3PP8A

2.1 angstrom crystal structure of putative oxidoreductase (ycdw) from salmonella typhimurium
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
312
structure length
310
Chain Sequence
SNAMEIIFYHPTFNAAWWVNALEKALPHARVREWKVGDNNPADYALVWQPPVEMLAGRRLKAVFVLGAGVDAILSKLNAHPEMLDASIPLFRLTGMGLQMQEYAVSQVLHWFRRFDDYQALKNQALWKPLPEYTREEFSVGIMGAGVLGAKVAESLQAWGFPLRCWSRSRKSWPGVESYVGREELRAFLNQTRVLINLLPNTAQTVGIINSELLDQLPDGAYVLNLARGVHVQEADLLAALDSGKLKGAMLDVFSQEPLPQESPLWRHPRVAMTPHIAAVTRPAEAIDYISRTITQLEKGEPVTGQVDRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.1 Angstrom Crystal Structure of Putative Oxidoreductase (ycdW) from Salmonella typhimurium.
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Oxidoreductase
molecule keywords Glyoxylate/hydroxypyruvate reductase A
total genus 99
structure length 310
sequence length 312
ec nomenclature ec 1.1.1.79: Glyoxylate reductase (NADP(+)).
pdb deposition date 2010-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3pp8A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3pp8A01
1TT7A 1NWHA 1GV0A 3WMWA 5ILOA 1M66A 3GDFA 3MJCA 4CR8A 1XA0A 1U28A 1AGNA 1QR6A 4GX1A 4OAQA 3E9MA 1QYCA 5JCJA 3PJDA 3GPIA 4NR0A 4CLOA 3JYLA 4YYZA 1YDWA 3TOXA 4CMCA 1ZH8A 3W4JA 5HS4A 4JBIA 2PZJA 3D5TA 3PYLA 3GFGA 4L76A 4CLDA 2WWRA 3JD4A 2Y67A 2G17A 1PGPA 2BI8A 4BNKA 2UV8A 3BXXA 3ICPA 3S2GA 1E7MA 4PCVA 5L7TA 2BKAA 3VKVA 1NFFA 4OQYA 1PJ2A 3DZIA 2EV9A 4XB1A 3EDMA 3NV9A 3EZLA 1E92A 1PJSA 1XSEA 1F0YA 2GLXA 2EKQA 5DCWA 1ZXLA 1GUFA 1NVMB 3COSA 2CZCA 2I9PA 2Z1NA 4UAGA 1AUPA 2AG5A 4FIZA 1NAIA 3RKUA 4YRBA 3HFSA 1HTBA 4Q3DA 2GN6A 4DRYA 2R6JA 1LDGA 3GVPA 3ZW9A 5AOVA 1FDTA 3ZHZA 1P44A 1GEEA 1JAXA 3NDIA 3VPXA 5JXWA 1RPNA 1Q7CA 2VYND 4ONEA 4XZ3A 3O8QB 5G0VA 4LK3A 4MVJA 1H9AA 5L53A 4JROA 4ZQGA 4BNJA 4QECA 3PPIA 2C7GA 1PQUA 4J2HA 3JYQA 3E5RA 4R1TA 3K30A 4JCOA 1S6YA 1K6XA 3H3JA 4IJKA 5T57A 3GRPA 3F1LA 4KQWA 4ND1A 4W82A 3RCBA 1KVTA 1P0CA 1Y9AA 2YJZA 3CMCO 3GVIA 4YAKA 5L4SA 1HYGA 1ULUA 4ESOA 4RZHA 4U5QA 3DMYA 2X0NA 3RBVA 1B16A 1R4MB 2VUTA 1RM5A 2X9GA 1T4BA 3M1AA 1VKOA 5EIOA 3QSGA 5I7SA 1PTJA 3UGKA 1PL7A 2VHXA 1YB4A 2JFGA 4MDHA 4O59O 1UP4A 5I8ZA 4J4HA 2QIOA 3D3WA 4UEKA 3ZNOA 1M2WA 1M75A 2DBQA 3GN1A 4EGFA 5A9SA 4WASA 4Y9DA 1VPDA 4HFJA 2DFDA 3OJLA 4II2A 3S2IA 3FWNA 5ILGA 3WWZA 2HK9A 2VOJA 3HWRA 2UUPA 2HSDA 2Q1WA 4BNGA 4XGNA 4S1VA 1SBYA 1UXGA 3VH2A 3ORFA 1E3LA 1YB5A 4K6FA 5FI5A 3BMQB 4FFMA 4PRKA 4GX2A 3OIFA 5U1PA 4ZQFA 3KZVA 3PYMA 3KYDB 5TRTA 2VZ8A 1LLQA 3GDOA 5C7IO 5I7VA 4CM9D 3EZYA 5DZSA 1T1RA 3ZWMA 2G1UA 4DYVA 1PEDA 3GGGA 2X5OA 1V3TA 2HCTA 5HM8A 4IDDA 5EQFA 5JS6A 5LDHA 1QLJA 4IDBA 4PLFA 4D3FA 3I9LA 2PKQP 1KC3A 1IULA 1Y8RA 4Z6KA 1NR7A 6ADHA 1X7GA 2J3KA 3ANMA 5ITVA 4FCCA 1L7EA 4CLRA 2WYWA 1E7QA 1UXHA 2GNAA 3DBLA 3I3OA 3I52A 3LDHA 4J9UE 4MVJH 5H81A 4M8SA 3BTOA 3DBRA 4RQTA 4BO9A 1I2ZA 3AK4A 5AXCA 3HNPA 3VZRA 5HBRA 4DQUA 3UF0A 3IC5A 4IQ8A 3ZNNA 3BMOA 3KSDO 4E2WA 3GC6A 4DIFA 4PLGA 2NWQA 4Q3AA 1YONA 3U09A 3FSRA 3IS3A 3JQ6A 3OEWA 4A0SA 2EGHA 1E5LA 1T2FA 4ZQBA 3MTGA 4FR5A 4O5OA 1QXSA 3GZNB 1TEHA 1LI4A 2P4HX 5GZ6A 5IZCA 3FCOA 4HNHA 4K26A 1PL6A 1EFKA 1PS0A 4QO7A 3WLEA 3WQSB 1EVYA 3IL2A 1FDUA 3WOHA 3H9JA 4DMLA 4U0JA 4GAEA 4BNTA 3CZRA 3KTDA 2Q2WA 4LISA 1RM0A 1SOVA 1A27A 1K6IA 2UUOA 1LC0A 1VJ1A 3ROKA 4D3DA 4WK6A 1ARZA 3QV1A 1ZSNA 2I99A 5A3JA 3CSDA 3K8ZA 1SCUA 1ZZEA 2AEFA 2NQTA 2O50A 4YA6A 4GX0A 2O7QA 4CM9A 4BKQA 4DREA 2GSDA 3OQBA 5F5NA 3VZQA 3L6DA 4RPGA 1U3WA 5TJHA 3IJRA 3JQ7A 3VTFA 4XYEA 4GVXA 1M6WA 3IOYA 4Z0PA 1E3WA 3WFJA 1H6CA 3WMXA 1GL3A 3Q0EA 1HL3A 1HSZA 4EJ0A 4JX8A 1SB9A 3HZZA 5L45A 1GCOA 4JXKA 1JVBA 2AQKA 4M89A 4EI2A 3GVHA 3BHIA 4PZEA 2HMVA 4R1NA 1UXJA 3VKUA 2PTGA 3A9WA 1C14A 3I6QA 4URFA 4E5YA 3E82A 1UP6A 4JP3A 2I3AA 4UUMA 1ZO8A 2PK3A 3VH3A 4FDAA 1J5PA 3DFUA 2X0JA 3BAZA 2QZZA 4LVCA 4YT5A 2A35A 1A9ZA 1IPEA 4DVJA 4CMHA 1LDYA 3NGXA 1B8PA 2FRDA 1JDJA 4OKIA 4XKJA 3ZV4A 4PFJA 1U7HA 4DGSA 3SXPA 1NNUA 1ISHA 1YGYA 3I9KA 4YB8A 1P77A 5JBIA 1MXHA 2YV1A 3GHYA 3HJAA 1E3IA 2FSVA 1B14A 4BL5A 2O3SA 4N5NA 1HWYA 2VYVA 4RPKA 4E2XA 2FR0A 3KYCB 4Y8VA 4GL4A 1GFSA 1JKIA 2RIRA 3GAFA 4A2CA 4MVJG 3VPHA 1TB4A 1BMDA 5G0UA 3V2HA 4IGFA 5MDHA 2UVDA 4WLFA 1Z7EA 1B8VA 3JQBC 3N74A 4PVCA 4R9SA 4OOEA 1BRMA 3ADPA 3D4PA 4RPHA 4I8XA 3SJUA 5F3RA 3QLJA 1Y5RA 1DDOA 4UVGA 5KTKA 4OGWA 2WDZA 3K73O 4J1TA 1MG0A 3RUEA 3IUSA 2C5EA 2IZZA 4RGBA 3KEOA 4XYLA 4HP8A 2Y93A 2WE8A 1EDZA 2ZQZA 1B8UA 1YL5A 5F1PA 5JSFA 2DUWA 4WCFB 2ZK7A 4XD2A 4D41A 4WEOA 4XRGA 1V3VA 3SLGA 3DZGA 2RBEA 3AW9A 4CL8A 4J0EA 1PWZA 3RQSA 1Y8QA 1YL7A 4E33A 4Z0HO 4ZVVA 4P38A 3ZU4A 2Z1MA 3GK3A 3EY4A 1T26A 2IEBA 2W2LD 1WLYA 4UUOA 3KB6A 3JCZA 1ZBQA 1SC6A 4QEDA 2B36A 3AY6A 1YS4A 4QFDA 4WECA 3VH1A 3DBRB 4BGEA 3H5NA 1ULSA 3L6EA 4E4YA 3ZWWA 4FS3A 3H2ZA 1H6DA 1P31A 2ZYGA 4RVHA 2X9NA 4QQRA 3NTOA 1MG5A 3ZU5A 3ITKA 1VJTA 1BG6A 1GQYA 3D64A 1VM6A 3LYLA 2X0IA 3JD0A 1U4SA 3KLMX 3TDKA 3T7CA 3T4EA 7MDHA 4CLRB 4L4XA 1BDMA 4N5MA 4R5HA 2VRCD 3LLVA 1E7YA 4H15A 2P4QA 1TLTA 4IPTA 1DC6A 4JN6B 4OL9A 1ISFA 3PWZA 4HWKA 5A5FA 1HE3A 1MB4A 4DL9A 1PJ4A 2B83A 2PD3A 4ND5A 4ND4A 1F8FA 1IOLA 3RUHA 2RAFA 3MJTA 4BNUA 1L7DA 2JCVA 4WLOA 4DC1A 4GWKA 2B4QA 4BKRA 1U3VA 3OA0A 2W90A 1NASA 2VCYA 3D3WB 3ZGYA 4Z9YA 3K2BA 4ZJUA 2PGLA 3VPFA 3QVSA 3GG2A 1XU7A 3DZHA 5DOZA 1HDYA 4B7XA 4OXNA 1EBFA 2BD0A 2CDCA 4D46A 5KOIA 1HZZA 3BMNB 3V8BA 2NSDA 1ZK3A 1H94A 4UUPA 5H83A 3JQCA 3VZSA 2EJVA 3EVTA 3G79A 5GZ1A 4LW8A 3DBHA 3IIEA 1UAGA 1R0KA 1B26A 5A05A 4EJ6A 4MINA 4LGVA 1Q2XA 5COBA 1J4AA 1P1FA 1KEVA 4YDRA 4FFLA 4KDFA 1GEGA 1KBZA 2WJPA 3PXXA 4ALMA 4R68A 4BOYA 2Q99A 1QYDA 5TJ9A 3TFQA 2BI7A 3VH4A 1MLDA 3ZDFA 1LRKA 4NG5A 4YCAA 1ZMTA 1EMDA 4E32A 3DHYA 1NX6A 1ZK0A 4NHEA 4I9NA 4A10A 1BHSA 4WCFA 3NYWA 1YQGA 3AI2A 1NQOA 2DAPA 2E37A 1QYWA 3Q1LA 4L0QA 4AVYA 3RKRA 2O3TA 1S7CA 4J6FA 2IXAA 1C1DA 2VT2A 4CMIA 2OXIA 5T8KC 3W8DA 2WYUA 5JY1A 1H2HA 3DB2A 1I32A 2EHDA 2YQ4A 1AXEA 1I10A 5A3VA 3WYBA 3C7DB 1DBVO 4N7RA 1Z6ZA 3NT4A 4AJIA 3CZMA 4NU5A 4Z0TA 2GYYA 1YO6A 2FHSA 3A06A 3LT2A 1T25A 1K3TA 3B1KA 2NNLD 3S2EA 5KVSA 3TSCA 1PJQA 2E49A 5JCJD 3F5QA 3L07A 3V2UA 1F8GA 4CLXA 3ENNA 3AOGA 4ZGWA 1U1IA 3ETEA 3ICCA 1EFLA 3Q9UA 1R4NB 4AJOA 1C1DB 4CMIB 4YT4A 1N1EA 4MP6A 1DFGA 3Q3CA 3PQDA 3QHAA 4KUEA 1B7GO 4J7XA 4FOSA 4LMRA 4LN1A 4OH1A 2C07A 2D5AA 4BV9A 2QRKA 3JQDA 3MOIA 4M55A 5G4LA 4TZTA 1XR3A 1MUUA 3HDYA 1AHIA 2YHUA 3GY0A 3WGHA 3DO5A 5L4NA 1YE3A 3WGTA 1JU9A 2HMSA 5CEFA 1EQUA 4HNGA 2NV6A 4U8GA 1TT5B 4RVSA 2HKIA 3D5QA 4NFSA 3AJRA 3H8VA 4U0KA 2VUUA 2JHFA 2HAEA 3LVFO 4RPLA 1HDXA 5IDQA 4HFNA 4FJ0A 2DBRA 3IP3A 4WOJA 3WBBA 3TNLA 1HF3A 4BO3A 3F9IA 3GA0A 3INRA 3NDJA 4G2NA 1Y1PA 2BFPA 4MPDA 2P5YA 1R0LA 2FZWA 4MVJM 1QSGA 4IS3A 1U2GA 3FPCA 1JW9B 3LC7O 3TRIA 4PG8A 4JBGA 4M49A 2I76A 3FN4A 4RQUA 4BNFA 5A9TA 1I8TA 1PWXA 1F06A 3DBHB 1U7TA 3FNGA 3JQFC 3UAGA 4DLAA 3DXFA 5TC4A 1N5DA 4KMSA 1SPXA 2V6MA 4LRSB 4AL4A 5CAEA 1PS9A 4UEJA 3CUKA 4XA8A 5DP2A 4OM8A 1MC5A 1WPQA 4YJHA 1VI2A 2VWHA 4C7JA 1Y9EA 2CDAA 5CPFA 3DDNA 1XKQA 2Y1FA 3CMMA 3WIDA 1P74A 4CODB 3JYNA 5AQ1A 5IN5A 3TFOA 4H7PA 3DAPA 1G0NA 3QVWA 4NIMA 5A03A 5JAQA 3RUIA 3I1JA 3Q2IA 4F6CA 3ZCXA 3DEYX 4BGUA 5TF4A 4CV0A 5JFOA 3KO8A 4WPGA 4KOAA 3OJEA 3PHHA 1EVZA 2GUGA 4P8RA 4DIOA 4XQ9A 5ES3A 1P3DA 3OQ6A 4XQGA 2O2YA 4AJLA 1KETA 1PZHA 2X86A 1IZ9A 4BO1A 2HRZA 6LDHA 4J3FA 1O9BA 3BTUA 3NDRA 5GY7A 4RVFA 3FD8A 4DQVA 3FBGA 3STHA 1WW8A 4AJJA 2NM0A 3GFBA 1X15A 3MJVA 1ZK2A 1HXHA 1HRDA 5FWNA 1A71A 2JAPA 4KWHA 3OHSX 3KBOA 3K9QO 1E3WB 3UXYA 4NI5A 2VQ3A 3WSVA 4BV8A 3EHEA 2P9CA 4RLSA 2O4CA 3PFFA 5GMOA 4UVDA 1JQBA 1YH3A 3I6IA 4J1NA 2B4TO 3WYCA 4HV4A 2GCGA 4YACA 3ETGA 4NK5A 3CE6A 4AJKA 2C82A 2X5JO 1C3VA 3FI9A 4IINA 2H6EA 4GGPA 4RVUA 1KS9A 2C54A 4PLTA 1TI7A 1MGOA 2JJYA 3WSWA 3FTNA 1UAYA 2HO5A 3HSKA 1ADFA 2YDYA 1E1LA 3GUYA 3PVZA 2GN8A 1X1EA 2V6BA 4R01A 4ZRNA 2IYOA 1HE5A 5I9NA 1ISGA 5AYVA 5KVCA 4CPDA 1K5HA 5LCXA 3RAJA 2VHWA 5FI3A 4I5DA 3WWYA 1BXGA 2P5UA 4XYBA 4TRJA 2XPCA 1MFZA 3TPCA 3UFXA 1F14A 2FWMX 3WBFA 4GH5A 4IJUA 3NX4A 1KVQA 2C5AA 3TZ6A 2QQ5A 3U4IA 2X8LA 4XDZA 1MXFA 3AM4A 4RCVA 4NDNE 4B8ZA 3K5PA 3JSAA 4KUHA 1W8DA 4RVGA 3TOZA 4L9RA 4TRMA 3D4OA 1I5RA 5EINA 4FB5A 3CTMA 1DHTA 1O6ZA 4KTVE 3GGOA 1T4DA 3I9OA 3JQAB 4FQ8A 3IKVA 4YJGA 3TF5A 3FR8A 1BXZA 2UAGA 3AUSA 4JIGA 4XQCA 1E1MA 3BMCB 1NHGA 5KKCA 1BW9B 3I83A 1PQWA 2BF7A 5JC8A 4YJDA 4BNVA 1A4UA 5KWEA 3PDUA 1Z82A 4E5PA 2ZIZA 4NFHA 1JWBB 4R3WA 2OO5A 3JYPA 5IAAA 3E48A 2X0RA 3TZKA 3DWFA 1GY8A 1IZ0A 1NTOA 3GVCA 4J7CA 4YJFA 2J3IA 1L1FA 4P4NA 3WJ7A 4E2YA 4WCFC 3DOCA 4ZA2A 3ZU3A 3H5AA 1ENPA 1UP7A 2JAHA 1O0SA 2VZ0A 3EC7A 3ZWAA 4G65A 4K1LA 1I3NA 3FR7A 3LT0A 5JO0A 1QV6A 2A92A 1A7AA 3C85A 1G1AA 4NK4A 1CQIA 2QHXA 1LLCA 2DLDA 5DT9A 2ZYAA 1DEHA 2CD9A 1YQXA 3P19A 1CIVA 4BMVA 1GUYA 1HKUA 5H82A 5F1OA 2RCYA 4HBGA 5DULA 4DPLA 2B5WA 1CEQA 1AE1A 2FPPA 3NJ4A 3I4FA 4YJHB 4A5OA 1GR0A 3FNFA 1NPDA 4AJPA 4JJGA 3E8XA 3HE3A 5CDTA 3QWFA 2W98A 4N5LA 4RF3A 3HFGA 3HN2A 2Q1SA 4IXWA 1UDBA 1YRLA 3DHEA 2NTNA 2A94A 2YFQA 3DOJA 1Q1NA 4IM7A 5T67A 1X0VA 1DAPA 1SAYA 3VPSA 3INGA 2VWGA 1C0PA 4J2OA 5C7LO 3AUUA 3RROA 2W2LA 5DN9A 3E03A 3N58A 1VSUA 2VZ9A 4XCVA 5BSHA 1YL6A 1PIWA 3LK7A 5TIIA 4BO0A 4RLHA 3SX2A 1Z45A 1VSVA 1DRUA 3JQ9A 3ETDA 4TRNA 1Z7BA 3GNQA 4IJVA 1LDBA 3DL2A 3H3FA 5T8KA 4DBZA 1ENYA 2AE2A 4Q39A 2DBZA 1C0KA 5T6BA 4BGIA 2NLOA 2J3JA 4M87A 1WP4A 5CP8A 4CUZA 5IDXA 1HLPA 2AEMA 5HRUA 1V35A 3AU8A 1U4OA 2NU9A 3PHJA 2GZ2A 4FC6A 5IZCC 1Q7GA 4L75A 4R54A 3EYWA 5F21A 3AY3A 3L77A 4DA9A 2NU8A 3W6UA 1ISJA 1U3UA 4MOWA 4EUFA 5IN4A 5L40A 2H1SA 4HFRA 2DTXA 4DLBA 4CMEC 4YT8A 3GHHA 2ZJ0A 1BWSA 3FF4A 3S1LA 2ZYDA 3AOEC 4CM3A 4D44A 2G76A 3VOSA 1OBFO 4W7HA 2FSSA 4HX5A 5COAA 5IDYA 3TZHA 4CLOB 4XIJA 5CEEA 1T2EA 1SO8A 3TJRA 2EERA 4YTEA 1Y6JA 4BO7A 4XEHA 1DIGA 3ZV5A 4DBVO 1GD1O 3W1VA 1QRRA 2CNBA 2JD2A 5T64A 1HT0A 1UR5A 4B8WA 2C7VA 2F1KA 4YAIA 1CDOA 1NM5A 4UREA 4QXMA 4PG4A 1CETA 4FGWA 2IE0A 5G0WA 2YV3A 4WKGA 5BNTA 3C1OA 3RSHA 4BUCA 2P2SA 2EP5A 1OMOA 4EUEA 4Z3KA 4E13A 4WLNA 3RC1A 2C2YA 3WX0A 4BMSA 2YZ7A 3KETA 3IP1A 2VWPA 3NKLA 3S55A 2NTVA 3OH8A 2NU6A 4HUJA 2BFAA 1IHYA 2JHGA 3B20A 1KEWA 4XQEA 1NP3A 1P45A 1R0SA 3DR3A 2E82A 3D0OA 4IZHA 3RFXA 5KKAA 1NXQA 1FDVA 1YB1A 4XDYA 2TMGA 4TRRA 2CVOA 4GKBA 2EW2A 3R0IA 3RJ5A 2YQ5A 3KV3O 2BGLA 4BO8A 2ZJ1A 1JA9A 2UYYA 3GEMA 3QWBA 4MJLA 1XYGA 5CEJA 1E6UA 3IJPA 5JDCA 1P9LA 3PQFA 4TVBA 1BXKA 4Y6RA 3KOUA 4H16A 4YAGA 3UH1A 1XHLA 4CR6A 1Q7BA 1XG5A 4KWIA 4CMGA 1LSUA 5ITWA 3RUFA 2GRAA 5DNAA 4BNIA 4BO6A 9LDBA 3MTJA 2PA3A 3WGOA 4Y6SA 5JLAA 4XR9A 3WXBA 4GI2A 4Q3NA 3EGOA 4HADA 4RO0A 4E5NA 5IG2A 4RDIA 5DOVA 3PLNA 1DC5A 2IODA 3ROPA 3WGYA 1K2WA 1PR3A 5JYDA 3H9QA 3JQBA 5HTOA 4UEOA 1W6UA 2EJWA 4EYEA 1YWGO 5JPIA 1WDLA 3OECA 4CM4B 4NQZA 5CG2A 5IXYA 3SEFA 3EK2A 4GVLA 2V6FA 1PSDA 2VWQA 1DC4A 3P7MA 4OXKA 4A26A 4YXFA 1GADO 4FFNA 1RM4A 4GWGA 3CXRA 1I3MA 3GLQA 4I5GA 1LXCA 3WB9A 2V6GA 4BMNA 2EXXA 4I08A 1ID1A 3PTZA 4C4OA 2Q1UA 3L4BA 4PIVA 4BKOA 3ZW8A 3C3XA 4R9RA 3FBTA 3RU7A 3QWAA 1X14A 4OYRA 2EEZA 4R5MA 3PP8A 4R41A 4J1SA 4WJZA 3GR6A 1H6AA 5I8WA 1ZK1A 2X58A 5THQA 3I5MA 1G0OA 1X1TA 2GGSA 1TXGA 1GCUA 4YBZA 1UZLA 1VC2A 3ZI0A 2GO1A 2GF2A 2ZTVA 1JVSA 4ITUA 5KNLA 1X0XA 1FJHA 1VKNA 1LRJA 4LMPA 2EGGA 2Q45A 5IZ4A 4FC7A 4GSLA 4XIYA 1DO8A 2O48X 1KOLA 1K89A 2EKLA 2ZB3A 1IHXA 1H9BA 2WD8A 3PK0A 4A03A 3A4VA 1G6KA 4UUNA 1ML3A 5ICSA 3NRCA 3WG9A 3ZHXA 4CMJA 5BR7A 2ZCVA 3AUAA 1PZFA 1SEPA 3KEQA 2VN8A 4DPKA 4INAA 1OOEA 1O89A 4P4GA 1WDKA 1ZVMA 3TZQA 2I6TA 3H7AA 3RD5A 3CPSA 2NTJA 2WD7B 3JQGB 3K2EA 5HA5A 1UDAA 2UDPA 3EMKA 2R00A 4IS2A 3F5SA 4RV9A 2A4KA 3U9LA 4DC0A 4XWYA 2PY6A 3FWZA 3GVXA 3H2SA 2QG4A 4GX5A 5JC1A 1D7OA 3RI3A 4F46A 1ZFNA 5JYEA 1OZAA 3V5NA 3QVXA 1R16A 1ADGA 1LSJA 3KYCA 2Q1TA 4I5EA 1K0UA 4CMKA 1JKFA 2VHYA 3AM3A 2O23A 3JD1A 3ADOA 2FZEA 2GN9A 4MP8A 2GPTA 4BQRA 1KVSA 3GQVA 1ZJZA 3T4XA 1PJ3A 5CHEA 3BMNA 1O8CA 2YW9A 1F17A 5A4DA 3BMCA 3ZHBA 2X6TA 4K28A 1R12A 4S3MA 2VYNA 4J4TA 1D8AA 2HJSA 1GPDG 3TZCA 4CUKA 1KEUA 2VHZA 3WDSA 3C24A 4Q3EA 5TX7A 2CF6A 1M76A 1ZW1A 2GZ1A 4RDHA 5ENDA 5TT0A 4ALIA 5A5EA 2A9FA 3W4KA 1WXDA 3JQEA 3U5TA 1GZ4A 4BVAA 3X2EA 4OOFA 3V1YA 3ZNQA 3WGIA 4JGBA 5DP1A 2DKNA 2JFHA 3FHLA 3OA2A 4CQMA 1NPTO 1H93A 3CH6A 3SVTA 1N7HA 3Q6IA 1U3TA 4QO8A 3PWSA 3MJSA 4YQYA 5BSFA 1EVJA 4M54A 3H5RA 1C0IA 2ZKLA 3LU1A 2D3TA 3HN7A 1LEHA 1QLHA 3JQ7B 5KJEA 4YVFA 2Y1OA 3ULKA 1Z73A 3HUDA 3PHGA 5F1KA 4J91A 2WM3A 2JD1A 1I2BA 1PU2A 3T7EA 4IY1A 1UZMA 1IYZA 1K6JA 4MIEA 1KYQA 1P0FA 3U4HA 4GMFA 1P1JA 3IMFA 4W7IA 5G4KB 4UVEA 3NTQA 1LTHR 2Q4EA 1JTVA 4IDFA 3M2PA 4NJMB 2PKQO 3NT2A 4CLEA 5C7OO 2PGJA 4PVDA 4QFCA 1GPJA 3U4CA 4BIIA 5I9LA 3E6AA 4Z3DA 2QRJA 3S2FA 3F46A 3DMTA 5TS3A 2XOXA 4PZDA 4XJTA 1C1XA 1X13A 4D0RA 4O63O 1GQQA 1LDMA 5L7WA 2E6UX 3H6KA 1P33A 1ONNA 1KVUA 4PRLA 2Q3EA 5U4QA 5JE8A 4D79A 2HJRA 1ADBA 4RF2A 3E5MA 1DIRA 5JMPA 1RJWA 2RHRA 1OAAA 1XEAA 2W2KB 2BH9A 1YDEA 2PNFA 3CIFA 4DLLA 4FFRA 4L74A 4OSPA 4I9HA 3G1TA 2GZ3A 4OQZA 2XXJA 2OZPA 4CM5A 1SEVA 2EWMA 3PHIA 3GUCA 3H65A 3QP9A 4YWJA 3MWDB 4B7UA 3ZU2A 3EVNA 4R16A 3ZWXA 4PLYA 5JAZA 4AJNA 2DT5A 5AXBA 4E3ZA 4Q3BA 3ZV6A 2Y05A 4GQAA 1DXYA 2NADA 1AN9A 2HU2A 3UW3A 1D4FA 3H9UA 2CUKA 4L73A 4R1SA 1P1IA 4O1MA 5AVOA 5GZ3A 3GAZA 4KUGA 3WICA 4CM8A 2RH4A 3JD2A 5B1YA 4Z9XA 1ADCA 2Y1CA 4MIYA 1IY8A 2EG9A 3HG7A 3INTA 3DHNA 2Y1GA 5L9AA 5TQVA 3UCEA 3LZ6A 3ZWVA 2PGDA 1VL8A 4P22A 3ASVA 4BKPA 5EESA 4C7KA 4A27A 3UICA 1YJQA 1DLIA 4NPCA 5TT1A 4RZIA 1FK8A 2J6IA 2PKRA 1WVGA 2J3HA 4E31A 5L51A 1EUZA 1RYDA 3U4DA 3GZNA 2JCXA 1J6UA 1PGOA 1UJMA 2D5CA 3SC6A 5JDIC 4GGOA 5HWSA 1E7SA 3VZPA 3H9GA 1O94A 2YHIB 4FD3A 1EK5A 3PIDA 2OUIA 3UCXA 3EUWA 4B4OA 3ITDA 4Y67A 4ZQEA 1ZXBA 3O8QA 3PZBA 4IIUA 3R3SA 4LCJA 3RUAA 3JQFA 4BNMA 2O3JA 5KJFA 2AMFA 1ZMOA 2ZTMA 1DC3A 5THKA 5KVVA 4LRTB 1CWUA 5HS6A 4OXYA 4U6SA 1HSOA 4EDFA 3NAQA 4FFPA 3I4CA 4NBUA 4HKTA 4IJWA 1IUKA 3LQFA 4W4TA 4HY3A 2AG8A 4BB6A 5EQDA 1DJQA 2IZ1A 1KIFA 2GDZA 1WNTA 4BHTA 2PD4A 5JAMA 2DTEA 1YOVA 4WNIA 1EDOA 4DQXA 3SC4A 3ONFA 1Q0HA 1EUCA 4ID9A 4PLPA 2X4GA 1DIBA 3KM0A 4MO2A 1EZ4A 3K92A 4IGEA 4GSKA 3AU9A 3ST7A 3ZWCA 1LUAA 5U9CA 1LNQA 3KVOA 1I30A 4A7PA 4W6ZA 3WR5A 1XU9A 3ANLA 3OEYA 3ZWPA 5DCYA 1N8KA 5KVQA 1MC4A 1I33A 4FSHA 2WE7A 1U8XX 3GEDA 3O03A 2EW8A 3G17A 3WQRA 2AHRA 1F12A 1ISMA 2HK7A 3V2GA 1PL8A 3NT5A 4FBGA 3U62A 1MA0A 4IUYA 3WNVA 4IBOA 1NFRA 1Q0LA 1ZKMA 2J5KA 1T2AA 3F3SA 4IDEA 2VUSA 4AJHA 2QX7A 4KQXA 2C2XA 2Y68A 3DZFA 4CMBA 1TVEA 3PGJA 4B4UA 4GLOA 4O0LA 3L9WA 4NBTA 1A72A 2B37A 4GPD1 1SOWA 4A73A 1R66A 3I9MA 3GNTA 2FMUA 1IL0A 2YY7A 1ZNQO 4YEDA 1HDZA 1EVIA 4NJMA 3H9EO 3A14A 3X2FA 4DYDA 2W8ZA 1NAHA 4W9NC 2FN7A 1ZSVA 1Z75A 1IE3A 1SB8A 3LC2O 4ZICA 3DBVO 3RC7A 4CJXA 2CDBA 4TSKA 4J4BA 1KVRA 3DMTC 3DTYA 2LDXA 4R4JA 5IXSA 1PJLA 1DHRA 1KERA 2PZLA 3KUXA 1GU7A 1SMKA 3QJ5A 1HZJA 1GDHA 2AQ8A 2D0IA 3L4BC 4E2ZA 2VNAA 2Y0CA 3VAZA 4B79A 1WWKA 2CY0A 1FDSA 4Q3CA 1FXSA 3AOEA 3GH3A 4TVOA 2DPHA 4PZCA 3JQGA 3UVEA 1QMGA 1PGQA 3ROMA 1LC3A 2AW5A 3BMOB 2ILTA 3NTRA 1XGKA 3ZZNA 4H3VA 5K6AC 1W0CA 4NJOA 1W73A 3RU9A 4TROA 1PJBA 2POQX 5JCXA 3ROQA 1CERA 2ET6A 1EEHA 3B6ZA 4L8VA 4B7CA 4R51A 4E21A 2BGMA 4Y98A 2I3GA 1BGVA 2J8ZA 1U5AA 4JQCA 3MCVA 1B2LA 2PV7A 3O38A 4ALJA 4FN4A 1RYEA 3F6YA 1O5IA 2ZTLA 3LLSA 1ZSYA 1B3BA 1R15A 2VOEA 3HDJA 3QQPA 3PHLA 3PIIA 4PG7A 2YDXA 4JJIA 2CFCA 3WNQA 3R6DA 4EUHA 2CVZA 3GZ4A 3M1LA 1E7RA 1LRLA 2DC1A 3JQ9C 4NU6A 4I9UA 1ZJYA 3F4LA 3LC1O 3VDQA 1PS8A 1QG6A 4NZ9A 1HYEA 2PH3A 5J23A 3V1TC 2BMAA 1E5QA 4TWRA 3LT4A 3WS7A 1DFHA 4RORA 3ZHYA 1V6AA 1XQ6A 4UVIA 4XYMA 1NQAO 5L7YA 1N1GA 3ONEA 1E3EA 1ZK4A 2C0CA 1GV1A 1M67A 1GAEO 3AFMA 1LA2A 2Q49A 1J49A 1ONPA 1CYDA 2IYPA 4OSOA 4J43A 1HETA 4MVJI 5ER9A 2AEJA 2OBYA 1X7DA 4CM8B 5L95A 1NPYA 4LCEA 2P9GA 2GASA 3SLKA 4ZHSA 5A9RA 2J5QA 3BTSA 4PN3A 1PX0A 2G5CA 1A5ZA 4FJ1A 3MEQA 4OJNA 3CKYA 1HDGO 4WUVA 4BNNA 1AHHA 3TN7A 1PGNA 2BFMA 4ZU3A 5A9SB 4R3NA 1B3RA 5BQFA 2TMDA 4WCDA 1OI7A 5JMWA 1YXMA 1WAMA 3RVDA 1DRWA 1I2CA 1NYTA 2DTDA 1LLUA 4ND3A 3F1KA 1C1XB 3FPLA 1R4MA 5TLSA 3F47A 2X5KO 3RASA 3V1UA 4AJ4A 5I7EA 1EUDA 1R4NA 3GPDG 5G0SA 1J0XO 2HMUA 3NEPX 4CQLB 4OMUA 4F6LA 4LSWA 3HDQA 3K6JA 4LSMA 2PR2A 3W8EA 4BO5A 2NQ8A 2NUAA 1ENOA 1T2CA 4YAEA 3IAHA 1H6BA 4OO3A 2EP7A 2QZ9A 1LSOA 1MV8A 3E18A 4DIBA 1R37A 3K96A 4WLVA 4M86A 2ZB8A 4P4LA 2HLPA 4WEQA 5C5IA 5KCZA 4FOOA 2OBNA 3ZV3A 1BDBA 4E6PA 4MKZA 2BHLA 2G0TA 4PLHA 1AXGA 3ZWYA 1ORRA 1GZ3A 4FGSA 3QVTA 4CR7A 3AM5A 4EW6A 4EBFA 4AJEA 3O9ZA 1EK6A 1YQDA 4I1IA 5JO9A 3DTTA 3KSUA 3PJFA 3C8MA 3ANNA 1LJ8A 1VE9A 2D4AA 4N18A 2DM6A 5TNXA 3G1UA 1E1NA 4CM7A 3QA9A 4E30A 1PJTA 4EITA 2W4QA 1P1RA 4JNKA 1MP0A 4YT2A 2H5LA 1XLTA 2X9VA 4MVJD 3NGLA 2EIHA 2G82A 1UZNA 1YOVB 3GEGA 5A04A 2Q4BA 4ILKA 1GYPA 2IEDA 4RL6A 5K0ZA 1A9YA 1YBVA 3TL2A 1FF9A 3LF2A 3JTMA 4ZQHA 1SNYA 2O3UA 1ZEMA 3E9QA 2VT3A 4PLVA 1Y8RB 3BHMA 3WQQA 1V3UA 3BHJA 4CLHA 2YHIA 2R00C 4YJFB 1E3SA 5DDIP 2NU7A 3VVCA 5CDGA 4BGVA 3BTVA 4JBHA 4QT0A 4BNLA 3AI1A 4IDAA 3LT1A 2BLLA 5JW6A 2ZATA 4JLWA 3AUTA 4G81A 3DFZA 3C7AA 4EEXA 5EN4A 1Y5MA 3ZWOA 4GMGA 3VC7A 4WLEA 3L6OO 3PQEA 3RFTA 4YQZA 4J9VA 4RJTA 4TQGA 1JLLA 4R69A 2Z95A 2OL4A 1KEPA 1CJCA 2PD6A 1ENZA 3NUGA 4BQPA 4W9NA 4NMHA 3GN2A 3DZKA 4YJGB 4DTIA 3SBOA 4ZD6A 3Q9NA 1I01A 4JP2A 3RWBA 3OP4A 4BO4A 4DUPA 4J49A 2Y0EA 2NVWA 5JDIA 4QUKA 5KJ6A 3OIDA 1Z74A 4MKXA 2XXBA 1Q0QA 1BTOA 4IDCA 1GYQA 1QORA 4Y6PA 5EPOA 3FNHA 3OSUA 2PWZA 4Z9FA 4B3IA 2Q2VA 3R1IA 2ZB4A 3NJ8A 3PRJA 4IQGA 1E77A 3A28A 3P2OA 1BSVA 1H0KA 3PJEA 3PZRA 4YPOA 3WLFA 2QRLA 3KYDA 3UN1A 4HFMA 1NWCA 3C7CB 1OC4A 2C59A 5CDSA 5CG1A 5IDWA 4QX6A 1UUFA 1I24A 3O26A 3DOOA 3C1TA 3AWDA 1GTMA 4MVJE 1EBUA 1TA4A 2ZQYA 4BNXA 5BNFA 3E1KA 1VRWA 1N2SA 1N92A 3PLRA 3QE3A 1MX3A 5IFLA 1E6EA 3N7UA 4YAJA 1JWAB 5I7FA 1PQPA 4J7UA 1NR1A 5B37A 1HLDA 4L4RA 5JAIA 3RJ9A 5FYDA 2W2KA 4OKNA 1UXKA 2ZTUA 4CL3A 1WZEA 3ASUA 2O4UX 4PG6A 2B69A 3GNSA 3JYOA 4UULA 3DZBA 1X7HA 2VTDA 4EZBA 4B4VA 3GMSA 3O4RA 2P68A 2ZB7A 3D3EA 3ON5A 3JQAA 4D42A 1ONOA 2I67A 4IDGA 1DOHA 1GYRA 3L9XA 4BB5A 3UHAA 3GMDA 1M6HA 9LDTA 3OJ0A 5I9MA 2OORA 2J5RA 2BELA 3OM9A 1NVTA 3U49A 5BSEA 1N9GA 1HYHA 4MIOA 1QP8A 4MP3A 1BVUA 1YJ8A 1DIHA 4II3A 4YR9A 5FFFA 5CDUA 3RUCA 1VL0A 2IXBA 2CF5A 2IRWA 3VHRA 4WLUA 3I23A 3OBBA 3PWKA 4FJ2A 1R6DA 3GOHA 1ISIA 2BFOA 1WZIA 4I5FA 1TT5A 3OQ1A 2HDHA 3HHPA 1DLJA 5KJCA 1XIVA 1GZ6A 2OFPA 2VTEA 4RF4A 2OOSA 1ZIDA 4PLWA 3EW7A 1UXIA 4TMFA 1PZGA 5CFZA 1KY5A 1CRWG 4IXTA 4AFNA 3FRJA 2OHXA 2WSBA 2ZCUA 4YRDA 1NQTA 3IUPA 3LSYA 1DSSG 1LLDA 2FPGA 2H63A 3HQ4O 2D59A 4NFYA 3U0BA 2D1YA 2GD1O 1HE4A 1V8BA 3MJEA 3PDJA 3DBLB 3MJ4A 5CDYA 3OJFA 3HB5X 3CINA 3OMLA 5TSDA 3UUWA 1XCBA 1QYVA 1Y7TA 2AQHA 2P91A 2HRBA 2JD0A 3OICA 1D1SA 1D1TA 4M1QA 2HK8A 2F00A 1I36A 3ZN2A 3IQDB 4X54A 1HE2A 1NFQA 5F5LA 4U7WA 4XGIA 5G0TA 4RF5A 4ALNA 5DBFA 4EJMA 3HB4X 2C20A 2Y1EA 2PZMA 2NVUB 1VL6A 3P5SA 5ADHA 1XWFA 3WTBA 2YUTA 4IIVA 2HMWA 5COQA 4XRRA 2Q2QA 3EAGA 1GQ2A 3U3XA 1ZEJA 3OJOA 4WNCA 1WMBA 5DBIA 5CPBA 3ENKA 1DAOA 2Y0DA 2V7PA 3WJAA 1LU9A 2X23A 1DFIA 3PFWO 1KY4A 2PFGA 4XR4A 4ALLA 4U6QA 3FNEA 3AFNA 3WTCA 3AI3A 5IJZA 3OFSA 3RFVA 2OP0A 3KXDA 2CSUA 2EF1A 3PYXA 1YBAA 2VHVA 2DFVA 3D1LA 1IPFA 4ZN6A 1DB3A 4CM6A 2IDZA 2CVQA 4FW8A 2FR8A 1B0AA 4F3YA 5DCUA 4WGGA 4KDEA 4UVHA 4IMRA 1OFGA 2B35A 4YRAA 5L3ZA 2D8AA 3KSZO 4IZIA 2I5PO 4CQMD 3WIEA 2QYTA 3M2TA 4OIMA 3RC2A 1U2DA 4DMMA 3TWOA 5A06A 4HXYA 2R2GA 3I9NA 4ALKA 1HDCA 1VJ0A 2Q50A 2AE1A 2CMDA 3E9NA 1BW9A 5LDGA 1W4ZA 4NH4A 2Y99A 3CEAA 7ADHA 1T2DA 4BKUA 4D45A 3QWIA 1EE9A 4E12A 4Q9NA 3MZ0A 3GDGA 2SCUA 3IKTA 1DJNA 3BIOA 3D4NA 3Q2KA 1RWBA 3S8MA 3DAFA 3QRWA 4G5HA 4PG5A 2YYYA 1E3JA 2JFFA 2BRUA 4FPXA 2D2IA 4XYGA 1QKIA 3G0OA 1ZUD1 1I3KA 1YVEI 1A4IA 3KHUA 2XAAA 4PLZA 1DIAA 3QWHA 2WTBA 4TKMA 2WD7A 4RPJA 4IMPA 4J1QA 4L4SA 4TKLA 2FY8A 3GF4A 1A7KA 5FEUA 1PZEA 2WMDA 1VLLA 4NBRA 3UCFA 2QYSA 1EQ2A 2V65A 2DU8A 3VTZA 3B70A 5B4TA 3K31A 4FFOA 8LDHA 5JNLA 3QW2A 3OF2A 3GGPA 1BVRA 1HEUA 3WGGA 3QIVA 1SZJG 1NBOA 3PEFA 1DPGA 3G3EA 2Z5LA 1UH5A 3ZH2A 1LSSA 4NBWA 2O3QA 3DAGA 4D0SA 1IB6A 3R3JA 1LDNA 3P2YA 4PLCA 2HUNA 4JK3A 2C29D 3L0DA 3ABIA 2X7HA 1U5CA 4XJSA 5EERA 4CMAA 2O7SA 1MFPA 3I9JA 1NQ5A 2RH8A 1CQJA 3ONDA 3PI7A 3UKOA 2VRCA 1JAYA 2Q46A 4QTZA 5JY6A 8ADHA 4MVJF 2QW8A 4D43A 2FOIA 3PGXA 5KIAA 2DUUA 1I3LA 2XF8A 3RBXA 1HDRA 4CUJA 5ICMA 4CM4A 4BS9A 4NNJA 1JN0A 4E0BA 1NHWA 1YBMA 2H9IA 1E1KA 2OP1A 5B12A 4DWVA 2O2SA 1YKFA 3DQPA 1QYXA 2X22A 3Q11A 1Y81A 4B4WA 2I66A 4XGKA 1Y8QB 2DQ4A 3G49A 1C0LA 4K6CA 3W6ZA 3TL3A 3C1AA 3LF1A 2AA3A 2BGKA 4BO2A 3WFIA 3WGQA 3OIGA 1O95A 1ZCJA 2WEKA 3HDHA 4TZKA 3TQHA 3OETA 3JQ8B 3PJGA 4BNYA 3VPGA 2GR9A 5K9ZA 2E4AA 3FTPA 2PLAA 3RIHA 3BA1A 3IDSA 3B1JA 5C37A 3VVBA 5EL0A 1LDEA 4B3HA 2PZKA 3BMQA 3QY9A 1DRVA 3WYEA 4AJ2A 5EJ2A 4AG3A 4E5MA 5K6AA 2JL1A 1LQUA 1H5QA 3ZWBA 1B15A 4D3SA 1NVGA 3DC2A 4MKRA 5LC1A 4WE3A 1XQ1A 2VRBA 2DPGA 4K9DA 4CM1A 4CV2A 4J0FA 5DF1A 3BYZA 2HMTA 4XX0A 1XDWA 4CMEA 1I0ZA 2AXQA 3MOGA 1LX6A 1HDOA 4PGFA 4ND2A 1V9LA 4ZRMA 3B1FA 1RM3A 2HQ1A 3M6IA 1PJCA 1LQTA 3JQ8A 3JD3A 2WYVA 3A1NA 3D7LA 4OHUA 2JKVA 1N7GA 4D7AA 1H2BA 4GLLA 5TGDA 5BNIA 5BSGA 2Y66A 3AY7A 5FF9A 3F4BA 1OC2A 2OGUA 2VYVD 3SJ7A 2PH5A 3RC9A 2I65A 4RVDA 2DVMA 4N54A 2NACA 4IQ0A 4QSMA 3VDRA 5DBGA 4KZPA 1CF2O 5G4KA 2YFHA 5B4UA 5A02A 4NBVA 3UOGA 5BT9A 5EMHA 1JKJA 5G2OA 3MWEB 5ENVA 1FMCA 2O3RA 5AXAA 4WOKA 4AICA 2B5VA 4BNWA 2IZ0A 5KJ1A 1U8FO 1PR9A 2FPIA 2Y1DA 5C3MA 4O6VA 3RUDA 4J90A 4J16A 4CV1A 5JDCC 5IF3A 1T1SA 4LVUA 3KLPX 3RBZA 3HADA 4JJFA 4ROSA 5ER6A 4W99A 1V0JA 1E7WA 1EE2A 4MVJP 3ZNPA 3ZWNA 4KTTE 4DXHA 3KRTA 2VNSA 3JV7A 1BXGB 3JQAD 5L4LA 1WDMA 4CQMB 3H4VA 5A1TA 4DPMA 4BNZA 1N9GB 1PGJA 3BZUA 1GUZA 5B4VA 4KP7A 4CV3A 2P9EA 2E48A 1P1HA 2GN4A 4EEZA 4BNHA 5T5QA 4E5KA 1QV7A 2LDBA 2EKPA 4GKVA 3GT0A 2RHCA 3DZJA 2NVBA 2AQIA 1E6WA 2NVUA 1LBEA 2DBVO 1U9JA 3QVOA 1XELA 3KYBA 4R1UA 1UDCA 2JCYA 4F45A 1FDWA 2B0JA 1T24A 1RKXA 3DONA 5AXDA 3L4SO 4B3JA 3W4IA 1WMAA 2OMEA 2YV2A 1E0DA 1KC1A 5MGBA 4XB2A 1P1KA 2FR1A 3WGZA 3GRKA 4AJ1A 2FP4A 2X1HA 2B4RO 1D3AA 3GG9A 2GERA 4CQLA 3W8FA 4GBJA
chains in the Genus database with same CATH superfamily
4Q15A 1NWHA 3CN7A 5IX8A 5CXSA 5LQNA 2CUTA 2FUKA 4JUIA 4BMZA 2HSEA 4HXEB 2IUFA 4CR8A 1XA0A 1QR6A 1YNOA 2A5GA 4OAQA 3NHFA 1P80A 1QYCA 1RPJA 3CR7A 4XEUA 3GPIA 2K5UA 5LPNA 3KB2A 4L7QA 2HA3A 2J7KA 3TGLA 3FTFA 3SKVA 1VHLA 3X2SA 4W1RA 3W4JA 5HS4A 2II6A 4JBIA 1KDTA 4HEHA 4FOLA 1OI2A 1RU3A 4TWJA 1XXHA 1D04A 1E9EA 3MGBA 1XZAA 4QXQA 3X1JA 1PGPA 3HC7A 3BXXA 5C3UA 1Y5NA 6CHYA 2JLCA 2RHLA 3EODA 4PCVA 3RBAA 5B36A 4OGLA 4LV8B 3VKVA 1FNCA 1G8AA 1PR6A 4N7JA 1NMZA 1PJ2A 3EVCA 1SWVA 1XSEA 2GLXA 3N7AA 4DEXA 4TN1A 3VR3A 2HEIA 1QO9A 3HYRA 4GXQA 1NVMB 2E4XA 4FYJA 1HG1A 2QSJA 1ZMRA 4I1UA 1AO0A 4F9EA 2XRFA 3AIOA 1BOOA 1GGFA 1PO7A 4BFSA 1H2YA 4OB6A 4EZIA 1SIWA 1DI0A 5G40A 2R8XA 4CEIB 3BL6A 1SCKA 4FIZA 4DJTA 3K70D 3DO8A 4BAUA 1SCJA 1THTA 2JFWA 5KHOC 4LBYA 4Q5IA 4V2IA 2GN6A 4DRYA 4X93A 4ER3A 4OI4A 4EY5A 1M8JA 2R6JA 4BBZA 3WRXA 1M74A 5EP4A 4DIEA 5A0VA 5J2UF 3ZHZA 2D4HA 1P44A 4MUMA 1JAXA 4R2HA 3SICE 5B7PA 3L7IA 3ROZA 5EHXA 5JD6A 3FPJA 2VYND 4JYMA 3ILVA 4QZVA 2PKCA 3B78A 5GJBA 4XZ3A 5CYFA 5I9BA 3KFVA 3DMFA 3PPYA 5G0VA 4C0HA 1Y3IA 1OXVA 1W96A 3B6KA 3CRZA 1HYQA 4HX9A 3C8HA 4F4IA 2CXTA 4JROA 5A7FA 2CK3A 3NXKA 3ZS8A 5EGSA 3UMCA 2VIIA 1QRTA 4TXNA 3TW4A 3E5RA 2WIBA 2Z2KA 3MB5A 3PSAA 4RCZA 2R5NA 1PFKA 3OOWA 1DUIA 3K30A 4I4TA 2CEAA 4LZOA 4MW7A 3HRHA 4PYKA 1U2DC 2OB2A 3ESAA 3HU5A 2L69A 2WJGA 3EG5A 4HZIA 4NG4A 1F4VA 1D2HA 3V7UA 4ND1A 3QLUC 5CR9A 5ALFA 4XLLA 3RCBA 4MUBA 4FP9A 2EW1A 4OP1A 1P0CA 2WT4A 2PJRA 2L18A 3CMCO 2MIIA 1R0CA 4RZHA 4B81A 3TMKA 1PW7A 2X0NA 4N12A 1WUTA 4UBJA 5F98A 4RWEA 1B16A 1YVRA 2Z2IA 4WESA 1RM5A 2D7DA 3HV2A 1VKOA 1PTJA 5IJAA 5EXXA 4QWMA 1PL7A 2YTZA 1E1RA 1YB4A 1DTEA 4FHCA 4O59O 4UEKA 2EQ5A 3ZNOA 2OGTA 4EGFA 2AWOA 4JZYA 2IPXA 5D7BA 5A9SA 1RI5A 1SOMA 2LVBA 4Y9DA 2IA5A 3CJRA 2GEUA 3DEAA 1C9MA 1RYBA 2QV7A 3FWNA 4KHPB 5D87A 2HK9A 3P2IA 3AESB 1S02A 4A2PA 1PR2A 3NP9A 2AYXA 4S1VA 1OXBB 1QIHA 3K6KA 4OHYA 2OSBA 3VH2A 2ZRLA 4NZZA 1UM9B 5HPYB 1N8SA 5EWLA 1YB5A 4K6FA 5FI5A 3SHVA 3BMQB 2DX7A 4CN8A 4MQMA 1EP3B 3B1XA 4PRKA 5U1PA 4DS3A 1LPSA 3KZVA 1QU3A 2VPWA 1E8MA 3KYDB 4G8JA 4XOUA 3GDOA 5C7IO 3H1PA 4JUCA 1U0NA 1NW9B 3L1VA 1T1RA 3RS7A 1FDIA 2G1UA 3RWOA 4ZGGA 3T1HB 1TRKA 1V4VA 1QWOA 3C98A 3HB9A 4FXOA 4RA9B 1TLFA 1OFUX 1JJFA 2OV2A 4M53A 3IP7A 5EQFA 5FWXA 4RKRA 3UK7A 3SK0A 3U6BA 1WVMA 4IDBA 2GYVA 4JYPA 3ENVA 3FA2A 6ADHA 3CXUA 3SMVA 1U2ZA 5DLPA 3PPWA 1Q1BA 1UCFA 4U7PB 3SJBA 3UHOA 5IT4A 2JJ8A 1YQTA 2C3MA 2WJWA 5ITVA 4CLRA 1E7QA 1Q15A 1UXHA 3LDHA 4CLOB 4K88A 4MVJH 4DWJA 5H81A 3Q9LA 3A1SA 1KY2A 3OIVA 3ESXA 4S0XA 3TVTA 3KQMA 5F4BA 5J5CA 3FB1A 1H22A 4FINA 4IHKA 2O1EA 4RA6A 3FRIA 3HJRA 3PC6A 5J4YA 3MLEA 4OLFA 5A2QA 2NYRA 4N49A 2BZ0A 3GC6A 4YRQA 1EG2A 1YONA 3FSRA 5IT0A 4OSEA 1C8LA 3CH4B 4IH9A 2ATIA 4L6IA 3T54A 4KR2A 4D26A 3CLVA 1UOQA 1MIOB 5GONB 1HDEA 3PQ7A 3GZNB 5EVCA 2PUEA 2YXDA 1OXXK 3ZY6A 5GZ6A 4FMDF 3TFWA 4HNHA 1A9RA 2VDWA 3MN1A 3FPAA 1PL6A 3GRCA 1YZYA 3D7MA 3DDCA 3E3LA 3QUBA 4K9SA 4QO7A 3NNDA 5D00A 4QYIB 2PSDA 3WLSA 3IL2A 2O8BB 4MAAA 4DMLA 3TNDA 1W87A 3X3HA 3ZY2A 1XTVA 2EBWA 3TJZA 2C7OA 4OLBA 3CZRA 3MIZA 4GMXA 1BFKA 1PG2A 1RM0A 1SOVA 1A27A 2JCGA 5I4CA 3NOOA 2UUOA 3DMDA 4JX9A 4P2GA 5DHSA 1LC0A 3THXA 3TR0A 1P39A 1VJ1A 2FXVA 4UNSA 2Z6UA 2BCEA 3HN6A 2J9FA 4IDHA 3REOA 3SBDA 3G2LA 2RC6A 3WGNA 1PV4A 2QTFA 5A3JA 2C92A 3B52X 3OTQA 5KOJB 5I5GA 3E4CA 5J1TB 5E95A 5GIPE 1ZZEA 2AEFA 3E2MA 1SUWA 2F1RA 4YA6A 4Z99A 4GX0A 1DX4A 3KQTA 2O0LA 4KQ1A 4XH9B 3CPJB 1D2GA 3MPUA 4HDCA 3C2QA 3OT1B 2JVJA 3C5WP 4HRYA 5FNVB 1W5TA 1OILA 3STUA 1SD5A 4WT7A 3IOYA 3DD1A 4I50B 4WA7A 4K86A 1E3WA 3TAHA 3WFJA 1O0BA 2GNPA 3HWX1 3BILA 3QLTA 4HLDA 1RWPA 4DIUA 1D2NA 1GXSB 2Y1WA 1KZGB 2GEBA 4FDVA 2BCJQ 2GXUA 4HB0A 3ND7A 3U1VA 3HZZA 2HUPA 1GNRA 1GCOA 2VDVE 2Y9PB 1JVBA 1NLYA 2AQKA 3CNLA 1XOIA 2BFCB 3EDRA 4M89A 1ZJJA 2O1XA 3HPQA 5JARA 4PZEA 2HDOA 4R1NA 1UXJA 4KMRA 3FCXA 5E2AA 2BR3A 4IUCS 4K0RA 1C14A 4LCBA 4YCNA 3NHWA 2P9BA 3QLVC 4TV8A 1AMUA 2JAXA 2I3AA 1PJRA 3OVMA 2OV6A 4KE6A 3VH3A 1BX0A 2BAGA 1WPXA 2XGOA 3FDIA 4LRQA 4BQSA 4BEWA 2ZB2A 1OB2A 1FE8A 2P5SA 1W0JD 1WBJB 3BAZA 4G41A 1VECA 4LZNA 2HM7A 2YJ4A 4XGRA 2GYWA 3BE6A 3IEUA 4LXGA 5AKZA 5GADl 3HA5A 1LTKA 4UU1A 4J94A 3FPEA 1B8PA 3RIMA 4CMHA 2FRDA 2Z2ZA 1KSJA 4AY4A 2AVDA 3RS0A 1I2MA 3AVPA 3UWPA 2P3QA 2ZIFA 4YB8A 1P77A 5F3WB 4WZBE 3CRMA 1QR2A 3IVRA 3N0WA 2BDUA 5E4TA 3AL0C 3HYSA 1VGRA 2O3SA 3PRHA 4N5NA 3CZ4A 1SQGA 5E4YA 4GL4A 2QX6A 3AIKA 2ZS7A 4A2CA 3P9SA 1CDEA 3ZX5A 4AKHA 1KAEA 3PNLA 3VPHA 1I2AA 1BMDA 1E62A 4B6EA 3JAMA 2UVDA 3ABOB 4JHLA 4Y18A 1B8VA 4V39A 2I2AA 4RPHA 4GPZA 2DPLA 4LNUB 2ENUA 5F3RA 3DDOA 1Y5RA 3HO6A 1MAUA 4EB0A 4FGLA 3BKXA 2YZMA 4HS9A 2WDZA 4UNIA 1D0VA 1Q11A 1UOEA 3R5KA 1HQKA 3RUEA 3UW1A 5IULC 3FHOA 3OEED 3L1KA 2I1QA 3DG9A 5GONF 2PMEA 5IM5A 5AM2A 2JGFA 4RNDB 4XYLA 1TNDA 5KSYA 4D8VA 2H08A 3HEBA 3I6MA 5JSFA 2YWFA 4WCFB 4XD2A 2A84A 3IELA 4CL8A 2CDRA 5DNVA 4E33A 3F6SA 4LHZA 3BL8A 3L0ZA 4QIHA 3SS7X 4AMUA 1GWNA 3PGLA 5IT5A 3ZU4A 1DEXA 3N0XA 4GD3Q 2YWDA 2H4HA 5JVDF 5AOCA 1T26A 2GHRA 1WLYA 2V03A 2WU1A 3KB6A 1E2JA 2ERYA 8GPBA 3HU1A 4M9RA 1O94C 2WSIA 4QEDA 3PE3A 1W2GA 1NVDA 4I50F 4QFDA 1A0OA 2OC9A 1IUNA 4NENA 4AO6A 3H5NA 1ULSA 3TNJA 4ZEVA 4P0QB 1FY2A 3MIIA 3NC0C 4LRXA 2HXGA 4UCXA 2D06A 4Z0NA 5DX8A 4MMXB 2F67A 1HX7A 1P31A 4RVHA 2X9NA 3LKBA 1A9TA 1KZ1A 3LA6A 5AWFC 4PIPA 4DA7A 4RHYA 2W7TA 3K2QA 3M70A 5B12A 1KOJA 4D4HA 4YCBA 3ZU5A 2HV9A 5KX5B 4G0QA 2XA2A 4PAWA 3GPBA 3O8DA 1E98A 3LYLA 4NBSA 5CB4F 2K2WA 4M8NE 1U4SA 4MLCA 4EA9A 1JUDA 1UBKS 2P7IA 3Q72A 1CVRA 3KZ1E 3MJHA 2XB2A 1ZGAA 1N3BA 3WWCA 1J9GA 1SCNE 3CONA 4L4XA 5KVAA 4TKUB 1QF6A 5HUQA 2J30A 3T7RA 4NDZA 1FU8A 2YS6A 4RAOA 4YJ3A 4ZT3A 1FP7A 5HEKA 3JZFA 4H15A 1E1RD 1KMHB 2FWJA 1CUFA 2GSWA 2LZ0A 2W2VA 2VH5R 5IBCA 5MFZA 1DC6A 2OENG 3H1AA 3ZHCA 2QRQA 5JCPA 3PWZA 3MQFA 1K2VN 2ZJFA 1PJ4A 3AEUA 1GGNA 2PD3A 3P2MA 1S2LA 4ND5A 4UUBA 5C1DA 4X45A 3D3NA 3RUHA 4CXMA 4ZT6A 3MJTA 1L7DA 2JCVA 2YCLA 3GJXC 1H23A 4BLQA 2B4QA 2ZJ2A 4Q4HB 1JNXX 2BM8A 1CQXA 2BEUA 1Y9ZA 2AR9A 2DY0A 2WUEA 3KQQA 3M6VA 3MB8A 1X8JA 1H8ED 1P9RA 3HABA 4QTTB 4LUCA 2V7UA 1OJ7A 5CK5A 4ZJUA 2V6IA 2PGLA 3CLKA 3E9ZA 3QVSA 3GG2A 1HFEL 1XU7A 4O1HA 5BSRA 2BD0A 4XD7D 1YVUA 1WQ3A 1HZZA 2VQEB 3ESBA 2NSDA 1G3IA 2BMWA 3CPHA 1SWWA 1ZC3A 1H94A 2BVNA 4MDYA 4PSKA 4WERA 3ORRA 4YRTA 2JDID 5EFZA 2PXHA 2CFTA 5AI4A 4GEKA 2BJHA 3G79A 4MI1A 1O9GA 1EJ2A 3IIEA 1TM4E 1R0KA 1TA9A 3F67A 1XCOA 1UC4B 2KI5A 4OJMX 2WIKA 1J4AA 4YDRA 1KEVA 5FKJA 3HJUA 4HNVA 2QROA 4TYMA 4KDFA 4KGZA 3P9CA 1WPRA 2C3UA 3IP8A 3P4YA 3PXXA 1HT3A 2Q99A 2JFXA 1QYDA 5TJ9A 4D96A 2ZYUX 4WKPA 4PYMA 2JAQA 2EDCA 4ISBA 4ZZ3A 3H0CA 3NM4A 1EMDA 1N2BA 4NBLA 4OHZA 1NX6A 1P4SA 3LIIA 1SELA 3QF4A 3QE0A 2X4IA 4OI1A 2VBIA 4EKEA 4J76A 1ZM4A 1P7PA 1VDZA 1XQVA 1V47A 1L5RA 1L4HA 2LIPA 2VK4A 3K53A 4JBLA 3NYWA 4WCFA 1YQGA 3Q1LA 4NYIR 2DAPA 1C3EA 1QYWA 2E37A 4QU0A 4WCVA 2Q8PA 2VT2A 1CUGA 2XUJA 4CMIA 4F8YA 4PO3X 1AC5A 3L40A 5T8KC 1DBQA 1RWMA 2OV3A 1EZ1A 2PIDA 3BRSA 3OFND 2R0QC 1H2HA 5K09A 3W9UA 1AXEA 2ZRIA 5HRAA 3NALA 2AR7A 3A0UA 3HBAA 2WWTA 3KLOA 3WYBA 4B6OA 1EHIA 4XM0A 4DA0A 4BY9E 1Z6ZA 5D3MA 3LTNC 1ZM7A 1T9KA 2EJCA 1J2JA 4ACAA 1JG4A 2FHSA 2X40A 2NXWA 1T25A 3L01A 4FNGA 3K70C 2RK3A 1OGYA 1WKCA 2LRHA 2OCGA 2GBGA 4IIFA 2K6GA 3Q9SA 5JD4A 4ESVA 3FCEA 2H29A 1PJQA 5J40A 3GU3A 1K92A 1IY1A 3UPUA 4GZ6A 1F8GA 4JA0A 5JBNA 4CLXA 1ND5A 3ENNA 3AOGA 2RD2A 1V9CA 3SM3A 1DV1A 4R1PA 1WSDA 2J1LA 3IIKA 1EXVA 1XAHA 2QRZA 5HJEA 1JDTA 1P2TA 1MVOA 2MYPA 4IZ6A 3WP1B 2K7FA 2QUJA 4AROA 5FUQA 3FXAA 4E1AA 5ERYA 3VV2A 1HQDA 2FW0A 5A4JA 1UPBA 2X2OA 4CBVA 3CX7A 3BH0A 4YT4A 2XUHA 1ZI8A 4F3CA 1N1EA 4POOA 3LRPA 2PL5A 1N2ZA 5ARBA 1Q22A 4K40A 3PQDA 3QHAA 4KUEA 3F7OA 3K09C 4LN1A 4QOHA 2C07A 2C3YA 3I2YX 4IICA 1ACMA 3UB3A 4DCCA 3DPUA 3MOIA 2D6FA 2OZVA 3FF1A 3A1EA 3DL7A 2APJA 1KMNA 1WTCA 3BMXA 2YHUA 1GILA 1R6VA 3GY0A 3JATB 3QVKA 1SKUA 4NMWA 5L4NA 1FPQA 2HQBA 2B92A 3KWLA 4ESHA 5LD2B 5CEFA 1JQAA 2BKLA 2VTVA 3R4VA 3VOAA 1C1HA 1TT5B 2A1UB 4RVSA 2HKIA 1PK7A 3BF7A 4QOSA 4X90A 3U9SA 5HKKD 2UU9B 2I6UA 3ELBA 3BC1A 3UWSA 2BY4A 4CEJA 2HAEA 4WQMA 3CR3C 1VIVA 4HFNA 1N6PA 1SC4A 3IP3A 4JLDA 3WBBA 1HF3A 4BNYA 4NEHB 5CX1B 4UEQA 1PFVA 2PKYX 3EARA 5JAHA 2P5YA 1R0LA 2PT5A 4IKOA 2VK1A 1O03A 4IS3A 2Q1XA 3M6MD 2PBRA 2Q2OA 2AT1A 2G83A 2QSZA 3AXTA 2I76A 4WDRA 1RRKA 4ECEA 4HXGA 1PWXA 1SCAA 1U7TA 1C9YA 4FHEA 5LQJA 1ZN7A 3G0BA 2DHRA 2JIMA 3PPVA 2LV8A 3WP0A 1AF7A 1N5DA 4KMSA 1DWUA 3O1JC 5SYMA 4LJ5A 4NS1A 2PMWB 1VDMA 2JI8A 3IR6A 3Q87B 2E5LB 3FVVA 5CAEA 1Z4MA 3CUKA 4OHPA 4XARA 1SBQA 5ICEA 4ZCRA 3THYA 3O4IA 5FLYA 1Y9EA 4ZOEA 1L5NA 3EUAA 3KELA 4S24A 4BLVA 4F92B 2RGNA 1SZDA 1E4EB 3CMMA 3FFWA 1TF2A 4CODB 4EK9A 4UTPA 1PKXA 2WV9A 1ULTA 1NZFA 3DAPA 5LLSA 3IXLA 3RIYA 3UATA 1DS6A 4Z2AA 1KO8A 3CR8A 4E6EA 4EX6A 5JAQA 4CZ2A 3RUIA 4Z4FA 5AK0A 2R48A 3Q2IA 2Z2XA 4LZLA 5EPEA 4F6CA 3A3PA 1SVSA 3OCJA 3ESQA 1KARA 4KPFC 3TSAA 5JFOA 4KOAA 5HMLA 3PUZA 3PHHA 4RD3A 4M9UA 1TW2A 1YSCA 4GMDA 4B2YA 1G20A 2FZ4A 4XQ9A 2W83A 1E9SA 1ZN2A 1KTVA 1P3DA 1O57A 1Z06A 3EASA 1OFHA 4XQGA 4U7DA 1KETA 1DX6A 1ZR2A 2QAJA 4LPKA 3BTUA 1RKQA 4DQVA 4JJ8A 1QHNA 2DPYA 1OFIA 2R6FA 3QXCA 1ECCA 2FRDC 3W6PA 1X15A 3GJ6A 4WNYA 1POWA 3IPYA 3RYCB 4F4UA 5IFKA 3OHSX 4ND7A 2BP7A 2DHEA 3D6FA 1Z0AA 4XWTA 1IBRA 4C88A 2BM0A 1HTWA 1S0UA 2O4CA 3PFFA 4RLSA 4ZOCA 1KFCB 1YH3A 1PAUA 3AVQA 3FNQA 3IOMA 3O94A 4QTYA 1ABFA 1K0FA 3F4KA 1J97A 4YACA 1Z62A 3ETGA 4YJ3F 4UC0A 1LPAB 4KLAA 4AJKA 1C3VA 1WUKS 5EIHA 1NI3A 4GGPA 5DTIA 1KS9A 5FV7A 2YY5A 1BJTA 2QZSA 1QHHB 1TI7A 1U7ZA 1MGOA 3AIIA 4PYRA 2C4VA 5CB4A 1A2BA 3FTNA 2HO5A 1LF0A 3HFJA 2B25A 1Z5WA 3L8FA 5SYNA 1E1LA 1Q6YA 1MO2A 3PVZA 1NJ2A 2JRLA 2QTBA 1VMEA 1FP1D 2QSUA 4R01A 1KL7A 4ZRNA 5SICE 3TCXB 4H2DA 2W6PA 3RABA 4D5GA 1T6BY 1GR1A 2ZYSA 2VHWA 1KYVA 4WSOA 1XZLA 4TWAA 2HLDD 3UG7A 3A25A 2VDJA 3D0QA 3OBIA 4CG3A 5MN5A 3CF4G 1KZ4A 1WD7A 1IXKA 1CUBA 2IUEA 4IDPA 1W4BA 2PX4A 4GR4A 3ZE1B 1QH0A 1ZGHA 1Q57A 1UBTS 2AZDA 3W3ZB 3P5BA 4HNQA 5LU9A 4GH5A 1SU7A 3TZ6A 2CL6X 1RHUA 3SPXA 4DB2A 3OKCA 1MXFA 4BNZA 5EWLB 1ZD3A 1IQ0A 2ZWIA 1SUDA 5KHAA 1JKMA 2WUGA 5TQ0B 4OCZA 2GVDC 1XNRB 3VR5D 2H2DA 1MAWA 3S4YA 1I7QB 4TRMA 1CR4A 4ZJZA 3U40A 3RS4A 3EPPA 2PSFA 3C8UA 5EINA 4FB5A 1DHTA 3UENA 1L4GA 3FMPB 1IIRA 1E2MA 1T4DA 2PX6A 2VPZA 3ZR4B 4KI0A 5GQSA 1GZ5A 3L8HA 5JH7F 4J0IA 5LYYA 4AKIA 4EHAA 2ADOA 2B98A 2F1JA 4C0WA 4MS3A 3FR8A 1BXZA 3C45A 3TIIA 1MVLA 4DY4A 4IKPA 1M1YB 4S1WA 5KKCA 3ZTTA 1J2EA 3RB8A 2WKQA 3JATA 2A58A 4IEFB 3OT5A 2D1TA 1A98A 2FJUA 1A4UA 1MX9A 5KWEA 1Z82A 5AK6A 4XVQA 5FFNA 1H9CA 4NFHA 1JWBB 2OM6A 2I2WA 2PCJA 2PKWA 2ZUCA 3T9FA 5IAAA 5JJCA 3GQBA 4HWGA 2X0RA 4UMFA 4ES6A 3H11B 2CCKA 3N2GB 3IALA 5DLQC 1KTIA 3EEBA 2ZT8A 4KFCA 1IZ0A 3GVCA 3EG9A 3C1UA 1PE0A 2J3IA 4J7CA 4YDSA 4YUAA 4JC8A 3KQUA 1OH7A 4HLQB 3PC4A 1CS4C 4ZA2A 3DOCA 4KVAA 3GPCA 4ZDJA 1FB5A 3JS5A 1ENPA 5NLLA 4UPEA 1O95C 4I19A 1K97A 1ZBDA 4G65A 3SIXA 1DV2A 4K1LA 2XGJA 3FR7A 2C7QA 2WIJA 1NDQA 1QV6A 2A92A 2DRIA 4XX0B 1A7AA 2AH5A 3R6TA 5JCOA 1M6VB 1RBQA 4JQYA 1LLCA 5DT9A 3V32A 3UV6A 2PWYA 3A31A 3FRHA 4X8HA 2C7RA 2FDCA 1HKUA 2RCNA 1M6YA 2RCYA 3IR7A 4HBGA 1TPZA 4X8OA 3ETJA 1OZFA 421PA 2A5JA 4GC5A 2QE7D 2VBFA 3BCRA 3RFUA 4A5OA 3THYB 3T8YA 1GL7A 3FYUA 4I9GA 4Q9LA 3WLHA 1MOZA 3EZ7A 3E8XA 2GD6A 5TMDA 5L3SB 3HKBB 2AZTA 3PC3A 4O4IB 2W98A 4GPAA 4N5LA 2A7QA 2R2AA 2C58A 3K0KA 4KO2S 5HFJA 5C18A 4FCWA 3C8DA 2PLNA 4M7PA 5MGNA 5FO0A 1H3EA 3DHEA 2YFQA 4ZXPA 4DT1A 1Q1NA 3KDAA 1KO7A 3BWBA 4IWYA 4FZ3A 1X0VA 4XVHA 1DAPA 4YECA 5T67A 1SAYA 1WEHA 3TLYA 4A0QA 4AWBA 3S1SA 3GO4A 2ATXA 2VS1A 2P0YA 5IP5A 1AB6A 2PWBA 2X6QA 5C7LO 2W2LA 5EJ9A 3UMYA 1LPBB 3AB8A 4PCUA 3GYGA 1CBUA 3KZCA 1QAMA 2FWAA 5TF0A 5TPWA 3ABSB 1YL6A 1YFZA 4UUAA 1Q20A 5TIIA 2CJPA 5I7AA 4DAEA 3SX2A 2EBFX 5DRTA 4AZVA 3ETDA 3VSDA 1Z7BA 4IJVA 3RT1A 4B6QA 1LDBA 1U0JA 1Q16A 3Q3VA 4Q4AB 4U39A 3L1HA 4G85A 5T8KA 4CKCA 3JRNA 3RANA 4AMYA 3PI6A 1KH2A 4WIAA 2OXEA 4M2LA 2QT9A 5K3BA 4BGIA 1KEEB 1AUQA 2NLOA 5CP8A 5IDXA 1H3NA 1EGMB 1Z22A 2J9ZB 4M7RA 3TRJA 4RTSA 2EDAA 5IC6A 4TTSA 2XGGA 4HRXA 4B4KA 2XCQA 5DU2A 4RUKA 2QQFA 1YZQA 2FG5A 3IT1A 3AY3A 3VNAA 4V1CB 4IIEA 3CVYA 1GKYA 3RYIB 3HMQA 3RT7A 4MOWA 3WNDA 2YZ2A 2YYAA 3JAKA 1PUXA 1XA4A 3T1NA 3MILA 3O8OA 4IRXA 4D2IA 5CB4B 1VMAA 3QW4B 3TRFA 2ZJ0A 1E3TA 2Q7OE 4YT8A 1MO6A 3WMRA 5ERXA 2ZYDA 3GGSA 3OCXA 4CKXA 4D44A 5TMPA 5DW0A 4HX5A 4WKOA 5IDVA 1QAOA 3ROEA 2AD5A 2C00A 3DL0A 1S9HA 4CIBA 4WI1A 2Q3FA 4PYOA 3WDLA 4UE2A 3WGLA 3FGPA 2JFVA 5G4LA 1S2IA 3BCUA 1VB3A 4I14A 1E2QA 4I5IA 3W1VA 2CNBA 5CFMA 1U7PA 1VPEA 5T64A 1XDSA 1HT0A 1D2CA 1NVWQ 2H8GA 4B8WA 1RWOA 1XMIA 4DTCA 5BY2A 1RHRA 4QG3A 5JVDB 5KDOA 5ES4B 2TECE 5MFPA 1UJNA 3RSHA 4WADA 1OMOA 3QFSA 3K0CC 4WLNA 1R88A 3SQMA 1VBMA 2FN8A 4ZAWA 2OBMA 3IP1A 1JQKA 1V71A 4ILEA 4Z9AA 3PGVA 4CCAA 1PHRA 3NKLA 1NDUA 3A36A 4IGIA 3JZIA 5DO9A 2WF8A 1CW2B 5EE3A 2RI6A 1JAHA 1KEWA 1YI8A 5CT8A 1GLGA 1NP3A 2R7AA 4LDQA 4BJ1A 1LV7A 2E5FA 3RFXA 2ZYTX 2OKCA 1FDVA 5LOVB 1OU0A 5FBZA 1YB1A 4G4JA 4XDYA 1TFUA 3CKKA 4BAGA 3Q8MA 3HKBA 1N1MA 4GKBA 1FYXA 2OYSA 1IMJA 1CQJB 2OV1A 3L7CA 3FUXA 1NZJA 4UXHA 2IITA 2BGLA 2XGMA 3RVBA 3ACBA 3X1WA 1FJGB 4LJ6A 3O2SB 4O2BF 1DAGA 1RLUA 3WK9A 5JWRA 2A1IA 1P9LA 2X8WA 3ANYB 3PQFA 1WHTA 4TVBA 1BXKA 5I3CA 4H16A 5KYWA 4IH4A 3FSEA 1BMQA 1ML4A 1I94B 4RMIA 2QNBA 5HILA 2HY7A 3ZK8A 2GRAA 4BNIA 1FUYB 4CKWA 1JEYA 2YBEA 3MTJA 3WGOA 5JLAA 1IFXA 2F1HA 3DW1X 4HQ6A 1ZPDA 3OCVA 4M76B 3EGOA 3AG5A 4PTZA 1IQRA 4RO0A 2AL7A 3REQA 5IG2A 5DOVA 3RU3A 1IVSA 1BQEA 1I5OA 1R74A 1PR3A 2G67A 3JWIA 5CNIA 3LM8A 3JQBA 4AULA 3GFVA 5HTOA 4UEOA 1EINA 2EJWA 5A3RA 5JNTA 1QVZA 5BWMA 1DBWA 1OCEA 3T7KA 3OECA 4CM4B 1H1LB 5EIFA 2WABA 2R4QA 5DYTA 4F71A 3FCYA 2ZUTA 4NRDA 4WZAE 4R84A 4QXRA 1G19A 3V4SA 4DR5B 4QKQA 3VX3A 4A26A 4PSVA 1V95A 5AUNB 1GADO 3FHCB 5IHPA 1CZOA 5LWQA 1YA4A 1FTGA 2BBTA 1NLFA 3GLQA 3WB9A 4GZ3A 2JFPA 4YMGA 3LUKA 1L5HA 4BMNA 4BNDA 4X6XA 5B57C 2RAPA 1ZUIA 3PTZA 1NZDA 4MKFA 1W7AA 3L4BA 4KH0A 4E03A 1TVCA 4LI3X 1CZLA 3C3XA 4WOBA 1TCVA 3FBTA 4XWGA 3RU7A 2IXEA 3PP8A 1RHQA 2IYWA 3I73A 5AI6A 1GAJA 4EJSA 4M0MA 3PNYA 3GCZA 3KUKA 1VL2A 2X58A 2Y2UA 3KZNA 3BWVA 2BMDA 2WIGA 4RA6B 5JJIA 1HZZC 2FOLA 1LFAA 2OBXA 3VJMA 3JASB 1L8AA 2QAGB 4YBZA 3ZI0A 1VC2A 2QN8A 2GO1A 3AEXA 1YS2X 3LHKA 4KFRA 1KJNA 4CCWA 1VKNA 2P78A 4ZI5A 4KQMA 1SFRA 2WWGA 2EGGA 4F0JA 3IDAA 1EWYA 1Q6ZA 5BQXA 3RAPR 4D97A 1XKXA 1DO8A 3M33A 3NYRA 1BVYF 4ZCSA 5IEBA 3NLLA 4XPZA 2ZXUA 2WD8A 2PKEA 1KI8A 1PR5A 3G1WA 4LJLA 1GZSA 4Z8XA 5T3YA 2W6JD 4ZCIA 1QTIA 3CSSA 5ICSA 3IQXA 1N0UA 3NHSA 1C7EA 4IHAA 1RAGA 3CO5A 2IY9A 4WY8A 3GEEA 3AUAA 4CMJA 5IYZA 3RTDA 1FUKA 4DN6A 2OLEA 4P4GA 4AZTA 4RCYA 5EZ6B 2FI1A 2QR5A 3F97A 3MBOA 1RYMA 5CA1F 2MSEB 1T13A 4WDQA 4YI5A 3RD5A 3TD2A 4F91B 5BR8B 4ZWNA 1JI0A 3I61A 2AS0A 2HREA 3TIFA 3NMUF 2UDPA 4TUYA 5ESRA 1IRXA 1LPNA 5LZ8A 3R9IA 2J6HA 3UA4A 1KQFA 2Q2NA 2R00A 3S2SA 5EZYF 3LPDA 3NKVA 4RV9A 1XZFA 2OFWA 2A4KA 3TKAA 4DMUB 3L92A 1JLMA 4TKVB 1Z4IA 1DAFA 4GX5A 1N5JA 4A1OA 1BH6A 2FEMA 1ZFNA 3NTXA 4XD7A 3A05A 4F46A 3KPJA 5EWMB 3TIGA 3QVXA 1KJWA 4EI9A 1LSJA 3CRVA 4ML3A 1ZUNA 1PW5A 3YASA 2CHGA 1JBEA 2VHYA 3AM3A 1Z0DA 5IJ9B 5C7YA 2HU8A 3N28A 2FZEA 1KVSA 1MJFA 3GQVA 5FHQA 3FZGA 5I9TA 3PFGA 2OCXA 2OO5C 2WWWA 3DV9A 4I9FA 4OXIA 3BMNA 1O8CA 1RP1A 1TF5A 1Y6ZA 1F17A 2IGBA 4KIFA 3BWYA 1J9ZA 4ZREA 2WLTA 3F90A 4DCOA 2R68A 3M89A 3Q3GE 1R12A 5JRJA 1TQHA 2ZM5A 2ZVQX 1TQ4A 1ESZA 3EVDA 4R2JA 4GLJA 1KEUA 1Z36A 4P5DA 4IJMA 5KTSA 5JMOA 2G4CA 2HDWA 4I36A 5ESDA 1U8TA 4PYNA 3SJCA 3VDMA 3UT5B 4QPJC 2CF6A 2YVQA 4ALIA 4EQ6A 2DZDA 2E3JA 5ALTA 1FLNA 3U5TA 2SKEA 3W06A 1GGKA 5K1ZA 4KIWA 1TDJA 4IFBA 4OOFA 4C7MA 4W5HA 1V16A 1RMTA 5BV0A 2DKNA 2JFHA 3G2MA 3A9VA 4KQEA 4LRWA 5AK4A 4L9WA 1W9MA 2HT1A 2VJLA 3PWSA 4FFSA 4QGBA 3LRTA 4PQYA 1EVJA 2BHTA 1D5CA 3HA2A 3GBSA 3NIFB 4KO8A 1T10A 1RI2A 1U2SA 1JBQA 3BFJA 1WMEA 3CLRD 3H5RA 2CK3D 3DDHA 9ATCA 2D3TA 1GRNA 5AVVA 1QLHA 2JLSA 4OHMA 2EFJA 3TVDA 3RTGA 4WINA 3ULKA 1IAVA 1X7ZB 2HNKA 3COYA 4XASA 5F1KA 4YRJA 5JMTA 4AY2A 4J91A 4AQDA 1I2BA 2CXOA 4US0R 1UPFA 4IY1A 1UZMA 1K6JA 3E9DA 2FPRA 3U4HA 3FB4A 4EH1A 4BJ3A 2J0VA 3IMFA 3D3KA 5G4KB 1Q0PA 3H42B 4ZVNA 1JZSA 4UVEA 5JH7B 3OE5A 5JROA 1JTVA 4LF8B 1T8YA 3USES 2J6CA 1M8PA 1L8XA 3M2PA 1ORHA 4M9QA 4TL7A 4AF8A 5DNYB 2XBMA 1NVXQ 4PR3A 4IVRA 4CLEA 4G9EA 2JKZA 2PGJA 1C1YA 2V7TA 2ZROA 4GXTA 4YS6A 4BUZA 5DBOA 3N8GA 2GF9A 1GPJA 5AHXA 4R7ZA 1AKWA 3NWEA 1OBHA 3JPWA 5K99A 3HCAA 5I9LA 2FVXA 1QO0D 3IVCA 3MCZA 1I7LA 1U2PA 1ZRNA 4M46A 1XZEA 2G88A 1IZ8A 2A0WA 1GPUA 2QRJA 3JU3A 3LPLA 4JODA 4AB1A 3VOTA 3ZJYA 4JJ4A 5FR1A 5LZ7A 1TECE 1GTZA 2WSSD 3P1JA 1W4RA 3DHVA 3M1IA 4D0RA 4OHRA 2REOA 1GQQA 1Y0BA 2CJFA 3WRWA 4H1WA 3H6KA 1P33A 9MHTA 1ONNA 5HK8A 1V26A 4WY5A 2H2HA 4DKXA 2QM8A 1AN0A 3K9HA 4FLEA 1YU9A 4RABA 4EECA 2RHRA 1I1NA 2Y8EA 5IMBA 5K0BA 4N40A 1OAAA 5AHKA 3C3EA 1XEAA 1FXWF 2FKAA 3KQLA 4EKNB 5BP7A 4X65B 1YDEA 1J8MF 2GJ8A 5DFAA 4GQIA 1DRJA 4L74A 2V3WA 1UBNA 4EPXA 4IW3B 4ZVRA 5J4KA 4PZ0A 2VSOA 4YP0A 1YJAA 4ZMRA 2JA2A 2XXJA 1D2RA 2OZPA 1ZESA 4ZDKA 4CM5A 3OFNA 2JJMA 4NPAA 3PHIA 4PZUA 621PA 1BE8A 4TTQA 3H65A 2JIBA 4YWJA 2VSNA 3UAXA 3Q8XB 4HUQB 1PP4A 4Q03A 5FPQA 4LSZA 1SHTX 2GKSA 2XHZA 4TXLA 5JAZA 4LYAA 4RJ2A 1DKLA 2R8PA 3FCCA 1CRZA 3KKEA 4LOIA 1N0HA 4Q21A 4Q3BA 2IW3A 5BNZA 1IN7A 2Y05A 1RWKA 3BGIA 1NVAA 3P2JA 3UJBA 1YZLA 2XVAA 2EEPA 2R9VA 3OJXA 3LY8A 1T2VA 3H9UA 2CUKA 1CNFA 2FJPA 2RHDA 4RLQA 4KUGA 4EFDA 1N2OA 1E2GA 2RH4A 3JD2A 2RC5A 4HLNA 1GZ7A 2R84A 4C4PA 3I8XA 1FMJA 1UANA 1PT7A 2RAVA 3F0TA 5JADA 1TYDE 3LQYA 4BFTA 1MZVA 2N0SA 3AT1A 5E38A 3RRYA 4ZHQB 2PLRA 3TCKA 3ZWVA 2CVHA 4L5CA 4TLEA 3ASVA 4RJLA 3RFCA 5EESA 4B3BA 4Q4LA 4R2XA 4AF7A 3UICA 3VVLA 2GCOB 4NPCA 1XEXB 1FK8A 1PT6A 2PKRA 1XVUA 1B6RA 2WFZA 4L15A 1O6BA 3BH6A 3EG9B 3L49A 1HYBA 1EUZA 1WF6A 3LXMA 1E2LA 1AO3A 1OASA 4M22A 1GRRA 1OROA 2O2GA 3QEMB 2JCXA 3DAHA 4D57A 2PL1A 1XN1A 3KR9A 1VIDA 1ZUNB 1UJMA 3SC6A 1KIAA 1OFUA 3DLIA 5B1HA 4I1YA 1E7SA 2PX5A 3CQ9A 2QDXA 3PFKA 1WY5A 3OPYA 4FBMA 4N5IX 5AKEA 5FOUA 4FD3A 2XQGA 5ECDA 1Q1GA 1ZISA 5C5DA 3CYFA 1KMCA 4NYMR 2ZI4A 4IHQA 2G71A 4B4OA 3R23A 3ITDA 1U0LA 5AM4A 3WWOA 4OB7A 3K5IA 1K9SA 3R3SA 4GRIA 1JALA 4ZAGA 3L4EA 5M2QA 1FTQA 1VG1A 1PBTA 4KQJA 2DETA 5BOSB 4ZVPA 1CWUA 3DSRA 1Z8HA 4IHJB 5E6SA 4RY0A 4U6SA 3LW8A 1F2TA 3NWPA 3RWMB 1JEJA 1X2EA 2ALJA 1X92A 3ZCUA 2Q62A 4IJWA 1GTL1 3ZGVA 2UXBB 4ZCMA 1W94A 2C1ZA 3HJTA 2ID9A 2RGNC 4UZFA 1IY0A 3DFMA 4F84A 2AX4A 3P52A 3DVQX 1D09A 1NNLA 4OGGA 2IZ1A 5E6RA 3U7QB 2W6ID 1WNTA 1QJ4A 2ZRPA 4MA5A 4L2IA 1EI9A 2PD4A 1KAMA 1EDOA 3K2IA 1L5KA 4DQXA 1NT4A 3SC4A 1C3JA 3SZ3A 3HXLA 1A3CA 1Q0HA 3COJA 1NI4A 1MW9X 1WA5A 2G1AA 4GSKA 3ST7A 3GJRA 3DXZA 3QBJA 2G9UA 5U9CA 3K8YA 1LNQA 1YACA 2FA9A 1NF3A 1T8SA 1NOJA 1JU4A 3IO5A 2QOEA 3LQ2A 5DYNA 4ZTBA 1XU9A 2E4ZA 3TLMA 1GL6A 2ZXFA 1KJYA 3OEYA 4MW6A 5LMNB 4HLUA 2WE7A 1JQJC 2ZBVA 2QMEA 3C70A 1ECLA 3A3YA 4QJ4A 2EW8A 3G17A 4LJ8A 2QJFA 5G3YA 2R6AA 2XUAA 1ISMA 3AGQA 3G5MA 4HMQA 4NEQA 5EIBC 3CCBA 1Z3CA 1X38A 2IXGA 4E7OA 1MA0A 3UAWA 5GONA 3SSMA 4O2AA 3WNVA 2XT0A 2P6RA 1TL7C 5AJWA 4BFVA 1Q0LA 4C7OB 4OL0A 1T2AA 4FBLA 4H6WA 2ZJYA 3DKRA 1M33A 2C1XA 3FJOA 4CMBA 4U7HA 4B4UA 3OEEA 1AUVA 3AP1A 2BGJA 2ZSHA 3L9WA 1ESMA 1SCBA 1VHQA 2AZMA 2FPWA 1DOAA 2OCKA 4O4IA 4ZVMA 2JK1A 3ZZ0A 2B37A 3NWOA 1SOWA 4DA8A 4A73A 1EVEA 3FKJA 4HAUA 1VQ1A 1D6SA 5CMLA 4ANFA 2C9ZA 2QM3A 3E7DA 3D59A 3CWQA 1MO5A 2QLMA 3KSMA