1F2UA

Crystal structure of rad50 abc-atpase
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
149
structure length
149
Chain Sequence
MKLERVTVKNFRSHSDTVVEFKEGINLIIGQNGSGKSSLLDAILVGLYWPLRIKDIKKDEFTKVGARDTYIDLIFEKDGTKYRITRRFLKGYSSGEIHAMKRLVGNEWKHVTEPSSKAISAFMEKLIPYNIFLNAIYIRQGQIDAILES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords RAD50 ABC-ATPASE
publication title Structural biology of Rad50 ATPase: ATP-driven conformational control in DNA double-strand break repair and the ABC-ATPase superfamily.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 37
structure length 149
sequence length 149
chains with identical sequence C
ec nomenclature
pdb deposition date 2000-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1f2uA00
4LPSA 4NHOA 4EPYA 2BMDA 1NNEA 1S96A 5K8TA 3OAAA 5A0FA 1GSIA 5FOTA 2Z6VA 3B78A 3SNHA 3BC1A 1I2DA 4ILEA 4QBFA 1EK0A 4F92B 5JCZA 3GJ7A 4F4IA 5LB4A 1Z0KA 1YRBA 4OHWA 1GNRA 2FF7A 2VO1A 3MJHA 4PZYA 4NCJA 4XTRA 2ZRAA 3RHFA 1WE2A 1EFHA 5DGXA 4H1VA 1BO6A 5DISB 4V02A 4LJYA 1W47A 2Z0MA 4PO8A 1GWNA 1U8AA 2C99A 1E2EA 1AN0A 1OFUX 2ZITA 4MA4A 4MGIR 1KO5A 1ANKA 1KK3A 3BERA 4ITRC 2WKQA 3I61A 3AVWA 2BBTA 1HYQA 3SE0A 4DEYA 2IYTA 1P61B 3W5IA 5KNCA 2GBLA 4YC7A 1E2JA 1BMFA 2J1LA 3UWOA 2G83A 2QTFA 3SJBA 1CRPA 2GA8A 1QHHA 3FMFA 4I1OA 4HZUA 1R10A 4NCHA 3PENA 4Q48A 5KDDA 4DDUA 3FHOA 4FW9A 5FUYA 4AY2A 1U8YA 1KIMA 4TSFA 5DHFA 5LB2A 4A82A 3AUXA 1MT0A 1UFQA 4TTQA 4KCGA 4OYHA 1F2UA 2MMGA 3BAFA 4IFBA 1TUIA 1FFHA 1WP9A 2G77B 5EE3A 4D0LB 1CTQA 3NC0C 1XMSA 2P0EA 4B35A 1R4AA 2ZREA 3LVRE 4WZBE 1W4RA 2OBLA 5EUMA 4IEIA 2J0QA 1DAKA 5LPNA 1ESMA 3ZQJA 2QQ0A 4C0QC 1R0WA 4HLUC 2P67A 4HLQB 4B6EA 2ERXA 2F9LA 4PSVA 1N6NA 1N5JA 4UJ3A 1CS4C 2F1HA 4TLDA 4TMWA 4TZ0A 3VKGA 3B1YA 5IK2A 3S1AA 2JGNA 4IDNA 5FPKA 2XZOA 2ZRIA 4JL8A 1KDOA 2PT7A 1NY6A 2IYYA 4BLRA 1UDWA 3B7GA 1ZNYA 3KKPA 1D5CA 5KHOC 4IDHA 1AK2A 3QEJA 4TQ9A 4QHYA 2J0VA 5ELXA 1RJ9A 2G1KA 3QKSA 2OXCA 4M53A 4NYIR 4YONB 5AJWA 3U3JA 3K9HA 1QVRA 3HU2A 2OSBA 5G3ZA 2NGRA 4RD6A 2GXAA 2D74A 2WWHA 3GFPA 2O8DA 1OXTA 5FTKA 3FE2A 5G3YA 5KPJA 3MAAC 4PHFA 2W6ID 1EX7A 1KK0A 4XIGS 3U3KA 3I72A 3EZ6A 3ZVNA 1KNXA 4B3BA 2C95A 1VYTA 1G3RA 3B9PA 5SZKB 1NG9A 1G8HA 1DO0A 5KSZA 4QJ5A 3ZLJA 2GKSA 3BB4A 3VKWA 3U61B 1G41A 1VYVA 2CHQA 1T5LA 2H8KA 4JIMA 1JALA 1NG1A 4TZ6A 5D3MA 1J90A 3W6PA 2HT6A 2J0SA 1D2MA 2QSYA 4D4MA 3FVQA 3QPUA 3GJXC 1Z47A 1KOFA 4GNKA 1LF5A 4DSUA 4US1R 3W90A 1ZC3A 3C15C 1ZNWA 4DVGA 1E32A 2PH1A 1IOZA 2X8AA 3FDIA 3CX6A 1UKZA 4Z8XA 1H8ED 5JHHB 3TUIC 4X8MA 4BFZA 4ASUA 2JATA 1BYUA 2Q3FA 3LAWA 1P9RA 4JSYA 1A82A 3EAQA 3ZVLA 3BXZA 4LBZA 4WVFA 4KXFB 2EFGA 3K53A 1DOAA 4PTLA 4Y0VA 2VTKA 3PITA 4LI0A 2C03A 4AWXA 1XTJA 2NO7A 2Z4SA 3RLFA 1Q3TA 3A1VA 2O8EA 1U0JA 4IRUB 4UNNA 2CJWA 2JAQA 1EFRD 4A0HA 2OILA 2AWNA 3AP3A 4PXAA 5GVRA 2ZJ2A 4ESHA 3NC1C 4DLUA 2A5DA 1G9XA 3Q5EA 1SULA 2J59A 1HE8B 1XCPA 1XB2A 2ZRLA 4M2LA 4F93B 1EGAA 2QNRA 4PAMA 5JWOA 1EWRA 2ZI9A 3ND9A 2WICA 4GSYA 2B7CA 1RFLA 2QU8A 2RGBA 2VSOA 4KI0A 2MSDB 1KSFX 1DELA 1JECA 2WPDD 3VR3A 3HU3A 4HDQB 4IKEA 1IJFA 3P4YA 3WNCA 1U99A 2UZIR 1W0JD 1DVRA 1UJ2A 1U94A 2JJ2A 2B8WA 2Q21A 1X86B 3KKNA 4NYJR 4WXRA 3ZVMA 2LKCA 2QY9A 3RRNA 4TLEA 5FBVB 2XXAA 1GG2A 1FL9A 1R0ZA 1IN5A 4UNQA 3QG5A 2REBA 4DDWA 3KL4A 4CEHA 3CIOA 1WRBA 2IHBA 3W6OA 3KJGA 2CE2X 2IYQA 4DBLC 1KO1A 5JEDA 2ZM5A 4CEIB 4Z51A 3BFXA 1KO7A 1QHSA 3IILA 5J4KA 3O8CA 4NZYA 4U02A 1UKEA 3K1JA 3VX4A 1OXXK 3K09A 3AF4A 2DB3A 2ZUBA 1WDTA 1XWIA 2ZRJA 4P0TA 4B34A 2YZ2A 4DIEA 2ZRFA 4URZR 5GJVC 2NTYC 3PV0A 1TAGA 2FOLA 3KXLA 3RYTC 2ZSAA 4OJQA 2FFQA 4N1AA 3RABA 1ZUNB 3DPUA 3L0PA 1D2EA 2HDNB 3OEED 1DAGA 5FTMA 5BXQC 4X8OA 1AS2A 3AVQA 4KFSA 2FE4A 1OW3B 2PLRA 1JPJA 3LXXA 1P60A 1RVDA 4GP7A 4M9SA 3TSWA 2WJHA 2A5GA 4JVLA 2H17A 1NRJB 2DFLA 3QBVA 3ZDQA 1QHGA 1GRRA 1MABA 1XTSA 2QMUA 4YDHB 3RC8A 2CL0X 3M6AA 2CXXA 4B32A 3SHWA 4L8GA 5F9HA 5KDLA 2GJ9A 2IHYA 4KODA 2ZXUA 2A2ZA 1HY3A 2A5FA 1CRQA 4IOLA 4M8NE 1VG1A 3QBTA 2ZJOA 1MRNA 3UMRA 4DEXA 2IS6A 4C4PA 4D81A 1OT3A 3GJ0A 3AGPA 1Z0IA 4ZDIA 4NTZA 5GJWC 1FQKA 1HV8A 4M1KA 5AJYA 4HB0A 4AYXA 3AKCA 3TQCA 3K8YA 2O5VA 4ZCLA 1TTTA 5EE1A 2V54A 1JPNA 4KV9A 2ANBA 1LW7A 3SYKA 2Z5FA 3FKSD 2R2AA 5TVKA 2ZR9A 1WCV1 3EARA 3IDQA 4MUBA 4ZIRB 2NO1A 2R62A 1L7VC 4M1YA 1NMZA 4KFRA 3AVYA 4RZUA 1E9FA 1NVXQ 3K9LA 1Z0FA 4QGHA 4D80A 3GEIA 1E1RA 3NEYA 5UKDA 1K5DA 2ZYUX 4RY2A 2GWHA 1UADA 1D8TA 4LBWA 4MITA 4Z1MA 2X77A 3WRXC 1NBMD 4LDJA 5DYGA 1M7HA 5LD2B 3IIMA 2VHTA 4ZDJA 2B6HA 2JJ8A 3IPXA 4L5BA 4LZZA 2WWYA 2HV8A 1TADA 2YINC 4OI1A 1XEXA 4DB4A 2DFKB 1WB9A 1GL7A 4MRRA 2F55A 4P33A 1P2SA 2G1JA 2B8TA 3NVAA 3Q85A 4PQFA 4QG7A 5FOWA 3NHBA 1T9HA 5FTLA 1G8YA 1CKEA 2VLIA 5DNYB 3BK7A 3CR8A 1JR3A 4B76A 2JLSA 2H7VA 5K8LA 2W2VA 2ZS8A 4FXPA 1GRNA 1PV4A 5IF9A 3GLGB 4LYJA 2ZRGA 1SHKA 2BV3A 2A5YB 4TMKA 1ELOA 2CDNA 2O8CB 4CVNA 2FA9A 1G3IA 1OHHA 3EPKA 5CK4A 5HE8A 4C0SA 4G3XA 5CM9C 1P2TA 1Z0DA 4XVRA 4RSGA 1N5KA 4NMMA 4A0GA 3I32A 3F5FA 1I4TD 2ATXA 2JLQA 5LDDC 2R8RA 3FHCB 2Z4RA 2F1JA 3SQWA 1GKUB 1ODFA 2DFNA 2D3WA 3LLMA 1GUAA 5BWMA 4RD1A 1T0JB 4LJ9A 1T6NA 1Q1QA 2ANCA 2J0UB 1W46A 2VHUA 3KXKA 2OLKA 2UVQA 1KY2A 4KJZA 2O8FB 3QPWA 2IWHA 3T15A 2YKGA 2Z43A 3A1SA 4B48A 4KFUA 4URVR 2OFXA 1BIFA 1UBGA 1RE0A 5CM8B 4MGZR 3TIFA 4B3DA 5J40A 3WYAA 1CR4A 3A58B 1YR7A 1ZM2A 4PHHA 3SYLA 2OBNA 1L4YA 1E79D 4DLZA 2XB2A 2ZJYA 5H70A 2XSZA 4TYPA 3W34A 4C0BA 1N0UA 4JLOA 3U7FB 1W36C 3KUCA 4C0AC 4Q9JA 4D4JA 1H8HD 3BBPA 1VECA 3THOA 4PC6A 2DBYA 1SKYE 4XH9B 2O8BA 1KO4A 1Q12A 2ZSEA 2IX3A 4ZO4A 5JRJA 2ZETA 1OB5A 3KTAA 4B71A 3EWAA 3G82C 4R9UC 5HCIA 4UJ5A 4YQFA 1Q22A 4I1SA 1KI6B 2ZS9A 4DRZA 4B3GA 4PFSA 4YLGA 3TH5A 1COWA 4TMXA 5EXXA 1C9KA 3KQHA 4C2TA 5FTNA 5BYJA 1JR3E 1ONBA 3BORA 5H8WA 1E2GA 4V0LA 2IYVA 3U6BA 2OFWA 2QG6A 1CR2A 1ETUA 4QRHA 3LBHA 2CCJA 2IA5A 2OCPA 4NDZA 3OE7D 3TAHA 4IXNA 2YWFA 1NVVQ 3LX5A 3K0EA 2IS2A 4NP6A 1M8PA 4QNRA 5J4LA 5JFGA 2ONJA 5EP4A 4IOJA 1S9DA 2DWQA 5EZ6B 5FPYA 4N3NA 1LS6A 2HCJB 2RGNC 4L4UA 1Z83A 1Z3IX 2QT0A 1E2MA 1WF3A 1U8ZA 4ACAA 1PJRA 2BCGY 5JI2E 1DTSA 3DKPA 2VP4A 3QF4A 4LSGA 4AG5A 1FUUA 1S9HA 3T61A 1OIWA 1G7RA 5DIFA 4HLUA 1US8A 3HYTA 4JKIA 4AK9A 3QE0A 3F3YA 4DIDA 4OKSA 1W2HA 3BS4A 4FMDB 4TMVA 2GILA 1NSTA 2IF0A 1G17A 121PA 1II9A 1FUKA 2HF9A 2IYZA 2XNDA 4P4SA 3REGA 3MWKA 3EPLA 1T91A 1JJ7A 1U90A 2PZFA 2PJRA 4I99A 4ZV4A 1YR9A 3A4LA 4KAXA 4G5SA 1GITA 4QXAA 1SHZA 1ZUIA 4OI0A 5E95A 3OFND 2GXSA 3SN6A 1E2QA 5H1YA 1E9AA 3KDSE 5BN5A 1FQJA 3GMTA 1ZRHA 2DR3A 1NP6A 1AQYA 5DH9A 1G7CA 1J8YF 1ZD1A 3CWZA 4OI2A 3ZZTA 6Q21A 1N6IA 1K6MA 2OBMA 5B57C 3J81k 3CUEF 2FPKA 5CDFA 1KKLA 2PJZA 2ZANA 4B47A 2H5EA 2EW1A 4B74A 4LJ8A 1OH8A 5JJKA 4TT3D 821PA 1Q3HA 2ZR7A 3OZXA 3K9GA 2FV8A 2E87A 2AL7A 3GLIB 4Y0AA 1SVKA 2EYQA 4K46A 1XJ0A 2XB4A 3Q3JB 1NIPA 3CX7A 5C4GB 4B2PA 5C46F 3VFDA 4JZKA 4GRAA 2C2HA 2ERYA 4NYMQ 3K0SA 2ZQ5A 1D2NA 4GPTA 4W7SA 3MUFA 4KYUA 1UAAA 1R0XA 3OEEA 4O3MA 3SQXA 4A1FA 2N1BA 4Q1EA 5HTKA 1JJVA 5KOYA 3VNVA 2XJ4A 2WJIA 3SJZA 4QGFA 1PUJA 4RZXA 4ABYA 1KKMA 2OXRA 1VG8A 3A1TA 3PCRB 4Q4HB 3KQLA 2QAGC 2VA8A 4OQFA 4X8LA 2YVUA 3ADDA 1FW6A 1KO8A 1ZD8A 4OQXA 3NWJA 1D9XA 3IQXA 3C5CA 3U3OA 5KU1A 3QSYA 4HUQB 2CCKA 2R6AA 1R8SA 2ZS7A 3IUYA 2J46A 5J5CA 3V00A 1BKDR 4KBFA 1F48A 4G0NA 3FPAA 4QBGB 1UKYA 5SZIA 4XTCS 3RRYA 4B75A 4WAUA 1K8RA 2BHRA 4MYHA 1AKEA 2TMKA 1KDPA 4PPGA 5F2EA 3WXMA 2ZVQX 1KK1A 3GPLA 2ZSBA 2H92A 3KJIA 3DZ8A 1KI8A 1TL7C 3AB3A 2F9MA 2P6NA 3QENA 4G5OA 4EPRA 4ZIRA 2RGDA 3F8TA 2WWFA 1D9ZA 4Q1FA 4DWJA 1X6VA 4C9BA 1KAOA 4MUAA 3UMFA 4RZ3A 4JT2A 5FH9A 5CDFE 3P32A 1G19A 1WA5A 4HB3A 3Q72A 2I1VB 2C77A 5FOVA 1YZQA 3KQNA 1GNQA 1N6HA 5AWFC 3LVQE 3A37A 2GESA 2FGJA 3KQKA 3QVUA 2QGNA 4XWOA 4V0MA 2YC2C 3AVUA 4LC1A 1WBDA 3Q8XB 1YR6A 2FMXA 1NBMA 4Q18A 4UQOA 3EZ2A 4N0EA 3D6TB 3R8CA 1UEIA 1YHNA 5DE3A 1E9EA 3SC3A 1RZ3A 3GJ8A 1T3SA 4LYFA 2IF2A 4ZDWA 1XPOA 1Q1BA 4RD0A 3IQWA 1TF2A 1RRGA 3LQQA 1ZP6A 2AXNA 3GLGA 4TTPA 2PCLA 4XWKA 2V1UA 4Q7JB 3MWJA 4JL6A 2FZ4A 1NSFA 4KO8A 3NKVA 1Z0AA 4TL9A 1KSHA 2AX4A 2FG5A 4WIAA 4FCWA 4JVSB 4IJMA 2CHVA 2GZDA 3R9IA 5FPHA 1W4BA 2FPLA 3EW9A 4CF7A 2OZEA 1CP2A 4BLOA 2DWPA 1OJLA 2F43B 3RS5A 4BFXA 1LTQA 4E5UA 3MMPA 1YR8A 2KSQA 3UG6A 5AUNB 4OHYA 1R2QA 4Q4JB 4DKXA 1SGWA 2IC5A 3WP1B 1OFIA 3U6KA 4BLPA 1KI1A 3LLUA 3WP0A 3OEHA 1ZM4A 2PT5A 4RD4A 4AYWA 4EIWA 5JSZB 4R71A 4GZMA 2C5LA 4V0NA 3FFBA 4FN5A 2XZPA 3PQCA 2WJGA 2WWWA 1ZW6A 3QQ5A 3QKUA 3Q9LA 4PSAA 1ZCAA 3U4QB 4Q7KA 4RFSA 4O2LA 5JI3E 3NBYC 4BWYA 1G3MA 4NONA 1E2PA 4DT1B 4OL0A 1XMJA 2QAGB 4O2RA 3RVBA 3TE6A 3AV0B 2MMCA 1XP8A 4XOIA 1ZUHA 4HLCA 4IOMA 1W4AA 4LBYA 4V0ME 1E4VA 1OXUA 1RRCA 1FP6A 2PZEA 1MOZA 4JLKA 3U3MA 1NBME 1KI6A 2J41A 2R6DA 1XPRA 1IXZA 4QJ3A 1QHNA 2QRZA 2QPAA 2WKRA 1K5GA 3PFIA 4KHZA 2NO6A 2NMVA 1KJYA 3CM0A 1UKVY 2CK3D 2IYWA 2D2EA 3A1WA 3IEUA 3GLGE 5GJBA 1SKQA 2CNWD 4EPVA 1Q21A 2O0HA 1JNYA 4PAOA 3A6PC 2VL7A 2BBSA 1QHYA 1N2CE 1TNDA 5B64A 5E7JA 4RD3A 1W48A 1G6OA 1M2OB 4IEEA 3EZ9A 3Q7QA 4GI7A 3BIFA 4ZKEA 1OYYA 4M0LA 3T1OA 2FPMA 1DADA 4FI3C 3T5GA 2FZLA 2W2TA 4K81B 3WYFA 3QG1A 4L16A 4MRVA 5E4FA 1JQJC 2YV5A 3IHLA 5L3VA 1OXSC 2GXUA 1MO4A 1U81A 2CVFA 4BFVA 3L82B 5JJLA 3OE7A 2GJSA 2J87A 4C0LA 4IDOA 4QHTA 3C8UA 1P62B 3PIRA 1R0YA 5JS7A 3X2SA 4C0KA 1XJQA 5GADl 1NL3A 1M34E 2QM7A 3I8XA 3AVOA 5CB6A 3V4RA 5JLJA 1Z08A 1Z0JA 1ZMXA 3VR2A 2PMDA 2AD5A 5TDHA 3IBGA 2VEDA 1XCMA 3EZFA 1JAHA 3C16C 1GRQA 3H0KA 4JLJA 2BJVA 1X8LA 2WSMA 2DCUA 3TW4A 2WSSA 2ZYVX 4QBIA 4TN1A 1E2LA 2QZ4A 2YWEA 1HH4A 3FMOB 2GXQA 4A36A 2WHXA 2XTZA 3QXJA 4Q1DA 1IN7A 1HEIA 2IUSA 5FUVA 1LB1B 3RRZA 4Q7MB 1W4CA 1MV5A 3DM9B 4R2HA 2F6RA 3ZYCA 1CJKC 4JSTA 2B92A 721PA 1PUIA 4LUCA 2G88A 4PPQA 4D0GA 2GZHA 2D4HA 2NZJA 4JLMA 1QBKC 2DHRA 1SVWA 4F4CA 1X1SA 3DHWC 2RMKA 3IIKA 1HQCA 3GLIA 3BGWA 4DCUA 4O25A 5TB5A 4MYCA 1G64A 4GOXA 5FUWA 3B60A 1JEDA 1CJVC 1G16A 4BFSA 5L8VA 2GCOB 1R7RA 4TT3A 2NPFA 4AI6A 4D4KA 4W9MC 3ZZ0A 2C8VA 3OIUA 1F2TB 4LJ4A 3P4XA 2PL3A 3BH7A 2V6JA 2BM1A 2H16A 1KHTA 1Z8FA 1XCGB 1XU4A 4MKGA 1NJFA 3OIWA 5JZVA 4IDPA 1F6BA 1I4LD 1RYFA 3TR5A 1NN1A 4I1VA 1M7GA 4GL2A 1N6RA 2AK3A 4EQ6A 2D7CA 3ASZA 1VKJA 1NN0A 2H57A 4HUQA 2A9KA 4GT1A 2WWIA 2BDTA 1QZXA 1SZPA 2OLJA 3V4FA 2VHJA 4A15A 4PSKA 1TU3A 3V9PA 1E1QD 2FDCA 4Q4AB 2X1VA 2ZI5A 1BOFA 1IXSB 3ETLA 2GZAA 2ECKA 2ZI4A 3KJEA 2ZRBA 2GVZC 2Q9CA 1Z28A 4QFMA 1C4OA 4OHVA 1M6NA 3CPJB 5FBWB 3SS8A 3QXXA 4B44A 4FWIB 4E03A 2DY1A 5FL3A 1SXJC 2FX3A 4JLAA 2J45A 2FSGA 1KGDA 5FUXA 4EJSB 2OO7A 4HUTA 3H2YA 3QKRA 3VAAA 4Q5IA 2RGNA 1VIAA 1WBBA 3BFVA 1FTNA 4DLYA 3GLHA 3RRMA 4XD7D 1R5NA 2ZE7A 2HLDA 1E0SA 2AD1A 4BPBA 3GLIE 3CH4B 3DMDA 4DLVA 3P20A 4YXWA 1CU1A 3MSXA 4JBWA 4WA7A 2VBCA 3I92A 3P26A 3I3SR 1YZKA 5IDVA 2XJ9A 2REOA 1J2JA 3MCAA 3QPVA 4HZIA 3EZ7A 4URUR 4Q1AA 3VX3A 4ERNA 4C7OB 5LD2C 2ZROA 3QJYA 4AG6A 4XSHA 4JKYA 4LPKA 3QIAA 2E9SA 4EUNA 5LBIA 1BS1A 3LDAA 3NEJA 2ZRPA 4A4DA 5L3SB 5C4MA 3AH8A 1DBSA 3EG5A 2JDIA 1NVVR 3BH6A 3AKEA 3ECCA 2GF9A 1TQDA 1OIXA 3UG7A 3T1VA 3WYGA 2Q9AA 4D82A 3CWQA 1NN5A 4DSNA 3DOFA 4NCIA 2G6BA 1QDEA 3EX7C 1IY2A 2XNSA 2E1RA 1MO3A 1N0WA 2QENA 4FWTA 2C9CA 4Q4JA 5JCPA 4LHZA 1UEJA 1IQPA 1J8MF 2C96A 1P2VA 2YOHA 2REXB 2JCSA 2BMEA 4TTRA 5HE9A 2XX3A 1TQ2A 5CYPA 4PPFA 2GCPA 4G5QA 4DC9A 4DXAA 2RH5A 5ANRB 2A3RA 5FI0B 5KDOA 4D4LA 3T06B 4RKFA 1E2IA 4E07A 2YJTD 1G18A 3GLHE 2CVHA 2QPOA 4LJ6A 4DT1A 1DO2A 2NO0A 1M74A 2HUPA 3BRWD 3AF2A 1XMIA 2QAGA 3ZIAD 4DDVA 3A4NA 5JWHA 1YU9A 2GK7A 3EIHA 4OK3A 3BD9A 3ASYA 5FOSA 1VG9B 2VP0A 2ZU6A 2Z83A 3K0AB 1E0JA 1P9NA 3AM1A 2ZRHA 4KVAA 4R7ZA 4NH0A 2RHDA 3LV8A 4HAYA 5EE5B 3T12A 1SVSA 2FJUA 1SXJD 1KTVA 5AJVB 4HDOB 2VP5A 1XXHB 3VQTA 1SQ5A 4MKIA 1ZVQA 5DYIA 4H1UA 3B13B 4A0RA 1SXJB 2ZRNA 5FBLB 3I4LA 2NG1A 2CK3A 4YMVA 3ZQ6A 4FINA 4MYTA 2WJJA 2AHOA 3KB1A 4NKRA 1J7KA 1P6XA 2ZJAA 1OKKD 3EC2A 2RAPA 5C2JB 2JLZA 3O8RA 1E4YA 3K9NA 3AVXA 4CRWB 2HJVA 3AF1A 4D25A 3PJRA 3FMPB 4RD2A 2ZAMA 5IT5A 2G0NA 1Z2AA 1XD8A 2FU5C 2SHKA 1XPUA 1W0KD 3NIBA 2D7DA 3ZS9A 4LBVA 1IY1A 1G21E 2ZPTX 2PLFA 2ZE5A 5HZKA 1GTVA 3GP8A 2Y8EA 5IHPA 4DSOA 3BE4A 1PLLA 1U0LA 4BQSA 3LO5A 3LW8A 3JVVA 4IXMA 2BOVA 1TUEA 4L9WA 4URWR 4B3FX 1NVUQ 5JEEA 2OESA 4ZKDA 2FEMA 5IRCD 4JVNA 4DUGD 4BECA 3VU9B 3T1TA 2ATVA 3F0TA 2ZYWX 3TBKA 2GEUA 1U9IC 221PA 4PANA 3MD0A 4JT4A 4Q21A 2CL7X 5CLQA 1T8TA 5P21A 5JECA 3RS2A 4NCKA 3JZAA 2KJQA 4F91B 3TW8B 4JBXA 3CNOA 3BFKA 4PQRA 2CEAA 2AFIE 2HF8A 1G8PA 1U0HC 3PUYA 2HEIA 1XTIA 1ZYUA 1G7TA 4DCTA 3PUXA 1FZQA 1OV4A 2GDJA 3JZMA 4IOKA 2BMFA 2R6CA 4NYIQ 5A5GA 1KMHB 4G5GA 3PEYA 4HI0E 3EIEA 2Q3MA 2QTVB 1JI0A 2W0SA 4FMCF 5L3QB 3A4MA 3SBDA 1CBUA 4M1MA 4MRNA 1KYIA 2AN9A 3VR5A 4QM6A 1E9RA 2JA1A 1VHTA 2O0JA 4RJLA 4BLSA 4AKHA 3X1WA 4V0KA 4US2R 1DEKA 4E09A 3NH6A 1S4QA 5FL7D 2KBEA 3H84A 4UNRA 1S0UA 3CRVA 1DAIA 2GCNA 2W83A 2ZRCA 4LC0A 5HPYB 3HDTA 4BZQA 2IYXA 2OCAA 1CJUC 2RGGA 2W6IA 2OE2A 1DAFA 4LYAA 5TV2A 2CLSA 2R44A 3DOEA 1FP7A 2ORWA 3E5HA 4Q4AA 4NE2A 4F38A 1NJGA 4FCVA 2N46A 4YMUA 3MLEA 4KU4A 2NOAA 1UBFA 4B33A 2QMEA 3N70A 1P73A 4GFDA 3RS3A 5CIQA 1YZLA 1B0UA 1QG2A 2ZUCA 3ND8A 4MH0R 1Z22A 4JBYA 5CB8A 3CBQA 3CO5A 1IY0A 2EU8A 3AKYA 2IYLD 1E9CA 1DAMA 2IBMA 4TLBA 4TYWA 5F9FA 3SZRA 2ODEA 3C4JA 4DZZA 3CH5A 2F1RA 1H8EA 3CX8A 4B6FA 3ZS8A 1E0KA 4OHXA 4Q03A 5J47A 3U3RA 2VIIA 1ZNXA 1E9DA 1GVNB 4TYYA 4Q1CA 4IVRA 4P3YA 4K8OA 2FH5B 1IN4A 1L2TA 2NZ8A 4AC9A 4W5JA 4B3XA 1SVIA 2YHSA 4EPXA 4TL8A 1NKSA 3I8SA 1RW4A 3B85A 3A36A 3ZD7A 3NBXX 2ASEA 1DPFA 2WMNB 4B43A 1EFRA 1DAHA 3MWYW 4LHWA 3AVPA 2XGJA 4C7OA 1GFIA 3NH9A 1OF1A 4EFLA 3U2QA 1P3JA 2MSCB 2QMOA 2BVNA 3B9QA 4NYJQ 1KK2A 2XITA 2WMOB 4XSGA 5CK5A 3IIJA 4TSFD 4U00A 4DLSA 1ZAKA 2OFOA 4Q9LA 1E9SA 5DSZA 5KPDA 1KZ7B 3UKDA 3C5HA 4WBSA 2QQEA 2FEOA 1P4SA 2IYRA 1Q44A 3L0OA 3LA6A 4BRWA 4HZUB 1G7SA 1UDXA 2WPDA 2J5XA 4LV6A 2WV9A 4HYYA 2WZQA 3B2EA 4A9AA 1OLOA 1FX0B 2QE7D 3NTUA 3WMGA 4CEIA 5KNDA 1OH6A 1W0JA 1GP2A 2GNOA 1SVMA 1JXOA 2HXYA 2DWOA 3A1UA 1MO5A 4F4JA 3T35A 4XWAA 1F2UB 2WBLC 4HAWA 4LHYA 4QGAA 2R9VA 2WWGA 1XJCA 2IT1A 4TQUS 2GTPA 3LQRA 4NL4H 1OIVA 5FOUA 4AD8A 4YMTA 4W5WA 3I62A 4PPNA 3UPUA 2ORVA 2C78A 3MRSA 1GNPA 5IK2D 2MSEB 4F7WA 2BCJQ 3ZD6A 1R5BA 3E2IA 4HLDA 5FPTA 2OAP1 4X8HA 2BC9A 4JL5A 1W5TA 4NCNA 2EFCB 4NBSA 4KBGA 3RNLA 4HAUA 5JMTA 3K0AA 4FMBB 4CEJB 2GJAA 3SDZA 3S1AB 1A5TA 2ZYTX 1Z2CA 4LJAA 3U7EB 3TGPA 2AFHE 4CYMA 3ZIAA 1JAIA 4AYTA 1Z5ZA 3AKDA 4II7A 3TSOA 4CIDA 1YRAA 2P6UA 4M1OA 1G20E 5EJEA 1XXHA 1RJ9B 4P31A 1ZINA 1VG0B 2J7KA 2JLRA 3QY0A 1XTRA 4A2QA 1HT2E 1Y3AA 3QOFA 3FHTA 3E70C 3VNUA 3AUYA 1P9WA 1SXJA 1D6JA 1DG1G 1NY5A 1XEWX 2EVWX 3ADBA 2XTMA 2O8DB 1GL6A 4QBHA 2FSFA 3AGQA 5TXGA 3N2EA 3CB4A 4URXR 3NDBB 2GAOA 2XZLA 4QKQA 2JASA 2ZRKA 4U5XA 1JXMA 4JS0A 1DAEA 3NHAA 1MH1A 3MJRA 1E96A 3NXSA 2GHIA 3BWDD 5JS8A 5J4YA 3KFXA 2QA5A 1KI2A 5FI1B 1AGPA 4P32A 1A1VA 2QEQA 3X1DA 3R8FA 4JYCA 2XOKD 1G1MA 2G0TA 2IYUA 3SOPA 3UWKA 5B58C 1OKKA 3FKSA 4TL6A 3OIVA 4URYR 1O3YA 2OUKA 4KLNA 4ASUD 1T5IA 3X1YA 4D2IA 1GM5A 3KB2A 1YJ5A 1NVWQ 2J7PD 2XEXA 3AF0A 4MRSA 4R2IA 3VKHA 1YVDA 2OM2A 4D0NA 2PEYA 1KI4A 3RS7A 1ZIPA 4PR0A 3VU9A 4JLVA 3WMEA 4C0HA 4HAZA 2X19A 1GDDA 2P3SA 3G5UA 4MDEA 2F3RA 1E2KA 1KSGA 1E99A 1S1CA 2VPPA 2GEDA 3OESA 2OT3B 5DO9A 1AS0A 5AUOB 2N42A 2W58A 4LRWA 1XF9A 3TR0A 2WOOA 1GOTA 2QT1A 1XXHE 2OHFA 4HDCA 2O8CA 2O8EB 2CJWB 5JBQA 2ZJ5A 3X1XA 3QXCA 2OCYC 3JVUA 5DI3B 1F3OA 3MGCA 3KKOA 4OJKA 1KNQA 1SXJE 4KSBA 2F3TA 2VP2A 1KJWA 3RAPR 3W8RA 5G41A 1Q20A 1VYUA 4TLAA 4RVCA 2C9OA 5CITA 3SI7A 1RRFA 2QL6A 3EPHA 3K70D 1EESA 2V4ZA 5L3QA 3NBZC 421PA 2RGCA 4CT5A 3U60B 1AS3A 3BB1A 4AKGA 2J0UA 4WZ6A 2O8FA 1NMYA 2C98A 4B3CA 1E3MA 1ZBDA 1DE0A 4MRPA 1IXRC 5CJ2A 3K70B 1G8GA 1J70A 1GILA 4DJTA 1UBCA 3HPRA 3TUJC 4JYBA 3M4YA 1WQ1R 3GD7A 3UATA 2JIZD 3TAUA 2RB4A 3TLXA 3MG9A 3NBFA 2KWIA 4CEHB 1UPTA 1HT1E 2IEYA 4WXPA 1KSJA 3SEAA 2HXSA 2L0XA 5TY0A 5KTYA 5FBRB 3ONWA 1WMSA 2R6GA 1OH7A 4PHGA 4Q7LA 3QXSA 4L15A 4E22A 5HKKD 1E79A 3W3AA 1L8QA 5KYKA 2QUZA 4MDFA 1S1MA 2OCBA 4PC1A 3KQUA 1LS1A 4MKFA 1H8HA 5G40A 1PLKA 3KUDA 2ZR0A 1KI7A 3NG1A 4A2PA 3PG5A 5F3WB 3GLFB 3LBNA 1Q1ZA 1T8UA 1ZM7A 1EFCA 2BMJA 2CMKA 3D8BA 4IVQA 4LWZA 4TQAA 1TPZA 4BLQA 2DPXA 1G8FA 2RCNA 4KSCA 4A0FA 3LNCA 4DLTA 2IXFA 2VYFA 3HR8A 2WAYA 3QI2A 1MABB 5JRZA 3AVTA 3EWSA 1Z63A 3WNDA 4EJSC 1T0HB 4C0JA 5BN3A 3CPHA 1LF0A 1E0AA 4KYIB 3VMFA 4HATA 1ZIOA 3LY5A 1A2KC 4QC2A 2CLCX 3UANA 2WIBA 1U9IA 2YOGA 4POAA 1OH5A 4Q9HA 2JLUA 3O8BA 3ICEA 4XVUA 1TMKA 3B1VA 4EFNA 1E1RD 1JR6A 3L0IB 3IHWA 1SVOA 1DG3A 2JLVA 3LD9A 4WOPA 4MQBA 1YZGA 4Z1MD 2AKAB 3KKMA 2F7SA 2EYUA 1AZSC 1QVAA 1FX0A 3PUVA 2QP9X 1EG7A 1S3SA 2YWHA 5FTJA 3IBYA 5KNBA 4MGYR 1A4RA 2CL6X 3GFOA 3UXMA 3WMFA 5J4HA 1NIJA 4LOAA 1P7CA 1TQ4A 3SYNA 3OFNA 5EXSA 2QE7A 4WW0A 4Q00A 5DN6D 3K0CC 4HAVA 2WKPA 1N3BA 1EWQA 2PMKA 3ADKA 2O52A 1LY1A 1C1YA 1OFTA 1QHXA 1JB1A 1JR3D 1KZGB 3QKTA 1SKYB 2D06A 3D31A 3W8NA 3IGFA 1XEXB 1CULC 3DKVA 3LFUA 1E9BA 4GMDA 2HYDA 3R20A 1OHHD 5FR1A 1N6LA 3REFA 2BKUA 3X1ZA 4D26A 3PUZA 1Z6GA 4HAXA 4CEJA 3C14C 4DLXA 1TF7A 2BBOA 1GKYA 2ZE8A 3HJNA 4M9QA 2VRWA 1AM4D 1W5SA 5M04A 1AGRA 1XTQA 2H1LA 2ZRMA 2JLYA 1IM2A 2R6FA 4W5HA 1R8QA 4Q4HA 3AP1A 1KI9A 1KI3A 1XD2B 4Q01A 1P5ZB 3P27A 2FN4A 1AZTA 1EFUA 2WJVA 4LV8B 1QRAA 3FMIA 4I81A 2LCFA 2QN6A 5JWRA 3CF6R 4N0DA 3FWYA 5E3HA 3L0SA 4G1UC 4PO1A 1XRJA 4IVPA 4BE7B 2A7QA 2BWJA 1Z6TA 1NN3A 4BRUA 2XSZD 1IJEA 1VCOA 3OIYA 4P4TA 1AA9A 3CLVA 3KXIA 2QROA 4Q9IA 1NLFA 4ZI3A 1X8KA 3A8TA 2ZVPX 2RHMA 3CPEA 4LHVA 4LJ5A 2QSZA 3MWLA 2AWOA 2W6JD 4Q1BA 5KUTA 3TK1A 1COWD 2QGZA 3FGNA 2H18A 3PEWA 1GZSA 1HA3A 1UM8A 3U44B 5EE0A 1OFHA 3W3ZB 2ORIA 2O8BB 1J99A 2JJ1D 1R5OA 1E6CA 1VPLA 1CIPA 1X1RA 2AK2A 2XOKA 4QNMA 5DI9A 3ICQB 3KTAB 2QP4A 1AIPA 2VP6A 1WXQA 1CLUA 3Q7PA 1W49A 5SZJA 3B1ZA 3GFTA 5H68A 3LXRA 2V6IA 2J7PA 4JMPA 2QI9C 5BN4A 2ZTSA 3RWMB 1F5NA 1KDTA 2ZEJA 4QGGA 3B8HA 4EAQA 2BBWA 1XFAA 2ODBA 3EC1A 4LV5B 3PXGA 3RSOA 2C04A 2IW3A 3GEEA 2VHQA 5B2ZA 5CIWA 3SJCA 1ZM9A 5DI3A 1XBTA 3RWOA 4CZ2A 3CZPA 1TF5A 2VSXA 5AJZA 4M1SA 4BLTA 3KKQA 1GIAA 2IUUA 3KFVA 3B1WA 2F43A 3E1SA 3WRYC 1RC8A 4BEBA 4H9GA 1EFTA 2FFHA 2QM8A 4XVQA 3T1QA 4GZLA 3QF4B 2ZI6A 1II0A 2XNDD 2OV2A 2W2XA 2YNMA 1U98A 1G291 4U7DA 2A30A 1N0VC 1US8B 4LY6A 2KI5A 1AKYA 4LGMA 1MO6A 2BIFA 2CHGA 5JSZA 5BW8A 5FOXA 4OHZA 2X2EA 2YWGA 3RDPA 2ZU0C 3SR0A 2ZAOA 3HYRA 4P4SB 2EFEB 4J0QA 3DEFA 2WOJA 4TMTA 3DMNA 3U4QA 3THYB 2J9RA 4L9SA 1FOEB 1NF3A 5TARA 4A8JC 4GP6A 1HUQA 2I3BA 4EKDA 4ZCIA 4LHXA 1FNNA 3L2OB 2VSFA 1II8B 1YQTA 4QL3A 3IKJA 4RKEA 4PZZA 3SBEA 4BZXA 1LVGA 2JIZA 3U7HB 4WZAE 5FFMA 4ARZB 2OG2A 4FD2A 4JJKA 3VHLB 2HCBA 2GK6A 3D3QA 5BQ5A 3WY9A 521PA 4BFUA 3Q5DA 4JVMA 4ACBA 4ZI2A 2QRNA 1X8JA 1PLJA 1E2HA 3AP2A 4D6PA 4FIDA 3R7WB 4JJZA 4BFWA 3HU1A 3GEHA 2LWIA 3L8YA 2FSIA 4BASA 3GLFA 5HKKA 2BJWA 5KSYA 1E98A 1ZU4A 2CCGA 1VCMA 4OBEA 2PX0A 1HE1C 4PX9A 4B2LA 1L4UA 5CLLA 1T3LA 4M22A 4NYMR 1QG4A 5K8IA 5A4JA 4AURA 4CDGA 3TVDA 2HT1A 2BEKA 2GEVA 2CNWA 3H1TA 4A2WA 1S2MA 4MGKR 4P4UA 1DARA 3L8ZA 4QOSA 2PEZA 1RIFA 4LJ7A 3N5CA 5DLQC 3AF3A 5EXPA 3FOZA 4ZCMA 2Q3HA 3B5JA 3U7GA 1KAGA 3WHLA 2JLXA 2KE5A 2ZJ8A 1CEEA 3FB4A 4OI4A 1E2DA 2IS1A 2WAXA 2WIAA 2VF7A 1A7JA 2ZSDA 3W6NA 1VCNA 4GOJA 3TSZA 2QBYB 2WVJA 5EZ5A 1OSNA 4M21A 1G5RA 1N5LA 4AIIA 3LBIA 2ZI7A 2HJGA 3TQFA 1X3SA 5AUPB 2HYIC 2PZGA 3K0FB 4EFMA 1E2NA 2P65A 3KX2A 2JLWA 2GJKA 2OEPA 1KJZA 2BEJA 2F1IA 4Q02A 3VR4A 4ESVA 4RFVA 2V7QD 1BYIA 5AK0A 3G0HA 2FNAA 3R9WA 3L43A 5GJCA 3IPYA 4Q66C 1B23P 1N6KA 1V43A 2GBLC 1CJMA 1G6HA 3EXAA 3FTQA 3GLFE 2QORA 4UKDA 4MYUA 3ZJYA 4O0MA 1P2UA 1IAQA 2PCJA 1LFDB 2CLDX 1E69A 5SZHB 1W44A 1OE0A 2YOFA 5JHGB 2XAUA 1DS6A 2V1XA 1G5TA 1XEWY 4ON9A 1FNMA 5DN6A 621PA 2GF0A 3RSLA 2GCOA 1T3HA 3CF0A 2NPIA 3GCGA 1HTWA 1XD9A 2FSHA 3WHKA 4A8JB 1F2TA 1IONA 3H4MA 2FFBA 4FMCB 3HPQA 3LX8A 3WBKA 3IEVA 1YKSA 5EQTA 3PVSA 4DDTA 2NQ2C 1OB2A 4NU0A 3ADCA 3C41J 3TVTA 1AQUA 1XD2A 2YC4C 5KSPA 2VHCA 2FFAA 3M1IA 1CJTC 4V0OA 4BFYA 1ZNZA 1W7AA 3OEHD 2IXEA 3N2IA 4RCZA 1XNJA 4GMXA 4TMZA 4A6PA 4IDQA 4M1TA 4YDSA 1JBKA 5EUQB 3TKLA 4DCSA 4OK5A 1M7BA 2P2LA 3HWSA 1I2MA 1NMXA 3CZQA 1FMJA 3DDCA 1U2RA 3O47A 1VTKA 3T34A 1Q0UA 1ZC4A 3B6EA 4HSEA 1S8FA 2D2FA 3CRMA 3CRRA 2G3YA 4QM7A 3CF2A 1QF9A 1N6PA 2VH5R 2G9NA 3HR7A 4OQLA 3UK6A 4G01B 2AKYA 4Z8YA 2ZIAA 4GBMA 1G5PA 4OK6A 1E1QA 1ESNA 1KMQA 3ZVRA 1YZUA 3BOSA 4DCVA 3B82A 5EP2A 1OPXA 4US0R 4RFSB 2NIPA 4EJSA 3M0EA 1S3GA 1MRSA 3RANA 1ZJ6A 2V55B 3TNFA 4OQNA 2EWWA 3OAAD 2AXPA 1Y63A 1VMAA 1YZNA 2ZI3A 3U44A 1A2BA 3NDPA 1ZM3A 3THXB 3THWB 3LH5A 5BYKA 3OHMA 4Q4LA 4AKIA 4IHQA 4IFEA 2WJYA 4S2EA 1IHUA 4CGZA 1BH2A 4BEJA 1YZTA 2W6JA 1PZNA 3CONA 4UNSA 3GQBA 2ONKA 3FYHA 1YE8A 1H65A 4PZLA 1G3QA 4XD7A 4ZPXA 1GKIA 1Q57A 5EP3A 3LW7A 1Q1EA 1ZD9A 4PHTA 2PBRA 4FCTA 2JEOA 2GJ8A 2JJ1A 3KJHA 4Q9KA 5F98A 4B2IA 5L3RA 4BFTA 3PR1A 3PEUA 1BMFD 2EQBA 3DZDA 2FGKA 3BH0A 3HP1A 3EA0A 1LNZA 3SU8A 3EA5A 2QTHA 2GAAA 5L3SA 2P5SA 3W9YA 5AJXA 2X2FA 4KITB 1NLZA 4RZ2A 4YMSA 2BKEA 3SJAA 4I4LA 1RYHA 1XDBA 5FPSA 2PX3A 3K0CA 4R98A 3RS4A 1QHHB 1CR0A 1N5IA 4MKHA 2I4IA 4OQMA 1N25A 2ODNA 4FMDF 1P72A 4M4SA 1V5WA 1E2FA 1XX6A 4UNPA 4LYHA 1TX4B 1IBRA 1FPMA 2BM0A 2DFTA 2CBZA 2WSSD 4BZPA 4DLRA 1QHIA 3WBJA 4C30A 4RCYA 3RC3A 5HCNA 3W5JA 4EPWA 4HB2A 3VHXA 3QVVA 2O0KA 2QMHA 3LRPA 2IK8A 2ZJBA 2VF8A 3CRQA 2RGAA 4JLDA 3THYA 1CXZA 3UIEA 3CNNA 2FWRA 3MFYA 4KVGA 2WWXA 3DM5A 1II8A 5C1BA 1PVOA 5C18A 2K5UA 2YYZA 1XTKA 4DCNA 4JLBA 4ARZA 1LV7A 3K70C 1EXMA 3B1XA 1MR3F 2Q0HA 2B21A 3P1JA 3I5XA 3EPJA 1VCIA 5E7IA 3DL0A 1IN8A 4KFTA 5DHAA 3R7WA 4UXIA 4Z54A 4A6XA 4M1WA 4TLCA 1W36D 1KY3A 4XJXA 1MKYA 3QXHA 5J4VA 3SHFA 4Q19A 2ZRDA 2EFDB 3QKSB 2RGEA 3CNLA 1R6BX 1JEEA 1CR1A 2GVDC 4EPTA 3K09C 1N6OA 4UXHA 4PQYA 1XMVA 2WM9B 4S35A 2IL1A 5FR2A 4ZDKA 2Q9BA 4IW3B 4YMWA 1SVLA 3GJ3A 3TRFA 3PEVA 1W36B 4M9XA 4DSTA 5JJIA 1Z6AA 2RGXA 1T4GA 1TEVA 4C3ZA 2Q6TA 3GJ6A 1KDRA 2EWVA 1O87A 3CRW1 1IN6A 2DYKA 3TJZA 1OXVA 1JQLB 2J3EA 5EE9A 5HZHA 4EDHA 3BJIC 2P5TB 3QEOA 2W0MA 4LK2A 4EQ6B 3IO5A 2QAJA 1GAJA 1G4UR 5CJPA 2QBYA 5KO2A 3AQ4A 4HEJA 5D3MB 1CF4A 1F60A 3O8DA 3GJ5A 2B7BA 4V03A 4B73A 1Z6YA 1P75A 5D3QA 2V3CC 5G53C 1OYWA 1Z06A 1TU4A 2RKOA 3EIQA 1UF9A 3GJ4A 3I1FA 3DVLA 1W0KA 4DB2A 4GDFA 1UBEA 4CT4B 2ZJZA 3K0FA 4JLPA 2HLDD 3U5ZB 4PAQA 3DO6A 3IO3A 5B30A 2GETA 2V9PA 3QKRB 2P6RA 4YXWD 1RKBA 1Z6XA 2W00A 1E94E 3CW2A 2D62A 3PUWA 4HB4A 3GLHB 4DUGA 2IUTA 4QHSA 3SFZA 1EX6A 1TEXA 1G3UA 1Z29A 2QP3A 3TMKA 4PO9A 4LX0A 2IS4A 3RS0A 2ZSFA 4G5RA 2V7QA 3R9XA 1NLYA 4I1UA 2I1QA 4JLNA 4TWZA 4M9ZA 3AVVA 4DHEA 1I4DD 4LCBA 4TL7A 1KMHA 2LKDA 1HQYE 2QPTA 5KSOA 2R65A 1FMLA 2OAQ1 1W1WA 3VR6A 1M1YE 2VQSA 3FFAA 2JDID 2ZE6A 5TMPA 2UZ3A 2IYSA 3EASA 2JJ2D 1ZU5A 4A8JA 3BB3A 2C9YA 2IWRA 1HURA 4QJ4A 5AR1A 3VR1A 3VTKA 2CE7A 5AUQA 4UXJA 1VDZA 1Z07A 3ZGXA 1G4AE 3SFVA 3TUZC 1VHLA 3QUSA 1TQ6A 2IEZA 3H86A 5HR5A 2V8OA 3AEZA 3D7MA 3I5YA 3LWNA 4AKEA 4BGDA 2ZUDA 1W2GA 3KZ1E 3OF5A 4TYQA 5CYOA 5GVSA 2XXAB 4Q47A 4A92A 4GOKA 3ZZUA 3FKQA 4NPHA 2KB0A 3C7KA 4PC3A 5FL7A 2NO9A 5K8UA 1RRPA 3WNBA 4KLZA 1ZCBA 5EXTA 2ODWA 4C2UA 1NI3A 3QF7A 1GL9B 3QNUA 8OHMA 4TYNA 1XZPA 5E7MA 1NKTA 2VP9A 4CW7A 3I73A 3CKLA 3ZH9B 2UKDA 1VIYA 2XTNA 3T5DA 4BUJA 2KBFA 1RPZA 1XEFA 2IXGA 3CR7A 1AJEA 1FTSA 4DLWA 4PC2A 2A78A 2AR7A 2EFHB 4PC7A 3THXA 2GRJA 2A5JA 5EP1A 3THWA 2WTUA 3UMSA 1XZQA 5FBQB
chains in the Genus database with same CATH superfamily
3L7BA 3B6IA 4LPSA 2QUBA 5FEUA 3GH3A 2BMDA 2VFAA 3C7TA 1SHLA 3I45A 4OKNA 1BE0A 3URMA 5AOVA 5LNK1 4IINA 1VBFA 1GSIA 3AONB 4C2BA 3JPWA 4HNAB 1S2GA 1OX5A 2AH5A 3SNHA 3NVKI 1N2IA 4ILEA 4F92B 1BN7A 1VC2A 1V1RA 4Z7NB 1YRBA 4D8UA 3HSSA 5KVSA 4HGYA 2IDJA 2VO1A 1MC4A 4PZYA 4BO7A 2RBEA 3JWEA 2JRLA 4KBYA 1EFHA 4H1VA 1F8XA 4JD5A 3RB8A 2G5GX 3DKKA 1QV7A 1AN0A 4MA4A 2IEBA 1ANKA 2Z57A 2EZUA 1YUBA 3SJUA 4RF3A 4BYMA 2BBTA 3LCVB 2QRQA 2IYTA 2WUDA 5MDHA 4YLYA 1E2JA 5BQOA 2A58A 2QTFA 3DPIA 3V7FA 1T0UA 1UXGA 1CQIB 3EYAA 3PDCA 4EARA 4RPKA 3LC7O 3PENA 1SK8A 1X7HA 4Q48A 2I54A 2PKXA 5IS2A 2B8NA 1YBHA 4TSFA 4A82A 4DCPA 4XM0A 2C5BA 1XDDA 3G0CA 2QLJA 3VGPA 4JI4B 1YNOA 4XYBA 4ER3A 2WIDA 4OYHA 2ID4A 1F2UA 4Q7EA 2XMRA 5J4KA 1TUIA 2IHTA 1Q7CA 1WP9A 1K6EA 2G77B 1C4KA 2G04A 3CCFA 3DEZA 3NC0C 4O4JA 4D0LB 4OXRA 1B6RA 5JYBA 3FOAA 5IJ9B 4YP9A 1W4RA 4OMUA 4TQGA 1MX3A 4XJSA 1LK0A 1IK4A 3ZQJA 2GKOA 3E5NA 3HGMA 2HRCA 2MSNA 3PFCA 4ZCQA 2V9ZA 4BWVA 4TKUB 3WQQA 3PKZA 4C0QC 1UJMA 2B1JA 5J23A 3KWFA 5A9RA 1RXWA 1N5JA 3LYUA 4GPIB 4KDFA 4P9NA 4D9HA 1SA0A 3DBRB 2WUVA 3STHA 3HY4A 1BFKA 2FMIA 3IXQA 3K94A 3VR4H 1MOSA 4DZTA 1WCXA 2EFYA 2VDOB 4RC9A 2XZOA 1WZ2A 2P3LA 4PW0A 4ZWNA 1DGQA 1KDOA 3OWHA 4F85A 4MI9A 4BO9A 4QEZA 4U7PB 4BLRA 3JASA 2P7IA 3WL8A 1P0IA 3O75A 3QEJA 4GZ6A 4QHYA 4OKIA 2QTLA 1KDYA 3VO1A 2VQ6A 1RJ9A 2WMYA 3FCAA 2G1KA 2ERCA 4AJ9A 4XWYA 1V6SA 1P0QA 3IELA 3QKSA 4TS9A 2OXCA 5TMBA 3TEFA 4NYIR 4B0PA 5AJWA 2APJA 5C5IA 5EXEA 3NEPX 3E3AA 2RG7A 3O8QA 2OZVA 4RD6A 5FOQA 4LNUB 3OQMA 4UBOA 4S1TA 3MLAA 3QY9A 3SNKA 3TTWA 2CFRA 2XUGA 4LXYA 5FTKA 3EJ6A 5G3YA 2YXDA 5EJ5A 3RSZA 1TCBA 2OORC 2ZBGA 2FWBA 2QTMA 2W6ID 3VPGA 3OPXA 4B3BA 4IIVA 3ESBA 1G3RA 1M9NA 3B9PA 4RORA 1CZLA 5KSZA 4QJ5A 1MHPA 1MQ8B 4M3NA 5B3JA 4E07A 3EIFA 2G36A 3Q8KA 2WE7A 2ZBQA 3EEIA 3Q9NA 5IMBA 3WAGA 2CHQA 3UUEA 3H5RA 1WQ3A 1JALA 3F6EX 1TEHA 4BVHA 5CXUA 2WHPA 1A9TA 1YC2A 5AIBA 1YULA 1WVGA 4IQ0A 2J0SA 2PO5A 1GQQA 3QPUA 1Z47A 4WQMA 3WLLA 2DG2A 4GNKA 3AR8A 4US1R 3JQAD 4WESB 1ZOIA 1L5OA 5HCUA 3C15C 3GDHA 3K9WA 1GNSA 4DQDA 2C20A 5LWQA 1E32A 3WK4A 4DS3A 1IOZA 4PGMA 1L5ZA 1SK9A 4RDHA 4AJPA 4NU6A 5REQB 5H7XA 4F1JA 4F6RB 5EIBC 1U9YA 1A2OA 2HLHA 1ZW1A 5CR9A 4X8MA 3VZBA 5CB0A 4H7PA 4UHHA 2COEA 4WBXC 2C5HA 3E4CA 5E2IA 2WV7A 2PT6A 4E13A 1VSTA 4WVFA 3AI1A 1DDOA 2I6SA 3ZI7A 2H7YA 2JGEA 5FTWA 8AT1A 3K53A 5U1PA 3MMZA 4JBHA 1NU8A 5KYWA 3H5AA 4LIPD 3PITA 3SXUA 4LSWA 3N07A 5NULA 2YH2A 5FLKA 2VDWA 1N8SA 1QYIA 2QWXA 4XWWA 5DM4A 1U0JA 4PBRA 2JAQA 1EFRD 2DQZA 1ZOOA 2OILA 2ZYGA 3SEZA 3UY4A 4WEQA 4A0HA 1A1SA 1RI1A 3JY6A 4YV7A 1EEHA 4I9HA 1FY2A 3H87A 3R6LA 2BGKA 3DDSA 3IQHX 3OLQA 4IP0A 4WDRA 2E5LB 4DSOA 1GO2A 3WLAA 1ORWA 2J59A 3H1BA 3PHJA 5G1OA 4B8ZA 2ZSUA 3FZGA 1NV8A 1VL1A 1XB2A 3G0IA 2ZRLA 4CV0A 3EZXA 4F93B 3B7WA 5AXBA 4F3TA 4R05A 1K6JA 2Z2ZA 3HBMA 1LBIA 2ZI9A 3ND9A 4GSYA 2B7CA 1W5AA 4N18A 1RFLA 1KHHA 3VC7A 3Q1KA 1B15A 4GX2A 2R00C 1ISPA 1KSFX 3IAEA 5AKIA 5HQTA 1DELA 4AUEA 1G8JA 1AGXA 2WPDD 2FLVA 3VR3A 2X9NA 3ZWYA 3HU3A 5B7PA 1S2DA 3S8EA 4HDQB 2JC3A 3P4YA 2VF2A 1LBTA 1XGKA 1DVRA 1UJ2A 2UZIR 4DMMA 1NBHA 3OCXA 4WXRA 1R00A 3WHPA 4Z7JA 1JIQA 1L1FA 5KYXB 2BEVA 1W9MA 3N2GB 3U48A 4BKOA 3HFRA 3DKRA 1FL9A 1Z68A 2CUKA 4TVKA 1GGMA 3D2AA 3EBOA 3I64A 3L06A 5TS3A 1EX9A 2QM0A 4DDWA 2Y68A 2DBVO 3KJGA 2HIHA 1KO1A 3M6UA 2ZM5A 4KG7A 2X8LA 4FYPA 4ZJUA 4EABA 5BSHA 4J43A 3AUSA 1GT91 5JD3A 2VF5X 1BMTA 2WP0A 2QRVB 4XLZA 4U02A 1UKEA 5CA0F 3K1JA 3VX4A 4IMPA 1EJ0A 1SNYA 2XVAA 3C3MA 4PSDA 4YH1A 2OGWA 2ZIEA 3CXUA 1SG6A 2AOUA 4URZR 2NTYC 4RANA 4BZZA 2FOLA 5EIXA 2HWUA 4FFDA 3RYTC 2FFQA 4N1AA 3RABA 1RYNA 3OX1A 3L0PA 4CUZA 4CIWA 2HDNB 1M83A 1DAGA 3SYRA 3M8KA 2Q2OA 4NWIA 5B4VA 5BXQC 1AS2A 3B1FA 4KFSA 4ZYLA 2VYQA 3PJDA 2A4KA 2PLRA 3V4SA 1L7AA 1E61A 4GP7A 1VMKA 2VT3A 5C5CA 4AM8A 3CLUC 2VK1A 3MUEA 4X00A 3ZQ4A 2FR0A 2F3SA 2IITA 4JVLA 4YCAA 1JP7A 5HYVA 2JNWA 5JARA 1H93A 1XROA 3FRJA 3NONA 3QBVA 1NRJB 5ERGB 4S0ZA 1DV1A 1QHGA 2Y4NA 4YDHB 3TDMA 1MZPA 1L8LA 1V3QE 1W73A 4B32A 4EYSA 1ZI6A 4FKMA 1QBGA 3FZQA 3JRWA 5IZCC 3OF2A 1PS0A 2ZXUA 4DR5B 2A2ZA 3GG9A 4B3MB 5T41A 3N7UA 5C8YB 2QR5A 1RS0A 5IP5A 3FOEC 2C92A 2WTMA 1VYHA 1GAQA 2C7OA 1EVIA 1KAMA 1HT0A 3BEDA 4L0DA 3GJ0A 4C4PA 1RC0A 1Z0IA 4DUZB 5K0GA 5D5HA 3RV4A 2Q3LA 4JR1A 1FFXB 3HCRA 4K88A 3TQCA 3U1TA 3FZYA 8ADHA 3DHYA 3B6JA 3G2MA 4ZCLA 1DRWA 3V5NA 5H02A 3FIJA 5B4UA 4EB6B 4KV9A 1ESDA 4UPEA 5C8XA 3F49S 1SC1A 1U3UA 1CUWA 2DERA 1WULS 2KHZA 4RHUA 1WCV1 2P8JA 2H4XA 2VJPA 3EARA 4MUBA 1L7VC 2FP4A 1NMZA 2NZUG 5IN4A 2PXAA 1M6VA 1GHTA 1NFFA 4CG1A 3GGCA 2XNCA 3K9LA 1T9DA 3OIGA 4D80A 3DH0A 4C1NA 4M8SA 3SKXA 5ICSA 3PZBA 1PU2A 4RY2A 3GRPA 1ZGCA 4DIUA 5JAIA 2FYTA 2XE6A 3FCCA 4LBWA 1BWRA 1IQUA 2A86A 1R4NB 4P58A 3EHDA 2ALJA 5DYGA 2A14A 3NAQA 2HV9A 1ZL2A 4GO1A 4KQMA 2OHJA 5IW8A 2JJ8A 2WU4A 4HX9A 1VXOA 1Q0RA 3H9QA 4TZTA 1YJCA 3H5VA 4OQQA 5ALUA 3PFWO 4XPZA 3W2IA 1GL7A 4MRRA 1W93A 4P33A 5BW4A 4QG7A 2B8TA 1I36A 1ZICA 2EFJA 5E8JA 2NN3C 3FMGA 5LWHA 5FTLA 1CKEA 1D6NA 2ZB2A 3KZMA 3PPYA 5TPZA 3E3NA 1JR3A 1E1YA 2JLSA 3ESRA 2ZS8A 5M2QA 1Q0LA 2ZUSA 4I6EA 4LYJA 1NM5C 1DCTA 5GONB 2CDNA 3BM5A 2YZMA 3ECAA 4B6JA 1WVMA 3EPKA 1N2CB 4KPUA 2C4UA 1U3DA 4KV7A 1OZGA 1P2TA 3BIWA 4XVRA 5CM9C 3SEFA 1OAOA 1UBOS 3LC1O 3F6RA 1USIA 1I4TD 1JQBA 3DEJA 2C5EA 3KPVA 1HQKA 2VTDA 5LDDC 1LA2A 2DT5A 1X1TA 3FHCB 5ECDA 1EUQA 1TO2E 2NO4A 4Q15A 3SQWA 4AMUA 1GKUB 1Q2UA 2V9CA 3LLMA 1E5TA 3Q3CA 4NMHA 4RD1A 4RNDB 3CRZA 4LJ9A 3D2BA 1C1XA 1SXHA 3ENWA 4LGVA 4E2FA 2ANCA 2J0UB 1W46A 2QLMA 2AG8A 3KXKA 2UVQA 4KJZA 1HX7A 3QPWA 2EF1A 3DCNA 5EFZA 2VXCA 4U7TB 4B48A 3ITEA 1BIFA 1RE0A 5CM8B 4B3DA 4DWWA 3HWRA 3WYAA 1SPXA 1CR4A 5D6NA 3A58B 1Y6ZA 4ZMRA 1WR8A 2C4TA 3DMYA 3NCTA 1KC3A 1M3SA 2QSJA 2ODTX 3SYLA 4UHDA 4G8DA 3B8EA 4NOLA 3A04A 5ENDA 4ND8B 5HF9A 3F5DA 1W36C 1N0UA 5KJEA 1E1KA 2BP7A 4WCVA 2ILVA 1C30A 1UZMA 1ZMOA 2Q07A 3EFOA 3SLRA 3AL3A 4UOZA 4D4JA 4U9UA 4Q9JA 1SRRA 3TIVA 3BBPA 1K5HA 2ZIXA 3VVCA 3DFIA 2KS6A 5MGBA 5DNUA 5AVJA 5C3MA 1KO4A 3ABOB 2Y1XA 1GGKA 3NT2A 1E4EB 1JG3A 3EWAA 5HCIA 1XKQA 4I1SA 1EUCB 1FQWA 2P4HX 4HHEA 4B3GA 4L1KA 3IV6A 1U1DA 4YLGA 3TH5A 3W3AH 4F4UA 5L7WA 4JENA 2DY0A 3FGPA 3DV0A 3HCCA 3OMXA 3QKSB 4LY0A 1JR3E 1OLSB 4X1IB 3WGGA 3ZWOA 1WPRA 2PPLA 1EE9A 1FTWA 2Z56A 1PP4A 1T1IA 4WJLA 1E2GA 1GXSA 2O5EA 4P2GA 2NP6A 1N3IA 2BZGA 4NF2A 6LDHA 2MYUA 2Q6KA 4OIMA 2OFWA 1PWEA 3S55A 2CCJA 3IUBA 1LSSA 4RZSA 4YUAA 1ZWLA 4UAGA 4FSDA 4NDZA 1GSOA 1U3FA 3VNRA 1E62A 2CHUA 1RAAA 1J0DA 3AEYA 4EJ6A 2XA2A 4NP6A 5JZMA 3MT9A 3T4EA 4BNJA 4EKGA 3H2JA 1U6KA 1M8KA 4D56A 2ONJA 4GPZA 1DCKA 2JIRA 1GN8A 3IR7A 4YVFA 5I8PA 4BNXA 3MWGA 1S9DA 2RONA 4GVPA 4HS9A 5DOZA 1BVRA 5EZ6B 1VE1A 3K73O 1AB5A 1LS6A 2HCJB 2RGNC 1Z83A 1Z3IX 4LQ4A 5EUCA 1ESEA 1KP9A 3TD6A 2ZAIA 2NPOA 2YMQA 1U4NA 2VP4A 1JF8A 3QF4A 4QXQA 2PSHA 2BGJA 3SQOA 5GZ6A 1EP2B 4HT3B 1S9HA 5COQA 1G7RA 3COYA 4QECA 5A9SA 4AK9A 1EQ2A 1W88A 1IHPA 3G5MA 1RZUA 2OD2A 4Q9AA 3ZV6A 2I2DA 4FMDB 3RVPA 5DTEA 4Z1MD 1U7TA 4KXQA 1K3TA 1TMYA 1CB7A 4LAFA 1Y4AE 2GD1O 3L7LA 2WMDA 4UHEA 3UICA 4I2VA 1I6LA 2UZAA 4EY8A 3UEOA 2PZFA 1JDNA 3TQOA 3RC9A 4ZN6A 4KAXA 1GITA 2AQIA 1SHZA 1JTFA 1G8KA 1ZUIA 1Y80A 3IMCA 2GXSA 2XMGA 1XVTA 2B5VA 5BR8B 3J7TA 1AKVA 2WF9A 5H1YA 3SR3A 1Y8QB 4PF1A 1C0KA 3H83A 1DJLA 3GMTA 1G63A 2HCFA 3KEMA 1QH0A 3W5CA 2AI2A 3R9KA 3RC2A 4YDQA 1QJCA 4XDGA 1E5LA 3BAZA 3NEAA 3SZ3A 4F04A 5B57C 5LMNB 3A9VA 4XUEA 1KKLA 1RBYA 4G56A 4H16A 4BNDA 4EUKA 3U56A 1XZEA 4D9GA 2ZANA 3H2HA 2FKNA 2EW1A 2H5EA 3FHJA 4RV4A 4TT3D 1NQVA 4GM4A 1SELA 3V8EA 3ZZNA 821PA 2FW7A 3MN1A 4CL2A 1JU9A 2E87A 2FV8A 1CUVA 3PUIA 1YASA 4Q6BA 1XJ0A 2B2XA 3Q3JB 3FIUA 1CUEA 1UBNA 1YMUA 2JCXA 4UEQA 4UCXA 4EHHA 4KPFC 3ZE9A 1DEXA 1UPAA 2ABWA 5FQOA 3PQ4A 4H7JA 3ZHXA 5E9JA 1LX7A 4MHSA 1QP4A 5FQNA 5HW0A 1A27A 3NDRA 4TV8B 5BSTA 1R0XA 3OEEA 4O3MA 1HDEA 4A1FA 1U5BB 5HTKA 1JJVA 3QVGB 5KOYA 1NOIA 3MB8A 3VNVA 5AM1A 1YRWA 2H9IA 1QH1A 4QGFA 1ZR4A 4ABYA 1ZHHA 1KKMA 3QW4B 4BAGA 3A1TA 1VG8A 4BBZA 1MJ5A 2OGSA 5DXAA 4KE9A 3GUYA 4F06A 1KO8A 1ZD8A 1TYAE 4HDRA 5CNJA 3VDRA 1FP4A 4TVBA 4ZI5A 4Z4FA 4DA6A 3QSYA 1UFKA 2VS1A 2CCKA 1R8SA 2BELA 3VSDA 5K0NA 3RVOA 1YB2A 1RQXA 1F48A 2EIXA 4FQ5A 3FPAA 3PNPA 4QBGB 1VI2A 4YJ3B 3TNLA 1Q50A 4ESOA 4O6VA 4B75A 2Q5IA 3LGXA 4HO1X 3WE7A 1PZGA 1A5ZA 2BHRA 4INJA 5EZYA 1UP7A 4MYHA 5KYVA 4LN1A 1VE3A 1TIBA 3MGKA 1VKHA 2ZSBA 3L5KA 3GJSA 1QOQB 2BFEA 2RGDA 4E3WA 4Q1FA 1D9ZA 3FWHA 4JXZA 2QG9A 2UVDA 4GOMD 1Q0HA 4RK7A 2Q5LA 5FP0A 4RZ3A 3UMFA 5FH9A 3KAJA 3SHTA 4CKEB 4QASA 5JUWA 1G19A 1PL7A 1M5UA 2X4GA 1SVUA 4UTZA 4ZEMA 1KRHA 1IOWA 1UP4A 4BP9A 1RHJA 3ME5A 4BQFA 5PGMA 4GEKA 3W4IA 3RBZA 4R1PA 1EK1A 4BGUA 2WRZA 1EM6A 1HF3A 1XA4A 2Z98A 3ET4A 1ZQ1A 3FRIA 3KQNA 1TT5B 3BGDA 5AWFC 3LVQE 4GPAA 2GESA 2TMYA 3EF0A 2FGJA 2G40A 2XE7A 4JITA 1P29A 3ZE7A 3RSSA 2G63A 2C54A 2FWIA 4V0MA 4CTMA 5ALVA 2Q4TA 3OLCX 3AVUA 2CDCA 2P5UA 4LC1A 4IUDS 4DDKA 4PN3A 4JC0A 4XPIB 1WKCA 1IG3A 2H4HA 4JJ7A 2FMXA 2R1UA 3GEGA 4FK8A 4Z9BA 1QORA 3M4XA 4N0EA 1JHMA 5FA6A 4HVTA 5DE3A 4AMVA 1RZ3A 1KC1A 2ZB8A 5LZ2A 1O95A 1TLTA 1ZA2A 4NENA 4NU8X 1RRGA 4ZYVA 1ZP6A 2V1UA 1BHSA 4NFHA 4F1WA 4XWKA 1ILEA 2V0GA 1NV9A 3T8YA 4DSZA 4KO8A 4L6IA 5JSQA 1XKTA 2B4TO 4P54A 3OOHA 5DGIA 3PX7A 2AX4A 4MPJA 4WFJA 1NHGA 4L4RA 3R9IA 3V4VB 4MTLA 1ZA1A 4X6YA 2BZ1A 5D1HA 2OZEA 4CF7A 5LM3A 4F71A 4RENA 4DV6B 2F43B 1ACLA 2EP5A 2LW7A 2PBLA 4CCAA 2ZJFA 3MMPA 2C29D 4DPMA 4QG3A 5F7XA 1DDIA 4Q4JB 1Y5IA 4DEVA 1W8IA 1Y1PA 4TV9F 1OFIA 1DCFA 4BLPA 3LLUA 1THZA 3WP0A 3P2YA 1QFJA 2R8OA 1RMTA 2IEAA 5A4MS 5A3RA 2GMWA 4RF2A 3AC0A 3V8PA 4R71A 1O0BA 4V0NA 3FFBA 2PHZA 4O5AA 3E0QA 2WJGA 2WWWA 3QQ5A 1QZUA 3A2MA 3Q9LA 3RVJA 1QRRA 4HN4B 2WILA 3ZNPA 1H9AA 1T0BA 2X23A 5KKCA 4NONA 3RREA 2PXXA 2PX5A 4OL0A 1D1PA 3NJRA 3QLJA 5CAEB 4IXWA 1SEVA 2IPOA 3IHKA 3TE6A 3AV0B 3DE6X 3Q3GE 4NHEA 4XOIA 3L07A 5I5EA 1SG9A 1ZUHA 4W8OA 1WMBA 1REQB 1H2WA 2ADMA 3NB0A 4V0ME 2PZEA 1RM4A 1MOZA 3M6XA 2YQZA 3NOXA 3C8DA 4JLKA 4IIDA 4W9NC 3EQ6A 4X7RA 5ER6A 2CYAA 3U3MA 1XYVA 3OY2A 4PGFA 4QOEA 2H4YA 4HV4A 1E59A 4N5DA 1QHNA 4URHA 1XZJA 1QCDA 5U4XA 1BWSA 3LNTA 2WKRA 1K5GA 3EWNA 5FT9A 1R8YA 4J6FA 5IDXA 1QDLB 3A25A 4W6ZA 4DBLE 4G1MB 2CK3D 1N2EA 3IEUA 3TOVA 4Y7DA 3VTAA 3ZJ4A 4ZGGA 4DNQA 3D4PA 1ADBA 2CNWD 1Q21A 2OCGA 1Z6QA 5LBUA 4EPVA 2YZNA 4EY6A 3HXOA 3A6PC 1EYZA 4QTTB 4TROA 1TNDA 3TN7A 2V0NA 2FPWA 4PWZA 1W48A 2Z2JA 1C3OB 3KYJB 5K2OA 4DA9A 2PUGA 1U4OA 3AJRA 2X4DA 3WYFA 3QG1A 4L16A 4B45A 5ESXA 5KVCA 4WKNA 1TRHA 2QVCA 3G3EA 2V0CA 2YV5A 4HGZA 3IHLA 3P4UA 1GL3A 4IAOA 4ZQBA 5C8ZA 5HTOA 4CLDA 3ZWAA 4YRNA 1OVMA 1Q15A 1VP3A 3WRXA 4BNIA 1Q83A 3AY3A 5J58A 1PDWA 2GJSA 2J87A 4C0LA 4UHBA 4QSMA 1L4GA 4MCHA 4MV5A 2OZPA 4MVJG 5JS7A 1MTZA 3KHUA 5MN5A 2B1QA 1XU9A 3A9CA 2DUNA 2F1OA 2MJLA 1Z08A 3ZCXA 1X92A 3R3YA 3FBTA 3IOCA 2QYTA 3EMKA 1SO8A 1X1AA 2W4IA 3UOWA 5BR1A 3IBGA 5A5GA 2VWHA 1A71A 1FVOA 4UZSA 1GRQA 3GWZA 5TF4A 4IYRA 4BNHA 4DSTA 1BEZA 1K98A 1ZOLA 1YF3A 4WXMA 1O9HA 1X8LA 1IWOA 4GBED 1N78A 4RTMA 2WSSA 2ZYVX 1YI1A 2O3UA 4HFNA 2CLEB 2CJFA 1K7FB 1H1LB 3D4LA 3WLOA 2YWEA 3G6WA 1YL7A 2IE8A 3BRSA 3VBEA 2AHRA 2EGGA 2OV4A 4F86A 5C7OO 2VPZA 2IUSA 1HEIA 3RRZA 1WU7A 2VUSA 4LISA 4G26A 2GRUA 4F5YA 2DUUA 1L5MA 4YJGA 3HKCA 2BHTA 3ZY4A 3W2TA 3ZXSA 1AHHA 3QFSA 3BCRA 4J3JA 3NXKA 4AP9A 1GRVA 1J56A 5ED0A 5K3EA 4PPQA 3ROQA 2GZHA 2D4HA 1R9NA 1NDQA 3GGJA 5F12A 1KEVA 1VPVA 2ES4A 2O3TA 4TMYA 3NDIA 4X90A 4J0DA 5DXJA 2HTFA 4UHCA 3GLIA 3NCHA 4A0QA 2J3MA 4MYCA 1ZD3A 1HYGA 3CE6A 4HCJA 1L4NA 2AXQA 4O5OA 2BLLA 1M2VB 5KTNA 1R7RA 1Y3HA 5EJGA 2NPFA 4D4KA 1THTA 3ANSA 4QRDA 3UGJA 4AI6A 1AMOA 3UWSA 4P92A 1NX9A 2PL3A 2V6JA 3BH7A 4NBWA 4XGQA 5EUBA 4EB8A 4RE6A 1KHTA 3VPCA 1JDJA 1ZEMA 1Z8FA 2IVFA 1OFUA 1XU4A 3HDGA 5AHRA 1X7ZA 4D5EA 2A1UB 4Y2SA 3KQOA 1VSUA 1F6BA 1YACA 2PWPA 2DUJA 3TR5A 1N6RA 3ASZA 2O3JA 2A9KA 3A7EA 2JJMA 3LLSA 2WWIA 4HXGA 2X6RA 1SC3A 5K0TA 1NJSA 5HIIA 4E5VA 4EEXA 3V4FA 2WUWE 4PSKA 2XB8A 1TU3A 1UZLA 1EVYA 4QFDA 3V9PA 1DIOB 2X1VA 2GYYA 3R3WA 2W6MA 4REOA 3EXG1 3U4DA 1Y6FA 3DR3A 2PMFA 4JVOA 4Q0MA 5FWNA 4FFOA 2ECKA 3KLBA 1A0OA 1W85B 3AUAA 3KJEA 3KKZA 4RM2A 5KIAA 2ZRBA 2G5CA 5IARA 3PSAA 5FWXB 1Z28A 4LX8A 3DMTA 2FMUA 2QTRA 1C4OA 2V7PA 1S3FA 2WFZA 3CSUA 3HNRA 4RK5A 4WE3A 1YQUA 2K2QB 5FBWB 3SS8A 5BNIA 4B44A 1QGDA 1SB9A 3KELA 1KJ9A 2QIOA 4JJAA 2AC7A 3ZBTA 4E03A 1U2DA 1SXJC 2FX3A 5FUXA 1OYOA 2VRBA 4NOMA 4LF9B 4BX9A 3QKRA 3WLFA 2RJNA 4ANFA 4UVGA 5HKOA 3FUXA 4JQCA 2QN7A 2YZGA 2ZCUA 4HWTA 4TTJA 2XQJA 3GLUA 4W63A 3RTEA 4G9GA 1Y1KE 3W6UA 3ZBUA 4HP8A 3GLIE 2FDRA 4LOLA 4LVUA 2R751 2FTKE 3SYMA 1QANA 1ST2A 3P20A 4DLVA 3SP1A 5AI9A 4OQYA 4FFNA 4WA7A 1T8WA 3LQKA 3MGBA 4IIGA 1J9GA 4ZQFA 2M6LA 3ZD7A 1CQXA 2XCQA 1JNXX 1YZKA 2Y9PB 5IDVA 4AWBA 5CVVA 3AWDA 1J2JA 1VL0A 5JNWA 4U3JA 5K3CA 1JRLA 1GZ5A 4TMFA 1WW3A 5HOEA 1U1GA 1W6RA 1UJCA 1SZJG 4UASA 1E3LA 1KJJA 4C7OB 4AG6A 4XSHA 5I4KA 2OYSA 1G20B 1Q7TA 2E9SA 3JQGB 4JKYA 4EUNA 3H18A 1PFQA 2ZRPA 3S28A 5T64A 4NNJA 1IM5A 1N75A 3AH8A 1L5LA 4PYJA 3BH6A 1ZJ4A 4V1CA 1QVZA 4XX0B 1QQ5A 2GF9A 2JZOA 2OXIA 4F6CA 2Q9AA 2CY0A 3CWQA 3VU3A 4NCIA 3G5LA 5SYAA 4YP5A 4XLLA 3SYTA 1Y7HA 1IY2A 4V3BA 2PX4A 4KNWA 4F72A 4I0WB 4MGHA 1MO3A 2F8SA 2E18A 2QENA 1O89A 4RMIA 4YRRA 4ZAGA 3PRJA 1Y3BE 1A97A 2Y4OA 5AW3A 1MIOB 4XEHA 1P2VA 1P1BA 3DZIA 2BMEA 4YWHA 5B6JA 5KVQA 1NE7A 1MDBA 1NNLA 1VIVA 2RH5A 3HFJA 4DXAA 2ZUTA 5JQGF 3GG2A 2X0JA 3GGOA 5FI0B 2O6HA 2X7XA 3DTNA 4DARA 3OPYB 2IP2A 2YJTD 4IIJB 4C7JA 4LJ6A 1L4KA 1ODSA 1TB4A 2ZIFA 4KWIA 3D2CA 4NY1A 1E3WA 1SBNE 1YBVA 3ZOKA 1U0RA 1QTRA 2JHCA 3BRWD 3AF2A 3B3FA 4HGNA 5H82A 5IAKA 4CBVA 2TYSB 3UMCA 2B8EA 4CM9A 1SZCA 4MWSA 4OQPA 4K0KB 5JZBA 1VL5A 1ADFA 2C57A 3BD9A 3I37X 1VG9B 4HNVA 2H31A 2PL9A 1E0JA 3EQ8A 1P9NA 2YHIA 3K0AB 4KO3S 3H1EA 5JE8A 2GM5A 4NH0A 4PLGA 4HAYA 1QVVA 4AW9A 4AS1A 3S5JA 4D3YA 1AE1A 1EXNA 3LU1A 4B7XA 4D5GA 2Z30A 2NW6A 3ZWXA 1KTVA 5FDFA 2PUTA 1S3IA 2AFIA 2H7CA 1XG5A 4EM6A 1ZK1A 1XXHB 2H2AA 1IQRA 4C6TA 1WDWB 4B6GA 1K92A 1U7UA 5T8KA 2UZ1B 3A11A 2BFFB 5F5NA 2PFKA 4BJ1A 4H1UA 4MW1A 3B13B 5DTQA 1MW8X 1SXJB 4GPD1 2ZCJA 1FDSA 3I4LA 2XWSA 3TXYA 1GCAA 2DUMA 2PV0A 1C3VA 2QKYA 2XKJE 3HJCA 5K7SA 1UBTS 3KB1A 1IHDA 1B0ZA 4NKRA 4FZ5A 1SIOA 1QKKA 1ISSA 1L5VA 1XDWA 2ZJAA 4LWOA 4Y18A 3PTAA 4J75A 2WT9A 4TS3A 2W22A 2JLZA 1MQSA 1NQ5A 1XVAA 2Y67A 5B12A 1C8VB 3F5SA 4QPDA 1PR4A 2QHXA 3DBLB 3K9NA 4Y1RB 5KAMA 2HFJA 4CRWB 1VRWA 2QTAA 4D25A 1KP2A 2ADOA 4ITUA 3PHIA 5KHLB 1OWPA 2EZTA 1Z2AA 5D1NA 1RWOA 2WZDA 1JJAA 1GU1A 2PQ0A 2D7DA 2M32A 2ZTUA 3ZS9A 5GINE 4GYWA 1B8OA 1GG5A 2OBBA 2ZPTX 4MICA 4O1IA 3FTNA 4XYGA 1FFWA 4BV9A 1CB0A 5ABPA 2Y1LA 3WZMA 2GT1A 3G1TA 1LNSA 1PVVA 3LOPA 2FI1A 4MW4A 3BE4A 3KQVA 2WIKA 4BQSA 1H0HA 4Y2UA 1Y1QA 4U2EA 5BRNA 2XMZA 1Z7GA 1ZAYA 2OESA 4JVNA 4DUGD 4BECA 1BFUA 2YIJA 1NT4A 2BDUA 1WUIS 1U9IC 221PA 3IPCA 5G4KA 1YCDA 3MD0A 3M5PA 3QLUC 3L8MA 4FHZA 4PFJA 4WV3A 4HRVA 4XCXA 2XDQB 3A9UA 2GZ2A 5CA1A 1CC1S 1DBQA 2WAOA 4QD3A 3RS2A 1M8GA 2I2AA 4B87A 3LRXA 4KR6A 3I8OA 4WOKA 2R96A 3DEYX 3QPCA 4MYSA 1EH5A 3R09A 2AFIE 3E7XA 1H66A 2CVZA 4E5DA 4R69A 2AG1A 1JU4A 1U0HC 1ZJJA 3WQBA 5HJ5A 4WJKB 3ZYZA 1ULBA 1V8PA 1JIKA 3BEOA 4WADA 1ZYUA 1G7TA 3E8XA 4P5DA 4X54A 4EHFA 4YIKA 1CZOA 3PUXA 1WSWA 4X44A 3HUTA 4P7KA 2NT3A 3JQRA 1KMHB 3O9VA 2C3PA 4MUGA 1VZ2A 1PT6A 2LR0A 5AM5A 5JD4A 5C0OE 1BGVA 1DTWB 3HN6A 3QYAA 4BQPA 4J7CA 4JJGA 4ZOLF 2JFQA 3OSZA 1DMSA 4N01A 5C1OA 4U7GA 4MRNA 4QUAA 1C50A 2I03A 3VR5A 2MINA 2EJWA 4RKQA 1E9RA 3A3KA 1DNPA 4GRIA 1VHTA 3KQMA 4KRGA 3X1WA 4AVYA 1DEKA 5DIZA 1UPCA 4E09A 2YFYA 1M2GA 1S4QA 2YWCA 4UTOA 2A57A 1T36A 1X13A 4ES6A 3Q6MA 3HZZA 2HBZA 3HY3A 2DTDA 2PIDA 3EGEA 3HDTA 3LKZA 2ZSHA 1U2ZA 5EWLA 3A7DA 5LP6A 3ZTYA 2UYGA 1NR5A 1YVUA 1A69A 2CLSA 3DOEA 3EH2A 1Y9JA 3HFGA 3CCBA 3R5JA 1DHRA 5JCXA 1NW4A 1QLHA 4Q4AA 4NE2A 2EZ4A 4YAOA 3KT8A 1LW6E 4E11A 5GGXA 3KHTA 1CDZA 1GFWA 3MLEA 3MNFA 4FEEA 4M86A 4OXXA 4BXOA 3C8HA 4YUYA 2BF7A 4LFCB 1P73A 1TMOA 5C1DA 1AUPA 1XAHA 2JEYA 1B0UA 2JIQA 1I7LA 2IXBA 2ZUCA 3LK7A 2J6HA 4MXDA 4MH0R 5K0LA 3WLNA 1KMMA 5CB8A 1W59A 2HN9A 2QBYA 1NYRA 3A6ZA 1OC2A 1RM0A 4A5OA 1DAMA 2IBMA 3EOAI 1G2IA 4TLBA 4DV5B 2OHHA 3TD9A 4EW3A 1NBEA 1NHWA 3AR4A 4IIHA 3SEQA 1G8SA 3CX8A 4ZMSA 5JVDF 2MTBA 4IX9A 4LWQA 1CUHA 3EMBA 3U3RA 1XRQA 5J47A 1QPZA 3OU2A 1GVNB 3AB7A 4FYKA 3TRKA 5HM6A 1BD4A 4IVRA 4K8OA 2FH5B 4P3YA 4RY0A 5CXSA 2O2GA 7YASA 4ICIA 4AC9A 1G38A 4FEGA 4N3GA 2MT9A 5DF1A 2PKCA 1SCKA 3CUUA 3OU7A 4RZIA 1U3GA 3KVYA 3H4IA 3A36A 3DCIA 2P9JA 1F8FA 1TO6A 3OM1A 1BX0A 1WZEA 2A6PA 3D3KA 3MSCA 1XAJA 2LGJA 4UUAA 1Y8RA 1DKOA 3A4IA 1DAHA 3MWYW 3RS8A 3FPBA 3L7IA 1VL2A 2ZWOA 4FGJA 2PWYA 4U5QA 1OF1A 4ZVMA 2WA1A 2YS6A 1P3JA 1WG8A 4NQZA 3SQDA 1ECGA 2RARA 3D7NA 3U7QA 2VDQB 4P83A 2PZJA 4WNAA 3FVVA 1J9ZA 3RV3A 1NDHA 5C1PA 3D3WA 3QJ5A 4DR1B 1IH8A 1XHLA 3FROA 4CN8A 3FNRA 3PQ8A 1GGNA 1KZ7B 1HORA 3AU8A 2WYOA 3UKDA 3C5HA 5I7UA 3HO8A 2FEOA 3HWWA 1Q44A 4M0DA 2CVPA 3ZU2A 4QA9A 5HHTA 4KKVA 3D5TA 3I5UA 2PIAA 4G1VA 1FRZA 2WZQA 1B6GA 1EFPA 3B9RA 1MTOA 1OH6A 3EGCA 3ILXA 2QUIA 3CT6A 3QVXA 5B58T 2HU7A 4A23A 4KUHA 3WGTA 1FS6A 3D8RA 3CVOA 2HXYA 1NYQA 3OJCA 3I53A 4LOJA 1WP4A 1JBEA 1WV0A 1F2UB 5LXTF 3CUWA 3UB4A 4BP1A 4HAWA 1T1EA 2W98A 2ZKIA 4W4TA 3O9ZA 4S2UA 1P5FA 4QXPA 3AMVA 2ISCA 4J2TA 4QUIA 2G7MC 5DB4A 3LQRA 1F0PA 2IPNA 1DC7A 4YMTA 5IYZF 4PNPA 4LOKA 4MRMA 3F96A 1S6YA 4F7WA 2BCJQ 1QK3A 4GZ3A 2AOXA 1X3LA 3QEAZ 3L6DA 6REQA 3GGDA 1NI4B 1YD7A 3I04A 4KN8A 4HLDA 4LMBA 3GP5A 1W87A 4HFJA 4V24A 4YACA 4X8HA 2BC9A 2V96A 4II2A 2WU3A 5HBRA 3V4OA 3RNLA 1T9CA 2C2KA 3K1AB 4KBGA 1NXPA 1MX1A 4YRBA 5AVVA 2VT6A 4GXTA 4FMBB 1GCOA 1VLZA 4HX5A 4RYLA 3O3MB 1W76A 5IJ0A 2V98A 4LJAA 3U7EB 1SD5A 2COUA 2D1SA 4RMHA 4HAOA 1Z5ZA 1ZK3A 3LCJA 1PG0A 2X8JA 2RKBA 1NURA 2GM3A 3ITKA 2ACWA 4PIMA 1X7WA 5B1HA 3W8DA 4N0MA 4C4OA 4HUJA 4C4RA 1RJ9B 4C3VA 5AVUA 2PM8A 1BRTA 1VG0B 3CZCA 3PDWA 3QY0A 1E3DA 3UYKA 5F3RA 4MW2A 3FHTA 3VNUA 1P9WA 1QO9A 1UMBA 1Z7YA 3BD6A 3MTGA 2ZGVA 3O8QB 1U9JA 3C3WA 4N3AA 1DG1G 3PXCX 4X5OA