1GXSA

Crystal structure of hydroxynitrile lyase from sorghum bicolor in complex with inhibitor benzoic acid: a novel cyanogenic enzyme
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
267
structure length
267
Chain Sequence
QQEDDRILGLPGQPNGVAFGMYGGYVTIDDNNGRALYYWFQEADTADPAAAPLVLWLNGGPGCSSIGLGAMQELGAFRVHTNGESLLLNEYAWNKAANILFAESPAGVGFSYSNTSSDLSMGDDKMAQDTYTFLVKWFERFPHYNYREFYIAGESGHFIPQLSQVVYRNRNNSPFINFQGLLVSSGLTNDHEDMIGMFESWWHHGLISDETRDSGLKVCPGTSFMHPTPECTEVWNKALAEQGNINPYTIYTPTCDREPSPYQRRFW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Hydroxynitrile Lyase from Sorghum Bicolor in Complex with the Inhibitor Benzoic Acid: A Novel Cyanogenic Enzyme
pubmed doi rcsb
molecule tags Lyase
molecule keywords P-(S)-HYDROXYMANDELONITRILE LYASE CHAIN A
total genus 77
structure length 267
sequence length 267
chains with identical sequence C
ec nomenclature ec 4.1.2.11: Hydroxymandelonitrile lyase.
pdb deposition date 2002-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1gxsA00
3CCCA 4W9RA 5ALIA 1TCAA 4OYYA 5ALNA 3WJ2A 5AI9A 1NU6A 5AKHA 2XQKA 2OPHA 1EDEA 4KE6A 5ALYA 4ZRDA 1Q0ZA 3QBJA 4J0DA 2XUPA 4FNGA 5AI5A 4DMCA 2CEKA 3QPAA 4KRXA 5K3BA 1XZJA 2OGZA 2OQVA 3B12A 3BIWA 3BJMA 5ALEA 3O4GA 5JATA 1EB8A 3A2LA 1EXWA 2V9ZA 1JJBA 4DNPA 2XQIA 2XUOA 3VVMA 1VA5A 3IULA 3BDIA 1BCSA 2Y6UA 5DWDA 3AINA 3ESCA 4FTWA 4U2FA 5AO9A 3BF7A 1LPAB 2ZYHA 1VOTA 4Y2JA 1DT5A 3BE8A 3K2IA 4UHCA 1UT6A 4LYEA 2HADA 2XMGA 4UBLA 3WWDA 4X00A 1F6WA 2C5FA 1EHYA 5HQ3B 4UUQA 2CZQA 4QDZA 5HKBA 1UXOA 1CUZA 1P0IA 1VA4A 4KE8A 4JYPA 4X97A 3UUEA 3M83A 1JU4A 1OXMA 3DYIA 4HXGA 1E8DA 1TAHA 2XLBA 1SOMA 2C0PA 4C87A 2WHQA 1MNQA 5JAUA 3KD2A 4GEGA 4JEIA 3VJKA 1QIIA 4QE3A 4DMKA 3HSSA 3IUJA 1AX9A 4N5HX 5LZ8A 4XX1A 1E3QA 4X90A 4UBNA 2VJAA 1CRLA 4C4YA 3WIBA 3H2KA 1X2BA 5AICA 5JD4A 5CT5A 4G9GA 4Y2VA 4MEBA 3QM1A 4X71A 1YAHA 1XZAA 4DNOA 3GROA 4DNQA 4WFIA 3KWFA 4P08A 4QDUA 1K4YA 3R3ZA 1CUWA 1QTRA 2Q0XA 1T4MA 2CB9A 2WIJA 4OB7A 4UHDA 5A7HA 2I3DA 1CUIA 3WJ1A 2D0DA 1LLFA 3D3NA 3SWWA 4A16A 1MTZA 4UBMA 4G8CA 1HBJA 1DINA 4EHBA 3Q0TA 5FLKA 3WK5A 4ARAA 4H7DA 5HF5A 5EHNA 1U65A 4OSEA 4EY6A 3BF8A 4FKBA 4C4ZA 3VISA 1SC9A 3C8DA 4NZZA 1CUYA 3N2ZB 3EQ9A 1YSCA 3L1JA 1XZEA 4FLMA 5AH0A 1QE3A 4RNCA 3ESBA 2H7CA 4IQ4A 3T4UA 1QOZA 3RKSA 1IZ7A 3O0DA 4J7AA 3G0BA 4DIUA 4YPVA 4O08A 4CCYA 2FUKA 2WLSA 2DHCA 4Q3KA 4CIBA 2FJ0A 4X91A 4K6HA 5AP9A 3BIXA 4I19A 4NVRA 3R0VA 2PPLA 5D3ZA 4BAUA 3R3XA 2QT9A 1QO7A 3PUIA 5A62A 4EB0A 4HRYA 1D07A 2JGFA 1G42A 4XWGA 2C4HA 2G63A 4V2IA 1AURA 4OUKX 1CFJA 2VJDA 1WCYA 4BC0A 1MU0A 3WL7A 2HA0A 3HRHA 2ROQA 3UUFA 3ZLTA 4Y2XA 3EQ8A 5ALSA 1MX1A 4AO7A 5C7YA 2WSLA 2X76A 1QZ3A 3WL5A 4DMHA 4DNFA 4Q34A 5ALPA 2H7XA 3R3UA 1WM1A 5LKAA 2QJRA 1MO2A 5AOBA 2IIVA 4XVCA 1XZLA 5JAOA 2OCGA 2XUDA 3H2IA 1JT2A 4K6GA 1GKLA 5KWJA 4M0FA 1CUJA 1CPYA 2R8BA 2DHDA 1QIHA 5JAHA 5LZ9A 5EIAA 1JJFA 3GBSA 2XUKA 1CUCA 2PSEA 3R41A 4AN0A 2WIKA 5ALQA 4BDTA 4K6KA 2G5TA 2EDCA 4INZA 5CMLA 5A7GA 3GFFA 3WYNA 4OYLA 3FYUB 2PSHA 2X5XA 3NGMA 4QNNA 1ZJ4A 2HU7A 2PU7A 2WUFA 5AKZA 2WKWA 3W04A 4L3WA 1XZGA 3IVMA 1LPOA 2BGRA 5ALRA 5CT9A 2ZJFA 4RE6A 2BUCA 5ALVA 1EVEA 2WFMA 4EY5A 4H77A 5ALHA 1XZFA 4E14A 4RPCA 2J3QA 4UFOA 2ACEA 4XIIA 4BATA 5AKIA 1L7AA 2PU5A 2EEPA 4OB8A 5CH3A 3C6BA 3WZLA 4ZGBA 2HU8A 1OCEA 4BZZA 4AN1A 1BRTA 4G8DA 5DNWA 3FLAA 3G9ZA 4E46A 2P8SA 1VZ3A 2ZYSA 1XZDA 3WYDA 4I4CA 3I2JA 1ZI6A 4GW3A 1MPXA 4KACA 3D0KA 4AMYA 2YXPX 3EBLA 5LZ5A 4BTVA 4FOLA 4M0MA 4FWBA 3WWPA 4B81A 3DD5A 2VA9A 3KDAA 1J2EA 3H1BA 3LP5A 5AKXA 1DX4A 1XRMA 3E4DA 3LLCA 2ZYIA 2QUAA 1R9NA 3IDAA 2JGKA 5CURA 1BN6A 3AZOA 4QWMA 3I2FA 3OPMA 4ITVA 5E4YA 2WUGA 2WU4A 5CW2A 1A7UA 4Q1VA 2O2HA 4L0CA 5IVHA 3GELA 1VE6A 1WHTA 4H7FA 2XUAA 1XQWA 3FSGD 3DL7A 2C5GA 1DWOA 2VAXA 2VJBA 3H2HA 4HXEB 4X94A 5ALZA 5K3AA 1CUVA 1JMYA 3X3HA 4BAZA 2WJ3A 4UBOA 2W22A 4X6XA 3WA7A 3C70A 3NUZA 3RM3A 5K3EA 4WFKA 1AUOA 3R3YA 3OURA 1IVYA 2XUFA 2XI4A 1YS2X 1IMJA 3WK9A 4B9AA 2IITA 2XUQA 3ILSA 1ZI8A 2GYWA 4E15A 5HF9A 2AJDA 3N0TA 1EK2A 5T4BA 3O9MA 1GZ7A 2ZJ6A 4N8SA 4C4XA 1XZIA 4B83A 4H7IA 4BRSA 3V1KA 1QONA 3ESDA 2XMQA 2WJ6A 1XRLA 3M81A 5A6VA 5C81A 4PNZA 4BCDA 1CUEA 4MWTA 4CCYB 3G9XA 4BVKA 4C88A 5ALGA 1YS1X 2CJPA 3WK7A 2FX5A 4WDQA 3GUUA 1F8UA 2I78A 4P93A 3K6KA 3EF3A 4J0KA 3PFBA 5CXUA 1SFRA 1CR6A 1UK7A 3LIPA 4UBKA 5K5EA 5AK3A 5AM0A 4B0PA 2OQIA 1MAAA 3OC0A 2OLEA 2WU3A 4BB0A 1F0NA 3A2MA 5K3FA 4MYDA 3RLIA 4AXBA 4W63A 2DCMA 4G4IA 1USWA 4LHEA 3MVEA 4OCZA 5LZ7A 4KAJA 2VSQA 3IUNA 1O6FA 4DYHA 4J0HA 2HA6A 5DNUA 4LXIA 2WG1A 4MQLA 2PKYX 3OOSA 3STTA 3KWJA 2PX6A 1AGYA 2XDWA 1KU0A 5JAPA 2JF0A 3PUHA 2DSNA 2PSFA 3NWOA 4U2BA 4Z49A 1Q0RA 4PO3X 3FVRA 1MX9A 2B61A 4X6YA 4F21A 5EHQA 3OM8A 4H0CA 3WKAA 2ZSIA 4OU4A 5FKJA 1XZBA 3H17A 5IVDA 4Y2SA 2DQZA 2CBGA 2OG1A 1W4LA 5JALA 4CFSA 3HABA 2OAGA 1VE7A 5HCUA 1R50A 4B0OA 2QS9A 2AXEA 3M82A 1QIMA 1TK3A 1AQLA 4KJXA 2ORYA 5EI5A 2PL5A 3FVTA 2AJCA 3TEJA 4QWWA 4Q82A 3O95A 4IH9A 4H7KA 4P9NA 1R1DA 5HF8A 2WIGA 1RP1A 4KAAA 1XKLA 3FYUC 5EHXA 2BCEA 3HI4A 3DQZA 4UFPA 1UOPA 4AMZA 3D2AA 3W9BA 3PF8A 3WKCA 4J0GA 2WG2A 4G4GA 5D7BA 1F0PA 3GZJA 5HK9A 4WY8A 5HK8A 4FBMA 1XLWA 2WUDA 2O2GA 5HF6A 2B9VA 4Y2PA 5E2IA 3FBWA 1K5PA 3QZUA 3U1TA 4HTAA 3HZOA 4H18A 2ZYRA 3QPCA 2O7VA 3BL8A 1XZHA 5ALFA 1BU8A 3GA7A 3JYHA 3FLBA 1XLVA 3WWEA 1W6RA 5DTIA 1N5MA 2Z3ZA 3PF9A 4WFJA 4KR0A 1K63A 2PSDA 1DQYA 2QTBA 3VJLA 1LZKA 1H23A 3VVLA 1EDBA 3R3WA 5AM1A 3SX4A 1W76A 4X95A 2VJCA 4X93A 1VLQA 4PSCA 4MYSA 2PUHA 3C45A 4W1SA 2X8BA 1WB5A 5LLSA 2G4LA 1UK6A 4LIPD 3G0GA 1P0PA 3L1IA 2PBLA 3B5EA 1ACLA 2WHPA 1UKBA 3W9UA 3UMJA 2WG0A 3KOOA 4J3JA 1ZIXA 2WTNA 5BV7A 1MNAA 3I2HA 3PDCA 3O4IA 2NW6A 1QGED 1DQZA 1EK1A 1QFMA 4W1PA 2HIHA 4FLEA 1MT3A 2RHTA 1EI9A 1R3DA 1GPKA 4YX9A 2Z5GA 3WK4A 3IIIA 1ETHA 1TKRA 1R9MA 1WHSA 4GBGA 1YA8A 1GPLA 3FLEA 3MUNA 1RWQA 2XQGA 4U2DA 5K3FB 5FXMA 3STUA 4BC1A 3F9CA 5LP1A 4BP8A 2HL6A 2Y2VA 1XKTA 1CUUA 3STXA 1EB9A 3QMWA 4QZVA 3C8HA 2GBCA 1ORWA 1J1IA 1DTEA 3STWA 4B80A 5E4TA 1HLGA 3DDUA 1LPMA 3U0VA 4PV7A 2C0QA 2RGUA 1UWCA 3DYVA 1Y7HA 4B7ZA 5AIAA 4RGYA 3F67A 4YK7A 1GT6A 1A8QA 4EZIA 1CUFA 1CUDA 4A5SA 4KYVA 1HL7A 4OB6A 2OXEA 5SYMA 2HA2A 2RI6A 2C58A 4BZWA 3D2BA 5ALTA 1J06A 5LKRA 3WIOA 1BEZA 5T4HA 4MQMA 3H19A 2XMBA 5T4FA 4J0JA 3H18A 3IUMA 5JD5A 4HAIA 1ZIYA 2QJWA 2WTMA 3WL6A 4GXNA 4FFWA 1DWPA 5A7FA 3H2JA 3C5WP 4G9EA 1H2XA 1TCCA 2JGIA 4QDXA 1DX6A 1E89A 4KE7A 4UBJA 1EX9A 5ALMA 5I7UA 3OG9A 2PM8A 2XQFA 1WPXA 4PQEA 4DGQA 4K2AA 4C89A 1FJ2A 1NX9A 2JGLA 2RIPA 4G5XA 5ALJA 1THTA 2XMZA 2DHEA 3WKEA 5AI0A 3WZMA 4DM7A 3AILA 4J03A 4GHWA 3QH4A 4IH1A 3T52A 1DWQA 2B20A 5KREA 4DTCA 1KEZA 2HFJA 1MN6A 3V1LA 4MEAA 5AKEA 2VATA 2B4KA 3G7NA 2WILA 5ALWA 4AB1A 2VF2A 3QVMA 2OCKA 4JNCA 3IA2A 1W75A 3D2CA 1A88A 3AUKA 4X7BA 4DMFA 1OILA 3I6YA 4CI9A 1VXOA 2HRRA 4NMWA 1WPRA 4X3CA 5F4ZA 4OPMA 3DEAA 3IURA 4ETWA 2QM0A 5YASA 2WM2A 1X2EA 5CH8A 2J4CA 4AQDA 2PSJA 3WK8A 3FCYA 2OGTA 5JARA 3SC2A 3QPDA 2ONCA 1ODSA 1XQYA 1UK8A 3C6ZA 3PE6A 5CXXA 3AIKA 1YAJA 3K9BA 2WQZA 1DT3A 1LBSA 2QOEA 5CT6A 4Y2YA 1WB6A 1ZD4A 3G9TA 2QMQA 1G5FA 3RK4A 2XUJA 2AJLI 4BCCA 1BE0A 5LIPA 1YASA 3ANTA 1TIBA 1JJIA 1ZJ5A 4KRYA 5FRDA 4QDOA 2HM7A 3QMMA 4B9EA 1GQSA 2G5PA 3G8YA 1CQWA 3CXUA 3LCRA 1YB6A 3I2GA 1PJAA 4EY7A 1Y37A 3O4JA 1HPLA 1CUHA 3WQHA 1EH5A 3QMVA 2Y6VA 1CUAA 3BWXA 3C43A 2QVBA 4I3FA 3TGLA 4PW0A 1PV1A 4F0JA 4CG3A 1U2EA 4YASA 1DU4A 4Q3LA 5AOCA 5JZ9A 3DJYA 1B6GA 4CIAA 4G4JA 4IH4A 1L7QA 1XZKA 3KXPA 2XUIA 2WFZA 3WLAA 2WHPB 3A6ZA 5DNVA 5EIEA 4BAGA 3DKRA 3LS2A 2CMFA 1LBTA 5AK4A 5H3HA 1ZD5A 5DJ5A 1BN7A 2VT6A 1EINA 1ORVA 4XJVA 5ESRA 1LPBB 5C8XA 3I1YA 4C6HA 5LZ4A 2QXTA 3JWEA 4M0EA 2K2QB 2DQYA 5AM2A 1SCKA 1M33A 1LPSA 3O4HA 5E4JA 1ZICA 5JZSA 1CVLA 3V9AA 1AKNA 2ZJ7A 4Q05A 4KAFA 3C5VA 4FBLA 1BCRA 4LXHA 1EA5A 5FOQA 2CKMA 1H2ZA 1QFSA 2VQ6A 4E11A 1ZOIA 1U8EA 3HJUA 4IO0A 4UHHA 3DKKA 2V97A 3G0DA 2VTVA 1O6GA 3PICA 5C8ZA 3DOIA 3WA6A 4AZ0A 3KSRA 5J3JA 2JEZA 3FYUA 3FOBA 4ZREA 1ZD3A 2BGNA 4ROTA 1XRNA 5AKJA 2WFLA 4B84A 2XB6A 3I6ZA 2H7YA 1ODTC 5BWCA 1S8OA 1TCBA 4PSUA 2LIPA 1MAHA 5EFZA 1WOMA 2J4FA 3HYSA 4H7JA 1UFOA 2QRUA 3G0CA 4J0IA 5ALDA 4WY5A 3ICWA 5AM3A 1IUPA 1QIGA 5LYYA 1J07A 4B85A 2XMSA 4AZ3A 3H1AA 2GZSA 3E3AA 3WWCA 5LZ2A 1KU6A 4ZWNA 1IUNA 3E0XA 1SCIA 5HFNA 1UZAA 5BOVA 5FUMA 7YASA 4WDRA 2R11A 5EIHA 4FMPA 5AKGA 5DYTA 3ESAA 1H22A 3A70A 3G0IA 1BROA 5K3CA 1Q84A 1THGA 3ZLVA 5FPPA 3WL8A 2ES4A 1LZLA 1CUXA 1HKHA 1FFDA 3D7RA 2JGEA 1EDDA 2OAEA 3HXKA 2QUBA 1XZCA 2AJ8A 6YASA 1W52X 2Z3WA 1ISPA 2I3ZA 4C01A 3WMRA 1G66A 4UFNA 2PVSA 2DR0A 1GQRA 1VJ5A 5AM4A 4GWLA 4BCBA 1C4XA 1L7RA 4KEAA 5AM5A 2C7BA 3I2IA 2QXUA 5ALKA 1CEXA 3ZPXA 4Q3OA 5KBYA 3MGAA 5EHZA 5AOAA 3F98A 5JANA 1UOOA 2RHWA 4G1FA 3D5EA 5FP0A 4Y2RA 4UHEA 3SK0A 4DSZA 4BTLA 2HA7A 3A2NA 4GECA 3YASA 3PFCA 1AMNA 1BS9A 3HC7A 1U4NA 1ZGBA 1XLUA 4BRZA 4CG1A 4ZXFA 5ALXA 4FLFA 4H7EA 4OD0A 4F60A 2Z8ZA 5JADA 4U2GA 1GPNA 2CUTA 3AIOA 1G4HA 4S0XA 1QIDA 2VEOA 3EQ7A 3F96A 3O9VA 3AFIA 1QO9A 3I1IA 3FNBA 3QYJA 3CN9A 3G9UA 3AZQA 2WHRA 1ODCA 3QITA 4N5IX 1MX5A 3C87A 4G8BA 1YR2A 2WFLB 4D9JA 3AIMA 1QIJA 4NS4A 3R40A 2XMCA 2BUAA 3I6MA 5I9IA 5AK6A 5DYWA 2Y2UA 2YYSA 4HXFB 3I28A 2FJPA 5AJHA 1GXSA 1NU8A 1WB4A 2GBIA 5K3DA 3HACA 5ALLA 5SYNA 3W05A 2ZVDA 4FFVA 4BVJA 3ZV7A 1ZGCA 1ZD2P 1X70A 4CCWA 3V1NA 3DLTA 1LNSA 2XLCA 5A2GA 4UHFA 4B6GA 3AJAA 4UPDA 2EDAA 1FFCA 3ANSA 1EVQA 2QR5A 2JBWA 3WWOA 3P2MA 2D5LA 4H35A 2JGMA 4UHBA 3V48A 3LIIA 1R4ZA 1CUSA 1HQDA 2RAUA 4BDSA 1IZ8A 4GDMA 2XQJA 2XMRA 4ZV7A 2Y1KA 4N8DA 4RE5A 2W6CX 1QIKA 1FFBA 1QLWA 2J3DA 4LKOA 5FV4A 4UBIA 4QA9A 3IB3A 4F5ZA 4X6UA 1YA4A 2I03A 4W1RA 5A71A 3STYA 1CIJA 1ZI9A 3ZLUA 1B41A 3DCNA 3Q8WA 4EBBA 3TRDA 3S8YA 4ARBA 4QLOA 3NOXA 5FPQA 1XQVA 2VAVA 4QDTA 1A8SA 1E66A 2AJBA 5CTAA 2QZPA 4WJLA 1XROA 4GI1A 4DLNA 1H2WA 3V1MA 4PSDA 2OGSA 4EY4A 2WIFA 3H04A 1VKHA 4EA6A 3VDXA 3ZI7A 1QTIA 1AC5A 5CRIA 5IVKA 3F97A 2RONA 4LXGA 3BXPA 3BDVA 2GZRA 1JKMA 3H0CA 2YASA 2QKYA 1K6EA 1SCQA 3FWHA 3IBTA 5BWBA 1E8NA 3L1HA 3OTQA 1CLEA 1XRPA 1XZMA 3W06A 3DS8A 3WKDA 2OCIA 3FYTA 3IUQA 3FSGA 1R88A 4W1QA 3C6YA 1BEEA 2YH2A 1ACJA 5CH5A 3F8SA 3RARA 1JI3A 2HHAA 2IX9A 4BE9A 1XRRA 5AIBA 5JIBA 2HFKA 1YB7A 3AZPA 1UKCA 2VT7A 5DYYA 1CUGA 4BP9A 3DNMA 3TJMA 3ED1A 1VXRA 3PI6A 3C6XA 2DFPA 4OU5A 1T2NA 1AZWA 2BJHA 4P92A 4TVKA 1I6WA 4FDMA 2HRQA 3ICVA 4K5QA 4PF1A 4B82A 5JD6A 1CV2A 4U2CA 2H9YA 3R3VA 4AO6A 4BVLA 3WKBA 4KE9A 4DSAA 4MXDA 2BKLA 5DTJA 2GBGA 1N8SA 5AI4A 1Q83A 5ISMA 4Y2QA 2HA5A 5JZBA 3FCXA 3HLKA 3I2KA 5AKLA 5AK5A 4ZI5A 2V96A 2JGJA 5FDFA 4ZV9A 2WUEA 5T4EA 5HKAA 3M3DA 2BFNA 3HEAA 1N1MA 2ECFA 2V98A 2GBFA 4JYMA 1FFAA 1QJ4A 5IH7A 5D3KA 2XE4A 5ALOA 1JMKC 1K8QA 5HFAA 4FHZA 2GYVA 3D4LA 2UZ0A 4HRXA 4JUIA 1YCDA 2XUGA 3VKFA 1UK9A 4Y7DA 5ALUA 4X92A 2OCLA 1C7IA 1LPNA 4J0CA 4L9AA 1GKKA 4L72A 1XFDA 5HZGA 1IUOA 5JASA 3JW8A 3E1GA 4H7HA 5IKXA 2ZSHA 3ZWQA 1P0MA 2O2IA 3DOHA 2E3JA 2PUJA 3WI7A 1W1IA 5JYCA 3WK6A 1UKAA 4GLBA 1CQZA 1JU3A 3DL4A 2XUHA 1XQXA 1XRQA 3CCBA 2HU5A 1FSSA 4EUSA 1P0QA 4MWSA 4QEKA 3S2ZA 4MJ3A 4Y9SA 2ACKA 1E8MA 3G02A 5I8PA 5AI6A 1VZ2A 4A23A 1MJ5A 1N5RA 5AI8A 1E5TA 3W2TA 2JIDA 4CG2A 3D59A 1GGVA 1Y7IA 3B3QA 4QLAA 2JEYA 1A8UA 5C8VA 1TRHA 2HA4A 4JH0A 4HVTA 2O7RA 2H1IA 5AKYA 5CBKA 2HDWA 1JFRA 1LPPA 3CN7A 5IVIA 4TPKA 4WCVA 4AO8A 5DLPA 1FFEA 4HS9A 3EIOA 5EGNA 4Y2UA 1CUBA 2XMDA 3H2GA 1PFQA 2WIDA 4X85A 2XT0A 3VXKA 4BYMA 4BBZA 1HDEA 3VJMA 1QIFA 3BJRA 1LGYA 5AHXA 3FAKA 4LYDA 2HA3A 4EY8A 2Z8XA 4U2EA 2BAGA 5HQ3A 1C7JA 5AKKA 4FNMA 5D6OA 1UOQA 2WJ4A 4BE4A 4HZGA 5CT4A 4TGLA 1RYYA 1H2YA 5KWIA 4AX4A 3STVA 4N8EA 4Y2TA 1Z68A 3MUOA 4IHAA 2BUBA 1TQHA 1QIEA 2GYUA 5CT8A
chains in the Genus database with same CATH superfamily
5KYXB 3HGMA 4FSDA 1JLHA 2C3YA 13PKA 4F38A 3GD5A 1ITZA 4W9RA 4CN8A 3PS9A 5ALIA 4JASB 2Z6UA 5AKHA 2IOYA 3EGWA 2OM2A 2X2OA 1BJKA 3BCUA 3QVOA 4NI5A 2YOHA 3KBOA 3OY2A 1EDEA 3P9RA 1N78A 1U2DA 3B6EA 1SQ0A 3CH6A 4FX2A 2YJ4A 5IFKA 2RHOA 3L8DA 2AEFA 3NRJA 4KE6A 3F5FA 1FLAA 1Y34E 2AC7A 2YCLA 5ALYA 3NC4A 3R7WB 1GSHA 3D7NA 1UPTA 3IAXA 1L7EA 5HGJA 2NYAA 4JA0A 1YB5A 1OZHA 3WRXA 5DASA 4EUKA 1SQSA 1UIMA 5CVTA 2C5LA 5AI5A 4H15A 2CEKA 4PINA 1G6Q1 1KZ1A 4KRXA 4NYIQ 5JSKA 1MIHA 3SSMA 3PHHA 1XZJA 5K3BA 4J4BA 1O7JA 3DBLA 3Q7QA 5DGDA 1XMOB 2LD4A 2R8YA 3BIWA 4YY3B 3BJMA 1YVRA 2A88A 2I4NA 4ESHA 1PT6A 2RBKA 4U4AA 2RGCA 3NAMA 2V9PA 4BS9A 2DVMA 1P3Y1 2V9ZA 2ID8A 3FSEA 2JLUA 2HI0A 1Z83A 4OAQA 4ND4A 2PTHA 4KFSA 2P27A 3C0KA 1QK3A 2GUWA 4B76A 1GARA 3PYXA 5I6DA 1OH5A 1VA5A 2BZ0A 1Q57A 1MG0A 4HS4A 3BDIA 2GPTA 1VGQA 3DMTC 3I04M 3L7KA 1IDOA 3AINA 4GI5A 2C57A 3Q1KA 4YUVA 1KMHB 3BF7A 1LPAB 5FO1A 1K86A 2GN4A 2ZYHA 1G2QA 3RRYA 5K6AA 4AJHA 3L6EA 4OQ4A 2X9VA 2QENA 3HZHA 4LPKA 1E0KA 2ZB4A 5E6UB 4Y2JA 1Q95A 5LDDC 1QQ5A 5HJEA 1Q16A 4JOCA 1PTJC 1XQ1A 2FAXA 3P27A 1GN9A 1OAOC 1PP4A 3WGZA 3N5CA 4BKMA 5CXSA 1D6MA 3BMCB 4EUEA 3ORHA 4PYRA 1R6TA 2HADA 4NL4H 1DCTA 4AVYA 2AR9A 1UBGA 1WP4A 1U0LA 1Y8RA 2C5BA 2WSIA 3L0DA 4O1HA 4X00A 2L18A 2LV8A 1ADCA 1RQRA 3ENQA 5AJUA 1UDXA 3MMPA 3HBAA 1F6WA 4AYTA 4DWWA 1OFGA 1Y4UA 3GCZA 1C3EA 2ZKIA 4AL4A 2GK4A 3JQ8B 1HH4A 2BFOA 1JHZA 2W6JA 4Y1RA 2FN8A 3JZMA 3LX8A 3WB0A 4GFDA 1P9LA 4P4SB 4CIDA 1C9DB 1VA4A 3PX2A 1AKUA 4DY6A 3IO5A 3MLAA 4M1YA 4JYPA 5EXTA 4RXUA 1V47A 3WQBA 3Q41A 3WRVA 3M83A 1RZVA 2PH3A 5IEBA 4EHJA 2H07A 1JU4A 1M2WA 1CVRA 4EG8A 1FU7A 4K9OA 3HB9A 4M0LA 2PUDA 1YC2A 5D3MA 4TZTA 5C3UA 4D9KA 3EY9A 2H4XA 1L4FA 3ASVA 4M38A 1QTNA 4QU9A 4MK4A 3B9BA 3ZKWA 1Y7LA 3Q3JB 4Q9KA 2C0PA 3V33A 4YWHA 4K87A 4JB0A 5JSYA 2PYIA 1QH9A 2I87A 3GRPA 1G7TA 3L46A 3PWTA 2Z83A 3KX2A 4WW0A 5DP2A 3RUIA 5JAUA 1VP3A 1FP6A 1QIIA 5KB3A 1JIKA 5TSDA 4JLUA 1Y9EA 2IOFA 3HVIA 3F8TA 4DDKA 4DMKA 3IUJA 5JCXA 4MS1A 1AX9A 3TQOA 1QG2A 1A9XA 3ITDA 4TT3A 2G06A 5DU2A 2SNIE 2ETVA 3T7KA 3OIDA 4QFDA 5AJTA 4F3RA 3ZH9B 9LDTA 4IIJB 3MHPA 3ZH2A 4E4YA 3UBMA 3OTGA 4MR7B 4EELA 4C4YA 2EV9A 4YCNA 2B0JA 4GLFA 1RFLA 2SCUA 3EISA 1HNXB 4PSVA 1ZNQO 4JYZA 5JD4A 3PQFA 3V3TA 2FSVC 3B38A 4G9GA 3S4YA 1I4LD 4B34A 1PUJA 2XZPA 1JIUA 2FMXA 4H4DA 3AJ9A 5F1KA 4JJZA 3QM1A 2FY8A 4B47A 4IKEA 1ZN8A 3BHMA 2AZTA 3IYLW 4MRMB 1PX0A 3WYGA 1SQGA 4LOLA 3CLUC 1QX3A 4DNQA 2KHZA 4R2JA 3KWFA 3EUWA 4HN9A 1WCXA 4Z9YA 1EWTA 2I5PO 1QTRA 5JYEA 1LC3A 1T4MA 2Q0XA 1AA6A 4B4WA 2CV0A 1S2IA 1FFWA 2BC9A 2ERCA 4MKHA 3VKWA 3JSAA 4LG1A 1NR1A 3WJ1A 2D0DA 3FF1A 4MWOA 4A16A 5HJ5A 4UBMA 1USKA 5CVCA 3UOAB 3ZTWA 1I1QB 5C7LO 2J48A 5HXAA 1ZC3A 1HBJA 2DGDA 1DINA 2VXCA 1UJCA 4C21A 3T8YA 4Q24A 2KW5A 2ZIFA 2Y9PB 3FNHA 3ICPA 3ITEA 3OE7D 3QFHA 1M2OA 2O1EA 2H2WA 5I7OA 3VZSA 3VX3A 3N2YA 1VG9B 2YYZA 3C5EA 3X1XA 5DW0A 4ARAA 4D79A 4A5OA 1AQ6A 3SPXA 3COJA 2ZR0A 4KVGA 4OSEA 3BF8A 1AKMA 4EX6A 5FLYA 1PK7A 3VISA 2R4UA 1JA1A 4KBYA 4JD5A 4RHFA 1KI6B 1CQIA 5U4QA 4HDMB 1NBOA 4IGKA 4C0WA 3K6RA 3PFFA 1DAMA 5KMGA 2BEWB 3PC2A 3X2EA 4ZMBA 2J5BA 4V0ME 5HM6A 3AKDA 3PQ4A 2IZ1A 4W82A 1DDGA 3E2PA 2J59A 4UEJA 5IAGA 5FFFA 2BDEA 3DM9B 4JI2B 1M54A 5NULA 4PBRA 4MKRA 3VPDA 2ZR8A 4BBJA 2Z5LA 4B79A 3AYZB 3BWMA 4FLMA 4Q4AB 1GAQA 1UINA 3AEQB 1G7CA 1RYHA 4RNCA 3IBYA 5EMJA 4YAKA 1RYBA 1XYYA 1QHYA 4WXRA 1MLDA 1QOZA 3RKSA 4F5DA 3LA6A 2XPCA 2WYIA 3G0BA 4DIUA 1B76A 5JOQA 3OEWA 1OBCA 3TCKA 4NXMB 1E20A 3K6SB 1USIA 2ZYAA 2QGFA 3FNRA 1YR6A 4XJSA 1G2OA 2HK7A 4IF4A 5TGZA 1MHTA 1L4YA 3A7DA 2R5NA 1WUYA 4ZOCA 2P5SA 4NH0A 4CIBA 1H2FA 1NFFA 5CDFE 1U28C 3R20A 3HJFA 1P5JA 5IZCA 2HR1A 1DJLA 3AETA 2D6FA 1FFHA 2OZPA 2ZRNA 3PIDA 4NVRA 1GT91 3KUCA 1N77A 2PPLA 3JQ9A 1HEIA 4B43A 5GQSA 4GYYA 1D04A 2WJZB 4E21A 5EP4A 4RQUA 1COWD 2Q29A 3GT0A 3I05A 4PZUA 1UC5B 3I6IA 1DCKA 2YWDA 1WXFA 4I4IA 5A4FS 4DHEA 5B4TA 2PXXA 3GG2A 1NBHA 3AJ8A 2QT9A 1W85A 1K8ZB 1FNDA 1MEOA 2L2QA 3GGDA 4OHCA 1A71A 3KV1A 4QTTB 5CYFA 5DX1A 4EAAA 2RHHA 4G84A 4R40A 4U9HS 4DDTA 4NHOA 1LI5A 4TUYF 3WGVA 1K2WA 2J0SA 3IV6A 3G2JA 4OLHA 5D86A 5BYJA 4OTZA 3INRA 4TQ9A 3SZGA 3MBOA 4YMLA 4GU5A 4PAGA 1Q6ZA 1S4QA 2R4TA 3DHNA 1Z5NA 1AH2A 3ASUA 1AURA 4MV3A 4EB6B 2XW6A 5EP1A 1YIOA 5JH7A 2A0FA 5EC8A 2I80A 4C7BA 4LA4A 5B1EA 4BC0A 1M7HA 1MU0A 4UAUA 5JXGA 4C2UA 2HA0A 3CE9A 3CMCO 3K8OE 1Y82A 1P75A 4QGBA 1RU3A 3D8SA 3KE8A 5EJGA 3ZLTA 4YQFA 3EMDA 3HUFA 3VDNB 4IM7A 1J22A 4PPQA 4XEHA 4G0OA 3NIBA 4EKIA 2JLYA 1E96A 1E7QA 4Y2GA 3WL5A 4FS8A 4I99A 3NHKA 1ILEA 1RQLA 1TDJA 1Z28A 2PT6A 1TU4A 1UOEA 2C5SA 2CJXA 2XX3A 2PAAA 1QAMA 3H4IA 3WMEA 2ZI6A 1GRNA 3DBLB 1NBIA 5HRCA 3R3UA 2WD7B 2ZOSA 1NQXA 1U5CA 2FWBA 2OHVA 1MO2A 3JRXA 3KLPX 3KQQA 4IDGA 4RGQA 2FLKA 2O8BB 1TMOA 4GPIB 5DGIA 2ZPUA 1XZLA 5DDIP 2PMKA 1RWPA 1V41E 5JDCA 2XUDA 5EQDA 2O20A 3H2IA 1I5OA 3ADBA 2HPZA 4RPLA 1PK9A 2O4UX 1JT2A 3NM5A 2VPWA 4ITRC 2BISA 4GRAA 1NYQA 1UJ2A 2A5JA 2BN4A 1TA9A 2G9ZA 2F1RA 2P2GA 3NBZC 2WPNA 4PNPA 1YR9A 4F2WA 2D4AA 3S0JA 1JSCA 4P35A 1N25A 5LZ9A 1V1MA 3IPCA 1AM4D 3NG1A 5DVZA 4CCYB 1SVOA 1VGRA 4B3GA 2A78A 5KX5B 1NXSA 2FHPA 1IONA 3KJFA 4KSBA 2IHVA 3WLIA 4BYGA 1QP0A 2DBQA 3AF5A 3K5IA 2XBUA 2PSEA 5CNIA 1DO0A 4R2KA 3R41A 1VMAA 2IYSA 1PR0A 3AONB 3LX5A 4U02A 3VR5A 5CDGA 1Z17A 1KSJA 2WIKA 3D6TB 3UJAA 4ZI2A 3QE9Y 4QUBA 2XYGA 1SXJA 4WY2A 1ZA1A 2AVDA 4MRPA 5KYXA 4I1RA 3P19A 3GZTB 2JGNA 1PAUA 2P9QA 4KHZA 1ISHA 3DQQA 2ZRCA 3HO1A 1TGVA 2PQMA 2C8KA 2G5TA 3OEYA 4KL8S 2GNPA 4DLPA 4INZA 2JJMA 3AG6A 4M89A 3OVMA 2V58A 3ZWBA 5CBPB 2DY1A 1DBRA 1RMTA 2C1ZA 2Q9AA 2YZNA 3GJQA 2WMNB 3C4JA 3MJSA 3MWFA 5CPBA 4AJIA 4JI6B 3EXHC 1PGPA 2B8JA 4OYLA 3ECCA 3WYNA 4E0BA 5BQFA 2PSHA 4MUHA 4LS3A 4F8EA 1QRDA 1SRQA 3NGMA 3BJIC 1VPWA 1PTKA 2PU7A 2WC1A 4LXUA 3DTNA 1SG0A 3TX6A 2VJPA 3UJ9A 2C04A 3T9EA 5BSWA 5JQWA 1WE2A 3UHJA 5B3AA 1A5TA 1QDLB 4CKZA 3EF0A 1I2CA 3DC2A 1DKLA 2QRLA 2X1HA 1L7MA 5KKCA 5FA5A 4B6SA 2AZ4A 2DB3A 3PC6A 1KSHA 1ZGHA 1W1UA 3T4XA 5CM2Z 4EPRA 3NHBA 4RE6A 1J56A 4S04A 1Z7EA 3HWSA 3MWJA 4AI6A 1GA6A 1UBRS 2AYZA 2WFMA 4CI0B 4RIHA 3SQLA 4BN5A 3VC7A 3LUDA 3NYQA 1TF5A 1VRVA 2R25B 1GDTA 3A9VA 3KSDO 2ZS8A 4YRMA 2WM8A 5AJWA 2P30A 4PGFA 1ZL0A 4ZAYA 2CFOA 5EIWA 5TX7A 5EKTA 3UXEA 3OWOA 1JDBB 1OBHA 2XA9A 4MA5A 4BWFB 4C3ZA 4LF9B 4P0QB 4KQFA 1CSEE 1DGQA 3VSBA 4BATA 3DSRA 3E7XA 3HV2A 4Z4HA 3N9IA 2EEPA 3SE7A 1KYZA 1V43A 1XT6A 3R76A 1OAOA 2XAAA 3P26A 4NKRA 4HAOA 5FOVA 2ZWPA 3SIRA 3DF9A 3G6KA 1RHUA 4C04A 1OBFO 1XZPA 1UZUA 2E9SA 4LYAA 4S1OA 5DCYA 4YPFA 2JDIA 2P4HX 2W2TA 4P53A 1C4WA 2EKBA 4RVHA 4Q9HA 4DAEA 3SXUA 3PVCA 3VPSA 4ENPA 3OJ0A 1HOXA 1K88A 3FLAA 5DNWA 3TN7A 3KB2A 2VF8A 2OCBA 1VZ3A 1UDRA 1M2FA 2X5JO 3IDOA 3ME5A 5C1PA 1B15A 3WYDA 4S1WA 5TJ9A 1L5WA 5L7YA 1Q1BA 4MITA 2B3DA 3RG2A 1MPXA 1NQVA 1WSWA 3Q4GA 3T3MB 4DRXB 1EAYA 1QGYA 1VLVA 3L0PA 1DKQA 2BW0A 2GM5A 4D9FA 1RPZA 2CLKB 2ZXUA 3EGDA 1ZCBA 3S2YA 1EXMA 2WEKA 4J4HA 4Y6OA 3KLOA 4M0CA 3D8NA 3U44B 1J2EA 1XRMA 3E4DA 4RMHA 3ZX5A 1VMIA 1FTSA 2BFFB 3LLCA 3L92A 4CEJB 2PRKA 2Q41A 2QUAA 1R9NA 3IDAA 4R8RA 4GI2A 2P41A 4ZAFA 2XZLA 2JGKA 3LVBA 5KTMA 1DP4A 1NVGA 2FQ1A 2UU9B 4A15A 1MO4A 4H4CA 1FDIA 2PO7A 4L27A 2WUGA 3ODPA 5E4YA 2WU4A 5CW2A 4KRFA 4XD7D 1YS6A 4E7OA 2X4LA 4DUGD 1RCTE 2HQ1A 2LZ0A 1S6YA 4BVFA 5DN9A 3LHIA 4C08A 1VSTA 1XUOA 3O3OB 1I4DD 4GSYA 1WQ1R 2ZI7A 3LY5A 4OP3A 2IFTA 3A1NA 3OQHA 4XVHA 1LBIA 1NAHA 2BGJA 3QXGA 1S2MA 4H1TA 4R51A 1WU7A 2R8EA 5IF9A 3E7WA 4KWCA 2NZ8A 4MVJA 1JSZA 2IP1A 2XUAA 4JP1A 3WLHA 4DIMA 1X1CA 3C6KA 1N6PA 3GJ4A 1D6NA 1VJCA 2XZDA 3AG5A 4O5OA 4BQPA 3FSGD 5BP7A 4A36A 3L7NA 1C9MA 1ZGGA 1UFKA 2CMHA 4NMHA 4CT0A 4QT4A 1DWOA 3GPLA 2UYYA 1E1LA 1KEPA 2OO3A 1C1YA 5AYVA 3QW4B 3IPYA 3TTVA 5HDQA 4RF5A 1M2HA 1I0IA 2PBZA 1QFJA 1ISGA 2A9OA 2MIIA 2VK8A 3JPWA 3MEQA 5ALZA 5DRYA 1POWA 1P4JA 1JMYA 1RI4A 1T3HA 2MSEB 5FX2A 2YW9A 1TUIA 2C42A 4TWBA 2PMBA 3UFXA 5TE9A 3AR2A 1JV2B 3DXZA 3EXAA 5HOQA 3HYRA 1OU0A 2A0YA 3NFYA 4KODA 4DS3A 3IUEA 3WA7A 3GJ0A 4I5IA 2O52A 3EUEA 1U3TA 3NUZA 4G0ZA 4FC7A 2RBGA 3PPYA 5H0IA 3JVEA 3LUPA 4CMIB 4CV2A 3IQGX 1S7GA 1W2HA 3MT9A 2XECA 3QUBA 3EDMA 3OURA 4HVCA 1IVYA 1XCGB 4E2FA 1ZK0A 1T5SA 4MVWA 1QU2A 3EQ6A 2XVXA 4L8WB 1U8CB 4ZVRA 4EMBA 7AT1A 2R65A 3UHFA 2EKLA 3VSAA 1YNOA 5IMBA 2P9CA 4UMVA 5ECDA 4XIJA 3T3EA 3MINB 1JT9A 4DIOA 1YT5A 2FP4A 1C9JA 2LDBA 2NVOA 2VUHB 4FYXA 4MSUA 1DKRA 1CQPA 1GUDA 3P2JA 4P3PA 4Y30A 4ZJPA 3TI7A 4NZPA 2ISSD 3BE4A 2GPYA 1QUEA 2NX2A 3K9LA 4BY9E 3WGHA 5I47A 3AY6A 1Q7GA 4O33A 1PVVA 3T5TA 5M04A 1QKIA 1IPHA 2IHTA 2WJGA 1RWMA 2PYDA 2XMQA 4YO8A 5JTUA 4OLAA 1VIYA 2ZAOA 1SCBA 3L0ZA 4JVSB 5CVJA 1HF3A 2W6IA 3V2GA 4FI3C 3R7AA 1W93A 3P96A 3DLIA 4K3VA 1WX1A 5C81A 4PNZA 2JBAA 5ERXA 2Z04A 3H65A 1W5TA 2BOVA 3KLBA 1XJWA 3NM4A 5MHTA 3I32A 2AH5A 4WGFA 4Q00A 3LUKA 3AKCA 4LGMA 1YZHA 3CRVA 1YS1X 1DBVO 1RBQA 5GGYA 3KQHA 2CJPA 4I66A 3VHXA 3ZJTA 1F60A 2FX5A 4A73A 1G6OA 4K6OA 4W5OA 3KJEA 3IV7A 4GP6A 4LF7B 1GG5A 2IYZA 3GUUA 3IODA 2I78A 4P93A 4DQLA 3K6KA 1X7HA 4NOJA 4NG5A 2Q5HA 3BMCA 3EBOA 1UP6A 4MB2A 3T5MA 5JO0A 2BJWA 3ZCSA 1SFRA 4GL4A 3SOZA 5K4HA 3MWKA 1REQA 2EGGA 3BH0A 3G8CA 2ZVJA 2OHFA 1R6BX 1EBUA 2H85A 3LIPA 3LZCA 1H9BA 3P4UA 1DFHA 4MRSA 4HTFB 4YCDA 5TQ2B 1HXHA 2YDXA 5TQVA 1CY2A 2WIBA 1UCFA 3LLVA 3R6TA 3M3PA 5AM0A 1QDUA 1MAAA 1WCV1 2H29A 3OC0A 2OLEA 2RHCA 2WU3A 1Z8DA 1VSVA 3MWEA 3OLZA 4HFMA 4O63O 4YAEA 4ZHSA 3DV0A 3QWBA 5JRZA 1WDMA 3KQLA 2GPBA 1CETA 1HEUA 4AXBA 3QVVA 3OCWA 4W63A 2DCMA 2OGUA 4JLOA 1M75A 2R66A 2X8WA 2P40A 3GRKA 2X19A 5BV0A 1CY6A 1HDYA 3N2EA 4R69A 4OK3A 2G0NA 2YVAA 3MVEA 5D8DA 5ARCA 3AOGA 2J3HA 2HUPA 3OJEA 4M1ZA 2WM9B 3ZDBA 4UOQA 5AHKA 4H6XA 4NTZA 2PT9A 1F2VA 2TMKA 2Y1XA 4EG0A 4QQRA 3OX1A 2HA6A 3SJBA 3ZUGA 4LXIA 2WG1A 2PKYX 2H1RA 3CVOA 5F2OA 4DR6B 2PX6A 3PDIA 3PTLA 4JCCA 1R4AA 5FWYB 4BP3A 2ZCUA 1CX9B 3OEHD 3VZDA 7ADHA 2WU0A 3KAKA 4B31A 4OFWA 3GOHA 4QPJC 4I9UA 1YQXA 4C5AA 4NE2A 2FGJA 4Z49A 1Q0RA 3VH4A 1U7UA 4X60A 1A9XB 4BO5A 1SHLA 1T6XA 3EODA 2E85A 1Z88A 5EVCA 3OJOA 1NXVA 2ZU0C 1JZTA 2B61A 1GTZA 2PBRA 1YQ9A 1IHYA 3H1PA 3OMLA 4J2OA 2H4ZA 3LUAA 4X6YA 1U5AA 3T0GA 1N9ZA 1E6WA 3OM8A 4H0CA 3IJ5A 1SUCA 2ZSIA 4CGYA 4HPXB 5FKJA 2PXCA 3H5LA 3HBJA 5BVHB 4JP8A 4ZOLA 4X64B 4YRPA 1ZVQA 3B70A 4CM4A 4D82A 3K7EA 4B7AA 1BD3A 4O4HF 1SHTX 1T2UA 3DMTA 2QN6A 2ILVA 4YLGA 5E7MA 3TIVA 3AW8A 5P8WA 2OAGA 4DR7B 2YC4C 2C2WA 2QS9A 3C48A 2ID9A 1VL0A 4G0QA 2HHHB 5CLGA 4NU6A 2ZK7A 3CIFA 3CCFA 1YQQA 3RS2A 4PC1A 4EHKA 3HCAA 4KJXA 2ORYA 4KLZA 5CLHA 2JFBA 2P9TA 1UDWA 4KUHA 3ZY5A 1OC2A 4CQMB 1PW7A 2AMJA 3FVTA 4RL4A 2J9YB 4A0HA 1HDRA 2AJCA 3QBDA 5KYUA 3TEJA 2MJLA 4D8XA 1JDVA 1G1AA 3NPAA 4QD3A 4TLCA 5I7VA 2R60A 4DJEC 3DGEC 1CRWG 4P9NA 2D1QA 3QVSA 1NOKA 2OWDA 4H1HA 4K26A 2WD7A 1PF7E 4KAAA 4I1SA 4CM1A 2E2WA 4ZJZA 3OZTA 3H9JA 5BURA 5KYWB 2ZSKA 1G59A 1T1EA 1R6DA 1SURA 1Z5UA 1ZGAA 2V55B 1OT5A 1VLZA 2PWZA 2BFDB 4RADA 1NXOA 4PX9A 3TUJC 5JLAA 4HEQA 2RMKA 3TRIA 1P9NA 4JJFA 1FFGA 1XVVA 1Q91A 4JGIA 1GGFA 3JARA 3ICQB 4G4GA 4OAPA 5KSYA 4KMMA 1F0PA 3GZJA 3U37A 1C2YA 3BBLA 5HK9A 1IQUA 3L6DA 1T0UA 4WY8A 2IYLD 3TTYA 2JAUA 5JYBA 1CERA 3RUEA 3MWEB 3NB0A 1J2TA 1LRKA 4D3YA 5BW5A 4KO3S 4E5UA 3W8DA 3BB4A 1V7PC 3I9JA 3D4IA 3S1AB 1EQ2A 1WKCA 3E7DA 1R0SA 1V35A 5TY0A 3HFGA 5HF6A 1NNUA 2C9YA 4D42A 3Q3CA 3SQWA 3DDNA 1DL5A 4Z0HO 4PLYA 2EBFX 3TAXA 4CMEA 5E2IA 3KOUA 3RTBA 1CK4A 2CNLA 2DT5A 3H9EO 3K2EA 4NYMQ 4C0HA 2VS1A 5JTTA 3S1SA 3KNZA 1MGPA 4MDHA 4MVJG 4YQEA 4RLHA 3U1TA 3HZOA 2HX1A 2NZJA 3OZDA 3W4IA 4C4PA 1RKQA 2D5AA 2IYYA 3FJYA 1KDOA 1P1IA 3I30X 4NICA 4HNHA 3PR2B 1Y42X 1QRTA 1MX3A 3TLCA 2NM0A 2AG0A 3FPHA 3IOYA 1HG0A 4HAVA 3ZD8A 1QVWA 3TMKA 3PXXA 1YVDA 1BU8A 2Q5JA 2X8LA 3UMRA 4R9VA 1RT9A 2QYTA 3Q11A 3TRFA 1FRQA 4HKTA 1IZYA 1YQUA 1GY8A 1NQ5A 4TS1A 2FMIA 2ZRKA 1Q7CA 1ZHOA 1N5MA 3KKKA 4M22A 2I6XA 3WSTA 2ATVA 2G1PA 3OE4A 2VK1A 3PF9A 3Q10A 4WFJA 3TBHA 1X74A 4AKSA 3ZHTA 4IL5A 3NBUA 4URWR 2I9KA 4E30A 1B16A 1DQYA 2HH9A 2FNAA 3L0OA 3OC6A 4HQ0A 4MQFB 4KFCA 2BMJA 3DV9A 1I6MA 3FB4A 2O14A 4JLPA 3K2QA 4FFBB 1G38A 3GP5A 4BMYA 1IPFA 4MWZA 5CVDA 2VPTA 2YC2C 4RTQA 1KOFA 3SX4A 3PJEA 4HDNA 2EJVA 2KM1A 4X95A 5LA6B 4BJ6A 2KPOA 3CPSA 4X93A 2BM0A 3O8RA 3E22A 2VP5A 3F9RA 4RZQA 4CM3A 5HS4A 5J4KA 4PSCA 4FZVA 3HB7A 1UBOS 1F6DA 1YUBA 5EXPA 5FORA 5HG0A 3ROQA 2FTKE 4F4DA 2GN8A 3DPUA 4LZLA 4W1SA 3SYTA 1BKSB 2X8BA 1WB5A 1F4VA 3ETDA 1M1NA 1D1TA 2G4LA 2X1MA 1UADA 4OJQA 4MDYA 3X44A 1JUDA 1P1FA 5FPSA 2OFOA 3EXG2 3EWAA 4FFOA 1KVSA 5EE1A 5KSZA 1KY3A 3PI7A 3H6GA 4GL2A 1O9HA 2PLFA 5D5QA 4RU1A 4BBPA 4WH0A 5DHPA 1N3BA 1T2EA 4ZOLF 1E5VA 3CLKA 3GH3A 1DIBA 3L1IA 2PUAA 4KCGA 7REQA 1KJQA 1EWKA 2GXAA 2NTYC 3LDFA 4PE5B 1W8DA 2PBLA 2WYUA 4MI1A 2ZVPX 1ACLA 4ZN6A 3LFUA 3BZWA 4V0MA 5KCMA 1RPJA 4GPD1 4BLQA 1HFJA 1JQ3A 2BMDA 1UKBA 2N42A 4QRHA 1O96B 2H4WA 4IDBA 1M9NA 3UB3A 1JPUA 3D4NA 2Y68A 4PBSA 3KPWA 3AI7A 3TB6A 3HBLA 1G98A 5LWHA 4IXMA 2Q7XA 4B3JA 4ZPJA 1XSEA 5HIIA 4XB6B 1E9CA 1ZVVA 2WG0A 3L02A 5IDWA 3KOOA 2Q2WA 1FRVA 1R18A 3U39A 1G0OA 1MNAA 2WUVA 3C2QA 3UV6A 5BV7A 2KBFA 1EK1A 3VKVA 1QFMA 2JFUA 1GU1A 4C1BA 5HW0A 1LW7A 5CTJA 1VIDA 2O57A 2SKCA 3GCDA 1IOWA 2JAXA 4L73A 3G49A 2OK7A 4GMKA 3CRMA 2VHUA 3M34A 3HN6A 3K1AA 2H5EA 2RHTA 3EDRA 1EI9A 3PVZA 3URKA 4E6PA 3L7IA 4EYSA 2JKZA 2R44A 1IEQA 4J49A 4GMHA 3PQEA 4YQZA 1ETHA 1M2JA 1VDZA 3QE4A 3UAVA 2VH2A 1N0WA 1WHSA 2WAAA 1NWCA 1GPLA 2YWFA 3AY0A 3NLLA 4FSHA 2ZRPA 4XPIA 3HY3A 3VYSB 4CHTA 1HMPA 3RVMA 1M6YA 2AF4C 5AT1A 2Q45A 2PWBA 2WT8A 5HJ7A 3SZMA 5DBOA 2P6RA 5FXMA 4CV0A 4PYOA 3LOUA 1CJTC 1RPAA 3A6DA 3FWKA 3HNOA 4IIHA 5DEIA 4BC1A 4RTOA 2P4EA 1P5HA 1Y6JA 1SUIA 4MRNA 1NPDA 2HL6A 4O2AF 2EW8A 3X2SA 2O2SA 2G1UA 1BA3A 1L5NA 1O95C 2FE4A 1TUEA 1DTEA 1PLJA 1W581 4YI3A 4YJ3A 2MWMA 2MMGA 1TIPA 1Q12A 3SHTA 2QMOA 1OLSA 1HLGA 4JJGA 4ENUA 3DDUA 2D8MA 1KDZA 1LPMA 2JJ1A 1JHYA 5FNVA 5LQDA 4PV7A 5SYAA 4X62B 4C4TA 2VSFA 3KTAB 1DQRA 1PJCA 1YQEA 2QJFA 3R7BA 1H1LB 5J9FA 3HNRA 3G82C 1M5UA 1UWCA 2YDYA 4BKOA 2CMDA 3BAZA 3N53A 3RVQA 3ZK9A 2Q3FA 1Y7HA 2D54A 3EG9B 1P2VA 3FZNA 1X8XA 4R9UC 4CLEA 1GPH1 2YNMA 4GXQA 5KZMB 5K0NA 4KIFA 1G5HA 3CY6A 3F67A 4B5LA 1JX6A 1VJ0A 3H8VA 1Y33E 2BM8A 3TTXA 2QGZA 3K09C 1J4AA 1D9ZA 3VO2A 4G0WA 5LU8A 2OAP1 3H8JA 3LT4A 1XNJA 1EFLA 2KS6A 4BEWA 1CUFA 1ZSNA 3G0OA 4A5SA 4HEJA 3W79A 3FHOA 5J2TB 4IY1A 4CMEC 2XXJA 1YXMA 2FP4B 5CAEB 4V39A 3USES 2N47A 5BW4A 1NXXA 3EGCA 3MA0A 4BFVA 4GP7A 3GLIE 3ESQA 3RC2A 4TV9A 4L4YA 5IUKC 4BZWA 4DM3A 3RQIA 4OMUA 3ZUPA 1EESA 5ALTA 1R6AA 1LDEA 3BWCA 3COYA 3IQEA 2VT2A 3HM2A 4U1RA 4ZT7A 4D9IA 3DG9A 4PRZA 3GL9A 4HQRA 5LKRA 4LJRA 1WV1A 1HNWB 3LA8A 1UM9A 4ZA2A 4ZT5A 3C8MA 3RTAA 5T4HA 4EYQA 4MQMA 4U3JA 4MWCA 3W2FA 4BRWA 1IXZA 2Z0MA 5JH7F 1L3BA 2BEVA 1MFPA 2G8NA 2GK3A 5K2OA 3VR5H 2ZZNA 4XWAA 3UFXB 1THMA 4J0JA 4QFCA 4RH0A 1NQWA 2C82A 3R0QA 2IKQA 4GPZA 4HAIA 1ZIYA 3ORYA 3M6WA 3ZE6A 1ECJA 5FBLB 1Y4AE 1ZM4A 3ETGA 1O87A 5JS1A 2QM8A 1BHJA 1ZQ1A 3QVWA 4MVJD 4GXNA 3T7IA 1YZVA 2ZROA 2VQFB 4MVCA 4U63A 1KDYA 1XA3A 4A82A 4QBKA 1IOVA 4I50A 4ILKA 4TWIA 3NHYA 3NW9A 2GM3A 2VDJA 1LF5A 4PIPA 4DT1A 1BE6A 4WASA 3U3XA 1M0EA 4O2BA 4EW6A 1TCCA 5JXWA 2ZZMA 4L08A 3ORFA 3RVSA 2ZUWA 3HR8A 3CX3A 2VR1A 4QDXA 1U7WA 1Z2PX 4PEVA 2RBEA 5LP6B 5DWVA 2IW3A 4BFSA 4UBJA 1EX9A 3PHLA 1I4EB 1DPFA 3OKPA 1QGOA 2JH9A 2PX5A 2AD5A 4R7GA 2WJHA 3A6GA 4BMVA 3TGWA 1S2OA 3DCJA 4ID9A 1JKFA 3FDZA 3PGA1 3LL7A 3EVDA 4RQBA 1LLDA 2C3MA 3U56A 5BN5B 3W7BA 1THTA 3B8HA 1EFRA 4PZDA 4V3CA 5BVHA 3H5AA 3GLFA 2VQDA 4K8OA 4D8TA 2WWHA 3AILA 3W8NA 3QU4A 3TNFA 4AWAA 1A4IA 1EEHA 3DWGA 1I8TA 3GNQA 4DVGA 3GLGE 3M4JA 2A0XA 5BPHA 1T5TA 3ISTA 4WSOA 4BWVA 2QQ0A 3LBNA 5BVGA 4OHKA 2EG5A 5LXTA 2HFJA 1MN6A 1GFWA 2O8NA 4KH0A 3RUFA 4MEAA 3EVEA 4HMQA 1LFDB 2FZ4A 1E2NA 5AKEA 5IJ9B 2VATA 4FEAA 4B3MB 3NV7A 2X0RA 3HHEA 2XNKA 4M55A 4M1TA 2VF2A 1KJJA 1EJ0A 1F3LA 4TL8A 3LPCA 4NV3A 1FW6A 3SZ3A 3AESB 1ZCFA 3GJ7A 4IS3A 1UBUS 3IP1A 3DWIA 3GG9A 3VVBA 3WIDA 3ZIAD 3IEMA 1T15A 4J3FA 1Z4QA 1QPBA 1XEXB 3F2VA 4UUNA 1R12A 1WDWB 1YCFA 1W75A 1O94C 2WOJA 3IAFA 3AUKA 3LF2A 4DMFA 4DMRA 5BT8A 1R00A 2BMWA 1Q6YA 2A33A 3CG4A 2BMEA 2HMYB 3FPLA 5EQJB 3WFIA 1YK0A 4HF7A 3K09A 2CL7X 2I3AA 2QMEA 5G0SA 2HRRA 4BQRA 4X3CA 1WPRA 2Z9BA 4D4MA 4I4LA 4AUKA 4WZAA 4JB3A 4KQKA 1BS1A 1ONBA 1WXQA 2NPFA 3GDGA 5IU6A 2XTAA 2P2NA 1SKAA 4ETWA 2CLMB 3WLPA 5A3RA 4FKMA 2QM0A 5E2BA 4PGHA 4EYGA 1F4PA 2HMTA 2G6BA 1X2EA 2PCJA 3AGPA 3B8EA 5EXXA 1O95A 2J4CA 3NBFA 4EF6A 3EXIA 3QEBZ 3BE6A 3CSSA 1U2TA 1H8ED 2GEVA 3B1YA 3T7DA 3TMYA 2OGTA 3ZW7A 4MVJF 5AUPB 1XQYA 1H4SA 1TMGE 3WFZA 1MH1A 1RIIA 3CLTD 3T15A 3X2FA 1GKIA 2XOEA 2G77B 3NJ4A 2OZLA 5D3QA 3AIKA 4ENQA 3OTIA 4PG4A 4Q6BA 1YAJA 2Q28A 3K9BA 2YXNA 4QVGA 4DA8A 4RENA 4KMRA 4RZHA 4P54A 3GEMA 2OR3A 3B3AA 1TZ2A 1K7FB 1IM2A 1Z73A 1ZYUA 2A5DA 5IP5A 3SHVA 5BUZA 1JG4A 1UBCA 3O2NA 1Z2CA 2YQZA 3HLYA 4Y2YA 4AS3A 3G9TA 1GPDG 2OCDA 4BV8A 2FG6C 2QMQA 2NOAA 3TWOA 1D9XA 3HDTA 1G5FA 1QVVA 4LSGA 1T5LA 1DHRA 3DE6X 5LC1A 5LIRA 3L0SA 2Q5FA 2AJLI 5BR7A 2OTCA 2AEMA 1KEVA 5UKDA 2C94A 3OPYI 1SJ9A 2GO1A 4P7GA 1HY3A 4NBUA 4MKIA 2ZSDA 4RORA 2G07A 3SXPA 3R6LA 5EHIA 4A26A 4B4VA 1TIBA 4C0LA 3C41J 2P5UA 2ZUEA 4IJMA 1XFAA 2VZ8A 2R79A 4KRYA 1I2DA 2F17A 2VK2A 5IDYA 4MAMA 4LRWA 4A1FA 4RSGA 2B1JA 1FNSA 2YMQA 3LK6A 4QYXA 5A3SA 4BVBA 3OZWA 1GNPA 3DKIA 4IWYA 2DTEA 3BKWA 4RDIA 4LQCA 4NU0A 1ICIA 3I2GA 2YMPA 1CTQA 4F9GA 4BNJA 4EY7A 2JZNA 1RRPA 2DKNA 1RWBA 2HF9A 2R00C 4KSCA 1XXHA 3AFMA 3LSYA 2F3RA 3AEUB 3CM0A 3DBHB 4XB1A 3UH1A 5A4KA 3RYFB 3BWXA 2H5IA 4OHWA 2O1XA 1RC8A 1XWWA 4RAQA 3D4PA 3UUGA 5HE9A 1ZEMA 4K9DA 4KW7A 1JW9B 2ZIXB 5SZIA 5HCIA 3AF4A 4QBTA 3I9MA 2HLHA 2ZSAA 4WLOA 2EW1A 2J8ZA 2R8RA 1OD6A 3C85A 3HJBA 3L6BA 3PFNA 3RO7A 3ZHYA 2QTWB 5U4XA 1GFZA 1B6RA 4PW0A 2HKIA 2FUNB 2FPIB 5HQJA 1DE0A 3VDQA 4D0RA 1M1XB 1VYTA 2IYPA 4ND6A 5TV2A 2CZCA 3BIFA 3PC8A 4CG3A 5IJ0B 4ZHQF 4KQJA 4LDJA 4XQ0A 1MO3A 5GJBA 4J07A 2P7HA 2CXTA 4RCVA 3LDGA 2GZ1A 4K9SA 3ZN2A 1ACMA 2VQ3A 4KGDA 4DDUA 3DMHA 3DJYA 1IQ0A 4D97A 1A8PA 4G4JA 2R7NA 4GNRA 1JG6A 3PUWA 2BZ1A 4N0MA 3FCCA 3ROEA 3U3DA 3V4OA 1H2AS 1EFVA 1NFRA 2ZYVX 4CQMD 1F2TB 3P9QA 5A2QA 4KBGA 5C5CA 1FS4A 1KAEA 4YMIA 2YQ4A 1CNMA 3IR5A 1E2EA 3N5KA 5FLEX 1UMDA 3MOGA 4BKQA 1YNSA 4M53A 4PNHA 3KFVA 4PONA 4XA8A 3E82A 1YFLA 4WXHA 1KDRA 5BSGA 3NORA 3M1AA 1CR0A 3U7EB 1XDWA 3KXIA 3BK1A 4A0SA 2YY7A 3B7GA 3DKPA 1T8SA 3KK0A 3UIEA 1JHMA 2YINC 4FGKA 1L7DA 4LISA 3LK7A 2CMFA 4Z8XA 2AHRA 4DUGA 4QGSA 5AK4A 3TM4A 1SBTA 4NJOA 4PWYA 1P91A 4QRDA 5DJ5A 3A3YA 1PYGA 3VZRA 1ZG3A 4REQA 4YYZA 1U9IA 3I5XA 1X8JA 2ZZKA 3MGBA 2C2OA 3I1YA 3Q0EA 3UAYA 1WY5A 2VUUA 4BNVA 1WW3A 4C6HA 3QEAZ 1IPEA 2ZSJA 2C7GA 4O8ZA 2J3JA 2CLSA 3RJMA 3O83A 4B3SB 1IG0A 2EJCA 1C41A 3A0UA 3FPEA 3JWEA 1RJFA 2P9ZA 3O91A 4JBYA 2RK3A 3FFTA 4MW1A 4PPFA 3F1KA 3SJZA 4BFXA 1JHUA 2QTZA 3J80A 3IS3A 3BMQA 2WYOA 5AM2A 1T3TA 3RUPA 2ASEA 3AUUA 3N05A 3NHZA 4AX8A 1K6XA 4L85A 5LP6A 3G2MA 1LPSA 4MV0A 3GUYA 2R7LA 1M66A 2IPLA 4IEFB 1EVKA 1RMQA 1PQPA 3P2KA 1GDDA 4MW4A 5E4JA 5EJ8A 2OCYC 3DTTA 3GPDG 5ER6A 2UAGA 1ATZA 3WYFA 2C4KA 1P2UA 3MMNA 5AW8A 2CFCA 1GPAA 4JP2A 5BR4A 2WA2A 3MLEA 1VPEA 2Q4BA 4OAOA 3VNRA 3X0DA 1MA0A 2HIGA 3CZ4A 2MYNA 1IHUA 2QX8A 1KAGA 2BEWA 4KQ1A 5F9MA 2YWRA 2J5KA 1NYLA 3PBKA 2F7SA 3PGMA 1EA5A 1GLGA 4NECA 3HP7A 2CKMA 4WZBE 1ISRA 3QHQA 4R16A 5AJYA 4BMDA 4HDCA 4OHPA 3U61B 3HCNA 4N3NA 1T26A 5CJJA 3GMSA 1E2KA 4KFTA 5BWLA 3U19A 2X1LA 4B2IA 2B1RA 2Y05A 4G25A 3H8SA 5IULC 1CR1A 4B8YA 2YVUA 4E11A 1JQEA 1F2UA 3FGOA 5K09A 1XMSA 2F1JA 2P9BA 2G25A 1VIAA 2H63A 2X0FA 1TOAA 2MT9A 2G08A 4YROA 3UBTA 4Q19A 4FJ0A 4BV9A 5G53C 2VTKA 4HZUB 4RQTA 3EC1A 1JEJA 2GEFA 5MDHA 4JIGA 1XEXA 2CUNA 5FYDA 1DDIA 1WY7A 5FWXB 3HADA 3DWFA 1J7JA 3DZHA 5C8ZA 1LJUA 1DC5A 1T1JA 3DOIA 1ICEA 2TRSB 4LF6B 1Q1NA 1VTKA 2R3SA 2R48A 2REQB 4QXRA 4G6ZA 3WA6A 3FRHA 3L40A 5J3JA 4HWOA 3KEGA 3O6VA 1EBBA 3NTUA 3G5TA 1R5JA 4PYJA 1N92A 3IBCA 2XD4A 1X7YB 1AK2A 3FOBA 2QUZA 2BGNA 2CNOA 4UTPA 1E32A 5KYNA 1O1YA 1SA0A 2KLBA 2OV2A 5EP3A 1HYQA 1XRNA 1YA6A 2XDYA 2ZE7A 3OIYA 2FSFA 5EKSA 1SCNE 5LYJA 1Z0FA 2ATCA 3CS3A 4B84A 1PO7A 4TWAA 1GR1A 3HPRA 4OATA 1ZVMA 2J3LA 2Y9MB 4V1CA 4TS3A 1V9CA 3NWJA 1LV8A 1G8SA 4G5HA 1BQ3A 1G8MA 4JLNA 3S1LA 3U4QA 3PZBA 4J94A 1ADFA 1MXFA 1PI3A 4CQMA 4BKRA 3REQA 3FPAA 2CMGA 1D6JA 1O54A 4NPCA 5EFZA 1N2ZA 2VP9A 4KDEA 4BFWA 3E5NA 1VI5A 4ZI3A 1C30A 1KZ6A 3DD1A 1HDOA 1S3GA 1T5BA 2PVPA 3D43A 3M4YA 4IJUA 4WX2B 3SYNA 4N18A 2FVYA 3JZDA 3VO9A 1DRUA 3Q8MA 3V2UA 4D4JA 2YHIB 1DQNA 2ODWA 5ALDA 5E7QA 1EFCA 5TJHA 2NUTA 3TKAA 1OBOA 2PMFA 4OJNA 3VI3B 1G64A 4ZT2A 3OZSA 4F71A 1L5YA 4K03A 4L15A 2ZRIA 3RWBA 1J0DA 5I7RA 5K8IA 4LJKA 3MTDA 3U7GA 2FW8A 4US0R 4AZ3A 5AVSA 5KX5A 3LC7O 4HP8A 2JLWA 2RHJA 4O0MA 2EF0A 3GAAA 3RS9A 5BSEA 1NBME 3GZNB 3RUAA 3B82A 5HRAA 4P82A 1VLJA 2HQBA 4OLBA 4OGLA 1SZPA 2AFIA 3HH8A 2FX3A 3V7UA 5HOEA 3OQNA 4O2BB 5JSFA 1KU6A 3FGNA 4ZWNA 2EJWA 1ZN9A 3KEFA 1LQTA 3RSZA 1IUNA 5L7WA 1YS4A 3TRJA 2RAVA 1JE0A 1SCIA 4FGSA 4A27A 1G63A 1KRHA 4AUEA 3FMOB 2PUVA 5BOVA 1GCIA 3TDMA 2Q4OA 1N2XA 3DDZX 4PZAA 3X1ZA 1TPYA 4RTLA 2R8OA 5FWXA 5FUQA 3OZUA 4PFQA 2Z2ZA 5AKGA 1JE1A 1PG5A 4S1TA 4YONB 4DZRA 4GC5A 4ZZ1A 3L5OA 2OP0A 4XVQA 5BSTA 2QY6A 3WB9A 5I9MA 3SR3A 3HCCA 2B78A 3ZDZB 3PHIA 5F7ZA 4PHCA 5I3ZA 2H9AA 1QKKA 3Q6NA 4DMUB 4BNHA 5FPPA 3W34A 2W8BB 3WL8A 3ZTTA 1LSUA 1O89A 1WW8A 2IYFA 5CB4F 1LZLA 2WF7A 1R8YA 1DQPA 4YJ2A 3O2QB 5A5EA 3HA2A 2LCIA 3TF5A 1HKHA 4L95C 3E27A 1EVZA 3HTXA 4DR4B 3I76A 4YRAA 2HMSA 4J0EA 4LJSA 3TIGA 3W6UA 4LSWA 4Z54A 3DMNA 1W85B 2PWYA 4PYKA 5A5GA 5LDGA 5J2TA 4IRUB 4X8LA 4UVHA 1Z13A 3BC1A 4N41A 4QASA 2VAWA 3AO0B 3GP3A 1Q11A 3HG7A 2ZI3A 3FKSD 2Z3WA 1TUGA 4BX2A 4EUFA 1KYYA 5COAA 3EYAA 4KJZA 2OYSA 4R1TA 3CT6A 4RLQA 3ZBTA 1PJBA 3HFJA 4MHOA 4JLKA 5KSWB 2B5WA 1CRPA 4F45A 4IXWA 3WDLA 1XX6A 1KI3A 3A9SA 1ZN2A 1PR4A 2XODA 3NVDA 4UFNA 3ZWYA 3LBHA 1RR6A 4UUBA 1AB5A 4LFCB 5JI2E 2ZDHA 3X1DA 5ED4A 4D4KA 2H1HA 3TJZA 5A4AA 4AF6A 3H1GA 3OZ7A 2MSNA 1BZYA 2FLWA 3K0FB 1BCSB 2QDKA 4U0KA 1P18A 3IAHA 3PE4A 4UULA 5KX5F 4EGAA 3P0EA 3OFKA 1Y3IA 4DEYA 1G4AE 3EEIA 1C3LA 3RJ5A 1R64A 3OLQA 5KVVA 3BRQA 3Q9NA 4ZVPA 1N0HA 2Y1DA 1ZHFA 3E9NA 1KSGA 2PUCA 1V6SA 1QGUB 1J8DA 1SBCA 2C7BA 4O02B 3OF3A 3SS8A 1QUFA 4IJ6A 4MICA 5IYZF 1QPZA 4M54A 4M0KA 1RAFA 1FTWA 1T25A 2I7VA 3D1VA 3LVRE 5ALKA 1QRUA 2FN4A 4Q3OA 2LP4Y 3UQZA 4UE6A 4XGNA 2W2OA 1I4TD 3QELA 1FJHA 3THRA 5HBGA 2JB9A 3UK1A 1HE4A 3O92A 4LX8A 3OEED 4C4SA 2WV9A 5AFSA 1P2FA 4WTOA 2OZVA 5LMUB 2JD1A 2HOQA 2GFHA 4Z2AA 3NWPA 4AQYB 1NG1A 4IP0A 4WUVA 5I48A 3QLTA 3R8CA 4H3KB 3VGJA 3LCJA 4RHCA 2W4QA 3WNDA 1DCMA 4MULA 4BLOA 2ZUTA 1ZR4A 2PKXA 2CJYA 4U7HA 1PBTA 1F3OA 4V02A 4FZ5A 3WOHA 2QX9A 5F12A 2DRIA 2HO4A 1RVDA 2REOA 2YY6A 3AM3A 1X1TA 1TLFA 2GJ9A 3K15A 3YASA 3HU2A 5KPDA 1EZ4A 4F72A 1AK1A 4ZTZB 2C78A 3KB6A 2VJMB 4DQXA 2XRMA 3TVYA 3W77A 4N0PA 1ECPA 4N12A 4RVOA 4D4HA 4IFIA 1E2GA 1HNNA 2H18A 4ZXFA 3GVPA 4YPOA 1GCUA 2WKQA 1IBRA 5IJAA 2IEGA 3B6MA 3REGA 4DV4B 2AVNA 1WXGA 3O8LA 2IC5A 3FPJA 4H7EA 5HFJA 5IM5A 4LDQA 2VTBA 1POXA 1W44A 5D00A 4HDAA 1G20E 1NV8A 4A03A 1YZNA 2J87A 1PZNA 1A9QA 1KVQA 3AEUA 4K6CA 5TQ2A 3T3DA 1FLNA 1X7XB 3GW8A 2F64A 2JIZD 4YAFA 4OI2A 2GRUA 3TGPA 2L17A 3ZBUA 5A6SB 2X9GA 1JDTA 1CJVC 3AKZA 1A72A 4IIJA 3FFWA 4ZVMA 1UL1X 2VYCA 3AFIA 3CLRD 5T64A 2VCYA 3WX0A 3PNLA 2FEPA 1X1BA 2IPXA 3FNBA 1QQTA 4OBWA 1ZX1A 3G9UA 4CUZA 4N4AA 1JMVA 2QMZA 3SVZA 1QGAA 3OCVA 4M9SA 1ODCA 1RWKA 1YS9A 3EMVA 2IZ7A 4L4UA 4RETA 3ZQUA 4IHJB 1M67A 1PQYA 2GZAA 4RYLA 1TAUA 2WTXA 1SBNE 1XTIA 2H0QA 4IFBA 4YJ3F 4ZOQI 3AT1A 3KYBA 3B2EA 5IC4A 3QOWA 2CC2A 4DJDC 2W00A 2DWCA 2QN3A 4FN5A 5E6SB 3KKMA 2SECE 1DJPA 3GLIB 3M70A 4I08A 1T0BA 1U9YA 1TJPB 2I2XB 4H0NA 5CLFA 4WZ6A 1HT3A 1USGA 4MX8A 1B7GO 1Q14A 3AF3A 3L7BA 3I8XA 3OFNA 3OOHA 4QICA 3DDCA 4H3VA 4YV2A 3QSYA 5DYWA 3MIZA 1MTOA 1KYQA 5AHRA 1ISMA 1CNEA 4FNOA 4REOA 1P3DA 5HWSA 3BS4A 2IH4A 3IB6A 1NUHA 1TLLA 4M8NE 4S0ZA 3VA7A 2I29A 2W0MA 4G81A 6ABPA 1Z4JA 3U3MA 5AJHA 1ODFA 1YB1A 1NU8A 1J25A 1NN1A 1PG2A 2XHEA 1PVOA 1VL2A 3H1TA 4XASA 3WMGA 3G7SA 4P0TA 3PX7A 2VHTA 2AFHE 4DLBA 1UWLA 4R6WA 5KNBH 5M7EA 3UJ3X 2C77A 1C9EA 3OUUA 3JALA 2ZRFA 3FNQA 3T0IA 1LKZA 3EXIB 2E4XA 3A9TA 1KL7A 1RKUA 2FZLA 2FF5A 3PSHA 4Q7EA 3T9CA 1WCIA 1YTLA 1J0EA 2FW6A 2F59A 4G1EB 4UMDA 5D85A 3GQVA 4ZKEA 1ZGCA 3B5JA 3RTDA 1TQ4A 3SS9X 5EUBA 4HH1A 2ZBQA 5BSFA 2VKTA 3GNSA 3LLUA 1MQAA 3M6VA 5G2OA 2BZSA 3LI2A 4TN1A 3RVJA 1SULA 3RRJA 2ADOA 3ROTA 6REQB 2GXQA 5THKA 1N2HA 3V1NA 1D8AA 1SZJG 2QZJA 3PIRA 4ETIA 1CY1A 2ZIWB 4MPJA 4ZCLA 1PT8A 1PL7A 3ANXA 4Q1AA 5EAIA 3VPBA 5B57C 5HPYB 2IGBA 2QAJA 2HXSA 3SM3A 4F7DA 2OVBA 5KI6A 4J1QA 4ZAGA 3UOGA 1Y80A 2RFLA 2D2XA 4NNJA 6NULA 4BXOA 1DUIA 1M1YA 2G83A 2VJOA 2VUIB 1JVSA 1ESMA 3A36A 3JQ6A 3O94A 3QHPA 4GR5A 4B6GA 1NW9B 1ZUNA 2VNAA 1BFUA 2VPIA 2XCLA 5I45A 1OOEA 1NQTA 2FKAA 2CXUA 1ZNWA 2ZSEA 2Q07A 5AVRA 2FH5B 5CX4A 1EDZA 5CFPA 4B3IA 4CIYA 4II2A 1M74A 3JSXA 2UKDA 1JB1A 1F0KA 3HVHA 4IHKA 4M76B 1E7RA 2IY9A 4UHBA 1LTKA 1MOZA 3INNA 5HSGA 4Q1FA 3ZHCA 1C8KA 1TM2A 4ZYZA 2WJPA 1VJTA 4HMOA 1R4ZA 3PEYA 2PGNA 1JHPA 4I6JA 4R0NA 3U81A 4Z0TA 3E03A 1Q0LA 1KA9H 4G41A 1E3WA 3EEOA 3ZZMA 4EQZA 4GDMA 1ZRMA 1J09A 2AXNA 1LXCA 2N0SA 2XQJA 2HDOA 4I8DA 1KFJB 1XELA 2BMVA 2V1XA 4IF6A 4ND7A 5EJEA 4AF7A 4ZQIA 1F12A 4M8IA 3M9XA 1RAHA 4FOOA 1UWVA 4FYVA 1BJTA 4P31A 4PGAA 2Q3HA 3KZXA 1ZESA 3ZOKA 1COWA 2FW7A 3RVNA 3ZCVA 2W6CX 1QIKA 1PS8A 3B2QA 1TA0A 4E5KA 4QOGA 5F5LA 1X1DA 5K0EA 3EVTA 4WZZA 2GDJA 2C8LA 5AHOA 1N2OA 4A6PA 4LOIA 2FZCA 2IP2A 4QA9A 2F1IA 5G4KB 3Q7PA 4N3GA 3IB3A 3WBFA 5DM0A 3SMVA 1AGRA 4GMDA 5IXYA 1KAMA 4FVTA 4HQOA 3K2BA 1CIJA 1QP8A 3Q3EA 2QTVA 2ZE6A 3ZG6A 5EKDA 3V6MA 3L82B 3KQUA 4ESVA 3MWDB 2VAMA 4I4TF 4EG4A 5JDIA 4BO7A 4Y6SA 1AOXA 5TNXA 4PG7A 5J2UB 2OILA 4L5JA 3N2LA 1ESZA 4CM8A 4QLOA 5IBCA 2J7KA 5D2CA 1NUQA 4F5YA 5KNDA 1WD7A 1CJUC 1P1HA 3A1DA 4CM9D 2HSEA 4FCWA 4CQLA 1RM0A 1E59A 4XE5A 2AJBA 3MGGA 2R5WA 1F0YA 4X8MA 1X0XA 4AUNA 5CNKA 4DLXA 4GI1A 4DQKA 3RNOA 5KIAA 2DULA 3DF7A 3OUTA 1H2WA 2EX4A 4K05A 4IWXA 2QNRA 3DO5A 1UR5A 3QV1A 4PSDA 2WIFA 1RM3A 4KKVA 3T9DA 4BX8A 4Z3KA 5MN4A 4Y1FA 4ACAA 4HNGA 4HAWA 3T5BA 5FEMA 521PA 3L6CA 2HF2A 4MUMA 1VKHA 3DV0B 4MW7A 4EA6A 4Q7QA 1RJ9B 2GAOA 2ORVA 1XEFA 4OJKA 5J63A 4HVLA 3K92A 2DQKA 3DT8A 4WXYB 3L0IB 2QU7A 3VDXA 2X3UA 3EOBI 2PNJA 3W5SA 3UK0A 4FZ3A 1OFVA 4NH4A 2B8TA 1QTIA 1AC5A 2XCOA 1WPGA 2F9LA 1OH6A 2GVZC 1IY9A 5CRIA 4PHTA 3ZI0A 4G5GA 1OYVA 2VDOB 1OY1A 4B6PA 2RONA 3JWHA 1EX7A 3HP4A 3PWKA 3VMMA 1R9JA 2C4NA 1EK0A 3BDVA 1H5UA 1UEIA 1JKMA 1LUAA 1NKTA 1EE1A 1TQ6A 2O9JA 4DLVA 1J8FA 1NBAA 2PA3A 3COWA 3QVJA 3AP1A 2ODPA 1JDUA 1H93A 5E6SA 4PZYA 3L1HA 1SAYA 2BIFA 5BYBA 3EA5A 4YCJA 4HTFA 4C0XA 1L4KA 1JHDA 2FV8A 4HJRA 3A1WA 4NE7A 1V1JA 2JIMA 2Z56A 3M5PA 5ITWA 2HO5A 2BKEA 5K2MA 2ZTHA 3VNBA 3QY0A 2OZEA 3HVJA 3DS8A 1RLMA 3KKZA 1JDSA 3FYTA 4Z4QA 2IF0A 3D6AA 2NUPB 1R0KA 1D2NA 1VKJA 3HMKA 5ESWA 2HLDA 2Z4RA 3OZFA 2QR2A 1R3UA 2YH2A 1TO6A 2R97A 3D7LA 4IZIA 1I1NA 2EYQA 3KJGA 4GZ6A 3KPJA 5DO9A 4BJHB 1UFQA 3OWHA 2XVYA 5BPFA 1XRRA 1W36C 2FQXA 2HSDA 1O8BA 2QRHA 4G1CA 3TVDA 2B6HA 5BYKA 2ZE5A 1U5BA 3PUZA 2XXAB 2R85A 1VKNA 1IZZA 2JFHA 1IN6A 2VT7A 3RH0A 3K9CA 3VR4D 4MO9A 2OZLB 2TMYA 3GA0A 3O8OA 4FYKA 1K1EA 4PPNA 3DNMA 3ED1A 4FFPA 1SOUA 1E7WA 4WNAB 1JSLA 2FFQA 1J7KA 2QVLA 4OU5A 4YGXB 2P78A 2BJHA 3KCNA 2RKWA 4UQPA 4TQUS 1ZOSA 1U3GA 2ATIA 1I6WA 1NNSA 3HYNA 4FDMA 1A2QA 1K0UA 2BMFA 5H4HA 3PT9A 2HRQA 4P5PA 4PICA 5EJ7A 2I2AA 1IEVA 5JD6A 1W4RA 1WEKA 2P4UA 3BVPA 3C1TA 4FYWA 4U2CA 4AM8A 3OJLA 3NM6B 4N5LA 1XMQB 5E1BA 3R3VA 5DNYB 1ZINA 3WKBA 4BNXA 5BORA 2AN9A 2CVQA 1ST3A 1GVHA 2HF7A 4MXDA 3GLGA 1ID8A 4YRZA 3OZBA 2OV3A 5DTJA 1NN5A 4LFAB 1F6BA 4MW6A 3FPSA 1YF3A 4HHEA 2XR1A 3ZU6A 1J9GA 5L6LB 2AG1A 1RQPA 3EWNA 2R2GA 1VHTA 5D5HA 2JS7A 3PNVA 2GBLC 1V3VA 2Y27A 3RRBA 2JIOA 2D5BA 3HCOA 4OF4A 3EHEA 2R1UA 7REQB 2IUTA 5CR9A 2ZJ0A 3ZQ6A 3W1VA 4HNUA 2XBMA 2AWNA 5F1YA 5CFNA 1WOYA 1KO8A 8OHMA 1OUMA 5LDHA 1P8AA 5KAPA 1CF9A 1N1GA 3DZCA 3ZXYA 2B4YA 3RD5A 1QQ6A 3EXEB 5CDHA 3M3DA 5KJ1A 4DV0B 2BFNA 3HEAA 4IKOA 4UXJA 5JD3A 2V98A 4IDAA 5EY5B 3QKRB 1THZA 4FR0A 1U2GA 4G09A 4KGZA 3ZNPA 3VTKA 2IYWA 3K32A 3C16C 3ZEAA 5CA0F 3Q98A 4YRCA 2QM7A 5D3KA 5DNAA 1GTRA 4MR7A 5F2EA 1UJ4A 1EHCA 2Q3DA 2I2FA 1ZK1A 4DCJA 1G3IA 3N2KA 4I9FA 1K8QA 2GASA 3MRVA 4AYWA 4HMPA 4TT8A 4GOKA 1NI3A 4KMSA 3L8HA 2BR3A 3KTOA 3KLMX 2QRVA 2ODAA 4HRXA 4JUIA 4MS1B 1P4AA 1CZLA 3COVA 5IBRA 1JDPA 2GM4A 2EC5A 4HDSA 1II8A 1UK9A 4X8HA 1CIPA 1DC7A 1R6VA 1Y3HA 5D1HA 2B1IA 2OCLA 4YRIA 1C7IA 4UUOA 3Q8KA 3H2BA 5JSZA 1WNTA 4AZVA 1ODIA 1O95D 8GPBA 3I92A 1J2JA 1SPBS 2DU8A 3NANA 1DLIA 1IUOA 5T67A 4CR6A 4EHLA 4V0NA 2X6RA 3E1GA 5I3CA 1HT2E 1N6IA 1UKVY 3JQEA 3KVOA 4PIVA 3GJ6A 2R1TA 1GEGA 5E6RB 3HWWA 5IKXA 2V0CA 2ZSHA 4HNQA 4TRMA 1IB6A 3E0QA 3KBBA 2GPAA 3QWFA 1P0MA 5ENVA 2FUG6 3AHEA 1NJSA 4E31A 3TW8A 3DPSA 2E3JA 2QEQA 3TPFA 3AR6A 1W30A 3A11A 3IQFA 5BSRA 2W70A 3MWYW 4FEGA 1UKAA 6ADHA 1KDPA 5J23A 4Q47A 1SUEA 1EVIA 2JEOA 2PHZA 2QRGA 1S4MA 3UAWA 3WGKA 2C2YA 3QA9A 1M6VA 1D4AA 4BMZA 16PKA 1K6MA 3O4VA 3EPJA 3Q7IA 3PC3A 2VHEA 5BN3A 3TLGB 5B6JA 1V7QA 3WLMA 4CL0A 1Y8QA 4A6DA 1FYEA 1M34A 1QDEA 2P3QA 3HU1A 3AY7A 4MI9A 1R2QA 4NFSA 4YMVA 1KOLA 3EK2A 4GS5A 3ZJYA 4Y6PA 3ZS9A 1X77A 1YE8A 3R3JA 1L3IA 5GZ3A 1KERA 1SXHA 5AI6A 1PLLA 3OOWA 4C20A 1IN5A 4HFNA 2JHAA 3KTDA 4ZMRA 5DIZA 3IHKA 4ZT6A 4KR3A 4F6RB 4L6IA 1PR5A 1X19A 4ISBA 3PNMA 4W5HA 1MJ5A 2CUZA 1GA4A 4FIZA 1ID1A 5EWMA 1RI5A 1ZLYA 2Z2KA 3O8QB 1KQFA 3WGQA 3ZGOA 3BRWA 3BFVA 4BLTA 1M76A 2JD2A 2XDQB 2D3TA 3R0XA 4MCIA 3R74A 2I4OA 3D59A 4MROA 5CG2A 5SICE 4QLBA 4KQ2A 2G1JA 3K70C 3K5PA 3CNBA 4GUDA 5EZSA 3R8XA 3JALB 1Y9AA 3HCFA 1E7MA 1A8UA 3QVGA 4HNAA 4GKBA 3GLHA 3WZ2A 5C8VA 4RO0A 2H48A 2WU8A 1Z4PX 2H1IA 2XGMA 4CR7A 1UPAA 4MWBA 3AEZA 1ZK3A 2HDWA 2PLRA 3J7TA 1TZBA 4HGRA 4OMDA 4V0RA 4N49A 5IVIA 1E5LA 2EQ5A 3TKLA 3WHPA 3FG9A 5B58C 3VKGA 1E1RD