3PP8A

2.1 angstrom crystal structure of putative oxidoreductase (ycdw) from salmonella typhimurium
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
312
structure length
310
Chain Sequence
SNAMEIIFYHPTFNAAWWVNALEKALPHARVREWKVGDNNPADYALVWQPPVEMLAGRRLKAVFVLGAGVDAILSKLNAHPEMLDASIPLFRLTGMGLQMQEYAVSQVLHWFRRFDDYQALKNQALWKPLPEYTREEFSVGIMGAGVLGAKVAESLQAWGFPLRCWSRSRKSWPGVESYVGREELRAFLNQTRVLINLLPNTAQTVGIINSELLDQLPDGAYVLNLARGVHVQEADLLAALDSGKLKGAMLDVFSQEPLPQESPLWRHPRVAMTPHIAAVTRPAEAIDYISRTITQLEKGEPVTGQVDRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glyoxylate/hydroxypyruvate reductase A
publication title 2.1 Angstrom Crystal Structure of Putative Oxidoreductase (ycdW) from Salmonella typhimurium.
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Oxidoreductase
total genus 99
structure length 310
sequence length 312
ec nomenclature ec 1.1.1.79: Glyoxylate reductase (NADP(+)).
pdb deposition date 2010-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3pp8A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3pp8A01
1U28A 4XDYA 2YW9A 3ADOA 2YY7A 4MO2A 1Y7TA 1NHWA 1YQDA 2D1YA 4EJ0A 3U5TA 1YE3A 2BGKA 1C14A 2B35A 4Z0TA 3ZHYA 3DHYA 2DUWA 3V1YA 4XWYA 3P2YA 5BSEA 3WGHA 2PLAA 1ISFA 4CL8A 4IM7A 4JJFA 2PFGA 1D3AA 3Q9NA 5IFLA 3D4PA 4MVJD 1NPTO 1M75A 3WGGA 4TKMA 2HU2A 3KV3O 3QW2A 3LF2A 4F46A 5BQFA 5CP8A 4R1NA 5KIAA 1KEWA 1QSGA 1EE9A 1RJWA 1DC4A 3W4KA 3DHEA 2I65A 4CMHA 3EVTA 3WGIA 4B8WA 4RPKA 3JYPA 3WR5A 4IIVA 3ZW9A 2ZQYA 5A5FA 3ON5A 3L4BC 1WDLA 3HFGA 1BMDA 5TNXA 3E82A 4CMIB 2IDZA 4Q3DA 4PZCA 4IJKA 1LBEA 4U6SA 2VZ9A 2JCVA 4P4LA 3G3EA 2O7QA 4CLOA 2OFPA 1N7HA 3I4CA 5IF3A 3OICA 3ZU3A 1BXGA 1ZK4A 3Q6IA 1XG5A 4R68A 1PJSA 1DIBA 1DHTA 2ZYGA 4IMPA 2NM0A 2X23A 4NI5A 2ZATA 4WNCA 5CAEA 5DCWA 4E31A 2VWPA 2FOIA 2EF1A 3GGPA 5KTKA 3QVSA 5JY6A 1PU2A 4DWVA 5A9SB 1VI2A 4PG6A 3DBRA 4U0JA 1TA4A 1E3JA 4S3MA 3WGZA 4MVJG 3H2SA 4OOFA 4JIGA 3FI9A 4MVJE 3QJ5A 4I1IA 1H0KA 1JTVA 1ORRA 2WE8A 2B5WA 5I8ZA 2JKVA 3JD1A 5EQDA 4YB8A 5AVOA 2YZ7A 2DU8A 3ORFA 5ILGA 4BNIA 4NDNE 3UN1A 4JP2A 5CPBA 4UEOA 3RJ5A 4NMHA 1BVUA 3ZV4A 4I9HA 3GEGA 3H6KA 4J0FA 4RDIA 3ZWOA 3MTJA 1ADCA 1YOVB 2J3IA 2Q1UA 4B4VA 3CZMA 3AFNA 3QWAA 4JQCA 1YWGO 4OJNA 1T24A 3AU8A 1DLJA 5CDGA 2EKQA 3WMXA 3D64A 4DBVO 1ISIA 3JYQA 5COQA 3C7DB 1SZJG 3ROPA 2A35A 4JCOA 4CMEC 4RF4A 1YRLA 1TVEA 2HJRA 4ILKA 4NH4A 3RUFA 1ZEMA 4XIJA 4A7PA 3TPCA 5G2OA 3RC7A 3BMCA 5A3JA 3U4IA 1Y5MA 2P4QA 1EE2A 1W0CA 1DSSG 3INTA 3FN4A 2AEJA 3FPLA 4WLUA 2QZ9A 4TRNA 2WD7A 4MVJH 2O2YA 3I9OA 2FP4A 4E5NA 1H6CA 1EQ2A 4E5YA 3W1VA 2BFAA 2RH8A 2EEZA 3G17A 3LVFO 4KDEA 1SB8A 2B36A 5JCXA 3AM3A 4JJIA 1DRVA 1UZLA 1KC3A 1PL6A 3IKVA 4CV2A 3ZCXA 2PA3A 4CM3A 3CINA 5F5LA 1VSVA 2HLPA 4L4SA 3JSAA 5DDIP 2GO1A 3ZWAA 1NAHA 2NU7A 2OO5A 1ADBA 1TB4A 1ULUA 2FPIA 4FFNA 1LDYA 4JBHA 4BV9A 1PSDA 4D3DA 1QLHA 2GF2A 4MKRA 3IDSA 4OXYA 5DULA 4E0BA 5BSFA 1GAEO 3MWEB 3L9WA 2R6JA 2VRCD 4J4BA 1Q2XA 3ROMA 3HN2A 1RYDA 4B7UA 1I3NA 2Y1EA 5T6BA 1LU9A 1A7AA 4PCVA 4UVEA 4U7WA 5TGDA 1NVTA 4FR5A 4ZJUA 1Y1PA 1RM3A 1DHRA 2O3TA 2V6FA 1KYQA 3CMMA 3GF4A 3S2FA 3KTDA 4FFOA 5ICMA 1X14A 2HQ1A 3P2OA 1DO8A 2E4AA 4P8RA 2I99A 5COAA 3S2EA 4N18A 5L40A 1YDEA 5I7VA 4B7CA 4R1TA 3E03A 5A06A 4IBOA 1IZ0A 3JQAA 1R0SA 2X7HA 3FCOA 2ZYDA 5TRTA 4MVJF 5TLSA 5BNIA 1CYDA 3L6DA 3HB5X 3HUDA 5K6AA 3VPXA 2OP1A 3T4EA 5T5QA 1HDXA 2AXQA 4DTIA 5BNTA 2VOEA 2IRWA 4L75A 4K6CA 1I2CA 1KVQA 2X5JO 3BHIA 4OXKA 4RCVA 3VOSA 4D46A 1KY4A 4IZIA 2CVQA 4NJMB 3ETEA 1CWUA 2HK9A 4BV8A 1ENPA 1I10A 1K6JA 2AQIA 3OF2A 1U7HA 4CQMD 1EFLA 3WX0A 1E7MA 3I1JA 3OECA 3GK3A 1EK6A 1MC5A 4RPJA 1NR7A 1MXFA 1PR9A 1PL7A 2QYTA 1U4SA 1JQBA 4J1QA 4JLWA 3GMDA 4Q3CA 4Q3BA 4B7XA 2J3KA 4E4YA 2AQHA 4DMLA 1QP8A 3K9QO 4J0EA 3PIIA 4CMBA 4CMIA 1PGJA 1NQAO 4IDCA 4I5DA 2HUNA 1VLLA 1CF2O 2EGGA 3IJRA 1O89A 3WGTA 4FDAA 2NADA 5A04A 3NTQA 1N9GB 4M89A 4PFJA 4R69A 2EJWA 4EJ6A 5A1TA 4TRJA 3WJ7A 1KEVA 1LLDA 3WLEA 4MVJP 2HO5A 3GVCA 2GNAA 4R3WA 4RF5A 4UREA 2GZ3A 4GX5A 1I2ZA 5K6AC 4MPDA 4IDDA 4CQMB 5HTOA 3WBFA 4YJFB 4M1QA 1GYQA 2IZZA 3PQFA 4AL4A 4F45A 2PK3A 3KEOA 4XQ9A 3H9JA 3WFIA 2VHVA 1CETA 2VHZA 4DIFA 3LC7O 2P9EA 2DFVA 3DWFA 4Z9FA 5IG2A 3GZNB 1VE9A 5CPFA 3TZCA 1MXHA 3L77A 1DOHA 2Q2VA 2UDPA 5KJEA 5B4UA 1C1DB 2YQ5A 1KEPA 3C85A 4LN1A 4MDHA 1T2AA 2RAFA 3GPDG 3IP3A 4R01A 4QFDA 4RVUA 5HWSA 2CD9A 4UVGA 1IYZA 4I5FA 2WYWA 3DAFA 1SMKA 1YOVA 3OQ6A 1ZEJA 3IP1A 3W6UA 5GZ1A 3VDRA 2EP7A 1PWZA 3C24A 1E6WA 4RVSA 3PZBA 1UH5A 4TVOA 3GN1A 2C82A 5TJ9A 2X5KO 3H3FA 1LDBA 1ZJZA 4NNJA 2B4RO 2EIHA 1NXQA 3L4SO 1ZK3A 2DPHA 4DIBA 4JGBA 1R4NB 4QO8A 2BH9A 1CRWG 2IYOA 3ZU4A 3IIEA 2ZTVA 2JL1A 1XDWA 2QZZA 1HSZA 3FBTA 3LLSA 3B1KA 1EUCA 4AJ1A 1EZ4A 4IDFA 1Z45A 4OM8A 3TZHA 1E5LA 4HP8A 4BVAA 3RROA 3W6ZA 3WSWA 2HMSA 4J7UA 3S55A 4J91A 2HMVA 3GT0A 1YDWA 2QHXA 2Q1TA 3AOEA 4CQLA 3UXYA 4N5MA 2X9NA 3P5SA 5L4LA 4CV3A 3WYEA 3K96A 1E7YA 1ONOA 1IULA 1W8DA 1M76A 3NT2A 2OMEA 3QWFA 3O8QB 5I9LA 3DTTA 5IJZA 1LNQA 5C5IA 4IPTA 3ZNQA 3U0BA 4GLLA 1E0DA 1OBFO 1ONPA 5TJHA 3TOXA 4E5MA 1U9JA 3FBGA 2BRUA 4WGGA 4J7XA 4FSHA 2CDAA 2IZ0A 4A73A 4ALKA 1JA9A 2VCYA 4KTVE 5L3ZA 5KVVA 4O5OA 1HETA 3PWKA 1HE5A 4ZQHA 3PTZA 1B2LA 1FJHA 3Q0EA 4BO4A 4DREA 1HKUA 1NAIA 1YJQA 1PGQA 3GNSA 4BKOA 2GR9A 3D0OA 3ZZNA 4YACA 3HADA 3N58A 2ZCVA 4CUJA 1E6EA 3PLNA 3OA0A 1P0CA 3U09A 1XCBA 1VL6A 3F6YA 2V6GA 3Q2IA 5DBFA 2GUGA 5CHEA 4J43A 4NJMA 5FFFA 3AOEC 3JQ9C 2VRCA 1EVIA 3ONDA 3WGQA 5FWNA 1ULSA 1LSJA 3HHPA 4HFRA 2CMDA 2QQ5A 3HZZA 1HDRA 2HSDA 1XU7A 4R5MA 1X0XA 1IZ9A 1C0PA 3LDHA 4LVCA 4ALJA 1T4DA 1JWBB 4RORA 4YT4A 3LT1A 1H2BA 1QG6A 3H4VA 4EI2A 4ZRNA 5T67A 2QYSA 4KUHA 3SXPA 3F5SA 4ALLA 1XU9A 4URFA 5EMHA 1YL5A 1IY8A 4FFRA 4M49A 1PGNA 1DLIA 4EZBA 1SEVA 1IHYA 2VQ3A 4IQGA 2DBZA 4ZQGA 1P1JA 3ZH2A 4XIYA 4ROSA 1N1EA 1N9GA 3X2EA 1QYDA 4PVCA 2ZKLA 2W2LD 4WCDA 3TZ6A 3M1AA 1R37A 3RWBA 4DMMA 2I3GA 3K5PA 1K5HA 2EKLA 3PFWO 5GMOA 1HYGA 2Y1DA 4EBFA 3D7LA 4JX8A 5FYDA 1P33A 2PZMA 3DDNA 4CQMA 3INGA 3K92A 4XZ3A 3UCXA 1M2WA 3ZU5A 4G5HA 4YJFA 1UUFA 5JDCA 4A26A 2NVUA 1RPNA 4WECA 3WBBA 3LK7A 3KVOA 1VJ1A 3W8FA 1ENOA 2W98A 4ND4A 1VRWA 2X0NA 1BVRA 3GZNA 3DBVO 3QY9A 2B4QA 3WQQA 4BS9A 2UUOA 2ZJ1A 1I30A 3AOGA 3DFUA 3AK4A 5KNLA 2VUSA 1C1DA 2NACA 4FFMA 5A9RA 3NRCA 4A27A 4DYVA 4QT0A 2IEBA 1P77A 5H83A 4WPGA 3BTUA 2GPTA 1QORA 4P4GA 4XJTA 1UP4A 1H6BA 4IXTA 2BLLA 3JD0A 4J2OA 3GRKA 4JBGA 1OC2A 3GVIA 4B3JA 4MIEA 1O95A 4L0QA 4HBGA 4D42A 1Q7CA 1JU9A 2HDHA 3RUEA 4BGEA 3VAZA 1E7SA 1C0KA 2NNLD 3MJ4A 2J3JA 3NEPX 5JNLA 1LDNA 1UDBA 3JQ7B 1B8VA 2NSDA 1IHXA 3B20A 1HLPA 2AMFA 2P2SA 1U3VA 2VYVD 5BNFA 3DC2A 3RKRA 3KOUA 1BXZA 3OQBA 1G1AA 4ITUA 1G0OA 1U2GA 3JYNA 4BGVA 4PRLA 2EWMA 2P91A 3QWHA 3GVHA 4OMUA 5IZCA 4L4XA 2JD2A 2IZ1A 3CPSA 4RPGA 1VPDA 1HDZA 5DOZA 4BHTA 1I24A 3RBXA 3QA9A 4WASA 2J8ZA 2F00A 1Z75A 3PDUA 4O63O 3UW3A 1HE2A 5TF4A 1XSEA 3GLQA 5EL0A 7ADHA 4CMJA 4DLBA 1XQ6A 2O3SA 3WWYA 1KY5A 1NBOA 1H6AA 3O8QA 3ZWWA 4NIMA 1BG6A 1DAPA 3OJOA 5G0VA 3KLMX 3JQCA 1YB5A 1HDGO 1A5ZA 2HCTA 4GX1A 3NKLA 5H81A 1NFRA 3DONA 4WK6A 5ER6A 3SBOA 4W4TA 3HQ4O 1DJQA 2Y68A 2O3RA 4A03A 1Y6JA 1X13A 3OIFA 5G0WA 4EJMA 4YVFA 2PZJA 4Y9DA 1A7KA 3A28A 4KQWA 1A27A 1KERA 4MVJM 2C07A 4CM7A 4BMVA 3NGLA 4J6FA 1ENZA 3PP8A 3DBHB 2I67A 1LRKA 1O94A 5I9NA 3NAQA 1K6IA 1LQTA 2VUTA 5HRUA 3VVBA 4HKTA 4BO0A 3INRA 5T57A 3Q3CA 4LSWA 1I36A 2GZ1A 2OBNA 3ZV3A 2C0CA 4UVDA 4AJKA 2QX7A 1UAGA 3PWZA 3ZWYA 5BSHA 5HS4A 4XQCA 1C1XB 3WWZA 1X1EA 3M2TA 2EV9A 1T1SA 4K26A 3HE3A 4OHUA 4QFCA 2AA3A 1B8UA 4OSOA 1F8FA 2CVZA 3BMNB 2XPCA 2BGMA 1MUUA 2VWGA 3D3WB 2YHUA 4B4WA 4IIUA 4IS2A 4PRKA 3DMTA 3QHAA 3OETA 5F5NA 2J5KA 1E3EA 3N74A 4W99A 1GDHA 1CERA 3AY3A 5AXDA 3PI7A 4ZQFA 3LF1A 3MJSA 4KQXA 3GC6A 2DTXA 1EUDA 4WCFB 3H65A 2D0IA 1T25A 2VUUA 4KUGA 3F4LA 2ZCUA 3IUSA 3JQBC 2VRBA 1L1FA 4AJNA 3HDHA 4II2A 3FWNA 1XYGA 2XXJA 1GUZA 1E7QA 3PHLA 3DOOA 1ZK2A 3SC4A 3KBOA 1KVTA 2OUIA 4HUJA 1EVZA 5A9TA 3PGJA 4BNYA 3RC2A 4M55A 1GYRA 5BT9A 3HSKA 4IGEA 5A03A 4CUZA 3GG9A 2B4TO 3O4RA 5B4VA 2FMUA 1DFHA 4B8ZA 1Z7BA 2I3AA 3IQDB 4DLLA 4B3HA 5EJ2A 3OJEA 4RZHA 2O4CA 2C29D 1LTHR 4KWHA 2ZB7A 5ADHA 1R66A 3JQFC 4IDAA 5U4QA 5JMPA 5DN9A 5LC1A 4B4OA 1WDMA 1C0LA 3UKOA 1J6UA 1BGVA 1JAYA 3ZV6A 3RI3A 4XYEA 2O50A 4YAKA 2CF6A 2D4AA 4PLWA 3BAZA 3CZRA 1K0UA 1LC0A 4IJUA 4W9NA 1MLDA 3PJEA 1NTOA 4IMRA 4ND5A 4J1SA 1J4AA 3G79A 2C5EA 4ZN6A 3DMTC 3T4XA 3AWDA 4L74A 2Q4EA 4D0SA 2AE2A 5GZ3A 3D1LA 3UOGA 3LT0A 3KETA 1KS9A 1QXSA 4XRRA 4BL5A 4AJ2A 1RYEA 3L6EA 1O5IA 3KYBA 1PJLA 1PZGA 4BNFA 4BNJA 1J5PA 2C20A 3U49A 1HF3A 5BSGA 1TT5B 4I9NA 2PZKA 2W2LA 3DO5A 5JYDA 4Z6KA 4JROA 1LA2A 3V2UA 2IE0A 2B0JA 2C2XA 3WNQA 1SAYA 3NV9A 3EDMA 4Z9YA 1FDSA 2NU9A 1ADGA 5IXYA 2DAPA 4EEXA 3JQ7A 1TT7A 3ANLA 3ZHZA 1EDZA 4D3SA 3BHMA 4CLEA 1YL7A 2Z1MA 3COSA 3E48A 5JCJD 1LRJA 3V1UA 3I9KA 3ANNA 3DB2A 4OYRA 2F1KA 1MV8A 3LYLA 4NK4A 3OIGA 2ZIZA 3LQFA 2G1UA 2GLXA 2POQX 3EW7A 5I7SA 4OQZA 1BHSA 2Y67A 5JMWA 1U5AA 2DBQA 4ZU3A 3C1OA 4ZA2A 4GX2A 4CM9A 3RFXA 4JK3A 4RLHA 2Q1SA 4FS3A 4GI2A 2JD1A 2VHYA 4E21A 1ONNA 4W9NC 1XHLA 3TQHA 1EUZA 2HK7A 1WXDA 3G0OA 2DT5A 1QYCA 4FGWA 3TRIA 1ARZA 3GRPA 3DAPA 1ISGA 1HEUA 4D3FA 1YBVA 4XKJA 4CLXA 2J6IA 2BELA 2DKNA 1N1GA 4FQ8A 4HV4A 4UULA 2X58A 3U62A 4O1MA 4OKNA 4NFHA 5KJ6A 2CFCA 4YR9A 3VTZA 3OMLA 3A14A 3H9UA 3NYWA 5EERA 2VYVA 3ZNOA 1P44A 1LSUA 2PH3A 4G81A 3PGXA 3RIHA 3WXBA 2R2GA 3DBHA 4CM8A 3EK2A 4Y98A 3TOZA 4CR7A 2H5LA 4NG5A 4E3ZA 1AHHA 2GN9A 2OP0A 3F9IA 2OGUA 3OHSX 1ZVMA 4JXKA 5DF1A 5JLAA 1DIHA 2ZTMA 3WGOA 3G1UA 1JLLA 1WWKA 4DPKA 3JTMA 4I8XA 4WLVA 4F6CA 2XOXA 4BO1A 4WJZA 1N8KA 3ZW8A 3M1LA 4DGSA 4GBJA 1C1XA 4UVHA 3UFXA 3DZIA 1YVEI 2ZB8A 4ZQEA 1YQGA 2X22A 4Q9NA 3STHA 1GL3A 3BMNA 3NGXA 4PZDA 3D3WA 1Y8QB 4FFLA 4IZHA 4Y6PA 4YJGB 1HZJA 2V65A 3E9MA 3MJEA 4BNUA 3FTPA 1X1TA 2WYUA 4MINA 3OM9A 1HWYA 1UZNA 3HDYA 4R16A 1P9LA 1F12A 1DC5A 4FJ2A 3JD4A 4HX5A 3H7AA 1E3LA 3ZV5A 1E1MA 1H5QA 3KEQA 4WCFA 1PQPA 1I8TA 3NJ4A 4JN6B 4TRMA 2UUPA 3GHYA 3LC2O 2FN7A 2UYYA 1OMOA 4AJPA 1ZKMA 3DR3A 3GH3A 1I01A 4PIVA 1VL8A 4CV1A 1GPDG 3K31A 2NVWA 4PLTA 4IXWA 3JQ8B 4INAA 4L76A 3NT5A 4LMPA 3SLGA 4WLNA 2BHLA 1Q7GA 2WM3A 3GN2A 3RC1A 3RFTA 1LRLA 2HMUA 3RFVA 5L7YA 1UZMA 2O7SA 3ZN2A 1GUYA 5KVCA 3ZDFA 3F3SA 1Q0QA 2AW5A 3QP9A 2YV2A 3A9WA 2NTVA 4XR4A 2H1SA 3ZWNA 3C8MA 5MDHA 1DFIA 1PJCA 4OSPA 3FR7A 3GGGA 1E7WA 2JAHA 4WEQA 3TL2A 4C7KA 4OAQA 3TN7A 3QVOA 5JO9A 1F17A 3GA0A 4TKLA 1RWBA 3QSGA 4M8SA 1RM0A 4HY3A 4QO7A 5CEEA 2W2KB 3T7CA 4WKGA 2YV1A 1YGYA 1NFQA 3WB9A 4PG7A 2B5VA 3CE6A 1GQQA 3L9XA 5L95A 3WS7A 1Z7EA 3IAHA 3R6DA 4YAIA 4MVJI 4PLPA 1GZ3A 5THKA 2P5UA 3MJTA 4QTZA 4DC0A 3FR8A 1SOWA 2GASA 1F14A 1EK5A 3DTYA 3I52A 4L73A 3Q2KA 4RF2A 3RUDA 4BNWA 1L7DA 3FNFA 1NYTA 2GZ2A 4P22A 1GD1O 2Y1OA 5DOVA 4BO8A 3LU1A 1ZK1A 4GSLA 1ZCJA 2AEFA 2HKIA 4K1LA 1XQ1A 2SCUA 4O6VA 5IXSA 1ZSVA 3IL2A 1I33A 3MWDB 4L4RA 3DZHA 1PR3A 1FK8A 2RBEA 4XB1A 1DFGA 3WTBA 5A9SA 2C7GA 3RVDA 1ZZEA 4R9SA 2W4QA 5ICSA 2UVDA 1G6KA 2A92A 1W4ZA 4IQ0A 1OFGA 1PJTA 4GLOA 1G0NA 3HNPA 4L8VA 1Q7BA 2O3UA 3ZHXA 4XYLA 2D5CA 3I6IA 1LLQA 1NPDA 5F1PA 4WOKA 2A4KA 2XF8A 3RASA 4BIIA 1MFZA 3KM0A 3FWZA 4RPLA 4X54A 1XWFA 4RZIA 4O59O 2P9CA 2J5RA 2FRDA 2Y0DA 2FPPA 4NZ9A 4EYEA 5JC8A 2IYPA 4QEDA 1B14A 3EAGA 1PS8A 1R6DA 5J23A 3OJLA 3CTMA 3UH1A 2DBRA 4ALNA 4ID9A 2PNFA 4KUEA 1B8PA 3PYLA 2E49A 4ZQBA 4XJSA 3Q9UA 4XQGA 1U5CA 4J4TA 3DZKA 4DXHA 5HM8A 3OFSA 2PH5A 3QLJA 3QWBA 5EESA 3E5MA 3ONEA 4BGIA 4CM6A 2V6MA 2DPGA 3GNTA 5JCJA 4FD3A 1LDEA 3C1TA 1LLCA 4J1NA 2BFPA 3QV1A 2GERA 3ICPA 4ALMA 1Z73A 5CEFA 1U8FO 3VVCA 1WVGA 5DZSA 1LSSA 4Z0HO 3AUSA 3UHAA 1P45A 3WGYA 4BOYA 4RPHA 1L7EA 2H63A 1JKJA 2VNAA 2EW2A 3FNGA 5L45A 2BKAA 3MCVA 1PS0A 1JKIA 4DC1A 1UXKA 4BQRA 1E3SA 1KEUA 1GU7A 3OH8A 4K6FA 4KTTE 3B6ZA 3QIVA 5TC4A 1LEHA 1B3RA 1KETA 3DQPA 5EQFA 5I7FA 2QIOA 3P19A 1IPEA 2PD4A 2NTNA 3QVXA 3ZWXA 1Y8QA 5JAQA 4BNTA 2Q45A 4YJGA 4QQRA 4PGFA 5B12A 3ASVA 4RO0A 3KHUA 3U3XA 2UAGA 4UVIA 4BNVA 1B3BA 2HRZA 1MC4A 2D5AA 3AM4A 3RCBA 4W6ZA 1MGOA 4DVJA 1NNUA 2FR1A 1LJ8A 4DLAA 4R54A 1ZO8A 3O03A 2OL4A 4N5NA 3JQDA 3O26A 3NDRA 4IY1A 4NBWA 4NPCA 1BWSA 4EGFA 3JCZA 3WQSB 5C7LO 4YA6A 2P4HX 2PGDA 2X8LA 3KYDB 1H2HA 5A02A 2EERA 5U9CA 3M6IA 1LX6A 2JAPA 1H9AA 2CF5A 3GHHA 3OQ1A 5AYVA 3UF0A 3WQRA 4D79A 2CDCA 2VOJA 3DOJA 3JQ8A 1PJ2A 1HTBA 3VDQA 2VYND 3BZUA 5JY1A 1R4MB 3I4FA 3GDFA 2CUKA 1ZSNA 2X0IA 5DCYA 3RU9A 2Z5LA 3FD8A 4BO9A 1ISJA 3QRWA 4Q39A 1UJMA 3OIDA 4DQXA 3SEFA 1Y9AA 3PYMA 4RQUA 1FXSA 5FI5A 4H16A 4BKQA 4ZGWA 2Q50A 1VJTA 3GFGA 4I9UA 2AQ8A 1EEHA 4FBGA 1HDYA 5B37A 1GTMA 3S2GA 2W90A 5F21A 3KZVA 2C5AA 4HNGA 3W8DA 3I83A 4FGSA 2O3QA 1D1TA 2FZEA 3DFZA 1EVJA 3R3JA 1SBYA 2W2KA 4YEDA 1RM5A 1N7GA 3HFSA 3RD5A 1GADO 3UGKA 1LUAA 3F1KA 1NPYA 1EQUA 1N5DA 1HXHA 3HDJA 2TMGA 3QVWA 3AUTA 2ZB3A 2JCXA 5IDXA 2E82A 4BNZA 5G0UA 2EJVA 1VL0A 2P9GA 4IJVA 4Q3AA 3RC9A 3WIEA 4YAEA 5DNAA 1W73A 3VH4A 1W6UA 4E6PA 1K89A 2Y66A 3PK0A 2JFHA 4YRDA 5JAZA 3MTGA 2ZK7A 4XYBA 3MZ0A 3U4CA 4DPLA 1T2EA 1O0SA 4C7JA 5CG1A 3OEWA 4E12A 4I5EA 5KVQA 4DIOA 4R5HA 5AXAA 4CLDA 3F46A 4RF3A 2DTDA 4FPXA 1BXKA 4RGBA 3VHRA 3EGOA 1HZZA 2DLDA 3GAFA 2LDXA 2YDXA 4KDFA 1PJQA 1NHGA 1U1IA 4YJHB 4GVXA 4UEKA 2DQ4A 2Z95A 3ETGA 4N5LA 4RJTA 2YFHA 4CLHA 4ZICA 2RCYA 1B0AA 4BKRA 8LDHA 2VHXA 4Z3DA 3TFOA 1JWAB 1ML3A 4F3YA 4CM9D 1A9YA 3NUGA 1ZBQA 4EUFA 1LQUA 2FSVA 2CSUA 1GZ4A 1U2DA 1WAMA 5KJFA 1GEEA 5I8WA 2AG5A 1PEDA 5AXBA 9LDBA 3NT4A 2D8AA 5C37A 5CDYA 4E33A 5LDGA 2D2IA 2HMWA 5C7OO 3BHJA 2A9FA 1MFPA 3BA1A 3MOGA 4E5KA 4YT2A 2HK8A 2C2YA 3CXRA 3LZ6A 2X86A 4PLGA 1GY8A 3DAGA 3HDQA 4Y6SA 3D5TA 3V8BA 2OXIA 1XEAA 1GCOA 1R4NA 3NDJA 5A05A 1PQUA 2WTBA 1EVYA 2JHGA 2GD1O 3VZQA 1CIVA 2Y0CA 4FIZA 1WPQA 1I32A 3JD2A 3Q1LA 4MKXA 3X2FA 3SJ7A 1DIRA 4WNIA 1E6UA 1YBMA 1B15A 3AJRA 4ND3A 1X15A 1LC3A 1UXJA 1LXCA 1DBVO 4DPMA 4C4OA 3E9NA 4ZVVA 2CY0A 4W7IA 1AXEA 3ANMA 4BKUA 5HS6A 3VPGA 3CKYA 1XLTA 1KIFA 5JDCC 1C0IA 1T4BA 3AW9A 4AJHA 4XD2A 4YTEA 1SEPA 1ZUD1 2CNBA 2OOSA 4GSKA 3WYCA 1OZAA 1WZIA 3PPIA 4MP8A 1PZEA 4K28A 3TNLA 4PLFA 3VPFA 4MKZA 1NWHA 4FJ1A 1U8XX 1D4FA 3F5QA 2JJYA 1FMCA 3F47A 3JYOA 5JAIA 2I76A 1WMAA 3TJRA 4BB5A 1SNYA 1U3TA 2QG4A 4FJ0A 3L6OO 4E2ZA 3ZHBA 1X0VA 5F3RA 2PZLA 2Q49A 2WMDA 4J3FA 1JAXA 1PJBA 2E37A 2HRBA 6ADHA 4PLVA 4QXMA 1M6WA 3RBVA 3ZI0A 5A5EA 3TSCA 1M67A 3KYDA 4AFNA 2Y0EA 4IDGA 3ST7A 4CR6A 1BDBA 5ITVA 4M86A 2I66A 1KVRA 3PQDA 4DQVA 2AQKA 1UXHA 3LT4A 1E5QA 2PGJA 5BR7A 5CFZA 3AY7A 1I3LA 1QYWA 4O0LA 4A10A 2Y1FA 3H2ZA 4Z0PA 1WZEA 3E18A 1SCUA 5CG2A 1H9BA 4PLYA 5T64A 3PFFA 3V2GA 3L07A 3O9ZA 2GDZA 5IZCC 2C7VA 2FPGA 2X5OA 4Z9XA 2ZTLA 3ZWVA 1A9ZA 2X4GA 4YXFA 3H8VA 4RVFA 3EMKA 4E30A 4YT8A 1K6XA 2E48A 5KJ1A 4XB2A 4NFSA 4OKIA 4WOJA 1GZ6A 3L0DA 1ZJYA 4NBUA 5ILOA 3PXXA 2I9PA 4EDFA 4YCAA 5CDSA 1XR3A 1S7CA 4YRAA 4NK5A 3B70A 4B4UA 5TT1A 5AXCA 2PKQP 3H5AA 1R16A 4BNGA 4HFMA 4NJOA 1CDOA 1U4OA 1R12A 2ILTA 3C7AA 5L7TA 2X9GA 4OOEA 1NWCA 2ZQZA 4PLCA 1HLDA 2C54A 4CMAA 2VYNA 3M2PA 4BO7A 3KLPX 4MJLA 4S1VA 4DA9A 5L4SA 3L4BA 4GH5A 2QRLA 2LDBA 5G4KB 2BFMA 1VSUA 2PKQO 1GV1A 3ADPA 3OA2A 1P1KA 4GQAA 4I5GA 5HA5A 1YONA 1S6YA 2FY8A 2VNSA 2GYYA 2AEMA 3H9EO 4EUHA 4FCCA 4BGUA 1PS9A 3ZNPA 2JFGA 1DC3A 2V7PA 1XIVA 2P5YA 3ITKA 3DXFA 4UAGA 1JW9B 2VT2A 4D0RA 5T8KA 1VC2A 4BNKA 1PZHA 1O6ZA 4ESOA 1P31A 1WLYA 3GFBA 2NU6A 3EZLA 4UUNA 4TZKA 4A5OA 4CUKA 4ND1A 4U0KA 2BD0A 3H9QA 1E77A 1M6HA 4YJHA 1E3WB 3S8MA 3C7CB 4MP3A 1NR1A 3K2EA 3AFMA 4II3A 4GKBA 1LDMA 3R3SA 5A3VA 4A0SA 5JE8A 4GMFA 3GMSA 4I08A 3JQGB 5JC1A 3AI3A 4LMRA 1MA0A 1PX0A 2G17A 1SC6A 3H5NA 1A71A 1OI7A 1D1SA 2RIRA 3I9JA 5L51A 1WDKA 3PJFA 1V35A 1T26A 1YB4A 3UAGA 3MJCA 3PHHA 1SB9A 1ZIDA 3WTCA 4PN3A 2DFDA 3K73O 3GGOA 3NJ8A 3VC7A 4R51A 3ZGYA 3TZKA 4XA8A 5DT9A 4LK3A 5MGBA 2PTGA 1V8BA 3EC7A 1Y81A 3QQPA 3EY4A 1E7RA 4PG5A 3RQSA 4YYZA 1FDWA 3WSVA 4HADA 5HBRA 5AOVA 2HJSA 4CMEA 4NU6A 3JV7A 4HFNA 2B69A 3NX4A 1UDCA 4GWGA 5ES3A 1IUKA 5IAAA 1OC4A 2JD0A 2Y93A 1DRWA 1UXIA 3EYWA 3PLRA 3CUKA 4CM1A 3AUUA 5B1YA 3AI2A 1WNTA 1E1NA 3F1LA 4IDBA 5K9ZA 4YT5A 1GEGA 2WEKA 3IKTA 5T8KC 4Q3EA 3IOYA 4J4HA 1PJ3A 1PQWA 4GAEA 4AJEA 1YH3A 3TF5A 1M66A 3OBBA 3VH2A 4J90A 1ZW1A 3H9GA 6LDHA 3DBLB 3OSUA 3WOHA 1DDOA 3I5MA 4FOSA 4E2WA 1NQ5A 4E32A 5TQVA 1Y8RB 5ITWA 5L53A 3KSUA 2ET6A 1I3KA 1SPXA 4NR0A 2P68A 1BSVA 4H15A 1I5RA 1AUPA 1KOLA 3NDIA 3BMOB 4AVYA 2Q46A 1YKFA 2ZJ0A 3VZSA 1HDOA 2GRAA 3I23A 4YQYA 2BI7A 4Y6RA 4CM4B 1AN9A 4QSMA 1YL6A 3DHNA 3F4BA 4J9UE 4CL3A 5EINA 3MJVA 3RU7A 1VJ0A 3VTFA 2FHSA 5G0SA 3EHEA 4HXYA 1TI7A 4BB6A 3E5RA 2O3JA 5L4NA 5FF9A 3KSZO 2PV7A 2G82A 1P1FA 4UEJA 3PRJA 1SO8A 3BTVA 2VZ8A 4Y67A 3SJUA 2CZCA 3AY6A 4Z3KA 1IPFA 4ZD6A 1BW9B 1Z6ZA 4JBIA 4ZRMA 4BO2A 2FR0A 3VKVA 3E8XA 4CQLB 1QYXA 1ZFNA 2O48X 3LSYA 2OZPA 3RUAA 4IGFA 4JJGA 4CMKA 4L9RA 3GQVA 1OAAA 2E6UX 1DB3A 2X0RA 1KC1A 1PGOA 3OJ0A 2VTDA 1HE3A 1VKOA 3DZJA 3OP4A 3PHJA 3IC5A 3G1TA 2VHWA 1T2CA 3FNEA 3VH1A 1NVGA 4U6QA 1YXMA 3K2BA 5IDYA 3WFJA 3VZRA 1TLTA 5JS6A 5IN4A 4YWJA 3WIDA 4XEHA 4RVDA 3WLFA 4OH1A 1YB1A 5IN5A 2XXBA 4TZTA 3K30A 2NU8A 2Q3EA 2TMDA 3QE3A 5G4KA 4E2YA 3NTRA 1MP0A 2Z1NA 4MP6A 1X7GA 4AG3A 3DL2A 3DZBA 5KKAA 1KVSA 1HL3A 1PWXA 1QYVA 4KWIA 3V2HA 1LDGA 1V0JA 1P1IA 2B83A 1P0FA 5B4TA 2DBVO 2IXBA 4UUPA 4CR8A 4TWRA 4R41A 3PHIA 4E5PA 4D41A 1JN0A 3D4OA 4AJLA 4EEZA 5ER9A 2OHXA 3WICA 4TVBA 1QRRA 3LLVA 4TSKA 3ENKA 4W7HA 1E3WA 3CEAA 4GX0A 3VPHA 4RDHA 2FSSA 5I9MA 4BNNA 4GKVA 4BMSA 2RHRA 3GG2A 4BMNA 3I9MA 4IS3A 5IDQA 3JQGA 3OEYA 1YBAA 2GGSA 4BNLA 5JDIA 7MDHA 2FWMX 4XX0A 3PQEA 2DTEA 2NV6A 1K2WA 4EITA 2NQ8A 1DIAA 3ETDA 5TT0A 2DUUA 4WCFC 1ZMOA 1N2SA 1DJNA 4J1TA 5KVSA 3K8ZA 1YQXA 1BRMA 3ONFA 4NBVA 3ZWMA 1GFSA 1TT5A 1ZSYA 3HWRA 4FOOA 4ONEA 4J7CA 3R1IA 3B1FA 3S2IA 4HWKA 2UV8A 4GGOA 2VWQA 1FDVA 4YDRA 3E6AA 3FTNA 5G0TA 5THQA 2OBYA 1UP6A 4RV9A 1OOEA 1J0XO 2CVOA 2BFOA 4PZEA 3JYLA 2XAAA 3I9NA 1DRUA 1FDUA 2Y05A 1EDOA 4YBZA 4AJIA 1P74A 3KXDA 4QUKA 4FC7A 4LSMA 5DCUA 5JPIA 2O4UX 2PY6A 4R4JA 1XGKA 3KB6A 1U3UA 3OJFA 1E92A 1EMDA 2NQTA 3EUWA 4OXNA 1R0KA 4H7PA 1QKIA 4CV0A 3AUAA 4GGPA 2V6BA 1B7GO 4XCVA 4BQPA 4FFPA 5FEUA 2BF7A 3D5QA 3EZYA 2JCYA 1UDAA 4MVJA 5H82A 3FF4A 1I3MA 3DEYX 3GDGA 3W8EA 1HYEA 3HN7A 2DC1A 1P1RA 2NVUB 2GSDA 1YJ8A 2O2SA 3DBLA 4K9DA 5EN4A 4EUEA 4Y8VA 5JDIC 3DOCA 4N7RA 1FF9A 5JW6A 3PJGA 2IODA 2FR8A 2NVBA 1FDTA 1U7TA 3ITDA 1Y8RA 3JD3A 4UUOA 3PHGA 4CM5A 3BMQB 3FPCA 2G0TA 3GPIA 4FC6A 4CJXA 5KWEA 3R0IA 2JFFA 4NFYA 3TDKA 4OQYA 1GQYA 4R1UA 5JFOA 2GN6A 3BMOA 4U5QA 3I6QA 2B37A 2YQ4A 2BMAA 4DUPA 5U1PA 4CM4A 3SX2A 4DQUA 4M87A 2YYYA 3RKUA 2WJPA 1ZNQO 3H5RA 2R00A 3MEQA 1RKXA 3RUCA 2DM6A 5KKCA 2VT3A 2H9IA 1EFKA 4XRGA 4NBRA 4BNMA 3CIFA 4NBTA 1LI4A 3BTOA 1TXGA 3Q11A 4R9RA 5TSDA 1MG0A 4A2CA 1V3TA 2Q2WA 5TS3A 5TX7A 2HAEA 4RQTA 4B3IA 4N54A 3U4HA 3WJAA 3KO8A 1BW9A 1NQTA 1NFFA 1LLUA 4D44A 1IOLA 5F1OA 4NHEA 3JQ9A 1QLJA 4R1SA 3UVEA 4MIOA 1T1RA 2Y1GA 3JQEA 5L9AA 4LCJA 3WNVA 3FRJA 2C59A 1A4UA 3GZ4A 3SLKA 2X1HA 3ZWBA 1DEHA 2H6EA 2IXAA 1KVUA 1MB4A 4XQEA 1Z74A 1MX3A 3PWSA 4IJWA 4CODB 2FZWA 4LRTB 2Q99A 2J5QA 3U4DA 3AM5A 5DP1A 3ULKA 1CQIA 1IL0A 1QV7A 5DBGA 1B26A 4AJOA 4TRRA 1XA0A 3RBZA 4YRBA 2VN8A 1Z82A 2G76A 4F6LA 4QECA 3ROKA 1XKQA 2WDZA 4CLRB 4MOWA 2R00C 3ENNA 3UUWA 2YV3A 1CQJA 1ISMA 1F8GA 3HB4X 1JVSA 4PG8A 1GCUA 2BI8A 2QRKA 4LGVA 4TQGA 1HE4A 4MIYA 4J2HA 4WE3A 1GR0A 2O23A 4OGWA 1DPGA 5FI3A 3PIDA 5G4LA 1NQOA 3U9LA 3PYXA 4IUYA 5EIOA 1P3DA 1T2FA 3CH6A 4YJDA 3S1LA 1HSOA 1BDMA 5EPOA 3UCEA 4H3VA 3WMWA 4GPD1 1NP3A 1PTJA 5C3MA 3UCFA 1TEHA 4D7AA 4YPOA 1Q0HA 1V6AA 1WW8A 2EHDA 2PD3A 4RVHA 3B1JA 3KYCB 1EBFA 3WG9A 4IDEA 4XGNA 1PZFA 4HFJA 2EW8A 3GY0A 2DVMA 1U3WA 4WLFA 3UICA 4GVLA 4BNXA 4AJ4A 1MG5A 4IINA 2VTEA 5KCZA 5IZ4A 2AG8A 1O8CA 4FB5A 1PJ4A 3TL3A 5LCXA 3VZPA 3GEDA 2PWZA 1P1HA 3C1AA 3V5NA 1ZH8A 4FN4A 4E13A 5F1KA 1ZK0A 1R15A 2RH4A 1ZXLA 9LDTA 5ENVA 8ADHA 1GV0A 3KRTA 3SVTA 1AE1A 3IJPA 4PVDA 4RL6A 5JAMA 1ZXBA 3HJAA 3GEMA 5DP2A 2YHIB 1PL8A 5KOIA 1H93A 1ID1A 5CEJA 5AQ1A 2GN8A 5KJCA 4D43A 1NASA 1E1LA 5JBIA 2EP5A 2ZB4A 4GMGA 3W4IA 1BTOA 1ISHA 1EBUA 2EG9A 2QW8A 4BKPA 4TROA 1K3TA 3DMYA 5JYEA 3VH3A 4BO5A 1GYPA 4R3NA 3G49A 1XELA 3MOIA 4ND2A 4Q3NA 1HDCA 5L7WA 4RVGA 1PGPA 4BO3A 3LC1O 3D3EA 2G5CA 2PR2A 4UUMA 4XDZA 4AJJA 4XR9A 3PEFA 3E9QA 3NTOA 4G65A 3V1TC 2X6TA 4GWKA 5K0ZA 2Q4BA 4LVUA 1NVMB 3KUXA 3BYZA 2Q1WA 3TFQA 1VKNA 1WP4A 2YUTA 1I0ZA 2WSBA 3VKUA 5CDTA 3PJDA 1UAYA 4WLOA 2YJZA 1HYHA 2WD8A 5C7IO 5CDUA 1DIGA 1V3UA 1ZMTA 2AE1A 2Y1CA 3BMQA 2CDBA 3AU9A 5TIIA 3IMFA 3W4JA 1QR6A 1RM4A 5JO0A 3VPSA 3ROQA 3HG7A 1DC6A 1PIWA 2NWQA 1WMBA 4OIMA 4LCEA 3SC6A 3BIOA 4W82A 4CLOB 1O9BA 3WDSA 1T2DA 3LT2A 5ENDA 1NM5A 4TMFA 4U8GA 1ADFA 4J9VA 3C3XA 4YAJA 4HNHA 1BXGB 2EXXA 3H3JA 4XYGA 3GVXA 4EW6A 5JSFA 1JDJA 4WEOA 1H94A 4G2NA 1H6DA 1A4IA 1F0YA 4B79A 3GVPA 4WUVA 1DAOA 2NUAA 2BGLA 1KBZA 3A4VA 4GL4A 1F06A 3FNHA 3RSHA 1X7DA 4P4NA 3GUYA 3RUHA 5JXWA 3RUIA 3T7EA 4D45A 3DBRB 1AHIA 4LISA 1CEQA 3QWIA 4AICA 3GNQA 4DBZA 1GQ2A 3K6JA 2JHFA 1V3VA 4NU5A 1E1KA 1A72A 1D8AA 4CPDA 2WE7A 5GZ6A 3JQ6A 3ASUA 1HT0A 4PLHA 3O38A 3FHLA 3ICCA 1GUFA 2ZYAA 3IUPA 3E1KA 3QVTA 3EVNA 4FW8A 4JNKA 1Y5RA 3ZU2A 2X0JA 4J49A 4KZPA 3A1NA 4XGIA 2PGLA 3KSDO 2I6TA 1QV6A 3TWOA 1X7HA 2NTJA 3RJ9A 1LSOA 1HRDA 5I7EA 4KP7A 3GOHA 4P38A 1D7OA 2VWHA 2WYVA 5COBA 1JVBA 4BNHA 1R0LA 4KOAA 3DZFA 3I9LA 2HMTA 3JQBA 1QMGA 2J3HA 3ZNNA 4CMCA 1R4MA 5DBIA 3PDJA 2I5PO 2AHRA 3GAZA 1B16A 3FSRA 1IB6A 4BUCA 1N92A 2GN4A 3BMCB 2RHCA 1J49A 4ALIA 3ABIA 4IQ8A 4PLZA 4CLRA 3PZRA 4RLSA 1DXYA 4CM8B 2WWRA 4DYDA 3WYBA 2WD7B 1UXGA 3A06A 2VZ0A 5IDWA 5LDHA 3DZGA 3ZWCA 1AGNA 4OL9A 1UR5A 5A4DA 3JQAD 1IE3A 4ZHSA 1UP7A 3JQFA 1YS4A 2ZTUA 4BO6A 4YAGA 1V9LA 4XGKA 1ENYA 3GR6A 1Q0LA 1CJCA 4J16A 2PKRA 4LW8A 4YQZA 4CMGA 2YDYA 2W8ZA 3TZQA 1C3VA 4E2XA 3CSDA 1E3IA 4NQZA 3ZWPA 3AI1A 3KYCA 3D4NA 3N7UA 1AXGA 3BXXA 3I3OA 4WLEA 2OORA 5GY7A 3PVZA 2NLOA 2Q2QA 4XYMA 3BTSA 4QX6A 3GUCA 1JKFA 2D3TA 2QRJA 2X9VA 4OO3A 2PD6A 2Y99A 4DRYA 4KMSA 1VM6A 2IEDA 1Q1NA 2GCGA 2YFQA 1SOVA 3GDOA 2D59A 2EKPA 2A94A 1I2BA 4PG4A 1NX6A 1Y9EA 3P7MA 1YO6A 4JP3A 4M54A 3RAJA 2YHIA 4DL9A 1GPJA 3CMCO 3JQAB 2EGHA 4LRSB 3IS3A
chains in the Genus database with same CATH superfamily
2IU4A 4ETMA 3Q6MA 3DHWC 4MO2A 2Y1LA 5LXTB 3L6BA 1YFJA 1C7EA 5D3MB 1UK8A 2QD1A 1S2LA 1YQDA 5E38A 3A32A 3MXTA 3U5TA 1D6MA 3CWCA 3FZGA 5FCDA 1R0BA 5CXQA 1ZKDA 2EDAA 3IILA 2ZSFA 2D62A 3BB1A 4HDAA 4PONA 3RHZA 3JW8A 4Y1RA 4BEJA 1E60A 3WGHA 2PLAA 2QMHA 2FPUA 3AR9A 3SIPA 1ISFA 1ZIXA 3VC3A 4IM7A 4K46A 1OX4B 1W9HA 1CE8B 2XUGA 3O95A 5F64A 1D3AA 1DOZA 1JILA 3Q9NA 5DBFA 5IFLA 4MVJD 1KJIA 2WC1A 1G5TA 2PMFA 4TKMA 1BKSB 4LSZA 2FB9A 2A4MA 4F46A 4A23A 3SIXA 4FYPA 3HDTA 5CP8A 2GPAA 4POAA 4ZVSA 1QSGA 3X0DA 2P9TA 3DMFA 1EE9A 1AKQA 4CMHA 4G8DA 3EVTA 4K03A 4B8WA 3WR5A 1P7VA 1H4VB 4PNPA 1M83A 3BN3A 1QF7A 3Q12A 4X7RA 4P3OA 3VXKA 1RE1A 4RKYA 2GM4A 1OFUA 1FP4A 1ZUNB 2ZQYA 4DSAA 2H2HA 4QODA 1Q5PA 4TLMB 3WOVA 3FUTA 2QTWB 1DKMA 2DQSA 2OBXA 1RAIA 2FMKA 1O9HA 1D2GA 1XTQA 2MR5A 2VDOB 3E82A 3HUFA 1TO1E 4Q3DA 2VZ9A 2I7XA 4U6SA 4DV1B 3G3EA 3IV7A 2BEUA 3HNRA 1E5XA 1JIXA 3IMEA 4MVXA 4KQ2A 2UYGA 3DULA 3O4HA 4UEQA 4OGLA 3GFFA 3Q6IA 1A8IA 1CYEA 1J39A 1YA4A 2XBUA 4MLPA 5ARBA 1OTYA 2ZYGA 3FLEA 4EKDA 4TTRA 2NM0A 3ZYCA 2X23A 1QP7A 4NI5A 3TOVA 1U2TA 3Q7TA 4M0UA 3WLRA 2EZTA 3V9PA 5CAEA 1UQTA 3UBMA 4ESEA 4EG5A 1V37A 4PC7A 3GGPA 2JFBA 1USKA 4UU1A 1AD2A 5CB6A 1PU2A 2P6RA 3K1JA 3W79A 3KBBA 1BWRA 4DWVA 5DX1A 1FLVA 3IHTA 4U0JA 1TM3E 3P1JA 4AKSA 3B9PA 3CNNA 3C74A 5JD5A 2FZCA 3H2SA 1YZUA 3QX9A 4P31A 5BP7A 4JIGA 3FI9A 4OLFA 3QJ5A 4X8HA 3H19A 3AEXA 3CGGA 4I1IA 5CR9A 4F96A 2JARA 1X80B 2RGAA 1W1IA 4ER6A 4JEIA 1K88A 3LT5A 1SXIA 5AVUA 1VL5A 4ZT2A 3BE4A 5KSOA 2P2NA 3UN1A 2J3EA 2XTNA 5CLJA 4PYRA 5JRZA 4JQSA 2H0QA 4NMHA 1AK1A 1N3IA 3IHKA 2QX6A 1YULA 2BLNA 3GEGA 1DXOA 3H6KA 3I0NA 3MTJA 2V7QD 4YRZA 3CZMA 3QWAA 4U8HA 2XR1A 5KNBA 1T24A 2IOHA 1GP2A 3AU8A 2PGIA 4RA6B 4BUZA 3K1ZA 4L57A 5AM4A 3TDNA 4EPRA 1ISIA 2OD2A 3K5WA 4RM2A 4MUYA 3C7DB 1IN8A 1RQXA 3N28A 2F3SA 4B44A 4OLJA 1BD3A 2CW5A 3TMAA 3ZTYA 3NM6B 4CMEC 4RF4A 1JAHA 3DUWA 5G2OA 1DX9A 1HC7A 3BMCA 3KSRA 4U63A 3RC7A 5KX5A 5FPYA 3R44A 4DUYB 4E7OA 1HDEA 4HQOA 5CGZA 4BLRA 5DM60 5K7SA 1CJUC 2AEJA 4K8RB 1DRKA 1X94A 1P81A 2NUPA 3FPLA 1I3CA 2X0DA 4TRNA 3TUZC 5FKJA 1ICIA 2OWEA 2XWJI 4DLYA 4E5NA 1EFAA 1EQ2A 2IX9A 2Q5LA 3LVFO 3G17A 5JCXA 1G5PA 1NDUA 3HB0A 2NT3A 1M2HA 4RQBA 4HDMA 3ZXUB 3DCIA 4UE3S 4U7DA 3C4VA 2YC4C 5I3CA 1PL6A 2G5GX 3V7NA 3QVKA 1YZTA 1VSVA 1T1EA 5F5LA 4ZT3A 1SXHA 3TQSA 4UM9B 2GO1A 1DKRA 4P5DA 3ZWAA 2WJ4A 2IHNA 3Q3VA 1V2GA 1CUYA 4JBHA 3H9CA 3ROTA 3EAQA 2BSXA 4FE3A 1EFVA 2B82A 1M1NB 1YUBA 1AK9A 4MKRA 4MV0A 4TTIA 3TTUA 1GAEO 1IATA 3GLUA 4BECA 3DAHA 1G6HA 2PM8A 4POOA 2O2JA 4GU5A 3B2EA 3I6YA 1Q12A 1I3NA 2TRSB 5DGCA 1E64A 2Y1EA 3UKJA 2XE6A 4WKCA 2BGNA 1A7AA 3H2JA 4V3BA 3X1MA 4RXMA 4AY6A 3O94A 3OLVA 4ARIA 1IVYA 1C50A 1BHO1 1JVNA 4RIHA 3BORA 1IQ0A 4ZJZA 1NVTA 4ZJUA 3S28A 1GAXA 2V6FA 1ZU5A 2PKCA 5BNWA 1KYQA 1EVQA 2WF8A 1W0KA 3ZZ0A 1TJ4A 2E21A 2VP5A 1JHZA 3URKA 5JQGA 2WP0A 4LTDA 2ZRCA 3EDRA 3AHIA 5DMXA 2QRGA 4YMVA 2AXNA 3HBJA 3FYHA 3BZWA 4L5IA 1XYYA 4R9NA 4HYEA 4RZ2A 5IK2A 2I2FA 5AK6A 4D6PA 5JZMA 2OG1A 3E03A 1XPOA 1P7CA 2G88A 4EO9A 2V5VA 2O6LA 3OF3A 4HRVA 3VYUB 3FHJA 4IBOA 2CKDA 3JZFA 3MS4A 1QS0A 5TRTA 3KLNA 5IKXA 1U63A 4P82A 2O06A 3KJGA 1U3DA 3PBKA 4KJXA 1NV9A 3HUDA 3L6DA 1W581 5K6AA 4M7PA 1DTWB 1QVVA 2QL6A 4XTRA 4D8XA 5JJ5A 1NXXA 3UEOA 5BNTA 1TZ2A 2WRZA 1KP2A 4LY0A 5KZMB 2GTPA 2QL7A 3QX7A 1VI5A 4K6CA 4FBMA 3BHIA 2UZ4A 3P0HA 4D46A 5K8UA 1XJQA 1E5DA 4NJMB 5KTTA 1HPLA 4LJ7A 4E5DA 1Z3CA 2V1UA 4ZWNA 2XQFA 4WVFA 1Z4JA 4LHEA 3HP7A 1OTXA 3WX0A 2JAQA 5JSZB 1GG9A 4DE5A 1ZCFA 3OECA 5CFNA 5A4IS 1EK6A 1G7SA 3AO0B 4V3CA 5D3QA 3EODA 1NR7A 1SOUA 1ODIA 3LSTA 2QYTA 3KXKA 4KPFC 4QUHA 3B38A 3BXHA 3EX7C 3EGVA 1UWVA 3IB3A 4Q3CA 1G2OA 4MV3A 4Q3BA 4ZQIA 2POCA 2J3KA 4YAFA 2AQHA 3DPSA 1PG5A 4H4CA 1CJTC 2G9RA 4HJXA 2BMDA 3DTNA 3K9QO 1W4LA 1KHTA 3M4NA 4CKZA 1E69A 1FUKA 1NRXA 1SQGA 4UQLA 1WV1A 2REQA 1NQAO 1RRMA 4E70A 1VLLA 4XWGA 2ESRA 2WKPA 3IJRA 3AKCA 2J9FB 2JHCA 5H59A 5KINB 5LVAA 4DM7A 4I4CA 3MB8A 3GFSA 3NTQA 3WWCA 4O3MA 3RTAA 2QNRA 5BORA 5BOSA 3B60A 2BEVB 2G6TA 3D6FA 1WMSA 3TNJA 4EJ6A 4FMDF 4PPQA 5M34A 2CXOA 1RP1A 1KEVA 2AZDA 2R8PA 4UHJA 3ZY5A 4C07A 4GOKA 5ALHA 3RVSA 3KL4A 3WLEA 3A3KA 1KBQA 1V1MA 3EVFA 3FTCA 4MVJP 3GVCA 2GYUA 4OHXA 5B6IA 4XVCA 4KXMA 2J0QA 4NECA 1OJ7A 4LC0A 4GX5A 1XV5A 1PNOA 3B5JA 4RD0A 4IDDA 3ZYZA 4K6HA 4CI9A 4CQMB 4D4IA 3F67A 1E1CB 4EB6A 4M1QA 1C4OA 3D2CA 1POXA 3PQFA 3W9SA 4Z7JA 1LS6A 1KQGA 4QYSA 3EISA 4PTZA 3ZE1B 2CE7A 1TA9A 1K08A 2MSWA 4DWWA 2VHVA 4UPDA 1FXWF 3HB9A 2JBHA 4ZYWA 5CPFA 1MXHA 3DL7A 3T5GA 3VHXB 2HT6A 2H1LA 1IN7A 3L41A 1U2PA 1DQPA 2Q2VA 2O6HA 4MKHA 1Z8DA 5JNUA 1GN9A 1OLUB 2FOXA 4LN1A 1M8PA 4R01A 4RVUA 5HWSA 3LCRA 2HWXA 2HU7A 2WMNB 2WYWA 3DAFA 1VL1A 5F7OA 3IP1A 2QRUA 2AKYA 3VDRA 3USCS 1Q0SA 3KELA 3BL5A 2WZBA 3GJ6A 5KSYA 3LS2A 2JLVA 3PZBA 1UH5A 1UC9A 2ZIEA 4EVIA 1Y6RA 2WUFA 2X5KO 3LKZA 1LDBA 1GWNA 3H84A 4YRNA 2G72A 2BCGY 2CFTA 1EM8A 1UMBB 3GP3A 2BC9A 4NYMQ 4BBPA 2ISCA 1KSFX 1LI7A 2Q9UA 2Z2ZA 4BLQA 3NTVA 1NXQA 2H9YA 2VEOA 1G8JA 3QU9A 5KBYA 2DPHA 2W6JD 1SKUA 5ALZA 2HWKA 3T1YB 3I42A 3R24A 2BH9A 3DEZA 3ZU4A 4GVPA 5HCNA 1QFSA 1G17A 5EXTA 2JL1A 4D82A 4G3XA 5E95A 1OI4A 2B0CA 2XE7A 4AJ1A 1Z45A 4I6JA 4TVSA 1E5LA 1T91A 3UANA 5CUQA 1NL3A 4LXHA 1PT6A 3VSDA 3W6ZA 2HMSA 2HMVA 4G56A 1YDWA 3C3EA 3MK31 2IYYA 4FKMA 4GZ6A 2I3BA 3ER9A 4CQLA 3SM9A 4N5MA 2X9NA 1B76A 1XCLA 2O1EA 3M8KA 3P5SA 4G4IA 4PX2A 5E2IA 5L4LA 3FJYA 1TYDE 4BE4A 3WYEA 3V8NA 3K96A 1E7YA 3D3NA 3L92A 4CZ2A 4KPEC 3NXSA 1UC4B 3PGA1 1QRUA 2OM6A 4LRQA 4Z8XA 1J5XA 3ZD7A 2NTEA 1LV8A 4RIGA 3JRNA 4RY9A 3QWFA 1O5TA 4TYQA 2YVLA 4YMHA 2GQ0A 1WP9A 3MWEA 4EMUA 2KJQA 2HY7A 2LP4Y 1M2VA 3EUEA 3OFJA 1M2GA 2NZUG 2XH8A 4KQCA 4OK3A 3AR3A 1Q7RA 2C4NA 3NB0A 4FZJA 4GLLA 1E0DA 1YT5A 5TJHA 3HJFA 3O90A 2ZJFA 4BNDA 2V7WA 6ABPA 1U9JA 2DFKB 4JLBA 3T12A 4KFTA 1TQHA 2KX7A 3SHVA 1AA6A 1TK9A 3L79A 4FKBA 3SE7A 5P21A 2CDAA 2IZ0A 4NKRA 5AOBA 1SVMA 3C6BA 4KTVE 2LZ0A 4OHBA 5L3ZA 1DEAA 3MRVA 5DPMA 1LPAB 3PWKA 1HE5A 1V8DA 4FHEA 2PWYA 3WZMA 1KWGA 3NALA 1HOTA 2JFYA 3WL4A 1B2LA 1QB7A 8ABPA 3P9QA 1JG1A 3TKLA 5CIWA 4YAWA 1JB9A 3NCTA 4URHA 4DREA 3PEEA 2YZGA 4B9AA 4N41A 3UAXA 1PGQA 3QBJA 2IY8A 4HWOA 4J0GA 1L8AA 3ZZNA 1A8PA 2R5NA 4Q4AB 1RLJA 1RJ9B 1PWYE 4C3UA 3V48A 3WK5A 2ZCVA 5SY9A 1E6EA 4NYJQ 3AW8A 2ZZKA 4PINA 1A9RA 2IW1A 1ZMXA 2MSNA 1A50B 1WSDA 3F6YA 2V6GA 5A62A 1Y1SA 3AOEC 3F6PA 4G8CA 3ZQKA 2VRCA 3LIPA 3ONDA 5KWVA 2AKEA 4QE3A 4CE6A 3SBEA 2Z2XA 3SU8A 1IN5A 3ELBA 4URVR 1N78A 3R20A 4BO1A 5BPHA 4LVCA 1S2DA 4B3CA 2A58A 3SHOA 3UJDA 2IF2A 1SELA 1SQ5A 3C3WA 1LCIA 1QIKA 1U2SA 1YMQA 1I0LA 4TWBA 2Q0QA 2QPTA 5T67A 5ED0A 1IY9A 1GM5A 3RLFA 1CRLA 1L4MA 1VXOA 1Y7LA 2I80A 2WU1A 3O3OB 2E1PA 2IQIA 4TTAA 3TAUA 4EZIA 3RT1A 5DEOA 3L4KA 2AB0A 1IG3A 2PR7A 4RKRA 2CK3A 5BUQA 4ZDWA 2YVUA 3FZYA 1KJNA 1IY8A 3O8DA 4M49A 1SCQA 4X90A 1P7WA 2JIDA 4CWAA 4EZBA 4YP7A 1RYMA 5KB3A 4MLDA 2DBZA 4IKPA 1P1JA 2GRUA 1L5HA 2H18A 3VV2A 2IIVA 2OV1A 2QGNA 1P72A 3FPSA 3P0JA 4UBLA 4O2AF 3PL1A 5KDLA 4YRSA 1QYDA 4G1EB 1O96B 4WCDA 4O08A 2FETA 1RPTA 4UXHA 2DJIA 1Q95A 3AB8A 4F6RA 2CVHA 4IKEA 3CRRA 4NZMA 2GEDA 4LQDA 1C7QA 1W25A 4D3XA 5GMOA 4Y6QA 2X8JA 4JX8A 1P33A 1YZFA 2TSYB 4JS0A 3UXMA 3CISA 3DDNA 5HFNA 1QGYA 3K92A 3AVYA 1M2WA 3EFEA 2EQ5A 2G9VA 3ZU5A 3R9XA 4YJFA 1UUFA 3I8OA 4KI0A 2E4VA 4L9SA 3WBBA 3UOAB 5IASA 5IVKA 1VLVA 3A4LA 1JEYA 1BDIA 3W8FA 1Y6GA 1MO3A 1ENOA 1QGZA 2H06A 1S0UA 3OZ7A 2X0NA 3OO1A 5HGXA 2B4QA 1J07A 2GRJA 3WIBA 1FTNA 3PPVA 3AOGA 3DFUA 5KNLA 4D6YA 2B34A 1G1MA 3OSZA 3C3DA 3PC6A 2V7EA 4KPUA 3H4TA 5A9RA 5BN5A 4CIWA 1XEXA 1XMXA 4IIHA 2I7TA 4M83A 4QOFA 3R4VA 4O4HB 2AC2A 4JDUA 1PV1A 4D4GA 1QUFA 2CNOA 4OXRA 1WY7A 4P4GA 4WPGA 2H92A 4XJTA 4A3SA 4UNRA 3KQUA 1HE1C 2P4EA 2F1JA 2QT1A 4LPKA 3T5DA 5LA6A 1IMOA 4ZODA 821PA 4J2OA 1NUPA 3G2JA 4RHTA 3L7JA 1OC2A 3GVIA 4B3JA 3DD5A 1L4EA 2NO6A 4MIEA 3IOEA 1Y82A 3OX4A 4HBGA 4HOYA 2ZR0A 3ZQJA 1FYDA 2O0JA 1BRTA 1RTTA 1LI5A 3EIHA 3RUEA 4DJJA 2NNLD 2OC9A 3NEPX 1EFPA 2FKNA 2I34A 2XQGA 4P5EA 5IEJA 5KWSA 1K9VF 1OIXA 2R8BA 1B0UA 3D0KA 1B8VA 3OIUA 4KXWA 4M37A 4YMLA 1XQXA 3B20A 4EHJA 3GCZA 4GSYA 1HLPA 1FNCA 2P2SA 1ND5A 1U3VA 1UT6A 2HJWA 1UKEA 2KYRA 2M32A 2VYVD 4OHMA 2ZT5A 1NN1A 3RKRA 3CUYA 5FI1B 5KYTA 4ZHQA 1F6WA 4ITUA 1G0OA 3JYNA 4HGRA 3RRZA 4PRLA 2EWMA 4US1R 1TMKA 1KORA 4BGVA 1ZOPA 2DSNA 2VH2A 4V24A 2WVAA 2JD2A 4QNNA 2OKCA 4RPGA 1E2NA 3WBJA 4CBVA 5EJ4A 1NT4A 3RBXA 5JEEA 2XZLA 4Q6BA 4C0XA 1XN1A 2WABA 3MD0A 3PDUA 4O63O 4CCYB 1Z88A 1XSEA 4YLGA 3UAOA 5EL0A 4WXYB 4U7HA 3R3ZA 2JGDA 4BU1A 3O4IA 1XQ6A 4B75A 3WWYA 1KY5A 3H86A 3DXXA 1DVRA 3AXSA 2ZYWX 3K70B 4X91A 2GH1A 1BG6A 1YUNA 3OJOA 1UDWA 3QKWA 4V0RA 1UADA 3TTVA 4DRXB 3W0LB 1A5ZA 3IE0A 4EECA 5AK3A 5H81A 2Z30A 3RV4A 3DONA 2CWWA 1WUJS 3G85A 3D1VA 3K6KA 4GD3Q 4HD8A 1D1QA 3HQ4O 4W4TA 4ZVTA 2FNAA 2WM9B 5I7UA 2FEMA 2O3RA 4A03A 5E4JA 1Y6JA 1F48A 1OGYA 1POWA 3OIFA 1JYSA 2W8BB 3QF7A 4Y9DA 2WHXA 3VHLB 3T15A 1ZYUA 1XOIA 1T35A 4XIFA 4WZBA 4MVJM 2RHOA 5F4BA 1SC4A 4CM7A 3MTEA 4IHQA 1W0KD 3RQIA 4P6VF 3RS0A 1SXPA 2UXBB 3U3RA 4J0JA 2CBGA 2WSSA 3P2EA 1O94A 4EFKA 1D0VA 1KL7A 5B58C 3NAQA 5G1PA 3RAGA 2Q9BA 2QTRA 3SXUA 3DEJA 4HKTA 4BO0A 3INRA 1QKJA 3MWKA 3Q3CA 3OX1A 2B30A 1I36A 3L02A 4HWPA 4MYCA 4TTVA 1XFDA 3ZV3A 3CB4A 5K0JA 1SZCA 4GL2A 1XA4A 2Z2YA 4JIMA 4OQQA 3VSEA 2FZ4A 5HS4A 5AIAA 4GUAA 3V34A 3BBPA 1X1EA 1HBJA 1D6SA 1UFKA 3GFRA 5JNTA 1DADA 4G8BA 3LKDA 5LQJA 2Z8YM 2B6HA 3RTEA 2OXTA 4QFCA 2AA3A 3ACBA 5L3QB 1HTTA 1F8FA 1YAJA 2QMYA 3FJ1A 1YUMA 5F5XA 4HUTA 1YZVA 3ORHA 2Q1XA 4FP9A 2A9VA 3RFCA 3T41A 1BHJA 3OETA 5F5NA 3RT7A 3H83A 4DC1A 3GXBA 1GZUA 1GDHA 1X2BA 5D3KA 4Y1FA 3VAAA 4B73A 5AXDA 4ZQFA 5JFTA 3ZD9A 4KQXA 4M0EA 2IYUA 4GM0A 2R9VA 2Q6IA 2ZSIA 2QR5A 2Z6VA 4WCFB 5FL3A 2BHSA 3PNOA 3F4LA 4LYHA 3VPDA 5AHKA 2CL7X 1HNZB 2GVDC 4II2A 1JSLA 2WWWA 1XYGA 3PXUA 3NANA 3SG0A 4C4TA 1UWLA 2EIXA 3ICQB 3CF4A 3PICA 4UMEA 3HR4A 5DXJA 4BRSA 3KBOA 4H7KA 3ZVNA 2XB2A 3E7FA 1CR0A 2QTZA 3BK2A 5DASA 3HA2A 1TZCA 3ELDA 1N75A 2WAYA 1RCUA 1X8XA 3HSKA 4B6SA 4N76A 1GQSA 1JWLA 2ZUBA 3DVLA 3GG9A 1ST2A 1FP7A 1DFHA 1W5SA 1Z7BA 4G9GA 1T9KA 1J99A 5EXPA 3SSAA 1T4CB 4B8ZA 4EKGA 2O0KA 5EJ2A 4RZHA 2O4CA 3ZX4A 5EXDA 3RVNA 2ZRAA 4URWR 2VSYA 4FDLA 4Y2QA 2J33A 2W2VA 3VBCA 1NN5A 2PX5A 2YVAA 1JJFA 5DN9A 4F3KA 5LC1A 1C0LA 3CW8X 3CZQA 3IODA 5IBQA 3WLOA 1AVTA 1JAYA 5CBPA 2GB4A 4II7A 2GJAA 1FE8A 3M6XA 1TO6A 3RVQA 4YAKA 4B3SB 1KJ9A 1RTKA 4JI0B 1J21A 4M1WA 3TTSA 3HS3A 1C2TA 1K0UA 2OQ2A 2X40A 3HGQA 1MLDA 2V3WA 2AR7A 2PJZA 2ZJOA 2RI6A 4Z99A 3G79A 4AULA 2P3LA 4HH1A 3AWDA 2VKTA 1RWVA 3BIJA 4XFJA 5DEIA 3TX6A 4D0SA 1FMFA 2RHTA 4AM8A 2WBLC 5GZ3A 1E9EA 4MR9B 5BN4A 4Z53A 2R7KA 5ALNA 4ZJPA 2W6ID 3JWIA 3UFBA 3LT0A 4X7BA 2OA0A 1QXSA 2YXLA 3GL9A 4MQ4A 3KETA 1O5IA 3ODGA 2VH1A 3KJXA 4RU1A 2XYVA 3WKAA 2UU9B 2J3MA 1PZGA 4OD0A 4BNFA 1J5PA 3GXOA 1HF3A 4R1OA 2QU7A 3EUAA 4I9NA 3ESXA 4KXNA 2W2LA 2X8BA 2C99A 3F49S 4Z6KA 1P18A 4ZCSA 5IAKA 2OLKA 4LHZA 3SZUA 3SZRA 3TL6A 2B0JA 2NTYC 4N8DA 4Q16A 4Q4CA 2FG6C 2QRNA 3IBGA 5JANA 4QJIA 2MU1A 2W2QA 1V71A 3NV9A 2B2XA 4A0FA 3ZE7A 1KFBB 5T41A 4BMYA 1XLWA 4EEXA 1VSTA 1XTBA 1MHPA 3E1SA 3ZGVA 3NNSA 3CRZA 3ANLA 2WQ7A 5FIUA 4NG4A 4D3SA 3BHMA 4CLEA 2Z1MA 1GAQA 4EG4A 3N76A 1LRJA 4KLZA 3VR4D 2YMLA 1CXZA 2YIMA 3DB2A 3I5XA 4H1WA 2HLDD 1NMEA 3A6PC 3G9ZA 3PITA 1UMCA 4OYRA 4LZNA 1MV8A 4XDHA 3LYLA 1GGNA 4GOJA 5K8JB 1PWHA 4IYRA 4R31A 1T0UA 4RL4A 4WERA 2GBGA 3LQFA 1UBJS 4C6TA 4Q03A 2L42A 2G1UA 3HUTA 1MJHA 4FMPA 2IS6A 1OH5A 2PBRA 3EW7A 3C5WP 2Y67A 3IERA 5C8YA 5JMWA 3PR3A 4GX2A 3EOAI 2AG1A 2CFIA 4JK3A 4OCZA 2BT4A 5IDVA 4RLHA 4FS3A 4RFSA 2JD1A 1CY2A 4L72A 2NPFA 3ZLVA 4R3UC 3TQHA 2DLNA 3GFTA 1XTSA 3V1LA 1P7PA 2JVKA 1NLUA 2C2HA 1DAEA 4LC9A 2WTEA 5ALVA 3QTTA 1ARZA 3TRIA 3GRPA 3M5CA 4P32A 4KRFA 1HEUA 3DFIA 1LS1A 1L7NA 2QTNA 1XJ5A 5CNIA 2QEQA 1Y8CA 2OBMA 4XWWA 1CUDA 1P6UA 3TKAA 1K8XB 1N1GA 3EQ8A 3SC2A 2NPIA 1BEUB 4OKNA 3U62A 2W4IA 5JSYA 4NFHA 4WOPA 2XMCA 3PUKA 3GFVA 2CFCA 3NYIA 1NDHA 5H70A 2Z6AA 1YBHA 1Q0TA 3ZXXA 4GRDA 4G0PA 3A14A 5HTKA 5EERA 3ZNOA 3AT1A 1JDPA 2DFNA 4OJTA 2PH3A 3D7SA 3S70A 4AY5A 1SBQA 1FJXA 4QUEA 2H5LA 1JF8A 4NRDA 2FSGA 3UAVA 3OHSX 4QFMA 1E3MA 2WKQA 3IKJA 1K9SA 1F38A 3ZDYB 7REQA 4L5YA 3JWHA 4DPKA 3IPRA 4ZU1X 1KJWA 2I7VA 5LYJA 4E4TA 1N8KA 1ULBA 3AETA 1T1GA 3M4XA 1W5BA 3QFCA 4GBJA 2PWPA 1RWMA 2XUDA 1NZFA 3RHFA 1YVEI 1G7CA 2F1RA 2ZB8A 1CR4A 1CJMA 1PUXA 4FILA 4Q9AA 2VXOA 4ZQEA 5JXIA 1QK5A 2BGGA 1WV0A 3AUXA 1U7OA 3GYGA 3NR2A 1WR8A 1LB1B 2B3DA 2R8OA 3THWB 4P98A 4HQFA 1HZJA 4YJGB 3CF6R 2QE6A 1X1TA 2WYUA 1CJVC 1ITZA 4F5EA 4CDRA 1JG6A 3HDYA 3JALA 2Y0PA 4H7IA 4R8RA 1P9LA 1Z34A 5DGXA 2CGEA 1DC5A 3OCUA 3IUQA 2D7CA 3JD4A 4MQUA 3DDZX 1FFWA 3OTGA 4NYIQ 2P75A 5FR1A 5JVDB 2AJBA 3ZV5A 4UW9A 1DG9A 3FJOA 1PQPA 4K9LA 5BN3A 1RKVA 4NCXA 4JN6B 3GRFA 1V1RB 4MW1A 4IWXA 2VNHA 2Z4TA 5IULC 3HJGA 3ZHCA 2FN7A 1RQNA 1TQ6A 4AJPA 4CKEA 1ULTA 3IQGX 1L7QA 1VL8A 4MGZR 3N0VA 4CV1A 4YUAA 1GPDG 1YS6A 1Z2EA 2AKAB 4PWYA 2NVWA 4IXWA 1QO0A 3LQ1A 2XRMA 4PQRA 4R8MA 2GAOA 3VU1A 3AQIA 3JQ8B 1LPOA 4HAVA 4MCJA 3SLGA 2QRPA 1Y4SA 4PO3X 4LX0A 4HH0A 4AZTA 1WD7A 3RC3A 3AEYA 3CCBA 1MHTA 5ALIA 4GP7A 1NUTA 4BCCA 5IHPA 2HIAA 4FINA 1QCDA 4N6OA 3K6SA 2IOFK 1C30A 3BGVA 3C87A 4Z4IA 3WGKA 2IP2A 1AQNA 2X9LA 5DCLA 3EOZA 2OKGA 1UZMA 2XUHA 5B2ZA 5LJLA 3ZN2A 1QRTA 1O6FA 4BY9E 1MJFA 1YZKA 4DDMA 3IKMB 3RR2A 1JJVA 2O0MA 1CQPA 3A9WA 1FZQA 2WKSA 4LZPA 5E6RA 2QRVA 3RSLA 4AUNA 3ESCA 3OE7A 4JXJA 5H4GA 4H31A 4BQOA 1DFIA 1KI6B 2HOQA 2P3QA 1N77A 1GKKA 5EUCA 2NO4A 2AXEA 3FOAA 3QVOA 1S8NA 3GA0A 1C7JA 4KFRA 3E3LA 4QYWA 2ZIXB 4ESVA 1Q6ZA 3OBIA 5CNJA 1T0IA 4QO7A 3E2MA 2IPXA 1USGA 5CEEA 1V16A 1WQ4A 3CLRD 3T7CA 3KJFA 3DOHA 2WA1A 3VYSB 3ZEIA 3UO8B 4O4LF 1Y4AE 2N42A 4YBRA 1DPFA 1NFQA 3PDIA 2BEKA 5CT9A 3Q41A 4PG7A 2B5VA 3WB9A 4OH7A 4C0QC 2Q5CA 2LRHA 4LYYA 3CE6A 5LQMA 3I2JA 4H18A 2XDWA 3P0EA 4Z8YA 1KK1A 3SR0A 2VJMB 1VMEA 4YAIA 2PYZA 2GA8A 2YOFA 1QIFA 2ZYUX 3HDVA 3MSCA 4KVZA 4MVJI 2GN2A 1RFLA 4YXWA 4QTZA 1GIAA 2GKGA 1CU1A 1WHTA 1NBME 2R66A 3FR8A 1RDFA 3I2KA 2SKEA 2FK8A 2JBAB 3MT7A 3Q2KA 3CVUA 1XRPA 1XD2A 2GZ2A 3FNFA 3V80A 2F8MA 3IVXA 1G5RA 2QUAA 5GJCA 4EATA 2AEFA 1IBCA 4K1LA 4Q4HA 4R2LA 1XQ1A 5BWLA 1QP0A 4Y9UA 1HG1A 3LD9A 4TZ0A 4JC8A 4Z4HA 4BATA 3HRHA 3EDYA 3MWDB 4RGVA 4OGKA 3IL2A 2PGOA 1GTL1 3DZHA 1CUJA 1U02A 3MGBA 3PQ8A 1ZGGA 2EAUA 3Q5EA 4PZPA 1GRRA 1KAEA 2C7GA 1K2VN 4TMYA 4U6NA 4EELA 2ZJYA 2W93A 5ICSA 1G6KA 3KCNA 3Q87B 3W3AH 5IS2A 3HABA 3A4IA 3VU9B 3WLMA 5ITSA 5C53B 1PJTA 1Q1AA 4ZIRA 2F1HA 4QTUB 2AC7A 2XT0A 2HU8A 4MI6A 3N6VA 3KALA 5HRCA 1FUUA 1NPDA 4LZWA 2RHDA 1QCCA 2E55A 1TZJA 4L27A 2HYIC 5AM5A 5G1OA 2OESA 4XE5A 2FGKA 3DL4A 2BE7A 3WLPA 4Q48A 2ISQA 3EGIA 3FWZA 4DMUB 1K97A 2ZROA 1EXMA 2DUNA 3IUYA 3ENVA 3DT8A 3L43A 4O59O 3ADBA 2J5RA 1M33A 1DKUA 2Y0DA 1GPBA 2ONJA 3S99A 3HWX1 4PNEA 5KOHA 4L22A 3T7JA 1SVNA 3FMGA 4QJBA 4P7GA 4QXAA 1TKRA 1R6DA 3OJLA 3QPCA 4QOSA 3UH1A 5JMTA 3CLHA 4N3GA 1GHTA 4ALNA 3HLTA 2ZIFA 3JWEA 3WGNA 4FONA 2E49A 4RTJA 1N6KA 4XQGA 5F2NA 5AM3A 1B8OA 2AR0A 4FFBA 3DZKA 3MWYW 2JA2A 3K9FC 5ERGB 3ZI7A 2PZFA 4DMHA 5CB0A 2NO7A 2IELA 4I2VA 4X60A 3E3AA 2GLUA 3OZXA 5JCJA 1JI3A 1ZGJA 1L4GA 1J22A 4M0FA 4Q1AA 2YHBA 4E03A 2ECOA 4KE7A 3AJ9A 3JASA 1JFSA 3MVEA 4L7VA 1JBEA 4MJXA 1L4BA 5DZSA 1FS6A 4X97A 5HR5A 3WGYA 4AWXA 1L7EA 2EW2A 1Z3IX 4H0CA 2PMEA 4WESA 5L45A 3N5KA 5DXAA 3ZH9B 5HZMA 2W48A 3G89A 1KRXA 1ZXXA 5JXHA 2ZWIA 5KHAA 5LIRA 4MYSA 1E3SA 1ZD1A 1KEUA 2OAP1 4QQKA 5EIBC 3AYXB 3FKJA 3H2IA 4ZEVA 2QF7A 4KTTE 3VFDA 3B6ZA 4DCUA 3OG9A 2FPMA 3ND9A 4HQLA 3ZIUA 4WBNB 5B64A 4XIIA 4U9IS 1D6JA 3P19A 3QVXA 1E8NA 4PRYA 5LLSA 3ZWXA 1NW9B 4LHYA 2QT0A 1Y8QA 4BNTA 5ESXA 1XZDA 2YHAA 3RS7A 2WJWA 1MOZA 3IDAA 1E2EA 1V96A 2Q0HA 4NAHA 4RO0A 3U3XA 4EYOA 4GI1A 2GN1A 4G5YA 2CMFA 1D2MA 1MC4A 1KPGA 1ANKA 2D5AA 4UMVA 3RU3A 3R5XA 2K4MA 4NCIA 1NNUA 1I2MA 1IHDA 2OHGA 4FFVA 1U5BB 1THMA 3EFOB 4R54A 2H29A 4N5NA 2OHOA 2D0DA 4NBWA 2OD7A 3JCZA 4KV7A 4FLEA 1PV4A 1EDDA 3UWOA 2NYAA 2PGDA 3KYDB 2XMQA 4RFLA 2QMEA 3BULA 1YU9A 5TMDA 3GUUA 3M6IA 5BWNA 4UXJA 1T9HA 2VHQA 2CF5A 1XBTA 2LCIA 4FHGA 3UF0A 3UJAA 3CNHA 4BVKA 4BB9A 4Y2VA 1HTBA 4A6PA 5DTEA 4JH0A 1Z18A 4BP3A 4NPAA 4UOEA 3EMVA 2PANA 4RYLA 2CUKA 2X0IA 3E7XA 3RU9A 5JCPA 1HTWA 1CJSA 4BO9A 3RBAA 2XITA 4PFQA 3DM5A 3DMDA 3THSA 4N39A 1TTQB 4KE6A 3CLVA 4DQXA 3D31A 3PYMA 4RA9A 2Z8ZA 1EZZA 1H5UA 3LL7A 3W2FA 1P4SA 2BEJA 2UVQA 3I5YA 1NI4A 4ZAZA 5LQKA 3P4YA 4LGYA 1V6CA 1GTG1 2ZXEA 3S81A 5EHNA 2NAPA 5DYIA 2JFNA 3QELB 3W3AA 4RANA 5HMMA 4QYIA 2OZLA 3QSYA 1EFTA 2C9YA 1F7UA 4AZ0B 1EGHA 1FNMA 1NXPA 4MUNA 2ZWPA 1Q1QA 3S2GA 2B1QA 2P4SA 4B6EA 1LJUA 3KZVA 1C2YA 4JQYA 1AU9A 5IARA 3KSAC 4PC2A 2CMGA 1IXZA 1CSEE 1PQ4A 1D1TA 1RXCA 2H65A 1EVJA 2FVXA 2Z2JA 4FYKA 4JEHA 2W2KA 2GK3A 3SZ3A 4YEDA 1GG2A 4MULA 1K7CA 5FT9A 2DBYA 1E4EA 4IGIA 1RP7A 3UGKA 1PYGA 1LUAA 3OWHA 3B7WA 1UKCA 1BCSA 1N5DA 4I4TB 3SC3A 4H2DA 3G7UA 4RADA 4TSFD 3AUTA 3F6CA 3PFNA 1E2QA 4YRJA 2E82A 2R751 2UZ1A 2YVKA 2IYLD 4HDCA 1UBGA 4HDRA 4JU8A 5CLLA 5HDBB 4B46A 3TZLA 3WIEA 1SQSA 5TEWA 4YAEA 5FNVF 5DNAA 2PLFA 1UFOA 2G1PA 3VH4A 2OPBA 2XYHA 1W6UA 2RC6A 3N8DA 2Y66A 2GK7A 3MTGA 1AIPA 2A9KA 4GM1A 2I62A 3IV6A 1CB0A 3MZ0A 2IS1A 5CG1A 2PJDA 2PS1A 3LP8A 3DZDA 3RS9A 4DIOA 2OHJA 3A1SA 1CK4A 1L5SA 3BJEA 1YTLA 3CNQS 3NPMA 5G40A 3ZU6A 3X3HA 4NCAA 3FM9A 3CKMA 3EGOA 1HZZA 3MB5A 2X76A 5AVJA 4BX0A 2YTZA 3GAFA 4PYOA 3UK1A 4RMIA 3RVRA 3VUEA 1AKNA 3BXFA 4YJ2A 1G4HA 3JZIA 4EHAA 4YJHB 2G6BA 1M0SA 4UEKA 2ZRQA 4JEUA 3N8KA 2KQUA 1U99A 2Z95A 4N5LA 4YNBA 1JXAA 4RJTA 1H8EA 4OAOA 3CVOA 1B0AA 1W85A 3FCUB 1E9DA 2VHXA 2VP4A 1BH2A 3IT2A 4LNUB 4BFCA 1JWAB 2DCMA 2OFWA 1Z33A 1X1BA 1P8JA 2QJOA 1MB0A 3K09A 1Q6YA 2IF0A 2R1TB 1ZBQA 5F2EA 1M5UA 1DQZA 3LA8A 1U2DA 3PD0A 2PMWB 4MQ5A 1GEEA 4XSHA 2YJGA 5I8WA 2IDKA 3W2HA 1I94B 1OGJA 9LDBA 1SVIA 2D8AA 5GONA 3LBHA 1WULS 1RZRD 4Y0AA 2UYCA 2C0QA 4ZVNA 1ISSA 3QPUA 5C7OO 2NO9A 3BHJA 3ND6A 3I9V1 1WXGA 3BA1A 4PYJA 4YT2A 3GARA 3U1TA 5BV1A 3LZ6A 2HNAA 3ZD8A 1SG6A 4WZZA 1NIPA 1GY8A 4PLGA 2BTOA 3HDQA 2I4OA 4TUYA 1RLIA 5KCMA 3V8BA 1GCOA 2VS1A 3M82A 3Q40A 1FFXA 2AR9A 2WNHA 5ICGA 2OGZA 4CL0A 1YDHA 2QTMA 2WINI 2PN1A 4KACA 2FF7A 3HRKA 5AT1A 3JD2A 2QXTA 3W78A 4BQSA 3KKOA 4XCXA 3SJ7A 3VJKA 3X2FA 4WNIA 1E6UA 4QGBA 1B15A 1QZ3A 4B3BA 5B7NA 1SQ6A 2HPAA 3VTAA 3OQOA 1PZMA 1X15A 1NN0A 4YPFA 5HSGA 1LXCA 1S2IA 4DPMA 4C4OA 3OESA 1ZH4A 2NV2B 1SUAA 1OH7A 3C3PA 4BKUA 2BWJA 1LWNA 2XEDA 5HS6A 5D7NA 2PGAA 4DQDA 1U3GA 5CAEB 3MJRA 2BONA 1T9GR 5HXAA 3ZVLA 3B6KA 2HRQA 3NIGB 4XD2A 2VXYA 2YX1A 3CGWA 1SHZA 5FLEX 4GSKA 3SK0A 1IXSB 3WYCA 1QGOA 2YN2A 3ANXA 1F4VA 2YR0A 2FN9A 4KXUA 2C0PA 2QV0A 3TNLA 1ZWKA 4L9AA 1XTVA 2QZJA 1IJKA 3JYOA 2JJYA 1FMCA 4KQ9A 2IYFA 3QMWA 5JNSA 3BWDD 3CWQA 2ONYA 4KEAA 1PL0A 4V0QA 2H7XA 3QJGA 2P5TB 1PWEA 1CFZA 3N86A 4FJ0A 1WKCA 1WUTA 3L6OO 4XX1A 3ZHBA 4F4HA 3UPDA 1DKLA 1W4BA 3MAJA 1JLHA 1HUQA 1UK6A 5KQSA 1JAXA 4FHCA 1C4WA 2Z6QA 4FD2A 4FE7A 4GDMA 1U9CA 1FZTA 2O2IA 1UOPA 4NONA 3RBVA 1DS6A 3FW1A 3TSCA 4HGQA 3H18A 1AKWA 4IDGA 3ST7A 4A2PA 3L1UA 2E4ZA 4KN8A 3EF0A 1P19A 5CA1F 2B7CA 5FUXA 3AKZA 1Z13A 2VDWA 2I66A 4M86A 3GLKA 2GTIA 1ZNWA 2R7NA 4BZWA 5FWAA 1M0TA 4FR2A 4QXOA 1UXOA 5C80A 3LT4A 2PGJA 2J48A 2Q6TA 3I39X 4F91B 3AY7A 1I3LA 4H3SA 2HF7A 4DV3B 4O0LA 4A10A 3KUKA 4Z0PA 1R18A 2WIDA 2GD0A 4NNOA 1FP2A 1SCUA 3WDKA 2OG2A 4QUBA 2C7RA 1H9BA 2YIDA 2F55A 5T64A 3BCUA 4KR3A 3HCOA 3DP7A 3KQNA 2FEPA 1W5EA 3L07A 3GJYA 2P67A 2FPGA 2X5OA