1X8LA

Crystal structure of retinol dehydratase in complex with all-trans-4-oxoretinol and inactive cofactor pap
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
342
structure length
342
Chain Sequence
PFPYEFRELNPEEDKLVKANLGAFPTTYVKLGPKGYMVYRPYLKDAANIYNMPLRPTDVFVASYQRSGTTMTQELVWLIENDLNFEAAKTYMSLRYIYLDGFMIYDPEKQEEYNDILPNPENLDMERYLGLLEYSSRPGSSLLAAVPPTEKRFVKTHLPLSLMPPNMLDTVKMVYLARDPRDVAVSSFHHARLLYLLNKQSNFKDFWEMFHRGLYTLTPYFEHVKEAWAKRHDPNMLFLFYEDYLKDLPGSIARIADFLGKKLSEEQIQRLSEHLNFEKFKNNGAVNMEDYREIGILADGEHFIRKGKAGCWRDYFDEEMTKQAEKWIKDNLKDTDLRYPNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords retinol dehydratase
publication title The structures of the unique sulfotransferase retinol dehydratase with product and inhibitors provide insight into enzyme mechanism and inhibition.
pubmed doi rcsb
source organism Spodoptera frugiperda
molecule tags Transferase
total genus 123
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1x8lA00
4GOKA 1GZSA 1T0HB 3T1TA 1KDPA 4TMVA 4X8HA 5BYKA 2ODWA 3A36A 3QXSA 2ZI4A 5KDLA 3OEHD 1XJQA 5CDFA 1MRSA 4EIWA 4LJ5A 1NVUQ 1ZCBA 1Z47A 4DCNA 4B2PA 2B8TA 4TQUS 3B85A 3ZQ6A 5L3SA 2QORA 2BWJA 4RY2A 1KDRA 4TQ9A 1UKYA 4JBYA 1E2IA 2OAP1 3IQXA 1NY5A 2H8KA 1UFQA 1PVOA 2CVFA 2J9RA 1N0UA 4BEJA 2BMEA 1G8GA 1NMZA 4TLDA 1OHHD 1IY0A 4JJZA 2AXNA 2FEMA 1D2EA 2WAXA 1FNNA 5AJXA 5FTNA 4WZ6A 1U8AA 3RS2A 4CIDA 1OYWA 2V3CC 4B3XA 1P2UA 4MH0R 3W34A 3NHBA 4IFBA 4FN5A 4P32A 1XD8A 2J7KA 1UM8A 2QBYB 3I73A 1P6XA 4G5GA 2CL0X 2G0TA 4OQFA 3T1QA 1NVXQ 2IL1A 3AM1A 4OHXA 5DO9A 2WOJA 1TADA 4ON9A 4A6PA 1WBBA 2KBEA 2NGRA 5G40A 2NO6A 1Z29A 5CDFE 1VPLA 4B35A 5HR5A 3WBKA 5AJYA 5EP3A 1AZSC 1W2GA 1O87A 3NWJA 2GILA 3K0AB 4R9UC 1IAQA 4JLPA 2P6RA 2VP2A 2IWRA 4YXWA 1YZUA 1GP2A 1E94E 4HSEA 1U98A 4XIGS 3SS8A 1VG8A 3CR7A 3CZPA 3ZZ0A 1D5CA 4IRUB 1HE1C 1W0JD 4KFSA 2Z83A 2IYXA 4NYMR 3QVVA 1XCGB 4H1UA 4KLZA 1F5NA 4P4UA 5EP4A 5CITA 2ZRJA 1II8B 1T91A 3PUXA 3THYA 2IW3A 5DISB 3L0SA 2YOGA 5IK2D 3BRWD 5EQTA 3U6KA 1NN5A 2V4ZA 1KAOA 3LW8A 4JLKA 5CIWA 2VF8A 5KDOA 1KO8A 4DSNA 4AURA 3BH6A 5JBQA 4FI3C 2AWOA 2IK8A 1N0VC 4GL2A 2OCAA 2KJQA 1TF5A 4S2EA 1IN6A 3K9LA 1GL9B 5FI0B 1Z28A 3B8HA 4QHSA 4X8LA 2VSFA 3TIFA 2HXSA 4BZPA 1OH7A 3CRRA 4PHGA 3BH7A 2D4HA 3K0EA 2ECKA 1P75A 1KO7A 3B1ZA 2ZITA 1M8PA 1JAHA 2OSBA 2W6ID 4BPBA 4CEIB 4FMBB 2NO7A 4BFVA 1KKLA 1GILA 2GETA 3KFVA 3K70D 2IA5A 2QRZA 2FWRA 4NMMA 1PUIA 1XBTA 1P9NA 1G18A 5J4LA 1KO5A 1KTVA 1SVIA 4LJAA 2ZYUX 5SZJA 3VNVA 3KFXA 2ZRCA 4PSVA 1Z07A 1IXZA 4EPRA 1OXVA 2X77A 5IHPA 2A9KA 3EC2A 3H84A 4PHFA 3CZQA 5AK0A 1D2NA 3ZS9A 3ZVLA 2WJVA 3CF6R 2JJ1D 4QG7A 3VR1A 5B64A 2EVWX 5E7IA 3K09C 1G7TA 1WE2A 3MWYW 1UAAA 5KNDA 4NCNA 5HZHA 5FBLB 1ZP6A 3QBVA 1SHKA 3VAAA 1JAIA 3LH5A 4Z8XA 1R0ZA 1YR6A 2JLRA 3CR8A 2NZ8A 2P6UA 2WIAA 1X8KA 2PMKA 4TT3A 2BKEA 1B23P 1WQ1R 3ETLA 3LQRA 2XJ4A 5DYIA 1T3LA 5LD2C 2IUTA 4XVQA 3QPWA 1YR7A 2DFNA 2CXXA 5K8IA 3U44A 2XXAA 4NU0A 1ZM7A 1N6OA 1VG9B 4FD2A 3SBEA 1FX0B 3K70B 1CF4A 2L0XA 1E4VA 3CRMA 3DMNA 4GRAA 2GZAA 3DEFA 4JS0A 1V43A 5EXSA 4WIAA 4ASUA 5DHFA 3P27A 2JLYA 2JIZA 4GZLA 1CBUA 4G01B 1NLYA 4DUGD 4EQ6B 2RGDA 4BLQA 4G3XA 1E9FA 1VDZA 4UXJA 1CRQA 4PHHA 4XH9B 3R9WA 1OXTA 3QNUA 1YQTA 5KPJA 5JJKA 2W6JA 3WMEA 2D62A 4NCKA 1TUEA 2DY1A 2ZSFA 1U81A 3AP1A 3I72A 2GCOB 1MR3F 3IILA 4OQLA 3LVRE 1DAGA 2IWHA 4A2PA 4Q7MB 3B2EA 3FFAA 5LPNA 3MAAC 1T4GA 2J0SA 1N6HA 4DDUA 2V54A 5FUWA 5SZIA 4TSFA 1G8HA 3BB3A 4LYFA 3VU9A 1GG2A 1E99A 1A2KC 4FWIB 4LYHA 1TQ6A 1COWD 4QXAA 1Q22A 4YLGA 3NDBB 1ZJ6A 4Q1CA 1XZPA 4WOPA 1ZM3A 1XZQA 2CDNA 2FGJA 3AKEA 4MA4A 5ANRB 1J7KA 5EE5B 3SJAA 4DEXA 1EFUA 2GZDA 2FPKA 2YOHA 5JECA 4HLUC 3ICEA 3QKSA 3FMPB 1XTRA 3P20A 2JLQA 4LV5B 3TNFA 3OAAA 1C4OA 4TYPA 1J99A 2ANCA 1Q1EA 5DI9A 2H92A 4JKYA 2CMKA 2IS4A 3ZD6A 5L8VA 4Q7LA 4ITRC 3KJEA 3LW7A 1XX6A 3M0EA 4JL8A 2BM0A 4Q9LA 2CL7X 4U00A 1ZD9A 4B3FX 3K0FA 1AQUA 2FOLA 4LPSA 1XEFA 2A5FA 5H70A 4DSTA 4R71A 3HYRA 3U4QA 4WZAE 4AYXA 2QN6A 2HT6A 4F4JA 5TV2A 1IHUA 2P65A 1N5JA 2AL7A 4ARZA 3GP8A 2OM2A 2W2TA 3R9IA 3Q7PA 3I8SA 3QF4A 2D7CA 3AF0A 4TL8A 4JVMA 1XRJA 3A4MA 3H4MA 2HV8A 4MRSA 1WF3A 4II7A 4LX0A 2BEJA 1Z0JA 1RJ9A 2FSIA 4NCHA 1QVRA 3PG5A 3B9QA 1E2GA 3QG5A 1IN8A 4AYTA 5BN3A 1DS6A 4DLXA 1CIPA 1DG1G 5HPYB 2BBOA 2QRNA 4AG6A 4KVAA 2YWGA 3CONA 3ZD7A 3NC1C 2ZE5A 1HQCA 1XD2B 4D6PA 4RZXA 2JLUA 2PCJA 5DN6A 1N3BA 3WHLA 3EPHA 3K9HA 4KLNA 1LF0A 1H8HA 3AF3A 5EE9A 3SYNA 4A8JC 1N5IA 3CPJB 2FPLA 3LLUA 1CRPA 3CM0A 4QBHA 4TN1A 2FF7A 4YMVA 2VP6A 4IVPA 4L16A 2BMFA 5FH9A 4PC6A 3A4NA 4PAQA 1TMKA 3PXGA 4KFTA 3MMPA 3S1AA 1SKYE 1E6CA 4NP6A 1SULA 5LB2A 3IEVA 1C9KA 3PQCA 2H7VA 3X1XA 3EXAA 3I4LA 4PC2A 1N6IA 1W5TA 3C8UA 4JT2A 1R6BX 4MITA 1U8YA 3RSOA 3EA0A 3BFXA 3B13B 1CJTC 1OF1A 3GD7A 3OESA 3TLXA 4MYHA 3Q85A 5JHHB 2IEZA 2AKAB 4US1R 5EP1A 1JJ7A 1ZIPA 4TTRA 1YVDA 4Y0AA 4YDSA 4HAUA 3CRW1 4PC3A 1NKSA 4TLEA 3I3SR 2QGNA 3CF0A 3A4LA 5CLLA 3TQFA 4AD8A 2ZREA 1HY3A 3I92A 1E2LA 2CL6X 3KUDA 1AS0A 3CWQA 3Q7QA 1A5TA 1M7GA 4MDFA 4WW0A 2HYIC 4MGYR 3I5YA 2VRWA 2W83A 3ND8A 4PPNA 1YRBA 4LSGA 3QE0A 3IDQA 2X2FA 4ZI3A 2BKUA 3ZVMA 4F91B 3GJ5A 4EAQA 2DWPA 4GOXA 2VP9A 1LF5A 2RH5A 2LKCA 2IYSA 4YXWD 1NP6A 3U60B 3TJZA 4Q9KA 4JJKA 1YU9A 4A0GA 2FZLA 1TL7C 1DO0A 3CRVA 1NG1A 2JGNA 3PR1A 4B43A 2J7PD 2R6CA 3ECCA 3DPUA 1P4SA 3TH5A 2IS6A 2XZLA 4B6FA 3AVXA 2FMXA 2QL6A 1S1MA 2ZI7A 2IS2A 3GMTA 2VHJA 4Q1FA 5EE1A 1OB2A 3ASZA 2GXUA 4IOLA 4Q00A 5JHGB 2AFIE 4NTZA 3PUYA 3RS3A 2ZM5A 1XMVA 2ZI3A 3TVDA 3CPEA 1GSIA 4TMKA 2V1UA 2OXRA 3K9GA 2IF2A 4ZKDA 1T5IA 4RKFA 1P73A 2IHBA 1JBKA 2GJ9A 4DZZA 1G7RA 5C46F 4JVLA 3UKDA 4A82A 4ZDIA 1MO3A 2DHRA 4QBFA 1FUKA 1T0JB 3FFBA 4FCVA 3CNOA 1ZYUA 4OK3A 3WRXC 2A78A 4KBGA 2ZRPA 1E3MA 5JZVA 2OZEA 2ATXA 3SJCA 2GXQA 3WY9A 2J1LA 3K0CC 1CULC 3SC3A 4QHTA 1G3RA 5FOXA 4MGZR 2JLZA 3A1VA 5CIQA 2IYVA 3UWKA 3EIEA 1EX7A 5J47A 1J90A 5JWRA 4EPTA 2ODNA 1DAFA 3W3ZB 5C1BA 1T8UA 2ONJA 3VR5A 2ZUDA 2BM1A 2MSEB 2YJTD 2VP4A 2WPDA 2Z0MA 4PQFA 4TTQA 4Q9HA 5AJVB 4Z8YA 3GLIB 3T34A 4QJ3A 2JASA 2VL7A 3CWZA 4QGAA 4U7DA 2V8OA 1KAGA 4OL0A 3THYB 4TQAA 4XJXA 1N25A 1VCNA 5A4JA 2O8BA 2FFBA 3IPYA 4Q4HA 3B60A 4MGIR 2GJKA 3MJHA 4IHQA 1XPRA 2GEDA 3FDIA 2WJGA 1E79A 1M74A 4QNMA 3O8BA 4A8JA 2CK3A 3GFTA 1X1SA 1V5WA 1D6JA 4R7ZA 4GZMA 5K8UA 3AH8A 2EWWA 3IUYA 2IBMA 1Q12A 4TT3D 2OT3B 3M4YA 3V4RA 3BS4A 2QQ0A 3KKMA 3KTAA 3RAPR 1XTKA 4BLTA 1FTSA 4LPKA 5AUQA 3C7KA 2JLSA 1N6PA 3TW4A 4RD1A 4IEEA 2VPPA 1Z6YA 4KHZA 1OH6A 1E9EA 1GDDA 4MRVA 3O8DA 4PAOA 121PA 3CPHA 1TF7A 4X8MA 4B71A 1UEIA 4ASUD 3RLFA 4A0HA 1MT0A 4KSCA 1JPNA 2W00A 3OFNA 3QSYA 4BRWA 2RGAA 1G41A 3SYLA 2JIZD 4XSGA 4JLJA 3RHFA 4AYWA 4YMWA 1HE8B 2CJWA 4RKEA 3EG5A 1AS2A 2WSMA 2NIPA 3KB2A 3R7WA 3AKDA 4TZ6A 421PA 3A1WA 2W6JD 4MKFA 2XNDA 3DL0A 3LVQE 1G64A 4MRNA 4RD6A 4G5RA 3V00A 4CDGA 5EXTA 3I5XA 5DE3A 1HT1E 1SKQA 1U99A 4S35A 3L2OB 2XTMA 4C0AC 2C9OA 4TSFD 2GCNA 1KK1A 3EAQA 2N1BA 1OPXA 4AKEA 1OV4A 2W0MA 3M6AA 4Z51A 1X6VA 1KDTA 4M1OA 4CVNA 2B7BA 2VSOA 4GMXA 4DLVA 3U44B 4Q1EA 2QMHA 1Q3TA 1QG2A 2QAGA 4ZKEA 3U3MA 2N42A 4OHVA 1BIFA 2ZTSA 4D0NA 1LW7A 1G5TA 2WJIA 3ZZTA 1QG4A 3VR4A 3WXMA 3ZDQA 1WBDA 2JCSA 2YWEA 4B6EA 2DFLA 3SN6A 3CLVA 2F43B 4HATA 4C0QC 3OAAD 4NDZA 4K46A 4P4SA 3B78A 1A2BA 3T35A 4B32A 5TVKA 3ZZUA 2IC5A 4BLRA 5JS7A 2ZJBA 3DZDA 2WMOB 3SDZA 3SBDA 2ODBA 1W0KA 4XD7A 2J0VA 4LBYA 5BW8A 2GJ8A 5B2ZA 3T15A 4CEHA 1FOEB 2ZRLA 3AVQA 3BFVA 1PV4A 3AQ4A 2HDNB 3LBNA 3KUCA 1TU3A 2PJZA 3GLFA 3BE4A 2J46A 4CEJA 4KFRA 4DLRA 3MG9A 1QHHA 4XVRA 1CR1A 4F93B 3TSWA 2F1JA 3K0CA 3VU9B 3PEVA 4AG5A 1GITA 1UKZA 4TLCA 2NG1A 1HUQA 3T1OA 2ZQ5A 3NBZC 5B57C 3WP0A 3FMFA 2LCFA 3B1WA 3TR0A 2MMCA 3LQQA 2FA9A 5G3ZA 3BBPA 2J0UB 2CCKA 2ZJ5A 2OLJA 2WKPA 4YMSA 2CE7A 5HE8A 5EE3A 2ZUCA 1J8MF 1Z63A 1ZD1A 5FPHA 2XGJA 1LS1A 2YVUA 2V6IA 1JQLB 2ZU6A 3L82B 2JJ8A 5DN6D 2HJGA 3VR3A 4QGFA 5AUOB 1N0WA 4EPVA 2BDTA 1H8HD 3IHLA 1J2JA 1ZAKA 4C0JA 5KPDA 4H1VA 5J4HA 4EFMA 2HF9A 1CEEA 1YJ5A 1KK3A 2QSZA 3W9YA 3U4QB 1SKYB 2JEOA 3FTQA 1XTJA 2WICA 3RS5A 2NQ2C 1KJZA 2Z6VA 3X2SA 2N46A 3GLFE 2IYTA 5J4KA 1N6LA 3QF4B 4F4IA 2C9YA 2C03A 1XD9A 5FR1A 4MRPA 2H57A 2PZEA 4BECA 3F3YA 4D0GA 2ZEJA 1RJ9B 2RGXA 1X86B 4NKRA 2XB4A 2CCGA 4XSHA 1XU4A 1CR4A 2Z4RA 4Q01A 4F38A 2BHRA 2JLXA 4A92A 2CNWA 4PC1A 1BS1A 3LX8A 1HH4A 1L8QA 3AVWA 3E2IA 1J70A 1M7HA 2OCYC 3EZ2A 3GCGA 5L3QA 4R2IA 5FPKA 5EXPA 4LWZA 3KB1A 4Q1DA 4V0MA 3SYKA 1XJ0A 1NN0A 2VA8A 4B2LA 5JRJA 1UF9A 3RNLA 5HKKA 3SHWA 4IDPA 4DBLC 4ZCMA 4I1OA 4R2HA 1M6NA 3KX2A 1TQDA 4PO1A 3VR2A 4R98A 5F2EA 4P4TA 4GFDA 4JKIA 2CE2X 4DIEA 3EARA 1XPOA 3D7MA 2ZI9A 2H16A 4Q03A 1R10A 1XXHB 2FJUA 4BFXA 3QXHA 4LHXA 1GM5A 3E5HA 3DOFA 4V0KA 1KSHA 1E4YA 3AVPA 4YONB 5FUXA 3UIEA 4CW7A 1QHYA 2PX3A 4P0TA 2XITA 3QBTA 3FMIA 4PSKA 1VHTA 1AM4D 2QP9X 3Q5DA 1Q57A 1U2RA 1KZ7B 4GP7A 4W5WA 5C18A 4DXAA 3ZLJA 1W47A 5D3QA 3DOEA 3LV8A 1KNQA 4DLUA 2W0SA 4ILEA 1TEXA 2MMGA 1NMXA 2NZJA 3C4JA 1IY2A 4RD3A 3SFVA 4QJ5A 1L2TA 2OAQ1 4ZDJA 3CH4B 2O8FA 4N0DA 3MWLA 2YINC 5CLQA 1Z0IA 1FMJA 1IQPA 2W58A 3BFKA 4B48A 4V0ME 2ZJAA 4DSOA 2IYWA 1BYUA 4Q5IA 3WYGA 1OLOA 1R7RA 3CB4A 2B8WA 2QPTA 3KXLA 1XTQA 4A9AA 1AKYA 2ZRDA 2IYUA 4D80A 4TL6A 4PC7A 2WWHA 1F2TA 3Q8XB 5GJCA 4YMTA 2WPDD 2ZSEA 4N0EA 3U7GA 2JAQA 3IBGA 4U5XA 1BH2A 2E9SA 3U6BA 1EFRD 1VMAA 2EYUA 1XMSA 2ZRHA 4ZDKA 4A2WA 4BLOA 2ZROA 2XOKA 3PJRA 1ZVQA 4P31A 3BGWA 1M2OB 1EG7A 2GJAA 3IIJA 4JLAA 3GLGA 2ZXUA 5F9FA 3QG1A 2ZE8A 1E79D 4TYNA 4YQFA 2CK3D 1IM2A 1RRCA 2XXAB 4K8OA 1P2TA 5FL3A 2CHQA 2QMOA 1VYVA 2GRJA 3WRYC 1XPUA 1PLJA 1KZGB 5CJ2A 4OK5A 2AN9A 2PZFA 5D3MA 4IFEA 3IBYA 2OEPA 3HR7A 2F3RA 2QT1A 1GRNA 3JVUA 4PO8A 4M53A 1T3SA 1MRNA 5JJLA 4URVR 3JZAA 2F9LA 4PXAA 3WP1B 4YMUA 2GXAA 2YHSA 3KDSE 1GVNB 2QMEA 5E4FA 3OFND 1X8JA 1F2UB 2VH5R 1B0UA 4HZIA 2XZOA 5TY0A 1E2QA 1XEWX 2GK6A 3THXA 4Q4HB 2ERXA 1MO4A 1OYYA 2FSHA 4KYUA 4QGGA 2XNDD 3B5JA 5E7MA 2VF7A 2PT5A 4URUR 3NBXX 5IT5A 4MQBA 3LY5A 2QNRA 3GLGE 2C8VA 3BXZA 3KJGA 1WRBA 3LBHA 1S0UA 2AD1A 3HU2A 2QA5A 5BYJA 4LUCA 3SZRA 1JEDA 5J4YA 4JL5A 3KTAB 4QRHA 5DNYB 1W4RA 3EASA 2P2LA 4IOJA 1CKEA 3CW2A 2ORIA 1G7SA 2NTYC 1PJRA 4TL7A 4NZYA 2FSGA 3IEUA 1OH5A 4C0BA 4B2IA 3FPAA 3V4FA 4WBSA 1XEWY 4UJ3A 1RRPA 3J81k 3O8RA 4GP6A 1W44A 1M34E 2ZPTX 2WBLC 4A4DA 4IJMA 3U3RA 2CJWB 2OXCA 3EPKA 4FMDF 1DOAA 5CM8B 1W0KD 3I32A 4XD7D 1E9CA 5BQ5A 3NH6A 1OSNA 1YKSA 3LWNA 4WZBE 4Z1MA 5KOYA 4UKDA 3N2EA 1BYIA 1RIFA 1OFUX 4LJYA 1G3UA 4NYMQ 4PAMA 4D4MA 1C1YA 2FFHA 3TUIC 5CB8A 4DDVA 3SJZA 3Q9LA 1FMLA 1HA3A 1RYFA 4B47A 3EW9A 1XTIA 2R6FA 2QAGB 5TMPA 1G5PA 3EZ9A 1U0LA 4NHOA 1G3IA 5CYPA 3TK1A 4JL6A 2EFEB 4A6XA 5J4VA 4E09A 1WB9A 2RCNA 1U94A 2OBMA 3GJ3A 3VTKA 5EZ6B 3W90A 5FOVA 2YZ2A 5HCNA 4A0RA 4UNRA 4P4SB 2RGNC 4Q21A 5FOTA 4DT1B 3GEIA 3RC3A 1Q1ZA 3A1UA 2LWIA 2GJSA 2CCJA 4TYYA 3C15C 4HDOB 2Q3FA 2WMNB 3IIKA 2ZI6A 4LGMA 4GDFA 5DYGA 2GVZC 1P72A 4P3YA 2QPAA 3REGA 4Q66C 3IHWA 2Q3MA 3WNDA 4D4JA 4CEHB 1LY1A 2Q9CA 3KJIA 1RZ3A 1W49A 4M1TA 4FWTA 1OH8A 3CX6A 5CK5A 3GLFB 3A8TA 3BD9A 2DPXA 4CEJB 3MWJA 1UBCA 3GJ4A 3KKOA 4RFVA 4BQSA 1XEXA 1W5SA 4HAVA 3U5ZB 1QHHB 4CZ2A 5AUPB 2J45A 2BCGY 2OHFA 1RKBA 5DI3A 5BN5A 1GUAA 3D3QA 2VLIA 3U3KA 2FGKA 1LB1B 2XX3A 2EFHB 1ZNWA 5G53C 5KYKA 5FOWA 1E2FA 2OBLA 1I2DA 4FW9A 1E69A 1G21E 1FW6A 2ZI5A 1DELA 1ZD8A 1G19A 4KFUA 3GJXC 4PANA 2J0QA 4BFYA 1II0A 2R65A 5K8TA 1S96A 1WA5A 2D7DA 2C96A 2WJYA 3VHXA 1KHTA 2E87A 2O0KA 4IVRA 2CNWD 2O8CA 1CJMA 1MH1A 3KKNA 1W4BA 3MCAA 3NG1A 3Q72A 1G4UR 4NCJA 2K5UA 3DM9B 1KI6A 5EUMA 2FDCA 1PZNA 3AP2A 4HDQB 5FFMA 4BEBA 2OBNA 1T9HA 2ZUBA 4DCUA 1PLLA 4KYIB 5EUQB 3THWA 3N2IA 4B44A 4MKIA 1CJKC 3PENA 4IDNA 3HWSA 3VKWA 1XJCA 2Z43A 4E5UA 2NO9A 4UNNA 5BN4A 4Q7JB 2R6DA 3X1DA 5HKKD 6Q21A 3KQKA 4PQRA 4G5OA 3RWOA 1G8PA 2F55A 3AV0B 3NKVA 1CTQA 2QI9C 1Z2AA 3HR8A 3NH9A 2VHCA 1NVVQ 4EPWA 3K09A 1E96A 2DFTA 4G5QA 4X8OA 1HYQA 4URXR 4ESVA 2ZJZA 3TKLA 3DO6A 1WDTA 2HUPA 5JRZA 1E2MA 3K0SA 5CYOA 1TAGA 3HPRA 4QOSA 4PPGA 4M21A 1Q44A 3F0TA 3IO3A 1OFTA 4GSYA 2BMDA 1R8SA 3LO5A 2BC9A 3I61A 1P3JA 3HU3A 2VP0A 2ZJ8A 1NY6A 5ELXA 2QM7A 2F3TA 1U0JA 4Y0VA 4TL9A 2J3EA 1BOFA 1DAIA 2R6AA 4JYBA 2A30A 5L3QB 2Y8EA 1US8A 3QKRA 3RWMB 3DMDA 1LTQA 4AKGA 1L7VC 3U2QA 1G4AE 5H1YA 3VX4A 4OBEA 3WYAA 4I4LA 1E1RA 3U3OA 4HZUA 2ZRKA 1ZNZA 4L5BA 3X1WA 2YYZA 4O2LA 3FGNA 221PA 2OCPA 3X1ZA 3MJRA 4NH0A 5CJPA 2EYQA 3WHKA 3QUSA 1NLFA 1ZNYA 1HQYE 3VMFA 3L0IB 4W9MC 5FTMA 4OJQA 2RMKA 3QKTA 4KBFA 2WHXA 4OK6A 4OHWA 1SVWA 1G8YA 1OIXA 2ZS8A 3AB3A 2V7QA 4JVSB 4G5SA 4LOAA 1Z3IX 2ZRAA 4LY6A 8OHMA 2ZRMA 3R9XA 1ESMA 5L3SB 2JLVA 4FMDB 1E1QA 1VG1A 2RGNA 3TR5A 4HUTA 1Z6TA 2BVNA 3CRQA 1U0HC 2XOKD 4C7OA 3OIYA 4I1SA 4POAA 1VYTA 4NONA 4Q48A 4JLBA 3QPUA 3SR0A 4H9GA 2HLDA 3RRZA 1JEEA 2BMJA 2KB0A 2OFOA 2CEAA 5BWMA 3IIMA 5GJBA 1RRGA 2ZRGA 4KVGA 3WYFA 3K70C 3T12A 3QOFA 4KODA 1G5RA 1S9HA 2FN4A 4HLUA 3RS0A 2GVDC 2PCLA 3H0KA 1TQ4A 2O8FB 5AJZA 4GNKA 1ZM2A 2XSZA 3EA5A 4JLOA 3QQ5A 3CKLA 1E2EA 3BIFA 4Q9JA 3TRFA 1OXUA 3FVQA 4LV8B 2QU8A 1DAMA 2VHUA 1Q1QA 1NNEA 4FMCF 1GFIA 3AF1A 1DO2A 5TB5A 3LBIA 1F2TB 4D25A 2AXPA 2WVJA 5JI2E 3O8CA 1EX6A 2PLFA 3A58B 2P5TB 1XFAA 3K0AA 3R8FA 3KQNA 4C30A 1E2KA 3A37A 4JLVA 1E98A 2WWXA 1P60A 4FXPA 3VHLB 3CNLA 4DLTA 1G17A 1IY1A 1P7CA 2UZ3A 3GLGB 1W36D 4D0LB 3SQWA 2I3BA 4I99A 2D2EA 1I4TD 2D2FA 5GJVC 2H1LA 4DRZA 4ACBA 2YC2C 2QTFA 2IHYA 5A0FA 1XMJA 1UBFA 1TX4B 3CBQA 5GVRA 2G3YA 2CHVA 4MKHA 5J5CA 1Z2CA 3FWYA 4NYIR 3ZYCA 5LDDC 4QL3A 1NBMA 1EWQA 2GF9A 1R5NA 4RD0A 1XP8A 1TUIA 3K8YA 1KO4A 1JB1A 4MUAA 2QQEA 4M1YA 3UG6A 1I4DD 1G3QA 1KMHA 1GKUB 1U90A 4C2TA 2QGZA 2J59A 3UMFA 3D6TB 4HEJA 5FUVA 2PT7A 3GLHA 3BORA 4XWOA 4E22A 3LD9A 4A36A 3BB1A 3THXB 2PEYA 4B3GA 4Q1BA 1LFDB 1NMYA 2AD5A 1E2JA 2VYFA 1P61B 1WXQA 3IGFA 1W36B 4Z1MD 4DSUA 3KJHA 4LC1A 3T5GA 3TUJC 1KYIA 4XVUA 3KKQA 4O2RA 3V9PA 2HCJB 3QXCA 1E9AA 1XNJA 1AK2A 4IKEA 5FUYA 1KSJA 1AGRA 3BC1A 2SHKA 1ZNXA 3FHOA 1G7CA 3KL4A 4M9SA 1YZNA 2V6JA 4I81A 2O0JA 4KCGA 1P62B 1JJVA 1N6RA 4P33A 4B75A 4W5HA 1NBME 4FINA 1OIVA 3ZH9B 4LJ6A 1IONA 5TDHA 1D9XA 4MUBA 4HB3A 4G0NA 4QFMA 4CYMA 3FOZA 4RCYA 2DCUA 4PZLA 4MYTA 3W8RA 1H8EA 5C4MA 2RGEA 4B3DA 1P9WA 2GF0A 2QP4A 3PUZA 4PZZA 3A1TA 2OFWA 1ZINA 3GLHE 4GOJA 3TAUA 3TVTA 3BAFA 5JCZA 1K8RA 1Q0UA 1Q3HA 4EPXA 2AFHE 4YDHB 4OHZA 2BV3A 2ANBA 1R2QA 2A7QA 2AWNA 2R8RA 2G9NA 3UXMA 2XEXA 3ZQJA 4CRWB 1RRFA 4Q02A 2IYRA 4Q7KA 1GWNA 2REOA 2G83A 2ERYA 3CIOA 2IT1A 4M9ZA 1DG3A 2AR7A 3T5DA 1NSTA 5GADl 3MUFA 1DARA 1E9DA 1SQ5A 3Q5EA 3ICQB 1E2NA 1SVOA 2FSFA 2QZ4A 3U3JA 4ZIRA 3AEZA 4DIDA 2JJ1A 1UKEA 4DKXA 2IX3A 2RGBA 4CF7A 4PR0A 3VFDA 3VX3A 3BOSA 1SXJC 5FOUA 1VIAA 4C2UA 5DH9A 3HP1A 5P21A 4AWXA 2GCOA 4HAXA 4V0OA 3C5HA 2P5SA 1GL6A 3MD0A 1T3HA 2G0NA 3F8TA 1Y63A 1UBEA 3ZIAA 2R44A 5JMTA 2XB2A 4D81A 4Q19A 3FB4A 1ZUHA 3UMRA 1G9XA 3MWKA 3NC0C 3OIVA 3RS7A 4C0SA 5KNBA 4BASA 1DE0A 1JECA 2C78A 4PPFA 2AK3A 1EWRA 2Z4SA 1FTNA 4NPHA 2KE5A 1FZQA 4DEYA 5KDDA 2NPIA 3QKSB 2PBRA 1GNQA 2O0HA 3BWDD 4HB0A 1UJ2A 2GK7A 4K81B 4KO8A 3EZ7A 2ZS9A 4ABYA 3T06B 1XEXB 1QDEA 2XTNA 2ZU0C 4LZZA 1NVWQ 4UXHA 5HCIA 1VCOA 3ADKA 4FMCB 5DI3B 4LK2A 1GNPA 5JCPA 1Z6XA 2YWFA 5KU1A 1BMFA 3KXIA 2B92A 1LS6A 1FP6A 1GKIA 3AP3A 3NBFA 4DVGA 3RC8A 1H65A 3K0FB 3DKVA 4A15A 3T1VA 2BJVA 5JLJA 4NYJQ 1RPZA 4CGZA 4IDHA 4TMZA 2PLRA 1GOTA 4LYJA 1R5BA 3ZS8A 3B9PA 3HJNA 4LJ7A 1JI0A 1HEIA 4US0R 4ARZB 2O8CB 3NDPA 1ETUA 2AX4A 4RCZA 5FTLA 3FE2A 1I2MA 1XB2A 3LNCA 1TPZA 4DHEA 3TUZC 2WWGA 1MO6A 3THWB 1II9A 4EPYA 1LV7A 3WNCA 1NIJA 1DADA 3TAHA 4RJLA 2C77A 1E1RD 2GTPA 5IF9A 1S4QA 3W5JA 3CH5A 3LLMA 3VKGA 3MSXA 4AY2A 4JLNA 1AJEA 2H17A 2G88A 2IXEA 3IKJA 1FUUA 4C0LA 3K9NA 1OXXK 1U8ZA 1L4YA 1DAEA 1S9DA 2F9MA 5FL7A 1R4AA 1MO5A 2GA8A 2P0EA 2J87A 3GJ7A 3U61B 3KZ1E 3SJBA 4C4PA 1M1YE 3DKPA 4US2R 4O3MA 4PTLA 1W7AA 4TLBA 4B76A 2BEKA 2V7QD 5DLQC 4OQNA 3GEHA 2WV9A 5E7JA 3L0OA 3ADBA 4LRWA 3MRSA 3H86A 4BGDA 2QMUA 2FPMA 1OJLA 4LC0A 2PZGA 1G6HA 4QBGB 5E95A 1IBRA 2JA1A 1Q20A 3AGPA 4M2LA 2OG2A 1YZLA 4V0NA 2GWHA 3L8ZA 3T61A 1JXMA 2H18A 5LD2B 2Q6TA 3S1AB 4HLDA 3CUEF 2F7SA 2JLWA 4LJ4A 3H1TA 1AN0A 4M0LA 3A6PC 1BO6A 2DFKB 2WIBA 1US8B 2XJ9A 2Q9AA 3NEJA 3QKRB 4FIDA 3REFA 2O8EA 1NJFA 2YV5A 4HZUB 4MKGA 4IOKA 4TYQA 3B82A 2XSZD 3QENA 3OE7A 1Z6GA 5CK4A 2ODEA 3C16C 4WXPA 3L43A 4DCVA 4B73A 1F6BA 4V03A 3PEWA 5JFGA 4BFUA 1XCPA 5FOSA 1IJFA 3FYHA 3RS4A 2VP5A 3CO5A 3LA6A 1NN1A 1SXJA 1YZQA 4EJSC 1QHIA 1E0KA 3MLEA 2KI5A 3TMKA 2X1VA 3HYTA 3SFZA 1IOZA 1KI1A 2BIFA 4LHVA 2IUSA 1E2HA 1ZC4A 4RVCA 4HAZA 2WKRA 1GRQA 3ZVRA 1RW4A 5TARA 3FHCB 1VIYA 3G0HA 3SU8A 4C7OB 1DTSA 3SNHA 2A5JA 3AF2A 1VTKA 1X1RA 4Q4AA 2R62A 1KI4A 2AHOA 3RANA 1XMIA 4Q9IA 2GCPA 1UEJA 4Q4JA 5LB4A 1CP2A 1KI9A 4PPQA 4XWKA 4PQYA 4JLDA 4D2IA 2DWQA 2CLSA 2C5LA 2MSDB 521PA 1G20E 1JR3A 1W48A 2PEZA 4L15A 3PUVA 1DBSA 1ANKA 4LCBA 1R0WA 3GJ8A 821PA 1JALA 1NBMD 1P5ZB 1N2CE 2A5DA 2ZRNA 3JVVA 1SVKA 1ZIOA 1SVSA 1QRAA 2C95A 3LAWA 3U7FB 5CM9C 3QIAA 1RE0A 3O47A 3R20A 1D2MA 4U02A 4F4CA 3BB4A 1E0SA 2FU5C 5EP2A 5KUTA 1FFHA 2EQBA 4URZR 1SXJE 2KBFA 1HURA 1P2VA 2QP3A 1CS4C 1SZPA 4JBWA 1EFCA 1LVGA 2CBZA 1AGPA 1NN3A 2HYDA 4HDCA 1UDWA 3NTUA 4ACAA 5FI1B 2Q3HA 2V1XA 3LFUA 1FQJA 1FNMA 1K5DA 3MFYA 4N3NA 2KSQA 2REXB 2WSSA 3AVTA 5FPTA 4F7WA 2J7PA 1YZGA 2FX3A 1W4CA 4PX9A 4ESHA 1NG9A 4BFZA 3OHMA 1Z0DA 1Z83A 4BZXA 3W6NA 4AI6A 2CHGA 1P2SA 3HPQA 4Q1AA 3OIWA 5KO2A 1YHNA 5JI3E 1OKKA 1KY3A 4JSTA 1MV5A 3GLIA 4BRUA 1QHXA 2HXYA 3UANA 1SVLA 3K53A 4LV6A 1Z8FA 4LBZA 2O8BB 2TMKA 1VHLA 3TW8B 2ZSAA 1E0JA 1KJWA 1JR3E 3PCRB 4OI4A 3ZJYA 5EJEA 1CR2A 4DCTA 2PX0A 1E2DA 1LNZA 1SVMA 2G1JA 2QT0A 2RHDA 2YNMA 4RD2A 2D06A 2B7CA 3OIUA 4A8JB 4D82A 721PA 1F3OA 2PH1A 1KMHB 1MABA 1Z6AA 2O52A 3GLHB 4NBSA 4UXIA 4DLWA 5JEDA 1GKYA 2P67A 1G6OA 1EFTA 1H8ED 4BWYA 4RSGA 2ZIAA 3CF2A 2VBCA 1QHNA 2GXSA 3WMFA 1NL3A 1OT3A 1X3SA 2HCBA 5KHOC 1W2HA 3QI2A 3UPUA 1AQYA 4DDWA 2YKGA 2GAAA 2O8DA 3TBKA 2DB3A 1F48A 4GBMA 1XWIA 1PUJA 1TQ2A 4BUJA 3EPLA 2WWIA 1YRAA 1ZU4A 2OE2A 3SEAA 1QZXA 5KSYA 1OXSC 1RVDA 2QG6A 3C41J 1RC8A 1HT2E 4ZDWA 1Z0AA 2QEQA 3QXXA 3RRNA 3WBJA 1YZKA 2DR3A 3PFIA 3R7WB 4IDOA 5H68A 2EWVA 1W1WA 2ZS7A 2PMDA 2Q21A 3GLIE 2WWYA 1KOFA 4GI7A 3FHTA 2EU8A 1E9RA 3QY0A 4EJSA 2XZPA 1OFHA 1E9BA 1YZTA 1KKMA 3UWOA 4IOMA 1Z0FA 2VEDA 2VSXA 4M22A 2GAOA 4RZUA 3FKQA 2B6HA 3ZIAD 2E1RA 4HLCA 4QHYA 1NRJB 3OEEA 3P26A 4BLSA 4OQMA 1A82A 4J0QA 1D8TA 4W7SA 3P1JA 5JWOA 1XTSA 1BKDR 3AKYA 5JSZA 3AVUA 4D26A 3SE0A 4V0LA 2QSYA 1VCMA 1Z08A 2B21A 2GEUA 2OESA 3LX5A 2F43A 2XAUA 4F92B 1VECA 1CLUA 3C14C 2JJ2A 2RAPA 3GJ6A 1BMFD 4ZIRB 1T8TA 3UATA 1GIAA 4HUQA 2KWIA 4RD4A 1TEVA 1OFIA 1NVVR 3CX7A 3D31A 2QROA 2IUUA 2GEVA 1S2MA 3EIHA 4TWZA 3GQBA 2BCJQ 3HDTA 3QEOA 2VHTA 4C0HA 1U9IC 5E3HA 5UKDA 4UNSA 3KKPA 1G3MA 1VYUA 2NO0A 1JR6A 1TU4A 5M04A 1ESNA 1AKEA 1Z22A 2YC4C 4MYUA 2HJVA 1S3SA 3RABA 4EUNA 1CXZA 2F1HA 4JBXA 3BERA 4HI0E 4TMTA 2REBA 2ZRFA 4IW3B 4QJ4A 4EFLA 3EX7C 2J0UA 1G8FA 1JPJA 5EXXA 1T6NA 2JDIA 4URYR 5FL7D 1E32A 3RVBA 4C3ZA 1S1CA 4AC9A 4QKQA 1ZW6A 1Q1BA 2JATA 4G1UC 1KMQA 4DJTA 1S3GA 4HAWA 2H5EA 3W6OA 4XWAA 4M1KA 5KSPA 1W4AA 1RYHA 5AUNB 2IXFA 1E9SA 1KDOA 2V9PA 1NKTA 2I1QA 2FFAA 1CR0A 4LHYA 3TQCA 2IEYA 4OYHA 4M9QA 3NIBA 4DB4A 5FPSA 3B1XA 4BE7B 4ZCLA 1GAJA 1GRRA 1S8FA 2C04A 3N70A 1YE8A 3B7GA 2F1RA 3DHWC 1GL7A 1UKVY 3P32A 3TSOA 1OB5A 3W6PA 1TNDA 1J8YF 3L0PA 5FR2A 3NHAA 3THOA 1Q21A 2R6GA 1FPMA 1KO1A 4GPTA 2HT1A 2RHMA 2ZYVX 3I8XA 5FTKA 3OE7D 4NCIA 4RFSA 1G16A 2IXGA 1WCV1 3IQWA 1FP7A 5B30A 3TE6A 3NXSA 1DAKA 621PA 1MKYA 3DVLA 1F60A 1KSGA 1KK0A 4QNRA 2WJJA 3LXRA 2QE7A 3PV0A 1TTTA 1SXJD 3GFPA 1ZCAA 3VKHA 1KIMA 1M7BA 2ZAMA 4L9WA 3B6EA 1AZTA 3EWSA 1JNYA 3AVYA 1ZUIA 3ADDA 4TYWA 4L4UA 4ZV4A 2ZR7A 1KJYA 1TF2A 2Q9BA 2ZJ2A 1E0AA 1K6MA 1NIPA 3EC1A 2A2ZA 3AKCA 4OJKA 2ZAOA 2HF8A 3E70C 1R8QA 1ZU5A 2WWWA 3M1IA 4B74A 5KTYA 1KI3A 2C99A 3FKSA 2ZSDA 1R0YA 4JMPA 1XXHA 2O8EB 1X8LA 3R8CA 1NJGA 1ZMXA 4DC9A 1IN5A 2P6NA 3ND9A 2YOFA 4D4KA 2OUKA 1JR3D 4Q47A 3TSZA 2F6RA 1KGDA 1SHZA 2R9VA 4JZKA 2I4IA 2QTHA 2WOOA 2FNAA 4AK9A 1GTVA 4LYAA 4JT4A 3KQHA 1A4RA 4OI1A 1YR9A 1O3YA 2D3WA 2ORWA 1Y3AA 3G5UA 4BFTA 3VNUA 1UBGA 2BJWA 3L8YA 4KI0A 3RYTC 2RGCA 4M1WA 4DLSA 4DB2A 1SXJB 4M9XA 4FCTA 3LXXA 4AKHA 3EZFA 5J40A 1XF9A 2FE4A 4PFSA 5CB6A 5JJIA 4JLMA 2IYLD 4MRRA 4JIMA 1U9IA 1VCIA 4OHYA 1I4LD 2BBSA 1KI7A 1KNXA 5HE9A 2QBYA 1ODFA 1QBKC 2I1VB 4NL4H 1EK0A 4IXNA 3W3AA 4Q4AB 1IN4A 3AUYA 3OEHA 4E07A 2WSSD 5F9HA 4AKIA 2QAGC 3F5FA 5DSZA 4Q4JB 2YWHA 2G6BA 3EZ6A 2WM9B 2CVHA 2ORVA 2QY9A 4BZQA 5L3VA 2IS1A 4D4LA 3SI7A 2MSCB 5EZ5A 3RDPA 4C9BA 4I1VA 4IVQA 1OKKD 4KITB 3TGPA 1DEKA 1UDXA 4KV9A 1XXHE 1R5OA 3DZ8A 4UQOA 5KSOA 4DLYA 4LI0A 3I1FA 2R2AA 4O25A 2DYKA 4LHZA 2J5XA 3VQTA 4C0KA 2QTVB 4HAYA 3PITA 1CJUC 1Z06A 3H2YA 2ZRIA 3P4XA 3LRPA 4ZPXA 2OILA 1N5LA 3EIQA 1OHHA 2ZRBA 2QENA 3FMOB 4PSAA 4TLAA 2WAYA 2ZR9A 1WMSA 1G1MA 4ZO4A 4BFSA 4HLQB 2RGGA 1GNRA 2ZSBA 5D3MB 1II8A 3UG7A 3QEJA 4L9SA 1UPTA 3NEYA 1MOZA 3GEEA 1L4UA 2ZANA 2ZJYA 2NO1A 1N6KA 2W2XA 4GMDA 1ELOA 2P3SA 2UVQA 1A7JA 2A3RA 3UMSA 5FPYA 5IRCD 1KI8A 5SZKB 4IXMA 1OW3B 2X2EA 4W5JA 2VHQA 5SZHB 1R0XA 1F2UA 2PL3A 4QBIA 3KQUA 1PLKA 5K8LA 1JXOA 5JWHA 1EFRA 2QPOA 3DDCA 4CEIA 5FBVB 1Z0KA 2GNOA 4M1SA 4RZ3A 3QPVA 4OI2A 3N5CA 3G82C 2ZYTX 4XTRA 3AVOA 1KI2A 4L8GA 4BFWA 2O5VA 4DLZA 5C2JB 4EFNA 5JEEA 1W0JA 3CNNA 4HYYA 2WTUA 2FG5A 4DCSA 1EESA 5L3RA 2EFGA 4HB2A 1MABB 4B3BA 4KU4A 4WA7A 2ZE6A 2EFCB 1VG0B 1IXSB 4LJ8A 4QM7A 3OEED 3OZXA 2C2HA 5IK2A 1NF3A 2XTZA 1IJEA 2PJRA 1OIWA 2DWOA 4BLPA 3SHFA 4WXRA 2XNSA 3RRYA 4B34A 2Q0HA 4KXFB 4M1MA 2O8DB 4OI0A 3QF7A 2ONKA 3GPLA 2OLKA 2GESA 4JVNA 4Q4LA 4TMXA 5EE0A 3B1YA 3B1VA 4LBVA 3PVSA 4XOIA 1KY2A 4TMWA 2OV2A 1SGWA 2QUZA 1QVAA 2EW1A 3NBYC 1YR8A 2ASEA 3QXJA 2IYZA 5IDVA 2GBLC 2ZVQX 4YC7A 2JJ2D 5G3YA 3SOPA 4QM6A 1W46A 2GKSA 3ZGXA 1FQKA 4JSYA 4MDEA 4V02A 1FL9A 2W6IA 2IF0A 2F1IA 1IXRC 1CJVC 1JQJC 1K5GA 1FX0A 4KJZA 5G41A 1T5LA 4EJSB 1NLZA 5GJWC 5BXQC 2UKDA 2A5GA 5FTJA 1N6NA 3IPXA 4B33A 5KNCA 4NYJR 4Z54A 3ASYA 4OQXA 2EFDB 4WAUA 4NYIQ 2HEIA 2RB4A 5HTKA 4EQ6A 4UNPA 2FV8A 3GJ0A 2Z5FA 1ZC3A 4MYCA 4E03A 3BJIC 1A1VA 3K1JA 1XDBA 4QC2A 5LBIA 2ZR0A 3AF4A 5JSZB 1EGAA 2BBWA 4UJ5A 1ZBDA 2C98A 4A0FA 3KXKA 5DGXA 3EPJA 2JDID 4ZCIA 2AK2A 5FBWB 3PEUA 4URWR 1ZUNB 3ONWA 4M4SA 5AR1A 4DT1A 3EWAA 5A5GA 2UZIR 2NMVA 1UADA 3QJYA 2CLDX 4JYCA 4UNQA 1XCMA 3U7EB 1KSFX 3VR6A 4B3CA 3Q3JB 4HUQB 3U7HB 4CT5A 4FCWA 1E2PA 1QHSA 1NI3A 3P4YA 4LBWA 2CLCX 3WMGA 4DDTA 3SQXA 5DHAA 3NVAA 3WNBA 4Q18A 5AJWA 5HZKA 3I62A 2X8AA 3LDAA 4I1UA 4PO9A 3CX8A 4RZ2A 3PEYA 1N5KA 4TZ0A 2NOAA 4PZYA 4DUGA 2OFXA 2VO1A 4ZI2A 3QVUA 1VKJA 4NE2A 1DAHA 4OKSA 5GVSA 4LHWA 2WKQA 3W5IA 1G291 2LKDA 2DBYA 2W2VA 3KQLA 2BOVA 2IYQA 1NSFA 1P9RA 4GT1A 1EFHA 1HTWA 2WJHA 4A1FA 4MGKR 3UK6A 1KK2A 2GDJA 3X1YA 5DIFA 3A1SA 2C9CA 2FEOA 3C5CA 4DWJA 2WWFA 5JS8A 2WZQA 1EXMA 2ZE7A 5C4GB 1KI6B 3MGCA 2QM8A 5F3WB 5H8WA 3GFOA 1DPFA 3W8NA 1COWA 3JZMA 3OF5A 4A2QA 2QE7D 1AS3A 3RRMA 3ZVNA 3RSLA 2FFQA 3E1SA 4O0MA 2AKYA 4KAXA 4XTCS 4IDQA 3IO5A 2IYYA 1QHGA 3AVVA 1ZM4A 2G77B 1AIPA 2V55B 2BBTA 2NPFA 2ZJOA 2ATVA 4EDHA 4N1AA 5FBRB 4AIIA 1QF9A 4WVFA 2OO7A 1OE0A 2FZ4A 2VIIA 1XD2A 2VTKA 3PUWA 2G1KA 5F98A 2QAJA 2OCBA 2VQSA 4LJ9A 2FH5B 5KSZA 3FKSD 4LDJA 1DVRA 2GZHA 3PIRA 5B58C 4QGHA 2RKOA 2X19A 3DM5A 3BH0A 1WP9A 1E1QD 1ZM9A 4RFSB 5FBQB 4EKDA 2J41A 4ERNA 2GBLA 2GHIA 3HU1A 4M8NE 1ZRHA 4KSBA 1CU1A 3BK7A 4CT4B 2ZYWX 4HB4A 3D8BA 4TTPA 2HLDD 4PHTA 2ZETA 2ZVPX 3ADCA 1W36C 1ONBA 3AUXA 3AGQA 4IEIA 1AA9A 1IN7A 1Z5ZA 5AWFC 1HV8A 1RFLA 3QKUA 5TXGA 2A5YB 2D74A 1D9ZA
chains in the Genus database with same CATH superfamily
3C3PA 4GOKA 1ULTA 1PS0A 3R7NA 1SHJA 4X8HA 3QXSA 3IQHX 1Y80A 1HC7A 2ZI4A 3N76A 3TQSA 3R7AA 1JKIA 2WAMA 1P1FA 5CDFA 4EIWA 1ZXLA 1RMTA 4MRMA 4WERA 1J1UA 1IFXA 5BYAA 3HKCB 1Z47A 2CW5A 1WSAA 2FKNA 1T0BA 2B5OA 4LZJA 3VBEA 4CFSA 3WGHA 3AM5A 3L9XA 3QPCA 2QLJA 2XGOA 5DXJA 3GGCA 4RBNA 2VDQB 5FA8A 1I5EA 2H4FA 3P94A 3G0BA 2B1JA 2BWJA 1KDRA 2WJAA 5CDUA 4FDLA 1P7WA 3LQ1A 1E2IA 3D6JA 1N3IA 1XHLA 4RK5A 2W2QA 3DF9A 4N39A 2HWYA 2Y1DA 4R3NA 2J9RA 3ZGVA 4JI6B 2I71A 2VS1A 2BMEA 1BKYA 1I5OA 3MXTA 4RNCA 4G4IA 1TRKA 5ER9A 4FYPA 4GYWA 1OHHD 1HEYA 5ITVA 3L7KA 4JJZA 5FYQA 5JISA 5B7GA 4YT4A 1GUYA 2G36A 4EYEA 1ISPA 4A26A 5F1PA 3STHA 5AJXA 4E1BA 4AS3A 4JI8B 3A9CA 3RS2A 1A8UA 2BF7A 1FTGA 2WUEA 2P2GA 5DBFA 1GFWA 4CL8A 5B3KA 1MOPA 1ZR4A 3C2QA 3E22B 3L01A 3CVXA 3I73A 4LDPA 4OQFA 1NVXQ 1OVGA 4JENA 2IL1A 2Q2NA 1YD7A 2QN8A 2P9BA 1FK8A 1KOJA 5E2BA 1DKLA 1DRVA 2BE7A 1XROA 3BMOA 5EFOA 1WBBA 2NGRA 2JH9A 2OHGA 4ZICA 2IPXA 1QKIA 3QOYA 3F1LA 1VPLA 4BIIA 2DBZA 4B35A 4DMKA 4F06A 2BSXA 2WTBA 3C4VA 1O87A 2GCEA 4G67A 5DFAA 1QMGA 5AVJA 1FVFA 3RVOA 4BE4A 2WMYA 5DBHX 4D3XA 3CKYA 4MUEA 1NI4B 2FZEA 2XYHA 5LXTB 4UE2A 1T9GS 4OLFA 5DLYA 3U9SA 1EXWA 4JFRA 4OIFA 4YXWA 4C7JA 1IBMB 1RXUA 4KKXB 4TT8A 1W0CA 3R74A 3MELA 4XIGS 2PWBA 2H11A 3B6ZA 3CR7A 4YJ2F 3IUJA 3ZZ0A 1Q7EA 5IXYA 3V8PA 2IUFA 4I66A 3PHLA 4MMXB 1R88A 1LZLA 4CKZA 3SICE 4H0NA 3QVVA 1U3WA 4KLZA 2CVZA 3DMTC 1V4NA 4M8LA 1ZN8A 5EP4A 2YOGA 4FNMA 4PX2A 4WLEA 1T5OA 2V4ZA 1KAOA 5C7OO 4Q4CA 1Y3HA 4L2IA 5EJGA 4ND5A 1GCAA 3LCVB 1FPQA 3BG5A 3WLJA 5JBQA 1H93A 2AWOA 2ZPUA 2I54A 2OCAA 1Z5NA 3GDOA 3V48A 1PJ2A 3AO0B 3CUUA 1INLA 3IQFA 3K9LA 5FI0B 1KZ9A 5CEJA 1ORDA 4GI1A 4BB0A 3PKJA 4K86A 3EY9A 3S29A 1RKVA 2CV1A 5A6VA 4EW6A 1SEPA 4RMNA 5AVWA 3MS7A 3VJRA 2D4HA 3K0EA 1P75A 3B1ZA 1ZOOA 3ER9A 5LWHA 1M8PA 4B4WA 4CEIB 4RY9A 2BZ1A 1VPVA 2IIBA 5JNVA 2NO7A 1E20A 1GILA 4N82A 3K70D 3OJ0A 4KK3A 3A70A 4Y2TA 2QRZA 3BWBA 2YWJA 2I65A 3NHKA 4NMMA 4C4RA 4R1LA 3BMNA 1XBTA 4JC4A 3NHZA 1KTVA 4WV3A 3VNVA 1NJ8A 1UFOA 3M1YA 2ZRCA 4PSVA 3AM3A 2JFXA 2WSYB 4JU9A 1D03A 2OHOA 4GPIB 5HMLA 5J58A 1E7QA 3IRUA 4I4NA 5DBGA 3I30X 2GBIA 2O0MA 1D2NA 2WJVA 3CF6R 3NO4A 1MC1A 1EGMB 4OAOA 2CMFA 2GAFA 4L8VA 4C4YA 4UFNA 1G7TA 4G8JA 2V4MA 5KNDA 1YC2A 4X90A 3H1AA 1XC7A 2POQX 3VAAA 4EG7A 2BFAA 4RULA 1KYWA 2PSSA 3NBAA 2NN3C 4YMHA 3KXDA 4PGAA 1TT5A 3EK2A 1XAJA 3UBTA 3LQRA 1SBIA 2XJ4A 1T3LA 5DYNA 2XTJA 4V0RA 2HJRA 1C8BA 1YR7A 2DFNA 3AR7A 3LCMA 3Q41A 4CMEA 1L1RA 3OZSA 4CDNA 2XXAA 2JPDA 4ZP1A 2BFEB 3CZ5A 2AOTA 3O95A 1IZ0A 2L0XA 3CRMA 3HM2A 3TCNA 3WTCA 4DR5B 5GWXA 3QBDA 5LWQA 4JS0A 1V43A 1M1NB 1E2UA 4WIAA 5DHFA 4U7HA 5EZSA 5EYPB 3KHTA 2JLYA 1GNSA 3PFHA 2R85A 1JFTA 3V1UA 1NR7A 1XSEA 4IXWA 4BLQA 4G3XA 4R1PA 4P6VF 1XE3A 1VDZA 2VHVA 3LKBA 4OHMA 4PHHA 4UXJA 4Q3AA 1OXTA 1NYTA 3ET5A 2BGGA 1V1RB 4L4SA 3SYTA 1ZY2A 4A16A 3BYZA 5KPJA 1E4EA 3DBLA 1GU1A 3WMEA 2D62A 1YVPA 2QV7A 3DWFA 4R8KA 3N2YA 1A8HA 3AP1A 5IKPA 3KYDB 3UGJA 4ETNA 4ZZIA 1HSZA 3WSVA 1QR2A 4OQLA 2IWHA 3KQWA 1I36A 2FP4B 3B2EA 5LPNA 4ZHSA 2EZ9A 1FLDA 1N3LA 2PO7A 2V54A 4NNOA 1SR8A 5FUWA 3A9WA 1F06A 1XNHA 2XKKA 5H59A 1SKMA 1KAHA 3V1MA 1OLXB 3BB3A 3GEPA 2ZBVA 3CZAA 5KWEA 3VU9A 2H51A 1E99A 1MBZA 1R0RE 2BM9A 4FWIB 1Y5RA 2H1HA 4LYHA 4PYNA 1Q22A 1E63A 2R00C 3GJTA 1C14A 1H6BA 3JQBA 4J16A 1B73A 1XZPA 2DWCA 1JIKA 3EXG2 4Q1CA 4WOPA 2IOFA 3DBHA 3LF1A 4DLLA 2CDNA 1HR0B 3UK1A 4DEXA 2XVZA 1U7HA 4S1TA 2FVXA 2FPKA 3H8SA 3E7PA 4WK4B 3WWYA 2YWXA 3GCXA 4B3IA 4ZJYA 2A9OA 4GX0A 3F46A 3QYPA 3L77A 1M73E 3WL5A 4BB6A 4LV5B 3ICEA 1UIRA 2VYNA 2AIRA 2FG6C 3DE0X 3N2KB 4HQ6A 5DI9A 3UVEA 1QYRA 1E3JA 2M9MA 3NHUA 3JQAA 4NK4A 4Z49A 2DGDA 2NACA 5IAKA 3OKAA 2O3RA 3LW7A 4M7WA 3VSEA 4RK6A 1QVVA 4E08A 3KUXA 5KNDH 1Z38A 1LD3A 4LF6B 2HFKA 3AG5A 1ZD9A 4TUYA 4U00A 3F3KA 4KH0A 3K0FA 2AT1A 3JQ6A 5JFOA 1V0JA 1WSDA 3N39C 1XEFA 3RBXA 4DSTA 3LUAA 1E1KA 1WHSB 1JDNA 1LSUA 1RR6A 2PYZA 3N07A 3QHAA 4YNBA 1M6YA 2ST1A 5KWSA 4P81A 5CH8A 2QN6A 1WKVA 2HT6A 3CO0S 4QU9A 4RVUA 5TV2A 1CK4A 1Z39A 1IHUA 1O57A 2P65A 4G5XA 2OM2A 2RBGA 1PCXA 2DHDA 2NUPA 1D2CA 3COYA 3D3EA 3G7UA 4H35A 4P54A 4R7TA 5DHPA 3G6KA 2GFIA 1QE5A 2CZGA 3EG9B 1Z7EA 2E6KA 4EVQA 2YVKA 3PNKA 3A4MA 1R6UA 1WF3A 2FMHA 3DZGA 2BEJA 3MCWA 4HXYA 4K8RB 4X85A 1RJ9A 4JI1B 3MLBA 3B9QA 1E2GA 3G2QA 2UZAA 1D2RA 2V7EA 5KYUB 1PYDA 2BBOA 1RAEA 3AETA 3OWHA 3F7NA 4JNCA 1KZHA 4TRMA 1GNTA 5GPBA 3O3OB 2J5BA 2YWGA 4KNWA 5G0UA 3CONA 2ZE5A 4D9CA 4D6PA 3F6EX 3IJEB 4RZXA 4X3CA 4YN3A 5AM4A 3WHLA 3EPHA 5BSEA 4MTLA 4CKWB 1MAWA 2OKCA 1ZI8A 4G07A 4JN6B 4GIBA 4OP2A 3FWPA 3SYNA 4A8JC 5ITZA 1JHAA 4HQOA 1I5RA 1TLLA 4MUMA 4HO1X 4E31A 3WZMA 4PLWA 3TIXB 5L7WA 4KPEC 2FHPA 3CM0A 5I7AA 1CRPA 4H7DA 1EKXA 5IX8A 4UFPA 3O38A 3WVNA 4G4JA 4XM2A 5FH9A 4C1BA 1EMDA 1SCKA 3A4NA 4YCAA 3FXAA 5ES3A 3C0KA 4KFTA 2AUMA 4K7JA 1SKYE 1E6CA 4YJHA 2XVMA 4EABA 3RSZA 5FEUA 3R0JA 3H5VA 4S1PA 3IEVA 1C9KA 1D3AA 3EXAA 1AKRA 1N6IA 5FORA 4JQYA 2HBYA 1H4VB 3AFOA 4JT2A 5JE8A 4WBNA 2HIAA 3OZBA 4BJHB 2HK8A 4ZOLB 2P9JA 1D4ZA 3HQ4O 3RSOA 4KR6A 2NVUA 2P4HX 4MZXA 4QBTA 2OM6A 2XXJA 1A8PA 3IPCA 3OESA 4B6OA 5E6SA 5EP1A 2PGNA 1XK6A 3DAOA 4COOA 2PKEA 3BREA 4TTRA 1F0YA 2GCGA 2P2NA 4YRFA 4HAUA 4HX2A 2G07A 4OJTA 4OXYA 3M3DA 1NKSA 4TLEA 3NTQA 3CW9A 1VSTA 5CT9A 3TX6A 4DJ5X 1HY3A 3EN0A 3I92A 4FGWA 1REQB 3D8TA 1PKXA 1BX3A 2IITA 3Q7QA 5F33A 4KVZA 3CW8X 4MGYR 3HNOA 5CH3A 1N32B 2DG2A 2PA0A 2VRWA 5ELLA 4L8YA 3ZDFA 2O23A 2X2FA 4ZI3A 1OZAA 3ZCRA 1JQAA 4EMTA 3NDJA 5JO0A 4MVJF 1IUOA 4MULA 2RH5A 2A3NA 2IKQA 1H6DA 3GH1A 2C4NA 4TQGA 5AVUA 5CHEA 4JI7B 3ROTA 3CVVA 3NM5A 4TYYA 3CRVA 2WFLB 5REQB 3ECCA 4AWAA 3QBJA 3DPUA 4KTTE 4Y2JA 4BGVA 3QE9Y 2C94A 2XZLA 2E2WA 4B6FA 3OKFA 3FOEC 1X92A 2D5AA 1AZLA 3QUBA 4X20B 3GMTA 2VHJA 4Q1FA 2IS2A 5DRTA 4Q00A 3UHOA 1NJSA 2WUVA 5T6BA 2IP1A 3RS3A 1USKA 1I1HA 2ZI3A 4ICIA 5KOIA 1FXSA 3H2IA 5E1BA 1JDSA 5T8KC 2Q62A 8ADHA 2OXRA 3FF1A 2XUIA 3E35A 3MJFA 3UFXB 4ZKDA 3F49S 4HGYA 1KEPA 2C07A 1Q2XA 4Q9AA 1XLTC 5BWCA 3UKDA 3DF7A 3PPXA 2NSLA 3F5QA 1U8EA 1T0JB 3H9CA 2J0EA 2C5GA 5J2TF 1RS0A 1ZYUA 4QYWA 3PQ3A 3WO1A 2O2XA 4EGFA 2ZJ6A 2C1EA 2AQIA 2ZRPA 1KQGA 1CDDA 3T9AA 2IU6A 3ZJUA 3IA2A 5F64A 1ULZA 1RWBA 1BS2A 1R6TA 5AKHA 2C1ZA 2G5TA 4J7XA 4I1YA 4R1OA 4UHJA 4EG4A 2PUBA 4KFCA 2WTAA 4BVFA 6NULA 2G76A 1TOAA 4ONEA 1OWOA 3EIEA 4RYLA 1TCVA 5J47A 4W1QA 4KQ2A 3LY7A 4FB4A 4EPTA 1KZYC 4JBIA 5C1BA 4EBBA 1OC2A 1GPDG 3VOSA 2BL4A 2MSEB 4TTQA 4G0QA 3BXFA 5AJVB 4Z8YA 3T34A 4DMLA 5IDYA 4QGAA 2NADA 3TLCA 2ZVDA 3N8KA 4GKJB 1NRXA 1UDCA 4XJXA 5A4JA 3UNXA 2VC2B 2UU9B 4Q4HA 2V6MA 4PNZA 3HUFA 2DX7A 3JQDA 4MGIR 3ZNOA 3MJHA 4OG2A 3O92A 3R24A 1M8GA 4ND6A 4AF8A 2IUEA 5HJEA 1RJEA 1M74A 3E82A 2YASA 4UVHA 2CK3A 3RAFC 4WFIA 1X1SA 2VZ0A 2CLFB 2X3YA 3TRKA 1U2GC 1G5IA 1X1BA 4HQ0A 1XA0A 2GPBA 2P9HA 3PD1A 1Q12A 3PP8A 5CPBA 3TI9A 2OT3B 4MV9A 1UBHS 4B4DA 4G1FA 3V4RA 2FWIA 3VOBA 1O6FA 2QQ0A 3KKMA 3RAPR 5AW9A 4BLTA 5J2UF 3EF3A 2ZVJA 3G9XA 3MT7A 1Z33A 4GX5A 4KI7A 4LHSA 4LPKA 3C7KA 2MSLA 3HG7A 5AUQA 2J4CA 4YIHA 2KHZA 4RD1A 1FC0A 5EHNA 1PSZA 1XZGA 3WIBA 4IRMA 4RTJA 2VPPA 3QI7A 4J1SA 4KHZA 1ZD5A 1OU0A 4QOEA 4YDRA 4F1JA 5AQ1A 2J09A 2C7RA 2C7OA 4OXRA 121PA 2JGJA 3A1DA 2WFAA 2WRZA 3CPHA 1GGKA 1DBPA 2RJOA 1MT0A 2VK4A 1JPNA 4KSCA 3RLFA 3ZJTA 3RIXA 3A6DA 1K97A 4WQMA 2JIZD 2WNSA 1DC5A 4XSGA 4BMNA 1TUGA 3GARA 1RWMA 1F12A 1XCOA 3EG5A 1FFXB 1MGPA 2WSMA 3HBLA 4EM6A 1T4DA 2V7XA 3TI7A 4AMZA 13PKA 1I2ZA 421PA 4NQRA 4BNIA 2W6JD 3I2YX 1DDOA 5GZ6A 4HNUA 3EVCA 1AVTA 4FZVA 3EIUA 5EXTA 1KBOA 5DE3A 1YI8A 1SKQA 3RWBA 3K4PA 3E3OA 2XTMA 3JRNA 4JJ7A 4HT3B 2JGDB 2J6CA 1JSRA 2ZDHA 5HGJA 4GKVA 4Y8VA 3EFEA 3DZKA 1JFFB 3KKKA 2N1BA 3G0GA 4MQ4A 5AJUA 1VLQA 3ROEA 3M6AA 5B3AA 1B2RA 5EOVA 2OAEA 5IH3A 5F52A 4C7XA 2GPSA 5BR8B 4OX9B 1MJGA 2QMHA 3T52A 3U3MA 4ER5A 5BQXA 4ER7A 1ST3A 2WD7B 2ZTSA 4DMRA 2O2DA 4MLPA 4MQUA 1UQRA 3ZZTA 3ZC3A 4ISCA 3WXMA 3I5MA 3EGDB 4R54A 3SC2B 4B7CA 4UUBA 5GY7A 4MHOA 4HATA 3OEWA 3ERCA 4N8DA 1GQSA 3TZKA 1JVNA 2IC5A 1GZHB 2PNJA 4I08A 2C7BA 3ZGNA 2XWSA 4H3HB 2WMOB 4BNTA 3OE4A 3DWGA 1SBQA 1WU7A 2JLCA 4MQMA 1WZIA 4G26A 5KYWA 2PSHA 3L4SO 4H4CA 2JFHA 5BW8A 3BE5A 5AI5A 1BCSB 4M0DA 4WZAB 1ECFA 2ZCVA 5HM6A 4CEHA 5JMOA 1U7TA 2Q9UA 2HXGA 3TDKA 3IEMA 1EJBA 3ME5A 4AMBA 5BRJA 2XI4A 2JBAA 2PS9A 3TIIA 2XBUA 2ZSUA 3VMMA 2W42A 1TU3A 2OO3A 1GV0A 1SU8A 2J46A 3PWKA 3EXIA 1RMYA 4CEJA 5ENVA 1H3NA 3LPCA 3FGOA 4DLRA 1QHHA 5CA0B 1CR1A 2BFDB 4G65A 5BVGB 2WDZA 4RMHA 3VSDA 3V6LA 1GITA 4IMIB 5AK5A 1NBEA 1HUQA 4ZMRA 3DEJA 3P2KA 2HA6A 2ZQ5A 5T4BA 1USWA 1CV2A 1G9SA 2YUIA 3GG2A 4LF9B 3LS2A 1ONOA 3TXYA 3UAOA 1IHXA 1VLHA 2I6TA 2PAFA 3AR9A 3C74A 5G3ZA 4YCNA 2B4YA 2J0UB 2XUPA 2YV1A 2W6PA 3MWFA 1PBNA 4MIKA 2B34A 2DRIA 2OLJA 3U62A 2AYZA 4PONA 5F23A 3WYNA 1E92A 1EQAA 3G0CA 4ENWA 3DJFA 1UBTS 1LS1A 4UARA 1PR6A 4WTOA 3L82B 4IIDA 6LDHA 5DN6D 1D07A 2NZWA 4H27A 2VUUA 4EPVA 5JVDA 5JTTA 1H8HD 3NONA 1X74A 1Z4MA 2C3YA 3O8NA 4LDRA 5KPDA 3ZGZA 4D3SA 3WQRA 2AQHA 4B17A 2YTZA 2Y68A 3WLTA 3ZNNA 4S05A 1DHRA 3RKRA 2A9QA 3U26A 3S81A 3TFOA 1DC8A 3U4QB 2JEOA 3FTQA 2DWUA 5KBYA 1J2UA 2GJ4A 4EW1A 1MJ5A 2VQ3A 2ORED 1T5BA 1WPQA 2NQ2C 2WICA 3RS5A 4IMPA 1Z0UA 1ZITA 2Z6VA 2HSEA 2OOKA 3C3JA 2NW6A 3IDAA 5C8ZA 3GLFE 4E5NA 3IP3A 4YP9A 3OD5A 4ZTZB 1GYPA 4MS3A 3AIIA 3L0BA 4R9SA 3ESBA 1XZJA 3FJYA 1XD9A 3ZUGA 3QKWA 4PYJA 1SBCA 2IELA 4LY0A 1A77A 5IKMA 3TOXA 3OF3A 3ER6A 2IXTA 4AJ2A 3VNQA 2QYHA 4NKRA 2QIPA 2CCGA 4BBAA 2C3UA 1KR5A 2WIDA 2J4FA 4QOHA 3GPDG 4Q01A 3WADA 3KLMX 4A92A 4PC1A 2ZIUB 3W9SA 2O3JA 4WEOA 3VNRA 1FZTA 3LX8A 1TAQA 3U37A 4U7GA 1M7HA 3MMZA 1QQ6A 4R2IA 2RHCA 1PR1A 1Z8NA 4LYGA 4YUAA 1PAUA 5CTAA 1KFBB 4QU5A 4HQRA 4FW8A 4M0PA 1C4KA 3DE7X 3RODA 4ARSA 4IEFB 5BYBA 5KJCA 3DP9A 1Y9AA 2ZIVB 1ATZA 2AQKA 3U7QA 1XZCA 1GCIA 3T0FA 4F97A 3UB3A 5HKKA 3KQPA 2NSHA 5G1NA 4ZCMA 1ZOSA 4R2HA 3U31A 4CT0A 2VT6A 1Q0PA 2MCFA 4KOAA 4R98A 5F2EA 4P4TA 4J76A 2C8LA 3W3AD 8GPBA 4TXLA 5JCJD 4CQMD 1UMCB 2G25A 2CE2X 4DIEA 4E4TA 1TTHA 2AMFA 3D7MA 4CETA 4L9AA 1C7EA 3OJOA 1SUDA 2QM3A 4QWWA 2G7MC 2Z1NA 2Z98A 4QASA 1R10A 4A0SA 1RM4A 1QYIA 1PL0A 4LHXA 3HK2A 5KAPA 2HHJA 1Y7HA 2RHJA 1KSHA 2X86A 2XUDA 2YZKA 3FUTA 3UIEA 3V8QA 2EJBA 2RHRA 1QHYA 5KCMA 2BUCA 3UJDA 3FMIA 5I7UA 3LFTA 4UAUA 1AM4D 1J5XA 4FKBA 2QP9X 5BNIA 3RT9A 1Q57A 1TK3A 3MRXA 1HDGO 1RZVA 1U2RA 4GP7A 5HIJA 1N2ZA 3NASA 3HVJA 5CJJA 3ZWXA 1W9MA 5LQDA 4GX1A 4FONA 4BX3A 1ADJA 4P86A 3SWWA 5FAKA 3BEDA 2OC9A 5A9SA 2YQ5A 1X7WB 2G17A 2OAQ1 5KAMA 3CH4B 4QPNA 3CB2A 3T94A 5IN4A 2YINC 5CLQA 4DQXA 1K3UB 1IQPA 2HCTA 2W58A 2R86A 2EP7A 1GNLA 2XMDA 3FOCA 3PA6A 1EXNA 4RZSA 4CLRA 1F1JA 1L7BA 4DSOA 2W8BA 5DXFA 5EJ4A 2X0JA 4NJEB 3UN1A 4C89A 3KJFA 4A5OA 4MXDA 1DINA 3KT3A 4ZREA 3REQB 3UPTA 1V8FA 2D0DA 2FWBA 4RLHA 5K3SA 3RRFA 4D80A 4F9GA 2AF3C 2AYXA 3AV3A 4I6GA 4PC7A 1JXQA 2OC4A 1TYZA 5GJCA 5A71A 2WPDD 4N0EA 4XIIA 2QRPA 3IBGA 4R2LA 4B4VA 4NV0A 1EXDA 2E9SA 3VHLB 2EWMA 1FY2A 3ANYB 3U6BA 4LRYA 2EYUA 5DW3A 2ZRHA 3FPEA 1L1EA 5HBGA 1UT8A 2PL9A 4ZDKA 2ZROA 3OJFA 4IZOA 4IHJF 2P0YA 1NW7A 2Y71A 1M2OB 2H1WA 3BGWA 2GJAA 1X3LA 3QLVA 5HRUA 3IP1A 2OV8A 1U9ZA 4J4HA 5DK4A 4ZXFA 2HQSA 4CIBA 4LFBB 5F3RA 1NYRA 2VH2A 4K8OA 2WF7A 1KVSA 1ULBA 3CXRA 4GRIA 4RIHA 5DJ5A 1IY9A 2G80A 3EPPA 4D3FA 1VYVA 1XPUA 3WRYC 1AF4A 1KETA 1PLJA 3HB0A 2JF0A 3MCVA 2AN9A 4IQ4A 4OK5A 9MHTA 2PZFA 1IWBB 1SBNE 5D3MA 4IFEA 3BF8A 1P7YA 3SSNA 1DWQA 3PCTA 4MR7B 1AXGA 3FUXA 4YYEA 4PO8A 3STWA 1ZIXA 2WNIA 2FUEA 1T3SA 4CTJA 3PXDA 5ALFA 1OI3A 4UTXA 1RBYA 1VMEA 3JZAA 2F9LA 4DRXB 3B3AA 2ACWA 2YHSA 2BFWA 1H2HA 4BRSA 5EPUA 2XOEA 2G9QA 3EVBA 5DMHA 5T57A 4KR2A 3H5LA 5EJMA 5L9AA 1B0UA 3KELA 2XZOA 5TY0A 1MX1A 1XEWX 2LP4Y 3I9V1 3MBKA 1UK6A 3NBKA 5BN1A 5LSAA 3DPSA 3FFWA 1BWSA 4AULA 3WWPA 2V6BA 2YXLA 4PG5A 2B82A 1Z2NX 2LZ0A 1QB7A 1VQ1A 3TBHA 2PT5A 5ILOA 3NBXX 5F4BA 4MQBA 5JPDA 4RV4A 2YIMA 2RJNA 3GN2A 5NULA 4MHSA 5F4ZA 5CFLA 3DFMA 2C8VA 3A26A 4GUDA 1SBHA 4Z4EA 3RFXA 2N9UA 2HM7A 1WX1A 4TZTA 1OFUA 4I5EA 2BHTA 3GGPA 5IVIA 1JDTA 4Z2YA 4GMKA 3UQZA 4B1FA 3OM1A 3HU2A 2QA5A 4HEQA 3LX4A 4MVXA 1KA9H 1ND5A 3S2YA 5J4YA 4YBZA 3KTAB 4FKZA 4QRHA 4DR7B 1GXSB 1C0EA 4WZZA 3W5AA 4MYRA 2OHXA 2FWPA 1VIVA 5KOHA 3Q3HA 1UJ5A 3NGMA 2H63A 2OORC 3QWFA 5TMBA 1GGEA 4BB5A 4FD3A 1E7WA 4U7JA 4YJFA 4BO2A 2W90A 4NOMA 3F96A 3V4FA 4BNKA 2VQFB 1V9CA 4AF7A 2W5UA 4XGKA 1XEWY 4UJ3A 1PJTA 1RRPA 3EZLA 5F7XA 3FDZA 4KO2S 3ZXSA 4EW2A 2WIFA 3F74A 4JQCA 4LOLA 1RAGA 1YFKA 2AVNA 3OQIB 4IJMA 3U3RA 1UK8A 4LYEA 2GYYA 5I7EA 3BWXA 5IWCA 3I32A 4XD7D 1U9CA 2QLBA 1BQ4A 1H1TA 2OHJA 5BQ5A 1YKSA 4L0DA 2YWBA 5AP9A 2QY6A 5KOYA 4BO0A 2MHCA 4ALJA 4KZPA 1JV2B 1PJCA 4BATA 1D7OA 1FVHA 2OQ2A 3HFRA 4GVPA 1C3VA 3KZOA 4QTTB 4UBJA 4E1VA 2JGLA 5BNFA 2EX0A 3CZMA 4FUTA 4GMFA 3SJZA 1B41A 1RYFA 1SZDA 3NFRA 3EW9A 4M86A 4NS4A 4OHFA 1H9CA 5H80A 2SBTA 3TLGA 3K4HA 3EZ9A 4FGZA 3ZXIA 1G3IA 4DWWA 4JL6A 4OEHA 1A7KA 1A7AA 3MAGA 3QOXA 4MUXA 5HJ2A 3Q2IA 5J4VA 2CYCA 4ZEMA 3CN9A 3WJ7A 3KO8A 5K0SA 5F12A 4L85A 5TPZD 2YZ2A 1ZUNA 3HY4A 5HCNA 3EGOA 2DJ5A 4P4SB 4Q21A 4DT1B 4L7QA 2EJWA 3LKVA 2Q7OE 3RC3A 2I4OA 3LVFO 4RPIA 3ZBUA 2CCJA 1PKEA 3CXUA 5DM4A 2WMNB 4LGMA 3VR3D 4KNVA 2VWQA 3FSEA 4WKBA 4GOOD 1P72A 4P3YA 1RHQA 1DEAA 2CLMB 3V2UA 1AKMA 3GHYA 3DTNA 4LXQA 5T64A 4CCYA 4CMKA 2Q3MA 3JQPA 3DZHA 1LY1A 2H7CA 1ZCZA 2QTRA 1PT6A 2H0RA 1H2XA 2OQRA 5DTQA 2VDVE 5G1PA 4FWTA 4IIHA 4BVJA 1Y6JA 2FQYA 3BD9A 4F3TA 2QTBA 2DPXA 3EVEA 3GOHA 1F9AA 4RFVA 4BQSA 4TM7A 3DMTA 4HAVA 4UU1A 5CFMA 1NMSA 3KOOA 2QD4A 5T4FA 1CE8A 2A88A 1RKBA 2DFPA 2P9YA 4M99A 4RA9B 2UZ1B 5BN5A 3G8AA 3DFUA 1LB1B 1BQ3A 1B76A 2C8KA 3IB6A 3QJGA 4JLWA 3TOZA 1I2DA 1V26A 4OXQA 4RIEA 3V4ZA 1G21E 1UANA 1WU8A 2ZI5A 1JN0A 4I5FA 3KAPA 1JYFA 5AHWA 1BFUA 2H00A 4UPEA 1YB7A 4BFYA 1UFKA 4AQ7A 1QONA 1SOWA 5L4LA 4X94A 1XU7A 3ZDXB 3RYCA 3OIDA 4O2AF 4M9CA 4GM4A 4TPKA 1AUQA 2QRQA 3VHXA 4DY6A 2YHIB 2PUVA 3N8GA 3ZK7A 3HFGA 2O0KA 3LCCA 3UM9A 2YZ7A 5CH5A 5E6RA 4HF7A 2O2CA 1CNFA 1P8JA 1W4BA 2W2LA 3HCBA 3HVKA 3NG1A 3Q72A 1XNRB 1KI6A 2Q4OA 3RFCA 2ONYA 4HFMA 2IHTA 4LZOA 4WX2B 4BEBA 2GPJA 2DPHA 3RUAA 4XAQA 4YP5A 3DH0A 2WQZA 4J91A 1AN9A 4L4ZA 6ABPA 1PL7A 4BKQA 3OPYA 4WKOA 1NFFA 4PWZA 1O58A 1QHEA 2IU0A 3WGMA 3HY6A 3HB7A 4RQBA 1OBHA 4E5UA 1Z5VA 1NTRA 1UZMA 1IHYA 4B79A 2C0PA 1RIIA 3X1DA 1RKUA 3KKZA 2D0IA 6Q21A 1FFSA 2RAFA 3ZE0B 2QVCA 4DWOA 3VR2D 4PQRA 4G5OA 4RTSA 1Y6ZA 1G8PA 1KEEB 3FPLA 2F55A 1VHQA 3RBAA 3FMVA 3AWIA 4MLDA 4WACA 3PGA1 1NVVQ 3V80A 4Y7DA 4EPWA 2H29A 4I46A 3DCJA 4G5QA 4QYTA 1HYQA 1OPRA 3DFKA 2ZZMA 1FQWA 4GF5A 2BKVA 5G4LA 1T5SA 3DO6A 4MUFA 2HRBA 1G2QA 2HUPA 3K96A 5FEMA 3JWIA 4YH1A 4YJ3B 4HXGA 5GIPE 1TAGA 3P2EA 1WCIA 4PPGA 1C4XA 4M21A 1SC1A 4OD0A 3IO3A 2P5YA 1WKCA 4GSYA 4MMZB 3LO5A 4Z0HO 4ANFA 5J2UA 3PPWA 3DLBA 1P3JA 2ATCA 1UWLA 4RORA 1IZ7A 4HDKB 4LMRA 5A05A 1T1IA 1CUCA 3WDMA 4F2GA 2BJHA 2JRCA 3CLUC 2GK3A 4TL9A 4LXTA 1C7JA 1SA0A 2R6AA 4JYBA 1MC8A 2DT8A 2P69A 1US8A 4CKEA 3DMDA 3PQ8A 1UC8A 2AH5A 3NKLA 5H1YA 5LKAA 1PFGA 2VJAA 4BNDA 4PLTA 3PX7A 4OBEA 3RHSA 3SIWA 3U3OA 1JQ3A 4HZUA 2GEFA 5FLYA 5A03A 1U0OC 2IS4A 3DHEA 2VXBA 1EQUA 1NTOA 3C45A 4TKVA 2VTBB 3FGNA 221PA 5AKKA 3L92A 3IIIA 5EERA 2WU0A 5EC8A 1I2AA 3WHKA 4YUXA 1ZNYA 3Q2KA 1BKSB 1ULUA 2EKBA 4OHWA 4LCEA 1I3NA 4LWOA 3OQHA 5CTJA 3G2KA 3PPIA 4OXKA 5G4KA 3QV1A 3STYA 1OIXA 1OXKB 2ZS8A 3KE8A 3P9PA 4C07A 4CKBA 3CFYA 3SQNA 1YS9A 4JVSB 4G5SA 1QTQA 1JG7A 5EN4A 1U1FA 4JCCA 4QECA 8OHMA 2ZRMA 3PJFA 1E62A 1I1OA 3H11A 1E1QA 2PQ0A 2RGNA 1Z6TA 2RKBA 2BVNA 4KN9S 1CIJA 3ZY6A 2Q1TA 3I2KA 4NONA 3MJTA 3RD5A 2R00A 4R2JA 1XNQB 2XWQA 1EGQA 1G6KA 2QPLA 3SR0A 3EDYA 3Q3CA 5E2AA 2BMJA 4IIYA 1T5TA 3RRZA 3WKEA 1PZMA 4PICA 3IIMA 4AECA 4B9AA 4HNGA 5BWMA 3D3JA 4KVGA 3K70C 2H1FA 5ALEA 4F5WA 3D4OA 1G5RA 3HBMA 1X0XA 3HYSA 3UYKA 2O5CA 3NT4A 3LWBA 3VO8A 4OGWA 1TQ4A 2FZVA 2ZQZA 3O26A 3R7BA 3K9WA 5FLEX 2XQIA 3I09A 3W79A 3MTBA 1A04A 1BQEA 1RQGA 1Z4OA 4ZOEA 1DLIA 3BIFA 2GFQA 4WASA 5AK4A 2AEEA 4HWSA 1CUUA 4URHA 3FVQA 4LV8B 2QU8A 4W82A 4MS1A 3RG2A 4EH1A 2VHUA 3GP3A 3MRTA 1NNEA 1IBSA 1DO2A 2DQZA 1P80A 2BDUA 1U6IA 3DCIA 5TB5A 1AGYA 4OU5A 3DBRA 2AXPA 1PV2A 2IPAB 1HE5A 4ECAA 2FPXA 5JI2E 3KYBA 3BL5A 4J0CA 3I0NA 3O8CA 2Y05A 5FOQA 2OHIA 3A58B 4E11A 1Q0RA 5IXJA 3PF9A 1KFJB 2YW9A 3K0AA 3KQNA 2ZP1A 1E2KA 3A37A 4XD2A 1R66A 1E3TA 4OTZA 3VISA 1G17A 1ZGHA 5KS2A 3K9FC 1MA0A 3GLGB 1W36D 1SBZA 2I3BA 1PNVA 2Z5VA 3GFQA 3GA0A 4TS9A 4XWYA 1ZI9A 2PR7A 3VVLA 2JH8A 4TWBA 5AIAA 1X94A 2RC5A 1KWKA 2LD4A 2YFQA 3L6RA 3F7OA 3R4VA 4JP3A 3IELA 2DUMA 1XMJA 3DZIA 4ZAYA 2G8NA 4PZEA 4TVOA 2G3YA 2CHVA 4EHLA 1J8DA 4KGVA 1Z2CA 3HYCA 3EWIA 2I1WA 1Z15A 5LDDC 1AUXA 4QL3A 2WM3A 3P9KA 4JLSA 4KIFA 2XRZA 2GF9A 3F8SA 5IEJA 3DKRA 4XVHA 1MQSA 1QG0A 3PTLA 1XP8A 1TUIA 3TEJA 1C81A 2BEVB 3IKVA 1M34B 4O2AB 1D1PA 3HDQA 1GQFA 1MJFA 2V03A 3HVUA 1U90A 3H9JA 1A50B 1O94A 2E6UX 3P9YA 3OOEA 3OJXA 3ABRB 4GYJA 4OQQA 1DHTA 3GLHA 4IDAA 2NPOA 3I83A 5DWQA 4CNQA 5E3JA 2I2FA 4YY3B 3HXKA 3BQ9A 1LQUA 1FYXA 2AFHA 2IU4A 3M4ZA 3VM6A 2O50A 1Q7RA 4D5GA 1VJCA 1LFDB 4F5EA 5DHUA 3IMKA 1A97A 1ZL0A 3WGJA 4RELA 3WKCA 2P40A 3NBUA 2QTNA 4DMGA 4G36A 3VO2A 4AW9A 1ESZA 1K8QA 3TUJC 1VZ3A 5JBNA 4TV8F 1GAWA 2PSFA 4XVUA 1DXQA 5K0CA 3ZWOA 2Y1XA 2WHPA 1KAEA 3QXCA 1RJGA 3PK0A 3I01M 4AIRA 1X1CA 4HFJA 4H7FA 4HP8A 4PU0A 2SHKA 3FHOA 4NK5A 2DF8A 3KL4A 3A9SA 4BCBA 5EWLA 1JIVA 4DIKA 5BUQA 4PZCA 3SEQA 4HWTA 4EKGA 1WEKA 3R6WA 1F7UA 2V6JA 3FTPA 1O9HA 4UZFA 1N6RA 3DDUA 1ZMBA 2C83A 1OIVA 3ENQA 1IONA 5HILA 1P5RA 3PE3A 3FYDA 5FIUA 3SM9A 1C41A 4G0NA 4HB3A 3FOZA 1N9KA 4RCYA 3OTIA 4LYYA 2BGTA 3SS9X 1NVKA 2C7GA 1TMOA 1H8EA 2VK2A 3FLEA 3NETA 3TD9A 1RXVA 2RGEA 3H75A 4M0CA 1P9WA 5TEWA 2O1EA 1RSZA 1ZINA 2JGMA 1YT5A 4N0MA 3NHPA 4RH1A 1RBMA 1K8RA 1Q3HA 3MYYA 3ZY3A 1IMOA 1KRXA 1DV1A 1H3FA 1WETA 4GPEA 1YVUA 3HO8A 2AWNA 3ZQJA 5C1IA 2JH3A 3STTA 5JVDF 4Q7KA 3DDWA 1VRCA 2IOFK 2ERYA 1N1GA 1DG3A 2AR7A 3G13A 1NSTA 3P5BA 5D6OA 1NBHA 5T8KA 3UMBA 1DARA 1E9DA 3Q5EA 4X3PA 4MV8A 4HXFB 4NZPA 1L5FA 1LCIA 3FYTA 3CINA 3P9SA<