1X8LA

Crystal structure of retinol dehydratase in complex with all-trans-4-oxoretinol and inactive cofactor pap
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
342
structure length
342
Chain Sequence
PFPYEFRELNPEEDKLVKANLGAFPTTYVKLGPKGYMVYRPYLKDAANIYNMPLRPTDVFVASYQRSGTTMTQELVWLIENDLNFEAAKTYMSLRYIYLDGFMIYDPEKQEEYNDILPNPENLDMERYLGLLEYSSRPGSSLLAAVPPTEKRFVKTHLPLSLMPPNMLDTVKMVYLARDPRDVAVSSFHHARLLYLLNKQSNFKDFWEMFHRGLYTLTPYFEHVKEAWAKRHDPNMLFLFYEDYLKDLPGSIARIADFLGKKLSEEQIQRLSEHLNFEKFKNNGAVNMEDYREIGILADGEHFIRKGKAGCWRDYFDEEMTKQAEKWIKDNLKDTDLRYPNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords retinol dehydratase
publication title The structures of the unique sulfotransferase retinol dehydratase with product and inhibitors provide insight into enzyme mechanism and inhibition.
pubmed doi rcsb
source organism Spodoptera frugiperda
total genus 123
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1x8lA00
4A2QA 1P9WA 2YV5A 1CS4C 3WHLA 4MGYR 3TVDA 2BWJA 2QTFA 1OKKD 2UZ3A 3BH0A 2IYVA 3Q5DA 3SE0A 4MA4A 2DWPA 1XMJA 2MMGA 2JASA 2QA5A 3TSWA 4A92A 1JAHA 4F92B 4DRZA 5IT5A 4BFXA 2CHGA 1R5BA 3B7GA 4V02A 2G88A 1CJVC 3KJHA 2Z4SA 4GI7A 1NP6A 2AR7A 2IF0A 4QC2A 3QEJA 3QKRB 4B3XA 2ZYUX 4QNMA 5CJ2A 4A9AA 4US1R 2AHOA 5FTKA 1XZPA 2ORIA 4M21A 1SKYB 2DYKA 1DE0A 1C4OA 5BN4A 2GRJA 3TLXA 4QNRA 3FOZA 2O8DB 1KK1A 4WZAE 4EDHA 4Q4JA 1T0JB 2WBLC 4YMVA 3BS4A 4PZZA 5SZIA 1CRQA 2NO7A 1NSTA 3NEJA 2P2LA 5CM9C 1E9BA 2ZYVX 1LF5A 5DI3B 2ZSBA 4RD2A 1N5JA 1ZUHA 1TQ2A 3EARA 3VU9B 2ZUBA 5F98A 2Q3MA 4Z54A 5EUMA 5C4GB 1NKSA 4WIAA 3OE7A 1Z28A 5KSOA 1NG9A 3QOFA 1BMFA 3KL4A 5TARA 1KK0A 1SKYE 1IOZA 1JQLB 3LD9A 3K9NA 3MMPA 2E1RA 2IHBA 4EQ6A 5CB8A 5FBLB 2NO1A 4A0GA 5FTLA 1MABA 3U44A 2V7QD 4C2UA 1QRAA 1NN1A 1NI3A 3CNOA 1XD2B 2R9VA 2VHJA 5K8UA 4WZBE 2GBLA 3AVYA 1RRGA 2L0XA 1JR3A 1XP8A 4BLPA 4NL4H 4W5HA 4PR0A 5EE1A 4LHWA 5FPTA 3ZGXA 1OXXK 4Q66C 4B2IA 1MT0A 3MWJA 1FMLA 2IYRA 1II9A 2JIZD 1NBMD 4MRPA 4PO9A 1FOEB 2YOFA 2A5YB 2GAAA 3A58B 3LBNA 4JMPA 1K6MA 4LHVA 1MV5A 3I72A 4TYQA 2Q0HA 4Q48A 4TMXA 1F2UA 4DSOA 4JL8A 4F91B 3OIYA 2EW1A 2Q3HA 3T15A 5DYGA 1ZM9A 1YRAA 3SJCA 2QE7A 2F1JA 2VP5A 2WWIA 5HE9A 2Z5FA 5AK0A 4PZYA 1OIWA 4GNKA 5TXGA 2H17A 3QXXA 5L8VA 4X8LA 3KQNA 3FKQA 4PTLA 2VF8A 2ZI5A 3Q9LA 3LY5A 1KO1A 3QEOA 5EE9A 5B58C 1EK0A 1KSFX 3CWQA 4LZZA 2FZLA 3B1YA 4DCSA 5EP4A 1FFHA 1TX4B 1YHNA 3VHLB 1JXMA 1B23P 4GOKA 1KK2A 1RC8A 4JLMA 2XOKA 3QVVA 4EFMA 1WBBA 1SVLA 2C9YA 2IWRA 5IF9A 4DKXA 2YINC 3K1JA 4L4UA 2ZRBA 4LX0A 2QN6A 4Q4LA 1CXZA 4Q4HB 1JBKA 4QGHA 1KI6B 5JHHB 3NBYC 1EFHA 3EWSA 5F2EA 3SFVA 3T61A 4WBSA 2QRZA 4Z1MD 1RW4A 5BWMA 1JALA 3GLIB 5IK2D 1J7KA 2H16A 1A5TA 4UJ3A 4HB4A 4K81B 1LB1B 1SZPA 2CEAA 2W0SA 3B1XA 4ZDJA 2ZS9A 2WPDA 3MGCA 5HE8A 5KSPA 1G6HA 3U4QA 2XNDA 2O52A 4UXHA 1W7AA 4M9QA 2EFHB 5DNYB 2ZU0C 1G8HA 4HZUB 4AG5A 3S1AB 2VBCA 1AGPA 4O0MA 4OI4A 2KSQA 2X1VA 2AFHE 5BN3A 2ZI3A 3DPUA 1XPRA 4OL0A 4A2WA 2ZRLA 4PPFA 5LD2C 3MWKA 2O5VA 4DLRA 5JLJA 2PZGA 2BJVA 3EZ6A 3QXJA 4I1VA 4TZ0A 4MGZR 4NHOA 2HYDA 1FX0B 2WSSD 4IFEA 3K70D 2GCOB 1W36C 2Y8EA 1NG1A 2ASEA 2ZAOA 4LJ4A 1KSGA 3LRPA 3NEYA 3SBEA 3GLIE 2GCNA 2H7VA 4NKRA 3VHXA 4LWZA 1TEXA 3UKDA 1Z0AA 4BLOA 2EYQA 3QJYA 3LA6A 2C98A 4BFTA 2WAXA 5HCNA 2G77B 4BASA 4MUAA 4LJ9A 4CT5A 2PLRA 1G8YA 2O8EA 5FBRB 3ICEA 2PL3A 3HPQA 2QTHA 3MCAA 1CULC 3M0EA 1ODFA 3MWYW 4AC9A 3BFXA 1XZQA 4ZPXA 4B43A 3DMNA 2VSOA 1PZNA 4QXAA 1XD8A 2TMKA 5FOSA 3LVQE 2GCPA 3VR3A 2PLFA 2WWGA 2DY1A 5AJXA 5TDHA 4OQLA 4QGGA 1IN8A 1KY2A 4ACBA 1CTQA 4I4LA 4PSKA 1KSHA 2HV8A 1U2RA 4A0RA 4KSBA 4HUQB 1W36B 4I81A 1OXUA 2DR3A 4U02A 5L3QA 3T5GA 3KKNA 4K8OA 4DDWA 2BOVA 4GDFA 3FB4A 3GJ0A 4TYYA 1M34E 1NY6A 1KGDA 4PHHA 3VX4A 4XOIA 3BFKA 2A78A 3K9GA 2ONJA 4BEBA 2HF8A 2XZPA 4TLDA 4EPVA 3SYLA 3KZ1E 2OHFA 1E9FA 3EZ2A 4JL6A 4C7OA 2KWIA 4LJYA 3BB3A 4ZCMA 4ON9A 4DLVA 2Z4RA 3ETLA 1S0UA 1Q21A 1K5DA 2REOA 5KDLA 3H2YA 4WAUA 3A1VA 3WMEA 4OBEA 5TV2A 1JJVA 1X8LA 2GNOA 3FMPB 3LFUA 5FUXA 3EPKA 1FPMA 2YKGA 2XSZA 1XRJA 3TRFA 2ZJAA 2RGGA 4NCHA 1TMKA 3TSZA 721PA 3CRMA 2YWHA 5EXTA 2AD5A 3ASYA 2G1KA 4Q7MB 2IYSA 3CO5A 2A9KA 3HWSA 1RJ9B 4IKEA 1KKLA 1GFIA 5FUVA 3TR0A 2J41A 4E03A 2ZETA 4IOMA 4OQMA 3T35A 1MO4A 4CF7A 3FMOB 2XJ9A 2B21A 4GSYA 4M9XA 4DBLC 2ERXA 3QKRA 3K09A 1N6NA 4Q9JA 1OE0A 1OFIA 2QBYB 1OFUX 4M8NE 2X77A 4XVQA 1VCOA 2FEMA 4LGMA 4J0QA 1X86B 5FR2A 1OXVA 3HU1A 4YXWA 1NKTA 4FXPA 2O8DA 3CPJB 1JEEA 3CLVA 1OLOA 2PCLA 1DPFA 1MO5A 5CIQA 4AYTA 2VA8A 2R6CA 4PZLA 4LC1A 1DTSA 5KU1A 2GXAA 1YVDA 3K53A 5G41A 5KNCA 4TMKA 1AA9A 5G40A 3C4JA 4FW9A 4HYYA 3AGQA 5HCIA 3BD9A 3VR1A 2PEYA 4FCTA 2GETA 2YWGA 5LB2A 2P67A 4Q00A 3HR8A 3B78A 4JSYA 4DUGA 3W34A 5K8IA 1ZJ6A 2J87A 2YYZA 4EPRA 4WOPA 4BLSA 1Q1BA 1FQKA 2WAYA 5GJCA 4KO8A 5KHOC 2RB4A 5AUPB 3THXA 3ZVMA 4D80A 4B47A 1ZUNB 5EZ5A 3X1DA 1WDTA 4TYPA 3Q7QA 4DEYA 4O25A 1KI1A 2WOOA 2JLYA 4OK5A 1K8RA 1EFTA 2W2XA 4Q7KA 4BFWA 4JKIA 2KE5A 2BMJA 1H8EA 1HE8B 1XD2A 2OCPA 5LPNA 2P6UA 4TYWA 4IXNA 2OZEA 2JCSA 2CVFA 2NIPA 3AF3A 4S2EA 2ORWA 3QPVA 4LHZA 4XH9B 4B76A 2RH5A 1KMHA 1AZTA 1N25A 1W5TA 2GESA 4B3GA 4M1KA 2FGKA 3D8BA 2ZE7A 1KOFA 4LYHA 3TR5A 2DCUA 4KFUA 1ZD9A 4D2IA 4BEJA 3PUZA 5KPJA 4C4PA 3TAHA 3P32A 5IRCD 4OHVA 1GSIA 3T12A 3MAAC 2VP2A 3PITA 1YZTA 4YQFA 3H4MA 5JS8A 2X2EA 5EE3A 1E4YA 5KO2A 1UADA 1DAFA 4L15A 4RD3A 4QJ3A 1NBME 2F6RA 1ANKA 4PO1A 4JVLA 1YJ5A 4LYAA 1QBKC 3B9PA 4BFSA 1G64A 3AB3A 4DCTA 4ZI3A 3CPHA 1KO5A 3NDPA 1QHHA 1R2QA 4D82A 2DHRA 2FPKA 2J3EA 3G82C 2CBZA 4FINA 2D7CA 1RRPA 4JSTA 4KV9A 3FHTA 1KO4A 3TW4A 4S35A 2GJ9A 3VFDA 1T5IA 1JECA 4RZXA 2G83A 2IA5A 3K70C 3NG1A 1Z47A 2REBA 3BH6A 3TMKA 2B8TA 1G7SA 2FDCA 1OSNA 1Q1QA 2A5JA 1GRQA 1OXSC 3SU8A 1TF5A 4HLDA 4ASUA 1Z63A 5D3MA 4NCNA 2ZI9A 1EFCA 5DIFA 2ZJYA 4Q4HA 5JWHA 1MKYA 1G21E 1KI6A 1Z6GA 2P5TB 2P0EA 4OHWA 1QVRA 3UWOA 4ZCLA 2ONKA 1XJQA 1U98A 2GJKA 3QF4B 2IL1A 1E9SA 2VP4A 1EFRA 4GZMA 5KYKA 4TQ9A 3EW9A 1E9RA 4G1UC 3TKLA 2CDNA 4HLUC 3QKUA 1Z0FA 121PA 1KI2A 2QZ4A 4AYWA 1WXQA 3QIAA 4R7ZA 3SYKA 1OXTA 3SFZA 1Q0UA 1XEFA 3IEVA 1GRNA 3CWZA 2VP0A 2HJGA 3C5CA 2PX3A 1RFLA 2W58A 2FX3A 3K70B 2HCBA 2QQEA 1TQ4A 2VEDA 3BERA 3DMDA 3S1AA 4BLTA 3V4RA 3UIEA 1HY3A 1GRRA 1CJTC 3P26A 421PA 3DZ8A 3T1VA 3U7GA 2ZXUA 3WNDA 2PCJA 2J7PD 4XVUA 1GNPA 1FX0A 3BK7A 2GCOA 3CF0A 4QBGB 3KX2A 4FWTA 4OHYA 1Z07A 4MYUA 5FL3A 2WIBA 4CRWB 1P6XA 2HXYA 5EE0A 1UEJA 2VO1A 5SZJA 1IN7A 3O8RA 4M1OA 3FE2A 4YC7A 3FTQA 1NL3A 3RNLA 4B44A 3GJ6A 2VPPA 4A2PA 4MDEA 2ZRDA 1UF9A 3KKQA 3NBXX 1OH7A 4DEXA 3W6PA 2QSYA 3VX3A 1ZINA 3ZQJA 1DADA 3FHCB 2WHXA 3IHLA 4URZR 5TY0A 2JJ1A 3T1QA 4CEIB 2ZYWX 2R6AA 5AUQA 3ZZTA 1NLYA 3C41J 2GZDA 2QMHA 2IXFA 2OUKA 4I1SA 4LI0A 4Q1BA 2HLDA 3VR5A 1TNDA 1BH2A 2QY9A 2CK3A 4HUQA 5FTMA 4FIDA 4PC2A 2ZRAA 4TL7A 3NIBA 1TU3A 4FMBB 4IDNA 2AXPA 3EXAA 1W47A 4DLTA 2ZRHA 4LJAA 4A4DA 2CNWD 3X1WA 1CR1A 1GP2A 3QBTA 4GP7A 3HYTA 5FOVA 1QHYA 1ZP6A 4Q5IA 2NPFA 2V1UA 3GD7A 1DELA 3RVBA 1T5LA 4BFVA 2R65A 2OT3B 3ASZA 3WBJA 3RDPA 2CL7X 1KHTA 2R44A 2UZIR 1SXJC 2IUTA 3CX8A 1DG1G 3IILA 4RZ2A 5JSZB 1ZU4A 5HZHA 3BB1A 1XWIA 4NYIR 1OKKA 4V0KA 3L8ZA 1D2NA 4TLBA 4NU0A 3FFAA 3AVOA 4DWJA 1D5CA 2GJAA 4FN5A 3QPUA 4IOLA 2WZQA 2AXNA 1A2KC 4LY6A 4HATA 3E2IA 4ESVA 1R4AA 2H5EA 3RRMA 1QHNA 5BQ5A 4DDUA 4DJTA 4PSVA 1Z0KA 1VYTA 3LDAA 3QG1A 4PAMA 3MG9A 3VMFA 3SEAA 1RJ9A 2RGAA 3KUDA 1H65A 1U9IC 4ZV4A 2FFAA 5J5CA 1E9DA 1CRPA 3CH4B 5FI0B 1WQ1R 1HQYE 3W3AA 5HPYB 3DOEA 2LKDA 4JT4A 2F3TA 2Z83A 1XJ0A 4RZ3A 1JB1A 1Q3TA 1I2MA 1NMYA 2D2EA 3CR7A 5HKKA 2BMEA 5EP1A 1VIAA 3B6EA 1N3BA 1ZD1A 4NTZA 2V8OA 3I3SR 4C9BA 3TUZC 2MSCB 1VIYA 1P7CA 2GXSA 1W0JD 5KUTA 1ZC4A 4NMMA 1G41A 1S1MA 2ZI7A 3MJHA 3PG5A 2VQSA 1ZCBA 3PEUA 4ZIRB 5L3SB 4IJMA 1U8ZA 5FL7D 4DLXA 3PV0A 5H68A 4B71A 3A36A 1MH1A 3PENA 2RHMA 2CJWB 3I5YA 3SQWA 5FFMA 4CEHB 2R6GA 3T1OA 1CR4A 4YMUA 1X1SA 1G8FA 1SULA 2FH5B 4Q4AA 5CYOA 2V7QA 4N1AA 4RD6A 5JWRA 1KMQA 1QF9A 4RD1A 3ZH9B 2JJ8A 4K46A 4MRVA 4GMXA 3PXGA 1OF1A 3FMFA 3EPLA 3JVVA 1VCMA 1G7CA 2ATVA 5JFGA 2UVQA 1ZM7A 1IN4A 2HF9A 2OSBA 1E1RD 4RD4A 4A8JB 1TUEA 4PHFA 1DAIA 3QPWA 4Q1AA 5AJZA 2JIZA 5FR1A 3I92A 3TW8B 1SGWA 1TL7C 3KQLA 4TSFD 5J4LA 4BQSA 2CLCX 1H8HA 5IDVA 3LLMA 2OO7A 2RCNA 2IS1A 1Z0JA 3DM5A 4NBSA 2NQ2C 4O2RA 2ZRNA 2FOLA 4C0LA 1ONBA 4BLRA 5ANRB 2PT7A 2GEUA 4MUBA 1VYUA 2ZRJA 3ZIAD 5J4KA 2RHDA 4B73A 1MO6A 3AP3A 3ZZUA 1R0YA 2SHKA 5FPSA 1LS1A 2GA8A 2WKRA 3UANA 5LB4A 3GEEA 1HT2E 1Z29A 2QTVB 1OH6A 1IHUA 1RIFA 2D2FA 5CDFA 1T8UA 2WMOB 3U6BA 4PC6A 1OHHA 3B1ZA 5CITA 4AWXA 2W2VA 5H1YA 1AKYA 1VG0B 2R8RA 3AKCA 4DB4A 4QM6A 2GF9A 4E09A 4BRWA 5KPDA 4MKHA 4AKGA 2NOAA 1SQ5A 1UKZA 4MYHA 3EAQA 2Z43A 3HYRA 4L9WA 1G9XA 3CRRA 3IIMA 4BWYA 1KSJA 2OFXA 1E0SA 4NYMR 4Q9KA 3LVRE 2F9LA 2VL7A 1DS6A 2B7CA 3I5XA 2A5DA 4C2TA 5UKDA 2W6JD 4NDZA 4JYCA 4Z1MA 4QKQA 2VTKA 3OZXA 1I4DD 2JLVA 2ZEJA 1D6JA 1KJZA 1A82A 2J59A 3A8TA 3NHAA 4EUNA 2ODWA 2IX3A 2QROA 1W4AA 1T91A 4UNSA 2ZSAA 4JJKA 1D9XA 3H86A 4RFSB 2QPOA 4LC0A 2CVHA 3TK1A 2IWHA 1KIMA 3L0SA 3RANA 1I4LD 1E9CA 3B85A 5DISB 1L4UA 2BJWA 2R6FA 2WJYA 3WYFA 2I4IA 4HAZA 4ARZB 4MDFA 3ZYCA 3I73A 4YMTA 2JDID 2V6JA 3B1VA 2VSFA 4IVQA 2WSSA 1E2LA 4TMZA 4B3BA 2IUUA 2QU8A 1XPOA 3ND8A 3GLHB 1QHGA 4KFSA 2RGBA 4B3DA 2G9NA 2V1XA 1XNJA 4TL9A 4W5WA 5JI2E 2ODBA 3AVQA 4NONA 1LY1A 3NBFA 2QENA 2VHCA 1XFAA 4US0R 4JLVA 621PA 1E79D 3LW8A 3CB4A 4IVPA 4N0DA 2BKUA 1WBDA 3P1JA 1P5ZB 1PLKA 3KFXA 4OK6A 1II8B 1JXOA 2EFGA 3SR0A 2OAP1 4YLGA 3VNUA 2CHVA 3GLHE 4QGFA 2ZM5A 2VRWA 5J40A 4AD8A 3Q72A 4JLBA 1GVNB 4G01B 5JHGB 3GLFA 3W9YA 1FP6A 1FZQA 1XD9A 5K8TA 1U8AA 1HYQA 4NCIA 1E2JA 4OKSA 3I61A 2PBRA 3SJZA 3EPHA 5EXSA 1VHTA 2PMKA 2QP3A 3K0FB 2IS6A 3L2OB 5A0FA 4JT2A 4QJ4A 4AKIA 2QP4A 2LCFA 1TAGA 4B3CA 4DSNA 1G19A 1T0HB 3RC8A 4DHEA 2FSIA 1XCPA 1P2TA 3B8HA 4A1FA 4GP6A 4Q19A 3U2QA 4NCKA 2XB2A 3UXMA 2XGJA 1XEXA 5FTNA 5KDOA 1IONA 3D6TB 1N6OA 1ZYUA 2F43B 3KJIA 1U94A 2A5GA 1KO7A 2B6HA 2IXGA 1RZ3A 4LDJA 2PT5A 1QHIA 3PR1A 1P60A 5FBWB 1SVSA 4WA7A 3A1UA 2HXSA 2LWIA 3CIOA 5C18A 4JLOA 3DZDA 3WBKA 5H70A 1YU9A 2F1HA 1E9EA 4U7DA 1K5GA 3GQBA 4W7SA 1M8PA 2V54A 3WP1B 1GL7A 3ADBA 2AX4A 5E3HA 2IYYA 4PC7A 4D0LB 5DSZA 4RFVA 1KJYA 3EX7C 1N0UA 3QQ5A 4RVCA 4GFDA 5JZVA 2VYFA 4G5RA 1G5RA 2PMDA 3BBPA 1UBGA 1N6HA 1Z0IA 4PPQA 4Q1EA 3PJRA 1TADA 4C0AC 1KY3A 2XTMA 5SZKB 2G3YA 4IOJA 2OLKA 2OEPA 1KI7A 2RGCA 2XTZA 3PEVA 2DFKB 1OT3A 1NY5A 1R7RA 4MH0R 5C4MA 3GFTA 4D4LA 4M53A 1JQJC 4B6EA 1EESA 2ZR7A 4KVGA 4QRHA 3R20A 5L3RA 2KJQA 4Y0AA 4OI0A 4MKGA 2QNRA 4LCBA 3JZAA 1P2VA 2PZEA 4A15A 5CYPA 3KKMA 1E2IA 4MQBA 3GLGB 4TMTA 3FKSD 4D4JA 4ZIRA 4P3YA 1XXHB 1BYUA 2LKCA 2RGNA 3A4NA 2ZU6A 2DFTA 3HP1A 3A6PC 5EZ6B 4V0ME 5GJVC 1A7JA 1DOAA 2A5FA 4F4JA 2V3CC 3AF1A 1G7TA 1KK3A 4JLJA 2DFLA 5AJVB 1Z2CA 3QSYA 3HJNA 1QHXA 1VG9B 4ZKDA 4TMVA 4FMDF 1ZVQA 1NVWQ 4PC3A 2GXQA 2JLUA 1WA5A 1TUIA 4L16A 3CNLA 3U3RA 3PEWA 3X1YA 1IQPA 2H8KA 4CEJA 4TLEA 1GKIA 3EG5A 2D74A 2FFHA 3VKWA 1UM8A 3IKJA 3LBIA 1XF9A 3GLGE 3FGNA 2QT0A 1XXHE 1SKQA 5FUWA 1X3SA 1L8QA 2YWFA 4G5QA 4GT1A 2ZSFA 4A8JA 2XZOA 2BV3A 2IYZA 2IEYA 2YJTD 4DLUA 1GDDA 3GEHA 4TL8A 3BH7A 4Q7LA 3SDZA 2IHYA 1ZNZA 2EWVA 1W5SA 2ZS7A 1XEWY 3KJGA 2JEOA 4MITA 2OFWA 1M7HA 1N2CE 4D26A 5LD2B 1N0WA 3TQCA 4C0SA 3UG7A 3QVUA 3RRNA 2HYIC 4KBFA 4JLPA 4P4SA 2GEDA 2VLIA 1U0JA 4TT3A 2ATXA 2P5SA 2WJGA 3Q8XB 3NC0C 2J45A 1Z6XA 1YZLA 3U61B 3SZRA 3DVLA 3EIQA 1WP9A 4URXR 2UKDA 3K0SA 4XTRA 3LBHA 3EZ7A 4B33A 4EJSC 2W6ID 3OIWA 3BXZA 3GEIA 3CUEF 4FMDB 1IAQA 3CBQA 3ND9A 1OFHA 3LV8A 5DGXA 2NO0A 2WKQA 2ECKA 4P33A 2AFIE 1XTSA 5JCPA 1S4QA 1JR3D 3ZLJA 2ZRMA 2J9RA 1J8YF 1XU4A 4CDGA 2JATA 4RY2A 1ZBDA 2ZJ5A 2WVJA 3KTAA 2YWEA 2OV2A 1E2HA 1BS1A 3QBVA 4OHXA 4HLQB 2QAGC 2ZYTX 4DDTA 3O8DA 4Q9HA 1AS2A 2GILA 3KKOA 1ZM3A 4X8HA 4ZDWA 4OI1A 4L8GA 4RFSA 4EJSB 2XXAB 5LDDC 1DAMA 4KHZA 3AF2A 2GK7A 2HEIA 2Q6TA 2ZQ5A 4RKFA 5SZHB 4URYR 1P9NA 3L82B 4PQYA 4QBIA 2J0QA 3HPRA 1KNQA 4WXPA 2Z6VA 1VG1A 3K0CA 2C77A 4M1YA 2NGRA 1CJMA 5JJIA 2QL6A 2E9SA 1NLZA 3FDIA 4M1TA 1ZUIA 2XOKD 2J7PA 3MLEA 5DE3A 3AVPA 1SXJD 4G5GA 2XTNA 4Q18A 1WMSA 5FOUA 2YNMA 5DI3A 1P9RA 2QAGB 2ZJOA 3U3JA 1W2GA 2ZS8A 1Q20A 1N6KA 2WWWA 3C14C 3VU9A 4CT4B 3GPLA 2CL6X 4MYTA 1OYWA 3I8SA 4XVRA 2OESA 2DWOA 2CLSA 4AK9A 2F1IA 4ILEA 1E1QD 3D31A 4JLNA 3IO5A 1JPNA 3CF2A 3IPXA 4AI6A 2ZRCA 1KJWA 2IC5A 2GXUA 3WNBA 4UNPA 1OFTA 1NSFA 5JS7A 1II8A 4MGKR 2XNDD 3GJ8A 4DCVA 1P61B 1PLJA 2F3RA 2EQBA 5JRZA 2FN4A 1SVMA 4ZO4A 1XTIA 3RAPR 4KYIB 1F2TB 4KITB 5DN6D 3ICQB 1E96A 2QORA 3RC3A 3IQXA 2WWYA 4DSUA 1KTVA 1ZNWA 2C9OA 3EPJA 2GVDC 4Z8YA 2GWHA 1XCGB 3KB2A 2CNWA 4I99A 4X8MA 1XTJA 3NH9A 2CHQA 2WMNB 1HT1E 3CX7A 4XWAA 3WRYC 4CIDA 2FF7A 4LYFA 2AWNA 2IXEA 2F43A 3NBZC 1NVVR 4FMCF 1BYIA 2Q9BA 1KYIA 1GWNA 4V03A 2OM2A 3BORA 1G8PA 4O3MA 4TLCA 2N46A 2OAQ1 2WWHA 4GZLA 5DO9A 1LVGA 2ODNA 1F3OA 2P6RA 4QBFA 3TNFA 1L4YA 4WVFA 1UDXA 4HAWA 1OIXA 3QNUA 3DEFA 3P4YA 2GF0A 3THOA 1KZ7B 5HTKA 1KI8A 1T3SA 5F9HA 1E6CA 2B7BA 2AK3A 2ZE6A 4LHYA 3TUJC 2D4HA 2J0VA 1V5WA 3LLUA 2FV8A 4US2R 4DLWA 3KQUA 2NTYC 4BFYA 4Q47A 4G3XA 4AURA 4H9GA 4QOSA 2OG2A 1LV7A 2PEZA 3U3KA 1GUAA 1RE0A 3TH5A 4LUCA 5FUYA 1YZUA 1YZGA 4IHQA 4OHZA 4ZDKA 4TYNA 2GTPA 1TQDA 3T5DA 3QXSA 5C46F 1J99A 1YR8A 1ZM4A 3X2SA 3GLIA 1VCIA 5L3VA 1X8JA 4D4KA 4NP6A 3B60A 4Z51A 1G3MA 1S9DA 4OJQA 4C0QC 3ADCA 1P72A 4TQAA 2ZR9A 2ZUDA 3RLFA 1E2EA 4EPTA 3ADDA 3CR8A 4IDHA 3EC1A 4BZXA 5FL7A 3H0KA 4NYJR 4FMCB 3RYTC 2BEJA 2QI9C 1G18A 4HZUA 4JBWA 4E22A 4XJXA 221PA 2QMOA 3G5UA 4CZ2A 1NNEA 3B1WA 4HDOB 3WP0A 4B74A 3V9PA 3SS8A 4MKFA 3SBDA 3TQFA 2BKEA 4OJKA 1PUJA 1T6NA 3OEED 1JNYA 1E2NA 1O3YA 4IFBA 1E1RA 5BYKA 4DT1B 2ZE8A 2NMVA 2GBLC 1EWRA 2RMKA 5GADl 1IY0A 4Q4JB 4TTRA 1IJFA 3Q3JB 2GJ8A 2YOHA 4Q1CA 4UNRA 2JJ2D 1AS0A 4TSFA 3RS5A 2WJHA 2XAUA 3OFND 3BOSA 2NPIA 4LV8B 3OIVA 1EX6A 3OAAD 1DEKA 3QG5A 4P0TA 4QGAA 3VQTA 4QL3A 2I1VB 4II7A 1IXRC 1GOTA 2BVNA 2BC9A 4PPGA 4D81A 2G0NA 3BE4A 3V4FA 3ZIAA 3RABA 2GVZC 3B13B 4Q1FA 1XJCA 1T3HA 4IVRA 2ZRKA 4DUGD 2YOGA 3B5JA 4EQ6B 1D9ZA 1AZSC 3X1ZA 4PFSA 4HAVA 3U5ZB 3I62A 1NIJA 3AVTA 1KDOA 3MSXA 3U44B 1N6PA 1IN5A 4M9SA 2B8WA 5J4VA 2NZ8A 2QEQA 521PA 4LHXA 3N5CA 4XWKA 3LH5A 3CX6A 1A4RA 4R2IA 1FQJA 4E5UA 3EC2A 1CJUC 1EXMA 1T9HA 1E99A 4PHGA 1XMIA 4JKYA 4B35A 1DAHA 3FVQA 4A6PA 1Z8FA 2QP9X 4BFUA 2E87A 3CM0A 4XIGS 1J70A 2N1BA 5EE5B 5E4FA 5KSZA 4A6XA 5EXXA 4E07A 3OEHD 2MSEB 3EIEA 5AJWA 1LNZA 2ZROA 5B2ZA 5TB5A 5B64A 821PA 2OCBA 1M2OB 1FW6A 4TZ6A 1EFUA 2D3WA 1AQUA 1NJGA 4IEIA 3SHWA 3K0AB 3KQHA 2W6JA 4TN1A 1XB2A 2K5UA 4EPWA 3EZ9A 2MMCA 2JA1A 5EUQB 5E7JA 3DM9B 1E2QA 1HH4A 1ESNA 1JR3E 1II0A 5EP3A 3GJ4A 1DAEA 4D4MA 1YQTA 1COWD 2CXXA 3IEUA 3DL0A 3SNHA 4O2LA 1ZU5A 2GZAA 2QSZA 1MOZA 4JZKA 3W8RA 2JLZA 1G5TA 2CCKA 3RHFA 2JDIA 1Q3HA 2O8CB 3CRQA 2HJVA 1CIPA 5FOXA 1SXJB 1Y63A 1BOFA 4WW0A 2QBYA 1PUIA 2IK8A 1S2MA 3LWNA 2ZE5A 4W9MC 4GBMA 3HU2A 4B2LA 1FNNA 3VR4A 5BW8A 4PANA 2WJIA 3GP8A 2QPAA 4MRNA 3DOFA 1GNQA 4PQFA 2VH5R 1G3QA 4ZDIA 1R5OA 1G16A 2C04A 5K8LA 2BM1A 3QXHA 3NC1C 1F5NA 2FJUA 4XSHA 4YONB 1WB9A 1TPZA 1YR6A 1FUUA 2C78A 4JJZA 1R0XA 4M2LA 5J4HA 1R10A 4X8OA 5GVSA 1S8FA 1QG2A 2FA9A 5GVRA 1L7VC 2AN9A 2CE7A 2DPXA 1CP2A 1N5LA 1UBCA 2Q21A 1SXJE 3U4QB 3R9XA 4CW7A 2J0UB 4R9UC 2NO6A 5FPYA 1N6LA 1A1VA 2C99A 1SVIA 4P4TA 4BLQA 3WXMA 3NWJA 1W4RA 2NZJA 5JBQA 1XX6A 1W4BA 1AKEA 4XD7D 2A3RA 1NBMA 1F2TA 3GCGA 5AJYA 3KQKA 3CONA 3AGPA 3AF0A 5FOTA 1NVUQ 4URUR 2PH1A 1OYYA 4KCGA 1KDTA 1RRCA 3RSOA 4EFLA 2WV9A 3IUYA 4JLDA 2RAPA 3R7WB 4B3FX 2GEVA 3OHMA 2EU8A 4RD0A 3TE6A 4DCUA 1GTVA 2O8EB 1E2FA 3ECCA 1G3IA 1DVRA 3ZDQA 4YMWA 1RYFA 1VG8A 2CCJA 4QG7A 4UQOA 5EXPA 3QF7A 3GFOA 1ELOA 2VHTA 3BB4A 4IDPA 4MGIR 1W46A 2ZUCA 4LSGA 5EQTA 5AR1A 3CRW1 1YR7A 3L0PA 3RWMB 4LBYA 1JAIA 2J0SA 1VCNA 1OB5A 1WF3A 2IW3A 4KFRA 3ZVLA 2RGXA 2ANCA 4UNNA 2F9MA 2N42A 1Z6AA 3PUWA 5L3QB 2X2FA 4JLAA 3TUIC 3U7EB 2JAQA 1VKJA 2YHSA 3QE0A 1NIPA 5AUNB 3WY9A 2D06A 4GMDA 1DBSA 4Q9LA 5DHAA 4H1VA 3CF6R 4KAXA 2FU5C 2ZRIA 1Z5ZA 4OI2A 2F7SA 4P31A 3ADKA 3K09C 3VKGA 3WHKA 1BO6A 3N70A 5CIWA 5IK2A 1T4GA 4C7OB 4JLKA 3DO6A 2PJZA 2PJRA 1O87A 3QY0A 3MWLA 1JJ7A 3QF4A 5CK5A 2QRNA 2C2HA 4XWOA 3CNNA 4Z8XA 3RWOA 3E1SA 1W49A 3IBGA 4PAOA 1OH8A 2JLXA 4LRWA 3FKSA 4I1OA 2Z0MA 3U60B 1TF7A 3LAWA 3W3ZB 3LXXA 1LW7A 2BCJQ 3CRVA 4JBYA 3WYAA 2EVWX 2C96A 4NYIQ 1JEDA 3E5HA 1DO0A 4TL6A 5IHPA 1Z6YA 1C9KA 1R8QA 2HT6A 3WNCA 1R0ZA 2C8VA 2IF2A 1LS6A 2R2AA 1GG2A 1W0KD 4QJ5A 2IEZA 1HE1C 2O0JA 5EP2A 5E7IA 4HEJA 3W6OA 1ZIOA 3V00A 1OV4A 5G53C 4LBVA 4GPTA 5JRJA 5DH9A 4EIWA 3G0HA 3A1TA 4DZZA 2QMEA 4LYJA 4KLZA 5TMPA 1P2SA 4DT1A 5CLLA 2A7QA 2JLRA 2ZRFA 2FFQA 5HKKD 2BM0A 1ZCAA 2D62A 3DKVA 3SJBA 4C0JA 1Q1EA 1E98A 4HLUA 4LBWA 1P75A 4LOAA 4MKIA 4DXAA 1L2TA 3TJZA 5CK4A 2IT1A 3U3MA 4LV6A 2WSMA 3OESA 5FH9A 4CEIA 3SYNA 3GJ3A 1MO3A 4ZI2A 2QAJA 3TGPA 4DB2A 2A30A 4F93B 2ZITA 3THXB 2BDTA 3NH6A 5JEDA 3MRSA 2H1LA 1N5KA 4ESHA 5A5GA 2C95A 2EWWA 2W6IA 3AVXA 4MRSA 1EGAA 4Y0VA 1CR0A 4DLZA 1G5PA 2IYLD 1IXZA 4Q02A 3ZZ0A 2ZJ2A 3PCRB 3WMFA 1UKEA 4YMSA 2R62A 1ZNXA 4F38A 4KSCA 1IY2A 4I1UA 5KOYA 3NVAA 4IRUB 4TLAA 4DSTA 3BGWA 1KMHB 1M74A 1EWQA 1CKEA 1NMXA 3BIFA 4GOXA 3AM1A 4QHYA 1NRJB 2VHUA 2VP9A 3NDBB 3T1TA 3FYHA 2WICA 2AWOA 4M1MA 5EJEA 1SHZA 2BEKA 5DYIA 4R2HA 5DLQC 5JSZA 1UAAA 3AVUA 1H8HD 2OBLA 4U00A 4AG6A 5M04A 3K0AA 4EFNA 1N6RA 4A0FA 2O8BB 3PVSA 4AKHA 1TQ6A 3QENA 5FPHA 3C15C 1FTSA 3CPEA 5D3QA 1HEIA 2EFEB 4RSGA 4QHSA 1XTKA 4LJ6A 2F55A 2G0TA 1E9AA 5AUOB 3MUFA 1QHHB 3U3OA 3UMRA 3BFVA 4P4UA 2B92A 2ZIAA 4KODA 4Q7JB 1PV4A 4BPBA 1P62B 1OHHD 3I4LA 2QUZA 2REXB 1KO8A 3A4MA 3BJIC 1RRFA 3R8FA 2O8CA 4C30A 3O8BA 2YC4C 4HB2A 1SXJA 2GDJA 1DG3A 5E7MA 3NKVA 1Q57A 3KDSE 3KXLA 5D3MB 4DC9A 1TU4A 4NH0A 5B30A 3PUVA 2FMXA 1US8B 3H1TA 1GKUB 2C03A 2IYXA 2WKPA 4PX9A 4CGZA 2QT1A 4NYMQ 4QM7A 3SQXA 1UEIA 5L3SA 5J47A 3U7HB 1HTWA 3AV0B 1E2GA 4B2PA 4HAUA 2KBEA 1Q1ZA 3QKSB 3C16C 1G1MA 4H1UA 1E1QA 2YVUA 2CJWA 2J7KA 2XJ4A 2IYTA 3TSOA 3ZS9A 4HB3A 4CEHA 1YRBA 4B6FA 4TWZA 1S9HA 2G6BA 4CVNA 1U9IA 4URVR 5DI9A 3VNVA 1YZQA 1KDRA 4RJLA 3GJXC 2BBSA 3KUCA 3WRXC 2J0UA 1E69A 1NLFA 2AKAB 2ZPTX 4IXMA 4IOKA 4FWIB 3MD0A 4PXAA 3LX8A 5DN6A 3SJAA 2ANBA 5HZKA 2ZSEA 1NN0A 2GAOA 3JZMA 1CJKC 2DBYA 2QM8A 3B2EA 3UMSA 4ZCIA 1F48A 2XNSA 1QHSA 4JL5A 4ACAA 4F4IA 1XDBA 3KKPA 1RVDA 4FCWA 4IEEA 4LV5B 3PUYA 3SHFA 2BBTA 4YDSA 1S1CA 3KJEA 5KTYA 4P32A 1P3JA 4QHTA 1G291 2FGJA 2IUSA 3AKEA 3AVVA 1P4SA 1OPXA 3E70C 5E95A 4KLNA 4N0EA 2BBOA 1G3RA 1XBTA 2BMDA 1UKVY 3JVUA 3P27A 3R7WA 4DCNA 1GZSA 4UXJA 4QFMA 5F3WB 3OE7D 5C1BA 1UPTA 4F7WA 1FNMA 4XTCS 2XZLA 1BMFD 2AKYA 5JI3E 1Z22A 4DIDA 1ZIPA 4U5XA 5G3YA 4RCZA 3RRYA 3HU3A 1S3SA 1FP7A 2FSHA 1I4TD 1I2DA 4FD2A 4LPKA 3BWDD 1DO2A 1JI0A 4GOJA 1CF4A 2ZI6A 2IYWA 1P73A 1FUKA 3HDTA 5BXQC 3CH5A 3LO5A 1U8YA 4WXRA 1W2HA 5CB6A 3W90A 3DKPA 1Q12A 4UNQA 1KI4A 3W8NA 2ZI4A 1IJEA 1YE8A 2GZHA 3C5HA 2C5LA 2J46A 4R71A 3MFYA 1E2MA 1GM5A 3T34A 1KI3A 4DIEA 3PUXA 1U0HC 4B48A 5CM8B 1OJLA 2QE7D 1J2JA 1XCMA 1R6BX 3QXCA 3IDQA 2JLWA 2FPLA 5FBQB 4YDHB 2RGEA 4KU4A 2BIFA 1R0WA 1AK2A 1RYHA 2QQ0A 3K8YA 1ZM2A 4BUJA 4GRAA 4LJ5A 3TIFA 4ARZA 1F6BA 1AIPA 1GILA 2EFDB 1M6NA 2OBMA 3IHWA 3PIRA 3RSLA 1VDZA 1G6OA 2VP6A 2W2TA 4LJ7A 4AIIA 1N0VC 2IYQA 1G4UR 2ZJZA 3A4LA 4POAA 5FTJA 2O0HA 5BYJA 3CZPA 3R9WA 3GLHA 2O8FB 3OEEA 2P6NA 1GIAA 1ETUA 4V0OA 2KB0A 2CLDX 2AL7A 2NG1A 2XITA 4TTQA 3QKTA 1KNXA 2C9CA 2WJJA 3A1WA 5FBVB 5JJLA 2XB4A 3UG6A 4BZQA 2JJ2A 3L0OA 2RGDA 3OFNA 1W4CA 2X8AA 4N3NA 4HAXA 2ZVPX 4Q03A 1C1YA 1NJFA 3OAAA 3VTKA 1TTTA 2J1LA 2WPDD 3C7KA 1BKDR 1IXSB 1CEEA 3SI7A 4PAQA 1X8KA 3F3YA 1KAGA 3U6KA 3THYB 4LK2A 2QM7A 5H8WA 1YZKA 5LBIA 3LNCA 3RS2A 5G3ZA 3UK6A 3A37A 1HA3A 3LX5A 3IIKA 1NN3A 2AD1A 1VHLA 1CR2A 4FI3C 3W5JA 2WJVA 1XEWX 2FFBA 4Q4AB 4AY2A 1X1RA 2FWRA 1R5NA 4M0LA 3ZQ6A 1DAKA 3K0FA 3W5IA 3BAFA 4F4CA 2ORVA 2PX0A 4HI0E 2Q9AA 3R9IA 2WTUA 1GITA 1KZGB 3W6NA 1E2PA 4BFZA 3WMGA 1UJ2A 2DB3A 1WRBA 2H18A 5JJKA 3ZJYA 2R6DA 3EASA 4NZYA 4A36A 2GHIA 3RS0A 1AGRA 3U7FB 2EYUA 3UPUA 4BECA 2CE2X 3FMIA 3OEHA 3EA5A 2V4ZA 2I1QA 4UKDA 1UBFA 1IY1A 2QMUA 3GMTA 3KXKA 4Q21A 3GJ5A 4NPHA 1XMVA 3REFA 3LQQA 3LQRA 5F9FA 3AF4A 2FZ4A 5FI1B 1U0LA 3AQ4A 3I8XA 4B75A 2W00A 3AEZA 4ABYA 2ZAMA 1OW3B 2F1RA 1N6IA 2VHQA 3DDCA 4FCVA 4D6PA 1J8MF 2O8BA 3AVWA 1COWA 3IPYA 2IYUA 4HUTA 2HUPA 5A4JA 3F8TA 1LFDB 3N2IA 1LF0A 4TT3D 1F60A 3LXRA 5KNBA 4HAYA 3P20A 5CJPA 2IS2A 4NCJA 4JIMA 4TMWA 5FPKA 3IBYA 2KI5A 1Z6TA 4LBZA 2FEOA 4KFTA 4RKEA 4V0MA 1PLLA 3B9QA 2HT1A 2NO9A 2V9PA 2XX3A 4HZIA 5BN5A 3RS4A 8OHMA 1E3MA 2BHRA 3WYGA 1W0JA 2X19A 3HR7A 4HDCA 5DHFA 1ESMA 1J90A 4PHTA 3THWB 3TBKA 2OILA 1HURA 4M22A 1S96A 3RRZA 3I32A 5CDFE 1US8A 1AN0A 1JPJA 3LW7A 1CLUA 1QVAA 3GLGA 2ZVQX 1SVOA 4OYHA 5ELXA 3SOPA 1XXHA 2XSZD 1M1YE 1YKSA 6Q21A 1HUQA 1ZAKA 1T3LA 3F5FA 3P4XA 2WOJA 1E0AA 3QKSA 4PC1A 2PZFA 1W44A 4C0KA 1MRSA 1E94E 2ZJ8A 3AUXA 1S3GA 3EWAA 1FL9A 4MRRA 4V0NA 4A0HA 3CKLA 3FPAA 5B57C 1FMJA 4AYXA 5KSYA 1ZW6A 1OIVA 1CU1A 4JVNA 4V0LA 3RS3A 3L0IB 5J4YA 4BGDA 1KKMA 1WE2A 1E0JA 2QG6A 3OF5A 1LTQA 4DLSA 2VSXA 1GKYA 3IGFA 1Z83A 4XD7A 3KXIA 4IDOA 2W0MA 4URWR 3UATA 1HV8A 3M6AA 4KVAA 1E0KA 2JLQA 4QBHA 4YXWD 2FG5A 3I1FA 2I3BA 4W5JA 2WM9B 2EFCB 1AJEA 4EKDA 2G1JA 4OQNA 1KI9A 3NTUA 3GFPA 4UJ5A 1VMAA 5TVKA 4EPYA 3UWKA 2QPTA 1Q22A 1GL9B 4RCYA 2OE2A 4G0NA 3ZS8A 3REGA 1VTKA 3CW2A 1MABB 1E32A 4LPSA 1IBRA 4JVSB 1SVKA 4ITRC 1XTRA 5GJWC 2V55B 5P21A 1BIFA 3BRWD 2OXRA 1XPUA 3GLFB 3F0TA 1G7RA 2ZJBA 4L5BA 1XMSA 1B0UA 1VECA 1DAGA 2WWFA 4EPXA 1Z2AA 3GJ7A 4OK3A 4B34A 4JVMA 3SC3A 2WWXA 1SHKA 4PSAA 1H8ED 2MSDB 2VF7A 5JCZA 1E2KA 1X6VA 3VR2A 1DARA 1AQYA 4HLCA 5JECA 3O8CA 1QZXA 3ZD7A 3QUSA 3L43A 2ZREA 1N5IA 2D7DA 1JR6A 2WIAA 2ERYA 1MR3F 1IM2A 2FNAA 5KDDA 2IS4A 1XEXB 1F2UB 2IBMA 2ZSDA 4IDQA 4M4SA 5FOWA 4D0GA 3VR6A 4XSGA 1YZNA 3O47A 2BCGY 4BE7B 1UDWA 3GLFE 2YZ2A 1PJRA 2OBNA 3PQCA 3DHWC 3AH8A 5HR5A 1E2DA 4KXFB 2H57A 3IO3A 3PFIA 4Q9IA 1W48A 1E4VA 4G5SA 2BMFA 3ZVRA 1R8SA 1NVVQ 2QGNA 1VYVA 3IIJA 3OIUA 4EJSA 1D8TA 2XXAA 3KFVA 2DFNA 1V43A 3K0EA 1ZC3A 2A2ZA 3M1IA 2FE4A 1Q44A 1UBEA 2RGNC 1P2UA 3Q5EA 1ZRHA 1U99A 3FHOA 4Q01A 4HSEA 1W0KA 2YC2C 4TTPA 1EX7A 4DDVA 2HCJB 1QDEA 3L8YA 3UMFA 2OFOA 4EAQA 4BRUA 2XEXA 4M9ZA 4KBGA 2ZR0A 4ASUD 1G4AE 4MYCA 2O8FA 2DWQA 1SVWA 3TVTA 1RPZA 3PEYA 1Z3IX 4L9SA 1E79A 5JMTA 5JWOA 2QAGA 1Y3AA 1QG4A 1D2MA 2ODEA 3D3QA 1VPLA 5CLQA 4C0HA 2GJSA 2RKOA 3ONWA 4JYBA 2KBFA 1M7GA 4A8JC 4G5OA 3VKHA 2ZANA 3AKYA 3Q7PA 1ZD8A 1EFRD 3ZVNA 1NF3A 3C8UA 1NMZA 1YR9A 2ZRPA 2VIIA 3AP2A 3CZQA 3EIHA 2ZTSA 4JS0A 4LJ8A 4DLYA 1G3UA 5KNDA 3H84A 4PPNA 1HQCA 4M1SA 1AM4D 2GK6A 1W1WA 4C0BA 3QI2A 4OQFA 3THYA 4PO8A 3FWYA 3Q85A 2HDNB 4NYJQ 1T8TA 4A82A 1MRNA 4BZPA 3A1SA 4B32A 4HB0A 1U90A 3KB1A 2W83A 1OH5A 3J81k 4AKEA 4RZUA 1G8GA 3AKDA 4GL2A 3VAAA 1G20E 2QGZA 2ZRGA 4ZKEA 2FSGA 1GNRA 3NHBA 4CEJB 4M1WA 3MJRA 1U81A 2CL0X 4WZ6A 3K9HA 3D7MA 4JBXA 1GL6A 2AK2A 2FPMA 1GAJA 1ZNYA 4KYUA 1NN5A 1IN6A 1A2BA 3NXSA 3N2EA 2GKSA 3X1XA 4DVGA 1M7BA 1UKYA 3BC1A 5GJBA 1ZMXA 3M4YA 4PQRA 5JEEA 1UFQA 3R8CA 1XTQA 4ERNA 1KDPA 4TQUS 2FSFA 2JLSA 3AP1A 4UXIA 3ZD6A 2Q3FA 3RS7A 1D2EA 2BBWA 3AUYA 2JJ1D 1NVXQ 3K9LA 2OXCA 1TF2A 4P4SB 2OCAA 4Q1DA 2HLDD 1WCV1 2P65A 2JGNA 2H92A 2J5XA 2OLJA 4IW3B 4R98A 1Z08A 4CYMA 2CK3D 1G17A 4NE2A 1W36D 1CBUA 4OQXA 3FFBA 1Z0DA 3B82A 2Q9CA 1Z06A 2CMKA 4C3ZA 5AWFC 3EZFA 1TEVA 2OCYC 3TAUA 1EG7A 3T06B 1AS3A 3K0CC 1OB2A 4KJZA 3SN6A 2CCGA 1PVOA 1RKBA 2V6IA 1KAOA 2O0KA 3IQWA 2P3SA 3KTAB 3EA0A 4HDQB 4D0NA 1FTNA 4KI0A 5C2JB 3THWA 4D25A
chains in the Genus database with same CATH superfamily
1P9WA 1QH1B 2CXTA 3CURA 4R2KA 4B3TB 5J9FA 3K1ZA 3Q5DA 3S55A 3N2NA 5AM3A 2MMGA 4A92A 2XUQA 1MQ9A 4TTTS 3CZ9A 2UUAB 3T3GA 4BFXA 2CHGA 4EX6A 5K4AA 4WLVA 5F52A 1O57A 5AHRA 3VZQA 3DQQA 3KJHA 4BMYA 2Z4SA 3EMDA 5DP2A 4GI7A 4HRAA 1LDNA 1NP6A 1TMOA 4FYWA 5DGIA 1PDVA 1NBIA 1U2ZA 1QRUA 2IH4A 2VAPA 5B3AA 4J3NA 3RVKA 3KSRA 3UJBA 5CJ2A 4A9AA 1T6YA 4POOA 2AHOA 3SS9X 1BX0A 5EWMB 4TWJA 1OGJA 2IDKA 2ORIA 3QVOA 4FOOA 2FQQA 1DE0A 4K86A 4KRGA 3LP5A 4M21A 4R68A 4AWAA 5BN4A 4ND1A 1TGVA 4EYEA 4R6XA 2WWRA 2PVPA 1H0KA 2RGYA 3AESA 2B0CA 5BNWA 4Q4JA 4GKVA 1T0JB 1TKCA 1T29A 1PIWA 1Z3CA 4YMVA 1DXYA 1CRQA 2NO7A 1NSTA 2HDOA 4LXQA 4ZPJA 1O08A 3W5UA 5A03A 5DPMA 3OURA 3PQDA 3S1LA 1OX5A 4KLAA 2Y1DA 3HEAA 1YA4A 4PVCA 4D6YA 4RD2A 1L5LA 4RA6A 2ZIFA 1Y4AE 3VU9B 5F98A 4UAJA 2VG8A 5EUMA 3DD1A 5KJ1A 1V8DA 4F06A 4NV3A 3QOFA 3T41A 4X6XA 1DJOA 3MS4A 4ZI5A 2XBLA 1KK0A 3D43A 1JQLB 3FWKA 4XQ0A 1QB7A 4YGYA 3MMPA 4FLEA 4HLNA 5FYDA 2BUCA 4EQ6A 5CB8A 1FDRA 5FBLB 5FD8A 2JIPA 4F96A 1GO2A 2NO1A 3W7VA 4B6QA 4D3FA 2VH2A 5FTLA 4MUFA 2J07A 1Y8CA 5I9MA 3HKBB 3EZGA 3RSSA 4O2AF 3E22A 3EHDA 4WASA 4C3UA 5K2MA 5K8UA 1ENYA 5IARA 4FGZA 2FLWA 3WJAA 4CL0A 5CB4F 3T7RA 3AVYA 1RR6A 1T2VA 2Z57A 3K6RA 4BLPA 3OX2A 5ALPA 4PR0A 2LCQA 4EEXA 3KTOA 3ZGXA 2RARA 1J4AA 5JFTA 1FNBA 1MT0A 1FMLA 1Z8DA 2EG9A 3OOJA 2JIZD 5U9CA 1HO3A 3MRVA 3DLPX 1XALA 4MRPA 4YMIA 3STWA 2I99A 2A5YB 2IRWA 1JBEA 2P9YA 3PXXA 3T7SA 1RZRA 4YV1A 1YS2X 5ALGA 1R0CA 5EY5B 3PHBE 4G8CA 2VBIA 1MV5A 3K8ZA 2CSUA 8ATCA 1QFSA 1NU8A 1T4MA 2WC1A 1F2UA 4F91B 1KHHA 1YNSA 3L1KA 5DYGA 4KRXA 3SJCA 4FR2A 2QE7A 2VT7A 2VP5A 3FCEA 3G9QA 3IX7A 2Z5FA 3FDZA 2GGSA 4GWKA 5GWXA 4QPDA 5BUSA 5AKZA 3N6XA 3DLHA 1Y3IA 1KEWA 2VF8A 3QEOA 2GBPA 1S4MA 4R41A 1IBCA 1VPWA 4EHNA 5BV2P 3FRIA 1KU6A 3LGXA 1FFHA 1O6FA 5EP4A 3RD5A 1D7OA 3I05A 1ZLXA 5BN1A 1N8TA 9ABPA 2W90A 2XOKA 3ROPA 4L5YA 2DKFA 3QVVA 4EFMA 2HN9A 4J90A 2X1LA 2IWRA 4ENUA 3QHPA 3K1JA 2ZRBA 3PX3A 1G1AA 4EG4A 2BR3A 2OQIA 1CY1A 1Y3DE 2EGHA 2PU7A 3H6GA 1VOTA 1LDEA 3JD0A 1E8DA 1MFZA 1O6BA 4Q4HB 2IHZA 3REQA 3U13A 4BKOA 4CI9A 5JZ9A 2CV0A 5TPWA 4EA9A 3C39A 3NBYC 1WY7A 1EFHA 3DBLB 4HS9A 4WNAA 4Z1MD 4FD3A 3IQHX 4RVUA 3HVUA 3U3ZA 5BWMA 6GPBA 5IK2D 3GLIB 1A5AB 4H7DA 3M4NA 4JMLA 2H16A 1A5TA 4MSUA 4TRMA 3ENNA 4E2ZA 5FULA 4YAEA 3B1XA 2X4DA 4ZDJA 2V0GA 1FXWF 4FGUA 2WPDA 5H83A 5KSPA 4AICA 2Q5IA 2Z09A 3B6ZA 3RUEA 2AZ4A 4M9QA 3FZNA 3GGDA 3VPHA 1WHTB 3UMCA 2EFHB 2ZU0C 1G8HA 1UIRA 3ELUA 4IQ4A 3O5AA 4PX2A 3S1AB 3TZ6A 5HP4A 4P2BA 2KSQA 1J6UA 3L46A 3OLYA 4C20A 1XPRA 5TQ0B 1JHVA 5E6RA 4A2WA 5LD2C 1O94D 2O5VA 3ETJA 3OICA 2BJVA 2FCRA 3QVGA 4MW4A 3FSGD 3QLVC 4N48A 3K70D 1YDGA 4MQUA 2GYUA 2SKCA 5DX8A 3E2PA 1NG1A 2ZAOA 3GLIE 4HQ0A 4ZO7A 3UV3A 1T4CB 5D5PA 4LYGA 5H9VA 4PEVA 3LDFA 5BT9A 4NKRA 1VCHA 4UTPA 3L7YA 3VHXA 4DAOA 4ZAYA 5M34A 1P29A 1J0BA 2GN4A 4COKA 1NASA 5K45A 1J97A 3BXHA 2BEVB 2EYQA 2OB2A 2OZKA 3LA6A 3HN6A 4GEGA 2WAXA 4HEA1 5HCNA 4BFTA 2G77B 2O2DA 3TNJA 3C85A 5IDXA 3AEQA 1A4IA 5AYVA 1TRKA 3AYXB 2PZBA 4LJ9A 4MWZA 4ZGBA 1UMBB 1FX1A 3LC2O 2CWWA 1M34B 1YMUA 3Q15C 4LY9A 4FJ2A 3HXLA 2X0KA 4Z4FA 2QTHA 4EL0A 3WGUA 3NDRA 1DU4A 1I14A 3QWAA 2GPTA 3BFXA 3OT5A 4ZPXA 4B43A 5I9NA 2K87A 1PJCA 1PZNA 2SKDA 1MIOA 4QULA 1YSCA 3GLGB 3NATA 1QE3A 2GCPA 5GOZA 2WWGA 1X7ZB 2ZB3A 5TDHA 1SXQA 1CUSA 1KY2A 4EK9A 1CTQA 3H8SA 1U2RA 1U7ZA 4A0RA 2OPHA 4KSBA 2GZMA 1UCFA 3E5RA 3M5PA 2LDBA 4QLAA 5IAOA 3A1NA 2DR3A 4U02A 1CJSA 2I7DA 1WV1A 5L3QA 3AEUB 1DWUA 1YDHA 1M34E 2XOEA 1C2YA 1R27A 4YWJA 1U80A 1EZZA 3SR4A 2PSJA 1LLFA 3F4BA 5GV8A 1NZFA 4BEBA 1DQYA 5D7NA 5HZKA 3ROQA 5JISA 1L5VA 3SYLA 1NVDA 4ZC8A 2JARA 1OA1A 2Q8QA 1FFBA 1QFZA 1B93A 1Y3CE 4QO8A 4EA7A 1V7CA 4LJYA 3P97A 3BB3A 4LKRA 4X6LA 4ZCMA 5J2TA 4ON9A 1OU0A 5IJAA 1XCOA 1VQ1A 5A62A 2Z4RA 4L8VA 3CRNA 3KR0A 3I0NA 4AJKA 3ZCRA 4D9BA 1U0BB 4HKTA 2J5RA 5BNZA 5LDHA 5KDLA 2HPZA 2OD9A 3AL0C 1QG6A 1BXRA 1KL7A 2J8ZA 3KDPA 3TLMA 1STOA 4OBEA 1LTHR 1IULA 3WMEA 4DLAA 1X8LA 1Y3HA 2BFAA 2GNOA 3B36A 4WUVA 4E6EA 4CKXA 1PGJA 4B81A 3TRFA 1W93A 2GNAA 4IIDA 3BZBA 3P2OA 2RGGA 2YMMA 4NCHA 3TG2A 1TZJA 4QDKA 1GAWA 2AD5A 1ZPDA 2B0JA 2OC9A 5DNVA 1P6UA 1GLGA 4ZVLA 1FYEA 3CO5A 2FVYA 2OSVA 5K6TA 4JB8A 4IKEA 1CZRA 4BO4A 1KKLA 3QBDA 4KP7A 3PKZA 3TR0A 2FPRA 2I7CA 2J41A 2ZETA 2IU3A 2VCEA 3WO0A 8MHTA 4D9EA 2WUGA 1GTL1 3B6MA 3FHJA 4EYGA 3K31A 3CUVA 3FMOB 4M9XA 4EP1A 2F4VB 3ZQKA 3EAGA 3QKRA 1N6NA 2XRFA 3IAS6 4Q9JA 2DXIA 1OFIA 3CINA 1HYBA 4GLLA 3WIEA 6REQB 1LX6A 4U8GA 1TM1E 2X77A 5DRTA 3RK1A 3S2SA 1VCOA 1PTKA 1C9JA 1T5OA 2FEMA 4LGMA 3U9TA 1OZFA 4BB6A 1RM5A 3INRA 1P3Y1 3HU1A 4TQGA 3G1TA 1CUGA 1Z4KA 3QMVA 2PCLA 3AY0A 1NYQA 3QP9A 4CN9A 1DO8A 3FY4A 5LIPA 1N1GA 2O07A 4FZRA 2R6CA 3JQFA 5CVTA 1DTSA 2VZLA 4JJFA 2GXAA 5L9AA 4CIBA 3CV3A 5KNCA 1PL7A 1FFCA 1S89A 5HCIA 1AA9A 3H42B 3BD9A 1D2HA 1WL8A 5AVRA 2JVIA 2YWGA 4TWIA 5LB2A 1Z26A 3JY6A 5DCYA 4DAEA 4DUGA 1OTHA 5K3EA 4IHKA 2X0JA 1CD5A 1R4MB 4K40A 4L0MA 5K8IA 3GUCA 2YQZA 1IPHA 2YYZA 4V38A 4EPRA 3MXOA 4F2WA 4BLSA 1GAQA 1Q1BA 4F1JA 3IPRA 3SHVA 4R2JA 4KO8A 5GJCA 3TLJA 3UYKA 1ZN8A 2O23A 5JXIA 1QH0A 3HBFA 1SIBE 3CUSA 1ZVMA 4PG7A 5EZ5A 2DKNA 4AMVA 4DEYA 3PVCA 1KARA 3BMNB 5DLDA 4GPBA 4CTJA 1CDOA 4XCXA 5LZ2A 3IYLW 3T9AA 1REQA 3M1YA 2BMJA 4CF5A 1XD2A 5LUAA 2OCPA 2P6UA 2CXHA 4TYWA 4JEMA 4JJ4A 4ARUA 2JCSA 1ACLA 1TA0A 2NIPA 3ABSB 3A4TA 4Z2YA 2ORWA 3QPVA 4LHZA 4PZ9A 4XH9B 1RM4A 2QZJA 3HWRA 4EUEA 2CL5A 4NHEA 1WKCA 3K6JA 1AZTA 3RTBA 3MCVA 3H5AA 4M1KA 1EP9A 2OG1A 2JHAA 2JFBA 1KOFA 1M75A 2ZE7A 3D8BA 3QYPA 3D8RA 4IIXA 4LYHA 5CGQB 5CAEA 2R1VB 1V2GA 1MO2A 1XKLA 2CLMB 2V5AA 5G0VA 4BEJA 1NVMB 4RHFA 1JSXA 1X7XA 2X3UA 2AOXA 2B30A 3L0BA 3Q3HA 4OHVA 1RPNA 1J21A 4JOBA 3H8VA 1YA6A 1ZAYA 3EYWA 3PITA 1BXGB 1YZTA 3FOWA 3H4MA 4G63A 4RVOA 5NLLA 3O31A 3V4LA 3DE6X 5IG2A 5JCJD 4TWBA 1HF3A 4L15A 1K2WA 2NUPB 2P5UA 1NBME 2AOTB 2B98A 1L5RA 1MENA 1BE1A 3PDIB 4JVLA 3UH1A 4LYAA 2ORED 4XLZA 4BFSA 3GJZA 3NHPA 2W6CX 3TSYA 3CLRC 4MS4A 4ZFNA 1R2QA 4D82A 2DHRA 3G82C 3GBPA 4JSTA 4KV9A 4YCMA 2D7CA 2QTRA 5B6PA 2WLTA 3CXRA 1KO4A 4B82A 3E7XA 1XTPA 3H16A 3N59A 1C4KA 4GQBA 4I2NA 4S35A 1T5IA 4FC7A 1IQUA 1Z56C 3HGMA 2G83A 1GR1A 2PAAA 4UFOA 5D84A 5EOVA 4CODB 5A4KA 3K70C 3RAFC 4AMUA 2FDCA 4J3FA 1M73E 1IEQA 5IW8A 3QU4A 3L93A 2ONCA 3SPXA 3SU8A 3N6VA 3K4HA 5JAPA 4ASUA 5DBOA 2BFDA 3LL7A 4NCNA 2ZI9A 4TUYB 5EZYB 2A84A 3V4PB 3F4KA 5DM4A 1XDGA 3RNOA 1PQ4A 1DRJA 2BYTA 3PJDA 5U1PA 4DLPA 5HX7A 1D1QA 1KI6A 1W8IA 1Z6GA 4OPMA 5KYVA 4X61A 3ZZ1A 2M2IA 2Q1XA 4JP3A 1AHNA 3K4QA 3AFHA 2AQIA 1U98A 1D4AA 3SMQA 1JWLA 3LY9A 4K3UA 1SCDA 3I9OA 3R5SA 2PXAA 1PWXA 1QTNA 1RAIA 2VP4A 3IP1A 3ISTA 4GZMA 3EW9A 4G1UC 5CTJA 3TKLA 3USZA 5BPFA 2MOKA 2ZJ3A 4HLUC 1OBCA 4LRUA 5D2CA 3TSAA 3UZUA 5IANA 2QZ4A 2PS3A 1FSGA 2YS6A 5B1DA 3AR6A 1KS2A 3QIAA 2Z8ZA 2BR5A 5GINE 4TM7A 5EHXA 3ZDAA 4DJJA 4PFQA 2SCUA 4ZRDA 3J80A 3DMDA 3JQAD 2FXVA 3V4RA 4O1HA 5BV7A 1HY3A 1EVJA 421PA 3VC3A 1LPMA 1G5QA 3DZ8A 3NNNA 3T1VA 1T4BA 1Z68A 3NHYA 3WNDA 2IV3A 5A6SA 2I9KA 1GNPA 4BNIA 1FX0A 2JKZA 1Y7LA 2O4CA 2XT6A 4CLDA 2O1WA 5I4BA 5K03A 3HE3A 1WR8A 3MM4A 1ZD2P 4A26A 1Z07A 4D79A 4CDMA 4QU8A 1NV8A 4Q12A 2WIBA 3FWHA 3QA3E 4QU5A 4RESA 3R6LA 4FT4A 1RLJA 2OB1A 2YNMD 5EE0A 5EQDA 1UEJA 3H8JA 3W2FA 1JQ5A 4LFCB 2O0MA 1I5RA 4M1OA 3FE2A 1L1FA 4EMTA 5C8DA 2LIVA 1KEEA 2P6OA 3TLBA 2VPPA 2ZIXB 3C8MA 4ZI7A 1C7EA 1N9ZA 2YHAA 4NWIA 1YFLA 2JZOA 3ZLBA 2E5WA 2HU2A 3TOSA 1TZCA 3DTVB 3ZQJA 3VX3A 5CYFA 1KF0A 4MR7A 3NC4A 4C4SA 4WL0A 2BH2A 4KV7A 3FHCB 1TM3E 1N7HA 3G2LA 2AW3A 3ER8A 1RXSA 2BGUA 2JJ1A 3LPDA 3EYAA 1E4OA 2R6AA 3OKFA 1UC9A 2DRIA 2ET6A 3T5BA 4C6HA 2IXFA 2OUKA 4FX5A 2QOEA 3CMCO 4GAEA 1UOPA 1Q1AA 4I1SA 4Q1BA 1TAHA 1Q7BA 1TNDA 4PZDA 4UUNA 3RTAA 1QLWA 1GTMA 2GO7A 3JSXA 1CB7A 5L6MB 3QKIA 4YROA 3EHEA 3ANSA 3UCEA 2XNKA 1GQFA 4TL7A 1QGZA 4E7PA 3NIBA 1TU3A 2GPSA 4CM9D 1NUUA 3ONNA 3CIFA 5F2NA 2JANA 4I9NA 1Y7IA 3NV7A 5DNEA 1W47A 3MJFA 2A1UA 4G81A 4DLTA 2Y4NA 1GGVA 3N8NA 4C0XA 3TDKA 4DIMA 3AHCA 2GD0A 5DDIP 2BFCB 4Q5IA 5FIUA 2R65A 1P0CA 2OT3B 1XG5A 2ACKA 3WBJA 2GFIA 2NZUG 2ON6A 2HQ1A 3LCUA 3RDPA 1GG9A 3BHJA 2BFOA 4RXTA 2X22A 4M9RA 4A10A 1DG1G 2X8LA 3BMOA 3F5SA 3PU6A 3IILA 4RZ2A 4EW1A 5JSZB 1TOAA 1QRTA 3IR6A 3GEMA 1EMDA 3MILA 4HNAB 3ZK9A 4BATA 5KJ6A 3AVOA 3BPSA 3BX1A 3U80A 3W2GA 4FN5A 1DBPA 4DWJA 3FYTA 3HJUA 3WLSA 2CVQA 1USVA 2AXNA 3PYXA 1LZKA 4OG2A 4R0VA 5I8ZA 2OO5A 4HATA 4R51A 4EKNB 4ESVA 1FDVA 4GMKA 2OUIA 3C3CA 5EHNA 1XZIA 3EMVA 4PAMA 5H59A 5ALFA 3MG9A 1RJ9A 3KUDA 4CMEC 1U9IC 4ZV4A 3RC7A 3T4UA 1CRPA 1WV0A 2HRRA 1O9HA 2P78A 3V8PA 3HDJA 4OXNA 4YV0A 3DEJA 3DOEA 4NOLA 4RFLA 2LKDA 2NU6B 4MK4A 4RZ3A 1HFWA 4MVXA 2AH5A 2HWWA 3IAHA 1EDOA 1NMYA 3ZG6A 2HR1A 4ME6A 4Z1OA 3HUDA 4WWHA 3IUBA 1M8FA 2V7XA 1Z35A 2V8OA 3F7NA 3R4CA 1P74A 4ZRNA 1Y5NA 4MYDA 2GXSA 1RXIA 2WK1A 3AONB 2FX2A 3MJHA 1WZNA 3DS8A 3N3BC 4WOBA 2VQSA 1KH3A 4Y2JA 5A9SA 4IJMA 1IWBB 4QXQA 1KRWA 1UBLS 2BEUB 3HTXA 4L28A 4FKMA 4DLXA 1XIVA 1ZCJA 3FYDA 4B71A 3PENA 2RHMA 4KXLA 1RBZA 4AP6A 3PHGA 5FFMA 2VQ6A 4ADSG 4CEHB 4Y2UA 3JATA 2B35A 4MMYB 1SULA 2QRLA 5DOZA 5I8WA 4Q4AA 4L72A 4QQRA 5ERYA 1E3LA 1XZCA 3H13A 3O73A 1QF9A 4RD1A 3VVCA 1THZA 2QRKA 1H05A 4LNUB 4F7DA 3RJZA 3OX1A 3Q5GA 4ZJUA 4GMXA 3JALB 3PXGA 1X7DA 1W75A 3EPLA 1V25A 3JVVA 3NAZA 2ATVA 4UC0A 5A0TA 1B2RA 1ZM7A 1IN4A 1E1RD 4OFXA 3HCNA 3TIVA 3QELA 4A8JB 1L1RA 4M98A 5I48A 1G55A 1N2IA 3VPGA 5B36A 1TL7C 3M6IA 4DZRA 4BY9E 1WNTA 1BMTA 2CHUA 4TXNA 5K20A 5IDVA 2H4JA 1J8DA 1Z0JA 2JGLA 4UPEA 5KX5A 2I91A 4QD3A 4GSKA 3A27A 3GEGA 5DVZA 4C0LA 1ONBA 4BLRA 4C4ZA 3R3ZA 5GTDA 5ALSA 3DTYA 4BZWA 5J4KA 1M2GA 2RHDA 2ZTLA 3SQLA 3LHDA 1XZHA 3VBCA 2JBWA 4R1LA 2OBBA 2WKRA 3UANA 3GEEA 1HT2E 5F3RA 3O8QB 4Y30A 4M60A 3QUCA 3ZV3A 5BV0A 2D2FA 3C5WP 1OVMA 4Z9FA 1H3NA 5CDFA 2WMOB 3T7JA 4FDLA 5CITA 4NZMA 1B16A 2W2VA 1SBTA 2CD7A 4I3FA 5HFNA 2D1SA 3VJRA 4NJMA 2VK1A 1QX3A 1ZGZA 3BL8A 4EG5A 1IOVA 2COKA 3ICCA 1E3QA 3C3AA 1EXNA 1PKEA 2NOAA 1V8PA 1H93A 2I78A 1DINA 3QHAA 4ZQIA 1U1FA 1G9XA 1N3YA 2VN8A 4HCJA 4GZ5A 2OFXA 1EX9A 1E0SA 4AMYA 2IU4A 4Q9KA 1N78A 2P75A 5CTAA 2VL7A 1IUOA 1UBKS 2SICE 3LQ4A 4DV2B 5HMMA 1W88B 4LXIA 2A5DA 3BULA 4L22A 4J16A 4YJGB 5T6BA 3L1VA 5BYAA 2PZJA 1BU8A 4F8EA 3N39C 9LDBA 5JXJA 2VTKA 2A0FA 1ZONA 3A8TA 1A82A 4ZICA 4D74A 2O2CA 4OA8A 4EUNA 2OZLA 4YP1A 1OILA 1T91A 1JDUA 1WLSA 1LKZA 2A67A 2C2ZA 2ZSAA 4YIKA 2G71A 4J9VA 3C4QA 3UWMA 3UUFA 2QPOA 1UKAA 2CVHA 3BJZA 2ZTMA 4JEHA 3QWIA 2V0NA 2IWHA 4Z4GA 2DTXA 3RVNA 1MV8A 5E3JA 4BOYA 1KBZA 3RYHB 1I4LD 3VC1A 1H3FA 1G59A 4BNLA 3FM9A 2GM3A 1D3AA 4MKXA 2BJWA 2R6FA 1BD3A 2Z95A 2I4IA 3LKBA 3DE0X 3VBEA 3VYRB 2HLPA 5BMOA 3DAFA 3T3NA 4QEKA 4ED9A 4YJ2F 1RC0A 3B3QA 2JDID 2V6JA 4MUYA 1YI1A 3B1VA 3QJGA 4G1FA 3C4VA 4KREA 2QDXA 4RL6A 2Y6VA 3N58A 3PFNA 2IUUA 3AWDA 4B3BA 3UVEA 1P7ZA 1AHHA 2P4QA 1H23A 3ND8A 4FFDA 4HNRA 2OYRA 1PS0A 3N0WA 5HF6A 2RGBA 4B3DA 5IMBA 4AUEA 4LQDA 1DQNA 1SU7A 4HDKB 4XPIA 3ZJUA 3L4EA 4PTZA 2ODBA 3UJ9A 1X3LA 1FP4A 1RQPA 1SC4A 2HWXA 3S28A 1IC6A 1ZN9A 3B52X 3OFKA 3SY8A 1LBQA 4B3JA 1NC3A 4EF4A 1Z73A 2I33A 1W85B 3DMTA 3W6ZA 3GH1A 4V1CB 1I3CA 1E79D 2E5LB 1QIMA 4G5YA 5ESRA 4N0DA 3QUBA 3OZUA 1N2HA 2BKUA 4IVPA 3ZK7A 3OCVA 4F6RA 5C1PA 1WBDA 4FOLA 1I0ZA 3DG9A 3P1JA 5K0LA 1P5ZB 4YRQA 5KYTA 3IJRA 1PLKA 2AS0A 4O4HB 3JD3A 3IT3A 2RG1A 4OK6A 4PE5B 5ELMA 5KJCA 1B8UA 2HWYA 3GDHA 4YLGA 3SR0A 1BE0A 2CHVA 3HRIA 4OU5A 4HDMA 1JW9B 1KQPA 2PMCA 4YJHA 1LLDA 5HM6A 2DUUA 3K94A 1FZQA 4FU0A 3TWOA 1XLTA 3NX4A 4LJKA 5THKA 1HYQA 2DJ5A 1XA3A 1VKHA 3R7LA 3UYLA 2FEWB 1VSBA 4PX3A 3OCXA 3IDFA 2QP3A 3HYSA 3KZVA 3LKDA 4RLFA 5EXSA 5T4HA 4YRSA 3MHTA 2AN4A 2VYVD 4ZZ2A 4WFJA 4DHEA 3DTNA 5IKPA 1XCPA 4R2MA 5DW3A 4BYMA 5AVTA 1JAZA 1S8OA 3GG2A 2LP4Y 2GCEA 3U2QA 1FIUA 3OEYA 1NZJA 4FR0A 2QTLA 3ORYA 5FTNA 3I9V1 4BAGA 4GVLA 3N05A 3QFFA 4Q3DA 2V59A 3KJIA 1C30B 3LVBA 1KO7A 1SXHA 2W43A 5SICE 1YZFA 2GKOA 1IQ0A 1C3VA 2O9JA 2WYVA 4HWKA 5KYYA 3PR1A 1J2YA 1QRRA 4RVFA 2Y05A 2HXSA 1EG2A 3CIOA 4EJ0A 5C18A 4JLOA 2XMDA 3GYBA 1Y6QA 3AOEA 3GCWA 1QLHA 1Y37A 1EU1A 3I04M 5KMGA 2IBTA 5I7OA 1YU9A 4PFKA 3DHVA 4QQNA 1X1TA 4CTKA 1BJTA 4CG3A 5K01A 4ZTZB 4W7SA 2V54A 3FGZA 1GL7A 3WP1B 1I01A 5E3HA 1YBHA 3MN1A 2WUFA 2IYYA 3EDOA 1JQKA 1VGRA 3AFIA 1Z34A 3ESXA 1NUAA 4FHFA 5A5EA 1U3CA 5CB4B 4KJXA 1N0UA 4GKBA 4FYYA 1C3LA 3PFGA 4HXGA 4LHEA 4BKPA 4MS3B 4AT1A 5JZVA 3W5CA 2VYFA 3KAQA 1CPYA 1BX3A 2AFHB 2EZUA 4EVIA 5LZ8A 3UTCA 1Z0IA 4U7PB 1H5UA 3HXKA 4P3PA 3PJRA 3OC0A 2WTBA 1AO3A 3VV3A 4B8YA 1CUIA 4O2BF 5BN5B 1MW8X 3BWXA 1J8QA 2X0EA 2FAXA 4EY5A 1ORWA 2C31A 1C7IA 2JI8A 4CLXA 3DR3A 1HYGA 1NY5A 1OT3A 1R7RA 4LJRA 1NX9A 3GA0A 5C4MA 4D4LA 4M53A 1Z0ZA 2DUNA 4JQZA 4KVGA 4QRHA 3IEIA 3R20A 4V3BA 4BBPA 1RC1A 2QNRA 1JHZA 1CSEE 3SC6A 2AEFA 5CYPA 2RJ3A 3KKMA 4EF5A 1EQUA 1ISGA 2Q28A 2QMQA 3JRNA 4ZIRA 4L5CA 3N1UA 4MQEB 3L8FA 4KQ9A 2LKCA 3MUEA 4MYRA 4LNAA 3A2NA 4CU5A 2XIJA 1DIHA 4MV6A 2MJLA 4UBNA 4UVIA 1A7JA 1DOAA 5EHGA 3AF1A 2IOFA 3HI4A 2PRYA 4PG6A 1JVNA 2FW9A 4UHHA 3ZX5A 1KQFA 3SYRA 1QHXA 2XCTB 5FWAA 2FG6C 4FMDF 1ZVQA 1PGNA 4PC3A 2GXQA 3L8EA 4EWLA 3GT4A 1TUIA 5C5DA 3R7AA 3DAGA 1N2CB 1NMEA 2IYFA 3CNLA 4GECA 4IZOA 3U3RA 1C14A 1JHRA 1PJZA 3X1YA 4EGAA 2C7RA 5E4TA 1XF1A 2H8KA 4XDYA 1GY8A 1NDUA 4TLEA 1TTHA 2PUWA 3B12A 3GNQA 3UWDA 1H0HA 3OWXA 4MW1A 3WBFA 1LI7A 1NFFA 2DJIA 5DK6A 1V7ZA 1XF9A 4UBMA 4JOCA 4HAIA 3VSAA 1TO6A 5CHEA 3EGVA 2GFHA 5AI9A 5FUWA 2XUHA 3NETA 3G79A 4P5PA 2ZSFA 4HK4A 1D2CA 4KNVA 4NBWA 1Q6ZA 5CDGA 3RYCB 2VTBA 3OF2A 3WGVA 5GMOA 1SKBA 2PZKA 2YJTD 1GDDA 4JXZA 3TW8A 2C3MA 3ADPA 3UAWA 2D1YA 4Y6PA 1CUZA 2X7JA 4CG1A 2FPPA 1KBOA 5ECGC 4OV6B 1ISRA 4IHAA 3VZRA 4KO2S 4ZJPA 1GCIA 2OFWA 4Z86A 5IKXA 1N2CE 1TMYA 4O08A 2A3NA 5I9SA 1N0WA 2A9PA 3N3AC 3TQCA 4A27A 5EJ2A 4M0CA 1BU5A 3OZVA 4UHBA 1N34B 5F7ZA 3TLEA 2HU8A 5KQGA 4YK7A 3WA7A 4JLPA 3U26A 2VLIA 3L6BA 3C3EA 4TT3A 2P5SA 4JI2B 5KREA 3U61B 3ND7A 3SZRA 3DVLA 3G7NA 1FTQA 2WEKA 1WP9A 4Y2TA 1SCIA 3IQEA 1UC8A 2WYUA 1U11A 3LBHA 1QGDA 3TAXA 2WMDA 4EJSC 1U6JA 1NXWA 2XKJE 3A7DA 5LFAA 3CUEF 1YB7A 5GV7A 3CBQA 3MT9A 1MOQA 2H0RA 1OFHA 4DQXA 3Q8WA 3HSYA 4II3A 2XMRA 1I51A 3MWFA 4GM1A 5DK4A 2WKQA 1U5CA 1Y9DA 3WIDA 1XTSA 1S4QA 1JR3D 4P81A 2NO5A 4ZODA 3NR2A 2RBEA 1J8YF 3I1YA 1GNSA 3AETA 1LK5A 4XJSA 3SSNA 1AT1A 2HJHA 2WAOA 1DZ3A 3PZRA 2XMCA 4HWSA 1BROA 1SUIA 5SY4A 3UEOA 2V6FA 3O2SB 4WACA 2WVJA 3KTAA 1O6GA 1U4SA 2MSLA 1M6VB 1F1JA 1I7QB 1EXDA 2RGRA 1KZ4A 3QBVA 1BS1A 4I50B 4MUEA 3W5HA 1NONA 4BTVA 4AECA 1QH1A 3GZNA 2Q3DA 5DHTA 1ORIA 3GJYA 4FHEA 1VE6A 2ZYTX 4WKCA 4CXMA 3O8DA 2AF3C 5K2OA 4RPLA 1Z5VA 2I67A 4Q9HA 1AS2A 1DHTA 3DWFA 4OXRA 5FPPA 3DGEC 4D4IA 2UYQA 1MZVA 2GILA 2CVOA 3UC5A 5E4YA 2QJTA 4U7FA 5B3KA 4X8HA 1WX1A 1XTZA 2TRSB 3UJ7A 2FSPA 2WKSA 3I0ZA 1LWOA 4A91A 2OCKA 2PR2A 1F8YA 3X1JA 1IZ9A 5LDDC 2ZKLA 1V4VA 1PU2A 2CDBA 4KHZA 5JCOA 3AF2A 2HEIA 3DF7A 1NXSA 2Q6TA 5H80A 5SZHB 4EGJA 3IEMA 4C7BA 3L82B 3L6RA 3IDOA 3PNOA 3QUTA 1E4EB 1T15A 4WXPA 3LF1A 3E5NA 4NBTA 2NVWA 2OY0A 4OXQA 3LPMA 2E9SA 1BCSA 3MMNA 2ACEA 4FUTA 5A4MS 2AC4A 2EZ9A 4I6JA 5ALUA 3UWPA 3VSEA 3LUFA 4GLFA 3BXFA 1SXJD 4G5GA 1RWNA 2WIKA 4P22A 4Q18A 2PRKA 5L40A 3UB3A 1WMSA 3C3BA 1PT6A 1EQAA 2TMDA 3H87A 3O1JC 3C1TA 3NI2A 3QZUA 5FOUA 1BDMA 1QKJA 3TB4A 1P9RA 1PT9A 2R6ZA 1N8KA 4HXEB 3AT1A 1QIIA 2WWWA 2GTIA 2QJWA 2W8ZA 3VU9A 5I9LA 3HWWA 5CG1A 5JXGA 1CQXA 3X1KA 2W4QA 4QYXA 3PC8A 2V3WA 4XVRA 4AUKA 3Q88A 2HQOA 3TLCA 3UHPA 1BHQ1 3R9XB 4ILEA 1E1QD 1LU9A 4LSZA 3CLTC 3CF4G 4E33A 1MPXA 3K32A 4KGXA 1Q3KA 2XWBF 4AI6A 3A9WA 3H7IA 2ZRCA 2B1QA 1KJWA 4C21A 1LDBA 2FUCA 2GXUA 1GQOA 3UHOA 2BKVA 2YIDA 2C2OA 3TMAA 1XZKA 2JD0A 3T3HA 2XNDD 2E85A 3I8OA 1EFDN 1WZUA 2F3RA 4YAGA 1YFKA 2FN4A 2W2QA 1SVMA 2ZQYA 1XTIA 3BFJA 3K9WA 4KITB 3KOOA 1O1YA 2QORA 1HFEL 4QPCA 1JEYB 3NVMB 4RW0A 4OHOA 5EIAA 1MW9X 3ILSA 4ZYTA 3KZMA 4Q9DA 1ZNWA 3PDJA 2CYCA 1EB9A 4C6RA 3EPJA 2Y67A 3JYOA 4QJBA 3A31A 4W99A 4QYWA 2GWHA 2QUAA 1KORA 1NNLA 2O3UA 4JCCA 4O4LF 2EGGA 4I99A 4UBLA 3NH9A 3IQFA 5ICCA 1J0AA 3O38A 5AVQA 4L2IB 2C58A 1HG0A 3G68A 2C97A 3KUUA 4ZVOA 1ZW1A 4Y1FA 1ZSYA 3VYUB 4CIDA 4LYFA 4R8VA 3TXXA 4MR8A 3BDVA 2X14A 4FMCF 2KM1A 4GEKA 3I6IA 5E9WA 5JSKA 1GWNA 4DA8A 3LCVB 1VE7A 4HHEA 1FLVA 5JSUA 2ZJFA 1G8PA 3PGMA 5A7GA 2WJ6A 5DASA 2PKQO 1A76A 4BO1A 1T34A 2BGIA 4R9VA 1HGXA 2WWHA 4FN4A 4GZLA 1U0EA 5E38A 2C4NA 2GBFA 4NFYA 5CEJA 4F9FA 1F3OA 2E4ZA 4QBFA 2P6RA 4C7JA 1R9JA 1JEQA 4QTUB 1RAAA 1WAMA 2OXFA 4W7HA 3LC0A 1P17A 4ZO8A 5DSXA 1KI8A 1T3SA 4JYZA 3TUJC 2AK3A 4ZQFA 1NGSA 2D4HA 2FW6A 5ES3A 1DZIA 2FV8A 4L9AA 4M8SA 4W8HA 2XE6A 3PL1A 3LYHA 3RI3A 3RUHA 1FPQA 3AERB 4ZRMA 2NTYC 4BFYA 4IIEA 4G3XA 1FRQA 4JXKA 4Q47A 5CNJA 2PEZA 1UANA 4YRDA 3U3KA 1GUAA 4Z3KA 3TH5A 2FZCA 3DBLA 1FC0A 3BL6A 4OHZA 2PXCA 1RWVA 3GDGA 3HFJA 4BV9A 2V9CA 3HUEA 1AURA 4MW0A 2BFFA 4E30A 1YR8A 1ZM4A 2Y9MB 4O8ZA 3BK1A 2Y1OA 3GLIA 1ND6A 3F49S 5B1IA 2VJMB 3VA7A 4D4KA 4OP3A 4Z51A 2O2YA 5K6AC 1OI3A 3ADCA 1KVQA 2AYZA 2Y0EA 4TQAA 2OL4A 4PVDA 1DT5A 4S05A 2CFIA 4OU4A 4KPEC 1FU7A 3JRXA 4NR0A 3H0KA 2VAVA 3TKYA 1PZGA 1BQ4A 2FZGA 3R0VA 1FS4A 1VDMA 3FMGA 1LSSA 3MGAA 5TQ0A 4UOZA 4EF6A 2QDKA 4GXQA 3NKFA 2QMOA 3G5LA 4KLCA 1EFKA 1DC8A 3G5UA 1Z13A 3B1WA 4HDOB 3BMXA 2YZMA 5DYWA 4B74A 5IUJC 4I5FA 3KLNA 2DR2A 4HDRB 1T1SA 5FA6A 1XCLA 3CUTA 1O03A 4IHJB 1CJCA 3HHEA 2HQSA 3DDHA 5ULLA 4X66B 3D7RA 3H65A 1MUUA 3U40A 1DSSG 1JZQA 1O6CA 2Q2NA 1QH8A 1W94A 2HK7A 2P35A 2ZZKA 1DNPA 2AF4C 1EWRA 2GBLC 1VFNA 2ZDGA 2A92A 2ZBGA 4GQAA 4H16A 3GRAA 5GADl 3QOXA 5B7QA 3BHIA 2G06A 2YOHA 1UK6A 3FBWA 2ALJA 1YJQA 4HOYA 4Y9UA 3RS5A 2N9UA 2RHBA 3KYJB 3WQQA 1IE3A 3FVTA 2XAUA 3OFND 1UMBA 3OKCA 1HTBA 1YUBA 3BOSA 4IVNA 4LV8B 4PLFA 4PSDA 4X93A 4WBNB 1QNFA 1WG8A 4P0TA 3ESZA 4QGAA 3ZY5A 1NVAA 5LNK6 4JT8A 2B6NA 1T2NA 1IXRC 1ZGCA 2X4IA 2BC9A 4PPGA 1EVYA 3RTEA 3ZWXA 1VIDA 1SZCA 3V4FA 3ZIAA 3CNQS 2C0CA 3EG9B 1X7ZA 2B94A 2GVZC 4PRZA 3RABA 1GVHA 3UMJA 3OCZA 1D6SA 1XJCA 3LXMA 4JJAA 5CH3A 4F97A 1T3HA 5HOEA 1U8TA 4JFAA 4AXBA 2YOGA 3B5JA 1U2SA 1NIJA <