1GXSA

Crystal structure of hydroxynitrile lyase from sorghum bicolor in complex with inhibitor benzoic acid: a novel cyanogenic enzyme
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
267
structure length
267
Chain Sequence
QQEDDRILGLPGQPNGVAFGMYGGYVTIDDNNGRALYYWFQEADTADPAAAPLVLWLNGGPGCSSIGLGAMQELGAFRVHTNGESLLLNEYAWNKAANILFAESPAGVGFSYSNTSSDLSMGDDKMAQDTYTFLVKWFERFPHYNYREFYIAGESGHFIPQLSQVVYRNRNNSPFINFQGLLVSSGLTNDHEDMIGMFESWWHHGLISDETRDSGLKVCPGTSFMHPTPECTEVWNKALAEQGNINPYTIYTPTCDREPSPYQRRFW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P-(S)-HYDROXYMANDELONITRILE LYASE CHAIN A
publication title Crystal Structure of Hydroxynitrile Lyase from Sorghum Bicolor in Complex with the Inhibitor Benzoic Acid: A Novel Cyanogenic Enzyme
pubmed doi rcsb
molecule tags Lyase
total genus 77
structure length 267
sequence length 267
chains with identical sequence C
ec nomenclature ec 4.1.2.11: Hydroxymandelonitrile lyase.
pdb deposition date 2002-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1gxsA00
1FFDA 1KEZA 4DMCA 1WPRA 5I8PA 3V1MA 2W22A 2FJ0A 5JZ9A 1BEEA 2D5LA 2PX6A 1G42A 5CT8A 4DNFA 4QEKA 2RAUA 2I03A 1SC9A 4G9GA 1L7AA 3UUEA 4C01A 4Y2QA 2WTMA 3M82A 2Q0XA 1WHTA 5EHZA 1NU6A 3GROA 5AOAA 3F98A 1LPSA 1IUNA 4UBMA 5ALMA 2QXUA 3Q0TA 4IH4A 1XZKA 1JJFA 1AURA 2HHAA 5AP9A 5T4BA 1BCSA 5YASA 4Z49A 3JYHA 3MUNA 1XFDA 1RWQA 4Y2UA 2JGEA 4G8BA 2OQIA 2HL6A 2NW6A 1YASA 1YA8A 2C0PA 1ZGBA 3VJLA 1CQWA 2WIDA 4Y2VA 3WWOA 2BUCA 4C6HA 4ETWA 4F5ZA 5A62A 1U65A 5K3DA 2PU7A 2DHDA 3LIPA 1H2YA 3IB3A 2WUEA 2C5GA 2O7VA 4B83A 5AKZA 7YASA 2XMSA 3QM1A 1VE7A 3EQ7A 4FHZA 2ZYIA 4P93A 3QZUA 4OSEA 5K3FB 1BN7A 1ZOIA 3VDXA 4KE7A 1QIDA 2EDCA 1WCYA 4UFPA 4B0PA 3HSSA 1QIHA 2WIGA 2ZYSA 2HIHA 4QWMA 1ACLA 2QRUA 2HFJA 2GZRA 2G5TA 4ROTA 3CCCA 4P08A 1XKLA 1DWOA 3WZMA 1P0MA 4D9JA 3FLEA 1DQZA 5HF5A 5AI9A 5ALLA 1P0PA 2WIKA 3IUJA 5LZ5A 1ETHA 3LS2A 4PSCA 4B81A 1GXSA 1UOPA 1VXOA 1FSSA 3NGMA 5A7HA 1CUUA 1JMKC 2WKWA 5ALVA 2J4FA 1BU8A 2C4HA 4UHEA 3G8YA 4N5HX 5JALA 4C4YA 4W1RA 4BYMA 2PSEA 4HZGA 4G8CA 4XVCA 4C87A 1XLVA 2G5PA 1MAAA 4BC1A 4Q82A 5AH0A 1Y7HA 1EK1A 1E8NA 3JW8A 1ZI8A 2WFLA 2CEKA 2VAXA 1LGYA 1J07A 1TK3A 4M0MA 1J1IA 3QMVA 4JEIA 3IURA 5AM1A 5FPPA 4OB8A 1CUWA 3I2JA 3FSGD 5KWIA 1R50A 2QVBA 1WB5A 5JIBA 2WU4A 3H2KA 3R0VA 1WHSA 3A2NA 1S8OA 4CI9A 1JJIA 4I19A 3SX4A 1LNSA 1QIEA 5HFNA 1YAHA 2WLSA 3D0KA 4N5IX 4ZRDA 2H1IA 3WYNA 3NWOA 5EHXA 1XQVA 4YK7A 2XQIA 1JMYA 2XMZA 2ZYRA 4MQLA 1UOOA 2YASA 1MU0A 5AI4A 4CG3A 4PO3X 3GBSA 2XUPA 3W05A 4HXFB 1GZ7A 3R3YA 1X70A 2ROQA 4Y2JA 1LPMA 2WSLA 3K6KA 3G9XA 4X97A 1QE3A 5KBYA 2G4LA 4X91A 3WK8A 5A7GA 1IUOA 3DJYA 3EQ9A 2XUQA 4EUSA 1C7JA 1EK2A 4QZVA 4HAIA 1CIJA 5CT6A 4UBLA 3P2MA 3V48A 2XUFA 1GPLA 4ZV9A 5IKXA 4XX1A 2ZJ7A 4DMKA 4UBKA 3FSGA 3QMWA 4BDSA 2WHQA 4OUKX 4S0XA 2CZQA 1ZJ4A 2OGSA 4B9EA 4XIIA 4EY4A 5ALOA 1CVLA 5HKAA 3KXPA 1XZLA 2QMQA 3H0CA 3F96A 4KE8A 5ESRA 3ANTA 5E4TA 3WWEA 2RHTA 3WL8A 3O95A 2JF0A 1DTEA 4QDOA 5ALJA 4OU5A 3GELA 1WB4A 2OXEA 4DYHA 2ZVDA 3H18A 2HA6A 3DDUA 2QT9A 4X95A 5CW2A 3I28A 2HDWA 4ZI5A 3WL6A 3GZJA 1GQRA 5HKBA 2H7YA 4K6KA 2Y2UA 3AZQA 3WJ1A 4C89A 3D4LA 4X94A 4A23A 4J0GA 4Y2TA 1G4HA 1ZD2P 2Y2VA 4UPDA 3YASA 4AZ0A 1JT2A 4FNGA 1YAJA 2OPHA 4OB7A 4TPKA 3DKKA 4RNCA 2DHCA 3FAKA 1CPYA 2ORYA 1AX9A 3BJRA 1XZBA 3VKFA 5CH8A 1TAHA 4IH1A 2WFLB 5DJ5A 4FTWA 1VXRA 1MAHA 1QLWA 3OOSA 4B84A 3E4DA 3ZPXA 1E5TA 3UMJA 4BVJA 3KWFA 3I2IA 3ZLTA 3C5VA 5CH3A 1GPKA 1IUPA 3MUOA 5AKEA 1EA5A 1QGED 3L1HA 4AO6A 5FV4A 1ZICA 1K63A 1ODSA 5AOBA 1ZD3A 3M3DA 1L7RA 5ALNA 5AM4A 3H2GA 3M81A 3V1KA 4J03A 2QR5A 3IUQA 2JGLA 3WIBA 3OPMA 4FFVA 3CN9A 1IZ8A 3ESAA 4UBIA 2B61A 5AKJA 4WFIA 3BIXA 4DIUA 2R8BA 4X71A 3H17A 1E89A 4X3CA 1GKLA 1W6RA 1ORWA 5EFZA 3Q8WA 3K2IA 2OAEA 3IUNA 2HA4A 2WILA 4HRYA 5LYYA 5LZ9A 4UBJA 3G0CA 3I2HA 4H7DA 1R88A 2XLCA 2XE4A 1BEZA 1CUBA 1ODTC 4K6HA 3STWA 5F4ZA 5K3CA 1AKNA 2HM7A 3I1IA 2HADA 1N5RA 3FLBA 4J3JA 1PJAA 4KEAA 5DTIA 3D59A 1BE0A 1EVEA 3DQZA 4DLNA 2I3ZA 4Q34A 4X6XA 5KWJA 4J0DA 6YASA 5C8XA 1N1MA 2GBFA 5AICA 1CR6A 3I1YA 5JANA 1R3DA 3O4JA 3WL7A 4O08A 4KRXA 2FJPA 1QOZA 1VKHA 4NS4A 2RGUA 5ALIA 5FRDA 1Q0RA 1UK7A 5E4JA 4KRYA 1ZD4A 1XZDA 3ILSA 5ALGA 5CXUA 4MQMA 4AB1A 4PSUA 2XUKA 3WKBA 3QITA 3WA7A 3PFBA 1MO2A 1H22A 3CCBA 3W04A 1LLFA 4KJXA 1YCDA 3VXKA 2RIPA 4ZWNA 4LXHA 4PW0A 4HXEB 2XT0A 2VEOA 3HC7A 3HJUA 4GW3A 4QA9A 4HS9A 4EB0A 1R9NA 2XQJA 4CFSA 2GYVA 4BZWA 1CUFA 4PSDA 2RONA 1GKKA 2IITA 2XQFA 4BP9A 3C6ZA 3AZOA 1HKHA 1Y37A 3W2TA 2XI4A 3N2ZB 4GI1A 1VOTA 5ALSA 3D7RA 4BVKA 3FLAA 5CXXA 1YR2A 2C7BA 2XUHA 3HRHA 2JIDA 4DM7A 3K9BA 4X90A 1MX9A 1CV2A 2OLEA 4DNOA 3W9BA 4U2DA 2XUOA 1EDDA 4C4XA 5LP1A 4L0CA 4BCBA 2BJHA 1XZJA 4GECA 2VAVA 1W76A 3DD5A 3PICA 4M0EA 1FJ2A 5AKGA 2R11A 1OXMA 4C4ZA 2I78A 1H23A 2Z3WA 2YH2A 5AM5A 4BE9A 1MT3A 1MX5A 5AM2A 3ICVA 2XMDA 5JD5A 2QTBA 3H04A 5JZSA 3WKAA 2JGMA 3G02A 1QIKA 2X5XA 2WIFA 4DGQA 3ZWQA 4Y2YA 1FFBA 5EIAA 5DYWA 5BOVA 3WKCA 5LLSA 1O6GA 1A8SA 1QFMA 4ARAA 3F8SA 1L7QA 5D3KA 1EDEA 3HLKA 5ALDA 3DL4A 5E4YA 4BAGA 5K3AA 5EHQA 4AQDA 4C88A 4LXGA 1XRMA 2QKYA 2Y1KA 3H1AA 3G7NA 5LKRA 2QJRA 2WUDA 3M83A 1PV1A 1C4XA 1PFQA 3LIIA 3WK5A 2DCMA 4QLOA 4GDMA 3RARA 1J06A 1XZFA 1EB8A 3BE8A 3HACA 1XQXA 1CUXA 2H7CA 1WB6A 3ESDA 3R3VA 4QDTA 3BL8A 2ZYHA 3H1BA 1DQYA 4L3WA 3D5EA 3IVMA 2WQZA 3AIMA 3TJMA 1HDEA 5CT4A 2BUAA 1DX6A 5A7FA 2HA7A 4W63A 3I6MA 2PVSA 5AKXA 1THTA 1CUCA 4J0IA 4QDXA 1XZCA 2VT6A 4NZZA 1QIIA 4V2IA 1UKAA 5ALQA 1A8QA 1O6FA 5D3ZA 3IDAA 2OQVA 1DU4A 1BCRA 3RM3A 4FDMA 1UXOA 2EDAA 1GT6A 3WK4A 3DEAA 1H2ZA 1EB9A 3OURA 4QDZA 5H3HA 1QZ3A 4KYVA 4OYYA 5K3EA 3WKEA 3DL7A 2QXTA 2RHWA 2CKMA 4LXIA 3NUZA 2IX9A 1K5PA 2BAGA 5D7BA 1YA4A 5AO9A 5DYTA 3E3AA 5A6VA 1EVQA 1A7UA 3QPDA 5DTJA 3STTA 5JD6A 1X2EA 4K2AA 5A71A 3WL5A 4OYLA 5AKKA 2PSHA 4MEAA 3ZI7A 4J0CA 3B3QA 2XMRA 3FBWA 4DSAA 1ORVA 5AK5A 1JU3A 1Q83A 2DR0A 5AKHA 4G5XA 1ODCA 3WI7A 4IHAA 3TRDA 1XZMA 4AMYA 4FWBA 4YX9A 3O0DA 1F0PA 3PDCA 1OILA 4BATA 4WCVA 4OU4A 2Z8XA 1XLWA 1XZEA 5SYMA 4H7FA 1RP1A 5IVKA 4JUIA 4LHEA 1T2NA 4M0FA 5DNWA 4F21A 1R1DA 1EX9A 4K5QA 4N8DA 4QLAA 1CUGA 4DMFA 4UHDA 4OB6A 2BUBA 2GBGA 3OG9A 2B20A 1CUIA 2O2GA 1EXWA 2JGJA 5E2IA 5AM3A 3SK0A 3FCYA 5CBKA 3U1TA 4AMZA 3WK7A 5AK6A 1ACJA 1CLEA 4Y2RA 3WQHA 2XMBA 1FFEA 3EQ8A 2VA9A 4EHBA 5ALXA 4J0HA 5AIBA 1AZWA 2DQYA 5AI5A 3ZLUA 4MYDA 1MNAA 4EZIA 5HK9A 3QMMA 4ZXFA 1TCBA 4FNMA 4P9NA 1QJ4A 4B85A 1M33A 1CUVA 2B4KA 4BRZA 1ZI6A 1Q0ZA 3S2ZA 1QFSA 1VZ2A 4FMPA 1VE6A 3C70A 4ZV7A 2C5FA 4LIPD 4BZZA 5HF6A 2PU5A 1HBJA 4FKBA 3VJMA 4GLBA 2BGNA 4AN1A 4X92A 1HPLA 1LZLA 5BWCA 2VATA 1F0NA 1F6WA 3C8DA 4QDUA 1MN6A 4FBMA 1OCEA 2PSDA 1XZIA 4BBZA 3DCNA 1MTZA 2G63A 2WFMA 5JAUA 3G0BA 1LBSA 1B41A 2RI6A 3X3HA 3C43A 4UFOA 4UHBA 4BDTA 5JZBA 1K8QA 3FCXA 3JWEA 3LCRA 2XB6A 5AK3A 4WY8A 1EI9A 2BCEA 1CUDA 3PFCA 3IBTA 5FP0A 3C5WP 4ARBA 5DYYA 3H2JA 5BWBA 2AJLI 2WU3A 4PF1A 4JH0A 4W1QA 2J3DA 2AJCA 4U2EA 3AFIA 2V96A 3RK4A 1MJ5A 3L1IA 1DT3A 3FYTA 5BV7A 5LKAA 3B12A 4K6GA 2PSJA 1SCKA 2VJBA 1IZ7A 4GBGA 2JGKA 3BDVA 4H18A 4WJLA 2CJPA 2Y6VA 4L72A 2VSQA 4Q3LA 4INZA 4H7HA 2VQ6A 2BKLA 3WK9A 4KAJA 3T52A 3U0VA 1UT6A 2DQZA 4IO0A 3GUUA 5AI0A 5JAOA 5AI8A 4GEGA 3TGLA 3PF8A 2GBCA 3VVMA 3QBJA 1ZD5A 4U2CA 3QPAA 3AIOA 2CMFA 2WM2A 4X00A 4CCWA 3I2FA 1EHYA 4UHFA 4PNZA 4UBNA 1N8SA 2AJDA 4PQEA 1TIBA 1MNQA 5HZGA 2JEYA 5KREA 3AZPA 3QH4A 3ED1A 1CUYA 4KAFA 1GPNA 4GWLA 1QIGA 4NVRA 4KE9A 3G9UA 3STXA 1CQZA 3RLIA 5FKJA 3R3XA 2AJ8A 2CUTA 2PPLA 1IVYA 3DLTA 3ZLVA 5CTAA 5I9IA 3C87A 4AXBA 4DSZA 1LZKA 2XUAA 2O2IA 1CUAA 1GGVA 4E15A 1IMJA 3HABA 2BFNA 4MJ3A 2FX5A 3E1GA 2ZJ6A 1I6WA 4QNNA 4EY7A 2Z3ZA 1VA5A 3G9ZA 4W9RA 5HF8A 5D6OA 4J7AA 2HRQA 1D07A 5JAHA 2J3QA 1ZI9A 1LPOA 4BCDA 1EINA 1G5FA 3EIOA 5HFAA 4E11A 3FVRA 3LLCA 1E8DA 4WY5A 1J2EA 5AI6A 4B6GA 2DHEA 4YASA 2PKYX 1BS9A 2QUAA 4GHWA 1E66A 3F97A 4B0OA 3OC0A 1FFAA 3D2AA 1W4LA 2QUBA 4G9EA 2WUFA 2WJ3A 4UUQA 4WFKA 3H19A 1Z68A 1W52X 4EBBA 2O2HA 2QJWA 3PF9A 3R3WA 4Y7DA 2WG0A 3C45A 3WWCA 5K5EA 2XMQA 2XDWA 3DOHA 4FLFA 3WK6A 2HRRA 1YS1X 1QIMA 4MWSA 5CURA 1ZIYA 1TRHA 3R3ZA 4TGLA 4I3FA 2XLBA 2YXPX 2OCIA 4E14A 5DLPA 4H77A 5JARA 4CIBA 3C8HA 1B6GA 4H7JA 4KAAA 2PBLA 5IVIA 1VZ3A 3AIKA 1A8UA 3L1JA 5AKYA 3FYUA 1AGYA 4N8SA 2WTNA 4H7IA 3W9UA 3CXUA 5LZ7A 2WJ4A 1E3QA 2OCGA 4BCCA 2CBGA 1XKTA 4Q1VA 2VTVA 3MGAA 3VISA 3AUKA 2WHPA 5CT5A 1EDBA 5C8ZA 4W1PA 2XQGA 1ISPA 5ALPA 1YB6A 4FFWA 1YSCA 1BROA 1UK6A 2WFZA 5CRIA 1W1IA 2V97A 3FOBA 1Y7IA 4TVKA 5T4HA 2VJDA 4Q05A 1Q84A 3I6ZA 1XRRA 2XMGA 2J4CA 1CRLA 3AINA 4LKOA 4H7EA 1X2BA 4F60A 4UHCA 3D2CA 5JAPA 1UKBA 1UK8A 1WM1A 3FNBA 3O9VA 5ALYA 1CUEA 4CG1A 2XMCA 1VLQA 1HLGA 2EEPA 5LZ2A 1ZGCA 5IVDA 3IUMA 4ZREA 4H35A 1KU6A 5FPQA 4RGYA 1XLUA 3BDIA 4E46A 5IH7A 2C0QA 4RE6A 4X6YA 5AHXA 3VVLA 2JEZA 3F9CA 3SC2A 2XUJA 3O4IA 3WIOA 3WKDA 4ZGBA 5ALUA 3R41A 2GZSA 4GXNA 2XUIA 4P92A 4AZ3A 1TCCA 2CB9A 4G4IA 4XJVA 5DWDA 3ESCA 1VA4A 3E0XA 3O9MA 1MX1A 4HTAA 3V1LA 2ECFA 2PL5A 3G9TA 5ALZA 1XRPA 3FYUC 4X85A 3NOXA 1BRTA 2WUGA 3BIWA 4MWTA 2OAGA 3G0GA 4AX4A 3LP5A 3A6ZA 1A88A 1USWA 1XZAA 4U2FA 3FVTA 4Q3OA 3EF3A 2WG2A 1QO7A 2Z8ZA 2OCKA 4RE5A 5SYNA 4EA6A 2LIPA 4CCYA 4OD0A 5J3JA 4IH9A 1WPXA 3GA7A 4FOLA 4Q3KA 1XRNA 1AUOA 2V9ZA 1CUZA 1ZJ5A 2IIVA 4HRXA 2HA2A 3EBLA 4G4JA 3I2KA 1JI3A 1SCQA 3T4UA 3BJMA 4CG2A 5T4FA 2XQKA 3KDAA 4AO8A 2H7XA 5ALEA 1HQDA 3TEJA 4MXDA 5AM0A 1U2EA 1QIJA 5HF9A 4BTVA 5A2GA 5ALKA 5ALRA 1ZIXA 4Y9SA 5ALFA 3V9AA 3STUA 1DINA 1NU8A 4A5SA 4AN0A 3PUIA 4OCZA 4B82A 1CFJA 1LPNA 1H2XA 4JYMA 3ZV7A 4WDRA 3PUHA 2HU5A 2JGIA 3FYUB 1DX4A 2VT7A 1R9MA 2HFKA 3GFFA 3I6YA 4W1SA 1QONA 4U2GA 5AIAA 4BRSA 1GQSA 3HYSA 2XUDA 5HQ3A 4G8DA 4BVLA 3KWJA 2WHPB 1RYYA 4H0CA 1CUHA 2HU7A 4OPMA 5IVHA 1VJ5A 3STYA 3BF8A 3DYVA 2VF2A 2HA0A 1UOQA 1XRQA 4QWWA 4BTLA 4BP8A 1JKMA 3STVA 3WLAA 4MYSA 1JJBA 4QE3A 5AJHA 4Y2PA 5CMLA 2PM8A 4UFNA 1UK9A 3WJ2A 4EY6A 1T4MA 4DNPA 3FWHA 5FXMA 4Y2XA 5EHNA 2E3JA 1XQWA 4BAUA 3HXKA 1U4NA 1UWCA 1P0IA 2DFPA 4LYEA 4EY5A 3C6XA 4WDQA 1DT5A 2WG1A 5EGNA 1CUJA 4HVTA 4WFJA 5T4EA 1XZHA 4RPCA 4FLEA 3C6BA 2ZSHA 2Y6UA 1QO9A 5JASA 5HK8A 5EIHA 1UKCA 4J0JA 4FLMA 5FUMA 2VJCA 3PE6A 5C81A 2WHRA 4KR0A 1WOMA 3R40A 4JNCA 3D2BA 3HI4A 2OGTA 3QYJA 4BAZA 4NMWA 4XWGA 1XZGA 3KOOA 2PUHA 1P0QA 2HA5A 1CEXA 3DKRA 5K3BA 4L9AA 2HU8A 1QTIA 3QVMA 1K4YA 3DNMA 2HA3A 4CCYB 4DMHA 3KD2A 4B9AA 2AXEA 3ESBA 3WYDA 1AMNA 5JYCA 3SWWA 1JFRA 3OM8A 2H9YA 2W6CX 5C8VA 3MVEA 1TCAA 4A16A 2GYUA 4HXGA 3W06A 4I4CA 3B5EA 1NX9A 4KE6A 2BGRA 1JU4A 3KSRA 3BXPA 5JATA 2WJ6A 1UZAA 4X93A 3ICWA 2K2QB 3BF7A 5ALWA 3G0DA 5FOQA 5LIPA 3QPCA 1SFRA 1SCIA 5AKLA 1H2WA 1F8UA 2V98A 3H2HA 3F67A 1EH5A 3A2LA 3H2IA 3R3UA 2X8BA 3O4GA 3WWDA 1W75A 1C7IA 5LZ4A 2B9VA 1SOMA 1AQLA 1K6EA 1CUSA 3G0IA 2UZ0A 2ONCA 3WWPA 3IA2A 4X6UA 1LPAB 4MEBA 3N0TA 4J0KA 4G4GA 4BE4A 3D3NA 2VJAA 2PSFA 5EI5A 4UHHA 2PUJA 2WIJA 1XQYA 4U2BA 1UFOA 2X76A 2DSNA 2XUGA 2QZPA 2AJBA 3V1NA 2GYWA 5HQ3B 1MPXA 4AO7A 3C6YA 4N8EA 5C7YA 5K3FA 5FLKA 2JGFA 4ITVA 1QIFA 3AJAA 1KU0A 2D0DA 4EY8A 1E8MA 3WMRA 4KACA 2I3DA 2FUKA 2OG1A 4FBLA 4YPVA 5CT9A 1G66A 5I7UA 5DNUA 2C58A 1DWQA 3S8YA 1XROA 5ISMA 4CIAA 3A2MA 4LYDA 1FFCA 4JYPA 3ANSA 2OCLA 5JD4A 4DTCA 5FDFA 2O7RA 2GBIA 3AILA 1LBTA 2ACEA 4H7KA 5LZ8A 3HEAA 1R4ZA 1AC5A 2ZSIA 3WA6A 2ACKA 5AK4A 5CH5A 4X7BA 3WZLA 1LPPA 4Y2SA 2QM0A 5AKIA 2ZJFA 1THGA 4BB0A 3O4HA 5DNVA 1QTRA 5EIEA 3CN7A 3PI6A 5HCUA 1TKRA 4G1FA 4F0JA 4UBOA 2Z5GA 3OTQA 2JBWA 1LPBB 4PV7A 1N5MA 1TQHA 5AOCA 3VJKA 1DWPA 1XRLA 2QOEA 2ES4A 2QS9A 2OGZA 3BWXA 3IULA 5ALTA 5ALHA 4IQ4A 1YB7A 3A70A 1YS2X 4BC0A 3UUFA 4B80A 3DYIA 3DS8A 3HZOA 3RKSA 5JADA 3I2GA 4DNQA 4B7ZA 1BN6A 3DOIA 1HL7A 2YYSA 1U8EA 2P8SA 3IIIA
chains in the Genus database with same CATH superfamily
1FFDA 4OBWA 5FOSA 1V5WA 5H82A 4CTNA 3UAXA 3KUDA 1F20A 3F3SA 3RAJA 2O8BA 1QTNA 1ZVJA 4K1XA 4LG1A 4PLWA 4YT8A 5AESA 1V11A 3DE6X 3MTGA 1EVIA 2W22A 3IDOA 1F4LA 1NJ6A 2W6IA 1C9MA 1HRKA 2WVHA 4OI0A 4RSGA 1WVMA 4RHYA 3I6BA 2D5LA 2H2GA 2ZBRA 1RXUA 2PX6A 3MTEA 3KR1A 5CT8A 5IM4A 1RPTA 4Q18A 4D1YA 1QKKA 2GXSA 4U3JB 1Q3TA 4WK6A 1N0UA 3G8BA 3TLEA 1UIRA 3OPQA 1VCMA 3VU1A 3LT1A 1JEOA 5DBGA 4BMOB 2O1XA 4F4HA 3A9SA 4BFZA 4YAFA 1U28C 5H3CA 1DELA 1G16A 1Y7LA 2NNLD 5E6SA 1ZUD1 4HSEA 2XKBA 2AT1A 5B37A 5J58A 1G8FA 1NT2A 1NUQA 1SHJA 4MI3A 4RLQA 3O93A 5FI1B 5IULC 4D5GA 4EEXA 2WTMA 3MT8A 4K9LA 3ZYZA 5LMNB 4GE0A 3L8ZA 1A97A 1R5OA 2R85A 4XUDA 1BDMA 1MEJA 2J9FA 2PGIA 4UBMA 1J5XA 4ZT5A 3Q0TA 2A5GA 4IH4A 2JJYA 1DRVA 3U26A 2UXBB 1JJFA 1ZC3A 4Z2AA 5J4HA 1X1RA 1K8XB 4N0QA 3MIZA 4YCAA 3WGQA 5AP9A 3RF6A 1E7RA 2AKEA 2PKRA 2AFIA 1KAEA 5T4BA 1BCSA 2V54A 3BUSA 4FGSA 2Q5FA 3E2PA 3L46A 1TM2A 4FFMA 1XQ6A 2SKDA 3PIDA 3K0KA 1LLUA 4KXYA 3L1KA 3OPYI 2ZJ8A 2UYHA 3TUIC 3WR5A 1TKBA 4LCEA 1JEJA 2B8EA 2HNKA 1IN6A 2IUFA 2P2ZA 2A8YA 2VNKA 3G68A 4OLHA 1BKDR 1V7CA 5EJIA 4OMDA 4UCWA 3WYCA 1ECBA 1WDTA 1YI1A 2ZRPA 4P3KA 2P41A 3ONVA 1KFJB 4TLBA 4RYDA 1DS6A 1YASA 3QEOA 2JLBA 2C0PA 5ICGA 2UZ3A 4BV3A 3BS4A 4DQDA 1NUPA 3E7FA 5C34B 4N41A 2BUCA 4RAQA 3K94A 2QTVA 3EAFA 3X1DA 2R1TB 3IHKA 4P3PA 3K5PA 3PXDA 1M8PA 2HIMA 2YNMA 4CMEA 2VPPA 4MB0A 4RF2A 1DE0A 5A62A 2V3CC 1X1SA 1U65A 4UC0A 4R2XA 1CK4A 3FX2A 2YY5A 3GEHA 3KQWA 5B7PA 5KNDD 5DIFA 3W5AA 2V7QD 2WUEA 3IB3A 3OQBA 2GO7A 4KMMA 1NVXQ 2ORWA 2PNFA 1Y4SA 1NI4B 2HK8A 1MGOA 4F5YA 4ND8A 5JNTA 1TTTA 3OECA 4M1MA 2O8CA 7YASA 1QV9A 3HEBA 4TYPA 3QM1A 3T5BA 4FKMA 4H27A 3H42B 3KHUA 4Y0AA 3EQ7A 3VDNB 3CLTD 1P0CA 4R6XA 4NABA 2D2IA 3HJRA 5ES4B 4HWSA 3S1AA 2DWPA 1B6SA 3ZE2B 1ZOIA 2JK0A 3GRRA 3TSAA 3VDXA 2WSSD 3OTGA 1ZQ9A 3DGEC 1VLZA 2DU8A 2YIVX 3IIEA 4ZANA 5E3IA 4WCDA 1D09A 1OLOA 2OMKA 4RKWA 2WI8A 5FTNA 1UBHS 1IHYA 1Y3AA 2PS3A 2C7PA 1ZW6A 3HU1A 4FW8A 4KFRA 1Q1NA 4MZXA 4B0PA 5JPCA 1E5DA 4RA9B 1QIHA 2R6R1 5CVUA 2WIGA 5BSKA 1WPQA 2V59A 1J7JA 2I29A 3F5MA 3GNQA 2JLAA 3MC1A 4K7JA 1KMCA 3BMXA 1ODJA 3OESA 5DNDA 2HFJA 1JHAA 3MWJA 1WBDA 4Z9FA 4DDVA 2O7SA 4K28A 4TWIA 5AOVA 2PKQP 5BSEA 2EYUA 1KYQA 5KOHA 5KO2A 3NI2A 2CFSA 4P08A 1J09A 1T36B 4ROTA 3ERCA 4TMXA 3RS7A 1X8LA 2Z8YA 1P81A 2AN9A 1XRSB 2GUWA 3F3KA 1QS0B 3OIDA 4YP0A 2DSTA 3FTCA 1OBVA 1P73A 3GGSA 5J5CA 2G9NA 1O4WA 3ZU5A 4GI7A 1GY8A 1AH2A 4EYSA 1L8QA 1C9YA 2HGSA 1N5LA 1P0MA 2FRXA 4D9JA 2PGDA 4F6CA 4H17A 4I99A 1FP4A 2CLKB 1NM5A 2CMGA 1PFGA 1B0ZA 2H1RA 2QG6A 3KALA 4F6RA 4C05A 2B37A 3TLBA 1J8FA 4MRSA 1NNUA 3VTFA 1E2JA 3HV0A 4BQOA 2ZWOA 3K09C 2WIKA 3D0QA 3OQ1A 4RTJA 2WOJA 3LS2A 5JCOC 1X7WA 3OY7A 1JZTA 2GCEA 2YVAA 1ODKA 3KTDA 5AJZA 4B81A 2X3FA 2W7TA 1QVWA 2C4MA 4RUKA 1GXSA 4RZHA 3K73O 1L4UA 4FZRA 4Q9KA 1R5NA 5L40A 4Z0HO 2I9KA 1LBHA 1Z74A 1WSAA 2QVLA 2ZT6A 2YYZA 2G28A 5JMPA 3LBAA 4ZAXA 1Z56C 3WGNA 5KNDA 3D6FA 4HEQA 2V7QA 3FHLA 1JIKA 4LZZA 2EBUA 2J4FA 1GOTA 1L3BA 4LGCA 1BU8A 2ZE7A 4CTJA 1UJMA 3EY4A 1YJCA 3RYHB 2G67A 2VT3A 5KX5B 2A1UA 2M32A 3SDZA 1U8FO 5A6SA 1UWVA 4TWRA 3KETA 1RJ9A 4G0MA 2IZ5A 421PA 4PYKA 3P9RA 3T35A 1UJ6A 4HX2A 3B1KA 3DG9A 1WW8A 1Z7BA 1V3VA 4WCFA 4C87A 3GGJA 2WSSA 4UNNA 4DLYA 3KVYA 2BZ0A 4ZI2A 3SKYA 1QLHA 1MENA 4ZKEA 4I55B 2O2XA 4HH3C 5EC8A 1E4VA 1J0BA 4BEVA 1SUFA 1KZ4A 2Y68A 1Z7WA 3H1PA 3JD3A 4C06A 3GPCA 3U7EB 1E8NA 2H59A 5DW0A 2PL1A 1K6JA 3E4CA 4XGNA 1B16A 1AVTA 4OH1A 1GLVA 5IMBA 3QFFA 1LGYA 3PU6A 2D1YA 2EZ8A 1P2VA 2V4UA 1PI3A 5KU1A 2L69A 4GU5A 3HU2A 1YKGA 2Y4OA 1T2FA 3IURA 1E6KA 2AW3A 2BMFA 2VFAA 3WICA 1ISHA 3PYXA 1KDPA 4J2OA 1C9EA 5FPPA 4BKUA 2RBKA 5JFGA 5KIAA 4GMKA 1KJJA 2QTNA 2MR6A 4I5FA 3G13A 4YRAA 2ONJA 2ZTSA 2EBWA 3OZXA 2Y27A 3PB3A 4OQQA 2WZBA 4ZCRA 1WB5A 1WUHS 1TZBA 2WU4A 3EF0A 2ZTMA 1JEQB 1UJ5A 1ABBA 3A9RA 3TLKA 3A0RB 4GPZA 1DO0A 4RH3A 3I45A 4XJSA 1XWWA 3M70A 5FJJA 4DLPA 4J1NA 2HNBA 4EX7A 1SUEA 5IF3A 2PUEA 4M36A 4ED9A 4MS1B 3KQMA 3GIDA 2GJ4A 1NVWQ 2K7FA 1EZ4A 1OT3A 1ZC4A 2EL9A 3K16A 3W3ZB 1SRQA 3GP8A 5EKSA 4M98A 1W88A 1Y8QB 4Q1AA 3PXGA 1YAHA 3UIEA 2JARA 4AS1A 2WLSA 3DXZA 4WLVA 4D9NA 1G2IA 1NXSA 5E9QA 4INPA 1GZSA 2PFKA 2H1IA 2HPZA 3ACDA 2UYQA 2FZKA 4CM8A 3AJDA 5HIKA 4NXMB 3KQSA 3EXHB 5G0TA 3GFPA 4X9XA 4ZAYA 4CN9A 3Q3EA 1EG2A 1XAIA 5A9TA 2BSQA 1X87A 2JZCA 3FBGA 4LW8A 1JMYA 1QYIA 5DO9A 1YOVB 4U0KA 4TZKA 1W5TA 1RS0A 2OENG 4MQLA 5CHYA 3OF3A 4KO3S 4J75A 3SZ3A 4BU0A 2MMGA 1RLOA 4XIYA 3VHRA 1UOOA 2WWGA 2QRZA 2ZETA 1MU0A 4G0NA 4I2NA 5EZ5A 4DN6A 1DBQA 3W5BA 1PG5A 4P98A 4WZAB 3RI3A 3T4PA 3VVCA 4AY6A 3GBSA 4FYHA 1E0AA 4GBED 1NR1A 1M2VA 2XUPA 4R0NA 3W05A 3ZNNA 1KR2A 2C07A 2VT2A 3EAGA 2Q4TA 1E1DA 1M7HA 4OJYA 1KE1A 3VSAA 2OZKA 4Y2JA 3WBBA 2H2IA 1D7AA 1XP5A 2VZEA 3UHAA 3TLCA 5BN5B 1NQXA 4IHQA 1PT8A 4D81A 3G9XA 4DDKA 1QE3A 1BVUA 2WJVA 3TZQA 2XYRA 5KBYA 2G4LA 4RV4A 2PGAA 3OT1A 3WMEA 2UAGA 1A4RA 3U2QA 3PKJA 4LNUB 2OYSA 1FE8A 1IUOA 1XTBA 4MJLA 4R68A 2VTBA 3DJYA 3RUDA 5KNBH 1Q6YA 3BK1A 3EQ9A 2XUQA 2BBOA 4ZJYA 3BB4A 1C7JA 5F3RA 3H5WA 4PGAA 2I7TA 5K0CA 1GTVA 1QHHB 5CT6A 4BO4A 4XUCA 1ZESA 3C3CA 4EA8A 4EB3A 4Q4HA 2FSGA 3P9QA 3QELB 4CGZA 1DTWA 3BBPA 1T10A 1CJMA 2Q6LA 3VPXA 4BMXA 5IKXA 4M9XA 4DCMA 3KFLA 4KZPA 4XFKA 3G5MA 2WYVA 2XADA 3RWBA 3DXYA 2D2VA 1E2NA 4YHHB 5AQ1A 3DAYA 4CKEB 1JFVA 3R0JA 1J39A 1HTBA 2OVFA 3O74A 4TV8F 3OZBA 4GLJA 3VZSA 4BO3A 1MHPA 3K72B 3VH4A 4GFDA 3REFA 3TDKA 4H1HA 3SJ7A 3ADDA 3DE5X 3DBVO 2GHTA 1DAIA 4RELA 4B3HA 1JH9A 1OH7A 1XPJA 3W5UA 3KXPA 4IY1A 3BD7A 1FYEA 5U4XA 4RIEA 3WXBA 4F1KA 2QYTA 3WGMA 4JBHA 1YZTA 3BXHA 4ZT3A 3WLPA 3LPLA 1DJPA 1LTQA 2AI1A 3AHJA 3TSOA 2OXIA 3VNAA 3F96A 2IYWA 5IK2A 3WQRA 3SBEA 3ZNQA 3PC4A 1V35A 1TT7A 3AVOA 4MAMA 1O2DA 3ANTA 4A92A 4CLRA 4U5QA 5E4TA 1SBYA 4ESOA 4JYCA 4MIYA 4W5JA 4CNQA 3BXFA 1VLLA 2VPIA 2RHTA 3DONA 3A6GA 1X0VA 1V1RA 3O95A 3KOYA 1FRVA 2P9TA 2A35A 2VAPA 3DYBA 4JT8A 1KEKA 5K7SA 1C3OB 2JF0A 1O9BA 1CZLA 2UUPA 3LBYA 4KKVA 3F6PA 1O6BA 3C16C 1FNMA 1Y89A 3UCXA 4Z5XA 4QDOA 2HEIA 1PDVA 4TS4A 4AYXA 2EJTA 2YOGA 4I5IA 4OU5A 3BRQA 2B25A 4FWIB 3K4QA 4GZLA 5FTLA 4M89A 3LH5A 1MC1A 3DB2A 2PUAA 1NJGA 2BKEA 4G97A 4AY5A 2Q3HA 4BNIA 1OYVA 3CNBA 1NQOA 3I37X 4LC1A 2ADFA 2W90A 2ZVDA 1A9QA 4GUDA 2PQ2A 1C1YA 1XNHA 2WJHA 2ZLBA 4N3CA 2FZWA 2GETA 3E5RA 3SNKA 4NONA 2H9IA 3ZZMA 4CBVA 1N1EA 1J24A 4BBPA 5G41A 2GCPA 4O4HB 1D9ZA 4KK3A 4B5KA 1LI5A 2HDWA 8OHMA 2O19A 3GZJA 4HTFB 1AQYA 3O0TA 1XOIA 5BPFA 3QF4A 3UHPA 5LUAA 3KEQA 1JDBB 1OFGA 3MJCA 4QGHA 5F51A 4X94A 5ITVA 5GONB 3GVXA 5EINA 4ARVA 1AF7A 4PHCA 1F2UB 4C07A 3FPEA 4BNKA 3HZRA 1XEAA 5AQEA 5EVJA 3C1OA 1DKLA 4G09A 1T1RA 3UHOA 4C2AA 2JKZA 1A9TA 2ORIA 2QTLA 3SD7A 3EIQA 2GCIA 1I1NA 2PS0A 3AEUB 3TB4A 2AXNA 3TPFA 3NHMA 3YASA 4ENVA 3HNPA 2P7IA 4IWYA 3S8MA 4YMVA 1TM3E 2HSWA 4TPKA 1I4TD 3DKKA 5FQOA 2IYVA 1B3BA 2R4UA 1GYPA 3NALA 2NVUA 2DHCA 2ZUFA 5DRYA 2ORYA 3GEPA 1KY2A 2QMEA 1UJCA 1E7QA 3BJRA 3BBLA 1TO6A 2ZQ5A 3NRCA 4HO1X 5BRJA 5JAIA 2CHUA 1RPAA 2B4TO 3GLSA 4XQGA 2FZVA 1XX6A 4HAOA 3I3SR 1ZRNA 4WN3A 2AWNA 4H16A 4RTOA 2WIBA 4NU6A 3H4MA 4NICA 3TRIA 3OIGA 4QYXA 5LC1A 3R7WB 3IPRA 3PGKA 1NN5A 4KX3A 4GP9A 4M7WA 3H0EA 5JDIC 2AFHB 4LTDA 1H93A 2W9XA 1LCIA 2Z2JA 4MQFA 4F8EA 1DJMA 3W2GA 4HT3B 4PU0A 3CPEA 1NVKA 4DFDA 3UUGA 5JZOA 1MB9A 4IQ0A 4IRMA 1EA5A 1CHNA 1XD9A 5JT1A 1VL2A 1QK3A 2Q99A 1Q77A 3JQ7A 3L1HA 1WHSB 6GPBA 2LCIA 5AT1A 4MWDA 4BE7B 5FV4A 5FEMA 3GG2A 3GOHA 2B8JA 2XZPA 5CPFA 2CXOA 1Q2XA 5CLFA 1GT91 4GE3A 5KDDA 1P3DA 2RHGB 4ZOBA 5AXDA 4DC1A 4DV5B 2FR0A 4DVGA 1FVOA 4DKXA 2J46A 4P86A 4CIYA 4MW1A 2FXIA 3JQ8A 3CEPB 3PPYA 2N46A 1MO4A 3F3YA 4E08A 4IDBA 4LV8B 3SKXA 4ZQFA 3KZVA 1C80A 4F1WA 3CLUC 4B3TB 3OPMA 2HB6A 1XVUA 4KO4S 4C76A 3QKWA 1RNLA 3ABOB 3CN9A 1X74A 4Z7NB 4H4CA 3KZXA 3ESAA 3NJRA 2JIRA 1R9GA 4KIJA 4WV3A 4X65B 2CJWB 3ZVMA 3NJ8A 1SKYB 5IABA 3INYA 3GXBA 1N1DA 4HDMB 4XI9A 5E8RA 3HKCB 3S2SA 1KHTA 2P40A 3ETCA 3NAQA 2JI6A 4DIUA 2NUAB 2WD8A 1Y0BA 1UPTA 1WMBA 1YL6A 2R8BA 2X23A 1EVJA 4PWZA 4JZKA 5F78A 3H8WA 1Z13A 4UM9B 5JY6A 3ML1A 3WTBA 1PS0A 2YOHA 4LJ5A 1QDLB 3KQKA 4LDAA 2OAEA 4CKWA 3AHEA 3IUNA 1NP3A 1COZA 3LUPA 3QX7A 3SLGA 5B1HA 3NOQA 4F9GA 2VYCA 1A7KA 1TD9A 4C08A 3G0CA 4L0MA 2ATIA 1WXQA 5CM8B 5BSMA 2K7ZA 2GJ8A 3U81A 4EHLA 3PI7A 2XLCA 1B3RA 2ZEJA 2J3EA 1CUBA 3D0RA 2YJ4A 4N39A 2OPBA 3E23A 2IYYA 5GV7A 3VR4D 2YFKA 5CEEA 1CJKC 2DH6A 2BF4A 3ND8A 5A3RA 1HLDA 2OM2A 3W1WA 2Q2WA 2W5UA 4ZYYA 5BOSB 3MHTA 3CT6A 3M5CA 4TV8A 2CF5A 3SG0A 4QFDA 3T95A 1PSWA 4GZ5A 1Z2PX 4XWAA 1WZ2A 2IJGX 2IEGA 2OWDA 3TLJA 3L8FA 3PEWA 2YJNA 1BNCA 1UBJS 4FVTA 1PJAA 1WWKA 2CCKA 3Q5EA 3R1IA 2J7KA 1L5RA 1TI7A 3BKXA 1CB7A 4NV3A 1EVEA 1OD6A 4KQIA 1IXSB 2VDLB 3DQZA 2M6LA 3DDWA 4DLNA 2H6EA 3PA6A 5DEOA 5JZVA 3T3NA 1QR2A 3LQFA 1JAIA 4LGMA 1R8YA 4Y1EA 2GBFA 1WQ1R 1X7HA 2VHXA 4TV9B 1RADA 5AICA 1NKSA 1RM3A 1H5NA 4LNAA 1T9GR 1I13A 1OKKD 5CCDA 5JANA 5K8UA 2G1PA 5UKDA 3RTBA 4KWHA 3WL7A 3A4MA 3FKQA 4BJ5A 4YCNA 3W6UA 2ILVA 3EC2A 2IYUA 1QOZA 3HCRA 1GUDA 5AVOA 3D3QA 4LV6A 5CB4B 4NS4A 3LW8A 3QOXA 4FQ8A 4TWAA 4NE7A 4AYTA 5KWSA 3FPSA 1MG5A 2QAGC 1VCOA 1Q0RA 1UK7A 3DVRX 3T99A 3V2HA 3DHVA 2NPIA 1TCVA 1IK4A 3FG9A 3IJRA 4RK5A 1SZJG 2WY2D 3IVGA 4RY0A 2QD3A 4O3FA 3KAPA 3AY0A 5B2EA 1PL6A 3GGDA 4PRLA 1D2NA 1QFJA 1ZOSA 4S1TA 3KYCB 2OC9A 4Q16A 5HUHA 1Y1LA 3ILSA 4WNYA 1FF9A 3FTPA 2ZUUA 5LQKA 1JL3A 4MQMA 4MTLA 1L4GA 2PEZA 2Z4TA 4AB1A 4ROSA 4TUYB 4LYFA 2GPSA 3WKBA 1JQEA 2QW0X 3A1WA 3QITA 4HDNB 4WQMA 5BV2P 5H59A 1VB5A 3PQFA 4UU1A 4UTZA 1PUJA 4TLLB 4ND1A 1LLFA 4QYTA 2VPTA 4B2IA 1H2HA 2WJYA 4PN7A 1TU0A 1ZLYA 2IHYA 2OP1A 2Y1EA 3C41J 4LXHA 4PW0A 1W7AA 4PIVA 4L8LA 4YAUA 1PEAA 1RHUA 5F1YA 3F7TA 2N47A 4JI8B 4JC0A 4LKRA 4NK4A 1GFWA 1XA0A 2KLHA 4PVCA 4ZTBA 4BVEA 3PWSA 4LZLA 2GT1A 3VR4A 3F4LA 4GRAA 4W5HA 3B6ZA 1QDEA 1WCIB 5KOYA 221PA 4UEJA 5JBIA 4GWKA 1AB5A 5HYVA 3DTYA 3U62A 2VCHA 1BXGB 4N4AA 2OFWA 3OZIA 1UMKA 3Q9LA 2G0TA 3CNNA 4RO0A 3T7TA 3BM5A 5KKNB 2PKXA 4L08A 4E22A 4MI6A 1QG0A 3OIYA 4KXVA 5BQOA 4BP9A 2CSUA 3PJDA 1Z15A 3C6ZA 4CKZA 2CCJA 3A27A 1HM5A 3AZOA 4LJRA 2HJRA 2BMEA 3W2TA 4OHKA 4D3XA 2XI4A 2G1JA 4YRMA 1EFLA 3RYIA 4W7SA 4AZ0B 1VOTA 2XGMA 3C4VA 3TX6A 3LZ6A 3OUTA 2Q4RA 5L7WA 3D7RA 1TUGA 5TQ0A 1RRVA 4BWGA 4EYOA 2V6FA 4P22A 1Q11A 4QRHA 1YR2A 4CKCB 1P2TA 1ORDA 1OKKA 4QGSA 2ZAIA 3ADKA 2XUHA 3G0HA 3VAZA 2YZKA 3LXUX 4RLFA 4BHTA 5JMWA 4MULA 3GLHE 1B23P 1Z0KA 4F56A 4IUYA 4B2LA 1TA4A 1X14A 5JCOA 2DTDA 1JGTA 3RIYA 1Y3DE 3NTUA 4BUZA 3RW9A 6AT1A 4R5MA 4X90A 2OLEA 4R71A 1YZGA 5DN6D 2X5NA 3W9BA 1DOHA 1Z22A 3NVKI 1T0UA 1PZXA 2ZVJA 3D4BA 1UBGA 1L1EA 4UUBA 3GA5A 1KQFA 1G20E 1I2CA 1B76A 2XUOA 4OSPA 2IS2A 2OO7A 3CKKA 1POXA 3ORSA 4HB4A 4RHEA 1Z25A 2HGZA 121PA 4IS3A 2N3ZA 3TVTA 3ENWA 4YAIA 4S05A 3ZIDA 1HI9A 1TEHA 1AHNA 1RQXA 4QGAA 1VGRA 2NTYC 1UWKA 4IHJB 4ND5A 3NNSA 4IOMA 1N0IA 1GHTA 3ICCA 3CWQA 2PAFA 1C9JA 3H9EO 4GAEA 4IYRA 5JH7F 3X2EA 2FW9A 3Q3JB 2NQ8A 2QE7D 4KLAA 1GG5A 2DOKA 4QU9A 1FJ2A 3OZUA 1LSUA 4C4ZA 1ZKMA 3HDHA 1GTMA 2Z3WA 4LZOA 3M0EA 2CNNA 2DR2A 5ED4A 4UZFA 2OWEA 3N9IA 3IKMB 2FFAA 1AGNA 1J0AA 1G60A 2QSZA 5EA2A 3GDOA 5E8JA 1ZJZA 1O57A 1OWLA 2FPUA 3WYEA 3NHYA 5G1PA 5DVZA 3KUKA 2H1LA 1KK3A 3H04A 3FSEA 2I4MA 2C4WA 3FWYA 4M0LA 4NBNA 4UDNA 5LP6C 3WKAA 1SVLA 1ZH6A 5ER6A 3HV2A 4TSRA 2WIFA 4BUCA 5ITSA 4AY2A 4Q12A 1MVNA 2JAHA 1SIOA 4DJAA 3VZDA 4KQGA 5KTSA 1UPAA 4G5OA 1MXFA 3ZWQA 1U0TA 3FJOA 5HKOA 1GUAA 4RSHA 4Y2YA 5K0EA 4EDHA 2GQ0A 3CLRC 4EF6A 5LQUA 2JANA 4TKLA 3UPTA 4MRVA 4IBOA 2NSJA 1Q1ZA 2PRSA 3JQQA 4X7MA 3RDPA 2WAMA 4UNQA 3WKCA 1Z39A 5JDCA 4FX2A 1UBOS 4LWOA 5LLSA 1ZM2A 4G01B 4QQNA 1QHYA 4YIHA 1ZHOA 1UBEA 3Q9SA 1ZK2A 1T0JB 5FTJA 1T6ZA 2OOKA 1L7QA 3BGVA 3WGHA 2PKWA 5KHLB 1VBNA 1RRKA 1AV6A 4IZIA 2X7JA 4PXAA 3TOXA 4URUR 3MS2A 3FFTA 2D1TA 1O5IA 1Y5NA 3G85A 4O4JF 4QYSA 5ALDA 1TYCA 4C7XA 5EZYB 2AUTA 3DE2X 4QD3A 1I0ZA 3ZHBA 4BAGA 4EHHA 5AFSA 4G5FA 5EHQA 1T0PA 4ZVUA 4AQDA 2C03A 5FUBA 1XRMA 2HRCA 2VL7A 1DXYA 5F7ZA 1ISMA 1CERA 5HOQA 1FNCA 1OBOA 1W4RA 2Y1KA 3H1AA 4FFLA 4NBKA 3G7NA 1OB2A 4FOPA 1JJ7A 3AM3A 3DP9A 1GTL1 4ENSA 2YXEA 5E1DA 2DBQA 2IEZA 4A36A 3OEED 1T5OA 5DN6A 4G0WA 1QHEA 4BO7A 2R87A 3EG9A 3M83A 4H6XA 3A1NA 2VVTA 1C4XA 2LRHA 1PFQA 3LIIA 4OGGA 1EX1A 1G5RA 3NBFA 5T41A 5CXQA 4DCPA 1YDEA 4F3TA 3RBAA 4DJJA 2PKQO 1GTZA 5MFZA 1RI2A 1J4AA 4H3KB 3BD9A 3HACA 1CUXA 3JTEA 5A4MS 2PZ8A 3R3VA 4GSYA 2XTZA 2O5EA 2DTXA 2QQ0A 2Q50A 1NT4A 2SKEA 2ZYHA 1M10A 4ITUA 3V8NA 3ESXA 4MMYB 1FZQA 4Q1EA 2LGJA 2QE7A 3D5EA 4IG4A 1UFRA 2GHRA 2ZOSA 4FMCB 4JCOA 3TJMA 2VSYA 1YQXA 1D2AA 3OZ7A 4IGIA 3HBNA 1U7XA 4BMDA 1MO3A 2C2BA 4UREA 4W63A 2ZDQA 5E2AA 3WDKA 3I6MA 5B12A 1KAGA 4QX6A 1RVV1 1OJ7A 2NZYA 4OBXA 3FUWA 1E79D 2WDPA 2FPLA 4J0IA 4QDXA 3W5IA 1O0SA 4KN8A 4GQBA 1QCCA 2VT6A 3BE6A 1JEDA 3KSUA 2NSYA 1QIIA 3SX2A 2FPGB 1UKAA 4V2IA 1QH1A 2BC9A 5C31A 3FTDA 3B1YA 2G17A 4IP0A 1WL8A 2X1LA 3VAAA 4PS0A 4PHTA 2OYCA 2IYXA 3TTTA 1QH9A 3LAWA 4HPWA 4K88A 3T0IA 2OL4A 5TJHA 1Z8NA 2R1VA 3C39A 4BFYA 1QRUA 5KSOA 3C0KA 4XGRA 1ZMRA 2XWSA 1PU2A 3E3MA 3E6AA 3PNKA 1EB9A 2RGWA 4J07A 4AU1A 2FLVA 2RBEA 3OURA 3FYDA 1QZ3A 2OAQ1 4A8JC 4C7KA 4WKBA 3WRXA 3SC3A 4RXUA 1K4KA 1L6IA 5AJTA 3T1QA 3I5YA 2AOTA 2WB4A 2XBUA 4MI1A 3WKEA 3A1VA 3AUSA 2FFRA 4PC2A 3HXTA 4L76A 3M4ZA 4X63A 2OXTA 3PTZA 1OFIA 2IX9A 3RRNA 1W1UA 2QMHA 5ILGA 4LRYA 4UTRA 1IBMB 1SAYA 1HH4A 5JLAA 2G40A 4N76A 4ND7A 1AHHA 3VPHA 3NC1C 3GARA 4PNEA 3VA7A 4AURA 1YZ3A 4XGKA 2VF4X 3UMRA 4EG1A 3J7AC 5CVEA 4I2VA 1DZ3A 1KY4A 3HY4A 5DYTA 4DT1A 3DXXA 1EVQA 3QVTA 3SIPA 3OEEA 3MNFA 1A7UA 1F9EA 1GTJ1 3PIRA 4LXQA 4C0BA 5CBPB 4FOTA 4HFNA 4MK4A 4D0NA 1JPJA 3DKIA 2I22A 1WV1A 2PLAA 1KFKB 4X41A 4EKIA 2FPMA 5JD6A 1JDVA 4DCVA 1VKJA 4JP1A 1O9GA 1FUYB 4XDHA 3LQ2A 1T3SA 3DVLA 5BRAA 3OIFA 3G1TA 3UPDA 2WD7A 3L7BA 4FB4A 2J09A 1WVIA 1V3QE 4GKAA 5E1OA 1H4SA 4WHMA 4OHRA 3B36A 3VTKA 1R4NB 2HJSA 2OBXA 4J0CA 5BNIA 1EVYA 4PXYA 3AI1A 2A7QA 1JHUA 3F78A 1J7KA 4QGFA 2YV2A 4PZAA 3U7JA 4CUZA 4MP3A 1L5MA 1F14A 3L7NA 1W94A 1ORVA 4E5SA 4V24A 2AJTA 4WNAA 3CF2A 5AK5A 1Z45A 1UDAA 3SYRA 5BNWA 2C2WA 4ODIA 5DM0A 5IC5A 3S2FA 2O05A 3GLHA 2CLDX 2WF8A 3QJYA 5LYJB 1Q3KA 3ZY5A 3ASYA 1E3WA 1ODCA 5JH7A 4KLRA 4TQGA 5JCZA 1HQCA 3WI7A 3LZCA 1E79A 3BL5A 3RU2A 3KFXA 4CQLB 1E3SA 1G20A 2B6NA 3PVCA 2W2NA 2G08A 1K92A 1V95A 4YX9A 1WXWA 2P4EA 3ACCA 4ZZIA 1I51A 2YC4C 2N1BA 3DPIA 1NFFA 3LXXA 4U9HS 1F0PA 1GD1O 1MOZA 3OY2A 1RTKA 4HBZA 3HA7A 2YUTA 1T9BA 3HCWA 2HLNA 2ANCA 1JLSA 2CJXA 2KM1A 4PFSA 4IWXA 4U1RA 3RS9A 4NENA 1AUQA 2A5JA 4BEJA 4QTYA 2JH8A 5HJEA 2Z8XA 4IMRA 5A4FS 1ZYUA 1PN3A 2JC3A 1XZEA 2FEXA 1AKQA 2VHVA 5CM2Z 5ILQA 2BHLA 4N5DA 2FX2A 2IHZA 3FFAA 4IIFA 1RP1A 2C00A 2HF7A 2DBYA 3H7IA 3EQ2A 1TPYA 3VH1A 1BHO1 3A32A 5K4AA 3ZXYA 3ZHRA 2FP3A 1I1OA 2WM8A 1S5PA 1XDDA 2ONYA 5DNWA 3HFSA 4FS8A 3T9AA 1VLMA 4AZSA 4EUFA 1MH9A 2QP4A 1ABEA 2J5QA 4K5QA 4UMDA 3MS7A 3MFQA 1RIFA 2AYYA 4N8DA 4QLAA 4DIEA 3PR1A 3DL0A 3P5BA 1BA2A 5SYAA 2R8OA 3WLMA 4CQMB 4OLBA 3KKEA 1N2CB 4AXXA 2BMJA 4O4JA 1I3NA 1B0PA 1I80A 1KPIA 1K06A 3KIPA 4FK8A 4BNDA 7ABPA 2MDTA 2D4HA 2HBZA 4PC7A 2ZS9A 4UTOA 3NVDA 2F55A 2E0IA 4TXHA 1U0BB 4FFDA 4TTVA 3WLSA 5AM3A 1L5FA 1MQSA 2VJYA 2X0KA 4KGZA 4O1MA 3TW6A 2HXSA 2PUCA 1H42A 1MCZA 3EZ2A 1QFYA 4UNSA 3BSSA 5T67A 1N4DA 2Y8EA 1DP4A 4IIEA 4Q3AA 3UMMA 2VDRB 5ITZB 4JXXA 3LJKA 1KL7A 5AK6A 5JRDS 1CS4C 3TKYA 5C3MA 3D7SA 4OTZA 1CLEA 4Y2RA 1QX4A 2JFQA 2NYUA 2XMBA 4MGZR 1RYBA 2HQSA 4FEGA 2GCNA 4MCAA 4Z4GA 1X1TA 3BXZA 4EHBA 4JBLA 3NEPX 3KR0A 3R5HA 3URMA 5KQPA 3RRYA 1CIVA 5C5EA 2VQ3A 3R4CA 4LEIA 4C3UA 2IW1A 4LPKA 4ILEA 2YXNA 4OQZA 2E5LB 1T26A 2Y4NA 1B6RA 3JQ9A 2PUWA 3H5IA 5CUQA 5LBIA 4AJ9A 1FS5A 3QMMA 4OHXA 4QXPA 4ZXFA 4LF4B 4DR6B 1EJ0A 1NRJB 1SCBA 3EZ9A 4JHLA 5BSVA 2VTEA 4CEIB 3TLXA 4TYMA 2PRKA 3FMFA 1GZUA 2A4KA 2PT5A 2XVXA 3W5VA 2FWRA 3RT7A 3VR5D 5H68A 3VI3B 4B85A 4J4BA 1KJ8A 4XLTA 3RUAA 1M2OB 3NHUA 3R2JA 2B4KA 3OETA 4HSGA 3GLFA 1JEYA 1Q0ZA 4LUCA 2PXCA 3S2ZA 3A36A 3TR0A 5L6MB 4EA9A 1QFSA 3J81k 1CY8A 3OZRA 4KFUA 1VZ2A 5DT9A 3V4FA 4M1KA 5TXGA 1VRCA 1KKMA 3C70A 4FI3F 2C5FA 2VCEA 3K0AB 1XU7A 1SUAA 3MTIA 1O8CA 1CS0B 4QJ4A 1LWOA 3IX7A 1Q7BA 4GI3A 4QVKA 5GOZA 2PU5A 5E6RA 1HBJA 4Q01A 4HMPA 1DX9A 1KAHA 3VJMA 4BGUA 4H1VA 4KFCA 1ZK3A 4X66B 4JLSA 2BGNA 1KKUA 2J5BA 4AN1A 4D3FA 3IXQA 4MUEA 3RODA 1J0XO 2H57A 2Y92A 3ONDA 1IQUA 5GP1A 3SZLA 2XYQA 4NMMA 3E5NA 1MN6A 4I4TB 4HL6A 4L27A 4DIMA 1JKXA 2QK4A 5JFOA 4REMA 4L4UA 1UT8A 3AR4A 4HAWA 4GMGA 1BCRB 1D1QA 3H75A 4H6VA 3MWGA 4NC9A 2BEUB 1JFSA 2PBRA 4GKKB 2WHXA 5MGNA 3K9WA 2JLSA 4PR3A 4YAJA 3O3NB 4FIDA 4WJKB 1RXSA 3P2YA 4CM7A 5KX5F 2GVDC 4TRRA 1SEPA 2ZXFA 1UQTA 3OU7A 3ZHZA 5DBIA 1LBSA 2JFPA 4OLJA 2RHBA 3RVDA 2OVBA 1ZMOA 1GEGA 3U3KA 1VHTA 4Q48A 4UM5A 2Q3FA 1ZU4A 2R8ZA 1RWKA 3BXXA 3NOOA 4LJAA 4RJKA 5HSGA 3NT2A 1GUBA 2XTNA 3Q0EA 3DZIA 3P2OA 3F8WA 3IPCA 2W4IA 3LCRA 2WLTA 4L16A 3V42A 4EYEA 1X8XA 3CF4A 2FSVA 1X1QA 2JFBA 2IYPA 4QFMA 3UYKA 1EJ6A 3KSZO 4J2TA 1Z4NA 4RMGA 3ZD9A 4C6RA 4U3JA 3EPPA 2IC5A 3CF0A 2P7HA 3AHCA 4KO1S 5C1DA 4CTMA 9ABPA 2VEDA 2GZMA 4JYBA 2FOIA 3UXYA 1SG6A 2YZ2A 2ZUTA 1Z8FA 4B6RA 2MR5A 1JN0A 3S0JA 5BWBA 2AJLI 1BTOA 2WU3A 3RRMA 1K88A 4PF1A 3VPSA 3WY9A 3IKTA 1FW8A 3TNYA 2OILA 1HMYA 2UZ1B 4U2EA 4YR7A 3G23A 3PFHA 3QPBA 1J33A 3ILVA 3RK4A 2I4NA 3VR5A 3DJFA 2DTEA 3T9BA 1U3TA 3UZUA 3TLMA 3D6HA 1JQBA 3EFOB 3GA0A 3R4VA 5K01A 3B12A 1OREA 4GRDA 4BNZA 4KXUA 2YVLA 4B3CA 5KZMB 2NV0A 4GC5A 5FWXA 1SCKA 2HMTA 4LYJA 2QUHA 3VR6D 2GR9A 1GRVA 1I3LA 4YV0A 2D0OB 1QGOA 3GD5A 1FP1D 3PZRA 4ER6A 2Q1WA 4A1OA 1PV4A 3DT6A 4DMUB 4FU0A 4OKSA 2NXNA 1ULUA 4Q93A 1Y6GA 4AG6A 4FX5A 4AVYA 5T57A 1REQA 1U2DC 4UJ3A 4TL8A 3ZDEA 5A3QA 2IUTA 3TEMA 4CL8A 4DA4A 2FQQA 1YK0A 2VRNA 5I47A 1AN9A 4G25A 2BKLA 2QMOA 3FCCA 5L4SA 1PJZA 4O2RA 1GU7A 2DQZA 3I83A 3PQ2A 4IO0A 4WZAE 3V1UA 5AI0A 2PCJA 2C2OA 3G2NA 1L7OA 1YS9A 3LW7A 3NTOA 4GOJA 4I8DA 5DHUA 5FTWA 3TGLA 5CDTA 3S1LA 1PLKA 2WV9A 1QR6A 1O0BA 3PF8A 3HXOA 1T34A 3CLRD 1ZD5A 4N47A 4MWZA 1Y9JA 4JASB 1DTSA 4YBZA 4FMDF 5HCIA 5JCJA 2W6QA 2CW5A 4ZVKA 4DSOA 3NAMA 1TVCA 4EG0A 4NCAA 1EHYA 2ZBUA 3UFXB 3W6OA 4BLUA 1NI4A 3OTOB 3IVXA 4DF3A 5KQMA 5ADHA 1RPNA 4Z99A 5DXJA 1DBWA 4CFZA 2QZJA 2WK1A 2I1VB 2ALJA 4IEFB 3ABIA 5L3VA 2ZR9A 2IPAB 4WPGA 3T7CA 1MNQA 2HIAA 4JR1A 5KSYA 1EFVA 4DYDA 1FL9A 2XCSB 1WX1A 4ES6A 1W49A 2QQEA 4G2TA 4HEHA 4IICA 5C4GB 1XNGA 3W5SA 3AZPA 3CH4B 1T3LA 5HW0A 4KVZA 4LOHA 3K0HA 2QPTA 1BWRA 2RH8A 1UM9A 4KU4A 2WBLC 3H2BA 1RC1A 4EHJA 4UU0A 2QTTA 1N78A 1RYHA 4GWLA 1UC5B 2H7VA 1CX9B 5CEFA 3B1FA 1I2DA 3DT8A 3T3MB 4WESB 1P9OA 1OAOC 3PL5A 2CV2A 3F2IA 4RV5A 3O8BA 4OV6B 2WZDA 3A05A 2AUNA 3NNNA 1SVNA 5FKJA 1KXJA 1Z6PA 2B9EA 1NP6A 1Q6ZA 3N3AC 1HY3A 3JWJA 1KP9A 1ATZA 1VP9A 3CSUA 3Q7TA 3C1AA 3VR6A 3ZVRA 5HZKA 3N2GA 5GM2A 2R47A 1QS0A 2B3DA 1A5AB 1TCUA 3DDOA 2DX7A 4HZUA 1YRWA 1HZJA 3MWKA 1E6MA 3KZ1E 2DVMA 3MRSA 4Z3DA 4LFCB 4Q9AA 2PUVA 2QL6A 1T8PA 3BXGA 5FULA 3OQMA 1R16A 4AXBA 2O8DA 3V8RA 1LZKA 1U2ZA 2NZ2A 1QZTA 2CHEA 1GGVA 1G5HA 1S2DA 1USUA 1D2RA 3BL6A 5D5PA 4E15A 6CHYA 3R7NA 3PV0A 3ULKA 4BFWA 1IMJA 3V80A 1JECA 2I6QA 3HABA 4F3CA 4W9MC 3WLKX 2G0AA 3F74A 5IPFA 2X5KO 4OHFA 1WEKA 5REQB 4NFHA 3CUWA 3ZX4A 4HVCA 3L4JA 4L73A 2WQ6A 4LOAA 5T5QA 3FRHA 1SG0A 1YJ5A 2ZJ6A 2NPOA 3RVLA 4QBHA 3UV3A 2BFDA 3GEBA 4EY7A 3WISA 4LHXA 4EGCB 3FDZB 2P35A 3N2YA 4C7MA 4B1FA 1P33A 4V0QA 5HF8A 3TLYA 3LHFA 4EI7A 1A7AA 1KGDA 5B3KA 1DIOB 1QBGA 1JEEA 1AGXA 5CIQA 5DU2A 3ZWMA 4DLSA 1Z63A 5FA5A 1WY7A 2FRDC 3MJFA 2NZ8A 3KKLA 3KT0A 5C7OO 1J23A 2O3JA 5IJ9B 5KYGA 3W6ZA 1ZMXA 2WAYA 3WXMA 1VPTA 4OBEA 3VYSB 4BLRA 2RGAA 3UA3A 2WAOA 1PS8A 4ND6A 4YECA 5JPDA 1LFAA 4ZODA 5KX5A 2J0SA 1K8RA 1QTQA 1ZI9A 1J8DA 2WZCA 3TW8B 2BM1A 4TN5A 4FYPA 1EINA 1ORIA 3FB4A 1ABFA 4PFJA 3EIOA 4LI0A 4UUAA 3ER8A 4I5EA 1UAGA 1RMYA 4CR6A 1EGAA 4IXWA 5DNYB 2Y0CA 1Z0JA 2OCBA 2WHYA 1K27A 1GPYA 4RA6B 5CXSA 1FLDA 3ZI0A 5GINE 4YASA 1F51E 4WK2B 1V8BA 4PG6A 3RANA 2HTFA 5D86A 1W5SA 2BGUA 4RTRA 1IG3A 1P6UA 2EIHA 4WWHA 3QQPA 3FFWA 2BL4A 4QNMA 2VBFA 4YWHA 4DWOA 2C61A 2F4VB 4RTQA 4P3YA 5BSRA 2AWOA 3OC0A 2QUBA 3PX2A 5GONF 2CYBA 1PJLA 1SBIA 4ZTZB 1GITA 2YFHA 3TBKA 3AONB 4I1SA 4IIUA 4L2IB 4ATNA 1UBKS 3R3WA 4Y7DA 4Q66C 3WWCA 5DPMA 2XMQA 1U3UA 3L7OA 3HGMA 1IM2A 3DOHA 3I5MA 2I2WA 4B6JA 3AERA 1RDFA 2C98A 4JMLA 2Q5JA 4YAOA 5FI0B 2WNHA 4RD0A 3CONA 3S27A 4F7WA 3P94A 3VU3A 5U1PA 2AFHE 3AOGA 3COYA 1I01A 1LNQA 2OD9A 1RLJA 4RIGA 2XVAA 2FG6C 2SHKA 3EVDA 2HRBA 3ZLBA 3X1WA 1RQNA 3ZUPA 5BNZA 2F8MA 3OTWA 3R3ZA 4TGLA 4I3FA 1CDZA 1T6BY 3KEMA 2YXPX 5AHWA 3LUBA 2PMEA 3DDHA 3QLTA 5DLPA 4GI5A 4S1WA 4IX9A 2KSQA 2J3IA 3BMQB 3RWOA 3JZDA 2DR3A 2ZSFA 4MHSA 2PBLA 3QUCA 1RQ2A 2I4IA 4MRAA 2ZIXA 3L0PA 3ZNPA 5THKA 3QVJA 3T7RA 4K03A 1DUVG 1PSDA 1XGKA 3L1JA 3QJ5A 4R2HA 5AKYA 4IEEA 1Z2AA 3H0KA 2AVNA 5JY1A 4HAXA 1Y8QA 2IEYA 4N8SA 3SXPA 1WY5A 3KOMA 4O5OA 4D42A 4R2MA 5HX7A 1KH3A 2KE5A 1W0CA 3W9UA 3AOEC 2ZIFA 1W9HA 4C29A 5J9FA 5A9SA 1QRTA 1ODLA 3V3KA 3B3AA 1GDDA 5LZ7A 3KLNA 2EHDA 2VHJA 3EVEA 3AVUA 3WHIA 3G2QA 4Y6LA 1TJPB 4QLBA 2L2QA 2IQ5A 1DAEA 1M83A 3JYLA 4J16A 1I5OA 3AKZA 2HK7A 2EKDA 1W4CA 1I0LA 5E7MA 1YJQA 3PFNA 3STHA 3MGAA 1NVBA 3CLVA 3WLOA 5LXTB 2O9JA 4I1PA 4FB5A 1WAMA 2CL0X 2Q5LA 2ZTVA 4ZQIA 5CT5A 4Z51A 1EDBA 2VPQA 4WZAA 1ODFA 2I2CA 4LI3X 1GO2A 1WKVA 1JB1A 1IQPA 4W1PA 3SAJA 3X1JA 2XQGA 2ZYVX 4L7VA 4YTEA 2FEOA 1KETA 1YB6A 3HHPA 3BZUA 10MHA 4FFWA 1ZQ1A 1YSCA 5ER9A 5HZMA 2ECPA 3UK6A 1UPFA 2WFZA 4LHZA 3SLKA 4GYJA 5LQDA 4TKZA 1AQNA 2FH5B 2W2TA 3LLMA 4L15A 1NE7A 4MS4B 2Z9CA 4WOJA 3FOBA 4MHOA 4YQYA 1BAPA 1Y7IA 4UXIA 3ZN2A 1CEQA 2BMAA 2B2XA 3GJTA 5G1NA 3AT1A 3GJSA 3F6BX 5D5HA 3QTTA 4GXTA 2WKRA 1E7SA 1HK7A 2YJZA 5KMGB 3I05A 5B3LA 4M1SA 3CMCO 4CJXA 1NVFA 2ZCVA 4PLCA 3R3JA 3BWYA 2EFYA 3PNOA 3WGLA 4LFAB 5DBFA 5FWDA 1ZAYA 1NXWA 1WUIS 4R9UC 2LNDA 2EJUA 2W71A 1X2BA 4EEZA 4UHCA 2VPWA 3W2EA 1JHMA 2I1QA 1YDWA 1XXLA 2ATCA 4KL8S 4ZEOA 2AMVA 2WMOB 5ALYA 1CUEA 5E95A 2WVGA 3JVUA 3RBZA 4BNJA 2QMYA 4YACA 5C1PA 2CV0A 4HUQB 1ELOA 3IV6A 3CNHA 4LY9A 5I7EA 1GGEA 1U7OA 3EFBA 1FVHA 3LFTA 5LZ2A 4F2WA 4JI6B 5AVUA 3B6KA 1RKUA 4DTIA 1EFPB 1J21A 3R5FA 4H35A 1L7MA 2IE0A 1RHRA 4ETMA 5IZCA 2ZXUA 3KQLA 4LQDA 3IQFA 3TQSA 4CMHA 2WKQA 4E46A 3DBLA 5IH7A 4LRUA 5KINB 1BZYA 1WDLA 4UXHA 5AHXA 2JEZA 2PT7A 5AJVB 1KOGA 5CPBA 3SC2A 4JOBA 1D6NA 3KCQA 4RD1A 4YRSA 1APBA 5ALUA 2IYSA 4DG9A 3DWFA 4LYAA 3OCCA 4GXNA 3H6GA 1F2TB 2IXBA 4QUEA 1K08A 5K0GA 3CZ5A 4NX2A 3E61A 4QJIA 1EFCA 4TV9F 5K4HA 3ZGOA 5KYUB 1IBLB 1ESEA 2IBSA 3EZGA 1I10A 3WBFA 4E7OA 4EJMA 1MEEA 4WUTA 3NCHA 4XJVA 1YMVA 5DWDA 4TL9A 1QGYA 1B7GO 2X6TA 3N5CA 3AEKB 1RAGA 2COUA 3IOMA 3L0OA 4J1SA 3PCXA 4PQGA 4EVSA 3T5PA 3TZCA 2MSNA 3CW9A 3EFHA 3I34X 3JX9A 5CB4F 3X1MA 4AZWA 2QX7A 1TAGA 1Y81A 3PT5A 3NBXX 1D5CA 2ZM5A 2OR3A 1H66A 3KPVA 1I94B 3U1VA 3G9TA 1JDSA 1GZ3A 4Q4JA 5IMSA 3FYUC 1M6NA 3ROZA 4LJ8A 4X85A 3T7IA 1NBEA 3LKBA 3Q11A 3RIHA 5KTOA 2X0FA 1BRTA 1OROA 1R8XA 4AWBA 5JI3E 1JLLA 1M54A 5T3UA 4HNVA 2AD5A 4DJEC 4MROA 4RM2A 3ZV3A 1AK2A 3MMNA 1KNXA 3JWGA 1XNQB 2KBEA 5CX4A 1SGWA 2AD1A 3LP5A 2CWDA 3A6ZA 3WLEA 4HQFA 1A88A 2XBLA 4K46A 4YT4A 2PMFA 1ZH4A 2WG2A 3L1VA 3KG2A 1ATIA 4BP3A 4D8VA 4FFRA 4HTFA 4KVAA 2OCKA 1PBTA 5A02A 4G0XA 2LIPA 3OEYA 3U6BA 4OD0A 4WSOA 2LZ0A 1E4EB 3OAAD 4A2CA 1Y5IA 2AOVA 3N70A 1IXZA 1U9IA 3E48A 4KVFA 2JCYA 4P3NA 4Q3KA 1K7EB 4WJZA 2WF5A 4IIGA 2Y93A 4DEXA 2XJ4A 1TT5A 5J2UB 1AUOA 1MQ9A 1S1CA 2YJ6A 4C22A 3KB2A 3AVPA 2NTNA 2L0XA 4FILA 1CUZA 4XEHA 1GGFA 4KNWA 1ZZGA 1P4GA 3HCFA 4C3VA 1IEWA 1ZJ5A 4JVMA 4KN6A 4TTQA 4E88A 1KYTA 4H1TA 3S7ZA 1M6VB 2VHWA 1W93A 1NZJA 1YDFA 1PNVA 1SCQA 3T4UA 3VDRA 5E6UA 3W3AH 3HTXA 1YD7A 3BJMA 2R6FA 4RMJA 1J8QA 4CG2A 2OCDA 3IR5A 3GG9A 3PUXA 4GNKA 4LXTA 4BX3A 2B0JA 2VXOA 4OX9B 2P9BA 2H29A 4HNAB 1JBEA 1KHHA 2Q6KA 4X45A 3ET4A 3MERA 5LBTA 4AO8A 3FE2A 3O9ZA 5ALEA 2DM6A 3TUZC 1XC7A 2GGSA 1FFHA 1RJGA 2Z5VA 3R5KA 4R8KA 5AM0A 3TRJA 3CUSA 1LLDA 4E30A 4FNOA 4IUDS 7ADHA 1EMDA 2ONKA 1P5RA 4LSMA 1QIJA 5EP3A 5HF9A 1RIIA 5A2GA 4H4DA 2XCOA 4RL6A 5ALKA 4DLAA 5CYFA 1UL1X 1Y98A 1J9ZA 2BEJA 3BFVA 2J9GA 1ZCFA 1LD3A 4QBIA 4Y9SA 2RDMA 3TOVA 4K87A 1L3CA 4HN4B 3UA4A 1N2OA 3ZG6A 3PC3A 2G4CA 2WF7A 3GLVA 5CFLA 2WSYB 3KM0A 3N07A 4N1AA 5F2OA 1KJZA 2FHPA 4HLNA 5K6AC 1H2XA 3QFCA 4LOIA 3B9PA 3ZV7A 2ODTX 2OBYA 4RFSA 4OXYA 3GZTB 1KEWA 3ZLJA 2O20A 5CLQA 5SZHB 3EOBI 1DXQA 3EA4A 2JGIA 2LD4A 1WU8A 3OJOA 3V33A 2O5VA 2JFXA 4GYYA 1NVAA 4CIXA 4MCHA 3JS5A 2H9AA 4IGKA 3JWPA 5C1BA 3VOSA 1NL3A 4IIJA 2PUDA 1W35A 2KI5A 1R9MA 4PO9A 1MO5A 3K70C 3TNFA 2X8LA 4NL4H 2CJWA 4K9SA 3K0FA 4GQIA 4WLOA 4XWYA 2GHIA 5BMOA 2Q2QA 3EQZA 1WXIA 2IZ6A 5F4BA 2DWCA 1RRMA 5K09A 3LCUA 2FMUA 4CODB 3OAAA 4E5UA 1L0BA 1OWNA 2NUAA 2VAMA 3ANYB 1PZHA 3HYSA 2HHHB 4ZHQF 3NATA 1DRWA 4ZVQA 4ENWA 1NX6A 4BVLA 2VBCA 5F21A 4EP1A 4B6PA 2X0IA 2WHPB 1Q15A 3KC2A 4L8WB 2ZRGA 3D8BA 1YHZA 1GCOA 1ZVMA 2OBMA 4ICIA 2X4IA 1II0A 2QY6A 4OPMA 3AESA 4PAOA 1VJ5A 3Q98A 5DP1A 1FRNA 5JNWA 4KUHA 4US1R 5A2QA 1RI1A 4KGDA 4LJ6A 5BUCA 2F9LA 4LTNA 3PEYA 4HAUA 3T34A 2C42A 4CI0B 5AW0A 5DMHA 1CY4A 4P4LA 5CDSA 2REOA 3HZZA 1M0TA 3E18A 5TLSA 4UOQA 1SVKA 3MCUA 4NMLA 4W7IA 2DBZA 4Q9DA 3UAZA 4AP6A 1DEKA 4WK0B 2D5BA 1RE1A 1YA6A 3KZOA 1PD0A 5CM9C 2EZTA 1NQVA 3GPBA 4I0WB 1T9DA 1PW5A 2HMVA 4HX5A 2ZBDA 1I9CA 4G23A 5ENVA 2DETA 3DAHA 1WW2A 3CZAA 1L8OA 4OGFA 3TJRA 4JOCA 4M1OA 1IWOA 1ECFA 4YGXB 2I2DA 3QPWA 4QREA 4XPIB 4FEEA 1KZ7B 3WDMA 3U61B 1BD4A 2XT9A 3DVQX 1Y4DE 2D7CA 1R7RA 1X0XA 4HN9A 5JEEA 2V6IA 4L5CA 4RTPA 3V8MA 4KK4A 1GYRA 3SX0A 5F73A 1IY9A 1L1RA 2JLQA 4U9IS 3FWHA 2C4UA 1TQDA 4C7VA 4GPBA 2PVCA 4JC8A 4R2IA 1L5LA 3E5HA 1ZD8A 1I2ZA 2AZDA 3OZGA 3I9MA 4MKRA 4MVJP 4TV9A 3VR1A 4DXHA 1Y1RA 1U4NA 3V2UA 3B5JA 3DMYA 4Y98A 1N5DA 2BBWA 4LYEA 3KSDO 4L57A 2QM7A 4IDCA 4N7JA 1CQJB 4WDQA 1DT5A 3K31A 1C0PA 1CUJA 4CM6A 1CP3A 5CJPA 2A7XA 1IJFA 4ZDIA 2O2DA 3BCRA 1ZAKA 4RPCA 1N7JA 1OXTA 4A5OA 3L05A 2P0EA 3MBIA 4KIWA 4G8JA 1EFKA 1T2CA 2AB0A 3FDJA 3JPWA 3MF4A 5CFQA 1KWKA 5HK8A 4ZMBA 5EY5B 2R44A 1N9ZA 5BSWA 4UAUA 1I3OA 1BU5A 2P2NA 4OIMA 3U7IA 1JKJA 2YJTD 3SMVA 3I8XA 4FMCF 3ZCSA 3P2IA 5C81A 1AA6A 1HGXA 2VYVD 4NU5A 4KR0A 3AVWA 3VOAA 4KITB 2ZYGA 4R4JA 3TSCA 1UDWA 2JH3A 2NO4A 2VOEA 3MJVA 3HI4A 4K40A 2HQBA 3HB1A 4NBRA 1PFUA 1SULA 2ZIEA 2JS7A 2NXWA 3TZHA 3NH9A 3EG5A 4HNSA 3UJPA 4IO1A 6LDHA 5DSTA 2G06A 4D8UA 4LK2A 4PIPA 3NTQA 3IP3A 3L49A 2H63A 5BR1A 3PR2B 3QX8A 3KOOA 1KJWA 2HMWA 2PUHA 4X1YA 5GVRA 4D3YA 2F9FA 4JQZA 4ZCQA 2NXCA 3IHTA 1RWOA 4DV0B 4PYRA 4X62B 2O8FB 3ZE0B 3EODA 1HNWB 4PFQA 3KJQA 2I87A 3N2EA 4EGSA 4OJNA 1PYDA 3HXMA 3QHAA 1BXGA 1CY6A 4CCYB 2B7CA 3F9IA 2GJ9A 1HRDA 2IW3A 1OXBB 1G63A 2QQFA 5DI3B 3RVSA 2Z6AA 2MCFA 1XIVA 1XR3A 3N28A 4R54A 3THSA 2D1SA 2MSCB 3D3WB 2IYRA 4NZYA 5DHTA 4ZCTA 3SEZA 5K99A 3SWWA 2I80A 3CRVA 3DMGA 1PZEA 4EITA 1GTSA 2H9YA 1E6UA 2EJWA 3B6MA 3S8EA 2YVUA 5C8VA 4RABA 4HVAA 2O57A 3ND9A 2ZRQA 2HSGA 3LU1A 5FX2A 4X8OA 4F11A 1CT9A 3RUHA 2JLRA 4ZVOA 721PA 4RTSA 1ZPDA 3ZK7A 1TCAA 2K2WA 3EC7A 1LXCA 3B78A 5COAA 1G3QA 5ARCA 4M21A 3UCFA 1DKUA 1T5BA 3UK2A 5D1HA 1QHFA 4RGVA 2A1TS 5FL3A 4MUMA 3TZLA 4U7FA 2H48A 2YMLA 4A3SA 3IODA 4CKCA 2GH1A 2J6IA 3TLAA 3B5EA 1YQEA 1ZM4A 3C74A 2OA0A 4A9AA 5AW3A 5KVQA 1P0FA 5JS7A 2HMUA 3VKHA 4FPXA 4B7CA 3F49S 2AXQA 1RZRD 1I4WA 4RK0A 1PQYA 3CHYA 3N5KA 4RMNA 1RYZA 1LI4A 3QV1A 4IG9A 3X43A 2FETA 5DK6A 2C20A 4BNMA 5CDHA 1X80A 1F4PA 3MTAA 3P32A 3PQ5A 4JBWA 2H5IA 4HC4A 4ISBA 4M54A 5LIPA 4QOHA 1QU2A 2W4MA 3CKMA 4RCYA 5KYWB 3FWZA 1NYRA 1FOEB 4M1TA 4AF7A 3KS9A 1ZN8A 4CDRA 1H2WA 4M0UA 1L7DA 1LRKA 2VYVA 2FEPA 1L5QA 4B34A 3GGGA 3G2MA 3LPMA 4QM7A 1EK6A 1T24A 1RRFA 3FIUA 5DTMA 4ACAA 3VU8A 2NV6A 3L4BA 2IIBA 2FW0A 3H1EA 3R8CA 3KSAC 1T0IA 2X8BA 3MGGA 5AWFC 2WPNA 2XYPA 3WYGA 5BR7A 1O58A 1CEYA 2X9LA 5CU7A 5LZ4A 2AF4C 1HA3A 2NVBA 1ID1A 3A31A 1DC8A 3FTQA 2NU7A 3QV2A 4Q9HA 4D92A 4ZHQA 1AQLA 2GNAA 2VWHA 3PWZA 3UICA 2UZ0A 1G5QA 2WU8A 1A2OA 3QHPA 4HB2A 3I01A 4Z8XA 2RJNA 1JF8A 1Z83A 4KH0A 1SBCA 4KYTA 3E3LA 3IA2A 1P2GA 4NAVA 1A0OA 1LC3A 1GKUB 2YDXA 3AEYA 3ODPA 2HCFA 4BE4A 3IBGA 2C3PA 2ZRAA 3JQPA 4G41A 3RRJA 1HSZA 3A10A 5HJ7A 3THXB 4R3NA 4C6TB 3ZHVA 4DA6A 3QX3A 1F12A 2GD6A 3QVXA 3UMVA 3E8SA 4F8JA 2W42A 1U9YA 4OI1A 2GEKA 2R8XA 4NYMR 5HS6A 4BVGA 3IA7A 1I8TA 2AJBA 3DZKA 1M1NB 4C3ZA 5HQ3B 1RLUA 1NXVA 4WEOA 2AXPA 3LLVA 4N8EA 4X20A 4D9BA 5C7YA 1IMOA 1EM8B 2OMEA 3LL4A 3GJ4A 2JI9A 4GLOA 5COBA 1VE1A 4JYAB 2JGFA 4QHSA 2BRUC 1N6RA 4GICA 4BEWA 1QIFA 2JJ1D 1BE6A 1LUAA 3CH6A 3LQ1A 2OBNA 3M6FA 4MVJE 3RRBA 3QHQA 4IRUB 5EMMA 5FFMA 4K6FA 4Y6GB 3VNSA 4AIIA 4FGUA 4DEVA 1NFQA 2I3DA 3HWSA 1NJ1A 2OG1A 1E0SA 3TDMA 5CJ2A 3TW0A 4J9VA 4JKIA 3P5SA 3EYAA 3C8ZA 2RHMA 3TLGB 4AIRA 3A2MA 3NIWA 5TX7A 1YZVA 1XLTA 2JATA 1RZRA 1JH8A 3G49A 1A98A 1ZISA 3V4OA 1KH2A 2PQMA 2QP3A 3GJ5A 1G3UA 2AG1A 2OXCA 3R77A 4FFSA 3AILA 4RQTA 4N12A 5LJLA 4UTVA 4MVJF 2ACEA 5L3ZA 4DMRA 3HEAA 2W6PA 1AC5A 1AOXA 4WOPA 3R7BA 2JI7A 3CG4A 3PC6A 4JQSA 4LAFA 1D6JA 2WSIA 2ACKA 1G21E 1VL6A 3TD9A 3SYMA 1EXVA 2G07A 3DE3X 1LPPA 2B6HA 2NOAA 3O2SB 4KR6A 4TMWA 5AKIA 1IEQA 3P4YA 3QFTA 2ZUBA 1NQAO 2PL3A 4YONB 1MJGA 1AA9A 2FP4B 3INNA 4X84A 4DS3A 1KSJA 2PMWB 1KJYA 3AUUA 5KTNA 2F3TA 5M7EA 4ALIA 2QD2A 3PFIA 3Q3HA 1VE5A 3FOZA 2FZEA 1YI0A 4TYQA 2B4AA 2O50A 2B4QA 3PI6A 1QCYA 1CQPA 3HNOA 2IU4A 3IP5A 4UBOA 2IKSA 4HLDA 4KPUB 3AR3A 3ZQJA 4QRIA 2Z2ZA 1EJ2A 3OTQA 2CD7A 2QUKA 3KU4A 1N5MA 4J4TA 2PANA 2YRWA 1DWPA 5GTDA 2OHGA 1G0OA 2OE2A 2WMDA 1ZD1A 2CVPA 2OGZA 2Q6IA 4YRGA 2VS1A 1WUTA 3M6LA 5K2MA 4UCXA 1KBZA 3P7MA 3KEOA 5FOUA 3T9CA 2FPGA 5DT2A 1WRBA 1JJAA 3CZ4A 4M55A 4B3JA 1NBOA 3KP1A 3THWA 2IS4A 2CB0A 1PJ8A 2JFVA 3G79A 4UDOA 1ML3A 1P5FA 1QYVA 2F3PA 2UYOA 2Z56A 1DDOA 3FHCB 4HGQA 4I66A 2AF3C 5P8WA 6Q21A 2NGRA 4TYNA 2VLIA 4BLVA 2Z43A 1IEXA 4ONEA 2RC6A 3HLTA 3VHXB 2BW0A 1L5YA 4AJ1A 3QPVA 3H13A 4AJOA 2IHJA 3FA2A 3VR0A 1YQUA 3DS8A 3HZOA 1R6DA 2FR1A 5JADA 4TTAA 3I2GA 5LWHA 3DFIA 4IJKA 5IC6A 1FMJA 2W48A 1PZFA 1SB8A 1I1HA 5GOTA 1N3IA 2VJNA 3SEAA