1U7HA

Structure and a proposed mechanism for ornithine cyclodeaminase from pseudomonas putida
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
341
structure length
341
Chain Sequence
b'TYFIDVPTMSDLVHDIGVAPFIGELAAALRDDFKRWQAFDKSARVASHSEVGVIELMPVADKSRYAFKYVNGHPANTARNLHTVMAFGVLADVDSGYPVLLSELTIATALRTAATSLMAAQALARPNARKMALIGNGAQSEFQALAFHKHLGIEEIVAYDTDPLATAKLIANLKEYSGLTIRRASSVAEAVKGVDIITTVTADKAYATIITPDMLEPGMHLNAVGGDCPGKTELHADVLRNARVFVEYEPQTRIEGEIQQLPADFPVVDLWRVLRGETEGRQSDSQVTVFDSVGFALEDYTVLRYVLQQAEKRGMGTKIDLVPWVEDDPKDLFSHTRGRAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ornithine cyclodeaminase
molecule tags Lyase
source organism Pseudomonas putida
publication title Ornithine Cyclodeaminase: Structure, Mechanism of Action, and Implications for the u-Crystallin Family;
pubmed doi rcsb
total genus 111
structure length 341
sequence length 341
chains with identical sequence B
ec nomenclature ec 4.3.1.12: Ornithine cyclodeaminase.
pdb deposition date 2004-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02423 OCD_Mu_crystall Ornithine cyclodeaminase/mu-crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1780.10 Alpha Beta 2-Layer Sandwich ornithine cyclodeaminase, domain 1 ornithine cyclodeaminase, domain 1 1u7hA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1u7hA02
3QWHA 2OHXA 3DZBA 4JJIA 2EGGA 2P9GA 4RVSA 1D8AA 3CINA 1A7KA 4ND3A 2WD8A 1NPDA 1WMAA 3C3XA 5DF1A 5JS6A 2Y93A 4MIEA 4BQPA 4ZJUA 4IJUA 5ICMA 4ZQEA 3HJAA 1LDMA 4DC0A 5B4VA 3EVNA 4ND5A 2XXBA 4Z3DA 1I24A 3INGA 1OFGA 2QZ9A 3VH1A 1BGVA 2NLOA 4J9VA 3NEPX 4JLWA 1Z75A 1ZK0A 3U3XA 1I2CA 4OSPA 1QLJA 3GR6A 1ZO8A 4GLLA 1ISIA 3EYWA 1VLLA 4H7PA 1KVQA 2Q49A 4PLCA 4XJSA 1K5HA 4A5OA 1M2WA 2O4UX 2V7PA 3D5QA 4JBHA 5A3JA 4MVJG 5EMHA 5AXDA 3OQBA 1F0YA 4KTTE 4DGSA 4XWYA 4BGVA 1EUCA 4Z9YA 1P1RA 4CMAA 4LRSB 1P1KA 3JD3A 1YRLA 5JDIA 1LNQA 2BFMA 3PHLA 4I5GA 3FBGA 4GWKA 3WX0A 4ALNA 2V6FA 4K1LA 2CF5A 3GPIA 3ZHZA 3SLKA 1GFSA 1HZZA 2Q2VA 4M86A 1MC4A 2HQ1A 1PJ2A 4E4YA 1BMDA 5CFZA 2PZKA 3I9MA 5JCJA 4E12A 2DPGA 4Y9DA 2I3GA 1UH5A 2WM3A 4TRNA 1XR3A 5GZ6A 5LC1A 1U7TA 3PHGA 3CTMA 5G4KB 3ETGA 1I2BA 3PGXA 4K9DA 2EW8A 3C24A 1R4MB 4BKQA 1DJNA 1F06A 1LTHR 2DUUA 2GPTA 4IS3A 3AU9A 5BSEA 2Y1EA 1XYGA 2YHIA 2D59A 4XDYA 1NX6A 1NWHA 1LU9A 1DFIA 1RM4A 5AXBA 4U6SA 4B3JA 1GZ3A 4R3WA 4KQXA 1LXCA 4CLXA 1VE9A 2DTXA 3F1KA 2O3SA 3BHJA 3G49A 3ONEA 3QP9A 5DDIP 4ALKA 1PR3A 1GTMA 3GNTA 3ZV6A 1H9AA 4CMEC 4GMFA 3GVXA 5I8ZA 3KZVA 1LEHA 1IPEA 1C0LA 4W9NC 3MOGA 2NNLD 4CM5A 1ARZA 3C7DB 5TS3A 3RUFA 2C2XA 2IYPA 4FFOA 1IHXA 4RF5A 4C7JA 1CYDA 2OBYA 4W7HA 2O4CA 2OP1A 1XG5A 1AUPA 2VN8A 2EKPA 5HBRA 2H6EA 3LLSA 1B8PA 4DLBA 1NPTO 1WP4A 4NH4A 1CF2O 2HJRA 4IZHA 1IUKA 2FZEA 4UVIA 1UXJA 4GX1A 1ML3A 2PZJA 3M2TA 4TQGA 1Y5RA 4DXHA 1EQ2A 2BFAA 4QO8A 1V35A 3WNVA 4CUJA 2VYVA 1LRJA 3U4IA 2CY0A 1E7SA 4FS3A 3O03A 3MJ4A 3KO8A 4I8XA 4CV1A 1DPGA 2WWRA 4FW8A 1E92A 4M49A 3W1VA 3JD4A 2QW8A 4OH1A 3H3JA 2V6GA 3P5SA 4MPDA 1XGKA 3GDFA 3VH3A 1TXGA 2C0CA 1U3TA 2X86A 2G17A 3ICCA 2Q3EA 5EQDA 1HE2A 1F8GA 1NYTA 4Q3AA 1EVZA 2AEJA 3GFGA 5L9AA 2VZ8A 3OJLA 3W4JA 4ZVVA 3CH6A 1QYXA 1L7DA 4AJKA 1X1TA 2AHRA 1BTOA 1UR5A 4DLLA 4JX8A 1Q7GA 2IZ1A 4DQXA 4BNLA 1EBUA 3H9GA 4LSWA 4WLVA 4ZHSA 3UCXA 4FC6A 3R6DA 3RFTA 4D3SA 3LT4A 4XR9A 4D44A 4ZRNA 5H82A 4R68A 3N74A 3D64A 2Z5LA 4D45A 3EZLA 5F1OA 1PU2A 2EJVA 1NFQA 3R1IA 3ZWMA 3I9JA 4TRJA 4YAJA 4JP2A 3WTBA 1BXKA 2HDHA 4NHEA 1B7GO 2HO5A 2EKQA 3D7LA 1HDXA 3GUYA 3ONDA 4L9RA 4PLTA 1SC6A 4XQCA 2J3HA 5JDIC 4W9NA 4Z9FA 2VUSA 3S2IA 2PD4A 3FTPA 2GSDA 4CM3A 4KZPA 3IOYA 3BAZA 2CUKA 3ASUA 3TOXA 5DBFA 4D42A 3L4BC 4E2WA 2H9IA 3CZMA 1PGQA 4DYDA 4WJZA 2FPPA 3KLPX 1LI4A 3IJRA 1T26A 2PZLA 3M6IA 3DBRB 1YWGO 3HHPA 1HYEA 1R6DA 4XX0A 2P91A 3VVCA 1ZNQO 1I0ZA 3WGGA 4KQWA 2AQ8A 3WJ7A 3NJ4A 2P9CA 2YJZA 2J3KA 1RM3A 5B37A 3UGKA 1JW9B 1ADCA 1P45A 1UZLA 3FD8A 1LC3A 5DOZA 1KS9A 1I30A 2PFGA 3F4LA 4JBIA 1BXGB 3NRCA 1MA0A 4J4HA 4MP8A 3V1YA 2LDBA 4RDIA 1I2ZA 1ONOA 2ZYGA 3EVTA 1DO8A 4FN4A 2P68A 2NVBA 2F1KA 3K30A 3PZBA 5A5FA 2AW5A 2GRAA 3WOHA 1HXHA 2PH5A 1B3BA 1E7RA 2ZB8A 4TKMA 3WTCA 5JCXA 1QSGA 3QQPA 2PWZA 2Y1OA 4XQ9A 4WLOA 3GEDA 4JJGA 4K6CA 3ICPA 1DSSG 3BMQB 3RBZA 2VOJA 4CLRB 5TT1A 4ZQFA 5I7FA 3Q2KA 1VL8A 5KWEA 5ITWA 3IKTA 3NDIA 4HBGA 3RKUA 4GWGA 1XWFA 4NBTA 4ZQBA 5DNAA 1VSUA 3ZGYA 3CKYA 1Q7CA 1LC0A 1B26A 1EFLA 3JQBC 1I3LA 4CL8A 1T25A 4BO7A 5TNXA 2C54A 4IJVA 5TSDA 3BMNB 3ZWPA 4J0FA 3GN2A 2Y1CA 1IE3A 3KOUA 2X5JO 4CR7A 4OYRA 1C1XA 2UUPA 2GZ2A 4GI2A 1OAAA 3PLRA 4CMBA 4IZIA 1K89A 1PGPA 2PLAA 1OOEA 4LCJA 4RPKA 5EL0A 2OL4A 2VZ9A 4JQCA 2A92A 2YHUA 1R4NB 5AVOA 4CQMA 1RPNA 1UXIA 4I9HA 2EP7A 1VJ0A 1RJWA 4WGGA 1J0XO 2O50A 1E1LA 1HDZA 2AQKA 4CLEA 1XELA 4R1TA 1PTJA 2OORA 1NHGA 3JYOA 1EE2A 3ZV5A 3DHEA 1XQ1A 4E5PA 5A9SB 1DJQA 1NFFA 2YUTA 3ADOA 4KWHA 1C1DA 2EIHA 2AE1A 1Y7TA 3I9NA 3SLGA 5L95A 1SB9A 5G0VA 4IMPA 1FMCA 5L7WA 4QUKA 4MKZA 2FOIA 2JCYA 3RUAA 3ZV4A 2I3AA 1EE9A 2GLXA 5IDYA 4MVJF 2CVZA 3QA9A 1MFPA 2X7HA 3RQSA 4KWIA 3AUTA 3PK0A 3UFXA 1DAOA 1ZEJA 3WQSB 4CM1A 4NI5A 3VOSA 4RQUA 1OMOA 3WG9A 1WW8A 3V8BA 1BHSA 5JC8A 3MJEA 5IDWA 4NFHA 2B37A 2VQ3A 3S8MA 3D0OA 5A1TA 5A04A 3AOGA 1A4UA 4WNIA 4ROSA 1IOLA 4LCEA 2GR9A 2YV1A 3O8QB 4BO1A 1DRWA 1GU7A 4RLHA 3VZSA 5F3RA 4WCFA 4CPDA 2C20A 1JKIA 1XKQA 2J3JA 2UYYA 3RJ5A 1GYPA 3QSGA 3WXBA 1DEHA 5BQFA 3KUXA 4BB5A 3KRTA 4HX5A 5C3MA 1RM5A 2ZJ1A 1E0DA 1J5PA 1H6BA 2B35A 1P1HA 4RF4A 3NDRA 1E3WB 2I9PA 2QRLA 1P33A 4FOSA 4IJWA 4WECA 4IMRA 3E5MA 1ID1A 1SNYA 3PDUA 5G0UA 5B4TA 1KETA 2WE7A 1YE3A 2UUOA 4PLZA 3DBHB 4BOYA 4UUPA 1PL8A 4BL5A 4DYVA 4BVAA 1R12A 3WIDA 3WYBA 4KTVE 3B1KA 5JCJD 3QWIA 4WLUA 1DOHA 2G82A 4I9UA 3JQ7A 2BI7A 3ORFA 2C29D 3ZWAA 3ON5A 3I3OA 4E5YA 1VL0A 4HADA 1PL6A 1HYHA 4EUHA 2JD1A 4PLHA 1IZ0A 3VPFA 3FCOA 3I83A 3PQFA 3VZRA 4C7KA 1GV1A 4YTEA 5I9NA 2J5QA 4ZQGA 4W99A 3RUIA 3JYLA 4IDFA 4YJGA 4EYEA 3IIEA 1W0CA 2W4QA 4E5KA 2ZQYA 4AL4A 2CVOA 3QJ5A 2YZ7A 1PJ4A 2TMDA 1L7EA 4G81A 3EZYA 1P44A 4UVGA 5ENVA 4B4UA 3PWKA 2I6TA 3VPGA 1O0SA 4N5LA 1HF3A 3P2YA 5I8WA 2NACA 4J7XA 4P8RA 3GZNB 3WIEA 3T4EA 3U4CA 1M66A 3PYXA 3JYNA 2ZCVA 3HUDA 5DT9A 1RKXA 2YDYA 3OJEA 3FN4A 4BNIA 4CUKA 5BT9A 1TVEA 3GVPA 4ID9A 3RUCA 3N7UA 3JV7A 3KV3O 4HKTA 4IS2A 3DMTC 5L40A 1PZFA 3SVTA 3AY3A 4QX6A 3ZNNA 3DZJA 1A9YA 1A4IA 1DIRA 3WGHA 3ROPA 3AFNA 4D46A 5KKCA 1GQYA 2YDXA 4CMCA 4J49A 4BS9A 4NDNE 5C7IO 1OC2A 5KJEA 3JYQA 1ONPA 4HFJA 4GH5A 3DTTA 3RC1A 1YOVB 3HSKA 4BNMA 5JAQA 1GUFA 3FNFA 2RCYA 4TRMA 3DXFA 3OETA 4BGIA 4GVLA 3F9IA 3IUSA 5CEJA 2AA3A 3AM3A 4YDRA 1K6JA 1QR6A 1ZW1A 2C07A 4MVJP 4YQYA 3GAFA 2JHFA 4AJ2A 4E2ZA 3WDSA 3KSDO 3L9XA 2RHCA 4IQ8A 5JSFA 1DRUA 2DFDA 5H83A 1JAXA 4M8SA 4A26A 1O9BA 4GL4A 1JN0A 2GO1A 3ZHXA 8ADHA 1VM6A 3IL2A 5H81A 4TKLA 1LRKA 4DIOA 1Y5MA 3H5NA 4YEDA 3FR8A 2VTDA 1ULSA 1PZGA 5JY1A 3E9QA 5JYDA 1R4NA 1Z82A 1PX0A 2WMDA 1N8KA 4RCVA 3VAZA 4KMSA 3WJAA 2ZCUA 4B3HA 3GAZA 2DM6A 1DC3A 1PJSA 3C85A 2X5KO 3KYCB 4A0SA 3MJVA 4BO0A 1HKUA 5KKAA 1LUAA 4MP3A 4EUEA 1GADO 5EERA 5U9CA 4J2OA 5AYVA 1MG5A 1CWUA 3HN7A 3GG9A 4UULA 3H65A 1X7GA 4BNXA 4FCCA 4E5MA 3MWDB 1DFGA 1N7GA 1DLJA 2RBEA 1BDBA 3BTVA 5DP1A 3TSCA 4UREA 3FWZA 3JQAD 4GX5A 4BO2A 2NWQA 2O7QA 2OO5A 4PG8A 3AY7A 2QYSA 4RVUA 3NTQA 1KEWA 3U4DA 2DTDA 2VHWA 3ZV3A 1DLIA 4ONEA 5IZ4A 1YB4A 3DB2A 4II3A 4NJMA 3LU1A 3IMFA 1U7HA 3A4VA 4IPTA 2HMWA 4IQGA 5K9ZA 3ANLA 2Y1DA 1NVMB 4XQEA 2Q2QA 1Y9EA 4XYEA 3OJ0A 4OQYA 4CQLB 4CMGA 2PNFA 2OZPA 1ZEMA 1E77A 4HNHA 1GPJA 3BYZA 1QG6A 2YV2A 3ZHBA 5TGDA 1X1EA 1Y8RA 2GNAA 1NAHA 3E82A 4OHUA 4YJFB 3OIGA 1N2SA 1WAMA 1RM0A 5T5QA 3Q3CA 1MLDA 4E6PA 2D3TA 4BKUA 1WMBA 1GY8A 5BSGA 2AE2A 3L4SO 3BHMA 3MWEB 5KCZA 4ZRMA 2ZTLA 1F12A 4CM4A 2X9VA 4B3IA 1HETA 1OZAA 4IDCA 4D7AA 3HG7A 3SJUA 2GCGA 2Q4BA 2VUUA 4XYGA 4ZU3A 4FR5A 1FDUA 1D7OA 1IULA 1KERA 3DO5A 3VPXA 5ILGA 4DQUA 3NX4A 1W4ZA 3KTDA 3ZWCA 4AJ4A 3BMOB 2XF8A 1YL5A 2HK9A 2R00C 2FPIA 4MDHA 1HSOA 3AI2A 3GNSA 4R69A 4YR9A 1ZSNA 3B1FA 3EGOA 2HU2A 4GLOA 1Z7BA 2ZK7A 4U6QA 1C3VA 1XHLA 1GYQA 1KEVA 1YQGA 4FOOA 3TRIA 2Y0CA 2DUWA 3NDJA 1E7QA 2FP4A 3L9WA 4BMSA 2CDCA 5L51A 4XA8A 3LVFO 3PTZA 1V3UA 2X5OA 1NNUA 4A7PA 1T2FA 2OP0A 3BMCA 3TZHA 4K28A 2B4RO 4CMIB 3AUUA 4XDZA 5ICSA 2Y1GA 2D4AA 3GQVA 3I6QA 3OICA 4RVHA 5GMOA 1YS4A 3H9EO 3WGYA 2AEMA 4AICA 3WSVA 1RYDA 4YXFA 1T1SA 3MTGA 1NP3A 3I9LA 1A72A 1HE3A 3PWSA 1FDSA 3BA1A 4EITA 4CR8A 4W82A 4IY1A 2W2LD 2E4AA 4RVDA 5IDQA 1LBEA 3JQFC 4J2HA 2Q50A 4BNJA 4CM8B 4QEDA 1LSOA 3K31A 5EINA 3PYLA 3F1LA 4L4RA 3GLQA 3KSUA 5F21A 1SO8A 3F6YA 4IGFA 4LVUA 3LZ6A 5LCXA 1D1SA 4YRBA 2FZWA 4I5FA 4BNGA 2I5PO 1ADFA 1B0AA 4A10A 2HMSA 4Q3CA 3KYCA 3O9ZA 3H9QA 1GUYA 2VYVD 1P77A 4XIYA 2BGMA 4F6LA 3LYLA 4WASA 2GUGA 4GX0A 1U8XX 4A03A 4URFA 1T24A 5KJFA 1U3UA 5HWSA 1JLLA 4RVGA 1KY4A 2EHDA 4MKXA 4CLOB 1DXYA 4EEXA 3H9UA 3HB5X 3GDGA 1QYWA 3ZH2A 3D4PA 1F8FA 5KJ6A 2UVDA 2Q4EA 2HK7A 3K5PA 3L4BA 4NNJA 1P1FA 4FFNA 1MX3A 1PZHA 1W73A 4CV3A 1WPQA 4EGFA 2NU6A 2YYYA 2X6TA 2HRBA 1U5AA 1YJ8A 4I1IA 3M1LA 5TJHA 3C1OA 4KUHA 4CQMD 4NU6A 1NQAO 3ZCXA 2C7VA 3A14A 4OL9A 4CL3A 3VZQA 1CQIA 4Q3DA 4NU5A 1NFRA 2DKNA 2IXAA 4R9SA 4XGKA 3QVXA 4CMIA 4ZICA 4L8VA 5TLSA 1P1JA 1GQ2A 2NTJA 3G1TA 3OMLA 4QO7A 4UUOA 3VKVA 3OP4A 4B8WA 5L4SA 4E32A 1HDYA 2DBRA 2IEBA 1GZ4A 3KVOA 1JKFA 1L1FA 3WGIA 3NT2A 4WCFC 4AJIA 3WLEA 3JQFA 4WEOA 4IDBA 3NTRA 5CG2A 1LSUA 1B16A 2B36A 4IXTA 3TZCA 3IDSA 4DC1A 1LDGA 4J9UE 1B3RA 1Q0HA 3MZ0A 1V3TA 2B83A 3WQRA 5FF9A 2YFHA 1U5CA 4HFRA 2CNBA 4A73A 2VWHA 4CUZA 3F46A 4M55A 1KEPA 5TIIA 4WPGA 4QFCA 1NPYA 1O5IA 1N9GB 1WVGA 3AM5A 4N5MA 4N7RA 1YB5A 2P5YA 1Y9AA 3V2UA 3CXRA 3WWZA 2CF6A 3K92A 1BXGA 3E1KA 3PIIA 1ZXBA 4DLAA 5JAZA 3PEFA 2Z1NA 3ROQA 1KOLA 5GZ1A 3LK7A 5I7VA 2VWPA 4UUMA 3GVHA 1JAYA 1YJQA 3F5QA 3ONFA 1C14A 2GASA 2X0RA 1GEGA 5MDHA 1EK5A 1QRRA 4Z3KA 1Z6ZA 5B1YA 4WEQA 3CE6A 4QXMA 5CDUA 1FJHA 3JQ7B 3UCFA 4XYLA 3OBBA 1T2CA 5L3ZA 5TX7A 3UH1A 3V1TC 5G0TA 2WE8A 3L6OO 3ZWXA 3HDJA 1H6DA 1ZK2A 3ST7A 4GBJA 4OJNA 4PG4A 3EC7A 1SB8A 1PIWA 2W98A 2ZIZA 4D79A 2P9EA 1JVBA 3JTMA 4YT5A 1C0PA 2FR8A 2O48X 4XRRA 3OH8A 1K3TA 4RORA 4FPXA 3U09A 4TSKA 1YONA 2QRKA 4PRKA 1EVYA 2RAFA 3SBOA 3EY4A 4YPOA 3W8DA 1JA9A 1XCBA 2GZ3A 1QORA 4WCFB 1E3EA 1U2GA 1GDHA 3QLJA 3I9OA 4LK3A 3FI9A 4UVEA 4WLNA 3H7AA 3QRWA 1UAYA 1ISMA 1QYVA 3KYBA 1WZEA 4IUYA 1JQBA 1JVSA 1UJMA 2F00A 4PFJA 3TPCA 4DBVO 5BSHA 4FD3A 3TJRA 1CERA 3ITKA 1RYEA 4AJJA 5BSFA 1VRWA 3CMMA 5IFLA 1CDOA 4Y67A 3C7AA 3DFZA 4FC7A 4HXYA 4Q9NA 2J5KA 4O0LA 5F5NA 1G1AA 2DVMA 4XR4A 1B15A 2YQ4A 2WYVA 3ABIA 3NYWA 5LDHA 3O38A 2R00A 2E37A 4Y98A 1ZMTA 3RU9A 4WOKA 3PWZA 1R15A 4R16A 1C1DB 4Z0PA 4JP3A 1H5QA 3Q0EA 4J16A 1P9LA 4PG7A 5HS4A 4NK5A 5A9SA 3F3SA 1HDRA 2C59A 4E21A 1LLCA 3QWBA 3L6EA 4FFRA 2NTNA 3JQ9A 2PK3A 4R1UA 4J0EA 2H1SA 1CJCA 2QRJA 3KEOA 4MOWA 4AJLA 2R6JA 4AJPA 4C4OA 1QV6A 3JQDA 3UN1A 1ZJYA 3WQQA 2CSUA 1X0VA 5ES3A 2G5CA 5COAA 4ALIA 4UAGA 5I9LA 2DTEA 2O2YA 4CM7A 4Q39A 4B4WA 5CAEA 4WOJA 1TA4A 5KJ1A 3U9LA 4IDEA 4GMGA 4OKIA 1EMDA 2FHSA 3A28A 4IDGA 4H16A 1V3VA 3QWAA 4PVDA 4R5HA 2BRUA 1V6AA 1ULUA 2JFGA 5FWNA 2GZ1A 2NSDA 2ZKLA 3S2FA 1Z74A 2ZATA 1AGNA 2FSVA 4E13A 3OF2A 3ZWYA 4EI2A 2ZTUA 3I52A 4CV0A 3S2GA 3CIFA 3NGLA 3BMCB 1UXKA 4HFNA 3FSRA 3GHYA 2W90A 3GZNA 3AWDA 2X0JA 2DLDA 1YKFA 2J6IA 3WMWA 2YHIB 1YGYA 1P74A 4N54A 3GHHA 2X9NA 3AY6A 3SEFA 2ZTVA 1MV8A 1VKOA 2HK8A 2OMEA 4TROA 1LJ8A 3IUPA 4BO3A 3GG2A 3VTZA 3DL2A 2HAEA 4GSKA 2Q45A 2R2GA 3RIHA 5KVCA 1N1GA 2O3UA 5KJCA 4BNFA 4CLRA 3TN7A 4BO5A 3I9KA 1MGOA 5I7EA 1MXHA 1YQDA 3NT4A 4L4XA 4JIGA 4ILKA 1W6UA 3RSHA 4IDDA 3IP3A 4DTIA 4Y6PA 3EAGA 4L74A 3GGPA 1DC5A 5IXSA 2BI8A 5L4NA 2EF1A 4FGWA 4TRRA 1DHTA 4LMPA 1R0SA 3K73O 5LDGA 3H6KA 3VVBA 1NAIA 3D4NA 3A9WA 2VNAA 3F47A 3WBFA 1B2LA 2WJPA 1ZJZA 5A02A 4YT2A 3P19A 2PV7A 5CEFA 1NBOA 5A3VA 1HTBA 1IY8A 5KVQA 1P3DA 4XGNA 4DVJA 3K2BA 1Y8QB 4QFDA 5F1KA 4NFYA 2HCTA 1E3WA 5AXAA 3DAGA 1R37A 1X15A 4KOAA 1HE5A 2HLPA 3LDHA 5F5LA 2B4TO 2ZQZA 4UEKA 3GT0A 2P5UA 4OIMA 3NUGA 4CQLA 3I4CA 2P4HX 4PIVA 1H2BA 1CRWG 4XKJA 3W6ZA 3MCVA 1H94A 3W8EA 3B20A 1HEUA 3Q9NA 1ZIDA 1HWYA 2PD6A 5JPIA 3E18A 3KYDB 4L75A 5CG1A 1GV0A 3TFOA 1A71A 2QX7A 1LX6A 4J4TA 4YT8A 3O8QA 4D0RA 1J4AA 4CLDA 5ER6A 3CUKA 2VYNA 3UOGA 2NVUA 1NASA 2CFCA 2D2IA 3JQBA 2A35A 1T2EA 3QVSA 4YRDA 4OMUA 3DHYA 3TWOA 1BVUA 4PN3A 2A4KA 3AUSA 4Y8VA 3WGTA 1ZZEA 4U0JA 1E1NA 4FDAA 4W7IA 1JWBB 5JAIA 2GN6A 1ZUD1 1JDJA 4EJ6A 1LQUA 2GN9A 2WSBA 1EK6A 1K2WA 1KY5A 3TZKA 1FK8A 3HB4X 3H3FA 3JQGB 4RPHA 1HDGO 3UUWA 1A27A 4A27A 4B7UA 1AE1A 1FDWA 5KNLA 4BNKA 1NTOA 5A06A 1CIVA 1KYQA 3NKLA 4Z9XA 4ZQHA 3LC2O 5G4LA 4OXYA 2EERA 2O3RA 1UDCA 4BO6A 5K6AA 4YCAA 3OM9A 2EKLA 2IDZA 1NM5A 1U9JA 3KEQA 3ZW9A 1K0UA 1U1IA 1UDAA 3JYPA 3WGOA 1K6IA 1JTVA 1WDLA 3D1LA 5HM8A 3AFMA 4F6CA 4CLOA 3RUEA 2PH3A 4KP7A 1B14A 1FF9A 1E7YA 3C1AA 4K6FA 4EDFA 3FNGA 2A9FA 3WLFA 1N92A 1GUZA 2VHYA 1GR0A 3L6DA 2VOEA 1M75A 1PJBA 4MIYA 5TQVA 4BO4A 1HDOA 2C5AA 4FB5A 4PLFA 1ZSYA 2X22A 3PLNA 3RC7A 2DU8A 4HP8A 5THQA 1R66A 2D8AA 4CM9D 4DIBA 4G5HA 4LW8A 2EP5A 2QZZA 4IM7A 1MFZA 3E9MA 3UHAA 2NU9A 1JKJA 2JJYA 1T4DA 3ADPA 4FIZA 3RFVA 4E2XA 2AQHA 1O95A 4CM6A 3PRJA 4BO9A 5ILOA 4YAIA 4MIOA 3RKRA 4LISA 4RZHA 1YVEI 1I10A 1DDOA 1JU9A 4WUVA 3WICA 7MDHA 1SAYA 3T7EA 4FBGA 3P2OA 3ZNOA 5C37A 5CPFA 1UP6A 4NMHA 1GCOA 2O23A 2WDZA 3AK4A 4CLHA 4BNUA 5AOVA 2EWMA 2UV8A 3U62A 2EW2A 2NV6A 1CETA 2E82A 4LN1A 4MVJM 4PG6A 2POQX 1ZK3A 4J3FA 3VHRA 2E49A 2J3IA 3O26A 4ESOA 4INAA 1CQJA 1Y8QA 4M89A 2TMGA 1XU7A 3DFUA 3PFWO 5KOIA 1ZFNA 4ALMA 2DBZA 1NVGA 1SPXA 1OBFO 1QV7A 5A9TA 5L4LA 4DL9A 1SZJG 3BMOA 2YY7A 2PD3A 3VDRA 5IG2A 1QKIA 2A94A 1QMGA 4PZDA 4A2CA 3QIVA 4UVDA 3TNLA 4U7WA 2OBNA 3KHUA 4XEHA 1EQUA 3X2EA 3RJ9A 1ONNA 3KBOA 2E6UX 1EDZA 2CVQA 1ISJA 4J1SA 3H2ZA 5THKA 3RAJA 4L4SA 4CM4B 3E9NA 3JQ8B 4OGWA 3U49A 4CV2A 4RVFA 3Q9UA 1TB4A 3DDNA 4BUCA 5G0SA 3UAGA 2WYWA 3SC6A 3DC2A 3LF2A 2B4QA 2PY6A 2Y68A 3SX2A 4YT4A 3H8VA 3WS7A 2BGKA 2JFHA 3NGXA 3RUHA 1ENZA 1D4FA 3DBLB 3GPDG 4FGSA 3ZNQA 1Q1NA 3SC4A 3DR3A 5MGBA 1E6WA 3ITDA 3INTA 1V9LA 1C0IA 2Y0DA 2I65A 4BQRA 1LLUA 4YJHB 3KSZO 3DONA 1MXFA 5B4UA 1PGNA 1NVTA 4M87A 2FSSA 3BTOA 3PJGA 1XDWA 4P22A 2YV3A 1LQTA 4LRTB 1D1TA 1ZCJA 1X0XA 3GOHA 4OO3A 5L7YA 5TJ9A 2YW9A 5ADHA 1O89A 5IAAA 3QY9A 3QHAA 5T64A 4RGBA 1HLDA 3E8XA 3I4FA 3JQ6A 3EDMA 5U1PA 3UVEA 4D41A 5CDGA 3DBLA 1O6ZA 2J8ZA 2Y05A 3PHHA 2I76A 4HUJA 5TT0A 4EEZA 3ZWOA 1E5LA 2ZB7A 1PSDA 1ZH8A 2ZYAA 2OOSA 4TZKA 2W2KA 4PZEA 4MKRA 4UEJA 5HS6A 4B79A 3HWRA 5EN4A 1ZSVA 2CD9A 4P4NA 2Y66A 1LSJA 1T2DA 4S1VA 3ZI0A 2JCVA 4R41A 2PKQP 4BHTA 1VSVA 4DQVA 3SJ7A 1SEVA 4DMLA 3LQFA 5JXWA 2BLLA 1TT5B 1P0FA 4RF2A 6ADHA 3IP1A 4MO2A 3X2FA 1ZVMA 2JKVA 3VH4A 3JQEA 4QTZA 4ZN6A 2BD0A 1DBVO 3QV1A 4IQ0A 4O5OA 3RASA 1PGOA 3GH3A 3IAHA 3TQHA 1PZEA 4D0SA 4R01A 2PGLA 4FFLA 1KEUA 3RU7A 1LDBA 4P38A 2D1YA 4FJ0A 5EPOA 4ALLA 1PJTA 3DOCA 4GX2A 4HNGA 1EEHA 3LT1A 1TEHA 1UP7A 4KUEA 3W6UA 2UAGA 1J6UA 1BG6A 2H63A 4ZD6A 4YYZA 1LA2A 3RCBA 1AXGA 3U4HA 3W4IA 2GF2A 1GZ6A 4CMHA 4DPLA 5DCUA 1C1XB 3ZDFA 1D3AA 1M6HA 4O63O 4XGIA 3HN2A 1MP0A 5CPBA 5JMWA 3BMNA 1ORRA 4W6ZA 1ISHA 3AOEA 4MINA 4DIFA 2I99A 1E1KA 2ZYDA 3NJ8A 4LGVA 3GY0A 4R54A 2IEDA 1FDTA 3KXDA 2Q1SA 4UVHA 5BNFA 1E3SA 4O1MA 4KDFA 3PGJA 4OXNA 4RPGA 4DMMA 4I08A 3IC5A 1R4MA 1ISGA 3GVCA 2BMAA 5G0WA 1PQUA 4RLSA 1KVUA 2O3TA 3TZ6A 1YB1A 4PGFA 4XB1A 3S1LA 2HMTA 4LVCA 4CR6A 2OUIA 1I32A 4FJ2A 2WYUA 3CZRA 3PFFA 5AXCA 5JO9A 1BRMA 3VTFA 1HDCA 4E30A 1NR1A 3OIFA 4RF3A 4Y6SA 1KIFA 2BF7A 2AEFA 3AUAA 1PS8A 1E1MA 2XPCA 4Q3BA 4BNHA 4B8ZA 4WE3A 5IF3A 1U3WA 4WLEA 2IZ0A 5GZ3A 4J7CA 4RPJA 4PRLA 3G79A 3NTOA 1TT7A 5TF4A 1YH3A 4GGOA 4BIIA 1U4OA 4YJGB 4CMEA 4DRYA 4DBZA 4XRGA 3PYMA 2W8ZA 1RWBA 1GQQA 1H6AA 3DMTA 4R3NA 1XIVA 3DHNA 3G1UA 4LMRA 3V5NA 4B4OA 1R16A 4J6FA 1AHIA 4IDAA 5T8KC 5HRUA 4GPD1 2PTGA 4AJOA 2B69A 3JQGA 3A06A 5BNIA 3WSWA 5DN9A 3ULKA 3DBRA 3ENNA 1PJCA 3TDKA 1LRLA 2Y1FA 1X14A 3OA0A 1MG0A 2AG8A 4EW6A 2IE0A 1SOWA 1PWZA 2AMFA 5CDTA 2O3QA 5JDCC 2X8LA 3MTJA 4TVBA 5HTOA 3VPHA 3ZU5A 3NV9A 1DHRA 4II2A 3SXPA 4MVJE 5BR7A 4TMFA 3C7CB 2EG9A 3PHIA 3VC7A 2X9GA 3BZUA 2HUNA 2PGDA 3PDJA 1U8FO 3FF4A 3L77A 3C8MA 2J5RA 3K9QO 4NFSA 4OAQA 2G1UA 1E3IA 1PJLA 5EQFA 1X13A 2JCXA 3PHJA 4QECA 1GYRA 4Q3NA 2Z95A 3ENKA 3KYDA 3O4RA 1A7AA 2C7GA 1DB3A 2ILTA 4BNWA 1DFHA 3JD0A 4ND4A 1ZBQA 2AG5A 1PGJA 2FY8A 2YQ5A 2RIRA 1G0NA 1U3VA 4AVYA 1QLHA 2V6BA 4YRAA 5I7SA 3LT2A 4NBRA 3KB6A 2RH4A 2V6MA 4I9NA 4E2YA 1UZNA 3D3EA 3H9JA 1Z73A 3Q6IA 1LSSA 5JNLA 3UICA 1X7DA 2RH8A 2XOXA 1PWXA 2VNSA 2IXBA 4O59O 2GYYA 1E7WA 4NZ9A 4GKVA 1Y1PA 4QQRA 4CMJA 4BKOA 2BKAA 4UUNA 1OC4A 3QVOA 2PKRA 1KVRA 2QYTA 5B12A 2GDZA 2VT2A 4HY3A 4M54A 2O2SA 5AQ1A 1ENYA 2DFVA 3D3WB 1EVIA 3FNEA 4R4JA 1R0KA 3FTNA 1ENOA 1BVRA 4YAEA 5COQA 3G17A 3JQAB 5KVVA 1KVTA 3ETDA 5A05A 1GPDG 3OA2A 3AM4A 2VRCD 4QSMA 3FR7A 2VRCA 4AG3A 3RVDA 1SCUA 2DBVO 4GSLA 1FDVA 3GZ4A 1VJ1A 3UKOA 5DCYA 1UAGA 3ASVA 2FWMX 2BELA 1B8VA 3FHLA 3TL2A 5DULA 4NQZA 4NG5A 2GN4A 1G0OA 5J23A 2OFPA 3BTSA 1TLTA 4BMVA 3HQ4O 4JROA 4JK3A 4CM8A 5IZCA 5EIOA 3M1AA 4JN6B 3DWFA 5A03A 3OQ6A 2BHLA 5ENDA 3E48A 2JD2A 5K0ZA 3F4BA 3N58A 4AJ1A 2VHVA 4XQGA 1Y6JA 2ZJ0A 3GRKA 1NR7A 1T4BA 3JQ9C 1YDEA 3DZGA 1PQWA 3LF1A 1ADGA 3G3EA 4QT0A 3TZQA 1LLQA 3JD2A 5JY6A 4RO0A 5FFFA 1DRVA 3EK2A 3JQCA 3LT0A 4WCDA 4NIMA 2Y0EA 2DAPA 3IJPA 3MJSA 3WB9A 4G65A 1H0KA 4XJTA 5IXYA 1BDMA 3OHSX 1I3KA 5T8KA 5JC1A 4J7UA 3AI3A 1QYCA 4I5EA 4TWRA 3PIDA 3PQDA 3DAFA 4LSMA 1WXDA 3GEGA 3EHEA 4S3MA 1Z7EA 1MUUA 2X58A 3OEYA 4J43A 2FRDA 4XD2A 3HNPA 1NHWA 2BFOA 4J1NA 2ZTMA 1YXMA 1WDMA 4CM9A 4NPCA 1BXZA 3T7CA 3INRA 3OIDA 5CP8A 2VYND 2WD7B 3WYCA 1PS9A 4R5MA 1TT5A 4OXKA 4E31A 3TF5A 1DIGA 4NJOA 3H5RA 4L73A 2AQIA 3D4OA 4RDHA 1DC4A 2H5LA 2VRBA 3M2PA 4OSOA 1E3LA 1QXSA 4DA9A 3JCZA 3ANMA 4P4LA 4YAKA 5CDSA 3DZFA 4RPLA 1CEQA 2GGSA 1SOVA 1XA0A 1ZKMA 2BFPA 2QG4A 1AHHA 3B70A 3HDYA 1XSEA 2VHZA 4YA6A 3LC1O 1U4SA 3BTUA 1I3MA 1V8BA 4RZIA 1LDYA 2XAAA 3E5RA 1KBZA 2B5VA 1P0CA 1Y8RB 4ZA2A 4G2NA 1ISFA 3ETEA 4HFMA 3LC7O 3GF4A 2EEZA 1F17A 4W4TA 1VL6A 3AOEC 2CZCA 1R0LA 3G0OA 1VC2A 4BO8A 2CMDA 2HRZA 3GGGA 4N5NA 4XZ3A 1A9ZA 3I6IA 4FQ8A 1F14A 1E3JA 2IYOA 4YJHA 3RBXA 4EBFA 3COSA 4AJEA 1T2AA 1XEAA 3UCEA 5DZSA 2DQ4A 3K8ZA 2V65A 3ZNPA 2EJWA 1HE4A 1I01A 3Q2IA 3OSUA 3OQ1A 2RHRA 5ER9A 3GNQA 4BNNA 4D43A 1BW9A 2VWQA 3UW3A 4E0BA 3WGZA 2HJSA 4ALJA 1M6WA 2HKIA 1QP8A 4OQZA 3QVWA 1K6XA 1DC6A 3WGQA 5FI3A 1AXEA 1KVSA 3PJEA 2Q2WA 5F1PA 4PVCA 5G2OA 1JWAB 4XYBA 3ANNA 1XLTA 3DEYX 3EW7A 1NQOA 3GMDA 3WFJA 2QIOA 4XIJA 4BNVA 3ROMA 3GMSA 3W4KA 4Z6KA 5JBIA 8LDHA 2FMUA 3CEAA 3Q11A 4NR0A 1U28A 5CHEA 1E5QA 1KC1A 3CPSA 1LDEA 3GRPA 4UEOA 3H2SA 1N9GA 1P1IA 4YAGA 4K26A 4IIUA 1EUZA 1I36A 3DAPA 1GEEA 5JO0A 2BGLA 5GY7A 6LDHA 2NUAA 3ZU3A 1OI7A 2FR1A 3U5TA 3IS3A 2WD7A 3CSDA 3FNHA 2D5AA 4KDEA 2P4QA 1IPFA 3HDQA 4O6VA 3WFIA 5A4DA 1YBAA 2X1HA 4IIVA 3VDQA 5TRTA 4JJFA 1EFKA 1YBVA 5U4QA 4BMNA 5IDXA 5CEEA 5IN5A 4U8GA 3PJFA 4GQAA 3IKVA 2X0NA 4Z0TA 1VPDA 1S6YA 1W8DA 1NWCA 3FPCA 1UZMA 1I8TA 1NXQA 5DP2A 4D3DA 3I1JA 3B6ZA 3T4XA 3ZHYA 1HSZA 2NU8A 3MJTA 4BV9A 3QW2A 3FWNA 3GK3A 2Q1UA 3JD1A 3K6JA 4ZGWA 4HWKA 1E6EA 2WTBA 4R9RA 4BB6A 4R1SA 4MVJD 5JMPA 3WWYA 3V1UA 3DBVO 4J90A 1H6CA 3R3JA 1GAEO 4RL6A 1YQXA 2EXXA 5JFOA 2IZZA 3PXXA 2JAHA 3DTYA 5T57A 4Y6RA 2IRWA 3GUCA 3I5MA 4BNTA 2VUTA 1N7HA 1EDOA 3OECA 4L0QA 1Q2XA 3C1TA 4EJMA 3EUWA 3OJFA 4E5NA 4NK4A 5C7LO 1YL6A 3VH2A 1DIBA 4IJKA 5K6AC 3MEQA 2PGJA 3ROKA 3KETA 1IL0A 4F45A 3CMCO 2NADA 4J91A 5DBGA 1HT0A 4JGBA 3Q1LA 3FBTA 2CDAA 1X7HA 5G4KA 2NTVA 1O94A 5FEUA 5TC4A 4I5DA 4IBOA 5BNTA 2ZB3A 3PQEA 4CODB 4F3YA 1EZ4A 2B0JA 3HADA 3JQAA 2I67A 5JE8A 1Z45A 3VPSA 2Q1TA 1Q0LA 1M76A 2VWGA 3TOZA 2VCYA 5JAMA 3MOIA 4BNYA 2EGHA 5JLAA 3WR5A 4XB2A 4RJTA 1ZK4A 2EV9A 3NAQA 3EMKA 3STHA 1YL7A 3QVTA 3WYEA 2O7SA 4IXWA 5IJZA 4RQTA 5C7OO 2ET6A 2GN8A 2O3JA 4BV8A 4H15A 5FI5A 3V2GA 4YBZA 1U2DA 3HFSA 3OEWA 5I9MA 2NU7A 1T1RA 3E03A 4H3VA 3L07A 3GVIA 4AJHA 5C5IA 4WK6A 1Y81A 3DBHA 4WKGA 3RI3A 4BKPA 1H2HA 1M67A 2CDBA 2JL1A 3OJOA 1BW9B 3ZWVA 4BNZA 1O8CA 3DZHA 3RC9A 4F46A 2NVUB 5EESA 4U0KA 2QQ5A 4FFMA 2PR2A 4YVFA 2NQ8A 2PZMA 3AW9A 1Q7BA 1EVJA 3GGOA 3NT5A 4X54A 5CDYA 1G6KA 2DPHA 3E6AA 3VKUA 4OM8A 1GL3A 4BGEA 2GD1O 1UDBA 1PQPA 2QHXA 2ZB4A 7ADHA 4P4GA 1EBFA 3ZN2A 1AN9A 2PA3A 1WWKA 4PLWA 3TFQA 1I33A 2DC1A 1ENPA 4JNKA 3RD5A 3KM0A 1N5DA 3RFXA 1SBYA 2VT3A 1H9BA 4PLPA 3L0DA 1HZJA 4N18A 2NVWA 4KUGA 4DREA 2X4GA 3WMXA 5FYDA 3RWBA 1SMKA 4EZBA 3RC2A 1NQ5A 1WNTA 3P7MA 2XXJA 3R3SA 3H4VA 1PS0A 3PI7A 4GGPA 4PCVA 2HMUA 4R1NA 4EUFA 1DIAA 2I66A 3F5SA 2Q46A 4TZTA 2UDPA 1A5ZA 2Y99A 5JYEA 3BXXA 4JCOA 3DOOA 4GAEA 4E3ZA 2GERA 1IB6A 3JQ8A 1DIHA 2X0IA 3GEMA 3A1NA 1UXGA 4MVJH 4DPMA 1ZMOA 5HA5A 3PPIA 5ITVA 3HE3A 1YO6A 3I23A 3DOJA 1UXHA 3BHIA 2OXIA 3KLMX 2DT5A 1IYZA 3ZW8A 4B7XA 3JSAA 5L7TA 2Q1WA 4ND1A 4E33A 4OOEA 1SEPA 1UUFA 4FJ1A 3IQDB 3GC6A 5IZCC 4GKBA 4ND2A 1PJQA 4YJFA 3W8FA 5L45A 2VZ0A 2PKQO 3ZWWA 1IHYA 3B1JA 3PVZA 1UP4A 2JD0A 4NBUA 1KC3A 3ZWBA 4M1QA 1EUDA 5T67A 1DAPA 1XU9A 4XCVA 1Q0QA 2VTEA 1LDNA 3U0BA 2FPGA 1HYGA 2Q99A 1MB4A 2JAPA 3BIOA 4CQMB 3DMYA 3FPLA 5KVSA 2P2SA 1XQ6A 3S2EA 2YFQA 4CJXA 3QE3A 2BH9A 3ZWNA 3GN1A 3VZPA 4NBVA 1E7MA 2NQTA 4JXKA 3WNQA 9LDTA 2NM0A 3DQPA 1I5RA 2OGUA 4IINA 1GD1O 4FFPA 4NJMB 5KIAA 3AJRA 4EJ0A 1TI7A 3HZZA 4MVJA 3FRJA 2IODA 1P31A 4TVOA 2C5EA 3K96A 1WDKA 1B8UA 2E48A 4J4BA 3ZZNA 2SCUA 5T6BA 4B4VA 3LSYA 1HLPA 4NBWA 3ZU2A 1PEDA 4L76A 1S7CA 3UF0A 2Y67A 3V2HA 5JW6A 2Z1MA 3AU8A 5JDCA 4GVXA 2VHXA 2JHGA 4YJDA 1NQTA 1WLYA 3OFSA 3GFBA 5KTKA 1QYDA 4IGEA 4Z0HO 1E6UA 4YQZA 4DWVA 3AI1A 1ZXLA 3RROA 1C0KA 4WNCA 1N1EA 3UXYA 9LDBA 1VI2A 2G0TA 2W2LA 3QWFA 3WBBA 3BMQA 3GDOA 5DBIA 3HFGA 4J1QA 3LLVA 1IZ9A 4BGUA 4AJNA 5DOVA 4YACA 1ADBA 3R0IA 2HMVA 2D0IA 4D3FA 3RUDA 1LLDA 1H93A 2G76A 4MP6A 4B7CA 4MVJI 1PR9A 2D5CA 5EJ2A 4PLVA 1VKNA 3D3WA 4PZCA 4XYMA 4RV9A 3S55A 4U5QA 5COBA 4R51A 3PZRA 4J1TA 4YWJA 2HSDA 2LDXA 1YBMA 2DBQA 1J49A 3HDHA 3K2EA 5IN4A 3GA0A 4OKNA 3RBVA 3TL3A 1MC5A 1YOVA 3ZU4A 2AXQA 4MJLA 4Q3EA 1I3NA 2JFFA 2WEKA 1HL3A 1HRDA 4JBGA 4AFNA 1YDWA 1FXSA 3H5AA 4ITUA 5DCWA 3MJCA 1PL7A 2B5WA 2W2KB 2FR0A 2C82A 3DZKA 3PP8A 4OOFA 3DZIA 2X23A 5L53A 5A5EA 1PJ3A 2FN7A 1BSVA 1VJTA 4PLYA 2C2YA 4YB8A 1WZIA 4BKRA 1ZK1A 4DUPA 5A9RA 3PJDA 4DPKA 1GCUA 4FSHA 4WLFA 4CMKA 1V0JA 4PG5A 4PLGA 4HV4A 1BWSA 3D5TA
chains in the Genus database with same CATH superfamily
2ZRDA 1SM4A 3F49S 3LWBA 5A6SB 3TLGB 2EGGA 1JSCA 1X94A 4RVSA 2FW1A 3HKEB 4OMCA 4X7BA 4ND3A 2OYCA 2WD8A 1DX9A 1NPDA 2WTMA 2PMWB 3VPAA 5CD9A 3N2GA 3A9UA 4BX9A 3ICQB 2J5BA 2O1WA 1LDMA 3EVNA 2ZRPA 1XX6A 4IILA 2XEDA 3SZOA 1M8KA 5FLKA 4R8VA 3EXFB 4XWAA 3VH1A 2OPHA 1SCNE 4LAFA 1BMFA 1C50A 2NLOA 2QP4A 4JLWA 3V8QA 2Z08A 3M34A 3KK0A 4JB3A 1I2CA 2BEUA 4UPVA 3HGMA 2YIMA 4XARA 3C3BA 3WLAA 1ZO8A 4LQCA 2YRXA 2V0GA 3EYWA 2D06A 1L4NA 2JRLA 3EBOA 3OTHA 5D01A 4H7PA 5SZKB 1JLHA 2HSGA 3TGPA 4PLCA 1QC5B 2V7PA 3D5QA 4JBHA 5A3JA 1ZJWA 5BUCA 5EMHA 4GKAA 4FYPA 5E4YA 5F51A 4EUSA 1FIUA 1VCNA 1RWMA 3HCNA 3OLVA 2ORIA 3PCTA 4XWYA 4IXDA 2ZR8A 5HOEA 3HVRA 4L4ZA 4RIIA 1P1RA 4CMAA 1RLOA 1YRHA 3C15C 3RSQA 1LNQA 1Y34E 5LWHA 3WO1A 4G24A 3PUXA 1YCFA 4GWKA 1Q74A 4R9VA 3WX0A 4BLWA 2GF9A 2V6FA 4TS3A 2CF5A 1KYTA 2Q2VA 1NSTA 3IRUA 4M86A 1AQLA 5BMVA 5M04A 1PCXA 3QTBA 5JNUA 2GEUA 1Z35A 2MSCB 2PZKA 4H18A 1NVBA 5CIYA 5AHOA 2XVAA 2VRWA 1Y4UA 4HMOA 2WTNA 2ZJ4A 3PHGA 3RSSA 4US2R 4R9NA 1AKUA 2ZJYA 2ZSDA 4L85A 1UBLS 5TMPA 3PGXA 1ACMA 4K9DA 4LMBA 4HN4B 2C9ZA 1R4MB 2A5JA 4Q12A 4UZEA 5A0FA 1VZ2A 4AIRA 1CUGA 1CUSA 2E4YA 2HA2A 4TV8B 5HYVA 2C83A 2G9RA 1ORIA 3BRQA 1ZCBA 1QH1B 1XEWX 2Y1EA 1XYGA 2Q28A 3ZDZB 2C97A 3AESB 2QLNA 3Q0TA 2QUIA 2YMMA 4MKIA 5T4BA 1GZ3A 4B84A 2QAGA 1LXCA 2ZWAA 3HYNA 4EATA 3PUWA 2UYGA 2DTXA 2V8BA 1DBSA 4JI7B 1C9NA 2XKAA 3BHJA 4IOMA 4ALKA 4I2NA 1CQIB 2PJDA 4Q18A 4F4IA 2IBSA 2EDCA 2LWIA 1D6NA 5KCMA 1CB0A 3NANA 1NKSA 2JDIA 3K94A 1EXWA 3KZVA 3WRXC 2BEJA 1NKVA 2YXEA 3AF0A 3D2LA 1U80A 4FVTA 2ZRQA 4LRUA 1IQ0A 2Z9DA 4O2BA 1WKCA 2FQYA 4JMPA 4CM5A 2O8DA 1N2HA 3JZAA 4AT1A 1SHTX 3AESA 4DV5B 1IOWA 1OI2A 1WIWA 2H9YA 3HO8A 4L7VA 4DLTA 4V0ME 3M1YA 4IP0A 4DB2A 1CYDA 3OT1A 4HG2A 1MB3A 2Y27A 3WZLA 1O7JA 2OP1A 2ZSBA 2AMJA 2IU3A 1XP8A 3RJTA 4Q9IA 2EKPA 2K7ZA 5TEWA 2IQ5A 2AN4A 2H6EA 4LE1A 2PLNA 1EK0A 2ODEA 2JLZA 1B8PA 2AI2A 5K8UA 4F92B 4MNTA 2G83A 1NPTO 1MEJA 2J07A 1K08A 1CF2O 5DHAA 3FOBA 4QUEA 4RKFA 2DJIA 3KQVA 5FT9A 1UXJA 5K6TA 3K0SA 4M0MA 4TLAA 4DXHA 5EE5B 3OC0A 2FHPA 4QFMA 1NXTA 4MCIA 4V1CB 4YGXB 1JECA 2X5NA 4HDCA 3I39X 5CYPA 6ABPA 1RJEA 3FLAA 1LS1A 2H4ZA 3KO8A 5REQB 4CV1A 4OH1A 1BDIA 1JMVA 2QPOA 2V6GA 4BX0A 2G0AA 3WL4A 1TTPB 3P5SA 3M4NA 4N65A 4ZCRA 3GDFA 4AMVA 1TXGA 3IV6A 4C2BA 1U3TA 1KK3A 3D8HA 4JLKA 1CJMA 1F8GA 3NAMA 4MQFA 5EFOA 2I9KA 3FSGD 5TMDA 5L9AA 2VZ8A 5BT8A 2YINC 4W5JA 3W4JA 2O5EA 2A5GA 2AHRA 1WABA 5B1EA 4PONA 1MPTA 1EX9A 4CU2A 4EHBA 2R87A 4MCAA 2EKBA 2PMBA 3H2JA 5HE9A 1XPJA 2QI9F 4HF7A 3WSTA 4DBLE 3H9GA 3FDFA 1H5UA 4EJ2A 1Y5LA 4B0OA 1TYEB 1TCVA 5CYGA 1CV2A 2IOQA 2G70A 3AGPA 3EVGA 4GBED 4P0QB 2HBQA 1J8VA 4XR9A 3QEMA 1K6EA 1U7UA 2R68A 1SK9A 4R68A 1LZLA 3N74A 1PFQA 2Z5LA 3TOCA 1WXHA 5F1OA 1PU2A 1LF5A 1UFQA 1NOKA 1XMPA 1USKA 2B3TA 2WJGA 4ZOBA 2KPOA 5DTMA 4C6TB 5HKOA 3E8SA 1CFJA 4RJ2A 3UKJA 1BXKA 3HKEA 3RO7A 3ZWKA 4I1OA 4NV0A 2CCGA 1HDXA 3ONDA 4FFSA 1GT91 1S3GA 3FROA 5JDIC 1JSRA 2V6IA 2YZKA 2EQAA 3USZA 3CQ9A 4ZOLB 2VUSA 2ZYUX 2GSDA 1SVLA 4XGQA 2JFVA 2LNDA 3BAZA 3ASUA 2FPIB 5C4IA 4D42A 3KKKA 3L4BC 4LC1A 2H9IA 3S44A 1A9QA 4KQ6A 1PWHA 2PJUA 3LPLA 3NHPA 1LI4A 2B0CA 3IMEA 3WLMA 2IXGA 1URPA 1YS7A 3MYYA 3DBRB 4KYVA 2GYVA 1G16A 2R4UA 3OAAD 4Q05A 4F2DA 4MUMA 5DLPA 4DLPA 4PX9A 3IE1A 3WGGA 2PZBA 2CXTA 1QE3A 2P9CA 2VSQA 4HPWA 2J3KA 4DV1B 5IKOA 4BEBA 5H4GA 3QXJA 1D2HA 3UGKA 1U7PA 3JU3A 1BAPA 3T8YA 3KKQA 4JH0A 3O1JC 1V1RA 3FD8A 2IYYA 1OU0A 3UK6A 1BS9A 5JHHB 4QQFA 1AC5A 1SU4A 5K8LA 2XKKA 1I30A 3HJTA 4JBIA 1BXGB 5DXJA 1MA0A 2OHGA 4BFSA 3VMMA 4MP8A 4ARCA 3EZ7A 3BJEA 1MRZA 4Q3LA 5JZVA 1OWNA 1FRQA 3EVTA 4ON9A 3CEHA 1VYHA 1X3SA 2F1KA 2D2FA 1E1DA 2NVBA 2W0MA 2GRAA 1C0EA 2PMFA 4UHKA 4Y6QA 4D80A 2I1VB 4UHCA 3O8BA 1SJ9A 2Q5OA 2FLKA 3A3NA 5HG0A 4CN9A 2MHCA 2PWZA 2B61A 1XDBA 4TTIA 4CKEB 4WLOA 4JS0A 4I8DA 3KVNA 5T41A 3ICPA 3BMQB 4JWKA 5ALIA 2QYOA 1CR1A 2ZYHA 3CLTD 3RBZA 4G0VA 5IF9A 4A92A 3PPVA 1PFWA 2JS7A 4QBKA 3SS9X 1XNRB 4LGMA 5CDFA 3SIRA 7ABPA 5FNVB 2H1WA 3PRYA 5I7FA 2FQ1A 3KC2A 4AS2A 3GYGA 3EZFA 1YZTA 4YUVA 1M6VB 1B6RA 2ZBVA 3QQ5A 1QYIA 3AG6A 1CX9B 1RLUA 3B51X 3LQRA 3RKUA 3F3KA 5DNAA 2V7TA 2NU9B 2PVPA 3VKWA 1VSUA 2AVDA 1IM8A 5IAEA 3CKYA 2C94A 4NG4A 4B3TB 3SZGA 3N59A 5DM2A 5EZYB 3IMCA 3C3AA 3F7NA 1EA5A 2Z2KA 3C5WP 3JQBC 3S4YA 4G07A 3V7UA 3DO8A 3L0OA 4W5OA 5LXTB 5FPPA 3QX8A 3IHLA 2C54A 5IYZA 5AVYA 1F1BA 1V96A 4LGCA 4B6OA 1L7OA 2NYVA 3GN2A 2Y1CA 1EGVB 2LXNA 1JTEA 3PSAA 3NDBB 4GI2A 1XXLA 3TR6A 1UBSB 1CEXA 1V9SA 2JJ1A 3PLRA 3A31A 4IZIA 1PGPA 2PLAA 3LX4A 4Q1DA 3U1VA 5CAEB 4AP6A 3T6KA 4QQKA 4N01A 4MUGA 1AJEA 1R4NB 2AR9A 5EVJA 3EIFA 1PD0A 1RPNA 1E1QD 1UXIA 2FZGA 3U17A 1CZUA 4DEYA 5HFNA 5HCNA 5EGNA 3RABA 5LZ7A 3WAGA 1GRVA 1K7SN 2MU1A 4ARZA 1PX2A 5IMBA 3DC7A 4OFBA 2OHJA 4R1TA 4HDRB 4A0QA 4YUXA 1CXZA 4PNZA 1EE2A 3JY6A 4ROTA 3EZ6A 3FMVA 5ALUA 3TDMA 4P3PA 4B3MB 2G09A 3NRJA 4XPZA 1VI5A 4URUR 1O96B 4I55B 4MQUA 5GPBA 1DJQA 3QVJA 4LJ9A 1NFFA 1TZKA 2YUTA 4Q7MB 2X7XA 4LE0A 1KOFA 1C1DA 3SLGA 1Y7TA 3USCS 1XMJA 3MG9A 5HIIA 1WPRA 3O4FA 5B3AA 4IMPA 1VMAA 2BZ0A 5EPEA 5CUQA 1F4VA 4QUKA 1TYAE 3T12A 1P7CA 3RUAA 3ZV4A 4DZZA 2JI7A 3MJFA 4JAVC 5I9IA 1EE9A 2GLXA 5IDYA 1QB8A 4MVJF 1GPH1 2GAJA 4BZWA 2VAVA 3RQSA 1P17A 3P0JA 4QDXA 1G2IA 4FHCA 4Y1RA 5KNCA 2AXPA 1G20A 3PK0A 2TMKA 1F0PA 1Z33A 4H0CA 3WQSB 4EM6A 2RK4A 4IIDA 2OGWA 4MR9B 3LA6A 3WG9A 1OMOA 1JXQA 3EYAA 5LYJB 1BMTA 1R7RA 4DSOA 3TOVA 3DYBA 4NFHA 2VQ3A 3M6MD 5A04A 4HNSA 1A4UA 3MLBA 2YYZA 2FUG1 3ENQA 4DRXA 4LCEA 4BO1A 2WJ4A 4AZ0B 1DRWA 1JR3D 1Q83A 2VEOA 4OPMA 4RLHA 4ZTBA 2VL7A 3VZSA 1VIMA 2AK2A 4NL4H 3KOXA 3MRSA 2C20A 1JKIA 2P41A 2Z2YA 4OA5A 4OM7A 2J41A 2VDUE 2UYYA 3T9BA 1BD3A 2W37A 4D9CA 5J5VA 1J2UA 3EF3A 1GL6A 2WTUA 1GZ7A 1L5VA 3KL4A 5AW7A 4BXOA 2Q8NA 3KUCA 1N6KA 4UAJA 4JC8A 3GFOA 1W4BA 3V4FA 4AYTA 1M2JA 4BJ3A 2AZDA 1H6BA 3NDRA 3W9UA 1VYUA 4LC0A 1JBQA 3U2QA 4EKEA 1KZGB 1UWCA 1ID1A 1SNYA 2NUPA 2QAJA 3IAM1 3ROZA 3I45A 1KETA 2H17A 3QF4B 4G1MB 3D8NA 2Y8EA 4LDAA 2QX8A 3WWCA 1KZ6A 1N0HA 5IABA 3KNZA 2RONA 1AQJA 4KQJA 4UUPA 4ZANA 4HB3A 4BVAA 4A5SA 4JNCA 3WYBA 5JCJD 3B1KA 3YASA 4N47A 3BF8A 1V8FA 4OUDB 4HN9A 2EJBA 4DCPA 1OWPA 2BI7A 2ZVDA 3AKEA 2DWQA 1M73E 2WKRA 2E6KA 2WMOB 2OV3A 1TECE 1GNVA 3I3OA 4E5YA 4HADA 3IDQA 4D4JA 2VC2B 5AW8A 3BUSA 4EUHA 1J7JA 2JD1A 4PLHA 4MLCA 4M9QA 3E8MA 3FCOA 1AGRA 1MVNA 1UK9A 2ODTX 3G5UA 2XWPA 3ZZ1A 4HYQA 1ABBA 3BH7A 3DHVA 2XB6A 2HF9A 1HDEA 3UT5A 5DSXA 2VUIB 3RVPA 2J5QA 4ZQGA 3RUIA 3BQNB 4CIAA 1E99A 4PC7A 3V9PA 3ESQA 3V4SA 3WP0A 1C7JA 1UKAA 2W4QA 2ZQYA 3G2MA 3NMUF 2QL9A 4R2JA 3QJ5A 4P3KA 1Y89A 2P9ZA 3M0EA 4DF3A 3EZYA 1TE2A 2YASA 4A9AA 4M37A 2TSYB 2EQBA 4I46A 1HA3A 2YVLA 4X1IB 4KXWA 4BNDA 3P2YA 1ZRMA 3T3OA 1FLDA 3GDHA 4KNWA 4P8RA 4Y0NA 3T4EA 3N39C 4PZLA 3OIWA 1YFKA 3A9VA 1ZGHA 3DVRX 2RKBA 1MTOA 4D0NA 4O3MA 3JYNA 4UXIA 4FN5A 2W93A 2XVMA 4ZEMA 4S05A 7REQA 1YA6A 3BKWA 4CUKA 1TVEA 3CNHA 3FYDA 3ME5A 1UT5A 1JSXA 2ZTHA 3L0ZA 1YA8A 3E2PA 3JV7A 4DN6A 1QIEA 4BBPA 1GTG1 2K7FA 2WAYA 1F8UA 2HPZA 1DX6A 1DAIA 3LIIA 4MWEA 4OB7A 3ZNNA 3CJRA 4ENTA 1RC0A 3WGHA 4QC2A 3B6IA 3FPFA 4G84A 3T54A 4J49A 3N8NA 5LKRA 5IVKA 2AFRA 3OE5A 3E58A 5A7FA 3P0EA 3TUIC 4BS9A 1OC2A 1QZXA 2YXBA 2O7NA 3KFVA 4FGZA 4S0ZA 4D26A 2P62A 3JYQA 4AKSA 3DTTA 3UJ3X 4JVSB 4IKPA 2BGTA 5FHQA 1LK5A 5FYQA 3RC1A 3ND7A 3HSKA 1UPTA 4ESHA 2QK4A 1G5PA 5B2EA 1XP5A 3X1JA 1CUIA 2RCYA 4BX2A 4N41A 4BGIA 4ND6A 1W19A 4ZVLA 2W4IA 4L6IA 1SUSA 3LTNC 3Q4GA 5LB2A 3AM3A 1W5TA 3N75A 4S12A 1QR6A 4YDRA 3ETJA 4YQYA 2BN4A 2JHFA 4JC4A 5LDDC 4D25A 3WDSA 3DQQA 1P9OA 3CNBA 3HR8A 3ADDA 2RHCA 1U3CA 2GM3A 5JSFA 3LX8A 4J0HA 5YASA 4M8SA 1U0BB 3UWOA 2FV8A 3LZDA 3NPMA 4IHJF 1KYYA 8ADHA 1L8OA 5IAKA 4C4XA 1XVVA 4DIOA 4YEDA 1NQWA 3GGCA 3DHWC 5ANRB 3KPYA 1GPAA 4JLDA 1YI0A 5JY1A 4AQYB 4CF7A 5JYDA 3FIJA 1Z82A 2NYUA 2PZGA 3AR7A 3OZEA 1N8KA 2OM6A 4ZO7A 2BKEA 3SF8A 4UDNA 1ST2A 3PC3A 1PRYA 5TDHA 2J3EA 1UKYA 2DM6A 4MROA 5LP1A 4YMWA 5LWQA 1DC3A 2LZ0A 3C85A 2X5KO 5KTRA 1QMPA 1QIJA 4X7RA 1U65A 1HKUA 1RI4A 5KKAA 4DDMA 4MP3A 4EUEA 1GADO 3H7IA 5U9CA 3U4QB 1YBFA 2WSLA 3BXOA 5SV2A 1MG5A 2X9QA 2GJKA 2XDQB 1UZAA 1WKVA 3EA0A 3H65A 4JLPA 3SFTA 4E5MA 4TYNA 4XGRA 1N7GA 3I34X 5BSRA 1T36B 1FTGA 2F3RA 2I6QA 3W6PA 4UREA 1FFAA 8AT1A 4GX5A 4BO2A 4PG8A 4MH0R 1IN5A 2WTEA 2QYSA 4FKZA 1OYOA 3I01M 5JADA 2IP4A 2VHWA 1VGRA 2C7PA 3DVLA 4N49A 4WSOA 4ONEA 3ZV3A 5IZ4A 3D31A 4EO9A 1JJ7A 1O8BA 4II3A 4TVSA 1ACJA 1U7HA 1G21E 3JVVA 2FG7C 4IPTA 3HP1A 3L0CA 4DBLC 3W5BA 2MT9A 3ANLA 3W5IA 2Y1DA 3KL2A 4EHJA 2CFSA 3K1AA 4M53A 3ZK9A 4U4AA 1RABA 1JLRA 1XMSA 1QVVA 4EG3A 4MV6A 3VO2A 4HHEA 5KWJA 1T6BY 4Y1EA 3B13B 4LHWA 1XJWA 3T5DA 2I2BA 1KWKA 2R5NA 2ZJFA 5IVIA 2VBGA 3IJ5A 4WVLA 3QPVA 2FUEA 4UQLA 4J2TA 3WLOA 1OVGA 2RMKA 3BYZA 3GAAA 2SKEA 3M6VA 4NJEB 4YHBA 3WE7A 4R2MA 3ZHBA 5TGDA 3LNTA 1X1EA 1Y8RA 4MX8A 1ABEA 1GTL1 3IGFA 2VSFA 4UOQA 3RS3A 4Y1FA 1HQDA 3LH5A 2ONCA 1MX1A 3AIIA 1L7XA 4KBYA 2I4TA 2WUGA 5BSKA 2PX8A 1KHHA 2Z1DA 3T9CA 1POWA 5DGTA 3DE7X 2WILA 3D0RA 4ZC1A 2JAXA 4FOLA 4CM4A 3S1AA 2X9VA 3SEZA 4B3IA 4IDCA 4NE9A 1KARA 4UUAA 4EY4A 2GCGA 2Q4BA 1NVEA 2YVUA 3EXAA 4FR5A 1KERA 4ZU3A 5CK5A 2ONJA 1CPYA 3GJ0A 4J07A 3FUWA 4GIBA 5HQ3A 3VPXA 3WISA 4YI3A 2WHPA 4FD2A 1W4ZA 1XVTA 4KK4A 3KQSA 4EPVA 1FUIA 3FHJA 3TIVA 1TD1A 2IHVA 3ABZA 2WJYA 1NVKA 1UBGA 2P4EA 4YHHB 2C99A 2PH1A 4W9MC 1NXVA 3AI2A 2PNJA 1ORWA 4C0JA 3Q40A 3N2YA 1G2PA 4X93A 1ZSNA 3U37A 1M2HA 3OZFA 3L05A 1FQWA 1YZUA 3IXMA 3ODPA 3GLUA 1C3VA 1XHLA 2G28A 4LZZA 2EFCB 3IBFA 4FOOA 5J4KA 1X9IA 4OH7A 2Y0CA 3JRXA 3NDJA 3DLAA 4X0EA 4YCNA 4JOSA 1KJWA 1V48A 1LKZA 3EIHA 3SZRA 5L51A 1MQAA 2X4IA 3RS8A 3GJXC 1NNUA 4EF6A 1V11B 3IT2A 3WIOA 3L8YA 1YBHA 2IGBA 4FNMA 4UW9A 1KI3A 1RADA 2NNWB 1AOXA 1N2CB 3AUUA 3O6VA 4XDZA 4BMDA 3GQVA 2D4AA 4C0HA 3KSMA 1YS4A 2FPXA 3H9EO 1D4AA 2QUKA 1E1CA 2QRZA 2WP0A 1ZNXA 1NP3A 2R8PA 3V33A 1WXEA 4TQ9A 1H1TA 1W5BA 4W82A 4PC3A 2QA5A 2W2LD 4RVDA 3BE5A 2C4KA 1J42A 5KNDH 4FDUA 3JQFC 2UZAA 2UYHA 4J2HA 5LYJA 4NOLA 3IDZA 1UANA 4CM8B 3D8BA 4O4IF 4BFYA 2R6HA 5HW0A 5KTOA 5CVCA 1YKGA 5F21A 3CUYA 1EVKA 2XMGA 1D1SA 1F8XA 2GEJA 4IQ4A 4I5FA 4Q7JB 2I5PO 1PKXA 1V41E 3JQPA 4S2UA 1FSGA 3OWXA 1M1NB 5CVTA 4Q3CA 3REQB 2CJWA 3OQOA 2HWXA 3G2IA 4C5BA 3IT3A 1UPFA 4XIYA 3UQZA 2YWBA 2BGMA 3OD5A 1ZD9A 2H07A 3BD7A 3Q72A 4RY2A 5EYPB 4EMSA 3P8ZA 1U8XX 2P9BA 3MGGA 3PEVA 4RK1A 1UBCA 1POXA 4L6CA 1QIIA 1PK7A 4URFA 3R7BA 4I1SA 3VOBA 4EB6A 3W5UA 3GOQA 3BX1A 5KJFA 3EFOB 1NXSA 2I62A 2QLJA 2EHDA 2REQB 2W4MA 3AHCA 4GYKA 4MKXA 3TEJA 3EGWA 3V1NA 4NFLA 4UMFA 4EEXA 1K88A 1LGYA 3HB5X 3FUCA 1Y6RA 3EEBA 4IDQA 2HEIA 4G97A 1QYWA 4O4HA 4PSVA 3RW9A 4AY6A 2VSYA 3ZH2A 3LHIA 2Q0HA 2MYUA 5GONA 2B98A 3CZQA 2HK7A 4LZJA 4EAQA 3G02A 4JLOA 2B4YA 1P1FA 4LJKA 3FM9A 1MX3A 4Q7EA 2VHUA 4FW9A 4CV3A 1WPQA 2Z8XA 1JVNA 4S1WA 2HRBA 3RIEA 3WLSA 1NBHA 4TV9F 1IK4A 1UJBA 2WBLC 2BWJA 3C1OA 3K9HA 1NQAO 3V00A 3A27A 3RK4A 2RHWA 1M34B 3LY7A 1BN6A 4HNQA 3ZQKA 4LECA 3U0VA 4OL9A 2B25A 1WOMA 3VZQA 3EMBA 3Q2OA 5BORA 3KZKA 4J75A 4Q3DA 2VDNB 3OIYA 3TSYA 1NFRA 1R4AA 2FQWA 3HJHA 1I7NA 5C80A 1TO1E 3QY0A 1FTWA 4YMGA 3U56A 3QVXA 2QAGB 3Q9SA 2AD5A 2HF7A 1CTQA 2RHGB 1N0VC 4B7AA 2AN1A 3KPWA 2BGRA 2WNSA 3OMLA 1DU4A 4UUOA 1QUFA 2QQFA 4IJ6A 2PRZA 2ANBA 5IC5A 2P7HA 4DCCA 4E32A 5L4SA 3Q98A 3MMXA 1A3CA 3NP9A 4YCLA 1E2MA 1ZR2A 3TQRA 1GZ4A 5HHTA 3KVOA 4K2AA 1M2OA 2BR3A 4K6OA 1JKFA 9ATCA 3ZK8A 3MF4A 2ZQ5A 4JUIA 5EG5A 1TK2A 2R8YA 3B2NA 1VMIA 3OX3A 4R8SA 5T7BA 1Y8ZA 1F0KA 1L4UA 3JQFA 4DNQA 3MSXA 3WGJA 5GVRA 2JIDA 5ALKA 2PUCA 2B36A 2IJGX 4F85A 2KLBA 4GLBA 4F3CA 2HR1A 4X65B 3IVGA 1KH2A 1WCYA 1X9HA 1EVEA 4IHQA 2O8CB 2VLBA 1V3TA 3QF7A 3OF5A 4F2WA 4Z4QA 3SR3A 4CUZA 5D84A 5IC4A 3DDOA 4KYUA 5K51A 1CVLA 1KEPA 1IMJA 2QROA 2WHPB 3GCDA 2VF2A 2ZDGA 4N7RA 3SSNA 2AN5A 4A6DA 2P5YA 3L7KA 1NLMA 3BGDA 4UPDA 2EBUA 4BFLA 3E1KA 2HWYA 1Y9DA 1ODCA 1EP9A 3PEFA 4HRAA 3O3CA 3RPEA 3PBKA 2P6OA 1C9MA 2MJLA 3GVHA 1EFRA 3F5QA 3ONFA 2GASA 3ZJUA 3I5AA 5JT1A 2CKMA 1KZHA 2H4YA 2YC2C 2X0RA 1VCMA 1I51A 2GBGA 3K6SA 1EK5A 4CU5A 1QRRA 3IPYA 4Z3KA 5KQSA 3KCQA 4WEQA 4MTCA 4QXMA 4QYWA 5KOYA 3UMVA 1UJ4A 3KTAB 1RAHA 4XYLA 4LHYA 1T2CA 2G1AA 3A1WA 3V1TC 1QGOA 4ZFNA 1RHMA 4EKNB 5FBWB 3TD9A 4B6GA 2C2MA 1XHEA 1L7AA 1ZI8A 2JGDB 2OYSA 4QGSA 13PKA 1ZK2A 3ST7A 4GBJA 1D4OA 4BFUA 5K3AA 1AVTA 1JG6A 4YQEA 4WQMA 4LZPA 3NTLA 3QSYA 1MRNA 5CXSA 1DJMA 1SB8A 2DETA 1ILEA 2ZIZA 2WINI 521PA 2VH5R 1C0PA 1Y6ZA 2B8WA 4IHJA 4MI1A 4MUFA 4OQMA 2FW8A 4G3XA 4XTRA 5AHKA 2EFJA 3JWIA 1JE0A 2D0PB 4TSKA 1FSFA 4QG7A 1N5LA 3EY4A 2CFIA 1K7EB 1JA9A 2R66A 2MDTA 4GE0A 2FH5B 4QREA 1I3CA 1B23P 1XCBA 1HK7A 1EGQA 3L0PA 2SNIE 3BB3A 1MD9A 1VIYA 1R88A 3A6LA 1AQUA 3CJTA 3B9BA 4KRXA 2GEFA 2HRRA 2JFZA 4XFKA 4BFXA 4LK3A 1O97D 4FFDA 4XM0A 1DAEA 2O0MA 1DAKA 3BD8A 3QNMA 3PNPA 5EIEA 2D7DA 4EMTA 2CXHA 4MJXA 3R9KA 3DVQX 3E7PA 4GPTA 1OLXA 4O1HA 3KYBA 1WZEA 4DIMA 1WQ4A 4OGKA 2Q0QA 1B76A 1G8FA 1IM5A 2BEVB 5J1TB 1CERA 3IP9A 4EI9A 5BSFA 1TIBA 3PGLA 1VRWA 1T91A 2ZZKA 3CMMA 1J8FA 3K6KA 4ENWA 3UFXB 3ACBA 2QW1A 3C7AA 4DWOA 1F9EA 3OOJA 1CUBA 3ENWA 2J5KA 1XVUA 1BH2A 1II8B 5F5NA 4NNPA 4AWBA 3CKLA 3TMAA 1G1AA 1DELA 2PIAA 3E1SA 1E58A 2P6MA 4RJLA 2IITA 2YQ4A 1UC4B 2PYZA 2XEXA 1VKJA 3ABIA 1E2IA 1TPZA 2Q2NA 1GN9A 2QX9A 4ZI3A 2AN3A 4Y98A 1ZMTA 1AMOA 1K9VF 5M34A 2IDJA 4WOKA 3PWZA 2WJVA 4KDRA 3X1DA 4ER5A 5FV4A 4R16A 3ZE0B 3HCBA 2JHCA 1E9BA 2OXRA 2JANA 5J4YA 1H85A 3C45A 3F6EX 3RC3A 3HCWA 1J25A 1P9LA 4CF5A 1ESDA 3W2TA 5HS4A 1C1YA 2J0UB 3F3SA 2WWWA 5AVZA 2VJKA 1Z5ZA 5E6UA 4E21A 1NUTA 1OXBB 1U0NA 4BJ5A 4FFRA 1I2AA 3JQ9A 3QHPA 3RARA 5JFTA 3OLZA 2OB1A 2XNHA 2BC9A 1OFVA 1CJCA 2W0SA 4GM0A 3L4KA 1EX1A 4QTUB 3UBMA 4MZDA 1L5KA 2QSYA 4NE2A 3RF6A 4B3BA 3I6MA 3NBMA 3WFZA 1PDOA 4MGEA 5LP6A 2WZCA 1DKMA 3OX1A 4AJPA 3L06A 5CNIA 5A7HA 1X0VA 5COAA 2NT4A 4E5SA 1W36B 2DTEA 4N9WA 2R0QC 1DCTA 5IKPA 2MCFA 4D56A 4JYAB 4WTOA 1EHIA 4O2BB 1DWOA 3D43A 1EMDA 3A28A 3D8SA 3AM1A 2V7VA 1V3VA 3QWAA 4H16A 4PVDA 2BRUA 4E14A 4QXRA 1ULUA 3WDKA 2GZ1A 3RIXA 4BJ1A 4FI3F 2GVNA 2CYCA 1Q3TA 4E13A 3N70A 1VCOA 1E96A 3QH4A 1V37A 4TPKA 2JAQA 2OFOA 4X94A 2B4AA 3S2GA 1JXOA 3KQQA 2LV8A 4HFNA 3FSRA 5TPZA 3DAOA 2W90A 3R9XA 3AWDA 3VNQA 4U3JA 4U7FA 3L3BA 1YKFA 4QBFA 5E3JA 4YWHA 5KQLA 1Q6ZA 1GGKA 1V1MB 3SF0A 1DBRA 1L4BA 3TQCA 1SKYB 5IBQA 2PUFA 3B60A 3AY6A 1RAGA 2BMFA 3HJBA 3PC2A 3SEFA 3UXHA 4ARVA 4ARIA 1VKOA 4LXUA 2WAOA 1MV5A 1LJ8A 2H29A 3LOPA 1RAFA 2H1HA 2HDOA 1UDRA 4OAOA 4AKTA 3DL2A 3T9EA 2HAEA 4GZ5A 2Q45A 2R2GA 2PFKA 5CX4A 3S40A 4OLBA 1IDOA 4YLEA 4DANA 3UGQA 5BRNA 4ARSA 5JRDS 1U99A 4P81A 3R0QA 2A7QA 2Z8ZA 4KPUB 3EN0A 1U0FA 1FRNA 1YQDA 1ZN7A 2XB2A 4JIGA 1J39A 3QOFA 1Q12A 1G291 3USES 1LW6E 3IIIA 3FSGA 2PVCA 4YP9A 2BUAA 1PV4A 4B85A 3KOWA 4TKVB 3T9AA 3JW8A 3LBNA 3CR8A 1W6UA 4G1VA 4C7MA 5ITZB 3K15A 3GJTA 4OLJA 1SQ6A 4FONA 5FP0A 3OEEA 3ZBUA 4F9GA 3TG8A 1J0EA 1ND6A 3QKSA 4LBYA 2A58A 2XQKA 3SY8A 4GRAA 4RXTA 1AHPA 3UV6A 2EBHX 3SC2B 3UBTA 4LMPA 2VP3A 4NWIA 3H5WA 2AL7A 3EVZA 1XZNA 3SZMA 3WBFA 3BERA 2RGCA 2YS7A 3TNJA 1ZJZA 3E70C 5EWMB 1L8QA 2O2XA 1OI4A 2PV7A 2HHJA 2P3LA 3P19A 5A3VA 3WYFA 2Y77A 3L92A 5I7OA 4XGNA 4D5EA 4UHDA 1NG1A 4ZZ0A 3FPHA 2HCTA 4JT8A 4XE5A 2EIXA 5JJBA 1E9VA 4UNRA 3LUDA 4ZDKA 4EPXA 4AZSA 1L7PA 3DF9A 4KOAA 4QHTA 2REXB 2ZQZA 4UEKA 1AN0A 1C3OA 2P5UA 4OKSA 4HX2A 2OXFA 2BZSA 2ZUFA 1T9DA 1UOEA 4UCFA 4WZAA 3EC2A 2WM8A 1I9GA 1XAHA 3W6ZA 2Y1KA 1CUZA 3MCVA 4JOCA 3KAJA 4JD5A 2PHZA 2E4XA 3DZCA 3W8EA 1QGUB 1S2OA 2HLDD 4YCSA 2WFAA 4MVXA 1ZIDA 1HWYA 1VB3A 2X3YA 3MTDA 1YR1A 4H9GA 5K8CA 4HI0E 1A71A 1ZCFA 3PIRA 2XJ9A 5CVDA 1J4AA 4O4HF 4YN3A 3ZS9A 4CLDA 4X60A 1UKZA 2VYNA 3D6HA 3R7DA 1NASA 2A35A 3BFPA 1T2EA 1WW3A 3IYLW 3PNKA 3W1EA 3ZPXA 2BTOA 2FSGA 3OQVA 2A4KA 3AUSA 3WGTA 1ZZEA 2B78A 1SRQA 1UL1X 3V4RA 1E1NA 1O4WA 1VSBA 2QVLA 2R5WA 1XCMA 3QEMB 5JAIA 2D2EA 3CO5A 3TTUA 4G4SP 3PFKA 3HUTA 1RI5A 2GN6A 3ZJTA 3AW8A 4I4TF 4ER0A 4YAWA 3CVXA 1EX6A 3R0XA 1I7LA 9GPBA 3PX7A 1ODLA 5IT0A 3SSOA 1FK8A 1S3IA 1T2VA 1OBVA 2VT6A 2WG2A 5KSYA 2WF7A 3A11A 1X8JA 3NM6B 5EWLA 1UMBA 5AVWA 2OO5C 3IVXA 1M7GA 5MGNA 1Y4AE 4BLRA 3HUUA 1X80A 3NKLA 4JEUA 4ZQHA 2WR8A 5TQ2B 1GTJ1 3A4MA 4WKPA 2WYOA 4DCMA 1UJNA 7MHTA 4RX1A 2HBRA 5K6AA 4BO6A 4WXYB 4YCAA 5F9HA 5TB5A 4YP7A 4LJ7A 2Q5JA 2VQFB 5AJHA 4ARAA 4Y2XA 5DGCA 1U9JA 3SBDA 1K0UA 2GETA 2JIPA 1Z4NA 5E1MA 2CLCX 1WDLA 3DVSX 4ZT3A 3TX6A 5CVUA 3K9BA 4Q9AA 4B5LA 2Q9CA 4O2LA 4Z4CA 4KP7A 2RHBA 1SGWA 1ZCAA 4BVKA 4D0GA 1E7YA 1QQ5A 3KX2A 1JJAA 4K6FA 3UJ8A 1OV6A 1G8KA 2QJRA 4KSCA 4AAYA 1ZMRA 3L6DA 3VUEA 2F43B 1M75A 1KYVA 1PJBA 2VF8A 3UHPA 1MF7A 3L7IA 4BO4A 4DJFC 3GGSA 3NBYC 1ECLA 4FB5A 2X22A 3A9TA 4QEZA 1JPJA 1N6PA 3K6RA 4HP8A 4KYTA 4RL4A 1ZOOA 5BW8A 2X1MA 1Y82A 3LT5A 1U2EA 1R66A 1ZM3A 1DG1G 3BIJA 3OSZA 2HEGA 4JLJA 1QTQA 2G5TA 2A9PA 3CIOA 1GZUA 4LPKA 3F3YA 4UKDA 1AK2A 3DLPX 1A8QA 3KS9A 2IIBA 4KO4S 3EVDA 3E9MA 3JZMA 5LJLA 3ER8A 2SCUB 1PK8A 3A26A 3CG4A 3IVCA 5IW8A 1HTWA 3MIZA 2PKCA 5D5QA 4DDKA 4QAQA 4TXMA 3UFBA 2E5FA 1CR4A 1G4HA 1UM9A 2EOAA 3DE4X 4E2XA 1O95A 4Z9AA 2OKGA 3C6ZA 2H08A 1CUXA 2GPWA 3PRJA 5AW1A 1BIFA 1YRWA 2BKUA 4MIOA 4YAIA 3PJRA 3ICEA 1YVEI 1FNBA 1I10A 1DDOA 2VPXA 1Y63A 5AQEA 3W5DA 3M7IA 3DKPA 5C32A 5AW3A 1RYHA 2WHQA 2X9LA 3NUQA 1MEEA 1QG0A 1S8AA 4G9BA 2AX3A 3QE0A 5JI3E 1O94D 4EB3A 2C03A 4ZYVA 4M0KA 2O23A 3UNXA 2WDZA 3IUEA 4BNUA 2HLHA 3PGKA 1OWLA 2PQ6A 4Q4DA 4X6YA 2OY0A 1CETA 4JI6B 3H0CA 4PG6A 2ZJAA 4M4SA 4FCVA 3IEPA 3T3DA 3OLQA 4PHTA 5DYNA 1FYWA 5CM9C 3UV7A 2G7ZA 3FDJA 1T9GR 2I6FA 1XRQA 3AP1A 3F96A 3ELYA 4INAA 4PSKA 4LFCB 1QIKA 1ZWLA 1M2VA 1XU7A 3V7WA 1M0SA 5I7HA 5KTSA 5JWRA 4G0NA 1OBFO 4IG9A 5DYTA 4RKWA 3FPAA 1SZJG 2MMGA 2YY7A 5CCBA 1GZDA 1I4OA 2A94A 4Z7OB 2J6BA 4U7WA 3VPCA 3RVMA 2H7CA 2OBNA 2HCBA 2RGAA 3DO6A 3IIJA 3NHKA 4H1TA 4LRQA 4XH9B 3RE1A 3X2EA 2DKOA 3ABSB 4R98A 1M33A 1DNPA 4JI8B 3TAHA 3HRHA 4RADA 4J1SA 4UM7A 1T8TA 4O33A 1DIOB 3H2ZA 4RCYA 5THKA 4CM4B 2DWCA 3JQ8B 4RMIA 4PQGA 1NRXA 4XW2A 5D3KA 1E9AA 3U49A 5K05A 1QRAA 3FFXA 3DDNA 2D1FA 4KXNA 5G0SA 5KDLA 4BJHB 4BUCA 4EENA 5ADUS 2W6CX 1X3LA 4KPGA 4AWAA 1GRQA 3IEMA 3RC8A 3DC2A 4RANA 2KHZA 4YT4A 3DCIA 3EASA 3U7QA 4BV3A 2FQQA 3GPDG 1XU4A 1Q1NA 3SC4A 3DR3A 3MQ4A 3BD6A 5FFMA 3INTA 3PNVA 1XFDA 4BZQA 3OWHA 2Y0DA 3ZOZA 4I1PA 2JNWA 3EFEA 4TOIA 4W8GA 3K2IA 3EXFA 3J81k 4GZLA 1MXFA 4MWCA 4BTVA 1TZ2A 1PGNA 3MOSA 3O3OB 4QPCA 4L8WB 3VR2D 2FNAA 3IA2A 3PJGA 4FGLA 4ZT2A 4LRTB 2QVGA 1D1TA 5E3HA 5C2JB 5JD3A 2ZE5A 4B87A 2D7CA 4JJ7A 3E9RA 2YW9A 4RS3A 4JKYA 4YR7A 2OHFA 3E61A 1PVDA 3VJLA 4BVHA 4Y0AA 4IDOA 5KDDA 4FTWA 3QPDA 5FA6A 4BX3A 3RJZA 3I4FA 5U1PA 4BP1A 3UVEA 5KWSA 3K4QA 3WZ2A 2HWWA 5AJUA 3J81A 2Y05A 1QIGA 1EGHA 2VI5A 3HCEA 2REOA 2G25A 5AVXA 3OU7A 1IJBA 5K0JA 4HUQB 2JIBA 4U39A 2VS1A 1QK5A 3FCAA 3ZWOA 4F5DA 2ZB7A 2DCUA 1ZH8A 5EUBA 2OOSA 2ZYAA 4KFRA 4FKMA 5AKKA 1H0HA 5IAOA 3TM4A 2W2KA 1KF0A 1UJ2A 4UEJA 3CUEF 1GRRA 1ZJJA 1ZSVA 2A2ZA 2ZYSA 4J0KA 4P4NA 1Y3FE 2Y66A 3RH0A 1LSJA 1HG0A 1Q6YA 2IXDA 3A1UA 4OBEA 4S1VA 1G5IA 2JCVA 1QH8B 4U9UA 5LBUA 3DTVB 4ZEWA 4COKA 1IU9A 3CF6R 3B7WA 3TMKA 1VSVA 3T1OA 3I09A 1NMEA 4UE2A 3MBIA 3NKVA 3EEQA 3PQ4A 4MGYR 4DMLA 3RS7A 1MPXA 5I51A 2COEA 5JXWA 1KDPA 3C7TA 4JSTA 3ZTTA 1X1BA 2EYUA 1N34B 6ADHA 4N1AA 4AO8A 2J1LA 4UAVA 5HQTA 3VU3A 1P7VA 1QIDA 5FORA 5LN1A 4BFZA 3U44A 4PNHA 3RASA 1PGOA 3IAHA 4YO8A 3O73A 1RQLA 4D0SA 4OTZA 4R01A 1J90A 3NI2A 2P30A 5KB3A 1W36D 5AKJA 2NV0A 1XI2A 3AV3A 1SBTA 4P38A 2GM5A 3HB0A 1PJTA