1F2UA

Crystal structure of rad50 abc-atpase
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
149
structure length
149
Chain Sequence
b'MKLERVTVKNFRSHSDTVVEFKEGINLIIGQNGSGKSSLLDAILVGLYWPLRIKDIKKDEFTKVGARDTYIDLIFEKDGTKYRITRRFLKGYSSGEIHAMKRLVGNEWKHVTEPSSKAISAFMEKLIPYNIFLNAIYIRQGQIDAILES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAD50 ABC-ATPASE
molecule tags Replication
source organism Pyrococcus furiosus
publication title Structural biology of Rad50 ATPase: ATP-driven conformational control in DNA double-strand break repair and the ABC-ATPase superfamily.
pubmed doi rcsb
total genus 37
structure length 149
sequence length 149
chains with identical sequence C
ec nomenclature
pdb deposition date 2000-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1f2uA00
1ZM3A 4NE2A 5G3ZA 4D4MA 2YNMA 5CDFE 5CLQA 2OZEA 3I1FA 1YRAA 2XOKD 2ZI3A 4LHXA 4A4DA 1AA9A 1AN0A 4PPQA 2QA5A 5F9HA 1LS6A 4DKXA 2XX3A 2C9YA 1G64A 4C2UA 1KI6A 1KSJA 3NVAA 3FFBA 4R7ZA 2KI5A 5IF9A 3A58B 1HUQA 2RCNA 4QJ4A 3T5DA 4DLYA 2P0EA 4MRPA 2FPMA 2XXAA 4G3XA 4TSFD 2BKEA 2G88A 3K70B 2IBMA 4M9SA 1T4GA 821PA 221PA 1FPMA 2DB3A 4DIDA 3SC3A 3LBIA 3N2EA 3BE4A 1CEEA 2O5VA 3PQCA 4MKGA 2OXRA 2EFHB 1XXHE 2WIBA 4JKYA 1AM4D 4UNNA 4TQ9A 2NPFA 3ZD6A 2REXB 2R8RA 4EDHA 4EFNA 4QKQA 1G4UR 5H70A 2GCOB 4F91B 5IK2A 3C14C 4PQYA 3BIFA 1CR0A 3AUXA 3B1ZA 3P4XA 1JJ7A 1JEEA 1ZNYA 3TSWA 4ZKDA 1LFDB 1HTWA 2ZAMA 5JRJA 4LJ9A 3B5JA 4KLNA 4I81A 3T1VA 4B3CA 4DLZA 2H7VA 1QF9A 3CB4A 3IPXA 1E32A 1YZQA 3B2EA 3AQ4A 2E9SA 4IDPA 2P65A 3AKCA 4JLMA 1P2SA 3F3YA 121PA 5C46F 3AVUA 1KI3A 4DLVA 1W0JD 2ANBA 3V9PA 1C9KA 1QVRA 5DYIA 2VP9A 3BFVA 3OIVA 3ZQJA 1XD9A 3LW7A 1NRJB 1Y63A 1HE8B 4PO8A 4DC9A 2RGNC 1R10A 2B6HA 4LJ8A 3NDPA 3CPHA 4S2EA 5K8TA 1JEDA 2PH1A 4I1OA 1ZUNB 4YMWA 2WTUA 2CK3A 2XB2A 1TUIA 1XEWX 4MYCA 2FGKA 1L4YA 1ELOA 2BIFA 1O87A 2SHKA 4NTZA 1AJEA 2E1RA 2DWPA 1FQJA 2NO1A 1XEXA 4US2R 2C9OA 1N5IA 4PHHA 4NKRA 4ARZA 1Z6AA 421PA 1J7KA 4GNKA 4ON9A 4CEJA 1KO5A 1VDZA 3RYTC 2J7PD 3SE0A 3W5IA 5F3WB 1Q57A 4MGZR 1Z6YA 3HWSA 3RRZA 4BE7B 3TUJC 1FL9A 5KNBA 1W36D 2QL6A 3DL0A 3WRYC 1KYIA 4CF7A 1XJQA 3FMPB 1XTQA 2HJGA 1Q20A 4TLBA 2OLJA 2NIPA 1EX7A 3T5GA 1KMQA 2ZJ8A 2CHQA 5J4KA 2H57A 4BFYA 5KTYA 3CPEA 1KDRA 1S9HA 4LK2A 3P1JA 4I1SA 1UDXA 1KY3A 2O8BA 2OLKA 4AYTA 2I1VB 1E9FA 3GJ3A 3HU2A 5GJCA 5JI2E 1DG3A 1W4CA 4URZR 2ZIAA 3HDTA 3QF4B 3VFDA 1VG8A 5HCNA 2QI9C 4C0LA 4CEIB 2NOAA 2X19A 2JLSA 3QPUA 4FD2A 3DKVA 3VAAA 2ZRAA 1NN0A 4KSBA 2DPXA 3R9XA 1XWIA 4KI0A 4ZDKA 1P9NA 3U4QB 4TTPA 4YMSA 3K0SA 2R65A 2V8OA 3BFKA 1EFCA 5DE3A 3WBJA 4TLAA 3L43A 1TX4B 1TQ2A 5DNYB 1ANKA 1ZCAA 4Q1DA 2ZJZA 3BORA 1OFHA 3PEUA 3RVBA 4G01B 1KI7A 1SXJB 4NYMR 1WB9A 1G41A 1ZP6A 5IK2D 5L3QB 1YHNA 2Z43A 4TMXA 3UKDA 1XD8A 1OFUX 1W47A 1YE8A 2E87A 3FKSD 1ZBDA 1U2RA 3WMEA 3GLFB 3BERA 1KSHA 1KK0A 1UDWA 2XNSA 3ZGXA 2F55A 1U94A 4AURA 2XB4A 1RRPA 1SVMA 2CNWA 4BEBA 5BN4A 2IYRA 3PEWA 3NXSA 1FMLA 1AGRA 4BZPA 2V4ZA 4GP7A 5HCIA 3OAAD 3TGPA 4TLDA 2D2EA 2WWIA 2BBWA 1BOFA 4ZCIA 1UKVY 1RKBA 2FOLA 2H18A 1UKZA 1E2DA 5J5CA 1KOFA 3W6OA 2QROA 1KKMA 3RABA 2OCBA 1E0KA 1G7SA 5FL7D 2HXSA 2XZPA 3QOFA 1LTQA 5EP4A 3ICEA 1F2UB 1EWRA 1W44A 3RRMA 1CXZA 4RZUA 2ZUBA 3IBGA 1N0WA 3F5FA 1U0LA 4DSTA 2WJGA 3UPUA 1QBKC 4UNRA 4OK3A 4DWJA 2HT1A 4TSFA 4NDZA 1AK2A 2BEKA 3AB3A 2ZE5A 1NVXQ 1FP7A 1Z83A 1P60A 3CH4B 3RS7A 2JLYA 5JEDA 3R20A 3LA6A 5JWHA 1AKYA 1OHHD 3ZZ0A 1UKYA 1VIYA 3Q8XB 3MFYA 3TRFA 4Z8YA 3IHLA 4JL6A 1IOZA 1DO2A 3NDBB 1Z6GA 4XOIA 3EZ7A 4G5SA 1NMYA 2FA9A 3VR6A 5L3VA 3QEJA 1Z08A 4QG7A 3D6TB 3K9HA 5KSPA 4BLTA 4U7DA 2OEPA 1KDPA 4L15A 3TW4A 2FV8A 4TL8A 5KNDA 4M1MA 4ZDIA 4PC2A 2OESA 1G3QA 1BMFD 1YZGA 4JMPA 4DLXA 1DARA 1OYWA 2A78A 1KMHA 3K1JA 1CTQA 1KSFX 2QENA 1W0JA 2H1LA 1W5SA 3CRQA 2QBYB 2O8DB 2ZQ5A 3OFNA 5TB5A 5E95A 3WHLA 1KK2A 4D2IA 3QKTA 1GSIA 1O3YA 4KVAA 4HUQA 4AK9A 5M04A 3B78A 5GJBA 3LD9A 3R7WA 4MA4A 3QXCA 3MJHA 3JZAA 2GCOA 1NKSA 4I1UA 4AD8A 4DLSA 1MO4A 1US8A 3GEHA 4US1R 3LFUA 3RAPR 1UBEA 4KHZA 4KVGA 1YZTA 2ZI5A 4U02A 1FQKA 2IYYA 3B1WA 3P32A 4BFZA 1GDDA 1JAHA 4IOKA 4F4IA 5CB8A 2VHUA 4B76A 2OAQ1 4GPTA 3DMNA 4P31A 1Z29A 1G8YA 2B92A 2BEJA 2NO6A 2ZE7A 2Q6TA 3MD0A 3QXJA 1OXSC 2ZI6A 1MR3F 5L3SB 3OEHD 4UKDA 1X6VA 4PPFA 2JA1A 4MQBA 1XCMA 1OKKD 3EA5A 3LX8A 2VH5R 3GJ0A 3KFVA 1BO6A 4W5HA 2JIZA 5TVKA 5UKDA 4M2LA 2G1KA 4LHZA 2QAJA 3DZDA 4CVNA 3CPJB 3ZJYA 3AVWA 3TK1A 3N70A 1RJ9B 4A8JB 1PLKA 3Q7PA 4POAA 2ZRHA 1GILA 3IQWA 5EUQB 1T6NA 1B0UA 5EXSA 2UKDA 2NGRA 4LHYA 2QP4A 2VHTA 5CJPA 4QHTA 4Q4JB 4B3BA 3THWA 4L9WA 3ZLJA 5JZVA 1IXRC 1ZC4A 1R6BX 1W2HA 2FU5C 3FB4A 3AP3A 2ZU6A 1OE0A 1W4RA 4KFRA 2BMJA 2F7SA 3KDSE 3QE0A 2D3WA 3B60A 5EE1A 1EWQA 2HV8A 2WVJA 1WBBA 3TSZA 4BFSA 4AKEA 5FOWA 1G18A 1BKDR 3K0CC 3W90A 3X1WA 3THXB 4A8JC 1MRSA 2P6NA 1J90A 4A2WA 1G4AE 2BCJQ 2C98A 2I1QA 5KSYA 2P6RA 1Q3HA 1CS4C 1KHTA 2N42A 2R6GA 4WW0A 4YDHB 2V55B 1FX0A 2XSZA 4LV8B 4ZCLA 3EW9A 4GDFA 3CO5A 1S1CA 2R9VA 5B30A 4P4TA 5FI1B 1BMFA 3IGFA 3QNUA 2C78A 2GJ9A 2JLQA 5JHGB 1FOEB 2R62A 1XJ0A 2QAGB 4JS0A 4OL0A 5CM9C 2GILA 1Q1ZA 3MUFA 2XAUA 2GF0A 2HYDA 2XEXA 3W5JA 4NYIR 4D25A 4QGHA 4OQFA 3X1DA 4P4SB 4G5QA 3O8RA 4MDEA 1N6RA 5JHHB 1G291 4DEYA 4NYJR 4LYHA 3PR1A 2HF8A 2FSGA 1TAGA 1M6NA 2QAGC 2BOVA 2ZU0C 3FDIA 3Q5DA 4Q7LA 1JXOA 2WAXA 2C77A 2IC5A 3B13B 2VSOA 3PVSA 4RD4A 2V7QA 4IOMA 2CE7A 2R6CA 3B1VA 4RCZA 1L4UA 1CJKC 1A2BA 4UNPA 3F8TA 3T15A 2O0HA 3P26A 2IHBA 4TL7A 4DCTA 3A4MA 3OEEA 1FNMA 3A6PC 5GADl 1UEJA 4LJ7A 4HZUB 2GTPA 4G0NA 4LOAA 2AXPA 2Q9AA 4LUCA 4LBZA 1M34E 3C5HA 2PJRA 3PIRA 3RC3A 4E22A 1E2FA 1Z2CA 2GK6A 3NBXX 2PL3A 5EXPA 3THOA 2JIZD 1QG4A 5FL3A 2FGJA 1II8B 3UMFA 2J3EA 1QHYA 3Q9LA 2IT1A 1KI1A 1VKJA 4GZMA 4NMMA 2EFDB 4K8OA 3WNCA 1IN6A 3H86A 3A4NA 1X3SA 2G6BA 2IYLD 2HXYA 4C4PA 4PPGA 3T06B 4AY2A 4ESHA 2Q21A 1F2UA 5DIFA 1Q12A 1MT0A 2ONJA 1TNDA 3M1IA 1AZSC 2GDJA 4Q9HA 4IEIA 3A1WA 2G3YA 4V0MA 2EFEB 4JZKA 1GWNA 3O8CA 1GM5A 5LD2C 1P9WA 3NKVA 3ADKA 1TL7C 2AXNA 5LD2B 1KTVA 1P75A 4FMCF 1R2QA 4YXWA 1VECA 2AX4A 3RS5A 4L16A 1NSTA 2GRJA 3KL4A 4M1SA 2W58A 1NLYA 1TADA 2IS1A 4A9AA 1SVIA 4B3GA 3RSOA 2A5JA 3GLGA 2JLZA 1S8FA 1AIPA 4YMUA 4FCTA 1I4DD 4Q00A 4D6PA 5G3YA 3TSOA 4DLRA 3AF1A 2JDID 2PJZA 2ZRPA 1IN7A 4JLVA 1JR3D 4KODA 4GP6A 3EZFA 2F43A 2B7BA 1Z6XA 1E1QA 1XMIA 3MJRA 3RRYA 3EAQA 4QNMA 1E9SA 3U3RA 4NYJQ 2J7PA 2FDCA 2NO0A 4AG5A 4KFSA 3REGA 1D2EA 2Z4RA 1E2PA 4XWKA 1ETUA 3SHFA 2QSZA 4ILEA 2O8EB 1W48A 1ZNXA 4DB2A 4C30A 1US8B 4QFMA 2CCGA 3MCAA 1E4YA 4M8NE 1II0A 1S9DA 2CCKA 4ARZB 2W6JA 3CZPA 3D31A 4HLCA 3EXAA 1DS6A 1T0HB 1LY1A 2AFHE 2XNDA 3ZDQA 4FINA 3X1YA 1P2TA 4F4CA 1E2MA 4M9QA 3LV8A 2REOA 1M7HA 2PT7A 5AR1A 4AKGA 3E1SA 1UAAA 3NWJA 1T5LA 2QORA 4WVFA 4GBMA 2ASEA 2VA8A 4P3YA 2ZVQX 2FH5B 4FN5A 2OUKA 2J59A 1R4AA 4LJ5A 1CRPA 5HKKA 4IVQA 4DZZA 1VCNA 2BJWA 3K0FB 1KI9A 1RJ9A 4A8JA 3GP8A 4PSKA 2K5UA 3RANA 2ZEJA 1QHHA 4RZ3A 3A4LA 3W9YA 2HYIC 1KIMA 1XRJA 3L0PA 3J81k 2BBOA 5TDHA 3T1TA 3B1XA 4GZLA 3JVVA 4OQMA 2FSIA 2VSFA 3IEVA 1XZQA 2ZR0A 4Q21A 3KJGA 3GPLA 1OB2A 4TWZA 1LB1B 1UF9A 2J0UA 2EWWA 3NG1A 1KI4A 1W2GA 3PITA 2YYZA 1DVRA 1KK3A 5EP2A 2O8CA 2CJWA 4IRUB 2WHXA 2ZSEA 5EZ5A 4PC6A 1OFTA 1P3JA 2CDNA 2J0VA 3QQ5A 2YWFA 3L0OA 1ZNWA 3ADDA 4HAWA 4Q18A 1VG0B 3VU9A 1Z8FA 1P5ZB 5BN3A 3U61B 4IDNA 3TKLA 2VIIA 4WA7A 4Y0VA 4OJKA 3WRXC 3SI7A 1HQCA 4LV5B 1NG9A 1GKIA 2WPDD 3OHMA 3WYAA 2PLFA 5J40A 3UK6A 3AVOA 2UZIR 1MKYA 4ZO4A 4AYWA 4PTLA 3SHWA 4XWOA 4B6EA 5C1BA 3DEFA 3MLEA 4GT1A 1NSFA 2RGDA 5BQ5A 2IYVA 4KITB 3CX7A 1U8AA 2J45A 2D06A 1NF3A 2DR3A 2RGGA 4JYCA 4LC1A 3R9WA 3QUSA 4LJ4A 2AWNA 2L0XA 3C16C 5A0FA 5J4YA 1VTKA 2HDNB 5H68A 4PHFA 1RRCA 2NO7A 3DO6A 1UFQA 5CYOA 4HSEA 1DG1G 3GJXC 4V0NA 4Q1EA 3EARA 3GCGA 4JJKA 5FTNA 3RS2A 3KKPA 5EJEA 2RGEA 1YJ5A 2O0JA 4LI0A 4QGGA 3SFVA 4BLQA 3QPWA 3U3JA 1FMJA 4RFVA 1YRBA 2AK2A 1VYTA 2O8FA 1Z06A 3E5HA 3UANA 1XCPA 3EPJA 4PPNA 1DOAA 1LNZA 2ZUDA 2BV3A 2KJQA 2QPAA 4LBWA 1E2HA 2D74A 1KJYA 5FBVB 1EGAA 4G1UC 4MUAA 3W3ZB 2PMDA 2ZUCA 5KDDA 2CE2X 4BGDA 3OIUA 3SBDA 1RYFA 1OIVA 3OFND 5CYPA 4WBSA 1Q22A 2AK3A 2VBCA 1WQ1R 1XU4A 1RRFA 1BIFA 1RE0A 2FJUA 4W7SA 3MRSA 3A36A 1NBMD 3LXRA 2OAP1 3SEAA 1CIPA 3I3SR 4B44A 1E0SA 2ORIA 1ZM9A 3AKEA 1GRRA 4ZKEA 1KI6B 4KJZA 1U9IA 4FMCB 1HURA 2DBYA 2GCPA 1KMHB 3DDCA 3M4YA 3B7GA 1G3RA 4N0EA 4TMTA 1E1QD 2UVQA 3C15C 4URWR 2XXAB 4DT1A 4W5JA 2F1IA 3AVQA 1NIJA 3GEEA 2R6AA 2EYQA 1H8EA 2Q3HA 2GK7A 4Z54A 2Z83A 2WICA 4L4UA 2P6UA 3B9PA 3KTAB 4YMTA 4MH0R 2VP5A 5FH9A 4B33A 1NIPA 3GLHB 1XXHA 4MRNA 4R98A 4WIAA 1D6JA 4NZYA 5GJVC 1H8HD 2R6DA 1VCMA 2BWJA 5LB2A 4B48A 3GJ8A 4ESVA 2B8WA 3EG5A 4ZPXA 3S1AA 1OH7A 3AUYA 3B85A 3RWMB 4PQRA 1KJZA 5FUYA 4EJSB 4HAYA 1UPTA 2AHOA 3E70C 4KV9A 4PX9A 1PZNA 1ZVQA 5L3SA 2ZI9A 1SVOA 2XNDD 1D8TA 1MABA 5JI3E 2FEOA 1N5KA 4V0OA 1G6HA 2XTMA 3K8YA 2IS2A 1OT3A 1Q1BA 4PSVA 4BRUA 3CR8A 2A3RA 4DUGD 4BZQA 5F2EA 5JECA 1P2UA 4BZXA 3KTAA 5CJ2A 4NPHA 2IXFA 1L8QA 1E2KA 5FPKA 1D2NA 3DHWC 2QRNA 1KI2A 4MITA 1VCOA 5F98A 1NN3A 3TE6A 3V00A 1G8GA 3E2IA 3M6AA 1UM8A 1DAFA 3S1AB 1A2KC 1R8QA 2C03A 2QMHA 2FEMA 4HATA 3TVDA 3ONWA 3GEIA 1EK0A 3EWSA 4IJMA 2QNRA 3NH6A 6Q21A 4KBGA 3KQKA 2W2VA 1V43A 2KB0A 1JAIA 1TU3A 2YOGA 1UBGA 1VHLA 3EWAA 5FOSA 2WKPA 1N6LA 2ZRIA 3GFTA 2QE7A 4OHZA 2IUSA 1QHXA 2DYKA 1ZM7A 2FNAA 2VTKA 2GAOA 4ASUD 2FFAA 4A6PA 4J0QA 4ZDJA 1ZC3A 1COWA 1IAQA 3EA0A 1TQ6A 4QJ5A 2IF0A 3QY0A 1F3OA 3H84A 4BUJA 4OI4A 1JBKA 2QGNA 2FFHA 3VHXA 1SXJA 2IXGA 2CLDX 5L3QA 4BPBA 3KJHA 4JBYA 1R0WA 4MYHA 3ADCA 1XD2A 3CX8A 1ZD8A 3V4FA 4OBEA 3FYHA 4A82A 4TQUS 1XEWY 3VTKA 3LO5A 4IFBA 1OXUA 1R0ZA 1JECA 2V54A 4GI7A 1CLUA 4LHWA 2O8BB 1CF4A 1SVLA 1IBRA 2IS4A 3CH5A 2VP0A 4UNSA 3U3MA 3QXSA 1XTIA 4GOKA 1JR3A 4QJ3A 5BWMA 2VHQA 3RC8A 4QM6A 1YZLA 5DHFA 1EFHA 1CRQA 1P4SA 1OYYA 2MSDB 4IXNA 4RZXA 2ZE8A 2JLUA 1TF5A 1N2CE 1NKTA 3LDAA 4P4SA 4QRHA 3KQLA 2RGXA 1R0YA 1DADA 3MAAC 2QZ4A 1U0JA 4GOJA 4RY2A 4GSYA 1OSNA 2DFTA 3IO3A 4BFUA 1II9A 1GL6A 4IW3B 3VR2A 3ZVNA 1KJWA 4RKEA 2V3CC 1YZUA 3HJNA 3U7EB 1IONA 4IDOA 3REFA 4DLWA 1ZMXA 5KDOA 4OHXA 3AF2A 2G1JA 2ZS7A 3AKYA 1IY1A 1GIAA 3GJ5A 1XFAA 4KCGA 1EX6A 1S4QA 2AWOA 3TLXA 1U99A 3LQRA 4AKIA 4UJ5A 1RZ3A 1W4AA 3EPHA 2XTNA 3KKNA 3I62A 5H1YA 1P61B 1E2EA 3HR7A 3BRWD 3AVPA 3ND9A 1G5RA 2XZOA 1R5OA 3ASYA 2FG5A 4DSNA 4Q7KA 4LZZA 3U3KA 4D0NA 3U44A 4ZDWA 4LPKA 3WNBA 3GJ6A 3SYNA 1Z63A 3ASZA 4BFWA 3LLMA 3CF0A 4RD3A 4URYR 3C5CA 1Q3TA 3GLIE 3SJCA 2HCBA 2Y8EA 1NBMA 5HR5A 3ZIAD 4ABYA 1G7RA 4Q4AB 1HA3A 2ZSDA 5FTLA 3QXXA 1PLJA 4QBGB 1GP2A 3I73A 3H4MA 2ZRDA 2W2TA 5CLLA 3W34A 1G9XA 3SYKA 2OSBA 2GHIA 2XTZA 1F60A 1EFUA 3K70C 2YC2C 2YHSA 4M53A 1N0VC 2CNWD 3IDQA 1CR1A 2HCJB 3WYFA 1E98A 3R8FA 1R8SA 5KYKA 4ITRC 5JMTA 3B6EA 1E1RA 5D3MB 4Q7JB 2DY1A 2ONKA 3NH9A 1E2IA 3TW8B 4LGMA 3FMFA 3CONA 1K6MA 1IXZA 4D4LA 2W6IA 2MMGA 2TMKA 4QBHA 5DHAA 4BLOA 1GRQA 4CEJB 2F1HA 3KQNA 2EFCB 2PLRA 1N6HA 4ERNA 3QG5A 3ICQB 4XD7A 3T1QA 2G77B 3QBTA 4JVLA 4QGAA 1N6IA 4B2PA 1XMVA 5KPJA 1DAGA 5L8VA 5E7MA 5BXQC 1OFIA 3SYLA 1YU9A 3FMIA 1S0UA 1MO3A 3CRW1 3IKJA 3K09A 4MKFA 3KX2A 1FP6A 2GJAA 1E9EA 2IX3A 1WP9A 2NQ2C 2QBYA 3K53A 4DUGA 2O8DA 1MOZA 1CBUA 4KFTA 2WWHA 3ECCA 5FUVA 4TYWA 4D80A 2G0NA 4XTRA 4MRRA 3PUZA 3WXMA 4EQ6A 4YMVA 5CIWA 2JGNA 4JLAA 3MWJA 1NNEA 2YWEA 4Q4JA 2AL7A 1E94E 4Q02A 4YDSA 1HQYE 3T61A 621PA 2IUUA 2GXSA 4ZCMA 3PUVA 3SN6A 3DKPA 4MKHA 1UEIA 3B82A 4DCSA 2JLWA 2JJ8A 3C41J 5CB6A 1S3SA 4HDCA 2Q3MA 4HEJA 5FI0B 4NL4H 4URXR 1K5GA 2EW1A 4IFEA 1M2OB 4G5OA 2FFBA 3N2IA 2PCJA 4PFSA 1AS3A 4JJZA 5C2JB 3U5ZB 5KU1A 3THXA 2ERXA 1RPZA 2W83A 3FHCB 4B3FX 4CRWB 3QG1A 3PXGA 1SVSA 4LY6A 2WWGA 4M21A 3WNDA 3KKQA 1GTVA 2XZLA 1E9DA 3QENA 1OV4A 3MWLA 2QP9X 3EASA 2N46A 2QMOA 3RSLA 3SS8A 4C0AC 1HT2E 5K8IA 4PO1A 1YZNA 4O3MA 5AUPB 2CK3D 2GJ8A 2IYZA 3U60B 1X8JA 3LAWA 3FKQA 4KO8A 2QAGA 2QN6A 4O2LA 5E4FA 1GNQA 3DVLA 4CZ2A 3EPKA 1N6OA 3H2YA 1FFHA 3PEVA 4OHWA 1S2MA 3BB4A 1F2TB 1EFTA 1KAOA 3W8RA 4TMWA 3HYRA 2C95A 1XP8A 3A8TA 3AVTA 3VKWA 3DMDA 2CL0X 4RZ2A 2ATVA 2ZYWX 3F0TA 3VU9B 4F38A 4WXPA 2Z5FA 2QTHA 4PR0A 1H65A 1YR8A 2GBLC 4YC7A 4Q5IA 1E1RD 4C9BA 2QEQA 3IUYA 5JSZA 4W9MC 1OLOA 2IWHA 1P9RA 1PUJA 4EPVA 3EZ2A 1H8HA 2ZJBA 4OHVA 5FUWA 1I2DA 1CU1A 1QHSA 4PHGA 2FZ4A 4QNRA 1SZPA 1Z0IA 2J5XA 2QUZA 4R9UC 3KXLA 3SFZA 2X1VA 5B58C 2H8KA 3TH5A 1T9HA 2GF9A 5TY0A 4UJ3A 3AF3A 1T3HA 2DFKB 2RGAA 5DGXA 1FUUA 1G16A 3UATA 3AP1A 4FW9A 1II8A 3U2QA 3I61A 1N6KA 5DH9A 3TR0A 1GRNA 4M1TA 5FR1A 3CLVA 3I4LA 3O47A 2ZM5A 2OFWA 1X86B 3VHLB 4EIWA 1YQTA 1OHHA 2O8FB 3RHFA 4OHYA 5EE9A 2ZSBA 1T5IA 5EE5B 3BOSA 5GJWC 4URVR 1Q0UA 4LYAA 4A1FA 5KHOC 1E9AA 5J4VA 2NZ8A 1JPNA 4GMXA 1EG7A 3X2SA 3GLIB 3IO5A 5DI3B 4LYJA 3BH6A 3KXKA 1JR6A 1EFRD 1OF1A 2NTYC 3ADBA 4RD1A 5K8UA 5FBRB 1TF7A 4M22A 2ZRGA 3WP1B 3ZQ6A 2HT6A 2R6FA 2YINC 4QGFA 1VPLA 3VR5A 3TIFA 4LDJA 2V6JA 1E4VA 4B34A 1W1WA 3ETLA 1KKLA 5BN5A 1W7AA 5JS8A 1N6PA 1E79D 4LCBA 2RAPA 3BC1A 1N3BA 1WF3A 2QMUA 5FFMA 4B73A 4YXWD 1ONBA 4HAXA 4TMVA 1IN8A 5B57C 3OAAA 2WJYA 4LWZA 4UQOA 1GG2A 2QG6A 4F92B 5HTKA 3NHAA 5A4JA 1NI3A 1R5NA 5FOVA 3VX3A 1Z3IX 2IHYA 3M0EA 4JBXA 1W36B 2D4HA 4OQLA 4P33A 3CNOA 4PC1A 3D7MA 2FWRA 5KDLA 2ZPTX 4ZI2A 3BWDD 4Q1BA 4UNQA 3LX5A 1OW3B 1FW6A 4HLQB 1TEVA 5EZ6B 4TL9A 1N6NA 4K46A 2ZSAA 3AGQA 2EFGA 1IQPA 3KZ1E 1I4LD 4JKIA 2WWXA 3ZS8A 1U81A 4NH0A 4B43A 3I5YA 2VRWA 3RLFA 4DCNA 1XTJA 4D26A 4MGIR 1NJFA 1UKEA 2VEDA 3W6NA 4O0MA 2BBSA 4LHVA 4MGKR 1TUEA 1N5JA 1MV5A 1SULA 3OE7D 2H92A 3LNCA 4FWTA 2GZAA 3TR5A 1KZGB 3LH5A 1JB1A 1FUKA 4B35A 4JLKA 2WOOA 2C2HA 4JIMA 5J4LA 1GOTA 2GWHA 1GL7A 2KSQA 4DCUA 1E3MA 1LV7A 2KE5A 4JLBA 2RGBA 3RS4A 3BGWA 3C8UA 1NG1A 4KU4A 4B6FA 4OI2A 3PENA 2AN9A 3OZXA 3RS3A 4ASUA 3CRMA 4C7OA 2A5YB 3WMFA 3UWOA 1GKYA 2ZRKA 4S35A 1DEKA 2RMKA 3UXMA 4EFMA 4FCWA 2WJHA 3CW2A 4HZIA 1QHGA 4DVGA 1JNYA 5JWOA 2EQBA 2A7QA 4G5GA 5HKKD 1NVWQ 2KWIA 4LJ6A 1KAGA 1E96A 2FZLA 4XTCS 2NPIA 3I92A 4P0TA 5TARA 3ZIAA 2V9PA 1RIFA 1Z0DA 3EIHA 4UXHA 5FOTA 4OK6A 2H16A 2WZQA 2GETA 1ZINA 3FMOB 5HZKA 3K70D 4MDFA 1BYUA 1BS1A 2EU8A 2ODEA 2OT3B 3K09C 4GOXA 5IHPA 4E07A 4GFDA 4Q66C 5HE9A 1A1VA 2ZREA 1NY6A 2KBFA 2YC4C 1X8KA 1HT1E 4FMBB 4H1VA 1T8TA 4URUR 4OK5A 4XVUA 2CBZA 1NJGA 3HPRA 2QT1A 1R0XA 4CEHB 2ZYUX 1DAKA 2VQSA 5BYJA 1VMAA 1NVUQ 1Q1EA 4TYYA 3D3QA 2OG2A 3OF5A 2WKQA 4JSYA 1SXJE 1YVDA 1XDBA 3U3OA 3NC1C 2P67A 2WSSA 4Z1MA 1VIAA 2OO7A 4B71A 1QRAA 5FTKA 1BYIA 1F2TA 4KSCA 3BK7A 1KO1A 4X8MA 5FPYA 3C4JA 2ZE6A 4IDQA 3AM1A 5TV2A 2J0UB 2JCSA 2F1RA 1R7RA 4NCIA 1S3GA 3MMPA 2OBLA 3B8HA 2CJWB 2DWOA 3PG5A 4X8HA 1DPFA 3SQWA 1F6BA 2D7CA 3Q72A 2CLSA 4BLSA 1E2GA 2HJVA 5E7IA 1F48A 1J99A 4C0SA 4IHQA 2BVNA 3GLHE 1R5BA 4DLUA 4GL2A 2ZRFA 4IKEA 4TQAA 1ZD9A 4B3DA 3EC2A 4LJYA 1NMZA 1TF2A 2YV5A 3GLGE 2WJVA 3TAUA 1GAJA 3K9GA 4JT2A 5TMPA 4Q47A 3L8ZA 1HY3A 2J7KA 3K0CA 3GQBA 3HPQA 2DHRA 1J2JA 4I1VA 2QRZA 4I4LA 4HB4A 5BW8A 4M1OA 4AYXA 3AGPA 3K9NA 4RVCA 3U44B 3L2OB 2F6RA 3CNNA 2GXQA 2CLCX 5FPSA 4DRZA 1LVGA 1E0JA 2REBA 2W0MA 4OQNA 3NC0C 2OILA 4US0R 5DO9A 2VYFA 4PZLA 1TTTA 2R44A 4N3NA 4RD6A 3TJZA 1E79A 2A2ZA 2WJJA 3EIQA 5E7JA 2J0SA 4N1AA 3ZVMA 1NBME 4JVSB 5EE0A 1RRGA 3SR0A 5B2ZA 4A0RA 1ZRHA 5KPDA 4HDQB 4RKFA 1P2VA 1HH4A 2I4IA 1WBDA 1QVAA 1TEXA 1XMSA 1Z0JA 4DT1B 2VLIA 5FUXA 2AR7A 4BEJA 3O8BA 1T8UA 3JZMA 2IYQA 1KNQA 4R71A 2BJVA 4M0LA 2GA8A 4AWXA 4EJSC 5JBQA 1ZAKA 4TMZA 3QI2A 4Q48A 5EXXA 4U00A 2QTFA 2AKAB 3TQFA 1D9ZA 4PZYA 3QF4A 2QMEA 4AIIA 4JLOA 1RC8A 2QY9A 1EXMA 1JALA 2CEAA 2Q9BA 3H1TA 3IIKA 3CBQA 4IOLA 5AUOB 2OCAA 3THWB 4JT4A 3D8BA 4C0KA 1XTSA 4HAUA 2BC9A 3CM0A 2N1BA 4CW7A 2WKRA 2GCNA 2J46A 4XIGS 2DFLA 1SVKA 2P2LA 2XOKA 3GMTA 2O52A 2ZJ5A 5AJWA 1ZM4A 3BB3A 4NYMQ 1U98A 5J4HA 1CJMA 1VCIA 1SHZA 2YWGA 5JRZA 2QGZA 3I32A 1E9RA 1OPXA 5DLQC 3T34A 1SGWA 1W49A 3QPVA 1G5TA 3B1YA 2FSFA 2YOHA 2ZI7A 5GVRA 3ZD7A 4PAOA 3TAHA 4EQ6B 5J47A 5KO2A 1P72A 4JLPA 2RHMA 3FOZA 2D2FA 3WP0A 1VYVA 2ZETA 4HLUC 3LQQA 4R2IA 3OESA 4D81A 1DBSA 1XXHB 5G53C 2IYXA 2CVHA 1Z5ZA 2BM1A 1M7GA 1UBFA 4P4UA 1DAEA 2PEZA 3PFIA 2CHGA 5SZJA 4GRAA 3AH8A 3BD9A 1W46A 4TYPA 1CKEA 1MH1A 2P5TB 3KJIA 4KLZA 1PLLA 3R8CA 4Q9JA 5K8LA 4CEIA 1HEIA 3HR8A 1XCGB 4DSOA 4EPXA 2PZEA 2ZRNA 1G1MA 3NTUA 5AJZA 5FR2A 2CCJA 4KYUA 5D3QA 4HB0A 4C7OB 2LKDA 5EUMA 1EESA 3PCRB 1YR6A 1XF9A 1A5TA 1IM2A 4QL3A 1UBCA 4QXAA 2G9NA 3BXZA 3PJRA 2PX0A 3DZ8A 2OHFA 2W0SA 2LCFA 4TYQA 3L8YA 4PZZA 1KNXA 4XSGA 3QKRA 1ZU5A 2ZRBA 3AV0B 2J0QA 1TMKA 4ZIRB 1T91A 1CR2A 1DAIA 3AVYA 3BFXA 1RVDA 2IA5A 1OJLA 4XJXA 2ANCA 1DTSA 2PMKA 1FTNA 3GFOA 4BECA 4TMKA 4KAXA 2F1JA 1N25A 4QBIA 2ZROA 1WCV1 3Q5EA 5SZIA 2A30A 4PAMA 1E69A 4U5XA 4DDUA 2VF8A 3VKGA 1ZIPA 3FHOA 1JXMA 1M7BA 2Z6VA 5JSZB 2PZFA 1FZQA 5JS7A 1K5DA 3PEYA 1HE1C 1OKKA 2W2XA 4DXAA 3SJZA 2C04A 2RGNA 1L2TA 4C0JA 3SZRA 4WZAE 2V1UA 2VP4A 3K0EA 2OE2A 4BFVA 4ACBA 4ZIRA 4XVRA 1S96A 4R2HA 2I3BA 4TTQA 5FOUA 3BH0A 4EPRA 2AD5A 5TXGA 4TN1A 2AKYA 1E9CA 4D4JA 1JPJA 4OJQA 1ZM2A 5KSOA 2IXEA 3R7WB 3GD7A 1EFRA 4A15A 3P27A 3FGNA 1G7CA 3W6PA 4V02A 3FPAA 4E09A 4Z51A 4FMDF 1WMSA 2X2EA 1G19A 3T12A 2JLRA 4EPYA 2X8AA 2B21A 2VPPA 4TLEA 2BMDA 1CJTC 2P5SA 4MRVA 3RDPA 4M1KA 4Q4AA 3TUZC 1G21E 5LDDC 4IXMA 4FCVA 2OV2A 5IT5A 4JL8A 4B47A 4BQSA 1X1SA 2WSMA 3K0AB 3KB1A 4TZ0A 4Q9IA 3VR4A 1RYHA 1DELA 2ORVA 1NMXA 4FIDA 1E99A 1OH5A 3AKDA 1X1RA 3QVVA 3LWNA 1NVVQ 4WXRA 1OXXK 3LVQE 4P32A 2YJTD 2WIAA 2AFIE 4Q03A 2ATXA 2ZJAA 3GLHA 1GUAA 4JLJA 5D3MA 1W5TA 2NG1A 1Z2AA 2NO9A 2HLDD 4HAZA 4LV6A 1MO6A 2ZR9A 2FX3A 4XVQA 2ZJ2A 1U8YA 2F9LA 3FKSA 5C18A 4JVNA 4TTRA 4HUQB 1AS2A 1ZUHA 2C96A 4M9ZA 4V0LA 1M74A 1OIWA 3HYTA 3CF2A 3KUDA 3KQHA 4M1YA 3IBYA 4PSAA 2WM9B 3TNFA 3GJ7A 1FTSA 5DYGA 3QJYA 1J8MF 2JJ2D 2GESA 1XEXB 3OIYA 1QDEA 4HI0E 3VKHA 3K0AA 4DJTA 2X77A 4JBWA 2F9MA 3KKOA 1MABB 1QG2A 2GEUA 2MSEB 2JLXA 2W6ID 3IQXA 1MO5A 1N5LA 2MSCB 2RH5A 3C7KA 3OE7A 4HDOB 4WZ6A 1PVOA 4NCNA 1W0KD 1ZU4A 5HPYB 2WWWA 3T1OA 2ZYVX 4ZI3A 4A0FA 5JEEA 5SZKB 1J70A 1Q1QA 2V7QD 1U90A 2IF2A 5FPHA 4B74A 1BH2A 4XWAA 1NN5A 5AJYA 2FFQA 4V0ME 3QF7A 1SVWA 3QKSA 2B7CA 2XJ9A 1FNNA 1Z6TA 1GZSA 1WDTA 3OEED 4HLUA 3EZ6A 2GJKA 1YR7A 2DCUA 2IYTA 2ZTSA 4D0LB 2O8EA 5P21A 4LBYA 4JVMA 3PV0A 2ORWA 3IILA 2BMFA 1GVNB 2NZJA 1Y3AA 2A5GA 4LYFA 4OI0A 3A1UA 2O8CB 1VYUA 2QPOA 3RWOA 1TPZA 1D2MA 4AI6A 1T0JB 2DFNA 2QQEA 2VO1A 5EP3A 5FTMA 5IDVA 4B32A 1ZW6A 1XX6A 1NLZA 2XJ4A 2ZRCA 4PHTA 2ZRMA 1JQJC 3JVUA 1A4RA 2RKOA 1W4BA 3THYB 1V5WA 2RB4A 3AP2A 4JL5A 2IYSA 1KO4A 2V6IA 3QKSB 1HYQA 5LB4A 3WY9A 1XD2B 4Q19A 3ZVRA 5CK5A 4HB2A 3I5XA 3NHBA 2YVUA 2OBMA 3DOFA 3CUEF 3DOEA 4PXAA 1H8ED 3BH7A 1P62B 1QZXA 3FE2A 1COWD 4LC0A 3PUYA 2CXXA 3KJEA 1ZJ6A 3VMFA 3IPYA 2PX3A 4HZUA 1JJVA 3N5CA 4FMDB 3SJAA 1XPRA 1XJCA 2ZJYA 5E3HA 2YKGA 4JLDA 2ZJOA 4QOSA 2WSSD 4Z1MD 2C5LA 5DI9A 3LRPA 4BRWA 4FWIB 3SU8A 4XD7D 5FL7A 3QIAA 3GLFE 4Q7MB 3BS4A 5FTJA 4A92A 4CEHA 1DE0A 3QBVA 4KXFB 2BBTA 2XGJA 1LW7A 1LF0A 4B3XA 4TYNA 2FE4A 4HYYA 3LLUA 1Z0KA 4PO9A 4JSTA 3OEHA 3AVXA 2V1XA 3TUIC 1E2NA 1N0UA 1NY5A 1Z28A 4Q1FA 5HE8A 2C8VA 2GXUA 4KFUA 4AKHA 5C4MA 2GXAA 2OFOA 3VR3A 2F3RA 2VF7A 4X8LA 1T3SA 2BHRA 1YZKA 1Q21A 4LBVA 4NCJA 2X2FA 3I72A 5AK0A 2ZAOA 4FXPA 2C9CA 4RD2A 3AVVA 5JJLA 8OHMA 1GFIA 3P20A 4CT4B 2GZHA 3NBYC 3ND8A 2WMOB 1YKSA 5L3RA 3UG6A 1SKQA 5BYKA 2QSYA 1U9IC 3QXHA 4EPWA 1AS0A 4LRWA 3MWKA 3VNVA 2WMNB 5EQTA 4UXJA 1S1MA 3MG9A 3WBKA 4ZV4A 3IHWA 2QE7D 4A0HA 5A5GA 1E9BA 2GVZC 2OBNA 2QM7A 1E2JA 1E6CA 4EAQA 1E0AA 5DISB 5KSZA 2WWFA 2RGCA 3H0KA 4DHEA 1WRBA 3NBZC 2FPLA 5DN6A 2PT5A 3RRNA 3IIMA 1GNRA 1LF5A 4M1WA 5LBIA 4IOJA 1TQ4A 2HEIA 1TQDA 4V0KA 1A7JA 4TL6A 5JCPA 1TU4A 4IVRA 2WAYA 1G3UA 3CX6A 1CR4A 2VP2A 4N0DA 5G40A 2WOJA 3LBHA 1JQLB 4EJSA 2ZYTX 4L5BA 4BASA 3CNLA 1ZYUA 2ZRJA 1AQYA 2ZITA 4QC2A 1ZD1A 3CWZA 4YLGA 1IN4A 3FFAA 3IIJA 4NHOA 2H5EA 1K8RA 1D9XA 1KSGA 4DEXA 2JLVA 3SNHA 4RFSA 2WPDA 4MUBA 3U7HB 1YR9A 1P7CA 521PA 5JFGA 1M8PA 4Q4HB 2ODNA 2D62A 1X8LA 5CK4A 2GAAA 2IWRA 4JLNA 4PC7A 3ZZUA 1ESMA 2JJ1A 1WA5A 3KUCA 4L9SA 1QHHB 1J8YF 3MWYW 2CHVA 2HUPA 1FX0B 1KDOA 2ECKA 1Z47A 4Z8XA 3TVTA 4B75A 4DIEA 1T3LA 5JCZA 3U6BA 1HV8A 2F3TA 2OFXA 1NLFA 3SBEA 1L7VC 5AWFC 2O0KA 1G17A 3BBPA 4YONB 2A9KA 3QVUA 4LSGA 1D5CA 4Q1AA 3HU3A 3L82B 4NP6A 4EKDA 4NCHA 5FBQB 3AEZA 1SXJC 1IJFA 3A37A 4FI3C 1XTRA 4QHYA 4CGZA 5CDFA 1QHIA 1AGPA 2QQ0A 2ZS8A 1UADA 4WZBE 4RFSB 3SDZA 2Z0MA 4RCYA 4RJLA 1OH6A 3WYGA 4TT3A 1AKEA 2CMKA 2PBRA 1GKUB 3B9QA 5KNCA 4NONA 1QHNA 1DAHA 1G5PA 2DWQA 1CP2A 4ACAA 4HAVA 4C3ZA 1JI0A 3BJIC 3PUWA 5SZHB 3K9LA 2XSZD 4A6XA 3R9IA 1ZNZA 1DAMA 2HF9A 3OIWA 1G8HA 1GITA 4DBLC 3PUXA 3GJ4A 5CIQA 1ODFA 1WE2A 1PV4A 1G8FA 2WJIA 4BLPA 5FPTA 4DB4A 2JAQA 1G3IA 4Q4LA 2CL7X 1AZTA 3U7GA 4DCVA 4DDVA 4DDWA 5DN6D 2VL7A 5G41A 4CDGA 3CZQA 3DM5A 1Q44A 4CYMA 3RNLA 3THYA 5EE3A 3RS0A 2QU8A 4HB3A 4MYTA 3X1ZA 1NL3A 3KXIA 5DSZA 1C1YA 5EXTA 4B2LA 4QBFA 3MSXA 1IHUA 2JDIA 4IEEA 2C99A 4OKSA 1ZIOA 3WHKA 1XNJA 3T35A 2IL1A 3DM9B 1G6OA 4XH9B 4PC3A 4EUNA 3Q3JB 3U6KA 3CWQA 3W8NA 1VG1A 2PCLA 1A82A 1KZ7B 2IEZA 2GKSA 2ZVPX 3NBFA 3QKRB 3AF0A 4CIDA 5JJKA 5AJXA 3VQTA 1IN5A 1XPOA 1VHTA 2OM2A 1SKYE 1G3MA 2GJSA 2JJ2A 3G5UA 4KBFA 2ODBA 4OQXA 4D4KA 1KO8A 2WBLC 3QKUA 1RFLA 2CVFA 1Z07A 4M4SA 3VX4A 1XBTA 1W36C 4DLTA 5JLJA 5AUQA 1G8PA 5B64A 3X1XA 3EZ9A 3UWKA 4C2TA 4E5UA 4Q1CA 1W0KA 3A1TA 3GLGB 4B2IA 1G7TA 3ZZTA 1IXSB 2ZANA 2W6JD 3LBNA 1SQ5A 4Q9KA 1NVVR 3TMKA 3G82C 4GMDA 2YWHA 3IEUA 3AF4A 4MYUA 4Y0AA 4WAUA 3GFPA 5HZHA 4NCKA 2GEDA 2OCYC 3KFXA 1LS1A 3EX7C 3L0SA 4JYBA 2F43B 2VHCA 3A1VA 5KUTA 1UJ2A 2WWYA 1OH8A 2BMEA 4RD0A 4MGYR 5ANRB 3SQXA 3Q85A 4MRSA 2H17A 2J9RA 4A0GA 4EFLA 2IEYA 4F7WA 2ZSFA 1P6XA 3CF6R 4NBSA 4PQFA 4LJAA 1CJUC 1GNPA 4EPTA 2JATA 4PAQA 5AUNB 3SOPA 5F9FA 1M1YE 3MGCA 3TQCA 2ZS9A 4TT3D 1CULC 4E03A 5CM8B 1U8ZA 2W00A 3NIBA 2XITA 4IDHA 3UMSA 3I8SA 2PZGA 4BLRA 1E2LA 3CKLA 4LPSA 1SKYB 2FF7A 3NEJA 4OI1A 4BFXA 4RSGA 4C0BA 2HLDA 1KI8A 2FMXA 4LX0A 4II7A 3KKMA 1OIXA 2GVDC 5LPNA 3CIOA 2VP6A 2VSXA 5EP1A 3O8DA 3WMGA 2YZ2A 3LY5A 1AQUA 1XEFA 2OXCA 5C4GB 1DO0A 3LW8A 3KB2A 5AJVB 1ZCBA 4HLDA 3UIEA 2GBLA 2LKCA 1MRNA 1SXJD 4AC9A 2UZ3A 5JJIA 1XMJA 3CRRA 3GLIA 4KYIB 2Q0HA 4DDTA 5DI3A 1CJVC 4DSUA 2GZDA 4YQFA 5IRCD 3K0FA 2YOFA 4Q01A 1G20E 1KY2A 4AG6A 5CITA 2CL6X 3L0IB 1OXTA 1VG9B 1C4OA 1IY0A 1Z0AA 2LWIA 3BB1A 2ERYA 2J41A 2JJ1D 2FPKA 1XTKA 1Z0FA 2JEOA 3HP1A 4C0QC 1IY2A 2QPTA 4F93B 1KDTA 1KK1A 2GNOA 3NEYA 4UXIA 1PJRA 4BFTA 3QEOA 1I4TD 3SJBA 4QM7A 4Q9LA 2BKUA 3VNUA 2R2AA 5H8WA 3Q7QA 1IJEA 5FBWB 3CRVA 2G83A 3FVQA 1P73A 5GVSA 3EIEA 3U4QA 3P4YA 1KGDA 2IW3A 5ELXA 2WV9A 4Q4HA 2QP3A 1KO7A 2J87A 1PUIA 2BM0A 3DPUA 4IVPA 4V03A 2IYUA 2JASA 4A2QA 3FTQA 1XPUA 1SHKA 2AD1A 2QM8A 5JWRA 1RW4A 4H9GA 5FBLB 1ZUIA 4M9XA 721PA 1B23P 2IUTA 1NP6A 4MKIA 4L8GA 2A5FA 2D7DA 2VHJA 2ODWA 5KOYA 3HU1A 1JR3E 3TBKA 2KBEA 4CT5A 4H1UA 4NU0A 3GLFA 3EC1A 1NN1A 3U7FB 3FWYA 2BDTA 2EWVA 3UMRA 1WXQA 4O2RA 4D0GA 1XB2A 3KQUA 3ZH9B 3A1SA 3LVRE 3V4RA 2MMCA 2P3SA 4C0HA 4D82A 2EYUA 4HUTA 3QSYA 1I2MA 2Z4SA 1F5NA 2IYWA 2ZR7A 1OB5A 4A36A 2NMVA 2G0TA 2EVWX 2PEYA 2QT0A 3VR1A 2FSHA 4F4JA 4TZ6A 1OXVA 3ZVLA 2OCPA 4O25A 4QHSA 4A2PA 2ZI4A 3BAFA 3W3AA 2FN4A 5FOXA 4G5RA 3ZYCA 4WOPA 3CR7A 2RHDA 1GL9B 2IS6A 2B8TA 4NYIQ 2A5DA 4XSHA 2GEVA 3LXXA 3ZS9A 2QTVB 4W5WA 2Q3FA 3I8XA 2ZXUA 2ZRLA 2BCGY 4X8OA 4I99A 4OYHA 1Z22A 2J1LA 3UG7A 1E2QA 1XZPA 4K81B 2Q9CA 2IK8A 4PANA 4TLCA 4BWYA 3EPLA 3G0HA 3FHTA 1ESNA 1U0HC
chains in the Genus database with same CATH superfamily
5G3ZA 4NE2A 5C35A 3A0UA 2YNMA 4EMTA 3NFRA 2PIDA 1UBMS 1D8AA 4PPQA 2J3LA 3BXOA 1JU9A 1NP7A 2QA5A 3HSYA 1E5XA 4DKXA 3AU8A 3FRIA 7ADHA 1WMFA 1K1EA 1YV9A 3VNQA 1EB9A 1NNUA 2AOTB 3OCUA 1P8JA 4Z7JA 4ZTZB 3IAXA 1YAJA 2II6A 4Q4CA 5KJ6A 2VQEB 2P2SA 1OLUB 1LLDA 4IBOA 4LJKA 3QW4B 1G20B 3A58B 2RCNA 1JYSA 2GFHA 4KQXA 4DLYA 4I1RA 1LW6E 3U7RA 4B6SA 5K4AA 1H5NA 2WJAA 2XXAA 4PXSA 4GPZA 4W5TA 2XQVA 1CUFA 1Y6ZA 3V32A 5I4KA 2L82A 4R2WA 2BI8A 3L8EA 4H2DA 4B3IA 3CEPB 5CA1B 2I2CA 1QTQA 4X6YA 1DJQA 2VJMA 3LBIA 3BE4A 1FFWA 2PGJA 3DBHA 2VLBA 5DHTA 3VDQA 4FE7A 1JJFA 1NAIA 2LDXA 1U9CA 2PH3A 2BSAA 3VBCA 7ABPA 3EVBA 2EFHB 4F71A 2QB5A 3WIBA 1CEQA 4K0RA 2RBKA 5FT9A 3V8BA 2IJGX 2FPPB 2NPFA 4DM3A 4I1PA 3U1TA 4EFNA 5IARA 4QKQA 3STHA 2FWBA 3FPKA 4OAPA 1NQAO 3FLBA 1XTBA 5IK2A 1I80A 3UOWA 2B4AA 2EERA 4F91B 4EG3A 3BIFA 3A32A 3AETB 3FYSA 5KJ1A 3N05A 3P4XA 4OEHA 1JEEA 1ZNYA 1LFDB 4CKZA 3S68A 5EJ9A 2W37A 4LJ9A 4B3CA 3T1VA 2H7VA 1RM5A 3RTGA 2XMCA 1UPCA 1RYYA 5F1OA 2HDOA 5J1TB 1OWOA 4LVCA 4W5NA 3AKCA 2H2DA 4JLMA 3AVUA 3FCYA 5AOVA 2HRQA 2VTVA 4DLVA 5FUQA 1A9XA 1C9KA 1QVRA 1D6SA 5DYIA 3LW7A 4GYWA 4WX2B 1JA9A 4YRQA 3TO5A 4QOEA 3OUTA 3QWBA 2J6CA 3D5QA 3JQDA 4K9LA 1GFSA 3UJ7A 4RVSA 2PMWB 3FOWA 1O0CA 3KLNA 2AB0A 3NDPA 2EQ5A 3H3FA 3AM4A 4YMWA 4I1OA 2XB2A 3HCDA 3VYRB 1TUIA 3ZV5A 2FGKA 1DKOA 3DZFA 3KXPA 2G5TA 3FNEA 2VT7A 2SHKA 3GCWA 3FETA 4K3VA 1H9CA 1GPKA 3MJSA 2RI1A 4M7RA 1M34B 1UL1X 1RM3A 1FK8A 4LDQA 1N2CB 1H4QA 4NAUA 5HFAA 1B0PA 1UZUA 2VTEA 3GMIA 4NKRA 2HREA 1Z6AA 2C2ZA 3DL2A 3WGNA 5JTTA 1J7KA 5EHIA 4GNKA 2V3WA 3L6DA 5EY5B 4AO8A 2XW6A 3PICA 2EARA 1KO5A 2W8ZA 2HEGA 3RYTC 3SE0A 3VVMA 3ZQKA 4CEJA 3Q6NA 2ZBUA 3OLZA 3TXXA 1V1JA 2CNOA 3RRZA 3PL5A 2I2WA 3TUJC 4LOKA 2YFQA 3LOPA 3Q87B 3WRYC 1CK4A 1KYIA 3V8PA 3FMPB 1FCJA 1C9EA 1Q20A 4TLBA 3TLCA 1NAHA 3DJFA 2NIPA 4DQUA 6CHYA 1Q0QA 5DM4A 2EZ9A 4IXWA 1MIOB 5HM8A 2H1CA 2OD9A 4LWOA 2OYCA 4OM7A 4BFYA 2C54A 1A8PA 1CIJA 1QCCA 5ALSA 4BX0A 3USZA 4I1SA 1TM3E 1KY3A 2BEVA 4P7FA 3TTVA 3ODPA 4ENPA 2SICE 3VH4A 1E9FA 4OXXA 3GJ3A 1Y8ZA 4EG6A 2IXDA 3BT7A 4OHRA 5JI2E 1DG3A 1NR1A 1W4CA 1YB6A 4MS3B 1M9NA 2JBHA 1E4EB 4HQNA 4ZV7A 1A9PA 4H08A 5THKA 4GMHA 2XE4A 4PNPA 3B3GA 2QI9C 3A6LA 4OUDA 1AMUA 4C0LA 3QPUA 1DKLA 1EEXB 2WP8J 3D2BA 4KSBA 3VAAA 3R9XA 1XWIA 3ZR4B 2PGNA 1P9NA 1UP6A 1I2CA 4TTPA 1T1IA 4CG1A 3K0SA 1Y7IA 4HPWA 4MW2A 3ZWKA 2EGHA 2A9OA 3BFKA 5DE3A 3R3HA 5K09A 1N75A 1P7VA 4P5PA 1P0MA 1P2DA 1TX4B 2FPGA 4L8YA 5DNYB 1ANKA 3CU5A 3DHEA 4QARA 1U04A 1N3YA 2ZJZA 3RVBA 1KI7A 1PTJC 5IXSA 1G41A 1E64A 4BNHA 1JAXA 1YS2X 3RFFA 5HQTA 3KHTA 2QJOA 4TMXA 1W47A 5M3BA 5K03A 1CB7A 3HA7A 2NV6A 3OG9A 2V6MA 1MTOA 3D8UA 1ZCFA 4WK6A 1U2RA 1D2GA 4JITA 5DEOA 3WMEA 1KK0A 3ZGXA 1LV8A 2WUEA 3DDWA 3FJYA 3H2BA 4AURA 2RK6A 3EGDA 5JT1A 2CNWA 3DB2A 1LA2A 1CHDA 3W7BA 5BN4A 3ZNOA 4WNYA 5BQPA 5A3VA 1FMLA 2UYCA 1RTTA 1PTKA 1NJ5A 3H5IA 5I7OA 4WE3A 2V4ZA 2PXAA 5CB4F 1DCFA 4A8TA 3C3WA 3LYLA 1LDMA 3LUDA 3OAAD 3OPYI 3TGPA 4PHCA 2ZTLA 4TLDA 5COAA 3AHEA 4FEYA 3FJOA 4PYOA 5FFNA 4E4TA 1FXUA 1QAOA 1JMVA 5G1OA 4LQDA 1UKZA 1K08A 3OOSA 5GV7A 4GO1A 4L2IA 3W6OA 2JI9A 3DMTA 4Q3LA 5TMBA 4OHCA 2PH5A 1LBHA 2EX4A 3RABA 1G7SA 5FL7D 4RTNA 2B8NA 4OQ4A 3LZ6A 3TLMA 4QSMA 2XA1A 4F5ZA 2IBTA 3I6ZA 3TFWA 4CM8A 1TXGA 2P6PA 4OQPA 5AHOA 1EGHA 1FFXB 4UMFA 4DSTA 5CBKA 1R00A 4FM9A 3DKRA 3AOEA 2BEKA 4KX3A 2VYVD 3AB3A 3URMA 2PKQP 1LJLA 1NVXQ 1P60A 2QRGA 3LTEA 1GPAA 3DJYA 2JLYA 1S7CA 5JEDA 3R20A 4MRAA 1INLA 1V6CA 1I1NA 1VGQA 2JFNA 2QX8A 1GQQA 4AX4A 1P31A 3OSZA 3LWBA 3QWFA 2G25A 2ZVJA 1KVRA 1W5AA 1H0KA 3FCOA 4ZVVA 3H8WA 3N2NA 4XOIA 3LLCA 1NMYA 2FA9A 2ODQA 3NDIA 2VN8A 4R16A 1USIA 1Z08A 3D6TB 3U40A 3AJ8A 3WHPA 3WAGA 4QVGA 2OEPA 5IVIA 3AYXB 3DC7A 3FF4A 4FDMA 4M36A 5CLGA 1QCDA 2C5SA 2FV8A 2HADA 3MMSA 3WA6A 3V8EA 1PTJA 1QFXA 1SPXA 2DUWA 2WNHA 4LF6B 1KJIA 2IHUA 4EJFA 3W1VA 4JEUA 1YZGA 3TOSA 2H7YA 2HIMA 3ZCUA 1OYWA 2YN2A 5KOJA 1CTQA 1KSFX 2JI7A 2Q41A 3T3GA 2H1LA 2WABA 1V7CA 5C5EA 3ZWAA 4TN5A 3PI6A 3OM1A 4YCAA 1C81A 4ZA2A 2HBYA 1FYWA 5EKTA 4RS4A 3UAVA 4D2IA 3UMMA 3BGVA 3FDZA 2ZBVA 1JDUA 3KOWA 2G1PA 4MHSA 4UU1A 3VR0A 2PLAA 1ZGGA 4FZRA 3WLAA 4AK9A 3IT3A 2AHRA 4MQLA 1GG9A 1RYZA 4E12A 3QXCA 4X54A 3MJHA 3WS7A 3JAMA 2GCOA 3EC7A 4AD8A 1HOTA 3V4VB 1MO4A 2QTTA 3NHMA 3GEHA 3IODA 3ZGVA 4PLVA 4P5DA 1FLVA 3N8GA 2BFBB 3C45A 3J80A 4FFNA 1FQKA 3SX0A 1FUEA 1JG4A 1JQEA 5BNWA 1JAHA 1JIJA 4I3HA 4F4IA 5CB8A 4B76A 1LX6A 2OAQ1 1USKA 4FZVA 4GPTA 3DMNA 1Z29A 3BZWA 4RX1A 5HIJA 3TAUA 2FRVA 3TSCA 4ZRMA 3IDOA 2EG5A 4UKDA 2J4FA 5L3SB 1J1UA 1FP2A 1H66A 3FWHA 4MQBA 4FW8A 4WCFC 3R7BA 5I3CA 1BDJA 4MVCA 1C7ZA 3LX8A 4YMUA 1MEEA 3KFVA 5LU9A 2K7FA 1CQZA 2JIZA 2H48A 2C4VA 4M2LA 5LM3A 5KVVA 4LHZA 1UKBA 1XZEA 1QZTA 2DVMA 2QAJA 3AY0A 3EFHA 1REQA 3KPWA 4N5DA 3NVMB 4UQLA 3WYNA 4C1NA 2Q3JA 1M1ZA 2FMHA 3AVWA 3N70A 1RJ9B 1Y3FE 2O3RA 4WEOA 3VPHA 1HRKA 1U8XX 1V4BA 2FCAA 1GILA 2FEWB 2ZRHA 5EUQB 2O7SA 3N8HA 1KOLA 3STWA 4F84A 1B73A 2H2WA 5GIOE 3O95A 4GOND 3PWSA 4MPJA 4QUGA 2QTBA 3WLKX 1H3NA 1ZJZA 2DHDA 3EXIA 4EHJA 2OY0A 3EGIA 1R6BX 4M0PA 5IJAA 3ETEA 2GB4A 3N75A 2ZU6A 3HZHA 4BMNA 4PICA 1U6IA 1SUIA 4XASA 2W6MA 3A9RA 1MUUA 1DNPA 3HQ4O 4KRYA 1EWQA 1VLJA 5BSVA 4E31A 1G6Q1 1WBBA 1FDSA 3TSZA 3GVPA 4AKEA 2EJWA 1WMAA 4BN4A 1DT3A 1ORHA 2WF9A 4I4TA 3BWYA 3E1KA 4MQMA 5AH0A 1U9JA 1W59A 2X8JB 3K0CC 3JQQA 2OO5C 4N47A 4KR3A 5K3EA 4QUBA 1MRSA 5AHRA 3THXB 1IB0A 2VUTA 1M8FA 2HMSA 3BE5A 3E81A 2P6NA 1ADFA 1J90A 2Q2OA 3L1UA 4A2WA 4GX2A 5FJJA 2C98A 5KEIA 2A57A 2I1QA 3MTBA 1OZFA 1JV2B 2VDNB 2R6GA 3OCCA 1E4EA 1U1EA 3CEJA 4TV8A 1FX0A 1LNSA 5CHYA 4GDFA 3CO5A 1S1CA 2XHEA 4PCUA 3U7JA 3UV3A 1DGQA 3HYLA 1CZKA 2Y27A 3AX6A 3M9XA 4XLZA 5IKOA 1GFZA 3A2KA 5C34B 3JQFA 2C78A 4HX2A 1NBOA 1UQUA 4RTPA 2R62A 1TM5E 2BE7A 2QAGB 4JS0A 2P9GA 3NZEA 4WQMA 1RBYA 1X87A 3ELYA 3R8XA 2XEXA 2OCXA 1PO7A 5GWXA 3W5JA 2D5IA 4H4DA 1G0NA 3E05A 3NTRA 4OQFA 4L02A 4QFDA 3X0DA 3X1DA 3PDIA 3Q12A 1YMVA 4G5QA 2PZ8A 1IUKA 1F17A 4MUIA 4MDEA 2HDHA 2X4DA 2NSLA 3IPLA 4WTOA 1OU0A 3B9RA 1L4HA 1I51A 1M6NA 1X7YA 3RVJA 5MFPA 5LA6F 2UYGA 2AE1A 3EVZA 4RD4A 1GADO 4IOMA 4FFRA 4DUPA 2QDKA 2KM1A 2ISSD 3DXFA 1OR8A 3PR2B 3QWIA 4UASA 1L4UA 5DBGA 1CJKC 4UNPA 3SDSA 2XLCA 3F8TA 3QZUA 4R69A 3EGDB 2ZAYA 1ZRSA 4Y1FA 3P26A 3K0KA 1QU3A 2A8YA 3JD1A 1FNMA 3R0VA 1P9OA 4TRNA 3PJGA 4ZVQA 4HZUB 3NWOA 4CNBA 2EHDA 4D6XA 3RD5A 1GPDG 1IEXA 4LBZA 2J31A 5BN5B 2PJRA 3UYLA 2JFQA 4BE4A 1WVGA 3BDIA 3FPGA 3K2QA 3THOA 4Q9NA 1Z5OA 3LWDA 1KBZA 3G7UA 2FGJA 3WICA 3OJFA 3Q9LA 3UAOA 2ZIGA 3QOWA 1VKJA 2R25B 4B83A 2C59A 4EELA 1R4ZA 3UUWA 3D6MA 4K8OA 3WNCA 1VKOA 1YACA 3O9VA 4XEUA 3A4NA 4A6EA 4AJ2A 5KJCA 1X3SA 2PMBA 1AXEA 1NJ6A 4V0RA 1HNWB 2A67A 1Q12A 5DIFA 3E27A 1MT0A 4QOGA 3K20A 5GZ6A 1W2WB 5DT2A 2ONJA 3CY6A 5I9BA 1JFLA 3FAZA 5JQGB 1LQTA 3AESA 4YI3A 4FN4A 2EFEB 3FH0A 4ZANA 1UK7A 3NKVA 3HI6A 2PMFA 3M6IA 4LW8A 1DO8A 3LGXA 4OD0A 5LN1A 2CZGA 2GGSA 2GBPA 1ZXBA 2QX6A 3JD2A 4YXWA 3UA3A 3DTVB 3EZYA 3PF9A 3IRVA 4M37A 4RKRA 1NSTA 4LQLA 3L7NA 4NEGA 2FW0A 1PSZA 3WC4A 2W58A 2I76A 1TYEB 2IS1A 3GUUA 1T2NA 5IXJA 1DIOB 3GLGA 2JLZA 4F72A 4IRMA 1PR0A 4NOKA 4RHTA 1O95C 1Z2PX 4Q00A 2NUPA 3I34X 3D6VA 3TSOA 2UU9B 2IY7A 2YN4A 2B5VA 3WYDA 1P1FA 2B0CA 2PJZA 4TRJA 4JLVA 3G8YA 1JR3D 4I8XA 1TI7A 5D87A 3NGXA 1VZ3A 4LZPA 5B2EA 3KZXA 4Y2GA 5CFOA 2ZYHA 2QJFA 1YMQA 2B7BA 4WV3A 4DTIA 1XMIA 4K40A 3JQGA 3MJRA 2Y05A 5B1HA 1CY7A 2C5FA 3PU6A 1E9SA 2MIIA 2Z3VA 2O8NA 4UHCA 4NYJQ 2J7PA 3W79A 3I01M 2FDCA 1ECCA 1KAHA 4F6RA 3LY9A 3NBKA 3D6NB 4Q24A 4XW2A 3ZK9A 3P7MA 1E2PA 3M6VA 4GG1A 4INPA 2FW7A 4OU4A 2WI8A 4QDJA 4CNQA 2G4CA 5CG2A 1L1FA 4DA0A 1QH8B 1JUDA 3HE3A 1EUDB 4ILEA 3T5AA 5CX1A 3E5NA 1ZNXA 4PV7A 3S28A 2ZTMA 4QFMA 5CVVA 2CCGA 1E4YA 4G4SP 5CEEA 1A97A 1YI1A 3ROFA 3E0XA 1II0A 1S9DA 2CCKA 2O2DA 3DDNA 2GLXA 3F4BA 3H13A 4ARZB 1QR6A 4EGFA 2PFSA 3L41A 2BHTA 1DBPA 4U8GA 2X0EA 2COEA 2M6RA 1T0HB 2G28A 3JTMA 1LY1A 4FQ7A 3ELBA 1E63A 2AFHE 1DOZA 2QVBA 3ZI7A 1OZHA 5AI5A 3DUWA 1SG6A 4J0HA 2WIKA 3ZYZA 1B1AA 3T0GA 1T4CB 4AMBA 5HTOA 2NU6A 1K4MA 1YK0A 2CZCA 2PT7A 1QQBA 1T5LA 2QORA 4KO2S 4WVFA 2VAVA 2ASEA 2VA8A 3AR5A 3GU3A 1M2OA 4P3YA 4DIOA 3FTEA 2QTZA 2CZQA 4GPAA 1R4AA 3WK6A 2VVTA 4F2DA 1WLSA 1CRPA 2F8SA 2E4AA 1DV2A 4IVQA 1N57A 4DZZA 1VCNA 5JAZA 5K3SA 4L95C 4ZYTA 4HDKB 1V48A 3I9FA 5L9AA 3PYXA 4PSKA 1QRRA 2K5UA 1VI5A 1N2ZA 3BF8A 3RANA 1QK3A 2YL2A 3FRHA 4RAOA 3MS7A 1GA4A 1DBVO 2RIPA 3J81k 5TDHA 2CMDA 3B1XA 3ZD9A 1MT3A 3ZXSA 1XZQA 3TNLA 4Q21A 3GPLA 4LF5B 4JDUA 4JEIA 4D9JA 4PZ9A 5CFZA 4RGQA 2OQIA 2FR8A 4CIVA 1XELA 4U2KA 1CDDA 1W2GA 1PR4A 1V1MB 2ZCUA 4F3KA 1DVRA 1Z39A 3HB5X 1ADJA 1U0BB 2O8CA 5EZ5A 3IAS6 3R77A 4TVKA 3M1AA 4PC6A 5DW0A 4YYEA 1NA5A 1P7YA 2J3IA 1SUAA 5ULLA 4L28A 3U61B 4F4CA 3GARA 3UYKA 1P4JA 3TJRA 1EWYA 1B6RA 1XDUA 3WRXC 3SI7A 3FPBA 1HQCA 1K5PA 4LV5B 3RSZA 2UAGA 1MJGA 2W43A 3WYAA 5IDQA 5JD6A 1Y8CA 4GE0A 1R66A 5J40A 3KOXA 3IQFA 1JW9B 4G8BA 1NM5A 2NQTA 3I58A 1MKYA 2Y4NA 3GQBB 3GAAA 3L6CA 1L8LA 4AYWA 2QYHA 2OXIA 1VPDA 1W4ZA 2YHAA 3B20A 4JUAA 3MLEA 4FDAA 2FZKA 1NSFA 2ZSJA 3HFJA 3ZBUA 4BLVA 4C4ZA 5M7EA 3CX7A 2J45A 2D06A 4ZHSA 3L93A 2GZ2A 4AY5A 3ZJUA 3HXMA 4JYCA 2QD4A 3EF3A 4IIEA 3ROMA 3QUSA 1ZOIA 2L0XA 2Q46A 5A0FA 4F2HA 2RJNA 4I5IA 1Z34A 2MOKA 1NYRA 4C04A 5ADHA 4DM7A 4HSEA 2YTZA 3ZC3A 1NFQA 3LCMA 3GJXC 3QVMA 5C52B 2Y9PB 2H8GA 4LN1A 1YJ5A 1CUSA 4RY0A 4BNVA 2HBRA 2AUMA 3ZBPA 3SFVA 3T9EA 4C5AA 3OTOB 2PRYA 1YL5A 1PYGA 2O2GA 1OV6A 2P8SA 1C5KA 1ODLA 2W93A 3UFXA 4F7DA 2OV1A 3QGMA 2O8FA 1H9AA 5JZSA 2W2MA 2VNSA 1JMYA 3F5SA 1DOAA 2FOXA 5ED0A 1LNZA 1YZHA 5L51A 1P29A 2BV3A 3H05A 4DAOA 3LECA 4LBWA 5ALDA 3LIIA 5IDXA 1EGAA 4G1UC 4V0SA 3D4PA 3ESYA 3H8VA 3NONA 5DYWA 1B8VA 5A62A 4C2AA 2JFVA 3NTXA 1MORA 4K1XA 2HBZA 5KDDA 3L1IA 1WPGA 3AL2A 3OIUA 1P4GA 4BGDA 4LKRA 4DNQA 3ACDA 1OIVA 2ENUA 4MAFA 4WNAB 5CYPA 1DT5A 1JTEA 3M2TA 1OAOC 2VBCA 2VNHA 2WMYA 2ZPUA 1TCBA 1Y6FA 4IMRA 3A36A 4CCWA 3UCXA 2Z9DA 4J1SA 3SEAA 4QQNA 1GLGA 4BNWA 3PVZA 1E0SA 2JCVA 3CG0A 2ORIA 3PC7A 4MIEA 4XIFA 4E51A 4EYEA 4Q4DA 4OKIA 4QULA 2HDWA 3ZNPA 4MVJM 1PJBA 1HURA 2IOFK 4FS8A 2DBYA 1K86A 2XKKA 3F6CA 1SCNE 1V8DA 5DLDA 4QQ8A 1KMHB 3DDCA 4LECA 3W8DA 2GA9A 1XAJA 3W06A 3NVDA 4TMTA 4FUTA 2H1OA 4RTJA 5DU2A 1N4DA 4RDXA 1O6FA 1KJJA 2JCBA 4I7EA 1H42A 2EYQA 4RW0A 1U7ZA 2Z83A 2COUA 1EJ6A 4BNKA 1Z68A 1L5MA 2YCBA 4MH0R 1E6LA 1LC0A 1WMBA 2GTIA 2RHHA 3DYVA 3OFJA 3GLHB 4HH4A 3M9LA 4R98A 5J5VA 3ZY5A 1D6JA 3RG2A 3RPEA 1N2JA 2XZDA 2W48A 5GJVC 5JSUA 1DIBA 4AZ0A 4BKPA 1GKLA 1VCMA 3KJNA 3WZ2A 3IEMA 1GVHA 3CUKA 2B8WA 3OLWA 3EG5A 4P3KA 2WIFA 4ZPXA 1A96A 3CCFA 3ZD8A 4R0MA 1OH7A 3B85A 3RWMB 4DDMA 1J2EA 3ETHA 3KU4A 5DTQA 3UZUA 4DR1B 5AW4A 1WSDA 4PRLA 4ZRDA 1NGSA 3H42B 1FYXA 4V38A 3ZHCA 1SVOA 1QFJA 5JI3E 1MABA 4Q34A 3UTDA 2FUEA 2FMFA 2UVPB 2C4MA 2O2HA 3O1LA 3OY2A 2DM6A 4IDEA 1JIQA 1PWYE 5J2TF 4YPVA 2ETVA 1Q1BA 4HK4A 1A1SA 1ENZA 3QPCA 2JLBA 4BZQA 1OX4A 2I67A 2QX7A 5F2EA 4F0JA 1XRLA 3E7PA 1D0SA 4NPHA 3OFKA 4AXXA 4DIMA 4GI2A 1E2KA 3IP5A 3JSXA 4AJLA 2FEAA 2O2CA 3JR7A 1JSCA 1S8AA 1VCOA 4MITA 1NN3A 4P6VF 5JO9A 1Y3DE 4C78A 3DAHA 1MEOA 1G8GA 2WYIA 1UM8A 4M7WA 1EBBA 13PKA 3RARA 1P81A 3CLTD 5DYYA 4HATA 4J91A 4B79A 3JS5A 4KBGA 4QGBA 2WFLA 4ZMSA 3PNLA 4RTKA 2X5XA 4OYYA 3LOQA 1WKVA 3NUZA 2KB0A 4AUMA 3BGIA 2YOGA 2A58A 5FOSA 3ANLA 1O94A 4WGGA 2ZRIA 1SD5A 3LK6A 2IUSA 3WRWA 2XH8A 1AGXA 1AK9A 5AKIA 1BWSA 3OEYA 1E3TA 1NXXA 4JA2A 4ASUD 3DBRA 3S27A 5JATA 4ZDJA 1SZDA 4J1QA 4KXNA 1QRDA 3EA0A 4MW4A 3H84A 4YJ3F 1VLZA 4BUJA 2OP0A 3COWA 5BQXA 1SXJA 1KJ9A 2EJCA 2PUWA 4X20A 3RVOA 2OK7A 3KJHA 3WMXA 3WYEA 4MB0A 4CT0A 3VYSB 5K3OA 5HF8A 5DYNA 1ZD8A 4YRLA 4D9HA 3ADCA 5HF6A 4GI3A 1RM0A 2QU7A 2ZCVA 4MK4A 3ILSA 3LO5A 4IFBA 3VTKA 1I6WA 2AJ8A 2EKDA 3NR2A 4PIMA 1QGUA 1CLUA 4KPFC 4Z7OB 5JCOC 5HNKA 1K7EB 3T6KA 5FEMA 2IS4A 1CF4A 3JQBC 1Y5LA 4BU0A 1D4ZA 2NV0A 3U3MA 4GOKA 1P2BA 2JGAA 2XF8A 5K3FA 2FN3A 2VHQA 2YYSA 4RETA 2GPNA 3GZ4A 3GEDA 2DFVA 2OHXA 1EFHA 4W8HA 5KQMA 1OYYA 3MN1A 2NV2B 2VPTA 3KR9A 1UMDB 4V1CA 1FA9A 1XWFA 2ID8A 2Y1EA 1AXRA 1QS0A 4EHDA 2EF1A 5EJFA 3U9SA 4QYSA 1P7PA 3C3AA 4GBGA 2UZ0A 2RGXA 1J25A 1U5AA 2LV8A 4QTTB 5C7YA 4OFXA 1NBIA 3MMZA 1GQYA 4GOJA 4LKOA 1SOWA 5INTA 2DFTA 2P75A 3IO3A 1II9A 4RE6A 5C3UA 2GPJA 5M2QA 3T7AA 2QW8A 5IAGA 1WDLA 2EJTA 4MV9A 4L4SA 2V3CC 1IONA 3CQ9A 4IDOA 1BJRE 3ZCTA 5K01A 3G2MA 1BE1A 4OHXA 4N5MA 1MG0A 5JJ5A 3AF2A 3RU7A 2G1JA 9MHTA 5ENZA 2H59A 3LYUA 3W2GA 2VSNA 3Q40A 1S4QA 1NV9A 2NVBA 3GNLA 3ED5A 3EQ7A 4XQEA 2XTNA 3KKNA 1IULA 1K0FA 1IQ0A 4KIUA 1E2EA 1G5RA 4M38A 1R5OA 3H1BA 1FRFS 2FG5A 2J9FA 2B9EA 4HXFB 1BEUB 2OMEA 4Q7KA 4JR0A 4EB6B 3O8OB 4MYSA 1UIMA 1R1DA 4MX8A 3IMEA 3U44A 1ZSNA 1NJ8A 3WNBA 5EESA 1SB9A 3SYNA 3ASZA 1VPWA 4HGYA 4E7PA 1XWWA 1SQGA 3O03A 1NQ5A 4BFWA 3EMBA 1PP4A 3CF0A 4FR2A 4Q16A 1S3IA 1Q3TA 3GLIE 3JARB 5FYQA 2HCBA 2NNLD 2Y8EA 3CUWA 2ARKA 3PC2A 2F3SA 3QEKA 1QPZA 1U1IA 3ZIAD 1FFEA 4Q4AB 3EVDA 4XYGA 4QDOA 1RI3A 3O82A 3FVWA 1GP2A 2MCFA 3UO8B 4YAKA 3H4MA 2GPWA 2HBQA 1S4MA 4W63A 1YVUA 3BL5A 3IQZA 2LE0A 3PUJA 3RYCB 3QY9A 2BUBA 2OSBA 4HWRA 2DFDA 3EDMA 2XTZA 2VSYA 1EFUA 1ZRMA 5ALZA 1ZAYA 1RR6A 4INOA 3ES9A 3KEMA 4PS1A 2JD2A 1HX7A 4PG7A 3E7FA 5LQRA 2CLIB 4W1PA 3L0ZA 4EZIA 3ICOA 4AQ7A 1E1LA 4RPHA 3MS4A 2H0RA 1DWPA 5C53B 1E98A 4C43A 5ALKA 2FWAA 3PX3A 1E60A 1NPYA 4LAFA 3OIFA 2ZAGA 4AJJA 1BA3A 3B6EA 2WKWA 3PQEA 4NECA 2ONKA 3T41A 1T6XA 4LGMA 2HK8A 3FMFA 3HABA 1FSSA 4YO8A 2B4TO 1Z12A 3BRQA 1O9GA 1IXZA 1THGA 4K9KA 3SHTA 2VK8A 2X1LA 2ZP1A 4LGVA 2HF7A 3RTAA 4J29A 3UCEA 1WUTA 4F96A 2YX1A 2EFCB 2PKXA 2PLRA 5DWQA 1AMNA 1JVBA 4CIAA 2Y3IA 2WF7A 4ERNA 4OMDA 3A1FA 3H16A 4UDNA 3T1QA 3QBTA 4QGAA 3LUHA 1C1XB 1N6IA 1Q95A 2Z1DA 1L5NA 4B2PA 5JCJA 4CCYB 1GLNA 4KWCA 1P1BA 3TKYA 3WZMA 3SSNA 4ZVUA 5BXQC 1OFIA 3EAGA 4KK4A 4K28A 3SYLA 1WV0A 4CG3A 1S0UA 3E0QA 3IKJA 2I4NA 1PG2A 2EV9A 3N3BC 1U3FA 2IX3A 2FLWA 2O8DA 3K53A 3REOA 2DULA 5CXQA 1L7QA 3FYCA 1TLLA 1GEEA 2WWHA 3K0BA 3ECCA 2PSDA 5E9WA 1XC7A 4XTRA 4D80A 4EQ6A 2I6QA 3ESQA 4FFOA 4CMHA 2JGNA 4JLAA 5E38A 3MWJA 2IYFA 1F6WA 1GNTA 2YWEA 4IQ4A 2MINB 1E94E 1FFBA 5ALMA 4ND6A 3LSYA 4H4EA 4M1QA 1U3TA 4J0JA 4UPVA 3T61A 1RWMA 621PA 2P40A 5B1EA 1HC7A 2GSDA 3FSJX 4QLOA 3SN6A 1N2EA 1AKUA 2CT8A 1X8XA 5DXJA 3ZU6A 1A8HA 1UXIA 4FBMA 3WJ7A 4BQNA 4G8CA 2FPWA 1ULAA 2UVPA 4BNDA 2LDBA 1E3DA 4F8EA 1T8RA 1KYWA 3SLGA 1OTHA 2DGDA 1MQAA 1QWOA 2WU3A 4CF6A 4IIJA 2FFBA 3MOGA 1ODTC 3VH2A 3SZUA 1E5TA 4BX3A 5BSHA 5KBYA 1L4GA 1AS3A 4H16A 4JJZA 3MBKA 3HL0A 1FBNA 1U0FA 4RJJA 3FLAA 4MZXA 2R1UA 3CXUA 3MXOA 5EJ2A 3H5VA 5KU1A 4CGYA 5T4HA 3WRYA 1QONA 3OOJA 3QG1A 2G9ZA 2H2GA 3MINA 4RM3A 3DS8A 3FIJA 3KKQA 1UQTA 4D3FA 2DF8A 3B6JA 2WTAA 4JHLA 3DQQA 5DHPA 4ZYLA 4KPGA 3IQGX 3F73A 2EZ8A 3HWRA 2CC2A 1GUFA 2QMOA 3GAFA 3JQRA 4MS4B 5DHSA 1HT2E 5AM1A 4RJIA 3TMAA 1NQUA 4HNQA 3TRHA 4C3OB 3DZCA 5E1OA 3VMMA 2IYZA 5MGBA 3FKQA 4MA0A 5H0IA 4DABA 1ACJA 4G25A 3K1YA 4Y30A 1XJWA 5E4FA 2G82A 1QFMA 1Z38A 1KIAA 3SX2A 2XA9A 1I7PA 2P3OA 3IAEA 3SVTA 4B0PA 4GOLD 2QSUA 4WDRA 3KPYA 1IPHA 4K9PA 4ESOA 3R9XB 1XP8A 1VHJA 2AYXA 1ECLA 3KDPA 1Y5RA 1A72A 2ATVA 1W29A 4RZ2A 4EHFA 5B6IA 2Z5FA 1B15A 1KPHA 1M1XB 1ZMRA 4XVHA 1VHWA 2HRRA 3TLEA 4YC7A 2BRUA 1OLUA 4H7KA 5EPUA 4BJ1A 1K6IA 3AFMA 1GTMA 4W7IA 5D01A 3OKAA 5EKXA 4JB0A 1PJZA 3QFHA 2IWHA 1L7RA 4JI5B 1ZITA 1OVGA 1RWKA 3FDFA 4MARA 2FKNA 3GPIA 1Z7WA 3FX2A 4GKKB 4E30A 1XUOA 4H6XA 4XWTA 1YRWA 2R3SA 1Y1SA 4AMGA 3EUFA 1Z0IA 2OPBA 4R9UC 3KZKA 5K3FB 3X1JA 1HF3A 2I22A 3ESBA 1C1DB 2Y9MB 2BGWA 2W6OA 1C8LA 4ARSA 4M88A 1T9HA 1I3LA 2GF9A 3ZCVA 1J07A 2HA3A 3KEFA 3HJCA 4B6OA 2RGAA 1E3JA 3BK2A 4BGIA 3AP1A 4FW9A 1II8A 2AGVA 5IASA 1L5LA 3B9BA 4RYDA 3AZQA 4XX1A 4FC7A 3QVXA 4DMFA 3ZDAA 1LPBB 4NV0A 2ZT6A 5P8WA 3U3ZA 1JSXA 1KXZA 1B8NA 3O47A 4BV2A 3H5LA 2OFWA 3PHBE 3ZZMA 4BNZA 3TGLA 3HACA 1JEQB 1OHHA 2G71A 4EVQA 1C7QA 3RHFA 1VKNA 2ZSBA 2AFIB 4WKCA 2ZPAA 5EE5B 1KFKB 1A7AA 1S89A 3C3JA 3OF2A 3AESB 3DQPA 5BMVB 1PNRA 4G0UA 4CN8A 3F7MA 4Z6KA 3EQ8A 1UWVA 1YIDA 2WTBA 3KU1A 3MAGA 3IO5A 2HSGA 5DF1A 1RHMA 3KXKA 3B6IA 1OF1A 4WESA 3ADBA 4J3FA 5K8UA 4GXQA 1T0IA 1A8UA 2GYWA 5FBRB 4NU6A 1TF7A 3P9IA 1ECBA 2ZRGA 4B7CA 2AZXA 1OXKB 4Y2PA 1M2NA 5BRNA 4HX9A 4LF7B 5B58T 1I7QB 3F6YA 3TIFA 4LDJA 4CKCB 4DJAA 3PWZA 2HSZA 1W1WA 4KYVA 4ZC1A 4P3OA 3KZCA 5JS8A 2H2FA 4GX0A 2HWYA 1N3BA 1WF3A 1OAKA 4LCEA 4HAXA 5B57C 5BPFA 3RH0A 2WUFA 3M5WA 3OHSX 1Y8RA 4KIJA 4RMGA 4BQQA 5IMSA 4AF6A 1CUYA 3W6ZA 1TD1A 5AVJA 1JFFA 3VR4D 3GH1A 3NHAA 1QMGA 4G24A 5A4JA 4MVYA 4E0BA 5FOVA 2B4RO 1MC5A 4J3JA 5FBZA 2XMPA 2IHYA 3VI4B 1QO0A 3OPXA 4L4XA 1BVUA 2HXGA 3RV4A 5B5SA 1U4SA 1IM8A 1J9EA 1T5DX 3HA2A 5KDLA 1XCOA 3IR7A 1TRKA 4QFBA 5E0KB 2PKCA 4LF4B 1L7XA 3N7UA 1YRYE 2ONCA 1Y34E 2VDKB 1TEVA 5EZ6B 1CW2B 1F4PA 1U02A 4K46A 1TYZA 2ZSAA 1COZA 3AGQA 2VC2B 4R1PA 3U81A 2LVBA 5K0JA 4JKIA 4WVLA 2JHFA 1U7TA 4K9SA 4FGUA 2Q7DA 4KLRA 3WWCA 3ZS8A 1E0DA 2EWMA 2FDRA 3CNEA 3IUNA 4AW9A 4BB6A 3T4XA 3DD1A 1E7QA 5EIXA 2ZULA 1SBCA 1XTJA 4PO3X 3GXBA 1A88A 1Z62A 3C97A 4MGIR 3W6NA 5J5AA 2VDJA 2ZJ4A 4BNTA 5KYWA 1HK7A 4YY3B 4F86A 5JSHA 1MV5A 4JP2A 1V6AA 3EHDA 3I52A 3CNBA 3KR2A 5I8ZA 1KRHA 4KC0A 4G5XA 3JWIA 1R0SA 3LH5A 3COJA 1TO6A 1KAMA 4MPDA 3LHFA 4RXMA 2P1DA 2H85A 3K4PA 2NW6A 2C2HA 4JIMA 3U48A 4EOGA 1GTRA 3U17A 2UV8A 3L49A 2XD4A 2NXEA 4FEGA 1LV7A 1E3MA 2JVJA 4B4KA 2QRUA 2IUEA 3RS4A 2M2IA 1NG1A 3C8UA 3SSMA 3LT0A 1UOPA 1FMCA 5CTJA 4JJ8A 4QVIA 4OVKA 2Q6KA 4M6WA 3O90A 3C4QA 4ASUA 1QRTA 2PUFA 2A5YB 1LBTA 3WMFA 4KJXA 4B31A 2YV1A 3H11A 4DLAA 5AM3A 2IOYA 3UXMA 4F6LA 5CXUA 3B89A 4HFRA 3EPRA 1DFIA 1QHGA 4DVGA 1Y1TA 2A7QA 2AFRA 4CJXA 1NVWQ 3N8NA 5HKKD 1VFPA 1S3FA 2D6FA 1PT6A 3I92A 2VKQA 3A6HA 3IUMA 2V9PA 2F17A 1RIFA 5C0OE 2IH2A 2NADA 1QYWA 4UXHA 3S44A 1TAQA 5IMBA 2HQRA 2P91A 2WD7B 1ZINA 2WZQA 4ZZ1A 4YJ2A 2QL7A 4P0QB 2C31A 2ECQA 2WLSA 4MDFA 5FAXA 3RAFC 2O5EA 1BYUA 3K09C 1HZZC 3RVPA 5IHPA 2JHCA 4HLNA 1D4OA 4ZVNA 4MW0A 1NY6A 2FWIA 2XT0A 2YC4C 2P41A 4H1VA 4Y9TA 1XPUA 1YD7A 4CWAA 4N01A 1NJGA 4ZD6A 2FHSA 1FS4A 1JFSA