4X95A

Crystal structure of fully glycosylated lysosomal phospholipase a2 in complex with methyl arachidonyl fluorophosphonate (mafp)
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
375
structure length
375
Chain Sequence
HPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of lysosomal phospholipase A2 and lecithin:cholesterol acyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Group XV phospholipase A2
total genus 124
structure length 375
sequence length 375
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02450 LCAT Lecithin:cholesterol acyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4x95A01
4N8EA 5AKXA 4B83A 3M3DA 3KOOA 4QLAA 1AMNA 5AKGA 2QZPA 5CT9A 2PU7A 3B3QA 2WIJA 4XIIA 1VA5A 5JD5A 3DYVA 1QTRA 4G9GA 3S8YA 2I3DA 4K2AA 3ZLTA 3PFCA 3WL5A 2ZYRA 3R3VA 3G0BA 2CZQA 3F8SA 3I1IA 3BF8A 3OURA 3AIKA 3O0DA 3TEJA 2ZSHA 5FUMA 4IO0A 4G8CA 4FLEA 1ORVA 3GFFA 4ARAA 4HAIA 3GBSA 2ZYSA 4F0JA 4WY8A 2HADA 5ALIA 3OC0A 2XUDA 2VJCA 3PICA 1MPXA 4A5SA 3HEAA 4OB8A 4C4XA 3STXA 2QKYA 2OGSA 1USWA 4LYEA 5A7GA 1JKMA 1FSSA 1A88A 2PSEA 5FRDA 5KREA 1CUHA 3WA6A 4BTLA 2QS9A 3MUNA 1LPAB 1CVLA 2BCEA 1ZIXA 4J0GA 2WG0A 3VVLA 5LYYA 3PFBA 4UUQA 5T4FA 1QE3A 2XUHA 1LPMA 5I7UA 1GGVA 2GBFA 1W52X 1YB6A 4C87A 2XMGA 4D9JA 2AJCA 5K3DA 1E8NA 4KAJA 4B85A 4ITVA 3HSSA 2QUAA 2OG1A 3ESDA 4X92A 5BWCA 1AC5A 4BP9A 1K5PA 3I2KA 4F5ZA 1BN7A 1ZI8A 4FLMA 2WQZA 2RHTA 5AKIA 5FV4A 2V97A 4OUKX 5CT5A 3ANTA 1FFCA 5ALQA 1EI9A 1OXMA 2JEYA 2GYUA 3CCBA 2XUKA 2Z3WA 4G4GA 4UBMA 4U2EA 1XQVA 1XZIA 4DMKA 3DL4A 1R50A 3VJKA 2Y6UA 3AZQA 2PU5A 1ZD4A 1GPKA 1BEZA 3QYJA 1T4MA 3WKDA 1YS1X 4QDXA 3FSGA 1N8SA 4RPCA 1VZ3A 4L9AA 2WFLB 4ZWNA 2EDAA 1IVYA 1EDDA 1GPNA 4W9RA 1U65A 4E11A 3WK4A 3I2FA 1LGYA 1OILA 3M83A 2VA9A 5ALYA 3ZV7A 4Q3OA 3F96A 1W6RA 2JGMA 2RGUA 1DT5A 4PQEA 2OXEA 1NU8A 4QA9A 4X71A 2AJ8A 3LCRA 1CQWA 2WUGA 3NWOA 1EINA 2HA4A 4DNFA 4ROTA 1ZOIA 1UWCA 3E3AA 1FFAA 1U8EA 1JJIA 1QIIA 1KU6A 1EDEA 4Q3LA 1X2EA 3VDXA 1MT3A 1Q0RA 4K6GA 3AJAA 3WJ1A 2Y2VA 4OCZA 1B41A 1WHSA 4J0DA 4Y2QA 4N8SA 5K3FA 3IUMA 3QPCA 4DIUA 5AI0A 2HU5A 4B82A 4YPVA 1BU8A 4Q05A 3R41A 4J3JA 4ZREA 3WWDA 2HA3A 5EIAA 1ODCA 3FBWA 5JIBA 1YAJA 1IUNA 3IA2A 5DYYA 5JANA 2JGLA 4BRSA 2JGEA 2WIKA 4QWMA 2XQJA 5ALWA 5ALZA 1EA5A 1ZIYA 5IVKA 1RWQA 2HDWA 4FKBA 1XRPA 2X76A 5AKEA 1AGYA 4TVKA 1JMKC 4X3CA 5HZGA 4EY5A 1UOPA 3S2ZA 4MEBA 1L7AA 4BATA 2XUGA 2UZ0A 4OSEA 3N2ZB 2Q0XA 2ACEA 2B20A 1XKLA 5A2GA 1XFDA 3C87A 4PNZA 3FLEA 3QMWA 1MO2A 5ALDA 3A2LA 5AIAA 1SFRA 4KJXA 3DS8A 5LIPA 3QM1A 1QOZA 5JZSA 2JGKA 3PF8A 1BRTA 1BEEA 4FBMA 4L3WA 5I9IA 4BC1A 1S8OA 3HRHA 5FLKA 5ALUA 2XMQA 5FPPA 3WK5A 5JD6A 2H9YA 4Y2UA 1VZ2A 3E0XA 3HI4A 4H7DA 5JZBA 1XLVA 5DTIA 1N1MA 4OB6A 1THTA 5K3CA 4ARBA 1H2XA 3QITA 4HZGA 5IVHA 5T4HA 2OGZA 5D6OA 3W9UA 5AHXA 1TIBA 3A6ZA 4EHBA 3R3YA 2BAGA 1R3DA 1IZ7A 1K6EA 2WUEA 2O7RA 3C6YA 3IIIA 1XRMA 2WLSA 4NVRA 2XQFA 4U2DA 3PF9A 3DCNA 1QIJA 1UK8A 1QGED 4H7KA 4MEAA 3KSRA 1ZD3A 4MWSA 1E3QA 1Q83A 4RE6A 4XWGA 3QBJA 5ALJA 4PV7A 4X6YA 5HFNA 5AI8A 2QTBA 5EGNA 4EY4A 3GUUA 5EFZA 3F97A 4V2IA 3BXPA 1U2EA 5AM2A 2VT7A 2Z5GA 3G0GA 3QMVA 2QRUA 1DT3A 4UBLA 5K5EA 1IZ8A 1F8UA 1CRLA 5ALKA 3DYIA 1L7RA 1X2BA 4RE5A 4B81A 3C70A 1XZMA 1VE6A 5E4YA 2WTNA 4JYPA 4B84A 2XUQA 2WUDA 4QDOA 2XE4A 3UMJA 1CUXA 3STYA 4NS4A 1XZHA 3H2IA 4OYLA 3EIOA 4X97A 3VISA 4HVTA 2XLBA 1CUVA 1HKHA 1P0MA 1LPPA 4FNMA 4BCCA 3NOXA 2J4CA 4BC0A 2PSHA 3I2GA 1VJ5A 3H18A 2FJ0A 3RLIA 1M33A 4AX4A 3WKEA 1LPNA 4H77A 1XROA 2LIPA 4KE9A 2WHQA 1MNAA 3PI6A 5ALHA 4CG1A 4UFPA 1G66A 2AJLI 1CUJA 4G5XA 5AKLA 5JAOA 3ESCA 1BCRA 5K3FB 2OCGA 2WFZA 2QJWA 4CG3A 1XLWA 2XUPA 1SCKA 3FLAA 3U1TA 2XUJA 2OQVA 1AZWA 3FCXA 4KAFA 5YASA 4CCYA 4UFNA 2XLCA 3FNBA 4G8DA 4EZIA 5E4JA 1EK2A 6YASA 4AQDA 3UUFA 3WIBA 2ZVDA 2QMQA 3H04A 2R11A 4H0CA 5EIEA 4YX9A 5CW2A 5A71A 3L1HA 1G42A 4ETWA 1N5RA 5LZ4A 1TK3A 3I2JA 5A7HA 3IURA 5DYWA 2RONA 4UHBA 4MXDA 2YXPX 4YASA 3FYUB 1GZ7A 1K63A 3CN9A 4UBNA 3WK9A 2ACKA 3ZLVA 3C6XA 1XRLA 5CH8A 3WYNA 2X5XA 3O4HA 1TAHA 4PSUA 1GKLA 2CMFA 3VVMA 1Q84A 5AK3A 2E3JA 4FHZA 4CCYB 4FWBA 1N5MA 5LLSA 4MQMA 1CQZA 1FFEA 3PE6A 3OTQA 2PSJA 2C5GA 2BUAA 5JATA 4A23A 2HHAA 1CUDA 2WKWA 4RGYA 2V96A 4U2BA 4Y9SA 4G9EA 5DNVA 3WK7A 4NMWA 5AK4A 2WFMA 3L1JA 3DL7A 4KR0A 4ZI5A 4S0XA 4YK7A 5HF5A 1YASA 4O08A 2CKMA 4LKOA 5C7YA 1CEXA 3FSGD 4GDMA 3STWA 3FVTA 5CH3A 2R8BA 2XMDA 3B12A 4P93A 3WZMA 1XZKA 4G4IA 4QE3A 5JZ9A 3H1BA 1AKNA 1GQRA 4BRZA 2PVSA 4QWWA 1H2ZA 3HYSA 3BE8A 2DR0A 2FX5A 1XZDA 4BE9A 5AI6A 1EHYA 3ANSA 4LHEA 2JGJA 3ZI7A 1ZD2P 4WJLA 1XZJA 1HDEA 3C8HA 5JD4A 5BV7A 1QJ4A 5AM3A 3K6KA 2WHPA 4GEGA 5LZ5A 2CB9A 1DTEA 1J07A 1VOTA 2HA7A 4P9NA 4H7FA 4ZV9A 4GW3A 4AN0A 1X70A 4UHCA 1TRHA 3IVMA 5CBKA 4Y7DA 1YSCA 3TRDA 2D5LA 4QEKA 5EHNA 1EH5A 3KWFA 4B9AA 1CUUA 4IHAA 2WJ3A 5JAPA 1XRNA 1YS2X 2ZYIA 3QPAA 4EY8A 4OPMA 4H7IA 5SYMA 2HRQA 2VATA 3OM8A 1JFRA 4CFSA 1Y37A 4A16A 2XQGA 3T52A 2G4LA 4BVLA 1LPBB 1PJAA 4WCVA 2RIPA 2XDWA 5ALFA 1XZCA 5ALPA 4U2FA 1VXOA 5LZ8A 1AUOA 4G4JA 5A7FA 4Y2JA 4UHEA 1VKHA 4KE7A 3DJYA 2WM2A 5AICA 4H7HA 1F0NA 1JJBA 2GZSA 1QIMA 3D2CA 4J0KA 4W63A 5LZ2A 2PSDA 4DNPA 4B6GA 2RI6A 4X93A 4KEAA 4DMHA 3D0KA 4KE6A 3G0DA 2OCKA 5CXUA 3IUJA 4TGLA 4MYDA 3RARA 1ZICA 2C5FA 4LXGA 3H2JA 4WFJA 3WI7A 4JH0A 3K2IA 1QIEA 2VT6A 2CJPA 5DNUA 1XZBA 1ZD5A 4IH1A 5DLPA 2ZYHA 1IUPA 1Z68A 3G0CA 1FJ2A 1YA4A 2RAUA 4BDSA 2WU3A 2QR5A 1TCBA 2H7CA 3GZJA 2J3QA 5HF6A 3I6MA 2K2QB 3A70A 2IITA 5JYCA 1UT6A 2Z8XA 1CUYA 3AUKA 4FTWA 3QZUA 4I3FA 3WWOA 1XLUA 1Y7HA 2XI4A 3NUZA 4C4ZA 3C45A 5AOCA 1CUSA 3R0VA 3KDAA 1QIDA 5KBYA 1CIJA 2PUJA 2ORYA 1DINA 1CFJA 4GWLA 2QT9A 1WB4A 3N0TA 1R1DA 3O4JA 5SYNA 1WOMA 1DU4A 5LZ9A 1WB5A 4AZ0A 1J1IA 2VJAA 4PSDA 3SX4A 5C81A 5FXMA 1XQWA 4HXFB 1RYYA 3D7RA 2D0DA 4AMZA 4CIAA 4MJ3A 2ES4A 2CUTA 1I6WA 1XZAA 5A62A 1CUCA 3GA7A 4DSAA 4K6KA 4UBKA 1P0QA 5AP9A 1BS9A 4Y2XA 3FCYA 1LBSA 5K3AA 3JWEA 1TQHA 3W05A 2HIHA 4N8DA 3AZPA 3H2KA 4PO3X 3RKSA 3FWHA 4XX1A 3DKKA 3U0VA 2HA5A 4OB7A 4L72A 4AO7A 4HRYA 2NW6A 1GT6A 3HC7A 1UOOA 4QDTA 4J03A 3IUQA 3G02A 4EUSA 3EQ7A 2BKLA 1YB7A 1GKKA 2W6CX 3DKRA 4BBZA 1G4HA 3CXUA 2PPLA 1SCQA 1CUFA 5CURA 3FYTA 3DD5A 5IH7A 3IUNA 1A8SA 5AM1A 1JU3A 3D2AA 2AJDA 1E5TA 1H23A 3M81A 1AURA 2PUHA 1A8UA 1HLGA 3IDAA 3W9BA 3LS2A 4Y2VA 4P92A 1SOMA 4U2GA 3EBLA 1NX9A 3AZOA 3W2TA 4AMYA 4LIPD 1MX5A 4BDTA 2PM8A 1UXOA 1AQLA 2J3DA 4LXHA 4QNNA 2B61A 5EHZA 2DHCA 2WIFA 1EXWA 5EI5A 4KACA 5LZ7A 3X3HA 3DDUA 3E4DA 2W22A 1MX9A 2QOEA 1YA8A 1P0PA 4BP8A 4C89A 2VTVA 3HJUA 3TJMA 3A2NA 3FYUA 1DQZA 2JGIA 5ALNA 5BWBA 4Q34A 1WCYA 5AO9A 2QVBA 3SK0A 5D7BA 1AX9A 4IH4A 5ALEA 3BWXA 3O95A 5K3EA 2XMCA 3I2HA 1CUGA 4C88A 1E66A 3HACA 4K5QA 5LKRA 1E8DA 2ZJ6A 4KAAA 4HRXA 3CN7A 4GBGA 3WL8A 2XMSA 3DOIA 3GELA 1XZGA 2WUFA 4AXBA 2VQ6A 4JEIA 4MQLA 4DGQA 2B9VA 5HF8A 5ALMA 5KWIA 5DTJA 1PFQA 5CT8A 1ORWA 2HL6A 3H2GA 4UFOA 3I28A 5HF9A 4GECA 4H7EA 1YR2A 5CT6A 4CI9A 2VAVA 2OPHA 2HA0A 2FUKA 2H1IA 5AI9A 3WWCA 4AO8A 4E15A 5HFAA 1E89A 4M0MA 2Z3ZA 1GPLA 5AH0A 2HFJA 5ALSA 2XB6A 1CUAA 1OCEA 4L0CA 1LNSA 2BFNA 3WKCA 5IKXA 2I78A 4FDMA 2P8SA 4N5IX 4CIBA 3FOBA 1QZ3A 4BVJA 4HXGA 4AZ3A 5CXXA 5AKHA 2XQIA 4BTVA 1F0PA 3WL7A 4BCBA 2XUOA 3FVRA 2HU7A 1XRRA 4J7AA 1CUZA 5DWDA 3AIMA 1UKAA 3BDIA 4N5HX 1EDBA 3ZWQA 2JBWA 1O6GA 2G5PA 3G8YA 4IH9A 3C5VA 1E8MA 1JI3A 2CBGA 1CR6A 2C0PA 3R3ZA 4H7JA 4AO6A 3H1AA 4JNCA 2VJBA 4BAGA 3CCCA 4PF1A 2HU8A 5CT4A 4KRYA 3PUHA 4UBOA 4B0OA 4AB1A 1DX4A 2ZSIA 3D3NA 1MU0A 5DNWA 5I8PA 1QO9A 4B80A 1XZLA 4X6XA 2JEZA 2G63A 4X85A 4G1FA 5T4EA 2B4KA 3WYDA 2VEOA 3LP5A 1C7IA 2BUBA 2V9ZA 3T4UA 2ROQA 4H18A 4HXEB 4EY6A 3EF3A 3AILA 2J4FA 5EIHA 3WQHA 1CUBA 1UKBA 1MTZA 5HK9A 4UHFA 3B5EA 5FKJA 1EX9A 3JYHA 1TKRA 1EVQA 1QLWA 2BGNA 4DNOA 1WPRA 3O9VA 2GBCA 1VA4A 2QM0A 2XUAA 3FLBA 5LKAA 4F21A 5C8ZA 4E46A 3EQ8A 3BIWA 3H19A 1B6GA 3SC2A 4RNCA 5AM4A 2Y2UA 4X7BA 1EB9A 5AKYA 4EY7A 5K3BA 3C43A 1DX6A 1XRQA 1K8QA 5AIBA 1JJFA 1UK9A 4DSZA 3O4GA 4QDUA 5KWJA 5ALLA 3ILSA 2YYSA 4FOLA 1BE0A 3H17A 1R9NA 1UOQA 3V1NA 4H35A 3C8DA 3BJMA 4MYSA 4WY5A 2XMRA 4Y2SA 5DJ5A 3I1YA 5ALTA 1HL7A 1CLEA 4J0HA 3I6YA 5AKKA 4B0PA 1DWQA 3YASA 2H7YA 3HXKA 2WSLA 5AKJA 5J3JA 4WDQA 5JADA 2VF2A 3FAKA 2DFPA 4X95A 3TGLA 4XJVA 3OG9A 5HKBA 2IX9A 4ZXFA 4DTCA 1ISPA 1C4XA 2XQKA 3NGMA 5AK5A 1J06A 2C4HA 4OD0A 1UKCA 3DLTA 5DYTA 2JGFA 4ZGBA 5AI5A 1MN6A 1Q0ZA 4UBIA 3QVMA 5E2IA 5D3ZA 3M82A 3OOSA 2Y1KA 1H2YA 3RM3A 3V1KA 3W04A 1H22A 2G5TA 2WJ4A 3MGAA 1EVEA 1ODTC 1HPLA 1MX1A 5FPQA 3R40A 1QIFA 3R3XA 2BGRA 1KEZA 2WJ6A 2WILA 3Q8WA 2ZJFA 4X00A 4DMFA 3ZPXA 1VLQA 4NZZA 2QUBA 3WKAA 5IVIA 1ZJ5A 4UHHA 1ODSA 2EDCA 3F67A 1ZGCA 4KRXA 4BVKA 2C0QA 4UHDA 1DQYA 1TCAA 2GBGA 5JAUA 3V1LA 2GYWA 2Y6VA 4K6HA 2QXUA 2XUIA 3SWWA 5JAHA 3OPMA 4EB0A 3Q0TA 2Z8ZA 1A8QA 2JF0A 3G7NA 1R9MA 1U4NA 3QMMA 5HQ3A 5F4ZA 4C6HA 1T2NA 2XT0A 3G9XA 3WKBA 5IVDA 4J0JA 3V9AA 3K9BA 3ED1A 2JIDA 3WK8A 4UBJA 1ZJ4A 2EEPA 4Q3KA 3H0CA 4ZV7A 5LP1A 4XVCA 2C7BA 2DQZA 5AOAA 1VE7A 1GXSA 2GBIA 3WMRA 3IULA 3WZLA 4FFWA 1QIHA 1XZEA 1WHTA 1UK7A 4F60A 1JT2A 3DEAA 3L1IA 3G9ZA 1C7JA 4E14A 1RP1A 4FBLA 4Y2YA 1QTIA 3D59A 1A7UA 2ZJ7A 4DM7A 2PKYX 3KD2A 2HFKA 3KXPA 2WFLA 1LPSA 4FMPA 4B7ZA 3VJLA 1QONA 5AI4A 1W4LA 2O7VA 1W1IA 2ONCA 4J0CA 5HKAA 7YASA 4CG2A 1QFSA 3DQZA 2WIGA 1ZI9A 2O2HA 2HRRA 5H3HA 1LLFA 1ZGBA 4OU4A 3HABA 2YH2A 3BF7A 3I6ZA 2RHWA 1ACLA 4TPKA 3A2MA 4WDRA 4IQ4A 1LZLA 1YCDA 3IBTA 2OQIA 5ESRA 3R3UA 4EBBA 5ALGA 3BDVA 3EQ9A 2HA6A 4X90A 2XMBA 4HS9A 4QLOA 4INZA 1LBTA 1CUEA 3BIXA 1ZI6A 2I03A 2OAEA 1P0IA 2PX6A 1UK6A 2BUCA 3LIIA 2CEKA 1UFOA 1XQXA 1SC9A 1KU0A 1EB8A 1JMYA 4I4CA 3D2BA 5JARA 1MJ5A 4OYYA 3HZOA 4U2CA 5BOVA 1XQYA 2ECFA 3F98A 5ALOA 1HBJA 5CRIA 3C6BA 3WA7A 1LPOA 3STVA 3G9TA 2C58A 3HLKA 1FFBA 4DMCA 4BCDA 1WB6A 3ICWA 1MAAA 1ACJA 1TCCA 3LIPA 3ICVA 3PDCA 1HQDA 1CUIA 5FOQA 5JASA 4M0EA 5CMLA 3MUOA 4KYVA 4X91A 3V48A 4BYMA 5AM0A 1UZAA 1L7QA 2OCLA 3STUA 3ZLUA 4OU5A 3UUEA 4Y2TA 1BROA 5D3KA 4EA6A 4QZVA 3IB3A 3PUIA 4MWTA 3RK4A 5A6VA 5AKZA 4PSCA 2O2IA 2QJRA 1LZKA 2DCMA 2H7XA 2PBLA 1XKTA 3P2MA 3F9CA 1VXRA 4BE4A 2WG2A 5ALXA 4M0FA 4BAUA 3G0IA 4GXNA 3QPDA 1XZFA 3AINA 3G9UA 5EHXA 3DOHA 2FJPA 1Y7IA 1CPYA 2O2GA 4GI1A 2IIVA 1BN6A 1W75A 1ETHA 2XMZA 4FNGA 1FFDA 3KWJA 4BB0A 2DHDA 3WL6A 4LYDA 4QDZA 3AFIA 4DYHA 4FLFA 4UPDA 3WJ2A 3VXKA 1CUWA 2HM7A 3O4IA 1H2WA 2GZRA 4JYMA 3E1GA 4BZZA 5ALVA 5AJHA 2VSQA 4C4YA 5CTAA 4Y2RA 1G5FA 1WM1A 4Q1VA 3VJMA 3WLAA 2QXTA 5FDFA 1QIKA 4DLNA 4WFIA 2DHEA 5E4TA 5CH5A 2WHRA 4W1RA 5EHQA 2X8BA 1MAHA 2WU4A 2WTMA 2YASA 2AJBA 4W1QA 1D07A 4J0IA 1PV1A 4Q82A 5T4BA 1YAHA 3R3WA 4C01A 5FP0A 3JW8A 3DNMA 2WIDA 3I2IA 3STTA 1MNQA 4Z49A 3ESBA 1F6WA 3C5WP 3VKFA 4X6UA 4P08A 3C6ZA 3WIOA 3AIOA 5AM5A 1O6FA 5HK8A 1IUOA 3GROA 4LXIA 3O9MA 3BL8A 2OGTA 2PSFA 4BZWA 3V1MA 4DNQA 1R88A 2OAGA 4CCWA 5HQ3B 4I19A 2XUFA 1NU6A 4PW0A 5C8VA 4WFKA 2AXEA 3D4LA 1W76A 3WWEA 4GHWA 2VAXA 5C8XA 4G8BA 1IMJA 4ZRDA 4W1PA 1J2EA 4AN1A 2OCIA 4FFVA 4JUIA 1QFMA 2PL5A 2I3ZA 5AOBA 3WWPA 5JALA 4W1SA 3D5EA 2V98A 4B9EA 3LLCA 2GYVA 1DWOA 2HA2A 4KE8A 5ALRA 1R4ZA 1DWPA 2DSNA 3BJRA 3ESAA 1GQSA 1BCSA 3WK6A 3H2HA 1QIGA 2VJDA 1EK1A 1THGA 2OLEA 1JU4A 4HTAA 3FYUC 2BJHA 1QO7A 1WPXA 3MVEA 3W06A 2WHPB 2DQYA 3QH4A 4GLBA 4Y2PA 5ISMA 4BAZA 1K4YA 4X94A 5AK6A 5HCUA 2WG1A 1CV2A 1SCIA
chains in the Genus database with same CATH superfamily
4F6RB 4NBTA 1T25A 5FTKA 1I3MA 4CT0A 4KQ2A 4UCQA 4QLAA 4OKSA 3KPVA 4H7PA 3PBKA 4P5PA 4MKZA 2NO1A 4D9NA 3HDYA 4C05A 1SD2A 1GJRA 3KR9A 5JS7A 1BWPA 1JQKA 3B3QA 1A2BA 3LCCA 4OHRA 4OBWA 4XR9A 3PR2B 2I3DA 1VBMA 2O0JA 3BVPA 1DO2A 1CZOA 2QL9A 3ELWA 2O8EA 4ZALA 3ZLTA 3UANA 4KPYA 3NAGA 2P0YA 2X1LA 2P41A 3G0BA 4FYVA 5EPOA 4HCJA 3U3OA 3A1FA 1UPCA 3BF8A 4B6QA 2X5KO 2ALJA 2ATEA 2F1KA 2FSIA 2IZ1A 2OQ2A 3O0DA 3TEJA 4IVPA 3VU0A 5K8VA 3W5BA 5KOJB 1R6BX 5LU8A 1I2BA 2FN8A 3J80A 4HGOA 4LSMA 2OAQ1 3TSOA 3FVWA 3ZR4B 4B3RB 4R7TA 4HNUA 5CLIA 4RV9A 2CFTA 2VWHA 2FRDA 1E20A 3MMZA 2IZ0A 4CMIB 4HYEA 1ISIA 2AFRA 4B1FA 1XT6A 2HADA 3OC0A 2YHUA 3K1ZA 2GERA 3W34A 3OEYA 2WFAA 2UVQA 4YRRA 4EHDA 3L7KA 4A5SA 5IULC 1JLRA 1D1PA 3E9RA 5ICSA 2H2DA 3WHPA 3HEAA 3I9V6 4KLZA 1HWYA 4OB8A 5KNDA 1I7SB 1Z56C 1IBSA 3CYFA 2DZDA 4QODA 3SHVA 4QUIA 1U63A 1FQWA 2CCJA 3ODGA 1G5IA 3AF6A 5A7GA 2ZVQX 3O8NA 4HB2A 4XX0A 4XVUA 1JKMA 3MINB 1AK9A 4AG5A 1IXRC 2HMSA 1S2OA 3HJNA 3VX4A 5HKKA 1PS8A 1OBVA 1SUFA 4CG0A 4REQB 2J87A 1KEKA 2PUBA 3ZUPA 2BR3A 3SZGA 1IOLA 2LIVA 3GRZA 2FFHA 4O4JA 3HKDA 2P9JA 1QAOA 3IT0A 4XTRA 3TINA 1CUHA 1GTVA 4EMUA 1O0CA 3VOSA 1C9YA 1FDIA 2IYAA 1G7RA 1GCGA 2C3UA 4V1CA 4FHFA 1BVRA 5ES4B 3H5WA 3K09A 3IMFA 3W0LB 1FZQA 1N7GA 3C3YA 4IDGA 5CXSA 4WD3A 3ZHBA 3L6OO 4NDNE 3TXAA 1JIVA 3BJIC 4JQCA 2H1HA 3QKSB 4BO2A 2VNKA 1VMDA 3PFBA 2G5GX 3HJHA 4O0MA 4AIRA 4B3HA 1JDUA 4FI3F 4REOA 4R1PA 3BWCA 1HR0B 4FW9A 3IQXA 5M3BA 4BFSA 2ZS8A 4QUJA 4JR1A 2FYTA 3QXHA 1L7XA 4I1RA 5CIQA 4BXOB 3GARA 4BQNA 4ESVA 4XJSA 1LBQA 2C2OA 3HSYA 4URUR 1GFSA 3K70B 2XOKA 1XAIA 2EG9A 2V7VA 3FCAA 1QUFA 2B2XA 2QZ9A 3PC3A 1B8PA 2XJ9A 1KYVA 3GP3A 4INJA 1RADA 1WXEA 4GP6A 3CVXA 1NUUA 4MW9A 4R51A 4P3YA 4QTYA 3B53X 4N5DA 5KMGA 3BWVA 2HHLA 5E1MA 4B85A 5IX8A 3VR0A 1QH1A 2CNDA 3PNOA 2W6JD 3ESDA 4RMGA 2AX4A 3I23A 2ZSBA 3LO8A 4X92A 4DPMA 1OY1A 2B0CA 3GJ8A 4MVCA 5IMBA 2H4WA 2VWPA 1NXTA 2HK6A 3MWLA 1E2NA 3RYFA 1C8LA 2JEOA 4LF6B 2WKPA 3UB3A 3I9MA 1XHFA 5COBA 3QV1A 2GHIA 4EB3A 2V54A 3V8NA 1JFVA 3AJRA 1E2FA 5LP6C 1V2HE 4EABA 1SXJA 2ID4A 4F5ZA 2AV6A 1IM2A 2AH5A 3FRHA 1RWXA 2HH9A 2X9LA 2I3AA 3W3AA 2UKDA 4B4VA 2KHZA 3FF4A 4IMPA 4OUKX 5AKIA 2Y0DA 3DT9A 1XWIA 1UL1X 4UVGA 2WE7A 5HUQA 3MIIA 4QO7A 3T7EA 2FF7A 3EWNA 1USGA 3RS9A 1SKUA 2BONA 1R4MB 3PC8C 1GWNA 3R5FA 3VUFA 4BV3A 4RM2A 1OXUA 2JHCA 5ALQA 1XB2A 2AI3A 3DBVO 3L4EA 3DBHB 1V5FA 4BQIA 3Q72A 2XT9A 3N39C 1G0OA 2GYUA 3D4BA 3SZ3A 4DZRA 4DWOA 5JFOA 1C9NA 4WOBA 2GA8A 2NO4A 1GTG1 3IUPA 4G5YA 4OLHA 1PJQA 4QFDA 3TRKA 4AJPA 1QYRA 5E1DA 1N3BA 1KXJA 2BFCA 1EFUA 1Y9ZA 1XQVA 2V58A 4HDKB 3VJKA 4JBWA 4IHQA 3H2YA 1JHVA 5JHHB 1YUNA 1NTRA 2Q27A 1MVLA 2BHRA 3EDYA 4OKNA 3RF6A 3T9FA 1HYBA 3EZXA 4UMFA 2WK1A 2PU5A 3DEYX 1GPKA 4J4TA 3QYJA 3NRJA 4H3KB 4NCIA 5FUBA 4M0CA 4JDUA 1P4GA 4UUAA 5DB4A 4AYWA 3FSGA 2XE8A 1QHYA 1GPUA 3L7LA 2BEKA 3QRWA 3TL2A 2RHGB 2XHEA 3DBIA 3T95A 3DVLA 1DTWA 3OA0A 3FUCA 3TEFA 3MZ0A 2YZ2A 3EUAA 3AB7A 1W2HA 3KT8A 2ZRQA 3RSFA 2BKAA 3X44A 1KL7A 1B4DA 5KPJA 1IVYA 3VU3A 4BLUA 2O2JA 5EJMA 2R1TA 4W9RA 3SKVA 3DZDA 1O54A 1GUFA 2ZITA 4QOJA 4DLBA 1Z0ZA 3L7DA 3CUYA 4XPIA 5DN6A 4LBZA 2DJIA 3QSYA 3MS2A 3FMGA 4ZCSA 3I2FA 1LGYA 3N8KA 4C30A 1OILA 5LQUA 3M83A 2EKPA 2VK1A 1Z5GA 1X7ZA 2LDXA 2O05A 2XZPA 4R2MA 3FYDA 1OFUA 1YB1A 3RT7A 3ZV7A 3QVJA 3HKEB 3QF4A 4KN8A 4E6EA 5MHTA 1WXWA 1BXRA 1F6DA 3PUVA 1AE1A 1E2JA 3TG2A 4O59O 1Z8DA 1QH9A 1W6RA 4QNRA 1FX0A 9ATCA 5K6TA 2PAFA 2RGUA 4K9OA 1ES9A 1NU8A 3EJ6A 2A86A 1M34B 1WXFA 4JC4A 3UJ6A 3NWOA 3UJDA 1WKCA 4BO5A 1K7YA 1C1DB 1JS1X 4DA4A 1OXXK 2HA4A 5EIOA 5DFAA 1WXHA 1GRVA 4DNFA 4PHFA 1PEAA 1D2GA 3L0IB 1IN8A 4BUJA 1ZPDA 3FPLA 5DX1A 3ER9A 3E3AA 1OLSB 5AUQA 4QQRA 3QKRA 2P35A 4W9NA 3N2NA 2WB4A 4RL6A 4OA8A 4PN7A 2EYUA 1R4NB 2V03A 3A31A 2RJ3A 3KG2A 2YVLA 3NUQA 4GMDA 3E7XA 3ROPA 3UA3A 3Q2IA 1PJTA 1EDEA 4IKPA 2DHRA 2PFSA 5HKOA 1RPAA 4Q3LA 1X2EA 3T6KA 1T3HA 1JBEA 3RAPR 2HMAA 3BZBA 4CUZA 1H3EA 3HL4A 1BGWA 2JI7A 4Q9KA 5KTSA 2IU4A 1Q0RA 1U1EA 4WKBA 2AI2A 3MMXA 3CTPA 4RIIA 2A1UA 3LPMA 1RKVA 3UT6A 1KE1A 3G5LA 2W4MA 3QPBA 1K8XB 5LUBA 1E4VA 3R6TA 4C14A 5LOVB 2FPPA 1IG3A 1LSUA 2XA9A 1V4VA 4CM9D 3OQPA 1WVIA 1B41A 3E0QA 4DREA 4DRXB 4L4SA 1C0LA 1H2FA 4FR0A 1S2NA 4Y2QA 4IS3A 2GSDA 5ADHA 1KNXA 1Q0TA 4WZBE 1EAYA 2A4KA 3OQVA 4C0SA 4DDKA 4XWWA 1HDIA 4DIUA 3QUSA 1E3DA 5ITZB 3JATB 2P2DA 4Q12A 2M1ZA 4BMZA 4ZTUB 1NY5A 2IYRA 3IE0A 2GAOA 2XEDA 1JI0A 1P4JA 3JQ7B 4K05A 2CDAA 2XOKD 4P80A 4ZREA 1XE3A 4DPLA 1XVVA 1YBFA 3IP8A 5EIAA 2GHQA 2GPTA 1ODCA 1W19A 2G80A 1B6SA 2WYIA 4GSLA 1AD2A 3CSDA 2P90A 2FI1A 2QN2A 3GH3A 3ICCA 4IJ6A 5DMXA 4W5WA 4F2PA 5BWMA 2QMZA 2W6JA 4G0MA 2WIKA 4RLSA 1AKUA 4TLAA 4FGUA 2CV2A 3GIDA 3JQDA 3UK1A 3KJGA 3S4YA 2YVKA 1EA5A 4EI9A 1SRQA 4RTQA 4HVAA 5G0TA 3MWKA 4OQZA 3AJ9A 5F1YA 4PG8A 4PQFA 4CDNA 1RWQA 2WSBA 3UMSA 3AEKA 4P3PA 3EPHA 1NN1A 3JZFA 1Y6GA 2WTBA 2H9AA 4WASA 2ARKA 3KOXA 1DEOA 5BNFA 3TLGB 1M0TA 1V95A 2EZ4A 3MCTA 1SB9A 1JE1A 1TU4A 3I1JA 2A33A 3KPUA 5DBFA 1JIQA 3CW9A 3CJTA 1JMKC 1JXOA 2Q3HA 3W3AD 1KAEA 1YQDA 1F6BA 3V7UA 2QIPA 1PRYA 3QU2A 4JXJA 4PR0A 3G2QA 2DWOA 4X54A 1WUTA 3KKMA 4INOA 4B40A 2O8CB 4NBRA 4OBEA 4B2IA 1Q1AA 1L7AA 5EC8A 3PC8A 1U0HC 2W2VA 4OBXA 1EFKA 5E6UB 5I7AA 1LWNA 3SYLA 4F72A 3LBHA 4MB6A 1K5HA 1R0YA 2DFVA 1C4KA 3K35A 3K0FB 3ZVNA 3F2IA 3BHJA 4R8SA 5A2GA 1DAEA 2JK0A 2IBSA 4YV1A 1CQJA 3GBPA 1OWOA 2PK3A 4AY6A 3C87A 3UFBA 5CG2A 5C0OE 1M2FA 3FMFA 1E7QA 5F21A 1M2OB 4NATA 1JV2B 3QM1A 3TE7A 5JE8A 3OCUA 3IOYA 3BA1A 4NWIA 4RORA 1H4SA 1ULBA 3PF8A 4Y6RA 4I1PA 2FGKA 1P2BA 4HQRA 1IJBA 5ED0A 2B8EA 4RX1A 1FU4A 4AF7A 4EUKA 2W6MA 1B00A 3NG1A 3LUKA 1XU7A 2AKAB 3BFJA 5B7NA 1G291 1GL6A 4YJDA 4FBMA 2A94A 1E5DA 2K7FA 5U4QA 1FEZA 1Y81A 2BCJQ 1T8RA 3LD9A 2F3RA 3HCEA 4GPD1 2PTHA 1DMSA 4Y9TA 1S8OA 1N2ZA 3VC2A 4DN6A 1PCXA 3OLVA 4WJKB 1W47A 4BNZA 4WTOA 4HLUA 3L2OB 4UM5A 1FVOA 1T10A 2QX9A 2VYCA 5CD9A 3ULKA 1N1DA 2YMMA 4X1YB 3KSUA 5LQDA 1JEJA 1HTBA 3RFCA 4ERNA 4Y2UA 4RTSA 4U9HS 1VZ2A 3PJRA 5CM9C 4LYAA 2HREA 3V8RA 1JQ3A 1Y5IA 1SWWA 5KU1A 5L45A 3U39A 4H7DA 2ZSJA 1A8PA 1CF4A 1G6KA 1AY0A 1XLVA 2YYZA 4WCFC 3NTRA 5ILGA 3U17A 3DHVA 4RKRA 3NC4A 1N1MA 1S1MA 5IDQA 1THTA 1I4EB 1K2VN 1JHUA 4G23A 3A7EA 4D5GA 3QITA 2W2XA 1XNRB 3N1UA 1KI9A 2FEAA 3QIVA 3P0RA 1A9QA 5HCNA 4MR7B 5KYKA 2E55A 1OYWA 5AHXA 1TIBA 3M4XA 2UUBB 4ZQFA 5KSPA 4PNPA 2IQ5A 4DDUA 5A5DA 3WO0A 1TX4B 4JXKA 4ECAA 1F5NA 3TKAA 3AR2A 1MB9A 1S1CA 2NO6A 4KVGA 4G8JA 2C2XA 3FPHA 4K26A 1R3DA 2JAHA 4AVYA 3NC1C 3O3MB 3F8TA 3C3WA 5ABPA 3C6YA 5DZSA 2JLBA 4L78A 1UR5A 1QH8A 1XA0A 3R3SA 3CV3A 5BRJA 2GM4A 3JYLA 3Q6IA 4JB3A 1E0DA 1NQ5A 2C3PA 1DJOA 2Q4RA 3M2TA 1RIFA 4RESA 2REQA 3A27A 4J43A 4BN4A 1OJ7A 1QUEA 2BFAA 1Z4IA 1WCIA 3ZEAA 1DIRA 1T5SA 1UK8A 3U7QB 3SSAA 1IM8A 3FKQA 3VSAA 1F17A 2MR6A 2X9QA 3A4IA 4JOBA 3QPVA 4MWSA 3TX6A 2VXCA 3VDRA 1HDCA 4PC6A 4XA8A 5EESA 1NQOA 1V26A 4WJZA 3G79A 4WN9A 4XCQA 1DJQA 4RTJA 3V2HA 1JAXA 1P9WA 3QBJA 3JVDA 1YF3A 1MZPA 2BHSA 3I5UA 2FFQA 4M1TA 2GH1A 5HFNA 4E08A 5AI8A 5EGNA 2TS1A 4M86A 1A4XA 3IAS6 3LT5A 4PCVA 3TMYA 5HWSA 5LJIA 1GZVA 4Q1FA 2EZUA 3GUUA 3ZLJA 1R4NA 4PG5A 1UJ4A 4EMBA 1NF9A 3EXIA 4KZKA 4V2IA 4JLAA 4RK5A 2HRDA 1U2EA 5AM2A 1RMQA 4PZPA 3A37A 3P26A 4RAOA 4UBLA 5DMHA 2BIFA 1M5UA 2P2ZA 2J41A 5AVVA 5ALKA 1I94B 1TEVA 3TSWA 3DYIA 2ZI9A 4EF4A 4L75A 5CB4F 1J56A 4DUPA 1C1HA 5ANRB 4B81A 4I9FA 1LS1A 4UPEA 4EGAA 1Z4NA 4D82A 1VE6A 2JLSA 3PT5A 3UAWA 4F8YA 1SQSA 3LLUA 3GX1A 4RJ2A 4LDNA 4B84A 2GUGA 3EA4A 2D2XA 2VZ8A 4QDOA 1J9GA 2CXXA 4IJUA 3AKZA 1AZLA 1CUXA 4IJVA 4JJ7A 3MAGA 5J58A 1FX0B 4NG5A 1Z6ZA 3CLRD 2JVKA 4G0UA 1ZJYA 2CL7X 2JFPA 2QTTA 4UEWA 2JGAA 4WOJA 3INYA 1QV9A 2ZI7A 3H4TA 3TJZA 3VKUA 4EPRA 1X7DA 1DX9A 1E63A 4OYLA 4Y98A 1EE9A 3HL0A 4C7OB 7ADHA 3EIOA 5EJ5A 1V3QE 3QPWA 1IN1A 3ZE6A 1PJZA 2ZVJA 3PVSA 5F2KA 1IDN1 2QM3A 4FFNA 3RWMB 1W2GA 4CQMB 1ZFNA 1XKQA 2GJSA 4D3ZA 4YMSA 3IJEB 5BV0A 1LPPA 3RRBA 5HJEA 1R8YA 2VBIA 4FT4A 4PYQA 1E32A 2MSWA 1XQ6A 4L08A 3NOXA 5KNLA 2PSHA 4H6WA 2QD3A 4N7BA 1UM8A 4IF6A 1KZHA 2C9OA 4BMOB 1SBHA 2J46A 3I2GA 4WADA 1N2HA 4O0LA 1RTKA 4HYTA 1JG7A 4IUYA 1A8IA 4GRIA 5JZMA 3N75A 4I50F 3WLQA 1O94A 2WTEA 1Q95A 2B2CA 2WYHA 1AMUA 4MPRA 3ENQA 2ZJ2A 4PLHA 2FQ1A 1C14A 2B5WA 2RGYA 4DMMA 4N48A 1SBTA 1XROA 1RKUA 3DV0A 1VIYA 1UIMA 4KE9A 4AJLA 1Y8ZA 1EZ4A 1MNAA 3PI6A 2MSEB 2YWXA 3IAM6 1TJ4A 2K7ZA 4Q9LA 4AKEA 4CG1A 3HB0A 4MYTA 4NJEA 4U3JB 4G5XA 3L06A 4TXNA 3T12A 5IDWA 4E3WA 3AFGA 4ID3A 2R44A 5CX1B 1IQPA 3B7PA 3RVLA 4ICIA 1Z82A 1QH0A 2G7MC 1C81A 1OX4B 3KUDA 4CI0B 3RFVA 2QJWA 3EQ2A 3NMUF 1NQUA 4TLLB 2X3UA 3ONNA 1XLWA 4JCCA 2P0EA 4KGVA 4L76A 1RTTA 4PLFA 4RFSA 4OHWA 4DIFA 1BMFA 4UXIA 3PHJA 3ZXYA 2ZI3A 1MV8A 1Q1QA 1NKTA 2VTEA 4PYRA 1VKNA 1WOYA 1T6NA 1Y8QA 3KZCA 5YASA 4F2GA 2RBGA 2AS0A 3GJ6A 4OQQA 4EL5A 2R79A 1P7VA 4BX8A 3IO3A 2N0SA 3SQLA 5J1TB 1HC7A 2CE7A 2EVWX 3RHSA 4Q4CA 3NATA 4GBMA 4GM0A 4HFNA 4Q5IA 1RMTA 3B6KA 2YXEA 4E5DA 1HZZC 3MOSA 4DLPA 5IS2A 3KJNA 2BM9A 2JIZA 2ZYVX 3PX2A 3P9PA 4PC2A 2PT6A 1AMOA 4BL5A 3DZJA 5KZMB 2ZM5A 4G1MB 1TMGE 2XXAA 2WNSA 6ABPA 3FTEA 3V9PA 3A2KA 4K8RB 3NPMA 2R11A 3E22B 4OH7A 4P7GA 4O5OA 2DFTA 5GJWC 1SVSA 4MI1A 5LUAA 1SMKA 4ZPJA 2R86A 3N8HA 4UATA 3T9BA 1NI3A 3PUXA 2B4RO 2RAPA 3DF9A 1XOIA 2Q3JA 3AKEA 4H17A 3DV2A 3RU9A 1J0BA 2VYFA 5DOVA 5IJ0A 1AU9A 2XXBA 4EVRA 3BXZA 5DYWA 5EYPA 3JTMA 5THXA 4KV7A 4YASA 2QQ0A 2XIJA 3C98A 3SG0A 1K63A 3ZX4A 4QO8A 2QK4A 3P52A 2ACKA 3CRW1 3ZLVA 3FSEA 1WMDA 2ST1A 3DSRA 4V2UA 2GVNA 1D2MA 3WNCA 1I7PA 4B71A 4IDHA 1JR3A 3KTDA 4L8FA 2PJZA 3QVVA 2QSJA 3GZNB 4A0HA 3TR6A 3UFXB 2GQ0A 2CMFA 4GR9A 4XQEA 1ZSVA 2ZKIA 1Y4SA 2AG8A 2Z8YM 4JL6A 4Q00A 3PRJA 4JBYA 5CJ2A 3UGKA 3WLFA 5JT1A 2E3JA 4WV3A 4KV9A 4OP1A 3NHKA 2ADOA 5A4JA 4MKGA 4FWBA 4WA7A 1ZZGA 2XE7A 5K1ZA 5LLSA 4MQMA 2PN1A 3JQ6A 5TPZA 3G13A 2V6JA 2ODAA 3R7WB 2H1OA 3FPAA 1W0JA 1IK4A 3OTQA 2QTFA 4N6OA 3SJBA 1XRJA 2PSJA 1XNJA 1I32A 3HV0A 3OD1A 4KFSA 5DU2A 1G1MA 1K3UB 3LK7A 1VI6A 3K5WA 2E1RA 2QT1A 2ESRA 4IV8A 3CO5A 1V8BA 2X5OA 3HR4A 1J24A 3NDPA 4R8VA 1H1LB 2IW1A 4S1OA 4MYCA 4ZODA 3PWZA 4QOHA 5DGHA 4CM6A 2JZNA 3BBPA 3HVJA 4KLAA 2XCTB 5G1NA 4HGRA 4MW4A 1H94A 2PLRA 2LD4A 2R3SA 4FGKA 4UAJA 3B1ZA 4G9EA 1M66A 4LJSA 4CU2A 3K0SA 1P4HA 3LW7A 3TTYA 1PJRA 4MVJM 4DLXA 1N5LA 4YRAA 5I9BA 2GILA 1ZJWA 2GB4A 3SP1A 1J97A 2Q6VA 3TNFA 4MS1A 4FFRA 2WFMA 1JKXA 5FWAA 3W8NA 4QJ3A 3O2NA 3L4JA 2Q7OE 1V25A 2AB0A 2B92A 3V2IA 1YCHA 4QUHA 5HIJA 5FV7A 4IG4A 3CFYA 2A3RA 4IXDA 3OOYA 1J20A 3D7NA 5IBRA 1UANA 3LM8A 3PYXA 2J6BA 3R0IA 3TUIC 4ZGWA 5T6MA 1OH5A 3UMMA 5IDYA 2INGX 1YJ8A 1CEXA 1V39A 3G2PA 4BFZA 1G98A 3S8MA 3CX3A 3M5WA 4Q1EA 5ILOA 4KNYA 2VSOA 2ZU6A 5CH3A 1RHJA 3LBNA 1JALA 5FBRB 4DCVA 1ZUNA 3B12A 1NW9B 5FBWB 2VTBA 1UXGA 4TROA 4XLLA 3HGTA 3P0HA 3M6XA 3KOUA 3WZMA 5E9AA 1XZKA 2VYVD 4IZ6A 2GMWA 3B7GA 3HR7A 3ND9A 4K03A 3ZS8A 4U7HA 4CM4B 5JZ9A 5J2TB 1A7KA 4WQMA 3FFWA 5C1PA 1GQRA 1I8TA 2CLOB 2W71A 5CVJA 2RH4A 2PVSA 4RVDA 3SGLA 4DHEA 5HMLA 3O7MA 5KX5F 1H2ZA 5AXBA 4M8NE 4R1OA 4WX2B 5L7WA 4UCXA 3QKWA 2PO7A 3HYSA 3BE8A 2NTVA 4LDZA 1Y1KE 2H2WA 2PUTA 4QU0A 3WWZA 3AFOA 2VHQA 5G0UA 4PYIA 1DG3A 1RLTA 1Y8AA 1GZ6A 2OK8A 2FX5A 3JQGB 4IOKA 1G16A 4J0FA 1XF9A 1CJTC 5JMPA 1DIHA 1DAHA 1H0HA 1TM2A 1N6KA 3T4PA 4BBPA 3IJRA 2VO1A 3MBOA 3ANSA 4COOA 2HIGA 2A1TS 3A1SA 1HFEL 2BN4A 3BK1A 2GK4A 3ONDA 2BGMA 3ZI7A 3ZW7A 1KWGA 5FLXA 2DFNA 1ZM9A 2IEIA 1HDEA 1KMMA 1RJEA 1SBYA 1ZD9A 3DE2X 4FYKA 4BO8A 3CG0A 1Z45A 3AR3A 4U3JA 2FR1A 1QJ4A 5AM3A 5KTOA 2YY5A 3JALB 2I1QA 5FYQA 3WGUA 1SXPA 1QPBA 3VNRA 1E9SA 3R9WA 2CB9A 3PHLA 4V3BA 4CR7A 4FQ5A 4P4TA 4PRKA 3B70A 1Q77A 3F5MA 2HA7A 1OX5A 4UUOA 4DT1A 3CA8A 4FZ3A 1SUSA 3LH5A 4H7FA 1BHJA 2BTEA 4YEDA 1EHIA 1Q3KA 4R71A 4YJ2B 4O1MA 4BU0A 1U0OC 3QEKA 4M6WB 4LY6A 3GQBA 1WDWB 1Q6YA 2QX8A 3VZPA 3T06B 1TRHA 2AE1A 3IVMA 3DBLA 3B5JA 1XNHA 3BAZA 2XB9A 5CDFE 2C5AA 1EM8A 1IEXA 5EE3A 4BFTA 3AERA 3SBOA 2JI6A 4Y1FA 5ESXA 1MQ8B 1K88A 4Y7DA 4RQBA 5BNIA 2DPYA 4AWAA 4L2IB 3E6AA 4ZI2A 1YSCA 1JHZA 3TRDA 5IU6A 1XR3A 4MB2A 3F9RA 3DCIA 4KP7A 3VU1A 3ZNOA 1PE0A 1IHYA 1LA2A 2WQ7A 4XQ0A 2ZSFA 5EHNA 2DBQA 3CNQS 3KWFA 2P4QA 4IAOA 4R98A 3C39A 3HEBA 4HX9A 4PFKA 4D9KA 2O8BA 1QFJA 6CHYA 3GP5A 4IHAA 2DPHA 3N2EA 3OOEA 5KDDA 2WJ3A 3NWPA 5MGNA 5JAPA 2ACVA 3E9MA 2I2CA 4O1HA 2PMDA 3K92A 4M9SA 1A9TA 4BB9A 3M9LA 3E58A 4MV4A 4B44A 3MMNA 2ZYIA 4X65B 2CF6A 5DX8A 4EY8A 5BVHB 4K9MA 3JZIA 5M04A 4M3NA 4IBOA 4LKRA 2RCNA 3UH0A 5DNCA 5KWVA 3PTAA 3OM8A 3ZD7A 1QANA 4IIHA 4CFSA 1K92A 1XFAA 3DNPA 3MBIA 2XZDA 4ZQIA 5J59A 2F1IA 4DLAA 2JBAA 3IVGA 4Z6KA 2J32A 3WMXA 1DE0A 2OSBA 1O0SA 2CLKB 1FZTA 2YVQA 1Z9BA 3D6FA 1LVUA 2G4LA 4V38A 1LPBB 4WKOA 5BUZA 3IOCA 4WCVA 3ZCXA 8ATCA 1R5NA 2J0QA 1OLUA 3SU8A 1L7VC 2H1CA 3GRCA 4KPUB 4DXHA 1AXEA 2OBLA 4P6VF 3HBLA 1AUOA 3H16A 2QLLA 4Y2JA 1TA0A 5L3RA 4LWZA 1TFRA 1VKHA 3D3WA 2GVZC 4WVFA 1J21A 4EOGA 3NONA 1ST3A 4EVIA 4U0KA 1KVQA 1QPGA 2PCJA 3KWMA 4RUKA 3GZTB 4UNQA 3UGJA 2C42A 3QX7A 4HRAA 4HC4A 3Q6NA 4N9WA 5ECYA 4ZCLA 1P1FA 1OTYA 3AR6A 4F6RA 4CKXA 1X80A 2EWMA 2VP3A 3KAJA 4DC1A 3QXJA 2H2IA 2VA8A 1E5VA 1N8NA 1QIMA 3IP9A 3MHPA 4FMBB 2RAVA 4HYYA 4YJ3F 5FH9A 5LZ2A 2PSDA 5EP1A 3R9XB 1U31A 1Q21A 3N0WA 3QY9A 3VM6A 4X93A 1JX6A 1K7XB 4KEAA 3DBRB 4EHFA 4BLRA 4A92A 3DPUA 1BFKA 4XFDA 2HQ1A 1U6JA 1EX7A 3ETJA 3LSYA 4GUDA 4CLXA 3ADOA 3IUJA 5B2ZA 1GG2A 2PO5A 4AUNA 1OBFO 3G0OA 1UDWA 2H2GA 5TJ9A 3KVOA 4I5GA 1XKXA 3U4HA 5G3YA 3UJCA 1NATA 2O2EA 3SC2B 1TUEA 3AK4A 1QIEA 3M6VA 2CJPA 4BZQA 4LWPA 5I9LA 4EHIA 2ZYHA 1HX7A 3DP9A 3FOWA 4D56A 6LDHA 3SJUA 1YA4A 1M7BA 3B20A 2RAUA 2WAYA 4JB2A 1PWZA 2P9EA 3H5NA 2VRNA 3DOEA 4L27A 5KX5B 3S6JA 5L4NA 3P0EA 4WGGA 4RSRA 1QP7A 3BA6A 1UBTS 3GZJA 2EP8A 4UUBA 1DHRA 4JJ8A 4OLAA 3QY0A 1DQRA 3U2QA 1H1DA 1Y89A 1X7HA 3NIFB 4D45A 5HF6A 1V5GA 4X1OA 2F9MA 4G67A 5IABA 4KHPB 4IS2A 4TV8F 5AW8A 2QZZA 4YP6A 5CEEA 4QXAA 3N86A 1CUYA 3AHIA 3RIHA 3KKEA 4NEHB 4XARA 1F3OA 3GZNA 3SAJA 2P27A 5BSRA 3ANXA 3FVVA 3DEIA 4QTTB 1PW7A 3EFOA 4XI9A 4NZMA 4YBRA 3CZCA 1YVEI 3T5GA 2BM8A 1CZNA 3FHOA 3VO1A 1JEQB 4XYMA 3ZV3A 4BMVA 3VR6D 3VMMA 3DTYA 4MKFA 3MUEA 2NM0A 2FPXA 3QFCA 3T5TA 3R0VA 4MUYA 1G9XA 1DBIA 3ZWMA 4KIJA 4XDHA 4WBNB 4D02A 1SIOA 5KBYA 4I1UA 1A82A 5FOVA 1HKUA 1DINA 3PUJA 3KSDO 5K0GA 4R8KA 6Q21A 1SUWA 4IL5A 1BFDA 5CDTA 1ODKA 1J7JA 2ECQA 4MJLA 4TMXA 2QT9A 1NGSA 3HA5A 1KJ8A 4L51A 5IW8A 2JARA 3G1WA 4MQUA 1VSUA 2J3HA 2VP2A 4EF5A 1L8AA 1T8TA 1BMDA 2WJHA 1XG5A 2X8WA 2W00A 2FMIA 3ZY3A 3INNA 1OIVA 1AUXA 4IVQA 1IJFA 4IGIA 4S0ZA 4M53A 2BTQA 2OXRA 4OI0A 3UBMA 3TM5A 1TJYA 4IJKA 3PC2A 3N58A 2QD1A 4TOIA 1E2MA 4MUBA 5BN3B 4S1VA 3LOQA 7REQB 3E15A 1U4OA 2CZGA 5FXMA 4CV3A 1D3AA 1FYDA 1PT8A 1WULS 1Y1QA 3DE6X 2ZG6A 5LLTA 1XN1A 3OF5A 4Q1CA 5FYDA 1HG1A 4UTRA 1PR5A 1SEPA 2J31A 2D0DA 4RV4A 1XCGB 3GT3A 4TTVA 5THQA 4AMZA 3FY4A 3SS9X 4DLZA 1W94A 2ZR8A 1YZYA 3ZXIA 4DIEA 5MFPA 1A69A 5JH7A 2M6RA 5IHXA 1I6WA 1DFGA 1NOJA 2ZB3A 4D8WA 4BKUA 5D01A 3DZIA 5TARA 1UF9A 3TL6A 5BPFA 5JCJD 2FWMX 3GRVA 3EODA 4EEZA 5CB6A 4K6KA 1Y4DE 5KNCH 3H87A 3ZUGA 1DRWA 3CVUA 3VNUA 3RVOA 3GJ0A 3DW3X 1WZNA 2JJ1D 3SFZA 1UMDA 2OA0A 3AY3A 3ELBA 1UWLA 1B6RA 4NOMA 3AF3A 3FCYA 3T5CA 4K1LA 2RHLA 3H86A 1H85A 4X24A 4HWTA 4FIDA 4C2BA 4MYUA 2WQ6A 1TQHA 2VJQA 4HNAA 4IKEA 5B7QA 4PWZA 4ADSG 2HIHA 5LU9A 3MGGA 4Q24A 3FI0A 4YROA 4I14A 4KAXA 4QPZA 4PO3X 5TVKA 3WSVA 3QLVA 4PCUA 1GTMA 5FPYA 4V0KA 1D0IA 4ZU3A 3WQSB 3U49A 2Q45A 3G3EA 1T8UA 2NWQA 1DKRA 1K1EA 4L72A 1EP2B 1L1FA 1RCUA 4E88A 2R6R1 3K30A 2P3OA 3RFFA 2VCHA 1JIKA 3PB3A 1R3UA 2DBVO 3I9V1 2FWIA 4K1XA 4P58A 3W5UA 3WV4A 4G1VA 3TCXB 5BSFA 4EYSA 4Z7JA 6AT1A 1KVUA 3AVOA 4CMCA 3R77A 5IYZB 1WKVA 1H42A 2BE9A 2GR9A 3N74A 1VIMA 1ZGGA 3F5FA 4XOUA 1JDTA 1GT6A 2AK2A 1VYTA 2QHXA 4ZAZA 4B6FA 3T7AA 1N9GA 5KVQA 5KHLB 2G8NA 3O2QB 3F5QA 4C4AA 3EQ7A 3NWBA 1KQNA 1AGXA 2B6NA 3D3JA 3SJ7A 1ZCJA 1YKSA 2W6CX 3L05A 2WWGA 4PGMA 4YQYA 4B4KA 1KI6A 1KP3A 1CQIB 2WW8A 3FKJA 4NJOA 4PS1A 1HNZB 2IPLA 3FZGA 4QQKA 4B6SA 2YNMA 2Q29A 4C76A 1FLDA 5CURA 2E89A 1V1JA 3RC2A 3P9CA 3FYTA 4L28A 3MTJA 2WMOB 4IIVA 4N18A 3CT4A 4ZT3A 3HMKA 1QAMA 3ILHA 2CNWD 2CUZA 5C1IA 5AJXA 5F2OA 1A8SA 1B7GO 1VTKA 2CFIA 3VH1A 2CVFA 3LLSA 3NDJA 4NU0A 4D5EA 1TZCA 2CLFB 4TSFA 2WZDA 2YS6A 3GBVA 1E3WA 1X80B 3I9OA 3KYBA 4N5LA 4AIIA 1ZOPA 4WZAA 4CTNA 1NNEA 3AERB 2NYAA 3TIXB 3P20A 3N6XA 3C1AA 5CA0A 1XP5A 3C5HA 2H3HA 3TAHA 3R9XA 3GUYA 3NGXA 4QXRA 3IDAA 4MUXA 2Q5FA 3LS2A 2V7GA 3FDIA 1QMPA 2Q4BA 4IICA 4DUZB 4ZRMA 3L8HA 5E7IA 4ILEA 2JIRA 3T5MA 4KG7A 2ETXA 1NOKA 3A1CA 5SZHB 3AZOA 1MX3A 3W2TA 4AMYA 4LIPD 4OQNA 3OIWA 3HXMA 1L5RA 1KY3A 2I7CA 2QMHA 4JJZA 1LJLA 4ODIA 1AQLA 1AH2A 2BFFB 4K0KB 1W5SA 3IEMA 4AP6A 1ZEJA 4WZBB 4A8JA 3FCSB 3KT3A 4QL3A 2QX7A 5AVXA 1GRQA 2F8SA 2NPFA 4C0QC 4PGAA 5I7HA 4FDVA 1OFGA 2NZXA 3LFUA 5D1HA 5LBTA 2WIFA 1IBCA 3QLJA 4YLYA 3JAKB 2VG8A 3VC3A 3HBAA 3X1MA 1CNFA 2RB4A 1S7GA 2BKXA 4GGOA 2XD9A 2NU7A 3RSHA 2M6KA 5LZ7A 3ZZUA 2BEVB 3AO0B 1RLOA 3OLWA 3DDUA 4TN1A 1YDFA 4HNQA 3PG5A 4L7VA 3EAGA 1MX9A 1XXHA 4I9GA 2WHYA 1JP7A 4JQOA 3SEQA 1IMOA 4TMWA 2GT1A 1D09A 1W1WA 2LNDA 5B4UA 4C89A 5M2QA 1PR6A 4GOMD 4OHCA 3K9HA 3HJUA 4OQDA 4CV2A 1UWVA 2P30A 2OFXA 4LC1A 1DQZA 1N7IA 2GZDA 3UMRA 2YV1A 2DKFA 3PC4A 2XYQA 2I2WA 5ALNA 5KU7A 1Y6FA 4XDGA 3CONA 1JFLA 4PSAA 4WBXC 1Y4ZA 3OZRA 1ISGA 2VL7A 5ALEA 1JE0A 1S2LA 3O95A 3GDGA 1M74A 3W7VA 5CNKA 2VZLA 4BBJA 2FX2A 4KPEC 1VPLA 4Q03A 1K4MA 2WPDD 2FCRA 2PKQO 4WZ6A 3I5XA 4G26A 1ZIPA 7AT1A 2IPOA 1MB3A 2FZKA 2FCAA 1IM5A 2IODA 3CHYA 1T91A 1E8DA 1U7UA 1WS6A 2AOXA 1JDBC 2CLHB 1CETA 2QLNA 4KAAA 4R81A 4K9SA 1M1ZA 3AG5A 5EPEA 1ZINA 2NYRA 3AM3A 1DARA 1UBJS 3IAFA 4GBGA 1QB8A 4NV0A 3IAHA 3ZVKA 4X9XA 1RXUA 3GH1A 3WL8A 3GPDG 2XMSA 3PWSA 4LECA 4U02A 4AXBA 1O95D 4XVQA 1KQFA 4JZKA 4MUJA 5JVDF 1W36D 4IWNA 5DTJA 1BIFA 3KB8A 3TLEA 3NTXA 1ORWA 1FFHA 2AHOA 2L69A 2QZSA 3DUWA 1IXYA 3PDIB 2SCUB 5KCZA 1M3SA 3F7TA 3OICA 3X2FA 4Q9NA 3UWMA 3NIBA 5KSWB 4WW0A 1VHTA 3HKCB 3NHRA 1YR2A 1QF9A 5CT6A 4DMUB 4EJSB 2G4VA 5HQTA 4HHEA 1P1CA 1ENZA 1SVWA 2H1IA 2FNAA 1V3UA 1QWOA 1RC0A 2ENWA 5LCXA 5KO2A 2HLPA 3C1UA 1E89A 2I2XB 2FW1A 1U8YA 2CVOA 1EE2A 3DB2A 3PDHA 4M0MA 3W5CA 1SAYA 3LDAA 3OO1A 3DHYA 4UDYX 2I4MA 1TEHA 3H5TA 4ALKA 4XQ9A 2ZBPA 2HFJA 4HADA 5ALSA 1MEJA 2IYVA 3LY7A 4WERA 3U7HB 4XVRA 1T15A 2FVXA 3ZYCA 1AA6A 3HGMA 1NRWA 4RSMA 2ZIAA 4DHWA 4E4RA 3MCUA 1SG0A 1Y3FE 2O8FB 4BVJA 4QUEA 2CGEA 3KKPA 2NTJA 2P0AA 4B4UA 5GZ3A 1N0HA 5C9ZA 2XWSA 3KAKA 1D1SA 4M9QA 5FTWA 4DF3A 1C7ZA 4B6JA 1DXOA 5IT0A 5AKHA 4KQKA 4RS4A 1OMOA 4OH1A 5HIKA 4AY2A 2B8WA 4OQ4A 3TDKA 4QTXA 5BSKA 4N0MA 3WL7A 2I5PO 2XUOA 4PZCA 4J4HA 5F9MA 2FSPA 2X22A 1XRRA 3V97A 3KJXA 3SPXA 4XGKA 3L7OA 1CUZA 2UVPA 2DPLA 4ASUA 2ZAIA 3BULA 4ZK6A 1GCOA 1KAHA 5EJ6A 1WWKA 2XX3A 3CF2A 4J1NA 1F2TB 2IKQA 3PNLA 1LU9A 4L5AA 3UW1A 2VBCA 4G0XA 4PAGA 5EIXA 1SC6A 5JPDA 5KYXA 1RPTA 3G85A 3LE8A 1CY1A 3BWYA 3G8YA 3ZE0B 1J39A 2MDTA 3NH6A 1EJ0A 1VPEA 5HOQA 1JYSA 1E8MA 3N6VA 3F6PA 5LQMA 3KB6A 1IY0A 2VI5A 3PHHA 2VYND 3PSHA 3RAGA 1V7ZA 3R6DA 4Y6SA 1WD7A 1O6BA 5KNDD 2VF4X 4RK0A 3RT9A 4TXJA 1O2DA 3K6SA 2IHNA 1VBKA 2Q5HA 3AC0A 3U4AA 3ETDA 5EMLA 3EE6A 3G7SA 4HDNB 4JR2A 3THXA 3HCBA 1DCTA 1W34A 1G20A 2Q2WA 4EKDA 2MYPA 4A9AA 1J0EA 2RARA 1Y1LA 1NMXA 1MB0A 1PL6A 1M2VB 2SHKA 1DAIA 4HNGA 4LUCA 5DTMA 3TQQA 4ZCQA 4B0OA 2XF2A 4CHTA 1YWGO 4DCJA 1ZUWA 4BV9A 1Q57A 1Z36A 3GDWA 3O84A 2ZXEA 2ZSIA 3NT4A 4YCDA 4E21A 1BU5A 3NOQA 3TKLA 4NE9A 2H4ZA 2PUWA 2O2ZA 2ILVA 2QRPA 3ESYA 4UE6A 2CLIB 3U3ZA 2D59A 3HVKA 3J7AC 4XTCS 1GZUA 3GLQA 4K7JA 2CW5A 3RVDA 3AR5A 1NF8A 4BMXA 3I42A 2ISQA 4X6XA 4EHNA 4KLNA 2ZJ1A 3I0ZA 2OXFA 3K9LA 4UDNA 3K0KA 1WABA 4G1FA 3A8TA 1SU6A 4WCFA 4NY1A 1J42A 3LZCA 4N6NA 5TNXA 3WNDA 4BQPA 4XB1A 2P9CA 1ORIA 2VEOA 4RLQA 4YWJA 2XZTA 4ENSA 1V48A 2K5UA 4Q7LA 4DDMA 1O0BA 1O97D 3L1KA 1KR5A 4RK6A 5C7IO 2V9ZA 2P1ZA 4D8VA 3UN1A 5IT5A 2ROQA 4HXEB 1EBBA 2H4YA 3LUHA 3GMIA 4JGBA 2G08A 4R6WA 1W7AA 3AILA 4PLPA 5EIHA 5CEJA 821PA 2BSAA 1UKBA 4ZJUA 1PGQA 4QGBA 3ZBTA 4UHFA 1NVAA 1OAOC 2QTRA 2VHUA 3H1FA 1ECCA 4ZYXA 2ZI5A 1CR2A 3QE9Y 5FKJA 5L95A 3VHXA 2FH5B 4KREA 4LDRA 4CM1A 3IT3A 4TWZA 3I5MA 3UMBA 3JQ8A 1AUQA 3JYHA 4PRLA 3CRVA 2NTEA 3KLBA 1IVNA 3SICE 4D3SA 2BGNA 1NOIA 1Q44A 1X94A 2FR0A 1W0KD 5DIFA 2JFOA 2JGDB 4KXUA 5AVRA 2UYGA 1XPJA 3KEFA 2QM0A 1G2OA 3NBUA 3GWGA 1MEEA 3BFKA 2A9JA 2IU3A 2WTAA 3KUUA 5EVCA 4JQSA 3R75A 4F21A 1LLQA 3OX3A 2VPQA 2RKBA 2NU9B 4RF2A 1J8DA 3EQ8A 4EKGA 2Y4OA 3EAFA 1AK2A 3IO5A 3AUYA 4TWAA 3AESB 5H16A 4U6QA 1W96A 3RUEA 1GTJ1 3M4ZA 3MBKA 2C8VA 3S3TA 2H17A 4RA6A 221PA 2R48A 2XNJA 4KQIA 1IXKA 1GGEA 1M0WA 4ZAYA 1O3YA 2QIOA 2AFIA 1FYXA 1FYEA 4URFA 1NAIA 3TQIA 1CZUA 3CZRA 3BC1A 1SNYA 5ER9A 3PQ3A 5DK6A 4U63A 4DG9A 3L0CA 5EZ6B 1KI3A 1EWQA 5DXAA 1NFQA 1NJGA 1ZC4A 2YHIA 1PTKA 4IF4A 2F8MA 2I76A 5FTNA 4DQLA 4G4SP 1MQAA 3UQYS 1A27A 2E18A 4IFTA 4TSKA 5KTYA 4OHXA 3K0CA 2JFXA 4CBVA 1XEWY 2X7JA 4A7PA 2HSGA 3O73A 2NZWA 3P9QA 4IDPA 1XZQA 5AIBA 1ZSNA 1S96A 3NX4A 1WU7A 3I83A 3K0FA 1JWLA 3EQZA 3GLFE 4GLFA 4O2RA 2X41A 1Z7WA 3O4GA 5AHKA 1ZNXA 5T8KA 3C3CA 4D74A 5BVGA 4IOJA 5D84A 3KYCA 2ZKLA 4YQEA 3TLXA 1GNVA 1HG0A 4AZSA 4X62B 3AJ8A 3BORA 2J7PD 2GZ1A 1P7ZA 2XMPA 4FOLA 2W2OA 3ZHSA 4DV6B 1ISJA 1W35A 4DCPA 2B99A 2FUEA 1ML4A 1I0ZA 3IKLA 3QVOA 2F9LA 4U6NA 1UOQA 1QGOA 2XGMA 4IKOA 2BKUA 1XZPA 3NPAA 3V1NA 3WS7A 1V1RA 4MGKR 2CSXA 4K6OA 1JR6A 1JZTA 2NVBA 3NR2A 1YONA 2BTQB 1X0VA 2A59A 2COKA 3ONVA 4F3NA 1SZJG 3H5LA 4DLRA 2YY7A 6REQA 4LXYA 5ADVA 1N9GB 2BFDA 4LMRA 4MYSA 2IU6A 3P27A 4Z0PA 1Y33E 2DBRA 2XMRA 4Y2SA 2TYSB 5FPTA 4AI6A 4BMSA 3QLUA 4CL8A 2PGDA 4U1RA 3SYRA 4D79A 5ALTA 4F9TA 1R10A 4ZK2A 1CLEA 4MUGA 4KI7A 2RH8A 5H0IA 4FFBB 2FG7C 4L8GA 1PGJA 2OY0A 1DWQA 3KV1A 1R8SA 2OFOA 3BSSA 1GFIA 4FFSA 5GVSA 1C9DB 1D1TA 3GLHE 2WSLA 4FZVA 4QPCA 2BEUB 1NT4A 2PH3A 4LX0A 5J5VA 5J63A 3O47A 2E5WA 4GOOD 4ARCA 2VF2A 2J7PA 4O33A 3NHUA 2P2SA 2DFPA 4AKIA 5ITWA 3L8YA 4LYFA 4QT0A 4D6PA 3TGLA 4P31A 1OASA 1E6LA 3K15A 3WYBA 1MP0A 3HDTA 3F71A 3DAGA 1DTSA 3D7SA 2ZAOA 5AW2A 5AW5A 1P4SA 4X84A 4DQVA 4MS3A 4MR7A 1ISPA 1WSAA 2ZYGA 4K6FA 4TKLA 4DPKA 4FIZA 3TO5A 4MCIA 4YRFA 4NYMR 1PQUA 4CFZA 3RSCA 3MJFA 4LRSB 4Z2AA 5KQMA 2QR3A 2YHAA 3DL2A 4OD0A 4INAA 1E3JA 1YACA 4PLVA 3DLTA 3PWKA 3F7NA 3QNUA 4JSYA 2JGFA 5DYTA 2H5JA 2EW1A 4YVFA 1RXEA 5FWYA 1W85A 2XA1A 3ND5A 3C7TA 1TK2A 3PKJA 2B3TA 2OK7A 1U8UA 1EFDN 3F0TA 3GW8A 4I50B 2D4AA 3FXAA 1GTL1 4MW5A 1JFTA 4IGAA 4KMRA 4NE7A 2FP4B 2G5TA 3B3AA 3O7WA 2BE7A 2FG5A 5G02A 3RGWS 3W04A 4TTIA 3WICA 3ZOZA 1EVEA 1ZQ1A 1ODTC 3NXKA 4DJFC 4E70A 2FWNA 5F23A 5J23A 1DEXA 3HHPA 4ZU6X 2R2AA 4AJ2A 1TAUA 1QIFA 3A6PC 2BGRA 1W6UA 2P79A 1XYVA 2B36A 3KS9A 1KSGA 2W70A 1K08A 1OBOA 2R6HA 1GU1A 3VOBA 2WJ6A 1TTTA 1UXKA 3Q8WA 1ENYA 4ZRNA 1H05A 2PFKA 1Q7TA 2ZJFA 1O77A 2G76A 1MAWA 1QU2A 2X2EA 1Z35A 4HNTA 4RQAA 1M1YB 2ZXFA 1V1MB 1XMQB 5JCXA 1PNOA 4AJ9A 4KUGA 4DMGA 3EW9A 3OSUA 4O4IB 3FTNA 4R2WA 4UHHA 3F67A 4OXKA 2FFJA 1W9HA 1VL2A 4QEZA 4KO1S 1ZGCA 4EI8A 3MS7A 4RA9A 3AFNA 3ROKA 4BVKA 1GKUB 2AD5A 4G0VA 2IW3A 1U4SA 2FB9A 1TCAA 2BKEA 3GU3A 5HYVA 2C7PA 4RV5A 4KYUA 2GBGA 2ZAMA 1IY8A 4EX7A 4G63A 1LKZA 4JWKA 1RI3A 3WE7A 1G21A 4RNDB 2Y6VA 4MV9A 2P9HA 4DEVA 4K6HA 4D4JA 2QXUA 4YAJA 1A5BB 5BYJA 1AKRA 5KYUA 4J6EA 4PG6A 3TLJA 3OZSA 1GSAA 4M1QA 3LWBA 3PXEA 1PBNA 1E1LA 3EUEA 4I5IA 3RUHA 4GFDA 3QKUA 4TKZA 2JF0A 3Q4GA 1TW2A 2PGAA 3A4MA 2IYUA 1S2GA 1UP7A 3L0YA 3LYUA 3QBDA 3G9XA 1KC1A 4HEJA 3I73A 3LECA 4DBLC 4GF5A 1Y8QB 3BX1A 1TADA 3MELA 3KUCA 2RMKA 2XTZA 5HMMA 3ZGXA 2ZBUA 4Z4FA 1JKJB 3KJIA 2C3YA 2JA2A 2JFHA 3F1KA 5BO5A 1ZJ4A 1JSRA 1GUZA 3KM0A 3ACCA 4R54A 1BXZA 2GEVA 1Q0SA 3U0BA 4HDAA 4C06A 4OHKA 4W5JA 3OT4A 4Q3KA 3H0CA 4JC8A 4DJAA 1SZDA 1FP1D 1VLZA 2WI8A 1E98A 1SHTX 2YNMD 2X15A 4Q47A 4RLFA 2WT8A 4BKQA 2C7BA 2FPSA 5BT8A 3L3BA 3VX3A 4BNMA 1XD2B 1ZYUA 1VCOA 1IBRA 1VE7A 2IYZA 4DEXA 1MFPA 3DZBA 1M8PA 4H1TA 3T0FA 2JZOA 5CJJA 5LD2C 1X1QA 3DLPX 1A77A 3OD5A 2GSWA 3LY5A 5K0TA 2FK7A 3O2JA 4CFYA 1SKAA 1N4AA 4CTJA 1DC3A 2YDXA 1NVVQ 3TD2A 1Z63A 1VPVA 4LN1A 2IOHA 4X0EA 1WHTA 2WJVA 1IPHA 3N2GB 4AY5A 1EFCA 2EW2A 3DEAA 1QVAA 3CMMA 5BV1A 1V4NA 1T0UA 4LQLA 1KJQA 2C96A 1TJ3A 1ZLXA 2OFWA 4DDVA 1PNQA 5FOSA 2P5UA 2PYIA 5TQJA 1C3OB 4EGFA 2C54A 1NLFA 3RYCA 3LQRA 5JMWA 3REFA 1VFPA 4KN5A 4B43A 4DS3A 2BZGA 1JILA 1M2NA 1T34A 1V5IA 1O57A 1P61B 3ANNA 2Y1CA 2DP4E 2XY4A 1I3LA 1YE3A 2QI9F 1A7UA 4GICA 4TRRA 3DM9B 1GM5A 3A3KA 2FXIA 3AHFA 2PX2A 1XMJA 3TSAA 1OH7A 1XU4A 4URYR 5AHWA 2PKYX 3SHOA 3PGMA 3KD2A 4RS3A 2HFKA 4Y0AA 4XR4A 5F78A 3OZUA 4JJ6A 1CY7A 4BZPA 1YK1A 4GMKA 3RRZA 1W29A 5J40A 4XEHA 1LPSA 1Y1RA 1VKOA 1UEJA 1YNSA 1YVRA 3CNOA 4IY1A 5JG7A 4B7ZA 4W99A 2XVYA 3UVEA 4E51A 3MM4A 1O96A 1CEYA 1K3TA 2JVIA 1W4LA 3DFMA 5JV5A 4QBIA 3QVUA 5BV2P 3VRHA 3FB4A 2B1RA 2XADA 1DEAA 1KQGA 1UAAA 3NNDA 4YS6A 4D97A 3AXTA 1H0KA 2I4RA 3C1OA 1I2ZA 2WIGA 1RFLA 2O2HA 4FB5A 1EWVA 2VHVA 4LWOA 1SCAA 4OGGA 1DRJA 3KU4A 2YH2A 2N75A 2V7UA 3OECA 2WRZA 4QGAA 4UZSA 5DO9A 4BNDB 3I05A 1U81A 1RJWA 3SDSA 4CKWA 3FGZA 2CL5A 1KMIY 2CWDA 3CVOA 2ZBRA 2SECE 1I24A 4BB6A 1NN5A 2PZAA 3E9QA 3M7IA 4IQ4A 1PBTA 5DXFA 3VPBA 1MBZA 1U7PA 3IDQA 4D0LB 1L9XA 4JDPA 2HCBA 1G8HA 4WKPA 4JB0A 3IBTA 3QENA 2OQIA 3UM9A 2BEJA 5ESRA 4QIHA 5KVSA 2Z4TA 4MR9B 1A4IA 4LOAA 1FS5A 4EBBA 1T9KA 1UBMS 4ER0A 1R0LA 2KWIA 1B2LA 2VPTA 1T5OA 1E2LA 1ZH0A 2QTVA 3H42B 3JQFA 4GI2A 4MEJA 5WRFA 2PR7A 2FUG6 3C7CB 3CTMA 1UMCB 3F78A 3IUSA 4RY2A 4C0XA 1ZI6A 3D4NA 2YQ4A 5EWMA 2I03A 2P6MA 5FR2A 1OQAA 4RABA 5IDVA 2PCLA 2AL7A 3D6JA 3NU1A 4Z1MD 2JJ2A 1NSTA 3LIIA 4EPVA 1OLSA 2WAOA 1V0JA 2R751 4G65A 2YHBA 4RKYA 4NH4A 1EP3B 1U2DC 3LK6A 1IAVA 1SC9A 1Y6JA 3FZYA 1G9TA 4I9HA 3HRIA 2KMLA 4CTOA 721PA 5AUPB 5E7QA 2QD4A 3NHYA 1AGNA 2HIAA 2VDOB 3UTCA 4YRKA 2V45A 4UMVA 4B7CA 1O5TA 2FN9A 5CP8A 4OYYA 2ZZNA 1Z6YA 1A9XB 2ZS9A 3GCZA 3M70A 4U2CA 3EFOB 5SZKB 3UIEA 3LLVA 3OKFA 4IDFA 4HQFA 4IYRA 4R9SA 1YHYA 1E69A 2AMLA 1NY6A 1Z6AA 2OMKA 3A1TA 1M67A 4FJ1A 4PPFA 1X7YB 4NU8X 5P21A 4EA9A 5MF6A 1HBJA 1AS2A 1RLJA 3JTEA 5DBHX 3BKWA 4QHYA 3HA3A 3HP1A 1NXPA 2EHJA 4NBNA 4QFMA 1KI1A 3C6BA 1RAEA 4AZWA 2C58A 3BKXA 1SOWA 3HLKA 3ZCQA 1FFBA 4UW9A 5FAXA 4CGYA 4DE5A 4BKMA 4LVOA 1J99A 1Z6GA 4Y1RB 3N0RA 4LRXA 2Y1EA 3BXEA 5IWAB 3CW2A 1Z16A 1B2RA 1H0SA 4NMMA 5GONA 1LWOA 3U7IA 1K27A 1HY3A 1IZZA 1DEHA 1RJGA 4PGGA 3I1FA 3ZE2B 5HOEA 1M10A 1KDZA 3Q3IA 2CVPA 3HP7A 3N5KA 4FCWA 5UKDA 4S35A 3ZC3A 2EATA 3PJEA 2W6OA 3BIFA 1RQGA 2VBGA 4TXHA 1P1RA 2XTAA 3OJEA 3LIPA 4HTFB 4N1AA 3R44A 3ZDXB 4Z4CA 4BMYA 1E96A 5BVHA 4P2GA 2NO0A 3USES 1P6XA 1Z37A 1SC1A 4M0EA 3VPAA 5CMLA 1H4QA 1TTQB 3JPYA 4EI7A 1OGJA 4ZHQB 3RYHB 1EFTA 3CEAA 4Z53A 1P0CA 4MQ5A 1UZAA 2P4HX 2X77A 3STUA 3KNZA 3KBOA 2A0FA 1BH2A 3D8HA 2MYTA 3EGEA 2J33A 3OF2A 1B8VA 4LJYA 5AOVA 2VNIA 1BROA 4G9BA 3EZGA 3KSZO 1GNTA 5BMVF 5BMVB 4MWTA 3O1IC 4LXQA 2YBEA 4YYZA 5DN9A 1IIBA 2AG0A 3AIIA 3CH7A 4NL4H 1KSHA 3P0FA 4EK9A 4FC6A 4R8RA 3HBMA 1N9KA 3HJRA 1HEYA 1NHWA 3QG5A 2J48A 4O2LA 5A9SA 1V35A 3PZBA 4YUAA 4YCLA 3KCNA 1W8IA 2GEBA 2WM3A 4BVBA 3VNQA 3EJWA 1VSVA 1GITA 2VCEA 4WI1A 3MWDA 3RSGA 2PBLA 4IHJA 1BSVA 3P2MA 3N2GA 3HUEA 4KWCA 3PYMA 4DNXA 2ZBVA 3UC9A 3ZS9A 4D25A 2RBEA 3LLMA 4UUNA 2QG9A 2LV8A 3TN7A 4RTRA 2C4UA 3HVUA 1Z7YA 1RWOA 1ISRA 1G2PA 1JQ5A 2JKYA 5KQSA 4Z9BA 5CM2Z 1B8OA 3DO5A 3JALA 1PX0A 1R9JA 3QPDA 3FUXA 3AINA 1NBIA 3RVBA 3GGOA 4FD3A 4UTXA 5ADWA 1CJSA 2IDJA 1ZJZA 1NBMD 2WT9A 4E1AA 1EGAA 3DOHA 5KMGB 1QV6A 2CJYA 3GPIA 3S2SA 2FHSA 4GZLA 2I6UA 2FMFA 2Z4RA 3PTZA 4GI1A 4E32A 4E2XA 1FMCA 5JPCA 3W5JA 1T0JB 4JA2A 1Q19A 1W75A 1ETHA 3EY4A 3KJQA 4WBSA 1Y48E 3V7WA 1PNVA 1U1IA 2PRKA 4A26A 2EFEB 2F59A 3FNIA 3PNMA 3DHNA 1TU0A 3I6QA 4KXWA 1KO5A 1FRNA 4GI5A 5IJXA 3WL6A 3WRYC 1RYEA 4QDZA 1UMBB 3AFIA 2AN1A 3M33A 1KK1A 3H8SA 4FLFA 1V8OA 1EFLA 4OYRA 3KEQA 4CN8A 1W46A 1KDYA 3DXXA 3QE0A 4ZOEA 3FPFA 1KAQA 1YA6A 1YQEA 3UHFA 1F7VA 1DC4A 1IFXA 5A04A 2QJFA 1H2WA 3UJ7A 2Q4EA 3UWPA 4TKVA 4F4CA 3R09A 4JYMA 4OQEA 2VP5A 5BSGA 1PV4A 1SXJC 4MPPA 1I6KA 3QEAZ 1H66A 2FQYA 2CDCA 3K2EA 4L57A 3U3RA 1SUAA 4Y2RA 5E8JA 1ZP6A 4IRUB 4MMYB 1EQUA 1NLZA 4UU0A 3N70A 2VS1A 4WNIA 3RODA 4N3BA 4URZR 4BIIA 5IUJC 2OLJA 2O50A 3G0HA 1EFAA 2Y8EA 5K0CA 5FDFA 3IAS1 3IQIX 2EP7A 1UBGA 3AP2A 3LCJA 3T99A 4CQJA 5CH5A 1C9KA 4W1RA 4IXTA 1QDUA 1MAHA 2VTKA 2LW7A 3RRJA 1UQTA 1KGDA 3MG9A 3PPIA 3QVKA 4F8EA 2RB5A 5I7OA 2JLZA 4QGGA 4ZDWA 4HVLA 5JDIA 2V7PA 4W1QA 3B52X 1K7SN 1X7WA 2G07A 1BAPA 3DW1X 1A2QA 4Z1MA 1M2OA 3TPCA 4AJNA 4K81B 2C99A 1ST2A 3FPJA 4IP0A 2R7MA 4J0IA 3R7SA 3KKOA 3OZBA 5LA6B 3EPLA 1J7KA 3CKLA 3E8SA 3PDWA 4RULA 3N5CA 1IBMB 4HB0A 5HX7A 2FDCA 1BZYA 4AL4A 2NXCA 3STTA 3SQXA 3OE4A 3ND8A 5IMSA 3F5SA 4YDHB 1A97A 1FLNA 1OKKA 2HUPA 5ULLA 3VZBA 1F6WA 1ENPA 1L7NA 2LPMA 1ULSA 3PPYA 4FN4A 4XWAA 2AC7A 3KFXA 2IY7A 1V47A 1QZZA 2R7LA 3JQ9A 3PKZA 1W8DA 4RHXA 4E7PA 1VPWA 2CXQA 3GMDA 4P08A 4JLSA 1ZC3A 1HEUA 1L3BA 2P9ZA 2J3MA 2PRSA 3C5CA 4UREA 2BTOA 4L02A 1JSZA 2RHBA 3WWYA 3LHDA 3IVXA 3KV3O 1O6FA 2QN3A 1Y8CA 3OHMA 3ZWCA 4P5EA 5JXIA 3HDQA 3GROA 3HDJA 4UCFA 5EUBA 3SVLA 4A82A 2VKQA 3OWXA 2OGTA 1RE1A 3GG9A 2HTFA 1FFSA 2NV6A 2OAGA 4CCWA 1CEEA 2NYVA 4F4IA 4UMEA 3FUUA 4YIHA 1RQNA 1TM7E 3Q88A 4TV9B 1HETA 2AXEA 2AGVA 421PA 1T8WA 3SMQA 5FADA 4CUJA 2BEWB 1WF3A 3QBVA 1N0WA 1JEDA 4KRGA 5HIMA 2POCA 2VAXA 5IN5A 5HSGA 3I3SR 2WVAA 2HQRA 1HDOA 1V45E 3AEYA 1YVPA 4YCCA 2V8OA 4S05A 4C07A 3UWOA 1E1CB 1H2RS 3FR7A 4PSKA 1SXJE 1XU9A 2D2VA 2I1WA 1RVV1 2YNMC 4I4IA 4KN9S 3WQRA 3ZVRA 2OCIA 3IDOA 1KRHA 3OZVA 4JUIA 1SUCA 1QFMA 4HSEA 4PZZA 2NXEA 4YRTA 1KSJA 4Q9HA 2DY1A 4D9EA 4ZVQA 1XL0A 4XWOA 5KOHB 2YZNA 1SELA 5HCIA 5JALA 1X74A 2ZE6A 5I01A 4RVNA 2OM6A 3CRMA 2E4YA 3T4XA 4LOLA 4RQUA 2PUAA 1RR6A 1JQLB 2D2FA 2IY9A 3LAWA 3PSAA 1X3SA 4G1BA 3D5EA 4AJHA 4DXAA 1CU1A 3QYFA 1W88B 2ZUUA 3L0OA 2NU6B 3DTNA 4MWZA 2GTPA 2SCUA 5DCLA 3ROEA 3NRCA 3UENA 1NNUA 4LDPA 4H3VA 1J70A 1OT3A 3CW8X 2QM7A 4MVJA 1YZHA 4R40A