3PP8A

2.1 angstrom crystal structure of putative oxidoreductase (ycdw) from salmonella typhimurium
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
312
structure length
310
Chain Sequence
SNAMEIIFYHPTFNAAWWVNALEKALPHARVREWKVGDNNPADYALVWQPPVEMLAGRRLKAVFVLGAGVDAILSKLNAHPEMLDASIPLFRLTGMGLQMQEYAVSQVLHWFRRFDDYQALKNQALWKPLPEYTREEFSVGIMGAGVLGAKVAESLQAWGFPLRCWSRSRKSWPGVESYVGREELRAFLNQTRVLINLLPNTAQTVGIINSELLDQLPDGAYVLNLARGVHVQEADLLAALDSGKLKGAMLDVFSQEPLPQESPLWRHPRVAMTPHIAAVTRPAEAIDYISRTITQLEKGEPVTGQVDRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.1 Angstrom Crystal Structure of Putative Oxidoreductase (ycdW) from Salmonella typhimurium.
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Oxidoreductase
molecule keywords Glyoxylate/hydroxypyruvate reductase A
total genus 99
structure length 310
sequence length 312
ec nomenclature ec 1.1.1.79: Glyoxylate reductase (NADP(+)).
pdb deposition date 2010-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3pp8A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3pp8A01
2X86A 2CD9A 4QECA 1PGPA 4Y98A 3P5SA 4ZVVA 4D79A 4JGBA 4W6ZA 1I5RA 2NTNA 3JYLA 4D0SA 2EP5A 3GVIA 3U9LA 3PRJA 4I9UA 3HB4X 4IIUA 1ZSVA 3PWSA 4YAEA 5HS6A 1X1EA 4PLZA 4LRSB 3NGXA 4IJVA 1YB1A 2B0JA 3MOIA 1GPJA 1BG6A 4U0KA 2GD1O 4C4OA 4EJMA 2DUUA 4IDBA 1UXJA 4IXTA 1H0KA 1IHYA 4GQAA 1PJTA 1M6HA 2EW2A 3DFZA 4CV0A 2VZ0A 4H16A 1WLYA 5IDXA 1A4IA 3JQ9C 7ADHA 5FWNA 1BSVA 1HWYA 3UXYA 3ETEA 3WSVA 3D0OA 2O7SA 1YL7A 5BSEA 2EG9A 3ADPA 1PGOA 3AM4A 1PX0A 4ILKA 2RIRA 2NQ8A 4R1SA 2X8LA 5TQVA 4FJ2A 4DBVO 3GEGA 3OF2A 3Q9UA 4XJTA 3JQAD 3ANMA 4JBIA 1HDOA 3AOEC 1NVMB 4D42A 4QSMA 1WDMA 3KYDB 7MDHA 3ZWCA 4ESOA 1R37A 3OJFA 3PHLA 3WNQA 4ND2A 3H5RA 4IZHA 5ILOA 2EF1A 1T1SA 4IZIA 4RL6A 5EIOA 1HKUA 1NTOA 3LLVA 1SB8A 3OETA 3IP3A 3KUXA 3BMOB 4B3HA 2B4RO 2NNLD 3DHNA 3ZHXA 3JQAB 2NSDA 4IQ8A 3LT4A 1DEHA 3BMNB 2J6IA 4RLSA 3LC7O 4FDAA 3VVCA 5IJZA 4BO3A 2IYOA 3L6OO 5F5LA 1K5HA 1KVTA 2PH3A 4U0JA 1E1LA 3QWBA 1SC6A 2X0NA 1P1JA 4YJHB 5IFLA 1U7TA 3IP1A 3JQGA 1UJMA 4GWKA 3RD5A 1NNUA 4KDFA 2DC1A 3O8QA 3E18A 3GG9A 4PG5A 4L73A 4IDDA 4RORA 4JXKA 2FR1A 5EMHA 3LT1A 4M86A 1YBVA 3ASVA 1M76A 1HE2A 1U3TA 3PLNA 4YA6A 1AN9A 4EI2A 1MV8A 4A10A 5HWSA 3HFGA 3VDQA 1I2ZA 2WTBA 2ZJ0A 2X0IA 3IAHA 1P1KA 3VPXA 1RYDA 2OBYA 3E48A 2PGDA 4DQUA 1CWUA 4J1TA 2ZCUA 3V1YA 1JKIA 3QWAA 3I23A 1TLTA 3KSZO 3VZPA 3ZWOA 5A02A 1ZIDA 1T2FA 3GK3A 4MVJP 1OBFO 4AL4A 2BFPA 3NDIA 3ENKA 1ENZA 2X9VA 3WMWA 1OC4A 2Z1NA 1YRLA 2HRBA 4NDNE 4BO1A 5I9MA 4DMLA 4O0LA 2GPTA 2O2YA 4TVBA 4MVJF 4HV4A 1ZVMA 3DZGA 3ZI0A 1M6WA 3GEDA 4YJHA 5LC1A 3WFIA 2QW8A 2NVBA 3CINA 4ZU3A 3JSAA 4DVJA 4CM5A 1TT5B 1H94A 3DBRA 1U2DA 4QUKA 3D3WA 5IDYA 3VVBA 2ZCVA 4ND5A 5ICMA 1N9GA 4DREA 3IDSA 4H3VA 3GVPA 5L40A 1PZHA 3GNSA 1JN0A 2HK7A 4WLFA 3GLQA 3DFUA 5I9LA 4GAEA 2Y66A 4WCFA 5LDHA 3BHIA 3JQFA 4E5PA 3CUKA 3KSDO 3MTJA 1HDYA 3LC1O 4E2XA 2XAAA 3KYBA 3KYDA 4M54A 4R41A 4BHTA 3G17A 1CIVA 3S1LA 3H3JA 5JY1A 2JJYA 4CLOB 2BRUA 4KP7A 3VH2A 2LDBA 4J91A 1LA2A 2CVQA 1AE1A 1P1IA 4E4YA 5ADHA 3H9UA 2W2KB 4N5NA 4LW8A 3O9ZA 1PZEA 2PKRA 3VOSA 4CMIB 3HDQA 5IDWA 1XQ6A 4ZQBA 4WOJA 3RKRA 5DBIA 5J23A 1JWBB 4N18A 5EQFA 4FBGA 4PLGA 1T25A 3I9MA 3GDGA 4L9RA 3OSUA 2WE7A 4FOSA 1TA4A 4IS2A 5TJHA 3GRPA 3K8ZA 1U1IA 4RV9A 4YT5A 3DZIA 3RKUA 4NH4A 4CM6A 3HB5X 4IIVA 2V6BA 1M2WA 2H5LA 4ND1A 4Q9NA 3RBXA 3FWZA 3JYPA 3NDJA 1QLJA 2NV6A 2GYYA 3OA2A 1F0YA 3U4DA 2GZ2A 3RU7A 4BNLA 4HX5A 5JNLA 3JD0A 3ZWPA 3DZFA 3GT0A 1JQBA 5JYDA 3OIDA 4WLEA 5T8KA 4GI2A 4CMAA 1C1XA 1RM3A 4GSLA 3UF0A 2HMSA 5G4LA 4LRTB 4OL9A 1Y7TA 2IZ1A 4BVAA 3U4HA 1QYWA 3ZGYA 4WCFB 3VKVA 3RUIA 2D3TA 3IC5A 1WZIA 4RF5A 1ZO8A 4OJNA 4BO9A 3VZSA 3UVEA 4XIJA 3W6ZA 2V6MA 1ADGA 3JQ6A 2HU2A 1JDJA 2NTJA 2UDPA 4I5GA 4BGEA 3E9MA 3OECA 4J16A 1PQUA 2PTGA 3C1OA 4WLUA 3W8EA 5FFFA 4UEKA 3V8BA 3C3XA 2X6TA 3D3WB 3VDRA 4MVJI 1BDMA 4EW6A 1NASA 1ZSNA 2GDZA 1GY8A 3LVFO 1Y5MA 4Z0TA 2GN6A 1LDYA 5TJ9A 1PQPA 3GVCA 1JTVA 3DBVO 2QRJA 4J9UE 1EDOA 2Y1CA 5COAA 2F00A 3E9NA 2DTEA 4FC6A 2VCYA 1YL5A 3AOGA 1H6BA 5LDGA 3ANLA 1I30A 3VPFA 4AJEA 2B4QA 5FI5A 3QV1A 1Q0HA 3U4CA 4XWYA 3G49A 1VJ1A 1E6WA 1LSJA 5AVOA 2JCXA 3TZCA 4EITA 5KNLA 3H9EO 1Z73A 3BMCB 3FBGA 1PQWA 1TI7A 1Y9EA 1GPDG 3FNHA 1C0PA 5GMOA 3W4JA 4DLAA 1X1TA 1A27A 3BTVA 3DO5A 3NJ4A 4J0EA 3WR5A 1RPNA 2G0TA 4HNGA 4OXKA 1SNYA 3K2EA 1VSVA 2PD4A 2X5OA 4TZTA 5THKA 4YQZA 1P0FA 3UW3A 4BO2A 2X4GA 5KVCA 1E7RA 2BFAA 4CM9D 2VYND 9LDTA 2AQ8A 3CXRA 1W0CA 2YV1A 3W4IA 4CLRB 3WIDA 3DB2A 3MJSA 4UVEA 4HWKA 4JP3A 1JAYA 2VWHA 3EC7A 4I5FA 4IS3A 3RFVA 4CODB 2P9CA 1WPQA 3MWEB 1Y8RB 4IDGA 1EEHA 3CE6A 1R66A 1OI7A 2FP4A 3BIOA 2BLLA 2BGMA 3Q11A 4JCOA 5EESA 4A7PA 4YRBA 1S7CA 2JFFA 3JQBA 4TRRA 4I08A 3ZHYA 3O4RA 4RDHA 1VE9A 3KLPX 1J5PA 3INRA 2RBEA 3GGOA 3O03A 1UP7A 1AHHA 3L6DA 1DHTA 3EMKA 3AJRA 4CM7A 3UUWA 4PLCA 4ZHSA 1BDBA 1PWXA 2AMFA 5JDIA 1NAHA 3RC9A 1HT0A 2DTDA 2E48A 4OM8A 2VHWA 5BT9A 5KKCA 4BMVA 5JO0A 4FOOA 1PIWA 2BH9A 1B14A 2DVMA 5TF4A 4E0BA 5HTOA 2B83A 3JQDA 4ND4A 5JDIC 3IUSA 3DOOA 3CH6A 2ILTA 2X5JO 1ULUA 3R0IA 5MDHA 1X15A 2PGJA 4LCEA 1UXHA 3BMOA 3KRTA 3U62A 4B7UA 4XQ9A 4GX1A 1JVBA 1YE3A 4XD2A 1RKXA 3ZWBA 3IJRA 1J4AA 4XRGA 2J3IA 4AJHA 3DMTA 4TSKA 4UULA 2YQ4A 4D3DA 2ZYAA 3H3FA 1ZFNA 1NYTA 3ZNQA 4J49A 1T24A 4WE3A 2XXBA 5F5NA 5L4LA 1E3JA 1P45A 3OH8A 1LRKA 4J1QA 3VTZA 4MO2A 1ZJZA 2GSDA 4FC7A 1I2BA 3PHIA 5DCYA 4C7JA 4RPJA 5AYVA 2PY6A 3WX0A 3EYWA 4F3YA 1A5ZA 3QW2A 4G81A 2QQ5A 3ITDA 4PN3A 1BTOA 4NU6A 1CDOA 1LI4A 4PG4A 4J1SA 3ICPA 4CLHA 4Z0HO 4Z9XA 5C7IO 1LLUA 1H6CA 2H6EA 1R12A 2PV7A 1NBOA 1KEVA 3AWDA 4RLHA 1U4SA 3O26A 1KEPA 2X5KO 1AUPA 5DP1A 4CM4A 1EVIA 3MEQA 3PIDA 3GPIA 3TDKA 1IUKA 2ZB4A 3S8MA 3JYOA 3D7LA 1QV7A 3JD1A 3QQPA 4NBTA 2P5UA 1HETA 2BFMA 3CMCO 5I7VA 4TVOA 2VNAA 1QYCA 2PKQO 2G17A 4AJIA 4D41A 5B12A 1NVTA 4GBJA 3JD3A 4G65A 4WLOA 1G0NA 1TB4A 3LC2O 4WK6A 5AXDA 4NNJA 3ZU2A 4NI5A 1EFKA 1JKJA 4AVYA 3MCVA 4IJUA 2W2LD 4PLFA 2C82A 5KCZA 4NBUA 4CUJA 3TL2A 3AI1A 1PJBA 1YVEI 4RVUA 3FNEA 3LLSA 1GR0A 1U3WA 3DMTC 2YY7A 4CQMB 3WQRA 4CV2A 4M8SA 4PZCA 2WD7B 4RF2A 2CF6A 1ZK2A 4BO4A 2XF8A 1R0SA 1IB6A 3EVNA 3SBOA 1P1FA 4W7HA 1XR3A 1JW9B 2EGGA 1B3RA 3WYEA 4JBHA 1V3UA 4E5NA 5CEFA 3VH3A 2Y99A 1HL3A 1EQUA 2FSVA 4Y8VA 2ZYDA 1LDGA 4CQLA 1UH5A 3KTDA 4GKVA 1O5IA 3T7CA 2WMDA 1Z82A 1I8TA 2CUKA 3F3SA 4FJ1A 2X23A 4RPGA 2B69A 4CJXA 1YWGO 3C8MA 1ZBQA 1PZFA 3PHJA 4MINA 1C14A 2Q1UA 4J4BA 3VZRA 2PWZA 1PJQA 3WGOA 1YQXA 1GCOA 4ND3A 4CMHA 2VOEA 1ISFA 1HSOA 3B6ZA 4A03A 3S55A 4BKUA 1L1FA 1XWFA 1DPGA 5T6BA 4EYEA 1A9YA 1WXDA 2Y1GA 1ENYA 2J5KA 1RYEA 1KY5A 4Y6SA 3TQHA 1KERA 5BSGA 2C2XA 3EDMA 4XX0A 3BZUA 3L0DA 1FDUA 1V3VA 1MFPA 1I32A 3QWHA 5JPIA 3IQDB 4OMUA 2H9IA 2IEDA 4YRDA 5IG2A 2OORA 2YFQA 3ZV3A 1Y81A 1F8FA 1E3EA 1VRWA 3RUEA 1R4NA 2CMDA 1DIRA 2GLXA 3OHSX 3FPLA 4IPTA 4PGFA 3RBVA 3PVZA 2FZEA 4WCFC 1MG5A 2FMUA 4YAGA 3QWFA 3DAPA 3HE3A 2Y1EA 3D1LA 4O5OA 3PIIA 5JBIA 4Z9FA 3R6DA 1R0KA 2XXJA 2ZB3A 3PYXA 5JW6A 3UKOA 3VH4A 1LRJA 5EN4A 2X1HA 3EW7A 3C7DB 1K6IA 2C7VA 4CQLB 3O8QB 2IZZA 4BNUA 1CETA 1RM0A 2YYYA 2HJSA 4WEOA 3N7UA 3ROPA 4XIYA 4IDAA 2PFGA 1CYDA 3SVTA 1OAAA 5DT9A 1H9BA 4OKNA 4AJOA 3HFSA 1YOVB 2NVWA 2IXBA 2I6TA 1W73A 3FSRA 4BNZA 1Z7EA 2UUPA 2JL1A 3ZU5A 2V6GA 1GYRA 2JFHA 5IZ4A 2B5VA 4PG6A 1HTBA 3INTA 3BHMA 3KEQA 2PZKA 3NRCA 1V9LA 2BELA 1UDBA 1YJQA 5BSFA 2AG8A 3GN1A 2VT3A 2Q4BA 2GZ3A 2ZJ1A 3NT5A 4BQPA 1JU9A 4Q3CA 4YJDA 1H2BA 3B20A 3GQVA 2JCYA 1KVQA 2ZIZA 5CFZA 5A5FA 5A9SA 2PZLA 4NK4A 1U8XX 4BNGA 3NJ8A 1YQGA 4AJNA 2P4HX 4A73A 2DLDA 3EZYA 4XZ3A 4YB8A 3DQPA 2X58A 4LMPA 1H6DA 4O59O 4BO6A 2HMVA 1V8BA 1I3LA 4PLVA 4YWJA 4BL5A 2A9FA 3ENNA 4XGNA 5TRTA 4CLXA 4E33A 2NQTA 1B7GO 2I99A 3GPDG 4S3MA 4Z0PA 5CEEA 1HLDA 4BNIA 1YJ8A 3PLRA 3WWZA 2WEKA 4CMJA 1HEUA 4YEDA 1BXGB 1VL0A 2AQKA 3TJRA 4YPOA 3DR3A 3IUPA 4GX0A 3AY3A 3H2ZA 4IBOA 3WLEA 1EUZA 3HADA 3L4BA 3CMMA 2AA3A 1ENPA 1SPXA 2ZTMA 4OKIA 4BKQA 1PGNA 3GZNB 2DBZA 2FPGA 3BMQA 3I52A 3PWKA 1SEVA 2O4UX 2QX7A 4YJFA 5DBGA 3TPCA 3L4SO 4BNYA 4PZEA 4B79A 1YBMA 1LC3A 2J3KA 1Z6ZA 4UUNA 1UAGA 1IY8A 3X2EA 1TEHA 3ZHZA 1HDGO 3A06A 5A9SB 4URFA 4H7PA 5JAQA 4BV8A 4GGPA 1C3VA 4TKLA 3TNLA 3JQCA 1YKFA 3SC4A 4FFRA 1JWAB 3A1NA 3KM0A 4CLOA 5CDUA 3AI3A 1ZW1A 2SCUA 3RBZA 4LGVA 4RVDA 2ZB7A 1ISJA 3IS3A 5IAAA 4XR9A 3G3EA 4PFJA 5G2OA 1HZJA 3DBHB 4ALLA 3PQFA 4CUKA 2VTEA 4CR8A 3ZHBA 1NPDA 4R69A 5L4SA 1YBAA 1ISMA 1YOVA 5I8WA 3VH1A 1U7HA 1ADBA 2HUNA 1DFHA 4XYBA 2E49A 1M66A 4K1LA 4DYDA 1LNQA 1ZH8A 2CDAA 1I3NA 5G0SA 2UUOA 2IZ0A 4QXMA 1MC5A 5HA5A 4A2CA 1N1EA 3C7CB 3IKVA 4U7WA 5EPOA 5AXBA 5L53A 2P9EA 1N8KA 3KOUA 2QIOA 4K6CA 5CPBA 4AJLA 2FPIA 1C1DB 2VYNA 2YFHA 3DOJA 3GN2A 4KDEA 3K9QO 4YT8A 4YAJA 1E3SA 2J5RA 3FBTA 4JJIA 2ZTVA 2C29D 3DONA 3DOCA 3MOGA 2HJRA 2VZ8A 4WASA 4C7KA 2B36A 2DFDA 5JDCC 3A4VA 3RUDA 4AJJA 4J1NA 4J90A 1EK5A 3WYCA 3JQ8B 2AEFA 3N58A 4KTTE 4NMHA 4EJ6A 2YV2A 1ZJYA 2J3JA 3PJDA 3ROKA 5A5EA 4L8VA 4MIEA 4XRRA 4CMIA 3H9QA 3CIFA 4NIMA 1VC2A 4Q3EA 4WUVA 3K31A 4RVGA 3H8VA 1F8GA 3MJCA 3AM5A 5DCUA 4ITUA 2FZWA 5KJ6A 1ZUD1 4O1MA 3TL3A 4JN6B 5A05A 3DTYA 3COSA 3DZJA 1PJCA 2H63A 5ENVA 3ZV6A 1E7MA 4BV9A 1LSOA 3INGA 2HRZA 2UV8A 1BW9B 3RVDA 1GUZA 1FF9A 1Y8QB 1XKQA 1D1SA 1E5LA 1DDOA 4BB6A 5KWEA 1ISGA 3FCOA 4BNFA 1HLPA 2I66A 3PTZA 1QXSA 3NTRA 1NQOA 3QVTA 3GHYA 2GN4A 5F1KA 3ZN2A 3EAGA 1U3VA 3I9OA 1BXZA 3ETDA 4XJSA 3LF1A 1H6AA 1LC0A 1ADFA 1OOEA 5KJ1A 3PXXA 1TVEA 3I4FA 4DIFA 4NJMA 3HSKA 2NACA 1EBUA 1R16A 2O4CA 2VHYA 3GR6A 3WBBA 1AHIA 5AQ1A 2A35A 1PS9A 3FI9A 4XCVA 1DFGA 1R6DA 3CZMA 3JQGB 4JBGA 3ZV4A 1CF2O 3BYZA 4BNHA 4ALNA 4RO0A 4RJTA 2Q46A 2DUWA 1VJTA 3OICA 1PS8A 3DBLB 4LMRA 2Q2VA 3E03A 1DXYA 3JQAA 2FPPA 4MP3A 3WGTA 3WDSA 1UZMA 5GZ6A 5BNFA 4BKOA 4XGKA 4YT2A 4NHEA 4L76A 4WNCA 1NWCA 3FD8A 3QJ5A 4GL4A 3TOXA 2V6FA 2W2LA 2J3HA 3MWDB 4Q39A 1BHSA 4NR0A 4DIBA 2O7QA 3ZNPA 3AUUA 2WJPA 3WTBA 3E1KA 2QG4A 4Q3BA 3X2FA 2GO1A 1V6AA 1YH3A 3IOYA 1GDHA 2BGLA 3S2IA 4YCAA 1M75A 1E1KA 4M1QA 5DOVA 2UYYA 1SO8A 4YRAA 4CM1A 3PFWO 3E8XA 3I9NA 5CG1A 3AUTA 1DJQA 1R4MA 3FRJA 4ROSA 4BNNA 4YDRA 3E6AA 3M1LA 4TRMA 2C2YA 1MUUA 5KJCA 4M87A 4OYRA 1V0JA 2YJZA 3EUWA 3AI2A 4D3SA 3EVTA 5G0WA 3VPGA 4FB5A 1MA0A 2ZB8A 4R5HA 2CDBA 4UVDA 4IDEA 5DBFA 2WD7A 3LK7A 3WJAA 2O3SA 1MX3A 4MP8A 1LRLA 1U9JA 3LDHA 5DP2A 4B4WA 1RM5A 1X0XA 1MP0A 3RIHA 3BTUA 1Y6JA 1GV0A 1LSSA 2O3QA 2R6JA 1QMGA 3V2UA 2TMDA 3LZ6A 3GG2A 3P2OA 3WXBA 1DRWA 5JMPA 1DC4A 4A26A 3WB9A 4ALKA 4A27A 4XR4A 4PZDA 1T1RA 1XU9A 1UXIA 3VZQA 3QP9A 1XU7A 1IE3A 2JD0A 3M2PA 3W8FA 1LDNA 2RH8A 3OJEA 5ER6A 1ZCJA 3FNFA 5IF3A 5JMWA 1GTMA 1K2WA 3F5QA 3HJAA 4E2WA 4CLDA 5HS4A 5I8ZA 4OOEA 1PL6A 2RHCA 2EXXA 4BMSA 1DSSG 3ANNA 3JCZA 4GH5A 2CVZA 4J7UA 4GWGA 1HZZA 3AUAA 3TWOA 4BQRA 1WZEA 1BXGA 1NR7A 2H1SA 2ZKLA 1BWSA 1EDZA 4IDFA 4DPLA 1PL8A 5IZCC 4AG3A 3PP8A 3FF4A 5F21A 3HDYA 1K6JA 3F4LA 4DWVA 2Q2WA 1QORA 4NFYA 2EIHA 4BNVA 1DC3A 2NLOA 1GD1O 1Q2XA 1RM4A 1NQTA 1U28A 3H7AA 4WCDA 2DT5A 3RFTA 4BNWA 1XA0A 3GC6A 1KVRA 1C0IA 2P4QA 5DCWA 3FTNA 4FS3A 4D45A 4PRLA 1ONPA 3B1KA 1CJCA 1ZXBA 3ULKA 3BAZA 1L7EA 2HSDA 3MJEA 4L4RA 3ZWXA 4QFDA 2JD2A 2Y0CA 4INAA 4LISA 1UZNA 4BIIA 1H9AA 2FY8A 2WD8A 5CAEA 4WJZA 3DC2A 3EGOA 1NR1A 4DC0A 2HMTA 3NEPX 3UCEA 3JQ7B 3QVOA 1P1HA 1M67A 3NAQA 4NFSA 4PRKA 3I4CA 1PZGA 2X22A 4MIOA 4BGIA 2YHIB 2ZATA 3PZRA 3IJPA 2BI8A 4R5MA 3KYCA 4FN4A 2Q45A 3ADOA 4HNHA 1A9ZA 3ROMA 3MTGA 3CPSA 3ZWYA 3C7AA 3IL2A 4W4TA 3ZZNA 5CDYA 2VWGA 5TX7A 1AXGA 1LBEA 2FR0A 4K28A 2D2IA 3OIFA 1XDWA 1QRRA 3GOHA 1KYQA 3I1JA 5THQA 1SZJG 3JYQA 4LVCA 4RPLA 4UVHA 2ZTLA 3NTOA 4FSHA 5DULA 4BB5A 4KUEA 1E77A 3BA1A 1K0UA 2DTXA 1WMBA 2HKIA 1DAPA 5TLSA 1CERA 1ID1A 3PHGA 4GVLA 1DLIA 3OP4A 3OEWA 2O3RA 2GRAA 5EL0A 1MC4A 1E5QA 1GYPA 1ML3A 1N7HA 4YJGA 1SBYA 2JAHA 3DL2A 4W99A 5IZCA 2C59A 1NQ5A 4ALMA 4CV1A 1PGJA 4P4NA 5CHEA 1X7GA 1NPYA 2PKQP 4BNMA 1A7AA 6ADHA 1VKOA 3GF4A 3CTMA 4NFHA 4I1IA 4Y67A 5JS6A 3ST7A 3AY7A 3HG7A 3I9JA 3L9XA 2B35A 5JAIA 1X13A 2W90A 3OMLA 1IULA 5H83A 4ZD6A 1SEPA 4XA8A 1QG6A 1VM6A 1PU2A 3BMNA 4R01A 4L4SA 2CFCA 4FFPA 5KVVA 5T5QA 3DWFA 4DPKA 4P8RA 1C1DA 2I5PO 3OQBA 4OH1A 2E6UX 5U4QA 4D7AA 1VKNA 3WIEA 4PVDA 2OXIA 2HQ1A 4XQEA 3CEAA 5I7FA 1Y5RA 4IUYA 4O6VA 3FN4A 4N5LA 3STHA 1GU7A 2BMAA 4CM9A 4AFNA 1QR6A 2IDZA 2CZCA 4AICA 4Q3DA 2NU8A 3KYCB 4E5MA 4KWHA 3DBRB 4MJLA 2LDXA 2YDYA 4B3JA 5K0ZA 3PYLA 1I33A 1XEAA 3ABIA 1Q7BA 3B1FA 3DDNA 1XSEA 1OZAA 1UDAA 2B37A 1EQ2A 1DIHA 1QKIA 3EY4A 3GDOA 4YTEA 1I01A 4OO3A 1PJSA 4J7XA 1BMDA 1A71A 1P31A 1WWKA 3LT0A 4YXFA 5ITWA 1N7GA 2O3TA 4FQ8A 4EJ0A 4EUHA 1NWHA 1MXHA 1E3WB 1GL3A 4CMCA 4CV3A 4JIGA 1WAMA 4F45A 5JC8A 5CG2A 1QV6A 2PLAA 1E1MA 3Q2IA 4RGBA 2FSSA 3WMXA 4JX8A 5B4TA 1Z45A 4DUPA 4EDFA 5AOVA 5HRUA 4WLVA 3PWZA 1XLTA 3FWNA 4GKBA 4MVJG 5ES3A 3PJEA 4N7RA 4FJ0A 4AJ4A 1LQUA 5IXYA 4XB2A 1NP3A 5L45A 3GEMA 1UP6A 3I6IA 3BTOA 1GYQA 1DRVA 3HN7A 4M49A 2CSUA 3KHUA 2D5CA 3RUFA 3K6JA 4F6CA 4BO0A 2DPGA 3HDHA 2DM6A 2OGUA 4K9DA 2GASA 1QYDA 5F1PA 4I9HA 2QZ9A 3ZW9A 3A9WA 3DEYX 4J6FA 4ZN6A 3U3XA 3WYBA 3L07A 4IJKA 4B4VA 3SLKA 3EHEA 4NU5A 5T67A 2EKPA 3GUYA 3M6IA 1W8DA 1IZ0A 2CF5A 4EUEA 3EZLA 1NPTO 1EMDA 5L95A 4LVUA 2Z1MA 1K6XA 2RAFA 5TS3A 3L77A 1DOHA 4R54A 3W4KA 1WP4A 3W8DA 4EGFA 2HMWA 4MVJD 3GUCA 3IKTA 1DHRA 2D5AA 1E92A 1ONOA 2Q3EA 1TXGA 1HYGA 1YGYA 4XEHA 4E31A 5A04A 4PCVA 2HO5A 5TT1A 3TZHA 2EW8A 1PJ2A 1LLQA 3HNPA 5BSHA 1MFZA 1O8CA 4YJFB 1JVSA 3PEFA 4OGWA 3KBOA 3ASUA 3GVXA 4R1UA 4XYLA 1ZEMA 2AEMA 1EVYA 3GHHA 3LT2A 3SJUA 2ZTUA 4HFRA 4D3FA 4XGIA 3PGXA 1ZMTA 1W4ZA 4YVFA 1X7HA 4R68A 3LQFA 3WGYA 4GMGA 4MPDA 2VTDA 2AEJA 5B37A 1IOLA 4J4TA 3BTSA 2FHSA 5ER9A 1P9LA 2ZQZA 3WWYA 4HXYA 4X54A 3JQFC 1C0LA 4ZQHA 5U1PA 4E2YA 4KTVE 5A4DA 4D46A 5L7YA 3QY9A 3GFGA 3OQ1A 1X14A 3O38A 1YDWA 2UAGA 1CQIA 2DPHA 4FD3A 4OQZA 3KEOA 3GVHA 2FOIA 2E4AA 2W4QA 2WYWA 3G1UA 2JFGA 1OFGA 3ONDA 3WQSB 2OO5A 5KJEA 1LDEA 2JAPA 4XQCA 5KTKA 2I3AA 1K3TA 3GY0A 4TZKA 1UUFA 4RPHA 1LLDA 1A72A 1WW8A 1SCUA 1BRMA 3WGQA 4RVSA 4XDZA 5IXSA 3FR7A 1RJWA 3D3EA 3KV3O 5L51A 1NAIA 4XB1A 2NVUA 4DLBA 5C7LO 2D4AA 4GGOA 3RC2A 3W6UA 4J2HA 1EUCA 4RVFA 4ALJA 1BVRA 1U4OA 4E12A 5JYEA 5C7OO 3OIGA 2AG5A 3FR8A 3FNGA 4JLWA 4Z9YA 1I36A 4YBZA 4IMPA 4CR7A 4YAIA 1O94A 4YR9A 1AGNA 3MJTA 5EJ2A 3OJLA 4RZIA 1QYXA 4KQWA 3AUSA 1G6KA 2C54A 3RSHA 1ZXLA 4Y9DA 2D1YA 3K2BA 1TT5A 3TSCA 5IN5A 1XHLA 1KIFA 3NV9A 5KVQA 5L4NA 4R3NA 2DKNA 2ZYGA 2BGKA 4CQMA 2X7HA 3GA0A 1KVUA 3RUHA 4OIMA 2O48X 3NDRA 5DOZA 2EWMA 3GNQA 4QX6A 1Z7BA 1Q7CA 3C85A 2BFOA 3WLFA 3FHLA 3GGGA 4MVJH 1IHXA 1VI2A 3I83A 3G0OA 2O23A 5KOIA 3WGIA 3JQ7A 3IMFA 3NT2A 4BNTA 4P38A 1P3DA 1HYEA 1BXKA 1UXGA 4CUZA 1Y8QA 1T2AA 1NX6A 5L7WA 1HDRA 1DIBA 4IGFA 3JQEA 4XKJA 4MDHA 3ETGA 1ZK0A 3OEYA 1DC5A 3OJ0A 3CZRA 4FFMA 5EQDA 3KZVA 4J7CA 5CDSA 4ZQEA 4AJKA 1Y1PA 3A28A 1LSUA 1SOVA 3U0BA 3E9QA 1DB3A 3V2HA 1DJNA 2DU8A 3D64A 4J9VA 3U49A 1PWZA 9LDBA 1VSUA 2DBVO 4E13A 1H93A 1O0SA 3Q2KA 3PQEA 3F1LA 4TRJA 2B5WA 3DMYA 1E7SA 1P74A 3H5AA 1CQJA 3SXPA 1E7WA 5K6AC 3DHYA 4XYGA 1J49A 2G1UA 4QTZA 1NM5A 1O95A 4Q3AA 3ROQA 5H82A 1ENOA 2Y05A 3QRWA 4L75A 4GLOA 1UAYA 2HK9A 3T4EA 1G1AA 4J2OA 4ZRMA 2HCTA 4UEJA 4E32A 3G79A 4DL9A 1VL8A 3WG9A 2JHGA 3VTFA 1B8UA 1DO8A 5F1OA 4CQMD 3H2SA 1JKFA 1YB5A 4MKZA 4QFCA 2R2GA 5T64A 2W2KA 3WQQA 4CPDA 4TMFA 3S2FA 2I67A 3TZKA 4H15A 4UVIA 3TRIA 1Q7GA 3WICA 1N9GB 3HZZA 3I9KA 3RCBA 4L4XA 2P9GA 3RUAA 3RJ5A 1NQAO 3RUCA 4HFNA 2IEBA 5BR7A 1BVUA 4MVJM 4N54A 5TIIA 2VHZA 4BKPA 1KS9A 1ZEJA 1GFSA 3ZH2A 1LJ8A 1OMOA 2VUSA 2YHUA 1R0LA 2PD3A 4GVXA 4K6FA 3ZWNA 1B15A 3Q0EA 4U5QA 4K26A 3DHEA 4NBWA 1NXQA 1MG0A 4G2NA 2G76A 1GADO 4CMKA 1HYHA 1JLLA 3F46A 1TT7A 3CSDA 4HKTA 4KUGA 2IODA 3NT4A 5CDGA 3VKUA 1S6YA 1ZZEA 2EJWA 3K96A 3ZCXA 5ENDA 4IMRA 2EEZA 4BNKA 4CL3A 1KEWA 3WNVA 8LDHA 4NQZA 2YQ5A 1HXHA 2NUAA 4CMEC 4R3WA 4J43A 3ZDFA 4EUFA 5HBRA 3AU8A 3MJ4A 3KLMX 1U2GA 3KXDA 4P4GA 3KETA 3VAZA 5K6AA 4XYEA 5DZSA 4ZRNA 4E21A 1YL6A 2IRWA 4OXYA 2GN8A 3Q3CA 4CM4B 1A7KA 2P2SA 1X0VA 4Z6KA 4WPGA 3P19A 2A92A 1YO6A 3DZKA 1E3IA 1B2LA 3MZ0A 2NADA 4CM8B 1H2HA 3OQ6A 5IN4A 4WLNA 4BMNA 2Z95A 4UAGA 3V5NA 4HADA 2YV3A 2QYSA 5G0UA 3D4PA 5COBA 1T2EA 1NVGA 1I3KA 4OSPA 1QP8A 1ORRA 4O63O 4RF3A 1DIGA 1E7YA 2Q1WA 4LCJA 5BQFA 2X0JA 2DFVA 4A5OA 3WOHA 5JO9A 1WNTA 2P5YA 2I76A 2W98A 2YHIA 2E37A 2ZK7A 3I9LA 2G82A 1ZSYA 1LTHR 4CMBA 1D8AA 2G5CA 4JNKA 5B4UA 1SAYA 1MGOA 2EKQA 4P22A 3QIVA 4NK5A 1SB9A 1Y8RA 1JA9A 3SLGA 4B4OA 4NJMB 3QA9A 4KWIA 1KVSA 1QYVA 3QWIA 3QVXA 4EEZA 2OUIA 3JQBC 1YS4A 1KY4A 4Z3KA 1F06A 1GV1A 3OBBA 5G4KB 1GEGA 2OP1A 3JD2A 1HDZA 4EBFA 1I3MA 4GX5A 5LCXA 1YQDA 2JD1A 2Y1DA 5JFOA 5TT0A 2FR8A 3SX2A 4Y6RA 3BXXA 4RQTA 4MOWA 3CKYA 2B4TO 2C0CA 4YJGB 1Q0LA 2V7PA 2GERA 2Q1SA 3E82A 4HP8A 2ET6A 1GQYA 4U6SA 3UCXA 4R1TA 4PLHA 3TFOA 1XQ1A 3PPIA 2JCVA 2TMGA 3G1TA 4CM8A 2HAEA 4JP2A 2PD6A 2QYTA 4IGEA 4MKRA 2WYUA 3C24A 4RCVA 3ZWWA 4MKXA 3NTQA 3Q1LA 2HDHA 3UAGA 3RC1A 4QQRA 4M55A 1Q0QA 2Z5LA 4KMSA 1KC3A 4HUJA 1EE9A 4Z3DA 3VPSA 3R3SA 3ZNOA 2Y68A 2OMEA 1D3AA 2D0IA 1EE2A 1KETA 4R1NA 1N1GA 4WKGA 1IL0A 3V1TC 4YQYA 5GY7A 4KOAA 3HN2A 2OFPA 1E3LA 4TROA 1KC1A 4DPMA 3PZBA 1PS0A 4N5MA 3U4IA 1B8VA 4AJ1A 4NPCA 3GMSA 5A3VA 1LX6A 1NHWA 4ZQFA 2YDXA 2VOJA 1RWBA 2DBQA 2PH5A 3NKLA 3DAGA 3VPHA 1LDMA 4KZPA 1T4BA 4Y6PA 4BNXA 2PR2A 1B8PA 1ISHA 1IPEA 2Y1FA 4E6PA 1E1NA 3TZ6A 5I7EA 4BO7A 2NU9A 1FDVA 3D4NA 3JYNA 1GCUA 1HRDA 1I24A 1ISIA 2OL4A 5T8KC 3WJ7A 1IPFA 1DBVO 3ZWMA 4DXHA 2C7GA 5JCJD 3RFXA 4CL8A 3GFBA 4EEXA 4ALIA 5JY6A 1O89A 3V2GA 3S2GA 1ULSA 1LUAA 4KUHA 3ITKA 3ZNNA 2VRCD 1C1XB 4BGUA 4W9NC 5FEUA 5A1TA 2V65A 2VUTA 1HDXA 2AE1A 3F47A 3UHAA 3DAFA 4R9RA 2C5EA 3GH3A 3KO8A 4M89A 4IM7A 4D44A 3H4VA 4DIOA 1U3UA 1XCBA 3EK2A 2QRKA 2I3GA 3AU9A 4NG5A 1GQQA 4IINA 5I9NA 5CPFA 1VJ0A 1D1TA 3JD4A 2FN7A 4PLYA 2BI7A 3KB6A 3WSWA 5HM8A 1D4FA 2EKLA 3L9WA 2NM0A 4J3FA 5I7SA 3GZNA 4E2ZA 2Y93A 4NZ9A 4B7XA 1L7DA 1XGKA 1A4UA 2Y1OA 1EVJA 2BD0A 4KQXA 2JKVA 4QO8A 2Y0EA 3GMDA 4CLEA 4LK3A 1GEEA 3VHRA 1F14A 1IZ9A 4DGSA 2NTVA 1GQ2A 2F1KA 1LU9A 2D59A 1U5CA 1AXEA 1J0XO 3I3OA 5DDIP 3HDJA 1QLHA 3TN7A 4FGWA 5AXAA 4RPKA 2PNFA 4W82A 1FXSA 2O50A 3NX4A 2J5QA 2Y0DA 1N5DA 3QE3A 3GGPA 4TKMA 4UUOA 5KKAA 3RI3A 3AFNA 1JAXA 3T7EA 1W6UA 3P7MA 3K92A 1BGVA 3WGGA 3F5SA 5IDQA 2CVOA 2EGHA 4IJWA 2HMUA 1B0AA 4R16A 4E30A 4TWRA 2PZMA 1P44A 2OZPA 3GAZA 4MP6A 1HE3A 5ITVA 1DAOA 5L9AA 1T2CA 2OHXA 4DTIA 5FYDA 4E5KA 2P68A 4CR6A 1ZK3A 4FIZA 2HK8A 2BF7A 2Q1TA 1EUDA 4ZQGA 4DYVA 1V35A 4RVHA 2A4KA 3OJOA 2VYVD 4GLLA 3PK0A 4PG7A 2PK3A 2FWMX 2GN9A 4WGGA 1I2CA 3NUGA 2IXAA 4MVJE 1GZ6A 1IYZA 2O2SA 2WSBA 3JQ8A 1HDCA 1VLLA 1EK6A 4A0SA 1X7DA 3AW9A 4UEOA 4DLLA 3PJGA 3NGLA 4DBZA 4F46A 2VYVA 5DF1A 1NFFA 4FCCA 4GX2A 4ONEA 3PQDA 4NBVA 4CMEA 3AOEA 2EV9A 2WE8A 1ZMOA 1WMAA 2WDZA 1UR5A 1O9BA 1XIVA 3TFQA 1J6UA 2I65A 4U8GA 2VT2A 1PJ3A 3DZBA 3GZ4A 3JTMA 4JK3A 2O3UA 3FPCA 3PDJA 4AJPA 3T4XA 1Z75A 2AQHA 2CY0A 4UVGA 4I5EA 5H81A 4PLWA 1N2SA 4IQGA 4DQXA 1KOLA 1R4NB 5CDTA 4PG8A 4II2A 3DTTA 1UDCA 2VWQA 1K89A 4B7CA 4PLTA 1HE4A 8ADHA 4BS9A 3IIEA 4BGVA 1DFIA 1FMCA 4BOYA 1GZ4A 5CP8A 2C07A 2RH4A 3OFSA 3DZHA 3R1IA 3TOZA 4HFJA 1SMKA 5TGDA 1P1RA 2OBNA 1BW9A 2AW5A 5C3MA 1LLCA 1T4DA 4IY1A 1WVGA 3LU1A 3BMQB 1ZK1A 2EP7A 5JLAA 1E6UA 1LDBA 3WS7A 3S2EA 4B4UA 1YDEA 5TC4A 2DAPA 1ADCA 1DIAA 1PTJA 4FGSA 1B26A 3H9JA 4PIVA 2VN8A 2VUUA 3L4BC 1CEQA 1I0ZA 2CNBA 1FJHA 1F12A 4OXNA 3K30A 1GAEO 3A14A 3D5TA 3B70A 4MIYA 3F6YA 2C20A 4NJOA 1P33A 4XDYA 4B3IA 1WDKA 3D5QA 2AE2A 3WGZA 1C0KA 1XELA 5CEJA 4R4JA 4IQ0A 5DNAA 2P91A 2GUGA 4D43A 2DQ4A 3QVSA 3LSYA 3UICA 2EERA 4J4HA 4R9SA 2CDCA 4YAKA 4RZHA 3LF2A 5JAMA 4JJGA 5L3ZA 3SC6A 3AK4A 3ZU3A 2Q49A 2VWPA 2Q99A 5JCJA 4XQGA 3N74A 5U9CA 3ZU4A 4B8ZA 2BKAA 3ZWVA 5EINA 4B8WA 3HQ4O 3HUDA 1OC2A 2GGSA 1E0DA 5GZ1A 1PSDA 2X9GA 4QO7A 1E7QA 4XYMA 1MLDA 4QEDA 4W7IA 4WECA 4WNIA 2EHDA 1GZ3A 5C5IA 1PGQA 2VZ9A 3GDFA 1LXCA 2E82A 3RROA 1NFRA 2YUTA 2OOSA 4TQGA 6LDHA 2R00C 4JJFA 4ZICA 1FDTA 3ONEA 5B1YA 3I5MA 3PGJA 2J8ZA 4I9NA 1YXMA 1PR9A 1P77A 3W1VA 5BNIA 1PJLA 3K73O 3WFJA 4DC1A 3VC7A 2O3JA 5G0TA 5F3RA 3PDUA 2Q2QA 3FTPA 3UCFA 4UUMA 4BUCA 2IYPA 5COQA 3ZWAA 1H5QA 2D8AA 3D4OA 1UXKA 1DRUA 2YZ7A 5JSFA 5KIAA 4Q3NA 3M1AA 2VRCA 1Z74A 4WEQA 5JDCA 2YW9A 3WGHA 1ONNA 2HLPA 1QSGA 5T57A 3BMCA 1ZKMA 5A3JA 4DRYA 4GSKA 5A9RA 1N92A 4DA9A 4FFNA 1FK8A 4G5HA 4LSWA 2VQ3A 2NU6A 4HBGA 5JE8A 1UP4A 5GZ3A 3AM3A 2I9PA 3V1UA 1VL6A 5K9ZA 3TZQA 1HE5A 1FDSA 4WOKA 4DMMA 4ZA2A 2X9NA 3H6KA 4GMFA 3E5MA 1F17A 3QSGA 3C1TA 3UFXA 5TSDA 1PEDA 1KEUA 5DN9A 4BKRA 3H9GA 5ILGA 1U8FO 5C37A 2RHRA 5JC1A 3UGKA 2X0RA 4UREA 4BNJA 4CM3A 4CLRA 4GPD1 3H5NA 2Q50A 1KBZA 4BO8A 5B4VA 3R3JA 1ZK4A 3ZV5A 5A03A 3OM9A 1ZNQO 2WM3A 4JQCA 4HY3A 3GRKA 3F9IA 3RU9A 1HF3A 3RWBA 1EZ4A 3DBLA 2OP0A 2R00A 3UN1A 4PLPA 2VHVA 1P0CA 3ICCA 4NBRA 1E6EA 3OA0A 3RASA 1HSZA 3HWRA 3UH1A 1B16A 1DLJA 5TNXA 1PR3A 3PFFA 4HFMA 3ZW8A 2PGLA 4YT4A 3F4BA 1U5AA 3C1AA 1GUYA 1E3WA 4FFLA 4ID9A 3SJ7A 5A06A 5A9TA 2DBRA 1GUFA 4CMGA 5JCXA 2W8ZA 2NVUB 3ORFA 3K5PA 2VNSA 1XG5A 4E5YA 2RCYA 2ZQYA 4I5DA 1R4MB 4I8XA 3UOGA 4F6LA 3WBFA 2IE0A 1PJ4A 2GNAA 3H65A 3QVWA 3DXFA 1NFQA 3RQSA 2PA3A 2AHRA 1CRWG 1EBFA 1G0OA 3PJFA 1O6ZA 1WDLA 3JV7A 4RF4A 2NU7A 2GR9A 2GCGA 3M2TA 5KVSA 2A94A 1R15A 3RJ9A 1FDWA 1MXFA 2UVDA 5JAZA 3I6QA 2AXQA 3B1JA 3HHPA 3U09A 4FW8A 4U6QA 3PYMA 4OQYA 2AQIA 2GF2A 2VHXA 4MVJA 2QZZA 3KSUA 1V3TA 2QRLA 4QT0A 3GNTA 3KVOA 4ZJUA 1YONA 1T26A 3Q6IA 4E3ZA 5G0VA 2GZ1A 3TF5A 2XOXA 2Y67A 2VRBA 4LN1A 3QLJA 4IXWA 4FFOA 3PI7A 4W9NA 4OSOA 2WYVA 3DBHA 2EJVA 5JXWA 3BHJA 4FR5A 5L7TA 4JROA 3GAFA 2BHLA 1YB4A 5G4KA 4BO5A 4UUPA 3RAJA 3E5RA 3L6EA 3JQ9A 2WWRA 1DC6A 3U5TA 4L74A 3ON5A 3AFMA 5EERA 1XYGA 1I10A 4DQVA 3F1KA 4OHUA 4FPXA 4R51A 4LSMA 5KJFA 2XPCA 4TRNA 3MJVA 4S1VA 4IDCA 1EVZA 2QHXA 3NYWA 1D7OA 1LEHA 1SOWA 1UZLA 3LYLA 5FF9A 1Q1NA 4AJ2A 1MB4A 3SEFA 1EFLA 3PHHA 2JHFA 3P2YA 2PZJA 4II3A 5MGBA 5AXCA 2Q4EA 1B3BA 4EZBA 4ZGWA 1LQTA 5FI3A 4OAQA 3ONFA 1ARZA 3AY6A 4RDIA 4YYZA 1NHGA 4YACA 4L0QA 4D0RA 2POQX 4RQUA 2C5AA 1PL7A 3RC7A 2NWQA 3QHAA 3WTCA 1T2DA 4OOFA 5BNTA 4P4LA 1VPDA 4PVCA 1Y9AA 4J0FA 3Q9NA 5ICSA 2FRDA
chains in the Genus database with same CATH superfamily
3MS2A 2CD9A 3BHNA 4QECA 3RYFB 3P5SA 4BFSA 1LCIA 4Y2TA 3CZPA 2DPXA 3LP8A 4TXNA 2ATEA 3JYLA 4QULA 4D4IA 1KI7A 1NMSA 1ZU4A 5INTA 1C41A 4I9UA 2A6PA 5A4MS 3COJA 4YCCA 4IJVA 2GPBA 4QYMA 1BWPA 2AWNA 5TGZA 4EMBA 4P5EA 3H2BA 3OZRA 3MOIA 2LW7A 1BG6A 1VJ5A 3MRXA 4U0KA 1WF3A 2N9UA 2V9CA 5NULA 4B8YA 4BVGA 5IBCA 1XMOB 4IXTA 3WLJA 1KDPA 1IHYA 5HCIA 3N2EA 4KNYA 1M6HA 1K4YA 3LCCA 3E22A 3P9CA 2QUIA 2VZ0A 1XMJA 1K1EA 2WNSA 4CV0A 2I7XA 3PDCA 1OU0A 3MWEA 1A2KC 2FQWA 1KO1A 1T5IA 2BPOA 1HWYA 3QKUA 3UXYA 3V8VA 8ABPA 5E1MA 2OXTA 2EG9A 5BOVA 3ADPA 3KQHA 4FOTA 1MAAA 3OMXA 5HJ7A 4QQKA 2UZ4A 2F62A 3E15A 5TQVA 4PPGA 1DG9A 3QU5A 4EG5A 4DA0A 5KQRA 3ANMA 3HBNA 4JBIA 1G8HA 4XVHA 2FSHA 1PK8A 3AOEC 3G85A 1KMHB 2VEDA 1GL9B 2QXUA 1HORA 3T35A 3KYDB 2CMHA 2ODEA 2QUAA 3ZWCA 1MMFB 1RNLA 1R37A 2B9VA 1HI9A 4ESOA 5JATA 4PAWA 2GJ8A 2HBZA 1XEXB 2EDAA 2YHSA 3UAVA 4WNAA 1K9VF 2M1ZA 1I5EA 1RI2A 2FPPB 3B3QA 4GPBA 4KOEC 5I4BA 4RL6A 3L7LA 4QNNA 4II7A 4RLQA 1SCBA 2XCLA 3HO1A 2QLTA 3LLVA 2PL3A 5H9VA 1UOQA 3A2MA 4CFZA 1L8AA 3BMOB 1OBOA 3T8YA 1M2FA 1UM8A 1V3QE 3ZHXA 4YIKA 1V16A 3RSLA 3IKMB 2REQB 3BMNB 1PZNA 4RHXA 3LC7O 3VVCA 3OM1A 4LS3A 3L6OO 2BCJQ 5F5LA 3NDBB 1WUKS 1ZN8A 2QUBA 1BD4A 3BICA 1SC6A 2X0NA 2FPUA 1P1JA 2EJTA 4YJHB 5LSAA 1SY7A 1Q5PA 3IP1A 5I48A 4REOA 4BX8A 3VU9B 2ZXUA 1DZ3A 1ZH2A 3I5UA 1NNUA 4MYTA 4Y2GA 5FLKA 4F71A 1XFAA 4JBWA 2IDJA 3GG9A 4Y3UA 4PG5A 1OW3B 3LLUA 4ZV7A 1GXSB 4OI0A 3JWIA 4MYDA 3RNOA 2FR1A 3LBIA 1SKYB 1IQPA 1TO2E 4M86A 2JS7A 1QH1B 4OCZA 4EG6A 1M76A 1RJGA 3BIJA 1ZC4A 4QDZA 3TCXB 1MJGM 3H3XA 4KE8A 5HWSA 1I2ZA 4FGLA 4CHTA 3MXTA 2WTBA 3PFBA 1QE3A 1U0RA 5FL7A 3ZLTA 1P1KA 5T4HA 5AW5A 1A96A 1IEWA 1XU4A 2OBYA 4KGVA 3TINA 3KQUA 3I6ZA 3M6UA 5CR9A 2OK8A 2GBLC 5BSTA 5TF0A 3IUEA 4J0HA 2H7CA 2BEUA 3RRFA 1VXRA 4E46A 2LIPA 3DQZA 2GZRA 4J1TA 4GVPA 4FYPA 1N0UA 4PZUA 1W59A 3QWAA 1A9QA 4HYTA 3SYLA 1XYVA 3ZWOA 3CBGA 2Z6QA 1ZIDA 1GPNA 2WHRA 4XARA 4K9KA 5CNKA 4MVJP 1K92A 4PBRA 5JD5A 3CVWA 3NDIA 3OEHA 4H1VA 2AFIB 2ZAYA 3RS5A 3CEHA 3WMWA 1EIZA 1ZMRA 1IBLB 4NBSA 2A2ZA 2NAFA 5I9MA 1AS0A 1MAWA 3IP8A 2EFJA 1NVUQ 2MINB 3DA8A 3LQYA 4WJLA 4M21A 2HX1A 2H4FA 3L5OA 2REXB 3GEDA 4JKOA 4QLAA 3SHVA 1X9GA 2QW8A 2NVBA 3KU4A 5D6OA 3VVMA 3JSAA 3U4AA 3Q15C 5KNBD 1EB8A 2GHQA 4UFOA 3UMVA 3GT4A 3OKCA 4NZOA 2OMKA 4EB6B 2C92A 1U2DA 5EHNA 1IWOA 1LNZA 1T8WA 1OKKA 3PVCA 2ZCVA 4FZJA 3R41A 5IVDA 5CLLA 5EXTA 4QHYA 4Y0VA 2O1XA 5EWMA 2B8JA 3IDSA 4E7PA 1BDJA 3G0DA 3GVPA 3AVTA 3THOA 4FU0A 5KDOA 1RKQA 5E3HA 4RTPA 4GYKA 3GLQA 4DLYA 1IG0A 5I9LA 3DKVA 3VKGA 1U9YA 4QBGB 4HB2A 5LDHA 5IANA 3PB3A 3CUKA 4E5PA 3PNLA 1MX9A 2DCUA 2FWPA 1EFVA 1XTVA 2WILA 2FXIA 3LC1O 5LXTB 4M54A 4R41A 4BHTA 3TD9A 4V0NA 5UKDA 4RMNA 3IT0A 3PENA 5EUQB 3S1LA 4AZ3B 2JFWA 2JJYA 2P5SA 2BRUA 3VHXB 3VJRA 2AF4C 4J91A 3B60A 2PUGA 4C14A 3ZIAA 2Q2NA 1P7ZA 2XADA 3EFOA 4BB0A 3KAPA 4QODA 4C1BA 3ZUPA 4CFYA 5ADHA 4LW8A 2AZTA 4X6XA 3O9ZA 2PKRA 1Z2PX 3HDQA 2C5SA 3I04A 1Z2AA 2BCGY 2IYRA 3ACBA 1UQRA 1WMSA 2XYQA 4ZQBA 3DW1X 3I3SR 2PJDA 3RKRA 3G59A 5FWYB 1ODKA 2OV1A 1PR4A 4OTZA 4TMVA 5K3FB 3OPMA 1ULZA 3B1YA 3EFBA 3QFTA 1IQRA 1T25A 2ENWA 3W2TA 2O6LA 3GDGA 1NDQA 1KI1A 2FCAA 2LKDA 2FFQA 2WE7A 1FU7A 4FOSA 1TA4A 4MMZB 3OCVA 3OQOA 4GWLA 2Z5FA 1NMQA 2V55B 1K98A 3DZIA 2QVBA 3EZNA 3G8DA 5BN5B 2Z6AA 5B2ZA 1NXVA 4MW4A 1U0BB 2XLCA 1E3QA 1SH7A 2OCGA 2V6BA 1E89A 1QYRA 3IKJA 5D6NA 1NVKA 4ND1A 3BIXA 3JYPA 4EFKA 1IRIA 4IZ6A 2F8MA 3OA2A 3G5TA 1CZKA 4M0LA 2GZ2A 3U4DA 3UMCA 2QE7A 4HX5A 3ZZTA 1W5FA 5JU6A 3Q9LA 4FT2A 3JD0A 3M4YA 3TLCA 2OXRA 1ZLYA 4JVLA 5FOQA 4EI7A 5KOJA 3MT9A 4QUBA 1K4KA 3IP5A 2YW2A 4CMAA 4HAOA 1C1XA 4GSLA 4MW1A 4QDOA 1X42A 4R7ZA 4L2IA 3Q0IA 4LRTB 1KYVA 3G5AA 2IZ1A 2YIJA 3ILXA 1MV5A 4FSXA 4B2LA 1HNNA 1PI3A 1XTJA 4QOIA 3ZDYB 3ZGYA 1SJ9A 2D3TA 3A04A 4M4SA 2LCIA 2CUTA 4Y6GB 1X8XA 1ZO8A 5B7PA 4LPSA 4DQ0A 3GO4A 3MTIA 3NW9A 4IIGA 5AVRA 2P9FA 3VOTA 1ADGA 3EGXA 4W63A 1KZGB 5I45A 1YKSA 2IIVA 3T9DA 1JDJA 1Z6XA 4P3YA 3LNTA 4ZOLB 1MPXA 5F7ZA 5HPYB 4NOKA 4K88A 3W06A 3GGSA 4XASA 2PUVA 3W8EA 3H9BA 4UEKA 3G2OA 3AR9A 3RARA 2RBGA 1UBRS 3C3XA 4L1KA 4CETA 2NO5A 3D3WB 4QOSA 2Z2JA 3SHOA 1GKUB 1EYZA 2GDZA 2WYOA 1WX1A 1Y33E 1DRKA 5J2TF 2H1OA 3RC8A 1LDYA 4MK4A 4ICIA 2AYYA 3OAAA 1TUEA 1MEOA 3WGKA 5TJ9A 3GLFE 1PQPA 3E9CA 3GVCA 1T36A 5D5QA 5EWJA 3STTA 3DBVO 1NMZA 4DLKA 1Z9BA 2QRJA 5GJBA 2IU3A 1M2EA 1XTKA 3D6FA 4US0R 5COAA 5E7MA 2G8NA 4H31A 2F00A 3E9NA 2DTEA 1PDVA 4UTPA 1QNFA 1YL5A 4PZYA 5LDGA 1XDBA 2NOAA 1P3Y1 4EYKA 2HLNA 5EJAA 4C3ZA 4RTNA 1TO6A 3H2YA 4DR2B 3IT2A 3MT8A 4XWYA 1KE1A 4NARA 1LS6A 1UKBA 4IHJF 2I2XB 1UJ2A 3G2KA 1N8SA 5CD1A 1UK9A 5EMJA 1E4EB 1KMNA 3AXSA 1KI6A 1DJMA 1GA1A 1TK9A 1IATA 1JSCA 2A1TS 2MSDB 2MYTA 1TI7A 1Y9EA 2R8ZA 1Y1RA 2ZT6A 2WTXA 1C0PA 4TV9B 5GMOA 4DLAA 1OT3A 4F1JA 4LC9A 1X1TA 1K2VN 3NJ4A 2CFRA 2G0TA 4HNGA 1SHKA 4TZTA 1L5GB 5JQGA 1U9IC 3BXFA 1L4BA 1NGSA 3UW3A 4AULA 1UT5A 1QHHB 1E7RA 2AFIE 3FNQA 3QZUA 3SQLA 2G6TA 2AWOA 1Z25A 3WA6A 2VYND 3SIXA 4BC0A 2E89A 9LDTA 2AQ8A 1W0CA 4DHWA 1VMEA 5K0BA 4N0PA 4TKLA 1BFDA 1C3LA 1NVVQ 1T9DA 3UQYS 4IDQA 1A4RA 3AKEA 5KNCD 1O7JA 2CLSA 3IO5A 3MJSA 2MSWA 3SVLA 4JP3A 3T3HA 4WV3A 1JAYA 4I5FA 4MH0R 4QBKA 1T5DX 4DMCA 4MRAA 5GM1A 3OZIA 2IXEA 4PHCA 2HPHA 5DSZA 2JK1A 3KXPA 1S9HA 2G4VA 3H5OA 4IV8A 2RC6A 4F9EA 4CF7A 2GYUA 3NFRA 1RHKA 1MNAA 4MJ3A 3KZCA 1J8DA 2HA3A 2ZITA 4QOHA 4E03A 3O03A 1AHHA 3DEAA 4V0KA 2R6CA 1OIXA 4L02A 1U3FA 4DV0B 4P81A 4PLCA 1L8XA 4O5AA 4QXRA 1PWXA 4DDVA 1CXZA 4KO8A 2R1ZA 1T4GA 3HYTA 2YBDA 2GCOA 5FBRB 1HT0A 2VPQA 1CFZA 3QITA 2ZJ5A 3O83A 4AT1A 3L0PA 1PIWA 2DVMA 1G4HA 1XZQA 5FR2A 5TF4A 4E0BA 5AW0A 1E3MA 3FBWA 1C0EA 2HN9A 1WZNA 2I4LA 4H2DA 1OBHA 5ALWA 5K3AA 4KKVA 1Y3FE 2X5JO 1IOWA 2DHDA 4Q9AA 1DWUA 2OZLB 5DRYA 1HX7A 1Q1ZA 2FAXA 3NZEA 2ZRCA 4G01B 1UXHA 3BMOA 3KRTA 3U1VA 2OHFA 3UBTA 4JI2B 4H1WA 4ZDKA 2F3QA 4XQ9A 521PA 3LBHA 1J1ZA 4B6RA 2ID8A 2AV6A 2CWDA 3R23A 1RKXA 1FJXA 2ZJ2A 4HDRB 4XRGA 2HRQA 5TY0A 4LXYA 1ZRMA 3K0SA 3AR4A 1SELA 3D6HA 1SU4A 2YQ4A 4UULA 4F84A 5LP6B 1X6VA 4ARZA 1EG2A 3A1SA 1TK2A 1JLLB 2I2WA 2C7OA 5D1HA 2DULA 4W8HA 1YRQA 3IURA 1LK7A 1LRKA 1UDRA 1VHWA 3COWA 4RVOA 5AI6A 3BGIA 3VTZA 1Z88A 3ANYB 2HBYA 1CS0A 1DBSA 2GCNA 3IMCA 3AVVA 1R9GA 2F3RA 4BECA 2PY6A 2AX3A 4HMOA 4F3YA 3OO1A 5KEIA 3KD3A 1GSOA 1FXWF 1EVLA 2PSJA 5IJWA 2X13A 2ERCA 4PG4A 5CFLA 2Q0SA 4J1SA 1MB9A 3G8AA 3PE3A 1SVLA 4Z2YA 4CLHA 4EYQA 3JAKB 4EO9A 2XODA 5E6SA 1RPAA 4I3FA 4RCZA 2H6EA 4IYJA 3WRXC 4CDGA 4ROTA 4GMDA 3ZD6A 3TW0A 1HQKA 1D2AA 1KEVA 4RLHA 5B57C 4TVKA 1CR2A 5CA0F 1JDTA 1KEPA 2V45A 4IIYA 4IKPA 4M9RA 4YRFA 5ECWA 1WF6A 2RAVA 3NM4A 1XD8A 4U2EA 1USIA 2P65A 2WINI 2PSFA 4DLUA 4NOJA 3RABA 1COWD 3OLCX 3JARA 4X66B 1JLSA 1YIAA 1IUKA 3DVLA 3K7EA 4RGYA 5LP6F 3D7LA 3JD1A 3JW8A 1ZM7A 5I7VA 2VNAA 4I1OA 4Q00A 2G17A 1YNOA 1A8IA 2H07A 4C03A 8OHMA 1OXSC 1OIVA 3I32A 3GLFA 1KI2A 3AP1A 3OT1B 1DJOA 5AXDA 3ZK8A 2PCJA 1JKXA 3EF1A 4NI5A 4BLVA 1EFKA 4F1KA 3UV6A 4NL4H 3JSXA 2XA2A 4RK6A 5K8CA 1V26A 1Y4AE 3AI1A 3FMPB 5BOSA 4TYWA 3INYA 1N25A 2VDVE 3FNEA 4RVUA 1X38A 4EVRA 2INGX 3Q9NA 1GR0A 3DMTC 3TTXA 2YY7A 4ZHQF 3CB2A 3M7IA 5HKAA 1KOFA 4MUJA 2F1HA 4M8SA 1Z4LA 3IEXA 4PZCA 4DV4B 3GUUA 2JLYA 2D1SA 2A1IA 2VJDA 4IGIA 2N1BA 3EVNA 4JYAB 4C3VA 4F93B 1V3UA 4UTNA 4E5NA 3F5FA 5CEFA 5HR5A 1QHHA 2CB0A 1CSEE 1EQUA 3VC2A 2FFRA 1PYOA 3O7MA 2QVYX 4HEQA 2NUTA 2B8NA 1J9GA 1H1TA 1J22A 4GKVA 5TPWA 5TEWA 2WMDA 1P4SA 4MKGA 2QM3A 3BJRA 4UDXX 1FUYB 1YWGO 4LVOA 4UM8B 2H0QA 3GLTA 4C22A 5FR1A 4AI6A 1C14A 2QJRA 5IUJC 2CBXA 4TSRA 3A3OA 3EVAA 5E0KB 3VZRA 1KF0A 4Z8YA 3N53A 2XB4A 4BKUA 2CNNA 3S55A 4ZPXA 1MH1A 4M1YA 5JRDS 4BBJA 1SHZA 4JP1A 5BPHA 3OIVA 1BGXT 4RIIA 5LP6A 2BGNA 1Y8CA 3IPLA 1FYDA 2ODQA 3OY7A 4Q82A 1A9YA 4YJKA 1WXDA 2ZI3A 3ADKA 1ENYA 4WA7A 3HHEA 4A0QA 4G1BA 4ARSA 4FWTA 1RYEA 4G5SA 4MRRA 4REQA 4GKJB 4KG7A 4RQBA 5HJ5A 5IASA 2FSFA 5JSYA 4COOA 4W8GA 4D9BA 3BZUA 3OQIA 3T9FA 1U02A 5HK8A 3QWHA 1V96A 1KK0A 2LNDA 3ED5A 4BWGA 2R1TB 1PVVA 4YRDA 4BMZA 4LY9A 1EX1A 3ZV3A 2V03A 1F8FA 1E3EA 3KPYA 3T5MA 1VCHA 5BV2P 1QANA 4GRAA 1QQ7A 3U26A 2WJAA 3DXZA 3FPLA 3OHSX 5EEGA 5HOEA 1RTKA 2Y9MB 5JANA 3L0IB 3CVYA 4PHHA 4R8SA 2FPOA 5AKEA 3IAAA 2WT8A 4G5XA 4WCFC 3S1AA 3RHFA 3X1YA 5B53A 2K87A 5KI6A 1SXJC 4MO9A 1WXHA 5JBIA 5PNTA 1RRVA 3B8HA 3MJDA 3RK4A 3RTBA 3ISJA 4LBVA 5AHRA 4A6XA 1OAKA 1R0KA 2ZB3A 2GO7A 3PYXA 2WTUA 3Q87B 3UKOA 4DXAA 1SVSA 3C3AA 5HUHA 1U0OC 4KR3A 1OTXA 3IEVA 3HYSA 1M73E 3CV3A 3FZGA 2IZZA 1ZMBA 2AIRA 1Z62A 3BXHA 4C0BA 4E88A 2YYYA 4JVMA 4FXOA 4UM9D 4WEOA 1X77A 3VNQA 1HLFA 3ROPA 1M0TA 4IDAA 2PFGA 3BWBA 4XIYA 2HOQA 1OAAA 5DT9A 1H9BA 2BMVA 2Q3JA 4AJOA 3HFSA 2H48A 4NYJQ 2EBFX 2YIDA 2NVWA 1JE1A 3LLCA 2MJLA 4N3CA 1Y1KE 2AFRA 1G8GA 3FSRA 1Z7EA 4O4JA 3RJTA 3TQCA 1GYRA 4L16A 4D4MA 1Z0AA 2HB6A 2PVSA 4AP5A 1DE0A 3V48A 1HTBA 4UXHA 1M6NA 3INTA 4MUGA 4MWEA 1T36B 2IW3A 2QVGA 2YOFA 2PZKA 3NRCA 4NATA 4RTKA 2MR5A 2BELA 1HDEA 1QTRA 1MABB 1UDBA 2SKDA 2XGGA 3BL6A 3HA2A 3N0WA 2ZUVA 2Q4BA 4HK4A 3H86A 4N12A 4OX9Y 3NT5A 4DKXA 3RIYA 4CCYB 5DHSA 3WJ2A 1AQIA 3L6RA 3B20A 2BSAA 4R31A 2BFEA 3ZBQA 1VPLA 2DWPA 4JLBA 4F85A 4BNGA 2PGXA 1XPRA 1OLOA 3MWYW 3VNBA 1DAIA 4AJNA 1H3NA 2HNKA 4YJ2A 2IPXA 2ADMA 1B8OA 2QG9A 2Z8ZA 3C7KA 5H16A 1PX2A 4AZ0A 1T4MA 5FLXA 3C48A 4LHVA 4DCOA 1LFAA 2KBEA 4KPEC 3NM5A 4O59O 4BO6A 2IZOA 1YDHA 1ZA1A 1RWXA 2AI1A 3GXBA 3K09A 1V8BA 2EOAA 5FXMA 2C97A 4PLVA 5JVDB 2AFHE 4XCQA 2RCNA 2GNPA 3K32A 2FKAA 5TRTA 4CLXA 2NQTA 3JWHA 1O5OA 4RS3A 3L1KA 3PV0A 3TQOA 5ES4B 3M5PA 5I9TA 3RGWS 3THWB 4ZU1X 2QNIA 3DJFA 3N8NA 1YCHA 2OVFA 3V33A 3DJYA 1N33B 3K09C 2IS4A 2B2CA 2IH2A 1ZX1A 3HSYA 2AQKA 1LBHA 4GX0A 4IBOA 3BXEA 3D8NA 3KAQA 3MUFA 4LDPA 4BJ3A 2KB0A 4JAVC 5EWJB 2AA3A 1VYTA 2R6ZA 4LRQA 5HCNA 5C8VA 5J43A 2ZI9A 1J0EA 1JR3A 3O75A 3AYZB 3GZNB 3K5WA 3BMQA 5AKZA 1V8ZA 3AI7A 1P18A 1Y7HA 2B8WA 4FFWA 5DBGA 4JYCA 1CHDA 3CN7A 3TPCA 3KUCA 1JQLB 5DHFA 1P4GA 4X60A 4B79A 3D5EA 4P54A 3S2SA 3KJFA 4BRSA 1IY8A 4A36A 4YPVA 3PQ5A 4FGZA 2YZMA 1V11B 1YUNA 2WWWA 1HDGO 2XMPA 4PHTA 2ADOA 2NXJA 2R8BA 2XEDA 5EVJA 5JAQA 1AQJA 4HS9A 4GGPA 2ATCA 1C3VA 1W2WB 3R24A 1YKFA 2HA2A 2MOKA 2GHTA 2GK4A 4EPYA 3T3IA 4YMWA 4ZI7B 1N6LA 1IG3A 1ZD1A 3GI1A 3SU8A 1Z38A 2QNRA 2ZSDA 3QFRA 5F2NA 1R6AA 2P5TB 4D6PA 3K70B 3A6HA 1DKUA 3KIPA 4RVDA 3BN3A 3RBZA 3T99A 3A36A 4ALLA 1VL1A 2BC9A 4PFJA 1HZJA 3R6WA 4Y9TA 4BV2A 1S2NA 2JEYA 4CUKA 1TZ2A 3ZHBA 4H6XA 2EVWX 3M5DA 5I7RA 1ECFA 5CIQA 3FYDA 5ALUA 4EGCB 4KJZA 3FYSA 2HUNA 1DFHA 1VJGA 3FUUA 4Q01A 5LXTA 5K8LA 5TVKA 3BDAA 4XPZA 4QJ4A 2CDAA 1MJGA 5EXEA 1J20A 1FNDA 2CNWA 5HDQA 3D0RA 3PD0A 1NVAA 3D0QA 3A7DA 2VDWB 2VXOA 4K9RA 3FF1A 3TGLA 2II6A 5B1HA 2IYFA 5CDFE 4RNCA 4EKIA 4K6CA 2CFIA 2F17A 5J58A 3QOXA 3I42A 5IJXA 1G17A 1M6EX 2ARKA 2VYNA 3OLQA 2YFHA 3DOJA 2ZIAA 4FBMA 3T3PB 4IW3B 5K3DA 1X7WB 3E70C 3ETJA 4E51A 2VPPA 2W7TA 3Q8KA 2ZTVA 2C29D 1Y0BA 4R9VA 2WQ7A 2H92A 4FMDF 4U7JA 2X2PA 3SXJA 1OGJA 3P71T 3BF8A 3TTSA 4GL2A 1I94B 4QGFA 4EFLA 5JDCC 1P29A 3K3PA 4AJJA 3VOBA 5GJVC 3S5JA 2QA5A 1EK5A 1JH8A 3WYCA 4EHHA 3IPCA 1TPZA 2AEFA 4KTTE 2C4TA 4IVNA 4E11A 2YV2A 3PJDA 4GMXA 4KRGA 4K9LA 4UDNA 5A5EA 4L8VA 4A16A 3LKDA 1WS6A 2G09A 2PS9A 3AVUA 3E1GA 4WGFA 2TMKA 2XDQB 3AHGA 3X1JA 4JYPA 1VC2A 1AIPA 3QHQA 4PY2A 2WSIA 3ZE8A 3C3CA 3HDTA 1FS6A 1RQ7A 3CFYA 3H8VA 4EHLA 1E9VA 1F8GA 3AXTA 1G2OA 3TSAA 3W3AA 3LUDA 1ILEA 2RGRA 1FLVA 3L7JA 2M9MA 5A05A 3TL3A 1B8NA 3OZSA 3A6ZA 1VFNA 1Y48E 1H2EA 3HVHA 2LKCA 4IOLA 1JI3A 2BV3A 5ENVA 3LOPA 5J4HA 3NHJA 1XAIA 2JIPA 1LSOA 2UV8A 2IUEA 5ALPA 3WI7A 2BIFA 3GA5A 1L7QA 1GUZA 2Z2XA 1E63A 1E5LA 2IEZA 1DDOA 3NB0A 4BB6A 4Q3OA 5KHLB 2YNMC 5K6TA 1QDUA 4LHSA 2IKSA 2W6MA 4EW1A 4G56A 5EHXA 1MC8A 3PTZA 1QXSA 3L8CA 1IPHA 1NQOA 3QVTA 3ZN2A 2RFLA 3R9IA 1PWEA 1JQ5A 1Q57A 1QJ4A 1U80A 2QM0A 5THXA 3RODA 1XKLA 1BXZA 3G6KA 3PQ7A 3GA7A 3KDPA 5SYMA 5EIXA 1YE8A 1ADFA 2NO9A 2VSQA 4OQNA 5KJ1A 5JSHA 7ABPA 1USWA 3LDUA 1MQAA 2NUBA 1I4EB 1TYDE 2V8OA 4RJKA 4I50B 4NJMA 5EE5B 5IBRA 5CVEA 3DDCA 4XD7A 2HA5A 2BUAA 4KFUA 1ULHA 4OB6A 3RGGA 1U11A 4HH4A 3WBBA 3HVRA 4Z3OA 2CXXA 5AQ1A 1ILWA 1AC5A 2RGXA 1JHOA 2A84A 1YFKA 1R6DA 2XD4A 3E9EA 5SZHB 4ALNA 4RO0A 5KU7A 4PYLA 1AB5A 1R4ZA 3L8ZA 3OICA 4FILA 2JGJA 3FLAA 3R5XA 3TLGB 5I8PA 1CUFA 1H0HA 1QHIA 3UHOA 1DXYA 1RRGA 4LDNA 1V71A 2A5YB 1MO6A 2JFVA 3RDPA 2QD4A 4IG9A 4YT2A 5BNFA 2H1IA 1WUIS 4EDHA 4KVAA 3ZKWA 1ORIA 3FD8A 4GL4A 4LF8B 3T06B 1HK7A 2V6FA 4S2EA 3MWDB 2J3HA 4NR0A 1G8SA 3WLQA 4E22A 4UTRA 1GJRA 4HO1X 3JQQA 2WJPA 1XTIA 2AOXA 4IHAA 1YH3A 5SZIA 1MAVA 1N5IA 3WAJA 1M72A 1PFKA 3OZDA 4YCAA 3W5IA 4WFJA 4M1QA 1VI6A 5DOVA 2UYYA 5FWXA 5CFQA 3I9NA 5IDQA 3PUIA 3M1LA 4X6YA 1V4BA 2C2YA 3IPRA 3W5JA 2FI1A 3HZRA 4UOZA 1E8NA 5KJCA 3AF6A 1V0JA 3EUWA 4LC1A 3AI2A 3ONNA 2E1PA 2PGIA 2WVHA 3Q98A 1UMCB 1YOBA 3EVTA 1M7GA 4PTYA 4FB5A 1F0NA 1ULTA 1VIDA 2XRYA 3FYUB 1V45E 4RSRA 4CFSA 1UJ5A 2V97A 3IVXA 3LK7A 4QPNA 3EA4A 1BWRA 1GILA 3PITA 1KI3A 1U9JA 3QVMA 4ZVRA 4B4WA 4X3CA 1OXMA 3DE0X 1MP0A 3RIHA 3SK0A 5LZ7A 1EKXA 3PL1A 3NBFA 2FQQA 1WSAA 2HJHA 3T1QA 3V2UA 3TLAA 4FEGA 4CDMA 4MWOA 3GG2A 4D4HA 4EPRA 1DRWA 5JMPA 3FMFA 2C5LA 2GTIA 4HQNA 1M83A 4YUYA 4QYWA 4PZDA 2C95A 3HUFA 2OCXA 1KO4A 4LHEA 3BD9A 2XB8A 3L3BA 1SPBS 4WXRA 1IE3A 6PFKA 1L4HA 1LDNA 1OX4B 3UG7A 4JSRA 4RTLA 3C3EA 1UBGA 2HV8A 2RH8A 4F3TA 5HIMA 1LVGA 3NBXX 1CP2A 2DJ5A 5ER6A 4ZCIA 4E2WA 2C4WA 1ICEA 3HJAA 3ITEA 3O1JC 1ZQ9A 3MA0A 2VJNA 4OOEA 2FCRA 5K3EA 1H69A 2QXTA 3GFRA 3PUVA 2P3SA 4KQGA 4LYJA 4BLSA 4DS3A 5HIKA 3A4LA 2YICA 4BMSA 3BT7A 2LVBA 5H1YA 4J7UA 4E4TA 2JLAA 2W6ID 4Q1CA 1L3IA 3AUAA 3EDCA 1NV9A 1XCJA 2CB9A 3TWOA 3CVUA 1L1QA 4BQRA 4DILA 2H1SA 2ZKLA 2XVXA 3CUVA 3COZA 3QX9A 2Z8YM 4MUEA 4UBNA 5GV7A 3W9UA 3COYA 1PL8A 3M0EA 2IFTA 1C3XA 4AG3A 5KNBA 1NXOA 2IHYA 3AEKB 3HJHA 3FF4A 3PGKA 4X20B 1G1MA 1K6JA 3EZ7A 1Y3AA 1U8TA 2XTJA 5KAPA 4JC4A 1L5FA 3OE4A 5YASA 3Q88A 1DC3A 2NLOA 3IODA 2VHUA 1Q2XA 4UOQA 2CFOA 3H7AA 1GZHB 2CXOA 2QG6A 4TPKA 5WRFA 1ZJ4A 3H1EA 4LAFA 4JI5B 5LUAA 2XJ4A 1BMFD 4G26A 2PT7A 4FS3A 3H7IA 1X8JA 5K0JA 5AM4A 1ONPA 3B1KA 3V8MA 1ZXBA 3I1YA 1FPMA 2HSDA 1GCIA 3UT5A 2JD2A 1DXQA 1QB7A 4MUXA 3F5MA 4QJIA 4X7PA 4C2UA 4LISA 1UZNA 3KT8A 3EVFA 1XMSA 3F9RA 3RSGA 4BIIA 4DJJA 4WBNA 5IPFA 1NNLA 3H87A 4IKEA 4OMDA 4EI8A 2BM1A 1M34B 2ZM5A 1KZ7B 2Y77A 1NR1A 1DKPA 3KWJA 4POOA 5KC8A 3JQ7B 3QVOA 3RKSA 3BBPA 1PZGA 3B53X 1L5QA 2YHIB 1XTUA 3IJPA 4X94A 3H8JA 4D5GA 2IX3A 5E1OA 3QTTA 1NBAA 1P2BA 4ZCRA 1Q84A 4HNHA 3ZGNA 3ROMA 5JISA 2E4UA 3JS5A 3MTGA 2MSKA 4HMPA 2OFFA 3GUVA 4L5AA 2GAIA 3QENA 4PBTA 4BRUA 5CDYA 3IL2A 4WWHA 3RVJA 4UD2A 5TX7A 1LBEA 2FR0A 1GQSA 2D62A 4HR7A 4KN9S 4Y2QA 4A8JB 2C00A 3HLYA 4HN9A 5JAHA 4RZ3A 1F6BA 1XDWA 3O2JA 3SBXA 4FYYA 3WL5A 2CN1A 2GB4A 3JYQA 3STXA 3VO8A 1Q0TA 4FSHA 1MJNA 5DULA 2ZP1A 4KUEA 1KHTA 4KXLA 2DPMA 3ZG6A 1M1NA 2DTXA 2XT6A 2O14A 3OQVA 2BHNA 1UBUS 1PLKA 2XQJA 1XD9A 2EZUA 2B4AA 1WSWA 3A9SA 5EIBC 3N87A 3OP4A 5A2QA 2X19A 3KLBA 1XVUA 1E5QA 1GYPA 3FETA 3MQ4A 4RK0A 5BMVF 1N7HA 2BCEA 2L42A 2PU7A 2JAHA 1E6CA 2RJOA 2WKQA 1AS3A 4YJGA 3QY0A 2C5HA 3RFCA 4YMTA 5IZCA 2C59A 1HQYE 1NQ5A 3R75A 1JDBB 4RBNA 1KO7A 1DX9A 2O2JA 1SXQA 1GSHA 2R85A 1II8A 4C2AA 5HQJA 2OEPA 1YJXA 4U2CA 4HI0E 3EEQA 4OFWA 2G04A 1CJBA 3N7AA 1U94A 1U98A 5JS6A 3HG7A 2V98A 3I9JA 2CHEA 3L9XA 4UHKA 4DANA 1X13A 4RTOA 1E2JA 1IULA 5H83A 2R1VA 2B30A 1SEPA 3DT6A 2AC4A 2OGZA 2OC9A 3R77A 1XXHA 3O9MA 4PFKA 4Z8XA 3TKLA 1PWHA 3BMNA 3NVAA 4MRMB 4R01A 5ADVA 2UYCA 4JYBA 4UHDA 2CFCA 3O4JA 4KQHA 1B00A 4QVKA 5K51A 1RC0A 3QNWA 5T7BA 2WD9A 2I5PO 3QBVA 4W7SA 1J7JA 1G9SA 3OQBA 1RJFA 4ZVTA 5AVQA 3ZS9A 2D0OB 2J7KA 2XQFA 3ZK9A 1TO1E 2GXAA 5I7FA 2Q3BA 3UK2A 2YRFA 1E98A 2J6HA 2QQ0A 3AERA 5HP4A 5KKNB 2RAPA 4N5LA 2GARA 1GU7A 4EATA 2PSHA 1A3CA 2IDZA 4Q3DA 3NDPA 3NOOA 4E5MA 1O9HA 4KWHA 3SIPA 3JPYA 1BEEA 3WDKA 5CYOA 3AUJB 3WP0A 3WO0A 3X1XA 3DCNA 3ZS8A 2GS9A 3EZFA 5K0ZA 3PYLA 3KQMA 4IVQA 1XEAA 4KSYA 1Q7BA 2Q5JA 4D9GA 3DDNA 2KI5A 2XWBF 3FFWA 5E6RB 4DG8A 3E3OA 2AG1A 2B37A 3P8ZA 1DO2A 1EQ2A 2Z04A 1DIHA 4YXWA 4E5KA 1S2MA 2G71A 4QBHA 1I4TD 3EY4A 5DPMA 4N48A 3R6LA 4CNQA 2PUEA 4X1OA 4UOEA 3P9PA 3RR2A 1BMDA 3R0JA 4H0FA 1WIWA 1OZ0A 1CUGA 4LA4A 4Y9RA 4YXFA 1C7JA 1T0JB 2Q3HA 1ECGA 1T29A 3C43A 5AD1A 1M8FA 1S2LA 3MELA 3W8NA 3AC0A 3K5HA 3PKZA 4YJ2F 1AKNA 2GVDC 3MJHA 4MI9A 4EJ0A 4PYJA 3EPJA 3HGTA 4CMCA 5F9HA 3A4YA 1SVOA 2NZXA 3NLLA 4F45A 3PUYA 3LRXA 2FMTA 2VPWA 1R6UA 2MIIA 1QV6A 3NEYA 3Q2IA 2O8EB 1NX9A 1Z45A 2QXYA 1BJRE 4KWEA 3QIAA 4MR7A 5H3LA 3KE8A 3CZ5A 3GROA 5EFZA 5HRUA 3CRNA 3OQPA 3PWZA 1XLTA 2CLHB 5FKJA 5ADUS 4CIYA 2JA2A 4N7RA 4ZEXA 4FJ0A 1P7VA 1LQUA 4RM3A 1ABFA 4UBJA 3U3JA 1NP3A 2HXGA 2MR6A 3GEMA 4N9QA 1UP6A 3I6IA 3BTOA 3GEBA 1GYQA 2QQFA 5LQRA 3K71B 4TTJA 1QIKA 4HDAA 4ZZIA 1JTFA 2GZAA 2CSUA 3RUFA 4DG9A 2ZR0A 3QGMA 3BRWD 1N2XA 3D1JA 4BO0A 2DPGA 2H2HA 4DA4A 1F0KA 4P9NA 1F5SA 2ZBPA 3BFVA 4DLRA 1JHPA 3M82A 1QYDA 4K9DA 1DTEA 2MYUA 4JLVA 2O0MA 4I9HA 1RFGE 3ZW9A 2CV1A 2ZUEA 2GXUA 3E7PA 3U3XA 4ZN6A 3L07A 2ETXA 3IAM1 5C1IA 3HB0A 4QU5A 2WAYA 2CJWA 5JBNA 3PNPA 1Q14A 2VT7A 5REQA 3VXKA 4YQEA 1YQ9A 3ZEAA 4F91B 1MEEA 4NU5A 1FFXB 3IGFA 3W5AA 3DEIA 4LY0A 3WXMA 4EKGA 3EXHA 3WLLA 4EUEA 4RX1A 1PVDA 1ZCBA 5B7GA 5JALA 2AN3A 1DKQA 3K6RA 5L95A 2IY9A 1TA9A 1Q3KA 3NV7A 4JC8A 4M1WA 4RK1A 1O4WA 1CQXA 4Q16A 3RFUA 3VMFA 2EKZA 3SHFA 3WLIA 2Z1MA 2QOEA 4N3NA 1K6XA 1E79A 5BV1A 2YWBA 1JHMA 1SBQA 2H2FA 2JHPA 2OGTA 1YV9A 1ZICA 2Q2OA 4LNUA 2D5AA 4MLCA 2FK8A 2QU7A 5TB5A 3S6JA 4EYOA 1HYGA 4RK7A 4W1SA 4E31A 2OO7A 1K8YB 2HO5A 4DIKA 3TZHA 1H4VB 1TJYA 2EW8A 2RGDA 2JKZA 4UKDA 4UC0A 4C6TA 1IVSA 1JFTA 3P9NA 5HTKA 1MRNA 3G2MA 1LLQA 1SXJE 4F2PA 2PQ2A 3HNPA 3K0KA 3K0AB 4JOBA 2AZDA 3C3DA 2V5AA 3DDOA 3LSTA 1TF5A 2PANA 3KBOA 1QP0A 3EMBA 1O6FA 1VE7A 2OCKA 1XP5A 2PBFA 2UVQA 1PEKE 5EC8A 2A4MA 2AEMA 1VG9B 4NJEA 4U2DA 3RRMA 1TQDA 4D3FA 3S29A 3PGXA 5CA0B 3I5XA 1KU6A 5DLDA 1OBCA 1CUIA 4BFWA 1TQHA 1X1DA 2PDAA 1JR3D 4G8JA 4MPDA 1X1QA 3W6OA 3B78A 5B37A 3NHSA 1DBWA 4CF3A 2RMKA 5CH8A 3GX1A 1IBSA 1P9LA 4MULA 3WWYA 4D4KA 4ES6A 4FUQA 3H5VA 4G0OA 3JQFC 4A6PA 4F4DA 4KTVE 4RHEA 5A4DA 3W5CA 3OCZA 4MEBA 5B7NA 5LIRA 4H6WA 1X14A 3O38A 1OYOA 3RVLA 4ASUA 4DWOA 2UAGA 2XUOA 3W78A 4DZTA 3BZBA 3N6RA 5LIPA 1S3IA 2HF7A 4G6ZA 1UDWA 2FOIA 2W4QA 2WYWA 4Q15A 1UFQA 4OAOA 3WQSB 4AMVA 5B2FA 4RZSA 4BWVA 5JS7A 5KJEA 4ZRDA 4XGRA 1L5HB 3CNOA 4HWOA 4XQCA 2C31A 2GN0A 2EFEB 1UBKS 1XX6A 4KQIA 4TS9A 4AN0A 1B76A 1K3TA 1W76A 4QFMA 5KNCH 1SFRA 1HZZC 1LPNA 1LLDA 2YYSA 2XUDA 1YJCA 4P31A 4WSOA 5C32A 1NUUA 2MSCB 1BRMA 4B3CA 4RVSA 5IXSA 4RK4A 1BN7A 1OQAA 3FR7A 1IBRA 1VE6A 3QKTA 4AKTA 2NVUA 4DLBA 2P4UA 5C7LO 2D4AA 3RIEA 1KDVA 4RVFA 2FEPA 1OWMA 1L1EA 3QG5A 3WQHA 4DCUA 3U4MA 1RRFA 4AECA 2FG5A 4MB2A 5EHIA 4DJEC 4K03A 4RW0A 5JYEA 3OIGA 2QWXA 3PJRA 4JLWA 5CLQA 1DMRA 4WOPA 1HY3A 4CEHA 1RYNA 3GUHA 5C1BA 3J81A 4YR9A 1CB7A 5EJ2A 3U7GA 4P33A 3PS9A 3OJLA 2UVPA 2NUTB 5FBVB 3AUSA 2BE7A 4OBWA 1W0KD 2BHRA 2DHRA 3CRMA 3RSHA 1FP2A 3SEZA 5ELLA 4DIUA 5DGHA 1KSJA 3PNVA 9ABPA 3TSYA 2FHPA 5A3QA 2V7VA 2QVZX 4PZAA 3W5HA 1KMQA 4M8LA 5JEDA 3QYPA 3PEEA 1P8JA 4I4CA 4N5HX 3SXUB 4MARA 4YY3B 2DERA 2X7HA 4ZO8A 1X1CA 1T1JA 5DSTA 1JPUA 2KYRA 2O19A 3KE9A 5DM0A 3LW7A 3U4GA 1Z7BA 4X44A 4DQLA 1QOPB 5EKDA 1CE8B 2OECA 4YCNA 1I6LA 1T6NA 1ITZA 3FHLA 1G2PA 1R0WA 4YPFA 3MMXA 3LTEA 5J2TA 1QRUA 1BS9A 3I83A 3JQ7A 1CY7A 1TEXA 3EIOA 3EBLA 3NT2A 4FONA 4G4SO 4ZVPA 4MRNA 4BNTA 2XGJA 1FYVA 1HQCA 3DEFA 3GLRA 1HYEA 2HF8A 2OLEA 1BXKA 2R60A 3CLVA