1U7HA

Structure and a proposed mechanism for ornithine cyclodeaminase from pseudomonas putida
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
341
structure length
341
Chain Sequence
TYFIDVPTMSDLVHDIGVAPFIGELAAALRDDFKRWQAFDKSARVASHSEVGVIELMPVADKSRYAFKYVNGHPANTARNLHTVMAFGVLADVDSGYPVLLSELTIATALRTAATSLMAAQALARPNARKMALIGNGAQSEFQALAFHKHLGIEEIVAYDTDPLATAKLIANLKEYSGLTIRRASSVAEAVKGVDIITTVTADKAYATIITPDMLEPGMHLNAVGGDCPGKTELHADVLRNARVFVEYEPQTRIEGEIQQLPADFPVVDLWRVLRGETEGRQSDSQVTVFDSVGFALEDYTVLRYVLQQAEKRGMGTKIDLVPWVEDDPKDLFSHTRGRAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ornithine cyclodeaminase
publication title Ornithine Cyclodeaminase: Structure, Mechanism of Action, and Implications for the u-Crystallin Family;
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Lyase
total genus 111
structure length 341
sequence length 341
chains with identical sequence B
ec nomenclature ec 4.3.1.12: Ornithine cyclodeaminase.
pdb deposition date 2004-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02423 OCD_Mu_crystall Ornithine cyclodeaminase/mu-crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1780.10 Alpha Beta 2-Layer Sandwich ornithine cyclodeaminase, domain 1 ornithine cyclodeaminase, domain 1 1u7hA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1u7hA02
4NJMA 1LRLA 1E1MA 3BMNB 3ZW9A 3PRJA 3T7CA 3PP8A 1GZ6A 4J1QA 4YWJA 1HEUA 2DBRA 2YFHA 4RVDA 6ADHA 1XYGA 1ZEJA 1T26A 1VPDA 4JXKA 3OA2A 4CV1A 3I52A 3CZRA 3IUPA 2QZZA 4PLPA 2E48A 2V6FA 2Q99A 4YBZA 3ZI0A 4DPMA 1SMKA 1UJMA 2WM3A 5ITVA 3GVHA 3EAGA 3P2YA 4QX6A 4EUEA 1E6EA 3G1TA 4YAIA 2IDZA 2EW2A 4RL6A 3IJRA 3ICPA 4WECA 3FPCA 1I2BA 3GG9A 1F0YA 1ML3A 2FN7A 4UEOA 1JKJA 1R6DA 2PZJA 3DC2A 3HB5X 4WK6A 5BT9A 3VZQA 1A4UA 2X0NA 3H8VA 3ONEA 2D59A 2EW8A 4YVFA 3EMKA 2Q49A 3DZBA 4M54A 2C59A 1ZZEA 2DTEA 4ND4A 3CZMA 5HTOA 1QSGA 3INTA 5KVSA 1H6BA 4MIEA 3ZHXA 4L73A 3UGKA 1Z74A 4WOKA 3UVEA 4IXWA 4CQLB 4JX8A 4NFHA 4IJUA 1U4SA 2EIHA 5CPBA 2Y67A 4KZPA 5CDYA 4HWKA 3ASUA 3DZHA 1GUYA 3ZW8A 2WYWA 3EVTA 1DRWA 1PSDA 1PS9A 3QWBA 2WWRA 2I99A 2CF6A 2WDZA 5AOVA 2BGLA 3LC2O 3RIHA 4ZQBA 3AOEC 4B4OA 2AG8A 2P9GA 2ZQYA 1RM0A 3R1IA 3AM4A 2PD4A 3A1NA 3IOYA 4J49A 4RVGA 2W2LD 4A0SA 2AEMA 3TFQA 4Q39A 5IG2A 1QP8A 3UN1A 3JD3A 4B7UA 5ILOA 6LDHA 4N54A 3UICA 3S55A 5IDWA 4M49A 3ZNOA 3KUXA 4B4UA 4Z6KA 4GL4A 1WMAA 4TKMA 1YBMA 3WLFA 3MWEB 4GI2A 5I9MA 4L4RA 4J7CA 4RPGA 2C7VA 5DN9A 4L8VA 2R00C 2V6BA 3QVWA 2OO5A 3RBVA 1SPXA 4WLUA 1YB4A 3D3WA 1EUDA 5G0SA 3DBLA 4N5LA 1EZ4A 3GEDA 4RF3A 4BO1A 1MXFA 4HFMA 3BTUA 4Y9DA 4YQZA 4TROA 4EEXA 5EESA 4BKOA 1ADBA 3VZRA 1OOEA 4P38A 1GV0A 1LSSA 3HJAA 5A4DA 5JCXA 5JNLA 1NNUA 1KEUA 4FOSA 4D42A 5C7IO 4RQTA 4YJHA 4JLWA 1DFHA 4KQXA 4O59O 3PPIA 4NG5A 3KVOA 1UDAA 1T4DA 3AY7A 3H9GA 2C82A 4ZRMA 3K92A 4D79A 4EUFA 2PKQO 4XDYA 5I7FA 2NU6A 1WNTA 1BTOA 3TZCA 3TZQA 1E6UA 2VYND 2QIOA 4OL9A 4U0JA 4GVLA 2CFCA 2AEJA 5C7OO 3GY0A 1YKFA 5HWSA 1Y9EA 3WBFA 1DRVA 2BKAA 3IDSA 3EK2A 2W4QA 4W6ZA 2GO1A 4U6QA 4IDAA 3TJRA 1WDKA 1SEPA 1YJQA 7MDHA 3GMDA 3I6IA 4J2OA 1FMCA 2GYYA 1LLCA 2HRZA 5KNLA 1ONOA 4J0FA 4I5FA 1O94A 3RFTA 3ZU5A 4IBOA 3RKUA 2R6JA 2GD1O 3PZRA 2Y1EA 5B1YA 1QKIA 3JYQA 3Q11A 4MVJG 2E49A 4ALMA 1LDYA 4NIMA 1NR7A 1ZK1A 1HSOA 3GFGA 1GYRA 5C7LO 1IL0A 2B5WA 4XYLA 5JPIA 2NQ8A 3A9WA 1PGQA 3WGIA 4D0SA 4D7AA 3GZNA 1C1DA 4WCFA 1CDOA 4I5DA 4D44A 1I8TA 4CMAA 3GN2A 3KSUA 4KUEA 2H63A 4DREA 8ADHA 4GX5A 5COQA 1WXDA 3LLSA 1SOWA 3WGYA 4Y98A 1TT5A 1GR0A 1VKNA 2PA3A 3ETGA 3AOEA 2B4RO 4GLOA 4J0EA 3DTYA 5DOZA 1HLDA 2VRCA 2D5CA 1UXIA 3K30A 3ADPA 3OA0A 4DC1A 4OHUA 4J91A 4ZU3A 1O95A 2V7PA 3MJEA 1R16A 1V3TA 2OBYA 1UXKA 2WJPA 1GQYA 1U8FO 3EC7A 1QYCA 4HNGA 2JCXA 1UH5A 1HYHA 4PZEA 1MFZA 1W6UA 1YXMA 2YY7A 4M55A 2Y66A 1QRRA 3MJCA 4DMLA 4ZQFA 3U0BA 1XG5A 2BI7A 2QRLA 3GNQA 3ZNPA 1NX6A 4MKZA 5IDXA 2R00A 4N7RA 4RLHA 1T2EA 3ZHZA 1GQQA 1NASA 4UREA 5L51A 1JN0A 1KYQA 3JSAA 2XXBA 1MG0A 1Q0HA 3W8EA 3KV3O 1FDVA 1PGNA 4LSMA 2OORA 3WWZA 2FR0A 4E12A 3MJVA 1P31A 3RUIA 1C0KA 4MVJE 2PGLA 1UP7A 3WG9A 4CMBA 2C0CA 3VDQA 4PLZA 2GZ3A 5C37A 1U28A 1JU9A 2X23A 3I9OA 3SJUA 4E33A 4PG6A 3KO8A 1T2CA 4Q9NA 3DB2A 3B6ZA 3RWBA 1ISHA 1PZGA 4OSOA 4YACA 2FPPA 4B79A 4G81A 4YEDA 4RF2A 1NPTO 4FFMA 1DXYA 3DR3A 3INGA 3I6QA 3QQPA 1ENOA 3EYWA 4K9DA 3JTMA 1LLUA 4BNVA 1NFRA 1OC2A 3W8DA 2CVZA 1AUPA 1YOVB 2X0IA 2FZEA 2P68A 2D2IA 4UAGA 2VZ9A 4IJKA 2WMDA 3KYDA 1IB6A 2HCTA 4EDFA 3PHGA 5KIAA 2HQ1A 3W6ZA 5ITWA 1EMDA 1X7GA 2DUWA 4IDCA 4E6PA 2OOSA 3PJFA 5L7WA 1ORRA 3FCOA 1IYZA 4QEDA 2J8ZA 4Q3BA 3HWRA 1BWSA 1HDXA 3WFJA 1Y9AA 4AJHA 1ADCA 4BUCA 4RF4A 3O03A 2OFPA 1RM5A 1O8CA 1T1SA 2D8AA 2X5JO 3DWFA 1YQXA 4CM5A 2UUOA 3FF4A 4E13A 2AQ8A 1GYQA 3PHIA 1JQBA 3JQDA 3QWIA 3JQAD 4NPCA 1JW9B 1EUCA 3U49A 1JKIA 3BMQA 3JQGA 2BELA 1E3SA 3O8QA 3V1TC 4ZN6A 1ISMA 1K2WA 1R4NA 2HK8A 3ZCXA 1ZO8A 3DDNA 5FI5A 3JYNA 4RVUA 5B37A 4QXMA 4BO5A 3S2GA 1DJNA 4KMSA 1K3TA 3D7LA 3F5QA 3HFGA 3TZKA 3K5PA 4NR0A 4XD2A 4E2YA 5JMWA 2EG9A 1I3LA 1QORA 2NADA 2DBQA 2CDAA 1LBEA 1N92A 4LCJA 5AQ1A 2WEKA 1BW9B 4CV3A 1VI2A 3OEWA 4CM8B 1YB1A 1YB5A 3PYXA 5DP2A 4QTZA 3MTJA 4R54A 4CM3A 4URFA 4Q3NA 5MGBA 1DC5A 3E1KA 3PYMA 4I9UA 3F47A 3RQSA 4FJ2A 5IXYA 2WYUA 1RPNA 3RUHA 3GLQA 5DBGA 3FPLA 1PR9A 2PD6A 5I8ZA 1PJ4A 3CH6A 3TF5A 5FWNA 3H7AA 1CF2O 2VQ3A 5TIIA 3IUSA 4CMIA 4MVJD 4AFNA 1E6WA 4CM4A 1XU9A 5DOVA 2YHUA 3KEOA 5H83A 3DAPA 3KTDA 3F1KA 4B4WA 4HP8A 1WP4A 3I9NA 1Y7TA 4PG4A 5BNFA 4YAGA 1MGOA 4CLOA 1MG5A 3M1LA 5CEJA 4PZDA 3L4BC 1EVIA 2DM6A 4MDHA 4NJMB 1D7OA 3ASVA 4L4SA 2VUSA 4WGGA 5JXWA 1G1AA 3QP9A 4ZRNA 1E7RA 1H6CA 4E21A 4FQ8A 3DBRA 4CM1A 2OGUA 4WNCA 3AK4A 1LU9A 1Q0QA 3C8MA 3GDFA 4HADA 1P1KA 4OSPA 2PFGA 2P5UA 1SBYA 3WQQA 1EBFA 1Y81A 1BHSA 3PHLA 3QVXA 5TGDA 3JQCA 3RUCA 1XGKA 2FMUA 1W0CA 3EW7A 4FPXA 3WB9A 1T2FA 1H9AA 3K31A 2OXIA 1XHLA 1TEHA 3QLJA 4PLHA 5T6BA 2FRDA 2DPHA 1DIHA 1N5DA 1U5CA 5G0VA 3RVDA 1YL7A 3GOHA 2VWHA 2PV7A 2UUPA 3KBOA 3GNSA 4FCCA 4E32A 3HSKA 5A9SA 4OH1A 4WPGA 4DPKA 4NHEA 3P7MA 1EDZA 1ZFNA 4E4YA 4ZICA 3ZU3A 2NUAA 1GTMA 2Z1NA 4KDFA 2D5AA 2IZ1A 2JD0A 4NK5A 3M2TA 1IY8A 3GNTA 2BRUA 2P2SA 1T1RA 4ZVVA 2PNFA 3T4EA 1M75A 1PJLA 1I32A 4WUVA 1O89A 4CUZA 3WLEA 1LXCA 4MKRA 2FHSA 4YJGB 3OBBA 3KXDA 2ZCUA 4R9RA 1R15A 1HDCA 4A5OA 2E4AA 3PFWO 3ZWAA 1P44A 2J5RA 2ZK7A 4YJDA 4DQUA 2JFFA 1FDUA 4J7XA 9LDBA 4B7CA 4NMHA 1M67A 2PY6A 1V9LA 3D5TA 1GCUA 1P1JA 3HADA 4PG7A 2EJVA 1A7AA 1DPGA 3IKVA 3E82A 1Z7EA 4M87A 3FNFA 1YRLA 3ZV3A 4UUPA 3KSDO 2O50A 3CUKA 1HSZA 4IS3A 3EY4A 4R1TA 1O0SA 3WTCA 3HN2A 4IDEA 3D3WB 5EIOA 1C1XB 2GN8A 2Q4EA 2P4HX 1GY8A 3DHEA 4J4TA 3JD0A 2DBVO 2YFQA 3CPSA 4M89A 1UZNA 2TMGA 1CWUA 4IDDA 1E7WA 2C5EA 3V1UA 5CAEA 2VWGA 3HUDA 5IFLA 2PZLA 2RCYA 3L4BA 3NTRA 2NU9A 4MVJM 3KSZO 2C2XA 1O5IA 3CXRA 3ADOA 4JJFA 5A05A 1SB9A 2DFDA 4YB8A 4RJTA 4WLVA 4YJHB 3SXPA 3GQVA 3GVIA 3LDHA 4CQMA 1GQ2A 1ONPA 1TA4A 1ZJYA 4IQ8A 2YJZA 2O7SA 4HKTA 1Z73A 3WGTA 2FPGA 4H3VA 4BB6A 3JQEA 3HDHA 4K1LA 4BV9A 4QSMA 2JAHA 3VH3A 3PHJA 4DRYA 3CSDA 1DC3A 4UVDA 1MC4A 2IRWA 4DTIA 5JS6A 3NJ8A 1VSVA 4AJ1A 4D45A 3B20A 4CLRA 1GZ4A 4ITUA 1GZ3A 5T64A 4L9RA 5BSEA 1MC5A 1I3NA 5EQDA 4ZGWA 4DIBA 1HDZA 1OC4A 1YBVA 3K73O 3OJLA 3IC5A 4GH5A 3HE3A 4LVUA 1B8UA 1OAAA 1UAGA 2HJRA 4H7PA 5TJHA 1CETA 1DOHA 1WAMA 1R0SA 4UEJA 4UULA 5AXDA 1I24A 2HAEA 2HK9A 4MPDA 3BTOA 4G65A 4A73A 2ZB7A 3QIVA 5IN4A 3ULKA 3ZWYA 2C5AA 1E77A 1PJQA 3ROMA 2H6EA 5JBIA 3PGJA 4MVJH 4PFJA 2RAFA 3GZNB 5TLSA 1ENPA 3WWYA 4CMGA 5JAMA 4H16A 2HDHA 2GPTA 1SCUA 3AI3A 5L3ZA 1E3EA 4YXFA 1PTJA 1D1SA 3ZWPA 1Y5MA 3G3EA 2IXAA 4DQXA 2D0IA 3KETA 4GKBA 1RYDA 1N1EA 2YQ5A 2VYVA 5B12A 3ONDA 4ZQHA 2Q2QA 2EF1A 1KEPA 4IJVA 4DBZA 4B7XA 4MIYA 5T57A 4CLHA 2C07A 1PGJA 2JHFA 1S7CA 4R5MA 1UZLA 4IQ0A 2BGMA 5ENDA 3ZWVA 5JO0A 1EFLA 3ZN2A 3DHNA 5DP1A 3PYLA 3DAGA 3E5RA 4JJGA 1I30A 1FDSA 3L6DA 3K2BA 4K26A 1UR5A 2GR9A 3PIDA 5ER9A 1AXGA 1KEWA 1MFPA 5CDTA 4DVJA 4Y67A 2XXJA 3F4LA 2NV6A 4J1NA 1F17A 3ZU2A 1BXKA 5KTKA 1V6AA 1ZK4A 2YDYA 4FB5A 4WCDA 4BNWA 1FF9A 1ID1A 1ZW1A 1IPFA 1KVRA 1VKOA 2TMDA 3DZFA 4F46A 1DBVO 3H9UA 1Q2XA 4KQWA 5KVCA 2ZJ0A 3FTNA 2CUKA 1E0DA 1ZJZA 2DKNA 3UCFA 1V3VA 1LDBA 3ETDA 4DUPA 1PGPA 4J3FA 1NVGA 3GVXA 2DTDA 4RV9A 3V2HA 1Z6ZA 3DAFA 4WLFA 4IDFA 4YQYA 2CDCA 2VNAA 1PS8A 1OFGA 4E5NA 1G0OA 3OSUA 2GGSA 3L6OO 1QYXA 3ZWBA 5KWEA 3BMOB 3DTTA 3RSHA 3EZYA 1NTOA 1VSUA 2FR8A 1TXGA 4MVJI 1KY4A 3K8ZA 1MB4A 5T5QA 1GYPA 4RO0A 2X0JA 3QJ5A 5I7VA 1IZ0A 3JD1A 5BNIA 1UP4A 3OJ0A 2Q1UA 4R51A 4LMRA 4GX1A 2J3IA 4I5GA 1VJ0A 1E3WA 1AN9A 4TRMA 4OOEA 3DONA 1Q1NA 1TVEA 2UAGA 3P2OA 4CR6A 5THKA 4EBFA 3V2GA 2NVWA 3HG7A 3KYDB 1D4FA 3RC7A 2C29D 1T25A 1V3UA 5FI3A 5JAZA 1U7HA 5K6AA 5G0TA 1YO6A 1GV1A 3JYLA 2ZKLA 1ZMOA 2A9FA 4DBVO 3H5AA 1PGOA 4NI5A 4YA6A 1RKXA 1MA0A 4WCFC 2B5VA 4DQVA 2XOXA 1JVBA 5F21A 3SVTA 4TRJA 2VRCD 4GX0A 4R3NA 4XZ3A 4MVJF 1LQUA 2A94A 1HDGO 3SC4A 5I7SA 3ITDA 3RD5A 3IL2A 1R12A 3GPIA 1KBZA 4XGNA 4DA9A 3NKLA 4E2XA 4KUHA 4IIVA 1P3DA 4Q3CA 4J2HA 2G5CA 3BMQB 1HYGA 3JQGB 1ISIA 3O8QB 4IQGA 1P1IA 1XU7A 3H65A 4IDGA 4BQPA 3D64A 1R4NB 1G6KA 2NWQA 3OH8A 2HLPA 4K28A 3L9XA 3UW3A 1BSVA 2AE1A 4HFNA 3NRCA 3AI1A 1R4MB 3NGLA 4OQYA 4IZIA 1DIGA 3AI2A 2AQHA 3KEQA 5KJEA 5L9AA 1EEHA 4P8RA 4HFRA 4M1QA 1FDWA 4C7KA 1IULA 4R01A 5A02A 1K89A 3M1AA 2D4AA 2P5YA 1JDJA 1U8XX 2X9VA 5KVQA 3HN7A 2HMWA 2LDBA 4PRKA 4D46A 1J49A 3RC2A 2Z95A 4L76A 3ZV4A 9LDTA 3KLMX 5H82A 4ND1A 5GZ6A 3ZHBA 3VPGA 1GADO 1U2GA 4DL9A 1YL6A 3T4XA 1X7DA 5DF1A 4AJ4A 4FFRA 1NWHA 2E37A 4IXTA 1VLLA 3WOHA 3GG2A 1Y8RA 4BKRA 4XDZA 3SBOA 4CM4B 4E3ZA 3WMWA 2QRKA 5DBIA 3A06A 1NQTA 3IIEA 3WYBA 1GD1O 4XQGA 3CTMA 3K96A 5KJ1A 2V6GA 4IMPA 1H93A 2O3RA 1LDNA 2Q2WA 4BNLA 4YT2A 2G76A 5F1OA 3C85A 1A9YA 3C3XA 2BI8A 4XKJA 2PD3A 2RH4A 1O6ZA 3GGPA 3GF4A 3GRPA 1KS9A 3I9JA 2AEFA 3RUDA 3ZH2A 5HA5A 1M2WA 1ULSA 4BNNA 4S3MA 1PQUA 2VOJA 1XEAA 1BGVA 1H94A 3Q9UA 1EQUA 5HRUA 1SO8A 4KDEA 5CFZA 2JHGA 2NLOA 5G2OA 5KJFA 3OQ6A 2HRBA 3WICA 2GSDA 2O3SA 1J5PA 3RKRA 4CM7A 3BIOA 1P45A 3PGXA 1Q7BA 2Q46A 5U9CA 3VPFA 1NP3A 1WLYA 2XF8A 1DC6A 1N1GA 2ZYGA 4PGFA 4GWGA 5A9SB 1IHXA 1IPEA 3DFUA 5CG2A 5EERA 1EUZA 4E0BA 2X1HA 5CHEA 4PLGA 3FSRA 1T2DA 2AA3A 4DYDA 1NHGA 1ZK2A 4JBGA 4QO7A 4U6SA 5BNTA 4QT0A 3UAGA 3QV1A 4L0QA 1N9GA 4QQRA 3I9KA 4WE3A 4IZHA 2DU8A 4R1UA 2PZMA 3RU7A 3GDGA 1GFSA 2RH8A 1YJ8A 1M66A 2J5QA 3I3OA 4NZ9A 2IYPA 4J6FA 4WLNA 3FWZA 5JE8A 4YRDA 4MOWA 2X4GA 1T2AA 2IXBA 2Y1GA 3V1YA 1GL3A 4IJWA 3TOXA 3JQAB 4JIGA 3FBGA 4W99A 4CUJA 4FJ1A 1VRWA 5I9NA 4IUYA 2BFOA 1F14A 2P91A 4BNYA 1JAYA 1P9LA 2GZ1A 1H2HA 4TKLA 5G4KA 3MTGA 4U8GA 3PVZA 1CQIA 3I9MA 1BVUA 1HDRA 3F1LA 3OETA 2NACA 4Z0TA 2O2YA 1EBUA 4NDNE 2EHDA 1BXGA 3NDIA 3CMCO 1PQPA 2R2GA 1SB8A 4AJLA 1Z7BA 3MCVA 4IMRA 2NTVA 1VL8A 3X2EA 5AXCA 3GUYA 1P1FA 4BMSA 5F1PA 4OXKA 2YYYA 4EITA 2EWMA 3T7EA 4LMPA 2GERA 4NBWA 1RM3A 4BO3A 5CP8A 3VTZA 1GUZA 1YDEA 2JKVA 1NVMB 4ZQGA 4TZKA 1VJTA 4KUGA 5MDHA 3VH4A 4FC6A 4C4OA 3N74A 3W4JA 4BO6A 2H9IA 3ROQA 1PR3A 3K2EA 1OMOA 2AHRA 3F6YA 4AG3A 2FWMX 1SC6A 1U4OA 3WGQA 2GLXA 3JV7A 1K6XA 2Z5LA 3QWAA 4XQ9A 3PJGA 3PTZA 2VHXA 5C5IA 1NFFA 3OIDA 4DPLA 5IDQA 4Q3DA 3ANMA 4BQRA 1E5QA 2Y93A 1H2BA 2B83A 1PZEA 4EUHA 4XQEA 4BNKA 4NK4A 1O9BA 1VL6A 2I66A 3NGXA 1EK5A 3BA1A 2DAPA 2DTXA 4NJOA 3AM3A 2ZYAA 3RJ9A 5EPOA 3KYCA 3HDQA 4IGEA 3D3EA 4CLRB 5JW6A 5K0ZA 5BSGA 3VZPA 2QG4A 1B15A 1ZUD1 1NFQA 3RUFA 3OEYA 3AW9A 3LT4A 4CM6A 1LC0A 3LT2A 3NYWA 3ENKA 3E9MA 1L7DA 3RASA 2B36A 3DZIA 1GCOA 2W90A 3AY3A 2FY8A 2PGDA 4JNKA 3DBHB 1FDTA 1LNQA 3ZDFA 3JQ9C 1MUUA 1HZZA 1DRUA 2RBEA 3FNGA 1LDEA 3NAQA 4MJLA 1A9ZA 3GGGA 1XLTA 3ON5A 1HL3A 5FEUA 1T4BA 5KKAA 4PZCA 4EYEA 1XIVA 3I1JA 3QVOA 5FFFA 4OKIA 1PX0A 3FWNA 4XCVA 1XKQA 5LCXA 3R3SA 2OP0A 4BO2A 1U5AA 2YV2A 3FD8A 4D3SA 4XIYA 5JDCC 1PL7A 3AY6A 4Q3EA 4YDRA 2VWPA 5A5EA 2BF7A 4FD3A 3UFXA 1LDMA 3VZSA 1NAHA 3FR7A 3MJTA 3PWSA 5JCJA 3G1UA 3NT5A 1GAEO 3EGOA 3WNVA 3RFXA 2GUGA 4UUNA 3WS7A 3DQPA 4LRTB 3GEGA 5T8KC 2HK7A 1VL0A 1HRDA 4RVHA 1B3BA 1HTBA 4MP3A 4KWIA 4XJTA 2H5LA 2JFGA 3PFFA 3H9JA 2NVBA 3ZZNA 1M76A 3CKYA 4R68A 2YV3A 4FOOA 3JQ8A 4LGVA 2E82A 1WZIA 3ITKA 4ALLA 1KC1A 1QLHA 2ZCVA 3JD4A 3PWZA 4GQAA 4CV0A 1U3TA 4NFSA 5LC1A 4J7UA 2NU7A 3VVCA 1U9JA 1QYWA 3H5RA 4DIOA 1DC4A 1MXHA 3DZKA 1S6YA 1KIFA 4QFCA 2B35A 2FSSA 4CQMD 1MLDA 3ABIA 5F5NA 2GN9A 3H9QA 2W2KA 4X54A 4Y6PA 1UP6A 3KLPX 3UOGA 3AWDA 3LLVA 5GZ1A 5JMPA 1HLPA 4P4LA 4WEQA 3DMYA 4AJNA 2OUIA 2O4UX 3ZNQA 4I5EA 4CLEA 1ADFA 1PJ2A 2A35A 3GZ4A 5THQA 2B69A 5G4LA 3VPHA 4GWKA 2DPGA 2AXQA 4CL8A 2EP5A 4BKPA 4J1SA 2C54A 3WGGA 4G2NA 4KWHA 1B0AA 4AL4A 5B4VA 1I2ZA 2X22A 1YVEI 3E9NA 4HNHA 2F00A 3BHIA 4LSWA 2I3GA 4JCOA 3KHUA 1Y1PA 1MP0A 4Z0HO 3EUWA 1R0LA 3H4VA 4N5NA 1U3WA 2Y68A 4B3HA 1NVTA 2OMEA 4F6LA 2X9GA 2VHVA 4XYMA 5EN4A 5BR7A 3HDYA 1JWAB 4RZIA 3VTFA 4R16A 1FXSA 1MX3A 1CERA 1B8PA 3GMSA 1ENZA 3ONFA 3WSWA 2WD7A 3ANLA 1Z75A 4LK3A 1LLDA 3OJOA 1QLJA 4MVJP 4XGIA 4AJOA 4BKUA 2XAAA 1M6WA 3JQ9A 1ZIDA 2YUTA 1WW8A 2VWQA 3BZUA 3QA9A 1NM5A 2RHRA 2VYVD 2X5OA 3AU9A 2HMTA 5BQFA 1H6DA 2AE2A 3AFNA 2Y0EA 1YH3A 3GAFA 1K0UA 3IAHA 1ADGA 4GVXA 3WQRA 4BGVA 1GDHA 2OP1A 4FFLA 1DLJA 3Q3CA 4E5KA 2X8LA 4ESOA 1CRWG 3NDRA 4CR8A 3HQ4O 3WFIA 2EJWA 3UHAA 1HE5A 5JDCA 1H5QA 1ZBQA 1DDOA 1I3KA 4N18A 1KY5A 4LN1A 5C3MA 4HXYA 1YQGA 2EERA 4JROA 5KKCA 4B8ZA 3O38A 4MKXA 4BKQA 3WMXA 4BNHA 1FK8A 3DXFA 4BNFA 4EJ0A 1RJWA 1NYTA 2CVQA 4JP3A 1PJCA 4MIOA 5T8KA 2DBZA 2ZTUA 1ULUA 5JY6A 4CMKA 1HDOA 5I7EA 2GF2A 4O1MA 1F8GA 2DT5A 3RJ5A 2VNSA 1DIBA 1BG6A 2ZTMA 3ZHYA 3ZNNA 3E03A 5TT1A 2UDPA 4JJIA 4BO0A 4XYBA 1F8FA 3LU1A 4KP7A 3DBLB 4WJZA 5JC8A 4RDIA 3OJEA 2JCVA 3QY9A 5JFOA 4Z3DA 3PQDA 3D4OA 4OQZA 2Z1MA 5DCUA 4R69A 1F06A 2WD8A 2W98A 3VHRA 3GUCA 3B1FA 3PJEA 4AJKA 4PLYA 3U09A 1DHRA 3UF0A 2ZB8A 1NWCA 3S1LA 4HY3A 4BNIA 1ISGA 4UVEA 1W73A 1Q7GA 4BNXA 3SEFA 5JO9A 4OKNA 3C1TA 2NU8A 3OECA 2ZYDA 2GN4A 1XQ1A 3E48A 3DFZA 2P9CA 3UUWA 1P0FA 1Y8QA 4HFJA 1H9BA 4RPLA 1UAYA 5LDGA 3TQHA 1M6HA 1I0ZA 1QYDA 4GMFA 4OAQA 4L75A 4R3WA 2X58A 3A14A 5L45A 4WNIA 3EDMA 4L4XA 4JBHA 5EJ2A 3F46A 1R66A 2VRBA 3LT0A 1X13A 2UV8A 1QMGA 2HUNA 2NQTA 4DYVA 4GPD1 3WX0A 3INRA 4XYGA 3OM9A 1BRMA 1TLTA 1GEGA 1Y6JA 4P4NA 3GN1A 3MJSA 2UYYA 4JP2A 2CZCA 1EFKA 3LZ6A 3DOCA 1PU2A 4J4HA 1ZH8A 4ZD6A 1I5RA 1YOVA 3TZ6A 5K6AC 5EMHA 4GGPA 4EZBA 4EJ6A 4PRLA 1LSOA 3TPCA 1SNYA 1CYDA 1U2DA 3FN4A 4BGEA 3NUGA 1BVRA 5JYEA 4FGWA 1Z45A 2G17A 4Z9FA 3WSVA 1E3LA 1A7KA 1C1DB 3H2ZA 4WCFB 4B3IA 4CM9A 4U0KA 1J4AA 1KERA 3MOIA 5TRTA 2PLAA 3C7CB 4FIZA 2NVUA 1YBAA 4XX0A 4CR7A 4DGSA 3V8BA 1GPJA 1TT5B 5L4SA 3QWHA 3WNQA 3L0DA 4RF5A 1EK6A 3NX4A 4D0RA 2VHYA 3BMCA 2D1YA 1LEHA 2IYOA 5F5LA 1OZAA 2Q2VA 4HV4A 1DFIA 3AUUA 5I9LA 1B26A 1RYEA 2VUUA 5AXAA 5TQVA 2QZ9A 4R41A 5TSDA 2POQX 5JDIC 2EKLA 1HWYA 1ZNQO 3AUAA 3OFSA 3R3JA 3RROA 4BHTA 5L40A 5J23A 4FGSA 4TQGA 2G1UA 1WPQA 3W6UA 4G5HA 3VH2A 1AHHA 4D43A 1N2SA 4RGBA 3P5SA 4ID9A 5G4KB 1PZFA 5U4QA 4Y6RA 3ZWNA 5ICSA 5CEEA 1B3RA 2O3TA 1ZXBA 4TRRA 4U5QA 4DWVA 5IJZA 4E5PA 4FN4A 3C7DB 4R1SA 3W4IA 2YHIA 2G82A 2O23A 3OICA 1FJHA 2GASA 4IGFA 1BW9A 3EVNA 3D1LA 4KOAA 1WWKA 1G0NA 2HKIA 4L74A 3NTOA 2G0TA 3CMMA 3PLNA 3COSA 2J3JA 3BAZA 5TX7A 2A4KA 1SEVA 4GKVA 3U3XA 2VCYA 3WIDA 4QO8A 2C7GA 5ICMA 4HBGA 2I6TA 3I23A 2JJYA 4CJXA 1E7YA 4RPHA 1DAOA 3G0OA 3QHAA 3X2FA 3WQSB 3Q2IA 5JAIA 3PK0A 1HE2A 3K6JA 4FSHA 1HZJA 4YT5A 3C1OA 2B4TO 3PIIA 1EVJA 4W4TA 1RWBA 3WGHA 3QW2A 5IZ4A 1A27A 2B37A 1X15A 4YR9A 2QYTA 1C0IA 5DT9A 1I01A 4N5MA 4RPJA 4TVOA 2QX7A 3JD2A 1UXHA 3DMTC 4XGKA 3QRWA 3QWFA 3C1AA 3NT4A 2YZ7A 4J43A 3NT2A 4F3YA 3O4RA 4TZTA 2HJSA 2F1KA 4AJIA 3PEFA 3U4IA 4A10A 3FBTA 3IP1A 4GMGA 3TNLA 2QHXA 4MO2A 3KYCB 4E31A 3W4KA 3NTQA 4A7PA 4YT4A 4WEOA 3HFSA 4E30A 3IJPA 3UCEA 5A3VA 4DLLA 1HKUA 3LQFA 4NNJA 4I9HA 4I08A 1B14A 1BXZA 3PJDA 3Q9NA 3TSCA 4DLAA 4UUOA 4PLWA 5B4UA 2EP7A 3ETEA 4BO9A 4EI2A 4BV8A 4INAA 1EDOA 2DC1A 2ZJ1A 2O3UA 2Q3EA 3FNHA 4BB5A 1E7MA 3FI9A 1BDBA 4RQUA 3L9WA 4PG5A 3SLKA 1TI7A 1XELA 3S2FA 4XIJA 1F12A 4PLTA 1GPDG 3RAJA 4RVFA 1K6IA 1AXEA 1DIAA 3ORFA 2EGHA 2EKQA 4RPKA 1T24A 5CPFA 1ONNA 1PL8A 4I9NA 5ENVA 4AJEA 4XB2A 4CODB 5HBRA 1PWZA 4ZHSA 1LC3A 4IM7A 4CUKA 3WDSA 3VKVA 2FPIA 5JDIA 3RUAA 4YJGA 2IZZA 4E5YA 3GGOA 3Q0EA 5AYVA 3RBZA 3M6IA 5HS4A 3NEPX 2Q45A 1B8VA 2Y0DA 3PI7A 4Z9YA 1XQ6A 1ZEMA 4TRNA 5A04A 5DNAA 3JQ8B 3IQDB 3AM5A 3ZU4A 4XR4A 3VDRA 1WVGA 4IS2A 4PG8A 4P4GA 3Q2KA 3BYZA 4YJFA 4CMIB 4NBUA 2A92A 3GK3A 1JA9A 3PQFA 3IMFA 4M86A 4M8SA 4ONEA 2GRAA 1KOLA 4Q3AA 2Y1FA 4ALNA 4CLOB 3PLRA 1C1XA 2WTBA 5EQFA 5CDSA 2W2KB 2EXXA 3JQ7A 3JQBC 1Q7CA 3A28A 2P4QA 4PVCA 4BOYA 2NTNA 1CEQA 1D8AA 5DCWA 1IZ9A 2X9NA 1LRJA 1ZSNA 3DBRB 4BMVA 2DQ4A 1NXQA 3F5SA 4BL5A 1PJTA 5L4LA 1A4IA 1UXJA 5K9ZA 2O2SA 4JGBA 1XWFA 3RUEA 1ZSVA 2CY0A 3AJRA 2FOIA 4ZA2A 3DMTA 4FFPA 1E7QA 5JAQA 1LSJA 3RC1A 1LRKA 5A9RA 3KOUA 3ROKA 3VOSA 2B4QA 2J6IA 1YONA 2SCUA 1LX6A 3I4FA 1EQ2A 3UXYA 4LW8A 4PLCA 4XRRA 4CMCA 1ZK0A 3SJ7A 4BGIA 2BMAA 5TC4A 4NFYA 1NQAO 4D3DA 1EVYA 5FYDA 3WXBA 2NNLD 4XQCA 4PCVA 2WD7B 1ISFA 3D0OA 4C7JA 4CMHA 5TF4A 1I33A 1P74A 4QFDA 1XSEA 4II2A 1EE2A 5DCYA 2PKQP 4BNZA 2PKRA 1U7TA 4KTVE 3DOOA 1Z82A 5AXBA 4AJJA 1XR3A 3QVTA 3HHPA 4ILKA 3TL3A 1Q0LA 2DUUA 5JCJD 2ZB3A 1ZSYA 5CDUA 4BNUA 4FW8A 5EINA 1QYVA 1D3AA 2GZ2A 3LSYA 4WKGA 3JYPA 2O3QA 3F9IA 2ET6A 1A72A 1VE9A 2PTGA 3GT0A 3LT1A 1LTHR 3KYBA 5BSFA 3FR8A 1NQ5A 3E9QA 2VZ8A 1PZHA 3RFVA 2OHXA 3E18A 4WOJA 3WJ7A 3ZWCA 4BNMA 1WZEA 1PJ3A 4BMNA 4W7HA 4OM8A 8LDHA 3GH3A 1I10A 4ND5A 3VAZA 1NQOA 1CIVA 4XYEA 1X0XA 1UUFA 5KJ6A 1X1TA 3JYOA 4CMJA 4OJNA 3WYEA 1A71A 3NDJA 4DMMA 3SLGA 2EKPA 4P22A 3H2SA 4YTEA 2Y99A 1P33A 3QE3A 4NH4A 1KVSA 3ENNA 5I8WA 4OMUA 4YRAA 1WDMA 2J3HA 3NV9A 2WSBA 4UVGA 3VPXA 3W8FA 3GHHA 3GDOA 1I36A 3I5MA 3BTVA 2Y1CA 3OJFA 1E3JA 1V8BA 2VHWA 2AQIA 2W2LA 1E3IA 4FFNA 3TL2A 1LJ8A 4B4VA 1MV8A 3OQBA 4YAEA 3C24A 3LVFO 5TS3A 4EEZA 3MZ0A 3SC6A 3GR6A 1NPDA 4HUJA 3ZV5A 1NAIA 1HE3A 4OXNA 4WLOA 3QVSA 2X6TA 2BHLA 4AJ2A 5CG1A 3ZGYA 3JQBA 1P1RA 2VZ0A 3G49A 5H81A 4DLBA 2C20A 2JL1A 2WE8A 3MOGA 2I9PA 5L7TA 4W9NC 1TT7A 4UUMA 1DHTA 1I2CA 1ZKMA 2HMVA 3H6KA 3U9LA 1PS0A 4CQMB 3BMNA 1Y5RA 3OMLA 1Y8QB 1NHWA 1VJ1A 3Q6IA 5L53A 3IP3A 3V2UA 2P9EA 5IZCC 2YDXA 3GFBA 3L6EA 1E7SA 1H6AA 2Y05A 3Q1LA 1BMDA 5ER6A 4GSLA 3ST7A 4J1TA 1R37A 3BTSA 2GCGA 2DLDA 3BMOA 1JKFA 4AVYA 1J0XO 4GBJA 1HDYA 5DDIP 3TOZA 2OBNA 4IINA 1GUFA 2PGJA 1YWGO 1C0PA 3KRTA 1HF3A 2WYVA 4BNGA 5KCZA 2Y0CA 3BXXA 3CINA 1ZCJA 1PQWA 4KTTE 4ROSA 5A5FA 3NJ4A 3HB4X 2VYNA 5GY7A 2VTDA 2HU2A 1KC3A 1DO8A 1NBOA 3LK7A 2PH3A 2CD9A 2UVDA 4F6CA 3U62A 3O9ZA 4YCAA 2IZ0A 3F3SA 5G0WA 3WTBA 4LCEA 4S1VA 2I67A 5ILGA 3DHYA 3RI3A 1ZVMA 3GHYA 3N7UA 4CQLA 1U3UA 3OF2A 2I65A 3BHJA 2NVUB 4E5MA 2HSDA 4UVIA 3AUTA 3MEQA 2IODA 3AUSA 1UXGA 5FF9A 3PXXA 3BMCB 4W7IA 1ZXLA 4B3JA 5JY1A 1UDBA 3TRIA 1QXSA 3AU8A 3ZWOA 1YDWA 3KZVA 4Z0PA 4CLXA 2I5PO 1I3MA 2AMFA 4O6VA 4MP6A 3OP4A 2VT2A 1JAXA 3GVPA 4BGUA 4FFOA 3D4NA 3LYLA 4OYRA 3WBBA 1GU7A 1DEHA 1NR1A 4NBRA 1ZK3A 2I3AA 4RORA 3CEAA 3L4SO 2ILTA 4GAEA 1DIRA 1R4MA 2EV9A 5HM8A 4GGOA 4PIVA 5A9TA 4YAKA 3H3FA 1B7GO 1DFGA 1LDGA 1OI7A 2X0RA 4E2ZA 5EL0A 4XA8A 3WGOA 4AICA 1LA2A 4FBGA 5ES3A 4J4BA 2YHIB 2V6MA 4NQZA 3L77A 3ZWXA 1JWBB 3GAZA 3E8XA 3CE6A 4BO8A 1HETA 3IKTA 2FSVA 1E92A 1X14A 2B0JA 2CF5A 3LF2A 5TT0A 3DO5A 4R1NA 4A26A 3AFMA 2C2YA 3C7AA 3EHEA 5IN5A 1V0JA 2W8ZA 3JQFC 1R0KA 4Z3KA 2Y1DA 1PL6A 2X86A 3AOGA 3DZJA 4YPOA 2V65A 4QECA 4R5HA 3L07A 3WIEA 3FTPA 4PVDA 2JFHA 5L4NA 4W9NA 3RBXA 4LISA 3I83A 2GNAA 1PIWA 3U4HA 2VN8A 3VVBA 2JD1A 2QRJA 3M2PA 2JAPA 2DVMA 2CNBA 3RC9A 2JD2A 4YAJA 1KVUA 1YQDA 2Q1WA 3KB6A 3OQ1A 4XRGA 5IZCA 2PWZA 5BSHA 1SAYA 2NSDA 4O0LA 1CJCA 1AHIA 3TZHA 2CMDA 5JYDA 4TMFA 3PDJA 5KVVA 1C0LA 1L7EA 3B70A 4K6FA 3LC1O 1E3WB 1X7HA 2PZKA 2Y1OA 3JQ6A 5G0UA 2BFMA 4YYZA 3S2IA 1X0VA 2YQ4A 2VOEA 4NBVA 2GN6A 4IY1A 4CM9D 2EEZA 1B2LA 3QSGA 2D3TA 4BNTA 3G17A 4CMEC 4XEHA 2AG5A 5A3JA 2CSUA 5IDYA 1YL5A 1K5HA 4DC0A 4JK3A 7ADHA 3EZLA 3ICCA 4JQCA 4OIMA 5COAA 4ZJUA 2DFVA 4R4JA 1HT0A 2FZWA 2NTJA 3VH1A 4YRBA 2IE0A 2J3KA 5B4TA 4J16A 1X1EA 3STHA 1A5ZA 4EW6A 5IAAA 1WMBA 2FR1A 3TDKA 5A06A 5L95A 2BH9A 4OO3A 1QG6A 3LF1A 1LI4A 1YE3A 5TNXA 1DSSG 2ZQZA 3UCXA 1KVTA 4ND3A 4A03A 4RDHA 1E5LA 3HNPA 2ZIZA 4Y8VA 2HMSA 4ALJA 1OBFO 1B16A 1WDLA 2AW5A 4IPTA 1IOLA 3PZBA 1N7GA 1QV7A 1IHYA 5JLAA 3ZWWA 2FP4A 2OL4A 1PJBA 3OIFA 2QYSA 4H15A 1HXHA 5DBFA 3JQAA 4RZHA 1IE3A 1N8KA 1XDWA 2I76A 4PLFA 2X5KO 4J9UE 3DBVO 3GPDG 2QQ5A 1HE4A 3HZZA 3DZGA 3PHHA 4U7WA 3ROPA 3U5TA 1HYEA 1KETA 1YGYA 2RIRA 4FC7A 1U1IA 3W1VA 1EVZA 4XR9A 3WJAA 4W82A 3B1KA 2BGKA 4UEKA 5CDGA 1Y8RB 1AE1A 5A1TA 3O26A 4JBIA 4YJFB 5U1PA 3WR5A 1PJSA 1JVSA 4AJPA 1UZMA 2PH5A 4CLDA 2ZTLA 3JQFA 5F1KA 4FDAA 4BO7A 3I4CA 3V5NA 1JTVA 1JLLA 1KVQA 3F4BA 3OIGA 1LLQA 1PEDA 1UDCA 2WE7A 3ZWMA 3JQ7B 3WGZA 4BNJA 3KM0A 1J6UA 1ARZA 3R6DA 4O5OA 1CQJA 1P1HA 2Q50A 4BO4A 3FRJA 2NM0A 1ZMTA 4GX2A 3B1JA 1C3VA 2E6UX 2PK3A 3K9QO 4J9VA 4NBTA 1ISJA 5GMOA 5JSFA 2O4CA 5TJ9A 4EJMA 4FS3A 4EGFA 1XCBA 4MVJA 1LUAA 3VPSA 4XB1A 1SZJG 4BVAA 1SOVA 5DZSA 4R9SA 2VT3A 2O3JA 1C14A 2GDZA 2PR2A 1QV6A 3FHLA 2QW8A 3FNEA 3E5MA 4LRSB 4MINA 5T67A 2CVOA 3SX2A 5IXSA 4LVCA 5ADHA 3U4DA 1LSUA 1LQTA 3ZV6A 4B8WA 3S2EA 4BIIA 4DXHA 1QR6A 1VC2A 4D3FA 4ZQEA 1NPYA 1V35A 3E6AA 4ALIA 1P0CA 4CMEA 2YV1A 1E1NA 4TSKA 4TVBA 2BD0A 5GZ3A 5JC1A 3GEMA 2O7QA 4MP8A 3TWOA 1BDMA 3HDJA 4RLSA 3VC7A 5IF3A 2VHZA 1DAPA 3GVCA 1XA0A 1YS4A 5AVOA 4QUKA 4XWYA 2CDBA 2Q1TA 2OZPA 4PN3A 3VKUA 5KOIA 1H0KA 4CPDA 3RCBA 3DBHA 5HS6A 4NU6A 1N9GB 1L1FA 3GRKA 3I9LA 3S8MA 4IDBA 4Z9XA 2VUTA 1U3VA 1DB3A 4OOFA 4YT8A 4OGWA 1GEEA 4D41A 3DL2A 3H5NA 4FR5A 3WYCA 2JCYA 3U4CA 3N58A 3TFOA 2ZATA 3GA0A 1W4ZA 3OHSX 3ANNA 4PLVA 3D5QA 4CL3A 4BS9A 1DLIA 1E1KA 2IEBA 3H9EO 3TN7A 2AQKA 3PWKA 2O48X 3MWDB 2BFAA 4I1IA 5KJCA 4WASA 4O63O 3DEYX 4UVHA 3DOJA 3CIFA 1N7HA 4A2CA 4E2WA 4RVSA 4CV2A 3IS3A 4TWRA 3JCZA 2EGGA 4F45A 1W8DA 1BXGB 1TB4A 3PQEA 2ZTVA 4Y6SA 4XJSA 3UH1A 3PDUA 1ENYA 4HX5A 5LDHA 2HO5A 4OXYA 3GC6A 4II3A 4J90A 4CM8A 4NU5A 3LC7O 4K6CA 5L7YA 4WLEA 2BLLA 1DJQA 2Q4BA 4GSKA 1K6JA 2Q1SA 2XPCA 4ND2A 3UKOA 4ALKA 5CEFA 1EE9A 3RU9A 2J5KA 2IEDA 2ZB4A 3R0IA 2RHCA 4IIUA 2BFPA 2HMUA 1IUKA 1PWXA 2X7HA 3D4PA 4FJ0A 2YW9A 1KEVA 3G79A 4JN6B 3BHMA 5A03A 2H1SA 2VTEA 4DIFA 4GLLA 3H3JA 5COBA 3A4VA 4RCVA 3P19A 1D1TA 4I8XA 1RM4A 5F3RA 3MJ4A 2LDXA 1AGNA 1P77A 4A27A 5DULA 1VM6A 1E1LA
chains in the Genus database with same CATH superfamily
1T10A 1E1MA 4LZZA 3PRJA 3T7CA 3PP8A 4YWJA 1HEUA 4BX8A 2DHRA 2YFHA 4OREX 2HM7A 1G20B 4UE3S 1Y3DE 4FUTA 3KYJB 2Q5OA 4CDNA 1ZEJA 4HVCA 1BIFA 2GN2A 4KI7A 4JXKA 1UBGA 3OA2A 5B1DA 1NW6A 5JXGA 4CV1A 5JJIA 4RKWA 4Q48A 4E46A 3CZRA 2G71A 2V6FA 4DPMA 1L7XA 2Q5IA 3L1HA 4KN8A 4HX2A 2QAJA 1YAHA 2I3ZA 4ENPA 5J5AA 1EJ2A 2IDZA 3X1DA 2J46A 4KQ2A 5B2FA 4HQRA 4MV6A 1TJ5A 1U02A 4WECA 2ADFA 1I2BA 4JIMA 4ENSA 1F0YA 2FN7A 2CJWA 4UEOA 4OXIA 1JKJA 5F78A 3V7FA 3DQZA 1DAIA 3M7IA 3GFVA 3KCNA 4F9TA 2PMWB 4NWIA 4LS3A 1A4UA 3A31A 3KSMA 4NL4H 4P9NA 4JI0B 3WIOA 1ODCA 1Z3IX 3H8VA 1OLUB 3ONEA 2EW8A 4YVFA 4EJSA 2HBZA 1E2GA 2OQIA 2RFLA 2AUNA 4HVAA 2C59A 4A8JB 5BR8B 3R23A 4UAUA 3GW8A 1IOWA 4R3UC 1I51A 1I4LD 2RHDA 2X5XA 4G23A 5DSXA 5KYKA 2ZIFA 1EP2B 4Y30A 3WNBA 4L73A 2YJGA 3UGKA 4RTSA 1K86A 4CQLB 4Q7MB 4EW1A 2R62A 4LY3A 4F9EA 4IJUA 2NZUG 5BWBA 2EIHA 3KXLA 3IO3A 1WCYA 4KZPA 1YI8A 5EHZA 5AKKA 3VTAA 3OQIA 1GUYA 3FZYA 2WYWA 5CCDA 2R11A 3CM0A 3ZW8A 2GD2A 1PSDA 2BEVA 2XKAA 1WPXA 2GNOA 2WWIA 4FR0A 5DB4A 4A8PA 4KQGA 2B8TA 1B6SA 2QJFA 3RF6A 2Z8ZA 5BUCA 4ZQBA 4P98A 4ESEA 3CVWA 2DCUA 2PNJA 3AJ8A 1Z2EA 2IYTA 2AG8A 3R8XA 4JYZA 3SPXA 1RE0A 3R1IA 1QH8A 4RVGA 1NQVA 2BCGY 5JS2A 3RGWS 4IYRA 4FNMA 2AEMA 4Q39A 5C8ZA 5IG2A 3CN9A 3EZFA 5C7YA 1YFLA 3AT1A 5D01A 4MW1A 5CRIA 3TUZC 3JD3A 4B7UA 5ILOA 3RG2A 3K8QA 5ILQA 3UV6A 5LQSA 4O4IA 1R4ZA 3EF3A 3KUXA 4YBRA 4KI0A 2B78A 1EXVA 3O1HB 4DDWA 1JFSA 3IMCA 2MOKA 4F91B 1FMFA 2VJBA 1E1CB 1QDEA 1WMAA 4Q4AB 1VI5A 5DN9A 2JFPA 2D2VA 3N75A 3OFKA 2AN4A 2OO5A 3QVWA 4G36A 4L8VA 3WGUA 4WLUA 2PIDA 5SY4A 2GI4A 2WU8A 1EUDA 1OZGA 3MGAA 3BG5A 4N5LA 4FDMA 4RV5A 3L0ZA 3BSYA 3THSA 1MXFA 3P32A 5B7PA 3ZJ5A 4BVJA 3U7HB 4E3WA 2HF7A 4Y9DA 4EL0A 4YQZA 1UK6A 2IS2A 3BGSA 4YRKA 1ADBA 3VZRA 3G9ZA 1DTWA 1P5FA 2VT6A 3KDSE 3NNNA 4BVGA 1Q12A 3RRYA 1QNFA 4Y18A 3U3MA 2KBEA 4AWAA 4D42A 4YJ2F 1SURA 4BTEA 2VDMB 4ZT3A 2JJ2D 3W7AA 3ECCA 1SU4A 2E4WA 3KVOA 2A30A 5CLQA 4WNAA 2E85A 3K92A 2XUZA 5FBLB 2I03A 4L9SA 1Z8HA 2H59A 5I7FA 2NU6A 1WNTA 1TRKA 2JKYA 1GT6A 2FX5A 1O6FA 2IDKA 3KFLA 3P2KA 3TZCA 3TZQA 2GF0A 3A1EA 3K8OE 3SMVA 1XTPA 4H1HA 2QJOA 2CFCA 1XRRA 1NUTA 4WZAE 4PHGA 3W2HA 3WRXA 1C7RA 1IFXA 4GZMA 2EHJA 5F5XA 1YKFA 4C14A 1JEYB 1ND5A 4OQQA 3B1ZA 2B1GA 5ES4B 3EK2A 4W6ZA 2G25A 2GO1A 4XAQA 1CU1A 2HA6A 2ATXA 3OLQA 1S0UA 1YJQA 2BEUA 1WHTB 4Q7KA 4EARA 2Z08A 1T8UA 4D8VA 1U8CB 1Q19A 3V4VB 4XARA 3T5AA 5KMGB 1EVKA 2HRZA 3G0BA 1GKIA 1ONOA 4I4NA 4TPKA 4WERA 1FC0A 4I5FA 1O94A 3OCUA 3F2IA 3BH6A 2NIPA 2O8DB 1RWKA 3RKUA 4UZEA 1UT5A 2YMMA 1MAWA 2GD1O 5ULLA 4CNBA 2Y1EA 4ZAGA 5KWJA 4P4TA 1LDYA 1Q0RA 1UJ4A 3A36A 4NIMA 1TK2A 1RI5A 2OWEA 4NAHA 3FJOA 1NATA 4HT3B 1WU8A 3G59A 1FP6A 3EG9A 4PCAA 2B5WA 5EP2A 1PGQA 3WGIA 3LGXA 3GCWA 3GZNA 4Z4CA 4WCFA 3CX8A 3PV0A 8OHMA 1I8TA 2ZUBA 2WV7A 3WLTA 3KSUA 4CMAA 1L3CA 3K0BA 3V4PB 3FDFA 1ETUA 4ND8A 4OH7A 3NORA 1WY5A 4S0XA 5D3KA 4DREA 3UH0A 4F4HA 4IEEA 2N9UA 3OZGA 3LFHA 3NBZC 2WPDD 3RYTC 3I2JA 4BP3A 1ZM4A 4PYRA 4AY6A 1GR0A 1VKNA 5AW9A 4EO9A 4ISBA 2PA3A 4DXDA 1BVHA 4L78A 3NC1C 4W5NA 4AC9A 2M32A 4GLOA 5DOZA 4Z3OA 4C04A 2W6ID 1HLDA 1M0WA 3IVGA 1M3SA 4L5AA 4B45A 1S96A 1K3FA 4FFBB 4JX9A 5FWYB 1S8AA 2JFUA 4DJAA 1AQ6A 3C7TA 3VR6H 4YRQA 4ZU3A 1O95A 4FMCB 3AGPA 2VXOA 2OBYA 3G89A 3NFRA 1UXKA 1EWKA 1BQEA 1U8FO 3QU7A 5DHTA 2A0KA 1HURA 3RYCA 4OLHA 3T3OA 2JCXA 1UH5A 2ZXEA 3WKEA 2J48A 1W6UA 2YNMC 3U4GA 2CV1A 1RRGA 1O96A 2VG8A 1PKEA 4YLYA 2JIMA 1Z35A 3IBSA 1XG5A 2BI7A 2PX0A 4BFLA 5DNVA 3DWGA 2OQ2A 1X7WA 3NATA 5AOBA 2AH5A 4CCWA 3PUKA 1GQQA 1JH8A 3C4VA 3MINB 3JARB 4G86A 4NYIR 3ZHZA 5CB8A 5L51A 4PCUA 2FLKA 4JELA 1Q0HA 1W44A 3CZQA 3NRBA 2AN9A 2YUIA 3W8EA 4ZV4A 1E6MA 5JWOA 2OORA 5G3YA 2O0MA 5L6LB 2FR0A 1DCTA 3HCCA 1SVKA 4E12A 3IV7A 5KNCH 1M34B 5AHRA 1UZAA 3LQ4A 1ZU4A 3OIWA 4WX2B 5B2EA 2R4TA 3B7GA 3IAUA 3JZIA 1EWVA 1G8FA 3BWVA 1EFHA 2C0CA 2NGRA 1XXHB 3SZUA 4CMBA 3PRHA 2JRLA 2I6UA 2X23A 3IESA 5MGNA 3G7NA 5EKXA 4E33A 4DJ5X 2IXFA 1OAKA 5FCDA 3RIEA 1F0PA 3LJKA 2DQSA 1ISHA 2ZUUA 4GZ3A 5EZSA 2FPPA 2VCEA 1FRQA 2CCJA 4WHMA 3QE9Y 4W5WA 3LL7A 3M6UA 4TKVB 1MPTA 3U4HA 1A95A 3MGCA 4W5TA 2C7QA 2ATIA 1U04A 2CDRA 2PKEA 2WUFA 1BJKA 3I6QA 3NAMA 4M0KA 4U3JA 3QQPA 4R2IA 4Z51A 2WSSD 3PNMA 4K9DA 5J2UB 1QF7A 1WUJS 2QW0X 2HC9A 1P80A 2BEJA 2ZWMA 4WI1A 4ZV7A 1V5GA 1V96A 3L18A 1NFRA 3WB2A 4BNVA 4PN7A 3PE4A 2QL6A 1TCVA 4MWEA 2CVZA 4TS1A 1ORDA 4DEXA 1DV1A 1I2AA 4YFVA 1SCAA 1JJVA 2VZ9A 4IJKA 2D06A 1AXRA 4Q1CA 2FRDC 5IAJA 4UU1A 3ZDZB 1KIAA 2HCTA 5I51A 2WU4A 3A58B 3NHMA 2GARA 2PFKA 4EHJA 1GKLA 4F8EA 2H1HA 4CIBA 1LPSA 2DUWA 2GBGA 3HLKA 3PC8C 4IDCA 4JHLA 4F2HA 2E1PA 3ZYZA 2H7YA 1T4CA 3LBHA 5HUHA 1TKBA 2SECE 2VSQA 3O8DA 3HWRA 1G5TA 2GZMA 4LECA 2C7RA 1BWSA 3WFJA 1F60A 2OMKA 4AJHA 1VHJA 1KJWA 2FQQA 1AKMA 3FVQA 1RP7A 3IMGA 2WNSA 4FMBB 4RX1A 2E55A 2OFPA 2IS1A 4UNRA 3RSSA 1T1SA 1MENA 4WKCA 2UUOA 5E3HA 5EEGA 4X8LA 4RS4A 4Y9UA 4G0OA 2DQYA 4TLAA 3Q8KA 1Z0ZA 2HU8A 3PHIA 1JQBA 2N1MA 1LD3A 3IVCA 3JQDA 1X1BA 4YFYA 4NPCA 1GLGA 2BELA 1E3SA 1IUNA 4EJ2A 3N05A 3KXPA 4GPAA 1RZ3A 5AVTA 1L7MA 1VI6A 3V00A 5BPFA 3INYA 3OHMA 3JYNA 4M98A 3FPGA 4X6XA 2UYCA 1XMVA 2BMDA 3D2BA 4XM0A 1LV7A 2ORIA 2QUAA 4QELA 4C1NA 2IC5A 3CLVA 2GEFA 4S1PA 4RJ2A 4XD2A 5SYAA 4E2YA 1QAOA 1I3LA 1QORA 3MAGA 4GLFA 1WNFA 1AA9A 4BXOB 5DKFA 4W63A 3LY5A 1LBEA 2ZYTX 4X62B 2XWJI 2PUEA 1OXTA 2ZYRA 3HR8A 3LFTA 2WT9A 1BW9B 5HG0A 2VDPB 3K9LA 4Q01A 1QRSA 4JKYA 4HJRA 4KFCA 1YJXA 1FL9A 3V2IA 4K2AA 4UHCA 4QTZA 2GJAA 4CM3A 1I3CA 1E9EA 2AF4C 1DC5A 3E1KA 3PYMA 3TMAA 3G85A 1FVHA 2E5FA 3IULA 4KO2S 1H0HA 3D02A 3FPLA 3L40A 2P5SA 2PD6A 4RGQA 1S3IA 2EQ5A 3P0RA 2OZKA 4TWAA 3W3AD 4AO6A 3K09C 4C78A 5K09A 1U8ZA 1E2QA 1FX0B 1OJLA 5TIIA 3OI7A 5THXA 3IUSA 2JGDB 1F0KA 4C6RA 3SIXA 2MYPA 2BDEA 3BXFA 5IC4A 4M8KA 3IAAA 3T5TA 3HR7A 5EE1A 3ND5A 4BMOB 5LA6F 3WV5A 3CYFA 1WP4A 3CRW1 1QB8A 3GT4A 3GXOA 4YAGA 1IAQA 4J3JA 1EKXA 6CHYA 3MJFA 4CKCB 2QGZA 2ZPAA 4U2GA 4JT8A 2WT8A 3MXTA 4ADSG 3LWNA 2FUG1 4JI6B 3L4BC 1W35A 3HY6A 3U44B 4NJMB 3T5GA 3NBUA 4LXGA 2VUSA 1G1AA 2FQXA 3K2QA 1XYYA 3KQQA 3QP9A 4RHEA 5DBEX 1QWSA 5ALKA 5HBGA 4BLVA 1IEVA 1GKUB 3PRKE 4IQFA 4HADA 3KWJA 2VQFB 3N2GB 1NLMA 2RJNA 1NVBA 1C3OB 2QL5A 4EGQA 2J5BA 2OFFA 1SBYA 1V1MB 5I7OA 3GEPA 4NS4A 3KXIA 3QVXA 4FYWA 2R8EA 1KI3A 1NUPA 2Q29A 3PUIA 4WVFA 5EMMA 2CXRA 1SC3A 2N1BA 3EW7A 3HXLA 4Q37A 1YCGA 5IWAB 2P9BA 2GVNA 1BZYA 5BV8A 1WMFA 4KR3A 3ZD8A 2YRXA 2X6RA 5T6BA 4PLHA 4D98A 1VQ1A 1U5CA 1N5DA 1WULS 2JIDA 3CH7A 1A9TA 1CF4A 2I7VA 1DCFA 1DG1G 3UGQA 2YOFA 4YRIA 5C32A 3JZFA 3PF8A 3BCRA 3LLUA 1MA3A 2G9RA 1MKYA 3CZPA 3CKLA 3S2SA 3ZDEA 4YQFA 3UPUA 1VMIA 2A57A 2J41A 1AMOA 3MQ4A 1A2KC 2A9QA 2G8LA 1SVSA 3N8IA 4NHEA 3JW8A 3P7MA 4GI3A 5HMLA 1EDZA 3R7AA 2XZOA 4L8FA 3VNUA 3W9BA 5EUMA 5IVKA 5E1OA 2F7SA 1RVV1 2H07A 2BUAA 1GPH1 3RTAA 1FNBA 1QBKC 1G2IA 4KRGA 1TDJA 2G4CA 2NSYA 2JD0A 4MHOA 3DMGA 3MLAA 4ZKDA 3OFND 3GNTA 2Q5EA 5LXTA 1F3OA 1NI3A 1RLMA 1T1RA 1ZLXA 2A86A 2EF0A 3AFGA 3AJAA 3R44A 1GUDA 4OP3A 1ZITA 1L5OA 3NIGB 3OZAA 3I12A 4H6PA 4OXQA 5AVSA 4BAZA 1O89A 2EG5A 3VAYA 3WLEA 1LXCA 4CUZA 4F2GA 5KTPA 5ISMA 1IBRA 4AUNA 3D8TA 2EBHX 4QNMA 4YJGB 5JASA 2PS1A 1ODSA 3QLTA 4K8OA 2I78A 2ZBFA 3KXDA 3P71T 4JI2B 1HDCA 1OU0A 1XRQA 4A5OA 1QVRA 2E4AA 2YWXA 1UQUA 5FORA 1BGWA 1JTEA 1SBCA 4MQEA 4JA0A 3LIPA 4DQUA 1Q57A 2WI8A 4E4TA 1ZJWA 1M72A 1JDUA 5KZMB 3W6NA 3ONNA 4J7XA 5GM1A 3VR4H 4Q00A 2FWIA 1M67A 3L1IA 3LIIA 1GTJ1 1EFRD 2JIPA 3GJZA 4QUHA 2VDLB 2MSEB 2PX2A 3COZA 3GT7A 1YC2A 4UDYX 4AZ3B 4B81A 1CS4C 2FWPA 3HJHA 3OWHA 4YMHA 5IASA 1TVKB 4HWSA 4QLOA 1HQDA 2HJ9A 3OJXA 3EPHA 3ZU6A 2BJWA 3ZY4A 3ZDBA 1R6AA 1H1DA 1P0IA 1E2PA 1PNTA 1Z7EA 4B09A 1Z7GA 4KRYA 5FO1A 4WQMA 2BMVA 2VBCA 2VXYA 3BFJA 2EKZA 2JBAB 3CF4G 5H5JA 4ZT7A 1MEJA 3ZV3A 4R1TA 1TF2A 1HSZA 2EZ8A 1O0SA 5A6VA 3HN2A 3W3ZB 3OKPA 2GN8A 4QAJA 2ZSDA 3DHEA 3QH4A 1A96A 3TTXA 9LDBA 3REOA 4Z8XA 2YWFA 3RS0A 4YJKA 1C9JA 4DT1B 2OBXA 2X7XA 4QM6A 2B8WA 2AZDA 4JODA 3UV3A 4DNXA 3RV3A 1KEKA 4IDDA 2X41A 1SN7A 4PGMA 3V1UA 3BWCA 5CAEA 3V8EA 1VYUA 1FFYA 4ARAA 5IFLA 2VP5A 3NTRA 4FE3A 5K0EA 2NU9A 2E4XA 2PZEA 3HKEB 2C2XA 3PHCA 4HN2A 2QV0A 5A05A 2XRYA 1SB9A 1Z5NA 3B8HA 3DDZX 1VCIA 1ZJ4A 1E6CA 3KZ1E 4YJHB 2EDAA 4JEHA 5HM6A 5D6OA 2NQ2C 2LCIA 5IM5A 5KYYA 3GLRA 3HU2A 3DTNA 2JFXA 2YJZA 4M60A 4MW5A 5FYQA 5K3SA 3LQQA 4AF8A 4E94A 1G5RA 3R5XA 4M9QA 2XCRB 2TMKA 3EZ6A 4B40A 2Q2NA 3JQEA 1M1XB 2WYOA 3BRQA 4BV9A 2ECOA 4KFTA 4QSMA 2Z4RA 3VH3A 4DRYA 3GEIA 2QT1A 1DC3A 4X84A 3TSZA 1GU1A 3IHWA 4B2IA 4IEFB 2IRWA 3I1FA 1MN6A 2A0YA 2GCNA 4L6IA 4L72A 3NJ8A 1VSVA 5E4TA 4D45A 2P69A 4Q24A 5FLKA 4CLRA 3LY9A 4ITUA 4YRJA 3ZI4A 1GZ3A 2IHVA 3FCAA 3CHYA 3S8YA 4X63A 3SS7X 3SQXA 4DIBA 4LVUA 1CR2A 4B5LA 1Z5PA 4B34A 1OAAA 1XALA 2CCKA 2V7QD 3VSCA 2CEKA 3KV1A 5LBIA 2UU9B 5TJHA 2DWOA 2UXBB 1RRKA 4OXXA 1CETA 2N42A 2YJTD 2VDOB 4UULA 4A73A 3MG9A 4YV7A 2HK9A 1KY3A 2FETA 5DLEA 4B6JA 2ONYA 1G2PA 2R79A 1E77A 3DPSA 3CRVA 5F76A 3ROMA 1QCCA 1ZONA 1VCNA 4PXAA 3SD7A 4XDGA 1CUVA 1E58A 1YDMA 1QHEA 3K0KA 2RAFA 1R6VA 3BH0A 3OUUA 3QTTA 1FYWA 5KS2A 3FMVA 2BY4A 3EARA 1PZMA 2IUTA 3E3OA 5CYGA 3E9CA 5BMOA 1MQAA 2GNPA 3CY6A 2ZRQA 1QIGA 4IFTA 2J6BA 2BGWA 1PTJA 1D1SA 4LHWA 1Y5MA 2BL4A 5AJUA 1UFOA 2CVPA 1Y3CE 3JRXA 1RYDA 4RTLA 3IB3A 1MR3F 3ONDA 4UHEA 2OAP1 5DFAA 2DYKA 2QTFA 4IJVA 1KEPA 4FYYA 2J32A 1A4RA 2GK4A 4MIYA 2C07A 2Y2UA 4R5MA 3QXHA 1QHGA 2Q1YA 2RB4A 4S12A 3DEJA 3FKJA 4EM6A 3WIBA 4EQZA 1EFLA 4PO8A 4HDRA 1X7XA 4G4SO 2P78A 1FDSA 3QEMB 2PRZA 1XJQA 5KX5F 3R4VA 4G85A 2XLCA 3ZYCA 4YJ2A 2MSLA 4JFRA 4DVJA 2BJHA 4UPEA 4MDYA 1JG1A 3CR8A 4LFCB 3W5HA 1YS6A 3ZU2A 4Z4EA 4EY3A 3N8DA 1GILA 3PFHA 5J43A 1VGRA 4Y2XA 4BAGA 4FB5A 1FF9A 1IPFA 3BH7A 4MKGA 5ECWA 3IXMA 3UT5A 2B2XA 4MZXA 1Q83A 3QE0A 4LJKA 4HWPA 4RFVA 4I1UA 4G84A 5ALJA 2CUKA 3EHDA 4FGJA 1PGPA 1JQEA 1TZMA 2ZIXA 1PBTA 3JASA 4NCJA 4D4JA 4TLMB 4XOIA 1LPNA 1NW9B 4BFTA 4YUVA 1NVGA 4LXTA 2HJHA 4D6YA 4RV9A 4DF3A 2ZAYA 2HQRA 2CNKA 2PAAA 3K7EA 4R2XA 4WLFA 5ETJA 1Q6YA 4WACA 3A0RB 2CDCA 2Y3IA 4G37A 1KZ4A 1XCLA 2QX9A 1S2IA 3D6MA 3H1PA 5EPUA 2O8FA 1UOOA 1P2FA 1JU3A 3OSUA 1N7IA 3BL8A 2LZ0A 5DTEA 2C99A 3RARA 5KNDD 2QBYB 1BNCA 2NSLA 2Z30A 1L4GA 4LV6A 1E9CA 1ECPA 4KMOA 3GJ0A 4XVUA 3RHSA 3RSHA 4AIRA 2V58A 4JJ4A 1NJ5A 1NTOA 5E95A 1U1EA 2FR8A 3FNIA 4KQMA 3T0FA 3DEAA 1QE0A 2M1ZA 1G60A 1KXJA 2J85A 2PBFA 1EHYA 2BBTA 3CZCA 1G2QA 3IQWA 4JLMA 1GYPA 4KAFA 1CRLA 2IFTA 2PAFA 1IZ0A 2WOOA 1DUIA 1UP4A 3PEYA 1CDDA 4LMRA 4KE8A 1YK0A 4EVIA 1BVYF 3AB8A 4I5GA 2ZU6A 1AN9A 2B4YA 4OOEA 5A7FA 5H9VA 4TS9A 4FZJA 1EB8A 2H2WA 1ILEA 1J8YF 3SZOA 4JOBA 4HWRA 3ILSA 2ZBVA 3HVKA 3L0CA 4K9MA 1M1YB 1T25A 2R8OA 3T3IA 1SULA 4QM7A 3KAJA 1OZHA 1YCDA 4DMHA 4Q9IA 2A9FA 1PW5A 3VYRB 1RC0A 2DPMA 3NBXX 3HVUA 1GKKA 2IHNA 4A9AA 2B5VA 1SQFA 4U1RA 2B34A 1T9DA 1RS0A 2VRCD 1OPXA 4TRJA 4IDOA 2K5UA 2H1CA 1WIWA 4NEQA 3QBJA 1HDGO 5FAKA 3E9EA 3RS5A 1WSBA 4V1CI 4LYGA 4XWGA 2Q9BA 1R12A 4ZVPA 4RU1A 3GPIA 2MT9A 2Z2KA 4H1VA 2QDKA 1WCWA 1XAJA 3CNQS 1OB2A 4IIVA 1P3DA 3ENVA 1FP7A 2G5CA 3BMQB 2A0FA 4WJKB 2OG2A 1WR8A 3O4GA 1H2ZA 1ISIA 5JD4A 4BQPA 4FYHA 4MQLA 4BQFA 2NG1A 3D64A 3AB7A 1QO0A 2ATEA 2BI4A 3IVRA 3NBMA 3KFVA 3MT7A 4YP6A 2HLPA 1I7SB 3L9XA 2WICA 1BSVA 2OD9A 5EQJB 4UFOA 1PK7A 2NAFA 1R4MB 1EWTA 3FDIA 4IZIA 4OQYA 1DIGA 2BCJQ 1UXOA 1VOTA 2AFIB 2AQHA 3AI2A 3DZ8A 2CHFA 2CHUA 4KVZA 5C1OA 2YV4A 3GUZA 3IR7A 5L6MB 4M1QA 1BKDR 3JTEA 2HIAA 2OOKA 3DV2A 3ZHTA 1IULA 1FJGB 3RVJA 4WY8A 3T1HB 2IDMA 4RMNA 4EBBA 2X9VA 4C5BA 5KVQA 2VPPA 1VRCA 1L4YA 2DWQA 2PH7A 3HCNA 1DXHA 1EM6A 3FWHA 4PRKA 5SY9A 3RYIB 3E8MA 3NHFA 1J0AA 4L76A 3GLIB 1XVUA 4CYMA 3VOBA 4ND1A 2JJMA 1GADO 2BPOA 4L51A 5C80A 1U2GA 3Q6NA 4DL9A 2OCIA 1E64A 2CBGA 3KVNA 4R8SA 5DF1A 3CVYA 3SYMA 2X40A 3M83A 5SZJA 4ZHQA 4KE7A 5CCBA 3R7SA 1XZKA 5A4MS 7AT1A 3K70C 1N3BA 3KOZA 5AJZA 2W2VA 4H7DA 1U0LA 3KEFA 2IJGX 2HBRA 2GN0A 2Z2ZA 4A23A 2QRKA 4OHMA 3SBXA 3A06A 4EK9A 3GLUA 3G0CA 3CCCA 3IIEA 1TL7C 3MHPA 4XQGA 4BX2A 4IGAA 3FOZA 3CTMA 3SC2B 2JARA 2DHDA 1OWOA 3EGWA 3ZE6A 4B47A 5KOJA 1PUJA 3HXPA 4LNUB 1LDNA 1SRRA 1HT1E 2IP2A 4B32A 2Q5JA 1W30A 5KCMA 1ESDA 1FY2A 1RJ9B 1SHTX 1Y34E 2FFAA 3C85A 1OREA 2BI8A 4QBGB 4WUTA 2WHXA 4HNUA 3GF4A 1YMUA 4MJ3A 2SNIE 4KQFA 1KS9A 3UOWA 3ZDCA 2Z2IA 3RUDA 5HA5A 4GUDA 1IOZA 5BWOA 3N6RA 4O1IA 2DETA 3BSFA 1J06A 4GICA 1N0VC 1PQUA 1CZHA 2X4IA 2VOJA 4PBTA 4XDHA 2R25B 4OHZA 1BGVA 2OAGA 1ZGBA 2OEPA 1XTUA 2ZJ6A 3D6VA 4OBBA 2RIPA 5HRUA 3TUJC 2GYVA 3DE5X 1YZVA 3IVXA 1OI3A 2GM9A 4X7RA 4LJAA 3GUHA 1DKRA 2GEJA 2HRBA 1D2HA 2O3SA 2OD7A 4WIAA 1OU4A 4MW0A 3CB2A 3LX6A 3MSXA 4LZWA 1RI4A 4LJ4A 1E0AA 2Y0PA 3NHZA 4MB6A 2Q6KA 1NP3A 5KWIA 1P73A 4YMGA 4JLBA 1ZMRA 3PGA1 5CNKA 1VMDA 2VF8A 1GL9B 1X94A 2OWDA 4PGFA 4B80A 5A9SB 4ZAXA 5ELXA 2GM5A 3H5VA 1IPEA 1ZMBA 2GEBA 3THWB 1RZVA 2DFPA 4RK0A 4MYCA 1E2BA 4WMLA 4OGLA 2CNWA 4P84A 4E0BA 1YIOA 2JH3A 4PLGA 4F12A 3FSRA 1CULC 3S3TA 1T2DA 2QTTA 3ZGLA 4DYDA 4QO7A 3AUJB 4JBGA 2OZVA 4U6SA 2JK1A 1Z16A 2CN1A 3O9MA 4QT0A 3KJIA 1TADA 4AWXA 2IHTA 3UAGA 4TSFD 4L0QA 4QQRA 4JFAA 4IZHA 4ZZ3A 4DW8A 1YDFA 4DAOA 3OEHA 2GBLA 1GNSA 5BMVF 1QGOA 3GDGA 2RH8A 2QAGB 3DL4A 4KWEA 2FWBA 1CUFA 1MQ9A 3HGTA 2WZCA 1CUEA 4J6FA 2K7ZA 1MVNA 1XZCA 2PT9A 2QZ4A 3FWZA 1H2YA 2Z56A 4YRDA 2X4GA 4ESVA 1GA6A 3V1YA 4MR9A 5JWRA 3COPA 2QLBA 4B6FA 1T8PA 3JQAB 4W99A 3K32A 4CUJA 5I4CA 4D4LA 1JG4A 2Z4TA 3JWEA 2I1WA 1QO7A 3H2GA 2I7TA 4LMBA 3PNBA 2V5VA 1K9SA 2GZ1A 2XT0A 5TEWA 4F56A 5ALZA 1Z63A 2H8GA 3F8WA 2F2TA 1ZRNA 1D0VA 4LV5B 4KXWA 5TMBA 3EVAA 1P60A 5CVJA 2AJBA 1BVUA 5AWFC 2PRYA 2WU3A 4RKEA 4BUJA 3GJSA 2NACA 3VOAA 4H77A 1BQ4A 1XTKA 1YKSA 1BXGA 3C43A 3QKSB 1PQPA 1O57A 2GKSA 4HMPA 1BEUB 4R1PA 3B3FA 4GOOD 4NYMR 4X3CA 5CXSA 3C98A 5F1PA 4B5KA 3IE1A 3LO5A 3CO0S 5EP3A 1IHPA 1CVIA 2CW5A 3HA3A 2BMWA 3OT5A 4RCYA 2EX4A 5CP8A 2O8CB 3KXKA 1NVMB 3WDLA 4EENA 1VJTA 4ZVQA 4DQLA 2W83A 3B53X 1MH9A 4C4OA 2VYFA 2M6RA 3GQBB 1J5XA 2FDXA 2I6XA 1L8OA 4EGJA 4GZLA 3FLAA 2FN8A 1PR3A 3LDAA 3ROQA 1QP4A 1EFTA 3WK8A 4OL0A 1M54A 1SC6A 2HGZA 2GLXA 3C16C 1K6XA 2AN1A 3PDIA 4HSGA 3PTZA 1ZA1A 5C5IA 4ENVA 1IZYA 3MD9A 2X4LA 5KC9A 3ZGNA 1XZHA 4DA4A 2EGUA 1YR9A 3D54D 4DPLA 2D0DA 4Q3DA 4G0ZA 4A8HA 4BQRA 5JFGA 3SHFA 2O54A 1T5HX 3KSRA 4W1PA 4NDZA 2PT6A 5A5VA 1J2RA 2J0UA 3KQSA 1KO8A 4H7EA 2LKCA 3BJMA 3OLCX 4JBLA 3VGJA 1N32B 2C7PA 1CCWA 1M5UA 2R6DA 3CVJA 4QA9A 1E1DA 3L46A 4NJOA 3HUTA 1KMMA 2OCBA 4G07A 4BFUA 4CL0A 4H3HB 2Y71A 4D0GA 4CWAA 1KXZA 4XJVA 4XX1A 3D4LA 9MHTA 3HDQA 1Q74A 5JW6A 3GRFA 5JCOC 1IXSB 2QT9A 3VZPA 3QUBA 3P9NA 1Y1KE 1Q91A 1U9YA 2DJ5A 3VKHA 3RUFA 2FJUA 1VKJA 1XC7A 1PD0A 2P3QA 3OY2A 2IOHA 5IVIA 2A58A 2H52A 2PXCA 2R96A 3LT2A 4P80A 1CY4A 1NN5A 3NYWA 3E9MA 1KDYA 1KMQA 2MSDB 3O7MA 3L02A 1GCOA 3AY3A 2FY8A 2PGDA 1JR3D 4AKTA 1MEEA 4YRFA 4ERNA 1FDTA 1X80A 5DT2A 5JZMA 4M1WA 4AZTA 2VHTA 5AMXA 3FNGA 3UAOA 3WLAA 1XRNA 2I2BA 1QFZA 1XLTA 3ON5A 2V4UA 4GOMD 2CXQA 1Q92A 4RA6B 4EUSA 4PZCA 2WTUA 4JT4A 1G5QA 5FFFA 4OKIA 4C08A 3FWNA 2Q0QA 4JXJA 2GRUA 1PWHA 1UPXA 3KPUA 4EX6A 2X76A 3WHPA 1XVVA 4YMVA 4XGQA 1T35A 1QHSA 1PSZA 1WB6A 1BX0A 1U5AA 5HRCA 5BW6B 3QEKA 3M3DA 4K9SA 1MB0A 4YROA 3FUXA 4FD3A 2P40A 2COEA 1J8QA 1P2GA 4HVLA 3G1UA 1J5EB 4HGOA 3FYUC 1EDBA 1WDWB 1W76A 1ZA2A 3LXXA 4FDLA 2GCOA 2JAQA 3GAMA 4PICA 3M1YA 4XCQA 3R7WB 2QN3A 3U1VA 3OMXA 5FUQA 1GZVA 4TYPA 2QGNA 4Y2YA 1VL0A 4K81B 2JHAA 2XUIA 2G28A 4MP3A 1HTBA 1C1HA 2OZLA 2H5LA 2JFGA 1T0HB 3DD1A 3NHKA 1UKYA 521PA 1J2UA 1Y80A 3ZZNA 5K8CA 4FYXA 4MWTA 1M76A 1PP4A 1YE8A 3CKYA 4NZOA 4R68A 4ZU1X 2H5EA 3JALA 4QVGA 1SC4A 4U5XA 2YV3A 4FOOA 3JQ8A 1Y1QA 2E82A 1WZIA 2YTZA 2J9GA 3H2KA 2VTVA 3MSCA 1CLEA 1S9DA 1JKMA 1OTYA 2H08A 1RLTA 1XCGB 2FA9A 2YY6A 4NPAA 4CV0A 2PMBA 1Z37A 3MWEA 5LC1A 4RACA 3C3BA 3CFYA 2FG5A 1J39A 3AW8A 3LZDA 4WKOA 3E9DA 2ZRHA 5H80A 1VKZA 3NH9A 3WAKA 5JZSA 2FPKA 2HIHA 2WSLA 4QFCA 4CQMD 1MLDA 5EAIA 1Z83A 2GN9A 2W2KA 2JIQA 3MUNA 4Y6PA 5DLYA 4UTNA 1IM8A 1GRCA 4JZYA 5BR4A 3FYHA 1YHZA 4Q19A 3O47A 3G6KA 2R1VB 2ZZKA 3T34A 2YJ6A 1IPHA 4QOJA 2X3UA 3X43A 1PKXA 4IH9A 3L82B 4RWEA 1TUBB 3BQNB 4MEAA 1OHHA 4IRMA 5G4LA 4QRHA 4ITVA 5EQTA 2HREA 5CIQA 2ZE5A 3NONA 2JEOA 4JASB 1RLUA 2C54A 4Q05A 5E6RB 4CGZA 3NEAA 1V1JA 1M8FA 5FT9A 2C5LA 1CZUA 3E9NA 2W70A 3UGTA 3QKRA 3AZQA 4HNHA 1GFWA 3RK1A 3GJYA 4DZTA 3O95A 3WGNA 3ESXA 1A8UA 3U16A 4U7PB 4KGVA 4EHAA 2JJ8A 3EZ7A 3PX2A 1Y1PA 4I8IA 4F7WA 1MP0A 4FGZA 1ZX1A 4NESA 1EA7A 4DWJA 4EGAA 3EUWA 1R0LA 4N5NA 2BSQA 3IAM6 2B2CA 2QTNA 4B3HA 4QJBA 2CKDA 4BBZA 2EC5A 2M98A 2X9GA 5IT5A 4XYMA 1F2VA 2XTAA 5FTNA 1L4UA 3T3EA 4CG1A 5HRAA 5JTUA 4RZIA 1H65A 2A4MA 1MX3A 1W25A 1CERA 3AFOA 3VDNB 5FULA 1OZ0A 4JDPA 3UJNA 3E4CA 2JLRA 3ANLA 1QTQA 3OHPA 1KBQA 3J7TA 3HKDB 3BN3A 1PBNA 4OAPA 3PGLA 1LPMA 1Q0ZA 4BKUA 3WYFA 4D3ZA 4OI2A 3JQ9A 2QIPA 3KR1A 5FTWA 3OQHA 1H4TA 1U11A 2VYVD 1YRYE 2I8LA 4EO7A 5KX5A 2HMTA 1DOAA 3SHTA 5EJAA 5BQFA 4UNNA 2H2HA 1M9NA 1H6DA 2Y0EA 1R9GA 1TYAE 3BGOS 1X9HA 2X0EA 3LPAA 2QE7D 2P4SA 4FCWA 1CR6A 4H0CA 1NG1A 4I1RA 5CYOA 3GEEA 1ATIA 4PC3A 3ZBUA 4BVBA 5K05A 4FFLA 4MUMA 3IBYA 1RPJA 3UAZA 3HKBA 4M9XA 5KTNA 5JDCA 1H5QA 2NSHA 2ZUFA 1DWUA 1E99A 5LM3A 4N18A 2QYHA 2NT4A 1YQGA 3NWOA 4X7MA 3A1SA 3HEMA 3S2UA 4BKQA 5HQ3A 2ZSBA 3WMXA 4BNHA 4P93A 5IUJC 4BNFA 1RJWA 4ZVLA 3CLUD 1PJCA 4MIOA 1W46A 5GGYA 2IYZA 5T8KA 1ULUA 3QEBZ 5JS1A 5KWVA 4HEJA 3TNYA 2ZRMA 5TQ0A 1LF5A 1NQWA 1M2NA 3IQIX 3KJZA 2XIQA 4U9HS 2GF2A 1BX3A 2J7PA 4DJFC 2QNIA 4GMKA 3OAAD 1US8B 1F8GA 2WAMA 4C89A 2HPHA 3EASA 4JYCA 3I0NA 2JEZA 3P9YA 4L22A 5E7MA 4EP1A 1DIBA 3R0QA 2F1IA 1BG6A 4X7BA 2C77A 2YXDA 5I9IA 1G8PA 2ZQ5A 5CW2A 2Q9CA 3D6NB 3BILA 4XYBA 4ZRDA 1TAUA 4C4YA 3LU1A 4Q1VA 2VJLA 5EHIA 4E7OA 4KITB 3CNBA 1DX9A 3SCZA 4D3XA 1C5KA 4L16A 4R1MA 1FDIA 3HCRA 4OM7A 1O6GA 3QY9A 5JFOA 3EZGA 1VHLA 3B6JA 3BWBA 3EUFA 4P53A 5JALA 3NWPA 2XGGA 4R69A 4A91A 1HFWA 3FNQA 4HYQA 5ALLA 3GUCA 5AHWA 1XZAA 2PXHA 3WRVA 3PJEA 1C8KA 5ESRA 1XEXB 4AJKA 2OVFA 4PLYA 4UASA 5L3VA 2H3EA 2VJOA 3RVQA 3IEUA 3U40A 1DHRA 1EFPA 3AF5A 4P7KA 5ADUS 3BK7A 5EKDA 1DP4A 3WLMA 3DCJA 1Q7GA 3BQ9A 4HRXA 3SIRA 1QONA 3NVMB 1G7RA 2IGBA 3OECA 2ZYDA 3CLHA 3N1UA 3UUWA 4BVHA 5TPZD 3FLEA 5F9FA 4HFJA 1C9YA 1FXUA 1UAYA 2X9LA 5FA5A 5KOYA 2R9VA 4BATA 4B2YA 2HUPA 4F8JA 4L75A 1KTVA 4P33A 5LMNB 3A14A 5L45A 4WNIA 1WPRA 5J2TF 4L4XA 2XNCA 4CIWA 3R5FA 1LLFA 1N5IA 2EFGA 2VRBA 4KV7A 3N87A 1WV0A 3BKWA 5DK6A 4MI1A 1PK8A 1N5JA 1P9OA 4MUKA 5EXDA 3SKVA 4OK5A 3X0DA 2IPLA 5AVJA 4D99A 4D9EA 4DG8A 2KSQA 1SVMA 2NQTA 3INRA 1B6GA 1TLTA 3A37A 3ACCA 4BJHB 1Y63A 2C1XA 5EYPB 1MJNA 2PUVA 5LLSA 3GU3A 1NVFA 2ZT6A 2NO7A 3LZ6A 4GWLA 4J4HA 1SWVA 2IU4A 1K3UB 4RZQA 4N7JA 5DGXA 4LJYA 1C2TA 5FOQA 2BHTA 3VM6A 5AW5A 4EJ6A 4RKFA 1Q84A 3CLSD 1U7ZA 1MT3A 3DWIA 3NKVA 3TPCA 4MCJA 4BY9E 4O8CA 4CF5A 4RAOA 3NUGA 3V7WA 5BSVA 2F3TA 1HR0B 1Y8CA 5JXJA 4HRYA 4Z9FA 3WSVA 3HA5A 1A7KA 1V8DA 4U0KA 4JVSB 3LA6A 1J4AA 1KERA 3E0QA 2QR5A 1AQJA 2IEIA 3HV2A 2UXCB 1AZSC 1KFCB 2PLAA 4G63A 3HACA 4XX0A 3EEBA 3V34A 2NUPB 4EJFA 5LMCA 2C2KA 1RJFA 1RWWA 2L82A 1XEFA 3ADCA 2GFIA 3C3WA 3WNQA 1YA4A 5BWCA 4GGMX 1N7JA 4PEVA 4D0RA 3BMCA 1GXSA 1N6LA 2EZ9A 2YH2A 2IYOA 4OV6B 4PSCA 5F5LA 5AUOB 1W581 4O5AA 1QGAA 3RK0A 3ORQA 2BKLA 1EP3B 3IAS6 1BWPA 3EFEA 5FA6A 3NP7A 5FXMA 2BW0A 3PCRB 3RFCA 4BLOA 7GPBA 3EZ2A 2WUEA 3O8OA 2POQX 3I8SA 1CLUA 3OLXA 4EKEA 1E96A 2G1UA 2HRCA 3D3KA 5DISB 3W6UA 4G5HA 3ZE0B 5FV7A 2JIRA 1AHHA 4D43A 4RJIA 1QHIA 1BJRE 1T4GA 5CIWA 3R9IA 1N2SA 3ROTA 4RSRA 1BO6A