1Z2DA

Solution structure of bacillus subtilis arsc in reduced state
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
139
structure length
139
Chain Sequence
MENKIIYFLCTGNSCRSQMAEGWAKQYLGDEWKVYSAGIEAHGLNPNAVKAMKEVGIDISNQTSDIIDSDILNNADLVVTLCGDAADKCPMTPPHVKREHWGFDDPARAQGTEEEKWAFFQRVRDEIGNRLKEFAETGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structures and Backbone Dynamics of Arsenate Reductase from Bacillus subtilis: REVERSIBLE CONFORMATIONAL SWITCH ASSOCIATED WITH ARSENATE REDUCTION
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
molecule keywords Arsenate reductase
total genus 46
structure length 139
sequence length 139
ec nomenclature ec 1.20.4.4: Arsenate reductase (thioredoxin).
pdb deposition date 2005-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1z2dA00
3NBMA 2R47A 5TPZA 1ABFA 5JNWA 2PUGA 4NCBA 4OLAA 1KRXA 4JP1A 1FFGA 3HV2A 4NCAA 4Z4FA 2DRIA 3LUHA 4O5AA 2JVJA 6CHYA 3O2QB 4RV5A 2JVIA 1P6UA 1MIHA 2PMCA 2XDYA 5TQJA 4ML3A 1JDNA 4DN6A 1DC7A 2CHFA 3HUUA 4Z9BA 3KKEA 3RVJA 1P8AA 3BREA 4ETMA 4N76A 5FWXB 2VK2A 1PUXA 4MQFB 4EYQA 4N0QA 3TD9A 2FW0A 5KC9A 2NT3A 1U2PA 4O1IA 4KV7A 4MQEA 1C0EA 1GUDA 4RXMA 3DZDA 4TLLB 4W5QA 1R8JA 5FBHA 3UUGA 3CZCA 3VNBA 2IOYA 4PYRA 4Z99A 1BVHA 1ZN2A 5IC5A 1URPA 2A9OA 5BRAA 1CYEA 4LZLA 4LE0A 4TMYA 2WRZA 1AB5A 4W5OA 3A10A 4MYRA 4MR7A 5TPWB 1M2EA 2HQOA 3OQMA 3CG4A 3QX8A 3OQOA 2MYUA 3CLKA 3GWGA 4YLEA 4OATA 4EVRA 1QP7A 4OLBA 2RGYA 4KREA 1IIBA 4XFKA 5FBKA 2PJUA 4IRXA 1JYFA 3K9CA 3HK2A 3HS3A 3CFYA 3GBPA 4XLTA 1YK1A 4G0YA 5EWLB 4RK4A 3DBIA 1Z18A 1VRVA 4G0PA 3OQNA 3C3MA 1FQWA 1M5TA 4G0OA 1NY5A 3OM0A 1Z2DA 4HNRA 4RK0A 4WZZA 2FEPA 2L19A 3KLOA 4LX8A 4Q6BA 1ABEA 1YVUA 5EWLA 3URMA 2RDMA 4MQEB 4Z4HA 1E6KA 5FWYA 2HSGA 1QQBA 2R48A 4DADA 2RJNA 1A0OA 4QYMA 3TB6A 1D2AA 1EHCA 2IPAB 2J48A 5CNKA 5KQPA 5FWXA 5TE9A 2FEWB 1USIA 2VYCA 3CKMA 5ABPA 3TMYA 2PKXA 1JLKA 3ILHA 4YR7A 3KTOA 5C5EA 4MS1B 1YMUA 3OLZA 4WXEA 5KI6A 4IILA 2HQBA 2FN8A 3DGFC 1OXKB 3HEBA 4G86A 8ABPA 5EWJA 3TO5A 3N6VA 2GX6A 4ZMSA 2BGGA 2YHAA 3HVRA 3EGCA 1P6QA 2LPMA 2A9QA 1QMPA 3RVQA 1NTRA 4IMIB 5CNMA 3RVRA 3GL9A 5IUJC 5KC8A 1NXOA 2TMYA 2E4ZA 3HDGA 4MQFA 4ZJPA 1MB3A 3IP5A 1TJYA 2L18A 3FDFA 1ISRA 3DLBA 3Q7TA 1W25A 3B2NA 9ABPA 1PEYA 2FN9A 5CNIA 5KQMA 2FTKE 1Z25A 4JASB 2FQXA 4W5RA 3N53A 3GBVA 4RDCA 1D1PA 5EWMA 1JBEA 2GWRA 5TPZD 3HZHA 3SNKA 1S8NA 4W5NA 2ZWMA 1C4WA 1F4VA 1QO0A 1VLZA 4L4UA 3NNDA 3Q15C 3W9SA 4TLMB 3MYYA 1Z16A 4HYEA 3RVNA 1Z17A 2FEKA 3BRQA 3LKVA 1U8TA 3H1EA 3D02A 5CHYA 5JNSA 5JNTA 3HSYA 1K68A 2MYTA 4FE4A 4G0QA 5HSGA 3T95A 4RZSA 1VPWA 1U04A 3ROFA 1QPZA 4S04A 3C97A 3O2JA 1FFSA 4MRMA 1Y1LA 3C3WA 3MA0A 5DGCA 1U0SY 1RZRD 1DG9A 2F8TA 4NV3A 4MS4A 1JDPA 4OG2A 2PUFA 1CHNA 4MR9B 1TLFA 1JFVA 2FMKA 1AB6A 3HUTA 3N0WA 4NQRA 3ILYA 4MS1A 2FMHA 2LBPA 2QSJA 4E7PA 4LDZA 3OLXA 4RK6A 4OBBA 2QV0A 4RK7A 1JWLA 2CD7A 1UDRA 3FGZA 3KS9A 3OLVA 4MR9A 3D8UA 3OLYA 3OMXA 4F3TA 4MS4B 4H3KB 3CNBA 3H6HA 2MYPA 3MF4A 3OMWA 3H5IA 2JBAA 5KQGA 4MRMB 4F06A 1GLGA 3BRSA 1QP0A 5ED4A 5CNJA 2HJ9A 3A3KA 2PLNA 1JYEA 5JS2A 3QLUC 1A04A 2MSLA 4WUTA 4YWHA 2PL1A 4JA2A 1DBPA 2I6FA 4EVSA 1I3CA 1ZGGA 1JH9A 2LP4Y 2FMFA 4N03A 4RSMA 1DBQA 3H5VA 1F51E 1MVOA 1P2FA 4RY0A 1NATA 5PNTA 5BQ3A 3E3MA 1Z12A 1D1QA 1OXBB 2B1JA 3A0UA 3HCWA 1BAPA 1NXTA 3G1WA 3KSMA 4JAVC 5EWMB 5KWSA 2FQYA 5TPWA 1LBIA 3IP6A 3NHMA 4LE1A 4YP9A 3RVPA 5GQSA 1FSPA 2OENG 3SQNA 3LUDA 2O20A 3F6CA 2E4UA 4YS6A 1B00A 1J56A 1FFWA 5BRJA 2NT4A 3HJFA 3CZ5A 2VUHB 3K4HA 3HXMA 3DGEC 3LTEA 4WT7A 3IP7A 3GV0A 5EWJB 4PZ0A 5BR1A 1RPJA 3JTEA 3G85A 3P9YA 1A2OA 2A9PA 1EWKA 1ZY2A 3M6MD 3RQIA 3T6KA 3OLWA 5IEJA 2GKGA 2F8SA 4Z4CA 4QICA 3JVIA 4FE7A 4F11A 2M1ZA 3UKJA 4ETNA 3QELB 3CU5A 3H5OA 1DBWA 4EYOA 2WY2D 3JPWA 2LIVA 1XHFA 5TQ2A 1XWWA 3SM9A 2JRLA 4MLCA 1VKRA 3TX6A 2W42A 1TVMA 2FVYA 1EFAA 3A0RB 3JY6A 1KMIY 4ZMRA 4IGAA 5T7BA 3KG2A 2WJAA 4F8JA 3LOPA 3QLVA 4PEVA 3RVLA 5I4CA 2ID9A 1MAVA 1JX6A 2FKAA 3BBLA 4W5TA 3QLVC 3RVSA 1LK0A 2PAFA 3IP9A 3KLNA 1NXWA 1QNLA 1QKKA 4MR7B 4PICA 4Q7EA 3SAJA 1EAYA 2OQRA 3LUCA 3F6PA 4S05A 4M88A 1DC8A 3S99A 4GPAA 4UHKA 2FMIA 3KYIB 4KK4A 3RVOA 3RVKA 4F12A 3I45A 4KQCA 4RKQA 3L49A 1NXVA 1ZGZA 4KK3A 4G0XA 1JL3A 4KZKA 1M2FA 2CWDA 2QZJA 4RXUA 4KMRA 1QP4A 1DRKA 4KRFA 3KHTA 1DRJA 3C6QA 3CS3A 3GA5A 1E6MA 2QW1A 1PEAA 3C3KA 3I42A 1GCGA 4XXHA 4H3HB 2IPLA 3FFXA 2FLKA 3EAFA 3UK0A 3O21A 1L5YA 1USKA 2HQRA 4RK1A 4OTZA 4O1HA 5JNVA 4GNRA 4EVQA 2PL9A 3QK7A 4P1ZA 1NXXA 1E6LA 5DCLA 5DKFA 2GI4A 2PUDA 1Z2EA 4RK5A 1DZ3A 4QPJC 5D2CA 3Q7SA 5B3JC 2QR3A 3EDCA 2ZAYA 3L6UA 2P4UA 4QYWA 2NUBA 3H1GA 4RKRA 2JCGA 5B3JA 2FSPA 3T38A 5E3JA 3H6GA 3KYJB 4HNQA 1USGA 4YRZA 1DP4A 1HEYA 3R0JA 4RY8A 3DLHA 1DCFA 5T3YA 3SY8A 4EUKA 1SXGA 2AYZA 1PNRA 3EQZA 1EWTA 1RNLA 2H0AA 3LUKA 4G0MA 3BILA 6ABPA 2A9RA 4MPTA 3N0XA 5IUNC 4KFCA 1ZH4A 4XASA 1JFTA 2H3HA 1XHEA 2FQWA 4TN5A 1DJMA 3O74A 2E4WA 1YS7A 4PE5B 2X7XA 4MS3B 4N41A 2VUIB 1RXIA 4HNSA 4XAQA 2PUAA 1M5UA 3O1JC 5JNUA 2JK1A 3RVMA 3QELA 3FFTA 2FLWA 2FXIA 4NICA 1ZESA 1BA2A 3LUJA 5F64A 5TQ0A 3QEMB 3CG0A 3F7NA 4RWEA 1ZH2A 5HQJA 4YGXB 4LE2A 3CRNA 3JPYA 3CHYA 3O1IC 1LJLA 1NXSA 1YS6A 3N75A 3QLUA 2PE5A 1D5WA 2N9UA 5IULC 1BDIA 3H5TA 4KVFA 3MMNA 2QXYA 3JVDA 4P98A 7ABPA 3HO1A 4UHJA 1U2QA 3EJWA 3LKBA 4YO7A 4MAAA 4L85A 3O1HB 4MR8A 3FFWA 1PHRA 3LUFA 1YTUA 2R25B 3FMVA 1APBA 5TQ2B 1EWVA 3EQ2A 5IEBA 4Z4EA 3H5LA 4Z4IA 5HM6A 2HPHA 5IX8A 1SRRA 1ZITA 2WWVD 4RXTA 3O75A 3H1FA 5JNRA 2E4VA 1E2BA 4G0ZA 4N0PA 5TQ0B 5C5CA 1T34A 4EYGA 2YHBA 4EGSA 1H9CA 3MM4A 2QVGA 5GOTA 4D6YA 3IPCA 3KCNA 4MS3A 4Z9AA 3SG0A 2CHEA 1QO0D 3H75A 2NZVG 3MIZA 1DCMA 3I09A 2QU7A 4MGEA 4Q6WA 3T8YA 3LUAA 4D6XA 1ZDMA 2B4AA 3JS5A 3NHZA 4Y9TA 2IDMA 1SXIA 2KYRA 4N47A 4E7OA 1Z26A 2IPMA 3N8IA 5DLEA 2LUOA 3HDVA 1MB0A 3E61A 3QLTA 1Z15A 4ZPJA 3HM9A 2P9HA 3OM1A 2JBAB 4KPYA 2MSKA 1GUBA 3I5AA 3H5WA 1BDJA 3Q7RA 2IKSA 4JOQA 4RU1A 1W9HA 3KJXA 3RH0A 4RY9A 3OO1A 4WWHA 4H60A 2E4XA 2JVKA 4ETIA 3NNSA 1ZVVA 1ZAYA 1JHZA 4JB0A 4D74A 2AYXA 2R4QA 1KGSA 1ISSA 4LDAA 4KQ9A 2GBPA 5KQLA 4B09A 4DQDA 4YV7A 3GRCA 1ZHHA 4EY3A 5FWYB 2PUEA 1LBHA 2WJWA 4FB4A 1BDHA 1CEYA 4MR8B 1TMYA 5DTEA 3M9WA 3IDOA 4IF4A 3QEKA 4LRQA 2IYNA 3GT7A 3F73A 3LFTA 3Q9SA 4YCSA 5IUKC 3M9XA 4CBVA 2IPNA 3MQ4A 4JB2A 1RXEA 1L5ZA 3Q41A 3ROTA 1KRWA 2L17A 3EULA 4XARA 2PUBA 5JS1A 1YK0A 4Z0NA 3QEMA 1SXHA 2WMYA 2L2QA 2M98A 4MLDA 1D4ZA 3CTPA 4ZYLA 1RZRA 2ID7A 2Q5CA 5IBQA 1QQAA 3QX9A 1JFSA 1NXPA 2WB4A 3O2SB 3EODA 4EYKA 1SD5A 3N0RA 1GCAA 1Z13A 4RS3A 4G97A 1YIOA 4WXMA 3IPAA 2JB9A 2RJOA 2E4YA 1LJUA 1DCKA 1WETA 2NZUG 1K66A 3GYBA 3LUGA 3VNAA 2QVCA 4KNYA 2MYNA 1JF8A 3LMKA 4Z4GA 3OO0A 1TM2A 1YMVA 2MSWA 2PUCA 3NNNA 4IMJB 5HKOA 2V0NA 1PNTA
chains in the Genus database with same CATH superfamily
4R5HA 1XVVA 4B5KA 1YRAA 2JLWA 1SCUA 5CFLA 2B2NA 1RAEA 4UOEA 2AI2A 2JCXA 4X20A 2ZBDA 4BJHB 2X1HA 7MDHA 1FBNA 5JJ5A 4D5GA 3U61B 2AUTA 3AHDA 1MQ8B 4PFJA 4RVNA 3UWKA 3AF5A 1Z35A 1Z0FA 1FS5A 1JT2A 3L0BA 3I12A 4ZT2A 1E69A 3OE7A 4GQAA 1CEXA 2ZR7A 1ZD8A 4J2TA 3B20A 4N54A 3VAAA 4IZIA 4H0CA 4Z0PA 3VR4D 1N2JA 4C0JA 5BSUA 3LCUA 1Z56C 3RB8A 3OQVA 4HFNA 1E3IA 1PUXA 3DBRB 2GQ0A 4GMKA 4MQFB 1L8QA 4KH0A 4BN0A 2YR0A 2ZDQA 3AERB 3WHPA 4B43A 1H0KA 5KC9A 1B74A 1XPJA 3BXFA 3QFRA 1BMFD 3STTA 2SKEA 3W5UA 3WLHA 2D2IA 2Q6VA 1JA0A 4J0QA 4OD0A 3ZR4B 4TLLB 1KYTA 4YUZA 3NKLA 5BSWA 2P35A 3K4PA 4Q3KA 3K8YA 4LCEA 5I51A 2WV9A 1LQUA 1RHQA 4XFJA 4C0KA 3NAZA 2GESA 3K09C 4KKVA 4NPAA 2DUUA 4KL8S 4UMVA 4LGMA 2WWHA 4RVHA 5BRAA 2EDAA 4N18A 5JSHA 5F21A 5K0ZA 1E9CA 4FDUA 4IEEA 1Y0BA 2FDRA 2VSYA 4MTCA 1ULAA 4KO3S 4WLFA 1A4IA 1DIHA 1QV7A 2PWPA 3FUWA 1K5PA 3FF1A 5DB4A 2DUMA 4PY2A 3RYHB 3SXUA 4YPVA 1DRVA 4NFLA 1Z38A 4QUJA 2ZCJA 2I7CA 2C7PA 2H08A 4IRXA 4R0VA 4V0MA 2XCLA 1X7YB 3HS3A 1Q7RA 2VN8A 4D0RA 1C4OA 4HLCA 4EHHA 1G41A 2NSDA 5EWLB 2J5RA 5A3VA 2M6LA 1RQRA 3F4KA 4BLQA 1GVHA 3OLQA 2G25A 3FWYA 3NMUF 4ZT4A 3I2HA 1AMOA 2GRAA 5C3UA 3V9AA 2XVYA 4LJ9A 1MV5A 2IYQA 2FEPA 4DLXA 5CW1A 2PGOA 4R71A 2GD2A 4M1MA 1RM0A 3WZ2A 5ALLA 4H6VA 2BC9A 4OQMA 2XF8A 4PS0A 9LDTA 5FWYA 1XDWA 4INJA 2XNSA 2FGKA 4DADA 1KVRA 2I2BA 1UBEA 4BNTA 5TGTA 4B6RA 2BFDB 3RC9A 5FWXA 2GYVA 4BGUA 3FPBA 3DV2A 2WIFA 5WRFA 4YMGA 4BU1A 121PA 2Q07A 2C3OA 4HATA 3W4JA 2QK4A 3PDJA 1TZMA 2ZRQA 2ZYVX 3ILHA 4IJUA 5DN6A 3SC6A 2WJVA 3TW8A 2DQZA 4RH3A 4LVUA 4FGUA 3CO0S 1Y3IA 1RCTE 3ZE2B 3MJCA 5EUQB 4IILA 3V8EA 3M1IA 1J0AA 4F0JA 2QMUA 2W2LA 1IZYA 3G2MA 3OOYA 2HQBA 4HXEB 4ZGWA 4C1NA 5E6RB 4CV3A 4M46A 1NVVQ 5I9IA 3NIFB 4H4DA 1AGRA 2EERA 3II6X 4CM8B 3WZLA 2X19A 5JS8A 2IBTA 3KSBC 1IVSA 4GI1A 2BGGA 3NWEA 3HKDA 1CRQA 3UJPA 4CQMA 3PENA 2NZWA 2OP0A 1RWMA 2F9MA 3L9WA 4P83A 4BMYA 2G7ZA 2A9KA 4EJSB 3ITKA 4E6PA 1NR1A 3WYNA 1QQTA 4MW9A 1QMGA 1OQAA 2VTEA 1DADA 1JDZA 3UK1A 2JGDB 1RPAA 1L7BA 1Z25A 3DOOA 4BQSA 1GZSA 4WUVA 3TW6A 5LOVA 4F04A 1XRQA 2OCDA 4II7A 2C82A 1KK3A 1JG2A 1RI2A 3C3XA 4LQLA 2J7PA 3G5TA 3QKTA 4ZYXA 3W5IA 1MQ9A 1KS9A 4ND5A 4EGFA 4BGDA 2E1RA 3E1SA 4BQFA 5KYYB 2RHCA 2OD2A 1CDZA 1OC4A 4OL0A 3PUJA 5FADA 4AKEA 3W9SA 1J06A 1K2WA 1I5OA 4MMZB 2GHQA 3NHKA 4QJ4A 4NENA 1S2OA 2NG1A 2NTVA 1R6BX 2O2CA 3RHFA 3T9DA 2Q3HA 4IIUA 2WIGA 3EIQA 4KXYA 2EFGA 3M6LA 3VYSB 3ZXXA 1FFYA 4E5MA 3NRCA 1T5LA 1VZ3A 2Q2QA 4K26A 1C2YA 3EHDA 3OVMA 4LF9B 4IJVA 5L3SB 2FAXA 2PA3A 1XCBA 2WKQA 2ZT5A 5CHEA 4AY4A 3T1OA 3WMRA 3KDSE 1E5LA 4NIMA 1J0EA 3LKZA 4GP6A 5DGCA 5BW5A 1XD2A 5JHHB 2BEUB 1V45E 3RJTA 1DG1G 2PIAA 1YQUA 5C9ZA 3A70A 2Q7DA 2YDYA 3ITDA 4IIEA 1QGAA 4MUGA 3TUZC 1QV9A 3TLBA 1ZM3A 1QIJA 2AC4A 3GGPA 4NQRA 4LX0A 1UBHS 1X15A 2Q6IA 4YMIA 1PJTA 4LJSA 2AQIA 4B3CA 1H05A 2GVDC 4NCXA 4BKOA 2WTUA 2O14A 1IXYA 1UDRA 3NJ4A 4AMZA 1ZCAA 4BUCA 4D43A 3L43A 3THYA 5FX2A 4D8TA 3BGIA 5MFZA 4TS3A 2FPXA 1XVIA 4MRMB 2UVPB 2O2YA 2I2FA 5HXAA 4G9EA 2HJ9A 4RHUA 1C3EA 1IBRA 1L4EA 2XYQA 3IELA 4H7FA 1C1YA 3AKZA 5DCWA 2FCRA 1P72A 4FS8A 3OHMA 5DYNA 3EDMA 3O5AA 2IP4A 2AFIB 2O3JA 4FDMA 4KZPA 2JAHA 4M87A 5ALJA 5M04A 5H8WA 2PZBA 1VJ0A 4X62B 4WN3A 1U0BB 1ZJZA 4Q34A 3L0SA 3AVWA 1CJVC 3QH4A 2FPPB 1FNDA 4W7HA 4Y0AA 1G17A 2AB0A 2JIDA 2I34A 3QE9Y 5BN5A 3ZE7A 3N8NA 3TE6A 3MB8A 3OPYA 1ZSNA 4GU5A 4KSBA 3OCYA 1FSPA 4B82A 3E9QA 3KJZA 2WD8A 4HDSA 3U4CA 4OAQA 4TYMA 5DYYA 4RHFA 3F6EX 2GEJA 5DM2A 2WJHA 2OMKA 3A4YA 4U2DA 3HJFA 1PJAA 5KSWB 2F2TA 2VUHB 3K4HA 1C7QA 3KU4A 2VT7A 2JHAA 4GR4A 1QKJA 3GEIA 2B8WA 1TJ3A 1NJGA 3ZIDA 4O4HB 1PR0A 1TFUA 4N0DA 4OU4A 2C2KA 1C81A 4Y3UA 5EWJB 4Z3DA 4AO7A 3R7DA 4E2YA 4QBKA 1XI2A 5EXDA 2CXQA 3IJPA 3LX8A 3DV0B 5DT9A 4B7CA 2C5FA 2PRIA 3F6YA 5L7WA 1RHRA 3WOVA 2BI8A 3SZMA 2JLRA 2NXCA 2OBNA 1TFRA 2WJIA 3JQ8A 4NR0A 4KYUA 1GFZA 3RFVA 4HAWA 3RG8A 2QSYA 2AF3C 1SELA 3KZCA 1GV0A 4IICA 4LXTA 3ROGA 1F9AA 1G3MA 2C7BA 5ALHA 1GG9A 3RGGA 1WRBA 3OICA 4RORA 5IDVA 1Y8QB 1KI9A 4BFVA 3UB4A 3GMDA 3VJLA 4DZTA 4ER3A 1WOYA 1HF3A 1VBFA 5BV7A 2DLCX 5F9FA 3D0KA 2BFWA 4BO3A 4NCHA 2O8EB 2XRMA 5GM2A 3SBDA 3BWCA 1KQNA 1ODIA 2WG2A 3JQGA 2HQ1A 2HHHB 3BBPA 3TDMA 4OUKX 2VF4X 3EPKA 5BV1A 3V00A 1U1EA 3D8RA 1AQNA 2EF1A 3ZLBA 2MR6A 1F2DA 4C4XA 5J43A 6GPBA 1F06A 3HGQA 2BDUA 1DJNA 1HPLA 1ISJA 1M1YB 1HDEA 1PDOA 1J33A 4E5NA 3SHWA 3DEJA 4GO1A 4N82A 4HEJA 3LT4A 1ZP6A 3TZEA 3IUNA 1JMVA 4PBSA 3I04A 1TGYA 2VYVA 4Q1EA 4H9GA 3DEYX 4CNBA 2EF0A 1V3UA 4DPKA 3BSFA 4EEKA 2VHUA 1KFCB 4GPAA 1QRDA 4AJHA 4F6CA 1E2NA 1OZGA 3EWAA 4C2AA 5HZHA 3QVSA 1ZC3A 3UAXA 1WOMA 1GP2A 1MRNA 4A0SA 5GZ1A 2BZ1A 4KAFA 3CPHA 1DDIA 1DRKA 5GJBA 1R3DA 3EFOB 2WG0A 4UZFA 1NOIA 3NTLA 3SC4A 1SIUA 4QRHA 3AB8A 5G53C 5AVUA 4BY9E 4QFDA 4CMAA 3KOWA 4UCQA 2PX5A 4LF7B 5A03A 1RR6A 1EX6A 4Q9IA 4B74A 1VZ2A 3T4PA 3CGGA 1DIBA 3WFZA 2QVYX 1PG2A 3DOJA 3LIIA 1H0SA 4HQKA 3BA1A 3LFUA 4AQDA 4ZGBA 4EI2A 5A3QA 4JVMA 1TC1A 3M7IA 1F3OA 1NVTA 4MO2A 4U7HA 1M1NB 4PCUA 1WSBA 2HV9A 5EZYF 4KYTA 4FBLA 3T38A 4F3NA 1YOVA 3N58A 1QH0A 3H6GA 1CY1A 5CBKA 3U4QA 4UUMA 1CUBA 1E2PA 1USGA 1BA3A 1DTWB 1YJXA 2NO6A 3F78A 4RKYA 4UMEA 1Q12A 1WUHS 2RB4A 3BDVA 4HK4A 4QOHA 1V37A 4BL5A 2H1FA 5A5GA 4BWYA 1TQDA 3T5DA 3JQEA 1YC2A 3LUKA 4J8PA 3L4BC 3JSXA 3EFEA 3AVOA 4BBPA 1US8A 2ZAMA 4IDGA 3SIRA 5IUNC 4KFCA 4KR3A 3ER8A 3KVOA 2R9VA 1X8XA 3I52A 5EPUA 1NLFA 5LQCA 4MGZR 1WL8A 1BGWA 1RFLA 1WPQA 3WDSA 1HETA 5DHPA 1UMDA 4OXNA 3IP8A 2VUIB 5KYTA 2QM8A 4ZZ0A 4K28A 1XZKA 2JFGA 3ORRA 3PGVA 2FXIA 3C7CB 4HLQB 4DABA 4AI6A 2UZ1A 3TNDA 5F64A 4V2UA 3U19A 4JC4A 4GC5A 1YRHA 1FJXA 1PNOA 1W94A 3U7EB 4LE2A 3VYUB 1U7XA 1D6SA 1PE0A 5DGXA 4JJKA 1SK9A 4EDFA 2CFIA 5G40A 2PRZA 3QFCA 3W3AA 3WBFA 1X86B 1CZOA 2LTAA 5AOCA 4P98A 1CE8B 4UU0A 4ZVVA 3VVMA 5AVWA 1KC1A 2VJDA 3BJEA 2FJ0A 3G5AA 3ZI0A 4MI1A 3BM5A 1APBA 1U2GC 5TQ2B 2BDTA 2GRJA 3EQ2A 2VDWB 2Q6OA 1J49A 4MUXA 1MR3F 1IRIA 1QR2A 4GMFA 5IEBA 3DZFA 4Z4IA 4Z4EA 2EBHX 4HNTA 1QE3A 5ALYA 3OQ6A 4YJGA 4BQIA 4F84A 1I33A 5IZCA 2PWAA 4YBRA 2NO5A 1TA9A 4FHEA 4JVSB 3HKEA 1IWBB 3LHFA 1Y3CE 2G1JA 2PUHA 3M5DA 4B9EA 1F8FA 2A1TS 3DWIA 4B48A 1GRCA 2IU4A 3TQCA 3WV4A 3ZTYA 1SR8A 1MXHA 1RHKA 3DNPA 1DUSA 1LW7A 2F9FA 1CU1A 1E5DA 1VLJA 2HXGA 3D7NA 4OKNA 4YJ2F 1EWYA 3L0IB 4Q6WA 3T41A 2UYCA 3DC2A 1U8ZA 4TPKA 2H63A 3LUAA 4WSOA 2PANA 1ZDMA 4NNOA 3O0TA 3WP1B 3WFIA 3ZLJA 1VL2A 2ZYIA 4AJ2A 2YVQA 4RTOA 2H4XA 2O7VA 5REQA 1OLOA 1BVRA 1UJCA 1MEEA 1W581 3A14A 3EQ9A 4GVPA 1GDDA 3JCZA 3AB3A 4BLVA 4P7BA 1E8NA 3F1LA 1MABB 3E27A 2HOQA 3JWHA 4KP7A 4O8CA 1CUAA 3CQ9A 4IOMA 1MX5A 3Q5EA 1QAOA 1A9ZA 4FYXA 4JOQA 4J1TC 3ZWCA 4EQZA 4RULA 4WZAB 2O19A 2FWPA 5JAMA 3ZZTA 4ND8B 1ES9A 2OZVA 1GAXA 4WADA 2PGDA 3SXPA 1N2BA 2ZJ2A 4GF5A 3UBMA 3PWTA 1VG1A 3ZHTA 1VMAA 4YRFA 2RAUA 2NU8A 3M3HA 3KXDA 3ZW8A 4E1BA 1EA7A 1I4EB 2H2HA 2RGUA 3HU5A 1EINA 1SWVA 3KR2A 3KAKA 5ENDA 4FB4A 1QZUA 5C1DA 3IQHX 4C43A 5FJIA 2VPPA 2NP6A 5A5FA 1U63A 2LE0A 2JARA 3E9DA 4C89A 1ECPA 1J0XO 5FYDA 3OKFA 1JHQA 1ORWA 1RXEA 2H29A 2WJ4A 4X7PA 1IBSA 2ZUUA 1KETA 1ONBA 1R4MB 3HYTA 1FYXA 4I4NA 3B5JA 1WW3A 2FRVA 3VR6D 5KNCD 5E9JA 4HJRA 4XQEA 1X1TA 1FVFA 3V8VA 1R0RE 3ZWMA 3TOSA 4D56A 1OGIA 3H1AA 4O33A 3DT9A 1PCXA 3ZWBA 4LOJA 1YBHA 3U56A 2IEAA 4N5IX 3FVVA 5BN4B 4DTIA 2IUYA 4V0OA 3DL7A 5DF1A 4OXXA 2JC3A 3O93A 3H5NA 1SD5A 1BYUA 1AF4A 4L5AA 4ZYYA 1CVLA 1BHSA 1HK7A 1A76A 3SYRA 2I91A 2F3RA 4ZOCA 4IKEA 2QVCA 2Q4EA 2AUNA 4UTNA 1LV7A 4PPNA 4ZXPA 1NAIA 2X6RA 2NMVA 4I8IA 4QE3A 4JI7B 2OR3A 1EVJA 1AM4D 1WQ1R 3NBMA 5J2TF 1ABFA 2C5SA 4DWWA 1KRXA 3EG9A 3G0HA 1M54A 1XTRA 1FFGA 2X9VA 4MCJA 3IBSA 1V8ZA 2H48A 1WZUA 3PE4A 1MOZA 4YONB 3DULA 1OAAA 721PA 2WWWA 3T9CA 2PMCA 1L5VA 2W6QA 1KDYA 1OPXA 3BKWA 4OI2A 2AZDA 3BQMB 2D7DA 3DXYA 2AV6A 1IUPA 1M73E 4JWKA 5KVQA 2MSDB 4YMHA 1D03A 4FFBB 4ITUA 1E96A 1KH1A 2K6GA 2ZSDA 4BIIA 2FW0A 5SZKB 2P2GA 3WGKA 4RTQA 3O8CA 1PJSA 3VKUA 5HBGA 1YDFA 3DZDA 1K5GA 2QV7A 4W5QA 2ZROA 1HE2A 3DTTA 3UUGA 3AF2A 3CZCA 4IDOA 2CSXA 4UW9A 4N5LA 3FOFC 2BISA 3ZE9A 4BGVA 3PUKA 5AVRA 1I51A 1M6VA 3ILVA 4GI2A 1JAXA 2P2CA 2BM0A 3EAQA 4HDOB 4D0SA 4G01B 5EZSA 5JV5A 2Q3MA 4EH1A 1Q7EA 1FFAA 3KEOA 4G4SP 1NVVR 1XQ1A 1R0KA 3PC8A 2NUTB 4JP2A 4YT4A 2HGZA 1IN8A 4MYRA 5KCZA 1Y8AA 4ARUA 2EYQA 1ZS9A 4V39A 5UKDA 3U16A 4E14A 1NRJB 2RGYA 3K0CA 4MKFA 2XQFA 1J2RA 1OV4A 2GD0A 2GM4A 1TCAA 2XE7A 3GF4A 6PFKA 3FYTA 4LG1A 5HPYB 1KOGA 4C06A 4FEGA 3OZUA 1VOTA 1WW2A 2VOEA 3T3PB 2MMCA 2DBVO 5DWVA 4EUEA 3TIVA 1H4VB 4G0OA 3AIOA 4Y2VA 5AVOA 5JJKA 3HVIA 1XELA 4S1OA 1SBZA 1MO4A 4LWOA 3BXGA 1PQUA 3H0KA 2RHLA 3BXEA 4WECA 1YF3A 2RJNA 4W8OA 1NVDA 1Y5LA 3I9JA 4G5OA 2Z1MA 4BRSA 2CHVA 2P4SA 3S28A 1ONPA 1W5EA 5ABPA 4NCJA 3ZJVA 5FLEX 3ZX5A 3HUFA 3JYNA 4HH1A 4P3KA 5I9MA 1P5HA 1YL7A 1NUUA 3D3QA 1Z62A 3K9LA 4UFOA 5DNAA 1YZ3A 1U65A 3U49A 4R7ZA 1QTNA 4EY4A 1O95C 3MWEA 1SOAA 1UP6A 1I01A 2EKQA 2QTCA 5FUWA 2IC5A 4CUZA 3KB8A 2R6ZA 4QEDA 4XUCA 4BNZA 1P1HA 1MPXA 4Q4AB 4ZD6A 3V4SA 2FQQA 2WWRA 3DW1X 2NW6A 4HVAA 4RVGA 3UVEA 1E1CB 2O2DA 2VXOA 1XXHB 4Y0VA 3S8EA 3R3ZA 1OWLA 2DTXA 4IMIB 1ODLA 1EK0A 3QUSA 4UREA 4MQFA 2ET6A 4NBNA 1EGHA 3OCWA 5IJXA 1A98A 1RM3A 1AHIA 4XE5A 4P7GA 5KWEA 1IWPB 2HJWA 3N2EA 4INAA 2OO3A 4U7TB 4N49A 1Q3KA 5KQMA 3LFHA 3FI9A 3O4GA 5CH5A 4CMJA 3RC1A 3MBIA 2WIJA 1OU0A 3U26A 4EDHA 3VTAA 4CGZA 2D62A 3L8HA 4RUKA 3DFUA 4W5NA 1Q0PA 1F4VA 3GLVA 4PYLA 3UBTA 1CZRA 1GNPA 1SBQA 1XWIA 3NO4A 4G4IA 5DPMA 3CUTA 3UMMA 3N2NA 3W9UA 5ALWA 4BKMA 3DD1A 4BQNA 1U8TA 2F17A 4DV0B 2V3WA 3R4VA 1N2CA 3D02A 1XTKA 2XUZA 3G2QA 1K68A 2Q5OA 1DZIA 2OLKA 1R4AA 1V11B 4HOYA 1IPHA 5SY6A 4RTRA 1O0CA 3ASZA 5AQ1A 1YJAA 3NVAA 1E2EA 3D2AA 4TX1A 3DCNA 2B99A 4IIJA 1RZRD 3DKKA 1DKQA 2ZYSA 4LJYA 1GPJA 2F8TA 3PQ2A 1CHNA 2QX7A 5BSRA 4WBNF 1RYNA 2I8CA 4C30A 3ANXA 1EQAA 3HUTA 4I5DA 2J59A 3BMXA 1KPGA 2QSJA 4DANA 3E9CA 2R6AA 4YIHA 1C50A 2C2ZA 3VPFA 4ZCIA 3C5VA 4EG6A 5ADUS 2NOAA 2IU0A 2AJCA 5ALEA 5AUOB 5JCOC 1ND5A 3OMXA 1B6TA 1CQXA 4A03A 5AW8A 4H3KB 4JL5A 3C1OA 2GYWA 5ED0A 4X94A 2DPYA 4GVXA 4QUKA 4BNDA 1WB5A 3R7WA 4XRGA 2CLFB 3PFGA 5LXTB 1QAQA 4IOKA 2XDAA 5TEVA 1I4WA 3GCXA 1WEKA 1W87A 3SOZA 2QWXA 1NFRA 1ZXXA 1YU9A 2X22A 3PXAA 2OZLA 2PRYA 2C4MA 2E1PA 5ALZA 4CR6A 2W0SA 3IMCA 1SVKA 1NJSA 2FUKA 1PS0A 2ILTA 2CSUA 4IHJB 1AUQA 4QFMA 5IG2A 3S8YA 1DB3A 1Q3TA 2PT9A 1INLA 4MROA 1M2GA 1QIHA 5KNDD 4TYWA 4FGLA 3DE2X 4TM8A 1NNUA 5FEUA 4I2NA 2JFFA 4OGLA 3AEUA 3DO8A 3E0XA 4FKMA 2ENWA 5GIOE 2WZBA 1CUDA 1MVLA 1CC1S 2DM6A 1NQUA 2NYVA 2YWHA 1QYVA 4IGFA 5JC8A 4YJ2A 3S2IA 4ERXA 4ZIRB 3H2YA 1L6IA 2X3YA 4G37A 4WDRA 3NTVA 3IP7A 3WWCA 4LY9A 4DIOA 2NSJA 3EE6A 3H2HA 3UH1A 1K5HA 2QD5A 4QYIB 2FP3A 2DFPA 3P9YA 3AF3A 4R1OA 2H17A 1F20A 3F7MA 1G5FA 3IEKA 1X7WB 2RG1A 5FUVA 5CA0A 3SICE 3ANMA 3ORQA 2P2SA 4DOMA 4V24A 1TO1E 3HEAA 4B6PA 4E5KA 3NALA 3KR0A 3DMPA 3KO8A 2JI6A 1OYOA 2AW5A 4TZ6A 1S0UA 1R9JA 4YLGA 1KZHA 3TM4A 3FMPB 1D7OA 1NN5A 3GNLA 3N6XA 4EW1A 4EHDA 5J3JA 1MW8X 1UMBB 3H5OA 1DBWA 5JYCA 1I2ZA 4BZPA 4EYOA 3BPSA 5TJHA 1CJKC 3RW9A 4C4PA 1GN8A 4KWEA 2ZEJA 4Y6PA 2H4HA 3K5PA 3MGAA 3VZSA 1BCSA 4DUYB 4MYDA 3MVEA 1G1AA 3TX6A 1GPAA 2UV8A 3DL4A 4B8YA 8LDHA 1OAOA 2YBEA 3EC7A 2BM8A 1M2JA 3S2UA 1NDQA 4URYR 1T0IA 5FR1A 2QQ5A 4I1YA 3OEEA 4V03A 2V9ZA 4JLVA 4TLAA 3BGSA 3PTLA 3QUBA 4UD6A 3TMKA 4EY7A 1U0LA 2F1KA 1U2DA 4IH9A 1GGEA 3PB3A 4KX5A 5KU7A 5MN6A 4DVGA 2MT9A 2ZBEA 4XX0B 1RWBA 1XDUA 3C4JA 4HFMA 3O8OB 3WB1A 4D8WA 1A96A 3NHAA 2W6NA 3DJYA 1LK0A 1XQVA 3B9RA 2DU8A 2I8LA 3JAMA 1YQXA 1XEXA 5EHIA 3TYXA 2IYSA 2WIBA 2C2BA 2H1LA 4ARSA 4M0FA 1MMFB 1U2EA 3LUCA 4F56A 1WQ3A 2QN9A 4FS3A 4IWNA 4KK4A 4ZEOA 3RVKA 1O5OA 2WKRA 1DQRA 4GBED 1QYIA 4ER6A 4DY4A 1V1RA 5AVYA 4NULA 4UE6A 4J0IA 4DBVO 2WA2A 3TZLA 4BMNA 3OSZA 1MA0A 2I4TA 3DNMA 3EC1A 1V4NA 5JZSA 3PR1A 4WK4B 3CS3A 2XNDA 3NJ8A 5FOSA 4FEYA 1AS0A 4RIIA 4AY3A 1MGPA 3AR7A 5DM0A 1B8NA 5B6IA 3NGLA 3C6YA 4ND4A 1PWZA 4OHXA 4E2ZA 3H16A 5JXHA 1XPOA 4CI0B 3WAGA 1JLHA 2GHTA 5JNVA 4WZBE 2J3LA 4RZUA 2FETA 3HKCB 4WCFB 3V97A 3W9BA 1JZQA 1ZOIA 3KQYA 4FLMA 4P1ZA 2JCVA 5I3ZA 4EJ0A 1FW6A 2J0QA 1XKTA 3DMGA 3ZZ0A 3SR0A 5B6PA 1LFAA 3PCRB 4CR7A 3GJ5A 1ZK1A 5CLIA 3DOHA 1TQ6A 4JNCA 3RC8A 3KOOA 1ZIYA 2CEKA 2OT3B 3FH0A 2A94A 4EJFA 2AUMA 3K6SB 4HNQA 5J47A 2A35A 1W29A 3DE3X 2IYOA 1X9GA 4J0CA 5FNZA 3ZCSA 1FLVA 4RH1A 1IYZA 5KMGA 3Q7PA 5KNDA 3ODPA 1ACLA 1N6OA 4BV9A 1AV6A 4K87A 1PN3A 1HE5A 2JCBA 3CH5A 1Z0DA 4JODA 4Q01A 1CT9A 1T8YA 3EQZA 1LX6A 2IBMA 2F48A 4NP6A 2WW8A 1YZTA 4B35A 3N0XA 2JKZA 1Z82A 1ZCBA 3AUUA 3N9IA 4C7BA 4J6FA 4TN5A 5T8KC 4BJ6A 4Q00A 1ACMA 1UAGA 5CMLA 4HVTA 5AXBA 4FNMA 3A1VA 4FWBA 3AY7A 4BNKA 2EBUA 2GF2A 2YICA 3B82A 5IAKA 3EXAA 5K6AC 3O8DA 1CUIA 2JS7A 1KFEB 1PJZA 1RJ9B 1X1EA 3L3BA 3PNLA 4GLLA 3QUAA 3F47A 1VHJA 2YWJA 3PC8C 3PPWA 4YGXB 2NZJA 1G4HA 3U4HA 2HN9A 1P1JA 1QVVA 1FC0A 3THXA 3PXBA 5LQSA 2FZVA 2JLBA 2WT4A 4IIJB 2P27A 3KWLA 4H1HA 1U5CA 5IABA 1M8JA 1ZX1A 2FOLA 2HDHA 2V6GA 1ETUA 3QKSA 4BRWA 5LP6B 2B61A 5FQOA 2PVSA 5ETJA 3STYA 4E4TA 3DP7A 5D7BA 1V3VA 3LUFA 1KAGA 3MB5A 4K03A 1ZVJA 2GZ3A 1YUMA 2EZTA 4D1YA 1CETA 3F9CA 4F8YA 1UANA 1NBEA 4C0BA 4ZZ1A 1K6JA 4MRVA 1ZL2A 4MGKR 4CRWB 5I7HA 1V16A 5TQ0B 1GPLA 1XMXA 3JVUA 4C0HA 1VJRA 3ANNA 1EA5A 1PZNA 5EE1A 5JXIA 1L5HA 4NG5A 1EM6A 4US1R 1T15A 4MS3A 2B5OA 1NV9A 4QUHA 4NE9A 1KJNA 2FPGB 3AXSA 4EA8A 4XIYA 5K0GA 2BGTA 4OJQA 3DWFA 2C03A 4FD2A 4XB2A 4HQFA 4PAGA 5FLYA 3I28A 4PGAA 3JARA 4IUDS 4YQEA 4DKXA 2IDMA 3HO6A 4Q16A 3RKRA 3SS7X 3TDNA 1GQYA 3PGXA 4RHXA 4C3ZA 2EEPA 1SD1A 1Z26A 2GZRA 2OHIA 1GQSA 3NB0A 2VK1A 1WDLA 4P81A 1W5FA 3D3WA 5GMOA 5B64A 3FYUA 2VNJA 2ZRDA 5B58C 1G0OA 1K27A 1W5SA 2NZYA 4F5WA 2RHBA 3OM1A 5E7IA 3VVBA 5FWNA 2QDXA 3UUEA 3R6TA 5B37A 3VYRB 1T6NA 2C2YA 3QV1A 4HCJA 3LRXA 1RI3A 1HYBA 2DT8A 3KOUA 3LLVA 3OO1A 4C4OA 4JVNA 4ETIA 4QOIA 1WY5A 1WB4A 1EJ2A 3OY2A 1NRIA 4TKUB 4H59A 1GEEA 3J81k 4YNBA 1LX7A 3GH1A 1WJGA 4YCBA 5A71A 1YI0A 4B3DA 4L3OA 1UPUA 3OU7A 3ABOB 2C0QA 3WGJA 4PAWA 2PGNA 1Y8RB 1C14A 5FWYB 2OQVA 1P1FA 1DKOA 2WVJA 2K2QB 2A2ZA 2XY4A 1CEYA 1TCCA 4I0WB 1DNPA 3AF0A 4R01A 1CE8A 3TL6A 2OORA 2VJMA 3TLYA 1CY0A 3U17A 2WG1A 1E2DA 1Y4UA 4BFYA 3P71T 2YZKA 4FOOA 2OO5C 4HWTA 4MSUA 1XMQB 2OFPA 3NLLA 1Z08A 4BX2A 5K8VA 5L3QA 5LNK6 5ELXA 5ECWA 5DTIA 2UZ1B 1LD3A 4BJ5A 1YK0A 2CXXA 1M1ZA 2C96A 1SXHA 2GSDA 3Q7QA 4Y2PA 3SIPA 3RM3A 3TH5A 1NSTA 1P0MA 3NRJA 1NN1A 3DAPA 1DJOA 3HSKA 3HDJA 4JGIA 2QMEA 1JXMA 2V7VA 2YN2A 3WBJA 1AGXA 2SCUB 4NBWA 5M3BA 2XOKD 1H2FA 1GOTA 2FLVA 4FZRA 1N5OX 3VR5D 3KUDA 2QRQA 1JG7A 4GWGA 4Z0TA 1BE6A 3KQOA 3NBZC 3QKRB 1DAOA 2BI4A 1JJFA 4D4KA 3H9BA 4UEOA 2GJ4A 4X66B 4WL0A 3EUWA 3HA7A 3VNAA 3UAVA 1JEOA 2DY1A 3DUFB 1GR0A 5D5QA 1QQ6A 4AMBA 5CVTA 2D8AA 3AUAA 4CM1A 1VPLA 2V0NA 3QXGA 4PQGA 4UAUA 3GCGA 4Y6QA 2ZJFA 3CZPA 1J21A 1YS1X 2R47A 4HG2A 3VVCA 2VDLB 1OX4A 2G71A 2NPOA 3FCAA 3LYAA 1JQBA 2Y93A 4RENA 4S1WA 4ZVOA 3UOGA 5D1NA 3PUHA 3NHWA 2ZBQA 3NXKA 2WHQA 4JEIA 1AU9A 3CLTD 1VSUA 5F73A 4IIDA 1RWKA 2SICE 2JBHA 4HSEA 4PIPA 1IM8A 3VR2D 5BW4A 1UCFA 3MGKA 4YCCA 1JQKA 1P0CA 4TSKA 3K70C 4HNAA 3HI4A 2XLBA 2J9FA 4E5VA 4EPTA 1K9SA 1JNYA 2HLHA 2VZ0A 5LZ2A 4BVFA 3W06A 2COEA 1JH8A 1PI3A 4QU0A 4BTEA 3HRIA 2M9MA 1GR1A 4PG4A 1DO8A 3GP5A 4RD3A 1U2PA 4YH1A 3KWFA 4KV7A 4G67A 3A2NA 2PQ0A 4LGVA 2II6A 3GWZA 4GQIA 3SZOA 1AY0A 1N5MA 4UBOA 3ZVLA 3GJ8A 5FIUA 3OURA 4BRZA 5IBCA 1M0SA 4DNXA 3A9VA 2CYCA 1OU4A 4DG9A 4H7KA 4J0DA 1XTQA 1KP9A 1SZPA 2FN4A 4CKXA 4EJMA 2OAQ1 3U4DA 4LZLA 4KVZA 3LECA 1YJQA 1SULA 3EF3A 1B0UA 5H4GA 4BZXA 4XIGS 2FZCA 2VK8A 2H1IA 4II3A 3EDYA 3VZPA 4Q1CA 2RKBA 4O2AA 3GDHA 2GFQA 3QXJA 4YRDA 3TGWA 3BMQA 3FVQA 2FZ5A 3LHSA 3K9CA 3PNPA 2IHKA 3MS2A 4G89A 2P1RA 3M1LA 4F93B 3FUUA 4FHCA 2Q8NA 4XLTA 1T8PA 3WIOA 5J4KA 3W5AA 1O58A 3BH0A 5J2UB 4DQXA 1A8UA 1XMVA 3JYQA 1ZVQA 2ZXFA 3WL6A 5EIHA 3HU3A 4RMNA 3WS7A 1M5TA 2ZJ4A 5JH7F 3UWSA 1I9CA 2PV7A 2AKYA 1YHZA 1W5AA 4B34A 1EP3B 4QPNA 2RDMA 2REBA 3UT6A 5HDBB 2RONA 2GZMA 2J67A 2R48A 2N42A 3ER9A 2B2XA 2Q5QA 4NJOA 1YRWA 1PL0A 2XE6A 5FP0A 1H65A 4QLAA 2CV0A 1V48A 1Z0AA 3HY4A 3IALA 3UZUA 2QYSA 1ZH0A 4MEJA 2A88A 3RU3A 1K97A 3QNWA 1RQNA 2XGSA 4C6HA 4CNQA 1YD7A 1JAZA 4GSLA 3HNOA 1P8JA 4KXLA 3VH2A 1HWYA 3IHKA 1D6JA 4L78A 1LKZA 1NLMA 1DXOA 1M34E 1N8TA 1Z63A 4MYUA 1PZHA 4BVEA 1KY3A 2WHEA 4FW8A 4LYHA 1OLSB 3NBXX 4MB6A 4KQEA 3KYCA 1XNHA 2DR2A 1A9OA 1J1ZA 3ZJTA 1B42A 1RWPA 3KL2A 4OF4A 1OVGA 3GZJA 1QG6A 3GIDA 4CLOB 2Y67A 2Q29A 4AJEA 1L9XA 2ETVA 4L4RA 2GILA 2DSTA 1WUIS 3W5DA 4LPKA 2XUPA 5CB0A 1NMSA 4A73A 4D79A 2CHUA 3B6JA 2AOWA 3ICCA 1Y48E 5I7RA 3PPXA 4PINA 2FTKE 4JBNA 5MN4A 3D4NA 4KX3A 3KR1A 4F60A 3G6WA 5IVHA 4G65A 7GPBA 4OXKA 5E2IA 2CBXA 1DHTA 3QVGA 3MBKA 4U2CA 5H02A 4TV8B 2W83A 4CLXA 1BXZA 1UJ4A 5LP6A 1MLDA 2JGRA 1Z9BA 1GV1A 3AILA 4H1TA 4OSPA 4RABA 3I9FA 4TXHA 4FI3F 3TOXA 1WF6A 3WLKX 4DIEA 2YKGA 1JPNA 2IEBA 3VDRA 1QC5B 1Z17A 3Q3IA 4HWPA 1FP2A 1QV6A 3M5WA 4P58A 4E1VA 5J1TB 3ZGZA 2IS6A 2V65A 1WCV1 2YWDA 3F3MA 1GJRA 5KNBA 1Q1NA 1U7ZA 5DHQA 2VJMB 4PZAA 1CQJA 1YRYE 4LNAA 1POWA 2PNJA 1T5TA 1T2CA 2Z0MA 2O3RA 4GEGA 3ZWPA 1D2RA 5EJ9A 2K2WA 1RXVA 4QAQA 2Z2XA 4ZFNA 1Z0ZA 3T4EA 4L9RA 3R23A 4U5XA 2G6TA 1E8MA 3QPUA 4FX2A 5A04A 1JFVA 3NHPA 5K3CA 3TBHA 4GW3A 5HQ3B 1AZWA 1PLLA 4ND6A 1TPZA 3KYDB 4RK6A 5T8KA 2EZUA 2V7PA 3BK7A 4RZ3A 2G4VA 3PE6A 4O3MA 2WTBA 1FFXB 4U3JA 2GUGA 3U7QB 1A4RA 3FWHA 3RYFB 5E6UA 1AKQA 2VT6A 4F3TA 4A2PA 1WDKA 2C42A 1W5TA 3HADA 3HA3A 4DJFC 2EKBA 2HDOA 5K4HA 3ES9A 4G41A 5CVVA 1PSWA 1F5NA 3U40A 3GPDG 4H2DA 1QP0A 1BHQ1 5CYFA 1F17A 1MAAA 5T4FA 4DQVA 4PZPA 4F21A 3JD4A 3A3PA 2HJVA 4XVQA 2Q7OE 4B17A 5JHGB 3K2BA 3FVTA 4TTIA 3QVVA 1QYRA 1R6AA 1GL3A 1M2NA 3LV8A 5CDFA 2QOEA 1GSIA 4EPWA 3A26A 3HFRA 1LF5A 1Z12A 3U81A 2AIRA 4P0PB 2ZUBA 3SKYA 1Q19A 3KSMA 4AU1A 2GFHA 1LBIA 3UXHA 3LT2A 2R8PA 1YL6A 2OENG 2QRUA 4BQQA 1ICEA 1OIWA 3OT1B 1JDBB 4OIMA 4ZOEA 4IQ0A 4ZTBA 2XRYA 1Q57A 3B48A 4KQHA 3AGQA 3ZQKA 3V9PA 4S3MA 3EXEB 4M0EA 4QJIA 2HH9A 2FPRA 2ZBRA 3VC3A 2AMVA 4KOEC 2PQ6A 4AWXA 3RYCB 4GP7A 4LYYA 2PSFA 3AUFA 3IIJA 4B8ZA 1JN0A 1OBVA 1OWMA 1QQ7A 5CT5A 2XE4A 4M99A 2OV6A 1EEXB 3MT7A 4PPYA 2HU7A 3AG5A 1JG6A 4CM8A 4MULA 1ESEA 3X1MA 3JTEA 2C29D 1T2UA 4M9XA 4XIFA 4NV1A 4JOCA 5JWOA 1S8AA 1XQYA 1NGSA 1KVQA 1U28A 1U5BA 3AJDA 3Q9NA 4MP6A 2EDCA 1DLJA 1U3TA 1XCGB 4Z2YA 3T6KA 1J5PA 3OLWA 4UM7A 4YLYA 1X1DA 2IITA 3HL4A 2ERYA 4ENSA 2BGIA 1NUPA 2QVZX 2XUQA 3LVQE 4BO8A 4POOA 3GLHA 1VA4A 1R15A 3K1JA 2EZ8A 3JAKA 4HWGA 4BV3A 1FU8A 5IXJA 1CB7A 3L7YA 4ZN6A 3P5BA 2D54A 4ZV9A 4X91A 1Q1EA 2BGUA 4MINA 2EWMA 1E64A 4JITA 4ID3A 3E5HA 2LIVA 3B2EA 3EW9A 3KQSA 3R24A 4U6NA 2CXOA 1R0LA 3SM9A 3VNVA 1G60A 4LW8A 4R2LA 1J4AA 4XSVA 3C6KA 3RWBA 3TLGB 3O2NA 3WVNA 1NF3A 7ADHA 2B4QA 1DTSA 3F4LA 2JAQA 5K2OA 3MT8A 3R3HA 1EFAA 4I50F 2PKQP 5HFAA 4QULA 3PEUA 1TYDE 2QGZA 3FUCA 1U9IC 1ZI9A 3AOGA 4IGAA 2G82A 5KOIA 3PT9A 2ZSUA 3QVJA 1NQXA 1SK8A 3MWDB 5JRZA 1EUZA 1V3TA 4PEVA 4PN7A 5JXGA 1SVUA 1UBOS 3K0CC 2E3JA 4WK6A 3JXEA 3IUSA 5I7OA 2OO5A 5IVIA 3Q3GE 4ARAA 3PITA 3KLNA 5CP8A 4BXOA 1QKKA 2WSIA 1RMQA 1E5VA 1QGED 3DR3A 5A4IS 4IX1A 2VQDA 5LBTA 3VBEA 4B1FA 5EQTA 2ZIXB 3E58A 1I7LA 1CZHA 4R2XA 4ER0A 5HA5A 1ST3A 2Z57A 4M1WA 3WL3A 1A7UA 1M2FA 3DOFA 3NW9A 4WAUA 4CVNA 4DGQA 5KNBD 2R62A 4AKGA 1BG6A 1UMKA 2ZVDA 4YCAA 2G0NA 2BEJA 4ZO6A 3HCCA 2UAGA 3EDOA 1SQ0A 3ROEA 3KKPA 5CCBA 4LJ8A 4LTNA 4WNYA 3WNZA 1L5YA 1XAHA 4P0TA 3ACCA 1VE5A 4TTJA 1F14A 2RH5A 3D64A 3DS8A 2Z08A 1B4DA 4CV2A 5KOYA 4KE6A 3RLFA 2YYZA 1XCLA 2WT8A 3NOVA 1B3BA 4ECAA 1WPXA 2LNDA 4XB1A 2NTJA 5DKFA 3H6KA 1IMOA 5KJEA 2QUAA 4OM8A 3TXYA 3E48A 1IOWA 4FSXA 4AZ0B 2PUDA 1NYLA 1YAJA 2QTRA 5BN5B 2YZ7A 3GU3A 3OTWA 4D0GA 4H7EA 3V8BA 5I5EA 4MQBA 1PG5A 3HJHA 1ACJA 2ZRJA 4NCIA 1AUXA 5CJ2A 1W2WB 3HPQA 5BNFA 4ZEVA 5YASA 1BX3A 2IXAA 2P5SA 2ZTUA 3FSGA 4HYYA 2PL3A 1E3DA 4E3WA 2HB6A 1QZ3A 4R9RA 3ASVA 2ACEA 3KOMA 3PHBE 4IDBA 4J6EA 4LC1A 2LGJA 2A9RA 2WZDA 4IOJA 4OJMX 4CTMA 5LOVF 1I13A 4J7AA 1XKLA 1CVRA 4QYTA 1D4FA 2IUSA 5JNTA 1ZSVA 5AM1A 4EARA 1IZ8A 5AKGA 1HI9A 3H84A 5DNYB 5T6BA 1N8SA 4PE5B 1BCRB 1PGOA 2QEQA 1TKCA 4MS3B 5FO0A 3X3HA 5BXQC 5C18A 1QZXA 3MK31 5H70A 4ERNA 2IYPA 5K8CA 3EF1A 3UKOA 2B25A 3ETJA 3T5BA 1LY1A 2CD9A 3AONB 1L5KA 5HW0A 3BD6A 2P9FA 1WSAA 2DLNA 4OH7A 2OGTA 5H0IA 3BCHA 3GLGA 3M6AA 3TLEA 1LSOA 1RHUA 4XM1A 4W7IA 2F1OA 2R6DA 4H6XA 2OFFA 2ASVA 2GDJA 2JEYA 5EL0A 2H57A 4I1PA 2Q9BA 5G02A 3RWOA 1PK7A 4TVBA 2I9PA 3I2JA 1IOVA 1P9WA 3EIFA 3QNMA 4GOKA 4N8SA 1V8OA 4NYMR 4Y0NA 4YJHA 4F96A 4DLLA 4GL2A 1G6HA 2FFRA 3CZ9A 1LZLA 1YNOA 1TQ8A 2WTEA 3HO1A 1YQQA 2CF5A 2YTZA 2ZUDA 1OBOA 3CLSC 5ADWA 1QRTA 2ROQA 4JUAA 3Q8MA 4JT9A 3KDAA 5JPCA 1CUGA 3FTCA 5B2ZA 4RJKA 1CKEA 2HIGA 3RR2A 1GA4A 1T9CA 2YWBA 5LMUB 4JJEA 4H18A 4QOSA 1IRXA 1C8KA 2YHSA 3O03A 2GPWA 1A27A 3EWNA 3GHYA 2E4VA 4P4TA 5EE0A 2VDQB 2CL6X 3RWMB 1BXRB 4DCPA 4D96A 3GRYA 1ST2A 1DU4A 4MVJI 4O4JF 4EGSA 1AO3A 3JVEA 5GOTA 1QDEA 1RFGE 3ENWA 2C2HA 1NQ5A 3NOOA 5KKNB 4WZAA 2GCGA 4PSUA 4EL5A 1NVMB 5K8IA 3A2LA 5EHGA 3H75A 1Y5NA 4I81A 3U3MA 5HTOA 3QWBA 1NW8A 1IM5A 4OP3A 4E2FA 5HF6A 2ZB4A 2PT5A 2BHSA 2ST1A 5JSQA 1N1GA 3GDOA 3R9XA 3C3EA 1KY5A 1T6YA 1HYHA 2J5BA 4CFZA 1QCDA 1A77A 2WR8A 2XAAA 1KEEB 3MYRA 4ZDJA 3FSEA 3EFHA 5EY5B 4DMCA 4MAFA 5KSPA 3BORA 4KRXA 3T61A 3OD5A 1XD8A 2J0VA 6REQB 2YOGA 1V7PC 1I7PA 2G76A 1I6KA 1D4OA 3HUDA 3A1CA 2HEGA 3Q8KA 3GJYA 5FLXA 3BICA 1AQ6A 1IQRA 1RQ7A 2PEZA 3ML1A 4G3XA 4N6GA 4PVCA 4IEFB 2ZU6A 1L4FA 4GQBA 1NIPA 1VL8A 3WMFA 1H4QA 1GNRA 2OBMA 2HHJA 3L5KA 3TNYA 2IS1A 3N07A 1Z6YA 1RTKA 2BMEA 4DRXA 3PIIA 5CDHA 1NR7A 2CXUA 1GZ6A 2DY0A 2F3QA 2FPKA 5ALGA 1I32A 5LQUA 2C97A 2VDWA 4Z7QB 2YY5A 1KEPA 1SCIA 2ZZKA 4G5HA 2WFAA 4ZC1A 2W6MA 4G5YA 2PZAA 1XIVA 3M9WA 4B71A 1G38A 3KHSA 3HR7A 1LVGA 2YBDA 3ULKA 3VFDA 2AGVA 3GT7A 4HPJB 5J9FA 3TBFA 3I1FA 2BGRA 2IPNA 2FH5B 2NVBA 4DWVA 1D2EA 3LS2A 4FHDA 3FCEA 3U1TA 1GGKA 2P11A 4D9BA 5BWLA 5JS1A 3PUZA 5KREA 1H3FA 1D4AA 1QJCA 4Z0NA 5CFNA 3LCRA 1G291 1PKXA 5CBPA 5AVJA 1R00A 2A1TR 2ID7A 2PMEA 5KX5F 2V96A 1EZZA 2HTFA 1JLRA 2PMKA 4G2TA 1W4RA 4JU8A 1M74A 4L07A 1C4XA 3K6KA 2YVKA 1CUVA 2Q3EA 3IH5A 1GDTA 4OX9B 3IAM1 5FBZA 6REQA 3WB2A 1NIJA 1A9YA 4JNKA 1M3SA 2QNIA 2R7LA 3ET4A 3ORYA 3OY7A 3QXCA 4DE5A 3AUKA 3W8RA 3FOCA 2TMDA 3CY6A 1IG0A 2GA9A 5JS7A 4K1XA 1ODCA 1YS9A 2DFKB 5B1SA 1U0OC 2ZTVA 2P9JA 5ITWA 1N3BA 2ZI7A 4IFIA 3RUAA 4AN1A 4BLTA 3IULA 4ZT7A 4S05A 3D59A 1RAHA 5B6JA 1FP4A 4WQMA 5KB3A 4MEBA 5JZMA 3EYAA 1YQGA 4MVJH 1JEEA 1FS4A 4BQRA 2GXQA 3KNZA 3VZCA 1T2VA 3NDBB 1JALA 2BRUA 3IQIX 4WLUA 4JV5B 3K15A 5GV8A 2JKYA 1EVKA 4UPVA 4G6ZA 1DE0A 4MV9A 3EY4A 4JWTA 3K2QA 5KVSA 3ELYA 4EKNB 2W2PA 2W22A 1E9VA 4FE3A 4NBUA 2XWJI 2ZLBA 2FY8A 3R9IA 2NWQA 2F7SA 1BMDA 1XLWA 1PJCA 2I2DA 3W05A 3FJ1A 2BKXA 3WYBA 1C0EA 4KN8A 2QM0A 2HCRA 2QMYA 4BKQA 1SG0A 2L82A 2O50A 2YJGA 3FWNA 3FRIA 1YDWA 5DVZA 2EFEB 1RP1A 3V4VB 3RYCA 3FCSB 3LF1A 1KMNA 4Q4AA 5DHAA 4Z99A 1C7JA 1JB1A 3HU2A 1ZMTA 4MKIA 4QM7A 3THXB 1N0HA 1Q0HA 2BKUA 2FPUA 2D1SA 1JMKC 1MJGA 2AZTA 1EFKA 2W2MA 1PL6A 2XV1A 1YOBA 3H9EO 4N0MA 1PJ2A 1X38A 1PV4A 1W0JD 2PKRA 3PPVA 4LMRA 3M6UA 4MR7A 1YHNA 4JQZA 4HYQA 2ODAA 2QYTA 1U28C 4MIYA 5TPWB 3VPBA 1O57A 5H7XA 3A04A 4B4KA 3KSZO 2OHXA 2XGMA 1NWCA 2QX8A 1Z5UA 4UTZA 2I29A 1OT3A 4ZCLA 2VF2A 2D5BA 1S6YA 1PU2A 4I1OA 4XSGA 3U60B 5CK4A 4RK4A 2A92A 4KQ1A 1R9NA 2V0GA 3HO8A 3A06A 1Z18A 1JQLB 4MUYA 3G2LA 4DMKA 4C07A 4EF5A 2GXSA 2J9XB 2CLHB 1AD2A 1G20B 1TVEA 2X8BA 1NSFA 3K05A 4FMDB 4YC7A 5HKAA 4J94A 5D3KA 5FI1B 2H1HA 2IGTA 1WU7A 2KBFA 3BXPA 3L8YA 4ODIA 5CDGA 4HN9A 1QH8A 1Z8FA 3QOXA 4I4TF 4O25A 4Q37A 2FUG6 1G2IA 3ZZ1A 4BVKA 1AMNA 1CF9A 3AM4A 3Q8LA 1JLKA 4B7ZA 3DM9B 2DETA 2XHZA 5HQ3A 1NPYA 1IN6A 1PW7A 2C54A 4GYWA 4JGGA 1E60A 3NWPA 1OROA 3WJ7A 3VSEA 2HMYB 2DJ5A 3QE2A 4R8SA 1ID8A 2QZPA 2D8MA 4P7KA 4Q9LA 4D26A 3KPJA 3P9NA 2RAFA 3R6DA 4F45A 1EFPA 4Y2QA 1NNSA 2MINA 3DEHA 3K8OE 4D9IA 5F35A 1CR0A 1AS2A 1PR3A 2P0EA 3B13B 2GX6A 3OE1A 3PD0A 2A5DA 2VDRB 4UHCA 4TTRA 3ZWWA 2XUOA 3AIKA 3LDUA 3PHLA 5CFQA 1KEEA 2A9QA 2VATA 2DZDA 4FBGA 2C9MA 2GBLA 5E2AA 5E9AA 1K4KA 3OZRA 2X7JA 3HZOA 4HGNA 3RVRA 4DCMA 4DBLC 4K9PA 3UEOA 1ZBQA 3NTUA 4O4HF 4FFBA 5FI0B 1ISRA 3ONEA 2POCA 3S2SA 3QHAA 4WCDA 2FZEA 3VR2A 5LN1A 2A84A 2JEOA 1CJBA 3KZ1E 4M1SA 3NC1C 4RZXA 5FPKA 2VRCD 2QTGA 4JASB 4QQ8A 3JASA 3C5HA 3I1JA 2IKQA 1BQEA 5LPNA 4JBXA 1ISMA 3QF4B 1P3Y1 3DDSA 3PSAA 5DX1A 2UUOA 3GFRA 3HYRA 1T8SA 4M89A 2IT1A 1OJ7A 4J76A 3OZGA 2VXYA 4MYTA 4PGFA 5CFPA 3G8BA 1PFUA 1VJCA 3FOZA 4I5FA 1HFKA 4X84A 3WLQA 5ADVA 4W5JA 5IDWA 3CVUA 1MB9A 5FBQB 1E3JA 2WA1A 1OLUB 5EKXA 3JYPA 5EUMA 1ULZA 4EIWA 2E87A 1N77A 1X19A 4KVAA 4FYWA 1E62A 4ZQCB 4EWLA 2Z1DA 4LFCB 4EHNA 4Q7JB 3OP1A 4NZ9A 3R9XB 5D8DA 4FE4A 1GU1A 2Z5VA 4IS2A 1BS2A 1FUKA 1Y9ZA 4CTKA 2WYVA 3KALA 1CJUC 1JR3E 1GYPA 2XWBF 3K0FB 4ZAVA 4D80A 3FCXA 1Z0JA 3ANSA 1SBCA 3FZGA 4ZT3A 4MUBA 5F5LA 2XD4A 4QXQA 4FMDF 4D9EA 4ZI2A 2F8MA 1JDPA 1YVRA 2FMKA 3I34X 4E09A 1DV1A 3PGLA 3ZHYA 2BH9A 1E63A 2QG6A 4ZYZA 3G2OA 1VKJA 1LDMA 1TYCA 3GFGA 3L7OA 3H2BA 4FTWA 4I4TB 4DCUA 3W5BA 3GJ7A 2D0IA 1DKPA 1UXJA 1BMQA 5K6AA 5GVSA 2E2WA 3C5WP 1XD2B 2PGLA 2Q4RA 4MR9A 1AHHA 2LVBA 4J7UA 5FL7A 4XB6B 1GEGA 2EFCB 2VTDA 4PBTA 4EOGA 5JH7A 5TMPA 4AUKA 5D86A 4PYNA 1I4TD 1YE3A 4RD6A 5DH9A 1JPVA 4Q03A 1AE1A 1E6CA 2FGJA 2ISQA 2WMDA 4LKOA 2RI1A 2XSZA 4U7WA 3WLTA 4CG3A 4XWWA 2OXCA 5JS2A 1VIDA 1Z2OX 3X1JA 5HR5A 1XZMA 4YAEA 1K4MA 4B7XA 4Y2HA 4F7WA 3COPA 4P3PA 3PKJA 1KNQA 1PO7A 1HG0A 1Q16A 3M1AA 5JCJA 1ZGGA 1KF0A 1L2TA 3NHRA 3RS4A 5K0SA 5TIIA 4K0RA 4QUEA 4KSCA 4J9UE 2JZOA 4IVQA 2ID4A 4IY1A 2AWOA 3FYUC 3OFVA 1X1SA 4IYJA 4JELA 3ZV4A 5L53A 1BSVA 5AJUA 4DA6A 2B1JA 1Z7GA 4X1KB 4E15A 4YRPA 1N9GB 4XDYA 1T24A 1VGVA 1GZ3A 2PBFA 3AH8A 4ROTA 3TIXB 3VAYA 5B55A 3P7MA 4W8HA 1UBUS 3SU8A 2Z09A 3RG2A 3PNYA 2AF4C 1L1RA 5HIMA 1XEFA 3R7NA 4BO4A 3DTYA 1UZMA 1FFWA 2NT4A 2FRXA 1L7NA 3OUUA 3PBKA 4RE6A 2FK8A 2HKIA 1S89A 4FDTA 2HU8A 3G0DA 3KTDA 3RS3A 3SS8A 4MLPA 3TKLA 1J8DA 3EVNA 2P1DA 3DO5A 3F9RA 3I83A 3LHKA 1IB0A 3LWDA 4N3BA 1DLIA 1OZFA 2G5CA 1DQSA 3RBZA 3G85A 3WK6A 1DC4A 1NF9A 4FFVA 5JSZA 1B3RA 1SBYA 1TVKA 3BHJA 5CYPA 3M8KA 3PIRA 5B1EA 4MUIA 3CVWA 3H3FA 3AV3A 1NG9A 1U81A 4JI1B 5EIXA 3BH7A 4I4LA 3VPHA 2ZRLA 3NHLA 2GEFA 4KQMA 1MRSA 1GN9A 4G1UC 4GKVA 4P34A 5CH8A 2XNKA 3BTVA 1NW4A 3ZKWA 3FTFA 4AYTA 3U44B 3F71A 3EG9B 1NU6A 1E4VA 2Q3LA 5F3DA 2F43A 5IKEA 3HXQA 1DQZA 4ALMA 4YJ3A 3EZXA 4JB3A 4MLCA 3CUKA 2C1EA 3OJCA 3V2GA 4CMEC 8GPBA 4FUTA 2W90A 3W79A 1WZEA 1R5JA 1PQYA 3LW7A 1C3OB 1UL1X 3AEYA 3LI2A 2FVYA 3AZQA 2QVLA 3G5UA 2R1TA 5JYEA 4JJFA 1KR5A 4WH0A 1LW6E 5DFAA 1WLSA 2CLEB 2OZPA 4DIFA 5T7BA 3R09A 1QXSA 4ECEA 2J31A 3A7DA 3I1IA 2ZI3A 4JLAA 3EUAA 2BP7B 1W44A 2EW8A 3E82A 4NVRA 1F8YA 2DFLA 2IYRA 4S12A 2VH5R 2HF7A 4MYCA 1RVDA 3S81A 4FMCB 1YS4A 3E05A 1I80A 4K6FA 4LWZA 4QDZA 4WNIA 4MR7B 4RSHA 4WKGA 5DZSA 3SHQA 3T1NA 1EFRA 1DBIA 1XALA 4OL9A 2OQRA 3H99A 2IZ5A 4YPOA 2A58A 2IRWA 2R6CA 3AIMA 5A3SA 1WMAA 1I9GA 4HL6A 3S99A 1DOZA 1XAJA 2C7VA 3IKVA 3V6MA 1QHYA 2Y77A 1R50A 3TVDA 5CDYA 5JEEA 3DLIA 1BTOA 1EX1A 1C9EA 3AI1A 4MV6A 1PG0A 1NBMD 3M1YA 3WA6A 5CTJA 2IZ0A 1HBJA 3FOBA 4WXHA 3GNSA 2JLUA 3MLEA 2NTEA 3ABIA 4UCWA 2RMKA 3UCFA 2B0CA 1Y6ZA 2VWPA 4OQNA 5D51S 5JBQA 3AZOA 1P17A 2P6NA 4OTZA 4TQUS 1JJVA 4FMBB 1ANKA 4RM2A 2XVZA 3RIEA 5L7TA 5JO0A 4IV8A 4DQUA 1MX1A 2YFQA 4PZ9A 3UAGA 3ZV3A 3IV7A 1NVUQ 2NU6B 4ZC8A 4M0DA 5T67A 5DP2A 4D97A 4COOA 4EMBA 1NQTA 4AIIA 4TTSA 3FTQA 4EECA 1A3CA 3USES 1JIUA 4Q1AA 1L5SA 3BFVA 3F74A 2JGIA 3L6CA 3P8ZA 4POAA 3BB4A 1FRQA 1E6EA 1EWTA 1C3OA 1GFSA 1UKCA 3JATB 2FE4A 3SZUA 3L2OB 5K6TA 1LU9A 2J9ZB 4NQZA 5E4JA 2UZ0A 4OP1A 1XHEA 3I53A 3BTOA 1ZJJA 4J4HA 3QW4B 2Y0EA 1J2UA 1ZGBA 5F7XA 3IBFA 4GXRA 1WUKS 4FQ8A 4K6MA 4O4LF 4ZQGA 4K5QA 3GLGE 1FYDA 3KQTA 5DSTA 4HNGA 4I36A 2VYFA 2XTMA 2GUWA 5D87A 2H51A 3OD1A 4OGWA 3TRKA 4FYHA 2JLZA 2JATA 2YY7A 1WWKA 3GDFA 2XJ4A 4NFYA 2HBQA 1IY2A 3IBGA 3ICVA 4Q4HA 2ZB2A 2X14A 3CHYA 2J3IA 5BSVA 3MINA 3N75A 1SUIA 1R4ZA 2MOKA 2IVZA 5EJIA 4KXNA 4RS4A 4N9QA 3TIGA 2QXYA 3GPBA 1IQ0A 1VPTA 4KMOA 3A1UA 3FNEA 3H2IA 4LPSA 1KO4A 4MXDA 5E6SA 4FLEA 4MVJG 1KEKA 3GVXA 3R40A 5EMMA 3WKDA 3NHYA 2IU3A 4JUCA 3RV3A 2DKNA 3GZTB 1EWVA 3MAAC 3DEIA 1E6WA 2QP9X 2WJPA 4GVLA 3ZWOA 1WR8A 2Z2ZA 2ZR0A 2WWVD 2C00A 2Q3FA 5D85A 3TM5A 3V1NA 3Q3HA 3K2IA 4TSFA 4EO9A 4N0PA 2IS4A 1E2BA 1X14A 4DBLE 2YHBA 2IEGA 2QVGA 2QTZA 1D3AA 2C57A 3CF2A 4YEDA 1ODTC 2J4CA 2AMYA 5KCMA 4C78A 1EFCA 3HUEA 5BWBA 3TVYA 4BMOB 1I94B 2IHZA 4K86A 3UAWA 5GV7A 1SBHA 1HNNA 1OFTA 1OREA 2VNAA 5IZ4A 3COWA 1B6GA 3D7SA 3PC7A 3RFXA 3TPCA 5JW6A 4DQLA 4D6XA 1MV8A 2WVGA 3HB9A 1U0HC 4JYZA 2RGXA 2PIDA 4GUAA 3PF8A 1G8YA 2X8WA 4KE8A 4RNDB 1PWEA 2ONKA 1T36B 1UBKS 5KOHA 1M6WA 2NTNA 4BNWA 4KGZA 2SHKA 1NA5A 1MQSA 3O82A 3HM9A 3K6SA 1DFGA 3O8QB 1HV8A 5IJ0B 3BTUA 1RZ3A 1N36B 4MW6A 1D2NA 2Q2OA 1Z07A 4MQ4A 4N8EA 1JTVA 3P9IA 4QC2A 5DWDA 4U7GA 4RV4A 1ZK4A 1Q6ZA 2WUGA 4AJKA 2GARA 1DV2A 3AP1A 4PV7A 2ZBUA 2YJ6A 2VYVD 4G1MB 5B1YA 1W8IA 5LZ7A 2JD0A 5AKYA 3WIDA 4F4DA 4LJRA 1CTQA 2GXAA 5TY0A 3WLEA 3GD5A 4LJKA 4CIAA 4FPXA 3WLSA 1UBSB 1MNAA 2B20A 3QFSA 4W99A 5J63A 3FOEC 4ARIA 1TQHA 2YV4A 4DLRA 2QN2A 2VAVA 3OM9A 4IM7A 3RUIA 1AS3A 1LBHA 1ADJA 1E7RA 3BMCA 4Y2GA 3TFQA 4HDMA 1T5BA 4HAOA 4P38A 4KPFC 2PGIA 2H4WA 3VX3A 2G07A 4OX9Y 1IY0A 5IUKC 1P1RA 1RWWA 2WU3A 2AH5A 1VE6A 3DZJA 5FBRB 3RVDA 3V1TC 2GF0A 1S02A 3JQDA 1VC2A 5TT0A 1UWVA 1G7RA 3ROTA 3HB4X 3I04M 2QQEA 4WZBA 4ZDKA 1NAHA 1UK7A 3LW8A 3OT4A 1YCFA 4BC1A 5IS2A 5DMXA 1RKUA 4MEAA 4KXQA 2YHIB 1R7RA 4FR0A 3LT5A 3KIPA 3OIGA 4CIVA 1Q6YA 3P52A 4YGYA 2E7ZA 3MILA 3RIGA 3FRJA 2B21A 3DBLA 3PS9A 2B92A 4Z3OA 1IHYA 3P4UA 4YCMA 1N2SA 4N3NA 3UFXA 2XT0A 3DVLA 4G97A 2JHCA 2H1VA 1JWAB 1W0JA 2E4YA 1T2AA 3GY0A 4EGAA 4NPCA 1U9YA 3SJBA 4HHEA 4ESEA 2GWHA 3OLCX 4Y2JA 2B82A 3JQGB 3WK7A 4CV0A 3ZDRA 4HAXA 3WIVA 2MJLA 1UBFA 3OX4A 4XM2A 5IDXA 3THOA 1H9BA 4Z1OA 4EHJA 2XB2A 1DIOB 2ACVA 1CFJA 4YT5A 4QTTB 5EIOA 3C0KA 2Q1WA 3KVVA 4O2AB 2OXEA 4O4IB 3QVOA 1YQ9A 1JA1A 1O6CA 1P0QA 4MDYA 4NMMA 5DW0A 4TM7A 1ZUHA 3FHOA 4H3SA 1B2LA 4B6FA 2ZIAA 4ETMA 3IHWA 4E70A 4KTTE 4O2AF 4X8HA 1GZUA 1GVNB 1EWRA 1JKIA 4QL3A 5KYVA 4DNPA 3AU9A 4N0QA 1GKIA 3WTBA 5BP7A 3VV3A 1QO7A 4O1IA 1HTWA 5FKJA 3Q88A 4JFAA 4UOZA 1JLSA 4HMQA 2R7NA 3HP7A 2IY8A 2AXNA 4KLAA 1ZWLA 2QYOA 3C5EA 3PJEA 1LRJA 4WVFA 2DMRA 1I30A 3C7AA 3WIUA 10MHA 3ZDDA 1E1KA 4K8RB 2RGEA 3IOEA 2MTBA 4UC0A 3ZV5A 4OXYA 2BFBA 2GPSA 2IQIA 3LQ4A 4CIXA 5GIPE 4UUPA 5F78A 2A14A 5HCNA 4RVDA 5FRDA 2ZTHA 3B85A 3BE6A 3WWEA 4JUDX 1QP7A 2Q9AA 3ENNA 1C9JA 5HWSA 4Q9NA 4TMFA 4KJZA 4ZOLB 3RKUA 2HA5A 4YQFA 3QP9A 3QENA 1TO6A 3L01A 1SQGA 2BVNA 4FI3C 3TS1A 1OYVA 4G4JA 1ZCFA 5L3QB 3IKJA 3P2JA 1V0JA 3D6JA 5DX8A 3Q3VA 1HNZB 4Y1GA 5FV4A 1ZONA 1XZEA 2WHRA 5EP2A 4GZ6A 2B98A 3K0AA 5IHPA 1DWUA 1NY5A 3RRZA 1NT4A 1XLVA 2W2OA 1NX6A 4QGBA 3OECA 3MN1A 5HP4A 3K1AB 2QTVB 1V5GA 1P4JA 2B69A 4QBGB 4IAOA 1PLKA 4Z4HA 4AS3A 3U7FB 2HSGA 2WWIA 1KMMA 4KODA 4W9RA 3N2YA 5HUJA 3UUFA 5CNKA 5FFNA 2UUBB 2G9NA 1XLTC 2VYCA 1VL1A 2V8OA 2WTXA 3L0DA 2H9AA 1HSZA 4RIEA 3VPCA 3TAXA 1Y3BE 1EXWA 4DEVA 4WI1A 4MCHA 3P26A 4ALKA 4DS3A 3ZCUA 2A59A 4MA4A 1YKGA 4XSHA 2G1KA 5KI6A 2HW8A 4X85A 3QVUA 4MA5A 1QIIA 4PRKA 3BXZA 3T12A 1JJBA 1ZVMA 4YQYA 2FN8A 1ZGHA 1KYVA 4DQ0A 5K8UA 4H7HA 2PY6A 5ILQA 8ABPA 1JHVA 4M9RA 5HFNA 3ZNNA 4ZMSA 4B75A 1AQUA 1P9LA 3AVXA 2PGJA 2ID8A 1HT0A 1UFQA 3GXBA 3QI2A 4AF7A 5LKAA 4B2YA 2D1TA 3A2MA 5DLQC 4F6RA 1GPUA 2PR7A 1W46A 1GLVA 1XTJA 2E4ZA 2X5OA 3BKXA 3EGIA 4NU6A 5FI5A 3ENVA 4EFKA 3DCYA 1JFLA 1N2OA 1CXZA 2WINI 3H3XA 2CMKA 3P2KA 4FGJA 5I4KA 5FO1A 2CEAA 5J2TA 3BGDA 1AGNA 3MNFA 3QKIA 3JQBA 3FFBA 2C58A 1M5RA 4Q1BA 2VTVA 4RDCA 4AJ1A 1IXRC 1K6MA 3IXQA 4TKVB 6AT1A 1EXDA 4P3YA 3VKHA 1XA3A 1BOFA 3R6WA 4RH0A 5C51B 2FFAA 4A26A 3ROKA 2I1VB 2DPXA 1Z16A 2EFDB 2WWXA 1Z5ZA 4NE7A 4B73A 3N8KA 2WQ7A 4GLFA 3BD8A 3G0OA 5ALQA 1WXHA 3D3WB 5C3MA 4EBBA 1CD5A 16PKA 1DINA 1WHTB 1XUOA 2EBFX 2J3JA 3E2IA 3ETNA 3RRBA 2YJZA 3GFBA 5LLDA 1HE8B 1H1LA 2AA3A 3WOHA 1FQJA 3VH1A 2MYTA 3O4IA 4OHUA 1YIAA 1WSWA 1WG8A 3NWOA 3AP2A 1ORHA 3LKDA 4NDAA 4MRMA 4TYYA 5DULA 1J8YF 1Z28A 4C2BA 3IHTA 3T5GA 5E3IA 1GUYA 4R81A 1XE3A 2OGUA 2ZXEA 2PXHA 1MA3A 2NQ2C 2ZYUX 4PHHA 1WSDA 4ZTZB 1KJ8A 1EIZA 1R6XA 3COSA 3ZY3A 4CCYA 5CBPB 2AHRA 2OBYA 2WWTA 3Q6IA 4R16A 4TV9A 5MGNA 1R6VA 2F8LA 1X80A 2Z8XA 3D4PA 4NCKA 2CNLA 3AUXA 4J29A 4E94A 5IPFA 1WCIA 2RIRA 1W30A 3GELA 3L06A 3FVRA 3GJTA 1FW8A 5FCDA 1M72A 2W2QA 5DYIA 2DCMA 1H6DA 2OCPA 2WNSA 4IF6A 4XI9A 4MYHA 1GO2A 4ND2A 1OA0A 5DE3A 1YB1A 2JZNA 1RHJA 2C5BA 2QJRA 2CV1A 3ZU5A 2JI8A 3SJUA 1O77A 3LGSA 3RREA 1VE7A 1AJEA 1U3UA 5DCYA 5EZQA 4F5ZA 4U6QA 4GRDA 3S4YA 2FPSA 1I0IA 3C8HA 3N76A 4X00A 5CT6A 1U6KA 2PMWB 4YROA 4UVHA 3TDKA 2XWSA 2BLNA 1M8KA 2G8LA 2D74A 5GGXA 2GN4A 4PU0A 5HKLA 3WL5A 4HMPA 1CUEA 2Z3WA 3SC2B 1RC1A 1HDCA 1JG1A 5JMWA 1K7XB 4M6WB 2PRSA 3H5RA 4WACA 1F4LA 4YDQA 3TQQA 3KL4A 1X7YA 1LSSA 3A1NA 3HKBA 3GRUA 4A3SA 1XPUA 1P2FA 5IYZA 5JAIA 5IC6A 3ZLUA 3LVFO 3ZS8A 3HCWA 3SQOA 4PC2A 3UXEA 4DR2B 4KQWA 2DFVA 5EMJA 1ZU5A 1VLQA 3AHJA 4RYLA 3QF4A 4LHSA 1BCRA 3EPRA 3SQNA 2CVHA 3WA7A 1MTZA 1OLXB 2RHTA 4V0SA 1D1TA 3E8MA 4YS6A 3MS7A 4JS0A 5EJ5A 4J2OA 2AVDA 3GLKA 4IIXA 1JDJA 2D5CA 4DNFA 4Z51A 1NQWA 1XFDA 3KUCA 4Q1VA 5IAJA 3GDWA 2X0EA 4HDRB 2BV3A 4NYJQ 5KPDA 1IBMB 4R1TA 4LXIA 3Q11A 4V0NA 3NATA 1JDBC 4URZR 2V97A 3ESAA 1TKBA 4JI2B 4YCLA 3RRMA 1A2OA 1J7JA 1PJQA 1BVUA 2B4YA 4RC9A 1G18A 1CUUA 2CJWA 1LPAB 1MOQA 2B1GA 4MI9A 3WX0A 5CFRA 2DCUA 5BO5A 1A5BB 4O4IA 1X80B 4MX8A 4ZEXA 3T5MA 3WLRA 2GAOA 1R16A 3H0EA 3KLMX 2W2KB 2R79A 1FNNA 3I61A 1MN6A 2GETA 1P44A 1VMEA 3K7EA 3IAAA 3RASA 1QS0B 3CIFA 1V9SA 3K1ZA 3LA8A 2J0UA 2P2YA 4GUDA 4HN4B 3VPXA 2I3ZA 3TGLA 4Q3CA 1G21B 3QEBZ 1SPXA 1UPCA 3COVA 5FFFA 4WY2A 1KK2A 3VHXA 3BL5A 3VHQA 4B9AA 2RFLA 4C20A 2FN3A 2JGKA 2EX4A 2O5EA 3G8AA 2OOSA 5EFZA 2OMEA 3QYAA 3PNKA 4M8KA 3V33A 1EG7A 3NCHA 5ERGB 3FTDA 1L6RA 3DAGA 4L8GA 4UFPA 4DA7A 1YA4A 2IOFA 5DK6A 5K8TA 1M2OB 5A4FS 3OU6A 2I4NA 1PAUA 1NRXA 1SXJA 2YC4C 4Z6KA 2V6JA 2R5NA 1S3IA 4MYSA 4X6XA 5F12A 3ZGOA 2HMSA 4F1WA 5IT5A 2FKAA 1JHYA 2W2KA 4BBJA 3UMSA 1IXSB 2XUDA 4HD8A 1T91A 2V7TA 5SICE 1MNQA 1T9BA 1FYFA 2HREA 1WMFA 3UKDA 4LSWA 5BWMA 3TLKA 5A9SB 1PDWA 1CS4C 4UHKA 2FMIA 2H7YA 2RI6A 1UQTA 2NADA 4M8SA 2UXBB 1MX3A 3BSWA 4DLVA 1LLUA 4RXUA 3UPUA 1QP4A 2JZCA 1H66A 4BBAA 2FW6A 4QNNA 3KHTA 1RPNA 1ECCA 3GQBA 4PW0A 1H69A 2G4CA 4OBWA 3OZXA 3UT5A 1SQ5A 1A95A 1W34A 3WISA 3X43A 5F3RA 5KIAA 4H3HB 2J0UB 1RQPA 1W96A 1IZ9A 1X7HA 5JDCC 5LMNB 3IRUA 3UK0A 4EI9A 4XKJA 2BSAA 3H83A 3SYTA 3WWOA 1V1RB 2Y2UA 1I6WA 2ODNA 1NNEA 4YDRA 3OQIA 1VP9A 3GB9A 1KQOA 1EDDA 4ANFA 2QBYB 3RYIB