1F2UA

Crystal structure of rad50 abc-atpase
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
149
structure length
149
Chain Sequence
MKLERVTVKNFRSHSDTVVEFKEGINLIIGQNGSGKSSLLDAILVGLYWPLRIKDIKKDEFTKVGARDTYIDLIFEKDGTKYRITRRFLKGYSSGEIHAMKRLVGNEWKHVTEPSSKAISAFMEKLIPYNIFLNAIYIRQGQIDAILES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural biology of Rad50 ATPase: ATP-driven conformational control in DNA double-strand break repair and the ABC-ATPase superfamily.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Replication
molecule keywords RAD50 ABC-ATPASE
total genus 37
structure length 149
sequence length 149
chains with identical sequence C
ec nomenclature
pdb deposition date 2000-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1f2uA00
4BQSA 4CEHA 2LCFA 4UNNA 5J4HA 2D2EA 3D8BA 4JVSB 1G5TA 4Q4HB 2PCLA 4D2IA 1PUJA 3CRVA 3MFYA 1GITA 2AXNA 4NYJR 1G6OA 2QENA 2QL6A 3RS7A 4TMWA 1NRJB 3E1SA 3VNVA 1TU3A 4RZ3A 3E70C 4BFVA 2ZXUA 3KB1A 1OF1A 4IDNA 1OFIA 4B32A 3K0CA 4JJKA 2D4HA 5EP2A 3B60A 1FMJA 1OJLA 2DWPA 2CNWA 3K0AA 4RY2A 3CIOA 3UG7A 3CPEA 3WYGA 1Q20A 3KJEA 5FOUA 3NTUA 2FEOA 3OIWA 3RS5A 1SKQA 3SFZA 1GZSA 4LJ8A 3UMSA 5C2JB 1OFTA 4QNMA 2JGNA 1M7BA 4AKHA 1GDDA 2YWEA 5FUYA 3FVQA 4CEJA 2D7DA 5J4KA 4FXPA 2ORWA 3CX6A 4JJZA 4CRWB 4BGDA 2XSZD 4A15A 4M21A 2XXAA 1NL3A 1Q1QA 4HSEA 2BKEA 4WZBE 2CCGA 2ORIA 5ANRB 2NTYC 1Z06A 1G9XA 2QP4A 3LXRA 4DKXA 4CEJB 4D82A 4PZYA 3NHBA 2IWHA 2OZEA 2OG2A 5C1BA 1S3GA 3B78A 1O3YA 3HP1A 1IONA 4IXNA 5DE3A 2R62A 2CLCX 3TVDA 3GJ3A 2H7VA 4OQFA 4BFXA 5CLLA 3OEHA 4TTPA 1OH7A 3ND9A 3IIMA 3LXXA 4D4LA 2GBLC 2G77B 2EYQA 4G5QA 4MYCA 2P6NA 1AZTA 4C0LA 3T1OA 1YZGA 3SBEA 5KPDA 4I1SA 4XD7A 4E09A 1XF9A 4BLTA 3SJAA 4DIEA 4DEYA 4AYWA 4IRUB 3KQNA 1TTTA 1RFLA 4LYAA 3TMKA 1W36C 4EPXA 4JLOA 4HLDA 5FUXA 2FMXA 2MMCA 5J40A 1BS1A 1JEDA 3HR8A 3NC1C 1WA5A 1NJFA 4BFWA 1BMFD 4DLYA 4QKQA 5FFMA 2KJQA 2B7BA 1K8RA 4JS0A 1FW6A 4LJ7A 1A7JA 1KI6A 2ONJA 1N6PA 4B6EA 5DISB 4TZ6A 3RSLA 4QXAA 2I1VB 4OYHA 5A5GA 3VU9B 1E2KA 1RW4A 1A82A 2VHUA 1YJ5A 2F43B 1DEKA 1JJVA 2BOVA 3GQBA 3U2QA 1HT1E 4A92A 4PHTA 2HV8A 4L4UA 4RFSA 5TMPA 2H57A 2JLQA 1Q3TA 2CHQA 4JLNA 1Z29A 3CZQA 1OHHA 2WWFA 4KLZA 4PC6A 4ARZA 3K53A 2RB4A 3K70C 2H5EA 5J47A 2IYZA 2V6JA 1KDPA 4XH9B 3TLXA 1GNQA 3NDPA 2HT1A 3K0FB 4HUTA 5BWMA 1NG9A 3W3ZB 4FMDF 1FOEB 2FEMA 4D0LB 2P2LA 1L7VC 2ZJ8A 3QI2A 1LW7A 2IUSA 1XD2A 1T0JB 5E7IA 1XFAA 1E2LA 2OLJA 1YR9A 2Z5FA 4Q19A 1W4CA 2WJHA 4H1VA 2ZJYA 1TQDA 4EJSA 2Y8EA 4MRPA 2E87A 4D25A 4DLVA 4GBMA 2NO9A 3VMFA 2QAGC 3G5UA 3WNCA 4DT1A 3LAWA 3KZ1E 1NP6A 2XNDD 3AVPA 4BZXA 1Q1ZA 1E2QA 2BBSA 5J4LA 3X1WA 1Q1EA 2DR3A 1ODFA 1ZJ6A 4HZUB 5DI3A 3EXAA 5CK5A 2IEZA 4EPRA 2XJ9A 4P31A 2C03A 1RIFA 5AJYA 1YKSA 1CR4A 2QTFA 2ZI9A 2ZRLA 1VPLA 3PIRA 2G9NA 3CF2A 5DYIA 2XGJA 1XU4A 4AK9A 1W2HA 4ZCLA 2GBLA 1G8GA 5GVRA 1W4AA 5EXSA 2O0KA 4P3YA 3SR0A 2BC9A 1QHHA 1Q1BA 2GXUA 4G0NA 4Z51A 4LBYA 4HDOB 2YZ2A 2J0UA 1U2RA 2QGZA 4MRRA 1CRPA 4KVGA 1HYQA 4RD3A 4KU4A 3W8NA 4TMXA 5KPJA 2VYFA 4JSTA 2QMHA 3IEUA 3MWJA 2GAOA 2DHRA 4Y0VA 1M34E 3THXA 3AP1A 2PCJA 5FPSA 3GLGE 4PXAA 2IUTA 1SVLA 1JECA 1T5LA 3QKSA 3RC3A 3FE2A 1EFUA 4GDFA 5B2ZA 1DPFA 4PHHA 2IL1A 4RZUA 1IN7A 4L8GA 1R4AA 1IN6A 1YZUA 2D06A 2QORA 3F0TA 4H9GA 5HZHA 4US0R 3Q85A 1XTIA 3SJCA 4K46A 1NVXQ 3FDIA 1E2DA 1TPZA 4JVMA 1RJ9B 4EQ6A 3LLUA 5JWRA 3GLGA 3ECCA 1NY6A 2N42A 3VU9A 2JLXA 4YMTA 3GLIE 1N6KA 3W6NA 1O87A 1CF4A 1VG9B 2IC5A 4FIDA 4B3CA 3NBYC 5FBVB 2ZSDA 3REFA 2DB3A 3DM9B 3IBGA 4DLSA 1KYIA 3NH6A 1F5NA 3N2IA 4X8MA 1N5JA 4G5GA 4KODA 3ZVLA 2J0SA 5CJPA 2C9YA 2EWVA 3QXXA 4ZO4A 4M0LA 5EJEA 3GLHA 3EZFA 3JZMA 3NWJA 3BJIC 2ZI5A 4R2HA 3RWOA 1OSNA 4OK5A 3UIEA 3GEEA 1QHNA 1R0WA 2AXPA 5L3QB 3K70B 1YZNA 1W7AA 1OFHA 3RRMA 4B75A 3R8FA 2QAGB 2IF0A 4LPKA 4A0FA 1JQLB 2RAPA 2OAQ1 1ZC4A 4YMSA 1NMXA 5F2EA 1T8UA 1Z5ZA 2R6GA 2ZANA 3ND8A 3SN6A 4D80A 2RHDA 2CK3D 1IXSB 3RVBA 3AP3A 2R9VA 2CCJA 4V0NA 5UKDA 1E2IA 2QMEA 3GCGA 2Z83A 4LBVA 4TLDA 1R10A 4XWKA 1PLJA 4EDHA 4OI1A 5KTYA 2X8AA 2CDNA 4GP6A 3WXMA 5KSPA 3EWSA 1G7RA 2HUPA 1CXZA 2ATXA 4Q66C 2BM0A 3FHOA 2AK2A 2GXSA 3W5JA 2G0TA 4N0EA 1VMAA 4E03A 4LHWA 2XEXA 4PAOA 2RMKA 1JI0A 1E2JA 1KMHB 4LYHA 4OK6A 4C2TA 2YHSA 4NP6A 1Q0UA 5IDVA 3QVVA 1XZQA 2JDIA 1VHLA 2FA9A 2VA8A 4BLRA 2HLDD 3BBPA 3TAHA 1NKTA 4QC2A 4C3ZA 2W6JA 4IDHA 1VYVA 1OH8A 2WAYA 3AH8A 2G1JA 1G18A 4I99A 1LTQA 3K9NA 4LWZA 3V4FA 1N25A 1DADA 2VIIA 1KDRA 4N3NA 4B3BA 5JI2E 2CK3A 2XZOA 2GAAA 5K8UA 4WXRA 4RZ2A 3Q5EA 2QQEA 1W5TA 1BIFA 3VNUA 3NEJA 4Q4LA 2IYXA 4RSGA 1EFCA 1US8A 4EFNA 5IRCD 4P0TA 3I92A 1DAMA 2VP9A 1JALA 3GD7A 5TDHA 3V9PA 5L3SB 2JATA 3W34A 1ZIPA 3THXB 3BFXA 1A4RA 5K8LA 1BKDR 3I32A 5G3ZA 1DVRA 3X2SA 2IXGA 3BWDD 1SULA 3LNCA 4DSNA 2YYZA 2CHVA 1AS2A 3VR2A 3WRXC 3NDBB 3TUZC 2XXAB 5DIFA 1G41A 3A36A 4PC2A 2W6ID 4FCVA 5JCPA 4V0OA 4Q7MB 4TYYA 3BIFA 5JWOA 4LZZA 1IBRA 2C77A 5AUQA 1E3MA 1MOZA 4M9XA 4UXHA 2PZGA 2FSHA 4BWYA 2AL7A 3H0KA 2TMKA 5AUNB 4XSHA 3ZVNA 3SBDA 1GVNB 1NSFA 3SU8A 2A30A 3O47A 4JLJA 2GILA 4MGYR 1FTSA 1D9XA 5JS7A 4B71A 3BH7A 1ZD8A 4BEJA 2FFBA 4DLTA 2OILA 4YMWA 2PEZA 4NCHA 3K09A 1XPOA 3AKEA 1ZM7A 5EZ6B 3K9GA 4I1OA 4IOKA 3UKDA 3I5XA 1J90A 3KTAB 5E3HA 1FQKA 3ONWA 4BFYA 2WWHA 4PPNA 3VKWA 3MG9A 1H8HD 3CB4A 2BCGY 3BXZA 3OE7D 5KSZA 1X1SA 3P4XA 1U81A 2A9KA 1P4SA 4E22A 1W0JD 2FGKA 1XMIA 2OE2A 3QNUA 4I1VA 5EE3A 1TMKA 2Z4SA 4TMKA 5JLJA 1T4GA 3TE6A 2O8DB 3VR4A 4P4SB 1RRGA 5CYOA 1R0ZA 4NE2A 4TLCA 4PQYA 3TK1A 2J0QA 1E9BA 1W0JA 4JL5A 4JYBA 3Q8XB 4M4SA 5FUVA 3OEED 2ZEJA 4Q5IA 3U3JA 1HY3A 1WP9A 3TR5A 3V4RA 1YR6A 2IS4A 2IYLD 2OXCA 3H2YA 4Z1MD 1UKVY 1Q21A 5FTLA 1QDEA 3CWQA 4Y0AA 3ZJYA 4ZDIA 2F1RA 2GZAA 1PV4A 3NBFA 4OHZA 3TJZA 1QHIA 3IGFA 521PA 2FE4A 3B1WA 3HPQA 1LS6A 4KFSA 3EIEA 821PA 2XNDA 1N6IA 1N6NA 3I62A 3RS2A 1YQTA 3L0PA 4PQFA 4Z54A 5ELXA 1FNMA 2FZ4A 2GEDA 3RWMB 3C15C 4LV8B 4BZPA 5H70A 4GOJA 2IYYA 4Q1BA 4HLQB 1P9RA 1XMSA 2GF0A 4LBZA 3AVVA 2PH1A 1LY1A 4JYCA 4Q4JB 2JLVA 2ZVPX 2G3YA 5DI9A 1XMJA 4JLMA 2LWIA 4HLCA 4CT4B 5JI3E 1CR0A 3TIFA 4ZDWA 5E95A 5JRJA 1SXJD 1WBBA 3QBTA 3T15A 3K1JA 1ZP6A 4B3FX 1MKYA 3FYHA 1E9RA 4IEIA 3SJBA 5LBIA 2EFCB 4TSFA 4FINA 5H68A 4A8JB 2NPFA 1KJZA 1ZNZA 4BPBA 2D3WA 3QF7A 1DO0A 4OI4A 1SXJE 1J99A 4GZLA 2WMNB 4LHZA 3ADBA 2YWFA 3VQTA 2O8EB 2GZHA 4PX9A 3ADDA 2R6CA 4DCUA 2PJRA 1RYHA 4KYIB 1XB2A 2J7KA 2ZJZA 5CB8A 4LJ4A 2GCNA 5GADl 4N0DA 3KXIA 1G5RA 2ZRDA 4IEEA 4DJTA 1NLFA 2WSMA 2JEOA 2ZITA 3DZ8A 2XOKD 3TH5A 2V4ZA 4TL7A 3A58B 4YMUA 5KHOC 4DCTA 5FTNA 2L0XA 5HE8A 2BMJA 1B0UA 1M6NA 1P72A 1E2EA 1VG8A 3ZIAD 1ZD1A 2ZR0A 2ZUBA 4QHTA 5CDFE 1J7KA 2O0HA 1VCIA 4A8JA 2ZS7A 3GP8A 2W2VA 4TSFD 1OIXA 3DM5A 4C7OB 4ESHA 3ZIAA 3D7MA 1KSGA 1FX0A 2WWGA 3CONA 1P5ZB 3HPRA 5P21A 1VIYA 4U02A 4KFUA 5FPKA 3I61A 3B5JA 3KQLA 4Q7KA 1GM5A 4OHYA 1S8FA 3AF1A 3M0EA 3TKLA 4DCNA 5CDFA 3I8XA 1CJKC 1P73A 1IN5A 4E5UA 2PBRA 1ZC3A 4Q1AA 1TF2A 2G1KA 4DUGD 1G3QA 1W36B 3UMRA 5CYPA 4RJLA 3N5CA 4GSYA 5HCNA 4OJQA 1Q57A 4HB2A 2ZSBA 3GJ0A 4EJSB 2O52A 2WIAA 3FB4A 5FOTA 1Z07A 2NG1A 3QSYA 2BBTA 2GNOA 1SVSA 1E2NA 2QRNA 3QUSA 2YVUA 1UADA 1CU1A 5FOVA 4A9AA 1DE0A 4U7DA 2C5LA 4KAXA 4D0NA 4KBFA 5KDLA 3QY0A 2FSFA 1LF5A 1GG2A 4HAYA 4URYR 3K0FA 1S9DA 2EU8A 2NGRA 1IN8A 3SYNA 4OI0A 3UMFA 3PUWA 1AQYA 4W5WA 1E6CA 4OQLA 1YHNA 3DHWC 3OZXA 4TT3A 1Z0KA 1UAAA 2WVJA 2VP2A 1V5WA 4ZIRB 3B8HA 1KI7A 2A5DA 2W2TA 4PTLA 2F3TA 2GWHA 2ZYTX 3BERA 2BJWA 4DVGA 4QL3A 3LH5A 3RS0A 5JZVA 4UJ5A 1TQ2A 4FI3C 1XD9A 4QNRA 3DMDA 3EASA 2ASEA 4FWTA 2OCYC 3QKRA 2DBYA 3S1AA 4R71A 3CR7A 5DN6D 2NO0A 1M7GA 3BGWA 2VHCA 3R9IA 2CE7A 2QSZA 4C0QC 3RNLA 3RABA 1J2JA 1D2MA 5FI1B 3HDTA 3TQCA 2Q3MA 4M1SA 5JEDA 1X8KA 2HYIC 1J8MF 1XJ0A 4IKEA 3G0HA 2QU8A 4F93B 1B23P 1XDBA 1GNPA 3MWYW 1HH4A 4ZI3A 3U7EB 3I5YA 2KWIA 1EGAA 4OHWA 1NBMA 5KNDA 4C0AC 2CMKA 4Q1EA 1CJTC 1VIAA 4QGFA 1G20E 1NSTA 1A5TA 3QEOA 4Q4AB 2ZI4A 4KSCA 2QT0A 4X8OA 3ZZTA 4M1KA 2XZLA 4FMDB 2A5FA 3OFND 3JVUA 4B34A 1W0KD 2F1JA 3LW7A 2ZPTX 3TNFA 5HKKD 4X8LA 1BMFA 4MKGA 1HTWA 2IS1A 1PJRA 4UXIA 1NBME 1T0HB 5IK2D 4HUQA 4XJXA 1HUQA 3GJ8A 4P32A 4DSUA 1KTVA 4A6PA 4POAA 2ONKA 2ZQ5A 3X1YA 1FNNA 3T35A 1XMVA 2VTKA 1BYIA 5DO9A 4HLUA 4OBEA 2ZRKA 3CRQA 1W1WA 5FL7A 3QXHA 3VKGA 3ZS8A 4TT3D 3EIQA 5SZKB 1XD2B 1RVDA 1DELA 5EP4A 4NBSA 4C0KA 3WMEA 3OEHD 4IFBA 2JJ1D 3AV0B 3HU3A 2VP5A 2WSSA 4MDFA 1KSJA 1CP2A 3U4QB 2O8CA 4JVLA 3IUYA 3T12A 4CEIA 1JAHA 1OYYA 1N2CE 1BOFA 1OXVA 4JSYA 1GNRA 3IDQA 1ZMXA 3A4LA 2ZYUX 2V9PA 1WE2A 2CL7X 3T1VA 3WP1B 3ZD6A 1JPJA 1RRFA 1W4BA 2A5YB 2CJWB 2ZRBA 3MLEA 3QQ5A 3L8ZA 4QHSA 2HJGA 4ABYA 2GESA 2GKSA 1VG0B 1J8YF 3AVQA 3LRPA 4KO8A 3PG5A 2JIZA 1L4YA 4Q18A 4CW7A 2RGEA 3L2OB 2REBA 3LVQE 4PPFA 1T91A 2XB2A 1E4YA 3IIKA 1KDTA 1G21E 2IYUA 4LC0A 4M1YA 2F9MA 1XEWX 4Q7LA 2V3CC 2FX3A 1MV5A 2AKAB 1TX4B 1UM8A 2ZR9A 4CIDA 1KO7A 1PLKA 4GL2A 1U9IC 3UANA 1E9DA 2XAUA 1FL9A 4C0HA 4MITA 4YONB 1T3LA 5HCIA 1P62B 1Q3HA 3NKVA 4MYHA 4IVQA 2F7SA 1G5PA 3IPYA 4II7A 2AR7A 3UXMA 4ACBA 4PHFA 2H16A 2HEIA 2QRZA 4BLSA 3Q7PA 4KVAA 1UKZA 4W5HA 4BLPA 5AJWA 4TYQA 2NMVA 1ZNYA 1ANKA 3PEUA 1NVWQ 4PO1A 4Q9IA 3NC0C 2BWJA 3U3OA 3EA0A 4N1AA 2WJYA 4PAMA 3VHLB 3LO5A 3BFKA 1P2UA 4GOKA 3AKYA 3BFVA 3NBXX 2DFKB 4BLOA 2PMDA 2BEJA 2ORVA 3LBNA 3SEAA 4DDUA 5G41A 5L3VA 4XD7D 1AGRA 4Q9HA 2WSSD 4UNRA 1QRAA 3AM1A 4PC3A 1X1RA 2F3RA 2WICA 1C1YA 2QBYA 5HZKA 4EPTA 1S9HA 4X8HA 2R44A 1P60A 2FH5B 4LYJA 2OBMA 3CRW1 1SXJA 1E99A 3RDPA 2O8EA 3TUIC 3KUCA 1YVDA 1SQ5A 4JLKA 4NDZA 4PSKA 4URXR 5H8WA 3TW8B 3MWLA 5IT5A 2PX0A 2YWGA 4QM6A 1KHTA 1EWRA 2C96A 3ZQ6A 2NIPA 5D3MA 4CF7A 2C9CA 4QGGA 3KJIA 1SVWA 1P3JA 4A0GA 2FV8A 1A1VA 3CR8A 3QXCA 5C4GB 3UK6A 2P5SA 1EX6A 2HCJB 2CXXA 2IS2A 2MSCB 2VPPA 4RD1A 3A4NA 4WA7A 3W9YA 1E1RD 4TYPA 3AGQA 4QBIA 4O2RA 2IHYA 4QRHA 4TMVA 2YOFA 2WWIA 3I3SR 3ZH9B 1IAQA 1GP2A 1KI1A 1SGWA 2ZJOA 3PITA 4HB4A 4QBHA 4B35A 2AK3A 2ODEA 1FPMA 3CX7A 2OEPA 3FHCB 1EFRA 2EFGA 1OXTA 2LKDA 5DNYB 3PJRA 1ZIOA 5EXPA 2Q3HA 2PT5A 4F4CA 2VQSA 1GOTA 3OHMA 4Z8YA 5FUWA 5CITA 3DL0A 1RZ3A 3SNHA 4LDJA 3AEZA 2GRJA 1ZBDA 4IVPA 4IOJA 3SQXA 3NEYA 5LB2A 1LB1B 1CEEA 3H1TA 1NMYA 1OKKA 3U4QA 3A1UA 1XTJA 3BC1A 2O8BB 5B58C 3EZ9A 2XOKA 2AHOA 5AR1A 1JR3A 5LD2C 2EFHB 1Z2CA 4IDOA 3P4YA 3QOFA 1CBUA 2JA1A 1MH1A 1EK0A 3U7FB 4LV6A 4ZPXA 3SZRA 3OE7A 3UWKA 2OFOA 3FTQA 4LV5B 1IM2A 4MGKR 4NYMQ 1E9SA 4PSAA 3KKMA 2OFXA 1A2BA 3C4JA 2F43A 2OXRA 3DDCA 1E0KA 4PC7A 5K8TA 4B44A 2PLRA 1LV7A 2JLUA 2JASA 2WMOB 5AJZA 2JJ1A 2PX3A 2ZRJA 1RKBA 4HUQB 2Q21A 1KK1A 3NVAA 4XVQA 5IF9A 2HJVA 3GPLA 2F6RA 4QJ4A 4IOMA 2Z4RA 3P32A 3FKSA 4M1TA 3R9XA 2JJ2A 3T5GA 2NO1A 3B13B 3C14C 3CNLA 5JHGB 3ZYCA 2B8WA 721PA 3LW8A 2QA5A 4EJSC 2IS6A 3VFDA 5FH9A 1FX0B 1NVUQ 1I4DD 1IN4A 1I4LD 3NBZC 4ZDKA 4ZDJA 3ASZA 1X8LA 1IJFA 1AS0A 4BASA 1XEFA 4D0GA 1OH6A 1QG2A 4HAXA 4Q21A 4O3MA 4CEIB 2R6DA 1NMZA 1TUIA 2FSIA 5KSYA 2O8BA 3O8RA 1ZM3A 1D2EA 3DVLA 3FKQA 4F92B 5JMTA 2I1QA 5JJLA 5FBRB 1E9CA 2WZQA 1G7TA 3LX8A 4UNPA 2GA8A 4D26A 3WMFA 1TU4A 2IEYA 4FD2A 4QJ5A 4TYWA 3KL4A 1L8QA 3B7GA 4Q01A 3GLIB 1U94A 1Z47A 4ZV4A 1KMQA 3FMFA 5C4MA 4IXMA 3QXJA 4NYIQ 3AVTA 3AVXA 4BFUA 4PO9A 3CPHA 5JS8A 2ZTSA 2QPAA 3EPLA 4C30A 1C4OA 4F38A 1YZKA 1KNXA 2C8VA 5AJXA 3FMOB 2BBOA 2VHJA 2OT3B 1AKYA 3U3KA 1ZINA 4CVNA 4FCTA 3VKHA 3E2IA 2QAJA 4HEJA 2JLSA 3DZDA 2FOLA 1FUKA 2JJ8A 3NXSA 2QROA 1OPXA 3OFNA 3LBIA 3KJGA 2XITA 1OIWA 1ZM2A 4QJ3A 2HDNB 5F9FA 3THOA 2FFAA 2HCBA 3O8DA 5EXXA 5FI0B 1KY2A 4KYUA 4LY6A 2WJJA 3LD9A 1ZU5A 4UQOA 4LX0A 1S96A 3IO5A 3A6PC 1H8HA 1G8HA 4PPGA 4A8JC 2QMOA 1E4VA 2QTHA 3C41J 4G5OA 2PZEA 3UPUA 1QZXA 3VR5A 2ZSEA 3M4YA 4UXJA 1G8PA 3GEIA 2CLDX 5FBLB 4BRWA 1UKYA 4NONA 3TRFA 2O8FB 1F3OA 2GJ9A 3L43A 1NVVR 1E79D 1OE0A 2YOHA 3OAAA 4MKIA 3LFUA 3KKNA 4US2R 2IYRA 2J41A 1QHYA 4DT1B 2DFNA 4DDVA 2JIZD 4B3DA 4M1OA 4UNQA 3THWA 4L15A 4CT5A 3BS4A 5JBQA 4JZKA 3AKCA 1M2OB 4LRWA 5J5CA 5HTKA 4A0HA 4G3XA 4G5RA 2Z43A 3I73A 3WYAA 2FF7A 4S35A 3QG5A 2J0VA 1NKSA 2C99A 2NO6A 2GETA 3U3RA 4DUGA 3VX3A 1ZW6A 1F60A 3B9PA 3QXSA 4XSGA 4F7WA 1Q44A 3CBQA 1EWQA 1KO1A 2GK7A 4P33A 2CE2X 1EESA 2RGNC 2VEDA 2RGDA 4PO8A 3T5DA 4F4IA 1WF3A 3KUDA 1GKUB 4PHGA 2F1HA 2O0JA 4JLBA 2I3BA 1KO8A 1FUUA 3LVRE 4DEXA 4IDPA 4TMTA 1DG3A 2E1RA 3GJ4A 2FU5C 5M04A 3K0AB 3PUXA 2ZU6A 4CGZA 5TARA 3K70D 2IYTA 4J0QA 1G3RA 4NKRA 4TL6A 1P6XA 4QM7A 3U44A 3PUYA 1SZPA 3T06B 3CF0A 2A7QA 4B3GA 2WM9B 4JL8A 1XPRA 2H8KA 3QIAA 3GEHA 4R98A 3WBJA 4LHVA 1Z0DA 2NZJA 4KFRA 3K0SA 3AUYA 5E4FA 1X3SA 4FW9A 2WWWA 1RC8A 1KI4A 4KHZA 1KMHA 2V54A 1VCOA 5GJVC 2PL3A 3R20A 1KK3A 4Q47A 2GJ8A 4DRZA 2CBZA 3LDAA 1R5OA 2CJWA 4GMXA 3SC3A 3ZD7A 4OK3A 1ZM4A 1EFRD 3OF5A 4TLBA 3K9HA 4M9ZA 3N2EA 4GZMA 2D7CA 1AM4D 1CIPA 4FWIB 4NCKA 2CVFA 1KDOA 5FTMA 621PA 3WNDA 5A4JA 4US1R 1D2NA 1G3UA 1N6LA 1UEIA 4V03A 4EFMA 1MR3F 5KU1A 3GJ7A 2HYDA 2MMGA 1AS3A 1E32A 1Z0JA 5DYGA 4LK2A 2RH5A 5C18A 1S1MA 1H8ED 2FJUA 1JR6A 1NJGA 1LS1A 1X8JA 3ADCA 2QE7D 4Q9JA 2QSYA 1TQ4A 4AC9A 1DAGA 3K9LA 1XZPA 1Z3IX 3ZDQA 2IW3A 1G17A 4BEBA 1GRRA 5BN3A 1AIPA 5FBWB 1UJ2A 3Q5DA 2O8FA 4LJAA 5HR5A 2ODNA 1T8TA 3SE0A 1Z63A 5DI3B 5L3QA 2DCUA 1ONBA 3SQWA 1VTKA 4DDTA 5BN5A 4QFMA 1FTNA 1KO5A 1IXRC 4W5JA 3GFOA 1ESNA 4JLVA 1F6BA 4LBWA 3OEEA 2BBWA 5CK4A 1TL7C 4YLGA 2PEYA 1GAJA 3EC1A 2BHRA 1H8EA 2VRWA 2ZI7A 3W8RA 1G3MA 1MT0A 1Y63A 2WOJA 3FMIA 4MA4A 3HU2A 3R9WA 2WTUA 2J7PA 3BH0A 2DY1A 1NN5A 2F9LA 2FGJA 3BAFA 3TQFA 5K8IA 2BVNA 2ZROA 5HKKA 2CHGA 3SDZA 1NNEA 3F3YA 3KQUA 3A1TA 5KNCA 4Q48A 2EFDB 3SHWA 3AQ4A 2QPTA 2ZJBA 1OXSC 3IEVA 4WOPA 1XCGB 1KJYA 2C95A 1CLUA 1PLLA 4BUJA 4MYUA 1KY3A 1OHHD 1S1CA 5KDDA 3PR1A 5DHAA 3IIJA 2ZJ2A 4M53A 1Z22A 4IOLA 2VL7A 3TBKA 4LOAA 2UZ3A 3C8UA 2C2HA 3HR7A 1P2SA 1DO2A 1GRQA 4AG6A 1XP8A 2JLYA 1Z6XA 1T6NA 4DHEA 3FFAA 3PFIA 5DLQC 1IY1A 2BCJQ 2QN6A 3EW9A 2GF9A 1HE1C 2ZSFA 3IILA 4JLDA 1P2TA 4AYTA 1NN1A 4EUNA 1KOFA 5G3YA 1T3SA 2W83A 4EPWA 3UATA 1P2VA 1XJQA 5EP3A 3CO5A 4ZCMA 1QVAA 4B2PA 1SHKA 3GLHB 2VP6A 1GTVA 3LBHA 4R9UC 2Q3FA 5FR2A 4KITB 2WJVA 3NH9A 2AD5A 1R5BA 2REOA 3QPVA 1DAKA 1MRNA 1XXHB 5DSZA 5FTJA 3GLFA 3P26A 4YDHB 1CRQA 1ZD9A 2VO1A 2Q9BA 4AY2A 2VLIA 4WZ6A 5KUTA 1XD8A 3OIYA 2EQBA 3ADKA 1QVRA 3VTKA 1QF9A 1TEXA 5FTKA 1FZQA 4IFEA 4YDSA 3TR0A 1NLYA 3W6OA 1UBEA 3SHFA 2OO7A 5FOWA 4KI0A 2XTNA 2ZUCA 1RRPA 3B1ZA 3GJXC 4NH0A 4MRSA 3R8CA 4Q4JA 3EPKA 3JZAA 1NG1A 3LY5A 3ICEA 1QBKC 1NN0A 4A2PA 1SVMA 4EQ6B 2K5UA 1P61B 4D81A 1FFHA 3HU1A 2DFTA 3MCAA 2QPOA 1UKEA 4DIDA 3RS4A 3X1XA 4BFSA 4PC1A 2WOOA 4TL8A 5EE1A 2OM2A 1E0SA 2QBYB 1IOZA 4B74A 2J59A 3RRZA 3U61B 4RFSB 3BOSA 3FWYA 2EWWA 2O5VA 4GPTA 2G0NA 4A1FA 1OYWA 2V55B 4A2WA 1E96A 1H65A 2FPKA 1QHHB 3WMGA 3DO6A 2WPDA 1L4UA 3TUJC 4RKFA 2GVZC 1HT2E 1K5DA 2WHXA 3TW4A 5CLQA 2WKPA 1IHUA 5SZJA 4A4DA 2A2ZA 2BM1A 3CX8A 2YJTD 3W3AA 1CJMA 4AKGA 4NU0A 2IYVA 5AJVB 2IUUA 1YZTA 1EXMA 2KSQA 6Q21A 2XTMA 1WBDA 2RCNA 1MO5A 4WBSA 2O8DA 3EPHA 2ZIAA 5FL3A 3C5CA 3IQXA 2ANCA 3K0CC 2CL6X 2VF7A 3IQWA 2HLDA 3LLMA 1N5IA 3ICQB 4Q02A 4HDCA 2PLFA 4E07A 2H1LA 2B7CA 2D74A 1DTSA 1AA9A 2P67A 1U0LA 3KXLA 1IY2A 4XVRA 1HQCA 3HJNA 1E1QA 2W0SA 4L9SA 4TYNA 1E2MA 5FPYA 5JEEA 4TL9A 3AF0A 3WY9A 3ZVRA 2VSFA 1G16A 1XJCA 3RHFA 1XRJA 1E2FA 1N0VC 1WDTA 3RRNA 3CF6R 1UBFA 3VR1A 4YQFA 3PVSA 1KK0A 3PEVA 4HYYA 3PENA 3TAUA 1KI8A 2G88A 3HYTA 3Q72A 3B1YA 5JJIA 4K81B 4WXPA 2EVWX 1JR3D 1DG1G 1MO3A 3K8YA 1ZUHA 1N6OA 2OLKA 5JWHA 1XWIA 1R2QA 2J1LA 2DWQA 2EFEB 3BB3A 2ZRHA 4TWZA 2A78A 4IJMA 1CJVC 1KSFX 2ZSAA 3U6BA 5CIWA 4UKDA 2R65A 4QOSA 2J0UB 1L2TA 5HE9A 1E1QD 3CM0A 4AD8A 4C2UA 1ESMA 3RRYA 3DKVA 1OB5A 2IT1A 1G7CA 4TLAA 1N0WA 2ZI6A 3WNBA 1S2MA 1QHXA 1A2KC 3RANA 1VDZA 1TF7A 2C98A 2BV3A 2J9RA 1U8AA 2KBFA 4OJKA 4YXWD 3QPWA 5KDOA 2WWYA 2J46A 3KJHA 4EAQA 2GCOA 5DN6A 2GEVA 4H1UA 3CH5A 4B73A 2UVQA 1G1MA 3REGA 1GILA 2WKQA 1M7HA 1Z6GA 3MSXA 2KBEA 3GLGB 4OKSA 4C0JA 4KBGA 1ZYUA 1F2TB 4LJ5A 2ZRGA 3TVTA 3PQCA 1GKYA 1EFTA 1Z6AA 2DFLA 2GJAA 2UKDA 4DWJA 5IHPA 4ACAA 4C0BA 3CRMA 1G8FA 1KO4A 3I4LA 1OB2A 2VHTA 5EUMA 2WJGA 5EUQB 2QP3A 3QG1A 4IW3B 3X1ZA 4RD0A 2B6HA 4QBFA 3WBKA 1ZUIA 2ZI3A 2J87A 3SYKA 5CM8B 5A0FA 4NTZA 4EFLA 2JCSA 3CH4B 3QJYA 4KLNA 4O0MA 3RC8A 3AF4A 1TNDA 2D62A 5EE9A 4AURA 4B47A 2YKGA 1YRBA 1W36D 3GJ5A 4URZR 1F2UB 1UBCA 2ODWA 4PZLA 1NIPA 3W5IA 1JXOA 3KQHA 1TADA 2AD1A 1ETUA 3T34A 2V6IA 1HQYE 4NHOA 4V0LA 3ZVMA 1GRNA 3FHTA 4LHYA 1CKEA 1YZLA 5AUOB 2AKYA 4B43A 2YINC 4M9QA 2B21A 3L0SA 5LPNA 5JJKA 2C78A 1W48A 1U98A 1KK2A 3D31A 2QMUA 2JLWA 2ZUDA 4OQNA 4Q1DA 4LYFA 2ZE5A 5GJBA 4LSGA 1II8A 1S4QA 1E69A 1ZNXA 1JQJC 4Z1MA 2CNWD 4M2LA 3AB3A 5HPYB 1M74A 4JMPA 1JAIA 4Q4HA 4V0ME 2QTVB 2P0EA 4B2IA 2OAP1 2BEKA 1YRAA 1VYUA 2OBNA 4BFZA 2P6RA 2XTZA 4TZ0A 3SS8A 5J4VA 2HF9A 5AK0A 4B2LA 2GCPA 3IHLA 3T61A 1TEVA 4JLPA 1II8B 5EQTA 5F9HA 2X77A 2QI9C 1U99A 3RAPR 3C5HA 1F48A 1WRBA 5LDDC 3S1AB 4CEHB 1W49A 3L82B 3PUZA 1GFIA 1TF5A 2GJKA 4YC7A 2J3EA 4L16A 3L8YA 1WQ1R 2VP0A 4QBGB 1ZNWA 1S0UA 2VSXA 5KNBA 2WIBA 3JVVA 1CR1A 3KQKA 3HWSA 5FPHA 5AUPB 1MRSA 1E9FA 4TQ9A 2ZE6A 4C0SA 3TSWA 1KJWA 3CKLA 1W46A 2Z0MA 4GFDA 2AFIE 4EPVA 1VYTA 3QKSB 1G3IA 2BKUA 5GJCA 3C7KA 1I4TD 3EZ2A 4GP7A 3OIVA 3FMPB 3QENA 1FQJA 1QHGA 4GMDA 4L5BA 5BN4A 4GRAA 3U7GA 3ZLJA 3VX4A 2QP9X 1D8TA 5TV2A 4FMBB 2FSGA 1MO6A 2CEAA 5KO2A 1GL6A 3CUEF 2OCBA 2BIFA 4MRNA 5CM9C 4HATA 4LI0A 5BYKA 4TQAA 1JEEA 4UJ3A 1XTKA 1Z2AA 3P27A 5DHFA 4KJZA 2FG5A 3D6TB 2FFHA 1OIVA 2EYUA 1VCNA 1KKMA 2ZYVX 5LD2B 2W6IA 2ZAMA 4I1UA 4ILEA 3OIUA 1G6HA 1LF0A 4HAVA 5B64A 1F2TA 3L0OA 1IXZA 2WWXA 3TSOA 2B8TA 4A6XA 4MUBA 4YMVA 2YWHA 1Z0IA 1SXJB 4MGZR 5TB5A 4IDQA 2H17A 1XBTA 3AF2A 5D3MB 2IWRA 4A82A 4F91B 3A4MA 2MSEB 2VSOA 2GK6A 3EX7C 5L3RA 4L9WA 3NHAA 2P3SA 5BXQC 2ZVQX 2REXB 1C9KA 2B92A 1SKYB 4MRVA 2W00A 3A1SA 1UBGA 4TQUS 3U44B 1COWA 1JB1A 3IKJA 4DDWA 1Z6YA 3GLIA 4AKEA 2IYQA 4DXAA 2QM8A 4P4TA 2MSDB 2ZRCA 2OCAA 4ESVA 4JIMA 4TLEA 1YZQA 4TTQA 3CPJB 2GJSA 2V7QA 2ZREA 5FOSA 3EAQA 3UWOA 2PJZA 3QVUA 1DBSA 4ARZB 421PA 1NN3A 2EW1A 2ZS8A 3GLFE 3DOFA 3KFXA 3LV8A 1ZCAA 2P5TB 2A5JA 1E0JA 1JBKA 1YR8A 2YNMA 4OI2A 2WPDD 1XXHE 1E2PA 2R6AA 1JXMA 4MKHA 2HF8A 3KKOA 3NG1A 2OFWA 4XOIA 4KCGA 2E9SA 4ON9A 4HZUA 4AI6A 1G291 1RYFA 2N46A 2A5GA 4NPHA 2J5XA 2X2EA 1Z8FA 1N0UA 3KDSE 3ZS9A 1W4RA 4Q9LA 2ERXA 2HXYA 2J7PD 1I2DA 4LGMA 1XXHA 3UG6A 3B9QA 2FWRA 3FPAA 2FPMA 2BMEA 3WP0A 4JBWA 4GI7A 4KXFB 3KTAA 2ZE8A 3LWNA 2VH5R 4JVNA 4BZQA 3D3QA 2IF2A 3PCRB 1OW3B 2D2FA 2V1XA 1KI3A 2GXAA 5JCZA 4ASUD 2F1IA 2ODBA 3GFTA 1N5LA 5LB4A 4ZCIA 5JHHB 3AVWA 4D4MA 4FMCB 4PANA 3OAAD 3QKRB 4LJYA 4PZZA 2AWOA 3R7WA 2PT7A 1VECA 1RJ9A 3U5ZB 1Z83A 3KFVA 5G53C 4JLAA 1G4UR 1R0YA 1OXUA 1T3HA 4NCNA 4CZ2A 4HAWA 1SVKA 2CLSA 3Q3JB 1GL9B 1M1YE 2ATVA 2NOAA 2ZAOA 1R8SA 2QGNA 2O8CB 2HT6A 2OV2A 3ZQJA 3F8TA 1T9HA 3AVUA 4DB2A 121PA 1JJ7A 2ZRPA 2P6UA 1Z08A 2NPIA 5GJWC 5D3QA 5EXTA 5FR1A 2XSZA 4URWR 2IXFA 3G82C 2Q6TA 3P1JA 4LJ6A 3THWB 1XTQA 4NL4H 4URUR 4QHYA 4AYXA 1KAGA 1G7SA 3MJHA 4HDQB 1OXXK 3ZGXA 1Q12A 1NIJA 5F98A 4NMMA 4YXWA 8OHMA 2FFQA 2V8OA 3SYLA 1U8YA 1DAFA 2N1BA 4LPSA 1TUEA 3MD0A 1GKIA 2KB0A 3NIBA 3B85A 2F55A 5EE0A 2ZETA 1VHTA 3EC2A 3QE0A 3QKTA 4DLXA 1Z28A 1U8ZA 5L8VA 4MKFA 2G6BA 2Q9CA 1P9NA 1XEXB 2WKRA 3B2EA 1E9EA 4MYTA 4D4JA 4FCWA 2KE5A 3M6AA 1Z6TA 1G8YA 1S3SA 2QQ0A 4XVUA 4BRUA 2X19A 2H18A 1P7CA 1N3BA 4C7OA 3B1XA 1KNQA 3HYRA 2UZIR 2IHBA 1R8QA 2G83A 5DGXA 4ZI2A 1UEJA 2R8RA 4R7ZA 4LCBA 3RS3A 4M1MA 2FDCA 4GOXA 4MQBA 4XTRA 4LHXA 1II9A 2YV5A 4K8OA 5B30A 1XCPA 3F5FA 4PFSA 4DCSA 3TSZA 4AKIA 4JKYA 2AFHE 5AWFC 1K5GA 3VAAA 2ZJAA 3FKSD 2ZE7A 1ZUNB 4ZKDA 2NQ2C 5SZHB 2OUKA 5JFGA 1BYUA 4P4UA 2VBCA 5BW8A 2J45A 3AVOA 1FMLA 3N70A 1BO6A 3O8BA 3J81k 1NI3A 4V0MA 1SHZA 1KI9A 1U0HC 2XZPA 1MO4A 1D6JA 4U5XA 4DLWA 3M1IA 5EP1A 1ZU4A 4F4JA 1V43A 1AKEA 4GT1A 2QG6A 2QE7A 3EIHA 5FPTA 5IK2A 4PPQA 2GHIA 4NCJA 3KX2A 5JSZA 4U00A 4XTCS 2ZRAA 2RGNA 1NF3A 3BE4A 3MUFA 1OKKD 4BFTA 3MMPA 3KKQA 4OL0A 2I4IA 4RD6A 4XWAA 2NO7A 3V00A 1W5SA 2YC2C 2H92A 2RGBA 3GLFB 2GXQA 4JBXA 4M8NE 1E79A 1SVOA 1RRCA 4DSOA 3EA5A 4EIWA 2V1UA 3PV0A 1R5NA 3H86A 4NCIA 3TGPA 4LC1A 3CRRA 3DOEA 1E2HA 5BQ5A 5DH9A 1UF9A 4WIAA 4Q4AA 3QF4A 1JR3E 3IBYA 3CWZA 1CR2A 3EWAA 2WV9A 4V02A 3PUVA 2HXSA 3QKUA 5JRZA 5EZ5A 4RCZA 2FNAA 2AN9A 2XJ4A 2X2FA 4C9BA 4Q1FA 1GSIA 1KAOA 2CL0X 3CNOA 3RSOA 2ZR7A 1P75A 1AQUA 2ZRNA 3I1FA 1NVVQ 3Q9LA 4HB3A 4OHXA 1RPZA 4B3XA 2ZRIA 1TAGA 1KGDA 1NLZA 1Z0AA 2XNSA 2ZS9A 1DAIA 3BH6A 3EZ6A 4MGIR 4OQMA 3A8TA 4BLQA 4ERNA 3QPUA 1LVGA 1PUIA 3U60B 4AG5A 3T1QA 3THYB 1DARA 1U9IA 4WW0A 3AF3A 4HAZA 4UNSA 4KV9A 4JKIA 1RE0A 2XB4A 1OLOA 3GJ6A 4XWOA 2QAGA 3WHLA 4QGAA 1Y3AA 2DWOA 2BJVA 5CIQA 2RGCA 2JLZA 4RKEA 1YR7A 1KZGB 3IO3A 3L0IB 4QG7A 3SFVA 3U7HB 1N6HA 1LNZA 2RGGA 4PQRA 1MABA 1X86B 2ERYA 4TN1A 2RKOA 3EZ7A 4NYMR 3WRYC 1E1RA 3FFBA 4B33A 1AZSC 4I81A 4DSTA 4LJ9A 2Q9AA 3VHXA 4O2LA 4DZZA 1E2GA 4G5SA 5KSOA 4G1UC 1WMSA 3DPUA 1DAHA 2GEUA 4TMZA 4NYIR 4JBYA 2WAXA 1YU9A 4RD2A 1JNYA 1OT3A 1HEIA 1G64A 4DLUA 4Q00A 1E94E 1M8PA 2DYKA 4B6FA 1SXJC 4NZYA 4B76A 1UDXA 3VR3A 3H84A 3LX5A 1MABB 2JDID 1E98A 2C04A 4LUCA 1CTQA 1WCV1 4RCYA 1GL7A 3SI7A 5C46F 3GFPA 1IY0A 4MUAA 2YC4C 3X1DA 4JT4A 1T5IA 1LFDB 1G4AE 2ZRMA 1QHSA 1IQPA 5CB6A 1HV8A 4HB0A 5FBQB 5JSZB 3H4MA 4BECA 3W90A 1CULC 1W47A 4CYMA 1DAEA 2OESA 2ZU0C 3BB1A 4PR0A 3DKPA 4B48A 4A0RA 4W9MC 1W2GA 4ZIRA 1WB9A 3I72A 4IHQA 5H1YA 2W2XA 1HA3A 1KZ7B 4HAUA 1XNJA 1HE8B 1AJEA 1US8B 2Z6VA 1COWD 2W6JD 2FZLA 3AUXA 1AN0A 2CCKA 3PXGA 2NZ8A 4JT2A 1DOAA 1D9ZA 1AGPA 4D6PA 1R0XA 4RFVA 3PEWA 1GIAA 4C4PA 1XPUA 2OHFA 3B6EA 4A2QA 1U90A 3LQQA 5BYJA 3QBVA 3GMTA 4Q1CA 1J70A 3BB4A 2BMFA 1BH2A 4FMCF 5FOXA 3ZZUA 1OV4A 3BRWD 2A3RA 5E7JA 1ZRHA 1KI6B 4DB4A 3IPXA 4PAQA 5SZIA 3K0EA 4KSBA 2CVHA 4ASUA 1KI2A 1QG4A 4URVR 5FL7D 4Q9KA 2QZ4A 2ANBA 1W44A 2VF8A 4GNKA 4M1WA 5TY0A 2SHKA 1G19A 3MRSA 3B1VA 4V0KA 1UFQA 1XEXA 1ZCBA 3BORA 2GVDC 2GZDA 3SOPA 1VG1A 1CS4C 1GWNA 1UPTA 1OFUX 3AP2A 3QEJA 4I4LA 4RVCA 4WVFA 3AVYA 221PA 3ETLA 1Q22A 4RD4A 2WBLC 3AKDA 4WZAE 5E7MA 1CJUC 4ZKEA 2RGXA 1F2UA 2YOGA 1NY5A 4W7SA 5EE5B 4AIIA 1D5CA 3AGPA 4AWXA 3PEYA 4ITRC 4JL6A 1FP7A 4BE7B 2GDJA 1YE8A 2GTPA 1GUAA 2QUZA 3DMNA 2JLRA 1KKLA 5F3WB 3P20A 1AK2A 3LA6A 4CDGA 2RHMA 3RYTC 1N5KA 1U0JA 2IX3A 1E0AA 4TTRA 3MWKA 4OHVA 2ZRFA 2BMDA 2V7QD 5JECA 3EARA 2FPLA 3IHWA 3LQRA 4FN5A 3CZPA 2VP4A 4A36A 2KI5A 3K09C 2DPXA 2C9OA 1JPNA 3CW2A 4WAUA 2OCPA 5L3SA 2QT1A 2QY9A 4HI0E 3FOZA 1OH5A 2R6FA 2ZYWX 1VKJA 5KYKA 1ZVQA 1XTRA 4RZXA 2IXEA 1R7RA 4Z8XA 2R2AA 3WHKA 3MJRA 1R6BX 1ZM9A 2BDTA 2IA5A 4QGHA 4MDEA 1SVIA 1DS6A 3E5HA 4Q03A 1FP6A 3A1WA 1UDWA 5G40A 2QEQA 2QM7A 1N6RA 4XIGS 1EG7A 2Q0HA 3KB2A 1EX7A 3QF4B 4IVRA 2AX4A 2P65A 2ZJ5A 3KXKA 4DLRA 1IJEA 1E9AA 4HLUC 4DLZA 4EPYA 5GVSA 2GCOB 4DCVA 5KOYA 1SKYE 4M22A 2RGAA 4EKDA 4DBLC 2IK8A 4D4KA 1XX6A 2QNRA 3VR6A 2W0MA 1I2MA 3ASYA 3OESA 2FN4A 4KFTA 2PZFA 3DEFA 3EPJA 1PVOA 4MH0R 3B82A 3KKPA 3EG5A 3O8CA 1Z0FA 3FGNA 4M9SA 2JAQA 2X1VA 1VCMA 2XX3A 4Q7JB 1II0A 2W58A 3U3MA 3MAAC 1PZNA 4G01B 3ZZ0A 2OBLA 2ZM5A 5CJ2A 3CNNA 1HURA 1KIMA 1P9WA 1XTSA 3THYA 2ECKA 1EFHA 1XCMA 1X6VA 4R2IA 2IYWA 2LKCA 3A1VA 4HZIA 1W0KA 2OSBA 2JJ2D 4S2EA 3A37A 3BK7A 1ELOA 5TVKA 2PMKA 3SJZA 4OQXA 3W6PA 3T1TA 1KSHA 3Q7QA 2WJIA 1TQ6A 3I8SA 4NYJQ 2IYSA 2IBMA 3GLHE 3MGCA 3R7WB 4PSVA 3BD9A 3RLFA 1K6MA 4P4SA 5B57C 3C16C 2AWNA 1XEWY 1NBMD 5J4YA 4DC9A 1WXQA 3WYFA 1ZAKA 5TXGA 2VHQA 3CLVA 4O25A 3U6KA
chains in the Genus database with same CATH superfamily
1WB5A 2I4RA 4BQSA 4CEHA 2LCFA 4AQYB 1USWA 3PSHA 1K4KA 4KZKA 1G5TA 2Z57A 1WY7A 5TQ2B 3TGWA 3MFYA 2HMUA 3H1BA 3MT8A 2AXNA 2R4UA 3UB3A 1G6OA 2QENA 5C7IO 4LXQA 1GPDG 1V7ZA 4PONA 4TMWA 1UMKA 4G37A 3HYLA 4UDNA 3VNVA 4RZ3A 2G36A 3E70C 3Q98A 3TLEA 4QXRA 3UT5B 3ZW9A 1OF1A 4UUBA 2OG1A 2Z3ZA 4NJOA 3SDBA 3ZI7A 3H5NA 2LUOA 2XECA 3OCVA 1Q0PA 5JYEA 5ADWA 4FK8A 1JL3A 5ISMA 1FNSA 1MB0A 2X76A 3F6YA 1TUBB 1KEWA 1NXOA 1R6TA 3GC6A 3GGDA 3CIOA 1T24A 3Q9UA 4OQDA 2CUKA 3CPEA 2W43A 3WYGA 1Q20A 3I6YA 4LF4B 5CT8A 3QPAA 1OD6A 4K03A 4OXQA 5C2JB 2OXFA 1N7JA 4OHUA 1XALA 3AO0B 1O95C 2JJQA 3SX0A 5JC8A 1UWKA 1GDDA 3ZHYA 2L17A 1IVSA 3UJCA 2I6GA 3CX6A 2MOKA 1POXA 3D1LA 4LISA 5T4EA 5C1OA 2GBFA 3O2QB 1E6WA 2VHEA 4GM4A 3VJLA 2YJGA 2BKEA 5L95A 2C2YA 3I3OA 2CJXA 2D0OB 2CCGA 1D7OA 5ANRB 5TMDA 1CQZA 4M0DA 4LVUA 5C4IA 5CA1F 3MQ2A 4UM8B 1WL8A 4X1YB 4KP7A 4GU5A 4KH1A 5H9WA 3MLAA 3LTNC 4RLQA 5DMXA 4I6JA 1IONA 1DJPA 1Q0HA 1ZXBA 2GZSA 4QXMA 2RI1A 4IX9A 3NW9A 2LV8A 4PYKA 5C8XA 1FQWA 4ND8A 4BLVA 3ND9A 5KYTA 3IIMA 5CA0A 3VU1A 1VSUA 1BFDA 1RKUA 4BU1A 3TTVA 2P6NA 2JCGA 3O8LA 3T1OA 3UCFA 4C0LA 5KPDA 3RSGA 4RBNA 3OQ1A 3O1IC 3BK2A 1GN9A 3I34X 1Q7CA 1XF9A 1DO8A 1YDWA 4AXBA 2FVXA 4BLTA 4CLEA 4DIEA 2H7CA 1TRKA 3L06A 5DM1A 4IRUB 2IHTA 2XMBA 4ESEA 5IJZA 4I1PA 3TMKA 4LYAA 1W36C 2BW0A 4ONEA 4JXZA 4IFTA 1KZ9A 4MVWA 1BS1A 2ZWVA 4CL8A 3BKWA 1NJFA 4BFWA 4DLYA 1FW6A 4QKQA 5K99A 4L6IA 1GLGA 2ONJA 3KSRA 1VZ3A 1DXOA 1LSJA 4JXXA 1SMKA 1FFDA 4DV7B 2I1VB 4OYHA 5A5GA 2FR8C 3VU9B 2QU7A 1RW4A 3KIPA 1FMFA 2F43B 1E3IA 3ULKA 3G88A 3H05A 1DEKA 4DBLE 3GQBA 1C9JA 3U2QA 1HT1E 4A92A 4HBGA 2HV8A 4K40A 1XEAA 3D1JA 1IZ0A 3ENVA 4X1IB 2JLQA 4XPIA 1EE9A 2I9PA 1Z29A 3KB8A 3CZQA 2OQVA 2Y9PB 3TCNA 2WWFA 3FPEA 4KLZA 4MYDA 1CQXA 5JYDA 1RAGA 2ACEA 2X22A 1T0BA 4W8OA 3K16A 1ZQ1A 1YIDA 3GMIA 4ZYZA 3R3XA 4XH9B 1GNQA 5KWJA 4Y6GB 1KEZA 2L19A 4HUTA 1ABEA 4CNBA 1L5RA 2YJZA 3PL1A 3B38A 4JGGA 3NM4A 3PHBE 3UT6A 1QG6A 2IUSA 4AJJA 3PWTA 1UT5A 2BE9A 1YOBA 2FQYA 4NU8X 5E7IA 5I5EA 3QE4A 3NHZA 3ZY5A 3ZR4B 2OD9A 3A32A 2RONA 2Z5FA 3FLBA 4UMEA 3RUFA 4D1YA 1JMYA 2ZJYA 5JDCA 3EY9A 5DSTA 2VXOA 3ETDA 1FJHA 2ECPA 3EXFA 4YX9A 4LDPA 3Q3HA 3VMFA 3WX0A 1F6WA 1EXWA 4ILKA 4EH1A 3SC2B 3KZ1E 1NP6A 2XNDD 2Y6UA 2NX2A 5D5HA 3VISA 1LC3A 4LSZA 2UVPB 1HC7A 5J4LA 5BMVB 2MYUA 3X1WA 5EKTA 1GA4A 3KVRA 1NRIA 4NCXA 2VJYA 5AJTA 1ORRA 4FIZA 4BXOB 4FNGA 4N03A 2C03A 3EDYA 1RIFA 1Y9DA 3T5CA 3UK2A 2ZJ4A 4ZJUA 4D44A 3DMTC 5IAJA 3T38A 3V7FA 5KHAA 1VPLA 4YCNA 4EELA 1Q2XA 3W4JA 2G9NA 2PRSA 3H8SA 3JWEA 3CF2A 4OPMA 5DHSA 2XGJA 5TIIA 1TM3E 1BCRB 3HGQA 1W2HA 3ZWPA 4AK9A 2FMTA 2W2PA 3DC2A 2I6XA 5EXSA 1N9GA 5B6IA 2O0KA 2WIKA 5HXAA 2IIQA 2PBZA 4CMJA 4Q24A 1R6UA 2BTOA 3M6WA 1MT3A 4BVBA 1TW2A 2ZVJA 4DOMA 4GBED 2J0UA 4ZVPA 4B6SA 5ERGB 5IUJC 4LYGA 3MGGA 4CCAA 5AW5A 1HYQA 1FFCA 4KU4A 3HXOA 1T6YA 2HK6A 2VYFA 3N2KA 4KUEA 4FYPA 1A95A 2GAOA 3IAS1 4WSOA 1CUZA 3WYCA 1BS9A 4K8RB 3GLGE 4K6KA 3D3NA 3GROA 2IUFA 3RC3A 3SX4A 1EFUA 1ORDA 5IARA 3H9BA 2IL1A 4RZUA 1IN7A 1E4OA 4M55A 4HQNA 3KPWA 5DXFA 5EAIA 3UKOA 1IN6A 2JFWA 3G2HA 3I6ZA 1QR2A 3IUJA 2B8NA 4YBRA 2HHLA 2G71A 3GZNA 4PAGA 4B7CA 1HDZA 5AW6A 3Q85A 2E89A 1XTIA 1SBQA 2X3FA 3SJCA 2FEPA 1COZA 3DDWA 3GFSA 4I9UA 4QU8A 5KJ1A 3O3NB 3PEEA 1AU9A 1PR4A 2HOQA 3ZNOA 1PR6A 4JVMA 4PLGA 3CFYA 4Q93A 3T5AA 2R8PA 5EKUA 4EQ6A 1ONNA 3LLUA 4HCJA 4UAJA 4UQLA 4Q3AA 1NY6A 1N6KA 3FTPA 1TCBA 1V11A 1CK4A 3DCIA 4X0EA 4BBZA 1RZUA 3KYDB 1FP2A 4JEMA 5HG0A 5FBVB 1F7VA 3WDSA 5DYNA 1JDTA 5BRNA 5KYWB 4RTJA 2EBHX 4DMMA 1KYIA 1WBJB 3TW8A 3SJ7A 4BQRA 4EB6A 3JQ9A 2FKNA 4MQ5A 2QZZA 1KRXA 1X7YA 1UFRA 3BVPA 1VL6A 4GE0A 5C1PA 3DBHB 4EKGA 3P7MA 2C9YA 1WLYA 3KS9A 4PZCA 1Z4PX 3ZY2A 3BJIC 2ZI5A 4R2HA 5EKXA 5JJ5A 4Z9FA 3FI9A 4A23A 4QZVA 1L5GB 3SMVA 1KQNA 3OKCA 1O08A 2QQFA 4B8ZA 3G2QA 1YZNA 1NNI1 4B75A 4ED9A 1AKNA 5C3MA 1RQXA 1MEJA 1L7XA 2GM9A 3A70A 3FCSB 3INYA 3W4IA 4BQQA 4LHEA 1Z5ZA 2R6GA 4IFIA 4M1QA 2HDHA 2C7PA 4M6WB 3K9QO 1IXSB 3OOJA 3QEMB 1IG3A 4IWXA 1G2OA 2YJ4A 3DLBA 1QIDA 3H2HA 5E6SB 1MMFB 3VJMA 4JBGA 4N0MA 2I2XB 4EJ6A 1ORVA 4LKRA 3L4BA 5EC8A 4TLDA 4XWKA 2NTVA 1CUWA 1Z13A 3EDQA 4OI1A 3K6SA 4FBMA 3AL3A 4XIJA 3UYKA 3ZTTA 1ZL2A 2CDNA 3C3MA 3OFKA 3COSA 1NAHA 1QYIA 4Y9TA 3IOCA 4U9HS 1CXZA 3PFNA 4O1MA 2BM0A 4UHFA 1JJAA 2AK2A 3HKCA 1XTZA 2G0TA 4R31A 4TXLA 1JIVA 1DLJA 1P4HA 3I9OA 2H2AA 1D6MA 4PAOA 2J3IA 1JI0A 1W581 3PGVA 1EQAA 1N9GB 2JEZA 3EDCA 1MPXA 3L1UA 1Q0UA 3Q2IA 5FNVB 2ZK7A 3LVFO 3IP3A 1M83A 1VHLA 3K96A 2W2MA 3KXDA 3L02A 3LDUA 4BLRA 2NT3A 4CLOA 2IY8A 1VGVA 3LQ4A 1NKTA 3NKLA 4ZK2A 1TZKA 3FWZA 4E2FA 3OP4A 3OTHA 1HDIA 1M66A 2H4ZA 3OJ0A 4Q16A 5CUQA 4CQLA 4F96A 3S8EA 2FTKE 2WAYA 4Z4FA 3AH8A 1IEQA 1D4FA 3DVQX 4TM8A 2PKQP 4O59O 2XMRA 3VI3B 3E22A 4BO5A 1DADA 5B3KA 2VIIA 4C88A 4N3NA 1M6EX 2X8BA 2CK3A 1GAWA 5JCOC 5MDHA 5K8UA 3HBNA 2E7ZA 3GJRA 1JU4A 2QQEA 1YL6A 3LQ2A 1Z5VA 4I1RA 4KXUA 4WK2B 4I46A 1K1EA 4AB1A 2IYXA 1YOVA 1HOXA 4LE2A 4OXKA 4EFNA 4DJFC 5NULA 4N7JA 5CD1A 1DAMA 5TDHA 2YMLA 4ALLA 5BPHA 1A5ZA 2WG0A 5E0KB 1NQTA 2VZ9A 1VI2A 3BHMA 1V1RB 3BX1A 1ZIYA 4PBRA 4E4YA 1F8GA 4Z7JA 5K8LA 2P2DA 3I32A 5G3ZA 2IXGA 1SULA 3DZFA 3HACA 2L2QA 3NHWA 4KYTA 1I5EA 3WRXC 3TUZC 3LUKA 1FUYB 1HE3A 1BW9A 4FCVA 3DMFA 3HKBA 2W4QA 4LFAB 2WTNA 4LZZA 1ABFA 4O8CA 4FVTA 1U1IA 1IQ0A 2H4XA 1IWPB 3HWRA 4FHGA 3RUIA 3WLEA 2PZGA 3E9YA 2UUBB 4TS9A 4HNGA 3JPWA 4FYMA 5DOZA 1A9SA 3DDHA 3I2FA 2Q7OE 1NW4A 1RAEA 2OKCA 4QU0A 3SBDA 3VMMA 1NSFA 4D56A 4JLJA 1DIGA 3ENWA 2WF6A 4MGYR 2FPGB 5KWEA 2O54A 5LN1A 3I2KA 3OZSA 3AUUA 4A7PA 1SC6A 3K5WA 1BXGA 1ILWA 1KEPA 4YMWA 2PEZA 4RTOA 4DM4A 2JIRA 4C6TB 4MS4A 1KQ3A 2PGNA 4MGHA 3UK7A 5KNDD 3C6XA 4ZO7A 3AKEA 1E59A 1HSZA 1DHTA 3K4HA 3K9GA 4HUJA 4MI1A 2WAAA 3I5XA 1QDUA 3KTAB 2X0IA 2IFTA 3GVPA 4TS4A 5EUBA 3ZWCA 2JD2A 1FQKA 4XXHA 4PPNA 3MG9A 5BVGB 1H8HD 3CB4A 2BCGY 3BXZA 3UEOA 1X1SA 3VTZA 1U81A 2R7MA 3IVAA 1H42A 2IEDA 1Y3IA 1MAAA 4QSHA 4E22A 1XMIA 3F98A 2OC4A 3RADC 3GUVA 2FETA 2PFKA 2H63A 4FUQA 2L42A 2X86A 2WG1A 2G40A 4HQRA 4PQYA 1YBVA 3KZMA 3ZWXA 4DTCA 3E84A 5JSQA 2J0QA 1QGZA 4INPA 1T8SA 1TMYA 4IP0A 5CT6A 3Q8XB 4KDEA 1SC4A 1BD4A 2ZIVB 1AA6A 3J7TA 1D2HA 1HY3A 1WP9A 1AMNA 3V4RA 2IS4A 1L1QA 3UMGA 1RMYA 3NAZA 1ISJA 2OXCA 3A2NA 2Q49A 3OLQA 1IPEA 1R9MA 2VAPA 1Q21A 4OA5A 5KWVA 2VRBA 3GRFA 1HRDA 4HEA1 3UICA 1JIIA 3CW8X 5TGTA 1RXCA 4G09A 3IGFA 4V2UA 1K8QA 3R9KA 821PA 4G9GA 5DTIA 4MWBA 4BNTA 3CEHA 2UYGA 3RS2A 3PC8A 4RS3A 3L0PA 1T3TA 1MQAA 3G8DA 5CFQA 2C7QA 1L5MA 3T7KA 1NW9B 5JISA 3QTLA 5C5EA 5IWCA 2PGIA 3ABQB 1MIOA 3C15C 3A9UA 4W9NC 3RUHA 4BZPA 2YMMA 4GOJA 4HLQB 5D3ZA 4CI0B 4PIMA 4M88A 3HABA 4JYCA 4XGIA 1GR1A 2ZVPX 3KP1A 2G3YA 1Y4UA 4HADA 1XMJA 1E8DA 4JLMA 4BVHA 4EF6A 1R18A 4X84A 4F5YA 2O3SA 3D7LA 1TA9A 4F85A 1UT8A 4UOZA 5JI3E 1XZLA 4CM4A 3ITKA 4D8YA 1BDMA 2B98A 4HXFB 5L7YA 3QBTA 1J33A 3T15A 1CZRA 4FMPA 3IE0A 1MKYA 2WJ3A 3FYHA 5AKGA 3ZUGA 1E9RA 4B3FX 3K3PA 1ZH4A 2BFOA 2OTCA 1FRNA 2X7JA 4B3GA 1NGSA 3T95A 2IYAA 4FINA 5H68A 3N28A 5HM8A 1M1UA 2NPFA 1ZH8A 4IIVA 1QZ3A 4UBNA 4BPBA 3DMYA 1DO0A 2OPBA 3HBLA 1J99A 1K6JA 3E9MA 5EWLA 2YWFA 2X0RA 2GZHA 3KB6A 3ADDA 2O1EA 2J67A 4DCUA 2PJRA 2J7KA 5TVGA 5C5IA 1JP7A 2GCNA 3LSYA 2PMWB 1LI4A 1G5RA 4GPIB 1NE7A 4W5NA 1V8OA 5JD3A 1EGQA 1NLFA 2GBGA 2JEOA 2QLLA 2XOKD 3BE8A 3HY6A 4LW8A 4CL2A 1SRQA 5HW0A 1NJ8A 5B5SA 3PA6A 4I9HA 3TKYA 1LQUA 3L1JA 5JSFA 3VDMA 3IJPA 2CXPA 3NAQA 4HN2A 4ZZIA 4OGKA 2P2GA 4IAOA 4RTKA 1B0UA 3HNRA 3PUKA 5JASA 1NSYA 3UGTA 5A6SA 1VG8A 3R0IA 1JJBA 4QHTA 3BTSA 1EEHA 3PPYA 4V0RA 3WMRA 5BWOA 1VCIA 1XE3A 4A8JA 3GO4A 5AM4A 2XGOA 2C7OA 2W2VA 3RI3A 2P4SA 1CP3A 3K5PA 1P6QA 5DM60 2AE1A 3DS8A 1Y9AA 3ZIAA 3D7MA 4AF6A 5HSGA 2JH9A 2WWGA 2EJVA 3HPRA 4DQLA 3Q0TA 4KO4S 1UKCA 5P21A 3TOVA 4EY5A 1JIQA 4UDXX 3M5PA 3B5JA 1IZ7A 3KQLA 2Q62A 1F3LA 1ZQ9A 1J9EA 2QN2A 2UYQA 5CVJA 3S5UA 1YQUA 1FP4A 4IIJA 3VAZA 4UPDA 5CDFA 4FJ1A 4CKEA 3CEAA 1CJKC 1IN5A 2PBRA 4L5IA 2G1KA 4Q1AA 3DPIA 5LKRA 1NJ2A 5DYYA 1W36B 5CYPA 3TTSA 1GPKA 1GQQA 1YS1X 3AEUB 2ZSBA 1W5BA 3LPCA 2EFYA 4BKMA 2H3EA 2HA4A 1Z6QA 2WIAA 5EZYF 1PYOA 4CKBB 1Z07A 1JDPA 2NG1A 2Q3BA 1X7XA 2ZB3A 4MEJA 2LDBA 1OAOA 1SVSA 2I67A 1ESCA 1M1YA 5AK6A 3VYTB 3KSUA 4KXXA 1USGA 3SEFA 3ZJTA 1D07A 4KBFA 1UP6A 4R40A 5KAPA 1EUDB 2GYWA 4XWYA 2V7WA 1WB6A 2EU8A 4NBRA 3VPGA 3MINA 3DZGA 3P2MA 3PUWA 1AQYA 1MP0A 3GPDG 3LF1A 1E6CA 4NLLA 1ZEMA 1R00A 2P4HX 2DWCA 4OJTA 4TXHA 2B6NA 4MIEA 1AUPA 4A3SA 1KI7A 5HUJA 1Q74A 1GQSA 2F3TA 2GWHA 4DVGA 3HVHA 1VPVA 3I01A 1WO8A 4PNZA 4KE6A 3AXSA 3QMWA 4UJ5A 5KI6A 3RUEA 1XD9A 3ZDXB 3DMDA 4NQRA 4GLLA 4YCBA 1ZCZA 2MYPA 3L18A 1KGSA 2OD2A 3QKRA 4XB6B 2DBYA 5FT9A 3E18A 5F21A 2V03A 4R71A 3QMPA 4X65B 1FVXA 4YUYA 1TYEB 1F38A 4E6EA 4EW6A 2I55A 2VHCA 2I54A 1NHWA 2D1RA 3MILA 2XGGA 4CV2A 1C30A 4ZOCA 1U0FA 3RABA 1I51A 1D2MA 1NXXA 4P35A 5AH0A 3HDTA 2ZDQA 1AKMA 1OVMA 1UDRA 3EIWA 2HYIC 5FAXA 2EJTA 1OWNA 3RJ5A 5AJUA 1GNPA 3MWYW 1LBQA 2Z95A 1XNQB 4FW8A 4BCBA 4XYGA 4CV3A 4ZANA 3RJMA 3NJ8A 3EEYA 1GCAA 5HF5A 4C0AC 2XQGA 3KL2A 5LNK6 1GFZA 1SKBA 1CJTC 1WHSA 1RE1A 3BYZA 1I5RA 2VRCD 3M1LA 4LZNA 2QUBA 4Q4AB 4X8OA 4C3OB 2QJOA 3ZZTA 2QNIA 2R7AA 3R4VA 5LQAA 1UJ4A 1BXKA 2JJYA 3OFND 1C1HA 1W0KD 2F1JA 2J4DA 5CTAA 4AUEA 3UJ9A 1U3CA 4KN8A 4CIWA 5GONA 3TNFA 1YVEI 2DECA 1CEXA 3C4VA 3PR3A 4GEKA 1MENA 1T2AA 1PS0A 1PJRA 1GZ5A 4D45A 1NBME 1L5VA 3ZNPA 5IK2D 3E9DA 1YMUA 3GJ8A 2B5VA 3Q7IA 5ICEA 4DSUA 2QSJA 3DUWA 4A6PA 4N3GA 4POAA 2ONKA 2ZQ5A 1Z6ZA 7AT1A 4NBVA 4NV3A 4TVKA 3T35A 4KXYA 1GPYA 2DUWA 1XMVA 2VTKA 3P5BA 4GDMA 4J0DA 4HLUA 1MVOA 2HJSA 5JAQA 5FL7A 3QXHA 4ENWA 2BGRA 3N2KB 3PNYA 1ZIDA 3PUIA 3C7DB 4ZGGA 1YBFA 4FE3A 4QPJC 1RVDA 2NVOA 1W75A 3OJXA 3OZVA 4C0KA 4IFBA 3K8QA 4BE4A 1RPJA 3AV0B 2VP5A 5HZGA 3SD7A 4BKUA 1RM0A 1FF9A 4H15A 1CNFA 3TECE 4GP9A 2XWPA 1ZK1A 3HGMA 4JVLA 4NOJA 4N8DA 4BO3A 4DR1B 5LWQA 1RQPA 1OYYA 2Y1FA 1N2CE 3CV3A 3LYLA 4MIOA 3UTCA 3W5UA 4DIUA 4JSYA 2PBLA 3R5JA 3PFKA 2R86A 1WAMA 2NUPA 4G8CA 4KR7A 5HBRA 1Y33E 3GT3A 1GADO 4TTAA 1W4BA 2A5YB 2G9QA 1G21A 3MLEA 3QQ5A 4RIEA 1Y4AE 5ETJA 4MAFA 4AO8A 4KQGA 2VJOA 1ZUD1 1NOJA 1S8NA 1ZGZA 1A5AB 2IEIA 2HJGA 1P2BA 2GESA 4ZHQA 5HTOA 2WTBA 2O5EA 1VG0B 5I4IA 2PUWA 2GRAA 4PLHA 3LRPA 1I2ZA 4HTAA 4I50F 4KO8A 4MOWA 5BMVA 1M1YB 3F67A 3KKKA 4HG2A 4S12A 4V1CI 3FZYA 2RGEA 3EZGA 3UAOA 3DC7A 2ZJ7A 4B17A 3L2OB 1B76A 4OLAA 4BV9A 3UJDA 1T91A 1BH6A 1Z4LA 2EF1A 5ALZA 2G09A 1KDTA 2LTAA 4LC0A 3ZI4A 3CLSD 4DLPA 1DCFA 1P9OA 2JFVA 2FAXA 2H85A 5L7WA 1G0NA 2M6RA 4EVRA 5EIHA 3R23A 4E11A 1V8BA 1KO7A 2XMDA 3H7AA 5SV2A 5HF6A 1O94C 2UUAB 1WMBA 1U9IC 3UK0A 4BO1A 3EVGA 4WESA 4EB0A 3VR3D 4RULA 3MYRA 4R68A 1A96A 1BEUB 3ENKA 1CJBA 3I9NA 5HQ3A 3HZOA 3OM8A 4IVQA 3C87A 4O2AF 3FZEA 1QFYA 2DPHA 3C7CB 4ACBA 2JVJA 3HCEA 1UKZA 2PUGA 1CD5A 4TYQA 2NMVA 3GOHA 2EP8A 5EPEA 1KFCB 5H81A 5C52B 3TW0A 3QSGA 3WAJA 3R5XA 5J2TA 1MH9A 3FGZA 4QDUA 2EKLA 3EA0A 4N1AA 2WJYA 5B37A 4DV0B 2VQDA 1F4VA 2WTAA 3BFKA 2ZJ6A 5GZ1A 3BFVA 2VT3A 1N1GA 2RAUA 3NBXX 4AT1A 3T9AA 1UFKA 4QEDA 3BCRA 3LBNA 5CR9A 2HWYA 5KTPA 4HNRA 5L3VA 1KYXA 3SHOA 5FLEX 3ND7A 4N18A 4Q9HA 4QUAA 1SB9A 1J2YA 2JZOA 4D3YA 3UVEA 4KWEA 2WICA 4I8IA 3HA5A 4KQXA 4EPTA 3K31A 1LJUA 4WOBA 2VHWA 2Z56A 1Z5PA 4EKEA 2J09A 6REQB 1AQJA 2IOQA 3CRW1 3DAFA 1SXJA 3BILA 3H18A 3HYNA 4DBZA 1FDVA 3VYRB 1ICIA 3OT4A 3QW2A 2AUTA 3RBZA 4YJFA 3GLKA 4WXYB 1QC5B 4LVOA 2C96A 2JFNA 2NIPA 3JD3A 3B6MA 4RQAA 1ZOPA 4TXMA 5D3MA 2QJRA 1P3JA 4A0GA 5I7SA 1A1VA 3UK6A 2QDKA 2C2MA 4J0JA 1EX6A 3P19A 1PGJA 1GZ4A 1WEHA 4JUDX 4M8IA 3SZGA 4YALA 5AMXA 1XJWA 4KIWA 4F4DA 4DADA 2XMZA 3W9YA 1YZVA 3GCZA 1KEEA 1HPLA 1FFXA 1FS4A 4BJ1A 5DXJA 4O2RA 1OXKB 2IHYA 3CG0A 4H0FA 4X1KB 2YOFA 1GP2A 2I1WA 5D84A 4BNVA 1WEKA 2ET6A 2OB1A 4L0DA 2WZDA 1Z6PA 2WF7A 1P5FA 2A7XA 1GSHA 2V97A 3LT5A 4XYBA 4F3YA 3MWGA 3CX7A 2OEPA 3ZHTA 1SCDA 5I01A 1TO1E 2LKDA 5ABPA 1SD5A 1AKVA 3ZG6A 1GGKA 1ADBA 4G1VA 2H1RA 1VJ1A 5HCUA 5JY1A 3DL0A 2DEUA 1RZ3A 1TIKA 2JCBA 4H3VA 2Q0XA 4LDJA 1DKLA 5EQFA 4IVPA 3VZRA 3D3WB 1NVEA 3SQXA 2MDTA 1LB1B 3I1YA 4IUCS 3C6YA 2JKVA 3Q3VA 3UZUA 4ARIA 4BIMA 2GN4A 1XTJA 1X7GA 3BC1A 2IJGX 3BL6A 1NZJA 3EZ9A 2XOKA 2NZVG 3M5WA 3MRTA 3OZRA 3MXOA 4KNWA 4YRPA 3K32A 3SBXA 3TN7A 3LNTA 5FNZA 1Z2CA 4UZEA 2P8SA 3P4YA 3QOFA 1CBUA 2JA1A 2YVQA 3T5BA 1B26A 5AKZA 1BHJA 3VUFA 1ZK0A 1JIUA 1SXQA 1YVUA 1BN7A 4D4IA 1JEYA 3OE7A 3S2YA 2YFQA 3LS2A 1IM2A 4NYMQ 4E2XA 2UYCA 5JVDB 1A5BB 3ILHA 3N8HA 2QL9A 1Y5NA 2Q0SA 2QPLA 4PC7A 1K6XA 2OSVA 3U0VA 4HH0A 4N54A 2GD2A 4DMFA 2QX8A 5AVZA 5IEJA 1I0ZA 3MZ0A 4PICA 4JI5B 1KK1A 3L0ZA 3L92A 3NVAA 4AZVA 3OIFA 4HD8A 4NARA 4ZYTA 5BPFA 2C59A 3R74A 2R3SA 2I0FA 2PU7A 2H1SA 2ZIXA 1L5LA 5JJBA 1I94B 2ZBVA 3LOUA 3ZYCA 2Z5LA 5LIPA 4IGAA 1P0MA 1LBTA 4K9PA 3VYVA 3I9LA 4EJSC 3RQSA 1NVUQ 2JAUA 5FH9A 2IS6A 2I8CA 4ZDKA 1SRRA 3BFPA 3NBZC 1T2CA 4MV8A 2JEYA 4K28A 1IJFA 4Q9NA 1LQ2A 4WY8A 1BX3A 1QLWA 3UFXB 1MGOA 2HF2A 3GT4A 5M2QA 2QOEA 1XEFA 2KS6A 4HAXA 2FPIA 3EHEA 2VYCA 2C07A 5CFZA 5F77A 3RYCA 1NMZA 1P18A 1VBNA 2WF9A 4AJNA 5DEIA 5KQRA 2O8BA 3DVLA 3FKQA 3MTJA 4YUZA 2LDXA 5FBRB 1MQ8B 4BMDA 1QIFA 1NNUA 2YJ5A 3COZA 4GPD1 1G7TA 1E7SA 3VOSA 1BMTA 5DK6A 4QQFA 4ZZ3A 3ZDBA 2IEYA 4N5NA 4NJEA 2FHSA 1OZ0A 3HKBB 3KL4A 4QJ5A 3N58A 4DLLA 1E77A 3B7GA 1AE1A 1NT2A 4WMLA 4EZEA 4YP9A 3U19A 4MLPA 5BUQA 5CW1A 5C4MA 3FLAA 4HWOA 3AVXA 1Y89A 3N75A 4PO9A 3KQTA 3FFXA 3EPLA 1DJNA 3AEYA 3PDJA 3GRUA 2H1IA 2BBOA 1NXVA 2VHJA 2WHQA 1G6Q1 4BDTA 4FCTA 1SNYA 2R85A 3E2IA 2F59A 3R24A 4HEJA 3ZEAA 4UCFA 4DQDA 2HZ7A 4GX2A 4ZQFA 2FOLA 2HJ9A 3G2IA 4P08A 1M76A 3ND5A 1OPXA 5BSKA 3OFNA 4BTLA 4RTSA 5DRTA 1T34A 1WZCA 5EIBC 4H3KB 2NZXA 2FFAA 2HCBA 4RS4A 5EXXA 5LYYA 4FFDA 1KY2A 3THOA 5LOVB 1V1JA 4ZA2A 4LY6A 1FP1D 3L07A 5AQ1A 5KYXA 3LDGA 4LX0A 4AG3A 3IO5A 3A6PC 1DXYA 1H8HA 2AEFA 4PSUA 4RKYA 3G3EA 4IS3A 1WSDA 3DEAA 4G9EA 5A9SB 3HP7A 3RS8A 2C2XA 1LPNA 5LQDA 5E9WA 4LRYA 4WN9B 1UKYA 4FGLA 4NONA 3QV1A 1THGA 2MSLA 3EFOB 3TFQA 5F7JA 3I0MA 3Q3CA 3LFUA 4HH1A 1FMCA 5J9FA 4GVLA 5IBPA 3ZNQA 1ISMA 1U1CA 3GUCA 2OAGA 5IDQA 3CUVA 4B3DA 1T9KA 3WLTA 4L15A 4CT5A 4MV3A 4GQBA 5DCYA 2H5IA 5J5CA 4YUAA 1S02A 3KD3A 4G3XA 1O8BA 1T9CA 3IQDB 4G5RA 4ER6A 2DQKA 4S35A 4CM9D 3U3RA 3I0ZA 1A9RA 1A77A 2GETA 3QUAA 2MJLA 5FLKA 4CQMB 4DUGA 4F7WA 2Y1CA 5LQRA 4XSGA 2GAFA 3CBQA 3LUJA 5KVVA 2FWBA 1EWQA 2C54A 4LRTB 5SYNA 1THMA 2VEDA 3H04A 3VVMA 4EOGA 1HLPA 2XA9A 5CH8A 5EEHA 3UH1A 4LHSA 2OV3A 2C5FA 2FSPA 3HDVA 3KQQA 4PHGA 1AURA 4WFJA 4O4HA 2I3BA 4F9GA 3ZQ4A 1NFRA 2AGVA 3AERB 3Q9SA 1DG3A 2E1RA 1N2XA 1QQTA 5M04A 2W6NA 3OQHA 2ZU6A 5F1KA 4PN7A 4CGZA 2B37A 5TARA 1O96A 3K70D 4G0WA 4MNTA 4OVKA 1Y6GA 2IYTA 4QULA 4NKRA 2GCEA 4CKBA 2CYBA 1CUBA 4TL6A 4JBLA 3U44A 3QVXA 4EUEA 3A7EA 1L7PA 3PFBA 3N0WA 2XY4A 3T06B 4C05A 2QQ5A 2A94A 3HA7A 1O8CA 3MMXA 2A7QA 1TLFA 2B1JA 3VSCA 3D64A 4BO8A 4LQLA 3VVLA 3OM1A 2A35A 1L0BA 2LRHA 3UV3A 3N07A 1RADA 1RC0A 2Y0DA 3QIAA 1QZTA 1S2OA 4R8MA 4U9UA 5GWXA 4EARA 3JYPA 1TVKA 2WY2D 3T4XA 2GZMA 5E4FA 1RC8A 3PQ7A 4FW9A 4CKYA 2NXCA 4EY4A 1E66A 4J1QA 4KHZA 1CZUA 1LJLA 1NC3A 1QPGA 4EZBA 4LS3A 2D1TA 1AV6A 5GJVC 3T5TA 1LI5A 5L7TA 1QYWA 3PWZA 4L7VA 3LDAA 4CCWA 1N1MA 1R5OA 4ZOLB 3ZUPA 1PWZA 3WO1A 2CJWA 1O96B 4CKCA 1SBHA 2PKRA 5IX8A 3ZD7A 3C1OA 1W88B 4KLRA 1EFRD 1PG5A 5BQPA 1NA5A 5K0TA 3L40A 3G9UA 2D5CA 5HVNA 1EVIA 1S7CA 2DKFA 1PJCA 4H60A 4IUBS 3N2EA 1BX0A 4LK3A 1K4MA 1CIPA 4KDCA 1QAQA 1U0RA 2CVFA 5FF9A 1KDOA 1IOLA 1CFZA 3L4EA 3H8VA 2PQ0A 4G1BA 5FTMA 2RKWA 4Y3UA 3A9CA 3DFFA 3GEDA 3FPBA 4US1R 3TB6A 3ZV7A 1UEIA 5A4JA 5CYGA 1GO2A 1XDZA 3Q1KA 5DLDA 3AEXA 1JQAA 4C4RA 3WFJA 1ZMRA 1UPCA 3DLPX 4J0EA 1NW8A 1Z0JA 5DYGA 2R79A 1EP9A 4XUDA 4LK2A 4CM9A 3MHTA 4PQEA 1KWGA 5C18A 4MJXA 5EYPA 1I1NA 1M2WA 2MYNA 1E3EA 1G6KA 1VJRA 4I1YA 4OBWA 1X8JA 5BWLA 4NMWA 2QSYA 4EGAA 1TQ4A 2QD4A 2XQIA 4OMDA 4AC9A 5LYJB 1M2HA 3CBGA 3FTFA 5G0VA 5C8DA 2IW3A 2O4CA 2BCEA 4TT8A 4GX0A 1K4YA 2JS7A 3NTQA 4ZEXA 3PUHA 2FWPA 1MX1A 1AIPA 1ST2A 3NRJA 4Z9YA 3Q5DA 5BN3A 2CKDA 3AQIA 3E8XA 1DUIA 3BA1A 4XWWA 2A14A 5IM5A 5KMGB 5E4JA 3SE0A 3FSEA 2CLLB 3DOCA 1Z63A 1EPUA 3Q40A 1ONBA 4B09A 4HRXA 4U7PB 1E2UA 4KPGA 3L8GA 1XCBA 1URPA 4YO7A 1HE4A 2G06A 3W1EA 4IQGA 1LPAB 1FTNA 3DEHA 3GRKA 1A7AA 5B6PA 4PFKA 2QNBA 4LBWA 3OEEA 1KPGA 2ISQA 1TL7C 4F11A 3PVZA 3RE1A 4UCWA 1H8EA 5HK9A 3VU8A 3HA3A 3FMIA 3BMNB 4E2ZA 4EKYA 2IV2X 4ZRNA 1BVRA 2J7PA 2HIHA 5IW8A 3BAFA 1NN5A 2BP7B 3A6FA 5FFNA 2ZWMA 4Y2XA 4ZGWA 5FWNA 3JVIA 5K8IA 5HKKA 2XVXA 5BSWA 2CHGA 3SHQA 4O63O 4LOIA 4QT4A 5FUMA 2QTZA 2JKZA 5ER9A 1U0OC 1Z33A 1LNSA 2DPGA 3S2ZA 3TSYA 1L8OA 3L4KA 2ZJBA 1JSRA 1OXSC 4Y2YA 1OBHA 4FFRA 1DKMA 3ES9A 1KYQA 1NR7A 3PXAA 3T5PA 3GEBA 1KY3A 1S1CA 2NXNA 3N6VA 4JP8A 2WWRA 4OH1A 5KDDA 3IIJA 2ZJ2A 5E6UB 1Z22A 2F4NA 2QUJA 4IOLA 5HKOA 4L9AA 4OAQA 2IUEA 3MOGA 3SZ3A 5LDHA 1JGTA 3R3JA 1WP4A 5TT1A 4B9AA 5DIZA 1GRQA 2DHEA 3VZQA 1RCUA 3S6JA 4BNGA 5CAEB 2PU5A 1Z6XA 2FPUA 3VSEA 2H00A 4H7FA 4EHIA 4HC4A 3PFIA 2BCJQ 2ZSFA 4AYTA 2I6QA 4D92A 1NN1A 1KOFA 1I24A 1X42A 1RVV1 2GSWA 2W83A 2QTLA 4NNPA 5G3YA 4ZMSA 5ILQA 3UATA 2H4JA 4EYSA 3CTPA 3CO5A 3P9IA 2Y67A 2GBIA 1SHKA 4GGOA 4GS5A 4C5AA 1P81A 4AO7A 1GTVA 3LBHA 3I6BA 4OCZA 4DV2B 2WJVA 2IX9A 3QPVA 3VSAA 4GR9A 3IP6A 3JQ9C 4B3RB 4YCCA 2QTTA 3NEAA 3B20A 4J0CA 3ZHRA 1FJGB 2OCXA 1Q3KA 2GEBA 5FTJA 2H1VA 2VH1A 3GMDA 3UJHA 4F6CA 3GLFA 3KSMA 4R1MA 1ZD9A 5IYZA 1AKTA 1ODIA 4NZPA 4AY2A 2QMQA 2SBTA 4WZ6A 3OIYA 3QMMA 2JRLA 4QUEA 2ZAYA 3PRJA 1SKUA 2X9LA 4LRQA 3OZBA 2PKXA 2IXTA 2QRQA 4J0HA 4RMJA 9LDTA 1QF9A 2H2GA 3WWOA 1FZQA 1TIPA 3K6KA 1OU0A 2PKEA 4IH9A 4MYSA 4R1UA 4DG9A 4UVIA 3NQ41 4P83A 3UQZA 3ANTA 1SCQA 8AT1A 2ZUCA 5EJMA 1X7WB 3UXHA 3B1ZA 5HYVA 2O14A 2R8OA 3GJXC 3W06A 3R8CA 3SKYA 4CTMA 3A9RA 3U4HA 3EBOA 1EVKA 3JZAA 3BMQB 5IABA 2QD1A 1QBKC 1UPUA 3MYYA 1HDEA 4IJ5A 4UBJA 2K5UA 3WS7A 1KYZA 4A2PA 1HDRA 5CM2Z 1FFHA 3VPFA 1C1XB 4D81A 2PKWA 2WLTA 1ZXLA 1I10A 2Y0CA 2QPOA 2HNKA 2IZ0A 4O3FA 1IEVA 4C2AA 2YHIB 2WOOA 2ZYHA 1BWRA 1RTTA 2OR3A 1P5RA 4TL8A 5LQUA 1WETA 3P45A 4B74A 2PGOA 4YRTA 3X1JA 1KMCA 3R7FA 4RFSB 3FWYA