1Z2DA

Solution structure of bacillus subtilis arsc in reduced state
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
139
structure length
139
Chain Sequence
MENKIIYFLCTGNSCRSQMAEGWAKQYLGDEWKVYSAGIEAHGLNPNAVKAMKEVGIDISNQTSDIIDSDILNNADLVVTLCGDAADKCPMTPPHVKREHWGFDDPARAQGTEEEKWAFFQRVRDEIGNRLKEFAETGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Arsenate reductase
publication title Solution Structures and Backbone Dynamics of Arsenate Reductase from Bacillus subtilis: REVERSIBLE CONFORMATIONAL SWITCH ASSOCIATED WITH ARSENATE REDUCTION
pubmed doi rcsb
source organism Bacillus subtilis
total genus 46
structure length 139
sequence length 139
ec nomenclature ec 1.20.4.4: Arsenate reductase (thioredoxin).
pdb deposition date 2005-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1z2dA00
3OM1A 1M5UA 4Z9BA 3KHTA 1BDIA 2L19A 3EQZA 3LUCA 1ISSA 4TLLB 3L6UA 2NZVG 3DGFC 2PUFA 3DLHA 5DLEA 4IGAA 2OQRA 1PNRA 4JA2A 2E4VA 1PHRA 3GL9A 2PUDA 3O75A 4HNSA 4HNRA 4RKRA 1QO0A 7ABPA 2HJ9A 1YMVA 3TX6A 4Z4HA 5IUKC 5FWXB 2LP4Y 3OQNA 4KVFA 3C97A 4Q6WA 1F51E 1W9HA 2NT4A 3GA5A 1DBQA 4MQFA 3O2SB 3I5AA 2TMYA 3BREA 3HV2A 4KMRA 4E7OA 1KRXA 2QXYA 4KREA 5DTEA 2R47A 2A9PA 4JAVC 4MS1A 5EWLA 3OQMA 4OTZA 1P8AA 3JVDA 4FE4A 2LBPA 3FFXA 2HPHA 4G97A 5DGCA 2QVGA 1RXEA 3CRNA 1ZY2A 4RY0A 4XARA 1QO0D 2AYXA 3F6PA 1D1QA 1JWLA 4N41A 3MMNA 4WXEA 2WB4A 4KRFA 2R25B 4HNQA 1TM2A 1QNLA 1CEYA 4IILA 2E4YA 3HJFA 3FDFA 2FMKA 5TQ2B 3RVSA 5IBQA 4EY3A 3G85A 4B09A 5BRAA 8ABPA 5D2CA 1DC8A 1YS6A 5IEBA 4OBBA 4Q6BA 2JVJA 5EWMA 3T8YA 2L17A 2M98A 2IOYA 2FN8A 3OLYA 5KQPA 4S05A 2OENG 1EHCA 3A10A 3KKEA 2MYUA 3O1IC 4YGXB 1YMUA 9ABPA 5JS2A 1C4WA 1LBIA 4MS3A 2QR3A 1MB3A 4RU1A 4WXMA 1ZGGA 3JPYA 4IF4A 1Z26A 3HEBA 5GOTA 1Z18A 2IYNA 1VKRA 4MS4A 4OATA 3KLOA 1PEAA 1SXGA 3QEKA 1MIHA 4H3HB 2MSKA 4MYRA 4ETNA 3RVQA 3H1GA 2PKXA 4Z4GA 1E2BA 5C5EA 3HK2A 2FMIA 2FW0A 4RWEA 3NBMA 2CHFA 3LMKA 1VLZA 5TPWB 4YP9A 2PLNA 1QPZA 1DBPA 3HSYA 1ZITA 4EVQA 4QYWA 3QLVC 3GBPA 3RVPA 4Z4IA 3VNAA 2WJAA 1JFVA 1E6KA 2ZAYA 4MR9A 2WRZA 4MRMB 5C5CA 3HO1A 1TMYA 3E61A 1JX6A 4L4UA 3G1WA 1K66A 2FQYA 5CNJA 2E4WA 2A9QA 4RK5A 5KWSA 4H60A 1LK0A 2E4ZA 1BDJA 4LZLA 2JBAA 5FBHA 3OLWA 3VNBA 4ETMA 4PZ0A 1L5YA 3H6HA 4L85A 3UK0A 2R48A 2PUAA 4MR7A 2YHBA 4NCAA 4O5AA 3RQIA 1DCFA 3LUGA 1RZRD 3BRQA 3RVLA 5CNMA 3BILA 3N0RA 2F8SA 4LE2A 3SG0A 2HQBA 2QSJA 1U2PA 2FSPA 1P6UA 3MF4A 2IPAB 3Q41A 2FVYA 3EJWA 3CS3A 4NICA 4Z4CA 3TO5A 3JS5A 3OMXA 2E4XA 3IPCA 1VPWA 1F4VA 3F73A 4RK0A 1DZ3A 3MA0A 3ILYA 2W42A 2FQWA 2B4AA 4KV7A 4NV3A 4OG2A 3N0WA 3D02A 5FWYA 1CHNA 1M2EA 3Q9SA 1RZRA 1OXBB 3E3MA 3NNNA 3OLXA 2ID9A 2LPMA 3KYIB 3GYBA 4RZSA 5PNTA 4DQDA 1QP0A 2VUHB 2WMYA 1HEYA 2HQRA 4DN6A 1C0EA 4NCBA 1FQWA 3H5OA 1XWWA 3GT7A 4G0QA 4JASB 2WY2D 4EUKA 1Z2DA 4KPYA 4WWHA 4ETIA 3MIZA 3LUDA 5IX8A 1AB6A 3O1HB 1Z2EA 4MR8A 3HM9A 2MYPA 2N9UA 3QELB 4CBVA 1PUXA 2MSLA 1DG9A 1DRKA 1LJUA 4KZKA 2L2QA 1USGA 4NQRA 4PYRA 5B3JA 2PUBA 1KGSA 2GKGA 1P2FA 1BVHA 4MQEB 1TVMA 3H1EA 2I6FA 5TQJA 3T95A 5BRJA 1YTUA 3IP9A 2FTKE 5HSGA 4N76A 3Q7TA 4H3KB 2YHAA 4MLDA 3RVKA 5BQ3A 3FMVA 4IRXA 1D1PA 1GCGA 1W25A 3CZ5A 4EYKA 4ZMRA 1AB5A 2V0NA 2Q5CA 5KI6A 4MLCA 3ILHA 3K4HA 4YCSA 3HS3A 2P9HA 4GPAA 1SD5A 3CKMA 3EQ2A 4TMYA 4EVRA 4F12A 2CD7A 4E7PA 4D6XA 1SRRA 3CFYA 1APBA 2PMCA 1YIOA 4KK3A 3IP5A 3SAJA 3MYYA 3A0UA 1T34A 2FQXA 3OO0A 2FMFA 4JB0A 4WT7A 4W5QA 4F11A 4F3TA 5EWJA 3O1JC 1QQBA 4FE7A 1ZESA 1USKA 5ED4A 3RVMA 4N0QA 1LJLA 2RJOA 4Q7EA 2X7XA 4KK4A 4RXMA 1ZH4A 2GWRA 1EWTA 2FEPA 2MYNA 1ZAYA 3RVJA 5ABPA 2LUOA 3HDGA 4ZJPA 2HSGA 2A9OA 1ISRA 2E4UA 1DCKA 3CU5A 1DCMA 2PL1A 1YS7A 4YS6A 2PUCA 3QEMB 4Z99A 3QK7A 2O20A 1BDHA 1FFWA 1JHZA 1NXXA 2IPMA 4G0ZA 4RV5A 3RVNA 3KS9A 3LUAA 4XXHA 1XHEA 3JVIA 3KYJB 1GUBA 4G0YA 5CNIA 2GI4A 4RK6A 3A3KA 1ZVVA 1TJYA 3QLUA 4ZPJA 5KC8A 5JS1A 4W5NA 4P98A 3FFTA 1ABEA 2QVCA 2P4UA 3DZDA 1NXWA 1RXIA 1E6LA 3N8IA 2FEWB 4RXTA 5FWYB 5IULC 1ZGZA 2QU7A 3URMA 3JTEA 2NT3A 1SXHA 3BBLA 3QLTA 3LKVA 3H5WA 5TQ0A 4LE0A 4XASA 5HQJA 5JNVA 1VRVA 1FSPA 4LDZA 3HZHA 3Q7SA 2VK2A 1JLKA 4YWHA 5TPZD 1ZHHA 3NHZA 2RJNA 1U2QA 3OMWA 2FEKA 2PJUA 3EGCA 3QX9A 1P6QA 3DLBA 1M2FA 3C3KA 4PEVA 2ZWMA 1L5ZA 3EAFA 4M88A 1USIA 3HXMA 1I3CA 2B1JA 4XAQA 3EDCA 3GRCA 3UUGA 3DGEC 3EULA 4MQFB 3TD9A 1EFAA 1IIBA 1U04A 2WJWA 3SY8A 1NY5A 3O74A 4RS3A 1E6MA 4P1ZA 4G0OA 1Z16A 3H5IA 3LUFA 4MS1B 3N0XA 4RK7A 5EWLB 3IP6A 4DADA 4RY9A 1D2AA 3LUJA 1BAPA 5TQ2A 5JNWA 3LUKA 4RK4A 3OQOA 4XFKA 4O1IA 5JNSA 1JYFA 1QP4A 1DP4A 3JY6A 3KG2A 3O2JA 3HUUA 1TLFA 1Z12A 3C6QA 3ROTA 3H75A 2KYRA 3H5LA 4UHJA 3CG0A 1DJMA 2JK1A 4W5RA 2FN9A 4UHKA 4YO7A 1MVOA 3N53A 2VYCA 4D6YA 3T38A 4LRQA 1A0OA 5JNRA 6ABPA 4QICA 3HDVA 5CNKA 4Z0NA 2JCGA 3C3WA 3S99A 4RKQA 1JDNA 1ZN2A 3KSMA 4MPTA 2FMHA 5EWMB 4S04A 1EWKA 4MAAA 1OXKB 3T6KA 4EGSA 1ZH2A 2CHEA 4XLTA 3NHMA 1J56A 4KNYA 3SNKA 1S8NA 4N03A 2FXIA 2GBPA 4MS3B 3H5VA 3M9XA 4G0PA 3SM9A 1Z17A 2GX6A 2PUGA 4JP1A 5JNUA 4WZZA 1WETA 2JVIA 4MS4B 5TPWA 4D74A 1JF8A 3I42A 5E3JA 1K68A 3H5TA 4LDAA 3N75A 1Z25A 2H0AA 4EVSA 2JVKA 2NZUG 3LOPA 4ZMSA 2NUBA 1MAVA 4G86A 1NXTA 4ML3A 1DRJA 4RSMA 1EAYA 3M6MD 2M1ZA 3FGZA 5B3JC 2PL9A 4MRMA 3RH0A 3Q15C 4EYOA 4OLAA 4W5OA 4PICA 4Z4EA 5JNTA 3H6GA 3CNBA 1DC7A 1A04A 3I45A 1Y1LA 3K9CA 4LX8A 4LE1A 5TQ0B 1QKKA 4MR9B 5T7BA 3MQ4A 2BGGA 4KFCA 2A9RA 2IPNA 3DBIA 1NXPA 4YLEA 1GUDA 3Q7RA 3SQNA 2IDMA 4OLBA 3P9YA 3R0JA 4KQCA 3CLKA 2JBAB 2PUEA 3N6VA 1NXOA 5F64A 2L18A 3TMYA 3OLZA 1JH9A 4IMJB 2VUIB 4Z9AA 5KC9A 1JL3A 4MR7B 1SXIA 5IUJC 4GNRA 2PE5A 3HCWA 1URPA 1A2OA 1PEYA 3LUHA 4N0PA 4YRZA 2LIVA 4G0MA 2MYTA 3W9SA 1MB0A 3NNSA 5FBKA 1GCAA 4RXUA 1YVUA 1M5TA 3KJXA 4N47A 2J48A 3BRSA 5TPZA 3IP7A 4FB4A 3EODA 3GWGA 4JOQA 4F06A 1NXSA 1R8JA 2IKSA 4PE5B 3KCNA 4Z4FA 3CHYA 3IDOA 3O2QB 1D4ZA 1DBWA 2FLKA 5KQMA 3A0RB 1KMIY 3GBVA 3HUTA 3OLVA 5FWXA 3QELA 3RVOA 3CZCA 4YV7A 1B00A 3QLUC 1QQAA 3MM4A 3I09A 3FFWA 1GLGA 3IPAA 5T3YA 3OO1A 1FFGA 4MQEA 4RDCA 1U0SY 3QLVA 5KQLA 4IMIB 2PAFA 1D5WA 4JB2A 4MR8B 1QP7A 4KQ9A 3QX8A 4F8JA 5TE9A 3GV0A 4WUTA 4YR7A 5I4CA 1Z13A 3KTOA 3OM0A 4ZYLA 4QYMA 2XDYA 4O1HA 1U8TA 3L49A 4RY8A 3M9WA 1JDPA 4Y9TA 2JB9A 5IC5A 1JBEA 4MGEA 1LBHA 1NXVA 1XHFA 2FKAA 2RGYA 4G0XA 2HQOA 1YK0A 3O21A 3ROFA 4HYEA 3UKJA 3CG4A 2CWDA 3KLNA 2QV0A 2QW1A 1JYEA 1Z15A 3D8UA 4W5TA 1H9CA 1KRWA 3CTPA 1QMPA 2RDMA 3HVRA 3LKBA 1CYEA 3LTEA 1PNTA 5KQGA 2FLWA 2IPLA 1YK1A 6CHYA 4TN5A 1EWVA 2WWVD 5GQSA 5BR1A 5HM6A 3C3MA 3JPWA 2JRLA 3F7NA 5DKFA 1ZDMA 3LFTA 2F8TA 2R4QA 2ID7A 3B2NA 3H1FA 1BA2A 5EWJB 4QPJC 3RVRA 5HKOA 1NTRA 2MSWA 3QEMA 5DCLA 1UDRA 3NNDA 5CHYA 2AYZA 1FFSA 2DRIA 3F6CA 1RNLA 4EYGA 3TB6A 4TLMB 1NATA 5IEJA 2QZJA 1JFSA 1ABFA 4RK1A 4EYQA 2H3HA 5IUNC 1RPJA 1JFTA
chains in the Genus database with same CATH superfamily
4DA7A 3FW1A 2YHUA 3T7IA 2IUYA 2XIJA 1GAEO 4O02B 3DTVD 4F38A 1BDIA 1B6TA 1PJ8A 1QK3A 3EVAA 1MHPA 1ECBA 4GKBA 3BJIC 3UK2A 3ZHRA 1PT8A 3D3KA 2CEKA 4AKTA 4JL5A 5DLPA 2XUPA 4CMCA 2CE7A 1L5LA 2HK8A 5BPHA 2YVQA 1Y1KE 3GRYA 2Q1UA 1QC5B 1TRKA 1JALA 3HCDA 3PGMA 4NCJA 5LB2A 5JS8A 1GTJ1 3L4BA 2H3EA 2XRMA 2B5WA 2BMDA 2POQX 1G291 3NATA 4B79A 5JH7B 2G70A 3BFJA 5IUKC 4ZGBA 1S01A 4TROA 1I7LA 5AW1A 1YU9A 1VMKA 3F1KA 5AHKA 1TZCA 2X6QA 1UEJA 4HDMA 1Y5IA 1XCOA 3LA6A 2RKWA 4P54A 4HXYA 3VNVA 1I1NA 1RACA 2BZSA 2IELA 3UHPA 3V1YA 1RZ3A 3OE4A 4E7OA 1M2KA 2BD0A 4UC0A 3WB1A 4MCIA 5LD2B 3CNNA 2PO5A 1LNQA 2P9YA 2ZIEA 4DYDA 4YPOA 5J2UF 3JVDA 1XEXB 4ZEOA 1CR4A 2LBPA 1TJPB 1XTPA 2HPHA 4Y9UA 3SSAA 2HC9A 1BN7A 4EFLA 3OE1A 5IXSA 3KLPX 4TMZA 5KYGA 2XXBA 1JA9A 1NQ5A 1O97C 3M81A 4LN1A 2VAWA 3FCOA 3SZUA 5HE9A 4PYLA 4DABA 3LO8A 2R25B 3TLJA 1L5OA 1IBCA 2HF8A 4HNQA 1DQNA 2B82A 4XQ0A 1WKCA 3RTBA 3VYRB 2FPWA 3QY9A 2BKVA 2YWHA 4ETWA 5H4GA 1T1SA 2ZIXA 4N1AA 2NAFA 3L8GA 4H7KA 5LMUB 2I6UA 2X8LA 1KZ9A 1DC8A 4Q6BA 3VSBA 1FYWA 1SCIA 4L8WB 4CF3A 2YASA 3OOJA 3EVFA 1LPBB 2FOXA 4PFKA 3O1IC 3RWMB 4BQOA 1RRCA 2GASA 2E49A 2XDWA 1IY9A 4DMCA 2OXTA 2M6SA 1ZZEA 1T3LA 2V4UA 3F9IA 1XTZA 4RU1A 4A4DA 4IDGA 4IEFB 1EUDB 2WU0A 3A8TA 3I6YA 2COEA 3HEBA 5GOTA 2IYNA 2WICA 1W5FA 4QEDA 4WZAE 1Q74A 1G0OA 1PQ4A 2IYSA 4OIFA 4YIKA 1IFXA 4LXXA 5BYJA 1L4UA 1K97A 3AI2A 1MIHA 1POXA 3KQPA 2HUPA 5JLJA 4YPFA 3OZAA 2IYAA 2R7NA 4NU6A 3F98A 5EC8A 3GEEA 3P4UA 4FHDA 3NV9A 4GYJA 2BMJA 3BQMB 4E09A 1RYBA 4ZT5A 2JK0A 4MVJD 5AI6A 1QPZA 3BJRA 2YINC 3QVGB 5AT1A 3LLMA 1BFDA 1R6VA 3Q85A 3I9V6 2F3TA 3VPCA 5ALOA 1QR2A 4FGZA 4IXNA 4MR9A 2YUIA 1KI2A 1W0KA 3ML1A 2NX2A 5EPOA 4JI1B 3OCZA 5CA0F 5COBA 4RAQA 3ERCA 4LIPD 5K8UA 5EE3A 3B1VA 4H60A 1OH8A 1B8UA 3KQQA 1VE7A 1G8SA 1ECFA 5HMLA 2DULA 3PENA 2V3WA 5KYTA 3CCBA 3UXYA 1ZP6A 1JECA 4RZIA 3HFGA 1V9CA 3IUMA 3Q3EA 5FUQA 3HNPA 3L18A 2G28A 4FYXA 3ONDA 3IAUA 4X3OA 1T3TA 4KH1A 5CNMA 4FX2A 2WTUA 3FNGA 2RI6A 4QGFA 4I4IA 3UA3A 1F2TB 3EZ9A 4I0WB 4L4RA 4M8LA 4ZVMA 5BN3A 3MGKA 2B4TO 3OM9A 2FSVC 1V41E 5DW3A 1P3DA 1UT6A 1B93A 1ZS9A 5IXYA 3CV3A 5EJGA 3P9KA 5GIOE 4KLZA 3I2FA 3C6BA 4GI3A 3WJ7A 2QE7A 3E5NA 4JGGA 1SH7A 4QUIA 2H1RA 2NUAA 4ZVKA 1HKHA 3E70C 2GPBA 5FPTA 2EKDA 3MA0A 3PRKE 1MF7A 3HC7A 4Y8VA 4ZOLA 5LLSA 2JJ1D 2JGFA 3AR7A 3GD7A 1VPEA 4REQB 4WUVA 1N0VC 3IP1A 1KZHA 1PCXA 1ENYA 1EBFA 2IYEA 2V65A 1QAMA 3Q9SA 1VL1A 1W6RA 2EX1A 4HJRA 2C57A 1O95C 3CPEA 3KKLA 4NE9A 4PIPA 2CXPA 3ONEA 2IQIA 3TLEA 4BNDB 4U8HA 1Z7YA 2HQRA 3ROPA 5AW3A 5CXUA 2WEKA 3KVYA 1FQWA 1SVLA 4G0QA 2P6RA 4JL6A 2AFVA 1M2NA 4E32A 4F84A 5B4TA 1AQIA 2YC2C 3AF2A 1O5IA 3L77A 1JPVA 2P2ZA 4GRAA 1BHSA 1S7GA 1WCIA 3D5QA 4ZXFA 3TSWA 4AP5A 2DBRA 3QELB 3QJ5A 2XGOA 1E9DA 1YWGO 3C85A 5B64A 4XLZA 4L0CA 4NQRA 1DGQA 2GZ3A 1K4MA 3KVVA 1Z45A 3AF1A 2GKGA 4OXXA 1AH2A 4BV8A 3DQZA 1FPMA 5TV2A 2GBCA 1AZSC 4I99A 4PLGA 1NI3A 4RHEA 4J1NA 3M1IA 4M49A 1R1DA 1U94A 4DEVA 1YTUA 1VGQA 1XQ1A 4H3KB 4EB6A 1XZ8A 4C1NA 3RVKA 1VZ3A 2RHMA 2WF6A 3H2YA 4MVYA 4IDDA 3W7AA 4BAZA 5JQGF 1MQ8B 2IYYA 4YCMA 1MC4A 1AZTA 2A78A 4R1UA 3UPTA 1UMDB 5KI6A 3KHKA 1PVOA 2HBRA 1Q91A 3WVNA 1XWIA 2I4OA 4AUEA 3DMDA 1IC6A 2ZJ8A 4A6XA 1T1RA 2QRNA 3MRTA 4G5XA 2RH8A 4FCTA 4WNCA 1R66A 4Y2VA 2PX0A 3OAAA 1EX6A 5FWAA 3D6FA 5TVGA 3ZCPA 3N2NA 4E7PA 3L0PA 3FSEA 1YA6A 1YIOA 5JVDA 3CJTA 3S3TA 2IHTA 4P81A 4DXHA 2BSQA 1VE9A 3TJZA 4IZ6A 3OZDA 1K86A 2EKPA 4M89A 4XUGB 2DPYA 5FOTA 1XRMA 4R5HA 2PGXA 2WNIA 4KK4A 4RXMA 1A98A 1RJ9B 1N5IA 3EXAA 4Q5IA 5ITSA 1MZVA 4KXYA 1M8PA 3I3SR 3A9CA 3JQEA 1SXJD 3MLEA 3KT0A 3R6LA 4IXWA 5EG5A 3U7QB 4XGNA 3VJMA 1UBFA 3GHHA 4FCWA 4E4YA 2O3TA 3TK1A 4B80A 2D6FA 4I14A 4YP0A 5ES3A 5KNCD 1LTHR 3IVGA 3DBLA 1IEWA 3DVAB 3V8QA 2ZKLA 1OB5A 3HXPA 3PR3A 3RG8A 1O89A 3I05A 1XVLA 4BNYA 1LW6E 1GL3A 1E7YA 4BWVA 1GNPA 4WXRA 2AR0A 3KS9A 2I3GA 4XXHA 4DAOA 1DMSA 2H4YA 3TSYA 5DGXA 3PLRA 4GRDA 4RMIA 2O06A 2J67A 4C4TA 4PRZA 1SHKA 1HDGO 3RRBA 5KC8A 1H2BA 4DJFC 4W5NA 2Z2KA 4FJ0A 3K8OE 2XQFA 4OQXA 3NTVA 1XL1A 4DBZA 1E2KA 2AOUB 5B30A 4CJXA 1E6LA 4MYSA 4GMDA 1D7OA 3N1UA 3VTAA 4CKBA 2BFWA 1K3FA 2XQIA 3A6KA 3Q9LA 4O29A 1NJ2A 3WMGA 4WBNF 3GRUA 4NDAA 5C2JB 2Q9CA 3LPLA 3FPKA 4L50A 2ATEA 4LX0A 1V8FA 1FSPA 2BKAA 2MMGA 2VK2A 1IQ0A 3DYBA 1GUYA 3HJNA 3TRKA 1IEVA 1P6QA 3ZHTA 1NUQA 3QKSB 4I1UA 3EAFA 1FU7A 5KTSA 1H3EA 3EUWA 1USIA 5M2QA 1YQUA 3ZD9A 5I7OA 4BZWA 2BY4A 3ILXA 2D2EA 3EGDA 1K8XB 2GK4A 4DDHA 4EELA 4EA8A 3TRHA 1QO9A 3R44A 2C77A 3F47A 4NOKA 4TMKA 1EFAA 5TXGA 5C8VA 4GI7A 2NTEA 4LMRA 3QYAA 1QCDA 4LBWA 3S70A 4F1JA 2ZI7A 4KSCA 2OFFA 4E2FA 5B6IA 1SELA 3HB5X 4P8RA 4Q9IA 2GPNA 3EGIA 3I23A 2Q5JA 3LOUA 1NF2A 1QLHA 4GI2A 1E1DA 4MJ7A 5GWXA 1E4EB 3EGEA 3X1DA 5LOVF 1L4BA 3E81A 4KQFA 3PKZA 5CW2A 3RSSA 1L7VC 1R0YA 4MPDA 5AKLA 4ZU3A 1T5IA 4HB3A 3FSGA 4POOA 1MRSA 4DA0A 2XXJA 2HZ7A 5F52A 3SZMA 3ZD6A 2JK1A 4I2NA 5JEDA 2WMOB 1H65A 1N9GA 2WYUA 1QK4A 3IULA 5KB3A 1ZWKA 1M66A 9GPBA 1R0XA 1KQNA 5CNKA 2V3VA 1YGPA 3JARB 1E8NA 3WIVA 1QIFA 2DERA 4RKQA 1XMJA 1NDHA 2FMHA 2OD2A 3DKRA 1NQUA 1CUDA 2VG8A 1JTFA 4CXMA 3DMYA 2P9TA 1SCUA 1R0WA 3RHZA 2YNMA 4C3OB 4BJHB 4DSOA 1C3XA 4B8WA 4E11A 1KQOA 5AUOB 4XJVA 4PBRA 3YASA 4MYCA 4HDOB 4F0JA 1SOVA 1TPZA 3HFJA 1K88A 3UT5A 1ZD9A 4GOMD 1T3HA 4IMRA 1N1EA 3OWHA 3BSFA 5FI0B 1Y33E 2R1TA 2ZSFA 3GDGA 1JUDA 4HPWA 1K5HA 3WGKA 1LGYA 2HI0A 1M74A 3C16C 4ZYTA 4M9UA 4E5VA 2NYUA 4W1PA 2QN8A 2JAWA 2AOWA 3U40A 1W5AA 4ZWNA 2B92A 2IIBA 4ZMSA 3QP9A 2NGRA 1ZWLA 1NXTA 1N9KA 2QTTA 3A9TA 1ODIA 3FPCA 4G86A 1KP2A 4RLSA 1G4UR 1WSDA 3QXGA 2PL9A 1PG2A 4L8VA 3B2QA 4TQ9A 4R40A 1C7ZA 4KAFA 3UPDA 5LSAA 1HLDA 4LOHA 5JYDA 1AQJA 2PWPA 3ONWA 4XJSA 1P33A 3AKCA 5FD8A 2ZYRA 3FG9A 2YY5A 4PCVA 1GPMA 1Z37A 1HE3A 4RVCA 3ESYA 4EG6A 1XRNA 2IZ7A 2O2SA 3AKDA 3Q5EA 4TXMA 1JIQA 2VUTA 1W2GA 4ZOLF 1XLTC 4U5XA 2NZJA 4C5CA 3LXUX 1OR8A 5HMMA 4FYHA 3FOAA 1WSWA 3VAYA 3IPRA 4DDTA 3ZHXA 3LLSA 2AOXA 4HZUA 2VYVA 4YAIA 4ZZIA 4JXKA 1L5VA 3D6NB 4TSKA 2Q8PA 5DHQA 3TOZA 3JQPA 3RKRA 3T99A 4UOZA 1VG0B 1I0ZA 3O6VA 1F1JA 2F1HA 4R81A 5H80A 1T9HA 4Z4IA 4QOIA 2JIPA 3NIDB 4N5DA 2O7VA 3DWIA 4QJBA 4V0ME 4Z9XA 2QG9A 4FC7A 4JJGA 2VYQA 2QTNA 5DBHX 5IUJC 1HDOA 3O9MA 2H8KA 4D9CA 3FOFC 1QM5A 5FBLB 3T3NA 3I9OA 3LUHA 1RDFA 4QG7A 2JG3A 1HC7A 2Q2VA 1B3BA 1MB0A 2P0EA 2ZYAA 3NNSA 5IYZA 2LCFA 3INYA 1Z7WA 4AN4A 1BXZA 2DH5A 1E1YA 3F8TA 1XHLA 1Z07A 2A9JA 2WJ3A 1YCDA 4GX2A 2XWBF 5IABA 1TDJA 1IXRC 1RAGA 1PFWA 4YDSA 1ADCA 1FVXA 1SPXA 2WIGA 5ILGA 6PFKA 4J4BA 2VNHA 4DNOA 1W9MA 2WYWA 4PLZA 3O2NA 3IBGA 4WRRA 1HT3A 1S9HA 3TLAA 4BKOA 4KL8S 3GX1A 2ID8A 5JAZA 5KQMA 1FFXA 3BK7A 3I8XA 1C8BA 1EK1A 3W5UA 4D4KA 2NP7A 1IN1A 2BUAA 4CHTA 4L16A 4MJLA 1GLGA 1FUYB 1KXZA 4DV2B 3VR6D 1NWHA 4U2FA 1MOPA 4PPYA 4NFLA 5DYTA 3UCEA 3NM5A 4L9SA 5KQLA 2W4IA 1D03A 3EISA 1JHRA 3EGXA 1RWKA 1VJ5A 1PTJC 1RQPA 3AY6A 1ZH6A 3PQ5A 2ZCVA 1W94A 4ARSA 3I5YA 4LJ7A 3G89A 3CGWA 5LM3A 1ZUD1 9ATCA 5FHRA 2XI4A 3DMHA 1ZJWA 1PR0A 5AM0A 4WAUA 2GZAA 1YL5A 4EECA 3E3OA 2I4TA 3Q7PA 1ZCZA 4XFJA 2HQOA 2ZSUA 1SBNE 2Q3JA 3BF8A 3FUXA 4ER3A 5LD2C 2Z6QA 5AD1A 2XADA 5TEVA 1JH8A 2PWBA 1A9TA 2OZLB 1WY5A 3Q8KA 1GNLA 2JD1A 2QMUA 3V1LA 2Z8YA 1S6YA 3MWFA 3BB3A 3HBJA 3PC4A 4EJ2A 1OFVA 5IASA 4LF9B 3L46A 2R86A 1SHLA 3K9WA 2H1SA 4N39A 3FLMA 4TTSA 4D4JA 2JBHA 4F1WA 5GVSA 1DELA 2FWMX 5G1PA 1B16A 2CB9A 2RH4A 4PANA 1RBYA 4YMVA 5A4IS 1QYWA 4DY4A 2HV9A 1Q84A 1HE5A 1OLXB 1C4KA 4GZLA 3A2NA 5A5GA 5HM6A 3F7NA 4X3CA 3X1MA 1FDTA 2WJZB 4GG1A 1ZDMA 2F8TA 2Z4SA 2BAGA 4P9NA 3EK2A 2FFQA 3EZ7A 1KS2A 5JUWA 1EVKA 4ZOEA 4R7ZA 4GPEA 5AJHA 3WAGA 1UK6A 3DPIA 5EWJB 1X2BA 2HXSA 1L4FA 1GQOA 3WIEA 1LSSA 5BY2A 3P4XA 3NNDA 2R8RA 5K4HA 3OX4A 4V39A 5I7UA 3KDPA 2VLBA 2ZJFA 4R01A 2PR2A 2YIDA 3ELDA 1WZ2A 3UOWA 5DNVA 1T5LA 4PQYA 4WACA 5BR4A 5HZKA 1ABBA 1WO8A 4DCOA 5EGNA 4IBOA 3GP8A 2FQ1A 3P9XA 1QU3A 4GOOD 4OYYA 4ALKA 4HAWA 4A6PA 1VCMA 3PUJA 1WX1A 1P4AA 1N92A 3I58A 3KHTA 1A9XA 4KWHA 1RP1A 2OAQ1 3PNLA 5DWDA 2OZKA 5CDFE 5JFTA 2HLNA 3LK6A 4B46A 1E3QA 3DGFC 1MZPA 5DLEA 5BN1A 3IL2A 2ATXA 4K9MA 2UZ0A 3EPLA 3B6KA 4GP9A 2CLHB 3ADBA 1ISJA 4X7MA 5JCJA 1W581 2IUSA 2GCNA 2QSZA 3GY0A 1A5TA 1JFFA 3A70A 3JZFA 4DR2B 3M4ZA 4OHBA 3TECE 4G1VA 5AKXA 4ZZ2A 3KKMA 3NJRA 5DHTA 1SKUA 5CD9A 2G63A 2RK6A 3LW7A 3LRXA 2X8BA 3BFPA 1XRJA 4CMHA 2ZR0A 1YE8A 3WZ2A 4CDRA 3I30X 4B87A 3I6IA 1CVIA 1KK3A 1GPNA 3DBOB 4RM3A 2KHZA 2DUJA 4MS1A 4MV1A 5EWLA 5F2EA 4QNMA 3OQMA 2G8NA 5A3QA 4G1MB 1OTHA 1Q0SA 1YHNA 1XV5A 2HL6A 2IXGA 3NEYA 4PGAA 5FIUA 3RT7A 1K7XB 3UFXB 4OEHA 2J9YB 4LMAA 3PNSA 3WS7A 5BUCA 3VU9B 3FPJA 1AE1A 3LP8A 4RZQA 2I91A 1PJZA 3LC2O 1F2UA 5G0WA 3QENA 4O3FA 1JR3D 3BYZA 4IIJA 3WL5A 3ZS8A 4E12A 4URXR 1EIZA 1SVNA 1Y1RA 2JZCA 4LRYA 5TQ2B 3JQBC 1M0WA 1H1LA 3G85A 3N7TA 4QWMA 3N2GA 1CF9A 4RIEA 4GX1A 2E55A 2IYPA 3A04A 3IUEA 1IE3A 1P9OA 1X7YA 2O2ZA 4ER5A 4B2PA 1TM5E 3FVVA 1SOAA 2H1WA 3NYQA 4Q7QA 1QZTA 2OHVA 3DFUA 1PQWA 2IOYA 1GO2A 3IEKA 4NYMQ 3DF7A 4X0EA 3HBNA 1B41A 4FYMA 2AJBA 3OZUA 1L5QA 1AJEA 4IHAA 1C4WA 3VHLB 3E48A 1KI6B 1E4YA 4XUCA 1S8FA 3IIMA 3WLTA 4KR2A 3RVDA 3P2EA 2OFOA 4Q21A 4QECA 3DUFB 5JC1A 1TIBA 4OATA 2ONYA 3CXUA 3IMFA 2NUTA 2GK7A 2OZEA 4X1OA 2HO5A 2PQ2A 3M5PA 1UFQA 1PVDA 1JZTA 2I2BA 4NYIQ 2DVMA 3T7AA 5BW4A 1JJFA 3AUAA 4OHVA 5BNFA 1KDPA 1HOXA 2CV2A 1CHDA 1QGDA 4JT9A 5CFQA 2Z9DA 3VUFA 1GPWB 4UVHA 5C5EA 3HK2A 1SK8A 3MPUA 4NK5A 2R1UA 1F6WA 2NXWA 3RODA 1TPYA 1XRLA 2VJQA 3KOZA 5E4YA 4YP9A 2GRAA 1Y8QA 4QA9A 2PLNA 1OILA 4X54A 3RAFC 2LE0A 2XBLA 5MDHA 3F2IA 1K8YB 5C7OO 2P9FA 2D13A 3MSCA 1YI1A 3F4KA 3ND7A 3VNAA 1KY2A 1ULAA 3TQRA 2JHAA 5IYZF 3ZIUA 1KE1A 2X76A 4GRIA 2WIDA 3B9QA 4EZBA 2Q9UA 3WLAA 2AX4A 3ONNA 4YDQA 3OKPA 1NI4B 2BHNA 2FQYA 3HJBA 4J0FA 4RFSB 4TXLA 2R6ZA 1DV2A 3Q8XB 1W5BA 5MN5A 4P0QB 2QG6A 4PPFA 5AJXA 3CZRA 4C29A 1AM4D 2PO7A 3BRWA 1AUQA 3BMOB 1SO8A 4L85A 4UPEA 2A2ZA 5JRDS 1YRHA 3DAPA 3WIBA 4CLRA 2RBGA 5KJ6A 4CUJA 1C0KA 1CDOA 2A0YA 4R3UC 2FN4A 1LLUA 1W1IA 3IKLA 3V7WA 3VJLA 1TF5A 5HZMA 3IBFA 1LJ8A 4QNNA 4YC7A 2BGNA 5EZSA 4AJOA 2QQ0A 3C5EA 3V3KA 1CY4A 3KZCA 5D7NA 4D41A 2P7IA 1HO3A 4EKIA 5A9SA 2FSPA 1GNSA 4DVJA 2IT1A 1MIOA 3KYCA 4L0MA 3RABA 1BDMA 3PTLA 5G40A 2QM8A 2Y2VA 3EQ7A 5TGTA 5IJWA 1ZD5A 4LOAA 2X8JB 3A36A 4Q00A 3ADKA 1IOZA 4HDQB 3B3QA 1KSHA 4CLDA 5TMEA 1ZRHA 3ED1A 1K0FA 3FNIA 4RH3A 4ISCA 4PN7A 1N57A 2G72A 4LBVA 4WCDA 1OC4A 3WIOA 2WIBA 1D4FA 2RK3A 4U9IS 3QTLA 2EZ4A 3AERB 3NRJA 3N8KA 2OESA 3S2UA 1VCIA 2YJNA 5FI1B 1V4NA 4TS4A 4N3BA 2Y0PA 2BGWA 4LHWA 3KXPA 4H3SA 2NQ8A 1T5TA 3MRXA 4LV6A 1M2HA 3ZJ4A 1RC1A 4KDCA 1NGSA 2AOTB 4MGYR 1JEEA 2IYXA 4V1CA 1Z2EA 4WDRA 1K0UA 1UBTS 4CNQA 1E3LA 1HLPA 2AX3A 1D6SA 1Y5LA 1Y82A 4OL9A 5JPCA 1GPDG 2A59A 2BBWA 3DWGA 2NQ2C 4CIWA 3JYPA 1FJXA 4LZPA 2P6PA 3NIWA 1DO2A 3B1YA 1QNFA 2JH8A 1TD1A 4ENPA 4DLYA 4IRUB 5AH0A 2I33A 3TLXA 1WB9A 4FT4A 1M33A 1Z4KA 5FOSA 4BATA 1IN7A 1S3FA 2PFKA 3IUPA 1CY6A 2V7QD 2W22A 3OQ6A 4KVZA 3ZHQA 5BQ3A 3VA7A 4RJJA 4YT5A 1RJEA 1QE5A 2O07A 3AEXA 1D1PA 1ZH8A 2C2KA 3C6YA 3CF0A 4AECA 1RHRA 3ANMA 3QLJA 1AB5A 3ZCVA 4HLQB 2X40A 3DHWC 1VMDA 1CWUA 1U81A 2WD7B 2VCHA 2Y0EA 3JX9A 4MDYA 5AKZA 3U3MA 4RVSA 2XYQA 5AVUA 1OPRA 1PD1A 1PYDA 4ZREA 3G02A 1VJRA 2A9KA 4EHIA 2JLXA 2YQ4A 1E2MA 1S2NA 3O90A 1WTCA 3FR8A 4LJ4A 1FU4A 3OO0A 4BCDA 4L3WA 1DBIA 2OHJA 3VZSA 1DFGA 2CDBA 2H1LA 1YAJA 3QMVA 1FMLA 3VKGA 3N2IA 1MFPA 4NSNA 1ODKA 1WD7A 1YFZA 3DFZA 3NHPA 3NAMA 5EOVA 2Q8NA 4DREA 1NURA 1SOMA 3NVMB 1C30A 2B36A 5D5PA 1ZH4A 3KXKA 2ODWA 2FSFA 1RWNA 3AB8A 4CTOA 1BW9A 2QTVB 3K6SA 1K5GA 3PVZA 3W7BA 3RSOA 1CUZA 3ZVKA 1AKVA 2QJTA 4K1LA 2GJ8A 2REOA 3EGWA 3WNCA 1KR2A 2PL1A 2ISQA 2WSYB 1QQ6A 2W2LD 5I01A 2JJYA 2PUCA 4GQAA 3W78A 4RTOA 2VKTA 1SUBA 1GU7A 2Z5LA 2DFNA 1G20A 2EG5A 3PITA 3KPJA 4PGMA 1L5FA 2VFAA 1SHUX 2Q3BA 1J9EA 3PE6A 3ZUPA 2W2QA 4ND8B 1TAHA 5C46F 3B52X 1HGXA 4HGRA 4UMFA 1O77A 1W4ZA 3UK1A 1GGVA 2J0UB 1KYQA 5BV7A 1K9SA 1IN6A 2GLUA 3NHKA 3ORFA 5K0EA 1VG9B 4JT8A 3ZY4A 3OIWA 5EE9A 3QBEA 5LMNB 2EGGA 2GPSA 4U3JA 5FTKA 3UAXA 3PC8C 4DDWA 1SUIA 2PZFA 1QFSA 1ZAKA 3JTEA 1E6CA 4IIJF 1QRAA 1AQLA 1VHJA 4Y2XA 4OM7A 4HNTA 1SU6A 4LBYA 4B6PA 4ZKDA 3BT7A 2VT3A 2Z4TA 3RBAA 2XUJA 2QTAA 2BM8A 1XCMA 5C9ZA 1I2AA 3BWDD 1EE1A 3I2KA 1JLKA 3L1VA 4P4SA 3OMWA 1CJCA 2GXSA 3MTGA 2ZRFA 4JFAA 4O2LA 4E07A 1XQXA 4JYCA 1G8PA 3PFGA 2H2HA 3A3OA 4HWOA 3VKUA 2XODA 2Y0CA 2QPTA 1KJNA 3MT0A 2O0KA 4MW7A 4D44A 5IT0A 3V00A 3W9UA 3A1WA 1HI9A 2E0IA 3AX6A 2G08A 3TNLA 2RHBA 3A27A 2FSGA 1ZKDA 5GPBA 2WJWA 1U04A 3QPBA 3CURA 4GD3Q 1GKLA 1NY5A 1CUIA 4LHZA 3T9AA 3IR5A 4CR8A 1CC1S 4DCUA 3H5IA 1ECGA 1SHJA 2FV8A 2QV7A 1XNJA 1BQ4A 1N75A 3K0BA 4LC0A 3SHWA 3ZWWA 4DADA 1ZI9A 3P2MA 3OC6A 5BVHB 2EQBA 3PPVA 1MW8X 3OJ0A 1P7YA 3FZYA 2YV1A 3JQFA 2EOAA 1S1MA 4FNAA 3N9IA 1KNXA 4NBWA 1KSGA 3VR2A 1N6OA 4MHOA 5P8WA 3KTFA 2HWKA 2PMFA 3DOJA 1WOYA 3G5LA 3EZ2A 3ODGA 4RPIA 2X22A 3L0YA 4KFTA 3V8BA 2P5UA 3HA5A 4RO0A 3ZDEA 3PNKA 2FN9A 4BL5A 5F76A 5KTRA 3C43A 4QPCA 1FNCA 3I0NA 1C3VA 3X44A 4Y9DA 3ZHVA 2EW8A 1REQA 4X65B 1KO5A 3UATA 2QYSA 1IVNA 2ZAMA 3O8NA 5L51A 2FW6A 3FZNA 1ZC4A 1J09A 1JAYA 2CF6A 4IAOA 4PR0A 2I65A 4GZMA 3T6KA 1M10A 1X8KA 3NJ4A 4J0QA 4D9GA 4Z0PA 3GP3A 4KNYA 2Y6VA 4MPPA 3FIUA 2KBFA 4HL6A 1AF7A 1WV0A 2M9MA 1VRWA 5K3FA 4F71A 2JLZA 3NRCA 4HGZA 4PC6A 1WB5A 3VRHA 2J4DA 1LPPA 3D6TB 4PRYA 4Q1EA 5H3LA 1K4KA 3F6RA 3IAS1 3Q0IA 4OJYA 2EJWA 4WKOA 2EBHX 3WICA 4BNNA 4C4XA 4X62B 1X7WA 2FGJA 3BG5A 4C7KA 2GA8A 2EGHA 4UDXX 1QHNA 3CWCA 5TJ9A 3ZYZA 4LXYA 3OZFA 4HQ6A 4LK3A 3VVBA 1LZLA 1TO1E 3CMMA 2RGGA 2IUEA 4A5SA 1KI7A 1QKJA 3IMEA 1DRJA 3QHPA 3EYAA 3MWDA 5B3JC 1EI9A 1FFEA 4QU5A 5F73A 4A8JA 4YEDA 5DV9A 1FC0A 1M73E 1KC3A 3KLMX 2D0IA 2D1SA 2G9NA 3LZ6A 3UFBA 1Q14A 2JFOA 1HMPA 3F9RA 5DM4A 3U3OA 4G0WA 1QVVA 3TR6A 2I66A 1I30A 1P1RA 1QQ5A 1YJBA 3K5WA 4NNJA 4RW0A 1LW7A 3SF8B 4O8ZA 4UM5A 3L8YA 4XSGA 1KK2A 1P77A 3HXTA 3ZQ6A 2DTDA 5ELXA 4QBIA 4A0HA 4LF4B 4G01B 4D02A 1EM8A 4ZVNA 2CEAA 3FJ1A 2QI9F 1DRUA 3O3OB 4IMJB 2IPOA 3TPZA 4XWWA 5GZ3A 4Z9AA 5KC9A 3RGWS 9LDTA 1W49A 3F49S 1L7AA 4GNRA 4EJMA 2CNNA 3OEHA 3SHFA 2J7PD 1Q5PA 1JG3A 2H5EA 2X2OA 1IIRA 2HT6A 5BP7A 5EMKA 5AHXA 3E8SA 4EK9A 4LWZA 2ZYVX 1OIVA 4JX9A 2NMVA 2JKZA 5IBRA 2F1RA 1BIFA 2OBYA 3OCXA 1BNCA 5B1EA 4BN4A 5TPZA 3QU5A 1ZK4A 3FYUB 3IOYA 2NVUB 5IFLA 1G64A 3TQSA 3F3KA 1GTL1 1R8JA 2JF0A 4HFMA 4PE5B 4YBZA 3MTAA 3RK1A 1GGMA 3FKJA 4BNLA 1RJWA 4I4CA 3C3YA 2AFHB 2XYPA 3QRWA 3W05A 3KE8A 1WEHA 2Q41A 4N7MA 5K51A 3UF0A 4UUAA 4NMLA 5E6RA 5F7ZA 5A6SB 5I9NA 1GNQA 5JMPA 4IZIA 2WWHA 4HX5A 3ZDQA 5DGIA 2HLPA 3QXSA 1U0FA 1ZN7A 4K9QA 8OHMA 4BV9A 4FFBA 1B00A 2OE2A 3CLVA 2EVWX 5CVEA 5DW0A 3L79A 5LBIA 2I7XA 4A1FA 2MR6A 3GLGA 2A3RA 4TTJA 4ND1A 1MV5A 2PAFA 1HSOA 2BZ0A 2W2TA 1PR4A 4BXOB 5CIYA 4KQJA 3IUQA 3VXKA 4HLNA 3KTOA 2NSYA 1O96B 1EZ4A 4A7PA 1Q20A 3IHKA 1V2GA 2CK3D 4QSMA 1VKOA 3M9WA 3FMIA 1SEPA 3S2EA 5LR6A 1MEJA 2Y3IA 5IC5A 1GGEA 2C03A 1I1QB 1N7GA 1RMYA 1XTRA 1FJHA 1CS0B 2OLJA 2RGYA 3G2HA 3R5JA 2AZDA 3H8SA 4O0LA 1KKMA 3I9MA 3T94A 3FTFA 1UQUA 1V45E 3LQ1A 3KT3A 3WYBA 1KAEA 2AZ4A 3M6FA 4HFJA 3TNYA 1NR5A 2V4ZA 3CG4A 1SCNE 5KSZA 3IUJA 2JLUA 1RCFA 2DE0X 3BWEA 3WK8A 2EF1A 2LDXA 2PRZA 1LUAA 2JCVA 1XI2A 2E4AA 1Y4UA 1G1MA 2AWOA 2ZBVA 4JKYA 4FX5A 3WSTA 2BISA 1EWVA 4BP1A 4XCVA 3SKYA 2DFTA 3C3JA 3QLEA 2BE7A 3ONVA 4KPEC 3A1FA 4OBEA 1EWYA 1QQTA 1RHJA 3WGVA 1R9NA 2XOKD 4JGBA 9MHTA 2OBMA 1ZSVA 2Z8XA 3JAWA 3SICE 4G25A 2ERCA 4YLYA 2R97A 5F77A 4RPGA 5DRTA 2GLXA 1DOAA 2EFGA 1EBUA 3GUCA 3OU2A 4OAOA 5DCLA 1L4NA 4JUIA 5IANA 1OT5A 1X7DA 1WHSA 1VA4A 1YHZA 4YMIA 4MQEB 3TQQA 1KPIA 3AG6A 1O58A 1X8LA 5HIMA 2Q07A 2XNKA 3S28A 4FOSA 1DV1A 1YVPA 3WMXA 4D0GA 2WG1A 4AUKA 1XN4A 3MK31 2C7OA 3KOYA 1YA4A 4KJZA 1P0FA 3ESQA 3HU5A 3ZKWA 2IUFA 1MABB 2OQVA 1FFBA 4MA4A 3PX3A 4YV1A 2VF8A 1PZXA 5L7TA 5E6SB 1F12A 2P0YA 3LRPA 1E18A 1I6MA 4NXMB 3VR5H 1SKAA 3R6GA 4IGAA 4ZHSA 1VPVA 3MGCA 4MWCA 1JQLB 4R2LA 4YFYA 1ISHA 2NTYC 4JR1A 3NONA 3BAZA 3PCTA 2YN2A 4PRKA 4IZHA 3I76A 3O75A 1BWQA 2HMVA 4W1QA 3UBTA 2BLLA 2F62A 1SR8A 3GCDA 3Q7IA 4PV7A 4Q1VA 4DE5A 2ZB8A 1AZLA 5FWXB 1C4OA 2LP4Y 1RD4A 1QVRA 3BCSA 2DFPA 3WRYC 1I4TD 4FW8A 4KQMA 4LPKA 5B1YA 3DBRB 5JAMA 5K3EA 5IDXA 1I14A 4J6FA 3UHJA 4N5MA 1CJVC 4LJKA 3MBKA 3U3JA 1JR2A 3R9IA 4ENWA 5JCZA 3BERA 4PLFA 4ZTBA 1DCTA 1R16A 3SIPA 2R47A 2A9PA 1YRBA 3MD9A 3RIMA 1DE0A 1EB9A 2G1JA 4CIYA 1SBCA 4NENA 1T10A 2YV3A 1K7SN 2ARKA 1MVNA 3QHAA 5HE8A 4GP6A 3THWB 5BURA 4CFZA 1Y5MA 3NPMA 5A06A 2C5GA 3O03A 4XARA 4B31A 3I12A 2AYXA 2YXEA 1HYEA 4D9FA 1CEQA 1UXJA 3BMCA 1U3CA 3EGVA 3KOOA 5EQDA 2A7XA 3T0GA 1ZR4A 5EIAA 1NAHA 3KAKA 4RZHA 2P6UA 3U9LA 3RT1A 3U61B 1TQHA 1D5CA 4AFNA 1KRHA 1GGNA 4BO2A 2FY8A 1T2CA 1TADA 3DLTA 2WSLA 1OFHA 4O25A 3I4FA 4YRQA 1LF0A 2FPSA 2ZUCA 3JSAA 5EWMA 1PK7A 1PIWA 1D9XA 3AF6A 4INZA 4F4JA 4IXDA 1AQ6A 4BFWA 3HP1A 4NZOA 4C0SA 1YQGA 4YGXB 4F6CA 4P0PB 3H5NA 2HSWA 3GH3A 1YCFA 1C9DB 4U7GA 1QV9A 2AMJA 3AEYA 4DL9A 1QF7A 4PG8A 3GPIA 2G7MC 1Z75A 4BVGA 1UDXA 2NYRA 3RFTA 4TTIA 1ST3A 3IBYA 1DT5A 3GXOA 1MVLA 1E6WA 3DPSA 4MUXA 4ERNA 4PN3A 1M6VB 2Q3MA 5U4QA 3VR4A 1M1YE 4RQUA 1Z4JA 5HIJA 5J2UB 1HFEL 3I01M 2QX9A 2G88A 2LZ0A 2XUZA 3PQDA 2RGNA 4EDHA 4RTRA 3WWYA 3K0SA 1P2GA 2MSKA 5J4KA 2OPHA 3TF5A 3J80A 1KF0A 1FVOA 1HBJA 3OFJA 3GLSA 4JYPA 3RYTC 1CJUC 4WCFA 4YP7A 1PO7A 5F7XA 2H59A 3FKSD 2FMIA 1YBFA 3EWAA 2OZPA 3FCUB 3G9XA 4N7RA 3ZHOA 1O03A 4EG3A 5JCPA 3FPEA 2W6JD 3VGJA 1V7PC 2WKRA 2GFHA 1E8DA 5KDDA 1E60A 1GRNA 4B8YA 1GTRA 3OTGA 4PHGA 2WFLB 4PHFA 1ZUHA 2G6TA 1TL7C 4X63A 3CVWA 3ZCSA 3PGXA 1Q1GA 3TQIA 2R0QC 4AY6A 2YTZA 1JG6A 2HWXA 2O3UA 3CLSD 4K9NA 4ZHQA 1FYXA 1TYBE 2UXDB 4MLPA 3VOSA 1JAXA 2XYHA 4OSOA 5FI5A 1J8YF 1SPBS 3AVUA 2XWPA 2I8AA 4HGQA 3LHDA 4YJ3A 3CLRD 1N2HA 1XD8A 2RHRA 3JR3A 3TN7A 1OH6A 3GFRA 1Z5PA 2FEAA 2ZUDA 3CH6A 3FSJX 1V96A 4EARA 1YZYA 1CQIA 1MO5A 1WE2A 4UBMA 5J1TB 4N9QA 1H9AA 4RD3A 3A31A 4KXVA 2PKQP 1QH8B 4KPGA 2DEUA 4CLOB 2QT9A 3PJDA 4F3CA 3KDSE 1KKUA 4L02A 1T5HX 3QTTA 3KTAB 4MUGA 4PG4A 1V37A 4X00A 4JODA 2E1PA 2PQMA 1FUIA 4DMFA 2R6JA 1R8YA 2HJVA 3DMTC 2H65A 5AXDA 4B76A 4I9FA 2YZMA 1ZN8A 2QZSA 4Z4CA 4FHGA 1WW8A 5JR3A 1F9AA 2XA9A 4HR7A 5DCUA 1F20A 4UDYX 3RV4A 4C2UA 2W42A 3I0MA 4Y9SA 5KINB 2L82A 1VL8A 4C4SA 4OLJA 1DDOA 1XTJA 3OJWA 3Q3CA 4FR2A 5FOVA 4ZCLA 4ENRA 1DLJA 2GA9A 2ILTA 5TR9A 3TXAA 3MB5A 4FT2A 3THSA 5EXTA 5K6AC 4URZR 4HADA 3KYIB 5LMCA 4CMGA 3BIJA 3E27A 4GNKA 4ER7A 2GLTA 2XB4A 1RC8A 4B3RB 1RHQA 5CIWA 3FTPA 5HDBB 3WYCA 3EPHA 1Q12A 3QPAA 5I7HA 2WYHA 3EFOB 4AZVA 1BQEA 2V54A 4BBAA 4X1KB 2W2MA 1KYZA 1W5SA 3RRJA 3V1MA 4AS3A 2QYHA 3O1HB 5EYPB 3KQUA 4GBGA 3JQ6A 1A3CA 1L2TA 3DVRX 3GLKA 1JJIA 2IHKA 5CJ2A 4X3PA 3WWEA 4CBVA 1PUXA 4XKJA 1DG9A 1DRKA 4HDRB 4UE2A 4WLOA 1USGA 4I9HA 5BN5B 1RXVA 2HUNA 3B7WA 1K7YA 3GGSA 3M6IA 2B0CA 4ZQIA 3DO6A 7YASA 2XYRA 1E9FA 5CLJA 1LVGA 1T2EA 1Y42X 3NCHA 1B14A 1T1GA 1HQDA 2GRJA 1GDDA 3OZEA 2C7BA 4IJMA 4ZOAA 1R00A 1DXOA 2R68A 4ZO6A 5BRJA 5CBPB 3WNBA 1M6WA 1G2QA 2C9YA 3SJZA 3K0FA 3EXEA 3D7KA 1BRTA 1VXOA 3LC1O 3MTEA 3WFIA 3LJKA 3CLTD 2ODEA 1ECJA 4ZCTA 2YJZA 3AINA 3DZIA 3GJQA 3ZY6A 1G1AA 2XGMA 4QELA 4G0UA 4ZJUA 1NQXA 2J4FA 4AI6A 1K3UB 4C3VA 4PZAA 1ATIA 4D6XA 1AKQA 2JIMA 3CFYA 3SX0A 3R20A 4FD3A 3RU2A 1WF6A 1T34A 4RF5A 2FMFA 3FNEA 3IHWA 2JZNA 3TI9A 5T6BA 1EK6A 1F6BA 1J90A 3R0ZA 2VP5A 5JTTA 3TJRA 1L7OA 1O2DA 3BWBA 1TK2A 1J97A 1WU8A 3G9QA 2ZI6A 3AR6A 5B3LA 4XEHA 1R3UA 3Q8WA 3B6ZA 2XDQB 4LOJA 3K70B 1JDUA 4OREX 3VM6A 4D2IA 1J5XA 4CM9D 1OAOC 1X70A 3LFUA 5EERA 4R0MA 5KOYA 1ZAYA 3HDGA 5EE5B 3NT5A 1SB9A 3RS3A 3P0FA 3QX3A 4YUYA 2FX3A 4ZEVA 1E5XA 5F3WB 5ADUS 1FQKA 4O4IB 3QK7A 1M34A 4NV1A 2I62A 5HEKA 1BDHA 2BM9A 2OGUA 2X0RA 3M3DA 2EZ8A 3LPCA 5ADWA 3U4QA 3N76A 3ENVA 4BECA 3LUAA 2H92A 2R7KA 4RCZA 4BLWA 3GLQA 2QTWB 3FDJA 1FTYA 1TJYA 2RAPA 2H6EA 4WBSA 2ZIWB 4NH0A 4L4SA 3L1JA 4MAFA 4FMPA 4S1WA 1ESNA 1NMSA 2XMPA 3L6RA 2IV2X 2C2HA 4IQGA 4YJGA 5J5CA 4RXTA 4ZCSA 2Z8ZA 1HOTA 2FVXA 3RQSA 4JOSA 3IFSA 1GR1A 4LE0A 2ZLBA 1H8ED 1Y5NA 3CGGA 3PHHA 1OWPA 4BP3A 1C3OB 1NULA 3TLYA 2BH9A 3WWOA 4YWHA 2GEFA 2CMFA 3L40A 3U0BA 4B3DA 2PJUA 1DNPA 1FK8A 3L9WA 5LZ7A 2FUEA 2FF5A 3RU7A 3NIBA 2NAPA 5DNCA 1U31A 2RHOA 1E20A 3VZBA 4CT4B 3PQ2A 1L7DA 1P2VA 2LR0A 5ITVA 2GCPA 3I72A 2IHZA 2VC2B 2FPRA 1XZBA 4HDMB 4NFYA 4P84A 5BWNA 4X66B 4OQNA 5FH9A 2HRQA 2OXRA 3HVUA 1LDEA 1ESDA 1O9GA 1PK8A 1TT7A 1E6MA 1RTTA 2NO6A 3ND8A 4RS3A 121PA 1Z16A 5K6TA 2RAVA 1RRKA 1Y5RA 5T8KA 1EK5A 4PZEA 3BWXA 3PVCA 5CCEA 2ZSJA 2F48A 5GVRA 4BB6A 3UQYS 3DH0A 1XMXA 1CEEA 4E88A 2OM6A 4DNQA 2AEJA 3ROXA 1GCIA 2K6GA 2WZCA 3MWEA 3R6DA 1N2EA 1P1CA 4BYMA 2DWPA 1USUA 1R5BA 3ZY5A 4C9BA 4Z9FA 1RQNA 3JAKA 4ABYA 3TSZA 1J39A 4MVJP 2GDJA 1SKBA 3K0EA 2AQIA 2VHTA 1MVOA 3OU7A 4WNAA 3RSHA 3M1LA 3DOUA 4LRQA 2ZIXB 4TKMA 4YP6A 4EGAA 1KDRA 3ESZA 3DYVA 4F1KA 2UYYA 2AR9A 4QKQA 1RLIA 3KSMA 4A91A 4ZHQF 3I04A 4PG6A 5AVKA 5GY7A 5IDWA 3C3EA 4WLFA 1NVVQ 2C2OA 3CVYA 1U3UA 2BW0A 2WT9A 1DTWA 4YJ3F 1WM1A 1V2HE 4D8WA 4RTMA 1S8NA 1N2BA 4ALIA 5BNWA 1JSZA 4G0PA 5JNUA 2PT7A 3G82C 3R3SA 4NV0A 2XKKA 5D87A 1RE1A 1XMIA 2B3DA 3B5EA 1NNLA 4GU5A 2COUA 4Q01A 5JAIA 2LV8A 3A6FA 5FO1A 2ZJ1A 2PX5A 2I55A 1HL7A 4MMZB 4EVSA 2NTJA 2NZUG 3OPMA 2BGIA 3HB7A 5F33A 1FLVA 3FCYA 5KVCA 4RSMA 2G0AA 4K40A 3BQNB 3MIIA 1P5RA 1ZJZA 1LQ2A 1U5BA 4MH0R 1WBBA 2G40A 2BZ1A 4MNTA 1GR0A 2ZBEA 1W46A 4H6VA 1TU4A 3ZLTA 4EPRA 5AM4A 5AKJA 4J7UA 3GFFA 4FQ8A 3C3CA 4NMWA 4OX9Y 1T5BA 4MR9B 1VKNA 3K96A 4ZFNA 2AFHE 1Y81A 2DPMA 3KU1A 4YLEA 3V4SA 1LNZA 2UYOA 1GLVA 4OLBA 1G8MA 4TVOA 1YZUA 4ER6A 3I1YA 1TF2A 2RBKA 3OLZA 4AAYA 5K2MA 4B40A 2OCBA 3HRKA 2WPDA 3BDAA 1SXIA 5CJJA 2YXBA 3CEHA 1J2RA 3E15A 1GPH1 1NSYA 3KUKA 4FU0A 4Q3EA 1LI7A 2JA1A 4G5SA 4HMOA 3STUA 2C2YA 3K8ZA 1QE3A 2V6FA 2HN9A 1CZOA 1E9VA 3HU1A 4MI1A 5JCOA 3TZEA 1NNUA 5BN3B 1CERA 1K7EB 1FDVA 1M5TA 3PQ4A 3ZDCA 5KTKA 3WLMA 3ANSA 5IJ9B 1ZOPA 2OBNA 4R71A 1V43A 2Q6TA 2IXEA 3LT1A 5EE0A 3THYA 3U7EB 4F06A 4PR3A 4E31A 2BHLA 4OQPA 3MHTA 3W4JA 3H8VA 4GGPA 1W87A 2NUAB 3DMNA 4B4VA 4R1SA 4ZOLB 3W1EA 3CUUA 3E2IA 1VM6A 2GVDC 4MRVA 5ITZA 4BNIA 1D2HA 1P9RA 1SULA 4TN1A 3AKZA 4E4TA 2ZJ7A 4F2GA 4RD1A 4IIDA 1AK1A 3LL7A 1GYRA 2IHJA 1HRDA 3GJZA 2Z2JA 3G7SA 3B1XA 3D7SA 3FKQA 4Y2PA 5HBRA 1B2RA 1RYHA 1V5EA 2W71A 4FOPA 4XPZA 3ZDYB 4Q3NA 5JSFA 4MK4A 3ROGA 4IO1A 1FFGA 2DWUA 4A82A 4HSEA 2FQQA 4TRMA 3U9TA 1WPQA 3QLVA 2CC2A 2BKLA 4XYGA 4HZGA 5CW1A 4O3MA 1QP7A 1WCIB 3E05A 2OQIA 4HQ0A 3MJEA 3HYSA 3D2CA 4O4LA 1VFPA 1T9ZA 2IHBA 3KQHA 1J24A 3Q8MA 3GFBA 1U1IA 2EC5A 3SE0A 4MGEA 1NXVA 1XHFA 2E85A 2C31A 3OX3A 1RYMA 2ORYA 2Y1GA 1YK0A 5GV8A 4EB6B 2PX6A 3O21A 5DASA 5DHRA 5I7FA 4H7JA 3HCFA 3QOWA 1DG1G 4EO9A 1P17A 4QXQA 3RASA 1HORA 4JC4A 2OD9A 2F3SA 3LKBA 3NYRA 4ZT7A 3LTEA 2W6IA 3DDNA 5ER9A 5C1BA 5AOBA 1XMPA 3D5EA 3ANTA 2GB4A 4LZNA 4M0UA 5K03A 4JI0B 4RTNA 3CRZA 1KDOA 4L28A 1GZSA 3RUDA 1AKNA 4BB9A 1CQPA 3TUJC 1V95A 3C2QA 4RIIA 2ZB4A 3JPWA 1B23P 4G41A 1EJ2A 4XUEA 2GKOA 2FWPA 4V24A 5DKFA 4BO7A 2BJVA 1HQCA 1MTZA 2QNBA 4UXIA 5FR2A 5JVDB 1IWOA 2B20A 1H6CA 1KA9H 3MMPA 4LDPA 4NVRA 4HHEA 1Z8HA 4WGFA 4AJKA 4DLTA 1TFUA 4R84A 3MCVA 5A9RA 2HQSA 4G37A 4QPJC 4X6UA 3EZGA 4B2LA 2PBRA 1X39A 3TEMA 5CHYA 2GTPA 4EUSA 4O08A 2V03A 3MJFA 3ZWDA 4EYGA 1CUWA 1F9EA 2XXAA 2Y1XA 5IEJA 2BELA 2WKPA 1I6LA 1F5NA 2ZS9A 1JPJA 2AGVA 3JQGB 4RK1A 2ZUTA 4K6FA 3SOPA 2ORVA 3EEOA 2QLMA 4ARAA 3BE8A 1JIXA 3CCCA 4C7VA 4I6EA 3DONA 3FNFA 2CKDA 1SIUA 1XJ5A 4G1BA 3DBLB 1J2EA 4G1EB 1E94E 3OE5A 3EZLA 1PZMA 4J16A 1P7WA 4PYIA 3PD1A 4DWJA 3I2JA 4RSGA 5CHEA 5I5GA 2BMFA 3BD9A 4HGNA 2F64A 3O95A 3TZQA 2MMCA 5K0CA 2PUFA 2Q21A 2VSXA 4M2LA 3RRNA 1HDRA 3BC1A 1B8VA 1BFUA 3DVSX 3KQKA 3RRFA 2DLDA 2XOXA 2ZK7A 3AMVA 3A6JA 3CRQA 3ISTA 4L0QA 2X0FA 2PUDA 3LV8A 3Q6NA 4OI1A 3B85A 4I9NA 3GFTA 1N2IA 5GGYA 2QRJA 4CKBB 1X1EA 4A2CA 3AB3A 3FYDA 1LK7A 2JHCA 3AUFA 4MQFA 1RXUA 3NETA 1LDYA 3AEKB 3WI7A 4FFSA 3PEVA 4KREA 1IB6A 4KGVA 3QGMA 4FWIB 1QJCA 1CRQA 5C37A 1EFUA 3EQ9A 1P1IA 5D3ZA 4ZT3A 2QAIA 3EGDB 4G97A 3P26A 4JLPA 2XSZA 1GZ6A 2ZT7A 3BM5A 5DULA 4ES6A 1UJBA 3P2JA 1YMQA 1KHHA 1QO0D 2OOSA 4HK4A 2Y4NA 4JKOA 4N49A 4JNCA 3M4YA 4DZRA 1E2QA 2UYQA 1E0JA 2YW2A 3JSXA 1C4XA 2YWGA 4Z8XA 2D2IA 5JMOA 2O48X 4MUFA 1V5WA 4C7JA 5CFNA 1Q0UA 2Q2QA 1VCOA 1ZVJA 2GHIA 1BWSA 4B0OA 3F6SA 3PR2B 1K5DA 2ATVA 1ZIDA 1BEEA 3IBSA 3PQEA 3QXHA 3QW4B 3R5KA 4JI3B 3ZE9A 3PV0A 4ZYXA 4YRSA 4S05A 2D4HA 1RXSA 4CQJA 4RWZA 1N9GB 1YMUA 9ABPA 1UC9A 3PWZA 1JDTA 4NCKA 1G19A 3C6ZA 2JJ2D 5JY6A 3DDOA 5FFFA 1BVRA 3L7CA 4GXQA 4DJJA 4YV0A 1CUEA 3FTCA 4PINA 2HLDA 3PL5A 4FMCF 3E9MA 2LWIA 5LJLA 3U09A 4EF5A 2GWHA 1X9HA 1SCUB 3J81A 3N8NA 1GL7A 2MJLA 2O19A 4WNYA 3KZKA 2VEOA 3KEOA 2UYCA 1DJMA 2OKGA 1A8HA 4PLPA 2WYOA 1FX1A 4NZ9A 1N25A 1KMNA 4C0HA 4YAGA 5JDCA 1EXNA 2C4NA 1XLVA 4TWRA 1VSQA 3M34A 4ZI2A 5I47A 3RJ5A 1VXRA 3ADCA 1YFJA 3UT5B 2YYZA 3LMKA 1VLZA 4JI7B 3DNPA 2R1TB 3L02A 1RAHA 4M0PA 3HSYA 2QQFA 1EVEA 4XGQA 4OSEA 1UDBA 3R4CA 1N7JA 4TL9A 3P19A 4O4HF 4R1NA 2WJYA 1R0ZA 3KZXA 1RMQA 5E0OA 4LRTB 2DXIA 3GFSA 1ZGBA 2HF7A 3GUZA 1G7CA 4CMIA 1UZAA 1Y89A 3G17A 4PY2A 4WNIA 5HP4A 5L6MB 3D8BA 1P29A 3G68A 3EXG2 1JKJB 1BO6A 1GSOA 2A92A 2OR3A 2H5IA 4HLDA 2O3SA 4KH0A 4F96A 5IZ4A 3T3DA 4IS2A 1OYYA 4TTRA 1CJMA 1H6BA 1O94D 4B6RA 5C1IA 2E89A 2ROQA 2JLSA 3HL0A 3SQOA 4WBNA 3DTVA 2JKVA 1MO6A 3KB8A 2ZSAA 3H05A 3MXOA 3LUGA 5A04A 1RZRD 2H07A 4XUDA 1PZEA 5JPIA 4ZO9A 3KQWA 4N5LA 1ANKA 1LC0A 1OWLA 1VLMA 2P90A 3AETA 3F67A 4LJAA 2PLFA 5H70A 1XAJA 1YJAA 4LE2A 2PY6A 4L8LA 4RTSA 2O8NA 1FSGA 5IM4F 3AHIA 3K70C 5BSVA 1TOAA 4K81B 1H1DA 2C3PA 2W37A 5FHQA 2FPMA 3R40A 3CS3A 1QYCA 1KVUA 1M8FA 3QUBA 2VRWA 1YUBA 3MTBA 4MMXB 4NDNE 4O4LF 4R6WA 4RF4A 2E4XA 4GOND 3TO5A 1Y48E 4BQSA 4AYTA 3A1TA 2VT2A 2D1TA 2JFQA 3D6MA 3X1JA 3BWCA 4H31A 1PGOA 1A5BB 2B4AA 5IYZB 2HKIA 2PLAA 2C7RA 4B6FA 5ICCA 5EXSA 1N2GA 3LCMA 3RWOA 1CHNA 5FWYA 3ON5A 1ZSNA 2JC3A 1OXBB 3OLXA 1HKUA 2HSJA 5AHRA 3UWDA 4WN9A 3A6ZA 2UZ4A 1HUQA 5LN1A 4L15A 4FSHA 2VUHB 1HEYA 1OAAA 3FZGA 4OXNA 5IKXA 4NCBA 1TA0A 1FDUA 5K1ZA 4ETIA 2O4UX 2AD5A 3A2MA 3E22A 1E32A 3E9RA 1QX3A 1E3JA 1FFXB 4NJMA 2DYKA 3BXXA 5IW8A 2VPWA 3V42A 5J4YA 4GUAA 2JASA 1KSFX 4BNZA 3GOHA 3AJ9A 4HJXA 1OTYA 3T9EA 2J5KA 4PYQA 3SM3A 4EPWA 4OY3A 1TVMA 4HUQA 2NADA 4N01A 4TT3D 2X86A 1IZYA 2V7UA 2X4LA 2PRKA 3QMPA 4YJDA 1BQ3A 3EGXB 4QBGB 1Y7PA 4OXQA 4R68A 4MLDA 2JIZD 2YRFA 3CB2A 2DSNA 3DDCA 4TT8A 4B3GA 3ANLA 1X0XA 4AVYA 2EJBA 1SVMA 1KERA 2DR0A 1KO7A 1S0UA 3BDVA 3DJYA 3PP8A 4YRCA 4P3YA 3T3MB 4CT0A 1P31A 2AN9A 4MV5A 1IOVA 1NRIA 4O2BA 4Y7DA 3W2TA 5B2EA 3EC2A 1E2DA 2JGIA 3GVCA 1B0UA 1IDN1 4ZCQA 2CXRA 2YDXA 4AYXA 1E92A 2RG1A 2AE1A 3WK9A 5KU7A 1NQTA 4OSPA 5D1HA 5EXPA 3EDYA 1T4CB 2C5EA 2C9DA 3PWSA 4C4AA 3J7AC 5JARA 3ZTTA 1JJAA 2GAAA 1YC2A 1O1YA 2Q1SA 3O1JC 4I81A 4AKHA 3BAFA 1F8UA 1D2RA 1USKA 4R1QA 3UUFA 5C8DA 3B1WA 5KAMA 2FZEA 1NX9A 2TSYB 3A6LA 4MVJA 1G8JA 5T67A 3PXAA 3BE5A 3L8FA 4QODA 1KEKA 1R2QA 2AN5A 2JAUA 5ABPA 2FZLA 3DNFA 4S1TA 4EABA 3NWOA 4UD6A 3SS7X 3WG9A 1Z8FA 1DTSA 1GTG1 2YXLA 3H9CA 3N2EA 2NVWA 4ILKA 2C82A 3HYRA 2PVCA 1MH1A 2P68A 3K53A 3OZRA 5D1NA 5ESDA 3PIIA 2CGEA 3WTCA 3MILA 2A0UA 2HA5A 3AFOA 1JIIA 4EY7A 4IKEA 2NP6A 3L84A 5TF4A 1WSBA 3F4BA 2B7CA 4IUDS 2TMDA 4Q39A 3ZGVA 1XVIA 2O1EA 3I6MA 3C14C 1TKBA 3ES9A 5AKKA 1K5PA 1A9XB 2QVCA 1ADJA 1XDGA 3N8IA 1Y4AE 1QUFA 4UD2A 3REOA 1V3UA 3UK7A 5ECGC 3LIIA 3ORYA 2YWFA 3KQSA 1T1JA 3HZHA 1AMNA 1NONA 3ITDA 3NAGA 2KWIA 4QPNA 3UM9A 2GFIA 1C0PA 3ABQB 3KWMA 3NHZA 2VS1A 3AR8A 4RD2A 5JRJA 5ALDA 2RE8A 1MHTA 1JFFB 2GVZC 3C3KA 4EGJA 1NRWA 1RYDA 1T9CA 2PEYA 3EDQA 4Q3DA 2I6XA 3EPRA 1MX9A 3QE2A 1Y6JA 3OSUA 2HJRA 2JJ1A 4WLVA 1DWOA 1RP7A 2C5BA 1AU9A 1NMZA 2X5NA 3WTBA 4KQGA 4PCUA 2E5FA 4PO8A 4J0DA 4XIJA 4J49A 4MS1B 4ZQEA 5EWLB 1JDBC 3G9UA 1D0SA 3EIUA 3UIEA 5IU6A 4FLEA 5UKDA 2CWWA 5IP5A 3S0JA 2HCTA 2FPIA 3WWCA 3OIGA 3TSCA 1VLQA 4G4SO 1KAQA 5JNWA 2AC2A 4HKTA 2NTNA 2HX1A 1UIRA 2IP4A 3H65A 2IP1A 2ZTVA 1OGIA 2P67A 3G1TA 5HCIA 1C7EA 2HXGA 1F2UB 2ZT6A 2HMSA 5U1PA 2Q49A 1RKVA 4AS2A 4IIJB 4RDIA 3IQZA 4FFRA 4GZ5A 2WV7A 1RQXA 3AWDA 4TV8A 3OCUA 1MDFA 1U0OC 1H1LB 5I3ZA 2IIPA 4HAIA 3N2GB 1MRNA 1INLA 3AL3A 2P9EA 4R3NA 2B9EA 1NOIA 1DKUA 2CXSA 1X7YB 3TNJA 4S04A 2I9KA 2FPGA 4K9PA 5ALUA 4K2AA 3LNCA 2IA5A 4F4HA 4UNQA 1T2DA 1KE2A 3RBZA 5JI2E 4RACA 4TRRA 2QRUA 4R9SA 5MN6A 2XGSA 1FJ2A 1EUYA 2Q3CA 1P1KA 2GBPA 3OJLA 7REQA 1J0EA 1A50B 2XNDD 4QULA 4G23A 1PGQA 2GX6A 3EA4A 3FVWA 4WZZA 2AJTA 4B3JA 2JVIA 1PNQA 2NUTB 3CX3A 4X6YA 4DSUA 4E6EA 4GEKA 4OYRA 4F45A 2GBIA 2JLAA 2C4TA 4UAGA 1LFDB 5G0SA 1DX9A 2IH4A 5JFGA 4XZ3A 1EGAA 4QOEA 2AJLI 2HDHA 3MRSA 3U4MA 3O8OA 1WA5A 2Y2UA 4QREA 3WL8A 3AHFA 5E3IA 2M1ZA 5KTPA 2GNAA 4MRMA 5ALHA 2QN1A 3GGDA 2I2CA 4DRZA 1Y8QB 4FCVA 5E4TA 4DWVA 1UDWA 2XUHA 3HGMA 1J8QA 4DT1A 3FR7A 1SXJA 2R2AA 2YVKA 3VMMA 2QBYA 1R50A 2I2DA 3DE5X 1Y1LA 1PV2A 5EP1A 3BWVA 1XQ6A 5AM1A 4QC2A 4WADA 1BYUA 3AY3A 2DOKA 1UZNA 1P9LA 3GEDA 3O3MB 3DFFA 4RESA 5KNCA 5KX5A 1I2DA 2EU8A 1MRZA 1GN8A 3PXUA 2FUG1 4HRXA 4DCCA 5KPJA 1BXKA 1NW5A 4EGCB 3R0JA 1AK9A 3VTFA 4TKLA 3GXBA 3R9XB 2H57A 5FLKA 3HXOA 4IJ6A 1QIJA 3O9ZA 1P4HA 1AUXA 4FFWA 4R1PA 4CQLA 4MQ6A 4DQUA 3KB1A 4CLRB 1M7GA 4OHOA 4PYMA 2OHFA 3DE4X 1GGHA 4UUQA 4R1OA 2ZWVA 4Q19A 4E22A 2ZJ2A 3LQYA 3VC2A 2AS0A 5EXEA 2LIVA 4RV4A 4Y2TA 2EDCA 3MC1A 2GPTA 1W36D 5JXGA 1LFAA 1MLDA 2LW7A 3KWFA 1T13A 5HRCA 2J48A 1XF9A 5A9SB 3I1IA 4HAXA 4G8BA 5LCXA 3KYCB 1C1HA 1IHXA 1BEZA 1GG8A 1HURA 3HL4A 5KJCA 5KYXA 4XM2A 1E9SA 1B43A 3IKMB 3LI2A 3DXZA 3DHNA 3FZEA 4EY4A 5CEEA 3QG1A 3O7WA 4J0EA 1CX9B 3BKXA 2C9ZA 2PS1A 4I1YA 4ZODA 2Q5IA 4RELA 1W35A 1UWCA 3INGA 3RSQA 3O2QB 2QM0A 2KW5A 3CPJB 1LCIA 1XVAA 3U2QA 3QUTA 5KMGA 1S3IA 1OW3B 1QIGA 4FYIA 3TTVA 2XMBA 1EPUA 1B42A 2C3OA 4O2BF 4QT0A 4DLBA 2ZBRA 3IOBA 3NPAA 5T6MA 1Q0ZA 2CMDA 3B3FA 4A2QA 2PZLA 3QVTA 5FQNA 3CZQA 2I4NA 4NECA 1GSHA 1NVAA 3QIVA 2ZPUA 2V9ZA 2ZIVB 4BLRA 4EKGA 3CM0A 1ZISA 5FYQA 4V1CB 3BSWA 4FHCA 2YBDA 4K9KA 3ZBUA 4J9UE 5ICSA 1Z6ZA 5CX1A 4HYQA 1FFHA 3SZRA 1E5TA 3N70A 1MOZA 4MVJF 5IKMA 4OHRA 4ZYLA 4HWPA 4MUEA 3HU2A 3C7KA 4HAOA 5I9MA 4CEHA 1SHTX 1IRIA 3GMDA 1F14A 3ZVLA 3SQMA 5JD5A 1A8QA 2JAHA 3FWYA 4RADA 1XCLA 1Z5OA 3DJFA 4QO8A 1Y9EA 1YFKA 4BNKA 4OMUA 4S24A 3ZDBA 3C3PA 2IYVA 4HEJA 1Z5VA 4HYEA 3M4JA 3L8CA 2ZBGA 4RLHA 1JMVA 3T52A 4GMFA 3OZIA 4FD2A 2PX4A 4BV3A 3UB2A 2WVGA 3V7FA 2BR3A 1CYEA 4RYDA 2KM1A 3ULKA 4D96A 2G71A 3JZMA 2V6IA 3CF4G 4MW4A 3OPYA 1P4RA 2ACVA 4JLJA 2VP3A 1JKFA 3ABZA 1DX6A 3IOCA 4DCVA 3IOEA 4DEXA 3GPLA 4E46A 4NBUA 1N5RA 4JLWA 2Q99A 3B2NA 3ITEA 2AG0A 4DJEC 1AGNA 2EATA 4YJ2A 1NTRA 1PR3A 3W3ZB 3O93A 2F1JA 3F6CA 3GAZA 5JZBA 1NBHA 1OI2A 5IAOA 1KI9A 3K6SB 2ERYA 4JYZA 1BW9B 4F9FA 3U4DA 2X19A 3DULA 4AG5A 1P4JA 2H17A 3LHFA 2F59A 1E7RA 3RROA 4JKIA 2CVOA 2WA1A 3OTHA 4KDEA 4KYVA 2JANA 2WQZA 3MTQA 4L4ZA 2YNMC 4YCCA 2FEMA 3LZCA 1WQ1R 3QI2A 3RU3A 1JIUA 1G20B 3ZE1B 4BMYA 2VQEB 2FRXA 2HRBA 2YVUA 1UK9A 3H5AA 2NXEA 3L6UA 5CH8A 1R3DA 5CVDA 3SGLA 2SECE 1XN1A 1D0VA 3G8BA 1PHRA 3I64A 1ZD3A 1R64A 2J3MA 1GJRA 1VYVA 4Q4HA 5ED0A 2GM9A 4UEOA 3UUEA 1GT91 1LTKA 3EY9A 3ICWA 2BFEA 2ODPA 3PHBE 3O31A 3TX6A 2G0NA 3K0AA 2H48A 4U3JB 4I1VA 4EHAA 4IDAA 2IWHA 2O2CA 4L72A 4P4GA 4TV8F 1QYVA 1F51E 3I4CA 1QDEA 5I3CA 4JUDX 3T5GA 3KJHA 3TRFA 2WF9A 3PXDA 2IODA 3I5AA 3ACBA 1SZDA 3DG9A 4P4SB 2R8XA 3QEAZ 2ZRGA 4TMXA 2VTEA 4HX9A 5TVKA 4BJ5A 4C0JA 1G5PA 2CVHA 4F2PA 4RVGA 2VBIA 4CM4A 3FOZA 1L5RA 3SIRA 5CU7A 3AVOA 3PJRA 3S68A 5DGCA 1TECE 4I3FA 1F1BA 4NMXB 4IX1A 1AZWA 3TPCA 4ROTA 5EL0A 3IQEA 5FOUA 1YKFA 1CS4C 2OCIA 5EGSA 1Q92A 3N2ZB 3SF0A 1GGFA 1GXSB 3HNOA 4DLAA 1H23A 5FKJA 5C1PA 4I9UA 2UUOA 3GK3A 1O9HA 1FP4A 2PV7A 4HQNA 4KXNA 3R7BA 2OYSA 3GVHA 1KYXA 3VR6A 3TL6A 8ABPA 1GY8A 4F3NA 3X2SA 2J8ZA 3IIJA 2HT1A 4HWTA 1N0WA 2JLQA 1YJCA 4M8NE 5K3DA 5JSUA 1KK1A 1UP4A 5EPUA 4E51A 3EMDA 4NBRA 4DF3A 3NB0A 5A05A 4YQEA 2BFCA 4KODA 2GPAA 3MUFA 2QUHA 2ZSKA 1RQ2A 5ALZA 5E95A 5JS2A 1REQB 3GRRA 1QMGA 3IBCA 3HVIA 1OZFA 4HY3A 1GD1O 2VDQB 1XVTA 1YRWA 1TC1A 1KY4A 1VYTA 2XUAA 3PXEA 3PZBA 3QI7A 4JYBA 4YCDA 2CDAA 5KX5F 4F6LA 1CZKA 3V55A 2FSHA 3L8MA 1E9RA 2HRRA 1MA3A 1MC8A 4W5JA 4C0WA 1RVV1 3IESA 5A7FA 3KP1A 2COKA 4CM1A 5HPYB 5IN5A 1NVMB 2I2XB 5CYGA 5K3FB 1JB1A 4FCCA 4KQKA 2CLOB 3NBMA 1YJXA 1L9KA 1Q15A 2C9OA 2GF2A 1L1QA 3MW8A 4ZIRA 3RS4A 2GYYA 2ECOA 1X7WB 4JLBA 1CZNA 5H3CA 2HOQA 2ILVA 4IQFA 4PS1A 3U31A 4CI9A 1HZZA 5ALYA 3A9VA 4KO1S 3SIXA 1F5SA 4HLCA 2NO1A 2PH5A 3ZGYA 1JEYA 1W93A 1KZ1A 5AW0A 1C9KA 1GQFA 1KYIA 4XDGA 5EKUA 3PNBA 3S1AA 4BEJA 3QFSA 3IMGA 3F8SA 4O2AA 4OHUA 4PF1A 4AY4A 5KTNA 1T2VA 4EWLA 2G4CA 4LA4A 4A8JB 4QM6A 1N2CA 4PC2A 2WU3A 4XD7A 4IWNA 3EFEA 4JDPA 2PU7A 2YDYA 1ZD1A 3QU2A 3U37A 4PVCA 3I9V1 2G4VA 4AO8A 2PVSA 3LY8A 2HREA 4A15A 1CUCA 2B78A 2XNCA 4MR7A 1Q3HA 2O7QA 4ALLA 1EFHA 3VR0A 2DQSA 4P82A 1DCFA 3DLPX 1VG1A 2F00A 4KE7A 3HB0A 1FX0A 4MWSA 2ODAA 4ZQBA 1MC1A 3MYRA 3G0HA 4A73A 2BEVA 1Y8CA 5L3RA 1CBUA 1EXWA 1EM8B 1NZFA 1ZK1A 4UNIA 1B26A 2CUZA 4RVUA 3P7MA 1JQJC 1U2PA 4Q82A 4QZVA 3CVXA 3IEUA 3Q10A 4S35A 3MF4A 1ORTA 4D45A 1QWOA 1ZICA 5EVJA 4B4UA 1SAYA 1NMYA 1OYVA 3KPWA 3KSDO 1O6ZA 3PRHA 3QUAA 4XI9A 1QGYA 4DGSA 2EJUA 3HXQA 2JFWA 1NV8A 2FP4A 5FA8A 3T3HA 1XDUA 3L05A 4DIBA 3C8HA 3PYXA 1DZ3A 1Z0IA 2Y9PB 3UYLA 3T1NA 1QP8A 1J4AA 4CLXA 3R0VA 1JTVA 1E7QA 2ZREA 4HXFB 3H2IA 3LGAA 3NGLA 4G5GA 1T5SA 4Q9NA 1RZRA 4HQKA 3DE2X 2LPMA 4M99A 4TLEA 4W5HA 4Y2YA 3L8DA 2PKCA 3AR5A 2WMYA 2A35A 5H8WA 5D3KA 3GT7A 2LCIA 5E6RB 1T2UA 5LQSA 1JFRA 2D1QA 3BK2A 5TS3A 2IZ0A 1QTRA 3VZDA 3KSAC 3IAAA 5MN4A 5A0TA 1JR3A 2VDKB 1LJUA 3AM5A 4FFBB 1XROA 4PYRA 3ZTYA 1L7NA 4V38A 3SMVA 2EP8A 1M2OA 4BNVA 5KEIA 4XYBA 3GLGB 2WZDA 2UZAA 2WDZA 3IVXA 1RCTE 2FZCA 1UJNA 3BGWA 2I6TA 2ZSIA 4I1IA 4YJ2F 4NU0A 4H0CA 1FLAA 4DYHA 3IQXA 4F2DA 1ZM9A 1QRSA 5AI9A 5FPKA 1CFJA 2PWAA 4Q9HA 1MJGA 5FQOA 1SFRA 5AVTA 3COYA 4KKXB 2FWJA 3ETEA 4U7TB 4FKBA 2GUGA 2XNSA 5NULA 3VAAA 3TB4A 1LB1B 2WUVA 4HWKA 2CHUA 4ERXA 1CZHA 4GPAA 2AG5A 4G24A 4XB2A 1JBQA 1Y6ZA 3R23A 2A6PA 2Y1CA 3RFVA 3AEUB 4FLFA 1P18A 5JBIA 3C7DB 3S40A 3SAJA 1ESZA 2PRJA 4EFDA 4H18A 4PRLA 4HGOA 3SC2A 3PI7A 4UAUA 1ML4A 4U9HS 4BPBA 1I01A 5CCBA 3RK0A 2WG0A 3A1DA 3O91A 4G2TA 1OH7A 1QU2A 1A9OA 1XIVA 2NUPB 1UOPA 1VRCA 3V97A 4MRRA 3W6PA 1LJLA 3NHSA 1JV2B 4YAJA 2O8FA 1PL8A 1VTKA 1EWTA 2I8CA 3JQQA 1J1ZA 5CJPA 3HTXA 4U6QA 2VJLA 3HDQA 3JAWB 2Q4OA 4KIUA 3UC9A 4D98A 4ZJPA 3DFKA 4A26A 3H17A 3I3OA 4L9AA 2EKLA 2V55B 3ZJVA 4Z99A 1ECPA 5JE8A 2WJ6A 2D0DA 3OWXA 4R9NA 4DTIA 1C41A 1G7TA 4IUCS 1OXXK 5EKSA 1VIDA 4MOWA 2Q1TA 4RV5A 2C9CA 1J1IA 4GSKA 4ITVA 5IAKA 3W5HA 1A9PA 2AHOA 4DA8A 3DZGA 1WLSA 1MAHA 2F1KA 1L8XA 2FZGA 2Q6VA 3P5BA 2WWRA 4J6EA 4LWPA 4RA9A 5CLGA 3GZ4A 3L5OA 3V7YA 4C4OA