4X95A

Crystal structure of fully glycosylated lysosomal phospholipase a2 in complex with methyl arachidonyl fluorophosphonate (mafp)
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
375
structure length
375
Chain Sequence
HPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Group XV phospholipase A2
publication title Structure and function of lysosomal phospholipase A2 and lecithin:cholesterol acyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 124
structure length 375
sequence length 375
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02450 LCAT Lecithin:cholesterol acyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4x95A01
5T4HA 4QDXA 3N0TA 5AICA 4W1RA 3H2JA 3IULA 2XI4A 3STVA 3A2LA 4UHDA 4DYHA 5EIAA 2AJBA 5AOCA 4PSDA 4U2FA 1MPXA 4EHBA 2QT9A 4L9AA 1VE7A 2AJ8A 1SC9A 2OCLA 2PM8A 3O4JA 5HFNA 3QVMA 4KACA 2C0PA 4UBMA 5CT9A 2PU7A 1E5TA 3D59A 1A88A 1JT2A 2QVBA 4H7HA 1DWPA 3I2GA 4Y2QA 3C6YA 5K3FA 4Y2XA 2WFLB 3WWPA 3T4UA 3OM8A 4DNPA 1WM1A 3D2CA 4J0HA 2BAGA 3EBLA 5IVHA 2VJBA 1FFDA 5AI5A 1UK9A 1U8EA 1QZ3A 2Q0XA 4B9AA 5AM0A 1WCYA 1DX6A 5IH7A 2Z5GA 4J0IA 2WUFA 1H2XA 4CCWA 4IH9A 4K5QA 2DHDA 3V1LA 5CH3A 5AI6A 2AXEA 3IIIA 3BDVA 1A7UA 5ALVA 4YPVA 4C6HA 3KOOA 2XE4A 3WA7A 3O95A 1AKNA 5AHXA 3LIPA 4X91A 4C4XA 4QLAA 1WPXA 5IVKA 5I7UA 4Q3LA 3K9BA 2VSQA 5DTIA 1SOMA 1Y7IA 4KYVA 4ZREA 2HFJA 5FUMA 1MX9A 1X2EA 3UUEA 4NMWA 3FBWA 1FFCA 4BCBA 2OCIA 2HA5A 4OU5A 3C6XA 4X93A 1EHYA 1ZI6A 1LZKA 4Q05A 2V9ZA 1CUDA 3W2TA 4Z49A 3FLEA 5JD5A 5AP9A 4LXGA 3WYNA 1JMKC 3I2JA 3OTQA 4G4GA 2WU4A 4BP8A 1J2EA 1FFAA 2OCGA 2V96A 3VISA 4CCYB 2Z3ZA 2B61A 5A7HA 4DSZA 1JJBA 1E89A 4Y2PA 2W6CX 4UFNA 5DNUA 2JBWA 1DQYA 4ARBA 1FFBA 2WG1A 4MQMA 1ODCA 1XZDA 3WIOA 2PL5A 3ZLTA 1I6WA 1MNAA 2HIHA 1RYYA 3QPDA 5AO9A 5HCUA 2WJ3A 3CN9A 5HK8A 2WUEA 1ZOIA 2XQJA 4PO3X 2GBFA 2DHEA 3G9XA 3M82A 3LCRA 3U1TA 3I28A 3W06A 5F4ZA 2WFLA 1CUIA 5ALDA 3C70A 1ACLA 1CUYA 1GT6A 2ROQA 3I1IA 5AJHA 2XUIA 1THGA 2CMFA 3G9UA 3RM3A 5CXXA 5LKRA 1JI3A 5JAHA 2ZYRA 4BYMA 4N8DA 3A2NA 5AKYA 4HRXA 5C8XA 2HHAA 4PF1A 2WIFA 1QIGA 2X5XA 1EK2A 2WUDA 3VKFA 3VVMA 1E8NA 1JU3A 4WCVA 1K4YA 2VJCA 3G0GA 4DIUA 2HU7A 1BE0A 1CPYA 1XZHA 2WHPB 4RGYA 3DYVA 4AMZA 5I9IA 2PVSA 4J0DA 3HABA 5DNVA 2BKLA 2DFPA 1XLWA 4ZV7A 1XQVA 2CBGA 1UKCA 5AKXA 4EUSA 1VA5A 1TKRA 5JD6A 4BTLA 5K3AA 3DKKA 4CG3A 3EQ8A 3BF8A 1CUHA 1JMYA 2DHCA 4DNQA 1QTIA 2HA0A 3HJUA 4BATA 3QYJA 3V1NA 3W9BA 2PX6A 4I4CA 1ETHA 4B81A 2G4LA 3R3YA 4BC0A 5AH0A 5FP0A 4G8CA 4ZRDA 3BWXA 5LIPA 3PF9A 1CUEA 4Q3OA 2OQVA 1R50A 3A6ZA 4E11A 4OSEA 1DWOA 2Y2VA 3HEAA 4H7JA 4H7IA 4FLFA 4CIBA 1YB6A 1LPPA 2OG1A 1S8OA 4BVKA 1Y37A 1A8QA 2C4HA 1WOMA 1ZIXA 4K6GA 1VXRA 4UBJA 3HYSA 3QMVA 3FNBA 5K3EA 4UBNA 3EQ7A 1LPOA 2HU8A 3D4LA 1IZ8A 2X8BA 3ICVA 4WDQA 2HA4A 4N5HX 1HKHA 3VXKA 1BCSA 3JWEA 1W52X 2HU5A 3CN7A 3GBSA 1YASA 1U2EA 3QM1A 1CLEA 4QDTA 2JGJA 1NU8A 3BIXA 1XRQA 2CJPA 1ZD3A 1XZLA 5FPPA 1AMNA 3SC2A 1CUXA 1Q0ZA 2XMDA 1EX9A 2CEKA 2IITA 3C43A 5JZSA 5JIBA 3I6ZA 2Z3WA 2QXUA 3I2HA 5E4JA 3GELA 4W1SA 3O0DA 5HFAA 5CW2A 1GXSA 2QXTA 1VZ2A 3R3WA 4FKBA 3HXKA 4ZV9A 5LYYA 5EIEA 4X6XA 4A5SA 2HA7A 1AURA 4X6UA 3AJAA 2ECFA 3VJMA 4OUKX 1MNQA 4AO7A 5LZ8A 3MUOA 4WFIA 4UBOA 1H23A 3STTA 2WFMA 2WHPA 5AI9A 1T2NA 2BJHA 2WKWA 1LNSA 1XZCA 4W9RA 4CFSA 2Y6UA 3PFBA 1EVQA 5CTAA 1QOZA 3C87A 4HZGA 1BEEA 4GW3A 3O4HA 4OCZA 4G5XA 1CQWA 1XZBA 4Q3KA 4EY6A 3VDXA 3GA7A 4GI1A 4I3FA 4KE8A 2HADA 3V48A 1BCRA 5AKKA 6YASA 1DQZA 2FJPA 3EIOA 5HQ3B 4ZI5A 5T4EA 3ANTA 5CH5A 5ALTA 2ES4A 3AINA 3AIMA 4BE4A 2QRUA 4QWMA 3E4DA 5ALKA 2CKMA 5K5EA 4TGLA 4XJVA 1EVEA 2C58A 5JZBA 1R4ZA 5BOVA 4RE5A 5CT4A 4U2DA 1UZAA 3G9ZA 4H7EA 4YX9A 1VKHA 4DM7A 5SYMA 3CXUA 1EDDA 1QIFA 3MVEA 5E4TA 4G1FA 5A7GA 2ZJ6A 4BZWA 5ISMA 4ITVA 5AK3A 4FFVA 4FDMA 2HFKA 2WG2A 1K8QA 3KXPA 3PUIA 1OCEA 4N8EA 2W22A 2BFNA 4BBZA 4B9EA 4JYPA 1DT5A 5C8ZA 3W04A 4S0XA 3BF7A 3GUUA 3OPMA 1WB6A 4QA9A 4DSAA 5A2GA 1P0PA 1VOTA 4BAUA 2WHQA 2QMQA 2O2IA 5ALYA 4GLBA 5T4FA 3L1HA 4QDOA 3RLIA 4O08A 1IVYA 4OB8A 4JUIA 1YR2A 1F0NA 3IA2A 2XUHA 4FFWA 4ZXFA 3H2IA 4BVLA 2RAUA 3C8DA 4GHWA 2ACEA 2XUKA 1BN6A 3Q8WA 4X97A 1C7IA 1TQHA 1G42A 3H0CA 1AX9A 1CUVA 4GXNA 1WHTA 5AIAA 2DR0A 1MJ5A 1K63A 2JGKA 1MX5A 1YAJA 3F98A 1UOOA 2CUTA 5AI8A 4ZGBA 5C81A 5ALNA 3WZMA 3H17A 2VATA 1QIDA 4ETWA 3ZLVA 3WL6A 2QUAA 5FRDA 3H2HA 4G9GA 4U2GA 1RWQA 4AMYA 2JGIA 3D3NA 5AKIA 3U0VA 4UFOA 4G8DA 2VF2A 4IH1A 2WJ6A 4EZIA 1ZJ4A 2I03A 2JGEA 5ALWA 2YXPX 4L72A 4KAJA 4HXEB 5IKXA 3EF3A 1SFRA 4OD0A 5JAOA 4PQEA 4N8SA 1WPRA 1G5FA 1LPNA 1GQRA 2PSEA 2GZSA 4U2BA 4K6HA 3CCCA 4KRYA 3WWOA 3G8YA 4J0JA 4FOLA 4X95A 5HQ3A 1ORWA 4H0CA 1IUOA 1UKBA 2P8SA 1XQXA 1EDBA 2G5PA 2HM7A 3PFCA 4KE6A 3D2AA 1AQLA 3WK9A 2EDCA 3DL4A 1Q84A 4XIIA 4UHFA 3RKSA 2PSHA 3DKRA 4AZ0A 3H04A 5AI0A 1LPMA 1W6RA 3STUA 3BJRA 1HBJA 4BRZA 3NWOA 4PNZA 5FLKA 2XUOA 1AC5A 2JGLA 5BV7A 1UK7A 3PF8A 2XMQA 1XQYA 3B5EA 4WY8A 5T4BA 3FSGD 1CUZA 1A8UA 4EA6A 2WG0A 1CUJA 2E3JA 1QGED 1ZGCA 5ESRA 1X2BA 4HXGA 4XWGA 1LPSA 1N8SA 1W75A 4H77A 2R8BA 5YASA 3TRDA 3WK5A 1HDEA 2XB6A 1K6EA 5ALIA 5DTJA 2OLEA 2WILA 3G0BA 2BUBA 3C5VA 1XZFA 1ZIYA 5JADA 5HF8A 1MAAA 5LZ5A 3KD2A 4OB6A 1GPLA 4OPMA 5CXUA 1ORVA 1VXOA 2VTVA 4EY7A 5ALZA 2DQZA 1CFJA 3KDAA 2VAVA 5DYYA 2H9YA 1MU0A 5H3HA 2XUDA 3TEJA 4GDMA 3GZJA 1XROA 2R11A 4K2AA 5HK9A 4B6GA 4RE6A 1TRHA 2WSLA 3M81A 1R88A 4J0KA 3FYUA 5JAPA 1F0PA 1LPBB 3G7NA 4GECA 2B9VA 1Q0RA 1CEXA 4BDSA 4UHBA 3IB3A 1UKAA 4C89A 3O4IA 1BRTA 1H2WA 1F6WA 1QFSA 3ANSA 3DOIA 3G0CA 1AGYA 3UUFA 3WLAA 2QR5A 2VT7A 1MAHA 4UHHA 4EBBA 4B80A 4B0OA 2ZJFA 3OG9A 3HI4A 1UK8A 4Y2JA 3H1BA 1MO2A 1SCQA 3G0DA 2AJLI 2Y2UA 4CG1A 5DLPA 3DYIA 5AM2A 1G66A 2JGMA 2OGZA 5ALPA 4WFKA 5ALXA 5HKBA 3CCBA 4C88A 1YB7A 2ORYA 5DJ5A 1L7AA 2BCEA 3RK4A 2GBIA 3ILSA 1MX1A 3FOBA 3DCNA 4K6KA 5K3DA 3KWFA 3DL7A 4PSUA 1CUSA 1PJAA 4DMFA 5FOQA 3I2FA 3D7RA 4BC1A 4MQLA 1GZ7A 1X70A 2C5FA 4MYDA 3E0XA 4J0CA 1WB4A 4LXIA 1CUUA 1CUAA 3W05A 1CV2A 1YS1X 3B12A 5ALHA 3DEAA 1OXMA 4J7AA 1XZGA 4Q1VA 1ZI8A 4NS4A 4KJXA 3WQHA 4WDRA 3FAKA 4FBMA 3BXPA 4NZZA 3ZLUA 3T52A 3UMJA 4AB1A 4MYSA 3HLKA 2GZRA 5AKHA 3F67A 1YA4A 4GBGA 2J3QA 3DQZA 2XQKA 2RHWA 1LLFA 2HL6A 2BGRA 2XLCA 4CIAA 4FMPA 2PKYX 3IURA 2YYSA 4UBIA 2H7XA 1ZI9A 3STWA 4F0JA 3VJKA 4AN1A 2QKYA 5LZ9A 2QJRA 3R3ZA 5AIBA 1QJ4A 2GBGA 4D9JA 4B0PA 3MUNA 5FKJA 4MJ3A 1VLQA 3QMMA 4QDZA 1DINA 4AN0A 1MT3A 1FFEA 2ZJ7A 3GFFA 4Y2YA 1YS2X 3FLAA 4BVJA 1TCBA 4DNFA 1QIMA 3B3QA 7YASA 1GPNA 1FSSA 1GQSA 3WKAA 4TPKA 4HVTA 5CT5A 4U2EA 2O7VA 2XUFA 3ZV7A 3I6MA 3PUHA 1EB9A 1L7QA 5ALGA 3HACA 2JGFA 3S8YA 3RARA 2EEPA 3O4GA 5CURA 3LLCA 4X92A 2XUPA 2V98A 5HZGA 1QIEA 2B20A 4EY8A 2CZQA 3AFIA 4MEAA 4BRSA 4ROTA 5EFZA 3MGAA 4JEIA 1TCAA 4KR0A 4G4IA 1L7RA 4EY4A 2NW6A 4DMHA 1Q83A 2BGNA 3H19A 1H2YA 5BWBA 2CB9A 3WIBA 1LBTA 4B85A 1XLUA 1DX4A 1HLGA 4A16A 2I3DA 3IDAA 3ESBA 2J4FA 1XRPA 4WFJA 1BS9A 4QWWA 1HQDA 1PV1A 1XZJA 1VE6A 3PE6A 5AK6A 2DCMA 3HZOA 2VJAA 4J0GA 4KRXA 2PUHA 1F8UA 4AZ3A 4IHAA 2QZPA 3HSSA 4FHZA 2OGTA 3PDCA 4NVRA 5JYCA 4B84A 4UBLA 2OPHA 4H7DA 5FV4A 3IBTA 3D5EA 2RHTA 4ARAA 2YASA 2DQYA 5IVIA 3QZUA 2ZYHA 4W63A 2ZSIA 2VT6A 3D2BA 1JJIA 2B4KA 5AI4A 1ODTC 3STXA 4XVCA 1ZD4A 5AKGA 3G0IA 5AM4A 4ZWNA 1CUGA 1EI9A 4M0EA 1E8MA 3V1MA 1EXWA 4TVKA 3WA6A 5DWDA 3TGLA 3YASA 4L0CA 1QLWA 2VEOA 1YSCA 3SWWA 1UWCA 3OOSA 4X6YA 3WK8A 1EH5A 2ZYSA 4Y2SA 1KU0A 1XKTA 1BN7A 1XKLA 2WTMA 3ICWA 2PSJA 4WY5A 3BDIA 4AX4A 1J06A 5JASA 1GKLA 2K2QB 1HL7A 1KU6A 5E2IA 4CI9A 5EGNA 4N5IX 4G8BA 3WKCA 3QBJA 5ALSA 4C4YA 4IQ4A 4Y2UA 3ESCA 2VAXA 3R3VA 3R0VA 2JF0A 5KWIA 5LKAA 5A7FA 4G9EA 3H2KA 4C87A 4Y2RA 1XZIA 5A71A 4Y2VA 5JD4A 4QLOA 4PW0A 1GGVA 1JU4A 3W9UA 5FPQA 1NU6A 4I19A 2Z8ZA 3IUMA 3WZLA 4QNNA 2WIKA 1QO9A 4BZZA 2XUJA 1OILA 1CIJA 2IIVA 2HA6A 5DNWA 5JATA 5J3JA 3BIWA 1UOPA 4IH4A 1PFQA 1ISPA 3DOHA 3FYTA 5ALFA 1TK3A 4FNMA 1AZWA 3WL5A 2XQIA 4MEBA 1ZICA 1DU4A 4BTVA 4PSCA 3I2KA 3FYUB 5SYNA 4DMKA 1CUCA 1QIKA 3DJYA 3ESAA 5HKAA 1VA4A 2VA9A 2XT0A 3FSGA 4BB0A 5AKLA 5ALUA 1H2ZA 2D5LA 4AXBA 5A6VA 5ALQA 3LS2A 3IUQA 1CUWA 2UZ0A 4LYDA 3I6YA 2WHRA 1N5RA 2PSFA 4Y2TA 1UT6A 2JIDA 1R3DA 2HA3A 3A70A 2XDWA 4Y7DA 1GKKA 4UBKA 5K3CA 4DNOA 2RI6A 3PICA 3O9VA 4KEAA 1G4HA 4KAFA 1XRMA 2HRQA 2OCKA 3FWHA 4X00A 4X85A 1DT3A 3V1KA 2OAEA 5AKJA 2AJCA 3R3UA 2WLSA 4UFPA 4LIPD 1DWQA 4M0MA 1B6GA 1O6GA 2H1IA 1TCCA 4Y9SA 1XRNA 1XZKA 4YK7A 3NUZA 3FYUC 1U4NA 1USWA 5K3BA 2J4CA 2Y1KA 4QZVA 5LZ4A 4BCCA 4P92A 4BCDA 3GROA 1MTZA 1R9NA 3WL7A 3G9TA 1SCIA 4UHCA 3WKEA 2GYWA 2QTBA 4W1QA 1UOQA 2ONCA 5ALJA 1TAHA 3X3HA 3A2MA 4BDTA 3DS8A 2Y6VA 2OQIA 3IUJA 1ACJA 1CQZA 2YH2A 1XRLA 2LIPA 1BEZA 2XMCA 3QITA 3AZQA 2C0QA 2RONA 4PV7A 2BUAA 4DMCA 3QH4A 5AOAA 4BE9A 1UXOA 4FBLA 1SCKA 5CT6A 5JALA 3M83A 1XZAA 1U65A 2WIGA 3WI7A 1E8DA 1DTEA 1P0IA 4QEKA 2RGUA 4OU4A 3WJ1A 1BROA 2WU3A 4H7FA 1GPKA 4FWBA 3R41A 5CRIA 4LXHA 1AUOA 4INZA 3C8HA 3P2MA 2QJWA 3H18A 4F5ZA 3S2ZA 2EDAA 3R3XA 4X94A 4B82A 1E3QA 4MXDA 1RP1A 5AOBA 2HA2A 5HF6A 1P0MA 1N1MA 2WUGA 2WQZA 2XUQA 3V9AA 5AKZA 2QUBA 5D3ZA 1XRRA 5EHXA 1J1IA 1P0QA 3JYHA 5E4YA 5I8PA 3WKBA 5JARA 4RPCA 4BAGA 3AILA 3DLTA 3WJ2A 1Z68A 2XUAA 3F97A 2XQGA 5ALLA 3F96A 1JKMA 4H7KA 3WWEA 1YAHA 3WK6A 2G63A 5KBYA 5D3KA 4BP9A 1LZLA 1CRLA 5AM3A 3BJMA 2WIJA 3FLBA 3DDUA 4P93A 1K5PA 1XLVA 2QS9A 1VJ5A 3N2ZB 4JYMA 2I3ZA 4B83A 1XQWA 2XLBA 2XQFA 5AM1A 3C6BA 5ALEA 3WKDA 3STYA 4OYLA 2WJ4A 2XMZA 3F9CA 5CBKA 2PSDA 3JW8A 2WM2A 1EINA 3EQ9A 3ZWQA 1QTRA 4OYYA 4LYEA 5AK5A 1T4MA 4P9NA 4M0FA 1UFOA 1W1IA 1QO7A 2I78A 2ZVDA 1HPLA 1ZD5A 1EDEA 2XMRA 1MN6A 4OB7A 4C01A 1IMJA 2JEYA 5LP1A 4B7ZA 3I1YA 4H35A 5EHZA 5AM5A 4CG2A 3WK7A 1XZMA 3LP5A 3H2GA 5EHQA 1C4XA 5A62A 1QIHA 2C7BA 5KREA 3IUNA 3D0KA 1D07A 1JFRA 5D7BA 3F8SA 4X7BA 3WMRA 2GBCA 1KEZA 2WTNA 1R9MA 3O9MA 2FX5A 4P08A 3ZI7A 5CT8A 4X3CA 4X90A 3AIKA 5KWJA 2QOEA 4C4ZA 4Q34A 2GYVA 2H7CA 2V97A 4F60A 1ZD2P 4U2CA 3ESDA 4Q82A 3TJMA 4LHEA 3M3DA 4HRYA 2XUGA 4V2IA 1QE3A 2JEZA 1A8SA 2H7YA 1C7JA 3SK0A 3K6KA 4HS9A 3C45A 5C8VA 4UPDA 4AO8A 2HRRA 1QIJA 4LKOA 3VVLA 1TIBA 3AIOA 4UUQA 4JH0A 4QE3A 4CCYA 4GEGA 1W76A 2VJDA 2Z8XA 2D0DA 4JNCA 1THTA 1EA5A 3LIIA 1EK1A 3DNMA 2ZSHA 5JZ9A 4E15A 3SX4A 5EI5A 5ALMA 2PBLA 1W4LA 3BE8A 1XFDA 1UK6A 3FCXA 4WJLA 3FVRA 5LZ7A 2O2HA 1H22A 3G02A 5FXMA 2VQ6A 1NX9A 3E1GA 3ED1A 5ALRA 4AO6A 3NGMA 5LLSA 4J03A 2PUJA 1ZGBA 5DYWA 1CVLA 4DLNA 4W1PA 1M33A 4XX1A 3C6ZA 4YASA 3DD5A 1R1DA 4FTWA 2X76A 1IZ7A 1QIIA 1E66A 2PU5A 2OAGA 1Y7HA 5FDFA 4MWTA 2ACKA 2QM0A 3QPAA 4E46A 1XZEA 3R40A 4KAAA 3Q0TA 4DTCA 2XMGA 3L1JA 3L1IA 2C5GA 3OURA 4HTAA 3WWCA 3WWDA 1VZ3A 4J3JA 2RIPA 1J07A 1ODSA 1CR6A 1IUPA 4H18A 5K3FB 4L3WA 2OXEA 3OC0A 4FNGA 5JANA 3FCYA 1EB8A 3IVMA 2G5TA 4KE7A 3PI6A 2PPLA 1IUNA 2FUKA 1JJFA 2WIDA 3KSRA 1BU8A 5HF9A 3FVTA 4HXFB 5CMLA 3AUKA 2XMSA 3AZPA 2OGSA 1QFMA 4DGQA 2HDWA 2DSNA 4G4JA 2WFZA 1LBSA 5D6OA 3WYDA 1FJ2A 1ZJ5A 4RNCA 5EIHA 1WB5A 5JAUA 4UHEA 3AZOA 5LZ2A 2O2GA 4MWSA 1YCDA 5AK4A 5HF5A 4EB0A 3HRHA 1WHSA 1LPAB 4GWLA 3QPCA 5DYTA 5C7YA 3WL8A 1YA8A 4HAIA 3E3AA 2XMBA 1CUBA 4IO0A 4FLEA 1B41A 1N5MA 4KE9A 3ZPXA 4X71A 5BWCA 3K2IA 3HC7A 3NOXA 5CH8A 3H1AA 4AQDA 2O7RA 2IX9A 5EHNA 1LGYA 3QMWA 4F21A 2FJ0A 1QONA 3VJLA 2BUCA 1CUFA 3KWJA 5ALOA 2J3DA 3BL8A 2ZYIA 4BAZA 2AJDA 2GYUA 3C5WP 3I2IA 4QDUA 5AKEA 5IVDA 4A23A 4E14A 3WK4A 4FLMA 1O6FA 4EY5A
chains in the Genus database with same CATH superfamily
2Z5FA 1Z0DA 1CW2B 3N0TA 1UZLA 5AICA 3IAM1 4JT9A 4W1RA 4XDZA 5D85A 3UIEA 1HQCA 2YINC 3OETA 4M0UA 2XI4A 4XDHA 5AVYA 4OHRA 3LPNA 3R6TA 4Z1MD 4DYHA 4PFQA 2P67A 4KKXB 3N2EA 4IIJA 4NYMQ 2Q3CA 2EL7A 1OE0A 2IYZA 2F00A 1M34B 4NJMA 3QBVA 5AOCA 5KYXB 1X7XB 5FPYA 4GZLA 1JF8A 1JHZA 3PQ3A 4HWKA 3KIPA 3EPPA 2QT9A 3CQ9A 1VE7A 2AJ8A 2GESA 2RAVA 4P5DA 1SC9A 4CUJA 4UCXA 1OFTA 1TU4A 2PM8A 1VYHA 3QKRA 1Y9AA 2O9JA 2PE5A 4Z4EA 3D31A 3D8BA 1WY5A 2ZU0C 3CE9A 4E2YA 3O4JA 3USCS 1Y89A 4LX0A 4EX6A 4JIGA 2R00C 3C3YA 1GA6A 1X7DA 2XBLA 5BMVA 3AOEC 1FP4B 1OU4A 4KACA 1SU8A 4MO9A 3GJYA 5HFJA 5CT9A 2Z2YA 1OXKB 4C20A 3Q72A 3SQOA 1GZ6A 2NO0A 4H7HA 4M0DA 2QVBA 3EEBA 2OKGA 1R4MB 4FFMA 4CEHA 2G76A 3CEHA 4D9CA 4UDXX 1IDOA 4IJ6A 4Y2XA 2LRHA 1QF7A 4PX9A 1GGHA 1A9YA 4FDAA 3OE5A 1NLFA 4PYMA 1HQYE 3L40A 5FNVF 3ZBQA 4Z51A 2PKQO 3G82C 1O96B 4RKFA 1LS1A 3WWPA 2PAAA 3N2IA 3OCWA 4JL8A 2J5XA 3A1NA 3SXJA 2XCIA 3EXIB 3PJEA 3PR2B 1ONSA 4LQ4A 2PZMA 3CUEF 1WM1A 1CJSA 3W5VA 4R51A 1V45E 4BLTA 1BTOA 5HYVA 5ERXA 4J0HA 3HU5A 2BBSA 2D7JA 5FYQA 5FUBA 3JQRA 1Z6GA 1CK4A 1E1CB 3UWPA 2PRJA 2ZE6A 2FPXA 2V4ZA 4DDVA 1A5SB 1NFFA 1QKJA 4GSKA 4A3SA 3C3CA 3WFZA 2VJBA 4RLQA 1VECA 1XD2B 1FFDA 5AI5A 3SSOA 2AMVA 2EARA 2QU8A 4FYWA 4XYEA 1UK9A 5L3VA 1NXOA 3B36A 1GTVA 4WQMA 3VDMA 2BVNA 4DR2B 4CV2A 2MYPA 1QZ3A 4C4OA 4B35A 5JAIA 1KWKA 1LBQA 3A1SA 2QY6A 4C7BA 1R0ZA 2Q2OA 3ZUGA 1Y4DE 2RAPA 4MVJP 3K9CA 2BHTA 3R9IA 5D84A 3RFUA 3MCVA 3N0WA 4L51A 4DA9A 5HJ7A 4I66A 2JARA 2GZHA 3LSYA 4GXQA 3TKLA 4IH9A 2B1GA 2DHDA 2QTTA 4X66B 4MHOA 3K96A 2CWWA 5CA1B 1H9CA 2G4VA 4TKVA 5JZVA 2FN9A 2HSWA 2PG3A 3GLHB 3P2KA 3TFQA 1T9AA 2VF4X 3WNQA 1UDCA 1R6TA 2R25B 3KR0A 3KOOA 3THXB 2WB2A 3QOFA 4J76A 1WXDA 3B5IA 1DQRA 3B70A 4PN3A 2XMPA 2FB9A 4LQDA 5B1EA 1G8AA 5KOHA 5CB8A 5E3IA 1VB3A 4PG5A 1FX0A 2J6HA 3NMUF 4RAOA 4HPXB 1YB4A 2IEGA 3VR3D 3KQKA 1KZYC 3PUVA 3S99A 3IQZA 3LIPA 4QLAA 1KVUA 5TC4A 4QBGB 1Z56C 3ZGVA 3BAFA 1ZVQA 3VMFA 4RVFA 5IVKA 3ZWPA 4EMTA 2QN7A 2ZAMA 4FGWA 2XEXA 4L4SA 4LDPA 5DTIA 2CNWD 4KYVA 2IXGA 1VI2A 3FTQA 3H2ZA 3FKJA 2XB4A 3JVDA 1XRSB 1R2QA 4N7BA 3ELYA 4TWJA 2DR3A 4X5OA 1XEAA 4TT8A 3HU3A 4KWIA 4WJLA 5BVHA 4KIFA 2GAJA 2HJRA 1THMA 1AMUA 3T5GA 2IHTA 4OFBA 4N7MA 2EKQA 1GRCA 1I1OA 1W4BA 4NMWA 3UUEA 5IJ9B 2C7PA 1W59A 1DO8A 2OCIA 3ETGA 3OQMA 4MI1A 1VHWA 3OCJA 1POXA 2VF5X 2R00A 2WBLC 3RUEA 2WR8A 3C3JA 1EM6A 3VA7A 2RGDA 5ITWA 1ZI6A 4IRXA 4PN7A 3ETEA 1TA4A 4ASUD 5A0FA 3SOZA 3FB4A 2M1XA 1CUDA 4JJGA 2JVKA 1VCNA 4PAOA 4Z49A 3MTAA 3CW2A 1EFPA 1OKKA 2FOIA 3FLEA 4L4ZA 1DB3A 1N2JA 4V38A 3UMFA 3AUSA 1V1MB 3QX7A 1U8UA 4KQ9A 1H2FA 2HDOA 5AW5A 2IYSA 1WZUA 3HMKA 3I0MA 3HYLA 4PHGA 1N5IA 3BFKA 4G5FA 2Z8YA 2IUSA 3FYSA 3HVHA 4RK6A 2GNPA 1GKIA 3N39C 1YRYE 4MUHA 1AB6A 1S1MA 4EG8A 3THYB 4F2WA 3TD9A 1FFAA 1W1WA 4GIBA 4IX1A 1YH3A 2A5LA 1QSGA 3GJ6A 1ZX1A 5JCJA 2MMCA 2B61A 2Z1MA 1J7KA 4OK5A 5A7HA 2G1JA 1YR7A 4FGZA 4RA6B 3TE7A 3AM4A 4OXRA 3ZQJA 4PZ9A 3C5CA 4NFSA 1GFWA 2VJLA 2GF0A 4UFNA 5EAIA 2WPNA 3OEEA 1Y6GA 2M98A 4DSTA 1SVMA 2Z9DA 1B0PA 4I9HA 4IV8A 3ED5A 3OCXA 4MVJE 5EWMB 1KIFA 3K0BA 2WG1A 3Q6MA 3FZQA 4GI3A 5E8RA 1MIOB 4AJPA 2XWBF 2VDKB 4ZAGA 2IU3A 5CDFE 2B34A 5D3QA 5B6IA 2CFTA 5ED0A 1UBOS 3Q12A 4MZDA 2X5KO 3E9NA 3GLHE 5LCXA 4DJ5X 4ETNA 2PL5A 3ZGXA 4ZAVA 9GPBA 3WGIA 3Q41A 3HN6A 3HEBA 2DFTA 2EG5A 2MYNA 4RMIA 2C83A 5IARA 4QHSA 4AQ7A 2I1LA 1A9OA 3O1HB 5EIWA 1TO2E 3DFUA 4Z4GA 1YTUA 3OZIA 1HDCA 5KOIA 2QMZA 1FQKA 3IMEA 3OCVA 1EXVA 5HCUA 3H3FA 4JJAA 3BCRA 4NONA 1QS0B 2GM9A 2GUGA 3LO8A 4NU0A 1TVKA 4PIPA 5IS2A 3AUYA 5HK8A 2IU0A 3TLKA 1V6CA 4H6VA 3PWSA 5A05A 3BGVA 3OKFA 2DLNA 1L4GA 4KQJA 3N6XA 1RHRA 3CIOA 4V2UA 4DCTA 4EYEA 3MMNA 3MUFA 5EQTA 1C0IA 3TZCA 2O8DA 4JSTA 3ZCXA 2W90A 1A5BB 3T5TA 1OU0A 2AEEA 4RXTA 1NAHA 3BREA 3COPA 1EJ0A 5F7ZA 5IYZB 2XTAA 3GAAA 4Q3CA 1WY7A 4BMSA 1QBGA 3WRXC 4N3CA 4HZUB 1HTWA 5CR9A 1EHIA 1NOJA 5KNDD 3LBHA 4UOEA 3AU9A 3ZJTA 3EAFA 1C9MA 1CS0A 1RXSA 2YMPA 5FA6A 1CUYA 3I1FA 4DWJA 6GPBA 2XT9A 4BO5A 1JQ3A 2ROQA 3FIJA 4JJ4A 2FPGB 3E9MA 3KNZA 4Q16A 4J7UA 5AJHA 4CLOB 3AJRA 1JHRA 2BEUB 3AW8A 2N9UA 3RM3A 5JBQA 3GARA 2QY9A 5AOVA 3SQLA 1L5OA 4NJOA 4KK4A 4XDGA 1JH9A 1JI3A 4L3OA 3K0AA 2ID8A 6Q21A 2RG1A 3DR5A 5AKYA 1T9DA 4DLYA 3R9WA 2QR2A 2EFYA 3GXOA 1XPOA 2WIFA 1QIGA 4MRNA 1W47A 3WLEA 5JBIA 16PKA 4KQEA 4I55A 2JFOA 1G4UR 4LXYA 2GILA 2WYWA 5LP6A 1EM8B 3EAGA 3HKDA 3ESZA 3MWFA 1DHRA 4ID3A 4HBZA 4NI5A 3BULA 4D4HA 4D4JA 4WCVA 2F59A 4BMVA 2DXIA 3R0XA 4RIFA 5BWNA 1FFYA 3G0GA 3V5NA 1HT1E 4RD0A 1COWD 1DSSG 2PZKA 1EBUA 4OM7A 2QYTA 2GJKA 1XZHA 3I30X 1NVBA 1XVTA 4AJ1A 2WHPB 4RL6A 1PT7A 2ODEA 4KVZA 4XOUA 4IQGA 4OHXA 4RGYA 3DYVA 3T99A 3EIFA 1NRJB 2Q8NA 4J0DA 4URFA 2EKZA 2GKSA 1VHTA 3HABA 4NU6A 5DNVA 1TZCA 2BKLA 1E61A 2P3QA 2DETA 3KYDA 2JB9A 1XLWA 2F4NA 4ZV7A 4BMPB 5IJZA 1KEKA 4MW5A 1H9BA 3FGOA 4X7PA 1QQBA 1E99A 1XJCA 2G5CA 3HM2A 1CB7A 4HDCA 1LY1A 4HEA1 5AKXA 2YL2A 5A4FS 1KZ6A 1QH1A 1KMMA 2I34A 3M6VA 1IE3A 1UBSB 4KZPA 5ARDA 5F4BA 2QLFA 3WGMA 2KM1A 2OV4A 2VPZA 2BEKA 5EPUA 5EJMA 3EWIA 3LQKA 1DCMA 5LQRA 1R0XA 5F2KA 4BTLA 4GYJA 1SWVA 2PJUA 4H1WA 2A14A 4L9WA 3WBBA 2HH9A 5BYAA 2YHBA 4CHTA 4EO9A 2GJ9A 4P35A 3PD0A 3OCYA 1B4DA 3ZD6A 4HQKA 4CG3A 4B3BA 1FTWA 1X77A 1RYDA 2W2PA 2GDJA 1V11A 2ZIAA 4DDTA 3ZY5A 5JWOA 3GVPA 1X7YA 1VRWA 4AFNA 4ZJPA 3KVVA 3BWBA 3QX3A 3QA3E 5DVZA 3ESYA 2X2OA 1W49A 1L4EA 5F76A 4D0RA 3LPAA 3IE1A 3ZDCA 1WG8A 2C78A 4HLUC 4MR9B 1SK8A 1BSVA 3NIGB 4HNTA 2P2LA 3HDTA 1Y1LA 3PC8C 1E1KA 1P81A 4KLZA 4Y8VA 4B81A 5E2BA 5AH0A 3NGLA 2VDWB 4HDNA 5FP0A 5DZSA 4G8CA 2C7OA 1A1VA 3TXYA 4RADA 1Z6ZA 4HVLA 5AT1A 1AKUA 1KP3A 1UKZA 4NZNA 2G8LA 1NN5A 2PKXA 3SHTA 5DNCA 2DG2A 3GAFA 3DLCA 3K5IA 1CUEA 3KYIB 5A6SB 1U6IA 3DDWA 3FPSA 4HDSB 4TZ0A 4R41A 1BFDA 4K46A 2PXAA 2CUKA 1JA9A 4TT3D 2VNKA 1GM5A 3TSZA 3NJ8A 1GZDA 4QSMA 1R50A 3KE8A 3OQJA 1PJBA 1PK8A 1QWOA 1DWOA 3I2YX 2Y2VA 5AW9A 3W5DA 5BNFA 2QN9A 3LUBA 4QYTA 4IDCA 4RK4A 4CIBA 5COAA 5IW8A 2A4KA 4OREX 4Y6RA 1RRCA 1E5XA 1MQ9A 4TMVA 3W7VA 3ESQA 3DFFA 3IPXA 4JB0A 1ZL2A 2O3RA 4IJWA 4B3CA 1WHSB 1XAIA 2C57A 1NF3A 3JQAD 3FCEA 1XTJA 4K6GA 4TTPA 2ZJ4A 1NF9A 3EXFB 4FWIB 3OF5A 3QMVA 2FN4A 2PQ0A 4ZMSA 4PYQA 2PMKA 2JFYA 4LNHA 2I2CA 2QD1A 4CM9A 3EQ7A 4RFVA 4EG5A 5HBRA 1JFSA 4ZQIA 3GPIA 1PAUA 3C15C 1WPGA 1NUSA 4KAXA 3K0FB 4N6OA 1AGXA 2JHFA 3E70C 1RWXA 2RHMA 1TQ4A 2F3UA 3ICVA 1PIWA 3LT2A 4U2KA 4WDQA 4X45A 5AVRA 2FK7A 2LW7A 1HKHA 2WYIA 3EZGA 2IYUA 3LDHA 4ZDJA 2QZZA 3HO6A 1X80A 4F4IA 5MFZA 3MJ4A 1RABA 3L7IA 4HX5A 4GGPA 4WE3A 4XR9A 4CKYA 1Z2EA 2B37A 1Y5MA 4C4SA 4MW9A 4LAFA 4YCBA 2NT3A 2B1RA 1YASA 3IYLW 3O82A 3L46A 4LGYA 3LC0A 1Z4OA 5DYGA 1PFKA 3V8VA 4R9VA 2GETA 2CXSA 3DGEC 13PKA 4REQA 3WZ2A 1SKMA 4MHTA 1ATIA 5TY0A 3SEQA 1U3UA 2MTBA 3MTDA 4FN5A 2YJGA 4ZPJA 4AF8A 3F8WA 3EQ2A 4EL5A 5IZCC 2W71A 5FPPA 1J42A 2ZDHA 2BFCA 3PPIA 1QGYA 1BS1A 2JIMA 4RKQA 4D41A 1D2GA 1JQBA 5CK5A 3PNBA 4MARA 1BX1A 3EGOA 4Q7EA 1Q0ZA 2XMDA 3CB2A 4ES6A 2VJMA 2JNWA 1IB0A 2OCAA 1S4MA 4FJ0A 3LG2A 3ZW8A 3KQQA 2PTHA 2QMYA 3R6WA 4WT7A 2OHOA 2RHRA 3B1JA 3L5OA 4MRRA 5EIXA 4LJAA 4XQ9A 5JIBA 3I6ZA 2WMOB 2QXUA 3FB1A 3E8XA 1P5RA 1TAGA 5E4JA 5GJWC 3GELA 3ZZNA 4NWIA 2P2YA 4W1SA 3RF6A 1I6LA 3O0DA 4TL6A 4DDHA 8ADHA 1TO1E 1U8CB 3I32A 5DP1A 4M1QA 3TIFA 4C9BA 4ZAWA 1R10A 5IJAA 1GXSA 3P9QA 4PZAA 1BWQA 1CZKA 3BMNB 1ONPA 2V6GA 5LPNA 3AVTA 2V7BA 2FX3A 1H4VB 2X7JA 5CAEB 2Q3LA 4MKXA 2V03A 3WMEA 1ELOA 2R8XA 4PHFA 3VGJA 1N0IA 4U7WA 3A9SA 2FG7C 4HLUA 3PDIA 4YRIA 4D5EA 2UV8A 3ELUA 4NJMB 2D4HA 1LI7A 3JVVA 2GA8A 4I1UA 3PC8A 1U7ZA 4LJ9A 4UMDA 3UJBA 3WWZA 3QTTA 5F35A 1M1YB 1Q0SA 3D1JA 2CBXA 1J33A 3A05A 3JAKB 4YHBA 5KO2A 1OWLA 2HA7A 2OAP1 1AURA 4F85A 3UKJA 4MPDA 2C9OA 3COSA 4LV5B 3WSTA 2P9HA 4YXWD 2DUWA 2IXDA 1LJLA 3LT4A 5EIBD 1Q7BA 2PWPA 3QKIA 5H3LA 4KXVA 4R68A 2PUCA 2OFOA 1B6TA 1LBHA 1MNQA 4GP7A 3N7AA 2F9MA 5JNSA 3NBXX 5LZ8A 1U94A 3TZEA 2HW8A 4E3ZA 4IDAA 2WFMA 2ZI5A 5AI9A 4BFVA 2R5WA 4KR6A 1Y5LA 3LC2O 4YRRA 3DOOA 2BJHA 1PNQA 1T2FA 4IGAA 5EKSA 3UANA 3VSEA 1XZCA 4UPVA 4F8YA 2VG8A 1DUIA 1SUBA 3PFBA 1EVQA 5CTAA 1SIUA 3CURA 1JG6A 1UOEA 3C87A 4HEQA 2AB0A 2ZBDA 4OQMA 3WMXA 3FFBA 2PGXA 3HR7A 3EOBI 4U6QA 1BEEA 4RHTA 2QTHA 3O4HA 2HUPA 2JZNA 1CQWA 5LLDA 1E69A 2H1VA 2G1KA 3D6UA 4MUXA 4Z8XA 4D96A 3L7NA 4YQFA 3HJCA 1C9DB 3KQYA 2W43A 4F91B 1UMDA 2L17A 4ZEWA 4M7WA 4Z4CA 1JEOA 3MB5A 4GI1A 2GCNA 2Z1DA 4I3FA 5CJ2A 3ZHTA 3BEDA 3QI7A 4X1OA 3ZE8A 1E2BA 4MUKA 2HRBA 1Y8RB 1RVV1 5AKKA 3W6OA 4PYOA 1E2DA 3F2VA 1V8DA 1YZLA 4LC0A 5J5CA 6YASA 3EIOA 3WTBA 4YV1A 4UM9B 3K2BA 3ANTA 4B3DA 2NXNA 2CFSA 1TPYA 3QEMA 2BZGA 4OATA 2TSYB 3UMCA 4BE4A 2QRUA 3A1EA 3FPEA 1Z4KA 5ALKA 1UT8A 3KTAA 4LRYA 1WKVA 1T5DX 4DUYB 3ZH2A 3H7AA 1EVEA 3FFWA 4D45A 1K9VF 2H29A 2XZDA 3AR7A 3ES9A 3Q1KA 4XWWA 2JI7A 4C3ZA 1Z17A 1CDEA 2IYFA 1UZAA 4Z4QA 1Z33A 1Z0UA 3G9ZA 1Q5PA 1WDWB 2BKAA 3SE7A 2VBIA 1VKHA 2H4JA 5LP6F 2YQZA 2FPWA 1P1CA 5JTTA 3UK7A 4IDFA 4MQ5A 5HA5A 4ENVA 4FU0A 3AHCA 2E0IA 721PA 2SKDA 4RIEA 4UMFA 5LQKA 4LHZA 2W37A 2GA9A 4JWTA 2HJHA 2Q4OA 3ZU4A 1D7OA 5A7GA 3FNFA 3BXHA 1G7RA 1KYWA 1R74A 4ITVA 1M7HA 4P3OA 1DJOA 4X1IA 5ESWA 4W5TA 3CJQA 1KZGB 5AK3A 3N2NA 4K9SA 4FDMA 1M1YE 4U4AA 3OQ1A 4CI0B 5KOHB 1RYZA 1ZM2A 5THKA 4JCOA 2ZJ1A 2UVPB 3GCGA 4I5EA 3AFOA 3JD3A 3OJXA 2WF8A 4Z1MA 4A03A 2FLKA 1QHGA 2YS7A 4NCNA 4A27A 1KRXA 4B73A 1MTOA 4RO0A 3G2OA 2W22A 3EGXA 2QVGA 4D3XA 4LUCA 3E4CA 4NQZA 3LUDA 3LHIA 1YMUA 4F8JA 5HZMA 5LLTA 1FU7A 3SZMA 4RTPA 1BW9A 3RK1A 4BNDB 1DT5A 3TWOA 2OOKA 2DMRA 4S0XA 2FLWA 3HYCA 3ZY4A 1SUIA 2HDHA 3I76A 4IFBA 5F1PA 3DV0A 4XEUA 1KSFX 2Y66A 2B4RO 2VP6A 1MO6A 1GLVA 3IMCA 4OL9A 3PZBA 5EVCA 2EZ8A 4K9NA 4AUNA 4R8SA 3DBVO 4QA9A 1M8PA 1WU7A 4LCBA 2R2AA 4L8VA 1HG0A 1T8WA 1UFKA 4K6FA 1IZYA 1JIIA 1N2EA 1VL6A 2DKNA 3D6JA 2HV9A 2J6CA 3TQOA 4MMXB 1A98A 4FWTA 3R6GA 2Y05A 4Q7KA 1TYEB 1XMSA 2HQOA 4Y6OA 3U3XA 1HEYA 4FR2A 1SRRA 1U2ZA 1XN4A 2PMFA 2QMQA 1VLJA 1EFPB 4IIGA 5T4FA 3W4IA 4LSMA 3IDFA 4G37A 4B6SA 2W6PA 4EL0A 2QD5A 3I92A 4KXXA 2PLRA 3KPWA 4FCTA 4G07A 4NYJQ 1IVYA 4OB8A 4J7CA 2NU9B 4QM7A 4JUIA 3ULKA 1NNEA 1YR2A 1Y42X 2XE6A 2XUHA 3IR6A 3HCBA 4F5WA 1XOIA 1FCJA 2X4DA 1PWHA 4D80A 2JPDA 3GD7A 3OF3A 1GUFA 3PVSA 2I65A 1F12A 4MLPA 3H75A 4RMJA 2MIIA 2XUKA 3FETA 1G21E 1XI2A 4TWIA 5JTUA 3Q8WA 2I3BA 4X97A 5K03A 3RCBA 2ZYGA 4JBYA 4EHKA 3IP8A 1LEHA 5J4YA 1H3EA 3SHOA 3CZRA 1G42A 4IJQA 5DF1A 1KHHA 5HR5A 1E5VA 2QRQA 3H0CA 2WOOA 3H9GA 1N5LA 1SAYA 4GXNA 5FD8A 2PNFA 5I7AA 1SO8A 4AW9A 4CMAA 1U0JA 2IHZA 2IW3A 2PX0A 3NTUA 4MNTA 5KJCA 1GL7A 1YAJA 4QVGA 4N3AA 3CRVA 4TSFD 2GZ3A 5AI8A 4BFUA 5C81A 4RK7A 1TI7A 3QIAA 3RBXA 3WZMA 3H17A 4TLEA 3MJVA 4ZQFA 5CYGA 1QIDA 2E4YA 2FUNB 1R6AA 3MB8A 4XB1A 3ZLVA 3I04M 4XW2A 1KYQA 4DRXA 1NYLA 5FRDA 1NQ5A 3H2HA 5FUQA 4DUPA 1X42A 5BYJA 3RF7A 3M1LA 1F0YA 5B4VA 4US2R 4RLFA 3NVAA 1KQPA 4TTIA 4XTCS 1N0WA 1O9GA 1T25A 2QLMA 4FD2A 4LVCA 1IAQA 4CM1A 1RJ9B 3QPVA 3PKIA 1AS0A 1XTKA 5DHAA 3KPVA 1SIBE 5AKIA 4E09A 5THQA 2TECE 1OBVA 3ZHUA 3PUJA 1HNWB 4TRMA 5KU7A 4CU2A 2HPZA 4HDRB 5FCDA 4JLDA 5HOEA 4N0EA 1NQWA 1PEYA 2UAGA 5E6UB 1MB3A 5T5QA 3JATA 3PB3A 3F8TA 4LWQA 2IT1A 1QYRA 1U7PA 2X2EA 4P1ZA 5KNCH 1UJ4A 2I03A 2Z9CA 1T6NA 2X3UA 4QARA 5E0OA 1QUEA 1JXOA 3DZGA 3UCEA 3HO1A 3NBAA 1EE2A 4IYJA 2VXBA 5DDIP 4LPSA 5CDSA 4KAJA 1KQFA 2OB1A 2FPIA 3I6QA 5IC6A 2BR5A 2QPLA 3TRIA 5IKXA 3R44A 1JDBB 2UYGA 3RJMA 2FVYA 1TZMA 4OD0A 5JAOA 3BH6A 3H84A 5H9VA 2CNWA 3RJZA 3CX4A 4JP2A 4C0HA 1WPRA 1PZNA 4X20A 1MR3F 1G5FA 3LGAA 1LPNA 5L8VA 1F8GA 2EWWA 2E4UA 5CBPA 1YDHA 3VDNB 3DE2X 4HPWA 1DXHA 4DLKA 2C7VA 2SKCA 2R8PA 3IPAA 2IF0A 3SDSA 4JBLA 5CIQA 1Z6PA 3WGNA 4KGVA 1Y6QA 4RSRA 2Z04A 1XQXA 1EDBA 2ET6A 2CD7A 2CDCA 3E5RA 2AOVA 4JR0A 4KE6A 4JLMA 3I39X 4ASUA 2IS1A 4LTDA 1FNBA 3E9ZA 3B2NA 1XKXA 3L9XA 1RDFA 1ZITA 2PGNA 3WK9A 4RTQA 4HG2A 3GJXC 3DL4A 3EDCA 5H3CA 1T3GA 3HKDB 5EJ4A 1N6IA 1NUQA 3DKRA 3DQPA 4Q6BA 3ZBPA 4AZ0A 4P83A 3PC7A 5FO0A 1D2CA 1C3EA 5AI0A 4F2PA 3IHTA 1G3RA 3LK7A 4ARSA 1ZLXA 3U49A 5CX4A 1W6RA 4JFRA 3WVNA 1Z2DA 5JVDF 2ZSUA 2V5AA 4JASB 4R7ZA 1N8TA 1NVGA 4QFMA 3NWOA 4KSCA 3QU9A 5HCNA 4UPEA 1QF6A 4D6XA 4JQSA 3NKFA 3NC4A 2XUOA 5D8DA 4A8JA 3U7HB 1U5BA 1I10A 1AC5A 1O2DA 2XNHA 3CTPA 3KJIA 3ROQA 5I9MA 2EKLA 1Z2NX 2HIMA 2VHCA 2ZE5A 4CKBA 4UJ5A 1H2EA 3PF8A 3W4KA 2IYQA 4DIDA 4PR3A 1E9CA 1NWCA 2EBUA 1MENA 2F64A 1PFYA 3UO8B 1CUZA 4W8OA 2ISQA 4E6EA 7REQB 2FUG1 4GT1A 2WG0A 4L28A 1GDTA 2VDMB 3K5WA 3D4OA 2FUCA 2VFAA 4KX3A 3P5SA 1AQJA 2X9LA 3KZXA 5DTEA 4YRCA 1V11B 4ND5A 1X7ZA 1X2BA 1XELA 2REQB 3JALA 3M0EA 4PR0A 1SXGA 1P72A 3F71A 1P2SA 3CGWA 2ISCA 3LRXA 4OXNA 3ABSB 5H1YA 2NSYA 3GZ4A 2PZGA 3OZ7A 3RO7A 2H4FA 4Y9TA 3W5JA 5ULLA 4C3VA 4B48A 5YASA 1S4QA 1R0CA 2XAUA 3A9WA 5ESRA 1PVVA 2HMSA 1Z4PX 2WJJA 4I4NA 4EJ2A 1HNZB 4RHUA 4Q9NA 4GBMA 5A4IS 2XODA 4QGBA 4B8WA 5ES3A 3Q7QA 3FNQA 2AN1A 5TPWA 1YZTA 4JQOA 1XVVA 3BRSA 3IBSA 1BXKA 5AJTA 2F4VB 5AVTA 2ZWOA 4PSAA 1QG2A 4MKIA 5ABPA 5KX5A 3TQQA 4YP6A 2IBSA 3A2KA 1XZ8A 2F3QA 4Y2HA 2O0KA 5KNDA 1E58A 1M2OA 5JY6A 2R751 3H4VA 1EVJA 4WN9A 4CCYA 4OB6A 1L8OA 4KCGA 3UQYS 4CM7A 1VJRA 1SXPA 4CLRA 1K98A 1KEUA 1IG3A 3GFVA 4R9SA 3MIIA 3JQ6A 1ORVA 4B6FA 5JFGA 2VTVA 4EY7A 1H94A 1T2DA 2ZVJA 1Z29A 3B2QA 3PNYA 4ZVVA 4WK0B 4EHJA 1TTTA 2IYWA 2JFZA 3GEHA 1FDRA 3KDAA 4MR7B 1A9QA 3Q9NA 2PT6A 4B1FA 2H9YA 2QYSA 5I01A 3D8NA 1C29B 1OF1A 1YJ5A 1JZSA 2D2VA 2F9FA 4GDMA 3ZDQA 4BNTA 1U0HC 3OOEA 4YIKA 4HLDA 3VI4B 2I1QA 4I1IA 3PQFA 1UP4A 1X80B 2MDTA 1PTJA 1WMEA 4HH4A 4FD3A 5HK9A 3P71T 1XA4A 4PYRA 4FB4A 1DBRA 1COWA 1OY1A 2C5LA 1A9ZA 4WOKA 4PTLA 5DK4A 2Q5EA 2ZSAA 5C4GB 1EE1A 3UOWA 1D1QA 4RE6A 2BBWA 2C9YA 2Q5FA 4YYZA 3ZR4B 2P9CA 4WH0A 4NK5A 1CIVA 2C3UA 4REQB 2GD0A 3D3KA 4QXOA 3L92A 4J0KA 4RD2A 3WDSA 4URWR 2IZ0A 1F0PA 1DQSA 4O4IF 5AVSA 1PFWA 2BFCB 1QK5A 4RVOA 4Q9DA 4A1FA 2R5NA 5LWQA 2QTCA 2B9VA 2BIFA 4E1AA 1Q0RA 3ODPA 5A4AA 4O2LA 3OEHD 3P9PA 2TRSB 3BMQB 1DEKA 3CF4G 3AEUA 1UBMS 1IEWA 3WMFA 1IPHA 4Y6SA 1JHPA 4XGIA 1DC4A 1K8ZB 3RHFA 1QDUA 3ZU5A 4PAGA 5BNTA 4LMBA 5FO1A 5LM3A 2ZS9A 2QT0A 1H93A 4PGFA 1H2WA 4XFKA 4HVCA 1JE1A 1F6WA 3SF8A 2QT1A 2GK7A 4QATA 1QFSA 2REOA 2GLUA 3DOIA 3FN4A 4NMLA 3WLAA 2IEAA 1M6WA 2QR5A 2QI9F 5IBRA 3IJ5A 1M10A 2PJZA 4EJFA 5LQCA 5JFTA 3VOBA 4GO1A 2IELA 5KCZA 4O6VA 5DRTA 3H83A 3AVOA 2HGZA 4HAOA 3EDOA 2OD2A 1XNHA 5JMPA 5TGTA 2RCNA 2VBGA 3QHAA 3T7JA 3DAFA 1ECLA 2JDID 1KE1A 4I3HA 3T3OA 3BIOA 1U90A 3P9SA 1PFVA 1S3FA 3U4MA 1G38A 2MSEB 1I36A 2JGMA 5CYFA 4DG9A 4MVJH 2Q6VA 4NBKA 4UASA 1GO2A 3CH6A 2GO1A 4NIMA 3GRYA 2PH3A 5EIBC 5HKBA 2Z98A 4TT3A 1GUDA 3CRNA 4ANFA 2ZRIA 3GRKA 3PE4A 2YHUA 2QN2A 1CETA 4M9SA 5DJ5A 5HKLA 3RAFC 2X8LA 3TNLA 2BCEA 1UZMA 1IZZA 4BVFA 1W4RA 2GBIA 2XDQA 2RSLA 2GHQA 4CMHA 2AH5A 1IY0A 2ENUA 3KZMA 5E1DA 2J48A 2ASVA 3DFZA 2BD0A 3FXAA 4R83A 4XQ0A 5GOTA 3GLFA 5DT9A 1KP2A 3BGOS 1XYGA 3JQAA 5D01A 2PQ6A 3E2PA 1PWYE 5JD3A 4D0LB 4GLFA 4EYKA 2QLBA 1PUJA 3B3AA 3MMPA 3JZIA 4M7OA 1CVRA 1SUEA 2JD2A 3DL7A 1LFAA 2XTMA 4YHHB 1M83A 1XEWX 2GD1O 3DUWA 1CTQA 5EGSA 4C2AA 4EHAA 1EZZA 3ZVKA 3T3GA 2VWQA 1CUSA 1JR6A 1Z2CA 2H1WA 3MBIA 1E1MA 1NMZA 3CVUA 3IP6A 1JEYA 4YAIA 1UMDB 1DAMA 4KDFA 4MQLA 3F6PA 1Q1EA 1UMCB 1WVIA 1X70A 2G1AA 2X4IA 3SJZA 4BRWA 3DHVA 1SVLA 4J0CA 1MUUA 3I9JA 3V4OA 4P4TA 1BAPA 1YBAA 5HDQA 2GPJA 2BPOA 1BJRE 2PRKA 4O25A 5JWHA 1P1BA 3RANA 1LU9A 3RUDA 2VPWA 3B12A 4YYEA 1N92A 1SKUA 4RD3A 3ET4A 2ZUVA 4GX5A 3I34X 4J7AA 1PBTA 1O6ZA 3U7FB 4TLAA 4Q1VA 2B25A 1A9RA 3GMTA 4RANA 1N9KA 3BH0A 3KTAB 3WQHA 3BILA 3HYRA 4F2DA 3FAKA 1OOEA 2VJNA 3KZNA 2EX1A 3UYLA 4AECA 2CDRA 2VF7A 2PGLA 2QSUA 1E2HA 4QJBA 4AIIA 2PTGA 4BWYA 2ZUBA 1Q20A 3O2NA 3S8EA 3JSXA 2CCKA 1YNSA 4MYSA 2IQ5A 2NVBA 3HLKA 5AKHA 3CH7A 2PX2A 4ND2A 3PT9A 4D5GA 1M2VA 2P2GA 4LMRA 5FOVA 2YIVX 4LRWA 4NG5A 3E8SA 1IHPA 1M76A 3QX8A 1N2IA 2FEAA 2GKOA 3WB0A 1KO5A 2RHWA 2V7TA 1BDIA 1E5QA 1LLFA 2HL6A 1P2BA 2I62A 3H2YA 5BP7A 4Q7QA 2EJCA 3G0HA 3GAZA 4KO1S 5HTKA 5F7OA 1FMFA 4DFDA 4IMJB 2PKYX 4KRFA 3A25A 2GBLC 3MRVA 4N0MA 1T1RA 3GH1A 4AJEA 2X2FA 2A35A 3H9JA 4BEJA 1Y3CE 1ZI9A 5IKMA 3L0CA 3RHTA 3SKYA 4Q4DA 3STWA 3GFGA 2NMVA 3H42B 2PIDA 3FF4A 1YUNA 2HI0A 4NK4A 4PBSA 2FSIA 4WNYA 1HX7A 3LY7A 4R1TA 1WUYA 1E1YA 3TQCA 2PX4A 2QJRA 2XV1A 1P7CA 3P4UA 4G89A 4J4BA 5AIBA 2Y3IA 1BA2A 3B9PA 2GAAA 1UF9A 4D9JA 3VPXA 4AJIA 3C24A 3AG5A 3MUNA 5A5DA 1ENYA 1Z0KA 3MTIA 2IY9A 3DV0B 3M6IA 2GUWA 1P0FA 1VLQA 2BY4A 3KEQA 2I1WA 3L6DA 4MJ3A 4X0EA 1KH1A 3T3PB 3QF4A 2HBZA 4ZQBA 1K68A 1WWKA 4YA6A 3EC2A 2ZJ7A 3V3TA 3HN7A 2FPKA 5I9TA 3FVWA 1XN1A 3EA5A 3IUEA 4ZVNA 3QVVA 1N8NA 1ZQ1A 4DE5A 1TCBA 1OV6A 1QIMA 4D4MA 4LEIA 2LZ0A 3ZE7A 2YICA 3LC1O 4YPFA 3VTZA 2B82A 4UUOA 5DHSA 5LB2A 3IQEA 4YH1A 4JB8A 5CPBA 4HVTA 4JBGA 2CLDX 3N2YA 2W2TA 3NVMB 2JFXA 2R6AA 1U8ZA 3HVIA 1T9ZA 2ZYAA 1T2CA 1JFFA 2A0YA 1GCUA 3PHJA 3ZDZB 1G6KA 1EB9A 5C5CA 1C4WA 1KMCA 4Q24A 3SVLA 5FTJA 3SZGA 3FH0A 3MSCA 3PKJA 1ZN7A 3PTZA 4XIFA 4TMFA 3VNRA 4IXTA 4ZCLA 5DK6A 4G5QA 1OH7A 4WLOA 1ZM3A 3PGVA 4DKJA 2BZ1A 3MUEA 3PNOA 1U2RA 4N0DA 1MC5A 4LXQA 1DRJA 3OT1A 4MAAA 3D8RA 2VVTA 3OH8A 3DP7A 3TVYA 2A5GA 4E22A 3IL2A 1Y5RA 3H99A 1RFLA 3VZCA 2DQSA 3B9QA 3RYHA 3TOVA 2COEA 2YR0A 2E21A 1QIEA 1J2YA 5JEDA 1RZVA 2FFJA 4MV6A 2IYLD 3FGNA 2O52A 3KU1A 3T7KA 4RYLA 1MGOA 4KR0A 4EG0A 4IFIA 1UBUS 1X9IA 1GFZA 2J5BA 2OK8A 4EMUA 5K6TA 2QSJA 3IPRA 4PC1A 4RIIA 3RU7A 3QW2A 3ZHYA 5CB4A 1ONOA 2E6KA 3BL6A 1G8YA 3IJEB 4Q9LA 1HSZA 3WY9A 3HDJA 2O59A 2FSVC 2X4GA 1UIRA 2R7AA 3HBMA 4RVNA 5FR1A 1EK6A 6NULA 4DRXB 1P77A 2TYSB 4N5MA 3L84A 3NWPA 4KQ6A 2CB9A 3E1SA 2QTLA 5ICCA 2DQ4A 2LP4Y 3A1WA 4XM2A 4MP8A 1JLLA 1VP3A 1RJGA 1E2IA 3GP8A 2CF6A 4HGQA 2FG6C 3PQCA 1YQGA 5EMHA 3VPDA 1XAHA 3OC6A 4J75A 4DB2A 2GDZA 2X0KA 4US1R 2FEWB 3TW4A 4RV9A 4BXOA 1I4OA 4ZYUA 1L5YA 2I3DA 1LDYA 3LX8A 4FE7A 3IDAA 4GZ3A 4FC7A 3WBKA 3K2EA 5DNYB 2P2ZA 2E49A 1I5OA 3K6JA 1ISSA 2I4NA 2NADA 3RI3A 4QWWA 4NS1A 2P77A 1HQDA 1NULA 3JATB 3NZEA 2CFIA 4JOCA 3K7EA 3ZK9A 1MXFA 3QSGA 4QXMA 5L4NA 5DM70 1HF3A 3I0NA 4HQFA 4LY3A 5JLJA 1IBKB 1DKMA 4YCLA 1CG6A 1GPDG 1R4NA 2Q3JA 3PE6A 5BT8A 3QEBZ 3V8RA 3TF5A 1IQRA 3O4FA 5D1NA 1QPBA 3OTHA 1VG8A 2A0XA 4KRXA 2XF2A 2V7XA 3BJEA 1Q7RA 3A58B 1WX1A 1OLOA 2HDNB 4QHTA 2G8NA 5IFKA 1F8UA 2N0SA 3NCTA 1EWYA 2Y77A 3E61A 3WGJA 1CDOA 1TLFA 4IJUA 1NV9A 2ZWVA 3T9FA 3URKA 3MW8A 4AZ3A 5ELXA 2I6TA 3EEOA 3C3KA 3M5WA 1QQTA 3CVYA 2GN0A 4AY6A 1XJQA 1I6MA 1PLKA 2AKYA 3OJEA 2OGTA 1L7PA 1NG9A 1G20A 2NZVG 4K9DA 1GCAA 4G0XA 1KYTA 4P81A 2A9RA 3RTGA 4UBLA 4CKEA 5HXAA 3DOEA 4H7DA 1B00A 3VKHA 2R6R1 3D5EA 3BICA 1WXHA 1KOJA 2PRYA 2X8JA 4DZZA 1C2TA 4KO8A 3EZLA 4YCCA 2XA1A 1P91A 3AFGA 3QZUA 4LDAA 3EXEA 2Z2JA 3FNIA 4P4SB 3S55A 3MRXA 4R1NA 4NBUA 1W0CA 1VE1A 2RHLA 2ZSIA 2YDXA 4CLDA 1AY0A 3H7IA 3WGVA 3NIWA 4FK8A 4L8LA 1OROA 4LG1A 3ZEAA 4AZ0B 3TBHA 3WLOA 1LVUA 1UFRA 1L4YA 2OFXA 1ARZA 2ON6A 3F5DA 1NTOA 5AKGA 4MCJA 3U3OA 5BYBA 1OH5A 4JNKA 5K0LA 4M0EA 3HBLA 1AGRA 4KPUB 2NQ8A 3WA6A 3QLVC 4D8VA 3QUAA 1KH2A 4IAOA 4A8JB 1U8XX 2GXQA 5JXJA 4ATNA 4BMYA 2FMTA 3ID6C 2DAPA 1R0WA 3LDAA 3OOSA 1Z62A 4X6YA 1WDKA 3T3EA 3VNAA 2B8TA 3RYCB 3F5FA 1WBDA 2P7IA 4HMOA 1EH5A 2G08A 2P1ZA 4FMCF 4G5RA 4TKUA 4Y2SA 5AYVA 2XZOA 1PEKE 2QLLA 3IHWA 4QGHA 5BV0A 1A69A 2WTMA 2WKRA 2O8FB 4CW7A 4MKGA 3DMPA 4TSFA 4XTRA 5C8YA 3NVDA 3K4QA 4NX2A 1JVNA 3NXKA 4FILA 3FDZA 4INOA 4P82A 3IBGA 5H70A 1ZNZA 3WO0A 4QUGA 2GOYA 3HBNA 4BU0A 2FSVA 3CB4A 4Q21A 4CMJA 1QHHA 3IH5A 1HL7A 4XIJA 1FQWA 3IAFA 5DI3A 2R65A 1X7ZB 1YI8A 3CNOA 3EMKA 3JALB 1WCWA 3PWTA 4G8BA 5EQDA 3H5VA 5DYNA 3WKCA 4OHYA 2Q5CA 1L5FA 1G8SA 3QBJA 5ALSA 3ZDRA 5AVUA 1CRPA 5A3QA 4B2YA 1A96A 2X0FA 1RW4A 1KYXA 4QG3A 1IM2A 2FZKA 1LWOA 3D8TA 3ESCA 2V7VA 2KB0A 3ND6A 3NYIA 3OQHA 1NDUA 2YJ3A 2GCIA 4KH1A 4B4KA 2JIRA 2D2IA 2P1RA 3R0VA 4DQXA 4IF4A 2HSZA 3PFWO 2BI4A 4PANA 5DOZA 4NYMR 5TEWA 4Z7NB 5LKAA 1T3HA 1IN4A 1DAIA 1KY5A 3CC8A 1FTGA 1PLJA 4MS1B 4C87A 4F6LA 1IOWA 3MELA 4Y2RA 1J2JA 5TPWB 1PUIA 3E84A 5A71A 2WJZB 5C46F 1EXDA 3BB4A 2HIAA 3M7IA 3LH5A 3SFTA 4G85A 4I1OA 4WERA 2ABWA 1MDFA 2ADOA 1P6XA 4A8PA 2ZRAA 1G98A 4KR3A 1I6KA 1GG9A 1D3AA 2J45A 1OPRA 3A4LA 4KLRA 1JPNA 5FPQA 5JZMA 3MAJA 4R1QA 1V9LA 4D6YA 4D3SA 2FEMA 1HE3A 2C4WA 3E48A 4WN9B 2XA2A 3WZLA 4QNNA 2WIKA 4BFCA 5AVVA 4LJ4A 2CFRA 1N5DA 2I2DA 4CLRB 3FSRA 4LDJA 5EFOA 4BZZA 1J56A 1N1EA 1USGA 1IOVA 3T7SA 4QYIA 1OILA 1ZPDA 4D9MA 5KQGA 4ARIA 3U4DA 2AHRA 3IDOA 3IKTA 2AMYA 2FZ4A 4P7FA 1FDVA 1CIJA 1AS3A 3O3NB 3VO8A 4IVRA 2HA6A 4QNMA 4F45A 5JATA 5KU1A 2NPFA 4KQ2A 1Q0HA 3VHRA 1JAYA 5K7SA 3QPBA 3QJ5A 1QHFA 3KRTA 2AA3A 4B3GA 1ISPA 4G97A 3MRTA 3FYTA 1VSVA 1YDGA 4OUDA 1UL1X 4I6GA 1VKJA 4JC5A 4GRIA 1E2KA 4KXYA 4G5OA 5C0OE 3NHSA 1J8DA 1HORA 3P5BA 5HILA 5KAPA 4FNMA 3VOAA 1VE9A 4B6EA 3IRUA 5HIMA 2OYSA 3WL5A 4C7OB 2QENA 1TZBA 2OHJA 4YJGB 4ZT4A 1SHTX 3DHEA 1KVTA 3L0PA 4OLFA 1O03A 4OI4A 1D9ZA 2V6JA 3TKAA 4QDJA 3QLVA 3E7DA 4PY2A 2E37A 3U6KA 1CU1A 1EEHA 3RFCA 3TK1A 2NX2A 4DCVA 1IPFA 1U3DA 5DSTA 4EKIA 5ILGA 2TS1A 3DJYA 5AXBA 5K51A 1NVKA 4JI4B 4MW6A 5LQNA 3RC1A 1WMAA 1SXIA 1FVOA 3UN1A 4PNEA 1GTMA 5ALUA 4JLNA 3AI2A 3LXMA 1I9GA 5KQSA 3PFHA 3O03A 4KFRA 3IERA 4C14A 2BI7A 2UZ0A 4UUPA 2IBTA 5MFPA 1QCCA 2P0YA 2IYVA 2JFUA 4HYEA 3W2IA 2WHRA 3K32A 3VTKA 5EJ9A 4RV4A 3NDIA 4N7JA 1DBQA 2PSFA 2ATIA 4PYKA 3K92A 3HVJA 2G88A 5F64A 3MWDB 4MA0A 2JIDA 3P0FA 1JI0A 2XOEA 3UJ6A 1ORRA 3CG0A 4XEHA 2XDWA 3D54D 1MO3A 3NP9A 4HGZA 4KW7A 4OYRA 4II2A 5AXAA 5K3CA 3K1AB 5HKOA 1X39A 3DTTA 4IXMA 5DGDA 4O2AA 1G4HA 3W6NA 4MKFA 3N76A 1XRMA 4OVKA 3K30A 3RG8A 1YO6A 4B5KA 2FF5A 2VK2A 1ADFA 2DWCA 4GOJA 3DWFA 3GFBA 4N76A 3GFSA 1TM1E 2BM1A 2XCLA 1T91A 4Q3DA 1Z6XA 3LX4A 5FBKA 4ESEA 3LVFO 5DMHA 1IN7A 1PD0A 1WABA 2B92A 2W4QA 3CTMA 1PK9A 5CVDA 2RIRA 2VPQA 3FMIA 2HR1A 3T5PA 3ZI4A 2AW5A 2YFYA 4JLWA 1UJMA 5AKJA 1RI4A 4NTZA 3GCWA 2OGUA 3AC0A 4CKWA 2R6GA 4BTEA 1IBCA 2W2KB 2OORC 5C3UA 4KDCA 4BQSA 4WBNB 3W2HA 3GDWA 1TCCA 4Y9SA 4L9RA 4WKBA 1XMIA 1TQ8A 1XZKA 2ZB4A 3GLGA 4EP1A 1OH8A 1K6IA 4LZZA 5L45A 5B2EA 2G7MC 2X6RA 4C30A 2AJTA 3O4RA 1YS6A 1J0BA 2V9CA 3H6HA 3JQAB 2PAFA 5EUBA 2AN4A 4I9UA 3W3ZB 2BFBA 5BPFA 4A15A 1L4HA 2AV6A 3COZA 3HA2A 1P17A 4P92A 3JRXA 3RTCA 1A9TA 4CM8A 3VNUA 1D04A 4GWKA 5KHLB 3WL7A 3BFVA 5EE3A 2IY8A 1P4SA 1SCIA 4O0MA 1ZMRA 2NPOA 4Q02A 4EAQA 1YI1A 4W1QA 4DSOA 4RVDA 1JEYB 3FBTA 3HADA 4KN6A 4YDRA 1M0EA 2CJXA 3GJ4A 3D7NA 1GY8A 4E5PA 5CA1F 3G3EA 5JQGA 2A88A 5H68A 4DV1B 1HO3A 1P31A 1R4AA 4IOKA 4BDTA 1I7NA 2JHAA 3C3PA 3GRPA 1ODLA 2X1MA 4XI9A 3UMBA 2F3TA 1Q50A 2YY6A 1OC2A 3NAMA 3ZZ0A 1W87A 1FPQA 3L7JA 2I87A 3T1YB 5HUJA 1AV6A 2YH2A 3GLRA 3Q98A 4EARA 4UOQA 1MP0A 1JBEA 1OBHA 3TMAA 4BIIA 4NL4H 1JEJA 4UNRA 3K2QA 5HRAA 4UULA 1MJFA 3QITA 2C0QA 2RONA 3NG1A 3ZY3A 1NSTA 4AVYA 3QH4A 1XDDA 5EZ6B 1JDZA 2DHQA 3SDZA 4M6WA 3NTRA 3O94A 5EERA 4B71A 4WMLA 1XZAA 4DY4A 2HK6A 2WMDA 1QRUA 5CDTA 2ZRGA 3RVDA 4HFMA 1E8DA 3WI7A 3DZIA 3OEHA 2I6GA 3L07A 1SH7A 4QBTA 4O3FA 1JAIA 3K70B 2RGUA 3R5HA 4EHLA 5EXXA 4Q6WA 1BROA 3BN3A 1UWKA 3E81A 4FFLA 3UWSA 4DWWA 4LF9B 4RZXA 3UY4A 3CVJA 3GRFA 3PITA 3QUSA 3TTXA 3H9UA 3W6UA 3OTOB 2O5EA 5JI2E 1NRWA 1HDGO 4WCDA 3X1YA 3HS3A 3M6UA 1QRDA 1F51E 2B0CA 2ZZNA 2OE2A 2C42A 2MCFA 5KJFA 1ZK3A 5TQ2A 4RD6A 4EO4A 4DR4B 1T0HB 3C8HA 3AY7A 4FS8A 5FFMA 3T4XA 5CVUA 5LA6B 1T1GA 3P2MA 4YRKA 1FDTA 3DEZA 3KBOA 4RVGA 2BISA 1H42A 4CMEC 2GD2A 2PNJA 4X94A 3SIXA 3RSOA 1E3QA 1Z18A 3OHMA 1P6UA 4JL5A 5FB3A 4DANA 4MXDA 1RP1A 4G1VA 4YJ2A 4GQIA 4YMIA 3IILA 2JDIA 4LSGA 2QAGC 1A1SA 5FYDA 3UB2A 2EAUA 5AKZA 3V9AA 1C9JA 2E4AA 1A4IA 1P3DA 1V37A 3LSTA 4G63A 1J1IA 3EJ6A 4BO1A 5E4YA 4RIHA 3B2EA 2BI8A 1U9ZA 4FX2A 2VAMA 1DBVO 5I8PA 2XYPA 4DR1B 1UPFA 3L6BA 3NNSA 3Q7EA 5JARA 5M3BA 1OFVA 3P52A 2BHNA 4OQEA 1U0LA 4YGXB 4DLWA 4YJ3A 4EPXA 2ANBA 1P9WA 2GLTA 2OORA 4QQFA 5FEMA 1TLTA 3AILA 2AFHA 3LCJA 2QG4A 5P21A 5JH7F 4PAWA 3AFHA 3WJ2A 2Q07A 2XUZA 2ZPUA 3RYTC 1E5LA 4BEWA 4GU5A 1T8PA 2O8EA 4X7MA 1NVUQ 5JCZA 1JJ7A 2G36A 2R60A 4LOIA 4PLTA 1RC8A 2XVYA 5ENZA 1W4AA 3DVLA 3UAVA 3K94A 3AXSA 3IQDB 1VG9B 4BGEA 1PR3A 2DWUA 2F3RA 3OD5A 4HP8A 3SJCA 2F1KA 3UNXA 5CFQA 2NVUA 1CY1A 1DDOA 2YXBA 2QZ4A 4UTVA 3I4FA 3E7FA 4IIVA 1B14A 1ZUWA 4QLBA 1GZHB 3OP1A 1NA5A 1YAHA 5DKFA 4J0FA 2B8NA 4B8YA 1MJGM 4YRMA 2R1VB 3OT1B 1TVCA 3CLVA 3BPSA 1V16A 2G63A 2EKDA 4JXJA 4YRBA 4I4TF 1F6BA 1FRFS 5IHXA 2VZ8A 5K8UA 1XEXA 3RYHB 4M1YA 4YV0A 2ZJ5A 2PJRA 4ZAZA 4ZZIA 5EKUA 3FCSB 3QI2A 3TL6A 2DT5A 3DDUA 1PL0A 4FYKA 1K5PA 2A5JA 2D59A 4P93A 4F5YA 2IEZA 2Y93A 5DGCA 4MCHA 1QHEA 4ETIA 3VKGA 2NZYA 1RQGA 2UYYA 3I04A 3AVUA 2XNSA 4RMNA 3W78A 1DKNA 2ZJZA 2WQ6A 4QPPA 1WL8A 5CB4B 1ECPA 3N3AC 2LDXA 1C0PA 1XQWA 2YN4A 1Z12A 4NCXA 4NZMA 4Z3KA 5K8TA 2NAFA 1Z37A 2VQEB 4I8DA 2PZJA 2ACVA 3BXXA 2C5HA 2OCPA 1CRZA 3U7IA 4FZVA 3UJDA 3AQ4A 2J1LA 5CUQA 1L5MA 2ZKLA 1SC6A 2RHCA 4RS3A 1JHQA 4TS3A 4YROA 3GDOA 4AC9A 2OPBA 2ZBFA 4WCFB 4OSOA 5TPZD 1E18A 4DKXA 1V9CA 1TEHA 4TVOA 2BGTA 2Q2NA 4BQPA 1IMOA 3ET5A 3PP8A 1H2HA 1MRNA 3INTA 3P26A 1B3BA 3C8UA 1MAWA 3ZWQA 3WLHA 1EA7A 4RFLA 2X40A 5MN6A 1RXEA 4LYEA 2ATEA 2DJ5A 3BMCA 5AK5A 4EEKA 4IINA 3RAEC 1PR1A 3LQ2A 4L8FA 1A7JA 2BL4A 3I45A 5DYIA 1UFOA 4B3SB 3NBYC 1NVVQ 2I78A 3T1OA 2QAGA 4FJ2A 4TLCA 1QVZA 3IQIX 3KJGA 4YTEA 1ZD5A 1ID8A 1EDEA 1P80A 2XMRA 3ROPA 3D4BA 4BNMA 1N36B 3GLQA 2ZW9A 2H1CA 1BGXT 3SC6A 1ISHA 4NMXB 4ESOA 3PDWA 4MKZA 4E7OA 5F23A 1AKMA 2HY7A 1DMRA 2YQ4A 1SBZA 1POWA 5LP1A 3I1YA 3EEIA 2QF7A 5SZIA 5FBVB 4DLLA 5KI6A 4UU7A 2FYTA 3GRZA 1B0ZA 1V4VA 3EQ6A 2NU7B 4CKEB 1ITZA 1DXQA 3PJFA 4HLQB 3MTEA 2X8JB 4ERXA 1QJCA 1U1EA 2DT8A 4IIYA 4JQZA 1JFRA 1BFKA 2KPOA 2UZAA 1GNLA 2W2NA 3ORRA 4Y3UA 4C7KA 2CXTA 3BRWD 3DE6X 3K6SA 1KEZA 3KVYA 1N5OX 1VCHA 1FTSA 4FEGA 4WZBA 5EINA 1BXGA 2AOTB 3O9MA 2FX5A 4LRXA 4P08A 3WRWA 3LZ6A 1MQSA 3VNSA 1WMBA 2CLEB 2IGBA 4R6WA 4C0LA 2ILVA 4X90A 5I7SA 4TMZA 3IQHX 5KWJA 4AP5A 2P9JA 4AS3A 2QPOA 4IDHA 4NR0A 3E18A 1EFVA 2V97A 4G3XA 3CG4A 2KLHA 4JLAA 5DP2A 3SSNA 9LDTA 2O23A 1FVHA 5J43A 1ZD2P 2P62A 4ZO6A 3UK1A 1M8FA 1H85A 3ESDA 3TJMA 2IHBA 4LHEA 4CF4A 5T67A 2ZBUA 4JC0A 3M3DA 5EJ8A 3MMXA 4HRYA 2XUGA 2BTEA 1FDSA 5JCPA 4BY9E 3VZBA 4BV3A 1A8SA 1HYQA 4U7DA 1SPBS 3CZ4A 3GEGA 5B12A 4L6IA 1C7JA 3SK0A 1GLNA 4KYIB 2Z6QA 1GTSA 1E60A 1SC3A 4JJKA 3TI7A 3TZ6A 1FLNA 4GBED 4RELA 1NLUA 3SMQA 1C30A 1EX7A 3FDZB 4HS9A 3C45A 1P74A 3Q15C 4QOIA 3DEIA 2I6FA 2IRWA 4TYPA 1YJAA 1ZHFA 2HRRA 3PA6A 2VHZA 5IG2A 4QGFA 2DY1A 1P2TA 2QRPA 4J3FA 2C8VA 4LKOA 4WW0A 3F1LA 3DW1X 1YE8A 4UUQA 3TIGA 2C9MA 1QFXA 4DBLE 2ZRNA 3RC3A 2VDRB 1AU9A 2BF7A 2BM0A 4PC2A 3VZSA 3MLEA 1O6CA 2AI1A 1EK1A 4ZTBA 2ZETA 1F17A 2GBPA 1SBTA 5JZ9A 3DLAA 1ZVJA 4E15A 2XF8A 1VDZA 4NBVA 5EI5A 3RB8A 4ENWA 2IF2A 2AYZA 2EHJA 2QTVA 3K35A 1G3QA 1TT7A 1P1IA 2CMDA 4G8JA 4MQEB 1PGPA 4MSUA 4RJ2A 5CEJA 2NUTA 5EKTA 5A02A 5A0TA 1AHIA 3EH2A 2ZROA 1PNRA 4S1PA 1W4LA 1RQXA 4L9SA 4P98A 4Y9DA 1CJBA 1XFDA 4UNQA 3K8ZA 4HNVA 3T9BA 2ZZMA 1P0CA 4NPCA 1E92A 1F48A 2L2QA 4TZ6A 1UK6A 2ZDQA 1WVMA 5CFRA 3KL2A 3DPIA 3U7JA 1GQQA 1G291 3C8ZA 1T9CA 2A67A 4YRJA 1M2FA 2J3HA 2XADA 2YY5A 5LZ7A 3GNQA 4W5HA 1ORDA 1VL1A 3GRVA 5G4KA 4YUAA 1I3KA 2C92A 2V6FA 4TRNA 2I0FA 1FUIA 4MRVA 1E32A 2J5KA 2IOQA 4IV5A 4BLRA 1X7GA 3M2PA 3PEWA 1NX9A 4BMOB 3JPYA 4DLBA 5KYTA 2QG9A 3OZTA 1FNSA 2G06A 1NHWA 4MTLA 4FE3A 4NAUA 4UDYX 1W34A 4R1SA 2F7SA 2ECQA 1V8PA 4IIDA 5BW4A 1P19A 2W00A 3O8OB 3RIXA 2ZB3A 3FGZA 3L8CA 4FIDA 1YVPA 4KREA 1MO4A 4J03A 3QQPA 2PUJA 4II3A 1ZGBA 2VF8A 4AU1A 2Q6OA 3EULA 3DTVB 4OUDB 2ZRCA 3PQ8A 5A4DA 3IELA 1OXVA 1H6BA 2EFCB 5K0TA 3AV0B 4CT5A 4W1PA 5ER9A 1T5BA 1WW2A 5AR1A 1HR0B 4LF7B 4TMXA 3IHLA 4F93B 3CUTA 1Q1QA 4YASA 5DNDA 2DYKA 3SYMA 4Z9FA 5GWXA 4CF3A 1VMIA 2CN1A 3R3HA 1GKYA 2HCFA 3ORHA 4TMTA 5L3ZA 5JNTA 1D2EA 1G4AE 2X76A 3NFRA 4GQBA 5SZJA 4QFCA 1VGRA 1M5UA 1UC5B 4HT3B 5A1JA 1E66A 5AW6A 5KTYA 1N4DA 5B2ZA 5LQJA 3HN2A 1RZUA 4D7AA 4YAEA 3UV6A 1O7JA 1CZRA 3QUBA 4KQFA 1YRQA 3BHJA 4PFJA 4DT1B 3Q2KA 3CRW1 4LX8A 5HRUA 2HJSA 3NDJA 1BGVA 3GC6A 4HGYA 3ZNQA 4K6CA 4D9HA 5KTPA 5HIAA 3Q7PA 3JARB 3GLUA 2FZVA 3JU3A 4CLEA 2EFEB 4BNWA 2DPMA 2IW1A 2IYNA 4I1PA 3EN0A 3NGXA 4BKUA 2F43A 1XTPA 2V8OA 1QK3A 5GQSA 4EVRA 2FQWA 3OPYI 4B87A 7GPBA 4QJ4A 5M34A 2VTBA 5EP3A 5JJCA 2C29D 4GKBA 5BXQC 3OURA 2WM8A 1ZBDA 2Q9CA 1QX3A 3WWCA 1RLOA 4XPIA 3OVMA 3KCQA 1G7CA 1WVGA 2HBRA 2HWKA 1CR6A 3L4BA 4KOEC 2QDXA 3HB4X 3SN6A 2WSMA 4N54A 3V6MA 1NP7A 3Q7IA 2ZIGA 4PFKA 4H18A 4BN5A 4DRZA 4DV2B 1JG7A 4OA5A 4ICIA 5K3FB 3L8MA 1WZEA 3V7UA 3H65A 3VO9A 1SQSA 1NVFA 2ESRA 2YQ5A 2REBA 3ZBUA 5JS2A 2AZTA 4AY4A 1YL6A 4XDYA 1VL2A 5FUXA 2CLKB 3A04A 5EKDA 3SIPA 2HX1A 1E7WA 2EHDA 3EXG2 4R2IA 3UAOA 1EB8A 3ZDYB 3QXGA 4JY7A 3R7LA 1QCYA 4DEYA 5IKOA 5HQJA 1R7RA 2PPLA 3C4QA 4CETA 5HVNA 4R8LA 4WNCA 1CWUA 1YZVA 2R68A 3ITKA 5EJEA 2FW8A 4IJ5A 3LUKA 4CKWB 1TYAE 1ABEA 1K7EB 1QU2A 5A3VA 5AFSA 1N6KA 5KNDH 2HRCA 1YJ8A 3RIHA 2ODTX 3ZC3A 4QX6A 3GLGB 3IJRA 1H1DA 4A6XA 3HA3A 3ZD9A 2JCVA 2L69A 3COJA 1AKRA 1MPTA 3AUKA 1V41E 5ADWA 1L7VC 4EATA 2FMIA 3D6TB 2B4QA 2RGNC 1SG9A 4PGMA 2OGSA 4C0BA 4KSYA 1ND5A 1FFHA 4R2KA 5CX1A 5EYPA 3S1AA 4EHFA 1MEJA 1B6RA 2HDWA 3QLUA 4GP9A 1GT91 3VHQA 1LBSA 2GPWA 2ZR8A 3MGCA 1W5AA 5BV8A 1FJ2A 2GWRA 2E82A 4FGJA 3JAWB 4EGJA 3TUJC 3R23A 1WTAA 4XM1A 1H8HD 3GYBA 5JQGB 3TLGB 4AUKA 2ZUCA 3DEYX 4YCSA 1WZCA 1YBFA 2ARKA 821PA 2O2GA 3WO1A 4INJA 4MWSA 3P20A 2JGAA 4I81A 1LPAB 1PGNA 1TTQB 1VMDA 5G0SA 3GG2A 3N7TA 3RS4A 3U9LA 1M54A 4BUZA 1KORA 5KVQA 1LLQA 2QE7D 1ZOSA 2CHQA 1G1MA 2FSGA 4HBGA 3T3NA 2JS7A 2XVAA 4BQOA 4RENA 4YECA 2IIPA 3FDJA 4U6NA 3HA7A 4DV0B 3OIUA 1HDXA 3CO0S 1T3LA 3LC7O 3E3AA 2X9QA 1CB0A 2XNKA 4IO0A 3KS9A 4FLEA 5GJCA 2JJ2D 4JVNA 4O4JA 1HSOA 4PC6A 4ZMBA 1CE8B 4KE9A 3D4PA 3G79A 5FPKA 3WYEA 3ILYA 2QRVB 1KO7A 3K2IA 1XWWA 3NOXA 4WOBA 3T9EA 1KI6B 4H0FA 3HJBA 4AQDA 4RHCA 3DHWC 1E3DA 1M75A 1N6HA 3EZ2A 4V0MA 5TQ2B 5KINB 2X5JO 4X1KA 3UA3A 4ALMA 3T7DA 2G9ZA 1VKNA 3TQFA 4WY2A 3VU9A 2RGAA 4E5SA 4M36A 2FJ0A 4R0MA 1Q17A 1Y1RA 2BLNA 2WE7A 1QONA 5ETJA 4BQRA