1Z2DA

Solution structure of bacillus subtilis arsc in reduced state
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
139
structure length
139
Chain Sequence
b'MENKIIYFLCTGNSCRSQMAEGWAKQYLGDEWKVYSAGIEAHGLNPNAVKAMKEVGIDISNQTSDIIDSDILNNADLVVTLCGDAADKCPMTPPHVKREHWGFDDPARAQGTEEEKWAFFQRVRDEIGNRLKEFAETGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arsenate reductase
publication title Solution Structures and Backbone Dynamics of Arsenate Reductase from Bacillus subtilis: REVERSIBLE CONFORMATIONAL SWITCH ASSOCIATED WITH ARSENATE REDUCTION
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 46
structure length 139
sequence length 139
ec nomenclature ec 1.20.4.4: Arsenate reductase (thioredoxin).
pdb deposition date 2005-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1z2dA00
1YIOA 2GWRA 3IP9A 4MR9A 4RY0A 2R48A 4MAAA 2FLWA 1U2PA 2FMHA 3H5IA 4RY9A 5C5CA 3F6PA 4NCBA 5TPZD 1NXTA 4RY8A 3TB6A 1SXIA 4YP9A 4Q7EA 5JNWA 1KRXA 2IPAB 4IMIB 1JX6A 2TMYA 4ZYLA 2VUHB 4EYOA 4YCSA 4MQEB 5KQLA 3LUJA 3RVMA 3KG2A 5FWYA 3CNBA 1JYEA 4KNYA 3QEMA 3BRSA 5JNVA 3NNSA 1QNLA 3D8UA 4GNRA 8ABPA 1NTRA 1C4WA 3D02A 4FE7A 1D2AA 1OXKB 2PAFA 2YHBA 1ZY2A 3QK7A 1K66A 1PUXA 4LE2A 4NQRA 4MS1A 3EQ2A 3GWGA 3O74A 2JVKA 4HNRA 4MR7A 1P6QA 3SY8A 5D2CA 1W9HA 2CWDA 4KK4A 5EWLB 5IBQA 4N03A 4RK6A 3TD9A 5HKOA 1AB5A 3OMXA 3LKVA 1A2OA 1D4ZA 3JPYA 3Q7SA 3OLZA 4NICA 3Q9SA 3DZDA 4ZMSA 3N0RA 3MMNA 5KQMA 1ABFA 1GUBA 3JVDA 1QP4A 2VYCA 3I45A 2WY2D 5C5EA 4Z4GA 1U04A 2FMIA 3OO0A 3SNKA 4QYWA 1CEYA 1SD5A 4MLCA 4F3TA 3QLTA 3G1WA 1TMYA 3L49A 3VNAA 1YS6A 3LUHA 1YK1A 4KQ9A 4MRMB 3HVRA 4XFKA 3N8IA 1WETA 2QZJA 4XARA 2HPHA 4WWHA 4N47A 3RVLA 3FMVA 4KMRA 2HQBA 1NATA 5BQ3A 2H0AA 3LUCA 4S04A 2JBAB 2E4WA 2XDYA 2PUEA 2I6FA 4EVRA 5CNJA 5TPWB 4IMJB 4RZSA 3Q7TA 1DP4A 5B3JA 2B1JA 3FDFA 3DLBA 2FMKA 5HM6A 2E4YA 1DZ3A 4QYMA 4HYEA 4IGAA 1QQAA 1E2BA 1DRJA 4KQCA 4W5RA 3Q7RA 2PUDA 4YRZA 1LBHA 1K68A 4MS3A 4E7PA 3ROTA 1EWTA 1VLZA 1XHFA 2A9QA 1GCAA 3HUTA 3K4HA 4JASB 4RS3A 4H3KB 4D74A 1PEAA 3BBLA 2HQOA 1NXPA 4RU1A 3OQNA 4RSMA 3IPCA 2FW0A 2NZUG 1QO0D 3A0UA 1DRKA 5BR1A 3RVOA 2O20A 1DCFA 5B3JC 2NT3A 3GT7A 1I3CA 2PUFA 4D6YA 1JYFA 1QPZA 3LUAA 1XWWA 1NXXA 4RKRA 1P8AA 2FQYA 2JVIA 5DTEA 5IUKC 1JHZA 3H1FA 4F06A 3HO1A 5FWXB 5DGCA 3GRCA 1D5WA 3QX8A 5KC9A 3T95A 4Q6WA 3P9YA 1MIHA 3I5AA 2MSWA 4G86A 1W25A 3KKEA 1NXWA 3QELB 4OLBA 3M9WA 2FQXA 2FXIA 4OBBA 3N53A 4Z0NA 5KWSA 3S99A 3C3MA 4E7OA 4O1IA 1C0EA 3KYJB 1H9CA 1Z18A 4TN5A 3EODA 2J48A 2FEKA 2LP4Y 1JDPA 5EWLA 3M6MD 3O1HB 3O75A 2CD7A 3KLOA 2PE5A 4RV5A 4ETNA 4PEVA 3EQZA 1RZRD 1VPWA 4RDCA 3H5TA 3FFTA 4Z99A 2NUBA 2R25B 3RQIA 4RXTA 3CKMA 1YMUA 3GL9A 3UKJA 2QXYA 5T7BA 3OO1A 2LBPA 1QP0A 4N0QA 5ED4A 2WWVD 1VKRA 2A9RA 3RVKA 5FBHA 2E4ZA 4KV7A 3KLNA 3DGEC 4YWHA 4RXUA 4ETMA 5JNTA 2PUCA 3H5WA 3HS3A 1QP7A 1YVUA 4G0OA 4N76A 5KQPA 4EVSA 4G0ZA 1FFSA 3HV2A 1ISRA 4MS4A 3NBMA 1GCGA 3RVSA 4MLDA 2FN9A 2FN8A 5EWMB 5TPWA 3TO5A 2QSJA 4G0MA 4RWEA 5TQ2B 1Z13A 2IYNA 3A3KA 3HSYA 3E61A 4W5TA 1ZGZA 3NNDA 7ABPA 1RNLA 3GBPA 5PNTA 2VUIB 3HDVA 4Z4FA 5BRJA 3MYYA 2ID9A 3SAJA 5T3YA 1ZH2A 1JL3A 3A10A 2QV0A 5HQJA 1MB0A 1P6UA 2A9PA 3N6VA 4RK4A 4LDZA 2YHAA 3OMWA 3OLWA 3T6KA 1YTUA 4Z9AA 1M5UA 9ABPA 3C3KA 2IPMA 2IOYA 3MM4A 4XLTA 4GPAA 4MQFB 1F4VA 3GA5A 1KGSA 1Z25A 3O21A 3RVNA 5CNMA 5BRAA 4OLAA 4KVFA 5IC5A 1TVMA 1QQBA 5JNSA 4DN6A 4EGSA 5IUNC 1QMPA 3E3MA 2M98A 2JB9A 4EVQA 4D6XA 5EWJA 2AYZA 3QEKA 2FQWA 4OATA 2PUBA 4QPJC 1EAYA 2NZVG 4ZPJA 3OQOA 1NXSA 3I09A 3Q41A 2MYPA 2PMCA 3ROFA 1E6KA 3O2JA 4WT7A 2FLKA 5FWXA 2L2QA 4TMYA 4CBVA 4ML3A 4MR8A 3N0XA 3HK2A 1JFTA 3CFYA 3FGZA 3B2NA 3HM9A 2B4AA 2OENG 3URMA 1EHCA 1T34A 2FMFA 4ZMRA 4QICA 1D1PA 1Z2DA 3JS5A 1U8TA 3H1EA 3CHYA 2MYNA 3A0RB 4F8JA 4H3HB 2RGYA 1PEYA 4LE0A 3T8YA 1BA2A 4KPYA 4ZJPA 2ID7A 1MAVA 3DLHA 4G0XA 1MB3A 1DBQA 4RK7A 2H3HA 4TLLB 2W42A 3SM9A 4KK3A 3QEMB 3OLXA 1APBA 1J56A 2PL1A 2JCGA 2JK1A 2VK2A 3HEBA 2N9UA 3JY6A 1AB6A 5JS2A 4KZKA 3BILA 1BDHA 2L19A 1FQWA 1YMVA 1ZH4A 1TM2A 4P1ZA 3H6HA 3FFWA 4MS1B 4MPTA 4MR7B 1SXGA 3IP5A 3QLUA 3CU5A 3LUGA 2WRZA 2IPNA 1ABEA 4MQEA 3OM1A 1Z16A 1ZDMA 2WJWA 3CRNA 1JFVA 1KMIY 3JPWA 3CS3A 4HNSA 1DC7A 4FE4A 4HNQA 5DCLA 3QLVA 3W9SA 3CTPA 4O5AA 1BAPA 4F12A 3KCNA 3UUGA 3L6UA 1D1QA 2JVJA 3C6QA 4XASA 4IRXA 1KRWA 2HSGA 1JBEA 4JOQA 3LFTA 1E6MA 3OQMA 2R47A 4L4UA 5IULC 3HZHA 1ZESA 1A0OA 2MYTA 2DRIA 6CHYA 1DCKA 4EYGA 1FFGA 3ILHA 5CHYA 3DGFC 3QLUC 2HQRA 2M1ZA 1JF8A 1S8NA 4MQFA 3H1GA 4Q6BA 4YR7A 2PUAA 2QR3A 4G0PA 1M2FA 2A9OA 2FVYA 4LE1A 4P98A 5CNIA 2GI4A 4RK0A 3IP7A 1ZAYA 1FFWA 2PKXA 1B00A 3CZ5A 3EULA 2L17A 1EWKA 1Z12A 4JP1A 4MRMA 4PE5B 1LK0A 4OG2A 4YV7A 3OLVA 4NCAA 1JH9A 1UDRA 4XXHA 1ZN2A 2PJUA 4Z9BA 4PYRA 5TQ0B 4F11A 3EGCA 3OLYA 5TPZA 5GOTA 5I4CA 2JBAA 3UK0A 4JA2A 4KREA 5GQSA 4RKQA 4DQDA 3IDOA 4OTZA 4IILA 1YS7A 2JRLA 3LKBA 3EDCA 4MYRA 4WXMA 2FEWB 3HDGA 4UHKA 5ABPA 2QVCA 4EYKA 4Z4CA 1M5TA 3HJFA 3F6CA 2ZWMA 3NHMA 3KHTA 3LTEA 1JDNA 4H60A 3GBVA 3EAFA 5IUJC 2GX6A 2MSKA 1BVHA 4Z4EA 2LPMA 4S05A 1ZGGA 2FSPA 1RXIA 2MSLA 3KYIB 3LUKA 1U0SY 2IKSA 4YLEA 4M88A 3SQNA 1M2EA 4LRQA 1EWVA 4YS6A 2PLNA 3NHZA 2F8TA 1URPA 3KJXA 1DBPA 4L85A 5FBKA 3O1IC 1EFAA 4W5OA 4Z4HA 2FKAA 3QX9A 4O1HA 1ZVVA 1OXBB 1DCMA 3DBIA 5IX8A 4WXEA 1JLKA 5KQGA 6ABPA 1DBWA 3FFXA 2F8SA 3SG0A 1USKA 3Q15C 4G0QA 2P9HA 3RVQA 2QU7A 3RVJA 1FSPA 4Y9TA 1NXVA 3QELA 3R0JA 4MR9B 2LUOA 3OM0A 2E4XA 4ETIA 4IF4A 2V0NA 3CLKA 1F51E 4JB0A 2MYUA 5KI6A 2Q5CA 1Y1LA 1ZHHA 2R4QA 3RH0A 3F73A 1R8JA 1NY5A 2FTKE 3EJWA 4JB2A 2WMYA 1JWLA 5JS1A 2GBPA 1CHNA 1TJYA 4MS4B 1U2QA 2X7XA 5FWYB 3MA0A 2AYXA 1LJLA 1Z17A 1Z2EA 3BRQA 4RK5A 4W5NA 2OQRA 4G97A 2WJAA 1PHRA 1TLFA 4EYQA 4FB4A 3MF4A 3LUDA 3LUFA 4RK1A 5IEJA 3F7NA 1CYEA 1BDJA 5DKFA 1Z26A 3KTOA 3ILYA 3MQ4A 5TQJA 3TX6A 3RVPA 1MVOA 4UHJA 3H5VA 3GYBA 5F64A 1VRVA 3C3WA 2L18A 1USGA 1QO0A 3BREA 5KC8A 4G0YA 4KFCA 4PICA 2BGGA 5TQ0A 1DJMA 3IPAA 3VNBA 5CNKA 2HJ9A 3KSMA 4EUKA 4PZ0A 4MGEA 2PUGA 3NNNA 4LDAA 3K9CA 3HXMA 3TMYA 1LBIA 5EWMA 3CZCA 3JTEA 1PNRA 1BDIA 5TQ2A 3MIZA 4XAQA 1IIBA 3G85A 1JFSA 1SRRA 1GUDA 2CHFA 3O2SB 3LOPA 1ZITA 5EWJB 1NXOA 3HUUA 1E6LA 4EY3A 2IPLA 1P2FA 4Z4IA 2KYRA 1LJUA 3KS9A 3H5LA 4JAVC 5TE9A 3H5OA 3O2QB 4N0PA 2RJNA 4W5QA 1PNTA 4YO7A 3IP6A 1HEYA 4MR8B 1XHEA 3RVRA 3CG0A 4NV3A 1QKKA 2ZAYA 1SXHA 1A04A 2WB4A 4TLMB 4LZLA 1RPJA 4DADA 2GKGA 5E3JA 4B09A 3H6GA 3I42A 1RZRA 1RXEA 4WZZA 3JVIA 1DG9A 2E4VA 1GLGA 2QW1A 3HCWA 3H75A 5DLEA 3QLVC 1Z15A 3M9XA 5JNRA 5IEBA 3N75A 2QVGA 5HSGA 1YK0A 1L5ZA 3N0WA 2RDMA 2LIVA 1DC8A 4KRFA 1USIA 2FEPA 4MS3B 4LX8A 3T38A 2E4UA 2PL9A 1L5YA 1ISSA 3C97A 4RXMA 2RJOA 2CHEA 4YGXB 4WUTA 4N41A 2IDMA 3O1JC 2P4UA 5JNUA 2NT4A 3CG4A 3GV0A 3LMKA
chains in the Genus database with same CATH superfamily
4CKZA 4KXLA 5KNLA 2HWYA 2R48A 4J16A 2OC9A 1Z28A 2P4QA 3GFRA 4EHIA 4MWZA 2VNHA 3FGNA 3GRFA 3LF1A 2CJWA 1KDVA 3WNDA 4D9GA 4YP9A 1E6UA 1HEUA 5SYMA 1IUNA 4CLOA 5LMUB 1H6BA 1O94D 1XL1A 2DECA 4TUYB 4DEYA 3EE6A 3BK2A 4QRHA 3RSHA 2UYOA 5JUWA 5AFSA 5M7EA 4XB1A 2OLEA 1QR6A 1ZBQA 4UUOA 3NHYA 4N6GA 3OE5A 1EEXB 5B6PA 1VGRA 2O3TA 5K0TA 1QNLA 1QO9A 3LW7A 3MTQA 1N1MA 1ORWA 1I30A 5ALYA 4EP1A 2QUZA 3FOWA 3L46A 1E9BA 2ZI4A 4DTIA 4KO4S 3JQ6A 2YIDA 3TSCA 3QK7A 4AJNA 4M7RA 4PX3A 5D01A 3VFDA 4JJ4A 2QGFA 3DULA 3V5NA 1U1CA 3GZNA 3A37A 1M9NA 2CDCA 3KT8A 1YKSA 3ORFA 2V7TA 2P2GA 4NICA 2HHHB 4EJSC 1WE2A 4G0WA 1P60A 1Y8QB 3OUZA 2ACVA 4UDXX 5DJ5A 1IBKB 3R3WA 5IG2A 1YBMA 3MMNA 2XODA 3LCRA 3EC1A 3DBVO 1QB8A 2ORWA 1A96A 2I4RA 2PO7A 4LJ5A 1F6DA 2O0HA 5IC6A 4CN9A 1QP4A 1U04A 1Z4JA 3OH8A 1WRBA 2A3RA 2R8YA 3SNKA 2C77A 4RPGA 1YB5A 4BTVA 2VP9A 4RTLA 3W78A 2D1YA 4NRDA 1TFRA 1CF2O 4JYPA 1YS6A 4YRTA 4MIEA 2BEKA 3DLAA 2EC5A 2VPTA 3KC2A 4HJRA 1MGPA 3ZWDA 4HQRA 4II2A 3T5PA 1SUFA 3LFHA 5KTMA 2FRDA 3GI1A 4AMGA 3N6RA 1EFCA 2AC7A 1VL0A 1WXFA 2R66A 4LWQA 3RNOA 4F4UA 5BQ3A 4DV7B 1TADA 4JI8B 3ELUA 4GXNA 1OT5A 4Q7LA 4EZBA 5I7VA 3TLCA 4P0QB 3NBFA 5CX4A 4EUHA 2UZ4A 1P9LA 4Y9RA 3N2KA 5A05A 2AJLI 1RYEA 1XVAA 2GM5A 3WK9A 1H1LA 3F47A 821PA 1LF5A 5I8ZA 5JVDA 4MJ3A 4F3CA 4KPEC 1IIRA 2PMBA 2VRNA 3LL4A 5J2TA 4UNRA 3DZFA 3L7KA 4C0JA 1XZBA 1LF0A 5EJMA 4DCNA 2C2OA 4PGHA 3RC1A 3ADDA 2CMGA 4JN6B 1M2HA 3MMXA 3IBYA 4EI9A 4WBSA 5EE9A 3K0EA 5IPFA 3WNQA 4LF8B 3ROTA 5F21A 4P0TA 1AS2A 1JLRA 5C8DA 2QJOA 4RS3A 1YA6A 3BUSA 2G9NA 2M6KA 2FSVC 1DX4A 4TKVB 1GCOA 2IUSA 3I1YA 1CUSA 1RQ2A 1F14A 1C7JA 3ITEA 4NFHA 5DHTA 1OAAA 4PX9A 3B5EA 3AUSA 4HC4A 3ZQKA 4D99A 1U9JA 5DM0A 3F5FA 4BO0A 4ZVTA 2KI5A 1C8VB 2P7IA 3TEMA 1KQFA 1X14A 1IK4A 2QDKA 2YFHA 2BDTA 4W8GA 1DG1G 1D5WA 3KSUA 4CF7A 2A3NA 4Q4CA 4G86A 1WKBA 1Q57A 1UKZA 1TK2A 3AM1A 3J81k 4QAQA 4OQEA 4OLBA 2FQXA 5CFNA 4EEXA 3PC8C 2HTFA 2V4UA 3KUCA 2G9UA 2P9QA 4E2FA 3I2KA 3QRWA 2IWRA 3OOHA 2O8FB 2V59A 1A7KA 3OFJA 1L7PA 2AUTA 2BUCA 1NN0A 3ZBQA 4I66A 3HU2A 4FFBA 3FMOB 2NZYA 1P9RA 2R6AA 2UYQA 3UATA 3H2SA 2EW2A 3QYPA 2WAYA 1JSCA 1M0EA 3H17A 1NPDA 4FOPA 2A67A 5AKHA 3CW9A 4TYYA 3WDSA 1GT6A 1R4AA 2NUBA 2LV8A 4MUHA 3ZWKA 3EPHA 3PRKE 4IBOA 5T7BA 2LBPA 1WUJS 1WMFA 1AK2A 1TZBA 4IIXA 1ACLA 1B7GO 2Y92A 5A5FA 4PZEA 1F60A 1M6YA 4QODA 3I9V6 4BWVA 1Q3TA 1AQNA 2GILA 1Y7HA 2JFNA 4KV7A 4DT1A 3MLEA 2R6HA 2IQIA 1OFUX 3K9LA 3BHIA 1S7GA 3TVDA 2Q2OA 2YFYA 3ZQJA 3ETJA 3VBEA 2BONA 5J5CA 4WKGA 2EFJA 1QCZA 4P2GA 3ZCRA 1JB1A 1SBNE 2Z5LA 3KELA 4LYJA 1F1BA 3R44A 4D9JA 5DYTA 1P77A 3RK1A 4BN4A 2F6RA 2WOOA 4C7KA 1UJBA 1Q3HA 2FN9A 4LBWA 1WSAA 1HDRA 3AUYA 4LZZA 4DNPA 4PLFA 1OREA 1M6VB 2EKLA 1GG9A 3DAGA 3IXMA 3MAJA 4J90A 4NKRA 4DCCA 2NO1A 1U98A 4MV3A 5IVHA 3VAZA 4CDNA 2FCRA 4E94A 3HDVA 1X7XB 4NLLA 3JD0A 2AOTA 4ZTZB 5BOSB 3QKSA 2OV8A 2WWIA 3L0CA 3I64A 3OWOA 1U2TA 4UAGA 1J1ZA 4DY6A 3O8RA 3C3KA 3M0EA 1E79D 3EPRA 3RSLA 4IOKA 2QUBA 2AMYA 1GPAA 1TEHA 1ZI9A 3FHJA 1H2RS 1PK7A 1UMBA 2YZGA 3PQFA 5H16A 2EERA 5IC4A 5K3FB 2OB2A 4B3DA 3QH4A 4UM5A 4JBHA 3ZV3A 3M5PA 3ZTWA 2N46A 4PYIA 3ZZ0A 2G4VA 2SBTA 2AYZA 1IB6A 2ZANA 3WK4A 4DQLA 3L18A 3WS7A 1LI4A 1H1TA 2O23A 5TARA 1EZZA 2J0EA 3OPYB 2GBGA 5JXJA 5FWXA 1P4GA 4UHFA 1PV4A 1N2XA 4PLYA 2QN3A 1LSSA 4RTPA 4B9AA 3ROKA 2SNIE 5ALNA 1XG5A 4OX9Y 2OO7A 4ZVUA 1L8XA 3ADKA 4P08A 1EUCB 1PCXA 4BCBA 4GZMA 2INGX 3RUIA 1UPXA 1Y5RA 3O4JA 1FFYA 2A57A 2DBVO 4XWTA 5JQGA 3AVYA 4AJOA 3EWAA 2OAP1 3TJRA 5TGDA 4JH0A 5COBA 1JG2A 4IJWA 1ZNXA 1FQKA 4O29A 2WMOB 1KDYA 1JHYA 2VYVA 4HLDA 4AWXA 3EPKA 4IIVA 1QGED 1DBQA 3CXRA 3R5XA 2XDAA 2H3HA 2YJ5A 4O4HA 5G1OA 4JLJA 4R05A 4Q02A 3L1KA 3SQMA 2UUOA 4S1PA 1E3LA 5ENZA 3REFA 4FMDF 3HY4A 2AFRA 1XAIA 4YROA 2XJ9A 3OQIB 5EEHA 3RV3A 2QTBA 3SK0A 1E1YA 3IAXA 3LBNA 4N5HX 5JDCC 3UMFA 3WL7A 2AZXA 4DG5A 2G67A 3IMCA 3RRYA 4NABA 5HG0A 3V8MA 1VBNA 4IDBA 4YJFA 5FBQB 2BDUA 3CNNA 4K6HA 3VKVA 5FQOA 3GQBB 2JIRA 2I2XB 4URZR 4ZCPA 2VP4A 3C8ZA 1XHLA 4LHZA 5DLPA 3EVNA 3F6EX 4OUDA 2QRLA 3UTDA 121PA 4CIAA 1BW9B 2EVWX 1QIMA 5EE5B 3SC6A 3L6CA 1SCDA 1ISHA 4I9GA 2YXEA 4GBGA 3ESYA 3MWJA 1N9GA 5EP4A 4R54A 3FR8A 4LHVA 5GAJA 3OM8A 1OUMA 4LJKA 1ESDA 4XOIA 1SBYA 2HJSA 4YRIA 3D6TB 2Q2WA 2YICA 4MCAA 3OZTA 4YMGA 2QBYA 3GCZA 1Y8AA 3OQMA 2R47A 1JNYA 1HTBA 1M8FA 1NRJB 3NW9A 2V5AA 1G9XA 3L7DA 4NG5A 3NIGB 3RJMA 1OZAA 2CNBA 3ZJVA 4ZRNA 4BNKA 2ZJOA 5AW8A 2R8BA 4LRXA 4MRPA 4LKRA 1WXDA 4HXYA 3IVCA 2C07A 5E0OA 1XQWA 3DOIA 1A7AA 5HDQA 4Q6BA 5JAMA 5JZSA 1X3LA 1XXHB 3OOYA 2QXUA 1Z0ZA 2XWQA 5ALZA 1MENA 5EIAA 4WJKB 2H1OA 4E22A 2F48A 5CUQA 4LV8B 4LSZA 3SJUA 2E7ZA 1GVNB 1SVLA 3BL6A 4A2PA 3I9FA 2IUTA 4NNOA 1JTEA 1M2JA 4B31A 4BB6A 4DC9A 1YR6A 2PBRA 4Z9BA 3ND5A 3B6EA 2VJKA 1PSZA 3IHLA 2C94A 2RBGA 2Z2JA 4R6WA 2I03A 1DWPA 3ELYA 5JPCA 2C7RA 2VNJA 3REGA 4LX0A 3HKEA 4CVNA 2XUZA 1WOMA 4QTTB 2A1UB 5GQSA 4RKQA 1XF9A 4NY1A 4BFSA 4JVNA 3WIVA 4UNIA 3ZE1B 1TYCA 5ECWA 2W58A 2A30A 1ISFA 2NZ2A 5AICA 5KSOA 1KC3A 2YYYA 4QLBA 3ZVMA 4OA5A 1D2CA 5FORA 3WICA 1GNQA 1YVEI 4TTAA 1XMXA 3C6BA 4HEA1 4TXLA 3TSOA 2X5OA 3ZHBA 2O6HA 1OVGA 1S2IA 1UBKS 4RANA 5FULA 2ZWMA 2GB4A 1C4KA 1RWOA 2FWIA 1TAHA 2OEPA 2OGTA 4IKOA 3L8CA 4NHEA 1DBVO 4PAMA 3ODPA 4ZAZA 2ZJ1A 4BO2A 5AI8A 2FEAA 3CMMA 2MSLA 3AP3A 2ZYGA 3MT7A 4QWWA 1HXHA 2FPLA 3EFEA 3FI9A 1PDWA 2I67A 3S28A 3I3OA 5DI3B 1FTGA 2Y0DA 4RS4A 1UMCB 2VPIA 3H8JA 3QBJA 4IS3A 3WMGA 4Q7QA 2TSYB 3GEBA 4KAAA 2IP4A 3QIVA 2FOXA 2BEWB 2F64A 3SIRA 1VTKA 2R00C 5FOQA 1XEAA 2WT4A 3OJFA 4D9HA 4A0GA 3NALA 3SE0A 2OCAA 3W5UA 2HZBA 4NJEB 4V38A 4K6MA 5DXAA 1GAXA 3QI2A 2ODEA 5ALWA 4FQ5A 3UHFA 3RC7A 2V9CA 2IIVA 3TTWA 1GILA 2YXLA 2NTNA 4PC1A 3GPLA 4AMZA 1CJMA 2YINC 5LBIA 2YWJA 4F93B 2J9ZB 5GY7A 3ML1A 1VB3A 1A27A 4H17A 3LBHA 4PGGA 4WX2B 4M7WA 2R2AA 4XVCA 1Y1RA 3WRXC 5L4SA 3FVRA 2ATVA 1LDEA 4TKLA 4Z9YA 7ADHA 2VPPA 1N2HA 4OLHA 4E51A 4LA4A 3QVKA 1XZEA 2OCKA 4W5NA 1MJ5A 2JH3A 1FS5A 1EKXA 4HDKA 1WR8A 2ZWIA 4J91A 4QJ5A 5I8PA 3BWBA 4PRLA 5KJCA 1NMXA 2YIVX 4P7GA 1CY7A 1RLUA 4DBLE 3NCHA 4MITA 1CUYA 5BV0A 2HIMA 1ZD9A 3ILYA 4HB0A 1MC5A 1P3DA 1ICEA 4DF3A 2ZSDA 4PZDA 4P4TA 2R62A 2DBZA 2GBLC 4RDXA 3LCMA 3BREA 3DQZA 1QG0A 1ZMOA 4TV9B 4DCSA 5BN4A 4X6UA 2HJ9A 1WVIA 3GG2A 4Z7OB 4ZD6A 3Q8WA 4MP8A 4I4TF 4IZOA 4DREA 2Q0QA 1Z83A 2W93A 3A6FA 4D0LB 2WINI 1YZYA 3DTTA 3PBKA 1Q0ZA 4INPA 1D8AA 5AJWA 3BE4A 1EBBA 3PKJA 4MGYR 1PNRA 2BRUA 4E15A 1IIBA 3DFUA 4D81A 2WJ4A 2QA5A 1G9SA 4Y7DA 5K0JA 4HZUB 5M5BA 3BE5A 4PLVA 4YACA 2Y27A 1YJ8A 5EKUA 5IYZF 3HZOA 2YTZA 3W1VA 2MDTA 2P2ZA 3ZNQA 1M34A 2X8LA 5ADVA 1XTKA 3C1TA 4FLMA 1XJQA 3O8QA 3L8EA 4AURA 1R8QA 3LD9A 2B99A 4ZI7F 3BA6A 1XIVA 1ZMTA 4M0PA 1YOVB 2GAAA 5B2FA 3BFXA 3CT6A 2BKLA 4JK3A 4MZDA 1HO3A 4UVHA 1PU2A 2R7KA 5IM5A 1SHUX 3Q72A 3B7PA 2WB4A 3RVRA 1G2IA 3M1LA 2QZ9A 3I42A 1Y6GA 1FMTA 4IFIA 4RD1A 1D2MA 2PK3A 5FPQA 3NO4A 1HC7A 2E37A 1P1KA 3L6RA 4L8GA 1WUKS 5FBRB 3PWSA 1BE6A 1XXHE 3HCPA 3EFOB 1FYEA 1I6WA 1RIIA 4OHBA 4P4GA 4RHUA 1XJ0A 1G20A 1Z63A 4RXMA 2ZXEA 3OEED 4YGXB 2J7KA 3CLTC 2DKFA 5CPBA 2P4UA 4RVUA 3NTLA 3TEFA 3Q87B 3NWBA 5B1HA 5DWDA 5G0SA 1ZJWA 2GN4A 2P9YA 3AL0C 5K8TA 4U6SA 1XA3A 3DL4A 1TYDE 1GNVA 2I7CA 1EFDN 2UZIR 4HNAA 3W77A 3P94A 2WWXA 4DLKA 5LP6C 1CR1A 1NSYA 1YDMA 1EVIA 2XGOA 5AVRA 1XC7A 4AJ2A 3WAKA 3ZIAA 1K89A 1PJ4A 4ZYLA 4GOKA 4BMPB 3OQJA 2DY1A 4I55F 3HL4A 1KPIA 5FAKA 4B5KA 3FPEA 2QXTA 1VYVA 2WM9B 3GJ8A 1V5GA 3IKVA 2PD4A 2G7ZA 4PGMA 3KYCA 3PWKA 5JXIA 1RTKA 3T3HA 3N2ZB 3FNRA 3HVKA 4DJAA 4HMOA 4Q39A 3U7GA 2GQ0A 4IHQA 2R7AA 2GAJA 4GYWA 4LV5B 2H5JA 4L0QA 3FYUB 1NTRA 1ULAA 3CF4G 2H85A 2Z56A 3U3MA 3N74A 4M9QA 4XFDA 4AKEA 2PAFA 4KG7A 1ECPA 1RKXA 1IJBA 3EQ2A 1OLUB 5CM9C 5HCNA 4OB7A 1SCQA 1Y7PA 1KTIA 2PD6A 1EVKA 5HIIA 1V96A 4QQNA 3ODGA 3UKOA 1AB5A 1H0SA 4BTEA 3C7AA 1FZTA 1MEEA 3OZXA 3INGA 1C9DB 1R37A 4AROA 1B6TA 3AF3A 3I45A 3O90A 4GH5A 5FBWB 3QYAA 5FI5A 3S2YA 1UFVA 3OO0A 5M3BA 2J32A 3G1WA 5J40A 3DV0A 1M2NA 3LUHA 1QFZA 3KIPA 2ID8A 1SC6A 4WZ6A 2PMKA 4XWOA 2IOQA 2BKXA 4QRDA 3FCXA 4PU0A 5AVYA 1UKEA 5BP7A 1J2TA 3T1VA 3VC2A 4C5AA 2ZUTA 1A1SA 1KZHA 4M0FA 1DKNA 2C2YA 3P2OA 4EABA 4TL8A 2F00A 3I04M 3WK5A 3PVCA 4G07A 2C9OA 1J0DA 1QRRA 1O08A 2H6EA 4J0HA 4EECA 2I6FA 4JHLA 2IF0A 3C6YA 4NYIQ 1PZFA 3TLGB 4G8BA 3DPSA 4UBKA 5F3RA 3TZBA 1X74A 3T4UA 1O6CA 1RAIA 1GL3A 2GLXA 4MKRA 5HM6A 1CRQA 2K7ZA 3MTGA 1OKKA 1ND5A 4C4RA 1WCIB 4EI7A 3Q7RA 2WWGA 3EDYA 4K81B 5CLFA 2E5FA 4XEHA 4F86A 1VIAA 4L0MA 2EHJA 3KE8A 4BAUA 4YI5A 1JHAA 4N65A 3KJEA 4A8TA 4QBHA 1FCJA 2CNOA 3L7MA 1UIMA 2QN8A 1CY6A 4B4VA 4ZOLF 4DDMA 4ZDKA 4E1AA 2HQOA 3QI7A 3C14C 3UMGA 3IP8A 2R85A 4BJ5A 4H6XA 4TV8A 1Z36A 5ARCA 3NDBB 5EQDA 4C4SA 4NAVA 2CSXA 3I1JA 3HJHA 1WXGA 3ROZA 3NAZA 3HRIA 1SC4A 4XJVA 5I3CA 4DVJA 4X91A 3C5EA 2O1SA 2YV5A 1J9GA 3TLXA 3A6KA 2FN3A 2HL6A 3E7XA 2JGDA 1JQKA 2X1LA 2CFSA 2ZUDA 4WZBA 1XWWA 1Q6ZA 1S96A 1LPBB 4ZHQB 1P75A 4BLUA 2XKKA 5BSVA 2E55A 2Q29A 3MB5A 3NHSA 4HN2A 1N2ZA 2C95A 2ZJ4A 2B98A 3QX8A 3ER9A 3BM5A 2ZJ8A 2J3JA 2P5YA 1MIHA 2CJPA 2Q5QA 3TTXA 5F77A 3AESB 1XUOA 4RLSA 4Q9KA 4B6JA 3GN2A 1JVSA 1ZGHA 2HM7A 2WWWA 4A6PA 2YNMA 4TYQA 2TMKA 1RQXA 2Q45A 2X76A 3R8CA 5J3JA 4ND8A 1CJCA 1Z18A 4RSHA 4F71A 4ZK2A 5K3OA 2HYIC 2J9FA 3CB4A 2AZTA 4LKOA 2LP4Y 1DKLA 2CNWA 2C88A 2HSEA 3DD1A 4BQPA 3VKUA 4H2DA 4MIOA 2CD7A 2P9JA 3H7IA 5TS3A 2IYOA 3WGJA 1JDVA 2AK3A 2IXTA 4MRRA 3ZY4A 4B2LA 1KO1A 3V46A 1E77A 1I94B 4JIMA 2AI3A 3TINA 4IZ6A 2AF4C 3CKMA 1Y1TA 1M67A 5AVKA 3VYUB 2ZZNA 1SOVA 4R98A 1POWA 1ISPA 1CCWA 1VFNA 1WXEA 2CVZA 3G8CA 1I4TD 3HXLA 3QU4A 2A9RA 2I99A 5CT6A 1KQNA 3DMHA 1YR2A 3DONA 4AS2A 1JT9A 1S01A 4M1SA 4TSRA 3I5XA 3USZA 2W6ID 3SS9X 1E3SA 1ZBDA 3UCFA 1ZMBA 1Z7EA 1X19A 1LPOA 4K88A 2RGAA 4WOCA 3CZPA 1H6CA 2GEUA 2HXGA 4HXGA 1XZAA 1G5PA 4XUCA 4E2XA 4HF7A 4JL8A 1E89A 2D0PB 2P77A 5D84A 4WN9A 1XELA 2BN4A 2CDAA 1AV7A 4TMZA 5HHTA 3P4YA 5ARDA 4V0SA 3R7FA 1NT2A 3LDUA 2VP0A 2B78A 1VGVA 2OCXA 1XMQB 1WQ1R 1EQ2A 1AS3A 3MQ2A 1OJ7A 2EARA 2ARKA 2J0VA 2UZAA 3MOSA 3P4XA 4XSVA 5EERA 2CXHA 5IHPA 2C7PA 2X7HA 3B6MA 5JE8A 5U4XA 1ZD2P 2X9QA 1GCUA 3O7MA 3U4MA 3T6KA 2OM6A 4FR0A 9ABPA 3PXCX 5I45A 3QX3A 3QVGA 5JD4A 4A9AA 1N3YA 4UE6A 1VECA 2GBFA 1GG2A 1XQVA 1HPLA 2IEAA 3C8DA 3DS8A 1QFMA 3OC0A 3RKUA 1HRDA 1KJIA 1P5HA 2Z3WA 5IC5A 5KEIA 1SRQA 2CXOA 4ZJUA 2FEOA 4U2KA 2QSYA 2I33A 3E3MA 4I6EA 4C29A 4KYUA 3NC1C 2E1RA 1H8EA 5HRCA 1QCCA 4C4XA 1VI2A 1YBAA 1EH5A 3COVA 3GRKA 3KKMA 3SOZA 2GXSA 4PWYA 3IMFA 3IH5A 1XRMA 1MIOB 3O2JA 4ILEA 3U39A 4BKQA 4EX7A 4BXOA 1FY2A 1U8EA 3LY8A 1QAMA 4CBVA 2FZ5A 3SQOA 4HJXA 5CX1A 4D9CA 2REXB 2ADFA 2QMQA 3ZPXA 5J4VA 1JLSA 1QH0A 2I66A 3DLIA 3V4RA 4QSMA 3P2MA 2OENG 3URMA 1J33A 1NBOA 5A5VA 4MUKA 3RYCA 4UARA 4EY4A 3GVHA 1DAIA 4IJKA 2O2EA 4IOMA 2BJWA 2RKWA 3WJ1A 2A59A 1T29A 3C2QA 6GPBA 5KOHB 4TTSA 3CLHA 3K8ZA 5FFFA 4PQRA 3NVKI 3WGGA 1JZSA 2CYBA 3O4HA 4RZXA 5ALOA 5JH7A 1NFQA 4JU8A 4NZ9A 2CLKB 3OIYA 3U6BA 1VXRA 4Q1BA 1WX1A 4ROTA 3X43A 2NO6A 3A9UA 5AUPB 2WPNA 3SM9A 5A0TA 1LH0A 1VPDA 3N07A 3AY0A 1ZGAA 4IDDA 5DCWA 1D4AA 1N2CA 3QF4B 3QU2A 4AN4A 4AP5A 1BVYF 4OHVA 2OVFA 2DFNA 4U5XA 4X84A 1BXGA 2XE7A 2XKJE 4J1QA 4EJ0A 3L8HA 1X0XA 1TM2A 3ETEA 2NV6A 2X0RA 3R5FA 1N5OX 1SIBE 3FFWA 4FI3F 4JCCA 3QENA 3MCAA 3L4BA 3KEGA 2VBGA 1N0HA 3WGMA 5ALRA 1F17A 3I1IA 1PDOA 3TE7A 3H86A 4R2KA 3COZA 1U5BB 4DR5B 4V02A 5HGJA 4D4HA 3UMYA 4ME6A 3SZ3A 2NYRA 4QLOA 4TSFD 3PTAA 1W87A 2QM0A 1QK4A 3I4CA 1AY0A 1Y48E 3UUGA 1ZA2A 5KDDA 1F8GA 2VRBA 3R7DA 4RYDA 4XASA 5CGQB 1R6DA 1YVRA 3N28A 4ND2A 4D0NA 5K6AC 1IOLA 1NBMD 1EVYA 1ICIA 2J59A 2QTHA 2Z8ZA 3WNCA 2Q1XA 5HJ5A 5F5LA 5LVAA 2BY4A 3RRXA 1Y6JA 3I6QA 5JBQA 2BMVA 2OZPA 3BGDA 1M83A 3FSJX 3TZLA 1Z8NA 2O5RA 1TM4E 1YZQA 3ETNA 3FOCA 4K6GA 4JX8A 4UNPA 1DQYA 3OQHA 3WGTA 4N0MA 4B6FA 4CT0A 1G7CA 3IP1A 2JIMA 3T3EA 2GGSA 3CNLA 3JQAB 1YR9A 3HXTA 4FZJA 3AEQA 3NS7A 5FV4A 4PZZA 1U2SA 1Q6YA 1U0FA 1RADA 5BV7A 1IFXA 3ONEA 3EULA 2ERYA 4CDRA 1O58A 1L7VC 2JKYA 3PA8A 3VU9B 4JMPA 2MHCA 1Y4SA 2P5SA 1US8B 4LRWA 2DYKA 3VHXA 1A9PA 2ZYIA 1E8MA 4O8ZA 3HP7A 5CA0A 3TI7A 1AQJA 2ZR9A 2QQ5A 1ZN2A 5F7ZA 3E8XA 2DWQA 4RX1A 4YDRA 5IT5A 2W2QA 2WIDA 2POCA 2RBEA 5G1PA 2XNHA 3AO0B 3H3JA 3PX7A 2P8JA 3ZJYA 2O2GA 3ICVA 4D4JA 4MW9A 3ET4A 1YR1A 3EBLA 2PVSA 1U0TA 1M54A 3AUFA 3K30A 1K0FA 2H17A 3C6MA 2C83A 2AR9A 3C45A 2YS6A 2JIDA 3QVLA 3LBIA 4DMCA 1PAUA 3H4VA 5T6MA 3PB3A 2FEWB 1AKMA 2H06A 2XCIA 5D85A 3NHUA 5CH5A 1OV6A 3RUFA 4MV6A 2OO3A 1UOEA 2RHLA 3N3BC 4DA8A 5A4FS 5ABPA 3D0RA 3MD9A 3S3TA 2W8BB 4L07A 1R0ZA 1WO8A 9GPBA 4YRPA 4JENA 3FYHA 4LCBA 2I0FA 3RV4A 1N6IA 2BD0A 2FGKA 3N6XA 3RJTA 4AC9A 1MOPA 4CTOA 4DV6B 2VEOA 1KQ3A 4PLCA 4CFZA 3NIDB 5A6SA 3K31A 4BGUA 3P0HA 3SKXA 4IOJA 3VC3A 3ZWPA 1TC1A 5F73A 2BR5A 1FFBA 1GWNA 3GMIA 1G5QA 1ODLA 2X4DA 3GD5A 3H6KA 3HB0A 4A0QA 3TCNA 3KJXA 1DBRA 1CTQA 3OPXA 3SD7A 1TA4A 4DLYA 1N2JA 4P2BA 3ABOB 1IPEA 1G16A 1HOXA 4P4UA 1KK3A 3U44A 2JIBA 1W4LA 1U02A 1S3SA 4LCJA 3NJ4A 3ADCA 2O3QA 1AURA 3I23A 1PE0A 3OOWA 1MR3F 4REQA 1JXOA 1PX0A 1UBCA 4TYMA 4F85A 4HLNA 3E9DA 5IARA 1NXVA 4G6ZA 3AGPA 4BAGA 3R0JA 1E1RD 2I6TA 2VCHA 3IE0A 4P4LA 3ISVA 4P5PA 4I8IA 3BHMA 5EN4A 1QCYA 4S1VA 1JBKA 2Q5CA 1JA0A 4D9FA 1ZNZA 3CRMA 5LA6B 3P19A 3S8EA 4ZI3A 2XIQA 2DKNA 1F8UA 1P72A 2HV9A 1Q95A 1KYVA 4XGIA 4UTXA 1OBFO 1X8KA 3HC7A 3TTTA 4IH4A 1Z17A 4W9NA 1Z6QA 2OQRA 3PVSA 4BRZA 3F2VA 4TKUB 4UDYX 1BMTA 1QQ5A 4HWGA 2VQDA 2W7TA 2R6CA 2ZUBA 4JQZA 1ULUA 2EJBA 1BDJA 4M1OA 2XHEA 1QLWA 3VU8A 2ZDHA 2J7PD 4XWGA 3TX6A 4EJFA 2WSBA 3RVPA 1GKYA 3P0IA 2H9IA 4BMOB 3CZRA 2IVFA 3HHPA 1O1YA 3RHTA 4IFTA 1PL8A 5BV2P 4AY6A 1QO0A 1GDTA 1HFJA 5G0TA 4AX8A 2ILVA 1B76A 3T3NA 3M1IA 5E2AA 3NNNA 2ODWA 1Z6YA 2XUGA 1V47A 3LIIA 4LI0A 3MJHA 2OZLA 4PANA 3TW4A 5GVRA 3KUDA 2CBZA 1LDYA 1UR5A 2CMHA 2IZ6A 3C7DB 5D7NA 1GD1O 5TQ2A 4F97A 2UVPA 2GLUA 1P81A 1SUDA 2NIPA 2LCQA 3WYEA 5BXYA 1DAHA 5EWJB 5C5IA 3SVZA 1NXOA 3Q2KA 1U7PA 3DBRA 4IJ6A 4IOLA 3PGJA 3TSYA 1IVNA 3ZE8A 3UY4A 1MC1A 1YFLA 1PT8A 1CQIB 1ZUD1 4Z4IA 2C54A 5C3MA 4JJFA 2Z5FA 5FA8A 4QTUB 2HQ1A 1Y7TA 2QM8A 3AERB 4BFTA 5L53A 1E8NA 3E9ZA 4LOIA 4B1FA 3EW9A 2YN0A 4O1MA 1W581 4YJ3F 4GOXA 2AMJA 5K8IA 5A3QA 1XZMA 1K75A 1SXHA 2H4ZA 3WGVA 3R74A 1RPJA 1W6UA 2GNOA 2I62A 3WLNA 3GGGA 4H35A 3W04A 4A1OA 3E05A 3JVIA 5B3AA 5CFLA 5AW4A 3NHLA 3SFVA 3C85A 3H9UA 4YDSA 1VGQA 3GGJA 4Z1MD 3DQQA 5BNZA 3HVJA 2AIRA 5K8CA 1MDBA 4POAA 3P5BA 4N39A 1R0LA 2E6UX 2JI4A 4DLNA 1GNLA 2GBIA 3WDKA 2O0MA 1VP9A 2H00A 1GQQA 1HE8B 2HCRA 5FAXA 1O5IA 2XUPA 4Q3EA 5K8UA 1AF4A 1B4DA 1WHSB 3PJEA 1ZK2A 3RQSA 1U9YA 3OKAA 1H94A 1XZCA 1KQGA 1KBZA 3BL5A 4BJHB 1KU6A 1T36B 2FVXA 3DEFA 5B58C 5KMGB 4UTPA 4S12A 5CW1A 1U4OA 1U2PA 5AHWA 4MW5A 3Q7EA 2P5TB 1KO5A 3TL2A 3U7JA 5JYEA 1LPAB 4RY8A 1MCZA 2ORIA 1GPLA 1KC1A 4YV1A 1JX6A 4H4EA 4B79A 1F2UB 3BCUA 4Y2QA 4ENRA 3GFSA 3H7AA 2XAAA 5BW4A 1MA0A 3Q3EA 4TLAA 3WK8A 1F2TA 1AKQA 5KYNA 1VCMA 3D4NA 2O3JA 4DWJA 1NBEA 1TKBA 1YCFA 3NNSA 3TQTA 3IBSA 4WOPA 3UM9A 1GQFA 3O7WA 3D8UA 1EJ6A 4GNRA 1TDJA 1UKAA 2O2XA 2X3YA 1OXVA 1F9AA 4FE7A 1ESEA 4B35A 5JJBA 1YI8A 3LT1A 4LECA 4OHPA 2YZKA 1H2ZA 1B42A 1PUXA 1UFQA 2NGRA 1SURA 1B15A 1LW7A 2VYQA 3OTQA 1C29B 4RVOA 1L7RA 4BO4A 2BHSA 1KPGA 3AW8A 1L3BA 2AOVA 1U4NA 3C3AA 4OI1A 4F72A 4P5DA 4OFZA 3FMPB 4X1IA 4F46A 3MFQA 3LKVA 4LXIA 3WTBA 3OLZA 3GLHE 3E5NA 4U2DA 1DRWA 1QBGA 1EVJA 4ZMSA 1TIBA 1W4ZA 2ZJ7A 2XXBA 4ZTBA 4U2BA 2JLBA 4LYFA 1GUBA 3CWZA 1T8SA 4DDTA 3FHTA 2O1XA 3M6FA 3PGMA 5LM3A 1LQ2A 2M1XA 1G5HA 2Y67A 2ZCVA 4PZLA 3VU0A 4H7KA 1B1AA 1JFFB 3VNAA 4PCUA 3O26A 4MB0A 1M1ZA 1XLTA 2QT0A 2MCFA 2QZJA 2XSZA 1VDZA 3L6OO 1R5JA 4KYVA 3QUAA 3UGQA 3ZHQA 3RVLA 3OEHD 4X45A 1GYQA 2DT5A 3ZVRA 2BEUA 3F6SA 5TX7A 3CJRA 5A4IS 2CLIB 1GOTA 1Y1PA 2CUKA 3C3BA 5CLIA 1TKRA 2Z4SA 5HTKA 1MX1A 3ZWNA 4G1FA 1KORA 4BB0A 4IMJB 1VLMA 3R5SA 1EFPA 1VI6A 2X58A 3CBGA 2XRZA 2D13A 1D6JA 1H5QA 2P9FA 3IEUA 4UNQA 5F9MA 3SQLA 4KCGA 4DSUA 5JDCA 4QOSA 4PXSA 1GQRA 1ZKMA 4UUAA 1TZKA 1TQ4A 3ZZTA 2AN1A 1PL6A 3EZ2A 2GK4A 4UJ3A 5FWDA 3IAM1 3TZCA 2GD6A 1DRJA 1R16A 4RFLA 2PSEA 1KTVA 4L51A 4ALMA 1GGNA 3VVMA 2BGTA 5CEFA 3EEYA 3FZQA 3F9RA 4HH4A 4LRTB 4A0HA 4ZCTA 4V1CB 1F0NA 2JAWA 1A72A 2NLOA 5TDHA 1PFYA 3PEFA 4V0QA 4CKEB 1VE6A 3THWB 2NO9A 2QR2A 3EC2A 2EOAA 3HMKA 5A5EA 1F2DA 1JJIA 4GXRA 5I9SA 4PYLA 1XP8A 4KWHA 4DLSA 4OEHA 3OQNA 1TT5A 5HJ2A 3DWFA 1TZJA 2CFIA 2XAUA 5DT9A 2ZYHA 5AW0A 1NVAA 3IEPA 1T3GA 3RFUA 2ZJZA 3TMAA 5IH7A 1ACMA 1TO1E 2W98A 3UA4A 4ZDIA 3E22B 2WIJA 4IGEA 3THXA 3CUTA 1ZU4A 2ZB4A 1T1RA 3C6XA 4DZTA 5CB0A 3DB1A 4OQDA 3BD8A 2DWOA 3W34A 2VAPA 1E1CB 2WTNA 3ROXA 4C7XA 3GLRA 1D7AA 5KC9A 1K8QA 2C7VA 3CKLA 3KQKA 4EW3A 1XNHA 1HRKA 3HRKA 2JZNA 3C39A 4HB4A 4L75A 2CEAA 1K4MA 2BL4A 4YK7A 3T1OA 1FMFA 4QOIA 4U7DA 3ET5A 4FZVA 2PRSA 4HAIA 5EJFA 1BYIA 2C4NA 3N53A 3OFKA 3OIFA 4QEKA 1PFKA 3CSSA 1QHFA 1YKGA 1BN7A 2C0PA 1Y82A 1Z6XA 2H1LA 5NLLA 4OI0A 4JWKA 1Z39A 4KXVA 5BN3A 1QDUA 2IRWA 5ALJA 4O2BA 5D00A 2WKQA 4JQCA 3RT7A 3DMGA 3K5HA 2GJ9A 4I9FA 1JDPA 4K0KB 1LDMA 4UDOA 2M6LA 1NDQA 4HGNA 3OCWA 4HB3A 2Q4RA 1VBFA 4RV5A 3BFKA 2PIDA 4G4JA 3LVQE 4IWYA 3IKLA 4WXYB 3RPEA 4B7XA 1VL6A 1CUDA 1HTWA 1P31A 1WDWB 2BFEA 2J9YB 3P20A 3KUKA 4Z99A 5CB4F 4EMBA 3K5PA 3DQPA 4C30A 4AIRA 5EJ8A 3ESQA 3G2PA 1U80A 3NDIA 3T9BA 4EMUA 4ISCA 3PYMA 4HOYA 3DYBA 5LJLA 1UPBA 1XEXA 2QVLA 4G23A 4RVGA 4EF5A 3LBAA 4P4SA 3DDUA 2I9KA 2COKA 2IE0A 3W5IA 1J0EA 1T0PA 3H5WA 3ZLUA 4Q7MB 4WFKA 3NKVA 3VDMA 2IP1A 5IHXA 1NU6A 3K6KA 1QHHA 3OIVA 4MS4A 1HZJA 2BBWA 4B80A 2X41A 4ACAA 4BDSA 3D43A 4A8JA 1VHTA 4G67A 4UBMA 3EVTA 4XGRA 4J1SA 2JLXA 2RHTA 1NUPA 2QSJA 4HDRB 5E1BA 2GN2A 2QMYA 4GFDA 4HAOA 4DR3B 4DMRA 4Q05A 4R9UC 2Q4EA 1SVKA 1ZGZA 1NQ5A 2NSJA 1FRZA 3KFXA 3WLTA 3FAKA 4MYSA 2ECKA 2RGXA 5BRJA 1QIHA 1X80A 5T3YA 4A26A 4UTVA 1P6UA 1W76A 1A5BB 2I7VA 2OV6A 3L6DA 1TO6A 2RJ3A 1CUEA 1C0LA 1JZQA 3IDFA 3OLWA 3R9KA 3W9YA 4BLTA 4WJLA 2A2ZA 3K6SB 3ORSA 3CVJA 4R1SA 3JRNA 4J75A 1TEVA 4WBNF 3FLAA 4EKIA 6AT1A 4CF5A 1Z37A 2P8SA 1U1DA 2SCUB 1I6MA 3BULA 3SIPA 4DG9A 1A5TA 4V39A 5G3ZA 4M0UA 2HBZA 4LQDA 5CXSA 1EB8A 3SFTA 1RQPA 2XRFA 1XEWY 1PR1A 1DNPA 1THZA 2CMKA 1ST2A 2XQKA 3D8RA 1MOZA 3AVQA 5AD1A 5IWCA 2NW6A 3V8QA 4R2XA 5LFAA 4DM7A 1PJRA 3PVZA 4YREA 1ZR2A 1SBHA 2GA9A 2C2GA 5KTYA 2O50A 1GSAA 2R1TB 4C7VA 1YULA 3F67A 3BE8A 2GK7A 4DLVA 2E87A 5DNUA 1JXQA 1TJ5A 5AUQA 3DBLB 4QGAA 3DDSA 1EHCA 3FUUA 3G68A 2GBLA 2WILA 2BWJA 3O4FA 3VPCA 2Q2VA 3CF0A 4KQXA 2KLBA 3OTGA 1QV7A 3S5UA 4N48A 2MYNA 2CJWB 4QXRA 4D0RA 4ES6A 1NSTA 3HSKA 1I4DD 5JALA 4BMXA 2ZYDA 3W5HA 1ZUIA 1KE2A 3R3HA 4B6EA 4CLOB 5ALVA 1ZC4A 2JEZA 3E5RA 1I3NA 1XU4A 5A3RA 1QK5A 5CRIA 5AW3A 5IJZA 3BTVA 4Y2JA 3QFHA 4F92B 1OLSA 2UZ0A 1MABA 4RJ2A 4P54A 4FMDB 2OWDA 3STXA 1XNRB 3UMMA 2O54A 3EXAA 3UG6A 1CRWG 1K8XB 1QANA 1QJ4A 2GN6A 4LYDA 4RA9B 1XDUA 1NSFA 4QIHA 3TOVA 4EB6A 2HRZA 4NBNA 4H27A 1NT4A 4KMSA 1KP3A 4PSUA 1GO2A 2X5KO 3LO8A 2W0MA 3TKLA 3WLIA 13PKA 2JAOA 2OL4A 2PPVA 5BT9A 2WUGA 3DDHA 1Y63A 4LFAB 2PZKA 1E1QD 3O47A 1FFCA 3UUEA 3GFFA 4KHPB 4W8OA 5EJ2A 3TGPA 4J94A 1YA4A 2EGUA 3NIFB 1BTOA 2BKAA 1II8A 2VHYA 3M4XA 3BICA 4N1AA 5K03A 5FIUA 3Q5EA 1B0AA 4ZVRA 3KWLA 1BFKA 3QQ5A 3QYJA 4HLUA 2D06A 4HWPA 4I46A 3BT7A 3CH5A 3MT0A 2YUTA 2EJCA 3DL7A 3E15A 1XK7A 2JVJA 3E1GA 4F7DA 1XRJA 4CMEA 2X6TA 3OBBA 1JB9A 1GPWB 4Z9FA 4BUZA 4NWIA 1Z82A 4GZ3A 1LBSA 1T26A 4XM2A 1JR3A 2J4FA 3RSGA 3R3UA 5DGIA 3T9EA 2OBFA 5DN9A 5F4BA 3ILHA 5HKBA 2RGGA 2JLZA 2I78A 4ZEMA 4NMWA 1YZUA 2WVAA 1W52X 2HQRA 3D54D 5KOJA 4YR7A 1DINA 4Y7CA 5ENDA 4HNVA 5I01A 3KR9A 4LOKA 3AHHA 1XVLA 3EWNA 3N2KB 2QG9A 4CMAA 3E9RA 2VHCA 1H1LB 3BJEA 4IDNA 2Y6UA 3IP7A 1ZAYA 4XIJA 2YV4A 2VP2A 5EESA 4D8YA 3U60B 4K6FA 4X1KA 3GVCA 4PGAA 4ECAA 4JJIA 2BFPA 2FSHA 4OG2A 4B4KA 2D2VA 4GYKA 4BIMA 1I80A 1PR3A 2PT7A 3U0BA 4U8GA 4KRXA 3ZXYA 4BU1A 5DU2A 4F11A 2G07A 4YP7A 5BYAA 3GY0A 5TPZA 5T67A 1SZPA 2J45A 4UHDA 3H2KA 4Z6KA 1NN3A 2CZGA 4JA2A 4QREA 3N59A 4IY1A 4WD3A 1C3LA 3LT0A 3E9NA 4NYJR 1ILEA 1Y3BE 2C2KA 2XE6A 3TQRA 2G88A 1UBJS 2EFEB 5KWIA 1C9YA 1OMOA 2IYEA 2DPYA 2JRLA 3K5WA 4GLLA 4B2PA 3B51X 2XCTB 4NCJA 5DASA 1V7PC 2GH1A 3OCJA 4RF5A 4JBXA 4DLPA 3NASA 3U4QA 3ZU4A 3L0DA 2GPBA 3WYCA 2ZGVA 4PVDA 2BZ0A 1F5SA 2PU5A 3B6JA 4MMZB 2E5LB 4XGKA 3IIKA 5DMHA 3H2BA 1E3WB 3WB0A 3JYPA 3RHFA 1R5NA 3RAGA 2AEJA 2MSKA 3PFBA 1DOZA 1ZISA 2GERA 3KSRA 1BVHA 3A11A 4HQ6A 4LMPA 3D2LA 5BXQC 3T0GA 1QG2A 2WVGA 1SXJC 3PXDA 3EHDA 4YLEA 4A2QA 4M88A 3J80A 2F67A 4GLBA 1EIWA 2PRJA 5FDFA 3JWPA 1OH7A 5DSZA 4C2UA 3B7GA 4KEAA 2X0IA 2V98A 3P0FA 4BFYA 3HP4A 3FVVA 1Q7BA 1Y5IA 3T5CA 3IURA 1URPA 1N8KA 1M5RA 4ZCMA 1WD5A 2D74A 4W5OA 1KOFA 1UK7A 2JJ2A 4FHEA 2W37A 4R68A 4G4GA 5AXBA 1DCMA 2ZP1A 4PQYA 1P9WA 2B7BA 4RTQA 3NWEA 3WZMA 1DBWA 1NRWA 3HCEA 1JRLA 1KZ7B 2OR3A 3T5MA 1U28C 2D2FA 3R6TA 4HO1X 1FUUA 1HUQA 1ODFA 2BF4A 4XM0A 3RS4A 5FLEX 5IJWA 4XWAA 1XB2A 1T8WA 1XCGB 2X3UA 3SQWA 4M99A 2Q6TA 4MR9B 3QEJA 4FCCA 4ABYA 3IEVA 3BBPA 4X6YA 3BGOS 1Q91A 4LTNA 4X6XA 1PJ2A 1KIMA 1VYHA 4PFKA 1QFSA 2DWCA 2W00A 3KKQA 4EW1A 1WV1A 4QQRA 4RZ3A 2XDQA 1OF1A 1GT91 1N1DA 1STOA 1Z68A 3HKBA 3JQGB 4IIEA 4MKFA 1V6SA 4P86A 4XDHA 4W7IA 1KEUA 4YNBA 4ALNA 4M87A 4C4PA 4D4MA 5K4HA 3PXXA 4UJ5A 3PI6A 4EPVA 2A4MA 5LPNA 1F7UA 1K3UB 4X3OA 3T41A 1E63A 1I7NA 3DR5A 3L1JA 3DL2A 4MKHA 4QJIA 4ZA2A 4E5UA 4D8TA 4DQVA 3OIGA 1R9NA 5E0KB 4JLVA 5AW5A 5CVTA 1YA8A 2I7DA 4EYQA 2UXCB 3ZEIA 1G55A 3QHPA 3L06A 5IEJA 3NEJA 1U9IC 3RU9A 3UC5A 3ZWQA 1LDNA 2Q5HA 1GY8A 3GDHA 2I2CA 5F1KA 1DJOA 4JITA 3DVAB 5HNKA 4XR4A 1ZLXA 2AOTB 3QKSB 3C3WA 3HFSA 3UMVA 3LW8A 3ENVA 4RVCA 3RIXA 4EKNB 1Z5ZA 5LU8A 3QZUA 3IX7A 2NO7A 5JECA 2PKWA 1BMQA 2OCDA 3S4YA 5BR8B 2PZBA 4QULA 3T3MB 3Q3GE 4M37A 3WKAA 3DVRX 4YN3A 4DRZA 3F90A 1QOZA 4OYYA 2P9TA 3INYA 3L7OA 1RCFA 3D7NA 1GL6A 3UK1A 1ESCA 3PGKA 1QP8A 4QOJA 4RPLA 1BEUB 2FF7A 4N5LA 2VDUE 1OB5A 2V03A 2WD8A 4EHKA 1BMFD 1YWGO 5IYZB 4WBXC 1BG6A 1OI7A 3KXLA 4X85A 5E3IA 2JLWA 4NBKA 4KMOA 3E7PA 4LDJA 3WQRA 1WDTA 3R7LA 1P1HA 3L7CA 4QXAA 5HZHA 5L7YA 5CFOA 5JAZA 1OZHA 1FDTA 2JLUA 3IAUA 1BCRB 3OUTA 3FPLA 1Q92A 5HX7A 2Z1DA 4CG1A 3G5AA 2VZ8A 4OOFA 3TTVA 1IM8A 1QKKA 4MW2A 4CIDA 4IV8A 3OFNA 4ESHA 3GEDA 1WF3A 5KREA 1UWLA 4G8CA 2GARA 4PNPA 2RGEA 1W6RA 5CVEA 3UQYS 1H0HA 1LW6E 1Y42X 1JPUA 3D4OA 4FWBA 4LOAA 3U80A 4C9BA 1YK0A 4JSYA 1CW2B 3PDUA 4KLZA 1WB4A 1Z5UA 3PI7A 4OP2A 4RD3A 3FMFA 4ZC8A 5GGYA 5BYJA 5SZKB 4AO7A 2QQFA 4X8LA 2ZULA 3M6UA 1L5YA 1GJRA 1P62B 1GEEA 3EDRA 2YYZA 4OQNA 4FFRA 1Y1QA 4NCNA 3RTCA 3GJ4A 5C32A 1B3RA 1J8VA 4TVKA 3AVXA 3WLOA 2Z8YA 3E84A 1XQXA 2JC3A 1L5KA 1YH3A 2Q5OA 5ELXA 4L9SA 4D4KA 3ACCA 5DYYA 1DIOB 1FZQA 1PBTA 2XI4A 3G8BA 5JXHA 2X6RA 2IXEA 3RUDA 3OSZA 3B8HA 3C0KA 2G5PA 2WLTA 4JYMA 1NFRA 4YJFB 4DAOA 4I55B 2EQ5A 3ZYCA 4YCSA 2WTBA 3QG1A 4XCQA 1KVQA 3KG2A 3QUCA 4EKDA 1M66A 2DBYA 2NACA 4A5SA 4BKMA 5KINB 4ZZ0A 2QLMA 3E9MA 3OY2A 1NI3A 2GEDA 1DSSG 4U2EA 3QE0A 1IN8A 3ZCQA 4NK5A 1H0RA 3U7EB 4A03A 3HBMA 4ASUD 2WAMA 2YOHA 1SG9A 2OO5C 1XTQA 1T2NA 5DK6A 3TRJA 3GF4A 3JZDA 1XDWA 2J67A 3VOAA 3UPTA 3JWJA 3GP3A 2I54A 3G2KA 4UXHA 4WXRA 2H16A 2WHPB 5JZMA 3K6JA 2DLDA 3LDHA 2QBYB 4IG4A 4DIBA 1GPDG 3SY8A 2LD4A 4IKEA 3U48A 4I8XA 4O2AA 3K9NA 4L8YA 1PKXA 4YAJA 1A2OA 1PGQA 2BP7A 3EOZA 1GKKA 4B3CA 2CK3D 1UJ2A 1O97D 1UOOA 3QPVA 1L7MA 1YZHA 4U5QA 4JU9A 3RM3A 3R5TA 3VKWA 1LV8A 1GYRA 1QIEA 2G4LA 2PV7A 2B0CA 1KS2A 1QPBA 3JVDA 4LZJA 3RF6A 3RLIA 1CQPA 1NPTO 4KVGA 1CRPA 4L8FA 4Z4GA 1YFJA 1FDVA 1YBHA 2GNPA 3BXXA 3WOVA 4TMTA 3UKDA 3QPWA 2XT9A 4JEMA 4A27A 1B1CA 3RC3A 3S5JA 3GJYA 3L5KA 5C1BA 1T6XA 1QQ7A 5TSDA 1GSIA 2KB0A 4WWHA 3ETCA 4N47A 4U1RA 3MB8A 4WINA 1L5NA 2UDPA 3C16C 1E0JA 5A0FA 3TPCA 2A5GA 2NNWB 3ZZMA 1EZ1A 4XI9A 3DCYA 1QMGA 4JJAA 4LNUB 4D8XA 4DPLA 4DR6B 3PV0A 5E4JA 3CCCA 3EWSA 4NAUA 3THSA 2V7VA 5AVZA 2Q6IA 1X15A 3PC2A 3NRCA 3ZDRA 1Y6RA 2QX9A 1XA0A 2AUMA 2QZPA 2Z2KA 2I9PA 1BC5A 3N8KA 1PLLA 3DP7A 1AKWA 3JYOA 3LI2A 4N0EA 4WGFA 1E2PA 3MOIA 4ZYXA 1AIPA 2OZVA 2IXFA 2GVZC 1J0XO 3S40A 5JD6A 1VE9A 3F74A 4YI3A 4ESOA 5LZ9A 3ACBA 4DXDA 2WWFA 3QKTA 4GR5A 4BNUA 1WWKA 2HGZA 2QS9A 4BZZA 4CGZA 1GIAA 3D81A 1UINA 3T61A 2DT8A 1VCNA 4ZOLB 3V4SA 4EA6A 3TGLA 2NYAA 1Z5NA 4LJLA 2BR3A 4YA6A 2WDPA 3IBFA 3MTIA 5EYPA 5LIRA 1TF2A 3ZD6A 1WIWA 7AT1A 2D5CA 5CURA 3IBCA 3LQ2A 4LIPD 5KNBD 1ZONA 1JS1X 1KY3A 2IHYA 4GAEA 4C5BA 4RMHA 2XWBF 3SYMA 3ZGZA 1XZDA 1I3CA 3OPQA 5AI0A 5I7AA 2ZJYA 2EAUA 4IH9A 4AF8A 1P9OA 1QHGA 4RKRA 2NOAA 4AZ3A 2HFJA 3KQUA 4MYDA 3L7YA 2DOKA 2O7SA 3EA0A 4F06A 4Q4JA 4ON9A 2DP4E 3EXIA 1J8YF 3FVTA 3GRCA 3TPZA 3R0IA 3AB8A 2CFCA 4R7GA 4JJGA 4L9AA 4BNLA 4FWTA 4EZEA 1CVIA 2C5EA 3HV0A 3P2EA 3R09A 2D5BA 4OHWA 3UWSA 1TT7A 2RK4A 3KKEA 3WL5A 2QNIA 1JHPA 2AJ8A 3BS4A 4OBBA 3IDZA 4QOFA 1D04A 3W6NA 3LC0A 1F3LA 3ZDFA 1Z4PX 2FG6C 5ANRB 5H83A 3LRXA 4BAZA 1J09A 4V24A 1M76A 3RJ5A 3T1QA 5LBUA 5A5DA 2GXUA 2MJLA 1KDPA 2I3GA 4PO8A 4V03A 4ZI5A 3N2NA 4NF2A 3ETGA 3E5MA 4CIYA 4NESA 3KTFA 4ZCQA 5EXDA 1CZNA 3U4DA 1FYWA 4IMRA 1KYZA 1CRZA 4U9HS 3D6NB 2AX3A 1LLQA 3LVBA 1QK3A 3EDOA 3SVTA 1K6EA 3ND9A 3EXHC 3BXEA 3FRHA 2IHJA 1U1EA 2ZB8A 2DF8A 3AIOA 4EO9A 3CPEA 4TN1A 2RHCA 5TVKA 4V0LA 2F9MA 4QDOA 4TPKA 4AKSA 4GDFA 1WM1A 1KO7A 4LVUA 2PUCA 2HH9A 5L40A 2DEUA 4UE3S 1NZDA 3IV7A 5KQPA 3M1AA 2XKBA 1QH1B 2ZS7A 2BMJA 4YQFA 4FMCB 1L7QA 2O8CA 5CDHA 1XD9A 4ZODA 5FXMA 2R4TA 2PT6A 1QTIA 3FDXA 1G64A 1DQSA 3DKRA 2QD4A 1Z13A 3L7AA 4FEGA 4KU4A 5I8WA 1RYZA 1YB7A 2R751 2OG1A 1MO3A 2Q8QA 1DLJA 3GK3A 3SJCA 2HC9A 3PC7A 4H08A 1ETUA 3O82A 4FUTA 3INTA 5C1DA 5JBIA 4BVKA 3PIDA 3ZJUA 1BO6A 4Z9AA 1YU6A 1JQLB 3VGJA 2DVMA 1BX0A 2YQ4A 1NUSA 2O9JA 3AEUB 4NU6A 4W99A 3RRBA 1N0VC 3PSAA 3RC2A 4KX3A 3PDCA 1WVMA 4GLFA 3A4IA 2R0QC 5JR3A 1P2VA 4OGFA 3LOQA 1QLHA 4MMYB 2B8NA 2PWBA 2JNWA 2ZRMA 3QEKA 1CIPA 2NV2B 1HV8A 2QP3A 1VSTA 3NX4A 1NI4A 1ZUHA 5FOXA 3KSBC 3RDPA 1BH2A 4KUEA 3AUTA 3TX2A 1WULS 2HUNA 2R8XA 2SHKA 5AHOA 2I2FA 2XVYA 4M6WB 3U3KA 4HFRA 5FUQA 4XWWA 3PFHA 3Q8KA 1K98A 4TMWA 1QHYA 1JSLA 1TAQA 2EBHX 2GO1A 3FSRA 3ZV4A 4EHDA 3KJZA 1OWMA 3CFYA 3NBAA 4KE8A 4TKZA 1E0AA 3ND6A 3FPJA 4D8UA 3B9PA 3PXUA 1ZSNA 2QTVA 4LXTA 2ZSUA 5K8VA 3B1WA 4ZMRA 1OAOC 4NU8X 3U9SA 3ETDA 2B1GA 2H59A 4HNAB 5HVNA 3FYCA 4H7JA 4E31A 4KR6A 4URWR 1QGDA 1VHLA 3M4NA 2V3WA 5REQB 4LJRA 1U2GC 2F9LA 1T3TA 1T5IA 4EF6A 1R12A 3K4QA 1S2GA 2QD5A 4KN6A 4ALJA 2I8LA 4MWCA 4MHTA 1MEJA 2OLJA 4TZ6A 4FEYA 2ATCA 5ECDA 2Z2YA 1Q1AA 3L8FA 4JI3B 2C82A 5F76A 2ZBFA 2GUGA 2AEFA 3CIOA 4LNAA 5EC8A 2EQAA 4LK2A 3SYRA 4DYVA 8GPBA 2OKGA 3LIPA 5J4HA 2FZEA 1KPHA 3RSOA 2E1PA 5C8VA 2OA0A 4RTNA 3HBAA 1YGYA 4BLOA 1AKEA 4NJMA 1CUJA 3OKCA 3RYHB 2IZ0A 1IQ0A 2V6MA 2FG5A 2OOKA 2IPNA 4J0DA 5BSEA 2WUEA 1V95A 4HRAA 1UC9A 2BMDA 2RHGB 3IQGX 4N8EA 4PCVA 3ZY2A 4JQSA 1YBFA 5A03A 4HGYA 1TLTA 4HNQA 2NZXA 4NDAA 2QTZA 4B8ZA 5HPYB 1HQYE 3R5JA 1BS1A 1RP7A 2ZSFA 3GPCA 3JAWA 3P9NA 3OETA 1CP2A 1C7QA 2QN7A 5FBZA 1GFWA 3EEBA 5A9SA 4D44A 3EVGA 4J6EA 3HA7A 4J0GA 2FE4A 2NQ2C 1T5LA 1JE1A 1X1BA 2C1EA 4R2JA 4B74A 4WZAB 4M3NA 2UZ3A 3UAWA 1FJ2A 2REOA 4HP8A 1CEQA 2B1RA 3CNOA 1QKJA 3ZR4B 1U6JA 1RI2A 1S7CA 4BLPA 4MMXB 2UYCA 4H6WA 4BHTA 1J5XA 3CPHA 1P7CA 4R83A 3W5CA 3U7HB 2VG8A 4DVGA 3WLAA 4RF2A 1N1EA 3CVOA 3GPDG 2Y76A 2GF9A 4PF1A 2H2DA 2GZ1A 4UAJA 3KWJA 2QR3A 2YVAA 1JVNA 2EFHB 3ICPA 4M1QA 4O4IF 2XX3A 1IM2A 4GC5A 3GFOA 1B41A 3A3OA 3F3YA 1EGHA 5EHIA 1MLDA 4CCWA 1C2YA 2EZ8A 3NYQA 1UZNA 2QLTA 2JIQA 3FYUC 3SCZA 4RVHA 5MDHA 4UD6A 3EUEA 3H5RA 4NCAA 2RI1A 4UFNA 2R7LA 4WOBA 5C7OO 2SKEA 3GG9A 3I9NA 3TLKA 2C2WA 1CKEA 3AL3A 2DCMA 3N1UA 4C7BA 3UK0A 2VDMB 3MYRA 2CDNA 4Q3AA 5DBOA 5KZMB 2DLCX 4UEJA 4MEBA 5CB8A 4TRMA 3ZVNA 4C3UA 2HOQA 1VBMA 1YS7A 3QU9A 2ODPA 4NEHB 4WCFB 2ORVA 4C14A 2O59A 1E3TA 2LE0A 3K1AA 4ZAVA 4DZZA 1WP4A 3CZQA 4GUDA 3BQ9A 1QRUA 2ZATA 2NXNA 521PA 2AB0A 2P9ZA 4Z4CA 2JGDB 3KFLA 3STYA 4RD4A 1X3SA 3JARA 4TRJA 2EFDB 2QX8A 2XNDA 1UBGA 3I5MA 3RAPR 2PANA 3LTEA 2EZ4A 1E66A 1E3DA 1FUYB 2G8NA 3GBVA 2J9XB 2CNNA 3R3XA 1DAKA 2GX6A 4BP3A 2QY9A 5AUNB 5DULA 1KFEB 5FRDA 3N58A 4PX2A 5EKXA 2EV9A 1ZGGA 2BIFA 2G04A 2RGUA 2HIGA 3NWOA 2FPSA 5T8KC 3TOCA 4BFCA 4LWPA 2EBWA 4MYCA 1YQ9A 4BNXA 1T8RA 1A7JA 1BX1A 1VG8A 4Q15A 3MTBA 1BVRA 3NB0A 4MEAA 4L85A 4ZI2A 4ND8B 5THQA 4IHJF 3UJ8A 5IK2D 1NJFA 1NWHA 1U8UA 1YJAA 2VXYA 3HMQA 3P2IA 3QX9A 2HD4A 5CPFA 5FPPA 2P2CA 1JLKA 1KF0A 1X7HA 5HF5A 3TXAA 5KNDA 1WG8A 1UMDA 3NWJA 4GW3A 3T7DA 3C41J 3FFXA 4G5YA 5KNBH 1S2MA 5D3MA 5KB3A 5L4NA 2FI1A 3JQBC 1KSJA 2PKRA 5HKKD 1HDXA 2QLBA 1JKMA 1AQYA 1EDEA 2JD1A 3LGSA 2YZ7A 1FSPA 1FPMA 4I50F 1FVFA 1JR2A 2HF8A 2VDKB 2YFKA 2X8AA 2I6QA 3D4BA 1EX1A 3PDIB 5E1OA 1L1FA 1YGPA 2FSUA 3GJ7A 3O5AA 5FH9A 2PRYA 3CUYA 3M3PA 4A2WA 3I37X 2GESA 3L7BA 4FNOA 2P4SA 3RYFA 2V6IA 1YS1X 1P3Y1 3F6YA 1JEOA 2BFBB 2R4QA 1HTTA 5HFJA 4B40A 4BVFA 2V1UA 3VDNB 3R0VA 1BX3A 4RHFA 3ZXUB 4IUDS 2OAQ1 3QVUA 2WOJA 2NXWA 3S1SA 2PEYA 3KTDA 5FUMA 1OZ0A 1IG0A 3BEOA 3SZLA 2DY0A 3G0CA 4YRNA 5HUQA 1L5LA 1ZD4A 3L1IA 4OJKA 2Q21A 1UZAA 5J2UF 1OOEA 5DHPA 2C29D 1OBOA 3NWPA 3SMVA 4G1BA 1H4SA 2B2NA 4PNZA 3EBOA 3JRXA 3D3JA 1YVDA 3V3TA 3R76A 2GD1O 3LWBA 1T8PA 4GI1A 3DVSX 4DMGA 2XT0A 1Z0IA 3RBZA 1U5AA 1M2KA 2VUTA 4C3VA 2X2PA 1L4FA 3EXFB 3VAAA 1XRQA 1E9VA 1K2WA 3ZWOA 3LX4A 3CKYA 3EBPA 3M7IA 2Q0HA 3S1AA 5BUZA 5C53B 3GLFB 1TFUA 4JUIA 1KEZA 4AQYB 1YRYE 5CB6A 4G0YA 2Z4RA 3A1SA 1E2QA 1XK6A 2II6A 1R0RE 1THMA 3KDSE 1YCHA 2D0DA 3RJ9A 2BLNA 4QKQA 2NU6B 2VATA 3OE7A 2B4TO 2XQGA 3OQ1A 3IQDB 3BCRA 3MLAA 3F49S 1TTPB 1G42A 3HCNA 1YUBA 2IIQA 5IM4F 1KY4A 1Z07A 3WGIA 1UWKA 1OWOA 1EG2A 4JZYA 2QRMA 3SOPA 1BU8A 1SRRA 4WPGA 1KI6A 1I2MA 1ZITA 3DTNA 1L1QA 3NEAA 4TWZA 4G26A 3WA6A 2LCIA 4LF7B 4DB2A 2IPLA 4X8OA 5HK8A 2NMVA 2XYVA 1HFKA 4DIDA 5FBVB 4OF4A 2VSQA 4TXHA 3TG2A 3ON5A 4BXOB 3H5NA 5JQGB 1YE3A 3KZMA 3CUEF 1SZJG 3GRYA 2VZ9A 3LO5A 3LY9A 4YJ3B 1Y3DE 3RASA 2VHVA 4WZAE 4XH9B 5EKDA 3UBMA 1U7UA 2QAGA 2ZAYA 1UP6A 4G1EB 4B8WA 1Y9ZA 4QYXA 5HF6A 1E5VA 4ZO4A 3N8GA 5AJVB 1IWPB 2Z6VA 5GZ3A 3Q8MA 1GADO 3T0IA 3V4VB 4OMFG 5E95A 2VFAA 5ALLA 3M6VA 3N75A 3BE6A 1AQUA 2YN2A 1SPBS 4CW7A 3CF6R 1T2UA 1PWEA 3CEAA 3N0WA 4DC1A 4F04A 1X9IA 1HYHA 3HUEA 4F4DA 4J4BA 5JH7B 2J08A 3HL0A 3PR3A 1FW8A 2Y77A 1ULSA 3M8KA 1IHOA 4PR0A 2HREA 1EZ4A 1OFUA 4N41A 2IDMA 4E32A 4WERA 4JI6B 1O6BA 5TY0A 3ADPA 1FRVA 1K08A 3GV0A 1T0BA 2RONA 3ORRA 3S7ZA 4AO6A 3F78A 3WMXA 2GWRA 1I3OA 4US0R 1UBLS 1SU4A 3ZV5A 3KSDO 4IJVA 2A5LA 3K09A 4HNGA 4MAAA 5KTRA 1U3TA 1CZRA 1DFGA 5K9ZA 1ZIPA 4B83A 1V7CA 2P6OA 2Y9MB 4MQ6A 1PZXA 5DSTA 1MT0A 2GJSA 2VUHB 2HWXA 3B3AA 3BFJA 3AUXA 1W7AA 3RVMA 2NTEA 3EXEA 3GGSA 4FOLA 2PGLA 4HWTA 4W5JA 4E12A 3Q6NA 1AF7A 4Q3OA 1VBKA 1EWQA 1Q7TA 3BRSA 4HMPA 5AOCA 4YRJA 5C4IA 2OAEA 2P90A 3EIWA 1EMDA 3GRPA 3DMFA 1FIUA 3TIFA 1UK6A 3ZCUA 5CFZA 4QDZA 1QC5A 4RGBA 1D2AA 2I4NA 1S4QA 1TUEA 1FB5A 1UEXC 1ZY2A 2O2IA 4ZZ3A 4UQLA 2BSQA 3IT3A 2V54A 2UU9B 2NWQA 3LLUA 1KFKB 4MWGA 4DZRA 2VO1A 2ZIXA 4HAXA 4BX2A 3OMXA 4BO5A 1D4ZA 4DJEC 1EDOA 2AI1A 4F8EA 1N8TA 5EG5A 3VR1A 3GAMA 4Y0VA 5DNAA 1CDEA 2Y1XA 3QMWA 1RRVA 1WLYA 4NCKA 5EQTA 5KQMA 4GBJA 1VJRA 1IQRA 1MJNA 2HXSA 2VYCA 2IBTA 5F2EA 1IOVA 3DMPA 4HY3A 3HGTA 1U7HA 1NWCA 2FMIA 3AEQB 3PS9A 4HXFB 4M1MA 3KVRA 4PCLA 4AN1A 2PM8A 2ACKA 4EA8A 3E9YA 1WZNA 1ZLYA 2XH8A 3KBOA 2FCAA 2WU1A 3U1TA 4U9UA 4A10A 3A7EA 3LCUA 3DEHA 3IO5A 3SIXA 4C0WA 3HVRA 4DV2B 3BYZA 5AKLA 4L4XA 2ZTMA 4JJ7A 4TTTS 1SA0A 3L4SO 3BCHA 1P6XA 2HQBA 2ON6A 1JAHA 4PINA 4LISA 3NOOA 4IIGA 4CQLA 1EX7A 5MGNA 2GCOA 4J7CA 4COOA 1U0GA 5JZVA 4HDMA 3D3WA 1UOPA 3NATA 1VFPA 2BFFA 2LCFA 3FCUB 1XZPA 3GFGA 4HBZA 2J0QA 4L27A 1QONA 3AR7A 3FKSD 3WGZA 2IITA 1QHIA 1IBCA 1TYAE 3KXPA 3L79A 1MW8X 2V4MA 1C7FA 2WJ3A 4OHCA 5E7MA 4BX3A 3IS3A 1YNSA 4MVJF 2P3LA 2QD3A 3I92A 1QHXA 3FNEA 3OVMA 4NE9A 5IF9A 5DE3A 2O2ZA 1WCWA 4IH1A 5ITZA 1T35A 2JIPA 1KAQA 1XHFA 3SFZA 2JL1A 3RS0A 1A98A 1XTBA 5C4GB 3LNCA 2VT3A 2B1IA 3K0AB 2DTDA 2F3QA 5A6SB 1IEWA 1NIPA 4QUDA 4FGSA 5DXJA 4GRDA 5B36A 1I2CA 2NZUG 2R1VA 2HMYB 3HB7A 3BWDD 2XEDA 4JR1A 4B8YA 1GKIA 3X1YA 3AUJB 5DRYA 2WC1A 4JZKA 3VAYA 4D4LA 4D6YA 3RBVA 1OV4A 4CEHB 1FP4B 4WQMA 2JVIA 2OYCA 4XCXA 1F1JA 2Q4TA 3VSEA 4O25A 2PKEA 3U44B 1EK1A 4KIJA 1H2HA 2HJWA 3MWEA 1CBUA 1ZEJA 2JJQA 2XGSA 3WHKA 4PHHA 4OXRA 2X1VA 4ID3A 1Y8RA 3N0TA 4YECA 3TFWA 3IUEA 4ZT5A 3PA6A 2BUAA 1FNCA 3OQVA 4ARZB 1TUGA 2JD2A 4PPYA 3RTAA 4E7OA 2OAGA 3U13A 1S9HA 2EWMA 4S0ZA 4GOOD 2ZYRA 3STHA 3I6IA 4QQ8A 4RKFA 4M8NE 5EZYF 1OGJA 2ZTUA 1V1RB 3IERA 3QHAA 1XZIA 3KLOA 4IUYA 1T6BY 4IVPA 1KDZA 2EATA 1CR4A 1YL5A 1Y98A 5JLJA 5DOZA 1RZRD 5FB3A 1GQOA 3BWEA 4I81A 1Y8QA 5CB4B 5JEEA 3K0SA 3LPMA 4E3WA 2FZVA 1GPJA 2OORA 4BO7A 3KBBA 2ZRIA 1A2BA 4JVMA 4TV8F 4LOHA 5D5QA 1CR6A 1RYYA 1K06A 2OMKA 2P4HX 2P1RA 3IEXA 2GHRA 4ZJYA 1ISJA 4JDPA 5JTUA 5EHNA 4BMYA 4OJYA 1RPTA 4UCQA 4NDNE 1N2EA 5HQJA 3ZV7A 1DT5A 3HN7A 1MGOA 1SK9A 5IJXA 2BE9A 2ISQA 3S1LA 3ST7A 1NDUA 5J1SB 4BP8A 1N2CE 1RWQA 4LHYA 3P9RA 2HCFA 3G2IA 4UNSA 5JMPA 6LDHA 3RVSA 1KMMA 3U7QB 3X2EA 1PR6A 1Q15A 1NP6A 4LBZA 1JH8A 1K7SN 2OZLB 4BVLA 2UUAB 2UXBB 3VR2D 2H9AA 8MHTA 1H2YA 2PBZA 1PLJA 1L7EA 1RJDA 1QHSA 2A0KA 5TQ2B 4ZU3A 1HI9A 3EDMA 3NNDA 1WTCA 4CKBB 1ECCA 3W2FA 2C7BA 4XM1A 2QK4A 3ECCA 1PEKE 1ITZA 2JJ8A 2QV0A 1JHVA 3R7AA 1YDGA 3GR6A 3HDYA 3OMWA 1W59A 1UZLA 1DFHA 4F5YA 3ZXSA 3E35A 3QE9Y 1O0CA 4B3RB 3ELBA 3PHJA 1SPXA 4HSGA 2O2JA 2VDLB 3A9RA 3LA8A 4FFOA 4BQIA 4YIHA 1D0IA 1FP7A 4P38A 1E9CA 4WBNB 2XE8A 4RM2A 4XLTA 1RI1A 1XQ6A 3E4CA 1F4VA 2IY8A 2C59A 3GA5A 1KY2A 1XXLA 3IJ5A 4MVJM 4MWEA 3LC7O 4TKVA 4BV8A 1Z4KA 1ZL0A 4FINA 1QQBA 5M04A 2Y0EA 3FA2A 2PUTA 3VZBA 1ULBA 1NC1A 1ZFNA 2CLSA 3WYBA 1D6NA 2PSHA 3M2TA 1CS4C 4D6XA 1TK3A 1T3ZA 3IAM6 4M7PA 2OHJA 3D4IA 3GP5A 1RWVA 2NZVG 1JUDA 1KEEB 3T99A 2MYPA 4MUXA 1YNOA 3KRTA 4BFUA 1QXSA 4U39A 1Y4UA 3OZ7A 2X42A 4D42A 3OHSX 4ETWA 2HA7A 3ZLTA 1QYVA 1L7BA 2LZ0A 3E1SA 4KGDA 3KLPX 2OP0A 5AK4A 5EPOA 4B7UA 3B52X 5F7JA 5EMMA 2V8BA 3EOAI 3KEFA 2HA0A 1CPYA 3G9TA 5CCDA 1NW5A 4B9EA 3M4YA 1R0CA 2GJKA 3QVWA 1H22A 4PV7A 5H4GA 1G8MA 3NBZC 3OWXA 5GGXA 5C18A 4RVFA 4UHCA 3WWYA 1U8TA 1X1CA 4IVQA 2V65A 4DJJA 2XNKA 5JS6A 1CUXA 2QTWB 1GA6A 2MIIA 1WPRA 3T8YA 4R8VA 1YSCA 3ZD9A 5FKJA 4PQFA 1OZFA 3V8NA 2JGJA 3DOJA 2IBSA 2C78A 4RHYA 2RG7A 1F2TB 1BWQA 4QX6A 4R0VA 6PFKA 2PL1A 1N5IA 5ERGB 1AZTA 2KBFA 3R3SA 1E2IA 1G4UR 1AB6A 1NF9A 3QLEA 2C04A 3QVTA 4FS8A 1BA3A 1E4OA 4WNYA 4BCCA 6NULA 2WBLC 1SBQA 1JJFA 1YS2X 1R9JA 1BKSB 1XBTA 1KH1A 2AV6A 4OQLA 4BRUA 3IP5A 3R40A 3O38A 2F43B 1DIRA 2IA5A 5DTMA 1G9TA 3GJRA 2XD4A 3BMNB 3G1UA 3SLGA 3ZH2A 1GAJA 4FYJA 3A70A 1I7PA 4NPCA 2ALJA 1OYWA 4Q9LA 5CLLA 3ASYA 3KD2A 1OX6A 4RJKA 4UM7A 3RTEA 1J49A 5JOQA 1O6GA 4CUKA 3F7TA 1M6VA 1A7UA 3ANNA 5HA5A 3DYVA 4AP6A 4ZKDA 2L42A 2VIIA 2EL9A 3NHWA 4DEXA 1IM5A 1UK9A 1KBOA