3PP8A

2.1 angstrom crystal structure of putative oxidoreductase (ycdw) from salmonella typhimurium
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
312
structure length
310
Chain Sequence
SNAMEIIFYHPTFNAAWWVNALEKALPHARVREWKVGDNNPADYALVWQPPVEMLAGRRLKAVFVLGAGVDAILSKLNAHPEMLDASIPLFRLTGMGLQMQEYAVSQVLHWFRRFDDYQALKNQALWKPLPEYTREEFSVGIMGAGVLGAKVAESLQAWGFPLRCWSRSRKSWPGVESYVGREELRAFLNQTRVLINLLPNTAQTVGIINSELLDQLPDGAYVLNLARGVHVQEADLLAALDSGKLKGAMLDVFSQEPLPQESPLWRHPRVAMTPHIAAVTRPAEAIDYISRTITQLEKGEPVTGQVDRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glyoxylate/hydroxypyruvate reductase A
publication title 2.1 Angstrom Crystal Structure of Putative Oxidoreductase (ycdW) from Salmonella typhimurium.
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 99
structure length 310
sequence length 312
ec nomenclature ec 1.1.1.79: Glyoxylate reductase (NADP(+)).
pdb deposition date 2010-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3pp8A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3pp8A01
3ZHYA 4ZRMA 1BTOA 1ZMTA 1PL6A 2Z95A 3HADA 4M87A 4BQRA 1N7GA 1XEAA 5F3RA 2DQ4A 1UR5A 2PFGA 4NK4A 3U0BA 4AJNA 2Y66A 2A94A 1UZNA 4YJHB 4W7HA 1ZFNA 3L6EA 1K6JA 1K0UA 2PZJA 1GL3A 3B1FA 3BHMA 3CH6A 4GWKA 1GZ3A 2CFCA 4J7XA 4K28A 1E3LA 2FPIA 1Y81A 4ZQFA 5TS3A 3BMOB 4NMHA 1I01A 1EK5A 1UUFA 3GC6A 3HZZA 4BB5A 2E82A 2W2KA 1A7KA 4B4VA 3E5RA 4NU6A 3RWBA 1T26A 3GGPA 2AG5A 1P1IA 1MP0A 1Q7BA 2YDYA 4IDGA 2VHVA 4NBUA 4GPD1 3GNSA 3LC1O 4GMFA 5HRUA 4JNKA 3SC4A 1ORRA 4S1VA 3WMXA 3F1KA 2PD6A 4R3WA 3ULKA 1JAYA 3K31A 4WLOA 3K2EA 3ZGYA 1VRWA 3LT2A 2YHIA 1A7AA 1SCUA 3CPSA 3O8QA 2VRCA 3UGKA 4RJTA 1DC6A 4CLHA 5CPBA 2B4QA 3Q2IA 4PLHA 1UAGA 1RM0A 4W9NA 4PVDA 2FN7A 3HFSA 2F00A 3ZHXA 4BKRA 2EKPA 1TVEA 4CM3A 3GNQA 5JAZA 3PHHA 2C54A 4YJGA 3U49A 2G17A 4FFOA 4I5GA 1T4BA 3AI3A 3GVCA 3JV7A 4Z9FA 4ONEA 4UEOA 4J0FA 4GGOA 4RF3A 3E8XA 1RKXA 4BO6A 3JTMA 3TZHA 1HLDA 1ZSYA 1NWCA 1VM6A 2CVOA 4UREA 4RGBA 2NU9A 4PLPA 2VTDA 3AOEA 2EP5A 4RV9A 2HRZA 1GUFA 1GU7A 2VT2A 1WVGA 3P7MA 5FWNA 1U4SA 3SEFA 4XQ9A 1NR1A 5B4UA 3RCBA 3KYCA 4JX8A 3QRWA 4YJFA 3FR8A 1B8VA 2I99A 4MVJE 2CDCA 4N5NA 3L07A 1YB4A 4NG5A 5K0ZA 2GUGA 3F1LA 4BNHA 4ZQBA 3CKYA 1I8TA 1UZLA 3KZVA 3B1KA 4GAEA 4KTTE 5DN9A 3V1TC 1EUDA 3QLJA 1ISGA 1ZKMA 2PWZA 3Q11A 2D4AA 3WGQA 3F5SA 5EN4A 3COSA 3WQQA 4M86A 4A26A 3KSDO 4RF4A 4NHEA 1FDUA 3VDRA 1DRUA 4LVCA 4WUVA 5LDGA 1E7SA 2V6MA 3DAFA 3INGA 4XYEA 5TT1A 3X2FA 4YAIA 2GPTA 4FFNA 3GHHA 4P4GA 4QECA 3LU1A 5JCJD 3OQ1A 4FPXA 3V2GA 6ADHA 2QRKA 4IJWA 5G0SA 3LC2O 3DBVO 5DOZA 3GUCA 3TZCA 1P1KA 2UAGA 1D7OA 5I9MA 1RYDA 1W73A 1OZAA 4DC1A 2Y05A 1KVSA 1LRLA 2AEMA 2HRBA 1W6UA 3DO5A 4PZEA 2QYSA 4AJIA 1VL0A 3RUFA 1PTJA 4CM9D 2P68A 1GQ2A 3ZV6A 4RPJA 5B37A 1E3JA 3GH3A 1HYGA 4ALLA 4XR4A 3PHJA 1ML3A 3R1IA 4LW8A 4E0BA 4QXMA 5J23A 2G0TA 3UVEA 4HFJA 2SCUA 4DQUA 4IDBA 3UH1A 5C3MA 1JKIA 1YQDA 2O4UX 3OEWA 3DZFA 3ANLA 3AUTA 3MTJA 3N7UA 5AXAA 3WQRA 4DIOA 4OSOA 5IAAA 3VC7A 4AFNA 1R66A 2FR1A 3IL2A 4DBZA 1U3TA 4C7KA 1TA4A 2BHLA 2IE0A 3GFGA 3GMDA 1NPTO 2CF6A 4RORA 4XDYA 5F1KA 2GN4A 2O23A 5A3VA 3OIFA 4XA8A 1N2SA 1LSUA 3RC9A 3ROKA 3M2PA 2HJRA 3WJ7A 4JP3A 4U0KA 3ZV5A 3RVDA 4J9UE 5BR7A 2ZATA 5DZSA 4WECA 3OJEA 5L3ZA 3ZWWA 1IY8A 4FIZA 4A5OA 2C5EA 3GVHA 3R6DA 1XYGA 2YHUA 1MC4A 4NPCA 3DR3A 4R5MA 1PGJA 3ZWXA 1YL7A 2Q1WA 4PG8A 3PK0A 1BXZA 3TL3A 4Q3BA 3ZNPA 4OO3A 3UHAA 5EMHA 2VQ3A 4J43A 1SB8A 2Q45A 4JCOA 4CM1A 1JLLA 4GKBA 3DL2A 1EQ2A 2I65A 2QRJA 3HJAA 3VDQA 5JAMA 3DOOA 1P1RA 3L4SO 3WDSA 1DFHA 4GX1A 4LMPA 2V7PA 4WPGA 3RUHA 2DUUA 1ISMA 1RM4A 2YQ4A 4DIFA 1EDZA 1OOEA 5DP1A 3NTQA 5FFFA 5TSDA 2B4TO 1H9BA 3H3JA 3O03A 1JKJA 4IIUA 4YJHA 2VCYA 4RQTA 4F6LA 5CDTA 1C3VA 1ZVMA 3U5TA 2D2IA 4RQUA 4EJMA 3OJ0A 3BMOA 3STHA 1P0FA 3FR7A 2B5WA 3BMCB 1ULUA 1HDRA 2HCTA 3PQEA 3FNEA 1LI4A 3E9QA 1NPYA 2PZKA 4IQGA 5LCXA 4DLAA 1U3UA 3GEDA 1VLLA 3QSGA 4Q3DA 1C0KA 3EW7A 4J4BA 5CEJA 3MTGA 2HLPA 3TQHA 3BYZA 3BA1A 2B37A 2FZEA 4XYMA 2C2YA 5JS6A 4XGNA 1QORA 4UEKA 2BFPA 4D46A 1GDHA 3ICCA 4MVJH 2I9PA 4FJ0A 2D5CA 1GUZA 4JBIA 5KTKA 1H6AA 1YOVB 3F9IA 1ADCA 4PG4A 1T24A 3AM4A 3VKUA 2QQ5A 4I1IA 1EUCA 5H81A 1LDBA 1IYZA 2NV6A 3A4VA 1DAPA 3ETGA 1XDWA 1MA0A 4HFNA 3VPXA 3W4KA 3PWKA 3GG2A 3D5TA 2EF1A 4YAGA 2NVBA 3O26A 3ASUA 2VHXA 4IDDA 1P74A 2WSBA 3ABIA 4R1SA 2P5UA 3I9LA 4FGSA 2GRAA 3ZNNA 2PKRA 2ZB8A 2FZWA 2NADA 2O3SA 4GVXA 1HXHA 4DQVA 3DZHA 3U4IA 1TT7A 3C1AA 4DTIA 1U2GA 3WSWA 2H9IA 4O59O 1R12A 1IHYA 2BELA 1PZFA 3SJUA 1NFFA 1PZEA 2C2XA 2QX7A 1E1KA 2AEFA 2AE2A 3JD3A 3NDJA 1NYTA 4PZCA 3WLEA 1NAIA 4NQZA 4NZ9A 2P4HX 2NVUB 2W2LA 1TXGA 3HDHA 3L77A 3RFXA 1GQQA 1NVTA 2EW2A 3SBOA 1N8KA 3IKTA 3PEFA 4E2XA 4EJ6A 2VHYA 3IP3A 1VJTA 3JQBC 2X0IA 1V3VA 1Z45A 1CETA 2EG9A 3P5SA 1EBUA 1UXGA 4PRKA 3GR6A 4L4XA 4MVJM 4K26A 4OQYA 4NI5A 4KTVE 2OGUA 2AQIA 3PQDA 1HDOA 3GVXA 1YRLA 3CUKA 4A0SA 1Y8RB 3IJRA 3LF2A 5KVVA 5TJHA 4OGWA 4CMBA 1QR6A 2UVDA 4RLSA 1M6WA 5MGBA 1B8PA 1XU9A 3FN4A 4BO7A 3ZWVA 3Q0EA 2ZQYA 4F46A 1DHTA 2QYTA 4E5KA 3R0IA 2ZJ0A 4EGFA 4E5YA 3CXRA 3WJAA 2BGLA 5KCZA 1Y7TA 1A72A 3I9NA 3JSAA 3WGTA 4CLOB 4Q3CA 1PX0A 1ZNQO 4BGVA 4WOJA 1DB3A 1B16A 4OHUA 2VZ9A 2JKVA 1ZK1A 1X0VA 1PGPA 1LDNA 2JFHA 3AOGA 2J3KA 5EINA 1V3UA 1P1FA 2YZ7A 4YQYA 3FTNA 2E48A 1MV8A 2JFGA 2B4RO 3HHPA 1YBAA 2NU7A 1PJ4A 3RUDA 4R54A 4UULA 4W82A 5ICSA 4AJKA 3HB5X 4J1QA 4IXWA 1ZK2A 2OOSA 3GAFA 2P2SA 3PHLA 3RI3A 3VZPA 4PLCA 2ZYGA 2Q4EA 4HNHA 3Q9UA 4FC7A 3ZWNA 3TDKA 1WLYA 2I6TA 3I1JA 4CMAA 2DVMA 1NBOA 4LCEA 1MG0A 2D3TA 2D1YA 5FI3A 3RUIA 7MDHA 4E3ZA 3D4NA 3FCOA 3DTYA 1YKFA 5IZCA 1IL0A 3DHNA 4ALMA 4BNMA 1EVYA 1T4DA 3D3WB 1VSUA 3R3SA 3UUWA 3RKUA 4HUJA 2O3UA 1E1LA 1HE4A 1U7HA 4Z3DA 1WDLA 3PWZA 4HADA 3U4CA 4OOFA 3EVTA 4XD2A 4BO3A 1WPQA 3DWFA 2YJZA 3GVIA 2Y1DA 1LTHR 3OQ6A 1KVQA 2EGGA 3RC2A 1H6BA 1F14A 1U8XX 3KXDA 4OAQA 3RIHA 4Y8VA 4GQAA 4E5MA 5I8ZA 4ALNA 3KOUA 1DOHA 3B6ZA 3EMKA 4J4HA 4QO8A 3NX4A 4A2CA 4ZICA 3DAGA 3DMTA 1MLDA 4H3VA 4ESOA 1U5CA 4IJUA 4ZQEA 5FF9A 3F4BA 3AY3A 2VWHA 3BMCA 2VRCD 5MDHA 1GEEA 1BGVA 4TMFA 1BDMA 4D41A 5BNFA 3RJ9A 1G0OA 2O3JA 4QTZA 3W8FA 1S6YA 1UP4A 4Z0PA 4M1QA 3FD8A 1HDXA 3P2OA 1PZHA 3QQPA 5AVOA 2V6BA 2YFQA 1EVIA 4D44A 2ZB7A 3PFWO 3ZV3A 1LUAA 4KP7A 1NPDA 1R6DA 4NU5A 2ZTUA 3KB6A 3OICA 3ST7A 2WDZA 3RBZA 3QVWA 2P9EA 1YH3A 2NLOA 4PCVA 1B0AA 4D43A 2CUKA 4JK3A 1HE5A 3JQ9A 3JD4A 4KDEA 3RBVA 1HTBA 4KUGA 2J6IA 1YOVA 3W6UA 4CODB 5KJ6A 4LRSB 3O4RA 3QVTA 3RASA 1E92A 3GDOA 5KJFA 4WNCA 1KOLA 4BMVA 2A4KA 4BIIA 2B36A 1DJQA 5ER6A 4CMEC 1HWYA 4I5FA 1K6XA 2GN8A 3LQFA 5EQFA 3H8VA 2VNSA 1Q7GA 4E5NA 3ZW9A 4E2ZA 3M2TA 4YRBA 2NUAA 1VJ0A 3AU9A 2YW9A 4BS9A 3QWBA 4BNZA 1NNUA 1C14A 3L9WA 4BNTA 4Y9DA 5KJ1A 3ZNOA 1P44A 3KVOA 2AXQA 5BSGA 1QV6A 3QHAA 4E30A 5C7OO 3TZKA 1LNQA 4BV8A 1O6ZA 3KRTA 2YFHA 2GZ3A 3A9WA 4IY1A 5A03A 5JXWA 4W4TA 4I9UA 2NM0A 3BIOA 3SJ7A 1JQBA 3AUUA 4YVFA 3DONA 3WGYA 4DUPA 1WDMA 3PVZA 4DIBA 5JAIA 4XJTA 1ZH8A 4CLRB 4XQCA 5TT0A 5HBRA 2VWPA 4J6FA 4WEQA 4EEXA 4XB2A 1NWHA 3FWZA 4BO9A 3S55A 1H6CA 4NNJA 2NVUA 5JDIA 5KIAA 3GDGA 3HNPA 1KIFA 3LT0A 1ADGA 3H2ZA 4CR8A 1E0DA 1U4OA 5JDCC 3WR5A 1HLPA 4HFRA 5F1PA 1X15A 3VPHA 1LSSA 4XKJA 1ZIDA 2VN8A 3BXXA 3BTOA 1CEQA 2Y93A 3E9MA 4MKXA 1MGOA 4XR9A 4XYLA 5DOVA 2OHXA 3D4PA 3I52A 3OFSA 2JL1A 2X1HA 5CFZA 5IDQA 2G5CA 1HRDA 5TGDA 3X2EA 2CD9A 1GD1O 3IS3A 3ZI0A 2DAPA 3B70A 4R3NA 5K9ZA 2BF7A 1FMCA 1SOWA 2VUSA 4ND2A 1Y8RA 3ITKA 2CZCA 1DBVO 1B8UA 4JJFA 3F6YA 1YQXA 2IZ1A 4EDFA 4ALJA 3LC7O 3GK3A 1Y5MA 4BGIA 5DNAA 4BKUA 1EVJA 5L7YA 3RQSA 1MG5A 1P1JA 4P4LA 1JDJA 4R16A 3O38A 3DZKA 5ITWA 5EPOA 1JWBB 2B69A 2BI8A 2PKQO 1E6UA 3ENNA 2R6JA 2W98A 3JYQA 2X9NA 4I9NA 4CLOA 1LDMA 1VJ1A 5HWSA 3CSDA 2EHDA 3ONDA 1NXQA 1A9ZA 1MFPA 4CPDA 4U7WA 4F6CA 3DZJA 5BSEA 1KY4A 1DRVA 4YCAA 3JYPA 1L7EA 1XU7A 2PGJA 4X54A 4Y6RA 4MPDA 1OC4A 1P77A 2OBYA 2QIOA 3BHIA 1GZ6A 3GGOA 4XB1A 2BFMA 4ITUA 1UP6A 3AFMA 1NFQA 1KS9A 3MCVA 3WNVA 4DQXA 3ZV4A 1T2CA 4YT8A 2C20A 3DZGA 3GG9A 3PDUA 3VTZA 2JD2A 1N92A 3FSRA 5JAQA 3KLMX 1E77A 4YA6A 4CV2A 1D4FA 1UAYA 4ND4A 4XGIA 4EEZA 4Z9YA 1L7DA 4C7JA 3HWRA 4PG6A 4RL6A 1Y9EA 3Q2KA 1Z7EA 1FDVA 5G0UA 4GX5A 1IOLA 3D64A 3PJGA 2WYVA 4KOAA 3GDFA 1DRWA 3ITDA 3ADPA 2J5QA 3E6AA 3UCFA 3WTBA 1QYWA 1GR0A 2DU8A 3D3WA 4CR6A 4EJ0A 4RF5A 1EUZA 3JCZA 3DMYA 2WD8A 2ILTA 1A9YA 1GV0A 1R37A 1HETA 4P4NA 3JQ8B 3M6IA 1QYXA 2BI7A 3PZRA 5CG1A 3E18A 2FPGA 3CTMA 2X5KO 3PGXA 4NBTA 5DF1A 1XLTA 1WDKA 3GAZA 4KQWA 2Y99A 5G0TA 3AI2A 3NTRA 4YJDA 4M55A 1Q1NA 1AHIA 3I9KA 1K89A 4OXNA 5EJ2A 4BNIA 3VH4A 2Y1FA 2NACA 2ZYDA 1ZK4A 4PIVA 4RVGA 1DAOA 3UW3A 3VVBA 4BHTA 1BW9B 2Y1CA 1MX3A 4J0EA 1HDCA 2LDXA 3HG7A 3AK4A 1ZJZA 1U9JA 2VYVA 3EY4A 2ET6A 3UN1A 5GZ6A 3PFFA 1KEPA 2G1UA 4YBZA 4II2A 3ZHBA 4MO2A 4B3IA 4B3JA 2D59A 4I5EA 3TZQA 4AVYA 4UEJA 2VYNA 3H9JA 4WK6A 4Z9XA 3JYNA 5CDYA 1YBVA 1WZEA 1BRMA 4TRJA 1PR9A 1HL3A 2R00A 3DHEA 3GN2A 3KSUA 3QA9A 3GN1A 2BRUA 2DPGA 1GYRA 1Q7CA 1NQTA 3FTPA 3JYOA 2Y0DA 3H4VA 3PJEA 1YXMA 3JQEA 5TIIA 1ZSVA 1ZK3A 5HS6A 4CM5A 1EZ4A 2FMUA 3K5PA 3V2HA 1LLQA 3WX0A 1O94A 2QZZA 2VNAA 4FFLA 4IDEA 4PG5A 3VH2A 3RBXA 2BGMA 1YB1A 4ZQGA 1NQ5A 3RFVA 3O9ZA 2ZCUA 1P45A 4JBGA 4G2NA 4L76A 1F8GA 2JD1A 4L4SA 1ISFA 2ZB4A 5KOIA 5L45A 1YJQA 1RM3A 2WM3A 2J5KA 3H5AA 4WCFC 4K6FA 3DMTC 3RAJA 1I3MA 1Y5RA 4JP2A 4L75A 4HFMA 4FJ1A 1RYEA 4MVJD 5IN5A 4AJ1A 4FD3A 4MKZA 2PZMA 4TKLA 2W2LD 3ENKA 3FNFA 5F21A 3I4FA 5H83A 1ISJA 1PGQA 3PWSA 2DT5A 1NHGA 5KNLA 5JPIA 2DKNA 3RU9A 1YQGA 2X0NA 4HXYA 2Z1NA 4A03A 4NR0A 1KC1A 4KDFA 4R9SA 5AQ1A 2X5OA 4NIMA 2PNFA 2X58A 1BXGB 2P9GA 2UUOA 3NYWA 1P9LA 3TOXA 5C7IO 4CLRA 4BGUA 3VPGA 4TVBA 4TRRA 3ZNQA 3JQ7B 1DIHA 1NFRA 5A04A 4JBHA 3ZWOA 1ENPA 5G2OA 1B15A 3OQBA 4XIJA 3PRJA 4YT4A 2HMWA 2ZJ1A 3GGGA 3Q1LA 1KC3A 1E5LA 1T2FA 1HYEA 2E49A 5A02A 4J16A 4BNKA 8ADHA 2HMVA 1WMAA 3KHUA 1H2HA 3DBRB 4GL4A 5DBFA 1U3VA 4N54A 1U1IA 1DXYA 4UUOA 2H63A 1F8FA 3D5QA 3KETA 2LDBA 4AICA 4IJKA 2J3HA 4H15A 1HT0A 2FY8A 2JCYA 3VH3A 3D3EA 3GZ4A 1KVUA 3GY0A 1TI7A 2HK7A 2P91A 3WB9A 1ZCJA 2Q2WA 3VZQA 5THKA 4BO0A 4J1TA 2D0IA 3EC7A 1SB9A 3H7AA 4IDAA 3U4HA 1IZ0A 2Q2QA 1K3TA 2J3IA 3RKRA 4NH4A 4BNGA 2G82A 4II3A 3A1NA 1X7DA 3S1LA 4J9VA 4QSMA 3DB2A 2Q4BA 2X8LA 3NRCA 3ANNA 3I4CA 4AL4A 4E33A 2QZ9A 2Z5LA 3UCEA 1UDBA 1GY8A 5A9TA 4YEDA 4BO2A 3WWZA 3I9JA 5A5EA 3FPLA 5I7FA 1TT5B 1PL8A 1PU2A 1XELA 3D7LA 4NBVA 1IB6A 3NT4A 1I5RA 1LC3A 1EFKA 1GADO 2Q50A 4GX0A 3TPCA 4K9DA 1ENOA 1Q2XA 3UICA 4IS3A 4KWHA 5GY7A 4CUJA 1Q0LA 4IM7A 1T2DA 2W4QA 4OKIA 1ID1A 4UVHA 3TRIA 4B7CA 1O95A 1YB5A 1YJ8A 2CSUA 1P31A 1CDOA 1FDWA 4MKRA 2B35A 4DYDA 1UDAA 1UJMA 1X13A 4QO7A 4EI2A 4J91A 4ZA2A 5H82A 3U9LA 1LX6A 4OH1A 4U5QA 2J8ZA 3IUPA 1M66A 4U6SA 2RHRA 3VTFA 1LDEA 4Y6SA 2WD7B 5ILOA 4YXFA 2OP1A 2JD0A 3W4JA 1GFSA 1H2BA 3PYXA 1ENYA 3H65A 4RF2A 1FDSA 1N9GB 2BGKA 1M76A 3PP8A 4FCCA 4J7CA 4A27A 3L0DA 4J90A 3G3EA 1NVMB 3VKVA 1J4AA 3EUWA 5DDIP 4Q9NA 1VC2A 3JQ8A 5ICMA 4DLBA 5IXYA 3G79A 1F12A 3H2SA 4OXKA 1KVRA 4I08A 1Z6ZA 1VPDA 1LJ8A 4D3FA 4MJLA 4RCVA 3H9EO 2PLAA 4D79A 1C0IA 4AG3A 1SO8A 3I9MA 1UP7A 4HKTA 4XDZA 4CLEA 4BOYA 4PFJA 3D1LA 3CE6A 3K30A 4RO0A 4BUCA 1OBFO 3OF2A 1BW9A 2FOIA 1T1SA 4WE3A 1NQAO 1I3KA 1O5IA 4Z3KA 4PLWA 4HX5A 5C37A 5JFOA 3SX2A 4GSKA 3AJRA 3C7CB 2B0JA 3AUAA 5A1TA 4ALKA 3CZRA 1GPDG 1V0JA 1Y8QB 4QX6A 2VWGA 3HDQA 3QVSA 2V6FA 4UVIA 3AFNA 3U09A 4OM8A 5GZ3A 3ZW8A 2RAFA 2HUNA 5EL0A 3PIIA 3DXFA 4D3DA 3WYCA 1ZBQA 5CHEA 4TKMA 3JQ6A 4AJ2A 4MVJG 5DBIA 1SEVA 2IODA 2AW5A 1T25A 2X5JO 3GZNB 4YB8A 5I9LA 4L74A 4UVDA 1NQOA 2WYWA 3PTZA 3Q3CA 4CMGA 4DGSA 4NDNE 2FHSA 3I3OA 4M8SA 5KJEA 1PQPA 4PGFA 3EDMA 1LSOA 3OEYA 4BKOA 4B7XA 3V1UA 4W9NC 1UDCA 1GUYA 3ZWMA 4DBVO 1QLJA 5JY6A 4GGPA 4YT5A 4CMHA 1CWUA 1R4NB 2HQ1A 4PN3A 1PJTA 3NGXA 4XRGA 1EBFA 5JCJA 3B1JA 3JQAB 3WIEA 1RPNA 1I32A 3GQVA 3H5NA 5JMWA 1LQTA 4CV1A 1B14A 2YV3A 1UH5A 3VH1A 4WCDA 4MVJI 4E13A 1FJHA 1IUKA 1MC5A 4LGVA 2WEKA 2H1SA 3EK2A 5T67A 5IF3A 3BTSA 1I2CA 3BAZA 4R01A 2IZ0A 3MJCA 5DCYA 3TN7A 3ZWCA 3AOEC 2X23A 3GEGA 2AQHA 4CM9A 4D3SA 3TOZA 4NJOA 2CDBA 3SXPA 3NT5A 1N7HA 4Q3EA 1ULSA 3M1LA 1H94A 3UXYA 1BXGA 1U7TA 1X7GA 3I83A 4YYZA 4AJJA 4J2OA 2VHZA 4F45A 3JQ7A 3ROPA 4U6QA 2GN6A 1LLCA 3W4IA 1XHLA 4PLTA 1JKFA 5COBA 4DMMA 1FXSA 5IDYA 3QV1A 3ETDA 3QWIA 4CQMD 3EYWA 3QIVA 2R2GA 3DBRA 3OJOA 1LQUA 3E9NA 2ZKLA 1Y1PA 1WNTA 2FR0A 3GPDG 1EEHA 2HK9A 2VOJA 3W1VA 2FSVA 1U5AA 4GX2A 5CDGA 4CUKA 3H6KA 1JAXA 1AGNA 4FDAA 4IQ0A 1DHRA 3ORFA 4WJZA 4XZ3A 4OIMA 2EKQA 1AN9A 1F0YA 3G17A 3WFJA 1O0SA 1Y6JA 2PA3A 3DAPA 4D7AA 4M49A 3KYDB 1H9AA 1O89A 3FWNA 3I6QA 3N74A 3A14A 3JD2A 3AY6A 1YVEI 4AJHA 4MINA 2XPCA 1C1DB 4FBGA 5KVSA 2GLXA 2CY0A 4MVJP 5DCUA 3U62A 1P1HA 4LISA 1T1RA 5ITVA 5KVQA 5COQA 1A4UA 4B8WA 1TT5A 3CIFA 4BNLA 1HSZA 5G4LA 5A9RA 3WOHA 1YBMA 1XWFA 2P4QA 1W8DA 4B4UA 4EW6A 3SC6A 4QEDA 1DJNA 2IDZA 5A3JA 3LT1A 1KEWA 3IKVA 3PHIA 1IHXA 1QYVA 1XKQA 1H0KA 3QP9A 2WYUA 1JVSA 2POQX 4GKVA 1D3AA 4UUPA 4RVSA 1GCUA 2RIRA 1F06A 3S2IA 2AQ8A 3GFBA 1XR3A 3DBHB 4OL9A 4PLYA 1WMBA 1E3EA 5G0VA 1U28A 3LZ6A 4EUHA 4B4OA 4GVLA 3WNQA 3LLVA 2Y1EA 3DOJA 1E7WA 4IUYA 4TZKA 4YTEA 2WD7A 2FPPA 2EGHA 4Q3NA 2DPHA 4J1SA 5F5LA 1E1MA 4JGBA 1PS9A 1ISHA 1N9GA 2DUWA 5IZ4A 2BLLA 1E7MA 4NFSA 3FF4A 5JE8A 3ANMA 4CQLB 4TVOA 5U1PA 3UKOA 2CMDA 2X22A 4TSKA 4IGFA 4LRTB 4Q39A 1PQUA 3IUSA 1EMDA 1I33A 3PIDA 1PS0A 1EE9A 1PJ3A 4BKPA 1I0ZA 4QFCA 4YT2A 4IS2A 2VYVD 4D42A 3DTTA 2EWMA 2PD4A 3PLRA 4TRNA 4DXHA 5CG2A 2AEJA 2PV7A 3OSUA 3PQFA 1NM5A 4J2HA 1O8CA 5L7WA 2XXBA 4R68A 4KQXA 3MWDB 3L9XA 1SBYA 2EXXA 4INAA 1GZ4A 4RDHA 2GSDA 4DC0A 3ZU2A 4BB6A 3PYLA 3VPSA 4BO8A 4L4RA 2IRWA 5CPFA 1HZZA 5TX7A 4R51A 1M75A 4CLDA 3W8EA 4KUEA 4DA9A 4CJXA 4I8XA 2C0CA 3LVFO 5A4DA 1OI7A 1Y8QA 2RH8A 4BO1A 5HTOA 5T5QA 5BSHA 4BKQA 2XF8A 4GWGA 3GHYA 4JIGA 5IJZA 2PK3A 4R69A 3HUDA 1B2LA 3DOCA 5GMOA 4P38A 1QXSA 2QG4A 1GTMA 4FS3A 1GQYA 4ALIA 1G1AA 4J7UA 4O63O 4P8RA 3GZNA 2PGDA 3K6JA 4PLVA 3RSHA 1DC5A 4FB5A 2IEBA 2BFOA 5G4KB 3GRPA 3FRJA 2O3QA 3OECA 4FOSA 5IG2A 2Z1MA 2CVQA 2PH5A 3C1OA 3PJFA 5JC8A 3EGOA 3K96A 5GZ1A 3WSVA 4TROA 1U3WA 3IMFA 3CEAA 3I9OA 2DBZA 2EIHA 4YAEA 4DVJA 1VI2A 1T2EA 1DIRA 2RBEA 1NR7A 1R4NA 5T57A 1LEHA 3MJ4A 3PZBA 4UAGA 4CM6A 3JQAA 3JQGB 5AXDA 1MXFA 4IMRA 1T2AA 1LDYA 1QYCA 1KY5A 3CINA 4NJMB 5B1YA 3ICPA 2NU6A 2C59A 3TJRA 4WLFA 5I8WA 5AOVA 1PQWA 2Y1OA 1KYQA 3ADOA 4KWIA 2XOXA 4DL9A 5KKCA 5L40A 5ADHA 1B3BA 4LCJA 3MJTA 2YY7A 1I30A 3OIGA 1QKIA 5DBGA 1QLHA 4ROSA 3WXBA 4MP6A 2EV9A 3BMNB 3QJ5A 2Q1UA 1I3NA 1NASA 3NDRA 4HP8A 3GNTA 3ZU4A 3WICA 3I5MA 4UVGA 2UYYA 3FBTA 3TZ6A 4WLUA 3KEQA 4NFHA 3GUYA 4TQGA 4FOOA 4BMNA 5AXBA 5B12A 4D0SA 5ER9A 4B79A 3ASVA 1CYDA 5T8KA 5F1OA 5C7LO 1ZEMA 2JAHA 3NAQA 4R1TA 2JAPA 4F3YA 3ON5A 1V9LA 3IP1A 1AUPA 1IZ9A 2A92A 3LF1A 1S7CA 3GA0A 1VL6A 1K2WA 1PJQA 1YL5A 1Q0QA 1A27A 5KWEA 4ILKA 2JCXA 4OJNA 1P0CA 2NTNA 4D0RA 2O3TA 2DBRA 4W99A 1YGYA 3KLPX 1ONOA 2GYYA 2Y67A 2QHXA 2J5RA 3ZWPA 4FGWA 3KYDA 1LBEA 2AE1A 5B4TA 2W8ZA 4L9RA 1D8AA 3OMLA 2IXBA 1ENZA 4DREA 3LLSA 4YRDA 3PLNA 1DLIA 4IBOA 2H6EA 3BMQB 3QWFA 4N5MA 1C1DA 3HB4X 3QWAA 4ZJUA 1B3RA 3LYLA 1I3LA 3OP4A 3TNLA 1QSGA 1LLUA 4QQRA 3P2YA 5ES3A 2A9FA 4RZHA 5AXCA 1QYDA 3WFIA 4KZPA 2GDZA 1DIBA 2OFPA 3WGGA 1JU9A 1UXHA 3FHLA 4N7RA 2HJSA 1E6EA 4R4JA 4KUHA 2P5YA 4WKGA 1AE1A 1R15A 1J49A 1OMOA 4DRYA 1JA9A 4W7IA 3OHSX 2X4GA 5L9AA 1GAEO 2X0JA 1U8FO 4E6PA 1LSJA 4G81A 1JN0A 1EQUA 3OETA 2B5VA 3DFUA 1PJSA 3DBHA 1CQJA 5THQA 4BNUA 3M1AA 4NBWA 3GMSA 4JN6B 1C0PA 4J49A 4MIYA 4XWYA 4ZVVA 3I23A 4EUFA 1DC4A 1LLDA 1M6HA 3VAZA 1H6DA 3D0OA 4E31A 2GD1O 2O7SA 1Z73A 1YDWA 2F1KA 3JQBA 1DIAA 4RPLA 2VTEA 2ZTLA 3BHJA 3KYBA 2IZZA 1R0SA 3AWDA 3KSZO 4XEHA 4RPKA 1Z82A 4PG7A 1XG5A 3RUEA 4CQLA 4JXKA 1ADFA 4AJOA 2Q2VA 4D45A 1AXGA 1NHWA 1WP4A 4O6VA 1LRKA 2OMEA 4JROA 1SNYA 5IZCC 4LK3A 3L4BA 4QUKA 1JW9B 1PR3A 3VPFA 2PY6A 4NFYA 1BSVA 1QMGA 1N5DA 4ID9A 1P3DA 1OAAA 1HDZA 4J1NA 2AG8A 2VZ8A 3WWYA 4I9HA 5CEEA 1KERA 2ZCVA 2X0RA 4AJ4A 3MOGA 4E2YA 2FP4A 1I10A 3NJ4A 4Y98A 4BNXA 3MEQA 3CZMA 3C85A 5T64A 4BNYA 2PD3A 5EIOA 2ZQZA 3PXXA 3TF5A 1CF2O 3NEPX 4E4YA 3HDJA 5EQDA 4LSMA 2I66A 2TMDA 1ZMOA 3OIDA 4E21A 3QVXA 3MJSA 4IMPA 4MVJF 4ZRNA 2HSDA 3F3SA 3JQDA 2NU8A 3AM3A 3UOGA 6LDHA 2JJYA 1KBZA 4HNGA 2PKQP 5FI5A 3ZU5A 5F5NA 4HV4A 5KVCA 5L4LA 1J6UA 1I24A 2PR2A 3K2BA 2WJPA 4U0JA 4WEOA 3WG9A 1GCOA 1M67A 2VUUA 1YDEA 4RVDA 1EVZA 1PZGA 3U4DA 3K9QO 4RPHA 2X6TA 4EYEA 5DP2A 2DTEA 3QWHA 2BFAA 4YQZA 4BMSA 1JVBA 4ZD6A 5LC1A 4E5PA 5G4KA 3WMWA 2YV2A 3DHYA 3AM5A 3IJPA 1XQ1A 1BG6A 1PWXA 2JCVA 2NTVA 1KEUA 1VL8A 3EHEA 3SLKA 4LVUA 3JQ9C 4AJPA 4YR9A 1ZEJA 2UUPA 4H16A 4L0QA 5ENVA 4FJ2A 4MP3A 2CF5A 3T4XA 4UUMA 1A4IA 2PTGA 3BTVA 3HSKA 3JQGA 2GCGA 1DPGA 2DFVA 2FWMX 4RPGA 1JTVA 1ONNA 2NQ8A 2V6GA 5DULA 1LA2A 5KKAA 4RVHA 4B7UA 1HE2A 4NJMA 1DC3A 3INTA 4NBRA 3S2EA 3TFQA 1X1TA 5A05A 2D5AA 2C5AA 3H9GA 4IDCA 4BNWA 1KETA 4IZHA 1C1XB 4FSHA 4CL8A 1I2ZA 3IAHA 2EP7A 1J5PA 2Y0CA 4Y67A 1DSSG 4G5HA 3S2FA 1V3TA 5JNLA 3JD1A 3RD5A 4PRLA 3A06A 1HDYA 3ZWBA 4AJEA 3BMNA 3C8MA 4U8GA 3NTOA 1FK8A 2PZLA 1HSOA 2YUTA 2WMDA 5AYVA 4HWKA 3UAGA 4GLLA 4AJLA 3WIDA 4CMJA 5I7VA 3N58A 1ZXLA 3HN2A 2HMSA 3MOIA 1BHSA 4OOEA 3ZU3A 5TJ9A 4BNVA 1TLTA 5K6AA 3L6OO 1IPFA 2I5PO 8LDHA 2VHWA 3IIEA 3JYLA 5JDIC 4WLVA 5L7TA 2CVZA 4OQZA 4EBFA 5TRTA 2Q1SA 2HO5A 1N1GA 4PLFA 3ONFA 2NSDA 3HQ4O 4IINA 4WLNA 4CM8B 1XSEA 2NQTA 3C3XA 1L1FA 4WLEA 4B3HA 3WBBA 2OBNA 4CM4B 3UFXA 4FQ8A 3HE3A 1ZK0A 1SC6A 3G0OA 1H93A 3SLGA 5BSFA 1VKNA 1KEVA 3NJ8A 1VKOA 2RCYA 5DT9A 2CDAA 5KJCA 5CDSA 2C29D 4Q3AA 1MXHA 2QW8A 3TL2A 1E7QA 1E3IA 4LN1A 4XIYA 4CMEA 3DBLB 3ZCXA 4RVUA 5G0WA 3QE3A 2WTBA 2DC1A 3BMQA 1EFLA 1FDTA 2VWQA 4BNFA 3HDYA 1PJ2A 2OUIA 1K6IA 3ROMA 1D1SA 4DPMA 9LDTA 3D4OA 4FC6A 4TRMA 4WCFB 3T7CA 4BNJA 1YONA 3E48A 3IOYA 1DLJA 2PH3A 3JQFA 4K6CA 2JHGA 4CMKA 5BNIA 5I7EA 4RZIA 1PJBA 1F17A 2PGLA 4M54A 5U4QA 4FN4A 5JC1A 2O3RA 1ZSNA 2CNBA 2HAEA 3FNGA 4HBGA 4IDFA 2EERA 3IQDB 3PHGA 1KVTA 2O50A 5HM8A 1BMDA 1JWAB 4R1UA 4B8ZA 2Y68A 4Z6KA 2E6UX 3DEYX 3GOHA 4O1MA 5T8KC 3GT0A 3F4LA 4XJSA 1ISIA 1UXJA 2YDXA 3AUSA 3OBBA 5JYEA 1XIVA 1VE9A 3CMCO 2OO5A 1CERA 2RHCA 2WE7A 4JLWA 4XX0A 2GASA 1XCBA 4IQ8A 5IDXA 5JDCA 1X0XA 3R3JA 4GH5A 2HDHA 4CM7A 3UF0A 3OJLA 4R9RA 4ND3A 1NP3A 1W0CA 3PYMA 5TNXA 1GYQA 1ONPA 2DTDA 4CR7A 1G6KA 4C4OA 1WXDA 3LT4A 1DO8A 5L4NA 3ZHZA 4O5OA 3INRA 4A73A 4CUZA 2IYOA 3I6IA 1RWBA 5ENDA 1EK6A 5ILGA 1BXKA 2AMFA 5HA5A 5CAEA 2JHFA 1GEGA 1R4MB 2YV1A 1I36A 2I76A 3GEMA 4IXTA 4ZN6A 5BNTA 1LRJA 1GYPA 4WASA 1WAMA 4N18A 3JD0A 2BKAA 1CQIA 3LSYA 4H7PA 1E3WB 3H9QA 2FRDA 4CV0A 4YACA 4NK5A 2IEDA 4BO4A 3FNHA 5LDHA 4UVEA 1BDBA 4YWJA 4XRRA 3FBGA 4R1NA 3RUAA 3ZWAA 1Z75A 2OORA 4XGKA 1PGOA 2E4AA 2GNAA 1CRWG 1WWKA 3TWOA 1OFGA 5CDUA 3PGJA 3WYBA 1UXIA 3HFGA 2X9VA 3WTCA 3EZYA 3WGZA 1MUUA 4RDIA 3GF4A 1WZIA 4FFPA 1HE3A 1X7HA 2OP0A 1GV1A 4L73A 4MVJA 4ZHSA 3VZRA 2EJWA 2GERA 5I9NA 3GRKA 7ADHA 1M2WA 5JYDA 2Y1GA 2Q49A 4CMIB 3DC2A 1MB4A 4Z0TA 5JY1A 5BQFA 4BQPA 1TEHA 1Y9AA 1G0NA 3NV9A 4E32A 4OSPA 4MDHA 5JSFA 4CV3A 2HK8A 4HY3A 5COAA 3RJ5A 2JFFA 4WGGA 3ZH2A 3ZN2A 5L53A 4MP8A 3JQAD 2EKLA 3DZBA 3AW9A 4PVCA 1BVUA 5A9SB 4I5DA 5EERA 5JW6A 2XXJA 2NTJA 1HF3A 2R00C 3VZSA 3L4BC 1HYHA 3WGHA 3LDHA 4GI2A 3S2GA 3WGOA 4FFRA 1A5ZA 1QV7A 3MJVA 1C0LA 4E2WA 3WQSB 1P33A 1RM5A 3E82A 5L4SA 2VT3A 3Q9NA 4CQMB 4OMUA 1PL7A 1OC2A 2ZK7A 4DMLA 3NT2A 1A71A 2X7HA 2ZTMA 5EESA 4GBJA 3ETEA 2GZ1A 1PS8A 1SMKA 4PZDA 5L95A 3JQCA 5FEUA 1I2BA 3V5NA 3E1KA 3NDIA 2VRBA 2OZPA 1BWSA 4OYRA 4QFDA 4W6ZA 3T7EA 3E03A 3KEOA 4BO5A 3CMMA 1C1XA 3FPCA 3G49A 2GN9A 3W6ZA 3NGLA 9LDBA 3V2UA 2H5LA 1ZO8A 3C24A 3WLFA 2VUTA 4RVFA 3RFTA 2P9CA 3BZUA 3F47A 3EVNA 2A35A 4PLGA 3RUCA 2DTXA 4S3MA 5IN4A 3GVPA 3K8ZA 4XCVA 2VOEA 4Y6PA 1IPEA 1FF9A 3DDNA 5L51A 4OKNA 1R0KA 3KO8A 4FR5A 2YYYA 4IGEA 4JQCA 4R5HA 1TB4A 3W8DA 1AHHA 2GF2A 2OL4A 2HU2A 1ZW1A 5I7SA 1UZMA 2BH9A 2IYPA 4XQGA 4XYBA 3WYEA 4K1LA 1RJWA 2GR9A 1QG6A 2W2KB 3TFOA 3PDJA 1LU9A 3K92A 1XGKA 4RLHA 4JJIA 4XYGA 4E12A 1HEUA 2ZYAA 3PJDA 2HMTA 4FW8A 3ZWYA 4CM8A 2GO1A 4B4WA 3C1TA 1IE3A 4CM4A 2I3GA 3KTDA 3AU8A 2C7VA 4JJGA 3PI7A 3UCXA 4OXYA 2AA3A 3Q6IA 1DFGA 5U9CA 2YHIB 3O8QB 1DEHA 1XQ6A 1BVRA 3KBOA 1PGNA 4BVAA 2EW8A 4TWRA 4BNNA 2HKIA 2O48X 3KM0A 2O2SA 3DBLA 4WNIA 5A06A 3WS7A 2C7GA 1QRRA 5TC4A 2UDPA 4MIEA 1V35A 3EZLA 4ZU3A 1YWGO 5JO0A 3VVCA 1SEPA 3QW2A 4YJGB 1E7RA 1GPJA 2XAAA 3FI9A 1LXCA 4WCFA 2OXIA 2C82A 4EUEA 3H5RA 4IPTA 3B20A 3OM9A 1LDGA 2W90A 4YAKA 1E3SA 3RC7A 2DFDA 1X14A 2YQ5A 2E37A 4PLZA 3WBFA 2C07A 3OJFA 3MZ0A 4GMGA 1R16A 1PSDA 2RH4A 3T4EA 1B26A 1EDOA 2ZIZA 1MFZA 3H9UA 1WW8A 3ONEA 4DYVA 5K6AC 4DPKA 4GSLA 3AI1A 4YDRA 5IDWA 1YS4A 3BTUA 5FYDA 1AXEA 1NX6A 2ZTVA 1Z74A 3H3FA 4TZTA 3KYCB 3DFZA 2WWRA 4YJFB 2EJVA 3ZDFA 2VYND 4L8VA 1K5HA 4URFA 4YPOA 2QRLA 1HDGO 1XA0A 3GPIA 1IULA 4Z0HO 3C7DB 3WGIA 3U3XA 2V65A 2Y0EA 2Q46A 2G76A 5C5IA 2AHRA 5JO9A 3DQPA 3NKLA 4IZIA 1SOVA 1SPXA 1V6AA 3KV3O 3P19A 2O4CA 4DWVA 1YL6A 2DBQA 4CL3A 2VZ0A 3K73O 3OA2A 2NWQA 2WE8A 4MIOA 4QT0A 3LK7A 1R4MA 4BV9A 4DPLA 4ND1A 1ZZEA 3RU7A 4J4TA 2J3JA 2O2YA 2X86A 2B83A 1PIWA 2HMUA 1E3WA 2I67A 2EEZA 5A5FA 1UXKA 1PWZA 5DCWA 3ZZNA 3JQFC 1YO6A 4FFMA 4IJVA 1NTOA 2NVWA 2Q3EA 1U2DA 3SVTA 1J0XO 2BMAA 4KMSA 4ND5A 2GZ2A 5CP8A 4BGEA 2DBVO 1QP8A 1ARZA 1PEDA 2Q99A 3GLQA 5B4VA 2DLDA 3VHRA 1ZJYA 5JCXA 4MOWA 3V8BA 4ZGWA 1Z7BA 4N5LA 1NVGA 1PJLA 2FSSA 4G65A 4R41A 3V1YA 1W4ZA 1ZUD1 2IXAA 4XQEA 4P22A 2DM6A 1ADBA 1PJCA 3KUXA 1E7YA 3EAGA 4CMIA 4ZQHA 1VSVA 1Q0HA 3E5MA 1X1EA 2X9GA 4CLXA 3OA0A 3AY7A 3QVOA 5TLSA 1E1NA 5JLAA 1CJCA 1DFIA 3RC1A 1E6WA 3NUGA 1H5QA 5JBIA 3MJEA 3TSCA 5A9SA 4O0LA 3A28A 3DZIA 4EZBA 3G1UA 1EE2A 3F5QA 2BD0A 1N1EA 4CMCA 5HS4A 2D8AA 5IFLA 1E5QA 3VOSA 4IIVA 1YE3A 3OH8A 5TF4A 3S8MA 1SZJG 2O7QA 4UUNA 4M89A 4A7PA 4CQMA 1O9BA 4DLLA 3L6DA 5CEFA 4LMRA 4YRAA 4LSWA 4GLOA 2GGSA 5IXSA 1HZJA 1R0LA 1LC0A 1ZXBA 2ZB3A 3HN7A 2NNLD 1V8BA 3C7AA 4J3FA 1D1TA 3MWEB 3F46A 3ROQA 2I3AA 3QY9A 3PPIA 2FR8A 3G1TA 1DDOA 5T6BA 4WOKA 1SAYA 4A10A 1CIVA 2Q1TA 1NAHA 5TQVA 4EITA 5JMPA 1DIGA 3RROA 5BT9A 4YAJA 3IDSA 3IC5A 2UV8A 4BL5A 2AQKA 2TMGA 1HKUA 1B7GO
chains in the Genus database with same CATH superfamily
2OLJA 1SXGA 4E07A 1GR1A 2GJ4A 5IM5A 1U0OC 5IK2D 3SG0A 4FT2A 1CRZA 1PL6A 2CKDA 4M87A 1T8UA 5I3CA 3F73A 1L8LA 1YTLA 3GELA 3WQBA 3UB3A 3ZHTA 2ARKA 1N7GA 4UPVA 4EB8A 5JXIA 2DQ4A 5JVDA 4NK4A 3RS7A 3DULA 5K8UA 4PYNA 5KNBD 4WOBA 4CIAA 4YJHB 4KLAA 4LFCB 4HDSB 1G8JA 4W7HA 5F2NA 1W5EA 1WCV1 1W5BA 3P9ZA 3BHMA 2JFUA 3NXKA 4PS0A 4J7XA 4ZCIA 2VQEB 5EP2A 2FPIA 3BMOB 4IX9A 2CWWA 1RIIA 5D01A 1UCFA 4L2IB 4B4VA 2DSTA 2IU3A 2EIXA 2WAXA 4LOLA 4YUVA 1JIJA 3GGPA 1P1IA 1BX3A 1Q7BA 4IDGA 4OYHA 4NBUA 5BO5A 1P2UA 3GNSA 2J6CA 3SC4A 3ZGNA 1W85A 1K8YB 3UH0A 3CFYA 3C3JA 3GBPA 5DNWA 4ZI7B 1J1ZA 2NOAA 1DARA 5K0EA 1FB5A 1JAYA 3K2EA 5H4HA 4KQGA 3OLCX 2G0AA 4H6XA 3SVLA 1JXMA 1VRWA 3SOPA 3CVWA 4K9RA 3DEAA 2VRCA 1GPWB 3QPBA 3R7FA 1QB7A 3IUBA 4JHLA 4M9ZA 4OYYA 1QE5A 4RJTA 4DLKA 2TMKA 4QDTA 1U7ZA 5EHZA 4A82A 2FN7A 3HYLA 2JH3A 4LVNA 2G36A 3FUCA 1UK6A 1PLJA 3ND6A 5ARBA 2EKPA 5CCDA 1BGWA 3UFBA 1OR8A 3TEMA 3TR5A 2PT7A 2YNMC 4CM3A 4X45A 2ZUVA 5JAZA 2C54A 2Q1YA 4Y7DA 3VHXB 2EL9A 1VHTA 4FEEA 4CL2A 5K45A 1E4OA 3ETNA 4AY2A 5JBQA 5HZKA 3U4GA 1EUCB 1I9GA 4Q4AA 4J0FA 4GGOA 3SSOA 1MJNA 2XB6A 4NZMA 1RKXA 1V9CA 3CA8A 4YRLA 1Y1QA 1ZSYA 5LQUA 1U6KA 3K09C 2AK2A 1ZH4A 1EVEA 2YXPX 5D7BA 4KQMA 3WLQA 5HR5A 4ZARA 2WF6A 3SBEA 2I3BA 4RGBA 1MC8A 3F5DA 3OLXA 3QLTA 3EZGA 4PLPA 1NE7A 2VTDA 3W77A 5FR2A 3JW8A 4RVCA 1RE1A 2HRZA 4PN3A 4HH4A 1EDBA 4C3OB 1MX9A 4FSXA 3AP3A 4ZV7A 4EMTA 1QIMA 3W5SA 4MROA 4XQ9A 1NR1A 3FCAA 1IM2A 5JBNA 2UZ0A 3T4UA 2XUPA 4Z1OA 3GFTA 1BX0A 3ASYA 4MCJA 1CRQA 1OROA 4WT7A 3BF8A 4NATA 4YJFA 1CS0B 1ORTA 4CU2A 1IK4A 2ODNA 2I99A 5AVQA 1P5HA 3PFNA 1OFHA 1ZM4A 4FD2A 1J42A 1PJ8A 4LHEA 4NS4A 2GQ0A 5EJFA 3NETA 4BNHA 1I8TA 5IJAA 1CRLA 3V1TC 4KTTE 5KDLA 3CZQA 3IAUA 3PXCX 1ZVJA 1ZKMA 1E1YA 3Q11A 1TYBE 3V7WA 5K8JB 3F5SA 3HNRA 3NAZA 3TUZC 4M86A 4TSRA 1KFCB 4WFJA 3W3ZB 5HQ3A 4EA6A 4DLWA 3QYAA 4NHEA 3VDRA 4B3SB 5J2UF 4TXLA 4KKXB 5TT1A 1E7SA 1U2QA 4ATNA 1K86A 5LXTF 4D80A 1UANA 4I8IA 3U4QA 3C3YA 4X8OA 2QM0A 2W48A 4FQ5A 2CMFA 3GHHA 3O91A 2HSEA 1AO3A 3S1AB 3O47A 3C8ZA 1COWA 3FWYA 2FVXA 5DE3A 3V2GA 2RGEA 1D6NA 4F5DA 5ALKA 4B80A 4B2PA 2ZI9A 3DBVO 4PC2A 3V6LA 2WOOA 3KOYA 3R5KA 2B3TA 1OTYA 3A7EA 4TM7A 3QQ5A 5DOZA 5C8ZA 1TQ4A 5HK9A 5I9MA 3X43A 1ZONA 4DEYA 3BB3A 4PSVA 1JFTA 5EUQB 3VR3D 4Q66C 3NOOA 1EX7A 3D4BA 1G5QA 3DO5A 4EHDA 1W34A 1TYAE 5IAJA 1F9AA 1RBYA 4ED9A 4TLLB 3GLIE 4CM9D 1NRIA 2P68A 3L93A 2RIPA 1DDIA 3P9SA 1GQ2A 2YVAA 4OUDB 3ZV6A 5JG7A 5JXJA 1IN6A 3UBTA 4F93B 1DQZA 4R8MA 1E3JA 4HWRA 2A0XA 1HYGA 1DRJA 4XR4A 2OGSA 3PHJA 1ML3A 1OREA 4GZMA 1O97D 1O96B 2K5UA 4LW8A 1N6HA 1X8KA 4LSZA 4KSCA 1MAWA 2H31A 2WF9A 3CN9A 2BISA 3FZQA 4QXMA 1OVGA 4ECAA 1RZRD 4IDBA 4EELA 2P3QA 5CNIA 1JKIA 3M4JA 4HZUB 2ADOA 2DHEA 2HQOA 3AUTA 4KQIA 1JA1A 4HGQA 2NZJA 2P2YA 1WBJB 2BEUA 2XW6A 2IQ5A 2ZROA 1EJ6A 2FR1A 3JWIA 4JUCA 4B2LA 4DBZA 1AGRA 2AN5A 3F8TA 5ANRB 3F90A 2CCKA 2BM9A 3QG5A 1PR2A 3VAAA 1N36B 2PUAA 2V7GA 1ECCA 3GFGA 3GMDA 4QOHA 1FLNA 3FAZA 4HQKA 3FOAA 1IWOA 2APJA 1MPXA 1O7JA 3EN0A 3JATA 2OE2A 5B58T 3LFTA 2JAWA 4GPIB 1JHOA 4M98A 5EIBC 4AQ7A 3W05A 4P3YA 1ZISA 1WUIS 3BFPA 3OIFA 4XA8A 3V33A 4C3VA 4EB6B 5LMNB 3ROKA 2ZW9A 3NNDA 1VLQA 4I4NA 2IC5A 4BZZA 4JP3A 4U0KA 1UWLA 1FDRA 2QUHA 2ZYRA 5JSUA 3RVDA 2F9LA 3DHWC 4J9UE 3VDMA 5BR7A 2N42A 3SKVA 1C80A 5MN5A 4IEEA 4YLYA 1H22A 5BSRA 4Q3KA 5ALSA 2NZ8A 2VDQB 4UMDA 1NNI1 1X9HA 1MAVA 2YHUA 3MWEA 3R6DA 1DELA 4RXUA 1VP9A 3DR3A 1Z0SA 2C42A 1PGJA 3L02A 1YL7A 2PX6A 4MS4A 4ZEXA 1EFRD 3FPJA 4JZYA 1Z68A 2OXTA 2PPLA 1AHPA 1CSEE 4RHFA 3OCUA 4MA5A 4MK4A 2VQ3A 1CJUC 5A5VA 5ECGC 3DL2A 1EQ2A 3DT8A 2QRQA 1J0CA 3HJAA 1RJFA 8AT1A 1ZDMA 3DAOA 1I14A 3L05A 3UJ6A 5FKJA 4QQKA 1ZL2A 4IG4A 1P1RA 4D6PA 3GP8A 1SHJA 2FMFA 1DFHA 3SNKA 3NAMA 3ROGA 4WPGA 1YZYA 2FWBA 3IT1A 1ISMA 1RM4A 2O54A 1Q83A 1SU4A 1VCHA 1EDZA 2NZ2A 3RJZA 1RHQA 1H9BA 3O03A 2YOGA 4Y7CA 1JKJA 2P9QA 3KR2A 1LS6A 2IHYA 4MA0A 2JZOA 1RHKA 2AC7A 3RSCA 4ENWA 4ER3A 1C3VA 3L1HA 4FHFA 1TJNA 4GPBA 5H3HA 2HHLA 2O7NA 4QVIA 1CY6A 4EK9A 1ZJ5A 5KNDA 4RH0A 1DCTA 2O0LA 3O8CA 5EJ2A 1MIOA 2OGTA 1QX3A 1QV9A 4EI7A 3RDPA 5DK4A 4HTFB 1QZZA 1CZOA 5LCXA 1YZQA 2CNDA 1FXWF 1ZUHA 2JFZA 1N78A 4O3MA 1VLLA 1RQGA 4Q3DA 5E6UB 2XTNA 4J4BA 1P62B 1MC1A 2JNWA 2HLPA 5DMHA 1RYYA 2J7KA 4M1YA 5K0LA 2FZEA 3KTAB 3Q3JB 5HOEA 2C2YA 4G41A 4PWYA 4CT4B 1A1SA 2O8VA 2XUHA 1F9EA 2GESA 3F71A 3FOFC 3V8QA 1V5IA 3WNZA 2I9PA 2FR8C 2HPZA 3IQHX 5F4ZA 2FWNA 3UKDA 3IVMA 2OBFA 1JG7A 1U99A 2R6FA 3FWKA 3JRWA 4LJ6A 4F9GA 2FEAA 3SYNA 3OT1A 3EIHA 1T9CA 4CGZA 5DLYA 3N59A 3TLGB 1JJAA 1Z4OA 2GHQA 2FRXA 3KE9A 5JZSA 1FPMA 3D6FA 1S1MA 3HU5A 4EY8A 3CEPB 5F35A 5JH7A 1CZNA 3HI6A 3EAQA 5K0FA 1M1NB 3K4QA 3SIWA 1UBCA 3GG2A 2YVUA 4YMHA 1J8DA 4RDCA 3KU4A 2MJLA 4RK7A 4YAGA 1FU7A 2NVBA 2ZSBA 3O26A 3V46A 1P5FA 2VHXA 2W6OA 4D5GA 3SNHA 3TH5A 5F78A 2WSBA 2NUAB 4EYSA 1U3CA 2P67A 3RG8A 3H1EA 4R1SA 1YRWA 2J4CA 1T5IA 3I9LA 4LHZA 1PCXA 3WLLA 2FZWA 1TC1A 2O3SA 1DKOA 2FPKA 2GS9A 1DC8A 2WAOA 4PSCA 1TT7A 2V03A 3Q85A 4DTIA 1U2GA 4YHBA 1O2DA 1SCDA 5F3DA 3WSWA 4DSNA 2J6HA 3G85A 4Q93A 4XARA 1V11B 1PVOA 4O59O 4AYXA 5THXA 1IHYA 5BT8A 3SJUA 3ZX5A 1HDIA 1PZEA 4FZVA 1VG8A 2BW0A 1RLUA 3I39X 4Q7QA 3D3QA 2QX7A 3UOWA 1Z62A 2CUNA 2HBYA 3JD3A 1NYTA 4OEHA 4PZCA 3WLEA 5B58C 3GEEA 1R6XA 1L8XA 3WRWA 4FUQA 2P4HX 2YIVX 2XZPA 5BWNA 1CRPA 3L41A 5IXJA 4RTQA 3DP7A 5IH3A 1OXVA 2EW2A 4LQLA 1N8KA 4AW9A 2AOWA 5EMKA 3IKTA 3C3EA 3AVWA 4E2XA 4F97A 3QLUA 4HXEB 1VJTA 1WTCA 3QX8A 2X0IA 3KIPA 1D5WA 4BFSA 1B0UA 3E22A 1KZ9A 3P5SA 1EBUA 3PNMA 3H1BA 1UXGA 5DX1A 3FOEC 3HB1A 2RH5A 3SMVA 4TLBA 1FOEB 3GD5A 2FA9A 3WIOA 4EPXA 1EFPB 1ODJA 2F3PA 3GZTB 4MLPA 4D9MA 4MLDA 4NI5A 1GTJ1 1G8YA 1ZN9A 4TUYA 2OGUA 1NIPA 1UKBA 4DA6A 4EL0A 3PC3A 5CCXA 4G5RA 2TS1A 4INZA 1LVGA 1YRLA 3FRIA 1IZ8A 4E3WA 3AF5A 4M22A 4TKUB 4BX2A 5E6RB 5KVVA 3K8OE 4OGWA 3R7LA 4CMBA 1JNXX 2PL9A 1Z38A 3UWPA 1B8PA 1FYVA 2CLKB 2H1IA 3G9ZA 1XU9A 3OX4A 2C97A 3FN4A 3V55A 1KJIA 3UNXA 4WH0A 2E4UA 3LY9A 1DHTA 3JAWA 5CVEA 5D7NA 4IMIB 4P32A 3MTDA 4IOKA 3TEJA 3WK5A 3R8CA 3BRQA 1V71A 3D81A 3QU4A 4ZVKA 4RULA 1R0CA 4Y3UA 4BB0A 2HSWA 4QBGB 1A72A 2P40A 2XYGA 3DLHA 1YB2A 4Q3CA 1VJRA 3IOBA 3X1YA 3CX7A 5EEHA 4ECEA 4BGVA 4KXFB 4ZCRA 1NT2A 4ZYTA 4KQ9A 3OZRA 1DB3A 4DCGA 2OZKA 5LYYA 2ACEA 1PEKE 1Q20A 1ZOSA 3USCS 1QHSA 4ZU1X 3N2GA 1IY9A 1Y7IA 2A9VA 4GEGA 4TYQA 1W8IA 3FJ1A 5JSKA 1P1FA 3DJYA 3RV4A 3K15A 1WR8A 4ZI3A 1PJ4A 2D2VA 2PG3A 3RUDA 2YKGA 5KNCD 4IXWA 4TV8A 2QTFA 3GW8A 4OGFA 3GBSA 1ZK2A 3GAFA 4XWGA 9MHTA 2FDXA 2VHCA 4UU7A 4FFRA 1ZD4A 3ZKWB 4B9AA 4XGRA 1W5AA 1Z4IA 1T3ZA 3PHLA 3RI3A 1CHDA 1T91A 4ESHA 4BVKA 3HBAA 2GJKA 4RMHA 4UBLA 3BRWD 1Q16A 4HNHA 1J22A 4KYIB 4OJQA 3Q9UA 3RF7A 1ZRMA 2R97A 3VGJA 3PWTA 5I47A 3TDKA 5I7UA 1WLYA 2I6TA 3I1JA 4PZUA 4NE9A 4TWAA 2H9YA 4U9IS 3SIPA 4Q4HA 1NBOA 4WVLA 1E6CA 4JMLA 1WBBA 2CUZA 4LCEA 2R4TA 5I9BA 2VP3A 4NJEB 1CQXA 1K7YA 2IPLA 5SV2A 7MDHA 3PQ8A 1WZNA 5IZCA 1IL0A 1M34B 1EVYA 4DLTA 2H4ZA 4LMAA 3HI4A 4JYBA 3OBIA 1V41E 1IEQA 4S1OA 3HU1A 2NZUG 3CZ9A 4ERNA 1UMKA 2N9UA 2P11A 1E66A 3U44A 4LV6A 3EAFA 1DG1G 1POWA 3EVTA 1KZ4A 2QUKA 3CLHA 4C43A 1R00A 2FPGB 1TEZA 3MJFA 2Y1DA 4FWIB 5CLQA 2JLCA 3PDIB 3EWSA 4YCNA 1EJBA 2Z5VA 2WT4A 3LA6A 3O7WA 2EGGA 5EGNA 3RC2A 1HTWA 3UXHA 5HJ7A 5E2AA 2PKYX 2CLMB 2QXUA 2XUAA 1FBTA 4OAQA 4ON9A 3DOIA 4G09A 3TUIC 4E5MA 3ZJ5A 1YR6A 2GILA 4QVGA 5JAUA 3B6ZA 3JWPA 1XZPA 4EQ6B 3SF0A 3LZCA 4Q4JB 1FMLA 4AN1A 2VDJA 3I76A 3TRJA 3S1SA 1GAXA 3C70A 1XWIA 3DAGA 2IUSA 3DMTA 4NCJA 3H5IA 5MN4A 3Q3VA 2O2JA 4MI9A 4WZAB 4XUDA 7GPBA 1YFJA 4B09A 4ZQEA 4J16C 5LR6A 1WHSA 4WKCA 4Y6LA 3F4BA 3GLHE 3NMUF 1S3SA 3BMCA 3L7LA 1D2NA 4Y2RA 2CL5A 2R7AA 4KR2A 2WWWA 5DM60 1XEFA 3FSEA 1G0OA 3RSLA 3FTFA 2X8BA 2G08A 3FPKA 3FVRA 3HY6A 3PEUA 3ZGOA 3I01A 3VHLB 3K9WA 1UP4A 1YZHA 4DC9A 2CXNA 3QQPA 3P2OA 2QP4A 3P2KA 4XVRA 3ITNA 4I4LA 4YCBA 2K87A 2ZB7A 1N9ZA 4II7A 3ZV3A 1CUHA 5EJAA 2J0UB 1PK9A 3R24A 3MWYW 4K3VA 3HZRA 2C2KA 2LP4Y 1Z2OX 1KDYA 4F85A 2YH2A 2YWHA 3F0TA 5YASA 3TLJA 4H7HA 2NLOA 1TTHA 1XKXA 2XUIA 2D0OB 3DL4A 4G24A 4RA9A 4Y2HA 4JK3A 3BN3A 3JD4A 5CXXA 1A04A 5TGTA 1U6IA 4G5YA 4TL7A 2WF5A 3D43A 1Q91A 1SUEA 4CODB 5KJ6A 1GGNA 4LRSB 4PHGA 3RASA 5LQRA 2NMVA 2HQSA 1R88A 3HBMA 2Q0XA 4HVCA 2V8OA 4M83A 4RLFA 3ZXIA 1IATA 4BMVA 3HY4A 4BIIA 3SDSA 2EG5A 4F2GA 3KK0A 5SY4A 2UXBB 1QU2A 4I5FA 4QPPA 3N87A 4ZANA 4I1SA 1Q57A 2JHCA 3P71T 1DVRA 3FSGD 3LQFA 3MSXA 2K7FA 2VNSA 3H6HA 3LL4A 4N12A 3BPSA 3ZI7A 1Y3CE 2ZBQA 1HH4A 4EW1A 2AFIA 4RBNA 1KOGA 4RZ2A 4GMDA 3CX8A 4GP7A 2EFJA 1J8MF 4BS9A 5ILQA 3KQSA 2JGAA 1C14A 2GM5A 2BOVA 3L9WA 3PGVA 5LZ8A 4Y9DA 2PGIA 3FE2A 4NABA 5BNZA 5KJ1A 4N6OA 1GUBA 4X1IA 4B33A 2G25A 1K7XB 4ZO9A 1TADA 2YASA 1OLUA 1YUBA 4AX8A 4E30A 4YRIA 5FTKA 3SHFA 1Y4DE 1YQTA 1LNQA 1TU0A 4LBVA 4BV8A 2QOEA 2YFHA 2GZ3A 5JXWA 5EQJB 4UFNA 1HKHA 3P2JA 3SJ7A 1JQBA 3NIWA 4HYYA 2BM1A 2CXUA 4YVFA 3TOCA 5JEDA 1WDMA 5A0TA 5TPZA 3PVZA 4QYTA 1ZH8A 2FRVA 3D7MA 4QDOA 3RVLA 4PW0A 3STUA 2OQVA 1Y3HA 5HZMA 4WEQA 4XM0A 4QNMA 4M0CA 1J33A 1NWHA 1CR4A 3GJQA 4GRIA 3PIRA 3MWKA 3O3NB 4ZT4A 1YZFA 2NVUA 3S55A 2DZDA 2FZVA 3C15C 1KIFA 1GJRA 3P4YA 4EVSA 4A6DA 5INTA 3AVUA 4ARUA 1U4OA 4F6RB 1ID8A 3NPAA 3R7AA 2BF4A 1YKSA 4GXNA 4BMOB 1RQNA 1KY2A 1MVLA 1X15A 2GPSA 2WKQA 4O1IA 3B5JA 5M7EA 5K4AA 1EIZA 3K9BA 3SYMA 4LQCA 2Y4NA 3BXXA 2VDMB 2JKYA 4C7OA 3EEFA 3T3EA 1CEQA 2QRVA 3B3JA 4XYLA 4E70A 1OIXA 3N8DA 1CBUA 1KI8A 3OFSA 4KJZA 5DOVA 1CW2B 3L8MA 1OX4A 4A8JB 4XIFA 4HNVA 1BCRB 2GA8A 2H1FA 5TGDA 3H5VA 2CD9A 3LA8A 3IS3A 2EBUA 4HDRB 3ESDA 5FL3A 5K9ZA 1QX4A 3OZIA 4U7HA 5SZKB 1FMCA 1Y82A 1SOWA 3C16C 2CV0A 3D6JA 4CW7A 2ZI3A 2DUNA 2VK2A 2G88A 2CZCA 3AR5A 3QIAA 5B7QA 5IM4A 5GJBA 2HYDA 5K0BA 3ICVA 3LC7O 4DEVA 1H4VB 2FETA 2DYKA 1SOMA 2OOKA 4HAZA 1JDJA 3DCJA 2BGNA 2VJMA 3QPWA 3HBLA 2ZKIA 2IZ6A 4HAVA 3A6HA 3MILA 2WILA 2B69A 3MBKA 4NS1A 2ZZNA 1D2HA 4EYQA 1HA3A 5CLJA 1X7ZB 1VJ1A 3PC6A 2CXPA 1WSDA 1Z5VA 3ABZA 4IVPA 4FQ7A 1EX9A 2GJSA 3E5NA 2LXNA 2OGWA 4COOA 2WKRA 1JSCA 3ADKA 4KBFA 3I2YX 1UMCB 1XXLA 2ECOA 1CNMA 4YCAA 3JYPA 4JHXA 3REQB 1L7EA 1SWVA 2FG5A 1XDZA 1G1MA 4Y6RA 4MPDA 3V4SA 5CB6A 1KWGA 1Y6FA 2PMWB 1UOPA 3VKWA 4C4RA 2C4VA 2QLJA 1D03A 2ZUDA 1YA4A 2OCPA 1FDOA 3IBCA 3E9EA 1KS9A 1MAUA 1SQFA 5K2MA 1EX1A 1I13A 3VI3B 3WNVA 1T2CA 4G1EB 4H77A 3QLUC 3IO5A 3DAYA 4GBED 4LOAA 5DTJA 4W6QA 4BX3A 3OZVA 2O8DB 3U61B 3U7JA 3TNJA 4YA6A 1IBCA 2YC2C 4CV2A 4OI1A 2FK8A 4ES6A 1C4OA 2GOYA 4QDUA 1XEWX 2NUBA 5EE5B 3HWRA 4RL6A 1HLFA 1Y9EA 2VS1A 3IEXA 1Z7EA 3EVAA 4KYVA 4AS1A 2IU6A 4GX5A 1E2BA 1T9GR 2FFHA 4J0KA 4Y2SA 4PQYA 5F2EA 2P9BA 3V32A 3ZCUA 5CLFA 4D0GA 4INPA 5WRFA 3ITDA 1ZJWA 3B5EA 2DJIA 4L15A 1QYWA 5BVGA 3D3WA 2ZIXB 2AFVA 2D5BA 4ZGBA 3OD5A 5EYPA 1U1DA 4NY1A 1Q0TA 3JCZA 5TEVA 4UDOA 2ILTA 1A9YA 3BKXA 4GC5A 3JQ8B 2O2DA 3M6IA 3ZHUA 1JPNA 3T35A 1ZRNA 3CTMA 3PGXA 1RQLA 4YI3A 4TZ6A 4ENVA 1XLTA 4C0XA 5JSZB 2PHZA 3R6WA 4BAGA 1E96A 1UBNA 3CCFA 1WZUA 2MYTA 1IC6A 2MMGA 4L16A 3NP9A 4RW0A 3QHQA 2OCAA 2WWVD 3N2KB 3R3VA 3STYA 3VKGA 3NR2A 5IARA 7MHTA 1BQ4A 3I73A 3SZOA 1T10A 1USGA 4BNIA 3HDTA 1CY7A 1V5EA 4HS4A 5C80A 2NACA 5AM3A 2B1QA 2REOA 2RE8A 4EJ2A 3UJNA 4EYGA 2WSYB 3IOCA 3TRHA 1YR2A 1US8B 1DAOA 5EXTA 3VVBA 4BHTA 4E22A 1GKLA 4CDGA 2Y1CA 3K53A 4JJ6A 1DKQA 4H31A 2HSJA 3EYAA 3AK4A 1M1YB 4TL8A 3OZSA 1KZYC 4CQJA 4AN4A 1Z9BA 4M38A 2ET6A 3UN1A 4MR7B 2Y2VA 1QO0A 4Q5IA 2G1UA 1BE1A 1S89A 2WAYA 4YBZA 3T1QA 1Y9DA 3NDPA 3D8TA 5SZJA 1WU7A 3CT4A 1K68A 4B3JA 4IV0A 4PTZA 5B1IA 2PGNA 4GIBA 2AF3C 5E1MA 5DH9A 3T1OA 1AIPA 3TFWA 4S0ZA 4UASA 1II9A 4WK6A 3JYNA 1SCAA 3K9HA 4PYKA 4N3CA 4TRJA 3EGVA 3K16A 3DHEA 1E2HA 2O0JA 2V97A 3QA9A 4HH3C 1V47A 1BS9A 4JT4A 4OJKA 5FNVA 1DT3A 4I5IA 4I4TA 1ZD3A 1AQIA 1MHPA 4LBWA 4WKBA 1BMFD 5FPQA 2FF7A 1Q7CA 2E4WA 2XNDD 3MMNA 3QEJA 4Q24A 4QXQA 2IOFK 3PJEA 3WSTA 5TIIA 1A8UA 4Q1AA 3CONA 4RD6A 1EZ4A 2FMUA 3ZBQA 1O94A 4BNDB 4PG5A 4IDEA 2LUOA 1OCEA 3DDUA 3ZZTA 1YB1A 4FI3F 4Z4IA 5ERXA 3R6GA 3UANA 2ZCUA 1P45A 2UVQA 1RWQA 1QCYA 4L76A 1OD6A 1F8GA 4R7TA 3L7YA 3U39A 4JC5A 1DL5A 1U0NA 1WLSA 2EQ5A 3IHKA 1W36C 2QXTA 1RM3A 1CS4C 3ECAA 3QEKA 3H5AA 1SVLA 3DMTC 3RAJA 1PFVA 3OHPA 3EVFA 1S8AA 4HWPA 1F1JA 3OO1A 2YJ3A 2H4WA 2VPWA 2YRWA 2HPVA 1QJCA 1P6UA 1MGPA 4MVJD 3AEUB 4MUJA 3N70A 5BWLA 3MTBA 3VV3A 3AF2A 2PZMA 2P6UA 2ANCA 3O3CA 3I0MA 5J43A 3EWNA 1NG1A 3IP5A 1U98A 1PGQA 3PWSA 3AZPA 3KB8A 5IT9A 1N6KA 1UFQA 3L8ZA 3PUVA 4X85A 1BS2A 2CJWA 1K6EA 3EX7C 2EL7A 2YL2A 1RYZA 2Z1DA 4QARA 1C3JA 1KC1A 4BQOA 4CCYB 3CJRA 3L84A 1P9LA 1H05A 1TK2A 3RYFB 3TOXA 1AURA 1Z88A 3LDUA 4TRRA 1F7UA 5CVJA 5AK4A 3ZWOA 1VQ1A 2XVZA 1T4CA 2UUCB 3P0HA 3SWWA 1W0JA 3OQBA 2Y6VA 4KXNA 5BW6B 4O4HB 1S8NA 5EXPA 1KI7A 4ISCA 2ZJ1A 4KIJA 5IC6A 4F84A 4EL5A 1E5LA 2HF9A 1Y3AA 2QKYA 4TTPA 2C7BA 2E49A 3A3OA 4J16A 4TQ9A 8ADHA 3ZE2B 4L5YA 1WMAA 1RXSA 2CHGA 2P77A 1HGXA 3GJTA 2PSHA 5LB4A 3UT5B 5BPHA 4YV1A 1TF2A 2WHQA 3CO5A 3QPUA 1U1IA 4G67A 4HNSA 3K71B 1F8FA 4TVSA 1HYBA 2PXAA 2HWXA 2W42A 2BFBB 4G8BA 4R2LA 5JAPA 1CVLA 1FNBA 2P27A 2QI9C 4GM0A 5IT4A 1KAMA 5KNDH 4OTZA 1QS0B 3QUSA 3ND5A 4FKBA 1RYNA 2Z57A 3ZTYA 1W4BA 1ZCJA 2WUDA 5THKA 1C9NA 1MRSA 2IUYA 3ZDDA 5JRDS 2WAAA 1HL7A 1RWNA 1C8KA 4G86A 2Q2QA 2UXCB 2VEDA 1ODLA 2G82A 4II3A 4BNGA 3VGPA 2MHCA 1U2DC 3W79A 4J9VA 1GA6A 3DB2A 2XNSA 2DQZA 4YECA 1ZA2A 1P80A 3I4CA 2ZSHA 4G4GA 1N1DA 1SQSA 2CMGA 1L5HB 2QD2A 2QZ9A 2WWFA 3O73A 4MHOA 2F90A 5CGZA 5H1YA 1GY8A 3UCEA 4ER5A 1D1PA 4PRYA 3D8UA 1KR2A 3T7RA 3LX8A 3O0DA 3OP1A 4I55B 4YEDA 2PT9A 1IDOA 5A0FA 3A11A 3I9JA 4MA4A 3BWXA 4AUKA 1PL8A 1TKCA 5CB0A 2IHKA 1T3SA 5I7FA 1H8HD 2GAFA 4BZPA 3W9SA 4CT5A 421PA 4D1YA 3NT4A 3W0LB 2DFPA 2Q07A 2WOJA 4Q1EA 1LC3A 3AF0A 1PFKA 3M0EA 3WK8A 4CDNA 3OIYA 4GX0A 2O06A 3N07A 1JIIA 1P3Y1 2GZRA 5REQA 1MEEA 1K8RA 2ZT8A 4OI2A 3S29A 3UICA 4BBZA 3B51X 2X8AA 3NVDA 4MWBA 4BP8A 4KR3A 5JZBA 5EPEA 4IXDA 2W4QA 4IIGA 4A1FA 1ID1A 4IJVA 3TRIA 4NZNA 2P6NA 3VR6D 4LOKA 3A36A 1OFIA 1SA0B 3CX6A 3E15A 2B35A 3SF8A 4RKEA 3SZUA 1I1HA 3GJXC 1ATIA 2PCLA 4DQKA 5CA1B 4FDTA 4J91A 1R3DA 1XRQA 3F8WA 2BTQA 1J7KA 3HL4A 4BVHA 6CHYA 2FPOA 4OH1A 2BZ0A 4M2LA 1M66A 3E70C 3DVQX 3BCHA 1T0UA 4OI4A 1IHPA 2H18A 1FY2A 2Z56A 1Y80A 2FPPB 3KWJA 5EE3A 3TEFA 4YXFA 1VLMA 1VTKA 4J03A 3WNCA 3VR5A 4DHEA 2PKWA 4MW4A 4QHTA 4F5WA 1T9DA 2H11A 1OTXA 2JK0A 4JOBA 5FNZA 4KBYA 1IY0A 1CLEA 1XMPA 5D00A 1P9WA 4O4IF 4Q9NA 2WWHA 2XRMA 4RFLA 3F6RA 3G79A 1F12A 3HBJA 4XEUA 3TIGA 3NJRA 2WSSD 3D0QA 3G82C 1ZGZA 1A2BA 4I08A 3GLUA 1ZINA 2GCPA 1LV8A 2JG3A 1XCGB 1RXIA 1RTKA 1NI4A 2H2DA 1BN6A 4MJLA 1RMQA 3T54A 4AZTA 2QMOA 1C0IA 4M4SA 4UBKA 2A1UA 2QPOA 1PRYA 4UNQA 1HG1A 1SO8A 3WLOA 2W6PA 1UP7A 4TTAA 3HKBA 3IIJA 4BOYA 2WKWA 1COZA 3QJYA 2WWGA 3TQFA 1DEXA 4K6KA 1L7QA 1PTKA 2OD2A 3CE6A 3H4TA 3GRFA 3IHTA 4EHBA 1FLVA 5DHAA 1T1SA 3SBDA 3T15A 3UTDA 3NYRA 1XPJA 2PTHA 1CXZA 3DOHA 4PLWA 4GEKA 3IE0A 1M2GA 2FH5B 2Q3LA 3CNHA 1W4LA 2Q9BA 5CDHA 5TB5A 2DFNA 4IHJA 2FMKA 4TS3A 4ALKA 5A1TA 1KAGA 1GPDG 3AFGA 3H19A 3EDRA 3O4FA 5AR1A 4S05A 4O2BA 4ZVTA 3TRKA 1P7ZA 1G9TA 1L4KA 1XVAA 2R8YA 2V6FA 3QVSA 4UVIA 2YS7A 4OM8A 2BTEA 5GZ3A 1TM3E 2RAFA 2BMJA 5EL0A 4DSAA 4D3DA 2YWFA 2OCXA 5E2IA 3WYCA 3L4EA 5HRCA 4ZYWA 2R48A 1Y89A 4MVCA 1ORIA 4UXHA 3FJYA 1JBQA 3R09A 4BWGA 3ANXA 4XH9B 3QE4A 5FHQA 2JIZD 1TM2A 4KAXA 1GU1A 4RL4A 3NBKA 2VI5A 1MBZA 1RWOA 4FYJA 2R751 5C46F 1OWNA 4TMKA 2PUEA 3NEJA 2W2OA 1CZLA 3AVQA 1IBLB 2WYWA 4CMGA 2DLNA 1TCAA 4JQSA 3USZA 1XLUA 6Q21A 4RFSB 3IPYA 1KI9A 4AECA 5SZIA 4LECA 5IJ9A 2PA0A 1Y1KE 3EDMA 2H92A 4G1MB 3GEBA 2FNAA 4ILEA 4B7XA 4W9NC 2QRUA 1GUYA 2CXTA 1UKAA 1EWKA 2VYQA 1QUEA 3AGQA 3ZWMA 4DBVO 4R3UC 5EQTA 5C8XA 4CMHA 3RK0A 1CUZA 2OHGA 2IS6A 3WRYC 2RJOA 3QVLA 3JQAB 4JVNA 4FEGA 3WIEA 1NUHA 2OSVA 1QQ5A 1I32A 3GQVA 3FY4A 4XE5A 2YV3A 5AKXA 3QVKA 4LE1A 2QAJA 3GI1A 4ZAFA 5BV7A 5T4BA 3FGPA 3IDOA 2PJRA 2FX2A 4EHKA 1DJOA 4PNEA 1UWCA 1RJEA 2H1SA 2C9OA 3E3OA 2PYIA 4Z99A 1N5IA 1LF0A 2NUTA 4BVBA 3K70D 2IZ0A 3TN7A 1Z3IX 1NJGA 4E88A 2O5EA 2ZBUA 1Z13A 1NULA 3DM5A 4J3JA 4HI0E 2M6KA 3UQYS 2GK6A 3LBFA 3PFKA 4CM9A 1A5BB 4YCDA 1J2TA 1UINA 3NT5A 1N7HA 2PZAA 2R11A 4YMGA 3KCQA 1ULSA 3IAFA 5CM8B 1JEYB 1YK1A 4U7PB 1RQXA 2HIHA 3I83A 4DLPA 2VHZA 4X90A 5ITZA 1A97A 4LF9B 2V5VA 2PUTA 4P81A 5KI6A 4XVUA 5EFOA 4BLUA 4QELA 2UUBB 4K2AA 4LKOA 5IVPA 2GN6A 1EVQA 1LLCA 2X4DA 3MS7A 4ZIRB 2D7DA 1ZD9A 3S81A 4G0PA 4JR2A 4M1ZA 4EFLA 5IDYA 1PF7E 2CBXA 3DE1X 1AQ6A 1GLGA 4CQMD 4RPCA 3HCEA 1JPJA 4DMGA 4U1RA 3JY6A 1SCQA 1Y1PA 1NN1A 4MAFA 4O29A 5HIJA 4CI0B 3GPDG 1EEHA 2HK9A 4DB2A 2PL1A 4H4CA 4BBAA 2ZJ4A 5CDGA 4N4AA 3ESCA 4OK5A 4R2JA 2FPUA 1KZ6A 4KGVA 1B41A 3DWIA 4D81A 3AW8A 2LR0A 3ORFA 2BLNA 4JOCA 4OIMA 4DWWA 5EZYA 4MDFA 4CYMA 1MB3A 3B3AA 1CJSA 1O0SA 2PA3A 1HO3A 1N2BA 2W22A 1XMQB 1UZUA 2H7YA 2IOHA 1G38A 2A0UA 3ZV7A 3SPXA 1YUNA 3HNOA 4M49A 3LHIA 4MEJA 1HY3A 4QTYA 1T3LA 3EEIA 2VKQA 5TS2A 3CUWA 1O89A 4QLOA 3JVUA 4MCHA 4AUMA 1EFRA 1UOQA 3A14A 1JG3A 1PTJC 1KL7A 1OKKA 1C1DB 2XPCA 3B60A 4FBGA 4KL8S 4NYJR 3VR4D 3FIUA 1P1HA 2PSJA 3J7TA 4LISA 2WB2A 5TQ0A 4B8WA 1TT5A 2QN9A 5A9RA 1BX1A 1P4RA 4G5XA 4KAAA 4EHAA 3H2JA 1QBGA 3CRRA 1EB8A 1EZ1A 3HR4A 1W8DA 4K6MA 5ALRA 4B4UA 3DFIA 1DJNA 1DKPA 3JPWA 5EZ5A 2Z2XA 4HC4A 1F4PA 1IHXA 3DVLA 1NY6A 1QYVA 2GD0A 3C97A 4AWXA 1S8FA 3KLOA 3QP9A 1A2QA 3G2HA 2CE2X 3IDAA 2WYUA 2GHIA 3EGXB 3MPOA 2IYVA 3OEED 4GKVA 4MYUA 1GN8A 5DT2A 5E9WA 5EE1A 4DDVA 2XA1A 4Q19A 3L7NA 4KO8A 1OZHA 3N0TA 4EGJA 1WMBA 1E3EA 3MINB 1VIDA 4R81A 1GAQA 4DRXB 4TYYA 2AS0A 3CC8A 1THMA 1GSAA 4G8CA 4GVLA 2Z09A 1FS6A 1LFDB 3FOZA 2DECA 1ONBA 3PU6A 3E23A 2WIAA 1Y37A 4QBIA 3CLKA 4M7WA 1EYZA 2O0MA 5GAJA 2JZCA 2WD7A 621PA 1K4KA 2EGHA 3AKYA 3ED1A 2ZJBA 4OHMA 5EWJA 4ZEOA 4ER6A 1XEXA 2D1SA 5CIWA 1N6PA 1JXOA 1E1MA 3IPXA 4QD3A 2WUEA 4ADSG 1TZCA 3FYCA 1N8NA 5DNYB 1XRLA 4KKVA 3VDXA 1Z56C 2BLLA 4R0VA 5GGXA 1RWVA 4NFSA 4TVOA 2P69A 1EDEA 1MU0A 2I6SA 2CMDA 2YRXA 5U1PA 4YJ3A 1JH9A 2QR3A 2W6NA 4BEJA 4DLSA 2B5OA 1P7WA 2B0CA 4KN8A 5TVKA 1GRQA 5BV8A 5KDOA 4LZJA 4U7JA 3KS9A 5DO9A 3IUSA 1NXTA 4N5IX 5BQPA 4Z4EA 1EMDA 2H29A 3WB1A 1EE9A 2QN2A 1Y1RA 2HEGA 4IVRA 1PZNA 4IS2A 3RJTA 2VYVD 4BVJA 4D4KA 4TKVA 5D8DA 2PD4A 2FP4B 1TUBB 4A0HA 1G6HA 1PUJA 2P7HA 3EFHA 3PVSA 1TGVA 5F9MA 2CSXA 3R9XA 1D0VA 1B8OA 1CQPA 1X9GA 2X2FA 3EXFB 5IEJA 2GZMA 2RKBA 3MCAA 1X1BA 2ACVA 3C8DA 4OXQA 4IDPA 3MWDB 3L9XA 1SVIA 2EXXA 4INAA 4GR4A 1GZ4A 2V74B 4RDHA 4COKA 1DX6A 1N0VC 4I50A 4BB6A 4KRFA 2OZEA 4YXWD 1HFEL 2FFJA 1VI5A 1ZCZA 4M1EA 4HL6A 4Q3LA 1OLSB 5F2OA 4IH1A 5KX5F 3L2OB 3BWEA 4PSAA 5JATA 5KQSA 3C7TA 1SCBA 4RGVA 4G01B 4I8XA 5C32A 1P75A 4BO1A 5HTOA 3ENQA 5K2OA 1M1XB 2XF8A 4JR0A 1TMKA 1XJWA 4CF7A 5LIRA 2ZULA 1LVHA 2ORIA 3WWOA 2PK3A 3Q3EA 4QLAA 4U7GA 4Y2UA 4KO4S 2CW5A 3IBFA 3OQMA 3G0HA 4KXMA 5KZMB 2BZSA 3PJRA 3O0TA 3WHLA 4D79A 3PR2B 1QIJA 4D8VA 1GTMA 3K1TA 3WL8A 1C5KA 1MABA 2PX4A 4F8EA 3WLKX 5JZVA 3UM9A 1R3UA 3HXTA 4PLVA 3NONA 1W1WA 2IEBA 2VQSA 3QM1A 4RZSA 5DGXA 3SFVA 3TLCA 4CF6A 1UOOA 4UNRA 5BUCA 5EE9A 2YINC 2L17A 1YQEA 3G6WA 5CURA 4AG6A 4BV3A 2BSXA 2CVQA 2J30A 2ZUSA 2AVDA 3DVRX 3N6VA 3T5MA 1ZPDA 1S4QA 1NRWA 1Z5PA 2V0CA 3BGOS 3RLFA 3WSVA 3ZC3A 2WZDA 3CEAA 2EIHA 3MUOA 3G88A 2R87A 4YAEA 4JC0A 4PPQA 2WFZA 2HV9A 5LB2A 1T2EA 2WZBA 1DIRA 4KYTA 5TV2A 3RVOA 3MJ4A 3QKWA 1GG8A 2GYVA 5B36A 5TPWA 3T61A 2O59A 3R23A 3RYIA 4CVNA 4QOGA 1MXFA 1IWBB 2K4MA 2FQXA 2HA0A 2YWJA 3DC7A 4R6XA 3ZD6A 4G0WA 1LDYA 1BD4A 1E69A 5B1YA 2C59A 4FYPA 1TUEA 5T3YA 1W0KA 2J31A 3UXMA 1CQZA 2VBIA 1NUPA 4YUWA 3GRCA 3ADOA 3KR1A