1U7HA

Structure and a proposed mechanism for ornithine cyclodeaminase from pseudomonas putida
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
341
structure length
341
Chain Sequence
TYFIDVPTMSDLVHDIGVAPFIGELAAALRDDFKRWQAFDKSARVASHSEVGVIELMPVADKSRYAFKYVNGHPANTARNLHTVMAFGVLADVDSGYPVLLSELTIATALRTAATSLMAAQALARPNARKMALIGNGAQSEFQALAFHKHLGIEEIVAYDTDPLATAKLIANLKEYSGLTIRRASSVAEAVKGVDIITTVTADKAYATIITPDMLEPGMHLNAVGGDCPGKTELHADVLRNARVFVEYEPQTRIEGEIQQLPADFPVVDLWRVLRGETEGRQSDSQVTVFDSVGFALEDYTVLRYVLQQAEKRGMGTKIDLVPWVEDDPKDLFSHTRGRAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords ornithine cyclodeaminase
publication title Ornithine Cyclodeaminase: Structure, Mechanism of Action, and Implications for the u-Crystallin Family;
pubmed doi rcsb
source organism Pseudomonas putida
total genus 111
structure length 341
sequence length 341
chains with identical sequence B
ec nomenclature ec 4.3.1.12: Ornithine cyclodeaminase.
pdb deposition date 2004-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02423 OCD_Mu_crystall Ornithine cyclodeaminase/mu-crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1780.10 Alpha Beta 2-Layer Sandwich ornithine cyclodeaminase, domain 1 ornithine cyclodeaminase, domain 1 1u7hA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1u7hA02
3GPDG 5JDIC 3F4LA 4ZQEA 5I8ZA 1EQ2A 3A14A 1R12A 3QVXA 4XGKA 4CLRA 4XRRA 5C7OO 2GN4A 5I7EA 2EGGA 1JA9A 3CTMA 4OXYA 3OFSA 4XQCA 2V65A 1Q0QA 1UP6A 2VYNA 4YT4A 3B1KA 1D8AA 4LRSB 2ZB7A 2GGSA 3UW3A 4O59O 2VZ8A 5JSFA 1KIFA 2G76A 2EKQA 2OFPA 2OO5A 2FP4A 2HMSA 3W6UA 4YBZA 4R5HA 1HTBA 2WYUA 1A4IA 1W4ZA 1ADBA 1QLHA 3LU1A 4ZJUA 2I76A 3I9JA 4BNVA 3S2FA 1E7RA 1CJCA 1Y5MA 2VT3A 3INGA 5JYDA 4P22A 1DAOA 1SPXA 1YGYA 1YL5A 3P2OA 5GY7A 4CLOA 3FPLA 4Y6RA 2SCUA 4GX0A 2HCTA 1LU9A 3ZU3A 4W9NA 3EGOA 4BNYA 4CM8B 4Q3BA 3O8QB 2VZ9A 3U0BA 1C1DA 4O6VA 2O3TA 2VNAA 3E48A 4OM8A 1M6WA 1OOEA 3ZZNA 4YAGA 5JDCC 2Q1TA 4PLVA 3C24A 1SBYA 5A05A 1ISIA 9LDBA 1I2BA 1WXDA 4GMFA 3FHLA 4GQAA 3JTMA 5U1PA 2D1YA 4B4OA 3FCOA 4MKXA 3DWFA 2PZKA 4CJXA 2OORA 4LCJA 1EVIA 2OOSA 4BOYA 3JYQA 4GMGA 2X5KO 3DTTA 3AUSA 1CDOA 1O94A 1IY8A 1FMCA 2EWMA 4U0KA 4XD2A 3H5RA 4E5YA 1A9ZA 4ALNA 1ZZEA 4I9UA 3DHYA 1U4OA 3PJFA 4MP8A 1U3UA 4Z9YA 5L7YA 1SB9A 2ZIZA 4MOWA 4NIMA 1B8PA 1T2EA 4BO3A 1LDMA 4DIBA 3RKUA 1J0XO 1BTOA 2O3JA 1NHGA 4D3DA 1GCOA 2AW5A 1LUAA 1BXKA 4Z6KA 3L77A 4CL3A 3GZNB 5JW6A 1D1TA 1JKJA 1EUZA 3DBVO 4YPOA 4BO5A 4IJKA 3VOSA 1E1LA 1FF9A 2EXXA 2ZJ0A 4MIEA 4NPCA 4B79A 4BUCA 4CQLB 2VHVA 4IS3A 1QYXA 4ZQHA 4RPGA 3FPCA 3ZW8A 3GAZA 4KWIA 5G2OA 1HRDA 3HB5X 4JIGA 2OBYA 1TA4A 2GLXA 2RH8A 1ID1A 4IGEA 4QQRA 2Y1CA 1LRKA 5KJEA 3U9LA 4I5GA 1YJ8A 1VJTA 4QX6A 3OJOA 2XXBA 4I9HA 4PGFA 2DPHA 2GERA 2GCGA 4YRBA 5JS6A 1DPGA 3O4RA 4P38A 3W6ZA 1SAYA 2W2LA 5A06A 1PGPA 5A3VA 2DM6A 1HDZA 1N8KA 1HT0A 2EKPA 5LC1A 3S2IA 3VZSA 4J2HA 3K30A 1G6KA 3JSAA 1DXYA 1NVMB 4D0SA 4PVDA 3ON5A 4ND4A 5IG2A 1NQAO 4C7JA 3K9QO 3ITDA 4W4TA 4TROA 2J8ZA 4J43A 4JP3A 1R66A 1DFIA 1HSOA 1E3EA 5I9NA 3JD4A 1V3UA 4UVIA 2PD4A 1ZO8A 3AM5A 1X1EA 3F6YA 5IN4A 3VPGA 5I7SA 3G0OA 5JMWA 4CLEA 3BHIA 4LMRA 3GHHA 1RM0A 4BNFA 1Y81A 5A04A 3AU9A 4DGSA 4DUPA 4FFRA 3K6JA 1RYEA 3ZNQA 2Y0CA 2YV2A 4OYRA 4A2CA 5DBGA 4Z3DA 4UVEA 1EDOA 5KVSA 2OUIA 4XYLA 2O23A 3JQ7B 4A73A 4YCAA 4Y67A 4MP6A 4WEQA 2G17A 4DRYA 1GYPA 2Z1NA 3CZMA 2JFHA 4R69A 3E5MA 3BMNB 3IJPA 1K6XA 3WGQA 1LRJA 2P5UA 3ZU2A 4ZQFA 2H63A 3FBTA 1SMKA 3Q3CA 1GL3A 3OM9A 2GO1A 1N92A 1DRUA 5HWSA 3KETA 4XQGA 3BMQB 2A9FA 4AJLA 4ZVVA 2P4HX 3BA1A 1F12A 1JDJA 5GZ6A 4E4YA 2NVWA 3H6KA 3PZBA 4OQZA 3IL2A 2CVZA 3QLJA 4JGBA 5BR7A 5JCJA 2CUKA 1YJQA 3PLNA 1K2WA 1LEHA 1PGQA 1B3RA 2JFFA 4J7CA 4AVYA 4CM4B 3ORFA 4YTEA 1LXCA 3AFMA 4HP8A 1QG6A 4E5PA 4ND5A 1UR5A 4GWGA 2GN8A 4FFOA 3ENKA 3K31A 4R3NA 3U4HA 2AMFA 3QA9A 1GPDG 3ETGA 2FR8A 2DT5A 5LCXA 3PHJA 3MCVA 1D4FA 3AUTA 2BI7A 2DLDA 1YQDA 3HDQA 5B1YA 2F00A 1GV1A 3ROMA 4P4GA 1P74A 3DZIA 3DHEA 2WD8A 2Q4EA 4MVJM 2E4AA 1JAXA 3C7AA 4BNTA 1V3VA 1VPDA 3LT4A 3WNVA 4ZQGA 3ZWBA 4J4TA 1XU9A 2YZ7A 3UVEA 4CMCA 2RIRA 2O7SA 2I67A 1ISHA 3QIVA 4CM9D 1WVGA 3AY7A 1V0JA 4NJMA 1E3WB 2EF1A 3EVNA 1YS4A 1GZ3A 4QUKA 3GG2A 3INTA 1K0UA 2I66A 4E2YA 1U3VA 2YV1A 1U9JA 2X6TA 1ORRA 1WZIA 4NBVA 4JN6B 5TNXA 1KEUA 2JD1A 1YB1A 1T2DA 5CP8A 3R6DA 2VZ0A 4DVJA 4PLWA 2B69A 1GADO 3JQEA 1VE9A 3DEYX 3OSUA 4NK5A 1N9GB 2WYVA 4CLXA 1MXFA 1NWHA 1T26A 1UUFA 4DPMA 1ZCJA 5AXBA 3L4BA 5CEJA 5MGBA 4B7UA 4IGFA 1UAYA 1QSGA 2C59A 2QZZA 5JE8A 4CQMA 2IODA 2Z1MA 5KJ6A 4WASA 3DZHA 3QWFA 5JO9A 1HEUA 5GZ1A 4J7UA 3RU9A 4BNHA 4WOJA 1YOVB 3WIEA 3VH3A 2D2IA 3FRJA 3IUSA 3JQBC 1IHXA 2UUPA 5L7WA 2FPGA 2JHFA 5TRTA 2ZK7A 1I8TA 1IL0A 2UYYA 4ESOA 3BHMA 3GEDA 4BO4A 4NR0A 1HL3A 2G82A 1PWZA 4GH5A 2Q50A 1YDWA 1I5RA 1ZJZA 4R01A 3QV1A 4X54A 2BFPA 3P19A 4XKJA 5LDHA 3NTRA 4EW6A 3EK2A 1XA0A 2WTBA 3PXXA 3FWNA 3GVIA 4PLYA 3ZV6A 4AICA 2NU9A 2Q3EA 2DC1A 3QVTA 4KTVE 1WNTA 1BDBA 5HTOA 1HWYA 1X0VA 4XDZA 1Y9AA 4EGFA 2HK9A 1TXGA 2I3AA 3DBRB 5TGDA 4Y9DA 4RF3A 3V1UA 3H9QA 1TVEA 4J91A 1GDHA 3PGXA 1NASA 3WSWA 3PYLA 3VVCA 4YDRA 1LSSA 1QORA 3IP3A 1HE2A 3I5MA 4CMKA 2XPCA 1N2SA 3L6OO 4EJ6A 3AY6A 1J6UA 2IXAA 4WPGA 5JFOA 2BI8A 2P9EA 1E1NA 1ULUA 2JJYA 3U4IA 4A5OA 3OHSX 1SCUA 3BIOA 3Q6IA 4ITUA 2OP1A 2HDHA 4N5NA 3U49A 3JQAD 3L9WA 4P4LA 3BXXA 5FI3A 3ROPA 2CD9A 3DTYA 4FPXA 3D7LA 1HETA 3HG7A 4GI2A 4DLBA 2O48X 1LSOA 5TIIA 4BMVA 3ANLA 3ZCXA 1HXHA 5IN5A 4JQCA 4UEOA 3JQFC 3DMTA 1X14A 4L9RA 3WGZA 1A7AA 3TN7A 4BNZA 2EGHA 4U6SA 4BS9A 4D7AA 1X0XA 1PJSA 3GOHA 4J1SA 3RU7A 1E3LA 1LLQA 2X0RA 3HSKA 4JROA 4NJOA 2GN6A 2YFHA 3KO8A 1UXHA 2C82A 3HDYA 1M2WA 4M87A 5C5IA 3B70A 3ZHXA 4UUOA 4IJVA 5I7FA 4AJ2A 4OO3A 5F21A 4IDCA 1ZK4A 2Y67A 5TT1A 3SBOA 4BKQA 1B7GO 1QKIA 2C7GA 4LN1A 1B16A 1YL6A 4OH1A 4LSMA 2FR1A 4J0EA 1BWSA 4NDNE 1JKIA 4BV9A 4EEXA 4YT8A 2P9GA 4FOOA 4IIUA 3RUHA 4Q3DA 1UH5A 4PLPA 3WR5A 3WG9A 2I9PA 2X0JA 3GMDA 4R41A 4I08A 4AJIA 4NBRA 2D0IA 1W8DA 1GQQA 2EKLA 3HE3A 1LDYA 3HJAA 4E30A 4JBGA 4ALIA 2GN9A 4YA6A 1F06A 3IS3A 3BMOB 3UFXA 3DBHA 3ADPA 3CMCO 5IZCA 4BNIA 5DDIP 4MVJD 4BV8A 1WMBA 2QQ5A 3E9QA 3TRIA 3CE6A 1I3LA 2ZTMA 5IZ4A 1ISMA 2UVDA 1PZHA 4K6FA 5L95A 2NM0A 3LF1A 4O1MA 4XIYA 2O3QA 3DAGA 3F46A 5FYDA 4MKRA 3QVOA 5ICSA 1GPJA 1CYDA 1FDTA 4IBOA 1O8CA 1ENPA 2NWQA 3IKTA 3GVCA 3GNTA 2P68A 4BO7A 1LJ8A 4J0FA 3L07A 3TFOA 3UAGA 2VYVD 2VRBA 1VI2A 4E3ZA 1FK8A 1HE4A 3OIGA 4BB6A 5J23A 4TVOA 1B8VA 3RFTA 4R1SA 1R4MA 4AFNA 1M75A 3UKOA 3WS7A 3BMCA 4CV0A 3ADOA 3ZHBA 2GZ3A 2Y93A 4XYGA 4MVJH 4BGIA 1U2DA 1NHWA 4CMIB 2FN7A 4HY3A 1ENYA 1QRRA 2QHXA 1UJMA 1I33A 3JQGB 1M76A 3PK0A 4RL6A 4E5MA 4ZICA 2ZTLA 1KVTA 2E48A 2WDZA 4R5MA 1I3NA 2R2GA 1AHIA 1ZW1A 2YFQA 5DN9A 4BNJA 3AWDA 3JYOA 4GKVA 1P1KA 1I0ZA 2X22A 2WSBA 2OL4A 1ADGA 5L4SA 3MOIA 4J1QA 2GSDA 3D3EA 5G0SA 4ZU3A 5JAIA 4WEOA 3ICCA 1ADFA 3AFNA 2FZEA 3RFVA 2W4QA 3AI2A 4XB2A 3E1KA 4YQZA 4QXMA 4OOFA 4BQRA 1RJWA 4EUFA 2OBNA 1H2HA 5JLAA 3PHHA 2Y1FA 1H5QA 4BO9A 4I5FA 1WDMA 1BVUA 1O89A 1P0CA 1ZNQO 3PWSA 3WQSB 1TI7A 1UDCA 1XKQA 2PZMA 4CM8A 4W7IA 3O8QA 4EYEA 2Q1SA 5JAMA 2VYVA 3CINA 4U0JA 1RM3A 2PKQP 1KOLA 3SC6A 1FDSA 4YEDA 1PSDA 1VL6A 3EMKA 4D3SA 3ZWNA 4GX2A 2XXJA 3JD0A 2X86A 4HNGA 2C5AA 4YAIA 1MC4A 5EIOA 3VAZA 2AEFA 2Q1UA 4JBHA 1Z45A 3S1LA 1U4SA 5JY1A 1UZLA 1YVEI 3K2BA 4YR9A 1XG5A 4EI2A 5CG2A 1KERA 1PR3A 3NYWA 3PTZA 2DPGA 3I6QA 5G4KA 3QE3A 4XEHA 5A9SB 1E7WA 3AK4A 2GUGA 4FOSA 2AEMA 4YQYA 1A9YA 1UXJA 1HDRA 1LNQA 5KKCA 4RPJA 3E03A 3EYWA 5ER6A 3AU8A 1JTVA 3ZI0A 4YJFB 3GZNA 3ZHZA 3LLSA 5BSFA 3GFGA 4YJHB 4LMPA 1ZUD1 2YQ5A 4H15A 3KRTA 4CMEC 3F5SA 3KTDA 4TKMA 2RBEA 4L8VA 4CQLA 3RIHA 4ONEA 1JWBB 1ZSYA 4BO1A 5CDSA 1FDWA 2EIHA 1A7KA 3H5NA 4WNCA 3WGYA 5KKAA 2YYYA 4D46A 5H83A 4IINA 3UF0A 3WMXA 4UEKA 5F1PA 5BSGA 1PQUA 1GAEO 2DBZA 5BSHA 1PL8A 3SJ7A 2NADA 5FFFA 3RBZA 1EVYA 2I99A 4AJ4A 3WSVA 4WLNA 4KQXA 2NQTA 1Q7GA 4OAQA 2GZ2A 3HN7A 4D3FA 1HDYA 3GNQA 4IDDA 3L6DA 4CR7A 1ZSNA 1H0KA 4GWKA 4RDHA 4OXNA 1ZBQA 5G0VA 5TT0A 1I30A 2CF5A 4NFYA 3KV3O 2X58A 3NJ4A 5JMPA 2QRJA 2EG9A 2A4KA 3B1FA 3DZJA 4YJDA 1BVRA 4FSHA 3RASA 2HJRA 4EITA 1PTJA 2EW8A 4E2WA 1B0AA 2BGMA 4FBGA 2RHCA 2Y0DA 4KOAA 5ILGA 1U7HA 2BGLA 3CUKA 4R9RA 3H9UA 1T25A 2ZYGA 4LISA 2WJPA 3E6AA 4NG5A 4XB1A 3CMMA 4L4XA 1KEPA 1PQPA 3PVZA 4OSOA 7MDHA 4QEDA 4ALLA 4CV3A 2O3RA 3ZH2A 3MWDB 3QWHA 2VWPA 1MFPA 3G1UA 1ML3A 3DFZA 1IZ9A 1Q2XA 1XHLA 2NSDA 2XAAA 3OEWA 4NU5A 4YJGA 2PLAA 3JQ7A 2R00C 2HMUA 3W4JA 3WBFA 2NU7A 4BVAA 1MG5A 2YDYA 2C20A 4K6CA 4HX5A 3BMNA 5DF1A 2EERA 3E18A 3RQSA 3DL2A 1RWBA 1IYZA 3JCZA 1E7YA 3IUPA 4BNWA 4PLZA 3EDMA 1JVBA 2NTVA 3AUUA 3Q2IA 5F3RA 3TOXA 3UH1A 2BLLA 3BMQA 4RPKA 5F5NA 3Q1LA 2Y0EA 1F8GA 5H81A 4B3JA 3ZGYA 3KXDA 4BNKA 4XQEA 5T8KA 2C7VA 3MTGA 1BW9B 1B2LA 3EAGA 4WLUA 4CM4A 3GUYA 4XRGA 3AI3A 4DYDA 3QWIA 3BTOA 4OKNA 3P7MA 1LDEA 4Y8VA 3PEFA 3RAJA 3DHNA 3DOOA 1GV0A 4PG6A 1G0NA 4CPDA 2FWMX 4R54A 3A1NA 3G1TA 2A94A 3T7EA 3U62A 1X15A 4K9DA 1NQ5A 2FR0A 4OXKA 3GZ4A 4CM3A 1N5DA 2W2LD 1TB4A 3AJRA 1K89A 4BNGA 4ZN6A 1Z7EA 3FTPA 4PRKA 2C2XA 4WUVA 5GMOA 4XQ9A 4NQZA 4EJ0A 1HKUA 3MEQA 4RQTA 1SOWA 1WMAA 4BO0A 3OA0A 1B26A 4II2A 5KVVA 3GLQA 3VKUA 1NPTO 5BSEA 1E3WA 3BYZA 3DFUA 3G79A 4NU6A 5I7VA 2B4TO 2EHDA 3PQEA 3B1JA 3M6IA 4IPTA 3ZV5A 2AQ8A 2IDZA 2D5AA 4IIVA 1LBEA 4CV1A 5EJ2A 1RPNA 1XDWA 4BNMA 4IUYA 4P4NA 3OEYA 3RC9A 1LLUA 2FMUA 4DIOA 3EVTA 1E3JA 1GUFA 2Z95A 2ZYAA 5JDIA 5U9CA 4UUNA 1Q0LA 2DVMA 3GT0A 4NZ9A 5ENDA 3EUWA 5L51A 1G0OA 3AOEC 3K8ZA 3H5AA 2O3SA 4B7XA 1U1IA 1N9GA 3UCXA 1MGOA 2IYPA 1XGKA 1C0PA 2FRDA 3ETDA 4BO6A 3JQ9A 1OC4A 2EP7A 2DAPA 3C7DB 2BELA 4JNKA 5HS4A 1AE1A 2P4QA 3KB6A 3EW7A 1EK5A 2QX7A 1YOVA 3QP9A 4UEJA 1WWKA 4JP2A 2DKNA 3PRJA 1DC6A 2Q2QA 5TSDA 2AG8A 1ZK2A 4E21A 5IDYA 1LSJA 3ZWXA 3H3FA 1NAIA 2H1SA 3HN2A 3G49A 3JQCA 4RF2A 3NUGA 3D5TA 3LVFO 2BH9A 3KVOA 4PZEA 3PHIA 5DBFA 2PKQO 4BKPA 2ZQZA 2JAHA 5JCJD 4IMRA 3IJRA 4WCFB 2CF6A 3GF4A 3W1VA 4WNIA 5G0TA 5JDCA 3RC2A 3GDFA 4HXYA 4DBVO 3P2YA 1Z7BA 3QQPA 4LW8A 2JL1A 4U7WA 3ULKA 1DEHA 3PWKA 4PN3A 4HFJA 1W0CA 2CDBA 3WLFA 2B35A 1DIAA 4IXWA 3DBRA 4BGUA 1QYCA 3ZWCA 2OXIA 2Y1GA 4CM6A 2BD0A 1BG6A 4YWJA 1XYGA 1QV7A 1ONOA 3TOZA 1IB6A 4HBGA 2TMGA 1DJNA 1HLPA 3AM3A 1YONA 5L53A 1D7OA 4OHUA 1WDKA 3EHEA 2V7PA 3GEMA 3ANMA 4PLCA 1IUKA 4BNNA 3GEGA 1T2AA 1FDUA 3VTZA 1H2BA 3RUDA 3TZQA 3FD8A 4OL9A 4MINA 1RYDA 3S55A 2VT2A 1F17A 1GU7A 3ST7A 5IDQA 3DAFA 4A7PA 4UUMA 1DOHA 4XZ3A 3WWYA 3EZLA 1TLTA 1U28A 1XIVA 3GR6A 3SC4A 1F8FA 2PWZA 4WLVA 4ND1A 4E6PA 1OZAA 4QO8A 4DLLA 4R1TA 4R1UA 5IXSA 3OA2A 2BGKA 4K26A 5HA5A 4GGOA 1C1XB 3GY0A 2CVQA 5HRUA 3NGXA 1PL7A 2PH5A 2RCYA 2QYSA 2WEKA 1PJ4A 4CQMD 3IOYA 4E2ZA 9LDTA 2O3UA 5H82A 1LSUA 5T6BA 2WD7B 1X1TA 3WGTA 1H6CA 1YB5A 1GUYA 4FIZA 2ILTA 1AUPA 1UXKA 4N5LA 3WGOA 4GGPA 2HK7A 4OJNA 4URFA 1CEQA 2AQKA 2WMDA 1GCUA 1H9BA 1T1SA 5CAEA 2YW9A 2DFVA 5DNAA 4H16A 4CUKA 3RI3A 4WLFA 6ADHA 1GTMA 1OBFO 1C0KA 1ZSVA 3ZNNA 3ONFA 1P77A 2X9GA 1UDAA 3PI7A 3ONDA 4FFPA 4W7HA 3PFWO 1GZ4A 4GBJA 4C7KA 1V9LA 2PV7A 2J3JA 5EESA 1GEEA 1BXZA 1HZJA 1YRLA 1O6ZA 3IP1A 3QWAA 2FSVA 4E5KA 2AQIA 4FFNA 3TF5A 3PWZA 4PLHA 3BMOA 2WM3A 4IQ0A 3I3OA 4PZDA 3U4DA 2P5YA 5EERA 3TZCA 3WYEA 1M66A 3NAQA 2Y1EA 3IC5A 3V1YA 3LLVA 1GEGA 1B8UA 5ICMA 3E5RA 4CLDA 4DQUA 4YT5A 2DTDA 4CM1A 3ZNPA 1XCBA 4ALJA 2DU8A 1N7GA 3HFGA 4FFMA 2X23A 1T4DA 3F4BA 2W98A 4BKOA 1Y1PA 3MJEA 1OMOA 1I10A 3OIDA 4XJSA 5K9ZA 2E37A 3R3SA 5L4LA 3FN4A 1QYDA 1IOLA 1VSVA 1PJLA 4IDBA 3NT2A 3VZRA 4MIOA 4DMMA 5DCWA 4Z9FA 2X9NA 5DCYA 2RAFA 4FCCA 2JKVA 1IZ0A 5G0WA 4PFJA 1GD1O 4RPHA 1P44A 1NQTA 4RLSA 3C1OA 4Y6SA 3GN2A 5ITWA 3DBLB 1ZXBA 2E49A 4RO0A 3GRPA 3FI9A 1SEPA 1UP4A 4J1TA 8ADHA 1BMDA 4J6FA 2CDAA 3TWOA 1MG0A 4CMIA 3BTVA 1W6UA 2C0CA 3DXFA 4R51A 3JQGA 1LC3A 1NR1A 3RJ5A 3MZ0A 1U5CA 2JCYA 1PR9A 2B37A 1GYQA 2PK3A 4YYZA 3LF2A 3KSDO 3RROA 1HZZA 5KVQA 3L0DA 5MDHA 1E6UA 2BFOA 4FJ0A 2HK8A 1ZK0A 1Y7TA 2UDPA 3GRKA 3EY4A 5DZSA 4EUHA 1P33A 2D59A 2X0IA 3WFIA 5L3ZA 2EJVA 2P9CA 1YKFA 5JAZA 2VUSA 3RUIA 1X7HA 4WLEA 2I5PO 5JNLA 1KVUA 4ND3A 3I9KA 1N1EA 3V1TC 1YBVA 1I3MA 2VHXA 1VJ1A 2YHIB 3LC1O 2UUOA 3OECA 4NBTA 4II3A 2NV6A 2V6FA 3PQDA 2ZTUA 1WP4A 2VUTA 3DC2A 3KYDB 4NFSA 1SNYA 2VOJA 4IQ8A 2GR9A 5B37A 1P3DA 4JK3A 4WECA 2IE0A 2GPTA 2Q46A 1KY5A 5B4UA 5FEUA 1DRWA 2E82A 1M67A 3ONEA 2CFCA 5IXYA 2IRWA 2ZKLA 1FDVA 4I9NA 4BGEA 3HNPA 1Y8RB 2WE7A 5ER9A 4J4BA 1E92A 1VL8A 1E77A 1NFRA 4JJIA 1V6AA 1NXQA 4IQGA 4GVLA 5A4DA 1DHRA 5IDWA 3O26A 4EDFA 4D41A 3HHPA 2ZATA 3JQDA 5EMHA 1Y8QB 1OC2A 4NBWA 1YXMA 3CH6A 1VM6A 2VHWA 4PG8A 4I5EA 2P91A 3EC7A 3VZQA 1A27A 2O4UX 1Q0HA 3PGJA 5A9SA 4CODB 3ZU4A 1VRWA 1QYWA 3W4KA 2ZJ1A 4RQUA 2BHLA 1DBVO 1E7QA 1YDEA 2PZLA 3GVXA 3SJUA 5IAAA 3SVTA 2Q45A 5B12A 4IZIA 1LDNA 3COSA 4LRTB 4YJFA 3ENNA 3QWBA 3GNSA 5EPOA 2HRBA 2Y1DA 3GHYA 3H4VA 4BNXA 4YJHA 4XYMA 1DIHA 3GDGA 3H9EO 3Q9NA 4Q3NA 3OBBA 3FNHA 3RUAA 4DTIA 2DTEA 2D8AA 5T64A 3C1AA 2QRKA 4CMAA 3IAHA 3KYCB 4G5HA 4HWKA 4KUGA 4OSPA 1YE3A 3WYBA 3PLRA 1HE3A 4XGNA 1R0KA 1H6BA 1BGVA 3ZWYA 5DP1A 3JQ8B 1UZMA 1LQTA 2H5LA 3H3JA 3U4CA 4XX0A 4A0SA 4BMNA 1FXSA 1UDBA 2ZTVA 3LQFA 5CPFA 4DC0A 2NLOA 1CQIA 1EUCA 1P1JA 2JCVA 1LQUA 2DFDA 3RFXA 1D3AA 2YV3A 3I9MA 3NEPX 3FBGA 2VWGA 5JO0A 3FNEA 3GVPA 4BHTA 3M1AA 3RUEA 1A4UA 2VUUA 4DA9A 4M1QA 1NWCA 3Q11A 4YAKA 2AQHA 5BNIA 5CEEA 1PS8A 5JXWA 3JQFA 4E0BA 1BXGB 4FGWA 4HNHA 5KWEA 2PY6A 4Q9NA 3KUXA 3AW9A 4NBUA 5HBRA 4AJJA 2CNBA 1MXHA 1GR0A 1AN9A 3TSCA 4B7CA 1K6IA 1PU2A 5JY6A 3FTNA 1EFKA 1UXGA 4FS3A 3OF2A 3V2UA 3ZW9A 3LC7O 4MDHA 3IKVA 3V5NA 5A02A 4J7XA 1U5AA 1HE5A 1PGNA 2ZCUA 1KC1A 1X7DA 5C37A 3OETA 1GYRA 1JU9A 3WQRA 4DREA 1HF3A 2E6UX 3WGIA 4DL9A 3RUFA 3SXPA 4EJMA 2AE1A 3GK3A 2HMWA 4U5QA 5ES3A 2JCXA 3WTCA 5IJZA 3NDRA 1ZFNA 1MX3A 1HDOA 1WZEA 4E33A 2EP5A 3RC7A 5AXDA 2VTEA 1XR3A 4ID9A 4MVJP 2WE8A 4AJEA 4J9UE 1CQJA 3VH4A 3AM4A 2ZB3A 4KP7A 3RBXA 3WGGA 5CDGA 2GF2A 3UGKA 1BW9A 3A28A 3QY9A 4M54A 1A5ZA 1B3BA 4Z0PA 1T2CA 4FD3A 4LVCA 4N54A 4TMFA 3LT0A 3DZFA 4DPKA 2PZJA 2IZZA 4TRMA 4YRDA 3FR8A 3HZZA 1PX0A 4IDAA 5AYVA 5BT9A 4OGWA 1VLLA 1AGNA 2ZCVA 1WPQA 2HU2A 3HDHA 1PJ2A 2GYYA 4RCVA 3UCEA 5JC1A 2V6GA 4MVJF 2D3TA 2GNAA 4LSWA 1GQ2A 3MJCA 2YDXA 3H9JA 4DXHA 3WXBA 2I3GA 1JKFA 1KETA 1NQOA 5L4NA 3C85A 5G0UA 1E1KA 2VTDA 1S6YA 3FR7A 3GFBA 3ETEA 2HJSA 1H9AA 3GH3A 4M8SA 5K6AC 1VL0A 2Y1OA 1BSVA 1Q1NA 4QO7A 1MFZA 2EW2A 4IDFA 4BKRA 4K28A 2HMVA 1KVQA 3LT1A 4PLFA 3RWBA 5A9RA 2B4RO 2BMAA 3KSZO 1R4NB 3TQHA 3NT5A 3N58A 1ENOA 3I4CA 2B0JA 3UUWA 1N1GA 5AVOA 4ALMA 3KM0A 3SEFA 3TDKA 3K92A 2OMEA 4DQXA 3BTSA 3MOGA 1LLCA 3D3WB 3MWEB 1WAMA 1IPEA 2RHRA 3GDOA 4FQ8A 4OOEA 4S3MA 2LDBA 4J2OA 2PA3A 2CDCA 2CMDA 4LGVA 3UHAA 3WLEA 4GX1A 2W2KB 4L0QA 1BHSA 1DFHA 3M2TA 4UUPA 2VHZA 4A03A 2HSDA 1OFGA 2C5EA 3A06A 2FSSA 5A5EA 4TSKA 4GKBA 5JCXA 3UN1A 4TRNA 1PZEA 1HYGA 4KQWA 1PJTA 1PJ3A 5EQDA 4WCDA 3Q2KA 4YAJA 2GD1O 2CSUA 3B20A 3PHLA 4H7PA 2NVUB 4AJ1A 1X7GA 2HKIA 3OJ0A 4XA8A 1DDOA 2VWQA 2J5QA 3BTUA 3CIFA 4WCFA 2BRUA 4GLLA 4Q3EA 3WICA 3PDUA 3JQAB 1LRLA 2PTGA 5CDYA 1SOVA 4OMUA 3V8BA 3WBBA 4B4VA 2IXBA 1V3TA 4KDEA 1MC5A 4CMBA 3G17A 1PIWA 3PIDA 2PNFA 5TC4A 4W9NC 4P8RA 5K0ZA 3DONA 1H94A 2PR2A 5T67A 2VOEA 3GGGA 4MVJI 3GPIA 1KEVA 4MIYA 4PIVA 1I24A 3SLGA 3DAPA 5F1KA 3EZYA 2X5JO 1GZ6A 2B36A 4PLGA 4DPLA 3DDNA 2X4GA 5KCZA 1I3KA 3IQDB 5KOIA 4AJNA 5DP2A 3H7AA 4DYVA 4J49A 2Q2WA 2B5VA 5TX7A 5KIAA 3LC2O 3DR3A 1ZK1A 1NR7A 3PJDA 4L4RA 1QLJA 1PQWA 3KEOA 4KWHA 2XF8A 1KYQA 2QW8A 3GGPA 1KVSA 4CMEA 8LDHA 3OICA 3DZKA 3JV7A 4GVXA 4CR8A 1PJQA 3FNGA 4NNJA 3TL2A 2VRCA 4QECA 3D4NA 4UVGA 3NRCA 4F3YA 4FB5A 5GZ3A 5HM8A 5COAA 3I23A 1DAPA 5THQA 1DFGA 4WKGA 5A3JA 2O2SA 4MKZA 5A9TA 1P1RA 1DIBA 3OQBA 4WE3A 1C1XA 4NI5A 1DC3A 3PPIA 3DOJA 4HFMA 4QFCA 4CR6A 4XJTA 1R6DA 1PS9A 3HFSA 1Y9EA 3TFQA 2WD7A 3JQ9C 4KUHA 4L74A 4TVBA 1T1RA 3MJSA 5JPIA 1E6EA 4FDAA 5ENVA 3PDJA 4LCEA 2ZQYA 3OIFA 4GLOA 3VTFA 3LSYA 4D42A 4L73A 4TZKA 5JYEA 2Z5LA 3QRWA 1DHTA 4IS2A 3HUDA 1NFQA 4R4JA 1DIRA 3WB9A 1MLDA 4IJUA 1NVTA 2JFGA 2HQ1A 3N7UA 3VPSA 4DIFA 4Q3CA 3KOUA 1I32A 5A03A 2A35A 1O9BA 2OP0A 3E9NA 4RDIA 3W8EA 4BNLA 2A92A 4BIIA 4OIMA 4CMJA 4Q39A 4Z9XA 3L9XA 3ZV4A 3NGLA 1RM5A 5DBIA 4RVFA 3I9OA 3I9LA 4L75A 1YQXA 3JYLA 3WOHA 5COBA 3H9GA 3VHRA 3PHGA 2JD0A 4RPLA 1DLJA 5TF4A 1PL6A 4R68A 4BGVA 1JQBA 1R16A 2R00A 1QYVA 5DOVA 2NU8A 1R0SA 1XELA 1SZJG 4JLWA 4XCVA 2YJZA 3QJ5A 4FJ1A 5T57A 3U3XA 1YBAA 3W4IA 2Q1WA 5G4KB 1LLDA 3I9NA 1NFFA 1Z73A 5I9MA 3H8VA 1ZJYA 4E2XA 4IDEA 3R3JA 3E9MA 5JBIA 1RM4A 4EBFA 3UXYA 1LC0A 2POQX 1E3IA 2DQ4A 3OH8A 6LDHA 2FZWA 4PCVA 4TRRA 3QSGA 4PRLA 2EV9A 2HRZA 3MTJA 3VKVA 3RD5A 3DBLA 4AG3A 4JBIA 4EZBA 3MJVA 4B4UA 4TKLA 1NX6A 5G4LA 1ZEJA 1EVJA 1XQ6A 2OGUA 3LK7A 2EEZA 4KMSA 1EEHA 1MB4A 2UV8A 3OJLA 4PLTA 3ZWMA 1TEHA 3PIIA 1TT5B 1Y6JA 3DZBA 4M49A 3V2HA 4OKIA 4A26A 3FWZA 4JX8A 4FC7A 3U5TA 3O38A 3RBVA 3V2GA 1DRVA 1SB8A 3K73O 2HMTA 1P45A 3OP4A 1SO8A 4R3WA 1T2FA 4INAA 2NU6A 1ZKMA 1IPFA 1CRWG 3WYCA 4Z0HO 2XOXA 2VCYA 1PGOA 3D0OA 2PD6A 3KHUA 3ZWWA 4CV2A 1CERA 4D0RA 4RF4A 4G2NA 3DMYA 5HS6A 4AJPA 1KS9A 2YHIA 4G65A 3ROKA 1IULA 2YY7A 3KYDA 3QVSA 3RCBA 5B4VA 4FW8A 1JWAB 1DIGA 3NKLA 4IY1A 1HDCA 1UZNA 2BFAA 2CVOA 4HFRA 2OZPA 1U2GA 5EINA 3PQFA 5T5QA 2H6EA 1P1IA 3ZU5A 3AOEA 5BQFA 2HLPA 4CM5A 5TJ9A 3S2EA 1ZK3A 1V8BA 2PKRA 4HADA 1Y8RA 2NTNA 2AEJA 3CEAA 5I9LA 1IE3A 4CM7A 1XQ1A 1Z82A 4U6QA 3E8XA 5JAQA 1LX6A 1EK6A 1E3SA 2G0TA 4YJGB 2I65A 4M55A 1IHYA 1Y8QA 4IZHA 4L76A 4E31A 3HQ4O 4TRJA 1GFSA 4CLRB 4LVUA 3TZ6A 2FPPA 4J1NA 3GMSA 2LDXA 3C1TA 4D43A 1J4AA 1NAHA 3MJTA 5EQFA 3LDHA 3L4BC 3VH1A 4HFNA 5CFZA 1DO8A 5CDUA 3TZKA 1VKOA 3NTQA 3CSDA 1HDGO 2PGLA 1E7MA 1EE9A 2Q4BA 2Q49A 1I36A 3I83A 4RVSA 4TZTA 4BB5A 4BMSA 1P0FA 3GGOA 4FJ2A 4ZQBA 4FC6A 2Y68A 4CLOB 3TL3A 4IXTA 5IDXA 3E82A 3NT4A 3KEQA 4MJLA 4D44A 1DJQA 2O7QA 3KYCA 1YQGA 5DCUA 2W8ZA 1ADCA 1YO6A 3P5SA 1L7DA 5FWNA 1C1DB 1P31A 1PS0A 3LZ6A 1YB4A 3GN1A 1SC6A 1F14A 3PJGA 5ITVA 4PG7A 1QXSA 4CMGA 3WTBA 3JQ8A 3OJEA 4YRAA 2C2YA 2NUAA 4DWVA 4PZCA 5C3MA 4IDGA 3JD3A 4C4OA 1ISJA 3TPCA 3KYBA 1NVGA 1P1HA 2DUWA 3K5PA 3FSRA 4FGSA 1AHHA 3WDSA 3M1LA 2FY8A 2PD3A 1JLLA 3IMFA 4MO2A 4JXKA 3WFJA 2NNLD 2RH4A 3HADA 3I4FA 4B4WA 4GSKA 1ZXLA 2Y05A 3NX4A 1XWFA 2UAGA 5LDGA 5BNTA 2FHSA 1NNUA 4JJGA 5I8WA 1CWUA 3ABIA 4O63O 2IYOA 3DB2A 4Z0TA 4CUJA 3ASUA 2AHRA 4UVHA 4Y98A 1BXGA 1PZGA 4U8GA 3WMWA 4QT0A 2VN8A 3C8MA 5U4QA 3VH2A 2J6IA 2F1KA 4XR9A 4TWRA 3VPHA 2BFMA 4IJWA 2X0NA 4QSMA 1WDLA 4O5OA 1QV6A 5F5LA 2O2YA 2DBRA 3WIDA 3HB4X 1FJHA 4PG5A 3D4OA 4XGIA 1Q7BA 3BAZA 3DMTC 1ZIDA 4QFDA 3OQ6A 4J3FA 2Q99A 4AJKA 2AA3A 5AXCA 3QHAA 1P1FA 1EVZA 4G81A 1EBUA 4F45A 3W8FA 4UREA 1U3WA 1VSUA 4I1IA 1C0LA 1Q7CA 3R0IA 3WJ7A 4YT2A 5KTKA 1KVRA 5KJFA 1VC2A 5CEFA 1JN0A 4W6ZA 1YH3A 5KVCA 2IZ1A 1MA0A 5F1OA 4CM9A 4IM7A 1LTHR 4E32A 1LI4A 4BL5A 1EZ4A 4A10A 3ZWAA 2I6TA 4F6CA 2CY0A 1CF2O 3H2SA 1K5HA 4FN4A 2DTXA 1WW8A 4WGGA 3RC1A 1DC4A 1E0DA 3KLPX 3OJFA 1MV8A 3INRA 1G1AA 4Y6PA 1NYTA 2ZYDA 2FOIA 2X9VA 1EE2A 4B3IA 3X2EA 2PH3A 1P9LA 4IMPA 3GQVA 2Y99A 3DZGA 3N74A 4UULA 1GQYA 2VNSA 1Z6ZA 1HSZA 4BO2A 4WJZA 1WLYA 1XSEA 5IZCC 3JD2A 2J3KA 1EQUA 4I8XA 5DT9A 1J5PA 2DUUA 4B8WA 1PGJA 3QW2A 1CIVA 3PP8A 3JQBA 4KTTE 5A5FA 1PWXA 2HAEA 4MVJG 3NDIA 2HO5A 1EUDA 3FF4A 3TZHA 3ZNOA 3UCFA 3O03A 1KEWA 1R4NA 2HUNA 4CUZA 4HV4A 1R37A 4XYEA 2QZ9A 3L6EA 3OQ1A 4N7RA 1HYHA 3OMLA 3D1LA 4M89A 5CPBA 1KY4A 1PJBA 1U8FO 5KJ1A 1JW9B 3KLMX 4NH4A 5L45A 3MJ4A 1JAYA 3Q9UA 3ANNA 4GAEA 2D4AA 3I1JA 3M2PA 1ZH8A 3F1KA 2Q2VA 3WQQA 3D5QA 2YUTA 4HUJA 3STHA 4R1NA 4F46A 1PJCA 3PZRA 4XR4A 1ULSA 2JD2A 3K96A 3WWZA 4OQYA 2B5WA 3D3WA 2BF7A 1QR6A 3K2EA 4DQVA 4UAGA 3ZWPA 3KSUA 3Q0EA 4XDYA 2O50A 3F5QA 2QIOA 4NHEA 1MUUA 3DQPA 4TQGA 3KZVA 3GUCA 5IFLA 4RVHA 3VC7A 1O0SA 2W2KA 4NMHA 3UOGA 2CZCA 3RVDA 3S8MA 1OI7A 4GX5A 2NTJA 2G5CA 2IEDA 4O0LA 4ZRMA 5L7TA 1XLTA 1LDGA 1NM5A 1V35A 4RVUA 4UVDA 4YACA 3PYMA 4D45A 3SLKA 4RJTA 3VZPA 2G1UA 1NPYA 4ZGWA 1ZVMA 4AJOA 2NVUA 4ROSA 1OAAA 2X8LA 1A71A 2C07A 3NDJA 1B15A 4NJMB 2B4QA 3LYLA 3QVWA 5C7IO 4MP3A 1E5QA 3JQAA 1NBOA 2AG5A 2C54A 3FNFA 3WX0A 4MPDA 1AXEA 2GRAA 2VWHA 2V6MA 1O5IA 2C29D 1KC3A 4ZRNA 3ZN2A 3VDRA 1PEDA 5B4TA 4BO8A 5BNFA 3ZWVA 4DC1A 4JCOA 2H9IA 5FF9A 4J9VA 2BKAA 4QTZA 4AL4A 4BNUA 2VQ3A 5ILOA 1DB3A 4D79A 3PFFA 4RF5A 3VPFA 3F1LA 4J16A 2YQ4A 4ZD6A 4RGBA 1U3TA 4GL4A 3NTOA 1T24A 4ZA2A 4CQMB 1C0IA 1EBFA 3CZRA 1K3TA 5AXAA 3LT2A 1UP7A 4ALKA 2P2SA 2D5CA 1ONNA 1UXIA 3TJRA 3AUAA 3AY3A 3WNQA 2AXQA 1XEAA 1F0YA 4RV9A 3L4SO 3HWRA 4E13A 4RZIA 4ILKA 2ZB8A 3BHJA 4YXFA 1ISGA 5C7LO 1E6WA 2TMDA 1NP3A 1GY8A 3CKYA 1GUZA 4K1LA 4CLHA 1VKNA 2NVBA 4W99A 1I01A 4S1VA 3ZWOA 4CL8A 3AI1A 1O95A 2PGDA 1CETA 1HYEA 4N18A 3GG9A 3A9WA 2JHGA 4LK3A 2ET6A 4CMHA 3ITKA 3HDJA 1L1FA 4KZPA 1EDZA 3U09A 3GVHA 5AQ1A 2QYTA 2DBQA 4KUEA 4MVJA 4GSLA 3UICA 4JJFA 1BRMA 2Y66A 2GZ1A 3ICPA 4I5DA 3GC6A 3X2FA 1Y5RA 1PZFA 5CDTA 2QRLA 1QP8A 1R15A 2GDZA 1SEVA 3GA0A 2PFGA 4RVDA 3GAFA 2EJWA 1R0LA 2V6BA 4NFHA 4R9SA 4RLHA 7ADHA 5JC8A 4RVGA 5AOVA 3NV9A 3W8DA 4ZHSA 4FR5A 4PG4A 3ZDFA 3WGHA 4HKTA 4A27A 4DMLA 3IDSA 5COQA 5DULA 1ENZA 3TNLA 3H65A 1UAGA 4H3VA 4WCFC 3AOGA 2R6JA 3T7CA 3PYXA 1QMGA 5L9AA 1YBMA 2NQ8A 4DLAA 4R16A 3ASVA 4EEZA 3G3EA 5FI5A 1VJ0A 2AE2A 3RUCA 2X7HA 3C7CB 4J90A 4KDFA 4MVJE 4L4SA 4XYBA 5EL0A 1X13A 1RKXA 2B83A 3PJEA 1U8XX 1LDBA 1ZEMA 2X5OA 4BKUA 1EMDA 5L40A 3I6IA 3BZUA 2PGJA 1W73A 1I2CA 3ZHYA 4Q3AA 1M6HA 4YVFA 1YWGO 3VDQA 1HDXA 3T4XA 1YL7A 3KBOA 1H93A 1Z75A 5KNLA 4WK6A 2NACA 3ROQA 1H6AA 2IZ0A 3B6ZA 1J49A 4E5NA 3ZV3A 2X1HA 1B14A 3S2GA 1U7TA 2OHXA 2VRCD 1ARZA 2O4CA 3T4EA 1H6DA 1EFLA 3CPSA 3DO5A 2QG4A 4B3HA 3JYPA 2GASA 1DSSG 1ZMOA 4YAEA 5IF3A 1XU7A 2J3IA 1DC5A 2J5RA 5T8KC 3R1IA 5DOZA 1TT5A 5EN4A 3JYNA 4RORA 2VYND 3D4PA 5TQVA 2ZB4A 4F6LA 4AJHA 3C3XA 1NTOA 4EUEA 1S7CA 3DBHB 3H2ZA 3VPXA 4DBZA 1BDMA 5TS3A 5CHEA 5K6AA 1Z74A 2W90A 3F3SA 3D64A 3JD1A 1HLDA 3RJ9A 4WLOA 3SX2A 4GPD1 3WJAA 2YHUA 1TT7A 1NPDA 1KBZA 2FPIA 4B8ZA 4N5MA 4BQPA 1ZMTA 5THKA 1DLIA 4XIJA 4M86A 2WWRA 3NJ8A 2JAPA 4NK4A 4YB8A 4E12A 1ISFA 3O9ZA 1JVSA 4RZHA 1LA2A 1MP0A 3CXRA 4ND2A 3JQ6A 1E7SA 1ONPA 4PVCA 3F9IA 1C3VA 4J4HA 1C14A 3DOCA 1AXGA 3A4VA 5CG1A 1E1MA 2J5KA 1R4MB 2DBVO 2IEBA 3VVBA 5TLSA 4W82A 4XWYA 3RKRA 2WYWA 1N7HA 3IIEA 3BMCB 3F47A 1K6JA 1I2ZA 4Z3KA 5TJHA 1D1SA 2J3HA 3I52A 1E5LA 4WOKA 1T4BA 4FFLA 1A72A 5A1TA 5ADHA 2VHYA 3RSHA 1L7EA 5KJCA
chains in the Genus database with same CATH superfamily
3HVKA 3GPDG 5JDIC 2WUEA 3F4LA 3ZJVA 1ESMA 1LQ2A 2Y0BA 4UU0A 1R12A 1SUSA 1JDVA 3Q85A 3G9ZA 2GN4A 3I61A 1N0HA 4C0WA 1XJCA 1JA9A 1R9GA 4ME6A 4OXYA 1G8MA 4Q4HA 1UK9A 2ZUBA 2QP9X 2V65A 3K94A 2EZ8A 5HOQA 3PB3A 3O8OB 5F12A 2GGSA 4O59O 1ZD5A 1YD7A 2HA0A 4X1KB 2GZDA 3RJTA 1I7QB 4ZAYA 1NSYA 2JLUA 4I55A 3HL0A 3EZXA 3UJPA 1AB6A 3IQXA 5IASA 1I4EB 5DSZA 1A4IA 1W4ZA 2D54A 2BMVA 2VSOA 3H84A 4FOTA 1ADBA 1QLHA 2R6ZA 3PDCA 2LCIA 3A3KA 1V1MA 5JAHA 4XH9B 4G0XA 4BNVA 2XQIA 2ZJFA 3CZ9A 1CJCA 1SKQA 1Y5MA 5F2OA 3QXJA 4UBJA 1K3UB 1VECA 1WCYA 1XNJA 5AMXA 3C3YA 1RI1A 3H87A 3W05A 4B71A 5JMTA 1TPZA 4ESEA 5DGTA 4DRXB 1FRNA 3TZBA 1SHJA 3FPLA 3PA6A 3ZDDA 3G5LA 1L1EA 3DB1A 4FDTA 3PUXA 4G8JA 4GX0A 4Y2PA 3H11A 3QGMA 2FVXA 1UJ5A 2OV4A 4LC0A 1RHKA 4U8HA 2O5EA 1WIWA 2HX1A 4YRPA 2VDJA 1SKYE 2OCIA 3FDJA 1RLMA 2AR9A 3E48A 4IIEA 1TCBA 1UMCA 3AX6A 1GTSA 1A8SA 1SU6A 2Z9CA 2F3UA 1YR8A 4B40A 1PDWA 3C24A 1ISIA 1AV7A 4E7OA 3TECE 4RSGA 2WIGA 1Q6ZA 3FH0A 4B4OA 1Q6YA 3EF1A 2PUTA 2V7XA 5AVKA 3S6JA 3DBOB 3L6BA 4DWOA 2OORA 1L5KA 3DGEC 4LCJA 4JQZA 1FUUA 1EVIA 2C03A 2OOSA 2BGTA 5DSXA 2DF8A 3G2NA 3N2GB 3JYQA 4GMGA 2IHZA 1QFMA 2EJUA 1CDOA 4OP2A 5E7IA 4COOA 3OJCA 2WSYB 2GZMA 1FMCA 1HFEL 2EWMA 3OLWA 4GR9A 4XD2A 2R65A 2ZBQA 4FYKA 2BEVB 3KZOA 4AI6A 1ZZEA 3EVEA 5CLGA 2JG3A 3PJFA 2WTNA 2BMDA 4J0QA 2C2GA 2ZIZA 5CNMA 1T2EA 2AXEA 1AQYA 1ECGA 2OFXA 4BO3A 3DE4X 5IARA 5M04A 1BTOA 4D3DA 3CNHA 3EGXB 5FH9A 1HUQA 1BXKA 1Q2UA 2CJYA 4MSUA 2V4UA 5HJEA 1JFTA 2BIFA 3G1WA 2G1KA 4DOMA 2G04A 2AH5A 2IY9A 3A4IA 1JDPA 1OLXA 1ZA2A 2XOKD 4GYJA 5FPQA 4B34A 1EK2A 3KDPA 1EHIA 2ZI6A 3GAAA 1E1LA 1FF9A 2ZJ0A 4IJKA 4MIEA 2BJHA 4NPCA 4D5GA 2ASEA 4BUCA 5HIKA 2FGJA 4XAQA 4O02B 4Z8YA 3S1AB 3SQMA 3GO4A 3GAZA 2N1MA 2EL7A 2W7TA 4KWIA 2O19A 1BQ3A 1XTTA 3IPCA 4MDEA 1HRKA 3HB5X 1GRQA 4J3JA 3TRHA 4IGEA 1FP2A 2GEUA 4QQRA 5KJEA 3G6WA 3P26A 5JECA 3I2JA 1E3TA 1S2GA 2MYUA 3WB1A 2BGWA 4I9HA 1WXQA 2CHFA 2VG8A 1Z15A 3G0DA 2XEXA 3QNUA 1UOPA 4FHDA 4PQYA 4DMGA 4PC1A 5JS6A 1DPGA 2VATA 2W2LA 1M34A 1PGPA 4TXNA 1ODLA 3RF7A 1HT0A 4BWGA 4G41A 4QXRA 4AZWA 1X8XA 1RBQA 4GLBA 3S2IA 2IGBA 2D1FA 4AS2A 4J2HA 4LGCA 3ABSB 3JSAA 1NVMB 4XUGB 4Z86A 3PKJA 3DOUA 2WNHA 3K9CA 4U5XA 1TW3A 2WWGA 4ND4A 4X97A 1QZXA 1II8B 2GNPA 4TROA 1USWA 2YHAA 3EVFA 4J43A 5HIIA 1HSOA 1XJ5A 3Q4GA 1P9NA 3WV4A 2JARA 3G85A 4G63A 4UVIA 3S5UA 3C6YA 5AHKA 1IK4A 2GYWA 1VBNA 5MF6A 1W87A 4PPNA 3U5ZB 4FKZA 1WCV1 5CVVA 4RK0A 3F6YA 3R0XA 2ISQA 1EVEA 3JR7A 1QZTA 4ARZA 4X65B 2BLNA 2X2EA 3FWYA 3T5TA 2QTBA 4J0JA 4TT8A 1VGQA 4C03A 1QHIA 3NVDA 1MN6A 2QN9A 2HWUA 5IWCA 4JEMA 3RS3A 3Q9LA 4DEYA 2IYEA 3K6JA 2CVHA 4OLJA 4XDGA 3ZNQA 2YV2A 3GXOA 1Z7WA 3DUFA 3R76A 5EUMA 3DGFC 2EX1A 3TEJA 1EDOA 1JQEA 3WYDA 5KVSA 4QPCA 4KVGA 4XYLA 1TVMA 2HSZA 2P3QA 4CN9A 4TWIA 4A73A 2GBGA 2W9XA 5T4EA 3BSWA 2X6RA 2R7KA 4WEQA 2TYSB 5DW3A 4ZOQI 821PA 3VVLA 2ENUA 5KTSA 2WQ7A 2FG5A 4OHZA 2Z56A 2Z8XA 3E9EA 3IJPA 1K6XA 4N9QA 5IYZF 1MZVA 1LRJA 4NX2A 4QDUA 1DC7A 3GW8A 3O3NB 1N32B 5C8XA 2H63A 4QM6A 1Y6RA 3LRXA 4HQNA 2FCAA 4KRFA 2KM1A 4BEWA 5IM4F 3L5OA 4W6QA 4TKUB 3BMQB 3WMFA 1AB5A 4IRMA 5JWOA 1QHNA 1XV5A 1KO1A 1O0BA 5NULA 1W5TA 2IFTA 5EKDA 4ZVVA 5HKAA 1F12A 3SF8A 3PXCX 3I0ZA 5KREA 5HQTA 2CVZA 3QLJA 4NF2A 2CUKA 3NU1A 3PLNA 4DCSA 4UEQA 1B3RA 2JFFA 4CM4B 1BDIA 2RFLA 2JFYA 4TV9F 5L3QB 5AIBA 4ZO8A 4PWZA 3T1YB 1RFLA 4FX2A 3QHQA 3QPWA 1TVKA 1UR5A 3JWGA 3WL4A 4GWGA 4HAZA 4KDRA 3NTVA 4RD1A 5GV8A 4Z1MA 3ENKA 2C2BA 3M34A 1DTWA 1JSXA 4MGZR 3QA9A 4DLYA 4UOQA 5LCXA 3SZLA 2PWBA 2QRNA 3PHJA 3B5IA 4OUDA 3RWMB 3UHOA 3HJFA 1E2FA 1OJ7A 4LYHA 4AS1A 1FYVA 1T4MA 1XF9A 2WSSA 4L07A 3HDQA 4TS9A 4TGLA 4LF9B 5CT5A 4P4GA 4M8NE 3DHEA 4B3CA 4AYXA 2OBXA 3STUA 1OLSA 3MM4A 1YMQA 4J4TA 1IWOA 4ZI7F 4CMCA 1DX4A 1UWLA 2RIRA 2O7SA 3OU2A 2R5WA 4MR8A 3KQYA 1ISHA 5TMDA 5D6OA 4F8EA 5JZVA 3X44A 2B2XA 4A2WA 4CM9D 3AY7A 2QSUA 5CJJA 4NJMA 5LUBA 1E3WB 1W34A 3JY6A 4S1WA 4QOHA 4XE5A 5EUCA 3P9ZA 3MHTA 2P2ZA 4JDPA 3FUXA 2I66A 1U3VA 4AXBA 1JXOA 1ORRA 2OB2A 4RZQA 1WZIA 4NBVA 2BYTA 2XXAA 1JVNA 2VF5X 2A58A 1T2DA 1FYEA 1E6LA 1L3BA 4TXMA 1EYZA 4DVJA 3LGAA 5GONA 4KAAA 3NWBA 1SIBE 3INYA 3JQEA 1VE9A 1QRAA 2L18A 3MTQA 3ONVA 3OSUA 3PNYA 1AMUA 1N3BA 5D3MB 1TUGA 4EHHA 1A5TA 4HN2A 4EENA 3MCZA 1G9XA 2IHKA 4IOKA 4QL3A 1FX1A 1MXFA 4E4TA 4YCMA 5BOVA 3C3EA 2UZ1B 2QN8A 2B4AA 3B9QA 3NPMA 5BXYA 2PX5A 1PEAA 4GKKB 3CKKA 5K3OA 1IHOA 4OHVA 4IGFA 1UAYA 1QSGA 3VSEA 5JE8A 2XIQA 2IODA 5K4HA 5KJ6A 5IVHA 1ZI6A 4TTTS 4WASA 5JO9A 3UJCA 4BAZA 5GZ1A 4A8TA 2VHCA 5IAEA 3BWVA 3RU9A 1PBNA 3SJAA 2B1RA 1GQFA 4AURA 5K0EA 1Y33E 4Y2JA 4H7DA 2Q6KA 1ODJA 2UUPA 3DKPA 5LYJA 2EQ5A 2HDWA 1L8QA 2XITA 4L5IA 5DTMA 3L8DA 3BK7A 2NG1A 3GEDA 3SPXA 3UWMA 4NR0A 2ZXUA 1A8UA 1RVDA 1JG7A 3DOIA 2FSGA 3YASA 3EXEA 1ISPA 3RU3A 5FJJA 2VH5R 1BYIA 2F1JA 4NONA 3TUZC 2V3CC 1ZGAA 4FXOA 1G7CA 5I7RA 5LDHA 3IQZA 2D13A 4BFVA 4COKA 4GI7A 4L2IA 1PFWA 2ZIXB 3EK2A 2PWAA 1YS2X 2WTBA 4GU5A 4MS4A 5G41A 5BW8A 5T4BA 1CJVC 4EA9A 1TTTA 2BGRA 4AICA 3HJHA 1J22A 2Q3EA 2WPDA 1HR0B 2DC1A 2OECA 3QVTA 1VBMA 1XEFA 1BDBA 1HWYA 1CLEA 2QGFA 3FNBA 2G0AA 4XDZA 2I6GA 2I3AA 5TGDA 3CLTD 2VXBA 4C4RA 2YJ4A 3R3XA 2Q5IA 4IIHA 2O0HA 3MA0A 4X60A 1GXSA 2F9MA 5CLQA 3R9XB 4BLUA 4TV8F 5DYYA 5GJVC 1XLTC 4DGQA 1HE2A 4CMKA 3HU1A 2WF8A 4EJ6A 5T4HA 3WO0A 1VOTA 4HDOB 4WPGA 2TMKA 3VR0A 1G7RA 2H85A 4NYJR 3W3ZB 3AETB 3IKMB 2EHJA 3Q6IA 2VP0A 4HNSA 4A23A 2QLBA 5K8LA 2XUKA 3K9LA 3REGA 3QVJA 3ORHA 4N5NA 4P0TA 3PXBA 4A0QA 5EIHA 3CCBA 2E4YA 2WSMA 1P0MA 2H3EA 2IYTA 5FI3A 5A7HA 2J4FA 2G4LA 3OX2A 2CD9A 5IS2A 4A15A 4FPXA 4DDMA 5CB8A 5CXSA 1Z26A 3VOAA 1HETA 2HF8A 4G26A 2O48X 3STVA 1LSOA 2OZLB 1YHYA 3NOVA 4HVAA 1HXHA 4IJ6A 4BMVA 2MYTA 3NIFB 2VT7A 3CIOA 4GI1A 5I7HA 1J7KA 1W85A 4U6SA 1RRVA 4J1SA 3QVGB 1E3LA 3DLCA 2OGTA 3Q3IA 4FEGA 2A9VA 3KO8A 2AVDA 1KZ7B 4UBOA 4DLWA 4HNTA 2CXUA 1MOZA 3PR3A 5C5IA 1EZ1A 3B70A 3DTVA 3E05A 5BN4B 4CW7A 4R2MA 5SY4A 1NNSA 1YDFA 1V47A 3RS9A 5JJLA 1L5GB 2P2GA 3CONA 5FPYA 1M2JA 1JFFA 5CA0B 3ILXA 8ABPA 1AC5A 1CZUA 1UKEA 4Z3OA 3JWHA 1VLJA 2ZS9A 4LN1A 2AI2A 3GLFA 4UTZA 4D0NA 4OH1A 4LSMA 5CAEB 4H4EA 2JJ8A 4J0EA 2BFCA 1XKLA 1XTUA 4Q3OA 4JHLA 1B42A 1IEQA 3OZBA 4C3ZA 2X40A 4BV9A 4BX2A 2MSKA 4FOOA 4KGXA 2XVAA 2A0XA 4P35A 4Y1GA 3T3EA 2WHRA 3QELB 2JFOA 2QU7A 1KIAA 1RVV1 3IT3A 4QDTA 4D81A 5HKOA 2I9PA 3K6RA 1SELA 4UHDA 2W70A 4AMZA 3LPCA 4EIWA 4FR0A 4XIGS 2D0IA 4XWOA 4B80A 3TJMA 3EFHA 3HABA 4PQEA 5JTUA 1S01A 4Q7KA 4F5WA 2AFHB 1GQQA 3HE3A 3VR4A 2J32A 2VAVA 4D1YA 1F06A 2QG6A 5EIEA 4MWZA 1SVOA 3FZEA 3UFXA 2R1TB 2RG7A 5LL6P 1GDDA 4LYFA 4E15A 3ZJYA 3PRKE 3EHDA 3KKOA 1H9CA 1K7SN 3PR1A 3HCEA 4G9EA 3RYHB 3X1ZA 1WMBA 4A0HA 4KN5A 1I3LA 1TCVA 2ZTMA 2PBRA 3VX4A 1WB9A 3WGVA 5KQGA 1NC3A 2AR7A 1ZR4A 3C5VA 3HWX1 3IEUA 1IM2A 4HYQA 2ZRBA 4J6EA 4MRMB 4QG7A 1L4HA 1UPBA 2CL6X 4X6UA 1KWGA 2O3QA 2G71A 3F46A 4JXXA 1E1YA 2WFLB 4G09A 1IZYA 4EABA 4PNEA 1GPJA 5DKFA 2DWPA 3TSOA 3RIGA 1SC4A 4IKEA 5IRCD 2X0DA 2R0QC 3UANA 2GAFA 2ZAMA 2Q3JA 3EBLA 1L5NA 4C5AA 3TFOA 2AJTA 4C6SA 1K8ZB 4JBLA 2GHRA 1BDHA 1FK8A 1N6NA 2W6ZA 4BFUA 4BB6A 5BWOA 1CDEA 4TVOA 5E6UB 5KTYA 3HGMA 2RE8A 4INZA 4M7PA 5JG7A 4JA2A 3EQ9A 1M75A 2CVFA 4PAMA 3WS7A 4CV0A 8GPBA 1ZHOA 4Z8XA 1M2KA 2IIQA 3ZDZB 2W8BA 4U6NA 1PR2A 3BRCA 2WW8A 3RG8A 2V6IA 4WH0A 3CC8A 3DZCA 4O2LA 5E1MA 2P3LA 1RHRA 2EWWA 4AZVA 4CF5A 2JIZA 5J4YA 2FN7A 5CFOA 3JQGB 5E1BA 1UJMA 5BORA 4IIJF 4RL6A 4I4TA 4M1WA 2FN9A 3NHWA 2M6KA 2CUNA 2OKGA 3DT8A 2P2DA 1AD2A 1JEYA 1V48A 2R2GA 3FZGA 3S2SA 2C4WA 2C94A 3GROA 5DN9A 4BNJA 4MR9A 2HA3A 1I0ZA 2K5UA 1ZH4A 1NJ5A 2ZS7A 3WMRA 1IVSA 1ADGA 5L4SA 4G23A 1N2OA 4MW9A 1D0SA 5JAIA 2H2DA 1BEEA 1NSFA 5JV5A 4MARA 3ICCA 4JQOA 5ALJA 3GWGA 4CEHA 1ADFA 3IHKA 1JPUA 1SVUA 1ZOLA 2BSAA 4EA8A 3JASB 1KDYA 1ADYA 4XB2A 4DB2A 3GLIE 5THXA 4R2HA 5H70A 2Y76A 3N0XA 3QKRA 1RJWA 3QMWA 4BQRA 4EUFA 3W2IA 4P0PB 3RE1A 3NGMA 1A5AB 2F1OA 4EJSA 5E6RB 2Y1FA 3HB1A 2IX3A 3KVYA 3I2HA 4I5FA 4JSTA 4LX8A 4RD3A 1O89A 3A32A 1J8FA 2YUIA 1CEXA 4N0EA 3KEFA 2RGCA 1YRAA 1FBNA 3K2QA 3WQSB 5GWXA 4K9PA 1MBZA 1L5QA 2VKTA 4UDXX 1UDCA 1T9BA 5AHOA 3C74A 5AVTA 2Q1SA 2CEKA 3UMYA 2VYVA 4YQFA 5ESXA 2FG7C 4KVAA 1Q50A 1RS0A 1QVZA 3DCYA 3P9RA 4A8JB 4DG5A 3AB8A 3EMKA 1JHAA 1DVRA 2GI4A 1RHUA 3CJTA 3DVLA 4D3SA 3ZVKA 3OUTA 3A3YA 3WLMA 3DL0A 4Q7LA 2XXJA 3HH8A 2AXNA 1YS9A 1KRWA 4MS3B 3ZHOA 1DEOA 2C2HA 4OMCA 2G67A 2QL9A 2WFAA 3O4HA 3DFFA 1VYVA 1BE0A 4GP7A 5FUWA 3V97A 1CUBA 4YAFA 1DDIA 1UZLA 1Y1RA 2R5NA 2V0NA 4M1TA 4OQPA 4D9HA 3TQFA 1LTQA 1Q12A 4RL4A 1IK6A 3VR5A 1CEYA 3NYWA 3K6SA 2OYRA 1MHTA 1R5JA 4DAOA 4P08A 1RFGE 2ATCA 3RVNA 1XC7A 4TS4A 2FWNA 1DTEA 5A9SB 4TYQA 1E7WA 2C0QA 1U1FA 3AK4A 3PICA 3OQPA 3L0BA 4HMQA 4FOSA 2HHHB 4PIPA 5EWJB 3GJXC 2ES4A 1R0BA 1GZUA 1XTRA 3DMDA 2C61A 5AW9A 4Q18A 1R0ZA 4RBNA 1GN8A 1YQ9A 2VK1A 2RK4A 3EYWA 3SNKA 1JH9A 1WDWB 3GZNA 2QTTA 3ZHZA 3QX8A 4C0LA 5BSFA 3FLMA 3AUYA 3E7WA 4YJHB 3ZGOA 5A62A 1ZUD1 5FV4A 1RTTA 2QRZA 5J40A 2EX0A 3F5SA 4QOGA 1CVIA 2RBEA 4J0KA 4CQLA 1SG9A 5CDSA 2ANCA 3A9SA 1E9SA 2DHRA 3VSCA 1CFZA 4BO1A 2QM3A 3FOAA 4WNCA 3WGYA 5KKAA 3LQ2A 3WXMA 4EG5A 3EXIA 4D46A 3OAAA 5H83A 1IWBB 1IXZA 3GMIA 2BFFB 3BDAA 2PX8A 3DDOA 1C1YA 3LUDA 3WMXA 1TZCA 4RHTA 5FWAA 4WVFA 1E2DA 1ULBA 3TI9A 5BSHA 4IL5A 1XLWA 3EG9A 1WL8A 1A96A 3RG2A 1F51E 4ZDIA 5IK2D 2I99A 2CLIB 3PFGA 3WSVA 1KI9A 1OFHA 3A1DA 3F5MA 4F1WA 2QAGA 5LP6F 3EFOA 5DYNA 1Z8HA 1JTFA 4Y2YA 5B1HA 4N41A 1Z62A 1QVVA 1XTKA 5KMGB 4OAQA 2QM0A 3CNNA 2GZ2A 3HN7A 1HDYA 4IDDA 3REQA 1RQLA 4NENB 4NNPA 2AOUB 1VYUA 5EC8A 5KC8A 1EUCB 1FMLA 4KO4S 2XQKA 4GWKA 5DU2A 4DCUA 1NW7A 1TKAA 1YFLA 4ZVUA 1ULAA 1ODCA 2FPMA 2CF5A 3BULA 1DGQA 3HJTA 2OXTA 4AWXA 4Q9AA 3KV3O 3LBNA 5JMPA 3DZJA 2B5OA 2EG9A 2GN0A 2YMQA 2GLTA 2QLNA 2UZIR 1L7NA 2A1TS 1MABA 3EUFA 2ZUTA 1YMUA 3SR4A 3U37A 1BVRA 5HSGA 1PTJA 3BQ9A 1J07A 4K5QA 2BGMA 2Y0DA 3S70A 3GLIB 2V3VA 4HTAA 3LPMA 2BGLA 4FMDF 4MJXA 3H9UA 1MRSA 1RRKA 1YK1A 4XB1A 1KEPA 3PVZA 4QEDA 1E64A 2O3RA 2ODNA 3AI7A 2PT9A 3MWDB 4BZQA 3UIEA 2VWPA 3PC3A 3MERA 4PQRA 1ML3A 3DFZA 3KV1A 4I0WB 3ZDBA 2Z2IA 4FZJA 1IZ9A 1Q2XA 4R8LA 3FCXA 4GMKA 2V4ZA 3BB4A 4FE7A 1BGXT 4JJKA 2D2VA 2IF2A 2W00A 2ZSDA 4C6RA 5KQSA 3ETJA 3CH5A 1QQBA 1X39A 3ZQJA 1JB1A 1MG5A 4RPCA 2C20A 1FVFA 4QJ4A 1UXOA 1WRBA 3E18A 5DF1A 3VJRA 2JI7A 3RQSA 4D9IA 2XR1A 1ACMA 3JCZA 2F1IA 1JP7A 2XSZD 4EO7A 2DJIA 2F8SA 5DNDA 3W06A 3AKCA 4MPRA 2NTVA 3KFLA 3Q2IA 4TLDA 4QUHA 3QNMA 3UH1A 4N76A 2BLLA 2PRYA 3NANA 3F7TA 1Y6ZA 3N70A 2HM7A 1ND6A 3WP0A 1F8GA 1FTSA 1HFWA 4QFMA 2EDCA 2ONJA 4XQEA 1P7CA 3MTGA 3TVDA 4CTKA 1BW9B 3GDWA 3GCXA 4IEIA 3JALA 2F1RA 4WLUA 4NCNA 3GUYA 3NHMA 1V11B 5LD2B 3H83A 1EXNA 4DR2B 4M0PA 5CM8B 3SHOA 1HEIA 4PSVA 4MITA 3T35A 3P7MA 1FPMA 2W71A 3K9WA 2AOXA 3RAJA 5GAJA 1NF9A 1ULTA 4PG6A 1G0NA 1GVHA 3H2GA 2FWMX 4NH0A 3WHPA 2VK2A 3P2EA 4CPDA 2OWEA 4QATA 2OFWA 4U3JB 3G8AA 5DHUA 1G98A 5EPEA 5FKJA 3P0HA 2A94A 2WJGA 1UJ6A 2E7ZA 1L4UA 1RQPA 2O6HA 3CCFA 3M4JA 4XTCS 1X15A 1YZKA 4K9DA 2H1HA 4RGYA 3BDIA 4TN1A 2WU3A 1J1ZA 3I0NA 4H7KA 4JVNA 4OXKA 4CM3A 1BJKA 1M6NA 1N5DA 4UHFA 5CBPB 1YS7A 3AJRA 3VHLB 3AJEA 3VPDA 3R9WA 3CPHA 4EG4A 1RZRD 2WHQA 4ZCQA 1X94A 2GXQA 4JA0A 4D3XA 2C2XA 2QTVB 2ZDQA 4EJ0A 1NXSA 2N47A 3ZQUA 1PR0A 4II2A 5KVVA 4X3PA 3GLQA 4BATA 4BX3A 1MCZA 2RI0A 1VQ1A 3BYZA 3DFUA 5B5SA 2B4TO 3NNSA 4CCSA 3JVDA 4ZI2A 3MS4A 3CNLA 3OCZA 1MA3A 2BMWA 2AQ8A 4C2TA 1BAPA 4GUDA 1H22A 4CV1A 4GPBA 3AVXA 2XNJA 1LLUA 2H2GA 3ZCVA 4KKXB 4YPOA 1I1NA 3I73A 3V9PA 4C0BA 1KJ9A 4LTNA 3G2QA 4EKEA 4WXEA 1RXSA 1Q0LA 5H80A 1U11A 2R2AA 3PC6A 1MDFA 2RONA 1KJIA 2GAOA 4MAAA 2AN3A 2XUDA 1N2CA 3AOEC 1US8B 3WI7A 4BE4A 4KNYA 1PW7A 1S02A 1U1EA 2YWEA 1MGOA 1ZUNB 3WK5A 2CWWA 4DM7A 2FRDA 1EK0A 3ETDA 3N28A 3IGFA 3P45A 4MQMA 1W5AA 2ZT7A 3T5MA 3UMCA 4DY4A 4WX2B 521PA 1TO2E 3FYCA 2EP7A 5HRCA 3QBEA 2DAPA 5DTRA 4JNKA 1AE1A 2J3LA 1EGQA 3E8SA 1PYOA 2RHLA 2JCGA 3I5AA 1X80A 3S40A 3A2KA 4Q47A 4UEJA 4GLJA 4JP2A 2DKNA 4P34A 3M49A 4EW3A 3VR2D 1QKKA 5ED4A 3LW7A 1QCZA 4ETNA 4IDQA 2AG8A 3FFXA 3ZQKA 4HWGA 1NAIA 1XVIA 4P9NA 3RVBA 4LZZA 4LCBA 4NE2A 3IVAA 4TQAA 1HY3A 1J8MF 3UC5A 5ILQA 3R7NA 3LAWA 4WNAA 4AMUA 2I7DA 2A0YA 5BO5A 1HQDA 2GOYA 1Z29A 4EW2A 4I7EA 1A9SA 1RTKA 1YR9A 2CF6A 2O2ZA 4N03A 1OFIA 3TQQA 2DULA 4WNIA 5G0TA 4EA7A 1NUQA 4F3RA 4F85A 4HXYA 5ERGB 3RTGA 3P2YA 3ED5A 1MPXA 1MMFB 1QFSA 5AT1A 3QKSA 2BUCA 3U1BA 1DEHA 2J30A 2X14A 1NIJA 3MYRA 4HFJA 3WLFA 2B35A 4O2BF 1DOZA 1JDBB 1Q14A 2X41A 3B89A 3PC2A 1MX1A 3LDGA 3OX4A 3C5CA 1JIKA 3CW9A 5BYKA 4UBLA 2I91A 2OXIA 3BWXA 1XNHA 1QV7A 1ONOA 3EGEA 3QF4B 4QSHA 2Q29A 5FXMA 1HDIA 5AI5A 1AKQA 1UJNA 1DJNA 3HI6A 4R2IA 5E9JA 3SHVA 4EHDA 4DUZB 1JUDA 3GJQA 1GLVA 4OHUA 1BE6A 4YRKA 4FIDA 4YECA 1WDKA 3EHEA 2V7PA 4KIWA 1U04A 4ZCTA 4D9MA 2OO7A 3ENVA 4IH9A 4HH3C 3UUFA 1Z5UA 4EKNB 1W5FA 5IYZA 1MRZA 1RE1A 3GEGA 4D25A 1PFKA 2IPMA 4UBNA 1Z5VA 5K3FA 2OWDA 3U16A 3LL4A 3IULA 3KWFA 1QP7A 1GILA 1XZNA 3AJ9A 3ISTA 5IM4A 1RXWA 1J09A 3BIWA 5IDQA 3DAFA 4A7PA 3QU4A 3WWYA 2QLLA 3HLKA 1TLTA 4IDPA 4JSYA 1FIUA 3GR6A 2PWZA 3JZDA 4L15A 4DV4B 5JVDF 4IJ5A 2ILVA 4UMEA 3DUWA 4LJ5A 3OZXA 3BSFA 4QO8A 3ZWQA 4AS3A 4R1TA 3ZXUB 2PR7A 3OA2A 5HA5A 3QFSA 3TIIA 4TV9A 1K7FB 1GG2A 4PZYA 4ETWA 5HRUA 2ZSUA 3NGXA 3P52A 3U9SA 4L85A 2RCYA 4NEHB 3IV9A 9LDTA 5C8DA 3AXTA 2O3UA 5H82A 1O97D 1LSUA 5T6BA 3EEOA 2VQEB 1X1TA 2GH1A 3HU3A 2FK8A 4LJ4A 5JZ9A 4H08A 2D74A 2WM9B 4LOHA 2B8NA 1K88A 2ILTA 4F9TA 4M9ZA 2B2NA 4M7WA 3VU1A 3WGOA 4OJNA 1TJ5A 2WMDA 1JBKA 4W5NA 2O8CA 3K70C 5DMHA 5EXTA 4FGKA 2DFVA 5DNAA 4H16A 5A3SA 1M1YB 1EZZA 2ZM5A 1OBFO 4RW0A 4HEHA 2WJWA 2CJWB 3UT5B 4D9GA 2C4UA 1QGUA 1AY0A 3ONDA 4F04A 1Z6XA 1ISSA 4TS1A 4AUEA 5LR6A 1KZHA 1U3GA 3PFWO 1GZ4A 3OCCA 1XZMA 3Q7EA 4MYCA 3QFFA 3ZXIA 5BUSA 3NM6B 5FNVB 1JIJA 2KJQA 1A8QA 1GEEA 1HZJA 3DKVA 3IP1A 2OGSA 3PKIA 4RY9A 1T8WA 4LRYA 4YCSA 2V97A 5HJ5A 5JQGA 2V8BA 5CLLA 2IHUA 4KE6A 3WGNA 1B43A 3BB3A 1ZITA 4PLHA 2WM3A 4F56A 2WILA 5JRDS 4IQ0A 1E4EA 1RKUA 1KJ8A 3FOWA 4M0MA 3CO0S 5EERA 3Q8LA 3LTEA 2Y1EA 3V1YA 2QN6A 3W2TA 5PNTA 2X8JA 1B8UA 3E5RA 2ZYTX 1J56A 1V4VA 2ROQA 1TAUA 4CLDA 1SQFA 1SVWA 1XCBA 2ZUSA 1JB9A 2CXXA 1N7GA 2DU8A 3LHSA 4LTMA 4I1VA 5DO9A 3UG6A 4BKOA 2I1QA 2RSLA 3WSTA 1K3FA 1RE0A 3MJEA 1I10A 1S2NA 2R1VA 4X95A 2IIVA 3VAAA 1D2MA 4MKHA 4J0HA 2AMLA 1TU3A 1VSVA 3K1ZA 2QE7A 3P8ZA 1PG2A 4WN9A 5GP1A 4YRJA 4AY3A 1IN5A 2QKYA 5DLYA 4GQIA 3MTBA 4AUKA 5A6SA 2QTLA 2A0KA 1ZD9A 2B0CA 4QWMA 1ZIPA 1KS2A 2JKVA 1IZ0A 4ZDJA 2B6HA 5I7WA 2JGKA 3VJLA 1NQTA 3DV2A 4OI4A 2TMYA 1FYWA 3DV0A 4LZNA 5FJIA 2G5TA 2WTUA 4RO0A 1RWOA 3BE4A 3GRPA 2Q4OA 3GBSA 1AS3A 3RVPA 3P2KA 5PGMA 1Q1EA 1MG0A 3BTVA 1Z0SA 3L79A 4FW9A 2BHSA 1FYDA 1N8SA 3PPXA 4IP0A 4JODA 5AOAA 4C08A 3RJ5A 4JOCA 3E7FA 3HXLA 1PR9A 3B1VA 1KQGA 4HQLA 2TSYB 2PK3A 3LF2A 5F5XA 5SICE 1JL3A 3A6EA 2OVBA 1RADA 5FTMA 5KNDD 1IN7A 5CCEA 1E6UA 4P93A 3EZ6A 2GVDC 2LV8A 4IIXA 1IY9A 2MSNA 4HDSB 4MX8A 3KQUA 3FGZA 4EB8A 1ZK0A 1N6RA 4BLSA 2PRSA 1P33A 2AT1A 2D59A 2BZGA 4ZAFA 1IEVA 2DQZA 3JAWB 3BREA 2NU6B 2VA9A 4I1PA 4V3BA 4WLEA 1W9MA 3KSAC 5JNLA 3QIAA 4HEA1 5B3LA 2XMPA 4N0DA 4TV8A 2O57A 1YQTA 2J31A 1JKMA 1HI9A 2PLRA 3ECSA 3V1TC 5EYPB 3WGKA 4ILEA 4HWPA 3V8MA 2PQ6A 1PZNA 2NV6A 4RWEA 1NBWB 4MROA 3CH4B 1Z16A 3KYDB 4X9XA 4RFSA 5AW3A 1KIMA 4IQ8A 2F4NA 2GZAA 3ZS9A 1WB5A 1C81A 3IESA 2GPTA 3IELA 1SBTA 1B1AA 4DJFC 1DRWA 2E82A 3AERB 1M67A 1E0SA 2CFCA 1OX4B 1SHUX 2AI3A 1LPBB 2WSIA 3FPEA 4Z53A 4CRWB 4BGEA 5KNDH 1DX6A 4OXQA 1VZ2A 2JVIA 3KQLA 5C4IA 3ZOKA 1LK5A 2I1LA 1NFRA 1V7CA 1E94E 4FEAA 4GXQA 5SZKB 3ME5A 4ZZ0A 4LQLA 4BQQA 2ZANA 5A4DA 1MO5A 5IDWA 1TM7E 3B8EA 2Q3MA 2ZATA 3HHPA 1YU6A 2DUMA 1OC2A 1WMEA 1YXMA 2ZVDA 5D5QA 3RS8A 4EG0A 5KNBD 3LECA 1J42A 3ETCA 4I5EA 2QX9A 4PZLA 1M1UA 3EC7A 3RF6A 2QMHA 1BWRA 1H4SA 2O4UX 1Y80A 1Q0HA 3DQZA 2C5HA 2XCSB 4KJZA 2DETA 3BGDA 1SUBA 3B3QA 3ZU4A 3IE0A 2J5BA 5DWVA 2BHLA 1PUJA 2VPXA 3NFRA 3NG1A 3A11A 3OHPA 3SJUA 1DCKA 1BDJA 4ES6A 4YMIA 3SVTA 2Q3BA 4MH0R 4EAAA 3W5SA 1ZH0A 2EWVA 4G9BA 1RJ9B 4G1MB 3DF7A 1FLAA 4HDMA 3UXMA 1JEDA 1QG2A 3GNSA 2HRBA 4Q1VA 2VDUE 4BNXA 3U60B 5HF6A 2HF9A 5K8JB 3VQTA 2QXUA 4Q3NA 3OBBA 1NMEA 4G4JA 2I4TA 3L7JA 1Z28A 2FHPA 1IMOA 1S3FA 2H1IA 2PAFA 3SEAA 4EI8A 4AY2A 4EL0A 4HWKA 4NY1A 4OSPA 1WTAA 1CQWA 4QUJA 2QIPA 1B2RA 3PLRA 4BPRA 1H6BA 1BQ4A 1BGVA 2XCIA 3JPWA 4B74A 4EY4A 2VUIB 3QXCA 1O87A 1O95C 5B55A 2JJ1D 1IJEA 4QPNA 5DP1A 4NDZA 1NXTA 3H18A 4D9JA 2Q1YA 2H5LA 5K0LA 3OQIB 1E32A 3RVLA 3U4CA 4Y3UA 3E23A 4HEA6 3AUXA 4OGLA 3MBOA 2ABWA 5B1IA 2I7CA 1T6XA 4UFOA 4DUGA 3K71B 4G0VA 3U13A 1U2ZA 2R96A 4N47A 3H6GA 3GJ8A 4HN4B 4HGZA 3EVGA 2V7QD 2WKWA 1D3AA 2R6CA 1F1BA 1RXIA 1SOMA 4BLTA 3SI7A 5JO0A 1T0JB 3MJRA 3HDGA 2ZE7A 4U7TB 1SQ6A 1U02A 4FP9A 4CQJA 621PA 1MQ9A 3BL6A 3IMEA 1BA3A 2JK1A 2VKQA 4CTJA 1KARA 5JH7F 3FGOA 1NWCA 2O2GA 4MUAA 4M0FA 5FP0A 4YONB 4YAKA 4XTRA 4JYZA 3JQFA 2BCGY 5CXQA 1WA5A 2HBZA 2PY6A 4Q9NA 3M33A 1N2XA 2NV2B 2OHVA 1RYZA 1QZUA 3QKTA 2WUGA 2CNBA 1Q92A 1AN9A 3TSCA 2O2IA 4B7CA 3KB2A 1K6IA 2COEA 4Q1DA 2QE6A 3OFKA 2WJHA 4EQZA 1EFKA 2DERA 4RMHA 4E2FA 3OF2A 1UBNA 1NQXA 1ZWKA 2YBEA 3IKVA 4JL5A 4PRYA 4U02A 4TKZA 5AVQA 1Z35A 1I2AA 3GYGA 3H2KA 1HE5A 4XSHA 1W4AA 3DM5A 1P3Y1 1X7DA 2XQJA 3WQRA 4DREA 1HF3A 3H1BA 5C7YA 1ECFA 3WGIA 4IIJA 4BDTA 5CX1A 4DL9A 4HS9A 4JC0A 3TX2A 4EJMA 4M6WA 2AE1A 2PQ2A 2WA2A 3GK3A 4G4SP 4OATA 3DHVA 3TDNA 4UDYX 3TTTA 2RHOA 1P2FA 1C9JA 3HDVA 3UPUA 4GQBA 1T10A 4XSVA 1Z2DA 4CFYA 4BECA 4CIBA 2EP5A 3I2FA 1Z4JA 1ZPDA 3AUFA 1QYIA 3UOAB 2C7PA 4OJMX 2VTEA 2QYHA 2RKWA 2P1RA 4G0PA 4RKWA 3RHZA 3U4QB 2I9KA 1L8LA 4J9UE 4Y7DA 1CQJA 5I51A 3BGWA 1BIFA 1QHYA 1ZL2A 4LNAA 5BOSA 1EFDN 1FTNA 3WGGA 1Z4KA 2H52A 3TLJA 2R25B 3H19A 2ZWOA 3L7LA 3ZLVA 3TH5A 1K2VN 4EG8A 3MB8A 2X13A 1B3BA 4RLQA 3CVYA 3V4RA 1ZW6A 4DPKA 2PZJA 1JA1A 4TRMA 1QHHB 4IDAA 4TWBA 4OGWA 1VLLA 1AGNA 3TXAA 2ECPA 2PT6A 2NQ2C 2ZCVA 3KXPA 3OM1A 3HDHA 4YRTA 4L8YA 4F6RB 5JZMA 2ZIFA 4RH3A 1V8FA 4QPZA 3FTQA 4IDOA 2H1WA 2WZQA 2VDWA 1RXEA 1T3GA 3CF4G 3RT1A 3TGLA 4B73A 4QDXA 2J85A 4MR7B 4L8LA 2YDXA 3H9JA 2BI4A 2JGDA 2RGNC 4DXHA 3WXBA 2B21A 3ZGLA 1XXHB 2GBLC 4YFYA 4C0AC 3PNKA 5FD8A 5G0UA 1C50A 2QJTA 2PLNA 1EWKA 3FR7A 1W4CA 1H9AA 3A1UA 4C9BA 4N6OA 4I3FA 1B23P 1AKMA 5K6AC 1VL0A 1EFRD 3KLNA 4KGDA 1GA6A 2P30A 4LF6B 3DHWC 1RKQA 2ZRNA 4HBZA 2O8VA 1NVEA 1JHRA 1B76A 1WPRA 1MC8A 1OWPA 1ZJ6A 1PT9A 1Q0RA 3OLVA 3RW9A 3BFXA 4ZAZA 4AZ3A 4PLFA 4C87A 5HXAA 4A36A 4XASA 1C4WA 4WA8A 3MB5A 3IPXA 3L1UA 3N58A 3VBEA 2O2XA 5CX4A 1G4UR 1CS0B 2DXIA 3FY4A 4HAXA 1E3MA 3OFND 1J2JA 1UKVY 1YJBA 1G64A 2QR3A 4MQEA 3DCNA 3ZY4A 4FYHA 3RADC 3VRHA 4EB0A 2FEOA 3KELA 3NATA 1TE2A 3VU9B 2CLMB 1I7PA 1TECE 3MT0A 4ALMA 1E5TA 421PA 1N5JA 1Z0AA 4UTPA 1T15A 1DJLA 4HEJA 1GQSA 4M1MA 4DC9A 4HVTA 4DQXA 3BTSA 2CUZA 1AUQA 2Y9MB 2Q9UA 4II7A 4JVLA 1U7OA 2BR5A 4MMYB 3HYSA 4BMOB 1WAMA 4E5UA 4DMUB 3D4BA 4LNUA 1UKCA 2XE8A 3ZBPA 4RTKA 5BSMA 3C6XA 5FFMA 3L4KA 4FXPA 1GPUA 4PEVA 3S7ZA 1QR2A 1Y7PA 2CDCA 5GGYA 5KQRA 5KYWB 1ZCAA 3OC6A 5AI8A 5AK3A 2PAAA 2R7NA 2Z2ZA 4MV6A 4P7FA 5AUOB 2G09A 2GCPA 2VHZA 2HSDA 1AZLA 3AXSA 3OZGA 3SXUB 4A03A 3TLBA 4P7KA 5A5EA 1RAAA 2XHEA 3OLCX 2A0UA 5A71A 5JCXA 3U7IA 1JHMA 3UN1A 5LP6A 5DWDA 2IYYA 3KJGA 1RCFA 4KQWA 5J3JA 5EQDA 4OIFA 4WCDA 4HB2A 4Q02A 16PKA 2I6QA 3UK2A 4FU0A 1NN1A 2QTGA 1BX1A 5CLFA 4AJ1A 5E6SB 1Z6PA 4PO8A 5FR1A 2W6MA 3L1HA 4V0QA 2PXAA 4G5FA 4DCJA 1ATIA 1E4OA 1FW6A 3TI7A 5BN3B 1KZYC 2F7SA 2C9MA 4GLLA 2P3OA 2VJMA 3VISA 5IVPA 3VPCA 1M2VB