4C5BA 1GL7A 4EA8A 3CRZA 1DHTA 1KL7A 3PWTA 1JJIA 1YFZA 4PQEA 1TKBA 4QUEA 4XM1A 1Y7HA 3LBNA 3NATA 1KP9A 1N9ZA 1G3RA 1KS2A 2QG4A 5A5VA 4OX9B 3TX6A 2PGOA 2M9MA 3A1EA 2JDID 4A91A 2E1PA 4TT3A 3ICEA 1V16B 1PUIA 4LG1A 3W8FA 2H5EA 2XSZD 1KA9H 2B8WA 3E7XA 1U2SA 2PPLA 4N6OA 1J0BA 4P5EA 2XJ4A 4LZOA 4R5HA 5AI9A 4EGCB 3SQOA 1QR6A 4W5QA 1VB5A 4ZZIA 4Z54A 5DN9A 1NYQA 1R6UA 3U7QA 1P4HA 4REMA 2JGDB 3JRXA 3OMXA 5DI3A 3LKVA 3R4CA 4YRIA 1M2WA 1KETA 1QO0D 2WHEA 3KR2A 3FHCB 3FZNA 2CN1A 1TJ5A 2C2ZA 3C8HA 1BE0A 1ITZA 3CB4A 2PMBA 1SBYA 1JFLA 1J07A 2Z1DA 2ZT8A 3KR1A 1Z0SA 4I1UA 5FEMA 1Q6YA 1NULA 2BWJA 1LW6E 2GWRA 2NU6B 4BUCA 3G1TA 3BWYA 4C0AC 4JUFA 1THZA 4LMRA 2HCJB 3RHTA 1DQZA 5FBZA 5GGXA 2HPZA 1JSCA 3S6JA 1LLFA 2CNNA 2GPBA 2VYVA 3D7KA 4GI7A 1Y8CA 3MWFA 3NEAA 1XA0A 4L7QA 4P80A 4RY8A 5T3YA 4X97A 5LP1A 1A72A 3ELWA 2EP5A 5HQ3A 2XVMA 1NW9B 2FPRA 4V39A 2ESRA 1OWNA 1M66A 1WPRA 1OXMA 1AZWA 2DSNA 3EVAA 1XAHA 4HYEA 4BWYA 5FHQA 1NXTA 4LJ6A 3OQ1A 4UVIA 2FUNB 5A2GA 4YIHA 1C7EA 5B7PA 1TYCA 1H23A 3OKFA 1LVUA 5CNJA 4XUEA 5EPOA 2XDYA 5A02A 3ADCA 4MIYA 2Q6TA 4JLKA 4JYAB 3AQ4A 2Z8ZA 4RMJA 8ATCA 2YXLA 3PYXA 5J4HA 4DXHA 3PGKA 3COJA 4B3FX 4OQFA 1ONBA 2XUDA 3BIXA 3I5XA 1ATZA 3NEPX 5HRUA 1XQXA 1I2AA 1M1UA 5CHEA 4HEA1 3CC8A 5DYWA 1X7GA 3DFZA 3ZY4A 3U2QA 3ZCQA 2G72A 1IFXA 4ZC8A 1XGKA 4MA5A 2CK3A 2XB6A 2B0CA 3VAZA 1PFKA 1SOVA 5IBPA 3TKLA 3M6MD 3FYSA 3C3AA 3IVAA 3QMPA 3R76A 2Q4RA 2QJFA 4QGFA 1B3BA 3BCHA 1TW2A 4L6AA 1YE8A 1GN9A 1RLJA 2XBLA 1NW8A 1DAIA 1TTHA 3PUHA 1FUUA 1CQIB 2E4VA 4IOKA 4GX1A 1Z56C 2HIAA 1Q14A 2ODAA 4MMYB 5J59A 4C6TB 1JXOA 5JLJA 1GPUA 2WWIA 2GEFA 3GLHE 3IOBA 2FF5A 4IKEA 3MT9A 3JYPA 4FFWA 5IAEA 1XMOB 3PX2A 1GTSA 4HZIA 1C2TA 3PRJA 5CW2A 3TBKA 4F4FA 3R5XA 1XZBA 4FDTA 4E0BA 3LG2A 3DEIA 1PQ4A 2F9FA 1BOFA 1H94A 4AYTA 5KTRA 4YRDA 3PD7A 2I8AA 4NJEA 2PSEA 1LEHA 2GX6A 3DF7A 4ZC1A 1VG0B 5KKAA 1KO8A 3RUEA 2DKNA 4AN0A 1QDEA 4LFAB 4Q1FA 3F6EX 3LL7A 3VR6A 2XCRB 3THWA 1TZCA 3FAZA 2YWBA 3DMRA 1A8HA 4JKIA 4K1LA 5KWIA 3FCOA 3D6NB 4UCQA 3ENKA 4QECA 1PX0A 3U9SA 3T1HB 4O2BA 1KZYC 3EXG2 3TEFA 2FN4A 4GDMA 4XYEA 3WHLA 3ZG6A 1VL6A 2C84A 2LDXA 2ZYUX 3K9NA 4KIWA 4MIKA 2FW7A 3D64A 3HCRA 2KSQA 3RSGA 1DJQA 4R05A 2AFHE 1SXIA 2KWIA 1C4KA 4QDZA 3U80A 1SBQA 1DC3A 2ZUBA 1FNCA 2P2NA 3T4PA 1PZEA 6NULA 3P9PA 3L02A 4DCUA 5BNIA 2SECE 3QWBA 4NY1A 2B83A 3JAKB 2F2TA 1B43A 3EHDA 4ZOQI 1AQNA 1VC2A 4NTZA 1G63A 3C39A 1UDAA 4GBMA 1VBMA 3BWCA 3MBKA 3ERCA 1W88B 3EXAA 2Z3VA 3HDYA 4ACAA 1C9YA 2DLDA 3Q0TA 3FB1A 1PL8A 2F43A 3PDJA 2FXIA 3EA0A 1FYFA 4BKMA 1SK9A 5DIZA 4I99A 2H06A 3HY4A 1K8XB 1PT5A 4JA0A 2RGCA 3RRYA 1RYYA 1MRZA 4F2GA 2H9AA 1SKUA 1RHRA 4ZYUA 1E0DA 1IK4A 2AR9A 3TJRA 2AOVA 3QFFA 3NIDB 4D96A 1QU2A 3ITEA 4MYCA 1YV9A 3DMFA 2FP3A 5KOIA 2DJ5A 5DB4A 1Z2EA 2HC9A 1A2BA 2V0CA 4R6XA 5HF9A 3TTTA 2HF9A 5KPDA 2FMTA 2YZ7A 4HAOA 4D81A 1QKKA 4XVCA 3U9LA 2ZJ8A 3N8IA 5B6IA 4G0WA 4RLHA 2WJHA 4XQGA 1NBEA 3GFFA 4DADA 4EBFA 3CB2A 1RHUA 2VYND 4RK5A 2GSDA 1K88A 3EXFB 1H2ZA 2I8LA 4G8CA 1F0PA 4LNHA 5AKHA 5ECWA 2PO7A 3CNBA 1KJWA 3EZ6A 3OC6A 1FSZA 1I1HA 4HDQB 4X64B 2H08A 3ZCUA 3LPCA 1H8HD 4OGWA 1JFSA 2W2NA 1KPHA 1PJ3A 1Z15A 1G3UA 2GVZC 2K7ZA 3EQ7A 1WMEA 5IH7A 3DSRA 3NS7A 3BQ9A 1Q0UA 1E2KA 5A0TA 2ZITA 3BHJA 1ZLXA 4KJXA 2BFNA 2H4HA 4YROA 1ZOLA 1MIOA 1KYYA 1XO1A 2Z8YM 4H60A 4KOAA 3HYTA 3DE2X 4U2EA 2HTFA 1SOUA 2ZJ7A 2PGJA 4UHDA 1W36B 3K6RA 4INJA 1BXGA 1A98A 2JFVA 3L0DA 5CMLA 5KDLA 1KR5A 3AI3A 3KDPA 4Q66C 1NM5C 4KV9A 1TD1A 5EMKA 5GMOA 4B71A 3V7FA 3K71B 5ENVA 1V3UA 2GYUA 2VT6A 3W04A 1VBNA 3JQAA 4MLDA 2C2GA 2X8AA 5CGZA 4PINA 5IPFA 2PX3A 3MS4A 4F4HA 3IMGA 3C3JA 3ZTTA 3OZSA 2FN3A 2WD9A 4CKWA 1Z5PA 3QFSA 2JHCA 3V4LA 3B6ZA 3QXHA 2VSYA 3DE7X 1U8EA 4V38A 3RS2A 5DSZA 5DASA 3IEMA 1WWKA 5HKKA 2QK4A 3EDRA 1X9IA 3HSSA 4ZT3A 1EUZA 2ZWPA 2AZXA 3ZYZA 1E2IA 5BWNA 3EXG1 4DMFA 1GY8A 1XX6A 4G5FA 3K70B 3DZIA 5L3QA 2Z83A 3DBVO 2FOIA 3FWNA 3CIFA 5FA8A 1EFAA 3R6GA 1K86A 1VP9A 3ETDA 1WABA 4M7OA 3S3TA 4WCDA 4Z0HO 4YAGA 1KK1A 2GBCA 1P0PA 2JBAB 1OBHA 1P77A 5CVUA 3O3NB 3BICA 2Q1WA 3P7MA 2Y6UA 3BH0A 4OY3A 4RAOA 5KUTA 2JFNA 4NPAA 1U7HA 1WTAA 1J2YA 4M54A 4C0XA 1VYHA 5AK4A 1N6HA 4J0QA 2AMLA 2HQBA 1YJCA 4MWEA 3OIUA 4BGEA 3S7TA 4IUCS 4G1MB 4HQKA 1C4WA 2RMKA 4NV3A 3L7KA 4E11A 5FAXA 3L93A 4DCJA 1E4OA 1L5YA 3C1UA 1IY0A 1GNQA 4WCVA 5IW8A 2R1UA 5DM2A 4YJ3B 4KOEC 1S01A 1ES9A 2HSEA 2M1ZA 3KB2A 2NTEA 4K3VA 4KTVE 1FTYA 4ENSA 3SZRA 3DE1X 3R7AA 1V43A 1U2GC 3G1UA 2O52A 2DTDA 4E5UA 2I6FA 3OCWA 2CYAA 1H22A 5JYEA 1AHNA 5EKDA 3HEAA 5ADWA 2QRNA 3L06A 4RS4A 5ICEA 4IUYA 1R4NB 5FL7D 1MO5A 3LDAA 4LIPD 4LRUA 1MD9A 1GT91 3R7NA 3W6PA 4C21A 5I45A 2Z58A 4DJ5X 1HI9A 1E4EB 3PQ7A 1TJYA 4GMFA 4TV9B 5KNBD 2HT1A 4FW9A 3NAZA 2VNSA 1CZOA 2B61A 4RCZA 2V6FA 4BB0A 2VJMB 1DFIA 4HLDA 3KPYA 2O7VA 5AKXA 1FP4A 2C20A 3RSQA 4C1BA 2ZIZA 3MTDA 2B98A 4HY3A 1BJKA 5IEJA 4ZIRA 2YNMC 1LCIA 3L1VA 4KL8S 4AJNA 3N8NA 3UJNA 5BYKA 1USKA 3O9VA 2I1VB 1CVIA 3BX1A 4PFQA 5AVWA 1AK1A 4D8XA 4U8GA 1RJDA 1F1BA 4CU5A 4V3BA 2ES4A 3JWPA 2GPNA 3T9EA 4R7TA 4JELA 5U1PA 2REQA 4IVPA 3MRVA 2BR3A 1LVGA 3VOAA 4CFYA 4Z4FA 2HTEA 5EINA 1I2DA 1L4BA 4JUDX 2WU0A 3TS1A 4R3NA 2A94A 2WIKA 4MUKA 2JJQA 3D8RA 5FTNA 5J2TB 4DR1B 1TM2A 2MOKA 1RADA 2IEGA 5IARA 1CUAA 1S8FA 3AF3A 3Q9UA 4PHCA 3L8FA 4WZ6A 3C3XA 5JAQA 2R2AA 3WK8A 5KJ1A 1PQPA 1SBHA 4J49A 2AFRA 1KBQA 1EDZA 1JN0A 2BTOA 4M1WA 1JDTA 3AM4A 5E6UA 1S2MA 1U90A 3JQ8B 1OU0A 2EHDA 3VZBA 1U7DA 5L40A 3FROA 3NAQA 3SC4A 4PY2A 4CJXA 3VPAA 4Y0VA 3BXOA 4JP2A 5KWEA 3LT5A 3R09A 4I4CA 4BEVA 3BGVA 3V1KA 2UVPB 2OGUA 2QX4A 1VKNA 2H85A 5AKEA 5FLEX 3GY0A 3PQFA 3ZBTA 5C1PA 1LH0A 1P9WA 4Y8VA 2X5XA 3VU1A 2CJFA 5AW0A 1QZ3A 1NI4A 3PGLA 3E82A 4ECAA 2IS1A 1PGQA 1N2GA 2V7QA 1ZMXA 1I10A 4C4XA 1WZNA 1IJBA 1GIAA 3T5PA 1A9TA 4K6FA 4XWKA 3T94A 1SQFA 1OYWA 5DJ5A 2FPPA 4CG0A 1XKTA 4WOJA 4JI1B 3WJ1A 1EINA 1D04A 1AGXA 1UJ6A 4CV3A 1ADGA 1OJLA 1M8GA 3FF4A 3IPLA 3PXAA 1IXRC 2L18A 1DS6A 3HFSA 4KN6A 4DLPA 2OQVA 4LXTA 3DWIA 3SS7X 4JLUA 1ORIA 2J8ZA 3ADOA 3KM0A 5E1BA 5IBRA 3VNQA 3WL3A 4AS1A 4ZPJA 4BIMA 5JH7B 2P68A 4DCPA 5KYXB 1GUDA 3MJ4A 3UHPA 4LW8A 3ZU3A 1OIWA 3PHGA 3RTGA 4HLNA 2AI1A 2AWOA 2WB4A 3VNSA 4D9HA 1ZJ4A 3ELBA 4TSFA 3NHYA 2NO4A 5EWLA 5EERA 5SYNA 1P61B 4ZI5A 1SUPA 3V6MA 5EQTA 1EUCB 4Q21A 1MC8A 3X2SA 2EIHA 3QF7A 3MWGA 4BX9A 3O6VA 3C5WP 1GUAA 1E3LA 4DMGA 2JJYA 3AVOA 3HYCA 3FOCA 4UOZA 5FFNA 1Z7GA 1I9GA 5AM3A 1RJ9A 4A8HA 3HA5A 4TV8F 2A0YA 4X7PA 4KDEA 2W6JA 1I1NA 1K6EA 1PJZA 2GCOB 2HDOA 2YS6A 4C0WA 4HWPA 3HYRA 3CLKA 3OCYA 4HDOB 4ZN6A 3KZOA 3TVTA 1ZUNA 3D4NA 3DBHB 3MPOA 4PX3A 2Z3ZA 3NWEA 5CDYA 2WVJA 3FOZA 1NZDA 2X9LA 2Y1LA 1U0JA 4URVR 3BWXA 2NO0A 4BQPA 1VRWA 3KD2A 1CD5A 1DIAA 2O48X 3KEGA 3K32A 3AHFA 6REQA 2C7PA 3EGDA 4IUDS 4Y2JA 4RTOA 4I0WB 3NH6A 1XZHA 4CQMD 3TRJA 4I4TF 1WD7A 4FHFA 4MEAA 1ADYA 1BEZA 1RBQA 2BGTA 1XHEA 5EJ4A 4YDHB 3ZOZA 4G6ZA 4CLRB 3LHSA 3OTWA 4IDFA 2GF0A 3D1LA 3I2GA 2GZ3A 2PBLA 2VHVA 2VPTA 3OUTA 4Q1AA 3GLGA 1JKFA 2C42A 5KHOC 3NAGA 1ZM9A 3F1LA 5FLYA 3KAKA 4R1LA 4BUJA 821PA 3EDOA 3A6KA 1T0JB 3OAAA 3RV3A 1KOFA 2NNLD 2VTDA 4OM7A 5AHRA 2OYCA 4AS3A 4HVCA 2G5TA 4ZVVA 3MJRA 5I7VA 1NVDA 1VDZA 2O8DB 3NQ41 4JC8A 4DCNA 4OIFA 3ZNNA 1JFFB 3SIWA 3OJXA 3X43A 2I99A 3IR5A 3Q2KA 1ZESA 3MUOA 3ESRA 3Q7QA 1N4AA 2RK3A 4BFWA 3ZDDA 1I5OA 3KETA 1XEWX 2PRIA 2ZJ1A 3LQRA 1E6UA 3EGIA 4FYIA 3WC4A 1D2AA 1IBCA 3KDAA 1TC2A 4KV7A 1M2NA 5EIOA 1MP0A 4MR7A 4X44A 1UDBA 2H4YA 2H65A 4PXAA 3GUVA 2I0FA 3O2NA 4YH1A 2I2FA 3GFSA 4LKRA 4PONA 5CDTA 3N2NA 1U9IC 3BB1A 2NACA 2ZTMA 3CSDA 4NENB 5HTKA 3WQBA 3DNFA 1EUQA 5KYUA 1XU4A 3GQBB 3NZEA 1NNLA 4I4IA 4QFMA 3L6EA 4QNNA 5K3FA 2VUIB 4PC2A 3AF6A 3PITA 4F2PA 1Z0UA 4MVJI 1NFFA 2WTMA 4H0NA 4LS3A 3NHKA 2WWGA 4M9RA 1TYDE 2HLDD 3RSCA 1OROA 3EIXA 3LY8A 4LDPA 4R16A 4Z6KA 5KDOA 1P1IA 1WSWA 3DZKA 4IGAA 1WA5A 2OWEA 2JHPA 1SCBA 2GJSA 3RFCA 1II8B 3TX2A 3CIOA 4R2KA 4A1FA 5JSQA 1E32A 3FE2A 4XYMA 1U31A 5JVDB 2GZAA 2G8NA 4YECA 5KREA 1Q0QA 2OTCA 1KNXA 3LNTA 2G6TA 3R7DA 3VU0A 1CW2B 5AKGA 1KIAA 2FPIA 4ND8A 3DDHA 3W2IA 3WGKA 3B6MA 1ZS9A 2RI6A 4GRAA 2PGLA 5FKJA 1ZUIA 3FDZA 3F8SA 4Y9DA 4G1CA 1E79D 1TJ4A 1CY8A 2WWYA 3PXEA 5A6SA 5TPZA 2XW6A 4PBRA 3ZK8A 4TLMB 1CZRA 1X13A 2D4AA 1J9GA 1SIOA 5F98A 2WNSA 3Q6NA 3QY0A 4NBNA 4E14A 2KX7A 3BL6A 1P2TA 4BFVA 3QKSA 4L5CA 3U3KA 3K6JA 4GS5A 3FNBA 4X0EA 3KKMA 1TM5E 1VL2A 4IVRA 4Q9LA 2CBGA 3PC2A 2OQRA 4N49A 1XKXA 2OM2A 3OEYA 5AW3A 2JI4A 1LK0A 4KE8A 1TYEB 2WFLB 1NPDA 2BHTA 2WK1A 3F3YA 1G5IA 3FTPA 3DMPA 4PLWA 3IX7A 4IIFA 1PZMA 2G25A 1TQ4A 1NLZA 3T7AA 1X7ZA 3GLHB 4UUPA 5JDIC 2CMDA 4XIGS 3OFNA 1BE8A 3DVRX 2EGUA 3OX2A 5HF6A 3KQPA 3L77A 2IDZA 2QRQA 4Y2SA 2WMOB 2HGZA 2BEWB 1OWMA 2HWYA 3H5WA 3PC8C 4QVIA 2FJUA 2XOXA 3KXKA 3IDQA 4NK5A 1P9LA 4B81A 1R4AA 2A86A 2BEVB 1RWKA 1JMVA 1XZGA 4F8EA 1FFDA 1ZGGA 3DEYX 3WNDA 5KNDA 2ODEA 2PY6A 2A9VA 4TV8A 1CJKC 3PNBA 4ERXA 1BVRA 3AKDA 3QYPA 4LQLA 4RF4A 4B17A 1WULS 5I4IA 3PE4A 4S1PA 2PDAA 4J43A 1VTKA 4XFJA 4DV3B 1BHJA 4MQBA 3ROQA 2BMEA 2PKQP 4X65B 2YRXA 2OUKA 3KALA 4GGPA 2J5XA 4QL3A 4AJ2A 2QTNA 2D7JA 3M82A 2IRWA 3FCUB 3JQ7B 1U98A 2AFHB 3QMMA 1A7JA 4ZK6A 4K3UA 4KGVA 4KXLA 4FGLA 3IC5A 4TKLA 5IVHA 2WUDA 3A4YA 1IH8A 3NBFA 1PTJC 1LLDA 1Z0IA 1WY5A 3H6HA 1KDTA 2QQ5A 4UVDA 4UPDA 3B12A 3Q6MA 3CF4A 1CUZA 4FWBA 4UXJA 3AP3A 4OBWA 5TVKA 3TLBA 1Z07A 4ONEA 1P4RA 3V1NA 2OMKA 3FOBA 3V2GA 4XDZA 5AJVB 3ZDYB 1FK8A 2C2HA 5FLKA 2YBDA 5C4MA 3O4FA 3HKEB 5KVVA 4RNDB 4Q12A 1AU9A 3O3CA 3P9ZA 2X15A 2RHJA 1NF3A 2C31A 2QVBA 3VR2A 2W6OA 1Y5RA 4B84A 5B1EA 1NMXA 4G5QA 1I6LA 5AQ1A 1KMCA 2HEIA 3BHIA 4GFDA 3MERA 4C7OB 1TM4E 5HBRA 1H2WA 3EVBA 4WNAA 3NOQA 4C7BA 1FMFA 3BFJA 4CMIB 1GM5A 1T0HB 2XOEA 5HGXA 1MO6A 4WA8A 1M72A 5KTKA 3EGWA 4FFBA 1Z2PX 4XPIA 2OCGA 5KJEA 3KKLA 5C4GB 1E6EA 3NVKI 1XB2A 4BGUA 3DH0A 3H5VA 3SJAA 2JD2A 2AJBA 4K7JA 3G6KA 5KSWB 4I1SA 1R27A 2TRSB 2C4KA 4JLBA 3FRHA 2D5LA 3G3EA 4S3MA 2AJLI 4JR1A 2HADA 4LJYA 3N6RA 1CS0A 2RHGB 1Z22A 1P1RA 4ZAGA 1KO5A 1S3SA 2NADA 3COSA 4Q7QA 3I01M 1V6SA 3OM8A 4LFCB 4D5GA 3Q3VA 2BKAA 4B40A 5KHLB 4HH1A 2E89A 3UFXB 2Z43A 3VPGA 3EE6A 2PLNA 1E1LA 5K3EA 1S4MA 2IV3A 3OTHA 1YONA 2R7NA 4HN4B 4FTWA 2D3TA 1AUPA 4E1VA 3EQZA 4GGMX 4PNPA 3HRIA 2VPPA 4XCQA 1VECA 4M1ZA 1SZCA 4A6XA 1NQVA 1ID8A 2KQUA 5F12A 2ZI6A 2XYVA 3R4VA 4ENPA 1Z82A 2QROA 3LP5A 4WJKB 3ZLUA 5IXYA 3JZMA 5C2JB 3TN7A 3NT4A 1WMSA 3BILA 1AF7A 5GINE 2H1LA 1GL9B 1SXJC 2HPHA 3Q9NA 4BNXA 4YMGA 4HATA 2P90A 5AKLA 5F23A 2IPXA 2OV2A 3DJFA 3LRPA 2DWUA 2M2IA 3JALB 2B5VA 4AMZA 5LM3A 4G25A 3QLUC 3ZCSA 3C0KA 2P5TB 3DO8A 1NM5A 1JGTA 4LSMA 3I8SA 1EIZA 2JIMA 2WT8A 1T0IA 4Q7MB 2IU0A 1HFWA 1EFKA 2X0RA 1KK0A 3AYZB 1X7YB 2HAEA 5M2QA 3ZHVA 1EHCA 4UAVA 4FEGA 2J09A 2XDWA 4JR2A 4M9ZA 1Z9BA 5JTUA 4NYMQ 3PKIA 2BJWA 3GVXA 2X0KA 3DHVA 3KLMX 4U9HS 1ZC4A 5ERXA 3HV0A 4J29A 5AW1A 4MKFA 1P5HA 1GNRA 2FWPA 3BDAA 4JT2A 5BVGA 2R48A 3GLFE 4G4GA 16PKA 4HDNA 3M49A 1VDMA 4KPUA 2BGUA 2Q8NA 4QXPA 5EEHA 4BO5A 2JIZD 3LT2A 1XNRB 1T2CA 3N2KA 3JXEA 3TUZC 4L8FA 3FWYA 4DEVA 2R8YA 3WLTA 3DUWA 4JJAA 3T4UA 1H4QA 1UR5A 4N39A 1MFZA 2J7PD 2BF4A 2OC4A 4IDNA 3SJZA 4AMGA 2Y2UA 3KJNA 4U7HA 2VT7A 1DEXA 4HR7A 1MU0A 1O1YA 4JLDA 3P5BA 1F51E 3QA3E 2VQSA 1X3LA 3JY6A 4Y9RA 4MA4A 1GGNA 1OC4A 3HR8A 1V6AA 5FPYA 2YXBA 3WGIA 4HUTA 3H9CA 4FHGA 4C76A 4R41A 1GT6A 2ILTA 1GPYA 2YW2A 3TMYA 5L51A 3IKLA 2HX1A 1FLAA 3JWEA 5ECGC 1DXOA 5LCXA 5SZJA 5BV7A 3KOWA 1EFTA 3KKPA 1JPJA 1Q0PA 1E1QD 4IOJA 4FBMA 3WL5A 1Q1ZA 2RB5A 3ZTYA 5HILA 4GL4A 4ETNA 1U2GA 1X1BA 4EUHA 5EP2A 4CGYA 1BGWA 2YASA 3ZV4A 2AZTA 1K7XB 2C9DA 2V54A 3DQZA 3ND8A 1N36B 2GRAA 3AQIA 1S02A 3GCZA 4Y7CA 3UMMA 1MRNA 2AW3A 4CLHA 5GM1A 1D8AA 3KZMA 3LECA 4ZAXA 4XVRA 5L53A 5ESXA 3BN3A 4FKBA 5BW5A 4GYWA 4G5SA 2QD1A 1UBMS 1V1MB 2GPYA 3IQXA 1RP1A 4UOEA 2I1QA 3L4EA 3QYFA 1L5MA 2VDJA 2ZE8A 4E13A 2CMHA 1KJQA 2JCYA 4IXDA 1JIJA 5JXIA 3E9RA 5D6OA 4WH0A 2YNMA 1G291 4G0MA 1QFMA 2I4OA 3R7SA 3KNZA 4N3BA 2E48A 3Q7PA 5IMSA 1L5LA 3D43A 1FNBA 2QVGA 3CF2A 1J4AA 2X3FA 1T9BA 2RFLA 3RYTC 5DFAA 5KO2A 3VYSB 1Y80A 1YR1A 2YWGA 1LSSA 3L7YA 1FUEA 4M87A 2QUIA 2WM8A 4QKQA 3V1UA 3A6PC 1IUNA 1DEOA 1KRHA 3FVWA 4GP7A 3GGJA 4CG3A 3ST7A 2QRLA 4LJ9A 3J7AC 1E62A 1H2EA 3R5TA 4WTOA 5IUNC 1OAAA 5AOCA 3FCYA 2AMFA 3DLHA 3I04A 4BFXA 1SOAA 4DQ0A 2EFDB 5FWYA 3L7DA 5KOHA 1U0BB 5SZKB 2XR1A 3D4LA 4ZVUA 4CCSA 4EI7A 1V1JA 2WYHA 2WF7A 2VH2A 3BF8A 3AVXA 2YV5A 5LMUB 3PKZA 3AVVA 2HF8A 2W48A 5H4GA 2DRIA 3U7GA 2F8LA 3SXPA 1Q0HA 1ODSA 5DNDA 3TB6A 5FTWA 3BIOA 4FLMA 4B43A 1DX9A 3HUEA 3HWSA 3RRZA 3SFVA 4QYIB 5KINB 4KITB 4LMPA 2BPOA 5LB4A 1REQB 2W2MA 3NYIA 3ABRB 3W1VA 4FHZA 1GZ5A 1KI4A 1R0KA 1X39A 4QEDA 2UVQA 3R74A 2C1XA 5B7GA 1GZ6A 1OV4A 3Q8WA 4L07A 3IKTA 3NTXA 3UKDA 4Z53A 4URUR 2Q49A 3GDFA 2YHIA 3RWOA 2GLXA 3WYAA 1OA1A 2ZYRA 1MHTA 4E70A 4JI2B 2CZCA 3IT2A 1UBCA 4E03A 3S5JA 3ORHA 3RANA 4DV0B 1V7QA 5JMPA 5CB8A 3LP8A 1RWOA 2QD3A 4OHBA 5K1ZA 3VHXB 3UJ9A 3TTVA 1GL6A 1DTEA 4LE2A 5G0VA 1P91A 1LDGA 4BNWA 1SPBS 1DTWB 1UF9A 1CT9A 1G21A 4F06A 3AONB 4OB7A 5EJMA 3UK1A 5C31A 4YCNA 1Z25A 1YS7A 3UN1A 4IDCA 2ZATA 3RHZA 1F2DA 1HFJA 1KPGA 3U7RA 4BNYA 3BRWA 3TIIA 1KI8A 2AEFA 1Z6QA 4RTPA 3UK7A 5KWVA 1XTVA 1QQTA 4CV0A 3LOPA 3JATB 4MR9B 3FNGA 5I3ZA 4GX2A 3CGGA 4Q3KA 4RQBA 1VIDA 4R98A 1GUFA 5ES3A 1JAXA 3KOMA 3RVQA 3CCCA 3MT0A 2VZ8A 4TXMA 3BSFA 5AICA 3GFVA 4OIMA 3KQUA 1SUIA 1KKMA 2IHTA 4FZ3A 1QGUA 2OFXA 3BWBA 1YL7A 2Y2VA 1ZXXA 1VKHA 2YXDA 2P2SA 1NPYA 3E9NA 4EG5A 4ETWA 4F92B 1P4GA 3AUSA 3EG9A 1F8FA 3EMBA 4MV3A 3DE3X 2FPOA 3KHUA 3L8YA 3WHKA 2ROQA 1CR6A 3WLRA 4L6CA 2A57A 4M9UA 1N32B 5LWQA 2OECA 3R7WB 3K0SA 1QB8A 3G6WA 1XPOA 4BO4A 2ECOA 4J4TA 3O94A 1RYFA 1CNEA 1JE1A 1XTJA 3F6PA 3Q2IA 4HTFB 5CHYA 5AVXA 1T8WA 2J5KA 1YB1A 3G0DA 2QM3A 4DCCA 4PAMA 5SZHB 1DBRA 3TQHA 4D9MA 1CY1A 4KQMA 1SGWA 1OZHA 1TEXA 4UE2A 1Y4AE 3AEUA 2XQJA 3EUFA 2B99A 1SG0A 3WKAA 3OQOA 3HJRA 3MSCA 1V9CA 3A9VA 1XU7A 2YY7A 3EC7A 2QLNA 3JQRA 4XLZA 4ZXPA 4BTLA 4C87A 1J56A 3B6JA 2J87A 3RRXA 1JG7A 3KLOA 4MPDA 3TSZA 1LPPA 3WISA 3IHWA 4L9WA 3UHOA 2V5UA 3LY7A 5EJGA 4P7KA 3U1BA 3TQQA 1Y6FA 5A71A 4RD2A 2O2ZA 1NF2A 3ASZA 3COYA 3T7CA 3ZVLA 3JQEA 3RWMB 3PHJA 4HVLA 3OEEA 4HBGA 2ZTHA 4CCYA 4H1WA 1QIFA 5F51A 3K35A 1S2NA 3CX4A 3T5MA 4BO3A 4EX6A 2DFNA 5AXBA 2YVUA 3REQB 2OBFA 3I45A 4R0MA 3E27A 3Q9LA 4RL6A 2CLCX 3PEVA 1NX6A 1JL3A 4REQB 5A1JA 3U4DA 1OTHA 1DBWA 1SUAA 4Y2XA 2EQBA 1JAYA 1MT0A 2V4UA 3I5UA 1QGED 2C07A 3G9ZA 3LC2O 4OQMA 1QK4A 4XCVA 4OHKA 4EO4A 5D1HA 5F5NA 3BMCB 3DV0B 4OVKA 1HQKA 2HK8A 4ZYTA 5JR3A 3UHAA 1QH1B 4AP9A 3GYGA 2XJ9A 3DL4A 4FXPA 4R9NA 1JSZA 2R25B 3W8NA 5AJHA 3V4SA 4G9BA 1U9IA 4E88A 2VEDA 4YJ2B 4M8NE 1BW9B 2DQ4A 3HVJA 1UKEA 1X38A 2PKCA 3KYIB 4MAAA 3WLHA 3PDIA 3KLNA 5DYTA 3BHMA 3R23A 4NJOA 2DBRA 1TJNA 4F2HA 3UMVA 1WCYA 4NH4A 3EIHA 4OXIA 5BQ5A 5K01A 3MOIA 3R77A 1I7LA 4ZTZB 3HNRA 3KR0A 3L0PA 3RAGA 4UQLA 1LF5A 3IERA 4E2ZA 4P7GA 1SB8A 1AZLA 2R00A 5DHTA 3C85A 4DE5A 3R6DA 1DO0A 4HFJA 3DAHA 1C9MA 3GEHA 3GEGA 3T5TA 1OYOA 2NPIA 3MM4A 4D0NA 3G85A 1U8AA 2HJVA 4KG7A 1JUDA 3DP7A 5I4KA 3CVVA 4FUQA 4JBWA 4LV5B 2R5WA 1O94D 2QTMA 5JSZA 1IBLB 2ZIGA 1R00A 1J20A 3E15A 4MVJD 2EF0A 1FTNA 3ILVA 3KWFA 3PGVA 4IR7A 3HWWA 4KWTA 4QC2A 5F77A 3ROKA 1VJ1A 4JCOA 3VBEA 4KB5A 1NXOA 1T8RA 3VPBA 4D9IA 2BKVA 3U5TA 3FZYA 3W3AD 4MRNA 4MXDA 4FHCA 4ZJYA 4NECA 4WKNA 2OKGA 3CLTC 2VN8A 1AG9A 1ICIA 4FGKA 4FS8A 4I9FA 4UNQA 4KO1S 2IEIA 4QSHA 3BD6A 4YJDA 2M6KA 1Z29A 3QLVC 4CPDA 1I51A 4EQ6A 1F4PA 5C8VA 2EFJA 5JHGB 2O8FB 4EJFA 1ONNA 3LHIA 1JA0A 3R0XA 3BJMA 1UKVY 4HDAA 4QFDA 2LD4A 3K8QA 1DMRA 2O1WA 4GO1A 4KP7A 3V4ZA 3W8RA 4YYZA 2I7XA 4JI6B 3GRRA 4CF3A 1PU2A 2Z56A 2OMEA 3BGDA 4D7AA 2PH5A 4QZVA 3UFBA 1TM3E 2X22A 2ZVQX 4MIOA 3KV3O 5JD6A 4WBNB 5CFMA 1MOZA 1Y4DE 4D97A 1EAMA 3CONA 4C4OA 1M7HA 1JDBB 1X6VA 1W35A 3L6OO 3USES 3FPSA 4JFRA 1E3EA 1EG7A 1H4VB 1YZTA 4U63A 4AG6A 4B73A 1L3IA 4CQLB 3BA1A 1PCXA 3PC8A 2ZRQA 1E2UA 1CZLA 3QOYA 2PCLA 2XTAA 4GMKA 1VSBA 1KXJA 4L95C 4QICA 4BP8A 3PI7A 1YGYA 3BUSA 2VJNA 3HA2A 4LGCA 4M8SA 4U2KA 1H0SA 3H2JA 3OZUA 2OVBA 4A8JC 3A04A 4TT3D 5CX1A 4DLAA 1XL1A 1ECBA 1UPBA 2GQ0A 2GFIA 2GZSA 2O6HA 3N6VA 4G4IA 3KVRA 4HDMB 4MQ6A 3H5TA 4OJYA 1G0OA 2XUJA 3H5IA 5E0KB 3D7LA 4AUNA 2CD9A 2BGKA 3NC1C 3QW2A 4J0IA 4DLUA 3ELDA 3HVHA 2HLPA 4Q4DA 2NV6A 4FJ2A 3RK1A 5M04A 3CEAA 2YQ4A 1ZYUA 1S2IA 4TX1A 1HA3A 2Q1SA 1RJWA 4Z1MA 3STYA 1AXGA 2H3EA 1NRXA 3T95A 3G5AA 2HQ1A 1V47A 5FI1B 3Q15C 1W2WB 2OK7A 1O57A 1BIFA 3N75A 1EJBA 1YQQA 5GY7A 1YTUA 4I3GA 1J39A 2LPMA 3IAM1 3NV9A 5BWBA 1PTJA 2BFBB 2PLFA 2VXCA 3RSOA 3CCBA 3R3WA 3X1KA 1OLXA 5ALYA 2Q62A 3TL2A 4XXHA 2VYVD 3SG0A 3EA5A 1ND6A 5L3SA 3RUCA 5JADA 2DUNA 1JG1A 5GWXA 3M6VA 4QASA 4E6PA 4W1RA 4FQ7A 4KPGA 3PBKA 2IWRA 4XA8A 3TVDA 1LPMA 4D99A 1TCBA 1Z47A 3OY7A 2VDQB 2CLFB 3IT3A 4ZJPA 1KDRA 1A4XA 2I67A 1Q74A 3QTTA 4YMHA 5K03A 4RDIA 1JWLA 5ECYA 621PA 3GVIA 3FD8A 3ITKA 2IL1A 4JC0A 3UJDA 3DOEA 4AZWA 3U61B 4JGGA 3I9V6 3MW8A 2CKMA 1QUFA 3VYRB 5BN4B 3CN7A 1N6KA 2CNWD 4BN0A 3AFMA 4DMKA 1GA6A 5JJLA 2B3TA 2J6HA 1A1SA 4M7RA 2BMDA 4WESB 1YA4A 4JLVA 3G0IA 3WLNA 2OAP1 4TQGA 3BJRA 2D1RA 3F4LA 1U1EA 4IICA 4YV7A 5JARA 1EMDA 3D8HA 3QPBA 3H8JA 1PEKE 4I08A 2CK3D 4TXNA 5K51A 4GKKB 4V1CB 2H5LA 3R24A 2G1UA 3Q10A 4S04A 3UBTA 1Z4QA 5D00A 4IF6A 2LGJA 5HG0A 3H2KA 3DLAA 4JDUA 4CTKA 2QL6A 3TSCA 4BNMA 4JLJA 4EHIA 4H0FA 1H6AA 1H1DA 3CUVA 5JDCC 4ANFA 1YH3A 2YJNA 1YR6A 1E64A 1W85B 2HMSA 1G9XA 3COPA 4OSEA 5BUCA 1ORWA 1RLOA 2HNBA 5AHWA 2G9RA 4FR2A 3S70A 3QKIA 2PMFA 2ZR7A 5FUVA 4B44A 4N5IX 4LGYA 5BNTA 4E5PA 3QXSA 2UZ4A 3LT0A 1MCZA 1QPZA 1IONA 2J46A 4XTCS 2ONYA 4RELA 5CIYA 2C7QA 2WKSA 2JAPA 4LC0A 3RU9A 2X8WA 4RAQA 1T24A 1F8GA 1IHYA 2OO3A 4YUAA 4IZHA 5T8KC 3CNHA 4H7DA 1A1VA 4JP1A 4OOEA 3EWSA 4LXUA 3L84A 1D0SA 1K75A 3PHCA 4L2I