4X95A

Crystal structure of fully glycosylated lysosomal phospholipase a2 in complex with methyl arachidonyl fluorophosphonate (mafp)
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
375
structure length
375
Chain Sequence
HPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of lysosomal phospholipase A2 and lecithin:cholesterol acyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Group XV phospholipase A2
total genus 124
structure length 375
sequence length 375
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02450 LCAT Lecithin:cholesterol acyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4x95A01
3ZV7A 1GPLA 5HCUA 4F5ZA 1YSCA 4BE4A 3IDAA 4W63A 1YAJA 4ZXFA 2RI6A 4BTVA 4CCYB 4BRSA 5K3EA 1UXOA 4DMHA 4LKOA 2XDWA 1UT6A 3PF9A 4XX1A 5ESRA 1HPLA 1QIGA 5A6VA 1Q0ZA 2WSLA 3R3VA 4GI1A 5EIAA 1H2ZA 3AIMA 3M81A 2P8SA 2XMQA 1QZ3A 3L1JA 1VOTA 2WHPB 4N5IX 2HIHA 3VVMA 4HXFB 3C6BA 4GECA 2QUAA 3JWEA 5FOQA 3C5WP 2HA0A 4X3CA 2OPHA 1H22A 1CIJA 4J0DA 3CN7A 2ACKA 3IBTA 2WFLB 3N2ZB 4PQEA 2QXTA 2WG0A 5C81A 4BVJA 4B80A 4Y2PA 4JH0A 5EHNA 4EY6A 1XZDA 3A2NA 4XIIA 2AJDA 3QMMA 5KWJA 2WUGA 5JZ9A 2H7CA 7YASA 4JUIA 1DTEA 4O08A 1K63A 2XUHA 2XT0A 4OYYA 3ANTA 1G5FA 3V48A 3QYJA 2QTBA 2DCMA 4UHHA 1BEEA 4IH9A 3GZJA 2B9VA 3I2IA 1EVQA 1PV1A 2QKYA 1XZGA 3I6ZA 4HAIA 4PSCA 4X94A 5DYYA 2Z8ZA 4U2CA 5T4HA 3ESCA 3OG9A 2JEZA 4NVRA 1CQZA 4UFNA 4DSZA 5SYNA 4EUSA 4C4XA 3WZLA 2XMGA 2HA5A 3EQ7A 4JYMA 4U2FA 1BE0A 5FKJA 5EGNA 1RWQA 4CFSA 4F0JA 3QMWA 1EI9A 5I7UA 5ALZA 2LIPA 5JANA 4QDOA 1MTZA 1MX5A 1UKAA 4Q05A 2WJ4A 1E8NA 3FVRA 2HFJA 2WU3A 3FVTA 1ACJA 1AC5A 1P0QA 1XRPA 5IVDA 3Q0TA 4UBLA 2O2HA 1VZ2A 1ISPA 5CBKA 3V1LA 5DYTA 4MJ3A 5AO9A 1UKBA 1IZ8A 1XRMA 2PSFA 5CXXA 3QPDA 5HF9A 1UK6A 4UHFA 2ROQA 4L9AA 4NS4A 1B41A 3R3XA 1T4MA 3PFBA 3I6MA 4AO7A 4E14A 2JF0A 4J0GA 5D6OA 2CJPA 3WA7A 2UZ0A 2IX9A 3K2IA 3R41A 1THGA 5CT6A 1XFDA 4KJXA 1L7QA 2GYWA 4J0KA 4QWMA 1UK7A 4WY5A 3ZLUA 4A23A 3QVMA 4FMPA 5JASA 2VJCA 4DTCA 1HDEA 3H2IA 4LIPD 4Y2VA 4FLEA 4DMCA 4PV7A 4Y9SA 2G5TA 1F0PA 3PICA 5J3JA 2VTVA 2QZPA 4LYEA 4OUKX 1CUWA 5CURA 5IKXA 5AI8A 5HK8A 1QFMA 4DGQA 3I2FA 3T52A 2PKYX 2RIPA 3W05A 5AM1A 3WK9A 1XLUA 2DR0A 1Q83A 1VE7A 1K6EA 3NOXA 3DYIA 1R4ZA 3G0CA 2DHCA 5ALVA 1CUCA 1UOQA 1TQHA 1F0NA 4QDZA 3C45A 3Q8WA 1UKCA 1ZIYA 1BRTA 1P0IA 3EQ9A 1J2EA 3CN9A 3IULA 5E4TA 3G0BA 1KU0A 3IA2A 3R3WA 5DTIA 1X2EA 2O2GA 2VATA 3V1KA 3AZOA 1P0MA 1AUOA 1MX1A 2WIJA 2I78A 4AN0A 5JATA 1VLQA 3IIIA 5HK9A 2QM0A 2WJ6A 4H77A 1A7UA 5IVKA 4QLAA 2PSEA 2WJ3A 2XQGA 5BV7A 2BGRA 4ZREA 2AJCA 4RE5A 4RE6A 2OQVA 3UUEA 4AQDA 4FLFA 4PO3X 2ZYRA 3ESDA 4YPVA 2VQ6A 2C58A 5ALNA 5FPQA 2JGEA 4UFOA 2I3ZA 3HI4A 2ECFA 2DSNA 3QPAA 1MU0A 2E3JA 5AI4A 1A88A 2DHEA 3WLAA 2CMFA 4BATA 1GPKA 5AKLA 3AZQA 4H18A 5A62A 3STTA 5AP9A 5ALUA 4IH1A 2XLBA 4L0CA 3F8SA 4QE3A 2WIDA 5CXUA 3BF8A 5AKKA 5AOBA 3KXPA 1XRQA 4K6HA 3KWFA 1E5TA 3OM8A 3WKEA 2IIVA 2QXUA 1WHTA 4YX9A 4BE9A 1G66A 4EA6A 3C5VA 4AMYA 4A5SA 5K3BA 3ZI7A 1WB4A 3BWXA 1FFBA 5ALMA 4LXIA 4FOLA 2QOEA 3OURA 4X85A 4PSUA 3F96A 4N8EA 1LNSA 5E2IA 3I2GA 1USWA 3G0DA 1ORWA 5ALKA 2BKLA 4I4CA 3GELA 3AIOA 3GFFA 4EZIA 4X97A 3MUNA 2GZSA 1EHYA 1ZD3A 4K6KA 2QJWA 3FWHA 2VT7A 4H7EA 3NGMA 5IH7A 4MWTA 4FLMA 5ALGA 3DL4A 3W06A 4M0EA 1CUEA 5AI5A 4Q34A 3AIKA 4FNMA 5SYMA 4WDRA 5AKYA 4L72A 1W75A 5JAUA 2BUCA 1ZOIA 3G7NA 3H0CA 5IVIA 5HQ3B 2PPLA 2XMSA 3WK7A 2XUDA 2XUAA 4DM7A 2CUTA 1CVLA 2XUPA 2BAGA 1XZEA 5ALLA 1X2BA 2HADA 3MVEA 1TIBA 1OXMA 1LLFA 4J0IA 3ESAA 4KAFA 2HM7A 1IUNA 4B9EA 1I6WA 1FSSA 2G63A 3BE8A 4OU5A 1U2EA 3QBJA 5JAOA 4X6XA 4K6GA 2WHQA 5CT4A 1N5RA 4X6UA 2QR5A 5DJ5A 5HFNA 3B3QA 3M82A 5A7FA 1BN6A 1XKLA 4L3WA 1GQSA 1EH5A 5JD5A 4HZGA 1G4HA 4MQLA 2OCGA 4C4ZA 5EI5A 4G1FA 2JEYA 4HS9A 1CUIA 1RP1A 2XLCA 4C6HA 1N5MA 4KE8A 4F60A 2WFZA 2BGNA 3F9CA 5DWDA 2WUDA 5AKEA 4J03A 4NZZA 4OYLA 2XQJA 4QWWA 4ARBA 1TRHA 1PFQA 2Y2UA 4ZV9A 4X91A 3FYTA 3WL6A 3DOIA 1XKTA 1DQZA 4U2DA 4FHZA 4UBKA 4FBLA 4HRXA 2PU7A 1QIIA 4TPKA 1BS9A 3QPCA 4BAGA 5HF5A 2VEOA 2WU4A 2VA9A 3DYVA 2C4HA 5ALQA 2EDCA 3SC2A 1CUFA 5E4JA 3BDIA 4GW3A 2WKWA 2XB6A 2EDAA 3ICVA 1W4LA 3WJ2A 2OCKA 4U2EA 4ITVA 3RM3A 1YS2X 5CMLA 1VE6A 4B83A 4BCBA 4GEGA 4BAZA 4N5HX 4BVKA 1T2NA 1ETHA 3E0XA 3WJ1A 2QT9A 1SFRA 2AJLI 1CUJA 1K4YA 1HBJA 3BF7A 3WKAA 1JFRA 4FFWA 2WUFA 4G8BA 2CKMA 3JYHA 1XZLA 1XZJA 4Y7DA 1C7IA 3IUQA 3HLKA 3WMRA 2I03A 4LXHA 1H2YA 5LP1A 1LPBB 4QDTA 4UHDA 4UBIA 1O6FA 1Y7IA 3LIIA 1DQYA 1QE3A 3H04A 2PVSA 5ISMA 3M83A 2HL6A 2OGZA 5AM4A 4GWLA 4ZI5A 4B7ZA 2OG1A 1Q84A 2J3DA 2C0QA 3WKCA 4X92A 3G0IA 5FXMA 5JALA 1P0PA 5AI0A 3R3UA 5A2GA 2YH2A 2WQZA 2BCEA 2D0DA 3HC7A 4H7DA 1DX4A 1YAHA 2WIGA 3G9ZA 1A8QA 3ED1A 1E8DA 1MAAA 2BFNA 5ALHA 1TKRA 2G4LA 2BJHA 5DLPA 4IH4A 1DWPA 4C89A 1UWCA 5ALIA 3WL8A 1CUAA 1A8SA 2CZQA 3YASA 1QIDA 4Y2YA 1LBTA 3KWJA 1QTRA 3FCXA 1NU6A 5ALXA 4DIUA 4X7BA 3TRDA 3JW8A 4H7FA 4EY8A 3HJUA 3LS2A 5FUMA 1GZ7A 5CT9A 4G4JA 5AK3A 1AMNA 1QIKA 1W52X 3AILA 1RYYA 3FSGD 1UOOA 1ZD5A 3H17A 3I1IA 2XMZA 3C6ZA 2VJBA 5I9IA 2VAXA 4OSEA 1ODSA 1TCCA 1UZAA 3BIWA 1CUGA 2ZJ6A 4UBMA 3VDXA 1XRNA 5IVHA 1XROA 2XMBA 4HXGA 4AX4A 5AKHA 2PX6A 2PBLA 4ROTA 4E15A 4UFPA 1H2XA 4N8DA 3KSRA 3FYUB 1MJ5A 4ZRDA 3QM1A 2W6CX 1QIFA 2PUHA 4KRYA 3A70A 4GDMA 5ALWA 3D2BA 3G0GA 2JGJA 5F4ZA 4BZWA 3WI7A 1MPXA 5LZ9A 2ZJ7A 1AGYA 1LGYA 2X8BA 1GXSA 4OB6A 1TAHA 5JZSA 2QVBA 4BDTA 4P9NA 1ZICA 3K6KA 2HHAA 4BC0A 2C7BA 2HA4A 3IURA 5AKIA 4EB0A 4B81A 3DD5A 1C4XA 1WB5A 4N8SA 1EDDA 2NW6A 3D2CA 3C87A 3SWWA 4KR0A 3RK4A 4E11A 2XUGA 3GUUA 1EDBA 4E46A 2XUOA 5T4EA 1TK3A 2HDWA 3DCNA 4DMFA 1IUPA 1GGVA 4WFJA 3AINA 5H3HA 3FNBA 4GXNA 1FFAA 2B4KA 4HVTA 4Q3OA 4Y2SA 2ZJFA 1R88A 3DNMA 1SC9A 4Q82A 1R3DA 5BWCA 1CUDA 3DL7A 4KAAA 3R3YA 1ZI6A 5C7YA 1WPRA 4GLBA 4H7IA 1R9NA 3WA6A 2WM2A 3D5EA 2V98A 1ZJ5A 3UUFA 3I1YA 4Y2QA 4X95A 4W1SA 3FYUA 3ZWQA 1HL7A 4J0JA 5HKBA 4X6YA 1UOPA 1CR6A 1XQWA 4C87A 2VJDA 4BRZA 1CUSA 5DNWA 2VF2A 1CEXA 2DQZA 4DNOA 4ZV7A 3ICWA 4B6GA 5AM3A 4X93A 3EF3A 4BCCA 4MYDA 1R50A 2RHWA 3O4HA 1ZIXA 1JU3A 2X76A 4KYVA 4DLNA 5ALJA 4CG3A 1YASA 1K5PA 2ACEA 2HA3A 3FLAA 3NUZA 5BOVA 1BCRA 5ALSA 4JYPA 4OD0A 2O7RA 2RGUA 3G9XA 4W1QA 4FNGA 3V1MA 2ZYSA 4Y2TA 1CUVA 1KU6A 4J0CA 5ALOA 4CCWA 1CUUA 4H0CA 4Y2JA 5K3FA 2OXEA 5T4FA 3R0VA 4FBMA 3WWEA 3SX4A 3H1AA 4U2GA 5EFZA 4INZA 4B84A 2ZSIA 1N1MA 2VT6A 2G5PA 4FWBA 3O4IA 2JGFA 1A8UA 1B6GA 1H23A 5ALYA 3WK8A 4UHBA 1O6GA 3WZMA 2OGTA 4H35A 1SCKA 1U65A 5ALTA 5C8VA 2QUBA 1MNAA 5LYYA 4BYMA 1VA4A 3BJMA 1QJ4A 3VJLA 2CEKA 4IO0A 4BP8A 4Q3KA 3ZPXA 5AKZA 5E4YA 3U1TA 4G4GA 1PJAA 3AJAA 3BL8A 5JIBA 4HXEB 1LPPA 5CTAA 5AM0A 5FRDA 3FBWA 2HU7A 1ORVA 3D7RA 1XZIA 5JARA 2HU8A 2XMCA 5KBYA 3LIPA 1E89A 2ES4A 5AM5A 2XUKA 2PM8A 3BXPA 3ESBA 3FSGA 4EBBA 1BEZA 2WFLA 3WK5A 4PNZA 1EK1A 5LKAA 5FV4A 2PSJA 2CB9A 1XRLA 1ZJ4A 4GHWA 1YB7A 1QFSA 3W9UA 1XQVA 5FLKA 3MGAA 4UHEA 3RKSA 1LBSA 1MAHA 1AKNA 3C8HA 5ALRA 3WIOA 3DEAA 2C5FA 2WUEA 1Y7HA 1QO7A 1VXRA 3G8YA 1E3QA 1EX9A 1VKHA 3L1HA 1J06A 3D4LA 3WYDA 3DQZA 3BDVA 3PUIA 2O7VA 2H7YA 3CCBA 1U4NA 3HACA 2FUKA 4UBJA 4XVCA 2V97A 1IZ7A 3PFCA 2Z8XA 1JMKC 1CLEA 3LLCA 1GKKA 1CUYA 5A7HA 2XQFA 3FAKA 5AOCA 3M3DA 5KWIA 4W9RA 3QITA 3D59A 3WK4A 4DYHA 3AUKA 4WCVA 3N0TA 4J0HA 2GBIA 3AFIA 1ODTC 4YASA 1YA4A 4RGYA 1EINA 2J4CA 4DNPA 3LP5A 4JNCA 4J7AA 3WKDA 5AJHA 4CIBA 2WIKA 2D5LA 3O4JA 1YS1X 4G8DA 2FX5A 3NWOA 4LHEA 5HQ3A 3AZPA 4Y2XA 3A2LA 4H7HA 3WWPA 4HTAA 5AI6A 5I8PA 2OLEA 4M0MA 1ZD4A 1MX9A 1X70A 3GBSA 2QRUA 4UUQA 5YASA 4EHBA 3GROA 4M0FA 3DOHA 3DKKA 1YCDA 1HQDA 1DT5A 4ARAA 2XUQA 3STUA 5K3CA 2VJAA 1QO9A 1XRRA 5CT8A 1LPNA 4BCDA 4ZGBA 3RARA 4B85A 4B0OA 3W2TA 4BB0A 3HZOA 5EHQA 3CXUA 1MT3A 5AK4A 3I6YA 4GBGA 1E66A 1BN7A 3PDCA 4DNQA 4EY5A 2OCLA 5LZ8A 1WPXA 4BTLA 1YR2A 4AZ3A 4LYDA 5LZ5A 1C7JA 2QJRA 4P08A 4KEAA 1DINA 3W04A 2YXPX 3X3HA 1DT3A 4V2IA 3O9VA 5K3FB 5AM2A 3OTQA 1JMYA 3ZLTA 4WDQA 2VAVA 2GYUA 1AZWA 1W76A 1S8OA 1SCQA 3C8DA 3I28A 5T4BA 3VKFA 3HXKA 4Y2RA 5BWBA 4B9AA 4WJLA 1FFDA 4WY8A 4CCYA 2PSDA 4W1PA 2YASA 3HABA 2WTNA 5K3AA 4NMWA 2WHPA 4FDMA 2RAUA 5FDFA 4FFVA 1EXWA 1YB6A 4K2AA 4I19A 2JGIA 1SOMA 3WWDA 3T4UA 3GA7A 3RLIA 2I3DA 5CH3A 5JAHA 4EY7A 4X71A 1CQWA 2ZSHA 3I2HA 1W6RA 4G9GA 5AKXA 5JZBA 3K9BA 2WG1A 5D3ZA 3I2JA 3FCYA 5HZGA 1MN6A 5AOAA 3P2MA 2ZYHA 2XE4A 4DMKA 3G9TA 1EA5A 4MQMA 4X90A 2OGSA 4IQ4A 3CCCA 5JD6A 3W9BA 2O2IA 1G42A 5K5EA 3C43A 3G9UA 3PE6A 5ALPA 3IUMA 4IHAA 5CT5A 5AKGA 3WIBA 2XMRA 1ZI8A 4Q1VA 1TCBA 1AQLA 4G4IA 2GYVA 4C88A 3DDUA 4WFIA 5A7GA 5EHZA 3WQHA 2XUFA 1BU8A 5DNUA 2V96A 3PUHA 4CI9A 4B82A 4KAJA 1XQXA 1EK2A 1IUOA 5C8XA 1IVYA 2JGKA 1THTA 1F8UA 1J07A 1H2WA 2C0PA 1WCYA 3KOOA 2CBGA 2WIFA 2PSHA 3R3ZA 3B12A 3B5EA 4CG2A 5KREA 1JKMA 1FFEA 4XJVA 3A2MA 2GZRA 4MYSA 2H9YA 3QZUA 2ZVDA 3ILSA 1XZKA 1CV2A 4AXBA 4QNNA 4S0XA 3VXKA 2IITA 1AURA 4MWSA 5EHXA 4BBZA 3H1BA 2Y6VA 3HRHA 1XZFA 2VSQA 1HLGA 2R11A 2PU5A 3C70A 3WL7A 1OCEA 1XLWA 2OAGA 1F6WA 2JGLA 1R9MA 2YYSA 4U2BA 3TJMA 2GBGA 4K5QA 2Y6UA 4H7KA 2Z3WA 5CW2A 5AIAA 1MO2A 2XMDA 1QIEA 4AN1A 3EBLA 2V9ZA 1GPNA 3D0KA 5HF6A 1CUBA 1K8QA 4G9EA 5DYWA 5JYCA 5EIHA 2Z5GA 3VISA 4AB1A 3A6ZA 2HA2A 1JU4A 1QIHA 1XLVA 4C01A 2WTMA 3BJRA 3STWA 1HKHA 3E4DA 3FLEA 3IB3A 5K3DA 4QEKA 2DHDA 2ZYIA 3I2KA 5ALEA 1XZAA 4D9JA 2JGMA 3O4GA 2AJ8A 3F67A 5AI9A 2B20A 1FFCA 1ODCA 5LZ7A 1XZCA 1CUXA 3EIOA 1XZHA 1CPYA 5AHXA 2W22A 3EQ8A 1ZI9A 4OPMA 4UBNA 2XQKA 5LLSA 3STXA 4BVLA 2Y2VA 5CH8A 2R8BA 4MXDA 3S8YA 3V9AA 2RONA 3HYSA 2OQIA 3H19A 4DNFA 1EB9A 4PF1A 5HKAA 1R1DA 4QA9A 3DKRA 1QLWA 1M33A 4G5XA 3LCRA 2OAEA 5FPPA 3D3NA 4TGLA 1VA5A 3VJMA 2OCIA 1MNQA 3BIXA 5FP0A 2AXEA 4P92A 4Z49A 1JJBA 1ZGCA 5AICA 4G8CA 4KACA 4YK7A 4AO8A 1ZD2P 1LPOA 1QTIA 1VZ3A 2XUIA 2DFPA 2K2QB 4CG1A 2BUBA 5AK5A 3UMJA 3S2ZA 4AO6A 3R40A 5DNVA 2EEPA 4FTWA 4MEBA 3FLBA 1EDEA 5LKRA 1AX9A 1NX9A 1UFOA 5JAPA 2BUAA 1LZLA 4H7JA 1OILA 2AJBA 3QMVA 5EIEA 2H7XA 4WFKA 2QS9A 1YA8A 1QIJA 2GBCA 3U0VA 3WL5A 1JI3A 1ACLA 2JBWA 1GKLA 4I3FA 1LPAB 2B61A 3E3AA 2HA6A 2Q0XA 3C6XA 1IMJA 1N8SA 4KE7A 3C6YA 4KRXA 5AH0A 2FJ0A 2HRQA 4QDUA 4EY4A 1BROA 3H2JA 2ONCA 4HRYA 2RHTA 3STVA 1U8EA 4F21A 1WB6A 3OPMA 1QIMA 3IVMA 2J4FA 3HSSA 2HFKA 4BC1A 3H2GA 1QGED 3G02A 1E8MA 1LZKA 3ANSA 4OCZA 3WWCA 4OB8A 3MUOA 2PUJA 1KEZA 4ZWNA 3PI6A 4UBOA 1CRLA 4A16A 2WFMA 5LZ2A 4LXGA 2HRRA 1DWOA 3KD2A 3H18A 3VVLA 1WOMA 1TCAA 4UPDA 5JD4A 4CIAA 3HEAA 3D2AA 1Z68A 4BP9A 4AZ0A 1D07A 4KE9A 4JEIA 3H2KA 2C5GA 2XQIA 3V1NA 2WILA 1CUHA 1JJFA 5HFAA 5D7BA 2XI4A 1DX6A 3OC0A 1EB8A 5C8ZA 3L1IA 1L7AA 2WG2A 1VJ5A 1WM1A 5AK6A 4OB7A 1VXOA 3STYA 1QOZA 4QLOA 3TEJA 3E1GA 5DTJA 4X00A 1BCSA 4RPCA 4FKBA 4Q3LA 4QZVA 4QDXA 1JJIA 2FJPA 3IUJA 2XUJA 4J3JA 3WWOA 3FOBA 3IUNA 4PSDA 1DU4A 3F97A 2DQYA 2QMQA 4OU4A 2Z3ZA 1ZGBA 3WKBA 3KDAA 2X5XA 4RNCA 2H1IA 4KE6A 4C4YA 1UK8A 1L7RA 4P93A 5LZ4A 2JIDA 3H2HA 1W1IA 2J3QA 2Y1KA 5CH5A 1FJ2A 5A71A 1EVEA 3VJKA 1GQRA 1GT6A 2HU5A 1QONA 1XQYA 3TGLA 3WK6A 3O95A 3ZLVA 3O0DA 2GBFA 4B0PA 3FYUC 3O9MA 1JT2A 5AKJA 1UK9A 3DS8A 3OOSA 4AMZA 1NU8A 4XWGA 1DWQA 3DLTA 2ORYA 5AIBA 5HF8A 4BZZA 1CFJA 1LPSA 1LPMA 3DJYA 3WYNA 1Y37A 4BDSA 1XZMA 1SCIA 1WHSA 4MEAA 1XZBA 4ETWA 2WLSA 1Q0RA 3QH4A 5D3KA 4Y2UA 5CRIA 2PL5A 4TVKA 2HA7A 5ALFA 1CUZA 3SK0A 4PW0A 4DSAA 4W1RA 3PF8A 2WHRA 5JADA 5LIPA 4BAUA 5ALDA 3F98A 6YASA 4UHCA 1J1IA
chains in the Genus database with same CATH superfamily
4EPRA 3ZV7A 3FMIA 5HCUA 4PS1A 1HC7A 4IX1A 3KE8A 1NGSA 4QGAA 4C2TA 2Z56A 3A31A 3SJUA 1W2GA 1BJKA 1JEDA 1KTVA 1C9DB 4G5SA 4JITA 4CCYB 4WLNA 4LK3A 5E2BA 1K86A 2KJQA 3U48A 2FPUA 4HNHA 4BN4A 4Z54A 3EYAA 1NBMA 4FYJA 3F4BA 3NNDA 1OOEA 1QF6A 2A3RA 2XDWA 4NCNA 4Q21A 3RSHA 3TS1A 2WKPA 4REQA 2BH2A 2ATIA 4XX1A 3TTWA 5ESRA 1FP2A 1HYHA 4U6QA 1PEAA 1Q0ZA 1XZNA 2ECKA 5EIAA 2AQIA 1H2ZA 3L8EA 2BBTA 3HB0A 1S2DA 3M81A 4KQGA 4P82A 1OGIA 2R0QC 1SVNA 1I9CA 2GARA 3CX4A 4J7XA 2C4UA 2ZPAA 3CM0A 4EB6A 3FFXA 5WRFA 1JG1A 1KJZA 5LXTB 1S89A 2VHVA 4ESOA 1VOTA 2C4NA 3EGOA 4KK4A 1U8AA 5SZIA 5IXYA 4ODIA 1PL0A 1KVTA 4JQZA 3FDJA 4DJJA 4DM3A 4QFBA 2QM7A 2VTBA 2HIHA 3TMKA 3WNCA 4ND6A 1A72A 4HXFB 1E7SA 2JJQA 4RSGA 2A8YA 5BT8A 1OYVA 2O2JA 3HR8A 3PUXA 4CN9A 1FIUA 2P0YA 4RFVA 3GRCA 4A6DA 2QGNA 4WBNF 1EIWA 2C42A 2BONA 1D6MA 1LWOA 1T0BA 1XTTA 5FUWA 3EXHC 1Z06A 2HA0A 1FVOA 1P1BA 5BN1A 3DEJA 4X3CA 3ANMA 4WHMA 2O8CB 1VSBA 1H22A 4N7MA 4CM1A 4HNUA 4DRXA 3HK2A 2LCIA 1FK8A 2JAHA 4P6VF 4WN9B 3CN7A 2QUJA 2ACKA 2VWGA 2YOFA 4MYHA 1KEPA 3IBTA 4DILA 3R9WA 3ZKWB 5C1IA 1PKEA 4KRFA 3NEPX 3H5OA 4CKEB 3EXIA 2X0KA 2PK3A 4GG1A 3DC2A 1QH1B 4GVLA 1XHFA 4B80A 2OL4A 3MW8A 1EWKA 1GR1A 1L1RA 4KW7A 1QVZA 4KLRA 2DTXA 2I29A 4JH0A 1SQGA 2OD7A 2RGNC 3QKUA 4JVSB 3RAPR 3A2NA 1U8FO 5KNDH 1NT2A 2XYHA 4B48A 3S8EA 4OHYA 2ZIFA 1KDPA 2GEJA 1KI6A 2AJDA 3S99A 3W8FA 4YLYA 1DDGA 1JBQA 5KINB 4KNYA 3TAHA 4URXR 2R96A 1VB5A 3D8SA 4A0FA 2MIIA 1P8AA 2WUGA 3T1OA 5JZ9A 3PQ3A 7YASA 3ZIDA 2DPXA 3GG9A 1A9YA 1J9GA 3LSTA 4UTOA 3JQAB 3MPOA 2AJTA 3F9IA 3G5LA 1Q0UA 1W5BA 1OLUB 1J0AA 5EJ6A 4MWDA 1ENYA 2AN9A 2BEKA 2VXBA 1SU7A 4MMZB 1RIIA 4XI9A 5FCDA 1Z7WA 3BJEA 3NTQA 5DN6A 4EPXA 4I55B 5FTKA 2O07A 2UUOA 3GRYA 3ZN2A 3K0HA 2Z1NA 4LRUA 4TUYF 1NFFA 3PNKA 4CUJA 4EGQA 4MGIR 4Q9NA 4IH9A 1A97A 4TXNA 4L5BA 4KGVA 2WDPA 2XA2A 4D9HA 4F1KA 3IELA 1XCGB 5TR9A 3BD7A 3B48A 1QNLA 1CCWA 4K8RB 3E9EA 3WRYA 1EBUA 4WXMA 1CS0A 2NM0A 2NZVG 4LBYA 2PV0A 3CW9A 3QF7A 3SHFA 5KX5A 3JQ9C 2QKYA 3EFEA 4KBFA 3KL4A 1XZGA 1T2VA 2OILA 2QX4A 1DKLA 3E15A 3LOUA 3ROKA 3MTBA 4HNGA 1C1DA 1FOEB 1ZU4A 4EWLA 1NM5C 2AKEA 4DDWA 3ESCA 3SZLA 1DXOA 5DTRA 1WUTA 2AR7A 2HXSA 2PVCA 2Z0MA 5BPHA 2DLCX 1QGUB 2BMEA 4YRRA 3PZBA 5J1TB 3H6GA 2P62A 2Z95A 2C4MA 3DFIA 3HUTA 1P0FA 3P2JA 4HDOB 4V03A 4GP9A 4ALMA 1SCUB 3NH6A 4BN5A 1ZSYA 1Z13A 3DYBA 3KQQA 2HIMA 2JLRA 3DFFA 2V54A 3EQ7A 3LQ4A 3OHSX 4WKPA 5CIWA 3UMFA 5LXTA 1N34B 4WW0A 1GP2A 1G1MA 5TPWA 3ABQB 3S1AA 3GPDG 1B43A 4G85A 4ZAWA 2Q50A 4R1OA 3TB4A 1CR1A 1G18A 5BWMA 1XMOB 4YPFA 4PINA 2B7LA 1B6TA 1RWNA 1UFKA 2ZWOA 3LDAA 4OUDB 4CM3A 5BURA 3EA0A 1XOIA 4QYTA 1U5BA 3QMWA 5CVVA 5EP2A 5HGJA 1VGQA 2FMKA 4CFSA 1XZPA 1OH8A 3B20A 4RXTA 5I7UA 1X1DA 1H1LA 1YDMA 4E7OA 1CJUC 2JIZD 1HDRA 4LE1A 4NF2A 5JANA 5K03A 3SVZA 1GGKA 2XOXA 4KV7A 5D3QA 4IWNA 4LMPA 2E82A 5FNZA 1E8NA 1SA0B 3TSOA 3PHJA 5C37A 1ZQ1A 3C1TA 2B92A 3B2NA 5MHTA 2VJLA 3NQ41 1XIVA 3LO8A 4PAMA 3BRWA 2BHNA 1GYPA 2JHAA 2GVNA 3A26A 4MULA 1TQDA 2BI4A 2O2HA 1CW2B 3RRXA 1YT5A 3T5MA 3DVSX 3VR0A 4DL9A 3DE0X 4EGSA 5CBKA 3WOHA 1M1XB 5SZJA 4MHTA 4N7RA 2RGBA 2DC1A 2CZCA 2H1OA 3N07A 1LF5A 4MJ3A 3GFVA 4NG5A 2BT4A 2VHCA 1ZVQA 1QGAA 1UKBA 3H75A 3HCRA 3V7WA 4NBLA 1IZ8A 3HUDA 4LNUB 4B32A 4BO2A 2N42A 3KE9A 3B6MA 1PZNA 4B3BA 3QF4A 2FUCA 4PLTA 1THZA 5IJZA 4UHFA 4CQMB 1QUEA 1UJ6A 3P9KA 3NDIA 5C1OA 4XGNA 3TW6A 4LJRA 3U9TA 1LLQA 4U8GA 3NC4A 4RV9A 4NS4A 4EYSA 4BIMA 1J20A 1ABBA 4CQLA 3U44B 3C2QA 2ZITA 1YI8A 3R3XA 3SQNA 3PFBA 3I6MA 3RH0A 2SECE 3ZJ4A 3CF2A 4ZU1X 5EKTA 2AFHA 2QX8A 4V0NA 5D6OA 2WY2D 4KIGA 4CKWB 6ABPA 2VF8A 1GQYA 3O3CA 3V80A 4CKYA 3KCQA 3UVEA 4MQ6A 2C7VA 4C78A 4DXDA 3TQHA 2OLJA 3U09A 4J4BA 3UN1A 3V7FA 5IJXA 5KHAA 3WB1A 1VSUA 2QU8A 1J8MF 3N2IA 4QWMA 4DA0A 2J6BA 4IEEA 2RGRA 4Z8XA 5AVZA 4M49A 2A9OA 3FF4A 5JASA 5JW6A 4CM8B 3MERA 3RHSA 3ZHRA 3EVCA 4ZC8A 3OZGA 3SLRA 3WHKA 3SF8A 5IKEA 1RQXA 4FLEA 2NYUA 3IP1A 4L22A 2I7VA 5DHAA 1E62A 5J2UA 3R8FA 4KYTA 1UKYA 4LWOA 1LA2A 3PJDA 1K5GA 1SJ9A 3OWHA 4KIWA 3DDHA 4DBZA 5LJIA 1TZ2A 1Y1KE 5DF1A 3PHLA 2XGSA 4B4DA 5GVRA 2XODA 2OZPA 3KKNA 3ZK8A 1FTGA 2VTVA 3GJYA 3MTAA 3TTXA 5L95A 1HTBA 1HTWA 2ERCA 2YBEA 4AECA 3EZ6A 5BOSB 2FEMA 4TLEA 5ENVA 5IKXA 2QXYA 1GG5A 1ZH0A 3OBBA 5EUQB 5HK8A 5BR4A 3AM4A 3GJ7A 1DV2A 1O7JA 3BE6A 1J21A 1UBRS 3G8AA 3I2FA 1NUSA 1TUEA 2PKYX 2RIPA 3H9JA 3W05A 2C2HA 5AM1A 3WK9A 2IBSA 2DR0A 3AI7A 2Z6UA 1Q83A 1K6EA 2ZAIA 2BC9A 3NOXA 3BZWA 2HLDA 5F5NA 3T3MB 4I0WB 1PJSA 4QFCA 1VI5A 4YJGA 1Z4LA 1YBHA 2QGFA 5E9WA 4XLLA 1CUCA 1IEQA 2PD6A 2A4KA 4M7OA 1F0NA 3K5HA 5E7IA 1Q1ZA 2YVAA 3ORHA 3Q8WA 4Y30A 3E82A 4WZAB 5DYNA 5J2TA 3N8GA 2X4LA 5J4HA 2X9NA 4L5CA 3WK8A 1QXSA 4LZLA 2AUTA 4ENRA 5JWOA 1P7YA 2P1RA 5KYUB 4YMLA 2PMCA 4BGIA 4MH0R 3AV3A 1DEHA 2W6QA 1KU0A 3AKCA 1VCNA 5IUNC 1E5QA 1IVNA 1SELA 5EEGA 2VP0A 3DW1X 3O0TA 5SY4A 4EENA 3HN6A 4OAPA 1X2EA 3N2KA 2ZJ2A 4MQFB 5DWQA 2ZSJA 1W0CA 2P9EA 4BNUA 4ETIA 3WGYA 4AF6A 4PVDA 2C7QA 5FFFA 1KXZA 3GB9A 2QMHA 5JVDA 1ZFNA 2VATA 4KLNA 3V1KA 4DCGA 3R7WA 3GL9A 3LFTA 4GI7A 5KNCD 2ZYDA 4PYNA 3UYLA 3R8XA 4S2EA 1KO7A 1VHJA 3MQ4A 4GKKB 5C53B 5DH9A 1LUAA 3IHWA 4JB2A 1ZN7A 4WZZA 1T3SA 3GGSA 5HW0A 3D9QX 5LMCA 3ZHTA 1HT0A 3VZBA 1MC1A 5IK2A 5H3LA 1Q7EA 3VO8A 2UVPA 2JFXA 1MX3A 3L4BC 3PEEA 4NBUA 1EUDB 1MIHA 2D13A 3LSYA 4XFJA 3V46A 4D9FA 1B0UA 3QLTA 2R4QA 3QKTA 1XEXB 1A8PA 4KXFB 4QSMA 4D0SA 1GGHA 1IB6A 2W42A 1WDTA 4OHMA 3VSBA 3RSGA 3LQKA 2AOVA 2HIAA 3E5NA 1H8HD 1L5MA 2VZ8A 4KH1A 5D84A 2A58A 3USZA 2GAIA 2ODBA 2X8WA 4ZREA 2AJCA 2PIAA 4TT3D 1C0LA 2VT2A 4Q18A 3ESDA 5CXSA 5K2MA 2YVUA 3K4PA 4ONEA 2RHBA 4FYWA 5FI5A 4DLUA 4PTYA 3RVNA 1GA4A 1OX6A 3NB0A 4N41A 2EZTA 3IT2A 3RK0A 1Y4ZA 1KRHA 3AUJB 3MPUA 4MVJF 1SHUX 3UCEA 3OX4A 1MAWA 1OWMA 4E94A 3HI4A 4EJ2A 1E3MA 1QG0A 4Z4GA 2IE0A 2HJ9A 2E3JA 4MVJE 5A6SB 3DWGA 1WF6A 4ZVUA 2NVBA 3GA0A 1XA3A 1E1DA 4OQ4A 2GAAA 5C4MA 2JATA 2DHEA 1YFLA 2ZE5A 2ISCA 4LQCA 2ZUFA 3CYFA 1Z3IX 1U28A 1EFDN 1KP3A 4HQ6A 5CYFA 3IAXA 3IP3A 5F1YA 2IVZA 5IN5A 3RUCA 2J41A 4DIEA 3HMQA 3RUFA 3T1VA 1U0RA 3KAKA 3MSXA 2V9CA 4PR0A 2QM3A 4PYLA 3R5TA 7REQB 4OP2A 1FA9A 1P4JA 5AP9A 4BMYA 1UP7A 2D7DA 3COJA 1F0YA 4INAA 1GUAA 4II3A 4AQ7A 2JKVA 4G09A 3SX0A 4J2HA 2R6CA 1PN3A 1XNHA 2GTHA 1NW5A 2VUUA 2ZRPA 3FRJA 4LHZA 5TQVA 3GPLA 4X44A 3DHEA 2OXRA 1W5SA 3OEHD 5AOBA 1NBME 3B9BA 5LXTF 1AO3A 4B4VA 1XRQA 4EB6B 3KVYA 2H2GA 3KWFA 2OEPA 4PEVA 4REMA 2AI3A 5JUWA 4W9MC 3OM8A 1MPTA 3UMSA 3HU5A 5REQB 4ZGWA 2QXUA 1XTUA 3L6OO 4FDUA 3PDWA 4YWHA 1SCJA 1WHTA 1TGVA 2CUNA 2JFQA 3WYBA 3R75A 2X0JA 2H5IA 4RVNA 4ENSA 2PZGA 3WNBA 1V11A 2HMAA 1CJKC 5FQOA 5TQ2A 3RD5A 5MN5A 1OB2A 2GPBA 1XMIA 2GTIA 3C5VA 3ZDYB 1NNI1 1J33A 5KS2A 4E31A 3HFGA 4S3MA 3BVPA 5K3BA 5A9RA 3ZI7A 5JFGA 1POXA 3ESZA 2RMKA 2AKYA 1VJ1A 2BGIA 2W11A 4ESHA 5AVOA 2FEWB 1DG1G 2QVXX 3QVGA 1YWGO 3EPLA 1VHQA 4N0EA 1MOQA 2COEA 3L6BA 3AF6A 2LE0A 8LDHA 4OO3A 1VL2A 1SC6A 2GUGA 4JJKA 3GCGA 2Q4RA 1G20E 2AMFA 4CTJA 3HCPA 3FOWA 1SUSA 4GXQA 4IV8A 4MMXB 1CY8A 4P34A 4N8EA 3LPNA 4KBYA 4OXIA 4DCOA 1LNSA 1IOLA 2YNMC 5E2IA 1NKTA 3IDSA 2B7CA 3KVNA 4DLKA 2JCGA 1OT5A 1VIYA 4MB6A 3I73A 4L15A 5EP1A 5ALKA 1WWKA 2R1VB 4GQAA 4WA7A 2XRZA 4ZDWA 2JI4A 3UIEA 3NU1A 4IZ6A 5JS6A 3NHJA 2DTEA 4RJTA 1WETA 1G16A 3EGWA 4ZJYA 4BFTA 4GT1A 4G37A 3SBDA 2DKNA 4C30A 3AVPA 3ZNQA 2XHZA 4X97A 4Q66C 1TT7A 1WA5A 4TTQA 1R6XA 5FWAA 3SDZA 1DUVG 1JX6A 3KKLA 1SK8A 1M5UA 2ZIZA 4UQOA 4NFYA 2QZJA 1B23P 2GZ1A 1NN3A 2DJ5A 3DR3A 4CT4B 3TPZA 3BREA 3NM5A 5B6JA 1NNEA 5KYWB 5K0FA 1PWXA 4D8XA 2LNDA 3RWBA 4DV0B 1W2HA 1R16A 3KFVA 1ZC3A 3NGMA 4OLHA 4BO3A 1W581 4FLMA 1NBWB 1B14A 1FYFA 3DL4A 5B3AA 3TDKA 9GPBA 5JCZA 1AS2A 1YONA 5KOYA 1ZMTA 3IDQA 3PUVA 2I9PA 4MVJI 4UMDA 3PGKA 4XA8A 5FHRA 1BDHA 1G2IA 3DLBA 4CM4B 5K8CA 2PWPA 3SKXA 3IX7A 3CPJB 2EG5A 2IY9A 1QX3A 2NQTA 1ILWA 1FP4B 2R2GA 3AIKA 3L8HA 3PX3A 4JENA 5DXAA 5SYMA 4C22A 3PRKE 3GLFA 2PLFA 2SBTA 3IOEA 4CV0A 5A4AA 1HZZC 1JEQB 2AHOA 3CZCA 3O8QB 4OHVA 2X86A 1SAYA 3IQZA 1KHTA 2XUDA 2DT8A 1U11A 3K53A 2C04A 2CUTA 3ZH9B 2YS6A 3TDMA 3KLPX 1CVLA 1KVRA 5E7QA 4P36A 4EHDA 4F4DA 4BBJA 3THYB 1XZEA 1LQ2A 2D2EA 1KJJA 2HADA 1FFGA 4PLVA 2O2SA 5ALLA 1O3YA 2P68A 1OXMA 3AR8A 2AYZA 2XH8A 1LLFA 4WKCA 3VO2A 1I7DA 3QVXA 2O8BB 2HM7A 1ZH4A 3D5QA 1IUNA 3GXBA 3ZX4A 4B9EA 3K0CC 1W8DA 3P0EA 4DF3A 1ANKA 1FSSA 3K16A 1L4KA 2PNFA 4RH0A 3KFLA 2WTXA 3ROMA 5JAOA 2BMDA 4GMGA 5EQFA 4BMDA 4K6GA 4F2DA 2JAXA 5HFNA 2TMDA 5F51A 4L74A 4MRSA 4BP1A 2PX4A 4OQYA 1YZUA 4CM4A 2NSLA 1WZEA 3M82A 1TTTA 3BXOA 4J1TC 1C1XA 4UE6A 1O5IA 5JD5A 5A4MS 2W2OA 2B5VA 1PUJA 4MKIA 4R9RA 2DUWA 4MQLA 2OCGA 3ACDA 3L4JA 3L8YA 2HWWA 1VL6A 2PRZA 3P0FA 3PPYA 1IATA 2OO5A 3JXEA 3LT4A 5H83A 3TZLA 1BTOA 2J3IA 3SQXA 4E4TA 2X2PA 5CNIA 3V8PA 1GRCA 4DANA 1K89A 2C0CA 4LISA 1W4AA 4AW9A 2BGGA 1SC3A 1I4WA 4Q7QA 4F60A 2WFZA 2BGNA 5I3CA 4HX5A 3SG0A 3WZLA 2XWQA 2RAVA 4LECA 2KLHA 4JXKA 4JB0A 4QBTA 3QEOA 4I9FA 3VR6A 4Y6PA 1NNUA 4LBWA 1RZUA 3EDYA 4FN5A 4NYJR 3EFOA 1Z82A 1ZGAA 5B36A 4WGGA 1Z07A 2QQGA 3IIMA 2ZAMA 2X4GA 3ANYB 1DC3A 4HLCA 4NZZA 4CIYA 1OLSB 2IYOA 1Z5GA 4JXXA 2JG3A 3VTAA 1EP1B 5GGXA 3MRXA 3QLVC 5JXHA 4DMUB 2ZUSA 2NZWA 1OLSA 3ETHA 5K3SA 5IAJA 1FDRA 5FO1A 1YL6A 2Y2UA 4IYRA 1QGDA 3A10A 1JE0A 1IE3A 3ABIA 3B7WA 3OLQA 3T7KA 4JSTA 5COQA 4CKXA 3U6KA 3G2JA 1XE3A 4MIKA 3VOTA 4U2DA 3JQ7A 1N3YA 2PGDA 4AIRA 1CRZA 3EOAI 3MJHA 3TRJA 1BS9A 1WR8A 2YCLA 2C3PA 2JFOA 4KLCA 4TS4A 3VU0A 4PPYA 1AHPA 3KXDA 2O8NA 4LFBB 2BFCB 4L9WA 2RH8A 4BNWA 2PSSA 5H8WA 1DC7A 4PWYA 5I9MA 1US8A 2WU4A 3IHKA 4GOLD 4I46A 1LW7A 4Q6BA 1R0KA 3QNWA 5KC9A 4LZOA 1MLDA 2YMMA 2EDCA 4UAGA 4M7RA 4AICA 1EBBA 5E4JA 4R7ZA 3ZE8A 4EK9A 1GRRA 1IPFA 3CNHA 4PQGA 1WTCA 5JQGA 2EQ5A 2Y05A 3ICVA 1TT5A 1XTQA 3QKRA 3FTPA 4BKOA 4U8HA 2BGTA 1Q57A 5AW4A 1KR5A 1WUIS 2QN7A 3H0KA 4DYVA 3KZMA 2WSBA 1MCZA 1DB3A 2WYUA 4YRZA 3A28A 5J4YA 4CKCA 2VHXA 3IQHX 1J6UA 1DBVO 3M0EA 3LVQE 4NBWA 4N3BA 4NESA 1NE2A 3ZCTA 4EHKA 5HZKA 3ASVA 3DZJA 3N8IA 2Q5QA 2V74B 3KIPA 3QE2A 4FHFA 5I9SA 3EUWA 4FMDB 4FD3A 1TAUA 3RM3A 5JMTA 3HV2A 4TMXA 3U4IA 1DJOA 3QENA 2VPYA 1AQYA 1GCOA 2KWIA 2XDAA 4Z9YA 4A91A 1AY0A 2JIMA 4LVCA 1T91A 4L0DA 4LTNA 4N5HX 1J1UA 4EMSA 3ZDXB 4PYKA 1MDFA 3A4LA 3E0XA 2QZZA 5DT9A 2YZNA 3FZGA 1LC3A 2NWQA 2G1UA 2NXCA 3HADA 2LWIA 4N7BA 2FG7C 3DPUA 4DY4A 3PGLA 1NSYA 1UPFA 1II8B 2ATXA 5GONF 1FP6A 2E85A 1RMTA 1DQRA 3BF7A 4OFXA 4RKWA 5HBGA 4ALKA 5IHPA 2MOKA 1BQ4A 2IYVA 4G8BA 3R0ZA 1Z63A 2SKCA 3F0TA 4JP5A 5EJ5A 3DDOA 3JYHA 2RGYA 3U13A 4MVWA 4DTIA 3AO0B 3MGBA 3M7IA 1XZJA 2FFBA 2F1OA 1X14A 3ZWKA 3PVZA 1H4TA 5FI1B 3UMMA 3I5UA 1JA9A 1JQEA 1RXEA 2X8JA 3OE7A 5FUXA 3FOCA 4P7JA 2VF5X 2I03A 1LD3A 2HGSA 3Q6IA 4QXMA 3D1LA 1LPBB 3SAJA 3ZBTA 2DWQA 1N2EA 4QDTA 3FTDA 2NPOA 2F6RA 2AK2A 4TMKA 4TTVA 1W85B 4WNYA 3UC5A 3H4VA 5BUSA 2GESA 1L7PA 4JAVC 5JLAA 4TL6A 3VH3A 1SXPA 3PHBE 4R84A 4R2IA 4ADSG 5BMVA 4A2WA 2GAOA 1TIPA 1G20A 1KAMA 1ZKDA 2PVSA 3MK31 2O1SA 3IOYA 1F8GA 4G5QA 4WZ6A 3ZI4A 4ZQIA 2IJGX 3PKJA 3SY8A 3FDIA 1JAIA 4ZK2A 5EMJA 3LY5A 4JX9A 3S0JA 1IN1A 1CRQA 4B6OA 3BQNB 1NW9B 3NEYA 4GWLA 4E4RA 3WLOA 2V8OA 4AJ2A 4HLUC 2VPWA 3VR5D 1OT3A 3WKCA 4X92A 3G0IA 3DA8A 4BE7B 3C3KA 4X5OA 1F1JA 1ZSVA 1GSIA 1YO6A 2C8VA 2WKRA 5A2GA 2D0DA 4Y9RA 2FN4A 2W83A 1N2XA 5CG2A 2UUAB 4DCNA 4IQ0A 4P98A 1QRTA 4H7DA 1DX4A 5I7AA 3SBEA 1YAHA 3G9ZA 3PHCA 2JHCA 3LUFA 4NONA 2J9FB 1SQ6A 1TF2A 3GFSA 3ID6C 1QPZA 5G02A 2OBLA 1MAAA 3K4QA 5ALHA 3GUVA 1KY4A 3QLJA 3T5TA 4KWIA 3ZVKA 1QC5A 4YP7A 3WLMA 1J2YA 1J5XA 4DOMA 2H08A 3BGDA 1W85A 1ZM3A 4ZYZA 2FDXA 2ATEA 1NOIA 1XWIA 1PNTA 1AH2A 1ZMBA 3BGIA 1UWCA 4R2HA 5K8LA 3NTOA 2CV2A 4D4JA 5I9LA 2XB2A 4ZARA 1TE2A 3ZDEA 1TJ5A 4IDOA 3T9AA 3YASA 3UICA 2XCQA 3TOXA 2A5JA 3NT2A 3BWBA 1K7XB 1DAHA 2NYVA 3H4IA 2Q3CA 1MR3F 3KXIA 4BLWA 4P0PB 4EH1A 3RKRA 5EXEA 5KKCA 4AG6A 2P2CA 5ALXA 1M1ZA 1UWLA 2OV4A 3QEJA 3QWBA 4X7BA 3OJWA 4E5DA 4MVCA 1XCMA 3IBYA 2PYIA 2Y66A 4QUBA 3RANA 1LJLA 3QJ5A 4KI7A 4MV5A 5FUMA 1TEHA 1GZ7A 1G3IA 2HSJA 1L5GB 2A1UB 3I9OA 5KNLA 4ZOLA 1A8IA 4DR4B 1AKEA 5AK3A 1EG2A 1AMNA 1QIKA 4JT8A 1QG4A 1H6DA 3AILA 2LD4A 3F6RA 4HGPA 1M7BA 1PT6A 4YAUA 3DNFA 5ELLA 3WGHA 4I9HA 3SFTA 4DN6A 1WXXA 2W8ZA 5JG7A 2QI9F 1U98A 2A30A 2XRYA 3C6QA 4IFTA 2IFTA 3IXQA 4NICA 1UBKS 1UZAA 2X2FA 3R09A 2C5BA 4QQNA 4ZCIA 1CUGA 2FQQA 2ZJ6A 3MLEA 3S81A 4K1LA 4J1TA 2JJ1D 1XRNA 4R01A 2JA2A 4YAFA 5IVHA 1WD7A 4G0UA 4LE0A 5IKOA 2XMBA 1WHTB 3PLRA 4ROSA 4OK5A 1C4WA 4GPAA 3JYQA 5FH9A 2BY4A 4DJ5X 5HILA 4S1WA 2O0LA 4POOA 1J70A 4RFSA 2J0QA 2ZT8A 1Q12A 3OE7D 2PX6A 5EXPA 1XCLA 2BM8A 2PBLA 4ROTA 4UFPA 1DBWA 1E7MA 2KYRA 1UDAA 4YCBA 3HNOA 3UM9A 4P7BA 3WBFA 5DE3A 3FROA 3MT7A 3SI7A 1X7ZA 2Z98A 2QTNA 3QBTA 3D7LA 3S4YA 5FJIA 2ARKA 5JO9A 3SNHA 3UZUA 1UPXA 1JQAA 3DWIA 3K9QO 4CPDA 2QG4A 5B1DA 1TYBE 2HOQA 3EGEA 1A2QA 1OV4A 2IEYA 3SS9X 2ZYVX 2EJUA 1QF7A 3QF4B 4GDMA 1AHIA 2WJIA 1RPTA 3SJ7A 5IDVA 1ZK0A 1RKVA 3VPBA 4R41A 3D2BA 4D3ZA 3C7CB 3G0GA 4MUNA 4AG5A 4UUAA 4RD2A 4LRQA 2XSZD 1F51E 2ZGVA 1SOVA 3SZUA 3F73A 3WI7A 3ZUPA 3HG7A 3GOHA 2C9CA 3BSYA 5AW2A 2C1ZA 2IHJA 1TK2A 3NV7A 4ND5A 5BQOA 2ZIVB 3RNOA 4EHNA 3H05A 2ZIWB 3CVVA 2N1BA 2PKQP 3TVDA 2BFAA 4LPSA 4RQTA 1MPXA 5G0VA 4DZTA 4RTOA 5LZ9A 1TKCA 4L7VA 3A9CA 1VPDA 1NJGA 4WZBA 5MDHA 2YMPA 4BMCA 1LGYA 2AFIB 2X8BA 3KJHA 1AKYA 1LDGA 2B2NA 3ZY6A 5ER9A 5JVDF 5LUBA 1GEEA 1Z0SA 2F8SA 2ZRBA 1TAHA 5IM5A 4O25A 1RWXA 4KYUA 4YXWA 2WEKA 3A6JA 3TXXA 4J7UA 1F8YA 2QIPA 1DIHA 2QVBA 3G1UA 4ZQHA 3RYHA 1QHSA 2QW0X 2X15A 3PQ5A 4LXQA 1Y8CA 2F67A 4LC0A 2WVAA 4K6CA 2YJNA 5LBUA 3HHPA 1W5TA 3K6KA 5CJPA 1R0WA 4FU0A 1MRNA 3FI0A 2EAUA 4QEZA 4BC0A 4HUTA 4GNKA 2C7BA 1I6MA 4ZT3A 1TVKA 2JLBA 3EASA 2HA4A 3GLGB 3IURA 3FCUB 3LGAA 5AKIA 4MDEA 3OUUA 3HEMA 1MFZA 2IEGA 2ET6A 2YV2A 4B3JA 2NO0A 1A0OA 1I0IA 5LOVF 1P7PA 3N1UA 4D3FA 4NBKA 4Y9TA 3DD5A 3FOEC 2PUBA 1PVDA 1Y82A 2C00A 3RJMA 3UXYA 2CFTA 4N8SA 4EG4A 4AKGA 1BFUA 1W8IA 2P1ZA 3D2CA 4BQFA 4E11A 4E32A 3C74A 1TM1E 4Q1AA 2Q21A 3GUUA 4AVYA 5AW6A 4TKLA 4ACAA 1JWAB 1SK9A 4HNVA 1EDBA 3GJ4A 3T0IA 1Z56C 221PA 3IUYA 3V1YA 5FPHA 3K1AA 1IUPA 4MIYA 1C0PA 1KSGA 1X80B 4WFJA 3RSQA 4BQQA 4NLLA 5H3HA 1F1BA 3DMRA 3IT1A 5BR1A 1WPQA 3L0SA 3LPMA 1EXDA 4QOGA 2ZYTX 3MILA 1YRQA 2P9FA 4HVTA 3L3BA 1T0PA 4R54A 5F7JA 1X38A 2ALJA 3AU9A 3LBYA 4F3NA 5HEKA 4YXWD 2GZHA 3I5XA 1KOGA 3BBPA 2GRJA 2AD1A 1UEIA 3AQIA 2E21A 3OECA 2HTEA 3H1TA 3WNVA 1AO0A 1SC9A 4YO8A 2GNOA 4O4JB 3R3YA 2CJWA 1W93A 1YE8A 2BOVA 3FWZA 4ZEOA 5I7WA 1N5OX 1EG7A 1IPEA 1Q50A 1R9NA 3WA6A 1W96A 4DS3A 4RH3A 3CLRD 3IBSA 2WM2A 4MP3A 2OQ2A 3F4LA 3HJRA 3HU1A 3PTAA 2JJ2D 2R7LA 2ECQA 2GHIA 1YZQA 4GYKA 2V98A 1L5ZA 9ATCA 3H9UA 2QBYA 2J08A 3I1YA 3PSHA 4BJ3A 1MRSA 5A02A 2CBXA 4IDQA 3H1EA 4JKYA 5AHWA 1HL7A 2IWRA 4N5LA 5AVVA 4RY8A 2VYNA 2XT9A 1VCOA 3KUXA 4MR7B 1M73E 1SBQA 2EBWA 5JZOA 4OGWA 2OESA 4YAEA 1Q2XA 3V2HA 1H8HA 3DKPA 3WFZA 1CUSA 1QCCA 4BRZA 4I4IA 3VSEA 1KEKA 2FWBA 1CEXA 4C07A 4MOWA 4XRGA 4O4HB 3FTCA 4DNOA 4UMFA 1U9IA 4B6GA 2AIRA 4Y0AA 1V48A 4ALNA 3THRA 1ZVMA 1GV1A 4EJSA 2H65A 3U4AA 4E3ZA 3D3QA 1GL6A 1GAEO 1T9ZA 2RHWA 1NLFA 4IOMA 4LZNA 4PPNA 2REXB 3P0JA 4C6RA 1YVEI 1K66A 1RAAA 4FZJA 2NU9B 3GRFA 3LYLA 1XC7A 5CIQA 3INYA 2X76A 1Y1QA 3G49A 3HKBA 1QVRA 2AW5A 5ALJA 4CG3A 5K4GA 2BRUC 1K5PA 2GEUA 2ACEA 3M5WA 3JCZA 3UHAA 2Z2ZA 4EITA 2CXQA 1T25A 1Z4OA 5EMLA 3W3AH 2ODEA 3Q7EA 4ZCPA 2PCJA 1TJNA 5ALSA 5DGTA 4JMLA 4LNUA 2VUHB 5EVJA 2ZUTA 3ZEAA 4JYPA 2AZTA 1OFTA 2O7RA 2GWHA 1HMPA 1F7VA 2G1KA 3QXCA 5KVQA 1E7QA 3TTYA 3KJZA 3ZTYA 2JJYA 1F2DA 3EISA 1MXHA 2I4LA 1Q3KA 3L6CA 5DU2A 4DDTA 3BWEA 3V1MA 1A4UA 1FQWA 1P61B 1NLMA 2CWWA 4D98A 3ADCA 1U02A 2ZYSA 1OH5A 1CUVA 4J0CA 1BSVA 1SO8A 2P2SA 2QUZA 1Z73A 4F1JA 3C3JA 1QYXA 3TM5A 2A9PA 4CJXA 2PBRA 1N2IA 1VG1A 3KYJB 5CEJA 3G2HA 4G81A 2ZRNA 1WW2A 5K3FA 5DISB 5JTTA 5FA5A 2C4KA 4I9UA 3I04M 2G67A 5FADA 3M9XA 2NZXA 5FV7A 3V4ZA 1E69A 3W90A 4HMQA 4JYBA 4C0XA 4EMTA 3JPWA 2EGHA 3EG9B 4OQFA 1X8JA 3SIRA 1C14A 2IK8A 5DP2A 1C0EA 4GWKA 2Y4NA 4R8RA 1GQ2A 2ZSIA 3WAJA 4KFUA 1PEKE 3AETA 2E4XA 5T7BA 2OCXA 3EFHA 3U5ZB 1H9BA 5CLGA 5CM2Z 3U7RA 1BFKA 3O4IA 4LE2A 4ER6A 4X61A 3M89A 3EN0A 3HY6A 2FOIA 4INOA 4LHXA 4GM1A 3LX4A 3ROZA 4KR3A 3QWAA 1H23A 2B4AA 1YC5A 5JECA 1BE6A 1DFGA 1EVKA 3UC9A 2Y4OA 1U3VA 1R0XA 1KZ6A 1O6GA 5AW3A 1A95A 1SXGA 3DM9B 4N5DA 3DB1A 2P9YA 3WZMA 5F2EA 4IEIA 1OBCA 2JAOA 1B3BA 4BQOA 1QVAA 4TYQA 3DHVA 3GLQA 4M21A 1S1CA 1S8NA 4BLVA 4JXJA 3N0WA 2FMIA 2P6MA 2VDRB 1II0A 1N6KA 2PZFA 3AP2A 4HQOA 3V7UA 5K8UA 1BHO1 4XWWA 1PR6A 2QT0A 3DBVO 1ZU5A 2C1EA 1YUBA 4A6XA 5KX5B 4JB3A 2ENUA 2DJIA 5KYYB 5GWXA 4RTJA 2DH5A 3HP4A 3JSXA 3OKPA 1MNAA 2E87A 4ZVQA 5JSYA 1VA4A 3P2YA 1N4AA 3UV3A 4BYMA 1IDOA 4OM7A 5F64A 2ZI3A 3LMKA 1TC2A 3ORYA 1TQ4A 2CNNA 1LF0A 2REQA 2Z5FA 1GZSA 2R6AA 3IEXA 4XPIA 3OJXA 4HZUB 1NW6A 3CY6A 1Q1AA 3T41A 4WBNB 4XUEA 1P5ZB 3MRSA 1A3CA 3OQVA 4BQRA 3Q7SA 4I14A 1C3VA 4LAFA 1E9CA 1I1OA 3AJAA 4Q9KA 4BNTA 3F8TA 4WACA 1Z39A 4CMCA 1JN0A 4HXEB 1W36C 2ZATA 1RJ9B 2PS3A 3ABOB 1WMEA 3VR3A 1U0JA 1NURA 3MAGA 1W9MA 4IDFA 4O1IA 3MMNA 4KPFC 3ZWXA 5TGTA 1WZCA 3MA0A 1K0UA 3AL0C 3IBCA 4QULA 1FX0A 2JLVA 1EK6A 2YS7A 2COKA 3D3KA 4O2AF 3EZLA 2XWSA 4KXYA 3IKLA 1NVBA 1P5FA 2R8PA 4MA4A 1TYAE 1I3CA 3CRRA 1ZM4A 2OCPA 2ETXA 4C06A 4P1ZA 4FB5A 2ZZNA 2CUKA 2HU8A 2XMCA 3LKZA 3R5FA 5GJWC 4JBXA 4NCHA 2G0NA 2W2LA 4MPJA 4PTZA 4WZAA 2O5CA 2RKWA 3QXJA 3TKAA 2GPSA 4RVUA 4QGSA 1YZLA 5K0JA 4TRMA 1XJQA 3LIPA 4JC0A 3WOVA 4B3CA 2OZEA 4LRWA 5LP6B 2ES4A 3TQOA 1KK0A 5DYIA 5AM5A 2PM8A 2BP7B 4MP6A 4MIEA 4R83A 1WU7A 2DECA 3O1HB 4BV8A 5DX0A 1TVMA 3ZY2A 1NVEA 3TTVA 3GFPA 3KZNA 5TXGA 2ZIEA 5K8TA 5JJKA 2ECOA 3N2KB 3T5AA 2YL2A 3NFRA 1JQ5A 3N86A 3E7FA 3DZGA 1GPWB 2PSJA 2V0CA 4OY3A 3WRWA 3GCZA 4I2NA 4HQRA 4EUFA 2BD0A 4RL4A 4RK5A 4F5DA 1GL3A 1P91A 2ERYA 3OQHA 4CU5A 1N9KA 4ILKA 1DDOA 3S44A 3EZ7A 3UY4A 2P3QA 4EO4A 2ZKIA 1E9VA 2EKPA 1G5HA 1DIRA 2FSHA 1T13A 1ZPDA 5FLKA 5EPUA 4EIWA 4DMMA 4YGXB 521PA 3ZK9A 2DLDA 1NVKA 2H4FA 1K3TA 1FVXA 4M0DA 1MB0A 2GM5A 1K5DA 2G9UA 2IOYA 4NBNA 1P1KA 1P3JA 4RULA 5ALRA 3WIOA 2XIJA 4EVQA 1T10A 1R9GA 4P0TA 3RJ9A 3NXSA 4J2OA 3P9ZA 5BV2P 1B0AA 5HJEA 1HQKA 1Y7HA 3MXTA 1VIVA 4QAJA 1MAVA 5EZYF 1KIFA 1GAXA 1VKHA 3HUFA 8GPBA 3L1HA 2W43A 1RHRA 5KOJA 1NXWA 5I8WA 5I9BA 1UBCA 1R12A 3A05A 3ETJA 4BFYA 4E1BA 4TYWA 3L07A 1UMDB 9MHTA 1TMYA 1G5IA 5KEIA 1SG0A 2I6UA 3BORA 3GGPA 4CODB 4EF4A 5J2UB 2FPXA 4J8PA 5DN6D 4M89A 1N3LA 4RGQA 5KX5F 4I5DA 4RXUA 1JS1X 1BMTA 1QOQB 3KB2A 2GNPA 4HGNA 1R8XA 1UFQA 2GJAA 2FPIB 2IW1A 2V97A 3CG4A 3CZQA 1JMKC 3I52A 3PFCA 1VCIA 3O7WA 4H3SA 1GKKA 1CZLA 1K1EA 2HZ7A 2RHGB 4O2BF 4X8OA 1IK6A 2CHUA 5C7OO 4ER3A 3PQFA 3ROFA 5EJGA 1NJFA 5AOCA 4PXSA 3AF1A 5D1NA 4UTVA 5LD2B 1PR4A 4XWYA 2E49A 2IEZA 4FGJA 1U8TA 1EUCA 2XEDA 3AEYA 2HQBA 3EC2A 3SDBA 3UHPA 5A04A 2ZRLA 1UUFA 4MCAA 1GL7A 4KWTA 4DYHA 2UYOA 3AUKA 3C3WA 3FW1A 5H02A 4CT0A 2QDKA 4H0FA 3WLTA 4GO1A 2R6GA 3V4PB 1V5GA 1X7YA 2ZVPX 2FK7A 4J0HA 3UV6A 4CM6A 3LBAA 2O0JA 4ZDIA 2XNJA 2ZT5A 2AG0A 1X80A 3EAGA 1IWPB 5EXDA 1ODTC 4LUCA 1A4XA 3HWWA 4L28A 1YKSA 3KNZA 3ZV6A 1KWKA 1L8XA 4RGYA 4C6TA 3S1SA 1NVMB 2Y67A 2H4JA 3RIYA 4U00A 4H16A 4V0RA 4Q4AA 2RI0A 3OEED 1SXJE 3LDUA 3PYMA 1F8FA 1N75A 2X1HA 3LP5A 4YNBA 3W5SA 2F1HA 1V7QA 1Z28A 4HGRA 1YJXA 4QPDA 5HRAA 1L8AA 3AVOA 1N6HA 3P32A 4INJA 4ZZ3A 4FWIB 2CFCA 3HYTA 2QD4A 1V2HE 4QYXA 2D5LA 3I32A 3I9V1 5FL7D 5IT5A 2AMVA 2E6UX 5TPWB 4D9NA 2FMXA 3L77A 3T0FA 5CLFA 2VSOA 3F3SA 4G0XA 1O96B 4IJVA 4OJKA 4NKRA 4Y2XA 2QTLA 3DT8A 4UNPA 1F3OA 4G5YA 1UC4B 1CY4A 1DKMA 1LTQA 4U2KA 2GMWA 1NJ6A 1D1QA 1JHUA 3GT4A 4HYQA 1ATZA 3CZ5A 3N6VA 3V8EA 3M33A 2OLEA 2V3CC 2AOUA 4M0MA 4F4CA 5DNAA 3C3CA 4DIUA 4EYOA 4L4SA 3BXXA 1MX9A 4EW3A 3CUUA 1L5HA 3EIFA 1REQB 1RKBA 3LBHA 4O0LA 3EXHB 3OM1A 1M2OB 1E2BA 1TW3A 1TRKA 1JKFA 2J3HA 4DQKA 4UUQA 3OOWA 5EEHA 2IX3A 5C4GB 1S96A 1SU8A 1ZD1A 4Q1BA 5FR1A 1FS5A 5FTMA 3VI3B 3ZGNA 1RJ9A 3ADPA 4U1RA 5T6BA 2I4MA 2SCUA 1E5XA 4DLSA 5L4LA 3HWSA 1YR8A 2WU1A 2PT6A 4ZMBA 2DU8A 3DOHA 1AXRA 1J56A 2FEAA 1YCDA 1HQDA 1DT5A 1RBQA 4ARAA 5CGZA 1QP7A 1E6CA 5IW8A 1HG0A 3CBQA 3TAUA 1V8DA 2D1QA 3IV6A 1Y5MA 2B37A 3B13B 2RK3A 2VJAA 2Y0EA 1GRVA 1SVMA 2D0IA 2QD1A 4G4SO 2ZCUA 3N75A 1FU4A 3WGQA 2XCSB 3QUSA 1I80A 4D74A 4ZPXA 1XXHB 1N4DA 5KIAA 1H2FA 1M76A 1GR0A 2W93A 4K6FA 4BV9A 1MIOA 2FMUA 1NJ2A 4B0OA 4QHSA 3VA7A 3KB8A 1JAHA 1EK5A 1X13A 3FFBA 3GUZA 3O8QA 1SHZA 3CVYA 3QWHA 1J8FA 1Q1QA 5MN4A 1HE4A 2NSYA 1JZSA 3CXUA 1ZG3A 2J9GA 4GZMA 2F55A 3QXHA 4UULA 2QZ4A 4DIOA 4ZEWA 4GICA 2B1JA 4GPIB 4NH4A 3SF8B 3MJ4A 4BV3A 2Z6AA 1OXXK 3OF3A 2TYSB 2P77A 4AZ3A 4FFDA 2JIBA 5JDCA 2H29A 2V7PA 4IHJB 1FDUA 4RTRA 2FPMA 3R5XA 2HJWA 4DJAA 2HCBA 3K9GA 4ZFNA 1OLUA 2F17A 3RHTA 5AUNB 2CC2A 3O38A 2Y99A 1T9KA 3WLIA 3ZHZA 2R48A 4C3UA 1EHIA 2HX1A 1GU0A 1V11B 2AX4A 2JGAA 3CX7A 3OZ7A 1MABA 4QPJC 4Z8YA 5TQ2B 3TG2A 4WOCA 4DG5A 1D6SA 2VSNA 3EFBA 2BR5A 1PBNA 3A3PA 1QR6A 3O2QB 1O77A 3BEOA 4INPA 1ZNYA 2V55B 4O4LF 2JLSA 5B37A 2VK8A 2BJVA 5G2OA 5BRNA 1NYLA 3LY9A 5DTEA 5EIWA 3LNCA 2UYHA 2PUFA 5TMPA 5JSFA 2ZETA 3KWLA 3ULKA 1QBGA 3OTQA 4KL8S 4BN0A 3A6FA 3TLAA 3E7PA 3VR5A 1VDMA 4WDQA 4N3CA 3DE7X 2GCPA 3AKZA 3FAZA 5E4FA 5EL0A 3HJBA 4GR9A 3H1PA 2UVDA 4IHKA 3RWMB 2M1XA 1XVAA 2DFNA 1GILA 1IYZA 1SCQA 3C8DA 4YY3B 2WAAA 3FUXA 4V0OA 4B3RB 5HRUA 4OM8A 3ETLA 4CL8A 5HWSA 1VRWA 4RVCA 2BZ1A 5C5EA 4Y2RA 3ZGYA 3U7FB 2QP4A 3K05A 1BAPA 1E1QA 4FJ0A 3C85A 4UVGA 2IP4A 3M6XA 4QU8A 3H0EA 4PCUA 1JJ7A 1NRIA 3EVZA 4HGOA 2GF2A 4JOBA 4KN5A 3TGPA 2OZLA 3MJFA 2JA1A 2PSDA 4W1PA 4CCYA 3PQ7A 5EINA 5M34A 3BGVA 4PWZA 2X9LA 1UPUA 1G9TA 3UAZA 1Z7YA 2G40A 3B1FA 3D6MA 4DWVA 1JALA 2KE5A 4F9TA 1ILEA 2WTNA 5BSUA 5K3AA 1KZ1A 2RFLA 4F4IA 3EHEA 4FDMA 1BWRA 3WIDA 2MHCA 2WZQA 5FDFA 3DFMA 1LDYA 1NOJA 2ONYA 2ZJZA 2ZOSA 3DBRB 1U7DA 1H1LB 1ND6A 3I9LA 3GLTA 4FFVA 2Z08A 1B26A 2HIGA 5A4KA 3KZKA 4RD0A 2DCUA 3ECCA 3I01M 3OZFA 1CJBA 4LF7B 3ZWBA 1FXSA 5GVSA 3G89A 5FJJA 3RLIA 5JFTA 4OOEA 3RABA 3ZE2B 5IAOA 4UUPA 2VDMB 1TYDE 1U1CA 3DVLA 3V4FA 3A6LA 3W9YA 1MW9X 4FDLA 2OV3A 1KYWA 4FFOA 2ZSHA 3UJHA 4BNZA 1G17A 3W77A 1W6RA 3LTEA 2PE5A 1CQJB 2QNIA 3K6RA 3USES 4G9GA 2HSZA 1X7DA 1P1RA 3MUFA 3H9CA 5AKXA 4IXMA 1JR3A 3KJIA 2ZTVA 4Q4JA 4J9VA 3PC8A 4D46A 5J43A 2OHHA 3VKWA 1KMCA 3LC1O 2WJHA 5HM6A 1KRWA 1IUKA 1L1QA 3Q2IA 3WJ7A 1HQCA 3F5SA 4E5NA 1DZIA 3BMNB 1JHOA 2ZYHA 3G9TA 1SKYB 2D4HA 2DPHA 4JC5A 4M1MA 4D6XA 2DVMA 3EXEA 4Y0NA 2HF2A 2YUTA 1GIAA 3CLKA 3CCCA 3EEIA 1KE2A 5IDXA 1YRYE 2ZE8A 1QJCA 1WQ3A 3EXFA 4LRTB 4OVKA 5JD6A 5K5EA 3BGOS 3LXMA 2W8BB 3C43A 5AVJA 1SQ0A 3COPA 1JP7A 1SB8A 5JV5A 3FNGA 2A4MA 4X3OA 3GWZA 2X7XA 3VC2A 4I50B 1O87A 1CP3A 4HDNB 4IHAA 4XVUA 3KSBC 1G20B 3X43A 1YFKA 3MB5A 1ULZA 3ILXA 4BIIA 4DHEA 4OI0A 1Y6RA 4XCQA 2B4TO 3ZGOA 2WZBA 1OAKA 1G7SA 5KNCA 1XV5A 2YIMA 2BEVB 1VJDA 4C88A 3VNSA 4BNFA 1PFGA 3EQ2A 1VPLA 2C9OA 3DDUA 3L7CA 3U19A 2PYZA 3T3DA 2EX4A 5DHTA 5JPCA 1YJ5A 5JH7A 1J7JA 3HH8A 3WQHA 5EHZA 1SKQA 1PL8A 2A9KA 1PX0A 2GN9A 3Q10A 4U7DA 4UOZA 4B17A 1Y80A 2GN1A 4XAQA 4E08A 4A2CA 4QUAA 5I7HA 5CDFA 4J29A 4KXXA 2R68A 4B82A 3KEQA 3L5KA 3W5DA 1YRHA 1ZS9A 4NHOA 1YC2A 4RZXA 4FCWA 3VOBA 1Q0HA 2XPCA 1P4GA 1JHDA 1ABEA 4ID9A 4Q4AB 3ABSB 1SULA 1T1IA 1PQWA 1CR4A 1FYVA 1K4MA 3WMFA 5BNTA 3W2GA 4BFWA 2Q9BA 4FEAA 2FSVC 2YWHA 5IYZA 1THTA 1J07A 1U7WA 1H2WA 3GJXC 4M6WA 1QG2A 2HK6A 1DADA 2HLDD 2Q1YA 2RHMA 4FC6A 4OBXA 1D9XA 4WTOA 1RYZA 2B5WA 1Z6AA 2Q1XA 4GEKA 4HGQA 1R0SA 3WC4A 3ZZMA 1QZUA 3H11B 3R3ZA 1PJCA 3GQBA 4CG0A 1ZW1A 4JMPA 4DEYA 4B2LA 1Y7PA 3GVCA 1TJPB 2ZZKA 2X7HA 5KCZA 1ICEA 2ZVJA 3E9QA 1NJ1A 3HSKA 2QRZA 1F12A 4FE3A 4XB2A 2JARA 1EUCB 2R85A 5HE8A 1GZDA 3VKHA 5IMSA 2YC2C 2CLIB 2ZVDA 5ESXA 5FLXA 5KO2A 3BILA 3FUTA 3GUHA 4JVMA 4KIFA 2EQBA 2OY0A 1QHEA 2A0WA 4AXBA 1EX6A 1OPXA 4PQFA 2Q7XA 5DGXA 3QI7A 5GONA 4QNNA 5EZ6B 3ZGLA 3MJCA 1JBKA 2AFHB 4AY3A 1FP1D 2JGDB 4I6JA 3W6PA 4DE5A 5JSUA 4RORA 3H84A 4HG2A 5KSWB 5C52B 5IAGA 4KPEC 2CXUA 2OV8A 2Y6VA 3HRHA 4L3OA 4CLDA 2CL0X 5BUQA 5IASA 4IIEA 3AXTA 2FRDA 2P9BA 3ITEA 4PFQA 4JLUA 1H93A 1QM5A 3GAMA 4GAEA 1L6RA 1UMDA 4KIJA 4C0WA 2OAGA 1BGWA 5IFLA 3VR3D 3F6CA 3PWZA 2NU7B 4FMDF 2KLBA 4AN4A 3D7MA 3HCAA 5I48A 3IE1A 3CLVA 4DLAA 3ET5A 4H7KA 1O94D 4JWTA 1VDZA 3QJGA 4OJYA 5CYOA 3B38A 2Z3WA 1GPAA 3PIDA 2JANA 2PAFA 4KUEA 2G83A 1PFVA 5T57A 1OFHA 4MB2A 2O8EA 3H13A 2FN8A 4AN1A 3VTFA 1W0JA 2FSPA 2YWXA 4MW1A 4X1OA 3TZQA 3LL7A 1GPNA 1P0CA 2W6JA 4REOA 3REFA 4YRIA 4Z4HA 5LOVA 1PVVA 1K7FB 1A9TA 1P5RA 4RHXA 5IANA 2V5UA 2NT4A 2NVOA 1V45E 2O4UX 1JQDA 5EIHA 2FRVA 2AZXA 2QV0A 1YBFA 4GGPA 5C3UA 2REBA 1FRZA 4G4SP 3SYNA 3DZCA 1ZR4A 4DMFA 1E5VA 3OU7A 3I9FA 2DKFA 2XYGA 3AHIA 3Q3VA 1U3DA 1UT8A 3PEUA 3KEMA 2HWYA 2WTMA 3UK2A 4D6PA 1HKHA 2XUZA 3E4DA 5JRJA 1K75A 4IZIA 1O9HA 3NIBA 2ZYUX 1Z15A 4WOKA 4JKIA 1K6MA 2ID7A 3RJTA 1FMCA 3I2KA 1RRVA 1XZAA 3ZE7A 4G01B 4HY3A 4M6WB 4EW1A 4MUMA 3O4GA 4PNHA 2VHWA 5IH3A 1XN1A 1DCFA 3F67A 3ZNOA 3JAMA 1ZK1A 5KNBH 2ZXUA 3QWIA 5DNDA 2D4AA 3HXOA 2IHBA 5FPKA 2FR0A 2NU6A 2B20A 2V7QA 3BQ9A 1NQAO 1EDZA 5J2TF 4D4GA 1Y5IA 3FDXA 1RWOA 1XZHA 2Y1EA 1K68A 4JLKA 1OC2A 3LZ6A 2QTVB 1E1CA 2NTYC 3EGCA 3OQIA 3OIYA 2W22A 5DXFA 4LFCB 1HO3A 1UPAA 4DDVA 1ZI9A 2I6SA 1J22A 1Z0IA 4UBNA 3UMVA 4ZN6A 1EP9A 3GLHB 3I6BA 2CUZA 2YYAA 1IHUA 3T3EA 4IUDS 2PEZA 2C5SA 4HQ0A 4HPJB 4W8HA 3N76A 4Y2GA 5AW0A 5GM2A 4KODA 4NP6A 2P6PA 1X7XA 3H9GA 1U7XA 2ID4A 1IHYA 3G68A 4WK6A 4RVDA 5CX4A 4PYJA 1Q6ZA 3QKSB 1XVVA 4NEQA 3LY8A 4OLAA 3RSSA 3MWDB 4H6VA 1EB9A 1NZJA 1R1DA 1TKBA 1U1FA 3DKRA 4BTEA 3OMWA 1M33A 2X41A 1F9AA 3EXG1 2F1RA 3BHJA 4V3CA 4FWTA 1XCBA 1GGJA 4V1CA 2NAPA 3V4VB 4F45A 3A37A 1R64A 2WAXA 4MWOA 4XWTA 2NXNA 2F7SA 2X9VA 3OY2A 4NYMQ 4EKEA 3SR3A 4ZJUA 3L49A 3NHLA 3C3AA 5BYKA 1ATIA 4YRQA 5ARBA 1IBMB 4XXHA 2DZDA 3VJRA 1II9A 1Z6TA 2OCIA 3E05A 5KTYA 1SXJB 1GTG1 1XXHA 4R8MA 3IJEB 3TZ6A 1CETA 3T1YB 1OF1A 2R751 3KQNA 2AOTA 2CLSA 4P92A 2E5WA 4ND1A 4TS9A 1UIRA 2IYWA 3UOGA 4Z49A 3RVSA 4RXMA 3SHOA 2Q3EA 1QHNA 1GTSA 5L3QA 2QVZX 3SR0A 2Q1WA 4BMZA 5AWFC 4MJLA 1Z5VA 1QDUA 2PZLA 1KQ3A 3HHEA 1Z0KA 1AB5A 4ZAGA 4EF5A 1JWLA 1HDYA 2B4YA 1N5IA 1FRFS 2DFPA 1GYQA 1BVUA 1MB9A 2G07A 5HDQA 1CY1A 4OJNA 4WL0A 3IT0A 3BC1A 4GOOD 1HE1C 2D1YA 2EGGA 1QV9A 4MQ4A 4P4UA 4H08A 5CP8A 2AB0A 5ENDA 3DTNA 3WBJA 1EZZA 1D4ZA 2G04A 3ELBA 2EEPA 3K9LA 4OKSA 3DMTA 2BVNA 4IWYA 1ULTA 3FLBA 5CB0A 3HVUA 1N2OA 2XNKA 1SVWA 5LKRA 1RQ2A 2RJ3A 3HB9A 1G8YA 3I01A 3NHAA 1HE5A 2CYCA 4TKMA 5LWQA 3O5AA 1KQFA 3UXEA 2ZR9A 4IIUA 1OZGA 3GFOA 2BUAA 4HQFA 1LZLA 1U0SY 2HY7A 4FONA 1XEWY 3RG8A 4JP2A 4CMEA 1NRXA 1D6JA 1TUBA 2C29D 1EM8B 1XCJA 3I9JA 3KKMA 3QMVA 4I8DA 1QSGA 1TJ3A 2PKWA 2GLUA 2CVFA 4YUYA 1DMRA 1QB7A 2D06A 4MKXA 3CLSD 4QOSA 3SSNA 2YXEA 4N0MA 4WFKA 4ICIA 4ZZ0A 1SQFA 2YOGA 3FMOB 3PC6A 4KYIB 1NG1A 5D8DA 3AWIA 3LNTA 2AXPA 3EDOA 4PGFA 3A9WA 2Z8YA 1H3EA 2YUIA 1ACLA 5F21A 5CPFA 3AP1A 1PIWA 4RANA 2E18A 2JAQA 3LYUA 3NDPA 2HA6A 1E20A 3SX2A 4HAOA 1FS6A 3GGDA 1F38A 4LOIA 2KBFA 3HTXA 1IMJA 1WKCA 2YYYA 1FFWA 2AHRA 2C77A 1AN9A 4MIOA 4O59O 4RF3A 1LSSA 1P3DA 1CZKA 2GXAA 3PQEA 5AH0A 4I7EA 4PTLA 1S01A 3UT0A 2I5PO 2EZ9A 1S2IA 4QHYA 1R0ZA 1YTUA 4I3GA 4P4GA 1XLTC 4P81A 5JAIA 1DTSA 1T0IA 5ITZB 5KAPA 4Z1MA 2NX2A 3F47A 5E9JA 1CZRA 1CB0A 2RHTA 1OWPA 4M3NA 4MQBA 1E4EA 4IQ8A 1WB6A 4KQWA 1EK0A 5F1KA 1TU3A 5DBIA 2QUIA 2O8FB 3MS7A 3N70A 1QIMA 4M0CA 4F84A 3HSSA 4TTPA 3ITKA 2HFKA 2ZUCA 2JL1A 1ECCA 1V39A 4DPLA 5EE9A 2FGKA 2WF5A 5A06A 5F7OA 1H8EA 3R4CA 4Y6OA 3JD1A 2BHLA 1E8MA 1RXCA 3WWYA 4JOCA 4MCHA 4ENTA 3HE3A 1D9ZA 4WJKB 5DVZA 1D4AA 2Q07A 3QELB 5BUZA 3B6IA 2I55A 3RFTA 2V65A 3K9WA 2H31A 2IOFA 2RBKA 4WESB 5AR1A 4ZWNA 1HOXA 3UUGA 3ZHXA 2ZR7A 4CR6A 1CRLA 2BW0A 2GI4A 2PLRA 3GMSA 1EZ1A 3UJPA 2DB3A 3JQCA 2F48A 3MAJA 5KTTA 5HCNA 1D3AA 4P33A 3T3NA 2E89A 3PK0A 3VVLA 5JD4A 2HQOA 1I8TA 1UMBA 4BJ5A 1T2DA 2EJCA 3CINA 3T7SA 5CEFA 3MOSA 4RABA 2HMWA 5AW5A 4NC9A 3ZQ4A 5CLLA 1M7HA 3T15A 4GSYA 3N87A 3WJAA 1MP0A 4FW8A 5KOHA 1Z6ZA 4ZPJA 1E7YA 3ZH2A 1OI7A 2NVWA 3LLMA 4YDRA 1T34A 3V1NA 2WILA 2DBVO 2ZWMA 1KPIA 1JJFA 4Q12A 4FHDA 1DUSA 1DX6A 4UJ3A 1EB8A 4D44A 1B42A 1BXKA 3U4MA 4Z2YA 3OOJA 4LSZA 2PRJA 2ZJ8A 3R7WB 5EN4A 2YMQA 3L1IA 4BJ6A 3AY0A 3TSAA 2WQ6A 2QRNA 1PT8A 1WW8A 2QLFA 3FMPB 1EP2B 2HSGA 4KV9A 2Q0SA 4RBNA 3AV0B 3WDKA 1L7AA 2BTQA 1VJ5A 4RZQA 1JBEA 2VBGA 2OHFA 3NBQA 4URZR 1U3WA 1KQOA 4GE3A 1J7KA 3NDJA 1C1XB 4QLOA 3E1GA 4WCDA 2MSKA 1RW4A 1BCSA 3H83A 3MFYA 3TE6A 3FWPA 4L4RA 4LDRA 1Z17A 3TLZA 4QZVA 3GAAA 4HNAA 3HBFA 4LWZA 1E2PA 2EU8A 3JASA 2DY0A 4MWEA 2QMEA 3UB4A 3ELUA 5FTWA 4FSHA 3GEDA 4QO7A 1IEWA 4V0KA 3MCUA 3OT1B 1JSZA 2G1AA 5LP6C 1T8PA 3JQ6A 1CQIA 4TVSA 2Z3ZA 5A05A 4MRMA 2WTEA 4YQYA 4FYHA 3RADC 3TNJA 2FWPA 1BD4A 1RWMA 2QL7A 4UHKA 2Q1UA 1P7ZA 4N3GA 1UK8A 1RPJA 3AUSA 4WKBA 2QTWB 3U31A 3HCOA 3K09C 4MA0A 2Q46A 3D3JA 1ORHA 4HFJA 2PQ2A 2J3QA 1C5KA 1KJYA 1YQDA 3DF7A 4IHJF 2ON6A 1ADYA 2NUAB 5AVRA 4DCTA 1JDBC 2HU5A 4YI5A 4EP1A 4RUKA 3TGLA 3TRIA 3L6EA 2YN0A 2OYRA 2QMUA 621PA 4MROA 4AXXA 3UAXA 3V8MA 3O0DA 4PYOA 2GBFA 4WOBA 5CA0A 1SRRA 3AYZB 2Z57A 1MV8A 3N9IA 4YCSA 1U04A 5A5FA 7ABPA 2CFRA 2FPRA 4OF4A 1G8JA 5AQEA 5AKJA 1QU3A 3JQBA 5IZCA 4P5PA 3QPVA 1D1TA 3E70C 1JPVA 3QFHA 1WBDA 3JD0A 4CCSA 4OATA 2W8BA 2H16A 3DLTA 1RYMA 5F7ZA 2E6KA 2ORYA 1ULSA 2ZBVA 5HF8A 1PGQA 2ZSUA 2H8GA 3M4XA 3AB8A 3LYHA 1UMBB 4WOJA 2B8JA 2GXUA 2WWRA 2XDQA 5HMMA 1CK4A 1LPSA 3WGJA 4BLUA 1OB5A 2PT5A 1PYGA 3DJYA 4I1IA 5K0TA 2I6GA 5DCWA 3IVAA 1Y8AA 2VJQA 3QW2A 5LDHA 2I3AA 3F5MA 4PS0A 4GR4A 1YV9A 3TSCA 2ECPA 3Q5GA 3GLGE 1UMCB 1OH6A 4OGLA 5B2EA 2CXHA 1SCIA 3HKDA 3VAZA 5BWNA 2MCFA 2J46A 3LQFA 3TMAA 4AURA 4WLVA 3SZRA 4A73A 1AXEA 3MTGA 5D51S 2VO1A 2OXIA 3T9BA 2OV2A 3AXSA 1QB8A 3R3JA 4EEZA 4MLZA 5CJJA 5KMGB 5DI9A 1YVPA 1ID8A 2PD3A 4G25A 1U0LA 3B6KA 4GKVA 4PW0A 3HU2A 4R9SA 1CHNA 5BVHB 3ISJA 2D8AA 1UBUS 3D8BA 1D0SA 2IRWA 2DFKB 3DULA 5JADA 3IMFA 3RLFA 5LU8A 1DRKA 3R5HA 3P94A 5EJ2A 3UCXA 1C4OA 1DG3A 1SD1A 3IAHA 3SKVA 2YIJA 1P6XA 3EIQA