4X95A

Crystal structure of fully glycosylated lysosomal phospholipase a2 in complex with methyl arachidonyl fluorophosphonate (mafp)
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
375
structure length
375
Chain Sequence
HPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of lysosomal phospholipase A2 and lecithin:cholesterol acyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Group XV phospholipase A2
total genus 124
structure length 375
sequence length 375
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02450 LCAT Lecithin:cholesterol acyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4x95A01
5DYWA 3IULA 1JMKC 1XRMA 4HVTA 5CH3A 3GUUA 1ODCA 1E89A 2OGTA 4KRYA 3WMRA 1XKTA 2HM7A 2VSQA 2RHTA 1YB6A 4Y7DA 2QZPA 2ZYHA 1AC5A 4GLBA 4B0OA 3AIMA 5E4JA 4Y2UA 3KWJA 4NMWA 2C0PA 4FHZA 4UBKA 2QM0A 3G0CA 4G8DA 2Y2VA 4ZGBA 2ZYRA 4CG2A 1Q0RA 3WQHA 2AJDA 4I3FA 4KE8A 4H7KA 3G8YA 4WDRA 2JEZA 4WJLA 3T4UA 1MX1A 1WM1A 2DFPA 4X92A 1I6WA 1C4XA 4Q3LA 3AINA 3DYIA 1VA4A 4RPCA 1BN7A 4ITVA 1ZJ4A 4N8SA 3KWFA 3C6YA 2WG1A 1F6WA 2B9VA 3C87A 1CUYA 3PFBA 3L1HA 2LIPA 4FOLA 5ALWA 1JMYA 3PFCA 1JT2A 3WI7A 3SWWA 3FAKA 1WCYA 4AZ0A 2PU5A 1ISPA 2ZJ7A 1DWQA 2G4LA 4XWGA 1X70A 1TIBA 3DOHA 4E11A 3G9UA 5BWCA 1IZ7A 4J0JA 3BJRA 4INZA 1XZKA 4J0CA 1XRNA 4MJ3A 1P0IA 3ZI7A 1P0QA 4Z49A 2DHCA 3SX4A 2XUPA 4TPKA 3H18A 5JZBA 3R0VA 3ED1A 2VJBA 1J1IA 2ROQA 3S2ZA 3LP5A 3WWDA 2HDWA 1PV1A 2QTBA 1KU6A 1TQHA 3I2HA 5ALVA 2ZYIA 5LZ5A 3ESAA 2ACKA 4G4JA 3DL4A 1J2EA 4BP8A 2DHDA 1PJAA 4X00A 1W1IA 1LZKA 3I2JA 4FFVA 3FYUB 1Z68A 1YSCA 4H7FA 1FFEA 2X76A 1CUCA 2Q0XA 4EY5A 1XLUA 1R9MA 3M3DA 5AM3A 1QFMA 3W2TA 3U1TA 3IA2A 3PUIA 3F96A 2VQ6A 1DWPA 3HABA 4G5XA 4ARAA 4DNOA 4CCYA 2H7YA 1B6GA 5A2GA 4MXDA 2WQZA 4DSZA 3HEAA 4U2GA 2BUAA 2RONA 5K3EA 1CUXA 5DNUA 5EIAA 2GYUA 3CCCA 4FNMA 2HA4A 1IUNA 4NZZA 2PSDA 3I2IA 4KJXA 3H17A 4Q05A 4CIAA 4QDUA 4J0GA 2H1IA 5A7GA 7YASA 3DYVA 5IVDA 1N5MA 3PI6A 4DLNA 2WG2A 1HKHA 1AMNA 1IVYA 5ALDA 4GBGA 2QUAA 3CXUA 3BDVA 5AI9A 3GZJA 3KSRA 3O4IA 3PE6A 5K3FA 2X5XA 3MUOA 2XUAA 1EX9A 4PSCA 4M0EA 4N5HX 4HZGA 2ECFA 2Y6UA 4BAZA 5I9IA 3HSSA 4W1PA 4BZWA 3GROA 1CUJA 2OGZA 3BF7A 2H7XA 2PKYX 3ICVA 2WFLB 2ORYA 3OPMA 5CMLA 2O7RA 2NW6A 4MYDA 4H0CA 3AIOA 5FXMA 1EH5A 1RWQA 3IUMA 4WFIA 3OC0A 3ZLUA 4X97A 4H7HA 4HXEB 5AKEA 4YK7A 1YAJA 1CFJA 4G4IA 1NU8A 5BV7A 4GHWA 3ZLTA 1FJ2A 2CZQA 1Q0ZA 3UUEA 2XQIA 5LKAA 3ZPXA 4MQMA 4ZWNA 3WL8A 2XQFA 3WK4A 3NGMA 4E46A 3WWOA 5K3DA 2YYSA 1Y7HA 5AK6A 4LXIA 2XDWA 3ANTA 4AN1A 1S8OA 3QMWA 4Y2SA 2C7BA 3VDXA 3DDUA 4ETWA 1CR6A 2OGSA 2WHPA 1MJ5A 4GW3A 3WWEA 3ESBA 5AKYA 4C4YA 1CUBA 4QEKA 4J03A 4K5QA 3HACA 4BP9A 3NWOA 4C87A 3O9MA 3RM3A 5JIBA 5LZ4A 4UBOA 3WLAA 4PF1A 4FFWA 4J0IA 5FUMA 2YASA 1K6EA 2RI6A 3C6XA 1YS2X 3TEJA 2O2HA 4B9AA 4FKBA 5T4BA 5T4FA 5E4TA 4HXFB 4C4XA 1L7AA 1FFDA 3AILA 1R50A 1XQYA 1MX5A 3PF9A 3FCXA 2OCKA 4UFPA 4ZV7A 5HQ3B 1QIMA 2K2QB 4X6YA 5LZ8A 3D7RA 1XLVA 3E0XA 3JW8A 2QT9A 3RK4A 4CI9A 2W22A 3V1NA 3WL6A 3IUJA 4LHEA 5A62A 4HAIA 2JGFA 4DYHA 2HRRA 4A23A 4B82A 2C5FA 3EIOA 3LCRA 5IKXA 3HJUA 4N8EA 4ROTA 1DT5A 1UFOA 1F0PA 3R3UA 3IDAA 4X85A 3VVMA 2VEOA 2PPLA 4BE4A 2WIDA 1G66A 5JD6A 2QUBA 5DYTA 5FPQA 3FVTA 2CMFA 2QXUA 2H9YA 5AICA 4WCVA 4QLOA 4EUSA 3PICA 4DMFA 1Q84A 1HL7A 4Y2RA 4W63A 3VJLA 1U8EA 1XZCA 1CUHA 4RGYA 1LBSA 5DTIA 3IBTA 1CLEA 4I4CA 5CTAA 1H2WA 2Z5GA 1LPPA 4CCYB 1AZWA 4J0KA 1DT3A 1TK3A 4OSEA 3HI4A 2B20A 2VATA 5A6VA 4QDXA 3DLTA 5JADA 4FTWA 1TCCA 3E3AA 4K6GA 3B3QA 4B0PA 1CIJA 2QMQA 3SK0A 1WB6A 2DR0A 2PSJA 4QWWA 1O6GA 2AJCA 4CFSA 1JU4A 4BC1A 5JD4A 1QIEA 1EK1A 1YAHA 1U65A 1L7RA 5FKJA 5EHNA 4L0CA 2HU7A 4YX9A 3YASA 5CT8A 3WYDA 1K8QA 1R3DA 3QPDA 4QA9A 3V1LA 4B83A 4UHBA 3I6MA 4JYMA 4U2CA 4LYDA 4H7IA 4ZI5A 2OQVA 5IVKA 1H22A 2PBLA 5CRIA 2VT7A 2IITA 2JEYA 2GBCA 5JYCA 2DHEA 4AX4A 3C5VA 5AIBA 4B80A 4Q3OA 4OB6A 1AUOA 4ZREA 1EDEA 3D2CA 5AOCA 5K3FB 2WTMA 4BDTA 2WUDA 3R41A 2C5GA 5IH7A 1XZAA 2QS9A 1QFSA 1UXOA 1LZLA 1X2BA 4EY6A 3FBWA 1AKNA 4QNNA 4FMPA 2OQIA 4DNQA 4U2BA 3FLBA 4WFKA 5AOBA 5AP9A 1BROA 1VKHA 2FJ0A 2GZRA 1GKKA 1UOOA 4LYEA 5LKRA 3F67A 1U4NA 4DMCA 1CV2A 3F97A 4Q3KA 2HA3A 1XRRA 3E4DA 4DMKA 3R3WA 5JAOA 1UKAA 5AM0A 2PSEA 3G0BA 2XB6A 5AO9A 3KXPA 5CW2A 2EDCA 3W05A 4RE5A 4LKOA 3IUNA 3C43A 3O0DA 2GBIA 3LIIA 4AMZA 1YS1X 2EEPA 1UOQA 2PU7A 2HL6A 3WWPA 2QJRA 1JKMA 2WUEA 4H7DA 3HZOA 5CBKA 3FYUA 5ALLA 4KAFA 1IZ8A 2QXTA 3G0DA 1ACLA 5AH0A 5AM5A 4FNGA 1A88A 1BRTA 5AKZA 4MQLA 4P08A 4OPMA 4DNFA 4L3WA 2XUFA 2HU5A 2ZYSA 5ALMA 5DJ5A 1RP1A 3HXKA 4IO0A 1QIGA 1EB8A 3H19A 4FBLA 5KBYA 5J3JA 2XI4A 5IVHA 4DM7A 3W9BA 4AQDA 3A2LA 2WU4A 5CURA 3C6ZA 4D9JA 1OCEA 4O08A 1EVEA 3O4GA 4QDZA 5JZSA 2JGKA 1FFBA 3QPCA 3LIPA 4K6KA 4UBMA 2BGNA 5I8PA 3C8DA 3BXPA 2XMCA 5ALHA 1G4HA 5HFNA 3FNBA 1XZLA 4YPVA 2BFNA 1LBTA 3WL5A 3FWHA 3QMVA 4V2IA 3RLIA 3STXA 1E8DA 1L7QA 4UBNA 2XQKA 3DL7A 5AM4A 2G63A 1WPRA 2PM8A 2XMGA 1EHYA 4EB0A 1CUSA 5AKIA 1D07A 3O4JA 3BJMA 3WZMA 5CT9A 2WIGA 3MUNA 5DYYA 1TCAA 2PUHA 4UBIA 1VXRA 2OCGA 2ZJFA 2ZSHA 2WTNA 1ZGBA 3HRHA 1UKCA 1DTEA 5EIHA 1LPBB 5ALFA 1GPKA 3QVMA 5T4EA 1UZAA 3SC2A 1WB5A 2CUTA 4GI1A 2WLSA 1BE0A 3G0IA 3STUA 3AIKA 1N1MA 3D0KA 4H7JA 4RE6A 4Y2TA 1XQXA 3OG9A 1KEZA 4OB8A 5HF5A 3VISA 2B4KA 4H35A 2RHWA 4LIPD 5BOVA 2C0QA 1QTRA 5HF9A 5ALQA 2QRUA 2XE4A 3DD5A 4FDMA 4EHBA 3GBSA 1VXOA 5EFZA 1ZI8A 4S0XA 4C6HA 5D3ZA 1LPMA 2V96A 1QOZA 2WKWA 2AXEA 4Y9SA 5AKLA 3WA7A 3D3NA 5EIEA 2IIVA 1M33A 1YA8A 2XQJA 4BDSA 3I2FA 1QGED 2FX5A 5CT5A 3VKFA 2CBGA 4GECA 1DX6A 2I78A 1A8UA 2XLBA 5YASA 1ZOIA 4UHEA 4G9GA 2BJHA 4UPDA 1QE3A 4UHHA 2Z3ZA 1KU0A 2O2IA 5ALKA 5ALTA 2HFKA 1R1DA 4DTCA 4L72A 1EI9A 4MWTA 3C8HA 2BCEA 2CB9A 4J3JA 2JGMA 5JAHA 4FWBA 3UUFA 3A2NA 4BE9A 4IHAA 4WY8A 5AI4A 1JU3A 1EINA 1BU8A 1JFRA 1CUUA 1BCSA 1ZI6A 4AB1A 2JGIA 2WUGA 1K63A 3QBJA 5LIPA 1W52X 3O9VA 4BCCA 1IUOA 4EY8A 3L1IA 1YASA 4GWLA 3FYTA 4BCBA 1UK8A 4TVKA 5ALUA 5CT4A 4GXNA 5ESRA 1E3QA 4XIIA 3F8SA 1YB7A 4XJVA 1IMJA 1MU0A 4X94A 4U2FA 3WJ1A 3FSGA 1H2ZA 1ODTC 5HF8A 5ALNA 3AFIA 5AI8A 3H04A 1SC9A 2WJ4A 3KOOA 5LZ9A 2XUGA 2GZSA 5ALOA 3WA6A 3LS2A 3R3VA 4UUQA 2XMZA 4NS4A 5FPPA 1ODSA 1WPXA 4HRXA 4CCWA 1O6FA 4FBMA 1VE6A 2ONCA 3PDCA 4X6UA 1XZJA 3V1KA 4CIBA 1ETHA 1UK7A 5JALA 3G0GA 2HA2A 1XZHA 5AKXA 5A7FA 5AK3A 1VOTA 1GZ7A 1UT6A 3WKCA 4B7ZA 1ZGCA 1GXSA 4XX1A 2W6CX 1J06A 2JF0A 5HF6A 2GBGA 2VT6A 3EBLA 5DNVA 3JYHA 4B81A 2JGEA 3IURA 1THTA 1SOMA 3H2GA 4NVRA 3EQ9A 4BAGA 4AMYA 3P2MA 3LLCA 1AGYA 3GFFA 2I3DA 1SCQA 5AK5A 4QWMA 3FSGD 3WKBA 3AZOA 3DCNA 1AX9A 2HA0A 1MO2A 3O95A 3Q8WA 3IB3A 1ACJA 3WWCA 4W1RA 5AIAA 4F60A 5JAUA 5ALRA 5LYYA 3FLAA 4C4ZA 1DWOA 1YA4A 1QONA 5AKHA 5AM1A 3F98A 5I7UA 3WIBA 1T2NA 4K6HA 4QZVA 2HFJA 1EVQA 4GEGA 3D5EA 1SCKA 4B9EA 1XRQA 5LLSA 1UOPA 5EHZA 5LZ7A 1P0MA 1R4ZA 4WY5A 3NOXA 1QLWA 5AKKA 1ZD4A 3C45A 2WFMA 3I2KA 5FRDA 1VJ5A 4G8BA 3WKAA 2CJPA 3VJMA 4JEIA 1K5PA 1Y7IA 1ORVA 3HYSA 5CXXA 1J07A 1E66A 4CG3A 3D4LA 3C6BA 4CG1A 1CUEA 2B61A 4BAUA 1HPLA 2WILA 1XZBA 5AI0A 4A5SA 1XRLA 1BEEA 1A8QA 2OCLA 1CUAA 1QO9A 4OU5A 3TRDA 2AJ8A 1DINA 3ZWQA 1CUIA 1ZICA 2WU3A 2WG0A 4L9AA 1QIDA 2RAUA 4ZV9A 1ZI9A 3FLEA 5EI5A 1CUGA 5JANA 3L1JA 2WIFA 5ALSA 5E4YA 4KE6A 5HK8A 4I19A 3N0TA 1MT3A 1A8SA 1BCRA 1BEZA 5C8XA 4BRSA 3OM8A 1T4MA 2DQZA 4E14A 1ZD5A 3OOSA 1LPNA 3IVMA 2VF2A 3ANSA 4ARBA 4BRZA 4BTLA 4KACA 4PSUA 4BZZA 1MN6A 1LLFA 4JNCA 1XFDA 1W75A 1UKBA 5A7HA 3WK9A 2QJWA 4OD0A 2G5PA 4LXHA 2UZ0A 3CN9A 1P0PA 3M83A 4H18A 2XMBA 2OAEA 5EHQA 2RIPA 3I2GA 4EY4A 3A70A 2XQGA 1JI3A 1CUWA 4MEAA 2OXEA 5HQ3A 2WJ6A 1TAHA 2HA5A 1GPNA 1G42A 2OAGA 2WM2A 1EDDA 2X8BA 2HIHA 2XUHA 1DQZA 2O7VA 5HZGA 2O2GA 1K4YA 2PSHA 2VA9A 5IVIA 4QLAA 1LPOA 3N2ZB 4IH9A 4Q34A 4EA6A 5K3BA 1CUVA 2XLCA 2WFZA 2BGRA 5LP1A 4KAJA 4RNCA 2OPHA 4C89A 3G9ZA 5HCUA 3WZLA 1XZGA 1XKLA 1F0NA 1H23A 4Q82A 4G9EA 1QIFA 4IH4A 3AJAA 4IH1A 4X71A 1QTIA 5AI6A 1XZMA 6YASA 3ILSA 3W9UA 3F9CA 2PUJA 3R3XA 1ZD3A 3AZPA 2YXPX 3BDIA 3A2MA 5FV4A 4Y2PA 4F0JA 1NX9A 1E5TA 2VAXA 4BATA 4QDOA 1U2EA 4TGLA 2VJCA 3C5WP 1W4LA 2QOEA 5K3AA 4BYMA 4UHDA 1H2YA 4BB0A 2IX9A 4P93A 1W76A 4H77A 2I03A 5C8ZA 4X90A 3KDAA 1QIKA 1QO7A 3IUQA 5C81A 3K6KA 4X93A 4X95A 5ALIA 1TKRA 1ZD2P 5AI5A 2FJPA 1GT6A 1VLQA 5ALPA 3STYA 3BWXA 2JGLA 5CXUA 1VZ3A 1MNQA 2XUOA 4W9RA 5EGNA 2Z8XA 2WHRA 1DQYA 4EZIA 2BUBA 2WHQA 1N5RA 4G8CA 3NUZA 4G4GA 3QMMA 1EXWA 3WKDA 5SYMA 2J3QA 4AXBA 3QH4A 2GYWA 3RKSA 5FOQA 4U2EA 1MPXA 2HA7A 2HRQA 4Y2XA 1NU6A 4ZXFA 4X91A 3WK7A 3M81A 4B85A 5K3CA 2FUKA 4DMHA 2J3DA 3QYJA 2J4FA 3W04A 3RARA 4B84A 3VXKA 4KE9A 4M0MA 3HC7A 4Y2VA 2HA6A 3H0CA 2WSLA 1QIHA 1FFCA 3FCYA 5DNWA 4FLEA 4YASA 3V1MA 1F8UA 3I6YA 5HKAA 3G7NA 3I6ZA 4XVCA 3FVRA 5KWIA 3BE8A 5CH5A 2DSNA 4JYPA 4PSDA 4H7EA 2P8SA 4HRYA 3H2IA 3H2KA 4BVLA 4F21A 4UHCA 1ZIYA 3R40A 4PW0A 1EK2A 1GPLA 3B12A 4FLFA 2VJAA 1B41A 4BCDA 5A71A 3DQZA 2VTVA 5JARA 2BKLA 3DEAA 3BIXA 4X7BA 3W06A 1A7UA 4J0HA 1C7IA 3QPAA 3WIOA 3WJ2A 3STWA 3PUHA 4HXGA 2XMQA 2C4HA 1SFRA 3C70A 4U2DA 4EBBA 2Y6VA 2VJDA 3G9TA 3DNMA 1Q83A 2QR5A 4X6XA 3G02A 3I28A 5AHXA 1GKLA 3I1YA 2V98A 5D6OA 4AO6A 2R11A 1EB9A 4WFJA 4C88A 5ALJA 2CKMA 5DWDA 1USWA 1PFQA 5KWJA 3G9XA 1GQRA 2R8BA 2YH2A 1MNAA 3DS8A 2ZVDA 2DQYA 1E8NA 3M82A 5DTJA 4OUKX 4N5IX 1MTZA 3U0VA 1QIIA 5ALZA 3WYNA 4BVKA 5C8VA 3CN7A 4IQ4A 2G5TA 2QVBA 4UFNA 3Q0TA 4JH0A 2JIDA 2RGUA 2GYVA 3I1IA 1UWCA 4WDQA 2OG1A 3R3ZA 1XQWA 5JASA 2WHPB 1OILA 4BC0A 3ZLVA 1DU4A 1QIJA 2XMDA 1WOMA 4ZRDA 1W6RA 5JATA 5CT6A 2XMSA 4FLMA 2XUKA 4B6GA 1QZ3A 3STTA 5K5EA 4LXGA 3V9AA 4UBLA 3WK5A 2Y1KA 1XROA 1JJIA 2PSFA 3BIWA 3AZQA 1LGYA 4P9NA 1XLWA 2WIKA 2C58A 3STVA 4HTAA 1LPAB 3WK6A 2Y2UA 1CUZA 4MEBA 5JAPA 1ZJ5A 4QDTA 3DKKA 2D5LA 1CUDA 4A16A 4AO8A 4C01A 3ESDA 1R88A 5EHXA 3WKEA 1TRHA 4K2AA 4OU4A 3OURA 1XZFA 2WIJA 3OTQA 4EY7A 2HADA 2Z3WA 2XMRA 3CCBA 1CEXA 1CUFA 4X3CA 2VAVA 1JJBA 1MAHA 1G5FA 1ZIXA 3S8YA 5AKGA 1HQDA 3ZV7A 1FFAA 1QJ4A 1CQWA 3BL8A 4OCZA 1RYYA 1XRPA 1N8SA 3WL7A 3D2AA 4OYLA 2PL5A 4BBZA 1CVLA 3GA7A 3JWEA 4W1SA 3UMJA 4DIUA 4Q1VA 2V97A 4KRXA 3X3HA 4DNPA 2XUDA 5AKJA 2ES4A 1UK9A 2ZSIA 5DLPA 4PV7A 3ESCA 2ACEA 5AOAA 1DX4A 2JBWA 3MVEA 1C7JA 4GDMA 4UHFA 4DGQA 4UBJA 3VVLA 1IUPA 4J0DA 1CPYA 1MAAA 4MWSA 3TJMA 5HFAA 2AJLI 2AJBA 1WHSA 2E3JA 3EQ8A 1LNSA 4KAAA 3QZUA 4KYVA 3QITA 5FP0A 5H3HA 4OYYA 5ALXA 1E8MA 1JJFA 5KREA 5AM2A 3AUKA 5FDFA 2XUQA 3QM1A 3EQ7A 3EF3A 3H2HA 1GGVA 1TCBA 3VJKA 5BWBA 1THGA 4M0FA 3B5EA 1X2EA 1VE7A 3H2JA 3TGLA 4UFOA 4AO7A 3D59A 2PVSA 2JGJA 4HS9A 4AN0A 4AZ3A 4G1FA 5ALGA 3IIIA 3DKRA 1BN6A 5AK4A 5LZ2A 4J7AA 1HDEA 1XQVA 3ICWA 1YR2A 2EDAA 3FOBA 1SCIA 1VA5A 1OXMA 5HK9A 1MX9A 2PX6A 1BS9A 5ISMA 1AURA 4PNZA 4E15A 1LPSA 4MYSA 5D3KA 1ORWA 5HKBA 2H7CA 2XUIA 1WB4A 3D2BA 1FSSA 1Y37A 1R9NA 3O4HA 5T4HA 1VZ2A 4BTVA 5JZ9A 3GELA 4W1QA 5D7BA 5C7YA 2I3ZA 2CEKA 5FLKA 1CRLA 1EDBA 3DOIA 4KEAA 3A6ZA 1UK6A 4F5ZA 3E1GA 1HBJA 2D0DA 3HLKA 5CH8A 5E2IA 3DJYA 3H1BA 4N8DA 4DSAA 1YCDA 5SYNA 4Y2YA 1XZDA 4OB7A 2HHAA 3PF8A 4PQEA 1CQZA 4KR0A 5F4ZA 2BUCA 2QKYA 2ZJ6A 1WHTA 3FYUC 1GQSA 3K2IA 3T52A 3BF8A 4BVJA 2DCMA 2Z8ZA 5ALEA 3KD2A 2V9ZA 4Y2JA 2BAGA 3V48A 4P92A 1AQLA 5AJHA 2OLEA 2GBFA 2WJ3A 3MGAA 3H1AA 2WUFA 1H2XA 2J4CA 2WFLA 3K9BA 4KE7A 3WK8A 5JD5A 1EA5A 5ALYA 2XUJA 4JUIA 4Y2QA 1XZIA 4PO3X 3R3YA 1XZEA 2OCIA 2HU8A 1HLGA 4QE3A 2XT0A
chains in the Genus database with same CATH superfamily
1N2OA 1X0XA 2E6KA 5DYWA 1NJSA 1OWNA 3P0IA 5BR8B 2V5VA 1J70A 2C82A 4HVTA 3Q2OA 5CH3A 2O2EA 2YXLA 2HOQA 3UXMA 3VU0A 4PYRA 1XMSA 3VZRA 2F3PA 3E9CA 2JI4A 2LUOA 3DZBA 1GSAA 4YACA 4OYHA 2VLBA 2VSQA 2V6MA 2BEVB 1RLUA 3GWZA 3WRWA 2FUEA 4Q3NA 4LHSA 2ZYHA 2HKIA 2I2BA 4E7OA 2IGTA 5I3CA 2GJAA 2H3HA 3BK7A 4ZCPA 4AKSA 1SBTA 4B6EA 4NEQA 5A3VA 5B7QA 5JXJA 4L6CA 4XSVA 2ACVA 1RIFA 1S7GA 4Y2UA 5E4JA 3K71B 4C5CA 5CDTA 1PU2A 1RYDA 3M6AA 4PGHA 5CNMA 2PQ0A 3S2YA 3ZHSA 1OT5A 4PYIA 3H3FA 3RVSA 1XTKA 2QM0A 2CXSA 3U6KA 4L07A 1RRGA 5LXTA 2V4ZA 4NZYA 4YAUA 3FFBA 3ZE8A 2QI9C 1M74A 4ZGBA 1QS0B 1MO5A 2YDXA 3ONFA 2ZYRA 3A06A 2CK3A 1JXAA 1YO6A 3GF4A 3KTFA 4OI2A 3PC7A 3ZQUA 3ZJUA 5FTWA 5LP6B 3N8NA 3P26A 4O02B 1P7VA 2AJDA 4W5RA 4KR6A 1ADCA 4QGFA 5BN4A 1PQYA 1F8GA 2IPOA 2VYFA 3C7CB 4I3FA 5LC1A 3ESQA 3B6EA 2P5SA 1OYVA 2YZKA 3HDJA 3EG9A 5DX1A 3NHJA 3E7DA 3G8YA 4H7KA 4ND7A 3M7IA 2FYTA 4WDRA 4QUEA 2JEZA 1YB4A 3PT5A 1VMIA 1VLZA 1RJEA 4EQ6A 3N53A 1E9DA 1TCVA 4NBVA 2Q0QA 3T4UA 3DMFA 3C6MA 1WM1A 4WJLA 4TYMA 1PGQA 2C3MA 3H6KA 4P2GA 4MCIA 3V33A 1I6WA 3DBVO 2BCGY 1KC3A 3QPBA 2ZCJA 4A1FA 2GF2A 4N5DA 4LOAA 1U0GA 2ZPAA 5JR3A 2GLUA 2M98A 3UUWA 2IA5A 1EE9A 1WY5A 1NNEA 5G4KB 5TJ9A 2I65A 2PT7A 2RH8A 2PKWA 3T0GA 3K70C 3H9UA 4UVEA 4Y0VA 3NTOA 1ENYA 4KW7A 4C2BA 5SZJA 1H4QA 3KT8A 1GGFA 1C1YA 3DC7A 4NEGA 3OTOB 2B82A 1RQNA 2QUHA 2FDCA 4IXNA 5KNDD 1UKYA 2WG1A 4TTJA 2C2HA 2P9FA 3NRBA 4B87A 3PFBA 2BFAA 3DMPA 3L1HA 5HEKA 3C5CA 1Y6ZA 4FOLA 1G20A 3P9ZA 4HPWA 4UEJA 5TMEA 4AKIA 3F2VA 2FY8A 5FF9A 3WMEA 4Q02A 2YHBA 4MZDA 4MVJE 4AC9A 1MUUA 3L7OA 4IMPA 3DGEC 4EB6A 1SN7A 2QA5A 2FW9A 4NMLA 3LUGA 1R0SA 4IDAA 4JJ8A 2NSJA 4OBXA 3RJZA 4QARA 1P1HA 2TS1A 1Z82A 3LO5A 4HAYA 4OLJA 1X7DA 4XW2A 3IXMA 2FN4A 5DASA 3TEMA 5ITZA 3MOSA 4AZ0A 3OIDA 4AUNA 1FFHA 2NX2A 3ZHCA 1T25A 3VAZA 2ZB3A 2PU5A 5EMHA 5EIXA 2D4HA 2OCBA 3CURA 3Q85A 3NPMA 4PYQA 2NXCA 3AR6A 1EFRD 5DW0A 5C8DA 1X70A 2GHQA 4GT1A 4P82A 3PNMA 1A7AA 4DYVA 5BWCA 5CCXA 2VBGA 4UD6A 1Y1LA 1Q5PA 1JIIA 1JHDA 1TF7A 4INZA 4Z4GA 2CHVA 3FR8A 1GNLA 3PHGA 4MW9A 1K8XB 2Q3HA 4WW0A 2ZGVA 4HRAA 4QYSA 1I4TD 4WK0B 3DULA 3HFRA 4XSGA 4WINA 3L7KA 2NNWB 4Z0TA 2YZNA 1IG3A 2QF7A 2B2CA 2I6FA 2XUPA 2ZUTA 3UGKA 4QVIA 4R6WA 1ZIDA 2HPHA 1QH9A 1TZJA 3E81A 1P39A 3IT0A 3U3RA 3UAWA 1E3TA 4E2ZA 1KQPA 5AJZA 3ORRA 3OT5A 3OTHA 5JZBA 3R0VA 1WVMA 4PPFA 5CW1A 5CK5A 4OX9B 3WLMA 5JNSA 3C39A 2H92A 2F62A 4S1OA 2AFHA 2VJBA 1J1IA 3H4VA 1N2CB 4IX9A 1GDDA 4K8OA 4MQUA 5FBZA 3TBKA 2RKOA 2XNJA 2CVOA 1EUQA 3TCXB 1C0EA 1PIWA 1Z8FA 1BA3A 2XPCA 2F3UA 4U7HA 3W8EA 2XNDA 3AESA 1LA2A 4DBZA 1AF4A 3RHSA 2QTBA 2ZVPX 1TQHA 1WCXA 4C14A 2ZYIA 1R6BX 1QQTA 1X8LA 2P4HX 4D42A 5JAIA 3ESAA 3GI1A 4PRKA 1HETA 1YB5A 1J2EA 3KEFA 3CLRC 3I09A 3OOYA 1VJ1A 2ZT7A 4LOJA 3F6RA 1UBLS 2HJSA 4R9UC 3TZLA 1QH8A 5BSMA 4W5NA 1LZKA 1E6LA 3E70C 2WD7B 4PBSA 5F7ZA 2HU2A 2O0HA 2QZSA 4E32A 4RTKA 4FFVA 3EOBI 5FOSA 1KVTA 4JJ4A 4BLVA 2VAWA 1T4CB 2KQUA 3OMWA 4QOIA 1YTUA 2YHAA 2HSJA 2BFMA 3AVTA 1E2BA 3WDKA 3T3DA 1CWUA 3K9WA 2C9BA 4Y9RA 3N5CA 4XWWA 4BLUA 1KAOA 3MS4A 4PO9A 4EHIA 3ZDRA 1KXJA 3MWFA 3U16A 2I71A 3EWSA 3UK1A 4JVOA 2VDMB 4NNOA 4PG8A 5I7HA 3N8GA 1G4AE 4RIHA 4HTFB 4AYTA 1Q50A 2QTVA 2P4QA 4EY5A 1XLUA 4JOSA 3A1EA 3WAKA 3CUVA 3VZPA 3OBIA 1NW4A 1HSOA 3IA2A 1AKTA 5BW6B 2JEOA 3GN2A 1WMAA 4NG5A 2BH2A 2QZ9A 4L27A 5EVJA 2PS0A 4BNJA 3KKEA 4XDHA 4DCCA 3W6NA 2I4MA 3BWYA 1L4YA 3HKDA 4QDJA 2VH2A 3K2BA 2VBFA 4JVSB 1WO8A 4GPAA 4K86A 5HDBB 3I1JA 1T1SA 3W4KA 3WO0A 1IHDA 2J9YB 1W93A 4G5XA 4BGUA 3F73A 3D6VA 2A30A 2VC2B 3KTAB 3JZAA 3JYOA 3HBLA 2FPSA 2AWNA 1E3EA 3OZGA 4HQKA 5A2GA 3L7DA 3JQAA 8MHTA 4ZEVA 3UB2A 4MXDA 4RVFA 4BNHA 4DSZA 5AR1A 5JJBA 3D8HA 3EZ9A 3QTTA 2BMEA 1RJ9A 4HWKA 1CUXA 1PNOA 3PBKA 3TZQA 1UXJA 4CXMA 5EIAA 3E5NA 4QQNA 1M1ZA 3CCCA 4KN9S 4G0MA 5AVJA 1DL5A 1F2UA 1KHHA 1E2EA 2A57A 2HX1A 3MMNA 5KYYB 4OLAA 3IO5A 1JF8A 1XTPA 3GV0A 1ZY2A 2H54A 3KOXA 4RD1A 4UE2A 5GOTA 3W34A 3B3AA 2JA2A 3NG1A 1CEYA 2AX3A 5H82A 3ADOA 2Q8PA 3BZUA 1X7YB 4NZZA 3W3AD 1KMNA 2OV2A 2C92A 4GX0A 3WGJA 1OB2A 2H1IA 1BH6A 1UH5A 4YRCA 4B3BA 7YASA 3DYVA 2JAOA 2YQZA 3E05A 1JR4A 1QKIA 3UIEA 2AYYA 3PI6A 4EJFA 4PLYA 5BY2A 1HKHA 1Y9AA 3K94A 3VJRA 1JAXA 4NBWA 1EFDN 1F4PA 1CD5A 1I4LD 3NBQA 3NBKA 1IVYA 1V1MB 2LTAA 4BGIA 4GBGA 2OAQ1 2QTVB 5TQ0A 3UFBA 5AI9A 4OJQA 4MKZA 3TW6A 2H2DA 2Z08A 3I8SA 4M3NA 1ATIA 5DP2A 4NBSA 1O3YA 2EXXA 4J3NA 5JG7A 3QBDA 3MUOA 2PA0A 4X54A 5E7JA 1W7AA 1KFJB 2GJ9A 4PR3A 5HS6A 2XUAA 1RIIA 1UC9A 3C1AA 4AT1A 1OH8A 2EBFX 2YZMA 3FPLA 4IUCS 1W36C 3SHFA 3FNFA 4JU9A 2Z5FA 3D6FA 1GG9A 2OSBA 4WOCA 4WZAA 3CVWA 3SP1A 5AT1A 5F64A 3Q8LA 1PZGA 5JVDA 1EVLA 3C8UA 2IYTA 2J5KA 5J4HA 4PSVA 4BLWA 4BUCA 4CL2A 1OFHA 3R6LA 4Q66C 1GXSB 2VQFB 4EM6A 1W36D 3R8FA 5I9LA 1V7PC 1Z6AA 1YUBA 3CT4A 3MCUA 4D0GA 5I9IA 1Z7GA 3HSSA 1HDCA 4ZKDA 4LOLA 4EDFA 4TV8F 2H17A 2QBYA 1U0RA 2PDAA 3BF7A 4K9DA 3UMCA 2H7XA 3DEZA 3ICVA 5DT9A 1NUTA 3NONA 5GJVC 2VRCD 3VNAA 5HR5A 1X3SA 5CMLA 2O7RA 3RKRA 4PRZA 7MDHA 3NDPA 3ZJ5A 1JN0A 2NW6A 4RDCA 2XBLA 2PO7A 3ABOB 1FNBA 2LWIA 4MYDA 3TN7A 4EJ6A 4KYTA 3GYBA 4YV1A 1LTHR 5AW7A 3QE0A 2HO4A 5DRTA 3V8VA 2H0AA 1LEHA 2NTEA 3GJ0A 3PVSA 5G53C 5DTMA 3WV4A 2FP3A 1EH5A 2G7ZA 1RWQA 2ZU0C 3R5SA 1EVYA 4I2VA 4ZEOA 2VWPA 3OC0A 4HNRA 2LNDA 4W8HA 1HZJA 4NTZA 4X97A 1JR2A 3SSNA 3NYIA 2PE5A 1DC5A 2VPPA 1YAJA 1CFJA 2HF8A 1TQ6A 4G4IA 1BX1A 2AR7A 4IS2A 3IDZA 4AL4A 3FMOB 4R3NA 3OQIA 1X1TA 2CZQA 4HVLA 1SHUX 4HEJA 5L6MB 3IAUA 4NFSA 2XQIA 3CLSC 2VHEA 3QLVC 4ZOEA 2NUAB 4YJKA 3I4LA 5I4CA 4FN5A 4L7VA 1VHTA 3WL8A 2UYHA 3FVQA 2XQFA 1UT5A 1YC5A 4YRJA 1C0KA 1JA1A 2CFOA 2IYYA 3WBKA 4Y6QA 4E46A 3EUFA 5IJWA 3CU5A 3WWOA 4W9MC 1Y7HA 1Z33A 2AG1A 4YYEA 2GRUA 3KE9A 1L7OA 1UDAA 3D6AA 4QXQA 3R1IA 1RAFA 3O94A 4W5WA 4AKEA 5LA6A 4AN1A 2QNRA 3QMWA 1DC6A 1PFWA 1NQVA 3HO8A 1SNYA 3AUJB 4Z9BA 1JTFA 1X86B 1P73A 2DCUA 3VDXA 4QOSA 1ZHHA 1UBMS 1CR6A 3JTEA 4YCSA 1U9IA 1VLLA 3T7RA 1A8IA 1C1XA 1CUBA 3EZ2A 5DHRA 3K9HA 2FHPA 1U7PA 1V9CA 1RWWA 1O95C 1R8XA 4K5QA 3HACA 4Z1MD 1HE2A 4URFA 2IOHA 2ODQA 2P9BA 2YN4A 4R31A 5JIBA 1AHPA 3U44A 1FZQA 4QUHA 4XPIA 5A3JA 3Q10A 3JV7A 4EGCB 4X1KA 1CW2B 2GD0A 2P9TA 1P44A 5FORA 1RNLA 1XYVA 5JSHA 4UM7A 3UANA 3WLAA 4E4YA 1RKXA 1XWFA 4F84A 4KPEC 3RI3A 2YWBA 5FUMA 4JC4A 1MEOA 2AB0A 3BGIA 4YHHB 3U4MA 4JASB 4M76B 4D4LA 3OOJA 3TD9A 2CF6A 2OV3A 1IOLA 1V3TA 1NVAA 2RI6A 5KVQA 1YQQA 3TEJA 5FOTA 4ESHA 1PL8A 3WIVA 1Q11A 4ZOLA 3R7LA 1I36A 4C4XA 3ESYA 1WKBA 4QUGA 3W5UA 4XIFA 4RJJA 4XUEA 3GFBA 1FFDA 3T4EA 5HP4A 1JSXA 4W6ZA 4AG5A 3N6XA 2C2XA 1Y6QA 1XQYA 3WQBA 4AECA 3BZWA 4I8XA 1G8YA 3SLKA 5F7JA 2A9FA 1I3OA 5A5VA 1OD6A 3IIMA 5EQTA 3KHKA 1JDJA 5HQ3B 3D8BA 3QLVA 4I5GA 4KO3S 3RC2A 3LM8A 1A7JA 2QRHA 4D46A 1QIMA 2FRXA 4X6YA 4S1WA 4Z0PA 2Q6IA 2XUZA 4MV8A 4UU8A 1AIPA 1PFGA 4LF6B 3HB9A 1P17A 3HVKA 2J0UA 4RJTA 3QOXA 4Q9NA 4HLNA 1ECCA 3BK1A 3VVCA 5CPFA 1NUPA 1ZM3A 3KQKA 2QLBA 1VCHA 4H17A 3C7KA 3RK4A 4KQKA 2ZSKA 3SDZA 4F85A 2B4QA 3HY3A 1Z38A 4QPNA 4UE6A 5LL6P 3I5XA 2QAJA 1F6BA 3V1NA 3WL6A 4PONA 3RV3A 4QYMA 1RI3A 1YR1A 1XKXA 4P4LA 4A36A 3WB0A 5J2TF 1JDUA 1UPCA 4RIIA 4BJ1A 2ANBA 3EIEA 4DZZA 1TYDE 4IHKA 1D6JA 1NUUA 4QREA 1RD4A 2X9VA 3WTCA 2EEZA 1RU3A 2C5FA 3QUCA 1E96A 3EIOA 4I9NA 4JLNA 1R0WA 1XA0A 4NLLA 3ZKWA 5IKXA 1Q7GA 2H29A 3QX7A 4X1OA 2IZOA 4IWXA 2VHVA 2ZAYA 2RGNA 3A7EA 3BKWA 1SQSA 2R66A 3NATA 4IHQA 4B44A 1HC7A 1VGVA 1HFEL 4IMJB 4M9CA 4BLSA 5B7GA 2HV8A 4GOJA 3JATB 1ECFA 1UFOA 3FZGA 2Z1DA 4FFBB 2BLLA 4I4NA 1YDFA 3LVBA 2YNMA 3GRYA 1LV7A 5CD9A 3TCNA 3BXHA 4CLRA 5KO2A 2VLIA 1V8OA 1EPUA 1JQLB 2DT5A 2CNWD 3RU2A 3D6TB 5MGNA 3FWYA 3PKJA 3ZJ4A 1G6KA 2XBUA 2EGGA 3KBBA 3L8CA 5EXDA 3VR5D 2JGRA 4AK9A 4UOZA 4D3DA 2CMFA 2MSKA 2H9YA 2QXUA 4OLHA 2Z95A 1AUPA 2G67A 3B1JA 5FR2A 4KR3A 3PICA 1UMBA 1Z8DA 2V5AA 1VIYA 4UCXA 4DMFA 3T9FA 2X0KA 1DRUA 2HF9A 4X5OA 4Y2RA 1GZ5A 1C9JA 1UFKA 1PQ4A 3G8AA 2QN3A 3FPSA 4IPTA 4WXEA 5FTMA 4DARA 1AA6A 4B2PA 1C1DB 1NRJB 1R7RA 3MJEA 4M1ZA 3VJLA 2ET6A 2QW0X 3DVSX 4A0GA 2GLTA 2H85A 3DDWA 4RGYA 4BZPA 1P4AA 1I7SB 1N34B 1L3CA 1QK3A 2WTEA 2BP7B 3HDHA 4YJDA 1MB2A 2C8JA 5CHEA 1HRKA 1FRFS 1FMLA 4HAWA 2QRVB 1OIXA 3BMOA 3PITA 3PGXA 1S2GA 2YOFA 4QYIB 1DARA 3P0EA 1UQUA 1TQDA 4W5TA 2BLNA 5DTIA 3F2IA 2VN8A 4UUBA 1X7YA 4LKRA 1CLEA 1F12A 4I4CA 3EVEA 2VCHA 1K3TA 2Q3FA 4TLCA 3VR6D 1ZHFA 1H85A 2PZMA 2XE6A 3OCCA 3OPNA 3U4QB 1PW5A 3ZDXB 5DNDA 4E5PA 3M3PA 5FI3A 1PL7A 1BQ3A 4JAVC 3D6HA 5KNCA 1I7NA 1P9LA 3SI7A 1FXSA 1YK0A 1YRAA 2PD4A 3VM6A 1YIOA 4FFNA 1ZCZA 5LD2B 4P0TA 3I37X 1TK3A 1UBFA 2R85A 4JLWA 4OSEA 4KPUA 2ENWA 4L4XA 5IAJA 3PDJA 2RGAA 5KYYA 5L7YA 5IEBA 3W8RA 2A3RA 3ZWPA 2B20A 2C83A 2J0EA 2QU8A 2W83A 3MGCA 3GEMA 4UXIA 1XLTC 1G64A 2IKSA 2A33A 4OP1A 4ZCTA 1TCCA 3HNPA 4EG6A 1FQJA 1U2TA 1VJ0A 1N77A 4M49A 4K6GA 2ARKA 2ST1A 4B33A 1USIA 5MFZA 2K7FA 2V7VA 1CIJA 1E2LA 1SOVA 1ZBDA 3BULA 3LXRA 2EP5A 1M2JA 1WB6A 1LCIA 3DFUA 4XOUA 3W8DA 4K81B 2PSJA 2P1ZA 3G2JA 4TLLB 5BR4A 3RIHA 2DFKB 4ROSA 3A1UA 4R7TA 2EKZA 1QV9A 3M9WA 3DOEA 4BC1A 4QNRA 4BN4A 1OX5A 2SKDA 3HCAA 3NVAA 3PWKA 3AUXA 1QIEA 1PT6A 3GARA 1RKQA 3PNPA 4QRHA 3RJMA 3ZY4A 4GKKB 3BHMA 3NDBB 4AJIA 1T8TA 4JBXA 3MQ4A 1NW9B 2WKRA 3ORYA 4DQXA 1DPGA 2ATEA 2EG5A 4BASA 5ADUS 3B5IA 1HT1E 4RTJA 1JEYB 3A3NA 4HD8A 2W6OA 1FK8A 2EFJA 4PO1A 3PCXA 1RXIA 5EXXA 1L7RA 3OSZA 4EW3A 1Q1BA 4F3CA 3UTDA 5AQ1A 1JH9A 4K8RB 2VDOB 1J5PA 4J2OA 4ZAZA 4P4TA 4LJRA 2GS9A 3IR6A 3SIRA 1ADYA 2QRGA 4JI3B 3ZGOA 4QTYA 2Z2XA 3S5UA 4Z4QA 1ESNA 5HOQA 3FI9A 1EQUA 3VVBA 3LOQA 1PR5A 5HYVA 2ZI3A 4NG4A 4BRUA 3WYDA 2HBZA 1ATZA 1R0KA 5COBA 3JR7A 2ORED 1MF7A 4G67A 5C1BA 1RPJA 2EBWA 4GPZA 5IKOA 2WWVD 3RRMA 3RHFA 4EFLA 5EJEA 4DT1A 1PX2A 1CY8A 5EGSA 3QKSA 1S8AA 3ROMA 3GQBA 5BSVA 5FUXA 1IRXA 4AN4A 3UATA 4C0AC 1W47A 2IF2A 3P9YA 3MAJA 2JAUA 4BV3A 4OTZA 5FA5A 1IXSB 3KNZA 4IDEA 2H1HA 4IIJF 3QVGB 1FU8A 5IKEA 1CQIB 1L1FA 3KUDA 2SHKA 1P33A 1LRKA 2A5DA 3LMKA 1VYUA 4ALLA 3DVQX 1C3LA 4ZI5A 4EGQA 2X0NA 4KQIA 4YP9A 1PFKA 2QX9A 4QYWA 3S2FA 3BSSA 4YONB 3QY0A 1JR3D 3DCIA 5I9MA 4D81A 5HKKA 2Q3LA 4TKUA 2PFKA 2JEYA 1H8EA 4OGGA 2DKNA 3UO8B 4MWEA 3Q7SA 1FUUA 4K6FA 2DHEA 4JX8A 3TQSA 4IDCA 2QD2A 2AC4A 4GGPA 4COOA 5CEEA 1BW9B 5F35A 1XTSA 3GAZA 1QHYA 4Q3OA 2XB4A 2GN9A 2UYQA 2BI7A 3HH8A 1FNCA 2J9XB 4IUYA 1ZM7A 2GAOA 3D2CA 1YZQA 4FZJA 4B75A 2X3YA 2GVZC 1EJ2A 1NNSA 2X22A 4MYRA 5AOCA 2A14A 3HFJA 4PAOA 1YL5A 2PJDA 2WDPA 2WTMA 3W90A 4AJLA 5ABPA 5JNRA 1N9ZA 3R41A 4LDRA 2O4CA 2C5GA 3DE7X 4YJ3B 3Q88A 4TSFD 1F8FA 2B7BA 5JSZA 1XELA 1MOQA 2GR9A 2QX4A 2VBCA 3KJQA 3LBHA 4N0MA 3BAFA 5LMCA 2O8NA 3T3MB 2FUG6 3WVNA 4MPRA 1UXOA 3IVRA 2XE7A 4ANFA 1ZINA 1LZLA 2FEWB 3QYAA 1B8VA 4NULA 4H4CA 4Q1BA 3RB8A 1XF9A 1U94A 3MM4A 3MJRA 3PPXA 3SLRA 3R6TA 1BQEA 2HSWA 2VPYA 1W4BA 3P2IA 1KYYA 1VIAA 3VAYA 2PFSA 3WQRA 3S70A 4BFUA 1SBZA 1VGQA 4FMPA 4DLPA 4DW8A 2IPAB 3NVKI 3AI2A 3FLBA 4U2BA 4BYGA 4CFZA 5AOBA 2IU3A 1ZGJA 5FLEX 1VKHA 2FMKA 2YRWA 5CA1A 2YJ4A 4OHOA 1C3XA 5ETJA 2GRJA 3ZHRA 2IV7A 1UOOA 4WXRA 2WWXA 5TS3A 2QV0A 1TCUA 1T13A 1GYRA 1K4KA 4IL5A 4RVUA 4EI8A 2NZJA 1NFFA 3WO1A 3T5AA 2IZ5A 4WKBA 4LWZA 3CT6A 1QPGA 1NYLA 2D5IA 1U4NA 1UZNA 1HL3A 4TSFA 3TW0A 1A77A 5I45A 3AVVA 3E8SA 2FFHA 4Q7LA 2E89A 5EG5A 4AI6A 2CNKA 2V74B 4UU0A 3WGGA 3F97A 4WQMA 5FPKA 4YY3B 1M76A 4Q3KA 2HA3A 1Y4AE 2VUSA 4XB2A 4G0YA 4K9PA 2QG4A 3RF6A 4EVQA 1GZUA 3GDWA 3I9KA 3W6PA 4Q3CA 3TFQA 4PZLA 2XNHA 2A7XA 3T5TA 1QV7A 2AA3A 3CNQS 4RE5A 3IUNA 1E5VA 4HX9A 4FPXA 4ZOCA 3KTAA 3O0DA 4WACA 2V6FA 4YQZA 4ARVA 3NDJA 4AYWA 2DETA 3KB1A 2GBIA 1P60A 1B76A 2EQ5A 2H1VA 2HQOA 2ISSD 3MJ4A 5KS2A 1UOEA 2B1GA 1QDEA 3ZU5A 4RZ3A 1YS1X 2WYWA 3KVRA 2EEPA 2HHLA 3AHHA 4YMUA 1TGYA 1T3LA 3EPKA 4IIDA 3KV1A 1QFZA 2RARA 4J1SA 3GOHA 3RIXA 3SVLA 3WWPA 1JKMA 1ZRMA 3L7MA 1AQUA 5KYTA 3B6ZA 4TYPA 4BV2A 1CS4C 5BUZA 3QXCA 1I24A 5ALLA 1G19A 3DOCA 1TF5A 4CMCA 1YQWA 1IZ8A 2NVUA 2V7QA 3G0DA 3GRUA 4CGYA 4CHTA 2FGJA 1T3SA 3WHLA 4NP6A 3VDQA 3WR5A 4FNGA 3H7IA 1IYZA 5EMJA 3VPAA 4RF4A 1PGJA 1ZD1A 2CDAA 1ODIA 4XJTA 3L8MA 2YWHA 4MV6A 4P08A 3U31A 3WLKX 5IM4A 3LQ2A 3H87A 2PS1A 3N07A 4L3WA 1NZJA 4RPLA 3KZCA 1IHPA 2HU5A 2DAPA 5EEHA 3U9LA 3O38A 2MINA 3BWEA 3V2GA 4FXPA 4Q4DA 3JRNA 5EPUA 1TU4A 4B34A 2D2FA 2VWHA 1SOUA 3OZAA 3I76A 4WUVA 1W5SA 5AXDA 2NP6A 4PHGA 1A9TA 1BE6A 1DIAA 1TA0A 2O7QA 3WB1A 1L7MA 3IALA 5KBYA 3BEOA 4U7DA 1JEOA 3WY9A 3MG9A 5CP8A 2RFLA 3RYFA 1UBCA 4AG6A 1K7CA 3H16A 4HNGA 1AN9A 1U6KA 4DM7A 4IP0A 1FS4A 3DE0X 2B1JA 4RVHA 4AQDA 4CE6A 1SA0A 1NNUA 3P20A 3R0JA 5E1DA 5IJXA 4N6NA 2Q9UA 1VPVA 4EFKA 4UNIA 3REQA 3SAJA 3OHSX 1PCXA 3ENKA 3JAWB 5K0LA 4AZSA 1E1RD 4Y18A 3UGQA 3KAKA 4QDZA 1A7KA 2JGKA 2ZIVB 1FFBA 3LT5A 1QK4A 1W49A 3V00A 1M6VA 2FB9A 4P4NA 3G88A 4XM1A 4PPYA 3S81A 2F8SA 5FJIA 2QNBA 2R60A 3PXDA 2WZQA 3HN6A 1TM3E 5H9VA 1KBQA 3BTSA 2AHOA 4TXJA 1NXVA 2XVAA 1FFSA 4OK6A 1CULC 3UH1A 4WA8A 1STOA 2BGNA 2WPDA 2B0CA 4OSPA 3TZHA 2YV1A 3KQOA 3TM5A 5IDVA 1Z74A 4O29A 1QDLB 3C8DA 4B4OA 4EEZA 2ZYWX 1QANA 2FP4B 3HP1A 2YIMA 3OPYB 4OFZA 1G4HA 1TVCA 5IZ4A 4HJRA 3LD9A 2H4WA 4FR5A 4UUMA 2AWOA 1R6DA 1KE1A 3HVRA 3TOSA 3AM3A 3CUKA 4NBKA 2CFTA 3B85A 5JCXA 2CHGA 3VOAA 2M6RA 2FN7A 4OMUA 3P9KA 3DOOA 3QMVA 2O3RA 1OMOA 3RLIA 3G2HA 2X5JO 3GEIA 3BWCA 4NRDA 4TQUS 3BILA 4F7DA 4NWIA 3TUZC 4M8IA 3BDAA 3HG7A 3V4SA 3GLFB 4UBNA 2E48A 2PRJA 1P2SA 4BZXA 3MXOA 2IC5A 4PG5A 2G63A 1JIVA 2G28A 3MIIA 5BR7A 2D1TA 2XMGA 4BQIA 2G80A 2PKRA 2KLHA 2ZS7A 4KMSA 4EB0A 4EUKA 3CVXA 5KQRA 5LPNA 3B89A 5DRYA 3UB3A 5AKIA 1D07A 2WVGA 4Q1CA 2NG1A 4HBGA 4XR9A 5KIAA 3O4JA 3BJMA 1KZ4A 3WZMA 3CM0A 1C30A 6REQB 2N3ZA 2QLLA 4PIPA 3V5NA 3VR4A 4CV3A 4MHOA 1CF4A 4YJFA 4UBIA 4FCVA 3U3ZA 3GLGE 1XGKA 2ZSHA 3WOVA 2AZXA 3N2GB 1WUJS 5F73A 4YREA 1ZJYA 3CRNA 1ZGBA 3HRHA 3U7JA 1UKCA 2NOAA 2AFHE 2W6PA 3T5CA 3O8OB 4B7XA 3ER9A 3FRJA 1XK7A 4Z2AA 3NHMA 4DDHA 5T4EA 1A27A 1VIVA 4S1TA 1WB5A 2CUTA 2IY8A 3MJVA 4XWAA 3SC2A 5BRAA 1J2YA 3TG2A 4KLCA 2PVCA 2VDQB 4NOMA 3ZWYA 3PRJA 3LRTA 2F90A 4AP5A 4HUTA 3CWCA 3O1IC 1KO4A 1T1EA 1VBKA 2Q5EA 3NBZC 4H7JA 2Q5IA 4YNBA 4IWNA 4Q4LA 3THWB 4L9WA 2PZGA 3X44A 4Y2TA 1SKYB 2HUNA 1ZNZA 3EEFA 1WUIS 1SIUA 4OB8A 2BEVA 3SKVA 3UHFA 2PD3A 3NWEA 2FSUA 3N76A 4FZ3A 2RHWA 2WYOA 1E3SA 1GPDG 3BMXA 4IKPA 3K0KA 3Q3EA 2RGGA 3T06B 4O63O 3JVUA 1XJCA 4FBGA 2B8WA 5ALQA 2EZ8A 3DMRA 2WP0A 2FUCA 2XE4A 1VHJA 3ENZA 5HF9A 3TLAA 4D82A 2ZWAA 4EHBA 4LHZA 3GBSA 4G56A 1XTJA 2QZZA 3BIFA 3BHJA 1HT3A 5FUWA 1Z37A 4DS3A 2OBMA 3HGQA 4HWOA 4D0SA 5K3OA 2NO9A 3BWMA 4F6RA 2JKVA 2ZXEA 3NCHA 3D6NB 2V96A 4CT4B 4HO1X 1WBDA 3KT0A 4NECA 5AKLA 2BZ1A 5JWHA 1M1YA 4BS9A 1KYIA 4M9QA 1ZK3A 3A27A 3AWIA 3ET5A 3FYCA 2TMGA 2AMFA 1RWKA 1XWIA 3D4IA 2C3PA 4IDOA 4JYZA 4ZCMA 3HKEB 1OREA 3ZDCA 1VJDA 1T2UA 3OLYA 3ICCA 1Q7RA 1JSCA 3A58B 2BDUA 1DX6A 2ZRMA 3QIAA 4IV0A 4OHFA 5DE3A 1A8UA 4JJEA 1VKNA 1XJ0A 2NO6A 1E9VA 2XLBA 3FVVA 3IOCA 4JYCA 5T6MA 5A9TA 1D1SA 1DO2A 2JGNA 2V8OA 1EWRA 1NXOA 2QROA 4B3TB 1PL6A 1NY5A 1P7YA 3KCQA 4UPDA 3WRYA 1QE3A 4S1VA 4C2TA 2WB4A 2VJLA 3U9SA 2DUNA 1EFPA 3C15C 5E1BA 5C0OE 4DTCA 4CV2A 4FFDA 2FMXA 2Q2WA 1H4SA 3LUPA 3OCXA 2IHTA 3C8HA 4MWTA 2GNAA 2I7CA 5AW3A 2BTQB 3UUFA 3C3DA 2QYSA 1GQOA 5KVVA 4LC0A 3VBCA 2XWBF 1Z4IA 4EEXA 1DTWB 5KJEA 5AI4A 2FU5C 4GX5A 2BCJQ 2IELA 2VH5R 3KYDB 3P2KA 4MWBA 3U7EB 2P69A 3BJZA 3TK1A 3PNSA 5K6RA 2R6ZA 4JKIA 1XD2A 1Y8QA 2BMFA 1Z47A 2OV8A 3AL2A 1PGPA 1BCSA 1FS5A 4IJUA 1DXQA 3T1YB 4AXXA 4AB1A 1NBMA 2QZJA 4HGPA 4ONEA 1NUAA 3O91A 1CIPA 1K63A 2WUGA 2GEJA 4RMJA 3TD2A 2AI1A 3G0HA 1N4DA 1OU0A 3HU1A 3QU4A 5EZ6B 2XCTB 4RESA 1FMFA 1IUOA 2BIFA 2GSDA 3UM9A 2WB2A 1CJBA 4EY8A 3L1IA 1AV7A 1XDBA 2NQTA 4UTOA 3BPSA 4JITA 5ITZB 3MN1A 2VJYA 2I8CA 2OEPA 1UK8A 3FYTA 3ZV4A 4B4WA 5JEEA 1LK7A 5JQGF 4TVKA 1IPHA 1K1EA 3I9V6 4FDVA 2WJYA 2VYNA 3MUEA 4L8WB 3PD0A 4A8JB 2AOWA 1S6YA 3NBXX 5BMOA 3ITDA 3WLJA 1BXRA 3UJ7A 2MSLA 3JZIA 3HDVA 3NOVA 5DB4A 1TZMA 4Y1GA 2ETVA 3L5OA 4IJWA 2PEZA 2PUTA 2EFCB 3O4RA 4YJ2B 2P3OA 1GSHA 1K6XA 3A3YA 4U2FA 3WJ1A 4GI2A 4X65B 1S4QA 4YGXB 4YA6A 4MH0R 1H2ZA 2ATVA 4O1IA 4V0KA 4JOCA 5F33A 3VH2A 4F04A 1BS2A 1ODTC 3L8DA 3TAXA 5G0SA 3ND5A 2IFTA 4O2AA 3AFIA 3SQOA 3RYCB 1H94A 5DEOA 4GL4A 4PXSA 2GQ0A 1E6WA 4I4LA 2QT0A 2X0IA 3LGAA 3OHMA 5ALOA 3CZAA 3WA6A 5J43A 4R0VA 4XASA 2WQ6A 1E3DA 1A4XA 1Z2DA 2WV9A 3PHBE 4XLZA 5FWAA 4PCAA 3UWKA 1W88B 3RSQA 3MWDA 4RIGA 2IVFA 1OC2A 2WINI 5HG0A 1YZ3A 1DCKA 4FDAA 1O6FA 3E2PA 3NFYA 2ZJ0A 2NSYA 2ONCA 4FBMA 3WLFA 4O4JA 5M29A 3U1VA 4YUZA 1EFVB 1ETHA 4JJGA 4G5OA 2PH3A 2FNAA 1VG8A 1CZHA 4HQLA 4RJIA 2BEWA 2PX2A 1NF3A 5JALA 1JPJA 2G71A 1P5JA 1A1SA 1TZBA 4O4HB 2FR8C 3INNA 1W0JD 1E1DA 1XZHA 2JI6A 1L4FA 3PU6A 1KI7A 1XCJA 4RPIA 4E5SA 2PAAA 3RLFA 5A7FA 4U7FA 3PTAA 4A15A 5AK3A 3AB3A 1U6IA 2H4YA 1GZ7A 3A9CA 2QG6A 2AFIB 1ZGCA 4WT7A 3S1AB 5GP1A 5GIOE 2OZKA 4Z6KA 4MUAA 4MJ7A 4PLFA 4PCLA 3TQTA 1TLFA 5J4YA 4KXQA 2VT6A 7AT1A 4B81A 3RGWS 4KQ2A 5L3SA 4QJ3A 3PZRA 1C7FA 1QBGA 3L6DA 1CR0A 3IURA 3LCUA 1TI7A 4XX0B 1SOMA 4D4KA 3ETLA 3QNMA 4ZO9A 4NVRA 1RYFA 3DEYX 1G6Q1 4PLGA 1IXZA 4XGKA 1M34E 4AMYA 1QOQB 4KTTE 3P2MA 3DAOA 2XVMA 3BA6A 2X6RA 1GGEA 2CLCX 1KFKB 3B20A 3GFFA 2LR0A 2I3DA 4I6JA 3CC8A 2WIBA 2JHCA 3GHYA 1XHEA 2IUTA 1U0NA 5EJIA 1G4UR 5EQFA 5AVKA 3EJWA 4GUAA 3TIVA 2OFFA 4E33A 4QOHA 5TQ0B 2O14A 2J3JA 6ABPA 1RHUA 2EWVA 2JLRA 3B6MA 3Q8WA 3O95A 3RH0A 2QYHA 4TS3A 3ZIAA 4WESA 1LDBA 2EHDA 3PQEA 4W1RA 2JJ2D 3WWCA 1F4LA 4EATA 1OKKA 1HG1A 3LQRA 3U7RA 2VQ3A 3AJDA 5JROA 1T4GA 1T6NA 1MP0A 1RWOA 4MB6A 3ZV5A 2I6SA 4BX0A 3Q9LA 4EQZA 3K9FC 5FOXA 2ZFUA 4ZU1X 4KV7A 4N40A 1YI0A 4B17A 9MHTA 1U04A 2HEGA 2O57A 1YA4A 1EESA 2OZLB 1DQNA 3TIXB 1IDOA 2FUNB 1GAJA 4B35A 1WABA 5H7XA 3N2GA 3AU9A 1J8FA 1J24A 4WY2A 1K7YA 1NW8A 1N2BA 3NHSA 1T2NA 3S40A 4FDLA 5F9HA 1DGQA 3ANLA 2OHHA 4ASUD 5K01A 2PRSA 4R9NA 1EVQA 1FSFA 1CZRA 2J85A 5FB3A 1SCKA 4JLSA 4B9EA 4KWTA 4FFOA 4EW1A 1H0SA 1XAIA 1AUQA 3R7DA 3WGNA 5EHZA 5LZ7A 1J7JA 4QU0A 4N4AA 4ND2A 4ZOBA 4ZOLB 5IBRA 4NS1A 4GBMA 5H68A 3F5MA 5CG2A 4GKJB 2JJ2A 3D3WA 1CLUA 3FN4A 1OVMA 3IMEA 4WJKB 3U26A 3SXPA 2NN3C 4WX2B 2CWDA 2P0EA 2AXQA 2C97A 1DMSA 2CLOB 3C45A 2W42A 3H1GA 4MA5A 1VJ5A 3AUFA 1E9CA 2JI9A 2WHEA 1Z39A 2NV6A 3LZCA 1ETUA 5T6BA 4A7PA 1JJVA 1OJLA 5FNZA 3FI0A 3HN7A 5JFGA 3FOEC 1OLUA 1K5PA 2CHQA 1J8YF 2OUKA 2AN9A 1Y7IA 5DCUA 1EKXA 3A05A 3HYSA 2UYGA 1O54A 3A9UA 3IBCA 4O4IA 2ZYDA 2BRUA 3DMNA 3I05A 5B4UA 4K1XA 4Z4EA 2ZITA 4QRIA 4QRDA 1KETA 4KMRA 4L51A 4EG8A 2EX4A 1ID8A 3KJXA 3KOZA 4ZYXA 5I6DA 4ND4A 5AI0A 4A5SA 2YVKA 2JH8A 3G5AA 1T43A 1R0YA 4RZHA 1A8QA 1HLFA 2OCLA 2H2HA 3VPXA 1P1BA 1V3QE 3IQZA 2Q5JA 4YMGA 5CJ2A 2J9FA 4XD7A 4L15A 1Q74A 1FDSA 1ZR2A 4L9AA 4PRYA 1ZN7A 4D9EA 4AMUA 5LJLA 3Q12A 3F5DA 3EIFA 4DYDA 4H3VA 5EI5A 5BSKA 4XM2A 1UIRA 2HNAA 4GMHA 1T35A 4PX3A 3VX3A 1RZRA 2D0IA 1LBHA 4L3VA 2X2PA 4KE6A 1OI2A 3WQSB 4KR2A 5BVGB 2TSYB 3N0TA 3C1TA 1X7GA 4YLGA 3RYIA 1MT3A 2ZRFA 3ONNA 2MYUA 6GPBA 1SZCA 3E61A 4W7IA 4ARSA 2VP2A 1C4KA 1GT91 4Z7NB 5KNCD 1I6KA 4ZARA 1H8HA 3PC8A 2D4AA 3I32A 3PGLA 4UULA 4WZZA 5ULLA 7REQA 2H4FA 4Q9KA 1T4MA 5LXTB 3FTCA 3LDFA 4OQ4A 2FXVA 1OXXK 2AYZA 4X3OA 2HQRA 2P35A 1N92A 1ADGA 721PA 2XRZA 3GLIA 4MGYR 1K68A 5JMOA 4Q1AA 4R5MA 3W2EA 3GNQA 1ULZA 1KY5A 2VF2A 1XDGA 3PHLA 4UD2A 1N6NA 2PPVA 2VNJA 4ES6A 1KKUA 5CVJA 4YRNA 4V1CB 3ANSA 3GPBA 1PJ2A 2ONKA 3SHVA 4BTLA 1T5SA 4G0ZA 4R69A 5HDQA 2I1LA 5IHXA 1O4VA 1M34A 4QPPA 2C57A 2GM4A 3HVIA 1MN6A 1LLFA 3BRQA 4FDTA 1DCMA 4JNCA 4EP1A 3BL6A 4MMXB 5CLQA 4ARIA 5IJZA 4DLBA 1OH6A 4LC1A 1RXCA 3OMLA 1EZZA 4P4GA 5JXIA 1Z2AA 2QJWA 1CY2A 3L6OO 2ZJYA 3CLSD 4CQLB 1YU9A 5CLJA 3SKXA 3LOPA 3HB0A 1LD3A 1ZM4A 3LT0A 3UK6A 3ZWOA 3OECA 2OE2A 3FMPB 2X0FA 2ON6A 3M83A 3LHIA 4KXNA 4EI9A 1FP7A 1GEEA 3H9JA 2OAEA 4UUPA 1U8AA 1ZUWA 1KH3A 1U99A 2CF5A 2RIPA 2PEYA 2GZDA 3IVAA 4R1PA 3B52X 3FFWA 3HUFA 2QIPA 5HRAA 3EFOB 1DFHA 4R2IA 4JT8A 3WICA 1J21A 4JLPA 3R74A 5KDOA 2RHCA 2XQGA 1E0DA 2GERA 3O1HB 2UZ3A 3HMKA 1JI3A 4CEJA 4KYIB 4TMXA 1PR3A 3NOQA 3OQBA 2J32A 1P4SA 4Q01A 1NKSA 2YVLA 2QYTA 4LECA 4BB5A 3TINA 2ZBUA 5GONB 1ZHOA 5FIUA 4G2TA 3OKFA 3F46A 2O8EB 1XL1A 3LY8A 4O0LA 5BPHA 4FC6A 3DF7A 2R2AA 2A86A 2GETA 1ISSA 4JLKA 4QX6A 4D92A 4FWTA 2VKQA 3OUTA 5KSZA 2QMYA 2YS7A 3EOZA 4CM9D 1LPOA 1QHFA 2OB1A 2R5NA 1YE5A 1XHFA 2NTJA 4IH9A 5D7NA 3LC7O 3DQPA 2C4UA 2QD4A 5KNBA 1MJHA 1S3SA 4QUBA 1JA9A 4CR7A 2WF7A 3F7TA 3T8YA 2OO5C 2FW0A 1J22A 4R1OA 5LIRA 1DZ3A 2F8TA 1UIMA 2BGRA 3I0ZA 1BWSA 2Y0CA 4RH1A 3WS7A 3WLRA 4C89A 1KK1A 1ND6A 3G9ZA 4YC7A 4AZVA 5JY1A 2C7OA 1VHWA 2PT9A 1XZGA 1XKLA 3FD8A 3FPEA 1E3MA 1F0NA 1H23A 2EZ4A 2QDXA 1XYGA 4Q82A 1QIFA 2GOYA 3ZJTA 4IH4A 2XDQA 1T0PA 3RAEC 4GE3A 4P3XA 1QH1A 2XWSA 3AJAA 1OWPA 4IH1A 4X71A 4YRLA 5HJEA 3DMTA 1USGA 3F9CA 3FNGA 3HDGA 2C99A 2XXJA 1A95A 2PUJA 1UMBB 4JLDA 3WHKA 2BFBA 4NV1A 5JJKA 4Q37A 1M7HA 1JQAA 2VPZA 2CYAA 1Q6YA 1UBTS 1WDLA 1LUAA 3AZPA 2YXPX 2WQ7A 3CLKA 3K9NA 4PC7A 1PDWA 4DDVA 1NV8A 2BMVA 3A2MA 4G1CA 2JIZA 4F8JA 2DWCA 2VJKA 5EPEA 4DVGA 1YS6A 1P2DA 4Y2PA 3DE2X 3R2JA 3VDRA 3PNVA 1ZD9A 1NX9A 1OTHA 3U1BA 1S7CA 3C3EA 4BATA 1RVV1 1GN9A 1HZZC 1L4UA 4QDOA 2V7QD 1YBFA 2IEDA 4B3HA 5KQGA 3K0AA 5B4VA 5K3AA 5BW5A 3SYLA 2I6XA 3NB0A 4H15A 5B5SA 3PR2B 1NFQA 4JL8A 3GH3A 2YBEA 4L0DA 3UJBA 4BB0A 2VYQA 4ZEWA 4ARZB 4GYKA 1U0FA 2IX9A 2REXB 4G01B 4MI1A 1IHUA 1J90A 3GGSA 3LT1A 2HAEA 1MQ8B 1TMKA 1UMKA 3ZLBA 4YH1A 2QPAA 1N6IA 4HDAA 1KR5A 3DT9A 1XQ1A 3LC1O 4LZWA 3SX0A 2NAPA 2O59A 1IL0A 3QP9A 1E3IA 1ORRA 3UPDA 4XVQA 1E69A 3FBTA 1M6WA 1NATA 3KUCA 4J1TA 5JU6A 5KJ6A 3C3AA 3E5HA 1QIKA 1PN3A 4C30A 4XVRA 3ZIDA 3KHUA 1U2SA 2DWQA 4YJ2F 2IRWA 4KPFC 4YYZA 4X1YA 3CZ4A 3A6LA 1E7MA 4ZT2A 3L02A 4TLBA 5AVQA 1TKRA 1VTKA 2G4VA 4ZT7A 4FB5A 1ZD2P 5AI5A 3VGJA 3VU3A 2EP8A 2FJPA 1H5QA 4HDRB 1GT6A 4XTRA 4XEUA 3AHIA 2GDJA 3SJAA 3TOCA 4E08A 2Z09A 1WDTA 4KGVA 1RM5A 2W8ZA 3C7TA 4ARZA 2A67A 2JVJA 4XYBA 3DFMA 2DBQA 4XCQA 1RBYA 3H0KA 3QEAZ 2HQ1A 2PUBA 4EHKA 4RM2A 2IHUA 1DQYA 2FVXA 3GLKA 4LGYA 1ESEA 1CF9A 2Q49A 4XWKA 2WHQA 4PS1A 2XKJE 4G8CA 5TGTA 5IANA 3HCOA 4ZCIA 1V6SA 5CM8B 1EXWA 3GY0A 3WKDA 1LDEA 5ICSA 1QMPA 1X74A 3H7AA 3KKOA 1SEVA 2IL1A 4IZ6A 2J59A 4XWTA 5SYMA 1B1CA 4AXBA 4D2IA 4LMAA 4HDNA 2QJFA 1ZQ9A 3QVSA 4H6WA 5G1OA 4C0QC 2GYWA 1EVIA 3E9NA 5TSDA 1HUQA 1HO3A 1U8YA 2BKUA 1UMCA 1TZKA 2EKPA 1L5QA 4ZVNA 1ZSVA 3E35A 1ZNQO 1F8YA 4XQ0A 3JQCA 4IR7A 3KX2A 3L1KA 1MPXA 2HGZA 2YKGA 2V4UA 4OHVA 1U80A 1JHPA 1MDFA 4MVJM 5C31A 1ORDA 2PTHA 2FF7A 3ZTTA 5K8TA 3WYGA 2W37A 3RSOA 3QBVA 4IIJA 2WZCA 3RC1A 1NU6A 2HDOA 3DVRX 4UUOA 4Y2HA 3HCBA 3FKJA 7GPBA 2PKQO 3OFVA 4QXOA 1UM9A 3L84A 4JCOA 5FWXA 3G82C 2DWPA 1QYDA 4DKXA 5CFOA 1Q0UA 1Q0HA 3GRZA 4WK6A 1L5KA 4CIDA 3ADDA 1G60A 3RFUA 1VIDA 3D3JA 3NTRA 2PYDA 1NQUA 1X1CA 2GHTA 4MI6A 4F4FA 1RWPA 2BGGA 3AHDA 2O23A 1DX9A 3F3MA 4PLVA 2IKQA 1HYGA 1FU4A 1M2OB 3LPNA 3U4DA 3VXKA 4BFTA 4POAA 3ECSA 4B2LA 1NMZA 4R9SA 2COEA 5JAMA 3VOSA 5FL3A 5H4HA 1NZFA 1A9XA 2WU8A 4LPKA 1TQ8A 2WU1A 1J2JA 3IBYA 4GLFA 2X23A 4TUYA 2HA6A 2E4WA 4JUCA 4PYJA 1J20A 1UQTA 1FP4B 3DZGA 4BX2A 4KFSA 5BT8A 4AICA 1BCSB 1A69A 2GN4A 3RHTA 1YACA 1TAGA 3T0IA 3R5JA 5EJ4A 2ZXUA 3L4KA 1N0WA 5BV8A 2PS3A 3QUSA 4HN2A 1DBSA 3HHPA 2BFEA 3HJBA 4FLEA 4RF5A 4YASA 4RZQA 4EKIA 4B3MB 1QKJA 2PX3A 3QFRA 4N0EA 4LI0A 2Q2NA 3HLTA 2VFAA 2L19A 1J39A 3DV0B 3W3AA 1GFSA 3KSDO 3RVRA 2QRZA 2SCUB 1DNPA 4LVNA 2D0OB 3OM1A 4JBNA 1KP3A 2BP7A 2WLTA 2JCSA 4IHJA 2O06A 4LRQA 3G5MA 3PA8A 3QE4A 1EIWA 2G9RA 1Y3HA 1YZNA 4BNVA 3U6BA 4JYPA 2BBOA 1Z0AA 3O1JC 4TLDA 3SYRA 2GK4A 3LWZA 2KS6A 5JVDB 2JH9A 4S04A 2ID7A 1JHAA 2A1TS 2BGWA 4MVJD 1EWQA 1CRWG 4UHCA 2Z9BA 5IMSA 3SY8A 3U3DA 3R40A 4IKEA 1NVVR 1YZUA 4PW0A 4GPBA 1Y5NA 2NU6A 1EK2A 1GPLA 2H2GA 1NA5A 3CF2A 3B12A 4KFTA 5ELXA 2GBPA 3LFUA 4FLFA 4NYJR 4YCNA 4CEIB 4B3IA 1BDMA 2G4CA 3JQDA 2XY4A 3HYTA 1JFVA 2AOTB 2RK4A 2ZPTX 3DQZA 3JQ8B 5FULA 4WL0A 3T3PB 3VR5H 3KB8A 3SFVA 4GLOA 2GASA 4DHEA 3GGGA 3BH7A 5MN6A 3D4PA 2C5EA 1M2VA 3FKQA 4II3A 5IBQA 2R1TB 4EELA 4UBKA 3F71A 2V9CA 1N1GA 3NGXA 1C7IA 1W88A 3QPAA 4J0HA 4WLEA 3UC9A 1VSUA 2J5RA 1MABB 2SECE 3L1VA 2RI0A 4QQ8A 1KMQA 3WIOA 1R12A 5F1YA 4FCCA 3S8MA 3WJ2A 5EMLA 2UUBB 4R1UA 3FB4A 2QVZX 1G5PA 1BXGB 2ZBQA 1GRRA 2MTBA 3QPVA 2C4HA 4D8WA 5A5EA 2AFIE 3AEKB 5H8WA 2HHJA 2NYAA 3TZKA 1PVDA 2F8MA 1IAVA 4IQ0A 2LE0A 4U2DA 4CQLA 4EA7A 1WXWA 2NSDA 2Y6VA 5AHWA 2A5FA 3W5HA 4DDUA 3LP6A 4XAQA 2VJDA 2Q27A 1H66A 1P5RA 2AVDA 3M1YA 4JB8A 4XYMA 1QYWA 3HZRA 2C8VA 3PC4A 4ZQEA 4BV8A 4DR3B 2GN1A 2R8XA 3IQFA 1R8YA 1PHPA 4MS3B 5KOJB 2J3KA 3E5MA 3KOUA 2QXYA 3KZVA 4X6XA 4EK9A 2O2SA 2YQ5A 3COVA 5KKCA 3AT1A 1A50B 3KTOA 1P7PA 3COYA 2B1QA 2BFOA 3NTLA 4WKOA 1NBWB 3F3SA 4YMTA 621PA 4DCVA 4GOLD 1GKLA 3I1YA 4KPGA 4LJKA 4TSKA 1NBAA 3EVTA 2LZ0A 4HDOB 5CXQA 5TT0A 1EB9A 4C88A 4J2HA 1WHSB 4ENWA 4Y1RB 2X41A 1LFDB 1CVIA 4CVNA 1JALA 3RU7A 3QUBA 2ZT8A 2R8BA 4C6TB 2Z2YA 3JQBA 2E5WA 3FDXA 1OXKB 2OOKA 2QJTA 3GQVA 1HEUA 2W5UA 4OFWA 3VOBA 3TGPA 4XLLA 2ESRA 2J9GA 1ULBA 3Q7EA 1RZRD 2XF2A 1D1PA 1NQAO 3B1VA 3BX1A 1KNQA 3HA7A 4HSGA 3PNLA 4J7UA 1I2BA 4FHCA 1MVLA 2Q7DA 1OXBB 3OPVA 4OUKX 4N5IX 1DCTA 3B1KA 3IMCA 3GCWA 5BYJA 3QU9A 3GFGA 3SS7X 1K2WA 4EECA 3B2QA 4QNMA 4MKRA 1UEIA 1K8RA 1M8KA 3AKEA 2NUPA 4H0FA 5D00A 4F3TA 4NSNA 4DJTA 1QLHA 1PFUA 1YIDA 3HKCA 3RYHA 1BDIA 4BJHB 2QYOA 3SFZA 2FQWA 1Y3FE 5JVDF 5CGZA 2XZLA 4C9BA 2W00A 3WFJA 3WRYC 1AKRA 2GYVA 4TUYB 3E9DA 2PMBA 3L6UA 1T3HA 2A9QA 5MN5A 2JARA 4F1KA 4F2PA 4NOJA 1JEJA 4ZRNA 1Y8RB 3CNHA 4WDQA 4ZT4A 4RVOA 3TVDA 5HRCA 5IJ9A 2F4VB 5KNBH 3PR1A 3UBTA 3QENA 3ZK7A 3OQHA 3FZEA 5JASA 3BCHA 2WHPB 5C32A 3RUHA 4RY8A 2YR0A 2EBHX 3BD8A 4BC0A 1P1IA 4P3KA 3ZGVA 4JI0B 3M6WA 4C0LA 3QLJA 4MX8A 2P68A 2XMDA 3I5UA 3OQIB 4K7JA 1GLNA 2YRXA 3AVOA 3EXEB 3HQ4O 2RHBA 4LJYA 4RL6A 5J63A 1DAFA 2AXNA 3UK0A 4BQRA 4Z7QB 4QODA 1VG9B 4L8LA 1S8NA 2XMSA 4HNTA 5JH7F 3IHWA 3L9XA 5KAMA 2XUKA 1JDSA 2VZEA 1QVZA 1DFGA 1ANKA 3KM0A 1U4SA 1P0CA 3BIJA 3NTXA 3ZCTA 2B2XA 5K45A 1P3JA 1T9DA 3GMTA 4RV5A 4LQCA 1XROA 1BE8A 4NYMR 3L46A 4ZHSA 1QHEA 1XU9A 3VH3A 3STVA 3OEEA 1NG9A 2VO1A 3T3GA 2DF8A 2W6ZA 2GYYA 1JAIA 1KQOA 5CJJA 5FI5A 3T7EA 1V8ZA 1EUZA 3EAGA 1QAMA 1Q1ZA 3GVHA 2A9VA 4RLSA 1CUZA 3TKAA 4YV2A 4NXMB 1G8PA 1F06A 4IXWA 1IOVA 2GFHA 1AS0A 4AWAA 4BBAA 1ZJ5A 4KVZA 3AUTA 4MS4A 4QDTA 5CDFA 1V4BA 2OK8A 4KGXA 4WE3A 1V5GA 2RHHA 5REQB 3NM4A 1CUDA 2C3UA 1NSYA 3AF2A 3GGPA 3QOFA 4C01A 4RV4A 4YDQA 4MR9A 3IV6A 4W7SA 5DCWA 1NRIA 1JEQA 2MMCA 3GFQA 3FZNA 3WKEA 3OTWA 3OH8A 3B1FA 1GYQA 3P2OA 4ZZ1A 4YO8A 3SF0A 1TRHA 5J2UF 2TMDA 1K7XB 8LDHA 3L82B 2AIRA 1QJCA 2J3EA 3OURA 5LU8A 3OQNA 3FMGA 3Q8XB 5HNKA 5CDYA 1XZFA 1ST3A 4MMZB 3OTQA 3UOGA 2B94A 3B1XA 3G5LA 2HADA 1JL3A 1E79D 4QTUB 4E5DA 3GT3A 2BFCB 3FIUA 5ICFA 2GCEA 3RIMA 4A91A 2HDHA 1GZ4A 1QNFA 1YZYA 1E5DA 3EXHC 2I80A 2Y27A 4MJXA 1UDCA 4HDQB 4REQB 4M21A 5HCNA 1O77A 4P0QB 1GPBA 3BMNB 1NVBA 5AHRA 1J6UA 2IPMA 2X15A 2PXXA 1EXMA 1H4TA 1M54A 1R0RE 2CYBA 3EZLA 1ZM2A 3N8KA 4WZBE 4BEWA 5HIKA 3COZA 4OF4A 4WECA 3LJKA 3VHLB 4A6PA 4AJEA 2NTVA 2AEMA 3GJRA 1CQWA 1QDUA 4KKXB 1O9GA 1SKMA 4PC3A 3HCCA 1SHJA 3OFSA 1RYYA 1WCV1 1XRPA 1N8SA 3DZIA 1PD0A 1Q44A 3E58A 2PWZA 5E6RA 5GQSA 3WL7A 4CF5A 5H16A 3ZNPA 5DN6D 1GJRA 2ZIZA 5HA5A 4QC2A 3OX2A 4BBZA 5DOVA 3WGMA 3JWEA 1ZOPA 1X3LA 3FETA 5BYKA 3MMPA 5CEFA 3O3NB 1P19A 5KVCA 1NNI1 3C97A 4MW7A 1ZITA 5I7WA 1WRBA 4DUYB 1JG1A 2E5FA 2QW1A 3DM9B 1YVEI 2BBWA 3NHFA 2XUDA 1SD5A 1Z4MA 1NR7A 1WX1A 2OTCA 1C0IA 3AERB 1CQPA 5AKJA 3BMOB 2P27A 5CU7A 1IOZA 3PC8C 2ZSIA 1Q1QA 2AUMA 2BV3A 3BMQA 4BX9A 2FMTA 3ESCA 2P90A 5AOAA 1DX4A 1CY0A 4ABYA 4YS6A 4HWGA 3AKYA 4YFYA 4DR4B 4YDSA 3EQZA 4FD2A 4WN9A 1WJGA 3VZQA 1XDUA 2PFGA 2RKBA 2A8YA 4NF2A 4D8TA 3N2YA 4ZZ2A 5KYGA 3BRWA 4INJA 4BNXA 1NVVQ 2Q2OA 3D3QA 5EXSA 3VVLA 4HPJB 1FOEB 3HRIA 3K0FA 3UF0A 3N2EA 1CPYA 1J8VA 4UZEA 4F9EA 4C0XA 3EXG1 2ECQA 3KK0A 9ABPA 2UV8A 3LY7A 3RUPA 4EO7A 2AJLI 3OO0A 4WZ6A 4BO5A 3WB2A 1Q92A 2JC3A 1GUAA 4FYPA 1H6AA 4PYNA 4IDBA 4KCGA 1YKGA 1P4RA 3EVZA 3GUHA 5TF0A 3OJOA 1JQ5A 3B78A 4KYVA 3M4XA 3QITA 1GZ6A 4ABTA 2H5LA 2PMKA 2QHXA 1F1JA 1Y1KE 2UUPA 5EKSA 2IU0A 1X8JA 3JD4A 1N36B 3QU2A 3IKTA 3Q72A 4RANA 1D1TA 2XUQA 3OEYA 3QU5A 3EQ7A 4HFRA 3C48A 2EW1A 4KBGA 1P1JA 4Z0HO 3ZXIA 1VBMA 1V35A 3V7UA 4AMVA 3H2HA 3ABQB 1E1LA 1OROA 3IEKA 4RF2A 2WVHA 3BJIC 2EJUA 1G55A 4U1RA 4GDFA 3ZWBA 5BWBA 3FTDA 3TRJA 2JLXA 2JIPA 5ER6A 2HMWA 3LUBA 4M0FA 1X2EA 1IBKB 1DOHA 3ZHOA 3TGLA 4AO7A 2QTCA 4Y98A 1XMPA 1ZL0A 4DCOA 2X77A 3GBPA 2X1VA 3LWNA 1QCDA 2V59A 1QH8B 2BF4A 1JHRA 1WW3A 2OFWA 3VR2A 5TQJA 2BEUA 4MLDA 2AMYA 5KSPA 2GF9A 3D1LA 5ALGA 3H84A 4GRAA 4EENA 2CHFA 3L40A 2BHRA 4EUFA 2HJGA 5LZ2A 2JA1A 4L02A 1FUKA 1TUIA 2R8OA 1YR2A 3AVUA 1MJFA 1SCIA 2A88A 4JHXA 4KQ1A 5CR9A 5LQCA 1LDMA 1YMQA 3UG6A 1IPEA 4AD8A 4F92B 3HBFA 2OR3A 2IP1A 1KC1A 1KVRA 4IUDS 4NCHA 2LIVA 5HZHA 2FN9A 1AURA 2FG6C 1O97D 4N18A 2Y1GA 2A5GA 3ER8A 3VGPA 1V45E 4E1VA 5IUJC 3CW8X 3RWMB 5K4GA 2QRQA 2XUIA 1L8AA 4ZIRB 1U2ZA 4P4SB 1RYEA 1LS1A 5GINE 3WBBA 1EXDA 1Y3CE 1GZSA 4YT5A 5JBQA 4N0QA 3VHRA 4OI1A 5EJ9A 2FFAA 1YNSA 1WSDA 2C5LA 2C42A 4BEBA 5IYZF 1WMFA 2ACWA 2YXNA 2ZIXB 5F23A 3FOZA 4DEYA 1FW8A 2GJKA 3N2LA 2PK3A 2F43B 1UJ4A 3N75A 5C3MA 1ZISA 3GELA 3SFTA 3GLGB 3C6QA 5LUBA 3RS2A 3IR5A 3KDPA 3DLPX 4KGDA 4DBLC 5C7YA 3IQDB 3KAQA 1SELA 3V8NA 4CJXA 3PWTA 2BMAA 1TPYA 2BFPA 3JSXA 3L6CA 5FLKA 1IM8A 3E7WA 3TDMA 5A03A 3GLIB 5L53A 3DOIA 4TKZA 3QVUA 1NQOA 3MWGA 4KEAA 1JLLB 4BN5A 4JJZA 3O90A 3UNXA 3K53A 5ILOA 1R37A 2G82A 1FQWA 3A6ZA 1NAHA 3AW9A 3E1GA 4KBYA 1FLAA 1NMYA 4E12A 2GM9A 4EJSA 2PWPA 4AKHA 3G5TA 1FLVA 2Q1SA 3KKKA 5B30A 2OK7A 4R9RA 3HLKA 2G1AA 3CR3C 3IRUA 5CH8A 5E2IA 4DUGA 5SYNA 4EJMA 4Y2YA 2PZJA 5DM2A 5B3JA 3NHAA 1XZDA 3USZA 3GGCA 2PZAA 3C5HA 1RM3A 1VYHA 4NJMB 4BQFA 3IDSA 4GPTA 5IJ9B 1UP4A 4W8OA 4YMLA 1U0HC 3CUYA 1CQZA 3R23A 3FHTA 5DGHA 2JFOA 5LMUB 2XBMA 1IQUA 4KU4A 4QECA 3ZBUA 4YEDA 2WA1A 3O31A 5F4ZA 2BHNA 4G8JA 4ZJYA 4L73A 2IS1A 3DE5X 2QGNA 4R81A 4Y6OA 4YJHA 4O33A 4GX1A 5NLLA