1X8LA

Crystal structure of retinol dehydratase in complex with all-trans-4-oxoretinol and inactive cofactor pap
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
342
structure length
342
Chain Sequence
PFPYEFRELNPEEDKLVKANLGAFPTTYVKLGPKGYMVYRPYLKDAANIYNMPLRPTDVFVASYQRSGTTMTQELVWLIENDLNFEAAKTYMSLRYIYLDGFMIYDPEKQEEYNDILPNPENLDMERYLGLLEYSSRPGSSLLAAVPPTEKRFVKTHLPLSLMPPNMLDTVKMVYLARDPRDVAVSSFHHARLLYLLNKQSNFKDFWEMFHRGLYTLTPYFEHVKEAWAKRHDPNMLFLFYEDYLKDLPGSIARIADFLGKKLSEEQIQRLSEHLNFEKFKNNGAVNMEDYREIGILADGEHFIRKGKAGCWRDYFDEEMTKQAEKWIKDNLKDTDLRYPNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords retinol dehydratase
publication title The structures of the unique sulfotransferase retinol dehydratase with product and inhibitors provide insight into enzyme mechanism and inhibition.
pubmed doi rcsb
source organism Spodoptera frugiperda
molecule tags Transferase
total genus 123
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1x8lA00
1XNJA 3U2QA 4I1UA 5GJBA 2QP9X 1Q1QA 4JS0A 3TE6A 3A37A 3MWKA 4TYPA 4BFWA 2EW1A 2WMNB 4C0SA 4H9GA 2OXRA 3DOEA 1QZXA 4ON9A 2XSZD 1XTKA 1YZNA 3RANA 4ZO4A 1GOTA 5AJZA 1KSJA 4FCVA 4XOIA 4IDNA 5K8LA 3K0CC 5KSPA 2F55A 3AKDA 4HAXA 2CE2X 2QPAA 1EGAA 3EC1A 4HZUA 4DLZA 2HJVA 3B85A 3QKTA 3MD0A 4Q9LA 2QSZA 4RFSA 1I4TD 1IN5A 3EW9A 1PVOA 2GCPA 5FUVA 2MSCB 4LDJA 2FDCA 1TADA 2F9MA 4JT4A 4D26A 4KITB 2RGNA 3TRFA 4E09A 1T5LA 4FMCF 1N5JA 6Q21A 3EWSA 1G7TA 1GVNB 1RZ3A 2RKOA 4LHXA 5DO9A 4AYWA 2VQSA 4TYWA 4DSTA 2DBYA 3CRRA 1DO0A 3T12A 2J7PA 3SZRA 4LJ8A 2NG1A 2ORWA 3W6PA 2J7KA 3HP1A 1N0VC 2CDNA 4D80A 1E2HA 3QPWA 4HI0E 4FIDA 2BEKA 3PFIA 2DY1A 2O0JA 5JECA 3KJIA 4BRWA 1EFHA 2PLFA 3PUVA 4KFUA 1N6OA 2O8EB 5F98A 1IXSB 4KVAA 3U3KA 2MMCA 2PEZA 4ILEA 4MGYR 3EPHA 1E6CA 2VF8A 1C4OA 4IKEA 1JAHA 3SNHA 3LBIA 3HWSA 4L15A 4EIWA 1OXSC 2D3WA 3AVQA 1J8YF 4IXNA 4KJZA 3KQUA 1D2MA 3GFPA 3UMFA 1T0JB 1XD9A 3CZPA 5GVSA 1P9RA 3ZJYA 4BLOA 1DTSA 1X8KA 2OE2A 1HYQA 1N25A 1GNRA 2YC4C 3AP3A 1Z2AA 3CRVA 3NDPA 3WNCA 1Q1BA 2IA5A 2RGXA 3FHOA 4WIAA 2GA8A 4II7A 1ZP6A 2AK3A 1U8AA 2OFOA 2ZPTX 3PUZA 1HQCA 4GSYA 2VP0A 2YWEA 5FFMA 4A15A 2AFHE 2J0UA 2VHTA 3NBYC 3LFUA 3RS0A 2GF0A 1K8RA 4M1WA 1HT1E 1LVGA 2XNSA 4GOKA 3ICQB 5EP4A 5CK5A 3IUYA 3AF1A 2QT0A 3CPJB 4YDHB 1W4AA 4HDQB 5FBQB 3KQLA 1ZM4A 3M1IA 2ZUDA 1ZW6A 3GLHA 4LI0A 1NRJB 2WJVA 1F2TB 4C4PA 3R9XA 2RHMA 1S8FA 2EFGA 5B64A 3CH4B 3OIVA 4MITA 1GUAA 1KNXA 2ONKA 3EA0A 1KI6B 4CEIB 3GLIE 3AVWA 4IDPA 2Z4SA 3NHBA 4LJAA 1N0WA 3V9PA 3VTKA 4U5XA 2O52A 4JBWA 2QA5A 1EG7A 1HT2E 3QKRA 1JR3E 4L16A 2J0QA 3NVAA 5JLJA 5BN4A 1SXJB 3MJRA 4JYCA 1BKDR 4A0FA 2R44A 4EJSA 3TGPA 4PHHA 1RRCA 1B23P 1P9NA 2ZI9A 2YHSA 2QAGB 4E5UA 3B13B 4MUAA 4PFSA 3RWMB 2AL7A 1ZM2A 1R5BA 2Z0MA 4BFYA 1A7JA 4PO1A 3QE0A 2Z4RA 2PJRA 5JRZA 4LBYA 2HCJB 4RD0A 3MRSA 5E7MA 4MYUA 1JEEA 3KJGA 4XTCS 1VDZA 4EFNA 2REBA 3DKVA 1MOZA 3GJXC 1G7RA 1NSTA 4QBFA 4OI1A 2RMKA 1YQTA 4DLTA 3T5GA 3K70C 1UKZA 3U3JA 4DCUA 4BFXA 3QG1A 3L0SA 3FKSA 4F93B 5GJVC 1VMAA 1ZYUA 1DG3A 4Q4JA 5SZIA 3GP8A 1DAMA 2WZQA 1E98A 1IAQA 3NWJA 1RIFA 2G77B 1G7CA 1G16A 1PZNA 3E5HA 4IDQA 1AN0A 1NLZA 4DDTA 1DE0A 2ZRJA 3B1VA 5TY0A 4K46A 1R4AA 4CZ2A 4JSTA 2GZHA 3P27A 3ASZA 2J3EA 3EZ6A 1E69A 2WPDA 5KUTA 4PPFA 1HV8A 2O8CA 4DLSA 1KOFA 1R0XA 4EFMA 1FUUA 3WNDA 3C16C 4IOKA 1S1CA 4LBVA 3IO5A 3BIFA 4FD2A 4N0EA 5TXGA 3KQHA 1CRPA 4QL3A 1GL9B 1BIFA 2V3CC 1Z22A 4JL5A 5HE8A 1HEIA 2EYUA 2IF2A 1OH7A 1E2NA 3QNUA 1Q12A 3U6BA 2YOHA 1G17A 3WBKA 5FOVA 5AUQA 2XEXA 1XCGB 2QQEA 4B76A 4F4CA 4Q1AA 1FW6A 5KU1A 3DOFA 2JA1A 1TMKA 1NP6A 5TDHA 2WJHA 3JVUA 4XVQA 4ZDIA 2YC2C 5JWOA 2JIZA 3LDAA 3NH6A 4Y0VA 5J40A 3RWOA 2CL7X 3U5ZB 4M1MA 2GVZC 4QGHA 2IBMA 4V03A 3SS8A 5JHGB 2G88A 4KYUA 1EESA 1E0AA 4DEYA 1E79D 4EPXA 3OE7D 4RJLA 1Q21A 2PCJA 4DBLC 2GTPA 3TW4A 4BLPA 4DLWA 1WP9A 1KJWA 4QGFA 4AD8A 3KQKA 1VG8A 3GJ3A 1XX6A 1YR6A 1DAEA 1Z63A 2WWHA 3GFOA 3W8RA 3ZYCA 4JMPA 3SEAA 1P2TA 1KAGA 2BBWA 2O0KA 1ESMA 4LYFA 4M9SA 4IDOA 1C9KA 4M9QA 4GNKA 2HT6A 1CIPA 1P62B 4ZPXA 1F3OA 2CVFA 3RLFA 1JR3A 3OESA 1AQYA 1N0UA 5IDVA 1QRAA 1Z2CA 5B30A 5BWMA 3TQFA 1XPRA 3H86A 3IGFA 4A8JC 1II8B 3VKGA 4PAQA 4WW0A 5A0FA 4TSFA 3BH0A 2BV3A 3U3RA 1NLYA 5FPYA 3TAHA 4RZ3A 2BJWA 1VYVA 5KNDA 2QRNA 2I4IA 3BB1A 4IEIA 4JL6A 1E9AA 2IYQA 4IOMA 2XTNA 5JS8A 3EZFA 2YKGA 1TEXA 4A92A 2XB2A 3GLGB 5FPSA 5CB8A 3GLFE 1IY1A 2QGNA 4DSNA 2UZ3A 2V6JA 1SHZA 2KSQA 3SBEA 2ODBA 1XDBA 1DADA 3FKSD 4WXPA 3LXXA 4YDSA 2E9SA 4TTQA 5IRCD 1E2PA 4O0MA 4DRZA 3ZVRA 2OSBA 1IJEA 4Q5IA 4GT1A 1G3UA 1E9BA 4ITRC 5JEEA 2CHVA 4DWJA 2QEQA 1US8B 2IC5A 3AUXA 5GADl 4RFVA 1G291 3KUDA 1YE8A 221PA 2PH1A 3BS4A 4C2TA 2PBRA 2CNWA 4IVQA 1KY2A 1P4SA 1R5NA 5AUPB 3P20A 4QKQA 4HAYA 4AC9A 2QBYB 2FG5A 4X8HA 1IY0A 4WOPA 1G4AE 5DI3A 1G41A 3ZVMA 4PPQA 1H8EA 1E1QA 1PUIA 2O8BB 3FHCB 1JPJA 1ODFA 4PQYA 4NE2A 1R10A 5FL7A 4DLXA 1KK1A 1S2MA 3I5YA 2KBFA 2KE5A 2ZRBA 1RFLA 2VBCA 3VR2A 1ZBDA 4P4SA 3VR3A 4WBSA 1M8PA 2WJJA 1TNDA 5FTKA 4PSVA 2JIZD 2ZTSA 3ADBA 4Q01A 4AI6A 2DCUA 1T3SA 3P4XA 2ORVA 1T3LA 2F1JA 5BYJA 4DCSA 3NHAA 2IUSA 3Q5DA 3VQTA 1R5OA 3QXHA 1IXRC 2W58A 5FUWA 4RD4A 1GG2A 2R6AA 3MJHA 5HCNA 2ONJA 2IWHA 4LSGA 4OK5A 5GJWC 1N5LA 4Q66C 4XSGA 3VU9A 2O8DA 1YHNA 2ZRLA 4MKHA 4DLVA 5EJEA 5DN6A 2CJWA 4EFLA 3FTQA 2AN9A 1E0KA 1S3GA 2F3RA 4BECA 5TV2A 3EA5A 2QY9A 4IVRA 3F3YA 3HPRA 3LO5A 4AKIA 4Q7JB 3HYRA 1YZTA 3DM9B 4M1KA 3VHXA 1OV4A 2PLRA 2YYZA 1AQUA 3S1AA 2DPXA 1JR3D 3MG9A 1VCOA 4W5JA 2QTHA 3THYB 2MSEB 421PA 2BCJQ 1E99A 4JKIA 4AURA 5BN5A 2RGNC 3H1TA 4ACAA 1KI9A 4TSFD 1Z29A 2QGZA 3SC3A 1SVOA 4Q7MB 1Q1ZA 3LVRE 1FX0A 3LX5A 2OILA 1YRBA 4MKIA 5K8IA 1GWNA 5KTYA 2HLDD 4Q9JA 3J81k 2GESA 1CKEA 2VTKA 4Q1CA 2OAP1 1SGWA 2H92A 2ZRKA 1XD2B 3I73A 5FL3A 4AG5A 1SXJD 1JJVA 2FJUA 5E7IA 1DG1G 5CDFE 1JXMA 4AYTA 1GZSA 1KSFX 4FI3C 1TQ4A 2A5JA 3L2OB 2OCBA 4NH0A 1MRSA 4UNPA 4X8OA 3B1WA 4PC3A 3GLFA 4XD7A 1BYIA 3U4QA 1JEDA 4LJ6A 1XTRA 3FMFA 4ARZB 2V1XA 2ANBA 1ZUHA 4DDVA 1ZU4A 2NMVA 2IXEA 4A82A 1R0YA 3TSWA 3U7FB 1ZNYA 1E2IA 2WSSA 2IS2A 3D8BA 1LFDB 3KFXA 1YR9A 4QHSA 2HXSA 4UXIA 2LCFA 1HE8B 1E2EA 3RABA 4A0GA 2VPPA 3QEOA 3EXAA 1NN1A 2CNWD 2AXNA 2QMEA 2XJ4A 2ZUBA 1X6VA 4P4UA 2XB4A 4QHYA 4C0HA 1EWQA 1S3SA 1OH5A 1ZMXA 4C2UA 3C14C 3M6AA 3VHLB 5JI3E 3QVUA 3O8CA 1OFTA 3JZAA 1H8ED 3QIAA 4C9BA 4MRPA 1D2NA 1SVSA 2IYWA 1ZNZA 1G8PA 1OHHA 2QE7D 3H2YA 5D3MB 1H8HD 2B6HA 4DLUA 1G3RA 1FNMA 4Z8YA 2AD1A 1W47A 4OBEA 1W4CA 4GMDA 4IHQA 5L3SB 4MYTA 2JLXA 1N6PA 4DCVA 4ZI3A 1ELOA 3BK7A 1RE0A 1IM2A 5IK2A 4ZIRA 4OHZA 5JEDA 2LKDA 2Q3FA 3VNUA 1ZINA 1KO1A 3HR7A 2ERYA 2NTYC 2QPTA 4PC6A 4EJSC 2XGJA 1ZIOA 3OEEA 4JT2A 1M7BA 1N6IA 2XITA 3AKCA 4CT5A 2FFHA 2JDIA 1XXHA 2ZR7A 1UDXA 5B58C 2P3SA 3DL0A 5JFGA 3F8TA 4V0LA 3QOFA 2IF0A 4B6EA 2YJTD 1DAGA 1OKKD 3IHWA 2OAQ1 4UXHA 1XPOA 4AKEA 3SQWA 4MQBA 1JALA 1JQLB 1FL9A 1CR0A 2R65A 3RS3A 3AV0B 3FYHA 4LCBA 3OIYA 4G1UC 3OEHA 5KHOC 4AKHA 1G4UR 2Z43A 4BFSA 4PHTA 2AHOA 2C5LA 2REOA 3MWLA 4QJ5A 3D31A 2VP4A 3PIRA 4TL7A 3CNOA 3QXJA 2XXAB 4PC1A 4EPTA 1QHHA 1E2MA 3MLEA 4HLCA 3WHKA 2IW3A 3X1DA 3LW8A 2GCNA 2XNDD 3K0AA 4ZCLA 1KO5A 1X8LA 1N6NA 2OESA 2X77A 1CLUA 1JAIA 4RD6A 2NO0A 2FPKA 1W0JA 2VH5R 4JVNA 2GEDA 4B48A 4M9XA 1MO3A 2WJYA 3OAAA 4GZMA 3RDPA 1A4RA 2IL1A 2VL7A 3BOSA 4L4UA 2PT7A 1YZQA 3FPAA 3SDZA 1P3JA 5BW8A 5CDFA 2FFQA 1LS1A 4US2R 4TN1A 3TSZA 2QP4A 3QF4A 4A0HA 1JBKA 1QVAA 2W6JA 3IIJA 2BIFA 3VKWA 5G41A 5AJWA 1OJLA 2FWRA 2LWIA 2AWNA 1S9DA 2YWHA 2XSZA 2CHGA 1VIAA 4DB2A 4D4LA 1XMSA 1ZC3A 4EPYA 1OLOA 2EVWX 2EFHB 3K9HA 3NIBA 4HZUB 1RKBA 1TU4A 1TX4B 1SZPA 4ASUD 2QL6A 5A4JA 3L43A 4OJKA 4WAUA 1NSFA 4RFSB 2G0NA 3QG5A 2A3RA 3U60B 4B44A 3KKMA 4MRNA 1FP7A 4MDEA 1P6XA 3H84A 4QJ4A 3I1FA 2NO9A 2OLJA 1FNNA 1RJ9A 3PENA 5JBQA 4ESVA 1Z6TA 3BJIC 1T8TA 1JPNA 4MRVA 3R8CA 2C77A 1UADA 3WYAA 2ZREA 1IHUA 2F6RA 1CJVC 4LHWA 3KL4A 4TLCA 2PMDA 4KFSA 2GETA 3TVTA 3HU3A 4TYYA 4OHXA 3N70A 5EUMA 4QNMA 3RRMA 1F6BA 1Q3TA 2B21A 1O87A 1V43A 2AK2A 2EFEB 3KTAA 3QJYA 4HLQB 4NYMQ 4NCHA 4TYQA 4B73A 3KXKA 2D2FA 1XB2A 1T9HA 5H1YA 3ZVLA 4KYIB 2K5UA 4C30A 1CEEA 2R6FA 4FMCB 3PEUA 1K6MA 2JLSA 2W0SA 1RYHA 2DFTA 2AWOA 4NKRA 5FBLB 4MGZR 2Y8EA 4KXFB 3NH9A 2FGKA 2GAAA 2OBLA 2QMHA 3LVQE 2ERXA 2FNAA 3EIEA 4EQ6A 2ZRDA 3IIMA 2CMKA 2J9RA 3BBPA 5L3QA 1WBDA 1SVWA 4TYNA 1MKYA 2JJ2A 3PUYA 2ODNA 2NOAA 4NCJA 1AGPA 1SKYE 4F4IA 1RC8A 4OQLA 2J0UB 4BGDA 4AYXA 1F5NA 1GRQA 1OW3B 2IHYA 3RS5A 1E9SA 2IYYA 2ZIAA 3CM0A 3UG6A 2V54A 4RKEA 3LQQA 1E4VA 5FPHA 1W2HA 1ZUNB 3KB2A 1W49A 1AA9A 3QBTA 4Q9IA 5EQTA 1MO6A 2GHIA 5FTMA 2A2ZA 4PAOA 3AB3A 4I99A 3TUIC 2QNRA 3K9NA 4YONB 1KDPA 3OAAD 4AWXA 5JMTA 3T1OA 2RB4A 1UKYA 3KZ1E 3K0FA 3ZD6A 3FHTA 2GXQA 1GAJA 3OHMA 4U7DA 1II9A 4BZXA 4JLAA 1CF4A 1IN4A 1KO8A 4EJSB 3RHFA 3EPKA 3W5IA 2Q9BA 3LAWA 2Q6TA 3QSYA 1XTJA 4W9MC 2W6JD 5FBRB 1OXTA 2XTMA 3FKQA 1YZGA 2ZEJA 2ZI7A 4G01B 3UPUA 4B3DA 1JR6A 3PR1A 2Q0HA 2V7QD 2WICA 2ZR9A 3QXXA 5EXPA 2GXSA 4DXAA 1KO7A 4BRUA 1XZQA 1X1RA 2WIAA 3B9QA 1KYIA 3WMFA 3BERA 2DFKB 2F43A 2H18A 4J0QA 8OHMA 4LGMA 2I3BA 4HB2A 1TUEA 2UVQA 4XWKA 5FOXA 2ZANA 4FINA 3ADDA 4P4TA 4TMWA 1U9IA 2FEMA 1GITA 3RC3A 2AD5A 2OV2A 2AKAB 2BKEA 4MGIR 2X1VA 3QVVA 2KWIA 4P0TA 3FWYA 3THWA 4DT1A 3X1YA 2W00A 1L2TA 4UJ5A 2SHKA 2ZQ5A 4DZZA 3BRWD 1S0UA 3AGQA 1NY5A 2JJ1D 1SKQA 2F9LA 4HB0A 4KFRA 4KVGA 4LC1A 1W36C 2JCSA 1ZD9A 4HAZA 3B6EA 1LNZA 3WBJA 2WBLC 5FOSA 3SBDA 4OL0A 3SU8A 5FTNA 1RVDA 1OB5A 5JWHA 5DLQC 3NEYA 1T5IA 1YRAA 1AS0A 3WXMA 3I32A 2HUPA 4Q9KA 3SJZA 4M1SA 4Q1DA 1U8ZA 3IPXA 2CBZA 4LJ5A 5IHPA 2ZE6A 1OYYA 1E0JA 1E2DA 2KI5A 1WF3A 4C0BA 1G3MA 1II0A 1OF1A 1XJ0A 5KYKA 4UXJA 1EFCA 1ZM9A 2MSDB 3A1VA 2FSGA 1D6JA 4NL4H 1YR8A 2JEOA 3ECCA 3LX8A 1GDDA 5SZJA 4WVFA 821PA 3ZQ6A 2JJ2D 5DYGA 2YOFA 1UFQA 2FSIA 5BQ5A 1E79A 1AGRA 3OE7A 3IEVA 3VR6A 3L8YA 5B57C 4YC7A 2CL0X 4BE7B 1Z47A 3NG1A 1DS6A 3LV8A 2PT5A 2WWIA 4LV5B 2ATVA 4CVNA 1T0HB 2NO1A 4G5RA 2CHQA 2Q3MA 1HQYE 1NKSA 2C78A 4U00A 1XEFA 1EK0A 1B0UA 2CE7A 4N3NA 1GKYA 5FR2A 3AVUA 2GKSA 1EX6A 1K5GA 1TUIA 1FQJA 2F1IA 2FFAA 2OZEA 2BVNA 3BORA 4HUQB 1OB2A 2GVDC 2J87A 1MABA 2GEUA 2OG2A 1GILA 3MSXA 1P2UA 1CJUC 4OI2A 3I3SR 1W0KD 2PZEA 4GPTA 1HE1C 3T35A 1M7GA 4PQFA 1QHNA 2D74A 4RSGA 2JATA 1NVUQ 2QRZA 2NPFA 1D9ZA 3U61B 5JWRA 5JZVA 2HJGA 4D2IA 1IN6A 5JHHB 3IQWA 5C2JB 1SXJE 2A5DA 2H5EA 2IYSA 2H8KA 1TF7A 4MGKR 4UNRA 1N5KA 1QBKC 4DIEA 4MYCA 2NO7A 2RGGA 2HCBA 2ZRAA 1NBMD 1JI0A 2X2FA 4MKFA 3K53A 5EXXA 3QKUA 3QKSB 1MR3F 2O8FB 1YR7A 1E9EA 4LK2A 3I5XA 4Q1FA 1ZRHA 3TVDA 1NN3A 1XWIA 4TZ6A 3L0OA 4LJYA 5KDLA 5E4FA 4C0AC 2GRJA 3G82C 5F9FA 2WJGA 2QTFA 4LWZA 2C2HA 3I8SA 2J45A 5KPJA 4ZKDA 4B3XA 3ZQJA 4GZLA 5KDDA 3LWNA 1L8QA 1J7KA 3QUSA 4HLUA 3TUJC 4JLBA 4IFBA 4FMDF 5HKKD 4PAMA 2ZI6A 4ZDWA 1HA3A 4G0NA 1E96A 4TLEA 1S1MA 3C8UA 2IXGA 4HDCA 2JLZA 1M74A 4BWYA 5F9HA 2ZRCA 2CL6X 1WDTA 2FU5C 3AGPA 4KAXA 4A6XA 5KNBA 2OCPA 1TQ2A 3LA6A 3SFVA 2GNOA 4YMWA 2G1JA 1TF5A 1KJYA 4RCZA 2BM1A 2D2EA 3VR4A 4O3MA 3AH8A 1FMLA 2H57A 4WXRA 4ABYA 1XMJA 1GIAA 1KI4A 4A36A 2FN4A 4OJQA 4PHGA 1A82A 4IOJA 4B3FX 2C03A 4EPRA 2PZGA 1OIVA 2V9PA 2O8EA 2OFWA 4F38A 5TB5A 5F3WB 2TMKA 3NC1C 2NZJA 5JS7A 4XJXA 3CR7A 2BM0A 2GCOB 4XVUA 4Q4AA 1CULC 1XEXA 1W36B 3CX6A 2J5XA 2YNMA 2WWGA 1BS1A 4HAWA 2CJWB 3DMDA 4RD1A 3FDIA 5KO2A 4B2LA 5JJIA 2RHDA 3IKJA 3ZDQA 3GLIA 4KLZA 4ZCIA 4OQMA 4EDHA 3OIWA 2IYLD 1UBCA 3S1AB 3UKDA 3CZQA 2R62A 1NI3A 2ZJ8A 2EYQA 5CIWA 2GJSA 1F2TA 2GBLA 4QGGA 4X8MA 4CEHB 2DFLA 4JIMA 1D9XA 4DLRA 5C18A 1KI6A 1FX0B 2F1RA 2V4ZA 3W34A 3ND8A 1Q22A 2QT1A 2HLDA 3DVLA 4G5QA 4LOAA 4QBIA 1CRQA 4JLJA 1JXOA 1GRNA 1FZQA 1SXJA 5FUXA 4YMTA 4NCIA 2ZYVX 3AF3A 2VHCA 4URXR 3CRMA 4I4LA 4TQ9A 2GDJA 2W0MA 1KMHA 1N6KA 3DHWC 3GJ6A 121PA 2DHRA 2IYUA 4YQFA 1SHKA 5AJVB 3U4QB 3D3QA 1GKIA 5G40A 4CIDA 4XH9B 3TUZC 2RH5A 3H4MA 3ZZTA 4B74A 1VCNA 4WZ6A 3P26A 2BMJA 4URZR 3TNFA 4YMVA 4LZZA 2A7QA 2FOLA 1FP6A 1CR2A 3GLGE 1DAFA 2IUTA 2FFBA 3QPUA 4FW9A 1M1YE 2N46A 3Q85A 2Z6VA 2CVHA 1Z07A 4C0JA 2FSHA 3KB1A 3QY0A 2IEYA 2Q3HA 5EE5B 1SVMA 4G5SA 3ZZUA 4N1AA 1FQKA 4POAA 1T4GA 2V8OA 1GNQA 2ZSFA 5AUNB 1P75A 2QE7A 3BAFA 4UKDA 1H8HA 2R8RA 4TLAA 3A36A 3OFND 1X86B 4KCGA 4YLGA 5LB4A 4JVSB 3A8TA 3U7HB 1F2UB 1W7AA 4LBWA 5E3HA 2YV5A 3TW8B 1GRRA 5J4HA 2C95A 3GJ0A 3QPVA 4NBSA 4ZIRB 4OQFA 1MV5A 2OO7A 2X19A 4KI0A 4RVCA 3A1TA 3E1SA 4C7OA 4P3YA 3RRYA 1KDTA 2XJ9A 4ZI2A 1IN7A 2CCJA 1PLKA 3K70B 4GBMA 4CT4B 4NONA 3R7WB 3L8ZA 5H8WA 5DSZA 2OLKA 1KO4A 4E03A 1KAOA 3V4RA 3QBVA 1XXHB 1PLLA 4LV6A 4HEJA 1GL7A 2A9KA 4U02A 4FCWA 3TQCA 1OKKA 1NMXA 2WAYA 2KJQA 3MUFA 1CU1A 1Z6GA 2YINC 5J4LA 5EXSA 2ZRNA 1VCMA 2OHFA 3PV0A 2OFXA 1CXZA 2HV8A 1U9IC 2QTVB 2WKPA 1Y63A 3KJEA 5DE3A 1WA5A 3RAPR 3I61A 1LS6A 4BZQA 1OSNA 3RNLA 5EXTA 5EZ6B 1QHHB 1KHTA 3L82B 1UJ2A 4RZXA 3EASA 1P5ZB 1T8UA 2GK6A 2JLQA 2XNDA 4JZKA 4DUGA 3DZDA 2JLWA 1E2LA 5FTLA 1W5TA 2WJIA 1G6HA 1WQ1R 4XSHA 1KK2A 2QAJA 1A5TA 3RS7A 2BHRA 1KIMA 4ZDKA 1GP2A 721PA 2ZSDA 1E2GA 3K09A 5FUYA 1VYTA 3T5DA 3LQRA 3CONA 2QMUA 2HYDA 3ZD7A 5DH9A 3SI7A 4D4JA 4GDFA 3LBHA 2HEIA 2D7CA 5J4KA 5C4GB 2IK8A 1NG9A 3IQXA 3LW7A 1FUKA 1II8A 1ZJ6A 1R2QA 3NBXX 1P2VA 1NL3A 2WWYA 1BMFD 4F7WA 3TMKA 1XTSA 3B1XA 4HAUA 5A5GA 2JLVA 5FI0B 4JYBA 1E2KA 2YOGA 2NGRA 3CLVA 3KKQA 4TQUS 3W6OA 3EIQA 4FCTA 5G3YA 5IF9A 3FOZA 2VEDA 4WA7A 1QF9A 3Q7PA 5L3VA 4MH0R 2BOVA 1TF2A 4ASUA 3DPUA 3DO6A 1E1RD 2GJ8A 3VNVA 2D7DA 3BB3A 4LRWA 1ZVQA 3PQCA 4HLDA 4Q48A 3WRYC 3T1TA 2WOJA 4QM7A 3U44A 5AK0A 4FN5A 1NN5A 4DB4A 4URWR 2JLRA 1R0ZA 4A8JB 4RZ2A 1RJ9B 2O0HA 1U2RA 1VKJA 1G8FA 2J0VA 1KZ7B 4XVRA 4EPWA 1ZCAA 4M22A 1L7VC 5SZKB 1NY6A 1XFAA 3A4LA 1XCPA 1WXQA 1OH8A 1VG9B 2ZRGA 4JBXA 3TJZA 5KNCA 1TAGA 2O5VA 3NC0C 1XMVA 2WWWA 3SHWA 3T06B 1DBSA 1YU9A 4YXWD 4Q4HA 1W4RA 3KTAB 2FE4A 1YZKA 1C1YA 4HYYA 2VP6A 4NTZA 3FMOB 1Q0UA 2FV8A 4B75A 3RSOA 4QHTA 3RS2A 1WE2A 4RY2A 3B78A 1W46A 4TL8A 3EIHA 2UKDA 1RRFA 3PG5A 2BJVA 4Z1MA 3E2IA 2WSMA 4TLDA 3OZXA 3CPEA 2Z5FA 4ZCMA 2BMFA 5L3QB 3CNLA 1QG2A 2ZVPX 1U90A 3BB4A 1TQDA 3TK1A 2ZAMA 2WTUA 3PEVA 3WY9A 2ANCA 2ZS9A 3UATA 1AZTA 3ND9A 2G3YA 1Z8FA 5KSYA 4PQRA 4DUGD 1KI1A 3I72A 2VF7A 2JGNA 1CP2A 3REFA 3A1SA 1YKSA 4PO9A 5CLLA 5H68A 4BLQA 1P9WA 4W7SA 4B3CA 1PUJA 2PL3A 1Z6YA 3ZS9A 3W90A 5CITA 1M34E 1FTSA 2ATXA 3REGA 4CF7A 3HU1A 4HLUC 2MMGA 5JJKA 2EWWA 4M1TA 2WWXA 3K0FB 4QBGB 3WYFA 4JSYA 4RZUA 4A2WA 4GRAA 2P6UA 4CRWB 1UBGA 3THYA 4URUR 1LV7A 1SVKA 3B82A 3R9IA 5JSZA 4MRRA 1Z0FA 1X3SA 2VHJA 4XWAA 4JLPA 1JB1A 4LY6A 4V0OA 3HU2A 3GEHA 4LX0A 5C46F 1VG0B 1PV4A 1UAAA 1XJCA 3CX8A 3V00A 1E9RA 2CLCX 1T3HA 2I1VB 2V7QA 3DKPA 5BN3A 1FMJA 1EFRA 1N6RA 1YJ5A 2WKRA 1W5SA 1N3BA 2F1HA 1NBME 2R6CA 4LHYA 4D0LB 4TMTA 1Z0IA 2BBTA 521PA 1UPTA 4M1OA 4UQOA 1HURA 2VO1A 2OM2A 2ZJ5A 2UZIR 3TIFA 2DWQA 4DDWA 1M2OB 1WRBA 2P6NA 3CRQA 2KBEA 4ZV4A 2FGJA 3LY5A 1ZM7A 3THWB 2J0SA 2QZ4A 1ZIPA 3CKLA 2XAUA 3GJ4A 5DI9A 2QENA 4YMUA 2JJ1A 3NXSA 4CYMA 2GJAA 4BFVA 1TPZA 2H1LA 4LBZA 4V0ME 1NIPA 5P21A 4R9UC 4NDZA 1XJQA 1NF3A 3RS4A 1ZD1A 4EPVA 3SYKA 1D8TA 3EC2A 1VTKA 4JL8A 4RD3A 2BDTA 1L4UA 3BD9A 2C99A 1Q3HA 3X1WA 4A6PA 3THXA 1DO2A 4HSEA 1I2DA 4DEXA 5HR5A 3CF6R 1ESNA 1ETUA 2WVJA 5C4MA 1E9FA 4DIDA 1V5WA 1Z0JA 3DM5A 2P67A 1M6NA 3Q9LA 3SR0A 2GBLC 2JLUA 2BEJA 2VP9A 1BYUA 3HJNA 1UEJA 3AF0A 4V0KA 4BLRA 2GXAA 5L3SA 4PTLA 3ZLJA 2AXPA 2W2VA 1OFHA 1E9CA 3U7EB 3PJRA 4IXMA 1AIPA 1MO4A 4O2RA 4Z1MD 4H1UA 1G3IA 1QHIA 5CK4A 1KK0A 1SXJC 4TMVA 2A78A 4LJ4A 1MO5A 4KFTA 4OYHA 1AZSC 2V6IA 2G1KA 1Q1EA 2ZU0C 3LBNA 1ZCBA 5E7JA 5LPNA 4ZKEA 3IBGA 3Q8XB 2RGBA 2YZ2A 3GJ8A 1Z08A 3EAQA 5J4YA 2QAGC 1P72A 3W9YA 5H70A 1BH2A 1Z0AA 2EU8A 3CX7A 4Q7KA 2HYIC 1DELA 3GLHB 1HTWA 1IXZA 4GI7A 2IT1A 4QC2A 1VYUA 3LXRA 4M4SA 1T6NA 2IHBA 3TBKA 3I8XA 1Q20A 3H0KA 3EZ9A 1CJTC 1OPXA 1ZM3A 3L0IB 3KDSE 3KUCA 1R8QA 3CBQA 2C98A 3QKRB 2DWOA 1DVRA 1K5DA 3WP0A 2IS4A 2R6GA 1MABB 3B5JA 4BEBA 3HYTA 1KKLA 3P4YA 5LB2A 1P60A 5DYIA 1W0KA 5HTKA 1AS3A 3B1ZA 2A5GA 1GSIA 3AF2A 2J46A 1CR4A 5L8VA 3SFZA 5HCIA 5FOUA 3PITA 1QG4A 4JJZA 1EFRD 5FOTA 3C41J 1XCMA 4P33A 4TMKA 1KY3A 3AVOA 1Z6AA 2P6RA 1NBMA 4E22A 3C4JA 1Z6XA 4JLMA 2BMDA 2JASA 3QQ5A 4OK6A 4Q47A 4QXAA 5TVKA 1RPZA 1BO6A 5K8UA 3GPLA 1CS4C 5AWFC 3A6PC 5CB6A 1TU3A 4DSOA 2IYTA 2H17A 4Q4JB 4NP6A 2CCGA 4NU0A 5FTJA 4B6FA 5BXQC 1EFTA 5J4VA 4Q00A 4BFZA 2ZYTX 3B1YA 1M7HA 4Q19A 1Z0DA 4D0NA 4G5OA 2ZITA 4V0MA 2OXCA 1G5PA 1I4LD 3AVYA 5HKKA 2O8CB 3JZMA 4OI0A 4PR0A 5J5CA 3T15A 4DKXA 4HB4A 4BLTA 4NPHA 2VP5A 2ECKA 4MDFA 1F60A 2P5TB 4HB3A 1BOFA 4GP6A 3ADCA 3T61A 2OBMA 4US0R 5EE9A 3CPHA 4M2LA 2A30A 4NYMR 3BE4A 1XTIA 4LHZA 4US1R 2C96A 4L9WA 3ZGXA 2ZRFA 4FMDB 5DIFA 4CEJA 5HPYB 3K09C 5DHAA 5E95A 5F2EA 1Q57A 1UF9A 1EX7A 4JLVA 1T91A 3VX3A 3QI2A 5EP3A 5JCPA 1G8GA 1XPUA 2ZAOA 3MWJA 2PMKA 4C0LA 3KFVA 3PVSA 1E9DA 1G5RA 1QHGA 4I1SA 4Z8XA 2X8AA 3MGCA 3ZIAD 3WRXC 5C1BA 1XU4A 2ZRPA 1SVLA 3OIUA 2QN6A 3BWDD 4I81A 4M21A 4Q4AB 5G3ZA 5HZKA 1XEXB 4S2EA 1XEWX 4HZIA 4RD2A 1ZUIA 1AS2A 1O3YA 4FWIB 4ERNA 1G21E 2E87A 1KI3A 2NPIA 3IPYA 2ZJ2A 1AM4D 2XOKA 2B8WA 3SJBA 1ZU5A 4ESHA 4DVGA 1GFIA 1XTQA 2ZUCA 3GLIB 1LY1A 2W2XA 2Q9CA 2EFCB 1IONA 2ZE8A 2XX3A 3B9PA 3W3AA 1GL6A 1HY3A 2BWJA 3T1VA 3EPLA 1G5TA 2ZJYA 1IBRA 3AQ4A 4B3BA 4IDHA 3AP1A 2QQ0A 3JVVA 3VFDA 4TT3A 3WYGA 2AX4A 4K81B 2C9YA 2GZAA 2B7CA 3BH6A 3SJCA 1Z83A 3WMGA 4C0KA 1UKEA 1NJFA 2BMEA 5EZ5A 3WP1B 2WHXA 4DSUA 2R2AA 1GM5A 4AIIA 3CIOA 1OXXK 4Q18A 4Q02A 4A4DA 2C9OA 3CW2A 3L0PA 3SE0A 1KMHB 2GK7A 4DC9A 1UBEA 4IFEA 3IEUA 3O8DA 3PEWA 4M0LA 3A4NA 4LYHA 1CBUA 3CNNA 2C8VA 4JLDA 4QM6A 3EX7C 1E0SA 1TQ6A 2ZU6A 2CLDX 4Q7LA 2OUKA 2CLSA 4A0RA 2D62A 3B60A 2ZS7A 2QMOA 1VHLA 2ZSBA 3ZH9B 1IY2A 1RW4A 3BGWA 3CRW1 4I1OA 3W6NA 4DDUA 3IBYA 3I62A 3THOA 3T1QA 4B43A 2HXYA 3GD7A 1X8JA 1G8YA 3GMTA 3TAUA 4B32A 4BZPA 3K0SA 4OHYA 4Q1BA 3QEJA 4MUBA 5DI3B 2IS1A 1CJMA 2Q21A 4LUCA 2BC9A 1AKEA 5FI1B 3VAAA 2BCGY 2OEPA 2IS6A 4EAQA 2RGDA 4IW3B 4PPNA 3AKEA 4LPSA 3U6KA 2OCYC 1VHTA 1ZC4A 2XTZA 4PZLA 5FOWA 5ELXA 5HE9A 3OFNA 2J41A 4Q03A 2FPLA 3TLXA 1DEKA 2PCLA 2F3TA 1WBBA 1LTQA 2J7PD 3HDTA 4URYR 1A2BA 1YZUA 2IYZA 2N1BA 1ZAKA 4FMBB 4TMXA 2QG6A 4IJMA 2FF7A 2PJZA 2RAPA 2ZJOA 3LH5A 4P4SB 3VX4A 3M4YA 3VMFA 1NJGA 4F4JA 5TMPA 4PZZA 3KX2A 2XZOA 4C3ZA 1KI7A 4C7OB 3AP2A 3CUEF 3F0TA 2VLIA 5IT5A 3A1UA 4Q1EA 2G83A 3X2SA 4D82A 4KBGA 4H1VA 1ZNWA 2FA9A 2G6BA 1Z28A 2D06A 2WIBA 1N6LA 3RSLA 4D4KA 2CEAA 3VU9B 2O8DB 4DJTA 3O8RA 1U99A 3GCGA 4OHWA 5LD2C 3Q7QA 2ZR0A 1NLFA 5JRJA 2XOKD 3A4MA 2B7BA 4L9SA 1W48A 4A9AA 1EFUA 4XTRA 1KZGB 4M53A 4NCNA 5DHFA 3SYNA 2B92A 2C04A 1FPMA 3KKNA 1NG1A 4KV9A 4B3GA 2WM9B 3LNCA 2QORA 3K9LA 3W8NA 2ZE7A 4R98A 3LD9A 1VECA 2KB0A 2VSFA 3Q5EA 1FFHA 4KU4A 1KMQA 3D6TB 2YWGA 3GEIA 3TR0A 2G9NA 1KNQA 2REXB 3A1WA 3AF4A 2EFDB 4TT3D 4W5HA 5ANRB 2QU8A 4CEIA 4NYJQ 3ICEA 4PXAA 4MA4A 3IO3A 2ZETA 1KDRA 1KK3A 3X1XA 4TTRA 2ZI4A 2DR3A 1AJEA 1OXVA 3M0EA 4HUQA 1JNYA 2PZFA 3KKOA 5D3QA 2N42A 1DARA 2PX0A 1R6BX 2XZPA 4F91B 2BBSA 3BC1A 4O2LA 3GLFB 1DAKA 1G3QA 2VIIA 4B2PA 2CK3A 2DFNA 2QAGA 2ZJAA 4UNNA 4B35A 2ZROA 5JI2E 3FB4A 4GOXA 1UDWA 4JBYA 4N0DA 4QNRA 2D4HA 1BMFA 2GILA 4IEEA 3LLUA 3SHFA 2ZRIA 4FXPA 5AJYA 1KJZA 1IJFA 3RRZA 2VHQA 3NTUA 3QKSA 4PX9A 2O8FA 2AFIE 4XIGS 2ODWA 1E1RA 4LJ9A 1X1SA 2NZ8A 4NYIQ 2ZM5A 1NMZA 2Z83A 3SOPA 3R8FA 3U44B 1EXMA 3O47A 3FE2A 3AUYA 1QHXA 4JLOA 1NVVQ 3KXIA 1NVXQ 5EE1A 4P32A 2L0XA 3I92A 1TL7C 2E1RA 3DMNA 1RRGA 3VR1A 1VG1A 2IXFA 1KGDA 4S35A 4F92B 2WPDD 5EE0A 2F7SA 4GMXA 4NHOA 4M8NE 2V55B 3FMIA 2IWRA 2RCNA 1N6HA 5L3RA 4B33A 5TARA 4YXWA 2IYRA 4Q4HB 1A2KC 2NO6A 4RCYA 4TL9A 2ZVQX 5KSZA 3WNBA 5FBWB 1Z0KA 1TTTA 3UWKA 4UNQA 4D0GA 2R9VA 4GL2A 4WZAE 2DB3A 1UKVY 3ZZ0A 3MAAC 4PZYA 4BLSA 4QOSA 4QRHA 1RRPA 2J1LA 5EUQB 2QPOA 1R7RA 5M04A 4BEJA 1FTNA 3K0CA 4HATA 4Z54A 3KJHA 4M1YA 1W2GA 5FR1A 3MFYA 3BH7A 3AVPA 5KSOA 1NNEA 1U0JA 2CCKA 4BFTA 1E2QA 1OFUX 2EWVA 3CWQA 4D6PA 2GXUA 1Q44A 1Z06A 2G0TA 1XXHE 1ZNXA 1KSHA 4JVLA 2P0EA 3EZ7A 2GCOA 4CGZA 4R2IA 2IX3A 1DAHA 4AK9A 3B7GA 1OXUA 1D2EA 1OT3A 3CF2A 1VPLA 4RKFA 4B47A 4I1VA 3K0AB 1J99A 4NMMA 1OIWA 2VHUA 4DCTA 1VIYA 3PXGA 1YZLA 2H16A 4PC2A 4V02A 4BASA 2ZRMA 2HDNB 4QGAA 1E94E 3Q3JB 2IYXA 3QENA 4Y0AA 1U98A 3N2EA 2IEZA 3IIKA 4L8GA 3DEFA 4A2PA 3VKHA 3GEEA 2FZLA 4LPKA 3WHLA 2GWHA 2ZS8A 4JKYA 4TWZA 1WCV1 2PEYA 1XMIA 4DCNA 4NYJR 4LV8B 4B34A 1XP8A 2VSXA 5KOYA 2FX3A 2JLYA 3QF4B 3OF5A 5JSZB 1E32A 3F5FA 4QFMA 2CK3D 2C9CA 4CEHA 1LF5A 3GJ7A 4MRSA 4BUJA 4KODA 3ETLA 3X1ZA 2A5YB 2OCAA 2P5SA 3CF0A 1OYWA 3P1JA 4PC7A 3B8HA 3V4FA 3BXZA 2VA8A 2VP2A 4BPBA 4LC0A 3P32A 4MYHA 2WKQA 3ADKA 3GQBA 3GLGA 4A2QA 1G1MA 3R20A 4PPGA 4TQAA 3T34A 1QDEA 1Z3IX 2J59A 4JVMA 2VSOA 5GVRA 1J2JA 2ASEA 1MRNA 4WZBE 1XRJA 4JLNA 4KHZA 2I1QA 1W44A 3D7MA 1IOZA 4TL6A 3W5JA 1G19A 2YWFA 1GNPA 4LYAA 1G8HA 4AG6A 3B2EA 1F48A 1QVRA 3QF7A 5UKDA 2VYFA 2ZSAA 1L4YA 1RYFA 1U0HC 1US8A 1S4QA 4X8LA 2EQBA 4IOLA 4NYIR 1HUQA 1NMYA 4E07A 1AKYA 5CYPA 4OKSA 1J8MF 4LJ7A 5CYOA 2QBYA 1E3MA 1G7SA 1NVVR 2ZI3A 3PEYA 1R0WA 3K8YA 1P73A 1W1WA 3THXB 4JJKA 2WWFA 1E1QD 2O8BA 3G5UA 3UANA 4CW7A 3NKVA 1R8SA 5JCZA 4OK3A 2H7VA 1OIXA 2PX3A 1G20E 3KKPA 4OQXA 5FL7D 4QJ3A 2YVUA 3G0HA 1Z5ZA 1F2UA 1AK2A 4HDOB 1MH1A 3U7GA 1COWA 4G5GA 2W83A 3MCAA 4JLKA 3TSOA 2ZYUX 1ZD8A 2VRWA 4MKGA 4CDGA 1IQPA 2QUZA 4EQ6B 3GFTA 2NIPA 4AY2A 2FPMA 3C5HA 4KLNA 5DISB 3EG5A 5AUOB 5DNYB 3EWAA 3UG7A 3GJ5A 3R7WA 3NDBB 3TH5A 1IN8A 1PJRA 1U0LA 1J90A 2GAOA 4KO8A 3PUWA 3UIEA 5EE3A 5AR1A 3U3MA 3BFKA 4NZYA 4O25A 5SZHB 1W36D 1XEWY 2ZE5A 3K9GA 3AVVA 3E70C 1I4DD 2W6IA 2FSFA 5DN6D 5EP1A 5CIQA 2DYKA 4PSKA 4DLYA 3SN6A 1XF9A 3FFBA 4UJ3A 3ASYA 3ZVNA 3K1JA 2FZ4A 4G3XA 3UK6A 2HF9A 2WV9A 1U8YA 3Q72A 4B71A 4GFDA 1P2SA 1XZPA 4KSBA 4Q4LA 5EP2A 2IUUA 3SQXA 4OHVA 2JJ8A 3CH5A 2QM8A 1NIJA 2BKUA 3HR8A 1GTVA 4ACBA 1Y3AA 2A5FA 3UXMA 2HF8A 4Q9HA 3TR5A 3IDQA 4KBFA 4IVPA 4FWTA 3LRPA 2OBNA 4NCKA 1P7CA 1CTQA 3CR8A 4KSCA 1OE0A 3DDCA 4ZDJA 2LKCA 4BQSA 4GOJA 1I2MA 3BFXA 2RGCA 3C15C 3CB4A 3I4LA 3SJAA 3MMPA 5CJPA 5KDOA 1JJ7A 3N2IA 1DAIA 2QI9C 4W5WA 5GJCA 1XD2A 1KI8A 1LB1B 1UM8A 5DGXA 3EPJA 5CLQA 4TLBA 1OFIA 2F43B 4TMZA 2XZLA 1KKMA 4M9ZA 4OI4A 1MT0A 4OQNA 2JAQA 4V0NA 5HZHA 3KQNA 5LD2B 4XD7D 5KPDA 3PCRB 4QBHA 4IRUB 3UMRA 2GJ9A 1E2FA 2WMOB 5LDDC 4ARZA 2ZSEA 3QXCA 1H65A 2ZJBA 4DT1B 1YVDA 3C5CA 3A58B 3ZS8A 4URVR 2ZXUA 1JECA 3FMPB 4LYJA 3TKLA 2WSSD 2CXXA 4D81A 3NBFA 3WMEA 2ZJZA 3FGNA 4GP7A 4B2IA 621PA 3KXLA 1EWRA 1G18A 2HT1A 1JQJC 3FVQA 1KDOA 1ONBA 3BFVA 3N5CA 2AR7A 2X2EA 4PHFA 4UNSA 5LBIA 2AKYA 4D25A 1G6OA 3FFAA 1XD8A 1CR1A 3O8BA 1N5IA 2QSYA 2ZI5A 1HH4A 1OHHD 2IYVA 5D3MA 4A8JA 4DHEA 2DWPA 4L5BA 1DOAA 1QHSA 1SQ5A 5CM9C 4R71A 5FBVB 2W2TA 5FPTA 4EKDA 4P31A 3AKYA 1N2CE 1COWD 1ANKA 1J70A 1KTVA 1NVWQ 1UBFA 1GKUB 3MWYW 4QG7A 2ODEA 4A1FA 2Q9AA 4LHVA 4R7ZA 5FH9A 3NEJA 4PO8A 1D5CA 1FOEB 2P2LA 2FMXA 1U81A 1XBTA 4Z51A 5IK2D 4CEJB 3SYLA 4XWOA 4TZ0A 2WAXA 3RRNA 3U3OA 3EARA 3K70D 3R9WA 1G64A 4YMSA 2QM7A 1G9XA 1NKTA 3OEED 5CJ2A 1OH6A 4K8OA 2GEVA 2R6DA 2V1UA 1QHYA 3ZIAA 1SULA 1CJKC 1UEIA 1SKYB 2GZDA 2JDID 3ONWA 2QP3A 4HUTA 5BYKA 4PANA 2W6ID 1VCIA 2OT3B 5J47A 3QXSA 2FH5B 1P61B 4Q21A 1WB9A 5FPKA 5K8TA 3NBZC 5AJXA 3OEHD 4TTPA 3EZ2A 3LLMA 3CO5A 1PLJA 2ORIA 2GJKA 3AVXA 1E4YA 2XXAA 3UWOA 3PUXA 1S96A 5CM8B 1A1VA 1KSGA 3AVTA 3GLHE 4PSAA 3HPQA 2BBOA 3IHLA 5JJLA 1S9HA 1U94A 3AM1A 5B2ZA 3IILA 1TEVA 1W4BA 3K0EA 1W0JD 2QROA 3UMSA 4C0QC 1NN0A 2WOOA 3RYTC 3CWZA 3DZ8A 3W3ZB 3RVBA 3VR5A 1KI2A 2NQ2C 3AEZA 4D4MA 4HAVA 4R2HA 1E2JA 4BFUA 2GF9A 2ZYWX 2RGEA 3C7KA 4AKGA 4EUNA 1SVIA 2FEOA 2P65A 1DPFA 2RGAA 1LF0A 2ZRHA 1WMSA 5G53C 1LW7A 2B8TA 3RC8A
chains in the Genus database with same CATH superfamily
4BC0A 3QBJA 4I1UA 4EHFA 1U02A 3DZIA 3BJRA 3C3PA 3EPRA 3MWKA 3OO0A 5EWLA 1ACMA 5LSAA 3FLAA 4EUEA 1NZFA 3O4HA 1B42A 4RIGA 2OXRA 4R3NA 2A0KA 4XI9A 4YJ2A 3MYYA 5KZMB 1BWQA 4LHEA 2FPRA 4ZO4A 1GOTA 1ZVJA 4HRYA 1Z7YA 2F55A 2YWCA 1WV1A 3KKZA 2VBGA 2CE2X 4HAXA 1EGAA 5AI5A 3R4VA 1DMSA 1GAQA 4KRXA 1JQKA 3B85A 1ULBA 3CG0A 3QKTA 4NESA 4M9RA 3GRVA 2PKQO 7GPBA 5HQJA 3LI2A 3RYHA 5FYDA 5CA1F 2N1MA 2DTEA 4W8GA 5AKLA 1C3EA 3VVLA 1P6UA 5FUVA 2WYIA 3WICA 5ENDA 1H4QA 2MSCB 2GYWA 3V48A 5KJCA 3CURA 4GXNA 1XFDA 4D26A 4IXWA 2EIXA 3O74A 4AUEA 4E09A 3AFHA 3TRFA 1T5LA 2P9HA 3PJEA 1CUBA 5DO9A 4P6VF 1WNFA 3WMWA 4YRZA 2LV8A 4IGIA 1V5GA 2YBDA 1DO0A 3HN2A 4MV8A 2JKVA 4RQAA 2HWXA 2ORWA 4ZVRA 5B1EA 2J7KA 5A05A 3OQ1A 2F67A 3NHUA 1L3IA 4FIDA 1CUJA 1Q1GA 2W8BB 2BI8A 4YECA 4D3SA 1KDZA 2XAAA 2MYPA 2E21A 4BRWA 5IUJC 3V3TA 1N6OA 4P58A 1HC7A 1QCYA 3ZI4A 4DTCA 4RNCA 2PKEA 3PNOA 2MMCA 2RI1A 3ZUGA 3EPHA 1U0SY 4EMSA 4ZRMA 3U0BA 2LUOA 4QPPA 4YIHA 3B3AA 1QRTA 3FFTA 2UUAB 3HHPA 1LBHA 3LBIA 4BV8A 3P0IA 4L15A 5ED4A 3D2BA 1QIKA 3IT1A 3WTBA 4DZRA 4ERXA 3I0ZA 3NM6B 3NRBA 3UFBA 5I9LA 4KJZA 3KQUA 1KP2A 2BGNA 1T0JB 4KQ6A 5E8JA 1Z3CA 4K9OA 5JZBA 2XCRB 1X8KA 3ST7A 3NDPA 3N76A 2N47A 1NBHA 3R0JA 4GR5A 4Q16A 4TXLA 2RGXA 1C7FA 2HPVA 5LYJB 4WIAA 3ESZA 3DEKA 4MMXB 1CEYA 1I3LA 1NV9A 5JOQA 2NSJA 2AK3A 1A9ZA 3QVMA 3VU0A 4BVAA 1HQCA 1FDSA 1SCJA 2YWEA 4OLHA 1I0LA 1O96B 2J0UA 2VHTA 3NBYC 5D84A 3GN2A 4A15A 3DFUA 1KFKB 1F7UA 3PZBA 1RWVA 2BT4A 3W4IA 2PUTA 1Z5OA 5NULA 4ZRDA 2IELA 4YX9A 3KQLA 2DG2A 3MUNA 1EFPB 3FFWA 3WIDA 1ZW6A 3GLHA 4U9UA 2WJVA 1F2TB 1ZUNA 3C1AA 3R9XA 2EFGA 3FPCA 4QYIB 5YASA 2CSXA 2ZWAA 2JCBA 3RJMA 4UTVA 2RKBA 1CZRA 3AVWA 4MPRA 4TS1A 4LJAA 3O2SB 1U8UA 2FCRA 5G0WA 3GZTB 2O52A 4U5XA 4YV7A 4GLLA 1DCFA 4AN4A 3QKRA 4LXIA 5EMMA 1QV9A 2HZ7A 1SXJB 4PSCA 5KAMA 4A7PA 5JJCA 1E4EA 4JYCA 2O5RA 5AIBA 2VJLA 2IP4A 4OH1A 1E3LA 4IIGA 3CINA 4ZTBA 3QLEA 3BL8A 3I9FA 2M6KA 1SU8A 4QSHA 2LDBA 5F23A 3TFQA 1QUEA 3RH0A 1K5PA 1DG9A 1HLFA 5BUSA 1H5NA 2QIPA 4FHGA 1GARA 3RAJA 3D5EA 1PGPA 4E5UA 1R6VA 4MUAA 4PFSA 5EHGA 3KQTA 2AL7A 3BIJA 3TQHA 5HKOA 1VSQA 1QRRA 2R7NA 3QE0A 4D9EA 1ZL2A 2PJRA 5KHAA 2OV3A 3TLCA 4LBYA 2Z2IA 3PQ7A 2YZNA 3MRSA 1CUFA 1XP5A 4FKBA 5GONA 5EIXA 1LPOA 1JEEA 1DLIA 4XTCS 1HDOA 1C50A 4N3GA 3JWHA 4JC5A 4LZLA 2HC9A 2YS7A 1T9GR 1YMUA 3PRJA 4DLTA 5A4AA 1C0IA 5BRNA 3C1OA 3T5GA 5E1BA 4RWEA 4ARBA 3U3JA 4DCUA 3SK0A 1FB5A 4LRSB 1VMAA 3HYCA 4EW3A 1DG3A 4JIGA 4Q4JA 3GP8A 1DAMA 4Q7QA 2YMQA 1Y3BE 1E98A 1IAQA 4N3AA 1RIFA 3G1UA 3ZE1B 5COQA 4Z4CA 2HCFA 1DUIA 3DLHA 1PZNA 2PYZA 4IDQA 3SSAA 5T5QA 3AV3A 1AN0A 1J21A 2PGIA 3HC7A 1BXGA 4FSXA 5E38A 4K46A 1QGAA 1R4AA 2H0QA 2GZHA 2P1ZA 4HUJA 1MQAA 2D1QA 3SMVA 3WXBA 4ZEMA 4BJ6A 1FS4A 2J3EA 4JP5A 1E69A 3BREA 4HYTA 5C7LO 4PPFA 2X2OA 5BOSA 3ER8A 1T13A 1EA5A 3UK7A 1KOFA 1R0XA 5CA0A 3S29A 2XWPA 1USIA 3RTBA 1QKKA 4HNVA 1P0PA 1S1CA 4LBVA 3HY4A 3KXDA 4FD2A 2V4MA 3GEBA 4QL3A 1GL9B 5K4AA 1I94B 3H9JA 5IRCD 2B4YA 2VWHA 3CX3A 4X6YA 3ZE8A 2EYUA 2IF2A 3ZQUA 3E9MA 3GZ4A 1E2NA 2ADFA 2YY7A 5ESXA 1G17A 1U2QA 2PRJA 4GD3Q 4N9WA 2Q50A 2QQEA 2XEXA 2GM4A 1U28C 3TNJA 1C81A 2AC2A 4LXUA 3DOFA 1H3FA 3LP6A 5KOHA 2JGKA 4BYGA 4ZDIA 1RPAA 5LP6F 4NENB 4DA4A 1LSOA 3S7ZA 4Y0VA 3CXRA 3U5ZB 1XNGA 4QUAA 3EIUA 3DKIA 1N5RA 5HF5A 5MN5A 4LDZA 3PD7A 4IUBS 2B4TO 4V03A 3INYA 4NU5A 1K98A 3L6DA 2OD2A 3MQFA 2E48A 1NP7A 4XFKA 1U0TA 4ZAWA 1EESA 2G71A 1E79D 4DEYA 4EPXA 3RV4A 5L40A 3RU7A 4N48A 1QH0A 3KZMA 2PCJA 1GPAA 1SUAA 3QNMA 4G1BA 1WP9A 4DLWA 4CKXA 1JHXA 1XCJA 1VG8A 3TF5A 2PWAA 1CUGA 1ECJA 2F1OA 4ZQBA 4WESA 3K2IA 2ZT8A 5BR7A 4UAGA 3W8RA 3MW8A 1QWSA 3FPKA 1E59A 3A3YA 1RRMA 1YUMA 1SM4A 4UM9D 1HZZC 1PR4A 3DE0X 5EJGA 5LU8A 2WE7A 2BBWA 1PK7A 4IYJA 4X24A 1CZHA 4LYFA 1G2PA 3EHDA 5BSRA 3PLAE 5AOAA 1N1MA 1GDHA 4IDOA 5JD5A 5BSUA 3OQNA 4GNKA 2HT6A 1P62B 5DPMA 1TAUA 1FUYB 5DK6A 1F3OA 5C9ZA 2GD6A 2CVFA 4MR8A 5D8DA 1JR3A 4M99A 3VJLA 1JKXA 1Y9DA 5IDVA 1AQYA 4P83A 3A1FA 3MF4A 3ZLUA 5CEFA 1XPRA 3TQFA 4LXYA 4HDSA 1YHZA 3H86A 2EKZA 3I1YA 1EBFA 1E8NA 1II8B 2BR5A 3JYHA 2A1UB 1Q0HA 1WHTB 4ZOBA 1D1SA 4KXMA 3BH0A 2BV3A 1MTOA 2EHJA 2ZYSA 3EGXB 3I39X 4Z9XA 1PL6A 3OCCA 4KG7A 1P1FA 2QRNA 2I4IA 4MR7A 3AB7A 4IOMA 1CUCA 3P9KA 3WISA 1FRFS 4YCSA 3DLPX 3M3DA 5JS8A 4H35A 3GLGB 4QO8A 4XIYA 3TFWA 5CB8A 1IY1A 3I9V6 2CUTA 4RHYA 5AVOA 4YMHA 5LMCA 4DSNA 1MPXA 4OPMA 1SHZA 4ZAXA 4XD2A 3FYUC 2AJDA 2XE6A 4A8PA 1EXVA 3BD6A 3FKSD 4OV6B 1DBPA 4GX0A 4BQNA 4TTQA 4C87A 4R8MA 4C88A 8GPBA 1QTRA 3GLVA 1E2PA 4DRZA 1K06A 1XRMA 1ZIYA 5EJ4A 3EMKA 4JU8A 3G7SA 3VOTA 4CQMD 1E9BA 4L8VA 3TZKA 2UUBB 5KNDD 4GHWA 1E3IA 4M0EA 1XC7A 4W9RA 1RKUA 1E6KA 4MUHA 2QYTA 5KX5A 4AY3A 1WMAA 3BS4A 3BQ9A 4AZ0A 1Q7RA 2CDAA 2XMPA 3FCCA 4ZEXA 3TLYA 4QKQA 1SXPA 3ZK7A 2WV7A 4HXGA 2E89A 4ARAA 2GSWA 2ZZNA 5DI3A 3FWNA 2H06A 1Z4LA 1C4KA 3C8ZA 3CJQA 4B6JA 1ENYA 4PPQA 3DE2X 1E1QA 1PUIA 3N2KA 4OG2A 1OBOA 2ZGVA 5EWMB 1ODFA 1BDJA 1MNQA 4DE5A 5F7ZA 5KNBD 2P9ZA 3KBBA 4K6CA 3THRA 3FVWA 2HSDA 2WTEA 1SB9A 2TRSB 5FL7A 3ESQA 2R8EA 1VBNA 2WA2A 5I8ZA 3PQ5A 1JB9A 2WFLB 1N2GA 1JG4A 1BU5A 3FGPA 1NUPA 2ZRBA 1RFLA 2DF8A 2VBCA 4FLEA 2NSYA 1ST3A 1KDYA 4ENWA 4YCAA 1ZBDA 3VR3A 1P0QA 3JY6A 4AJJA 2WJJA 3MGGA 5FTKA 4PSVA 2JIZD 4CLDA 4Q01A 4YRTA 1J8FA 1T3SA 4I5GA 3TJMA 3X43A 2Z2XA 3THSA 2XMSA 5AQEA 2C4TA 1L1QA 2WT9A 5AM1A 4EW1A 3F9IA 3Q5DA 1R5OA 1V7ZA 1ZGGA 1EFDN 2UXBB 5BUCA 3BMNB 2COEA 3OA2A 4KLAA 5TJ9A 2AQ8A 3DXYA 1IG0A 4WJKB 2NXWA 4X85A 4B3JA 3GXBA 2ONJA 2WUVA 1GO2A 1DXYA 3L3BA 4JJ8A 2YYSA 4D7AA 2K7FA 3BGIA 1CQJB 2VNHA 2ZZKA 1YQXA 4Q66C 2VK8A 5ILQA 1BRMA 3HCEA 2OBXA 1LTKA 4N5IX 1E6MA 1WXGA 3RVSA 1SZJG 4CTKA 3OTHA 3ODGA 1NXQA 3GZNA 3FZNA 2CJWA 4OYRA 2P2CA 4JXKA 1S3GA 4BECA 2XHEA 1XA3A 5I7SA 3EA5A 2UYYA 1HRDA 4RC9A 4WADA 4X9XA 1XQ9A 4M0FA 3E48A 4Q3BA 4AKIA 1G2IA 4Q7JB 4X97A 5CB0A 4I50F 1R74A 1BEUB 1JG2A 3S1AA 2DPXA 1I1NA 2X5KO 4MS4A 4RETA 4AS3A 3TRKA 2WAAA 1ZXXA 2C0QA 5C31A 2V9CA 1E5LA 3IVAA 5TPWA 4Y2YA 4RMJA 4ETNA 1VE1A 5B3JC 1UOEA 4DOMA 2YR0A 4DA7A 3Q40A 4R84A 2Z56A 3QYFA 3OEWA 4TSFD 3VR0A 2HZBA 1R37A 3A6KA 4NARA 5G0SA 5TQ0B 1TLTA 3E84A 3Q7IA 1Z5WA 5BY2A 1GWNA 2EKBA 1L4LA 3IOBA 3O1HB 5JAOA 4XPZA 3R7AA 3L8HA 4Q1CA 3M3HA 4GP9A 4B31A 1XD2B 4EHBA 1DG1G 1M8FA 1JXMA 3T3OA 1GZSA 2XDQB 2MSNA 3DZCA 3D4IA 2XYQA 4GE3A 4UNPA 2IYPA 3HGTA 3B1WA 2JFYA 2C20A 4PC3A 1DIOB 1N4DA 1RU3A 3W4KA 3UM9A 1J23A 3U4QA 1UJCA 1DLJA 1KMIY 2R7MA 2VXOA 3H18A 3JU3A 3LX4A 3K6SA 1QH8A 2HHCA 2NMVA 1K75A 5E1OA 5ICSA 4A82A 1OD6A 1IQUA 1V7PC 1L9KA 3EODA 3G8BA 2CNBA 1CSEE 3JD0A 4KBYA 1AF4A 2W2PA 1ZNYA 2L2QA 3SAJA 1JHZA 3D8BA 3LT4A 3MB8A 4DMRA 5JFTA 1LFDB 3KFXA 1YR9A 2OMKA 2HXSA 4U7FA 2LCFA 1KMNA 1E2EA 3AXSA 2QL9A 3RABA 3EXEB 3QEOA 1HNZB 3EXAA 3VA7A 1OBVA 3K0BA 1NN1A 2FPPB 2CNWD 4TM8A 4P7KA 3K1AB 3TNYA 3ZY4A 3H3JA 1X6VA 3OLWA 2XB4A 3CZ9A 2WDZA 4QHYA 4S12A 4LRYA 4CL2A 2X8JA 1YL7A 2B8NA 1ZMXA 3FNFA 3PNPA 2J3IA 3O8CA 1VL8A 2O50A 3JZAA 1H8ED 4J3JA 4QWMA 5CLIA 5KCMA 4HV4A 5J58A 2E7ZA 2X0DA 1T6ZA 5CX1B 4C0WA 5KYGA 3V1TC 5CRIA 2IE0A 1AV7A 1DCKA 4J16A 1XVVA 3BA6A 3KQQA 4NQRA 4Y6SA 5DWVA 5JCJA 1AGXA 1V0JA 4DLUA 1G3RA 2VYCA 1M6VB 1FNMA 4Z8YA 4CKBA 4R9SA 1I80A 3BWBA 3LUPA 1E1CA 5A4IS 5KQMA 2FR1A 5LOVA 1LCIA 1B14A 4MYTA 3TW8A 3ZOKA 2JLXA 1ZL0A 1VP3A 2B5OA 3L7AA 2NXNA 1RE0A 2IJGX 1S2IA 1QF7A 3KT3A 2OBFA 2ZJ4A 3AXTA 4J9UE 3F90A 1EVKA 4UVDA 4Z7QB 1X7XB 2Q3FA 3JD2A 3E22A 4E32A 4DA6A 1QH1B 2JGAA 2W98A 3PSHA 4V39A 5FYQA 1EP2B 3L92A 4ZK6A 3I9KA 1N9ZA 2VH1A 4H08A 5FJIA 3LK7A 4JT2A 3NHPA 1Y7IA 3DVRX 3T9BA 1N6IA 4OY3A 1U04A 2ZR7A 1XXHA 3VV3A 1UDXA 4Y1RA 2P3SA 3A25A 5JFGA 2QTCA 1O58A 3BWMA 3F8TA 3VOAA 2IF0A 2YJTD 4PHCA 1DAGA 1PYDA 4QDUA 3GP5A 2QYHA 4UXHA 1IIRA 1I6WA 4KAFA 2YZGA 5ERGB 3SQWA 1JALA 5IN5A 1FL9A 4R2LA 2R65A 2NU8B 4NWIA 3OIYA 4EB0A 3AIMA 5HW0A 3H1BA 2EOAA 3ZD8A 3RUCA 4BTEA 1HL7A 3C39A 2C5LA 2REOA 3MWLA 2FK8A 4R6XA 1GV0A 1M34B 2QVBA 3N87A 4W82A 1YCDA 4BJHB 2W6ZA 1PHPA 1Y34E 2CGEA 5BVGB 4O2AB 3WGIA 3V6LA 1SG6A 1LDMA 2PSDA 4MYSA 2A9FA 1Y5RA 2X1HA 4UEQA 3K0AA 1QGZA 1KO5A 3DP9A 1N6NA 1KBOA 2OESA 2WYVA 2X77A 3R5KA 4EHAA 5IJ0B 2P90A 2VH5R 4X44A 2K4MA 1H3EA 1E1YA 1PJ8A 5CUQA 3SMQA 3K6JA 4PFJA 4CR8A 1VZ3A 3KUKA 1QXSA 1QU2A 4M9XA 4ED9A 3ML1A 4YCMA 1A4RA 2HMSA 2HWWA 4KGVA 4C6TB 2C3PA 2X9LA 4DCPA 2VL7A 4HX9A 4HNHA 4L4UA 2DU8A 2VUIB 1YZQA 3FPAA 2PV7A 4Q1VA 2PX8A 4OQEA 4KMMA 1BS9A 1CDEA 3DOCA 5CDFA 5BW8A 5JSHA 1EQ2A 2Y0EA 1LS1A 3PQFA 2JFGA 3N0VA 1WCIA 1UBSB 4TUYF 2P3OA 1CJSA 2RD2A 1YA4A 3WJ1A 4NFLA 2QD2A 1W88A 3KV3O 1WZNA 5G41A 3VKWA 2IU0A 4PM4A 1SXIA 2LWIA 2H2DA 3LHDA 4BLVA 1NURA 3HA3A 4JP8A 2YWHA 3DMYA 1PN3A 1EGMB 1TOAA 1XAIA 2R00C 1VJ1A 2GR9A 3A28A 4RKRA 1E3SA 3DGEC 2V0CA 1KR2A 3RCBA 4D4LA 3PDHA 4EPYA 1SUFA 2EVWX 3FD8A 2QYOA 2PXCA 3GLQA 3LKVA 3L5KA 3MPUA 2YWJA 4H7EA 4JFRA 1HETA 2YDYA 1DUSA 2CXHA 3VO9A 1P74A 3NU1A 1NJSA 3AEUB 1ZHHA 2QL6A 4HD8A 5H59A 5A4JA 1FFEA 1CY1A 1IYZA 1FDVA 2G0NA 3TTVA 3U60B 2QLJA 3DVAA 4II2A 4QXMA 1YBHA 3IAHA 2WSBA 1ES9A 3KKMA 4IEFB 1JUDA 3SHOA 1JIXA 1OT5A 4FZVA 2F9FA 2NUPB 4MDEA 2J8ZA 4O2BA 1JVNA 1QGUA 2B4RO 3ZE2B 1TCBA 2NO9A 2OLJA 1RJ9A 2ETXA 2R79A 3PENA 4H3HB 3BJIC 5KNBH 2A4MA 4ZP1A 4MRVA 5CXQA 4RCVA 2J6IA 2QN2A 1UADA 3EQ6A 2ZREA 1IHUA 2F6RA 3QVTA 3KL4A 1Y89A 2B2CA 2ID4A 3QYPA 3PJGA 3VR4H 1PNTA 3AHHA 4KFSA 2I5PO 2VAXA 3FUCA 3HU3A 3TVTA 2WEKA 3V55A 2HSZA 3UPDA 1I3OA 2JANA 3NCTA 3SLKA 4BX8A 5CA1B 2Q7DA 2OQIA 2B21A 4IFIA 4E1AA 1V43A 1Z0ZA 2CFSA 3T5AA 1VGVA 5HIMA 4B73A 3FGZA 4IH4A 5H1YA 1ISFA 3ZVLA 5LNK1 2R6FA 5JQGA 4JA0A 2FEWB 2W0SA 2C5GA 4PGGA 5KTMA 3OLYA 1XWFA 2I80A 2VPZA 2FRXA 3I09A 1SQSA 3AFIA 4FHFA 5EKUA 3NYQA 1G60A 5ALFA 4ZJUA 5M29A 3TZQA 2Q4EA 4HDMA 2GAAA 2GEJA 2ZWMA 3EHEA 3IDFA 5TT1A 4P4LA 2R8BA 4EYSA 4LTDA 5F77A 1AKVA 2H0RA 3WIOA 2D1TA 3DO5A 4PYRA 2XUOA 2CMKA 2J9RA 1PZEA 2ZCJA 3N59A 1SVWA 3LKZA 2H59A 3F3MA 3I6IA 1SMKA 1UOOA 5I5EA 2WIDA 3TRHA 3G9QA 4ZV9A 5TEVA 3TB4A 4G0WA 5CDHA 1QDLB 1BQ3A 2NOAA 4RSRA 1IATA 2O07A 2Q2OA 3ZJ4A 2BR3A 4OQLA 3OQOA 2BUBA 1RXVA 1B6SA 3ZR4B 3VTZA 2GI4A 1E9SA 1IU9A 1RJWA 2PFGA 3CM0A 4KGXA 4KQGA 4Q6WA 5F76A 3U0VA 1EFVB 3TLZA 1LNQA 1N2IA 1MX9A 3I01A 4X1IB 4FUQA 2V5VA 1S3FA 3S70A 1W2HA 4MR9A 4DM7A 3QBTA 5EQTA 1GZ6A 2A2ZA 2VJNA 3HSKA 3GRYA 1VL2A 5IDXA 2JAPA 4D44A 1J06A 1JJBA 4ZN6A 5KYXA 4YONB 1KDPA 1OBHA 1UBRS 1USGA 2GHRA 2Y1WA 2P4UA 1BGVA 1D0SA 2RB4A 2V0NA 3ABSB 3GN1A 3N8IA 4XW2A 1OC4A 3ZD6A 2AOXA 3QLUC 1AUQA 3VBCA 3GCZA 2GGSA 4H4CA 3KU4A 3T7SA 4BZXA 3PNSA 3EXFA 1CF4A 1QPZA 3EEFA 4EJSB 3RHFA 4C6SA 3EPKA 2Y1LA 3LAWA 3UV7A 2QG9A 2Q6TA 3QSYA 4RL6A 2ODAA 5B1YA 3FKQA 5CT5A 4L27A 4YQZA 4ZC8A 3TZBA 4KPGA 4KX3A 2E6KA 1P2GA 3DCJA 4B6SA 1T9DA 4PAGA 1Z39A 5DLDA 1AGYA 3QXXA 2CNNA 2XNKA 3AJAA 4G9GA 4QBKA 5AXAA 1PTJA 3VPFA 1IM5A 3U7IA 4DXAA 4J94A 1N32B 1NPDA 2H29A 1KO7A 3AX6A 1PBTA 3AJEA 2HBRA 2W6MA 5AKKA 4IIEA 2DFKB 2IV7A 2H18A 1L7XA 3BK2A 4LGMA 3C7DB 1PNOA 1OXKB 1I30A 1T5TA 5FOXA 3BQMB 4X3OA 1GITA 3QKWA 2OV2A 5DFAA 1T1RA 4QFCA 1CQIA 2AI3A 3D0RA 1RHJA 3LF2A 4MGIR 5AM5A 2X1VA 4BX2A 5I8WA 4A26A 3FWYA 1WLSA 1DT3A 3GFBA 1YI0A 2W00A 3DW1X 3AR7A 1K8ZB 4DZZA 1SELA 3KJZA 4IIFA 3VPDA 3OETA 3UTCA 3IPCA 4HH3C 3LUAA 2G40A 4Z53A 1W36C 5JFOA 3LC1O 2HQSA 3E0QA 2EATA 2P8SA 2OHJA 3NHFA 1OGIA 2J08A 5DYYA 4U2CA 1PQ4A 3NR2A 1ZD9A 3TDKA 1S8AA 2JCXA 4LQ4A 2VQ3A 3UAVA 6NULA 2IY9A 4OL0A 4CUZA 1N2CA 4DQKA 1MJFA 3KXPA 4XUEA 4FTWA 1KRWA 3IQFA 4QOFA 2XMQA 3FN4A 4NBKA 1TVEA 3Q11A 3R1IA 1YRAA 1O95D 1NW3A 4CMGA 1LI4A 1SCBA 3ZJ5A 3Q2KA 3I32A 1V8OA 2HUPA 3SJZA 3MRTA 1S2LA 4IDAA 2E3JA 2Y2VA 2CBZA 2HWYA 4LJ5A 3MXTA 3KYBA 1OYYA 3QUCA 5ALTA 3BA1A 5JAZA 3D54D 3HJCA 2R84A 3IODA 4YASA 3BIWA 3DBRB 1G3MA 1O5OA 4RLSA 1XJ0A 4QREA 4EHDA 4ESEA 4UOZA 4RJIA 3GUHA 2WU0A 2C2OA 1I7LA 1ZI9A 2VVTA 2QUAA 3STXA 4I19A 5JNWA 1Z5UA 2FSGA 1KEKA 3OZEA 1NNLA 1SIWA 3KZNA 3JVDA 5IKEA 2XY4A 3ECCA 4WVFA 2AKEA 821PA 1AH2A 4L0DA 3PX3A 2FSIA 4MMZB 1FDRA 4ZJZA 5LBUA 1Y1TA 1NQAO 3WRYA 3IEVA 3VR6A 3N0RA 2AFHB 1G2OA 2BEVA 1JZTA 2HREA 4BE7B 1CNEA 3PGLA 3LV8A 3LQYA 1F8GA 1X7GA 4BX3A 4G5RA 1E3DA 1PFWA 5C8VA 2ZBUA 5LP6B 4OAQA 2QQGA 2VT3A 2N75A 4TKVA 3FPFA 1B0UA 1N3IA 4YJHB 1U5BB 4UCWA 3RVOA 1GPJA 2GKSA 2F1IA 3UEOA 2HPHA 2NNWB 4FP9A 1WV0A 2GFQA 5LCXA 2GVDC 1V9SA 4D3FA 2JGMA 3K6KA 3SC2B 4Z7JA 1OB2A 4GOOD 3EBLA 3B70A 3N2GB 4NBLA 1ZUWA 2GEUA 4D8XA 2WG0A 1LVUA 2W2KB 2WM8A 3MSXA 2C4HA 3D8TA 3E3AA 3I3SR 2PZEA 4MWDA 4NBTA 2GN1A 4MB2A 1M7GA 2IDZA 2BI7A 3PSAA 4NR0A 1QHNA 1TU0A 4R1SA 3SGLA 2JATA 3ZWPA 1PT7A 2QRZA 1HYHA 5JWRA 3DXXA 1K7XB 2YUIA 1IN6A 2B83A 1OUMA 5EJIA 3ME5A 2A5DA 2H5EA 2X7JA 1YCHA 2H8KA 3GPBA 4D8YA 2NZVG 2CBXA 3CSSA 3W1EA 4DIEA 4R2MA 4H7DA 1FBNA 1NQOA 5EGNA 1U0OC 1AKTA 5EXXA 2XCQA 4LDPA 4D3ZA 3QKSB 1MR3F 2PJDA 4OYYA 3MAJA 2BHTA 1P81A 1U8FO 4Q1FA 2WKWA 1QRSA 1XWIA 1SKUA 2ZIUB 4TZ6A 4H6PA 3KPJA 3L4BC 4FLFA 5HFJA 5EJ6A 1V5EA 3MOSA 1X38A 5KDLA 3VO2A 1PQPA 3B12A 2GRJA 2VYVD 2RAUA 2I3DA 4LWZA 5TS2A 5E9WA 3VSAA 3KYCB 2PXAA 4N6OA 2J45A 3HGQA 4Y2HA 4OXRA 4ZKDA 4G0VA 5FAKA 5HXAA 2JEYA 3ECSA 3ZQJA 4CMCA 1FEZA 1M0SA 2I6SA 1QGDA 1ZN8A 4LYEA 2AFVA 3HJBA 1J7KA 4XDZA 5BQXA 5KDDA 4JLBA 4IFBA 3UMYA 4C2AA 3KOMA 2Z5GA 5KNCH 3JAMA 4PZAA 4PAMA 2ZI6A 1ENOA 2QS9A 3W04A 3VJRA 5DBHX 1Y4DE 4QGSA 3CG4A 2QRUA 2XGSA 3HJHA 4H7HA 1FP2A 4HDCA 2FZ5A 4BWYA 1YDMA 2M98A 3DTVA 3U26A 2CL6X 5GY7A 4C2BA 4KAXA 5EI5A 1QU3A 1V4VA 4JJGA 1RC1A 3LA6A 3C5WP 3OLVA 1M2HA 4CGYA 3BMOA 1F8XA 1C0KA 3ROXA 1MG5A 2VTDA 4EELA 2JVJA 1DKRA 4JASB 2BM1A 3RRFA 2A4KA 4JI4B 1EDDA 1VZ2A 3IVXA 1RYZA 1Z2EA 2JHCA 2WUDA 3LXMA 1FMLA 4UUAA 4DG8A 3D1LA 4B8WA 4DMMA 3SICE 4ABYA 1GIAA 1KPGA 1TB4A 2FN4A 4IG9A 1QQTA 4F2WA 2G0AA 4P82A 3VYRB 1LD3A 4UU8A 4B3FX 4EPRA 1W0CA 5H16A 3WLMA 4X64B 3V1LA 4CNBA 1XVAA 2BFPA 2LE0A 1ZFNA 5TB5A 3T38A 1D03A 2XTAA 2FW7A 1S02A 4I66A 1EIWA 1GV1A 2HQBA 4J0KA 5ALHA 2A33A 2GZ2A 3B38A 2OSVA 3FM9A 3ZDXB 3GDGA 3C8DA 4A2CA 5JY6A 1QLHA 3E3LA 2ODQA 4HO1X 4HS9A 3T7KA 4EHNA 2QR5A 4G8JA 5IKMA 2VHYA 4GZ3A 1HDZA 3I42A 4EO7A 2G7ZA 1RLMA 3M1AA 4R1PA 4AWBA 4B2LA 2X0RA 1R3DA 2EV9A 4RS3A 4IIYA 3GLIA 4L8WB 4RTKA 4ZCIA 4WLOA 3P9SA 3VHXB 2AHRA 2DAPA 3EEQA 3F7OA 1HSZA 2IGTA 3A32A 1P9LA 2Q4DA 3AETB 3FSGD 1YH3A 3GU3A 2B6NA 3PDWA 4WT7A 4G4JA 5CIWA 5LZ7A 3CLTC 3UKOA 4BXOA 2CJYA 2R11A 1HQDA 5BN1A 3KZXA 5ALQA 3NIFB 3WDKA 4DLRA 1TM3E 3QGMA 4U2GA 4LZAA 2YZMA 1PT5A 1FX0B 2XDWA 4LGVA 5ECDA 2IDMA 3PXEA 1N0HA 2FF5A 1O77A 1HOTA 2QT1A 3P96A 4LOAA 1RLUA 4UE6A 3WMRA 5KTKA 4DV1B 5E9QA 4QBIA 2PGDA 4JLJA 3K0HA 1JXOA 3A9VA 4I50B 3T0GA 1OI7A 2A67A 2BKXA 4R5MA 3U3DA 4A27A 5ERYA 2BGGA 4TRNA 3ANXA 3AF3A 4NCIA 2VHCA 3WGHA 4URXR 2C0CA 2FVXA 4Z4QA 4I4LA 1JN0A 1H1TA 2GDJA 3DHWC 1KMHA 1YCFA 2PWBA 4ZOQI 2AQHA 2PR2A 5M34A 5AJVB 1ZJJA 3HCOA 3D3QA 4CIDA 3GYGA 3UJ7A 3NBMA 2GX6A 3OPXA 4O33A 2G5GX 3ZZTA 1YA6A 1XN4A 3A9WA 5GGYA 3DHYA 4ZYVA 3EXHC 4FBGA 1IJBA 3TNFA 1QQ6A 4OUDB 1L4EA 3BWCA 2WYWA 3UPTA 2A7QA 4PGAA 3PNMA 4DV0B 4P86A 1RCFA 3VH3A 4GX2A 2R96A 3D7KA 4RMHA 3QPUA 3LYHA 4RDIA 5AVTA 3HZRA 5FWDA 1GZ7A 2CVHA 4OQYA 1R0BA 1T8PA 4S1NA 1RM0A 1DFGA 4HDKB 2QTZA 4G5SA 2IITA 5HK9A 4M36A 1ZLYA 3OCYA 5K3FA 2IYOA 3RPEA 1VRWA 2V8OA 5IXSA 1GNQA 1FFXB 2ZSFA 4WE3A 1IDN1 2DZDA 1MHPA 2OGTA 3FAZA 1P75A 3M5PA 5PNTA 1Q7GA 4UHJA 4ER0A 5KTTA 1C1XA 1H8HA 1MNAA 4E5SA 3DBLA 4KCGA 3S28A 4DXHA 1TK2A 4C5AA 4U7HA 3A8TA 3U7HB 3N8HA 3W2FA 1RP1A 4LBWA 1ILEA 2J33A 3B3FA 3W5DA 4N41A 2UXDB 5A3JA 3OCXA 3LUJA 2VQFB 3QPVA 4R69A 4ZIRB 1MV5A 3CUYA 4TXMA 5E2AA 1V8FA 3E1SA 3WGYA 4AROA 4BKMA 4EHLA 3I2JA 2BELA 2POCA 1YRLA 4C7OA 2Z8YM 2Q5JA 1DKQA 4FEEA 2UZ0A 1WZ2A 1JLRA 1QYDA 5DSZA 1RWXA 2PSSA 1D4AA 2MYTA 3VPHA 3GRFA 3RYCB 1YRQA 2W7TA 4TV9A 2XCUA 4LV6A 1GL7A 4XGIA 3IAAA 2RAFA 2FQXA 1W1IA 5EXEA 1FFSA 1WAMA 3R0XA 4NEHB 3F67A 3IFSA 1CU1A 1Z6GA 3OUTA 1DIGA 2JL1A 3LM8A 5J4LA 1FDUA 2PGAA 1LPPA 5EXSA 1CJCA 4PYKA 3W5AA 3MSCA 3RFCA 4DMKA 4PZEA 3L6RA 2ZUVA 1QCZA 1YZFA 1ZJ4A 3PNYA 1PJCA 4PLVA 1HORA 1ICIA 4RHFA 1VFPA 3U81A 3VC1A 1Y63A 3N75A 4KQFA 1WA5A 1L5SA 4WGGA 3SG0A 2WTMA 2ZT7A 3BF8A 1ML4A 2AG6A 2NVBA 4IY1A 2GARA 4ZQCB 2C3UA 3L82B 5C3UA 3V1YA 4RACA 4LECA 4LG1A 1B2LA 2JLQA 2JLWA 5FTLA 1W5TA 3GOHA 2CZGA 4XQ0A 4XSHA 2QD1A 4AO6A 2X42A 2MR6A 4LVCA 4HGYA 1KK2A 1U7TA 1V8BA 4ZDKA 1KIMA 4JXZA 2PM8A 1DUVG 1UR5A 1JAYA 5EKDA 721PA 3TD9A 4U2EA 2ZSDA 1T1GA 3HV2A 4E4TA 3K09A 3LUCA 4IDDA 1AVTA 3P2KA 4CKWA 3LQRA 2QMUA 3JZDA 4Z86A 5F64A 5JRDS 1DIRA 4I1YA 4L5YA 4QOGA 1F6WA 3VO1A 4D02A 3LBHA 2O05A 4GDFA 3LZCA 4KDCA 4QA9A 4P80A 3B52X 4MJ7A 1JKIA 2RHHA 4DNXA 2CHEA 4PRZA 4YVFA 5C4GB 1RXSA 3IQXA 3RUEA 5ARDA 2ONZA 3ADPA 1Y6QA 4BLWA 3BWYA 4FD3A 3NBXX 3WRXA 1JHQA 2RC6A 3DDNA 4HXFB 2H4FA 4UHFA 3WWPA 4HFMA 1J6UA 2R68A 3HJAA 3F6SA 2JGEA 1NL3A 2NV2B 3GGDA 5CVDA 2ET6A 1YFKA 5A5GA 9LDBA 1EZZA 5FI0B 3OFVA 2YOGA 3ZCUA 4FCTA 5IF9A 1O1YA 4JU9A 4DMHA 2Y0BA 1W6RA 4MQEA 3KLPX 2BJHA 2WSIA 1QF9A 1C41A 4UTXA 1QB8A 3UJNA 3BTSA 2BOVA 1M1YA 1RXUA 4XQ9A 3SX0A 4N7BA 1XXLA 4ASUA 1TGYA 1Y1RA 3KZVA 2AI2A 2GJ8A 4TUYB 1K8XB 3T5PA 2IH2A 1N33B 2PD3A 2F62A 3BB3A 5I9TA 1QK3A 1E3EA 3TOVA 3U44A 5AK0A 2R4UA 1NN5A 1BDIA 5JMPA 3I5AA 3F73A 1L4HA 1KKUA 5E6RB 5TGZA 5INTA 4R7TA 1WKCA 2R66A 4HWRA 3CVVA 5D00A 3SM3A 4PLCA 1I2AA 5DHTA 1ZCAA 4DAOA 4MDYA 1L7VC 1NY6A 3KSUA 1E6LA 2O3JA 3FRHA 5FO0A 3ROKA 2LW7A 1Y4SA 1ZJYA 1T2NA 1WWKA 1NLMA 4GYKA 4MIOA 5H82A 3SXUB 2O5VA 1BHQ1 3UOGA 1XMVA 2WG2A 2OA0A 4M0MA 3GLUA 1T2UA 3EVZA 1QC5B 3SHWA 1DBSA 3OMWA 4EF4A 4YXWD 3ZHZA 1NW4A 2FE4A 1KTIA 2ASVA 3FYUB 3NHLA 4WASA 5CCDA 3TL6A 3I12A 3UUFA 1UC9A 2OKCA 4HYYA 1UZNA 2DBRA 1DU4A 1ZN7A 2MR5A 3L0YA 2FV8A 3F6YA 4B75A 1L5HB 1VMIA 3FSJX 3DDHA 2AC4A 4FCCA 4J1TA 2C7PA 2R5FA 5CHYA 4V3CA 2VPWA 4BKRA 1KZ4A 3P2EA 3EIHA 3PT5A 4TL8A 3KPUA 2PKQP 3PG5A 4KH0A 3RK1A 4OJYA 2WSMA 4TLDA 4RVOA 3V80A 2DWUA 1IWOA 1B00A 2ZIFA 3DAPA 2TMDA 1LPMA 1ZOIA 4R9RA 4RWZA 4ZCMA 5CT8A 3H5RA 5L3QB 2ZVPX 4W5NA 4QUDA 3B8EA 3BHMA 3TK1A 5IJZA 1XJ5A 2WTUA 3PEVA 2W6OA 4E30A 4IBOA 2IY7A 2D2IA 3RT1A 1R3UA<