3WISA

Crystal structure of burkholderia xenovorans dmrb in complex with fmn: a cubic protein cage for redox transfer
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
180
structure length
180
Chain Sequence
FKPDARFAWCVTGSGHLLDESIALALELPRADLFLSAAAEEVLPLYGWALPRLRKHFRVFRDNSASGVPVGMLYHGMYHTVVIAPATSNTVAKCAFGISDTLPTNMYAQAGKQCIPGIVFACDTEPTVVTQSPNEWVELRPRAIELDNVERLSRFEYTTLVRSLDELKAALGERLSTLDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative dihydromethanopterin reductase (AfpA)
publication title Structure of dihydromethanopterin reductase, a cubic protein cage for redox transfer
pubmed doi rcsb
source organism Burkholderia xenovorans
molecule tags Oxidoreductase
total genus 62
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2013-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02441 Flavoprotein Flavoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1950 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Flavin prenyltransferase-like 3wisA00
3QJGA 2EJBA 4ZALA 1E20A 3WISA 4ZAVA 3MCUA 1MVNA 4ZANA 1MVLA 4MWGA 1G5QA 4ZAZA 1QZUA 4ZAWA 3ZQUA 4ZAGA 4ZAXA 4ZAFA 3LQKA 4ZAYA 1G63A 1SBZA 4RHEA 4RHFA 1P3Y1
chains in the Genus database with same CATH superfamily
2QVXX 4KWIA 3AEKA 3DEJA 4C4OA 1FSGA 3ROKA 3TG8A 3QKWA 1XDZA 4BNIA 2UV8A 1WY7A 1RI3A 2VP9A 4IDOA 1DJOA 4JLAA 1KMQA 1N5MA 1YR9A 4O2BF 1K6IA 3RRJA 3TKYA 2E87A 2NO4A 4DWVA 2AMVA 2UZ0A 4GPBA 1AUVA 2PQ2A 5DTMA 4Q9NA 5ENDA 2EHJA 4LZLA 4R01A 5AVXA 3VPHA 1SPXA 2MR6A 3ZGYA 4AYTA 2DWUA 3H84A 1D6JA 2V8BA 2J45A 3UK0A 4X8OA 3ZWDA 3MWFA 1M1NA 1QE0A 3L1IA 1PYOA 3L0YA 3L7LA 4G1VA 1E0SA 1O96B 4KE8A 3SHVA 3HJBA 1DXOA 2JI9A 4YTEA 1QRRA 4BAUA 3FFXA 5JV5A 3A6LA 2JG3A 3ZEAA 5LPNA 2I87A 2P8JA 3DEAA 1ZAYA 3N8GA 4YCBA 3CINA 1J8VA 2RG7A 2YC4C 4B3BA 2I1WA 2Z43A 3DFKA 4HI0E 3NHPA 3JZMA 1UPFA 4PAOA 4KLAA 5F73A 4LYYA 5IT5A 3L1JA 3OLVA 3QNUA 3PQ7A 1Z0IA 4JLOA 3OCWA 5EIBC 4LNAA 1NVDA 5KTRA 4KNWA 2ZXEA 3ADDA 1ZD5A 2I4TA 3EEQA 2E7ZA 2R8XA 1X9IA 4BKMA 2HJVA 3LY7A 2C07A 1VPDA 2HIHA 3SJ7A 3IQHX 2G5CA 1V8DA 4KMMA 2WOJA 1BXRB 3GA0A 4Q3OA 4MXDA 1QHHB 2HMYB 1W85B 5HFNA 3KXDA 2VHVA 1E32A 2CN1A 4FILA 4JT4A 2WD9A 1FFXB 4PZPA 4PSUA 5BN5B 5ARCA 4F45A 1AJEA 1F14A 1YZTA 2JAWA 5AM5A 3FROA 3PC6A 5EE5B 4MB6A 2XUFA 3I8SA 1S8OA 3IEIA 1LX7A 5JRZA 1ISJA 1E3TA 1LBIA 5TGZA 2DPGA 3W6OA 3VR5H 2R47A 5B7QA 2Q1SA 4G0WA 2O8EA 3EOZA 4MWEA 2QU8A 4R0MA 1YCFA 4NCKA 1I6WA 1YF3A 4LHYA 4LX0A 1G9XA 2ECKA 4PGAA 3TE7A 3TNJA 1W8DA 4EG4A 4ZEMA 4PO3X 3OD5A 2AL7A 1KS2A 2R9VA 2NU6A 3B1VA 3CTMA 4BB0A 4UDYX 5LBUA 3CISA 4MUMA 3SF8A 5EWLA 3V3TA 3N0RA 2NUBA 4YRKA 2IS2A 1OFVA 5ILOA 2BI4A 5BQOA 1B73A 1P19A 1I9GA 2IFTA 2QM3A 2OUKA 2ORVA 2P2ZA 4DLUA 4MIEA 1E1LA 1NWHA 2IYZA 5DNEA 3SBXA 1RJEA 3G82C 1W0KA 2QE7A 5C34B 3EGWA 2CK3D 1QGYA 4RK6A 1XVIA 1XALA 3LRTA 3E81A 4Z9XA 4OO3A 2R3SA 3HJGA 1NF9A 2F1RA 1FYEA 3RROA 1PBNA 1V3QE 2QMOA 4RV9A 5K2MA 4NS1A 4ER7A 3HU1A 1US8A 2XUZA 1OLXA 4J7CA 3X2SA 1K86A 2C84A 4RJTA 2QX6A 4QTYA 3I01A 3CR8A 1CUDA 4UARA 3RYIB 2O8VA 3RF7A 3T54A 3I01M 4ZV9A 1Y7PA 2OKCA 1FYDA 1UBKS 2XITA 1I3CA 1KH2A 2QGZA 4N8DA 1CQJB 2J87A 4P4NA 3AXSA 3UJHA 1U98A 4BP8A 4L8WB 3M1AA 2E1PA 3MXTA 2AN3A 4LXHA 3GF4A 3REQA 3D6VA 4UW9A 4R05A 2AG6A 1NQUA 4G41A 4KDEA 4LOAA 4LWPA 4GX1A 3GCZA 2DHQA 1X7YA 1FLNA 3JVUA 4O4JB 3UTDA 1A7JA 1MRZA 2PVSA 4NLLA 3ZDRA 4B3JA 1VSBA 2HTFA 5BR1A 2HQRA 5EXTA 1RW4A 4X1IA 3AR4A 3FTQA 1AQNA 1XTSA 4XIIA 2ONYA 5AQ1A 1T6NA 3A14A 3BK2A 4LDNA 4WIAA 5JMOA 2UUBB 1C3JA 3FAZA 3MTJA 4Z6KA 1TKCA 5DO9A 3GUUA 3IQEA 4K05A 5EMMA 2CL5A 3Q6MA 1I7PA 3LQKA 1MD9A 4X8LA 2BFCB 2R96A 1BXKA 2FRXA 1QTQA 3V4LA 1RRMA 5H9VA 1IY2A 2JW5A 4E7PA 4PZYA 2BM9A 3KOWA 3VHLB 2JANA 2VRCA 1ZJJA 2W2OA 4P7JA 1QVWA 5F77A 2IYTA 3ZQKA 1ORTA 2Y2VA 3R7AA 1N2OA 3GT0A 2GLTA 2ENWA 2QORA 4JP5A 4MUYA 4N6GA 5TMDA 4F60A 5L45A 5KAPA 3TLYA 4MB0A 4TV8A 3KFXA 4L9RA 4QUGA 1I1NA 4AJ1A 2QZJA 2O48X 2IX9A 2JHPA 2WIBA 4L74A 1L1QA 1C3XA 3PIDA 4OL0A 4PYNA 1U31A 3HE3A 1XEXA 3F4BA 4UTVA 4ZTUB 2ZDGA 5DMHA 1KKMA 3JASB 2INGX 3IUBA 2NM0A 4O8ZA 1HOTA 3LQ2A 1CJTC 3P9NA 4PX9A 4YQFA 4M1ZA 3JQDA 3TOSA 3VOBA 2GNPA 4IXWA 4M9CA 1IU9A 3BA1A 4WGFA 2C3UA 2FSUA 3FOEC 3HEBA 4F84A 1QH1A 3WWDA 3GJ5A 4ND8A 3OD1A 1MXHA 4N3BA 2OGTA 3OQJA 4P81A 3OP1A 4LHEA 5A4JA 3S29A 1D1TA 3SXUA 4FB4A 3ZVMA 2XI4A 4KK4A 3GEIA 2GCIA 4YCLA 3OTWA 2FFRA 1UKBA 3A1VA 5FPTA 1VQ1A 4RTNA 3WLLA 2W00A 4IIEA 5F1OA 1X7ZB 2QAJA 4X54A 2XBUA 4N54A 5C8ZA 1W0JD 2QTBA 2CMFA 3G6KA 3J7AC 4DLBA 3KQLA 2IZ0A 1DHTA 3FLBA 3FNIA 4LXYA 1L8XA 1OHHA 4MLPA 3BIOA 3NTOA 1D6NA 1EVQA 3JRNA 4H3KB 4S0ZA 3OEWA 4ZTBA 4IQFA 3RUCA 4KUEA 4FB5A 3DBIA 2IW1A 3A0RB 1NURA 4I3FA 4CI0B 5CH3A 4L5AA 1MVNA 5KIAA 1JH9A 1TGYA 3IMKA 3IP9A 1GCGA 1J20A 2Y9PB 1Y5RA 2FI1A 4AWBA 1TZJA 1F2VA 2QSUA 5B4UA 5JXGA 5DHUA 3CE6A 4ARSA 1ZMOA 2R66A 1ZGHA 3WNVA 5F2NA 2FZVA 3UQZA 3B51X 4Z0HO 4JZYA 2FXVA 5D3MA 1SOVA 5EJGA 4WZAB 4ASUA 2ZROA 3DLHA 1E63A 3ZHSA 2QSZA 4WUTA 5JY1A 5BN3A 3F97A 4QDZA 3SZRA 5D5QA 5WRFA 4AWAA 1U81A 2L69A 3GLVA 2B1IA 2LRHA 1WULS 2PV0A 3H11A 4HVAA 3HA2A 2ZITA 3RGWS 4MARA 1HYGA 4MMZB 2ECOA 5ALMA 4DHEA 1YXMA 1UCFA 2JVIA 3DUFA 2FR0A 1ZI9A 1QV9A 3JWGA 3U7RA 1D07A 3ETGA 1CT9A 3EXIA 3BB1A 5CA0A 3MRVA 2QLLA 2R7NA 3VHXB 1FDOA 4CMIB 4GWLA 1U7WA 2ES4A 3IMGA 2NP6A 1Y33E 3N5CA 2JLXA 3NV9A 3UK6A 1AHNA 1TPZA 3FLAA 2PS1A 1Q0RA 4IQ8A 1BQ4A 2VS1A 3FJYA 2ZUTA 2XT9A 2WJYA 4QBIA 4RHEA 3CUUA 1LGYA 4NV3A 5JZ9A 1JB9A 1MTZA 4KR7A 2VO1A 2OMEA 3O92A 3RFCA 3TD6A 3THOA 3TDMA 4CF5A 6ADHA 3FWZA 5M04A 1XQXA 2GUGA 4GSKA 4JBIA 1HGXA 1N6OA 1ZMXA 3CKMA 4XB2A 1U2RA 2VHUA 4IEIA 1UBUS 2DETA 5AI4A 1JT2A 2B30A 1CUBA 3CW9A 3GZNB 1CB0A 4RLFA 4F96A 1A7UA 1I80A 1RVV1 1Y6ZA 2FQWA 2P78A 4ZQHA 3VYVA 4EHBA 1KRXA 3EIEA 1T0PA 1TEHA 1JDPA 1WX1A 2IHBA 3IUEA 5I3ZA 3KYDB 4B34A 1KK0A 2QVZX 3K73O 1DTWB 1E3MA 5T64A 6CHYA 1TTQB 4TRMA 2BPOA 2K7ZA 1PIWA 4E03A 5JOQA 1SBZA 1VGQA 3SLRA 3CLHA 2ZBVA 1MO2A 2AGVA 4D4KA 1G1MA 2JA1A 2R4UA 1SC1A 2VIIA 5IHPA 3OLCX 4BFCA 4WJLA 1XJ5A 3SC6A 3G2HA 4ZRDA 5AM3A 1KSFX 2WPDD 4PICA 2JATA 2Q5JA 2XTJA 1XNJA 3DCNA 1ZL2A 3AB8A 1XJ0A 3VI4B 3HY3A 4HFRA 5D6OA 4OHXA 2EXXA 5FBKA 2X4GA 1V3UA 5AW3A 1OE0A 5KREA 2ADMA 3NKFA 2V3WA 3AQIA 1PLLA 1RMTA 3VVBA 2FRVA 2X8JA 2F1KA 3JQQA 1WLYA 2V7BA 4FR5A 1EG2A 4KFTA 4J0KA 2FX3A 1FC0A 4BP3A 4IZOA 4AULA 1HDYA 1O6GA 1YBFA 3NS7A 4RQUA 3GFQA 4XX1A 4B6JA 4JI5B 3PRYA 4NONA 4WDRA 4HWPA 3PNVA 2WFLA 1SB8A 4M0CA 5EJFA 1A88A 2VHTA 3GFPA 4DLWA 3IT2A 4LJYA 1FYFA 1EFDN 4QGBA 5A5GA 3TEJA 4MW0A 1DX6A 3LOQA 1W36C 1FP7A 4UTZA 1NVMB 1U0FA 1XTRA 1EFVA 1U9JA 3GT3A 1KEKA 3ELBA 4AZ0A 3OLWA 2J0UA 5BMVA 1AKMA 4R1NA 3I9FA 3BCSA 3DBRB 4OFWA 2PSSA 4X97A 5UKDA 3C6XA 3GU3A 1ZU5A 2GCEA 2X13A 5I4IA 1MW8X 1RJDA 2HEIA 3DQZA 4JVMA 4Y2YA 2FB9A 3TVTA 3KYJB 1UT5A 2O4CA 5DHSA 4DDVA 2C98A 5E7QA 3FTPA 4OGLA 1OV6A 2AFHA 3HYCA 3DWEX 5FI3A 1BHQ1 3IAS1 4J3FA 4ZTZB 3FAKA 2XYQA 3MT8A 4MA0A 4CQLB 3I0ZA 4DF3A 3TB6A 3MSXA 1G4AE 1SN7A 2FPMA 1KU6A 5CLQA 1YRHA 1Q20A 4K6GA 3QG1A 1HQCA 2LR0A 3FFAA 2H9AA 3EZ6A 2J3JA 1U1IA 2I6FA 3A9VA 4D8WA 5B3JC 4MHTA 3L93A 1BA3A 4RH3A 5HZKA 1YDWA 2EX0A 3B1ZA 1U3CA 3BS4A 1ZK3A 5ESWA 5DCLA 3OZVA 3QEKA 2FEPA 1CZOA 1BDJA 4BXOA 4MV8A 2QLTA 2FPPA 1DKUA 3AUFA 4OM7A 3VVCA 4JBGA 4LDAA 2MDTA 2CJXA 1E6LA 2JGEA 3DOHA 2PZKA 3JQFA 3PJFA 2JHCA 2DQSA 4MWSA 4UMVA 3LZDA 1OBVA 2B0JA 1JQJC 2R5WA 4P82A 2WD7B 3PHIA 1H0SA 3VOAA 1P7ZA 2G09A 5K8CA 1KVTA 2NO5A 2PEZA 3G9QA 4J0DA 1B14A 3DKKA 5CBPA 2FCAA 2VQEB 3LQFA 4G26A 3MSCA 5EKSA 2IHUA 4EGAA 4M0LA 5K4GA 4C7BA 3FI9A 2D5CA 2JEOA 3L01A 4LYGA 4A8TA 2XKJE 4P92A 2QMUA 3SX2A 5HK8A 1W35A 3AFHA 5LQKA 1Z6ZA 4GQAA 1QC5B 2VCEA 2GZ1A 4KGVA 1C0PA 4MS3B 4POAA 5DMXA 4B81A 4MLDA 3GJTA 5K0GA 1ISFA 1BTOA 4XB6B 5A03A 3E7XA 3KHKA 3EFOB 2JI6A 3TTXA 1HEUA 4A2CA 1JWAB 1XDSA 4JXJA 3LLUA 4RY9A 1VMKA 5KVVA 3M3PA 3K15A 5CIWA 1KS9A 4R8VA 1GPBA 4DUYB 1N6LA 1ML3A 3MAAC 4TRRA 5D3QA 4JJFA 4CKWB 1Y1KE 1Y8RA 2R2GA 1DADA 5GGYA 2QTVB 2WJGA 2B6NA 3ESYA 3R3JA 1BN6A 2GPNA 3GJRA 5HRAA 2WTXA 2ZRMA 3DDHA 4Z54A 4A6DA 4AJ2A 3ER8A 4Z2AA 1DKRA 2BCEA 3A9RA 1G21B 2FP4B 4OATA 3DD5A 2WSMA 3JWEA 4Q4HA 3C5VA 5P21A 1G38A 3EQZA 3HBJA 1JLMA 4BTVA 4OQPA 4MO9A 3AF2A 4ZC1A 1ZW1A 1N4DA 2V5VA 1DVRA 5HKOA 3AW8A 4MO2A 4A8HA 2G72A 4BO4A 5IH7A 3AT1A 2FPWA 5M5BA 3OX4A 3HS3A 2JCGA 4BQFA 3EPHA 1Q11A 1W4RA 3D02A 4EK9A 4C4XA 1QH8A 4U1RA 4N41A 4KIJA 4TQGA 3VNQA 4J4HA 2BEWA 3ET5A 3H0EA 2IYQA 4MS1A 3DWFA 2BFOA 3GBVA 3LSTA 3UK2A 4DXAA 4L8FA 1IY0A 3TCKA 4XJXA 4BKRA 7MDHA 2O8BB 1CQIA 2PFSA 2ZBFA 2PIAA 3WYDA 1RM4A 5C32A 5IDXA 2D06A 2VXYA 2WM3A 2WV9A 3EGOA 3ZK8A 4ER5A 2N1BA 2BKLA 4L51A 3HZHA 1H23A 1ZUHA 2ECQA 1Y5IA 2XAAA 3MNFA 4R2KA 1NY6A 3RW9A 4RVCA 1Z73A 3DV2A 4B4WA 3F73A 3QITA 4YDSA 4XWTA 3EBOA 2CEKA 2ZRKA 2DLCX 2VUIB 4YFVA 5TS3A 4EYEA 3VPCA 4XPIB 5JUWA 5CEFA 1D4AA 1E7SA 2W4MA 2Q9BA 1NRWA 3HCDA 4UATA 1LDBA 4W7HA 3UC9A 4EJFA 4NU0A 4UBJA 2ZJ5A 1J0XO 5DYIA 1RJ9A 3SFZA 3C6MA 4EL5A 3NMUF 4OHPA 3T0FA 2MMGA 3CZ5A 4M98A 4RCVA 5A7HA 3QXHA 1CUVA 4GI5A 4RMJA 4DIMA 2MSKA 4ZICA 1ISRA 4U7WA 2YBDA 1GZ4A 3OWXA 3AEQA 2PGOA 1IMJA 5KNLA 1QP7A 1GZVA 2XPCA 3LIPA 1E0DA 3QIVA 4GPIB 4D8VA 1V3VA 3QFCA 3CZQA 3EIOA 1V37A 1XD2B 2A67A 2IL1A 1Q0TA 3T5BA 5TF0A 4PLWA 1YC2A 3TVDA 1M83A 2BGMA 1QQTA 2CNOA 3TL3A 3ZDAA 1I4DD 1O54A 2ZJFA 3IP5A 4MV9A 5HDBB 1VMEA 3HKEA 4G85A 3T3DA 4DIOA 2XGMA 1ZJZA 3UAWA 1GY8A 2OZEA 2QF7A 4PW0A 1EVKA 4HYYA 1X15A 3QUQA 2WUVA 2WJ6A 1QPGA 3GNSA 1C29B 1G5RA 2AUMA 2H1OA 1FDWA 3T15A 3FMIA 4RA9B 1XNRB 2A1IA 4JJ4A 3CRW1 2YXEA 7GPBA 1I10A 1NVTA 2VC2B 4F1JA 2J1LA 2YJTD 3B7GA 4IL5A 5FTKA 4AN0A 5JROA 1WMFA 9LDBA 3GP3A 2BT4A 4P35A 4BFVA 2HA3A 1XNGA 3RVMA 2XEDA 4BN5A 1HSZA 4B6QA 1C7QA 2P4QA 4I4TF 3PDCA 4Q1FA 4DEYA 2JS7A 4LPKA 4DCVA 2XMPA 4UFOA 3BSWA 1XN4A 1Y81A 3V2UA 4GBJA 3LKZA 4RF4A 1E5QA 1G5PA 1OWPA 4JENA 4YXWA 4HQRA 4MQFB 5KTMA 1HDXA 3QEBZ 1H9CA 2W2KA 2WICA 4YRQA 3WG9A 3BERA 4GAEA 2W11A 5BW6B 1JAYA 3EHEA 2AQKA 1WB9A 1V47A 1UT8A 2IHYA 1UXGA 1SU4A 1BC5A 1H4QA 2W5UA 2IODA 2PT5A 2ZTMA 4UVDA 1T9GR 2XXBA 3ENZA 1F2DA 4RX1A 4WFQA 2O4UX 1IUOA 1RKBA 2C2XA 4R1QA 3TKLA 5K0JA 5EIBD 1FJHA 3HL4A 1THMA 2IYSA 2ZFUA 5KTTA 2P0YA 3A1UA 4LFCB 5ALHA 4M22A 2FWNA 1Q3HA 3ITEA 3KZXA 1KO1A 4HDMB 2JI8A 3V4FA 4MEJA 3HBNA 3DE1X 4O2AB 5A4MS 2NMVA 1BVYF 1WVGA 2XGSA 3WLOA 5SY9A 1OA1A 2G1KA 2YY7A 4TMYA 4EJSA 1ZWKA 3SIPA 2WVJA 3G7NA 2IV2X 3UPDA 4E7OA 1RWKA 3NVMB 1KK1A 3TD9A 3C1AA 2OXRA 4QUDA 3D0RA 3N39C 3ORRA 3QNMA 4CN8A 3QMVA 3FLEA 4DV7B 2ANCA 3QVOA 2CHUA 3JAKA 4JH0A 1S8AA 4ZT5A 2GILA 1SWVA 2DT5A 5HE9A 4E0BA 3KQOA 2NUTB 2JFQA 4JY7A 2ZEJA 1NXSA 2ZQYA 2VDWA 1RPNA 3MMXA 4RM2A 1BCSA 1E2GA 3GPDG 4G5SA 4YC7A 1S3GA 3EGDB 2CD9A 3MMNA 3OEHA 3RFUA 1R4MB 4NJMB 5K20A 4QWWA 5L3SA 1YL7A 5ERXA 5D1NA 4AY6A 3SDZA 3AM5A 3VU8A 4E88A 1XBTA 1E4EA 2RH5A 4ALIA 3SEQA 1MX3A 4UQOA 4WW0A 1NZDA 1PAUA 2BCJQ 3FCYA 5DYYA 4DQDA 4NDAA 4M1OA 4FHDA 4DQLA 1GHTA 2PYIA 1CTQA 2ZG6A 2ZI5A 4G2NA 1D04A 1U7UA 2XZPA 3KD2A 4BNKA 1KXJA 1AE1A 1M6EX 4KWEA 3ZE6A 4HDAA 3W9UA 1E3WA 3ZD6A 1JSLA 2I2XB 1T8PA 4R7GA 5JS2A 2ZSBA 1JDSA 5HIKA 4TWZA 3ZCRA 1C7JA 2WVAA 1P5FA 3G5LA 1L4HA 1R10A 3LUJA 2PX0A 3VR2D 4TXLA 3IHTA 5DHRA 2Q2OA 3DLTA 2RGNC 2RGWA 4O29A 4HLUC 1XA4A 1YH3A 4GUAA 1U0LA 3ICWA 2O5VA 4FXPA 1DX9A 4RD3A 2P9GA 1M1ZA 1I14A 4BE9A 2VPIA 3QOFA 5B7GA 1U4SA 2IZOA 1AB5A 1EXMA 3T7SA 1B00A 1K06A 3D6NB 4DAEA 4C5BA 5LU8A 1KI6A 4EF4A 4HLDA 1UMDB 5I5GA 1ZRNA 2PUVA 3OIDA 3R7DA 4DIKA 3BRWA 2GF9A 4RFSB 1CSEE 1GVNB 4IGAA 4X20B 3U3RA 2D3WA 4G9BA 4AO6A 6AT1A 1EX6A 4I9UA 1DJMA 3AR5A 1LEHA 3C0KA 2JHAA 3G89A 4Z0NA 3TZ6A 2TRSB 4A27A 1Q0SA 3GA5A 1AURA 5IAOA 1W2HA 4JLMA 3WMWA 4K1XA 2ZIEA 4FGSA 1YI0A 1X0VA 2AD5A 2QRMA 2XB9A 1B3BA 4D3FA 5I4CA 1Z4OA 2OBNA 2UVDA 5MN4A 2Q7OE 3PPWA 1CP3A 2OUIA 2B4QA 1ES9A 1ZVJA 3DPSA 1CJSA 2HSEA 2H2GA 1VIVA 1VFNA 4PQYA 5HOQA 1OT3A 1NVAA 1R6BX 2JCVA 2QRLA 3IAHA 4DQVA 4X6XA 1ZOIA 3TTVA 1SXIA 2HEGA 3G2OA 1VYTA 3CIOA 3FHOA 4GLFA 4KUHA 1JYEA 3K8QA 3VPBA 3GVPA 1QCYA 4X3OA 4D1YA 2HWKA 2Y1LA 4O25A 3QJYA 4C7MA 4FM9A 1HZJA 2ZSIA 4F5DA 2WRZA 5K4HA 3WWOA 1ESCA 3WAGA 2OEPA 2PA0A 4LBZA 1SURA 4O4LA 3JRXA 3KKEA 3FZEA 4DEVA 1I4TD 3PWZA 3OQNA 2XHEA 5FH9A 2I33A 4P7GA 1W8IA 4HGPA 3WWYA 3L0SA 4DJAA 4W5OA 4NCAA 3DAFA 4ZCPA 4EG0A 3DOOA 1P0CA 3DM5A 4JP8A 2N3ZA 3T7RA 3PQ4A 3CB2A 3CUWA 4P4SB 1N32B 3P9ZA 1E2FA 1QNLA 3TQFA 3WGKA 3HBLA 3HY6A 4EW1A 1R8SA 3ESBA 1KEVA 1KEEB 5LA6F 2W0MA 3TZEA 2BI8A 1WNFA 3V4SA 1G8YA 3GROA 1EK1A 1C1DB 1U28A 3LGAA 2XDYA 3MT9A 4GR9A 4PLCA 1UPXA 4ZOBA 4DIBA 2UUAB 2PMEA 3RUIA 1DI0A 2OXFA 4XTRA 2FHSA 3SYNA 3VZCA 5KOYA 3WKEA 4GZ6A 3HB7A 2IXDA 2VJKA 3IHKA 1QYIA 2E4WA 4OHCA 4YLYA 3BXPA 4S2EA 3WGIA 4UAGA 4A8JB 1PJRA 3QUSA 3WIDA 4NBRA 3RT9A 3ZW9A 4YUAA 3LWDA 4CT4B 3RT7A 5FBLB 4C7OA 1TO1E 1K5PA 2JL1A 3UPUA 1QR6A 3TZHA 3AZOA 4ENQA 4X7RA 1ADJA 1PF7E 4UDNA 2JFZA 3RVJA 2M32A 4NZZA 1DU4A 2OQIA 1G8KA 4E30A 5CDTA 4FFOA 3M83A 5EPOA 4LZOA 1YHNA 3CM0A 3F5SA 2P2LA 4P34A 1ORDA 1RPAA 3KR0A 4IJVA 4JGGA 3OTQA 5L53A 4KPUB 3BL8A 3T9DA 3FSJX 4QXMA 1XK7A 4NPAA 5EUCA 1NR7A 3WB0A 5EMJA 3MWEB 2IK8A 4EB6B 2XECA 2COEA 4FNOA 4K8OA 3ZX5A 2F4NA 2IYWA 3Q3EA 3E82A 1V8FA 3GLHE 1Q6YA 3LE8A 1ESMA 3Q8WA 5YASA 4GG1A 4YMLA 3MLBA 3TTUA 3DFZA 3AVYA 1QMPA 4JA2A 5TDHA 3RHTA 4DCGA 3VDMA 1TK9A 3NJ8A 2BEUB 3I5XA 5LYJB 3PUHA 4FDVA 3ZZ0A 4TKUA 3RB8A 3LY8A 1N1GA 4JKIA 1FQJA 3V6MA 1TM3E 1Q84A 1Z4IA 2Z9BA 4FOLA 3FR8A 1EG7A 1ZINA 2NSHA 4IXMA 2J6IA 4MR9B 4QUBA 1L5KA 4PG8A 1YB7A 2FPRA 1AUPA 3L8EA 3UOGA 1J9ZA 5A5VA 5SYNA 2GN8A 1QVZA 2OC4A 2EGUA 2L17A 1OFGA 4PHFA 5EYPA 3CX4A 4DR3B 2P69A 2NUPA 1V5FA 5J2UF 3T12A 5CA1F 1HZZA 2EGGA 3AL0C 4KVFA 1N2CA 2OZLB 1S3IA 4H35A 1WE2A 3T4XA 1JIUA 1SBNE 2FRDA 4H17A 5LQAA 2Y0DA 3PJRA 4JVSB 4FMBB 4QXQA 1TX4B 1I7QB 1ZKDA 1GXSA 3WR5A 3EXHA 1SXJB 5IJ0A 4JJAA 1N2XA 4OI4A 1E3IA 4Q00A 3WJ1A 4EYOA 4Y1RA 4PPGA 2QQFA 4B4UA 4QBKA 3TMAA 3EH2A 2YYYA 2BR5A 2WU8A 4FS3A 1YQXA 2AZMA 3EAQA 2AOXA 4KI7A 5G0UA 5ADWA 4YJ2B 1DIHA 3M4XA 4CDMA 3THRA 1T3GA 4YUWA 4ZU1X 2CJFA 3ST7A 5D5PA 2H63A 3ED5A 1EDDA 3AERB 3MHTA 3MRXA 1NUTA 3Q5EA 2X3FA 1CK4A 2W2PA 4FZVA 1M6VA 4ABYA 3O91A 3R3HA 1IWPB 1SBIA 1UUFA 1YKGA 4QNNA 4FW9A 4UOQA 5GTDA 5JJ5A 1WUTA 2RGEA 4C78A 3G17A 2F3PA 3BEOA 1E9VA 4L2IA 4RMIA 1XCGB 1Z4KA 4N49A 4C43A 1Y9AA 1ZGCA 4Z9AA 3WDSA 4DLKA 4DQXA 5IXJA 4A82A 5KKCA 5BSGA 4R0NA 1Y5NA 2ZZKA 1H2EA 2OR3A 4M0DA 5JT1A 3DNMA 4CLXA 3MF4A 1EB8A 2OLEA 3EUWA 2G7MC 1W52X 5AJWA 1EFAA 2WIAA 2JCXA 2VPQA 3M1IA 4C2TA 3RBXA 4DM7A 1MZPA 5BPFA 3NHKA 4XLLA 6Q21A 1RI1A 2FU5C 4OU5A 2FLKA 1SBTA 5KEIA 4K6HA 2WF9A 1K8RA 3R3WA 2HA0A 1KHHA 3JSAA 3A6KA 2OHXA 3TOCA 1DBVO 1DTEA 1R16A 3OBIA 4WZBE 4FHCA 1T34A 1BE0A 3G9XA 1R3UA 4BC1A 2VHYA 4M89A 2X5XA 3TL6A 1N8TA 3N2LA 3PXBA 4D6YA 1FNNA 1T3ZA 4KTVE 1W36D 4XIJA 5FCDA 3RLIA 4EW6A 1WF3A 5MN6A 2DCMA 4HDNB 4DCUA 1ZI8A 4K6CA 1RYFA 1GL7A 2HT6A 5HSGA 1KJ8A 3Q7PA 1A2QA 3FWHA 3GARA 3H87A 2ADOA 1Z8DA 1FU7A 3C70A 4QFCA 1T3HA 1DQPA 1Y48E 4QG7A 5IABA 1NOKA 2QP9X 3DKVA 1JXQA 1I3MA 2WJPA 4I4CA 3PZBA 5DHPA 1F8GA 4MIKA 1AU9A 2RIPA 5KYXA 1U9ZA 3PUIA 3IR6A 5TPWA 1Q7TA 3UG6A 5BWOA 4UUMA 3TFOA 3TUJC 2KLHA 1O89A 3O8OA 2A2ZA 2VSYA 3GJXC 5CFZA 4EGCB 3EEOA 1NIJA 5FP0A 1XD9A 3K0AA 4WQMA 4NCBA 4UPVA 3HTXA 3ZUPA 3QYAA 3C41J 7ABPA 4DR7B 1ZGJA 1M74A 5B7NA 2Q5HA 3HRIA 2Z4TA 2C31A 3U19A 5FIUA 5BO5A 3CVWA 2HDNB 4IYRA 3DR3A 4MYSA 4PU0A 4ZQCB 3OP4A 3W8DA 3E2IA 1JW9B 5HXAA 1SHKA 4PAMA 5KYKA 3KSAC 4UHHA 1SJ9A 3GAFA 2BKXA 5IVDA 4CQJA 4ZVLA 3BC1A 1OFIA 4QJBA 5AK0A 3D6UA 1H93A 1UXOA 1AM4D 2V6FA 1U9IC 5D85A 3ER9A 1H5NA 4QM6A 2AD1A 1VKZA 4X93A 1FXWF 1XZGA 3FDXA 1EGAA 2DQYA 2FZKA 2GO7A 4YR9A 5B2FA 1TLLA 1EBFA 4B8WA 5I45A 4S1WA 1RYBA 3SX0A 3MTIA 5HKAA 1OZ0A 2JEZA 3ONFA 1NUQA 2YFQA 4M1SA 5HPYB 2RARA 1DLIA 3THXB 4XZ3A 1AV7A 4XIGS 4F04A 4GU5A 3ABIA 4LJ9A 3SSAA 4J3JA 1NX6A 2ZSKA 3BJEA 1TW3A 3W6PA 3K1YA 1PT7A 2CNWA 3RIGA 4BO8A 3L5KA 4U2EA 3SM3A 2Q6OA 3CLRC 1GU0A 4IICA 3EGEA 2QTTA 4ZVQA 3QM1A 4YRAA 1GWNA 2G4VA 4U6SA 1CUHA 3QK7A 1S8NA 2AI2A 4A7PA 2F7SA 4AX4A 1GA1A 4B32A 2Z6AA 5FLYA 1YT5A 4AB1A 3QE9Y 2HMAA 1G5TA 3BDVA 3G6WA 3LBIA 2X8WA 3TMKA 3IEVA 2VPXA 3QU4A 4QPDA 1X6VA 1YMVA 1YJ5A 4KXLA 4E51A 4DBLC 1AOXA 3OKCA 1KI9A 2R8OA 5CK4A 1U3TA 3W2FA 1TZCA 1YRLA 4AZ3A 3THWA 1K8YB 4X92A 1J42A 2FEMA 1UT6A 2IDJA 3CPJB 4H59A 5JE8A 3CH4B 2A0UA 1ZUIA 4HPJB 1Z12A 1KMCA 4MMYB 5DP2A 3IR5A 2PJDA 1DBRA 1N2ZA 4IY1A 2CUNA 1FZTA 1ZITA 4KIFA 4DCOA 4BECA 1WZIA 3PT5A 3SWWA 5P8WA 1W6UA 2J85A 2WUWE 4KKXB 3CVJA 2Z56A 2ZBGA 5A1JA 1SKUA 4NI5A 4FIDA 4OLBA 3EVCA 4HX9A 2P67A 5H80A 3TPFA 3ZDZB 1RRKA 1M2HA 1TAQA 1F4PA 2C3PA 3QVTA 4FNGA 2AC7A 3ISTA 1UQTA 4OYLA 4ARCA 3MS2A 2QE6A 2ZATA 4Q4LA 1QKJA 1BYUA 3IMFA 3T1TA 1V2GA 2CUTA 2Q50A 2Q0QA 1KTIA 4QXOA 3IUQA 5AW1A 4JA0A 5F7XA 1XNQB 4DE5A 3K0SA 3ZEIA 3FNFA 4ZC8A 4M53A 2PUEA 1PV2A 1O4WA 1KETA 1YU6A 2JJYA 4IJ5A 5KX5A 5EXXA 3SBEA 1NHGA 2J9ZB 5JH7F 3LVFO 4D9HA 3BMCB 1DX4A 5IAGA 4G8BA 2Q3BA 1MNQA 5G41A 5BYBA 4K9KA 1V7QA 4FMDF 1E62A 1Q7CA 3WLNA 1M2JA 4AKTA 5JECA 4YRLA 2QKYA 4LMPA 2FFQA 3TNDA 3OU7A 4Q7LA 4C88A 4OAQA 1LNSA 1GYRA 3AB7A 3D0KA 2PMWB 4HXGA 3VVLA 4O59O 4WACA 5KOHA 1TFUA 2JA2A 1JR6A 2I34A 5T4HA 1QGED 3ZIAD 2YW2A 4Q4JA 3KSRA 3T95A 2ZTLA 3IOYA 1SHTX 1CUYA 1XEWY 3M4ZA 2WYWA 2J31A 4KBYA 1CQWA 1DBSA 4UAVA 3R23A 2Y68A 3OPNA 4TS4A 1XCJA 5G1OA 2QWXA 3IAM1 1GG5A 4CM9D 4Y2JA 1RXCA 4ER0A 4HNAA 4FWBA 2IYUA 4Q18A 2VATA 3N8HA 1YR8A 4X7BA 1K8ZB 2ERXA 3BWDD 3EVEA 2D1RA 4DWJA 4X00A 2CCKA 1T3LA 2AX4A 5GQSA 2PSJA 3IV6A 3Q3GE 5AKEA 1ZJWA 1KEWA 2JFHA 3CTPA 4O2BB 5LD2C 1OU4A 2POCA 3KQTA 1YS6A 2WTNA 2ZI7A 4P83A 5CT9A 2C2GA 4LECA 4QLBA 5JD3A 2EARA 3ZZ1A 1IPFA 1HL7A 1QP4A 2P1RA 3ZBUA 3IIJA 3ICQB 1I13A 4TTSA 3CF4A 4HLCA 4Q7EA 4UBOA 1HC7A 1MMFB 1GFSA 3ZWVA 2NZJA 3QE0A 3GRZA 2AG5A 1FDSA 2AKYA 2B1RA 1UM8A 1AUQA 2NYAA 1DIBA 3ETDA 3G8AA 3T7TA 2G5GX 1NTOA 3UY4A 1ZDMA 1UC9A 1QO0D 4EJ2A 1JQBA 3ZXSA 4OOFA 4CLHA 5CDFE 1QU2A 5AI6A 2OHFA 4GVPA 3I2YX 2G4CA 2Q41A 1G17A 4JBWA 1WETA 1R9NA 1YS2X 1VSVA 1WXDA 2G36A 1V35A 2TSYB 3BFVA 3DEYX 3KD3A 1YJBA 4YMIA 3WIBA 4F1KA 5LQJA 3UAVA 1T4CB 4ADSG 2B5VA 3LNCA 1JMKC 4ZVMA 3U7QB 1GTMA 1L7RA 2NV2B 3LHDA 4EAAA 4XD2A 2QUIA 3L41A 4YDRA 3HUTA 4N76A 3ACDA 3LL4A 3PGLA 1PUJA 2BEKA 2OV3A 2NU7A 2VJCA 4S3MA 3DNPA 1V1RA 5FL3A 3U09A 1IXYA 1IHYA 1Q7BA 1NW9B 1A4IA 2PEYA 5TE9A 3G7UA 3GRAA 4BNDA 5IYZA 1ADYA 3DWIA 4NJEB 1EAYA 4KJXA 1ILEA 5B4TA 2QNIA 3D7SA 1A8QA 1QX3A 1MF7A 1XCBA 2QOEA 4CFYA 3UMYA 1E1MA 3RS2A 3T4UA 2JLSA 3OT4A 4YRFA 3VR6A 2F62A 2ZCJA 1ZUWA 2AKAB 2C77A 2O50A 4DVJA 5BR7A 1H2WA 3RC1A 4TXHA 3STVA 2B3TA 5ANRB 1MC8A 1ABFA 3WGLA 2BGKA 3DFUA 3PPYA 4G56A 4PLGA 4PIPA 4JEIA 4FCWA 1OF1A 1R9GA 2YOHA 4C5CA 2VRBA 4IS2A 2KX7A 3K8OE 1SBCA 3JPWA 3A3YA 4P4TA 1EWQA 3KFVA 4WV3A 5EIFA 4DMMA 5JNSA 2VTBA 1C41A 4EFKA 1ZSYA 5BNFA 3R7NA 2P9CA 4BGIA 4U7DA 3QP9A 3HBAA 4YRNA 2VAWA 5CT6A 4Z7OB 4ZYZA 4QFBA 2C5SA 2BDUA 3KKNA 5I4BA 3LFUA 4PC2A 2YV3A 4UBLA 3WFZA 2O2ZA 4IQ0A 5KMGB 5AW4A 2ZJ0A 1OXSC 1RCUA 2NVUA 3Q5GA 3L4BA 3R8XA 4B47A 1WAMA 1D6MA 2O2SA 3UG7A 1EUCB 4D7AA 5KSYA 2RB4A 4L0CA 3PDUA 5HR5A 2CSXA 2B4RO 4Z4FA 2HPHA 2WSSD 3I64A 4MQMA 3H3JA 4R16A 5IX8A 5ITZB 4H1TA 1UZNA 2PXHA 4JOSA 4KAXA 1J2YA 3SSNA 3HA3A 2F8MA 3R7FA 1ZH2A 4MVJG 3ITDA 2A5DA 1E5VA 3L4SO 2QRPA 3NH6A 4YI5A 2Q27A 4IV5A 4UC0A 3RVLA 2AJDA 3AK4A 5TGDA 1CJMA 3CNBA 5ITVA 2CW5A 4WVFA 1MABA 4ALKA 5G0WA 2CBXA 2P9HA 4HAZA 3U9SA 3OWHA 4ZFNA 4XDYA 3PUXA 4W4TA 5L7TA 2I1QA 1NN3A 4OP1A 2P9TA 4UEWA 3UMGA 1KWGA 4A8JC 1X3LA 2F17A 3LVBA 3GCGA 1NN1A 3UMSA 1AKYA 2P0EA 1EX7A 3FMVA 4JXKA 4I5EA 3MBKA 1GL9B 5DGHA 5DTEA 1PYDA 4G1BA 2YJ5A 3B1YA 4ZAVA 4D0LB 1L4KA 2PKQP 4PSCA 1UEXC 4IH1A 1MXFA 2TECE 4FI3C 2DTXA 4EFNA 1GG9A 4RH1A 3B38A 3KB8A 4M60A 5BQFA 2WUGA 3DAOA 1D3AA 1DARA 4YACA 1JG3A 3QMWA 1AA9A 3HFSA 3JYHA 1IN5A 3QU5A 4Q47A 5DU2A 5GV7A 2PZAA 5KDLA 3SYMA 3SQMA 1X8LA 4AMBA 4P0TA 2FVXA 3TLXA 4ERNA 4CEHA 5EAIA 4OHVA 4Z9BA 4ZVNA 1IC6A 5FXMA 5F9FA 1UAYA 2CYAA 4GT1A 4ZK6A 2IPAB 2C4NA 1YAJA 4I1YA 5GJBA 1WSDA 2YWFA 4ZVKA 3I5YA 1GGHA 3IT1A 1DDOA 3ZY6A 2SHKA 1EVJA 5EKTA 1UJ5A 1J1IA 3HJCA 4J07A 5HGJA 3L7YA 1ZIPA 2IXBA 1DQNA 2ODTX 1OZGA 3P0RA 1FIUA 2O2IA 3AKEA 4LNUA 5A3SA 4PCAA 1SEPA 4GX0A 1US8B 4KMRA 4KO2S 1MH1A 1GTRA 5HJEA 4CM1A 4RELA 2KB0A 2JK1A 4XWWA 1C5KA 1HRKA 3T9BA 2W4IA 1JJBA 1SB9A 2J5RA 4R8KA 1QGDA 4WKNA 1V7ZA 3NC4A 4P2GA 2QJOA 3ON5A 4E07A 1G2PA 3E0QA 2R6DA 3D3KA 2DFTA 3O75A 3F6EX 2CK3A 1Z6AA 2GGSA 3KVOA 3Q9LA 4QBTA 3FJOA 1ZCFA 4M9ZA 5BYJA 3TLBA 4ZO9A 4Y7CA 1YVUA 2PPLA 4YUYA 3W7AA 3WNZA 3WXBA 4M9RA 1NP3A 1U0GA 1A50B 1V3TA 2ORYA 3FKSD 3Q3HA 1Y3AA 1SXJC 5JJKA 3UKJA 1ODJA 2IZ6A 3LQRA 2YFKA 4Q1VA 2GEKA 3BVPA 2J4DA 2VDPB 3F98A 2OGWA 3INTA 3IYLW 1OFUA 3ADCA 4UM8B 4WCFB 3PX7A 4RA6B 2QRVB 1YB6A 4E31A 4EPRA 2YZ7A 4LTMA 4GS5A 4XWOA 1N6PA 1WQ3A 3AUAA 3EZ7A 1KFEB 2E5WA 1D2CA 2JFGA 4DQ0A 1YZYA 4U7PB 2Q8PA 3BRQA 3O1LA 4KGDA 2R8ZA 5AR1A 1X7XB 2GF2A 3OUTA 4YO8A 5D00A 3H17A 4PCUA 4ZPJA 3STXA 1QSGA 2V45A 4IDAA 4L9SA 1JNYA 4NZ9A 3S2EA 1FU4A 1KYXA 2JGJA 3PNBA 4Q9HA 4Y0NA 1A95A 3BGSA 4XYMA 1N78A 2CT8A 1C30A 4RANA 2VTEA 4M3NA 2J5XA 3V7FA 5KYWA 2GFIA 4DV1B 1TQHA 3CSSA 2RB5A 3GOHA 3LX6A 4RXUA 3ZLJA 3H1AA 5IJAA 1CZHA 3ISJA 4KFRA 4YCJA 4UUNA 1KNXA 2XMSA 1VG9B 1P9OA 3D7MA 3MGBA 1QG6A 1M6NA 4ED9A 2BSQA 4U7FA 2QVGA 4AMGA 4O1HA 2C9ZA 4ND7A 1N75A 1YULA 2XRZA 2P9FA 4BQEA 3GJQA 4X84A 5G4LA 1B41A 2GNAA 2PJUA 4BRSA 4S1OA 1LX6A 2DHCA 3FOWA 4O4IA 3DLBA 1DAGA 2GPWA 2XWQA 3I0NA 4U7GA 3AXTA 2ATVA 16PKA 5TV2A 4H1WA 1B8OA 2EF0A 3WLTA 1C7RA 2FN9A 1SCJA 1HFKA 1C0EA 1NLYA 4O2RA 3OQVA 4RL4A 4BQSA 1DJLA 1DAIA 1X1SA 3MILA 3HJFA 5B1IA 4NZPA 5AJXA 1VI2A 1T9KA 4C6TB 2M98A 4EIWA 5HCIA 1AF7A 1U7XA 2IW3A 2W6JD 3H1BA 4DCCA 2ADFA 1L5MA 5FA8A 4EUSA 5FLXA 4TWBA 1GU1A 5DM4A 4MW4A 4UVHA 2DQZA 5J47A 4KQHA 5JVDA 5LSAA 2P6PA 1PS8A 2QNRA 2HFKA 3HYNA 4PAWA 4Q1AA 2OPHA 2JIPA 4NQZA 2Q5LA 1DRKA 1BDMA 4OIMA 4PC3A 3UFXB 2BF7A 3KIPA 5LD2B 1AKNA 1P7CA 2F67A 1T5IA 2M1XA 4TN1A 4B0OA 3A4TA 4B7CA 3RADC 1PS9A 1KMHA 1Z6YA 3WHKA 2A92A 1OY1A 2G04A 1VJ5A 3EZGA 4FW8A 3OHMA 5E6RB 3G5AA 4CDRA 1FVHA 1QWOA 1VL1A 4G5YA 3AUTA 1CDZA 2GJ8A 5AHXA 1W0JA 1GZ7A 3LX4A 2ZZMA 4F2HA 5D86A 2FQQA 3L8GA 2C8JA 4RC9A 4FGKA 4UBIA 2H5IA 2H9IA 3LZCA 3RG8A 2X2OA 3TO5A 2BMVA 3NP7A 1M2GA 4G9GA 2BL4A 4LSZA 3R76A 4BL5A 3S7ZA 4C1NA 5J4KA 2WWTA 3O8RA 1UBCA 1FVFA 1AQIA 1DPFA 1E4YA 1P3Y1 4YJGB 4Q37A 2SKEA 5E8JA 1NUHA 2GJKA 4JUFA 4BEJA 4EHNA 5JS7A 3RVRA 3HB0A 4ZCIA 1NR5A 1QGUB 1WOYA 2AZTA 4FCVA 4ZJPA 1ZSVA 1XKXA 3L46A 4BTLA 2Z2YA 1KPHA 2PX3A 5BW8A 1E2HA 4MUHA 1YC5A 2WMYA 1YGYA 4H4EA 5F1PA 3I04M 3QFFA 4G0QA 5D8DA 4C0KA 3GJ7A 4K40A 5CA0B 4WTOA 3RSOA 5EP3A 2VDOB 2YIDA 3GFRA 3NETA 3GLIA 1VE6A 3NDPA 1RI5A 1ZZGA 2HA2A 1ADFA 3C24A 1IXKA 3MJHA 3D4LA 3QWBA 2FSVA 7REQA 4EKGA 1RFGE 4Z8XA 2DFVA 4AG5A 3V8QA 3KAQA 1RE1A 1GDDA 2DG2A 4GDMA 1OYWA 3LQ1A 1DKPA 2BAGA 3CZCA 4RKYA 4CEIB 2RC6A 4ZVUA 2KWIA 5FQOA 4BFTA 3AV0B 2YNMD 2XCSB 3ZD8A 5IWAB 1S5PA 1U2DA 1GQYA 1B6TA 3HLTA 5BNWA 5LXTB 1Q15A 4QUHA 2CXTA 4FHEA 2AA3A 1KIFA 4IRUB 4Q3EA 1JG6A 2F8SA 1IEVA 1IFXA 2E4XA 2VF7A 1Y42X 2VAPA 4KK3A 4NZMA 3DTVB 4JS0A 2ZB7A 2TS1A 2C5GA 5JPDA 5MN5A 3QNWA 4FN5A 4NBVA 2PX6A 4GMDA 5K3CA 2GN6A 2H3EA 1MIOA 4OFZA 4XVHA 1XFDA 1A82A 4IJUA 1GSHA 3G2LA 5FNZA 4ZVSA 5LMNB 2G7ZA 2VDKB 3RIHA 4B0PA 1LV8A 3LW7A 1I2AA 1YKFA 3MHPA 4KN9S 4B3HA 5EIXA 3JZDA 4RHXA 3UT5B 1O08A 3W79A 4R4JA 3A1NA 1AS2A 1PHPA 2FK7A 4QNMA 3UB2A 1IZYA 1XKTA 3I9V1 3K31A 1BWQA 3NDJA 2V0NA 3NALA 2VNSA 1F2UB 2BGTA 2OORA 4R2WA 4BFYA 3OU6A 3VYTB 3BREA 4IHJF 4CIAA 1IPEA 3RK4A 1GKKA 1FDVA 2ILVA 1YA4A 2Q7XA 2O9JA 4NX2A 1YUMA 1VM6A 2JVJA 3L4EA 3U49A 3BMNA 2JLRA 5AKJA 5THKA 2C42A 3KQQA 3O82A 2GCOB 2R1TB 3QWAA 1KZHA 5LVAA 2ZYVX 3PTZA 1PDOA 4D92A 4Z3KA 3PVCA 5BW4A 4GXNA 1N2SA 4INAA 1ODIA 4LE0A 4X90A 2BGJA 2VWHA 1QLJA 2O57A 2RI0A 2ZAYA 4BV9A 1EM8B 4PX5A 1KI3A 1KZ1A 3DTYA 1PSZA 5AJYA 3LKVA 4H6PA 5E2BA 5FNVA 4ZMRA 3A06A 1ENOA 3FUUA 3GRRA 3IELA 4NH4A 5F33A 1K3FA 1RYHA 3MJ4A 3ZBTA 3ZHVA 3EIWA 4ZEVA 4EYQA 5EJMA 2JGIA 3N7UA 5C8YA 1H2AS 3T35A 4A1FA 2WHYA 1HLGA 4QM7A 4TZ0A 3B20A 3CLRD 1EUZA 1QV7A 4YS6A 5TNXA 1BA2A 2OBYA 4RPKA 5DI3A 1NNI1 3OCYA 3ELUA 2QR5A 1MDBA 4DPLA 1RJGA 3SI7A 3UXYA 4YAUA 1WL8A 1MC4A 3KHSA 5AW6A 5EIOA 4QASA 3NBAA 5DYWA 1IM2A 2ZJ8A 1T2AA 1U2GC 1MAWA 1Y4SA 3OZWA 4MYRA 1YA6A 4H1VA 3RK1A 4B6OA 3DV0A 3ZLUA 4JR2A 4MAAA 1L7DA 1SC4A 1Z08A 3AL2A 3BL5A 4L76A 1W5BA 5IAJA 3B5EA 3SU8A 2F4VB 3IIIA 3PGXA 1GNVA 1Z7BA 2QRQA 4L3OA 3WBFA 1VFPA 3F9RA 1PD0A 2I62A 7YASA 1H4SA 4HNGA 5CFMA 3MVEA 3OMLA 1E77A 2HF8A 3CKLA 4EVSA 4FYIA 4JB3A 1SVOA 3MW8A 2Q1TA 2RHHA 4WOBA 2DTDA 2MTBA 1VYHA 2AEJA 3BDIA 1RMQA 3AV3A 3NIGB 3WYBA 2V3CC 2IXEA 4G01B 1DQYA 4LIPD 1SY7A 1X2EA 4P4UA 4BXOB 2RI1A 1JJ7A 1UR5A 721PA 2A9RA 1G4HA 1A8HA 2KBFA 3GGGA 3O84A 3CZAA 3PNYA 3DOIA 5CM9C 1G20A 3NHAA 3ZDQA 4KU4A 4MI3A 3KYCB 2V6IA 1UP6A 3Q3IA 4IBOA 5FTJA 1LRJA 5TVGA 3RAGA 4F4JA 4N48A 1T29A 3TQCA 2J08A 1O5OA 1KI8A 2AFHE 2PSDA 2Q3EA 3QVGA 4Q02A 4UOEA 1Q92A 1OWOA 3WK8A 2XF8A 1S01A 1QCCA 2YVUA 1K75A 1N2EA 1Z5UA 3ZYZA 3QELB 4HCJA 5F4ZA 3VJMA 4EX6A 1FX1A 2XE7A 3H8SA 5ICFA 4MWZA 3IFSA 1DCMA 1WNTA 1OILA 2QG9A 4HGZA 5M2QA 4GI7A 4P3OA 2V6BA 3IUPA 3HRHA 3P2KA 2IU4A 1GLNA 2Q6VA 5FI5A 5BUSA 2O2DA 3L0PA 3HJHA 4HXYA 4PYOA 3C4VA 5TVKA 4MWBA 4QG3A 2REQA 1HNWB 1YJXA 3R6LA 4K9RA 4YP6A 2WLSA 2W93A 3KJFA 4ZREA 6YASA 5EJ7A 3PD1A 1ATZA 5KKNB 1UMBA 2W6OA 3BMXA 5TSDA 5ALUA 3R7WA 2TYSB 1DKMA 2EAUA 3PFKA 3VHQA 5JS1A 4V3BA 3BJIC 3RARA 4U9IS 3RYTC 2NOAA 2QTMA 2UUOA 2WW8A 5AVWA 5CFPA 3TIFA 1Z6QA 3KUKA 4LZJA 1Y8RB 2NV6A 1HO3A 4CKBA 1T0BA 2CE7A 2ZYTX 2EJUA 3R5SA 4I6GA 4JBLA 1B7GO 2IGBA 2JRLA 2VUTA 3QU2A 4YH1A 3H2BA 1ISSA 1E9CA 1EWTA 3MQ2A 3NTXA 4OAOA 4C21A 2A3NA 3MYRA 2WF8A 4PLFA 3GPIA 3IAS6 1K9SA 2JLUA 5KNCH 3N0TA 1J99A 4LYDA 3ANMA 1E1QA 2V54A 1E8NA 1M2VB 2NNLD 3IDZA 3LT2A 4TYYA 1G3RA 1C0IA 1NRJB 3DF9A 3GEBA 4PRYA 3TLZA 4AJEA 4CM5A 2WJ3A 2QTHA 3DZHA 3K20A 1CS0A 2WHXA 3UB4A 5LDGA 5AUQA 1C4OA 1W581 1W2GA 3VM6A 3ZKWA 9MHTA 3CNOA 3O9VA 4TM8A 1K1EA 1C9DB 1JIKA 1NXTA 1Y3CE 1EDOA 1OXVA 1WY5A 4LSGA 1XN1A 2ZI4A 1I2ZA 1UP7A 4C4ZA 4MS1B 2XCTB 3HZZA 2W2LD 2FE4A 3IPRA 3NEJA 3NO4A 2YHIA 4H7IA 3CT4A 1GRVA 3C6ZA 4I4TB 5JSKA 3UWKA 1XQYA 3RKRA 5KC9A 1BFUA 1E2DA 2C7RA 1WKCA 1NU6A 5B6IA 5JXHA 2PL1A 4BV2A 3M49A 4DLZA 3BCUA 4LRQA 3GAMA 3WSTA 4JJ6A 3OU2A 1NU8A 2IIVA 2IP4A 5EG5A 5ES3A 4AUNA 4F46A 2QG4A 2QT1A 2C5LA 1CQZA 5F1YA 2O2GA 5E9JA 4YCDA 3SC4A 3P9RA 5DRYA 2HREA 1LDMA 3R24A 4AJOA 2AHOA 5EHXA 4Z53A 3O7MA 5IHXA 3NJRA 4QBGB 2CE2X 4TUYA 5EIHA 1OT5A 2NPIA 2Q4OA 5BSKA 5CNKA 4TV9A 3OJWA 1YL5A 3JQAA 1R5BA 2IE0A 1Q1ZA 1Z0ZA 2C4TA 9GPBA 4F3YA 1VP3A 5FBRB 3VYSB 3KTFA 2ARKA 2JFPA 3ZIDA 4OQLA 3PTAA 5JAQA 1OX5A 1G98A 5I8PA 5KQMA 2WB2A 4BLQA 2JAHA 4B3SB 3TIXB 1XG5A 4X5OA 2Y67A 4ZCTA 1HDCA 2RJNA 1Y6FA 1F8FA 2X7HA 2CB9A 4JELA 2FR8C 4OHYA 4U5XA 5G0VA 4A9AA 1Q1EA 2W6IA 3OE5A 1DEXA 2H6EA 3E5HA 4R3NA 2ACKA 3CLUD 3E7DA 4WKGA 5AOCA 3TAHA 1EWKA 2BFMA 3V6LA 3P97A 5CCEA 2CNNA 3A1SA 1S02A 2V65A 1TTPB 2ZJ1A 4RY2A 3U4QA 5E95A 1XU4A 3WMRA 1J56A 4DOMA 2WMDA 3SQXA 4R9UC 4JJGA 4FOTA 1O2DA 2FN4A 3PQEA 4AP5A 1MVLA 4LHWA 4CKCA 4OQDA 3NATA 5AIAA 1R74A 5B12A 5CMLA 4ML3A 1CKEA 4CW7A 2W2TA 1CR1A 3OHPA 2LBPA 4LCEA 4PINA 4DLAA 1DAHA 3C8DA 3G0CA 3PPIA 5EWMB 1U3UA 2PXAA 4GEKA 3TD2A 4OXKA 3B1KA 3NHMA 1QRSA 1GPYA 1F38A 1AQUA 1WXQA 3I92A 3LYUA 2GEFA 4N7MA 4CEJA 3BT7A 4RPGA 2C0QA 1NF2A 2XVXA 2CL0X 3EXFA 1YZ3A 2OFOA 5AJUA 3U0BA 4E2FA 4EA7A 4ZGGA 4JFRA 4XASA 1X77A 5JQGF 3LHIA 2J9GA 3MS7A 3S2FA 4LYJA 2FW7A 3ME5A 4GPD1 5BOSB 1T2NA 2J0SA 3CXUA 2EFYA 4F72A 1NOJA 3ITKA 3ZWMA 4BCDA 2OYRA 3U6BA 1UBNA 2NW6A 3HKCB 4G2TA 5L95A 1NJFA 3LP5A 1WBDA 4DNXA 1KFJB 1SR8A 3GJYA 1NVXQ 4G65A 3KWLA 2HYIC 3TQRA 3UOAB 4WOPA 3NRJA 4FDUA 3UJBA 4KREA 3LDHA 1TVKA 1UK7A 3IHWA 3DDSA 1XUOA 1F2TB 1B0AA 2VSNA 3IPXA 1M0SA 4LDRA 1L8LA 1EK2A 1ISMA 3MGCA 2ZSUA 4KPGA 5IUJC 4PS1A 5U9CA 2ID9A 3T9FA 3KBOA 1K6MA 1B3RA 4NCJA 4QX6A 4RTPA 2I3ZA 2DU8A 4R84A 4WCDA 5HTKA 3J81A 4LY0A 2XNCA 5AYVA 1L5YA 1A5SB 1PO7A 3PGMA 5DULA 2H1HA 5FF9A 1H2RS 3WV5A 3WIOA 1U8YA 2Y71A 2I6GA 3R5FA 4IGFA 2F3SA 5U1PA 4WCFC 4RZUA 4TXNA 2P3QA 4FGZA 3J7TA 1JDBB 2VG8A 3DF7A 3F1KA 1VLMA 3C3CA 4FVTA 4TTVA 4QLOA 5DK4A 3UW3A 4UFPA 5A5FA 2ZI6A 1F5SA 1Y3HA 1EI9A 4BPBA 3JAKB 2VP6A 4JWKA 1OREA 1JKMA 4CQNA 3GDWA 2PJRA 4BYMA 2GZHA 2R7LA 2RHOA 3IJEB 1O5IA 1XVAA 2YV5A 3RBVA 4MNTA 3OF5A 3DP9A 1O9GA 1JR3A 1LF0A 4RV5A 4BNJA 1L5HA 1SO8A 7AT1A 3QLJA 1GPUA 4MQBA 1BKYA 2MCFA 4DZRA 3SMVA 1SZPA 2ODNA 1L7XA 4O8CA 3VRHA 2XA2A 2Y77A 1P0IA 5GMOA 2OCIA 4XQ0A 3UXMA 3V8RA 5I5EA 5E9AA 3AIOA 3IPCA 3NQ41 3CLVA 4X41A 1NKTA 3FOZA 1G7SA 5K09A 2Q9UA 4HS4A 5I7HA 2ZJOA 4V24A 2I4IA 5AP9A 2I80A 2BEVB 2VHJA 2PS0A 3PA6A 2X2PA 5K6RA 3Q7QA 4Q3NA 1NPDA 1IDN1 1HLPA 1V45E 3MUEA 3R3VA 3SE7A 3MA0A 4QIHA 1GQOA 3OFSA 1OIVA 2H29A 1MOZA 5EKUA 2XBLA 4D4JA 3DDNA 1VSQA 3N58A 3UJ7A 4LYHA 3TK1A 4BX3A 3K72B 2QTFA 2ZR0A 3LY9A 1CLEA 4MVJD 1RKVA 1N6IA 4OGKA 2MYUA 1GSOA 3DBHA 3IGFA 3O93A 2OCYC 2WT4A 3HCBA 3QOYA 4GLBA 3PNQA 4JL6A 2GCPA 1M2EA 5ER9A 1AGRA 3I42A 3VYWA 2DJIA 3FCCA 1PUXA 3GRKA 3OOWA 4JHLA 3WXMA 1KI6B 1USUA 3KC2A 1EXNA 4WK6A 5CDYA 1SXJD 1BOOA 1R4AA 2H16A 1ZM3A 1RZ3A 2E4YA 2O1WA 2VNIA 3ESRA 3IVAA 3Q7RA 4LKOA 4ZU6X 3TLGA 4EATA 2IQ5A 3VR2A 5J2TF 1MRSA 1SULA 2BFEA 1JECA 1HFEL 2IYLD 3BWXA 3K0KA 4LOKA 4N0EA 5FI1B 4YYZA 3H9QA 1A1VA 1WDMA 1V96A 3C3MA 3MFYA 4C4RA 1EP9A 5KSWB 4B84A 3H9GA 3FDZA 2FYTA 4BLOA 4BJ3A 3GMTA 2QTNA 3WK5A 4IWNA 4N40A 4AD8A 3MTGA 4FT2A 1XRJA 1CDOA 2R00C 4I14A 4WJZA 2AZ4A 5SYAA 3TCXB 4EG3A 2DQKA 5AM0A 1POXA 4TLLB 4LV8B 3CVOA 5IKMA 1YTUA 2QMZA 5T8KC 1XYGA 5F2EA 3OPMA 3E23A 4MRAA 4WH0A 2QQGA 3NRBA 3O7WA 4QDOA 3ZDXB 4EEKA 5K6TA 3U56A 5DHFA 5LP6B 1IJKA 1GCOA 5JR3A 5GM1A 1AKEA 1HTTA 1KZYC 1VI5A 1XZLA 1Q1BA 4L4RA 3D2AA 1OLSB 4PPNA 1E9BA 1FSFA 4W9NC 1H42A 2AG0A 2VTBB 4A0QA 3NHFA 5JY6A 4ZYUA 2OM6A 4O3MA 3BB4A 1B2LA 4K26A 4PHCA 3MOGA 3A6GA 3P32A 2QRHA 1RACA 2AK3A 3B70A 3FCOA 1FNMA 1X70A 2O8NA 3V4RA 2D8AA 5K0FA 4MIOA 3CWZA 2OBBA 4YASA 1EHIA 3RGGA 1E1CA 5JJBA 4KYUA 3UUWA 4LJ7A 4JI6B 3CGWA 1PR9A 3FLMA 1QANA 3F9CA 3LOPA 4BNWA 1FX0A 4WN9B 5J2UB 1A5AB 1NXVA 3G13A 4HLQB 4XI9A 4YRSA 1C3VA 1U8CB 4GIBA 4W5JA 3T5MA 1QOZA 2CL7X 2ZWPA 3UJ9A 4BMPB 3EOAI 2QN8A 3VBEA 1LLFA 3L02A 3OQMA 2XIQA 2R7AA 3FPCA 4RJKA 5A1TA 1TVEA 2YN2A 1QHXA 4EZBA 1P7YA 2O5RA 1DRWA 3IP1A 1VSUA 5EESA 4FFPA 3QFRA 4RY0A 3C15C 2BLLA 3FPSA 4WFKA 2JFXA 4KOEC 3GLFB 2XXAA 5DLEA 3TR6A 5LB4A 4ND3A 5BORA 2IPXA 5INTA 5TIIA 4LOJA 4FFLA 3AEUB 2QIOA 5TT1A 5KWIA 2GT1A 4AO8A 2VYCA 3GPLA 2CC2A 4JOBA 3RG2A 4FMCF 5AJTA 3RUPA 5HA5A 1C7FA 3DB1A 3MXOA 1TYBE 4K9PA 1KDPA 4C87A 5CAEA 5L7WA 2KS6A 5FA5A 1LJ8A 4GKBA 3IXMA 1IZ0A 2BI7A 2FGKA 2UVPA 2YWEA 4IH9A 4AJ9A 1RYMA 3M6VA 4RYDA 2A1UA 2C9BA 1CD5A 1YQQA 5DM1A 1AMOA 3C85A 3U44B 4DA7A 3FNGA 1GPH1 4XUDA 5ILQA 2YBEA 4IDGA 1YWGO 3ID6C 1D2EA 3OMXA 4GM1A 4IV8A 5C53B 5JRJA 1AKWA 3OE4A 4KDFA 1P6QA 2CHGA 2ZTSA 4WY2A 1JBKA 4YBZA 2X9VA 4URFA 1P4SA 3AR9A 1EVEA 2WHRA 4KO8A 3PTLA 4ZI2A 1ACJA 4XYGA 3ZYCA 1G8MA 1II8B 1WU8A 1TIPA 1VC2A 2OGZA 4EVQA 1QV6A 2AVNA 3M70A 4HDKA 1M5TA 1S2GA 1KTVA 3L1VA 4EAQA 2VBIA 1ZRSA 4J91A 4H0NA 1H6CA 1Q50A 3SYLA 4RDXA 3NASA 5DX1A 4OHWA 4OJMX 5KI6A 5HKKD 5JTTA 1W34A 1B2RA 3GLQA 3I05A 3LA8A 3NVDA 4XVCA 3STWA 1OJ7A 3PC8C 4ENSA 4CLDA 5IJZA 1Y8QA 1D0IA 4R0VA 4OMCA 3HV0A 1G5HA 3PQ3A 2AFIB 4I55B 4QOFA 1VHDA 5FWXA 3GEDA 4Z5XA 4EYKA 3CNNA 3M3HA 2VT6A 4II3A 4YEDA 1P1CA 1CZLA 3QVVA 4K28A 4CIDA 4PBRA 4MITA 3BL6A 2HLDD 4YLGA 4RD1A 2B7LA 4BNGA 3WGOA 2IDMA 3OZFA 3WV4A 1BE1A 5IJ0B 5T41A 2AUNA 3A11A 4NAHA 4E5KA 4JXZA 4Y1RB 2WHPA 1ZGBA 1UEIA 4GKKB 2ZVQX 3DEFA 4XVQA 5EVJA 3Q12A 5I7RA 2HDWA 5KOIA 2VL7A 5F7JA 2W83A 2XCLA 1R12A 3A4MA 4ZXPA 1OZAA 2QN2A 3HB4X 3T5CA 2HK8A 3KZCA 5BT9A 3AWDA 3QJGA 3ETEA 3FHLA 4P9NA 4B83A 1NFQA 1UKAA 2NACA 2V7GA 1ZWLA 3GT4A 4E13A 1WXXA 3D7NA 2Y76A 1JWBB 1WQ4A 4GYJA 1NUPA 1HRDA 4JQSA 3COPA 4LDZA 3T1NA 1Z83A 4BVEA 1N2CE 4RIGA 3WLHA 4PYMA 3EULA 1B0PA 4GWKA 2OOSA 2TMKA 2ACEA 1J90A 2HNKA 4E32A 2KJQA 3K0HA 4GX5A 2JH3A 4YAOA 4JOQA 5MGBA 1AKRA 1NR1A 3O73A 5DNWA 3VPDA 4N0QA 5LC1A 3B78A 4E5MA 5CJPA 4B35A 5DJ5A 3P20A 4YAJA 3WLAA 1J0BA 3HB1A 2Y1FA 5CD1A 3LLCA 3CV3A 2A0WA 2DFNA 3IT3A 3T5DA 1I8TA 1YR2A 3V8VA 4D9EA 2ZJAA 5C7OO 3EUEA 1D7AA 5CFRA 2VSQA 2MYNA 3H3FA 3L84A 4CKEB 1RYDA 1T8SA 2DSTA 2GXUA 4GOJA 3GJ3A 5TQ0B 3D3WB 3T9EA 5AI5A 5ALXA 4X62B 4K9MA 4RVFA 3RSZA 5AVYA 3S44A 3TLJA 2ZUVA 4U3JA 4QVGA 4A6PA 5AW0A 4KR2A 3QVSA 4X9XA 3DQQA 1TEXA 2CLHB 2ZULA 3I52A 2EC5A 1KWKA 2XHZA 4TM7A 5EFZA 1WBJB 4KQEA 3O8DA 2HBRA 3CWQA 2E9SA 1GTJ1 1VMIA 3EQ7A 3C1TA 3WGVA 2P3SA 3AYXB 3ZK9A 4MR7B 3LIIA 1UOEA 2B8JA 1VXOA 2JKVA 2MHCA 3AHIA 5EHZA 1PKEA 4IIXA 2VEOA 4MOWA 1N2HA 4EP1A 2KQUA 3T1OA 5J4LA 2H0QA 3MBOA 1Y6RA 4MUIA 5KYXB 2PS9A 2JHGA 3N0WA 4OHKA 2FX2A 5TPWB 1II9A 2E21A 4BMOB 4CTOA 4YB8A 2JIBA 1QHEA 1TMKA 1C3EA 3JWHA 3KU4A 3CHYA 1Z74A 3V80A 2ZRCA 2M6RA 4DG9A 6PFKA 5LDHA 1CUEA 1PTJC 1PZHA 2UVQA 4IIJF 1QFJA 2JPDA 3NP9A 3QU7A 4M9UA 5F52A 4RTRA 1EESA 2VRWA 1Q22A 4DUGD 1F3OA 3BUSA 5EZYF 5AK6A 3D4IA 2IBTA 1E4VA 3FYCA 3R40A 2FLVA 5FUYA 3D3EA 1ICEA 2P8SA 3OOSA 4LBVA 3F96A 4TWIA 3TW8B 2ZI9A 1IN1A 4HZUA 4CIBA 1XAJA 2I91A 3VMMA 1GN9A 3D43A 4NOKA 4XGNA 1DIAA 4R31A 4BO3A 4ES6A 4ZV4A 1WHTA 4ZOQI 2P75A 3I61A 5BY2A 4AIRA 1AGYA 4HQLA 2Z9CA 1XMQB 3BSFA 3S2YA 2HF9A 2NAPA 3RYHB 1PJ2A 1R00A 3BE5A 4DA0A 5EJ5A 2R97A 5B3JA 4LY3A 3TIGA 1SUCA 4H9GA 2Y1KA 5CFLA 3FGZA 4FGUA 1I3OA 2RHDA 3L0CA 4GP7A 1MG5A 3U7FB 3BA6A 1KZ6A 3B9BA 3GRCA 3IIEA 4L7QA 2NXWA 3HSYA 3GEMA 2ZRQA 4KQMA 2WUFA 2XWJI 1XMJA 1ZH8A 2HWYA 1E0AA 3F8SA 1LPNA 2W6PA 3HHEA 1IL0A 1RC1A 4H31A 3ROFA 2XMCA 4JV5B 2OLJA 4ENUA 2W9XA 1KBZA 4D46A 3ZV4A 4FSXA 1VI6A 5L51A 5BUZA 1YMUA 5DISB 1W9MA 1J9EA 1GPDG 4NMHA 2JJQA 4DLTA 4OGGA 1VJ0A 4Y9TA 5FPYA 4AKIA 1PFKA 3AF1A 3GFSA 2BUBA 3MJVA 3VR5A 1C7EA 1J09A 2OWEA 4EFDA 4R1LA 1HYEA 4QU5A 1X3SA 3HO1A 1E7QA 2Q2WA 2NZ2A 1WB6A 3ND9A 4OSEA 1CUCA 3W2GA 1CUSA 2PRZA 4KC0A 4MUXA 1JEJA 1TT7A 3G9TA 2UXDB 4PFSA 3T3EA 2I55A 2VH2A 5IN5A 3Q8LA 1XZIA 2C00A 2CDNA 3B9PA 4LXQA 5CX1B 3ZTTA 3G0HA 4ID9A 2RAPA 1V6CA 5K99A 4TMWA 2HW8A 3DKRA 3VO1A 2GEBA 1H2HA 3L82B 3WQQA 4JYZA 3IAAA 4JP2A 3RASA 3JD4A 1WOMA 4M0MA 5C8DA 4J16C 4ZEOA 2W48A 3VUEA 1U7TA 4CV2A 4KAAA 1Q5PA 1V1MA 5KCZA 4RPLA 4S24A 4IO0A 4LISA 2LV8A 3NH9A 1M5RA 4UEQA 1VG0B 2BV3A 2H2DA 4EPVA 5B2EA 4GKVA 4EMBA 1OXMA 1YE3A 2Q3DA 4C4AA 4CLRB 3H6HA 2C4UA 3AETA 4L28A 2A5GA 2IT1A 1C9MA 1P4HA 4OHMA 3DAHA 3AILA 2YR0A 1NX9A 3QEAZ 1FY2A 3CH5A 3RS3A 1V5IA 3K2QA 1GV0A 1YA8A 1V5EA 3KQSA 3KUUA 3MTBA 3RYFB 5B64A 4YJHA 3RFXA 3U1BA 2SKDA 4HFMA 3R5JA 3N5KA 1RD4A 1P5ZB 1Z16A 3DUWA 4WNYA 1VBKA 4TVSA 2RKWA 1WKBA 2FSHA 3DPIA 3ETHA 3GGOA 3LA6A 1KDVA 3FBGA 3BWBA 1H0KA 2OCDA 5LZ7A 2JLVA 1B74A 1XELA 1XZKA 1YDFA 3FSGA 3E8XA 5CVVA 1S4MA 1G8FA 4GSYA 5E0KB 1QOPB 4MDHA 3WIEA 4IJQA 4I50F 3UAOA 4HQ0A 4ZI7F 3O21A 1NZJA 1XF1A 2DHRA 1BW9B 3NHWA 5AHWA 4KAJA 2DWQA 3WYFA 4AS3A 3FD8A 3K6JA 3KV1A 3IBSA 2RK4A 4EY6A 5KOHB 3CJQA 1GZDA 3EISA 1O96A 3MCZA 5A04A 3K9WA 3EB9A 2HXYA 4AKEA 1JNXX 1KO5A 3JVDA 3MJRA 3QPBA 3NJ4A 4RHTA 3KR1A 3RD5A 4W5NA 1X8XA 3BILA 2IOFK 3ZVNA 5JNRA 5F3RA 2CFCA 1T3TA 3P1JA 3QXXA 4C0SA 2YVQA 4NFLA 2C0CA 1JHPA 1IOLA 1GU7A 2UYGA 4X8MA 3MIZA 5K8UA 5IVHA 2MSLA 5EXEA 1P1JA 4DJFC 2XGJA 2UYQA 3KTOA 4W9MC 2VDVE 1JDBC 3WGZA 1A9SA 3NM6B 4KEAA 3JWJA 2PU7A 1GCUA 1NM5A 3RRXA 1A98A 1X1QA 1OQAA 4R3WA 2ORWA 2DTEA 1Q0HA 1AXRA 3KB2A 4TSFA 2XZLA 4DLNA 1V9SA 1WD5A 4KXQA 4KSYA 1BXRA 1N0UA 5T3YA 2DUMA 4H6XA 1QHHA 1W85A 2XMBA 4TS3A 4NOLA 4N5NA 4XOUA 3VOSA 4EA6A 3QY0A 1FFXA 2GJSA 2IA5A 2Q4EA 2OQRA 4KH0A 5AXAA 2FZ5A 4J1TC 3RVKA 1TM5E 1YCHA 2GAJA 2VNKA 5BN5A 2XCQA 1LJLA 2Z98A 2PGAA 4F8YA 4OREX 2ZVDA 1Q74A 3B6EA 3VBCA 2X1HA 5HX7A 3JX9A 2WNHA 1GLVA 1Q0UA 1BE8A 1RFLA 2D1SA 2MSEB 3SJAA 4ZJZA 1QKIA 1JVBA 4BNZA 5K8JB 4RPHA 2PLRA 3AU8A 3LXUX 3L7AA 4OXNA 4FFDA 5EE0A 4OK6A 3URKA 5B1YA 2YOFA 4RZSA 1RZRA 3NHYA 4HNSA 3JYOA 4XVUA 2KHZA 1ZIXA 3C98A 1U8XX 4MQLA 1GRRA 4LS3A 4YRDA 2JFUA 2ONKA 3IP6A 1RT9A 2PK3A 3NCHA 2B4KA 3I8XA 4KIGA 1WUHS 4G67A 4KZPA 4M8LA 1GTG1 4C0WA 1V11B 1EDZA 4A15A 5AW7A 3O1IC 3ZY5A 2X86A 1ORRA 2O3QA 3AEXA 1T36B 3MOIA 3OC6A 5EJ9A 2ZETA 4M1QA 1OXTA 4AM8A 3ND8A 3VSCA 1I4WA 3CFYA 1JHQA 1THZA 4HK4A 4OBXA 1KJ9A 1RWBA 2Y1EA 5A3RA 3WP1B 1CJKC 1UBGA 4IJMA 3C3JA 3K6KA 3RYIA 3ZHOA 2I4MA 2X5NA 3OQPA 5BURA 1I5RA 3IAM6 1DCKA 1QTIA 4FYKA 3MWJA 4J8PA 2TMGA 4WLNA 3WGHA 4BTEA 4WI1A 5BVGB 1CQJA 1V4BA 4CVNA 1KP9A 2H08A 1BH6A 2HH9A 2KYRA 3ANNA 4MRMB 4Z7NB 4NTZA 1OWMA 1ZD1A 1IHOA 2ZJ2A 4KQWA 3DZIA 3SPXA 3ZCPA 4AJLA 5CDGA 2PRYA 1U3GA 1O87A 3ONWA 1T1GA 2CLDX 2GD0A 4O4JA 4H4CA 5IM4F 4M37A 3GGSA 5IRCD 2NSJA 1PEYA 3JQCA 4HEJA 4CRWB 4TLAA 2GXAA 1UQUA 1VLJA 2JAOA 1X1TA 4FJ0A 4HP8A 4KWHA 4PSVA 5LP6C 4TL7A 3WKBA 3N87A 1FFSA 2EJTA 2NX2A 3HCPA 2BMAA 1OI2A 2Q0SA 4XWYA 5KJ1A 2OAGA 5K1ZA 3BKWA 3A3OA 1BWSA 1THGA 2YUIA 1XZJA 2X4IA 3QHQA 4YV2A 2BFCA 5AK4A 5HZMA 1VE7A 1ORVA 2CF6A 3L1HA 1E69A 2IEAA 4UTPA 1JYFA 2Z8YM 2LCQA 1VCMA 3H5NA 3AVTA 1DDIA 2D5AA 3EA4A 1UZAA 4QT4A 1L5LA 4YAGA 1F20A 4QBFA 1MTOA 3UUGA 4EHFA 4JB0A 1T9ZA 1P5JA 2C82A 4D43A 1NVEA 2ZANA 5LDDC 2DAPA 4F3RA 3KUXA 4I4IA 2V9CA 3BWEA 4MVCA 3BZUA 5JCZA 4R40A 1SQ5A 4FPXA 3ZLVA 1VBNA 3PRHA 2R1VB 1DTSA 4HB2A 3T7JA 3G0BA 4WUVA 4NNOA 4RGVA 2OCGA 3SZ3A 5KJ6A 1Z18A 3RQSA 3V2GA 1GZ6A 5LKRA 3K35A 3KQWA 2HL6A 4GI3A 4MROA 4PVCA 2Q4DA 2WSSA 4E4YA 4QPJC 3DE5X 5D87A 3ASYA 3RO7A 3ZWYA 4DKXA 1EMDA 2I7DA 4F9GA 4P33A 4D4IA 1Z0UA 2VF5X 3CG0A 1LFAA 4BP1A 4DCSA 2ESRA 5CNJA 3EY4A 1CX9B 4HLUA 4BQQA 3HNRA 3CSDA 3Q6IA 3LRXA 5GINE 2HNBA 2BYTA 7ADHA 1ZOOA 3CLTD 2WKQA 2WFZA 2RDMA 3F7TA 4JBHA 1XLTA 4I1OA 2Q0XA 2QL7A 1X7ZA 3I9LA 5KQRA 2B9EA 2LNDA 4QHTA 2VDJA 4IW3B 1G19A 1P0FA 1BD3A 4ZT2A 4CKYA 1X2BA 1JG4A 4YPFA 1FTWA 3KJGA 3RVDA 5L3RA 4LGVA 4F9FA 3BMOA 5LLTA 3EPRA 1BE6A 1RR6A 2PX2A 1U0TA 1A96A 2OT3B 4GBED 3H8JA 2OQ2A 2W71A 3BULA 3QE4A 3QEMB 1XD8A 1PT5A 3E7WA 3K5HA 1E8MA 3VC3A 2GEJA 1TCCA 3A2LA 2D1QA 3QW2A 2H1WA 3E58A 4HN2A 4HOYA 4KGZA 1SUWA 3WLJA 4A2PA 2DERA 1BJKA 4MV1A 3AW9A 4D3DA 2PWPA 1ZMRA 3F9IA 4BMYA 2BKUA 1UKZA 4LRSB 3K9CA 5FAKA 1ZJYA 5KX5F 3AKYA 3N2GB 4JOCA 4MHSA 1LU9A 2EFGA 2IPMA 2IZZA 3FFTA 3MT0A 4JUBA 3W5AA 1BEUB 1NYTA 4LAFA 4WZAA 5F9HA 1EX9A 1H5QA 3HK2A 1GG2A 2YVAA 5DB4A 1GNQA 2IEYA 3AI2A 3OEYA 2XT0A 1SK9A 4GM0A 5BRAA 2BTEA 3LWNA 5DDIP 4AL4A 2YICA 1C81A 1OWNA 1V0JA 4QUAA 4Q3DA 1MV8A 1E9FA 3VMFA 1P1RA 3P96A 1EQUA 3G68A 1Y8AA 1KJNA 2Q9CA 1WMSA 5I7OA 1G0OA 5EL0A 2NZYA 1Y9DA 2X5JO 3IVMA 4W5HA 3QKIA 2FDRA 1SM4A 2P4SA 3R0XA 4HPXB 3LYAA 3TTWA 3VHXA 3DGFC 4CMIA 4HFNA 4J0CA 1U4OA 3HCFA 4EABA 2H4JA 2W8BB 3DTVD 1MA3A 4AQDA 1G8PA 5KPJA 1XDGA 1SUPA 2WABA 2XCIA 5ERGB 1IE3A 1JEOA 5REQB 5ULLA 4HUQB 4BBAA 5CB4B 2IHTA 5CGQB 1JIXA 3TQIA 5JDCC 4AUEA 4Y2VA 4HT3B 4YJFB 3EASA 4EARA 5KVCA 3FKSA 2REOA 1I51A 3ZKAA 3FYTA 1CR0A 2NXNA 3Q72A 5G3YA 4RDHA 1XTZA 2EOAA 1Q7GA 4ZK2A 1KHTA 4NCHA 1GT6A 3I83A 4HWRA 1XVUA 4UHJA 3GZNA 5BSVA 1OJLA 3WFIA 3R8FA 1DHRA 4ZVVA 3TZKA 3MPOA 3U7HB 2OZPA 4ZU3A 4YROA 3U1TA 2X22A 2ZAMA 3H6KA 4H3VA 1V2HE 1H22A 3PSHA 3P0EA 10MHA 5KQSA 3KYDA 3CJTA 1HQKA 3IOBA 2IWRA 1DTWA 1XV5A 1YQGA 2CF5A 3FH0A 3GJ0A 4I1UA 4F4FA 2JD2A 5L6MB 4B6FA 1UC5B 1AKTA 3C5CA 3CUYA 1PJZA 2GK6A 4OXIA 1CVRA 3BSYA 5EINA 3ZIUA 3TUZC 3PDIB 1Z38A 2CJPA 2VCYA 2QQ5A 3ECAA 3FNRA 5G53C 1L4LA 1U7ZA 2B20A 3UMJA 2AZXA 4UU0A 1Q14A 2WNSA 4JIMA 3ZDFA 2PZFA 3OKPA 1AD2A 1PEAA 5CHYA 1A72A 1R0SA 1Y4ZA 2PKQO 2WTEA 3A31A 4ZCSA 3HKBB 4CM6A 5JD4A 2QS9A 1SCDA 4R69A 1KFCB 4J49A 3AR3A 3EVGA 4BEBA 1PL7A 5C5IA 2UZIR 3NGXA 3M9WA 5DK6A 1LVHA 3BXGA 1JQEA 2G83A 3BZBA 3DOUA 3F67A 3GV0A 4PNPA 1C1HA 1LVGA 1W47A 3DCIA 3MLAA 3A9CA 4RGQA 4EELA 1DDGA 4TTJA 5HILA 4CR6A 1J2UA 2GCNA 3EHDA 1Z6XA 5DT2A 4CMJA 3KX2A 1UKCA 3DEZA 2VJMA 1NBOA 5JSZA 2PL5A 1QB8A 1UDWA 4TKLA 3WQHA 1XRRA 3ABOB 4BFZA 3NIBA 3ZGVA 2CDBA 4NP6A 1R27A 1N0IA 3T1HB 5ICMA 2FG5A 3BIWA 3S7TA 4JEHA 2FSSA 2QI9F 3TLEA 2PS3A 2HO5A 5H3HA 2ONJA 5KVAA 3B1JA 2J48A 1E1KA 5BYKA 2QN6A 2XIJA 1JKJB 3H0CA 5A5EA 3WTCA 3D7KA 5J4VA 2C9MA 1RZUA 1KH1A 3OURA 2ASVA 1NQWA 3I58A 1W9HA 1K4YA 4IWYA 1VHJA 5E6SB 4BFWA 1Z5ZA 2ZS8A 4TLBA 2PKRA 4IP0A 3LOUA 3NHBA 4TMFA 3G49A 3P9IA 5E1DA 3ZBQA 1YU9A 2LE0A 3IILA 3PF9A 3RCBA 3AVXA 2DPLA 1GTSA 1Y4DE 1ZGAA 3LLVA 1WD7A 1P7VA 9ATCA 2WNIA 1YZVA 1FQOA 1HDIA 2PZEA 5C5EA 1L4NA 2BMDA 3K4PA 2YIJA 4DXHA 3KO8A 3PC4A 3RTGA 5I9BA 1TA0A 4DSTA 4HVLA 2ET6A 4K81B 5CK5A 1G6KA 1QLWA 4YMSA 1U5AA 3WIVA 3JARB 5FPKA 3KZ1E 2B99A 4BQRA 3REFA 5K9ZA 1ECCA 1QE5A 4GBMA 3NXSA 4DJJA 3QX8A 4PAGA 3ONDA 2R1ZA 2ZUDA 2CXSA 2QX8A 4HAIA 5EJAA 1O95D 2QJTA 3ZJYA 2WBLC 3MOSA 3RAEC 1ULTA 2DQ4A 1ULBA 5K51A 3T0GA 3BRCA 5FEUA 1RRGA 1WEHA 2HJSA 2WD7A 3A4YA 1QF9A 2FFAA 3BH0A 3G1UA 2DBZA 4HBGA 4S1PA 5LOVF 3KE9A 3VKVA 1ZA2A 1ZK4A 1YUBA 2PGJA 4PGHA 5E7JA 4GOMD 3WBKA 1UFOA 1LUAA 4O5AA 3ANSA 4TLDA 4BJ1A 1WXHA 1PW7A 1L4FA 2GCGA 1PJBA 4M86A 4ZALA 2DT8A 3BD6A 2E37A 2WQZA 5E2IA 4JSRA 3PEWA 3VXKA 2WYIA 1TTHA 1ZIOA 2Y92A 3IBTA 3HQ4O 3NIWA 4LC1A 1QC5A 1EKXA 3ODPA 1BFDA 1ULHA 4JLNA 4MS3A 2ORIA 3PXUA 4JMLA 4L95C 4PQGA 4HX2A 5GJVC 2PZBA 3HN6A 1JDZA 1JZSA 2JKYA 1CB7A 4Y2UA 3P0HA 1QZUA 2LDXA 3EFOA 3OPYB 4IMIB 1T9BA 3MUFA 3EZYA 1HQYE 3JR7A 3V8NA 4HZGA 3F1LA 2JJ1D 3KVNA 3L8MA 2QZSA 4ZGBA 1W5FA 1Z2NX 2D4AA 3IPYA 3LQ4A 5HUHA 2X4DA 4WLUA 2DULA 1UP4A 3DEKA 3DO5A 4CKWA 1O58A 4RIHA 2QTVA 2RGDA 4JCOA 4K6OA 3AGPA 1U0HC 5JQWA 1SUSA 2DVMA 2WV7A 3WMGA 1M73E 1PNVA 3QWHA 4Y1EA