4X95A

Crystal structure of fully glycosylated lysosomal phospholipase a2 in complex with methyl arachidonyl fluorophosphonate (mafp)
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
375
structure length
375
Chain Sequence
b'HPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Group XV phospholipase A2
publication title Structure and function of lysosomal phospholipase A2 and lecithin:cholesterol acyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 124
structure length 375
sequence length 375
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02450 LCAT Lecithin:cholesterol acyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4x95A01
5ALNA 4GECA 3E0XA 2QVBA 4YPVA 1ZGCA 5BWCA 1IZ7A 3AZQA 2QJRA 3WJ2A 1SOMA 1UK9A 3K2IA 4LYDA 5HZGA 3N2ZB 1MTZA 4X7BA 4L0CA 3STYA 2DSNA 3BXPA 5A71A 1CUIA 2WG0A 4KJXA 1G66A 3PF8A 1FFDA 3I6YA 4AB1A 3BWXA 1YB7A 1Q83A 1QTRA 1P0IA 1XRNA 2XMZA 1EA5A 3QITA 4J0JA 5AKLA 5C8XA 1UT6A 3G0IA 1GQSA 2GZRA 5T4EA 3W04A 1L7QA 3OURA 1S8OA 2RHWA 4KAAA 3SWWA 5DNVA 3NUZA 1Q84A 2HU8A 2JGIA 4PV7A 5F4ZA 1C7IA 2WSLA 3HLKA 4BZZA 3GELA 3CN9A 1H23A 3ESBA 3A6ZA 5JYCA 5I7UA 3D5EA 5ALPA 1WB4A 3L1HA 4ZXFA 5AKIA 3WIBA 1THGA 2W22A 5CXUA 3T52A 1X70A 3DCNA 4UBKA 4B85A 1YCDA 1MX1A 3M3DA 1Z68A 4BCBA 4ZV9A 4ARBA 1YS1X 1PFQA 4BC1A 3T4UA 2ZJ6A 4J0GA 5K3FB 5DYTA 5JAOA 5CT5A 3R3ZA 2HA3A 1VKHA 3EQ8A 1HKHA 3RM3A 4V2IA 1HLGA 3ZLVA 2C0PA 4QLOA 3UUFA 1UWCA 5BV7A 4CIBA 2HA5A 3QM1A 2GBGA 2WUFA 1CR6A 4P9NA 5LZ9A 4GEGA 2YH2A 1DQZA 1W6RA 3R3XA 1WHSA 3C5VA 1DQYA 5T4FA 1XQYA 4D9JA 5JASA 1EXWA 5EI5A 1Y7IA 4OB6A 1QIGA 1HL7A 3YASA 2C5FA 1K5PA 1IUOA 4KE9A 1XLWA 3BL8A 3G9UA 1QIEA 2GZSA 4QDUA 5EHXA 1ZI9A 4XX1A 4OD0A 3HJUA 2CMFA 4E15A 4Z49A 5H3HA 1YASA 3A70A 5K3BA 2OQIA 4K6KA 4KR0A 3IUQA 1Q0ZA 1GPLA 3OM8A 1GPKA 2Y6VA 4U2GA 1MJ5A 2RAUA 1FFEA 4RE6A 1GKKA 4ITVA 3WL6A 4UBNA 3RLIA 1YB6A 1WCYA 2ZYHA 1LPBB 4H7JA 1AGYA 1DINA 4OU4A 1XZIA 4B80A 2IX9A 4N8EA 1F8UA 5AK6A 3W9UA 5AI0A 5ALDA 2I03A 4DLNA 2ZVDA 5AI5A 4Q34A 5IVKA 4LHEA 1EHYA 5ESRA 2XT0A 4YK7A 2XMDA 5JAUA 3HEAA 5FKJA 2C0QA 1JJBA 1G4HA 3G9ZA 4OUKX 1SCKA 2VT7A 4DSAA 3D3NA 5ALUA 2OGZA 5CT9A 4Y2VA 1QO7A 4HS9A 1XRPA 1XLUA 2VF2A 3BJMA 1VZ3A 3VDXA 1QONA 3GBSA 2ZJ7A 1CEXA 2I3ZA 6YASA 3IUNA 4Y2RA 3WQHA 4LYEA 3STWA 4JYPA 3GA7A 5SYMA 3V9AA 3G9XA 2O7RA 5SYNA 3PI6A 1YAJA 1KEZA 1SCIA 2QZPA 5FRDA 3FYUB 3A2NA 3OOSA 4UHBA 3KD2A 5FUMA 1FFCA 5HQ3A 3FCXA 2WFLB 3PFBA 3FVRA 5JZSA 1CLEA 2WU4A 1J06A 4KAJA 2NW6A 2XUHA 4X6XA 4F60A 2WFZA 4NMWA 4B82A 4G9GA 3WK6A 4OYLA 3H2GA 3N0TA 4FMPA 2WJ4A 2R11A 3K6KA 4M0EA 3ZI7A 1BCRA 3A2LA 4BRZA 5DTJA 4QDOA 2VAXA 1XZDA 2VJCA 2OCKA 1NU8A 2HFKA 2JGLA 5FLKA 4JYMA 3AJAA 1QFSA 4H7IA 1A7UA 1QIIA 3I1YA 3IA2A 3STTA 2BKLA 1JU3A 2XLCA 4QLAA 4W1QA 2QJWA 4DMHA 3I2JA 4PQEA 4DMKA 5AOAA 2B61A 3PDCA 4IHAA 1LPSA 4Y7DA 2OCLA 3WMRA 3QPCA 1DTEA 3ZLUA 2QXUA 1VE7A 1P0MA 4Q1VA 3GUUA 3ICVA 2AXEA 4UHDA 5DYYA 5CT8A 4G4JA 5JIBA 4UHCA 3S2ZA 1CUGA 4DIUA 1RWQA 4BDSA 1JU4A 1XRQA 2ZYRA 3V1LA 4UHHA 2CBGA 2XUOA 2WUDA 4OYYA 2HDWA 3FVTA 1LPOA 2C5GA 1TKRA 3V1KA 5FDFA 3QBJA 5ALKA 1CUUA 5AM4A 1G5FA 1BN6A 3EQ9A 3ANTA 5IVIA 4WFJA 2ROQA 1TAHA 3MVEA 4Q3OA 5JALA 3KDAA 5AKKA 4KEAA 4WDRA 4HXFB 5EIEA 1JT2A 3R3WA 2O7VA 3AIMA 3F8SA 2WTNA 4IH4A 4G8CA 2RGUA 1CQZA 2J3DA 1JJIA 4AZ0A 3H2HA 5AH0A 1EVQA 4H77A 4U2BA 2XMQA 5I8PA 4B6GA 2QR5A 4EY4A 3VJMA 1SCQA 2PX6A 1MAHA 3OPMA 1LZLA 4FNMA 1LNSA 3DOHA 4E46A 1TCBA 1WB6A 2EDAA 4P08A 1N8SA 5JARA 5AK4A 3QMMA 4KAFA 1CUSA 1MT3A 4UUQA 5FV4A 4H7HA 1PJAA 3AUKA 4EHBA 5ALFA 5HF9A 5LKAA 4HRXA 3S8YA 3FNBA 4BVJA 4UBIA 4A5SA 5LKRA 1QJ4A 2G4LA 2XQJA 1UOOA 4J03A 3IUJA 2XMSA 4MEBA 2YYSA 1UK7A 1E8NA 1BCSA 3UUEA 3WYDA 3FYTA 2DQYA 4JNCA 3PICA 3FYUC 4X6YA 4BATA 2WTMA 3SK0A 3DJYA 3LIIA 3MUNA 4KRYA 4Y2SA 5LYYA 2UZ0A 2QM0A 1L7RA 2XB6A 2WQZA 4HTAA 4BP8A 5AI4A 3WKDA 4C01A 3C6YA 2B9VA 3KSRA 4E11A 2XE4A 2CZQA 3HRHA 4JUIA 3F98A 2ZYSA 4N8DA 4WDQA 2B20A 2WHQA 1XZFA 3DL7A 4H7EA 3Q0TA 2QOEA 3WA7A 5JD4A 2VSQA 2XUIA 4KE7A 3WZLA 5CMLA 1CUEA 5K3CA 4O08A 5AI9A 3D2CA 2XUJA 4GDMA 3PUIA 3M81A 3C87A 4JH0A 5E4JA 2V97A 3FSGA 4OB8A 5ALHA 2AJBA 2YXPX 2Z3WA 1XRLA 1XKLA 1R50A 4CG2A 1A88A 4C4XA 1EB9A 4U2EA 3WI7A 4FLMA 2G63A 4B9EA 1MO2A 2OXEA 1P0QA 1XZGA 3P2MA 5EIAA 3GFFA 1QFMA 1RYYA 2PKYX 1W76A 1GT6A 2JGMA 4WFKA 1GZ7A 1C7JA 1JI3A 2PUJA 2G5TA 4BTLA 2WIDA 2Z8XA 2DHDA 1WPRA 4XVCA 1AMNA 4PF1A 1W52X 5ALZA 4EY7A 1ACJA 4C4YA 1CUWA 2QKYA 3STXA 2X5XA 3LS2A 4C6HA 2HRRA 5AKZA 3PF9A 2BCEA 2O2GA 4G5XA 4N5HX 4G1FA 4AX4A 3IDAA 5DTIA 2PSEA 4HVTA 1K4YA 4Q05A 3Q8WA 3WWPA 3VISA 4AO6A 1QIDA 3ED1A 3WL5A 2VEOA 3WKAA 3FLEA 4UFOA 5AKYA 2RHTA 2OGTA 3TEJA 1A8UA 1WHTA 3FOBA 5DNUA 3C45A 2Q0XA 1ACLA 4OSEA 3G0CA 2OGSA 4C88A 1OILA 3WWEA 5HK8A 2YASA 4PSCA 3HYSA 4P93A 3WL8A 2JEZA 2HU7A 3O4JA 1CUCA 1EX9A 1XZEA 5D6OA 5AM1A 1CUAA 4ZWNA 5AKJA 1CUZA 4QDZA 4BE9A 5CXXA 1QIKA 2XUDA 2PBLA 2XUKA 4QEKA 1O6GA 1DWOA 3ICWA 1DT5A 3G8YA 2HRQA 4DNOA 3R41A 3DNMA 5K3FA 1GGVA 4DNQA 4H7FA 4BCCA 3QH4A 1IUNA 2WIFA 1MX9A 5CTAA 1ZD3A 4FNGA 3LLCA 4GLBA 4OCZA 2RIPA 4QNNA 4C89A 1H2WA 5FPQA 1N5MA 5AIBA 3QZUA 4AQDA 3PE6A 3LIPA 3H2KA 4BCDA 3FLAA 4J0DA 4X94A 4S0XA 5CT6A 1T2NA 3WA6A 2GYUA 4FFVA 3H18A 2H7CA 4X95A 2FJ0A 4QE3A 4KE8A 4G8BA 1H22A 3VXKA 5AK5A 2AJ8A 5KREA 4PNZA 2OAEA 1JMYA 4LXGA 3AIKA 2LIPA 3O95A 1THTA 5EHNA 2ORYA 1EB8A 1XZBA 2QUAA 1CVLA 5LP1A 4GW3A 4J0CA 3RARA 2Y2UA 1XFDA 2BGNA 3QVMA 5ALYA 1XZCA 5IVDA 4EUSA 2HA4A 3G02A 2WG2A 1J07A 4M0MA 1EDEA 1FFAA 3AFIA 3AILA 5DWDA 5T4BA 1T4MA 5A7HA 1B41A 3IULA 2WHRA 3AIOA 4UFNA 4AO7A 4MWTA 1WM1A 4HXEB 1IUPA 5AM0A 5EHZA 2OLEA 5AO9A 3V48A 1JMKC 2CUTA 3O4IA 3JWEA 4PW0A 2P8SA 5FXMA 1W4LA 2WHPA 4HRYA 4G4GA 5AKEA 4AZ3A 1YAHA 2D5LA 1D07A 2WHPB 2XQFA 1XRMA 3O0DA 4ZREA 2HIHA 1CFJA 3W06A 5BOVA 3HABA 2Z5GA 2DFPA 4WJLA 4KRXA 1LPMA 2EDCA 3H2IA 4H7KA 4X00A 1QZ3A 4BZWA 5EIHA 2BJHA 1YS2X 2VTVA 5HF6A 2DQZA 1F0NA 4CCYA 1U4NA 3PFCA 5JD6A 5E2IA 1F6WA 4CCYB 1VOTA 5HFNA 2JGFA 4XWGA 4EY5A 5LZ8A 3HSSA 5FPPA 4Y2YA 1H2ZA 3FYUA 3C8HA 1ODCA 4BTVA 2CKMA 3U0VA 2BUAA 2QS9A 2WILA 5K3AA 2RONA 3K9BA 3DD5A 2WFLA 2B4KA 1TQHA 2AJLI 2HA2A 4YX9A 5A7FA 1I6WA 3B3QA 2BGRA 4XJVA 4G4IA 4U2DA 4C4ZA 3KWFA 3E3AA 4UHFA 2QMQA 4TGLA 5ALEA 4F5ZA 1K8QA 2JGEA 4G8DA 4X3CA 2ACEA 3NOXA 2HHAA 4ETWA 4P92A 4DM7A 1ORVA 5A6VA 5LZ4A 4FWBA 2XUAA 1MNAA 4FHZA 3CN7A 2WM2A 7YASA 3HI4A 1HBJA 3RKSA 3F97A 4QWMA 5AK3A 1K6EA 4Y2XA 2ES4A 3ILSA 1B6GA 4GBGA 2BUBA 4W1RA 3H19A 5ALQA 1GPNA 3STUA 4EBBA 4BDTA 2DHEA 1ORWA 3WK9A 4QA9A 1DT3A 1J1IA 4BE4A 4X97A 1XZJA 3WWDA 1R9NA 3WIOA 3D2AA 1XZLA 5E4YA 1X2BA 3ZPXA 3IBTA 1QIJA 4DSZA 2XQKA 3ZV7A 3W2TA 3HZOA 3C5WP 4J0KA 3B5EA 4DNFA 1R4ZA 1BEEA 1AURA 3DYVA 2FJPA 1CUJA 1N1MA 4EZIA 4PO3X 5LZ7A 1O6FA 2CJPA 2OG1A 4QDTA 4H35A 3AINA 4B84A 4J7AA 4GWLA 2K2QB 2H7XA 4GHWA 4CCWA 5D3ZA 2JF0A 3VVLA 1L7AA 1H2YA 1XZMA 2HA0A 1IMJA 2HA6A 3QMWA 5JAHA 5C8VA 4EA6A 3DL4A 2XMBA 5HFAA 1UK8A 1XKTA 5ALXA 5C7YA 3DEAA 3DKKA 2E3JA 4H7DA 1TCCA 2DCMA 4L3WA 1EVEA 5EHQA 2XUFA 5AKGA 1GKLA 1VZ2A 4X93A 4L72A 3H04A 1C4XA 2PSFA 2Y6UA 1OCEA 5AOCA 1X2EA 4ZI5A 4I19A 1FJ2A 1FFBA 2CEKA 2QT9A 1QE3A 3FBWA 3OC0A 5AHXA 1TCAA 5FP0A 5HKAA 1XLVA 2XQIA 4HZGA 4W1PA 2Y1KA 5AM5A 2PSJA 3VJLA 5JADA 1DU4A 4UBJA 2OPHA 1DWQA 3FSGD 2VJAA 3JW8A 1BEZA 2WUGA 3ZWQA 1CUXA 1QIFA 2XMRA 4WCVA 4CI9A 3VJKA 2O2HA 5C81A 1U65A 1CUFA 3I2FA 4JEIA 4FBMA 2JGKA 3CCBA 2VJDA 1OXMA 1G42A 4TPKA 3WKEA 3BJRA 5ISMA 4K6GA 3C6XA 1R3DA 1QLWA 2BAGA 2X76A 2WUEA 1JJFA 3IIIA 3I28A 1VXOA 5LLSA 1AX9A 5CH3A 2W6CX 2VJBA 1R1DA 1CIJA 4UPDA 1E66A 1NU6A 5CURA 4F21A 3DLTA 2WIGA 1EINA 1Y37A 2PSDA 4EY8A 2V96A 2WG1A 4QWWA 1HPLA 3I2IA 2ZYIA 1XZHA 3WWOA 4ROTA 1UOQA 1QIMA 2XMGA 1R88A 3W05A 4N5IX 3OTQA 2I78A 1TIBA 3G0DA 1LLFA 3TJMA 2CB9A 4KE6A 4UBOA 3WK5A 4WFIA 4INZA 1TK3A 3C6BA 1WOMA 4B81A 2IIVA 1CQWA 3BIWA 5T4HA 1HDEA 3E4DA 2HU5A 4NZZA 4AXBA 1ZD4A 4QZVA 4FLEA 3D2BA 4W63A 4B83A 3O4GA 3I1IA 1E8MA 2X8BA 5CRIA 3NGMA 4KACA 4MQMA 2PM8A 3SC2A 1EK2A 5JAPA 3O9VA 4EB0A 4N8SA 3O4HA 4A16A 4AO8A 3ANSA 2GBFA 3D7RA 1XQWA 4ZRDA 5DNWA 2ZSHA 1N5RA 4CG3A 3WZMA 3DOIA 4Y9SA 1ZD2P 2G5PA 4IO0A 2DHCA 5K5EA 2IITA 4UBMA 3STVA 4TVKA 3IUMA 1AC5A 3QPDA 1ZJ5A 1MPXA 4FOLA 1U2EA 4CG1A 4FBLA 4A23A 4M0FA 4ARAA 3QMVA 4NVRA 1ODTC 3KXPA 4Y2TA 4B9AA 4ZGBA 3ESDA 4Y2JA 3R3VA 5ALVA 4UHEA 4K2AA 4LXIA 4OB7A 5HF5A 1QO9A 5JATA 3F9CA 5IKXA 4MEAA 4BB0A 4B0OA 5C8ZA 1CUYA 3GROA 1DX4A 4X92A 2HM7A 1CPYA 2XUPA 4HAIA 4U2FA 5DJ5A 4E14A 1UKBA 4DMCA 1UKAA 3LP5A 2QRUA 2Z3ZA 3E1GA 2XUQA 5ALWA 5AM3A 1GXSA 3M82A 4LIPD 2WIJA 3AZPA 2V98A 4NS4A 1LPPA 5CBKA 3WK7A 3D0KA 3H0CA 2QXTA 3C43A 1EDBA 2OAGA 2RI6A 1UOPA 4X91A 4AMZA 1NX9A 3G0BA 2AJCA 3WWCA 2HADA 5K3EA 1ZGBA 4RE5A 2HA7A 1R9MA 1PV1A 4U2CA 3V1NA 2GBCA 1XRRA 4QDXA 5HCUA 5KWIA 5D7BA 4C87A 4I3FA 1A8SA 1ZI8A 3KOOA 5EFZA 4MXDA 5LZ5A 4DMFA 2PSHA 5LZ2A 1GQRA 1QIHA 3QYJA 1VJ5A 5ALOA 3NWOA 2J4FA 4LXHA 3ZLTA 4FDMA 4MWSA 1VLQA 3L1JA 2XUGA 4X90A 1W1IA 1E5TA 1E89A 3TRDA 4BRSA 5JANA 1XZAA 4H18A 5E4TA 3IB3A 5KWJA 2JIDA 4LKOA 1AQLA 1Y7HA 2FX5A 2XDWA 4B7ZA 2GYVA 4RNCA 2Z8ZA 5AOBA 2BUCA 3G7NA 1YA8A 4H0CA 1XQVA 4MJ3A 2H9YA 4J3JA 4Y2PA 4BAZA 3IVMA 2JGJA 5JZBA 3V1MA 1UK6A 2JBWA 1BS9A 1ZJ4A 1MN6A 1LZKA 3SX4A 2D0DA 3HXKA 2OCGA 3QPAA 3G0GA 1U8EA 2VQ6A 1BU8A 2VAVA 2Y2VA 2BFNA 3C70A 3EIOA 2WJ6A 3M83A 1UFOA 4AN0A 4F0JA 3TGLA 4DGQA 3LCRA 1A8QA 2GYWA 4FKBA 5AJHA 5AIAA 5CH8A 4BVLA 3ESAA 2WU3A 3R40A 3BDVA 4MYDA 1W75A 2EEPA 4B0PA 3D59A 2C7BA 1AKNA 4KYVA 5ALLA 3R3UA 5BWBA 3PUHA 4W1SA 4OPMA 4YASA 3C8DA 1E8DA 2PUHA 1YSCA 2PU5A 2XMCA 1CV2A 3VVMA 2XLBA 3W9BA 1E3QA 1EDDA 1ZOIA 3AZOA 4WY5A 3WKCA 4RPCA 1AUOA 1VE6A 1HQDA 1ZD5A 2H7YA 5ALRA 4MQLA 1H2XA 1KU6A 3JYHA 3ESCA 3DS8A 4WY8A 4BAUA 5HQ3B 5ALTA 1LGYA 3MGAA 1UKCA 1CRLA 1UZAA 1VXRA 5J3JA 4UBLA 1CUHA 1QGED 3MUOA 1LBTA 5YASA 3WK8A 1ZIXA 1J2EA 1EK1A 5ALGA 1QTIA 2C4HA 4OU5A 3DYIA 3I2KA 1YA4A 3D4LA 2QUBA 5FOQA 1CUDA 2ZJFA 2QTBA 4X71A 3WYNA 1M33A 2ONCA 2VA9A 1VA5A 2FUKA 4MYSA 1BRTA 4I4CA 5EGNA 4G9EA 4PSUA 4DYHA 1MU0A 4BC0A 1ETHA 2PU7A 1ZI6A 2PVSA 1ZICA 3FCYA 4W9RA 3DKRA 3I6ZA 2ZSIA 4CFSA 5A7GA 4IH1A 4J0IA 5HF8A 4GI1A 4EY6A 2PPLA 1QOZA 2J3QA 1WPXA 4DTCA 5CT4A 4IQ4A 5K3DA 1ZIYA 1LPNA 4Y2UA 3H2JA 3FAKA 4J0HA 3EQ7A 1JKMA 2PL5A 5AKHA 3KWJA 3HC7A 1K63A 1LPAB 5CW2A 2VT6A 2C58A 1WB5A 1USWA 2XI4A 2DR0A 1P0PA 5DLPA 5IH7A 1RP1A 1VA4A 4Q3KA 3X3HA 4Q82A 5HKBA 3RK4A 4L9AA 5ALIA 3H17A 4Y2QA 3DQZA 5AM2A 3F67A 1KU0A 5AICA 2WIKA 4ZV7A 4HXGA 1JFRA 5CH5A 3EF3A 3BDIA 2WJ3A 5A2GA 3G9TA 1DX6A 3R3YA 1CUVA 4X85A 4Q3LA 1AZWA 3BF7A 1BE0A 5KBYA 3L1IA 1Q0RA 1IZ8A 3BF8A 1BROA 4K6HA 4DNPA 1LBSA 3CXUA 3FLBA 2R8BA 1CUBA 2GBIA 3VKFA 4XIIA 1ODSA 2HFJA 1MAAA 2ECFA 5AI8A 3H1AA 3HACA 3GZJA 2H1IA 2AJDA 1YR2A 4BVKA 1F0PA 2JEYA 4BYMA 4IH9A 4AMYA 5HK9A 3B12A 3O9MA 5AI6A 3U1TA 2OCIA 3IURA 4BAGA 1SFRA 3WKBA 4UFPA 3I2GA 3I6MA 2ACKA 2WFMA 3I2HA 5AP9A 1ISPA 1SC9A 3A2MA 2V9ZA 2VATA 4PSDA 1BN7A 2I3DA 5A62A 4CIAA 3CCCA 3DDUA 3BIXA 5ALMA 3FWHA 1IVYA 1EH5A 5JZ9A 3F96A 4FFWA 5I9IA 4X6UA 3WL7A 5LIPA 3WJ1A 4FLFA 5IVHA 1XQXA 2O2IA 4AN1A 1DWPA 1TRHA 2HL6A 2XQGA 3WK4A 2WKWA 4FTWA 5ALSA 3C6ZA 4BBZA 1MX5A 1EI9A 1MNQA 3WLAA 3H1BA 1XZKA 5JD5A 5DYWA 3BE8A 2WLSA 2J4CA 4RGYA 3UMJA 3R0VA 3EBLA 4GXNA 5AKXA 1FSSA 2OQVA 5D3KA 1XROA 1UXOA 5ALJA 3OG9A 4BP9A 4K5QA
chains in the Genus database with same CATH superfamily
3OKAA 2Q4TA 4J6EA 3DE6X 3AI7A 2FG6C 3NH9A 4E3ZA 3UA3A 1CR1A 4GECA 3TFOA 5GOZA 3IPRA 4PX5A 3UK2A 3C3KA 3EMBA 4TMYA 1M1NA 3I04M 3GMIA 3E2IA 4HQFA 4U6QA 2NO6A 1YRHA 2I8LA 3M6MD 3V8EA 1RADA 1U2SA 4YPVA 5BWCA 3IAHA 4CNQA 1CEEA 2QJRA 3CNEA 1UAYA 4PAQA 3E05A 4RJTA 3PFHA 4ZO9A 1U04A 3K2IA 2Z2XA 1XAJA 1FJHA 3QVWA 2X4GA 1XD8A 3N2ZB 3F5QA 4RJIA 1YQWA 4RDCA 4TWAA 2B37A 4MKRA 3STYA 4CCAA 1GGFA 4NCJA 1VE5A 4U7TB 3D6UA 3C41J 4D96A 2PAAA 1G2PA 3KEGA 4TMVA 3RS5A 4DZZA 4KJXA 2OC9A 4DC9A 3VVCA 2OV8A 1FDRA 4FINA 3JRWA 1YS7A 4H6WA 4W5WA 2W2KA 4K87A 2IYTA 1QTRA 3QE0A 3V34A 3WTCA 4YAKA 4GOKA 1KKMA 2PZFA 2XMZA 4N65A 3DFKA 3VGJA 5I48A 1EA5A 3EVDA 1ADBA 2COKA 5AKLA 1Z6PA 3WRXC 3GDWA 2SKCA 1WSAA 2B94A 4F7WA 5T4EA 4MUNA 1N33B 2DWPA 1YZTA 4W7HA 2NYAA 4I1RA 4Z4FA 2N0SA 1L7QA 3GGDA 3NHSA 2WNHA 3NW9A 3WLJA 2LNDA 3F7OA 3UXMA 2FSFA 1S8OA 1U7XA 2RHWA 3OJLA 4M89A 1G9TA 4ABTA 3OCXA 4DT1B 1AGXA 3EXEB 1EE9A 1TM3E 3SWWA 3NUZA 5TARA 4LJSA 3NMUF 4XDGA 2JGIA 2HU8A 4I8XA 4PV7A 5FWXA 3D1JA 5H83A 3RIYA 1A7JA 1X8XA 3IOCA 3CG4A 2ZE8A 5UKDA 2FPIA 4N3GA 3HTXA 1UJCA 2C20A 4JASB 3BXFA 3QFTA 5AVZA 2XNSA 1BGVA 1E3LA 1HGXA 5HX7A 2Y1EA 1H23A 2COUA 3KL2A 1DI0A 2W6NA 1U9JA 4PYMA 4OFXA 4WZZA 1QGYA 3KYIB 2QZJA 2YCBA 2P75A 2KBEA 5F9MA 2VP3A 1G4UR 3AEYA 5LCXA 3ROPA 4DWWA 3C1OA 3D5EA 4WJZA 3TVDA 4NX2A 5IBQA 2OFWA 1MTOA 3M9XA 3BA6A 3L1HA 4IEEA 1T0BA 4RVCA 1B8PA 4EGQA 4V0NA 2RB5A 1AHIA 4KDFA 1TEXA 4IDQA 1V6CA 1ORHA 2FG5A 2R97A 4MUEA 6GPBA 3NG1A 3LUDA 2MSNA 3DCNA 3I9FA 2UUOA 1ZGZA 3L0IB 2VZ0A 1SUEA 4K8RB 4BYGA 1YCDA 4R2KA 5BUSA 1QG6A 1HE1C 2XKBA 1SVUA 1E3SA 2ATEA 4IDNA 1YQUA 3TWOA 2XZOA 4Y6PA 1J9GA 2WMYA 3S28A 1E5XA 3GMSA 4BCBA 1HG0A 1W87A 3IDZA 3BL6A 4OKIA 3QLVC 2P62A 1OIXA 1Q1ZA 4BNZA 3RJZA 3GLRA 5BVHB 3RRZA 2YWGA 4RY0A 1NURA 3RJ5A 1FFGA 4J0GA 5K3FB 1IXZA 5I9TA 1OGIA 2G72A 4B2IA 4W6ZA 5G0UA 3THOA 3S70A 1NP6A 1GRRA 1B2RA 1G8YA 1SVNA 4I6JA 3PP8A 4IS3A 1RQRA 3OEHD 3ZHZA 1BWPA 4CIDA 3H1EA 1E7SA 4OP2A 1U2QA 3FNRA 3AERA 3P9SA 3RM3A 4IUYA 4DHEA 2OY0A 3CIFA 1C5KA 3WYAA 1HLGA 1Q1GA 3BE5A 2MYUA 4U02A 2HWKA 4Z86A 3TLKA 4W9NA 3EXAA 3ZLVA 2DEUA 3UUFA 2BELA 3OD1A 3U3ZA 4E2XA 2DUJA 2NVBA 4YJ2B 2PIAA 2YRXA 1WP9A 3Q85A 4RHFA 3E9CA 3PHJA 3RTCA 3WGMA 4CIBA 3IPXA 2XD9A 2HA5A 4PLHA 1QP7A 1LWNA 1J0EA 5G4LA 1ZUNA 5T3UA 4CT5A 4OTZA 2RB4A 4JXXA 1X7ZB 4RWEA 3W1EA 1EIWA 5FPTA 2EZTA 2CLFB 2OBXA 3AO0B 3DZHA 3Q7IA 4IQGA 3SE0A 1Z73A 1Y6JA 4JR1A 2XYRA 5HJ5A 2YH2A 1OXXK 2ZVJA 3IO3A 4ZZIA 5BMVB 1WUYA 3R3XA 1S8NA 3U4QB 2J7KA 4TVBA 2GQ0A 3AR7A 1QCZA 2C8LA 4FT2A 4TL6A 3BD9A 5DI9A 4UTNA 3THXA 5KOJB 3EAQA 1AB5A 1UC8A 4D9JA 3IUYA 3JARA 1KIFA 1L7XA 4KYIB 3TIGA 1SK8A 4OATA 2GAOA 6ADHA 2GA9A 1DRJA 3DV0B 4KIJA 4RDHA 2UZ1B 5TDHA 1HL7A 1GFSA 2VT2A 5DSZA 3UB3A 1DIOB 1K5PA 3BD6A 1EFHA 2ZSAA 4HB0A 3P0RA 3ASYA 4DB2A 1N2OA 2XNCA 2XWPA 3BE4A 3LE8A 1KFCB 4G5GA 3I5AA 3BL8A 3G9UA 2BDEA 3D64A 1F4VA 1NF8A 2QD1A 1C0KA 1I6LA 2ZRDA 2PL9A 1A9RA 2BFCB 3KT6A 1U98A 1PEYA 3OQJA 2RSLA 1ZI9A 1G6Q1 5DBFA 2IXBA 5KUTA 4WNIA 4ZCPA 2CMFA 1OAOA 2EYUA 2FOLA 2I0FA 3C6QA 3PRYA 3NXKA 2ZE7A 1VPTA 1EE2A 2HIMA 3TW0A 3AKEA 2A84A 4IGIA 1YASA 3A70A 4ZD6A 3LSTA 4P83A 4BIMA 4CE6A 2JLYA 3ITKA 4P0PB 5AW4A 3TB6A 4Z4QA 2PLRA 5C5EA 3VNVA 1NT4A 1NL3A 4G1UC 2FWRA 2G88A 3OAAD 1FRQA 2OB1A 3IUQA 3MTQA 4PRZA 4DQ0A 4P0QB 4ZVSA 3FN4A 4TLEA 2DY1A 2L2QA 2DWOA 1CY2A 1G8PA 1EGHA 1GPKA 3W0LB 1ZNWA 4HX2A 4U2GA 1NVVR 3K92A 4DMMA 3SZRA 2RAUA 2VJYA 5CIYA 1VKJA 4ZA2A 1NOJA 2POQX 5BWLA 3H6KA 3RFXA 1MIOA 5KSYA 3THWB 3MNFA 4FB5A 1CHDA 1GKKA 2QRJA 2RHMA 4KQIA 2A1IA 3OIWA 5JSKA 1JIKA 2G77B 1E59A 3WL6A 3B5JA 3AM4A 4U5XA 4O4LA 4XM2A 4JMLA 1MV5A 1YRWA 3LI2A 3JALB 1EFUA 3PHLA 2OAP1 1Z36A 3HJRA 4K1XA 4IIDA 2ZIEA 3TVYA 4ZYVA 2FP4B 4QDJA 4KHPB 4RM2A 3QG5A 1DINA 1REQB 5IBPA 2PCLA 2PH7A 1AQNA 3ND9A 4OQYA 1NNLA 2P9JA 5CGQB 4AKGA 3ASZA 3H42B 1DSSG 2P9ZA 4GSKA 4PCUA 1LBEA 2XE8A 2QLBA 1B8VA 3U4CA 3UXHA 4EUEA 3FNEA 3HXMA 3NETA 3WYBA 2VUTA 1FFWA 3HDJA 2HQ1A 3K53A 3KPUA 4RD6A 4Z1MA 4DLNA 4AZ3B 4EJ6A 3RRYA 2XBUA 1AQJA 1L7PA 1Z5PA 3QFSA 5HZMA 1H1LB 1HSZA 2XSZA 2XT0A 1YH3A 1ZH0A 1W29A 1T2UA 5HWSA 3P71T 2R6HA 2WEKA 3WBKA 4GH5A 4RXMA 4AJIA 5FKJA 3AKZA 4XARA 1PAUA 2P4EA 3GJQA 2C3MA 3IELA 1EQAA 2AEJA 1DCMA 3MN1A 1C8BA 2JLZA 2XB2A 1CNEA 2QIOA 1NQ5A 2O5VA 4JYBA 4YDHB 1EK5A 5T57A 3ZHOA 4C0XA 3Q1LA 8LDHA 3TPZA 5LNK6 5CG2A 1P2SA 1S6YA 5CT9A 5DV9A 3RB8A 3QKRA 2C2KA 5DT2A 4X3OA 3VZBA 4Y2VA 4B32A 1XRPA 1XLUA 3D8UA 5B7QA 1GTVA 2VJPA 4KYUA 3QLTA 2VF2A 2JFXA 5A3VA 3WJ7A 4YUWA 2YWFA 4G5QA 1RIIA 3WQSB 3N87A 6YASA 4MUXA 2OXIA 4F11A 3X0DA 3STWA 3B78A 2P4HX 1FYWA 3AUUA 1PL0A 2O7RA 2XHEA 4GX5A 2AG0A 3DBRB 4M86A 3OQOA 3DMDA 3NALA 2J45A 4PGGA 1SCIA 5GAJA 2EBUA 3M5WA 1M73E 4L8WB 1D0SA 3WGKA 1DLJA 3A2NA 3OOSA 4PX3A 3ZS8A 4LF9B 3HR4A 1V16A 3CNLA 1FFCA 1YL7A 3MJCA 4WEQA 3OO1A 2N3ZA 1SUIA 2AQIA 2DKOA 4OLHA 3QVXA 2Q1WA 3B1XA 4GKKB 1Q95A 2F3RA 2HTFA 2NSLA 3BIOA 5J2UF 3LJKA 4IHKA 4BO3A 1RAIA 1V45E 3H9BA 3B6MA 1YR7A 2YW9A 4O3FA 2EP7A 4RL4A 2NXCA 2XAUA 4KAJA 1ORTA 2NW6A 1AS0A 3DBLB 2XZTA 1E6WA 4MGKR 3P8ZA 2MHCA 4YO8A 4INAA 4I5EA 2H0RA 4ZP1A 2XUHA 4BMDA 2PXCA 2F43A 4JOBA 4JB0A 2R48A 1NFFA 3KOXA 3TQTA 4BLTA 1T5SA 2D5AA 4QO7A 1GYPA 4RM3A 5MGBA 1XVAA 2PN1A 2Z95A 1N2CB 1NQUA 5BMVF 3JYLA 1PD1A 3OCCA 5GGYA 2QZZA 1VMEA 3N2LA 4ZDJA 2ZDQA 1IOWA 2FVXA 2OBBA 5E6SA 5A0FA 4B82A 4K9NA 3ASVA 1NBIA 3N0TA 3L7CA 4FFOA 4V0SA 2CB0A 2F1KA 5ENDA 3TTWA 2BFMA 2R1TA 4DAEA 2XRZA 5IDWA 1R0ZA 2RGCA 1TC1A 4NBRA 1GKUB 4NYJR 4PG6A 1UOEA 2YV5A 4N3CA 3RUFA 3WWZA 3N2GB 3OE7D 4JBHA 4D3SA 2ZRGA 3I1JA 5G02A 2V7UA 3T5PA 1DAPA 5J2UA 2FPWA 2JGLA 1MQ8B 4OQQA 4B6SA 5KNBD 5LP6A 1CQIB 4QUHA 5JU6A 1QO0D 4DCGA 1VIAA 2HREA 3GRCA 3EQ2A 3R20A 4RJLA 4M9UA 2AF4C 2ZT6A 4IOMA 3DE3X 3Q8MA 4Z5XA 1MFPA 1Z28A 2WTEA 3I1YA 2HO4A 1L7EA 2BKLA 5CLQA 3STTA 2H9IA 1DRKA 1W96A 2QRVB 1R10A 2XLCA 1VPLA 2AG5A 3N74A 5C53B 3LK7A 1MAUA 1QC5A 1BH2A 2QL9A 1PNVA 4F5EA 1WUIS 4IL5A 4ZEVA 4NOLA 1RRKA 4E31A 1DOAA 4FM9A 3QPCA 1EX1A 5C4GB 1ABEA 3FMGA 4OQLA 2YHAA 2EZ4A 2Z4TA 4C22A 1OXVA 1TEVA 2E49A 4KQWA 3S40A 1Q0TA 3ZE1B 5ES4B 3K0AA 4S12A 1U4OA 2AXQA 1C1DB 2OCBA 2R6DA 1HDOA 1L5HB 2V5VA 1HYEA 2AXEA 1IFXA 3GUUA 3ICVA 4UHDA 1AF4A 4QTUB 4TV8B 4YMVA 5CT8A 4YT8A 1KIMA 4PHHA 5LDHA 4MS4B 721PA 4WUTA 1WW2A 5JNVA 5AVXA 3MYYA 1T1EA 3H1FA 4UHCA 5JBNA 1TVMA 4OAPA 2EV9A 3SMVA 4BO9A 2VI5A 5BPFA 2O5EA 1SVKA 2G28A 2V8OA 1CUGA 5H3CA 1PV4A 2CFTA 4Y30A 1QLHA 1DUVG 1ML3A 3F9RA 3PIIA 5TQVA 4BDSA 3RROA 4KKXB 5BSKA 4GOND 5LR6A 3G9QA 3IP3A 1NKSA 2XUOA 4UHHA 4JNKA 1RPZA 2F8SA 4GPEA 1JGTA 2R8XA 4BNKA 4JLWA 1M2VA 1QV6A 1FNNA 1LPOA 4L7QA 4Y9RA 1KBQA 2F8TA 3G2PA 1XTPA 2C5GA 5DBHX 1DUSA 1ICIA 4KK3A 1TKRA 3C16C 1R4NB 4LDPA 1E5LA 4BVAA 1MB0A 1BXGA 4FPXA 1GNVA 2JFNA 5I47A 3LPLA 3EQ9A 1M8KA 4KN9S 2WJHA 3HV2A 2ROQA 3W6OA 4P7JA 4N5NA 5U9CA 4AFNA 5LFAA 1A5ZA 4N5DA 4GC5A 4HG2A 2H1LA 2NUPA 1OV6A 2Y99A 3DEJA 3LC0A 1VPWA 1BW9B 2E87A 5C34B 1M83A 2VR1A 4WDRA 1FRNA 3Q5GA 4HXFB 4OGLA 3U9SA 3GAZA 4PSVA 4DQXA 1W4AA 2Y4NA 1JT2A 1YFKA 4JQCA 4NHOA 5CEFA 2FMUA 4YT2A 3E9MA 4MS3A 3AIMA 4ZQBA 4QAJA 2C1ZA 1JPVA 1OVMA 3HWWA 4ID9A 4PBTA 3JAKA 3GP3A 2CXXA 4Q3CA 4QUGA 2A1UB 5ESDA 4NCBA 2YX1A 4GMDA 4RWZA 3MWFA 5GP1A 3PC6A 4DLTA 1XT6A 3ACBA 4XPIA 1E2BA 5E2BA 4H77A 1NY5A 5EIOA 5B3JC 5TX7A 4MDEA 4MV1A 5EMLA 1UDAA 4B6GA 4KXYA 2LRHA 1IAQA 3OA2A 5TPWB 5DW3A 1J0DA 3L41A 1SBZA 3EBPA 4N0QA 4MYCA 4LQLA 3OP1A 3O93A 4Q9HA 2PEYA 3MILA 1SCQA 3EC7A 3P9PA 4J1NA 4G1MB 1MMFB 3P9RA 4KQ6A 1LA2A 4MR8A 4RSHA 4XVRA 1VDMA 4I8IA 4D9EA 4A26A 4RMNA 1EFPB 1IWOA 2GS9A 3OPMA 5KYUA 3R7NA 2I1WA 3ZK7A 3KZVA 3NRCA 4IEFB 1JU9A 1T0PA 2AL7A 3TE7A 3LFHA 1WB6A 1I2BA 3GNQA 3M49A 4LXTA 1DC7A 3F46A 3PDIA 4P35A 1M2OA 2FPMA 2ZI4A 3AB7A 4Y1EA 1T4GA 4BASA 1TZJA 3K0KA 5JARA 2PVCA 1ECFA 4DADA 2PBZA 1PZXA 1TUIA 3A1TA 2JH3A 3BHMA 3LVRE 5C4IA 1D03A 1GG5A 3IXQA 3DZKA 5ENVA 5FV4A 1Q0PA 1TM7E 3NFRA 4TTSA 5E7IA 3Q7TA 3EVCA 3QE2A 1TFRA 4XGQA 2OV3A 5FTMA 5LKAA 3S8YA 1QE0A 1SWVA 1OTYA 3D4OA 1WCIA 1A04A 2ASVA 4WVFA 4DN6A 6ABPA 1LTQA 4BFLA 1RI4A 1Z5UA 2JLSA 3ZJ4A 2VYFA 5BQPA 4IQ8A 2H1HA 3NV7A 2O1EA 1NW9B 5FCDA 4F1KA 3C4JA 3LY7A 1WSDA 3FNIA 4PX2A 3WGJA 3ON5A 3WYDA 2O8BB 2GJKA 1P31A 2CNWD 3PICA 4I36A 4BATA 1B3RA 1PP4A 1BD3A 1DIGA 3FCCA 5KNBH 4I50A 3WGIA 2XVYA 5FJIA 5E1BA 1W1WA 1POXA 2VQ3A 3LIIA 1OH7A 5D87A 4OUDA 4GYWA 4LDAA 4HAWA 5DN6A 5EWJB 1PG0A 1PT5A 4Y2SA 1KYIA 4RNDB 2QM0A 2OHVA 1I33A 2XB6A 3SOZA 4ZHQA 4HAOA 2GK6A 3CW9A 4M8KA 2WQZA 4HTAA 4MPPA 1KQFA 1PQWA 5PNTA 3VJRA 2D0IA 5JQGA 3RBZA 5BYKA 5JWRA 2Z30A 2X1HA 5IJ9A 2A94A 2KYRA 2VTDA 1OB2A 3PJFA 2YC2C 3LX8A 4MINA 3C6YA 4RTKA 1R27A 1QHSA 2DFTA 5GTDA 1A1VA 2XE4A 4X9XA 4H17A 5B53A 1OAAA 1SZDA 2KM1A 4NCIA 1DB3A 2HQRA 4JUIA 3F98A 1QGUA 3O6VA 4BP3A 4BX8A 2ZYSA 3S27A 4WDQA 1DBVO 3T95A 5FWYB 1OYVA 3MCTA 2PAFA 1E18A 2C3UA 2P9GA 3ISTA 4IYJA 1NJSA 3A6EA 2VHQA 2VXYA 2X3FA 3E9QA 1W5SA 3UCXA 4BWVA 1P1CA 2QOEA 2AC7A 2CL6X 2PKQO 2VQSA 2XUIA 4KE7A 3WGUA 4D8XA 2BTEA 3OFNA 5F9FA 3PRKE 4J4BA 4URUR 1K7YA 3BILA 4EHDA 1CUEA 2BFBA 2VCEA 3SYKA 2OHFA 1RIFA 2ZSDA 5DXFA 1H1TA 4NBTA 5BQXA 4GDMA 2NUTA 3PUIA 1RYHA 1JDUA 1HQKA 4DGSA 1K2WA 1IK4A 3QI2A 3BJIC 1V43A 1WDKA 3O1HB 4YAWA 1J25A 3N76A 1UPAA 3C87A 4DMUB 4TVSA 5IT9A 1KYQA 1LI7A 2V97A 3M6FA 2ZB7A 1LI4A 1ZGHA 4MQEA 4MKZA 1JG1A 1CS0B 3QIAA 4HDMB 1NP7A 1NJ2A 4KX5A 5HIAA 1HZJA 1VSQA 4JK3A 4U39A 1XWWA 2Z3WA 3RTGA 2HWYA 5JCZA 5DYNA 1LC0A 2I3AA 4W6QA 3Q3GE 4Z0TA 1SA0B 1LNZA 2ACVA 1C29B 4URFA 3WLRA 4GPBA 2FEMA 4H6XA 2YFYA 3JRNA 4A8HA 3IKMB 3UHJA 1PL8A 3HKDB 5KX5A 2QM3A 1MZPA 3H87A 1P0QA 4O2BF 3M9WA 5E6RA 2WM9B 3WFJA 121PA 1KBOA 3I52A 3RW9A 5FX2A 2G9UA 4RTNA 1HT2E 1Y42X 5EIAA 2AYZA 2X7HA 4X66B 4LCBA 5C1BA 4YAEA 3RIGA 4X1KA 5JSYA 4ED9A 1UXKA 4YCMA 1W76A 3RS0A 4Z6KA 2BR4A 5JDIC 5EP1A 1PE0A 1VBFA 3GG9A 1J2TA 1C30A 2ECKA 2MTBA 1XDGA 1ZGGA 2OMEA 2X14A 3WLFA 3ZYCA 4C0QC 4MYRA 3CLKA 3D0QA 1E2PA 4FMDB 3TMAA 3OJFA 2JFWA 3VH4A 1C4WA 1PG2A 2BFPA 2IQIA 4LJ6A 2DUUA 1UJ5A 1RQPA 3HM2A 5FNVB 2B1GA 4ZO6A 3RQSA 4TMZA 1IQPA 3QY9A 2Q5HA 3O8LA 4EY7A 1BWSA 1NBME 1V8ZA 3SFVA 1N2GA 1ZGJA 2P68A 1WTCA 1IU9A 2R6GA 2X5XA 3D5TA 3EODA 2C2MA 4LOAA 4OQEA 1YMVA 3BWYA 4E08A 1YCGA 5I45A 2WJZB 2O3SA 5HM6A 2VHWA 2PMBA 2O2GA 4E5KA 2H2DA 3WGGA 2WWYA 2DFVA 2GF0A 1G8GA 1KMNA 3WAKA 4EYOA 4D9HA 3Q8KA 1SKYE 1ZH6A 2NU6B 1RJEA 4ZOCA 4B17A 10MHA 3RFFA 5JXHA 1TEHA 2MWMA 1GSIA 4OFZA 3VISA 4WT7A 3W6NA 1PTJA 4AO6A 1V3TA 1NBMA 3ED1A 3AQIA 3WL5A 4CF5A 3BVPA 2VEOA 3MJRA 3LSYA 1LQUA 5GGXA 5CFQA 3WLIA 2AE1A 1NXTA 2ZBGA 4UAJA 3FRHA 1LQ2A 2B8NA 4RAOA 1KJ8A 1TU0A 1I0IA 2OGTA 2Q3BA 2XXBA 3L6DA 2H1FA 3PNBA 2X5OA 4ZAWA 5J63A 1ENPA 3T12A 2XITA 3EFOA 3TEJA 2WYIA 3G49A 1W93A 5DNUA 4HEHA 4QSHA 4I9GA 2H2FA 1OHHA 3BGSA 3SC2B 3CW8X 4DRYA 2HDOA 2QD4A 2WP0A 5KTMA 1CFZA 3IO5A 3NDRA 2XKAA 1RPJA 3L7OA 2DG2A 4Q6WA 4M9RA 2WJYA 4TRNA 1R8YA 3FNQA 4U63A 3OM0A 1I24A 4KZPA 5F12A 1M1YE 3PU6A 4PSCA 3ELUA 3UMMA 1N7GA 3BB3A 3IVXA 2PS1A 1AK2A 3W3AA 4P93A 5ECDA 4I1PA 4PAMA 3N0WA 1T5DX 5CA1B 1N6IA 2JFZA 4N5LA 4OJNA 4U8GA 5EE5B 3TUIC 2C3YA 5KNDA 3ZLJA 1EX9A 2QENA 1ZNQO 1ZXLA 2HMAA 1U11A 3JR3A 3BWMA 5CNIA 2J9GA 4AUKA 1EUYA 2M98A 2DPGA 4BVBA 3DP9A 3VFDA 2AG6A 2JIMA 4ZWNA 1KI6B 3G7UA 4A27A 4GL2A 3D02A 1NXOA 1ISSA 3PWSA 3PTLA 4HGPA 2P9QA 4RXTA 5FI1B 1N7HA 2X6RA 3VR2A 2EOAA 3CZCA 3I8SA 2A5YB 1JQ3A 1RQXA 1STOA 2GN8A 1M1YA 3RUIA 2XUDA 1KQ3A 3KTFA 2R7LA 3UT6A 4GX2A 4NOJA 1KVQA 1L5SA 2EQAA 4PSAA 3V7UA 4Z2YA 2Y0PA 1XD9A 4WK0B 3OKFA 3T0FA 2A1TS 2KBFA 2NT4A 4Q1CA 1DWOA 1EFKA 1GRNA 2QEQA 5JAQA 1T1RA 2XVXA 3O8NA 3G8YA 2W48A 4ZT6A 3MT0A 3R41A 3D81A 3WOHA 1G1MA 4EVIA 1WUKS 1P29A 1KMIY 3C98A 3CFYA 4TS3A 4QU5A 5GADl 1MXHA 2GA8A 1ZD9A 5CVVA 1LBIA 3LLCA 1M6HA 1SKQA 2BZ1A 2RIPA 3ORQA 4QNNA 5LDGA 3PNYA 2AFVA 1EAMA 2HMYB 2CJWA 2L18A 5G2OA 4ZJPA 3ABRB 2UYHA 4NE9A 1C3OB 1HV8A 3VOBA 4XQEA 2C77A 2H29A 3LF2A 4EGAA 5NULA 3HUDA 5KNLA 4MULA 1OXUA 3LQRA 3CNBA 3TQSA 3IE2A 1FUEA 1XCBA 3CYFA 3TXAA 2CLCX 2VYND 4L4YA 4C30A 2P4SA 4A2CA 3RRFA 3IALA 3RRNA 3RYHA 4QEDA 2G7MC 2W98A 3NEJA 2QP3A 1U3GA 2PUWA 2WE8A 2B5VA 2GYUA 1RZUA 2WKQA 3DEIA 3ENWA 4C03A 1Z7EA 4AYWA 3K9WA 2VPWA 4DTIA 1HLPA 3SC4A 4XM1A 2OHXA 3ME5A 3KV3O 4LSZA 4KOEC 1Y89A 4YUXA 1UXJA 2ASEA 5BOSA 3PC7A 4RK6A 4E1VA 3FOZA 3O38A 3HLTA 1MC8A 1GZ3A 2ZEJA 3FDIA 4PZUA 1F8YA 3AETB 2UZ3A 1X0XA 4JHXA 4C05A 5A5VA 2EX4A 1DNPA 4WKBA 1H22A 2L17A 3HZRA 1D4AA 3M34A 1PI3A 2P4QA 2EJUA 1QUEA 1MV8A 4QRHA 5AK5A 4DQLA 5DM70 1O97D 2MSWA 5EJ2A 4GDFA 1P45A 3NIBA 1HL3A 1SKBA 3P52A 2VBIA 3QKWA 4KR7A 2FPUA 2Y76A 3V4ZA 5KREA 3PVZA 2PH5A 2ZKLA 3F3MA 3UC9A 1RI1A 3K30A 1BQ3A 3ICCA 5KHOC 1WXIA 1VG9B 2GRUA 2HNBA 1XG5A 3AIKA 2OHHA 4FS8A 1NYTA 1W44A 3AW8A 3F6CA 2OCAA 1YQDA 1LDYA 2FCRA 3EBOA 3GEDA 2JG3A 2P6MA 1XZBA 3C3BA 2G17A 5FNVF 1A8PA 1NPTO 1U7TA 3G0HA 2EJCA 5JSQA 2PMDA 1AGRA 4AUEA 1FP4A 2IQ5A 4NFHA 4QYMA 4CN9A 4E22A 1ZUHA 5IK2D 3PQCA 3KNZA 3R24A 3TPFA 4CPDA 5A9SB 2BGNA 2QLTA 3U7EB 4NY1A 1MIHA 3CNHA 3PV0A 3URMA 1X19A 4EUSA 4X45A 5JCOA 4Q37A 1XJQA 2JIQA 2QPLA 2Q29A 5IM4A 3A25A 4M0MA 4F6RB 3LHFA 1ULUA 2JBHA 3RTBA 1Z2PX 1KL7A 5A6SA 1VMKA 5DWVA 3KLOA 3AILA 1SG9A 1SGWA 3BXGA 2E0IA 5I7VA 4YDRA 1YVUA 3CZPA 5T4BA 5A7HA 3KOYA 1CW2B 3VO1A 4EFNA 1DMSA 1JDNA 2WHRA 2D0PB 2QGNA 3AIOA 4TTTS 1RTTA 1V9CA 5LN1A 2IYEA 4AO7A 2UUAB 4AJEA 1MGOA 1K7SN 3JVVA 4CKBA 2QX8A 2J0VA 1AUXA 3B89A 1RWOA 2ZW9A 2WP8J 2Z2YA 4OHCA 4BMPB 5BQ3A 3HCCA 1YZUA 3SIXA 5EHZA 5CDYA 5AO9A 3V48A 1I8TA 3R7WA 3TZBA 2J08A 2R1VB 4DCMA 2G8NA 2X0KA 4D1YA 2BH2A 3C7CB 1K1EA 2VPQA 1KWGA 1KJZA 4RF2A 4G85A 4JA2A 5K09A 2OQ2A 3GJ5A 4YRAA 2RBKA 4E2WA 3K72B 3CEPB 5JJCA 1FS5A 1N2EA 4MEJA 3VH3A 1UBEA 3ULKA 4HRYA 1L4NA 5EVCA 1YFJA 5HRCA 2BLLA 2NYRA 1PQYA 1M10A 4TQ9A 3VUEA 3CVUA 1P6UA 4ARIA 4NEQA 4B3JA 3PHGA 4O0LA 4FE4A 5JS8A 5MN6A 3QG1A 3U39A 3UT0A 1XRMA 2FSIA 1ZM2A 3BQ9A 1WZNA 3O0DA 3M4ZA 4FOPA 4RSRA 3P19A 2W2LD 2J85A 4XYLA 5IARA 1BH6A 1KERA 2WC1A 3W5JA 1CFJA 1E9BA 4I7EA 4YXWD 3FZYA 3DE0X 2PGXA 2I9KA 1CB7A 2XTNA 5JPIA 5E3HA 1PU2A 2QNIA 3ICOA 1LPMA 3DW3X 3ZNQA 4H7KA 3VV3A 2QZSA 3AL3A 1QZ3A 2FG7C 3MJHA 4L0MA 4QPNA 3KUDA 3TZQA 4B79A 1Z4NA 3R9XA 4YT5A 3GLTA 5CYOA 2RHCA 3RPEA 1WZCA 4LY3A 4MUGA 1SKMA 4YFVA 2B8JA 1FP6A 4GD3Q 1WZIA 2A2ZA 4PONA 3PFCA 5FBQB 3ZWOA 2GVNA 4KREA 3GRPA 3DBHA 3I12A 5FHQA 3ADDA 1XVVA 1R6UA 5CPBA 4CCYB 5LB4A 3GPIA 3MS4A 1P2DA 1TPZA 3OM9A 3EISA 3KQLA 3QXHA 4DDTA 5L7YA 3T3OA 2JFGA 5BQFA 5TNXA 2BJWA 2WV7A 2VJMA 1S2MA 4G4SP 3PQ4A 1KK1A 2XODA 4OQDA 3W34A 2IBSA 2ZR7A 4YI3A 3PPVA 4GPZA 1GNPA 2A33A 2JK1A 5TPZD 4EGFA 1IBLB 5CDFE 3GNSA 4HWRA 4HGQA 4ARCA 1PBNA 5LMUB 1ANKA 3AI1A 3CEAA 3QOFA 4L50A 4D25A 4BTVA 2BHNA 3A9WA 3I4FA 1TCVA 5AJTA 5IT4A 2FDXA 4QYIB 3E5MA 2O8EB 4HK4A 4ZMRA 4G3XA 2QM7A 3W4KA 4M22A 1G8MA 3K9BA 3PHHA 1JX6A 3QVKA 5B7GA 4LTNA 4N40A 3U7FB 1TL7C 5IANA 2ZT8A 2CF5A 2RH5A 2NOAA 2B4KA 3QF7A 1AB6A 1TQHA 4IEIA 2B2NA 4MVJE 1C4OA 3C6KA 4C4PA 3UAGA 5EUMA 1KHHA 2A3RA 2BGRA 3E9YA 2X4DA 2YZ7A 1WXEA 4OK5A 4R31A 1ODKA 5CDFA 1SXPA 4U2DA 5DHFA 3FHCB 1NG9A 1KP3A 3JR7A 2M6LA 2Q2OA 4L4ZA 3HB7A 3JQDA 1GFIA 4RJJA 2QMQA 4P7KA 2BMAA 4KMSA 3RK1A 2CHGA 3SQDA 2F48A 1UFVA 2RJ3A 3ESQA 2O8VA 4Z54A 4CIXA 4CYMA 1X42A 3J7AC 4I55F 4F5ZA 1ECPA 3ROXA 4L0DA 1K8QA 3QU2A 4POOA 4RGBA 2JGEA 2QRLA 4G8DA 5ADVA 4L4XA 2O23A 3VGPA 2FUG6 2XOXA 3QXXA 4MVJA 4H1VA 2UYQA 1E1MA 4Z8XA 4XWWA 1BZYA 2E1PA 1Z0IA 2QRMA 3FWNA 2C07A 4J76A 3W5HA 5A2QA 4P3YA 3EXHA 1DDOA 4KHZA 5FA6A 4IIGA 4YUYA 1K8XB 4KVFA 3K9HA 3H8WA 1R12A 2JH8A 3BFKA 1JHQA 3KQQA 4KBFA 2G0TA 3H65A 2GEFA 1IVNA 3A1FA 4P92A 1KYXA 4YRJA 3SZUA 2RARA 5IDQA 2PUFA 2P5YA 3SS9X 1IXRC 4EQZA 4RIHA 3UWMA 1MNAA 3B48A 2VDLB 4FHZA 2HHCA 4LHSA 4OXKA 3GT7A 4TSKA 4CMIB 4RY9A 3SDSA 1J22A 1HT3A 2FEXA 3CVYA 1JTFA 5JNRA 3BKXA 1GSOA 3FUCA 3WGHA 3EPHA 4L5IA 5FADA 1UKEA 2WM2A 4RACA 1BDIA 5F98A 4RKWA 1HBJA 4XQ0A 1G21E 2VNSA 4JCCA 1JFFA 4QWMA 4R4JA 5JMTA 1N3LA 4DV5B 2I2WA 4S05A 2AOUA 2G5GX 2J7PA 1TJNA 4O6VA 2JAXA 2CLOB 2ZSKA 4RETA 3HZZA 3ORFA 3E27A 3W9YA 1L4UA 2BUBA 3P2KA 4H3KB 5JXGA 1R6BX 2EJWA 3L77A 3H19A 1RT9A 3NKLA 3VR3D 3VZDA 3SJCA 1TMGE 1YZYA 2LD4A 2PWYA 1Q1QA 2IA5A 2RBEA 3I39X 4MNTA 4YCBA 1YB2A 4AJOA 4BDTA 4K3VA 4EBBA 1WD5A 2C92A 2QTNA 4V0QA 3NDBB 1E3WB 4IRMA 1FL9A 1A72A 2IHKA 4YACA 4BP1A 1NJ1A 4NXNB 4X97A 1XZJA 1K7FB 2P9TA 4R1OA 1R9NA 4BKQA 3WIOA 1G21A 1HQYE 5AMXA 4JU8A 3RUCA 1Z17A 2GTPA 3D2AA 5E4YA 4ER0A 1X2BA 3ZPXA 1V11A 4LZLA 2F62A 1UDXA 4ND6A 1JR2A 4J90A 3OOWA 3I9JA 4NCNA 4AKSA 3O8BA 4XD7A 4DDKA 2ZI5A 4DSZA 4EVRA 1A7KA 3RF7A 2HX1A 3S81A 3KWMA 1NW7A 3LUAA 4LS3A 3ZXIA 2ODNA 5M2QA 1A9SA 2J3HA 3C5WP 4V1CA 3CVOA 2LDBA 3ZQ6A 4PHTA 2YYZA 1YJXA 5BURA 4E4YA 4ZPJA 2AW5A 2PRZA 1R4ZA 4IINA 4KO2S 5SZIA 4A1OA 1XL1A 3TMKA 4BNWA 3PX3A 4XRRA 3RYFB 4CEHB 2TMDA 1J0BA 3E9DA 5B6IA 3U80A 1YE5A 4YBRA 3OJCA 1ONBA 4IG4A 5JAMA 2VBFA 2Y1WA 1FSPA 1N1MA 3GAFA 5FJJA 3N2KB 1O6FA 1XCMA 5EIEA 2FKAA 2P9HA 4DNXA 5BR4A 1XJCA 2NXNA 4UJ5A 3AJRA 2YXEA 1BKYA 2FLKA 1OJ7A 3DT9A 4CNBA 4CUZA 3SXJA 4X1YA 4G0VA 1X77A 1IDN1 1UMCB 4JOSA 3AB8A 3IPLA 4J7AA 4O1IA 3KZ1E 1N6OA 1VB3A 3JATA 4KSYA 1K27A 3IMFA 2GUWA 4NCHA 2ISQA 3FWPA 3D7KA 2QIPA 3GRVA 4ZEOA 2A35A 5FI5A 4HQ0A 2JF0A 2PRJA 3RBXA 3VVLA 1L7AA 3MINB 1KYZA 2HA6A 2YIMA 3EPPA 4MRMB 4EG8A 4ZVLA 2IUSA 4ZO7A 5ERGB 4HAXA 3SLGA 5AHRA 4IKEA 5JAHA 2W4IA 3D3QA 4E12A 1N2BA 3MT9A 3S1SA 1FVXA 1LBHA 2ZB8A 3WBFA 1RCTE 3GLGB 1WSWA 1XO1A 4M8IA 1C2TA 4JC4A 1LK0A 3PB3A 4NIMA 4Q12A 3CSSA 4OVKA 2FQYA 1CDDA 1LLCA 3DEAA 4NFYA 3ER6A 2FWNA 1TA4A 2WA2A 5JDCC 5DGCA 4DR7B 1N0IA 1L4MA 1ZD8A 4KO3S 4NV3A 1FPMA 3MTBA 2B6NA 4G67A 4EF5A 5TMBA 2CXPA 1BX1A 4YEDA 3W2FA 1J0XO 2LCFA 4S3MA 1ZOPA 3ECCA 4OMDA 3ZDAA 4C2AA 5JVDA 1UC5B 1EVKA 2F1OA 3S68A 4AWAA 3CZ4A 4EG0A 1ESZA 4BJ6A 4M6WB 3TLXA 1L4EA 1QZZA 2PSFA 3SQMA 3KTOA 3R9WA 4MWOA 4I4TA 1A9XA 2VO1A 3EE6A 4BJ5A 4CQLA 4D0NA 3BD7A 1NW4A 2CEKA 4R9SA 2ZXUA 4NULA 3T3EA 4F56A 3CCFA 1G3RA 4L9SA 2J67A 2LWIA 1M6WA 4J16C 1U7ZA 4LYAA 3BMQA 4QIHA 5ENZA 2I6GA 4HNTA 2B92A 2QTRA 2X9QA 1U9ZA 5C8YA 1RNLA 4UUAA 2XQIA 4HZGA 3DZIA 2FRDC 4NP6A 3ZJ5A 3W6PA 1HT0A 4MI1A 5BSWA 2ID8A 4FQ8A 1Z25A 1OC4A 3F5SA 3JQ9C 5D51S 1PIWA 1DRVA 1XXHE 1YI1A 3F74A 5J23A 4ID3A 1MC1A 3LL7A 2YMQA 1DU4A 3JV7A 1KKLA 4UBJA 3RSGA 4EMBA 3LX5A 1SR8A 1JTVA 1JJVA 1KEWA 3NFYA 4CL8A 1OR8A 3VOSA 4CLOB 4KOAA 1OFVA 4QEZA 4XVQA 4X0EA 4PEVA 4DSNA 2VYVD 1IJFA 2NPOA 3WV5A 2ZS9A 3JQBC 3JYNA 4BNGA 1G5QA 3PNSA 1QIFA 2XMRA 4WOPA 4DILA 1M54A 3L5KA 2ZAYA 3R6WA 3VJKA 5JSZB 1W49A 1BVYF 3IC5A 1R0CA 1K0UA 4HMQA 1KQNA 1S7CA 3BBPA 4GKBA 4R8SA 3SQOA 3ETJA 3RBVA 2HF2A 1U65A 2FSUA 1XXHA 2DBRA 2I4TA 3Q3HA 2ZTHA 4XFDA 1MP0A 4O02B 2SHKA 2XF2A 4GPAA 1PFUA 4XLLA 4G0NA 1JEYB 3PQFA 2B4TO 1AKUA 2OFOA 1SCBA 3DZ8A 4QJ4A 5F73A 3RIEA 5IDXA 5IMBA 2D5IA 4O25A 2H1CA 4NDAA 5CW1A 5C1DA 5IZCC 3C8MA 3D3WB 1M66A 2NADA 1I2MA 4OHOA 4PCAA 3M2TA 5HOEA 2JCGA 4ALIA 3NPMA 1XD2B 5DLDA 4IVNA 1I5EA 1JT9A 3ZW7A 3NOOA 3V8QA 4J0QA 4ROSA 4OHWA 2D1RA 1NZJA 1B0UA 1BS1A 3P94A 5AUPB 4YP1A 1UPUA 4D8YA 2H85A 2RAVA 4K2HA 2PUAA 3C4QA 5JS1A 2EKBA 4OJMX 5I7AA 5LLSA 2H07A 3ZU5A 2QVZX 3B7PA 5F3DA 3RHTA 1E2DA 1NI3A 1QWOA 1XWIA 3DNFA 1MVOA 3FE2A 4NZ9A 4TKUB 5EPOA 1HEIA 1RYNA 2XD4A 4N76A 3OFKA 2W6OA 3DAYA 4FE7A 1CIJA 3SYTA 2B98A 5L6LB 2VUSA 3LC2O 4QOGA 3RTDA 1WUJS 2XCQA 3DL0A 3G79A 4OHPA 3G2OA 4KLCA 2J5KA 1SCAA 3KZXA 3GP8A 2HO5A 1QAMA 2Q41A 3SQWA 2HQOA 4CF4A 2WD7B 4FC6A 1U2RA 1Z13A 4YAJA 5IKEA 1ZM3A 5BO5A 4R83A 4U0JA 2WM8A 4UUOA 5D1NA 3DDZX 1JAHA 2OR3A 4DG8A 4PIVA 5DHQA 3OQ6A 3NEAA 4FYMA 1TUBB 5TB5A 1XEXB 2R5FA 2WG1A 1NHGA 4KAXA 4BLUA 1GG2A 3GLHE 3R5JA 1JN0A 1TU4A 4UHKA 1EFRA 3PGVA 3PQ6A 2AVDA 4MB0A 2VRCA 1QS0B 5BN5B 5K1ZA 4AMBA 3TI9A 3TCNA 5K8LA 4L4UA 3LOPA 4ZGWA 4ROTA 2GKOA 1KQPA 4ER5A 5L3SA 2NGRA 1JIVA 3KDPA 3DAPA 3X2EA 1CF9A 2WW8A 2QLLA 2AYXA 2P79A 2UXBB 5KEIA 3UK7A 3THYA 3PYMA 3UJ6A 5JNUA 1TIBA 3OE4A 3QEAZ 2W2VA 1Q7EA 4Q16A 2FLVA 2Y1FA 5JSUA 1F1JA 3HKBA 4LY6A 4UOQA 4KLNA 4QTXA 2IY8A 3D6TB 2X9LA 4YV7A 3QE9Y 3U16A 2GCNA 4P4LA 4L7VA 2ZYGA 2G25A 2CSUA 1UIRA 1IUKA 1K6XA 2F6RA 2CB9A 4Z1OA 1F2DA 1QP8A 1I1NA 1QAQA 2AK3A 5AHWA 3VYRB 2MSDB 2QJFA 1JJ7A 3FDJA 4NR0A 1JPJA 2VG8A 3VOAA 4WFIA 1GL3A 1TK3A 2BFWA 3W4IA 2UYCA 3GLFE 1KMQA 1W5EA 3U44A 4H27A 2CXOA 1K2VN 3QELB 4D9FA 4WK4B 4GWGA 4IIJF 4UATA 1U28A 5T4HA 3RYIB 1YZQA 2ALJA 2PXHA 1IEVA 3C97A 3M6XA 4LJ9A 3S1LA 3VR6H 1Z6YA 4NZZA 4OJQA 2XE6A 4AXBA 1DIHA 4BFYA 2I54A 4PWZA 1FNDA 5K0GA 2BH9A 4LF8B 1Y3IA 2A5JA 2QI9C 3ENKA 4C0HA 1XZNA 2FZ4A 2HCTA 4IRXA 1D1SA 1M1NB 1QKIA 3O4GA 3K32A 1QG2A 3WQBA 4WK6A 3SJUA 3WNZA 1FDVA 1G59A 1EDZA 1E8MA 4JDUA 1Y3HA 1VL8A 1Q0SA 2OSVA 1TZ2A 2X8BA 3NGMA 4KACA 3RHSA 4EB8A 1G5IA 2BHTA 3G68A 1G19A 4G6ZA 3GLFA 4NNJA 4MQMA 3BHIA 1ENYA 3KXLA 4MLDA 2ZWMA 4H1UA 2IZ1A 2Z56A 1EK2A 1M67A 1SOVA 4LZWA 5F5NA 4HVCA 3R6LA 2JBAA 2GEKA 4N8SA 1CDEA 1DWUA 3O4HA 1MW9X 3FOCA 3JSXA 4OQMA 2CFSA 1DKQA 3W3ZB 4JXKA 3UB4A 4OMFG 5L7WA 1GLNA 2FSGA 2GTIA 3CB2A 4B8WA 3T1YB 1R66A 3QE4A 1WIWA 3A7DA 4L9WA 1P5JA 1JDZA 2HLDA 5DNWA 1IOVA 2PNJA 2H18A 2O57A 1N5RA 1NFQA 2PKCA 3EGWA 2W2KB 3MK31 3EFBA 4HEA1 1Q57A 3ERCA 1MCZA 2AI3A 3DOIA 4X3PA 5FUBA 3E5RA 1L5KA 3T5DA 1ZRMA 3KQWA 3T35A 1ZO8A 4TYYA 2OPBA 2D1QA 5FI3A 4REQB 2IS1A 4B46A 2C42A 2FRVA 3U31A 3PXUA 1WX1A 1EWVA 4K86A 3I73A 3RI3A 4V2UA 3Q2OA 3CJRA 4NCXA 1ADYA 3OKPA 4LRXA 2WMDA 3KKKA 4R01A 1GTG1 2CMKA 1POWA 3HPQA 4FBLA 3ZIDA 1P9RA 4PRYA 1FE8A 2NX2A 4D97A 5FWXB 5A4FS 1J8FA 2GHTA 3ZE2B 5IAGA 4ZALA 1L5YA 2REXB 2FPIB 3WGYA 2DULA 1ODTC 4WGGA 4LJLA 1G64A 4II7A 4Y2TA 4B9AA 3MELA 4YDQA 2IS6A 1D6JA 4MYTA 1MZVA 3DOCA 1CRZA 3VU3A 4D4IA 3R3VA 4UHEA 2JDIA 2GBPA 1I5OA 4PQFA 4O29A 1KFKB 4Q7EA 4H1WA 2WYOA 3KR1A 5HF5A 2VQFB 2HXGA 2B78A 3AGQA 4IZ6A 4XSVA 2R0QC 1Y80A 4FUQA 4LHYA 1J56A 4BB0A 1EG2A 4B0OA 2OFFA 1CUYA 1NBOA 1HZZC 3GROA 3AJEA 2Y1OA 5TRTA 3PZBA 4RTSA 1JKJA 821PA 1DO0A 4R3NA 2GILA 1ST3A 2OP1A 2ZJ5A 1SD1A 4NOMA 1DQSA 3E7WA 1L5ZA 3LQ4A 1Z4KA 2BP7A 4TTJA 2SNIE 5DBGA 4PYIA 2CCKA 2ID9A 3B1VA 3V46A 1W581 5IZ4A 3GOQA 4LDQA 4QVGA 2VK2A 4J2OA 2G0NA 1QXSA 3SICE 3VR5D 3IODA 4C4RA 4WW0A 3LP5A 2CHQA 2YNMD 1PFKA 2EBHX 3GGOA 4RZQA 3ZUPA 5JRDS 1LY1A 4NXMB 1KSGA 2JPDA 4M9SA 3A2KA 3VDMA 4DCVA 4CGZA 4LNUA 3HB4X 1YOVA 2ZPTX 4UEOA 1TGYA 5EE0A 4NJEA 1VI2A 3ROTA 1Z0SA 1MENA 3T3IA 2OP0A 2V98A 2NQ2C 3O4FA 1RSZA 2ODWA 3LYHA 3EARA 3ZLBA 1P4AA 1BVUA 1LPPA 2WPDA 5CFPA 3SY8A 4NJMA 2J3IA 1AJEA 3L0ZA 2Z58A 1K66A 2QXTA 4RIGA 2R6ZA 4DBZA 3B7WA 1BTOA 3U7IA 4CEJA 3AERB 3RNLA 4RD3A 1Y98A 1LDGA 1IOZA 1J21A 2WT9A 3KU1A 1ULAA 4LGMA 4PQGA 3GN1A 1ZGBA 4HDKA 4UMVA 5K3EA 2HA7A 1R9MA 4B47A 4JLPA 5L3RA 2C7PA 4RCYA 3RUEA 2ZK7A 2H51A 4JI1B 4Q4CA 4YUAA 2MU1A 1A8SA 3DV2A 3GT3A 2C84A 3M89A 3QXJA 4KV7A 2IGBA 3KOOA 4ZEWA 2V7BA 4JSYA 4M9XA 1AO3A 4MXDA 3EHEA 3SAJA 4DMFA 4WN3A 3E7PA 5B3LA 4BX0A 4Z0NA 4KPFC 5LZ2A 1GQRA 3QYAA 4Z1MD 1OAKA 1H4VB 2O1SA 3BCHA 3F4LA 1Y1SA 3B60A 2J4FA 4PLGA 4LXHA 4UOZA 3Q98A 3RC1A 1RYMA 3THXB 4FDMA 4FEGA 4MWSA 5IC5A 3LW8A 1Q2UA 2ENWA 3P0HA 4X90A 3CH6A 5EFOA 3JARB 4EK9A 5KJ6A 4O4HA 1MRNA 2E21A 2YWJA 5I9MA 1GY8A 3FDXA 5B64A 4UUNA 1AHHA 2EKDA 1OH6A 3DZDA 3FMPB 1E5TA 2I4NA 4UMFA 5LC1A 3R4VA 4E13A 2CLIB 4BRSA 2VZ8A 2O0HA 3GLVA 3HFRA 5JJBA 3CVJA 1I6KA 2JJ2D 2ZUVA 3LP6A 3TZHA 3ACDA 1KVRA 4IPTA 5C3UA 3A0RB 4NYMQ 1ORIA 4M1SA 2WB2A 4CEIA 3ZWVA 1ZJJA 1G8JA 2LZ0A 1G20A 3FFBA 3WYCA 3B1ZA 3AY6A 1AXEA 4M1KA 1AQLA 4JBGA 3W1VA 2XDWA 4D8UA 3HP7A 5KWSA 1JIIA 1VKOA 3KP1A 1USIA 2RH4A 2BUCA 3KZCA 4EG7A 1RQ2A 4UE2A 4XDZA 1XQVA 1YDMA 3Q3EA 4N01A 3P2IA 3TFWA 2YIVX 4DIKA 3MB5A 1RW4A 1APBA 1AG9A 2WHYA 3SYNA 3IVMA 4EJSA 2UVPB 3O1IC 2EFGA 3U09A 2O0KA 5JZBA 5CB8A 1YS9A 2HK9A 4KQCA 2C57A 2OESA 1P3Y1 1UK6A 2JBWA 2PJUA 2HN9A 2WUWE 3AFGA 4JUDX 3LOQA 4B4WA 1PJ3A 1XHLA 1BS9A 2IYQA 1FVOA 1H66A 4P2BA 1OWPA 4BPRA 4KX3A 3G0GA 1R6TA 4RXUA 1U8TA 3HL4A 1T8WA 1W34A 3INYA 1MIOB 3IERA 3I2YX 5EE1A 4WA7A 1S2GA 2CXQA 4KQ9A 4OBEA 5F2OA 3FB4A 2OFPA 3EIOA 4KNVA 2PD4A 2WJ6A 4O4LB 4Q1DA 3A0UA 2ZI9A 5IULC 5BR8B 2RMKA 5T8KA 1KAHA 4MGEA 5L95A 2X2PA 4R0VA 1JQLB 1KAOA 3IB6A 4FSXA 4G97A 5JJ5A 4FFBA 4HF7A 4O4IF 2HSWA 4YJDA 3WB9A 3O82A 2W0SA 3CGWA 3LUBA 4KL8S 3GLIE 2WTUA 4DGQA 4BNHA 3OT1A 2XRYA 1KNQA 4CU5A 1DIBA 1U0EA 2GM9A 1DRUA 1FLDA 2FQQA 3TB4A 3ICEA 1OXBB 2I3GA 2X3YA 1KZHA 5ITWA 1MH1A 1VP9A 2B5WA 3PUYA 2WINI 3VKWA 4RV5A 1A9ZA 4PINA 5AJHA 1U3DA 4DE5A 5K3OA 5CH8A 3DQPA 2GN2A 2OYSA 1ZSYA 2PWPA 3HADA 3U4DA 3BDVA 4JKIA 3SP1A 2KHZA 5HKLA 5JS2A 3CZ9A 1NJGA 3LZCA 4MYUA 3TLAA 3V2IA 1GU0A 2GASA 4RVHA 1WSBA 2EKQA 2H2GA 4LRWA 2C7BA 5D3MA 2GNPA 4AJLA 3WHPA 4AZWA 1JMVA 1SUFA 2VRNA 4IHJB 1Q6ZA 1QU3A 2B1QA 2HK8A 1I2DA 3NOQA 4MJLA 1QK3A 3HUUA 3HVKA 1Z5VA 3QVVA 3EY9A 4OFBA 5DPMA 2NO9A 3FPEA 5I9NA 1E1KA 1FYFA 1IULA 2BGUA 1QDEA 1YZHA 1TVCA 2PU5A 1AXRA 4GOJA 4QG3A 5M04A 1JB1A 2KJQA 3EEFA 1FUUA 2D1TA 1P7CA 3NPAA 1CV2A 3QEOA 2QMYA 4IFIA 3KD3A 1RMTA 2C95A 3CV3A 2I2AA 3K1ZA 5LUBA 3T3GA 1M6EX 3L1KA 1JHZA 2G76A 3DO6A 4QECA 5DF1A 3FTFA 4BO1A 3KOUA 4EFDA 1E5QA 4RJ2A 4WXMA 2HR1A 4J8PA 3UWPA 1Z4QA 4KMOA 3PENA 1OWMA 2REQA 3LPCA 5IYZA 1TMOA 4D6XA 1VPVA 4NHEA 3WKCA 2JGDA 2JASA 2ZM5A 4ITUA 4M1QA 3RVDA 2K7ZA 3G2MA 4GZ6A 4QNRA 3EH2A 4DZTA 3EF0A 3GJSA 1KU6A 1FC0A 1L4HA 1FPQA 1LRJA 1MJHA 1QHEA 1XE3A 1Y9ZA 2OFXA 3HSYA 4XB1A 2WVAA 1QH8A 4UREA 1PK7A 1UH5A 2FVYA 4BAUA 1V16B 3LC1O 4ZVPA 3TG2A 2XCIA 1X1RA 1SHJA 1DC8A 1UCFA 1V71A 2Q6VA 4JP2A 2UUBB 1YVPA 5ALTA 2WVHA 4IDOA 4HNQA 2O19A 5B7PA 1IBSA 1PSDA 5DGHA 2O8FA 1UZAA 1VXRA 3NI2A 4WNYA 4TT3A 1XOIA 5C0OE 3W77A 3USZA 3CGGA 1QGED 2X1VA 2Z57A 3H2YA 3N39C 2AZ4A 1E4OA 1W8DA 2A9VA 4W4TA 3WO1A 3AWDA 4D3DA 5L40A 1VFNA 2G06A 1GGKA 3CF6R 5YASA 2GEDA 2WPNA 3R0IA 3WK8A 2F43B 2IL1A 3BMCA 2AN1A 1CX9B 2WZQA 1O8CA 1FDWA 1J2EA 5A04A 4WLEA 5A0VA 4IX1A 1Z38A 5ALGA 4U4AA 4C7OA 3IPYA 3QEBZ 1P3JA 4S1TA 1FNCA 4PRLA 2C83A 5E6SB 3PRJA 2A9RA 1FNBA 4ODIA 2QUBA 3S1AA 2O6LA 4W9NC 5FOQA 2R1TB 1NVDA 1SELA 2VP6A 2AXPA 3IXLA 3ETEA 4HDSA 2AFIE 2VDMB 5REQA 2RC5A 1M33A 5FTJA 4Y7CA 1P44A 3M6LA 4PQYA 3BWDD 1GVNB 5LP6B 2IDMA 2VPZA 4Q3NA 1E94E 4YQEA 1QSGA 4U6SA 4F2PA 4YMTA 3OF2A 1YB4A 4G9EA 1W30A 3L4EA 2ZBRA 2Z09A 1MU0A 4LKRA 4DYHA 4BMXA 3WYGA 4BC0A 1PLLA 1E1CA 2FPRA 2TECE 3DVLA 4Y6RA 4KKVA 3SZGA 3KQOA 4UU1A 3B9QA 4ZEMA 3L18A 3EQ6A 1N3YA 4OL0A 3PVCA 5EZSA 4C21A 4EABA 5I9LA 1QC5B 1TIKA 2V4UA 2PVPA 2AFIA 4INJA 1QYRA 4WZBA 3WDMA 4M54A 1YZKA 5EZQA 3AH8A 2ZR9A 3I05A 5EY5B 3ILXA 4TMFA 3R76A 3MWGA 5DHTA 1FB5A 4W8HA 1SU8A 2XYHA 3QGMA 4XAQA 3CONA 4E5YA 4EJFA 4ZQCB 2C2ZA 3UATA 4KIUA 1VSUA 1FX0A 3S29A 1V8PA 2JL1A 3H5AA 4Q48A 5DIZA 4WERA 3W5VA 3W90A 4Q03A 3QYFA 3K0AB 3NO4A 4M1YA 1QORA 4ZI7A 1YBAA 1F3OA 2BGLA 3DB2A 4GI1A 1P7WA 4RFVA 5DE3A 4D3ZA 3F6RA 3B36A 1XCLA 2EAUA 1F3LA 3O2NA 1XJ0A 2RHOA 4DA9A 4EFKA 2E18A 3UJ3X 3MC1A 3V1TC 1NBWB 1OAOC 2PQ0A 1K8YB 2VEDA 1NR5A 2VK8A 3D43A 3ORSA 2I34A 3UC5A 3D7SA 3HQ4O 1EUZA 3WICA 1R6DA 1ZIYA 4O4LF 4QC2A 4GR9A 2WK1A 4RW0A 3SX2A 3P9KA 4BKPA 3FAKA 1IRIA 3N5KA 1S2OA 1M2VB 5P8WA 2ZBVA 5A5FA 5CJJA 4J0HA 4RF4A 1QHYA 3EPRA 1GCOA 1I2AA 3CHYA 4KGXA 2QU8A 3FOWA 4XWTA 2C4MA 4LX0A 5LA6A 4PN7A 2GD6A 5AKHA 4HADA 2Q6IA 4HLCA 1LPAB 3BWEA 4PVDA 1IRXA 4LZPA 4BWFB 1BXGB 4UC0A 3UCFA 4LJ8A 1JHYA 1T1IA 2CLDX 4YRTA 4P98A 5IKPA 2DR0A 3WHLA 1I1HA 2YVQA 4JAVC 3OIDA 4HFJA 1XDZA 1FQOA 5ICSA 2NUPB 1PQPA 4WJKB 1VA4A 4Q3KA 3X3HA 1NLMA 2ZJ8A 2WR8A 2JJQA 1GT91 5DULA 1PSWA 1HLFA 1TJ3A 1TMKA 4IDDA 3T8YA 4LHVA 4DUGD 3N6VA 1D2CA 5FOXA 1V1RA 3VU9A 5HKBA 1V37A 3GI1A 4IHJF 4IFEA 1T6YA 4ESVA 5ALIA 4MS3B 5FD8A 3A9SA 1VBNA 2H52A 4QVKA 3M1YA 4KXNA 4Y2QA 5AM2A 1PNQA 3U40A 3RF6A 4P7BA 3ZHCA 3K70B 2YZGA 1P5ZB 1U8AA 1C3VA 3JAKB 4FHDA 3EYWA 4EIWA 3PD7A 3HBMA 2BE7A 4NATA 4XPIB 1Y9EA 5IXJA 2PZMA 3TX2A 1U6JA 3OQVA 4NOKA 1L1FA 2AC4A 1IJBA 1AS3A 4CJXA 3PWZA 1GL9B 4KXUA 5EGSA 3EF3A 4PM4A 3KAQA 4ZV4A 2RHDA 3RVJA 2LUOA 3OFND 1XWFA 5I7SA 3H1GA 5CLGA 5TEWA 3IKLA 4MR8B 2W9XA 5KNBA 2G82A 2XA2A 3F71A 5KYUB 3H5OA 3SSOA 3DBOB 3BGDA 1GRCA 4I9HA 1DX6A 2OOKA 1O5IA 1UXIA 3LUHA 1FP7A 4X85A 2DQ4A 2EJVA 2PX0A 1YCFA 3AVYA 1AZWA 3PDIB 1M2OB 3FPJA 1QHIA 3GQBA 3AOEA 1SQSA 1U1CA 1NRIA 3ZOZA 1F2UA 5D2CA 4CLHA 1IZ8A 1WV1A 3QIVA 1YZGA 3W4JA 1P9NA 3U7GA 4K6HA 4F2WA 1LBSA 4LPKA 3FLBA 3QOXA 2HAEA 1L6IA 3PC4A 3RVSA 2CHEA 3GEIA 4K05A 4BUZA 1ODSA 3AVUA 1U0TA 1WCIB 2FA9A 1SU6A 3EZFA 4JOQA 1WPGA 4L76A 3VTKA 4DCCA 4Z4EA 4FDLA 2WKRA 3HACA 4IJUA 4NARA 1YR2A 1K4MA 2ERXA 2SBTA 4XX1A 5I7FA 2JEYA 2V7QA 4MH0R 4BYMA 3W9SA 3P0FA 3OTOB 3L0BA 3EVEA 3CF0A 3IDFA 3O9MA 3KALA 3QNWA 3TVTA 4BVFA 5L3QB 5DU2A 1CB0A 4ABYA 4I50B 1PGQA 2XWSA 2IXGA 2K5UA 2O50A 1NT2A 4MS1B 1KWKA 2ZR8A 4OSPA 1EWKA 3G2IA 4OUDB 5DHSA 2XGSA 4N82A 4PS0A 1SFRA 2X23A 1GA6A 1U81A 1DBIA 1WUHS 3I6MA 4ILEA 4PLZA 4UVDA 4ZHQB 3PXGA 1V96A 2WFMA 4MV6A 3I2HA 1PW5A 3L6CA 1BWQA 1WQ4A 4LX8A 5JQGB 4AY4A 2X58A 5DXAA 5IJ9B 1ISPA 2ZI7A 3O91A 4KI7A 1Y8ZA 1BFKA 2VAPA 4MITA 4NSNA 5LP6F 1JG6A 1KAMA 2R65A 4CV0A 5H02A 2A58A 3EEIA 2X15A 2BMFA 2K6GA 4NTZA 5DYGA 5CIWA 3AVWA 2QMOA 3PFFA 2VLIA 1COWA 4RTLA 4PPYA 2JW5A 1QGUB 1G17A 1Y34E 2KW5A 1DLIA 1J2YA 2JANA 4P31A 1HA3A 3QXCA 3OJXA 2XT9A 5JCPA 4XB2A 3CMCO 3IMKA 1HTWA 3TIVA 2X22A 4E4RA 2X4IA 5JSFA 3I9MA 4NZYA 5IC6A 1EH5A 4WOBA 4XD2A 3PUJA 2FTKE 1F0YA 4LAFA 2AKEA 2P2CA 1DOHA 2W43A 2MYPA 4X6UA 2ZB3A 2E7ZA 3WL7A 5LIPA 1GCGA 2BFBB 4EHHA 2ZITA 1U7PA 3AFOA 5IVHA 1XFAA 1NN5A 2HJVA 2QT1A 2Z4SA 2O2IA 3WNVA 4L07A 2Y1XA 1TAQA 4ZN6A 2NUTB 2HL6A 3AJ9A 5ILGA 4F9FA 3KG2A 4FJ1A 3CW2A 2EL9A 1P5FA 2GZAA 3UMGA 4DV2B 4CDMA 2FSHA 1ZN7A 3FJ1A 1MQSA 4MQEB 3C6ZA 3DFFA 3ETHA 4BBZA 1JE0A 1LK5A 2ZXEA 2VL7A 1M7BA 3EUAA 4DEVA 1MNQA 5HM8A 1XZKA 3TTXA 1VCMA 2D62A 1VMAA 4KH0A 1OHHD 3IX7A 2AG8A 5DYWA 5J4VA 1VGQA 1PR9A 4QU0A 1I5RA 1WKCA 4XKJA 2WLSA 5IN4A 4N18A 2G40A 4DMRA 1Z5WA 1UJMA 3SGLA 3UMJA 5J4KA 2NYUA 4MCAA 1X7YA 3C1UA 4NEGA