3WISA

Crystal structure of burkholderia xenovorans dmrb in complex with fmn: a cubic protein cage for redox transfer
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
180
structure length
180
Chain Sequence
FKPDARFAWCVTGSGHLLDESIALALELPRADLFLSAAAEEVLPLYGWALPRLRKHFRVFRDNSASGVPVGMLYHGMYHTVVIAPATSNTVAKCAFGISDTLPTNMYAQAGKQCIPGIVFACDTEPTVVTQSPNEWVELRPRAIELDNVERLSRFEYTTLVRSLDELKAALGERLSTLDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative dihydromethanopterin reductase (AfpA)
publication title Structure of dihydromethanopterin reductase, a cubic protein cage for redox transfer
pubmed doi rcsb
source organism Burkholderia xenovorans
total genus 62
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2013-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02441 Flavoprotein Flavoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1950 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Flavin prenyltransferase-like 3wisA00
1MVNA 4MWGA 1SBZA 4ZAVA 3MCUA 3WISA 4ZAYA 4ZAWA 4ZAGA 4RHFA 3LQKA 4ZAZA 3ZQUA 2EJBA 1P3Y1 1QZUA 1G5QA 1E20A 3QJGA 4RHEA 4ZAFA 1G63A 1MVLA 4ZANA 4ZAXA 4ZALA
chains in the Genus database with same CATH superfamily
1M5RA 4KLRA 1V7QA 4E12A 5DT9A 3A9WA 1TW3A 3FRJA 4UHFA 2NVUB 4EUFA 5JBQA 2Q3CA 1BHSA 1CV2A 3GJSA 4QDTA 3VDMA 1A3CA 1WDTA 1SPBS 3LQYA 3LRTA 4WXYB 2DQKA 5HJ2A 5CH3A 3H04A 1N2CE 2Q5OA 4ALKA 1QHHA 4URVR 3DZIA 1B6RA 1RJGA 3EW7A 2O2DA 3LLCA 4NARA 4PGAA 5EJ2A 5SYMA 3T94A 1YJCA 1EHIA 4TS3A 5IYZF 4PZEA 2B1IA 3C6MA 3A32A 4DMFA 4WBNF 3PI6A 3CVJA 5EHQA 3ICWA 1BVHA 3RS0A 4Z3OA 5KNCD 3PDUA 1IXZA 5E9AA 4WNAB 2QB5A 4FINA 2PIDA 3MYRA 5DULA 3IHLA 1R16A 3H97A 4KSYA 3KSRA 1FRNA 1N0HA 1PU2A 2NUPA 1NU6A 3E23A 3EOZA 1GLGA 5HE8A 4C0KA 1JZQA 4WD3A 4EJ2A 5ICMA 4YR7A 2GPTA 4MW5A 3SKYA 1QBGA 2B5WA 2MYPA 5D7NA 1X7WB 1D2RA 4LOJA 2IK8A 3SQOA 3FBTA 3CMCO 3G8DA 1LPOA 2D2VA 2YWBA 2L0XA 4Q5IA 1R7RA 3H4IA 4LHSA 1Y3AA 3OQJA 1P8AA 4WKCA 1C3LA 3QU4A 4DCNA 1VPLA 1IHUA 2QJWA 3WMRA 2DRIA 4AECA 2XVMA 4D4MA 3OPYA 3FMPB 4J0CA 4Q4AA 2VPWA 2PD6A 1KDRA 4I9HA 3L6UA 4BN5A 3GLSA 2GVZC 3NORA 3FUWA 3GDWA 3OQ1A 3R3WA 2HWWA 3UXEA 1G3IA 4U2FA 3BC1A 1M2FA 5ITZA 3UICA 5FBHA 1OZHA 2YNMA 3EFHA 5K4GA 5AI8A 4J0IA 4ZVPA 1I3OA 4HDMA 2O3JA 2A9OA 1J5PA 4CQNA 1XCJA 1JDJA 3D7RA 2AH5A 2CLCX 3RARA 3UWOA 4AULA 4WCVA 3GXBA 5DBEX 4FTWA 3IT2A 1R0ZA 2HIAA 2YOHA 1TYAE 1ABFA 5D6NA 2FEKA 9ABPA 1B6SA 3HJNA 4KIJA 4IOKA 4FK8A 2JLSA 3REGA 3EX7C 2WIAA 4OX9B 1V48A 3A70A 4WCFC 4HUTA 4D3DA 2EZTA 1DRWA 5CT9A 3ZI4A 3EUFA 3ZEIA 1LU9A 2XUKA 2GYYA 2WT4A 4GQAA 4W82A 1EWTA 5KNBH 1HYHA 1U81A 2IW1A 2JDIA 1J0XO 4MCJA 3H3XA 2WAAA 3PZBA 4URUR 2RHGB 2XDQA 5FFFA 4FYJA 1HDIA 5A3RA 2BFEA 4MUMA 4XRRA 1N1DA 4F38A 3OTOB 1XT6A 4MMZB 2IEBA 2P9GA 4NWIA 2GX6A 1R6DA 1A69A 5LB2A 4E6EA 1RQXA 1G1MA 3ETCA 3WGLA 1ODFA 2DR3A 3AWDA 4EEKA 1QRRA 4HDQB 4A8JB 4E08A 1HA3A 2F62A 1HKHA 1VLHA 2B83A 2QD2A 1L0BA 4KEAA 1QH8A 1QB7A 3B70A 4PZCA 4TMTA 4X94A 2HMAA 2VQFB 3UAZA 1O5OA 5IVIA 3HNOA 2NTYC 3VI3B 4Q9HA 1QG4A 4D3FA 1XZEA 1J20A 3VA7A 3CBGA 3HTXA 4YJ2B 3T7RA 1GJRA 1Y4SA 4U02A 2UUOA 2JGRA 5DWQA 4A0GA 1BE1A 4EYQA 4DV2B 4HX5A 1P9OA 3BILA 3SC2A 1CNEA 1NQVA 1N2XA 4E2XA 3A9SA 2CLDX 3TW8A 2Z8ZA 2TRSB 1E6EA 3CLUC 3EF3A 4ZICA 3FCCA 2PYIA 3RF7A 4ISCA 2AN3A 1UM8A 5FNVF 5JCXA 4TUYB 5KX5B 4PNEA 2GZAA 3WKDA 3H5AA 1E3IA 1P1HA 2ECQA 1K75A 2PVCA 1EZZA 3H65A 1O6FA 2EYUA 4X91A 3FSRA 3N58A 2VJLA 5F7JA 4F56A 2O8CA 1E9DA 5CCEA 1U7WA 1ZYUA 2YZMA 1HDEA 2INGX 1XTIA 2JEZA 4Y2RA 3C4VA 5GVSA 3AXSA 3ELBA 3O38A 4KE6A 4C7OB 2IEIA 2VWPA 1YIOA 2A6PA 3EARA 5CVJA 5AQ1A 1X7GA 1RADA 3EHDA 2CVHA 1XRJA 3IEKA 2G8NA 3ZH9B 3PQFA 3R9IA 3UJCA 4BKRA 2V98A 3B1ZA 1XX6A 1F5NA 3HU5A 5FUBA 4MMXB 4AIRA 4L8YA 2IH5A 4NYJR 5FPHA 3JASA 4L15A 4UTVA 1FLVA 1W0KD 3MPOA 3DQQA 1BFDA 2AX3A 3LS2A 4I55A 5G41A 3SQNA 3F71A 1D3AA 2NO6A 2OO7A 1AHHA 2VQEB 5A2QA 1XXHB 3FDZB 2AMFA 1KNQA 1Z4JA 1E6CA 4XOUA 4EHKA 5TT1A 3MUFA 2J1LA 3DLBA 3BWMA 4DPMA 1QHYA 1RJ9A 2HM7A 2RC5A 3IODA 1TCAA 1TVKB 2CLFB 1JPJA 4NPAA 5EXXA 3FTPA 2D5LA 3RC8A 3C87A 1G20E 2BY4A 3C6XA 3OU2A 1N2JA 1CZOA 4P4SB 5K1ZA 1OX6A 1P9NA 3FAKA 4UM9D 3QFFA 3LPAA 2NMVA 3NIWA 4P4LA 3HXQA 1X92A 3MPUA 4RV9A 2YHAA 1B8UA 1RQPA 2CFOA 4KO1S 2CY0A 4W63A 1AV6A 1JMVA 4FGWA 2DGDA 1YL7A 5IAKA 2WB2A 1MVOA 4NEQA 3OZWA 1NT4A 3LUCA 3OQVA 3DZBA 2W4MA 5LNK6 4ESVA 3NM5A 4NJEA 3NIFB 1Q1NA 4G67A 4LJLA 5HEKA 1P6QA 1V16B 2IHYA 2WHYA 5A9TA 2ONKA 2VDLB 3V46A 2BGWA 1Q2UA 3I1FA 1X0XA 3N0WA 1YOVA 1X74A 4IWXA 4BDTA 2W2TA 3IEPA 3WLIA 2CMGA 1TVEA 3DCYA 4TQ9A 3WIOA 2PX4A 1CEQA 1K6JA 4ISBA 1HNXB 1MNQA 3KJNA 1T9KA 3AC0A 3PQ8A 4EA9A 4WKBA 3F5FA 4Q1VA 4RSRA 5LP1A 2J3DA 2ZIXA 1PT6A 4XB6B 5FO1A 3OZCA 1DEAA 1PK7A 3DD1A 2HQSA 3G88A 2PPLA 2XDYA 3NQ41 4PAQA 4YJHA 5DTJA 4CUKA 5A5GA 3PC6A 1D6JA 5A0VA 3Q6MA 4RSMA 5K20A 3RYFB 2OV2A 3KVNA 2HO4A 1OILA 4KQFA 1OASA 3IIMA 4HQFA 1E4OA 3ZDYB 2CVOA 2CZQA 2G7MC 4G26A 2YJZA 3K0AA 3K92A 3Q8XB 4H17A 3QLEA 4MH0R 3GA5A 3BSFA 2QX7A 3BFXA 4P36A 4CT0A 1ESCA 2IS2A 1P0QA 3CISA 1ZNZA 5BYJA 1EQAA 3LNCA 3J80A 1QCZA 2MIIA 3M9WA 2O6HA 3ELYA 3ZNNA 3A31A 1EFTA 1YS4A 3DAFA 1HH4A 3UY4A 4MVYA 5HBRA 5CB6A 1AK9A 4G1BA 1KJWA 3BL5A 5IFLA 2YRXA 4I5IA 2ZRHA 3R3VA 4XUGB 2MCFA 5GP1A 2I9PA 1J2TA 1WXXA 1P3JA 3ZHXA 2NT3A 1C1DB 2C7BA 4KE7A 3EIOA 5E6UA 5FWNA 1T29A 5IJWA 2AYYA 1L4NA 3EXHC 1SD1A 2OGTA 3EYWA 1RYHA 2OCGA 1R0WA 3VO8A 1QE0A 3HCPA 1MU0A 2Z2XA 1OROA 3O95A 3PQ3A 3RNLA 4MYUA 4BO4A 1QZXA 1K4KA 4ZO6A 2BSXA 3DF7A 2BI8A 4FJ1A 1IBSA 5EWJB 5BN1A 1B8VA 3HCFA 2Q5LA 4BP1A 3DFKA 4JP8A 1XOIA 3IDFA 4FHEA 1TF7A 3EDOA 3QLVA 5ARDA 3V1NA 1V3QE 3GC6A 3VR5D 4CGYA 5BV7A 1NQAO 2ZAIA 3M89A 3EK2A 2ACEA 5K3AA 5C0OE 1KS2A 3CCCA 2Q5EA 3L0OA 1T91A 1T6BY 3UHFA 1RAAA 4DQVA 3KQQA 3QLUA 1EYZA 4AMYA 1HBJA 2IYYA 2W83A 2MMGA 5E9JA 3V34A 3ZWQA 5H8WA 4ZU1X 2NP7A 4ID3A 2R7NA 2XCQA 4Z0NA 4YJ2F 1G5IA 1QOPB 4S35A 3NP9A 4C4TA 3X1JA 4C7KA 1QFYA 3U0BA 2ZTMA 3C2QA 4AG6A 3K9WA 4DLYA 5LKRA 2Q3BA 3Q5EA 4WI1A 3TTUA 4GYKA 2E5WA 5ESXA 4ENSA 5T4EA 3AVUA 4E14A 1WD5A 2QAIA 4TUYF 5KX5F 5C5DA 1B0PA 3BCRA 5F33A 1EVZA 3B38A 3HCWA 3UWMA 4P8RA 2AJLI 4KUGA 3U3KA 3PFGA 1JYSA 3LUJA 1NVVR 2HB6A 3ELWA 1U6IA 4MS4B 4Y1FA 3QYJA 2BMVA 4X41A 4ALMA 1D1SA 4JVSB 1E2UA 1GZHB 2EGHA 2GESA 4IZHA 1NN3A 3LAWA 1RNLA 2ZWAA 1XZJA 4JI5B 3HPQA 3N59A 2EZ8A 2GCIA 5L95A 3GZJA 3QJ5A 4G36A 2GEJA 3H2IA 3N0RA 3AZQA 3LCUA 3ZZNA 5IKMA 3B3JA 1BFUA 4RAOA 4NULA 1U6JA 2H9IA 4QPJC 3DXXA 5DNAA 4BECA 621PA 1RP1A 3DMNA 3UUEA 2GUWA 2VTVA 1RYDA 2C2MA 1BDIA 2X4GA 4TMYA 5K8TA 1O0CA 4QLOA 4BE7B 2PUCA 1MV8A 3BDIA 1PLLA 1FYXA 3D6HA 5J4HA 4YCBA 3IAHA 4XI9A 1H1DA 3ZS8A 1I0IA 5IH3A 4PXSA 4BFYA 4MW2A 3QG1A 5HM6A 1BKDR 1K9SA 3TB6A 2J0UA 3ZDZB 1AKUA 2NUAA 2Y27A 4PYQA 1TB4A 4F3NA 3DEFA 8ABPA 4O2BA 4F1WA 5J5CA 3UM9A 2AJCA 3JQ9C 3S2UA 2P8SA 4DKXA 5JNVA 5IS2A 1VKRA 2JGNA 1XHFA 1QV7A 4ZIRB 3QKIA 1ZQ1A 1G8KA 5B2ZA 3TCXB 3ENVA 1NVGA 2Y1XA 4CCWA 2EFGA 4M0FA 3WGZA 2OP0A 4Q15A 2CB9A 1E2NA 1Y5MA 3TD2A 5TRTA 1EFLA 4ND2A 3KQPA 1U3CA 3BMNA 3DEIA 2BBOA 2X7HA 5AM5A 1PVDA 1WB4A 2FF5A 4TM8A 4Y6QA 2NACA 3KEQA 4KFSA 4EO7A 3DVAA 3EHEA 3OM1A 3OZAA 3IDQA 2APJA 2IODA 3JS5A 1Y34E 1KZGB 3AMVA 4GLBA 5F7ZA 5FL3A 3RT7A 1JG3A 2WU0A 5FQNA 1EM8B 4DA8A 5KNDD 4QL3A 4HGQA 1D6MA 3T3GA 1KRHA 4GI5A 2PT5A 3QLJA 4NYIR 1V96A 1W19A 3HFRA 1PVOA 2YFHA 3IR6A 3M9LA 3NHRA 4U1RA 5FUWA 3AUUA 1CUGA 2CNOA 5JS2A 4HDRB 1PG5A 3WLEA 3EQZA 2ZUFA 3G6WA 3QU2A 5BV0A 5ADHA 3VTZA 4D46A 3ORQA 3CLTC 3UB2A 1IUPA 2K87A 4ICIA 3UAYA 2GKOA 3LM8A 4QKQA 4JLOA 3DNFA 2NV0A 5I7FA 2F4VB 3VKWA 3SX0A 2JFXA 2Z6AA 2JI9A 3PK0A 5E6SA 5CFOA 1DT5A 4P92A 1FMFA 1XCBA 2CDCA 3DAHA 1RQLA 4UEKA 5H9WA 3I45A 4Y6LA 3MQFA 2RKBA 4XASA 5KAPA 1LS1A 1L7BA 1SHJA 4EA7A 4J0FA 3C1TA 3RVSA 1I4DD 2WKSA 1X15A 3CUSA 3UWPA 3FYTA 5K8UA 1NMZA 5I8PA 2QG9A 3ZBUA 1ULHA 3ZHBA 1FMLA 2VYQA 3G2PA 4TTAA 2OD2A 4MS3A 2Y71A 3FROA 4MRMA 3C24A 1AKWA 2WV9A 2DAPA 1WVIA 2BSQA 2QR2A 2PS1A 1UT5A 1LZKA 1U2RA 2Q0XA 2ZUUA 2W98A 3DZJA 2PANA 1LRLA 3Q7EA 4IDPA 1I1NA 3HA7A 4RKYA 3ROTA 1J6UA 2F7SA 3EDQA 3SWWA 1G6HA 3OC6A 3TD6A 1Z35A 2ZM6B 1GUZA 1P4AA 4DDWA 1C30B 2B5VA 2MT9A 2PFGA 5GAJA 1E1QA 2JHAA 4PPQA 1EB9A 1RYZA 2Z95A 4YX9A 1NPTO 3EISA 2JLCA 4OU5A 4FQ7A 1YK0A 4G56A 3AZOA 1UFVA 2OVFA 1NBWB 3I52A 1ZCAA 4H31A 1FS5A 4KLZA 4CDNA 3ZK9A 1IQUA 2EP7A 4MTLA 1XCOA 4GKBA 5CDTA 1C3JA 3TG8A 6ADHA 1ZD1A 5I51A 1AF7A 1DCFA 4HUQA 3D3WB 3VOSA 4XD2A 2I7DA 2CXQA 1FBTA 3JRWA 5JLJA 2AMVA 2HSZA 4LHEA 3RKSA 5AW5A 4WCDA 3UATA 3U7QA 4JGIA 4DR5B 4YLEA 3PDIA 1MEOA 1H6AA 2CF6A 2QF7A 4G6ZA 5CX1B 3DDNA 5TX7A 1XROA 3THYB 1E9CA 6AT1A 5HHTA 4GX5A 4TS9A 2W7TA 2ODTX 4L28A 2YOGA 2J5BA 2B7CA 1NW3A 3L77A 4K9RA 3WK6A 1CR2A 1LV8A 2JVIA 3FOFC 2J5XA 2BEWA 2ZB4A 1TM4E 2Z8XA 2OHJA 4DXAA 5K51A 4XFDA 3AXTA 1CJUC 4I5EA 2C83A 3WMFA 3WGHA 1ULBA 2A9QA 2WPNA 1E59A 1K68A 3MWKA 1JKJB 1RXEA 1EGAA 1QR6A 4M9CA 1SBHA 1VBFA 2GZMA 3C1OA 4F9GA 1TK9A 3HU2A 5FORA 3W1WA 4B74A 4M99A 3THXB 5F3DA 1U8TA 4MDHA 1IONA 3MN1A 1FOEB 1T25A 3K9NA 5DH9A 2PD4A 4CKEA 3MS4A 4UREA 1EDBA 3G0BA 2C9ZA 4MR7A 5E1BA 1GTVA 1QX3A 4YREA 2YNMC 3X1KA 4E5UA 5EUMA 1M2KA 5LD2B 2HW8A 1ONBA 2NU6A 3DTVB 2VP3A 3DBRA 1PLJA 3TE6A 2FQQA 3TNDA 2B4TO 3F78A 1Q1GA 2O5VA 3L43A 3Q7IA 2YWRA 1WZNA 4DMGA 3I04A 2AG0A 1WABA 2ZJ6A 4Q3OA 4YAOA 4JL5A 2JANA 1QHEA 2O7QA 1UR5A 2YXLA 2JF0A 5A4KA 3KRTA 3GCGA 4RFLA 1QZTA 1TZBA 1WU8A 5FOQA 2RJ3A 1SC1A 1JQKA 2PXAA 1T3ZA 1Z0SA 1QH1A 2PKQO 2Q45A 3I09A 1TYBE 2OUKA 3NS7A 4N5HX 4RU1A 3TYXA 2R8XA 1GN9A 2JGIA 5EWLA 4YNBA 3IA7A 1OZGA 2GNOA 1SKBA 2WHQA 2ACWA 4Z0HO 3K16A 2ST1A 3VPFA 5JCPA 1FSZA 1RM4A 1Y1PA 1ZZEA 2XEXA 4NU6A 5TQ2B 3GNTA 2EX4A 1TCUA 1NVFA 1DBQA 3FLMA 4KVGA 3RTCA 3RAPR 4EWLA 5HGXA 2DSTA 1A9OA 4P7GA 3KEMA 1ARZA 4HGPA 3UT6A 4BGDA 1NTOA 1C9NA 1M10A 3T52A 4BJ6A 1BHO1 7MDHA 3LYLA 4IJWA 4IM7A 5F1OA 2VUTA 2OPHA 4ZCIA 3ZXYA 4LYHA 3B60A 1JR3D 2SNIE 4GI7A 3TPCA 4H4CA 3SE7A 3ZHOA 1L3CA 2X1HA 4IH9A 1M6HA 2DBZA 4YAEA 4M8LA 5DBIA 4ONEA 3MJSA 5IULC 3GYBA 1H8HD 1UMKA 2QPTA 2X1VA 3HJGA 1YT5A 1E98A 1N9GA 1PDWA 2P3LA 4S3MA 4BB6A 1IY1A 4I8XA 3X2EA 4DUGD 1R8XA 4FYVA 1SIBE 5G1PA 1GZVA 3I23A 3MSXA 4OAQA 3RTEA 3HO1A 3BL8A 4G0WA 2Z3VA 4RYDA 5AVUA 1AGNA 2C0PA 2O8VA 2BMDA 3C3PA 4B76A 4KN9S 2NU7A 3EJ6A 3QA3E 1X2EA 3GB9A 1WTCA 2OCLA 2FR8A 4RK7A 3W9BA 4G0NA 2WQZA 3QXSA 4R1TA 1QB8A 2RK3A 1DIAA 1YZGA 3QKSB 3WYDA 5BNIA 2CE7A 5CIWA 3THSA 4B3HA 4F84A 3ZNQA 3KQLA 1Z28A 2W93A 1SKUA 1VCIA 1CR4A 1GV1A 1GZ7A 1N1MA 2H31A 3ANYB 3F9RA 1G6Q1 2X9QA 3HA5A 1KTVA 4ITRC 4XCVA 5DCUA 5EFZA 1EFKA 3I58A 1M0SA 1VB5A 3ID6C 3OCUA 4FMCB 2QP3A 5B3LA 1Z73A 5K7SA 5DNEA 2QXYA 2J07A 1YR1A 3U3RA 4FFMA 2NV2B 3DEHA 4HTAA 4QPDA 1HDCA 2CL5A 1UMDA 3AEQA 4UEOA 2OBYA 3RHZA 5KJCA 1S2NA 3K53A 2JBAA 3LECA 5BYKA 1Z7YA 1PQ4A 4DQ0A 2ODBA 5M7EA 1JEEA 1V5GA 3OICA 4OOEA 2GS9A 5D3QA 3NPAA 4Q1FA 5FWAA 5THQA 1W25A 2VATA 4MKZA 1OMOA 4MB0A 3PXAA 4LWQA 5E7QA 3U2QA 3VX3A 6LDHA 4LJ8A 1KQ3A 2BDUA 4P98A 4WBXC 1SCAA 1CR0A 1WLSA 4AZVA 2DG2A 5D3ZA 4AZ3A 2DQ4A 1A5TA 3OLCX 3RUFA 3A9UA 3ABZA 2DJIA 2QE7D 1ORTA 3OE7D 5T67A 3OVMA 4RETA 3KT8A 5FOSA 5TPZA 5C4MA 3V8NA 3OD1A 2D3WA 4INAA 2OG2A 3OOEA 3R6LA 3VKHA 10MHA 5KJ6A 3ENNA 1EFRD 2EW8A 3QG5A 1TPZA 2CSUA 4R2JA 5A1TA 3PJDA 4BPRA 2FW1A 3NH9A 3K9CA 4I1UA 4CRWB 1S9HA 5EVCA 5BNZA 2AQHA 1P5HA 3WIDA 2F8SA 3WS7A 3VUFA 1QP8A 4MUKA 3ZJ4A 4LRUA 1YRWA 2J67A 1XQXA 3LDUA 3G9XA 2XMQA 3QWAA 3MJRA 2WYWA 1XG5A 2PWZA 1XKQA 3EAFA 3KQVA 3O1JC 5DF1A 4UUBA 5BQ3A 5AW0A 2CGEA 4PINA 4C4ZA 5KTMA 2V7BA 4UDXX 3L3BA 2ID8A 4ZAFA 3WHIA 1OREA 5EP2A 4CHTA 1K8QA 2DF8A 3G8BA 4MI3A 4YUAA 4IHJB 4JN6B 1YGYA 2NYRA 5AKHA 5DP2A 1Z2EA 4NMMA 5IKPA 1VJRA 3F6SA 3K1AB 2JHCA 4FR0A 1LSJA 2FFHA 3CSUA 4EHDA 3GMIA 3ME5A 3C70A 2WUDA 4L5BA 5HF9A 4CQMA 3AUTA 1IDOA 1NN5A 3D6VA 4HL6A 2XYPA 3OM8A 2IA5A 4HWOA 4QBGB 3I1JA 2FN7A 3QELA 4R31A 1GPJA 1PEAA 4OQMA 2WJAA 1KVUA 3H8WA 4CEHA 1BMTA 4NV0A 3DG9A 5BQXA 4A36A 2P3SA 2VP4A 1Q92A 3V3TA 4OQEA 1FQKA 1ESNA 3FKQA 4FDLA 4S24A 1AKTA 1Z6GA 4HNQA 2ZI3A 4TLBA 1RXWA 1E3TA 4YALA 5F3WB 1LS6A 2E4UA 5EZSA 5B1EA 3UK7A 3UV3A 2AB0A 1V8DA 4BVGA 2I66A 4RANA 4CTJA 3DDWA 4S1NA 1JLKA 2UVDA 3O90A 1D5CA 3FH0A 1L5QA 3QW2A 3QXXA 1VCMA 4RVCA 5ISMA 1W73A 3A1WA 1USWA 4RJTA 4OTZA 3DKKA 4DC0A 5ICSA 1Y8QB 4FGZA 3WV5A 4ZAZA 4AF6A 4KZPA 1BA2A 2ZDGA 3K7EA 4TV9A 3REFA 1APBA 3L4BA 3V42A 3OX2A 3WTCA 3D3JA 3T1NA 4BVEA 5K3FA 1NJ6A 4WZBB 1I33A 2FX3A 2I6QA 3F90A 3LYHA 3QPDA 4KOAA 3DBOB 3RYHB 1UDRA 1JHMA 1RQ7A 2GZ1A 1ISSA 5JVDB 2FUG1 1E3LA 1KOFA 1RACA 1XLWA 1YHNA 1GAWA 1X0VA 2P2CA 3CIFA 3B2EA 3L7MA 4G4JA 3MBKA 5BOSA 3CCBA 1DUIA 4GR5A 3WA7A 4N18A 2I7XA 2OHXA 1UC5B 3L8YA 2RAPA 1IAVA 2Q2QA 1O9HA 3DHYA 1JXOA 1XTKA 4ZEVA 3CVXA 2JIOA 1WCYA 4YAJA 3W6ZA 2OXEA 4FC7A 3AR3A 1YBHA 2OR3A 1Q14A 1RAIA 1GHTA 2Y1GA 3AUXA 4QBIA 3QTTA 4P53A 4TYQA 4FQ8A 4JI0B 2OCDA 1A8SA 2CJWA 1W1UA 3QLVC 5KU7A 3RG8A 3RSCA 1LLFA 1YQQA 1Z0JA 2A9JA 1QGAA 4Y1GA 5KJEA 4DCUA 4LECA 4ETMA 4QOFA 1J97A 3FOEC 1B14A 5AJVB 4MR9A 3HLTA 1U6KA 3QLUC 4JU8A 1WSDA 3DOOA 1OX5A 5JLAA 3JSXA 1U31A 2JJ2A 2P9CA 2R8OA 3DL7A 4N3GA 1NP6A 4OO3A 4X1YA 1NQXA 4IKEA 5TJ9A 2ZTHA 3HCCA 5I7EA 1H05A 2A9PA 5MN4A 1HK7A 2OLJA 3ZKWA 3EGVA 2R4TA 2UZIR 2AR9A 2N1MA 4QODA 1KKLA 1LBQA 3AUYA 4UNQA 1JI0A 1DBVO 2HCJB 4RKFA 3KYBA 4CLOB 3BICA 3L49A 2VH5R 2ZUBA 2FMFA 2WPDA 1AKMA 2QIPA 4FFPA 4MWCA 3HYTA 5A7GA 4A2PA 1CD5A 3DM5A 3KOXA 2GJSA 2PX6A 4GSLA 3RT1A 4UM9B 3OZ7A 2WTBA 2ZR0A 1ESEA 4DVGA 2CWWA 1V95A 2WFAA 3L0CA 1KRWA 1LDYA 1PZHA 3KJIA 1JMYA 4H1TA 4EKIA 1NI5A 5DM70 2EIXA 2XUGA 3LCRA 3EGXB 3K8YA 4K9KA 3THWA 3B8EA 3I1YA 2YUTA 2Y66A 4WN3A 4ASUA 1MOSA 4HR7A 4YAGA 1W4RA 4RJJA 2BFFA 2ZSUA 2J0EA 4FMCF 4XQEA 2C03A 3OCCA 5J4YA 3PUXA 2ASEA 5BP7A 4QPCA 3T9CA 2GJAA 2VP6A 5FP0A 3WADA 4PG7A 4E30A 2VP9A 3AF4A 4HDKB 4O8ZA 1DC5A 5D6OA 3K2IA 4EMBA 1P4SA 3VSAA 4JBGA 2XSZA 3FNBA 4PE5B 5AXDA 5JMPA 4F7WA 2GEDA 4M0LA 2COEA 3VPSA 2N46A 1OBVA 2KQUA 3W3AA 1VJGA 4RELA 2LNDA 4DA7A 1II9A 3CKKA 3ITNA 4EUSA 1XQYA 4H16A 1B23P 1JLMA 2GD6A 2FJPA 1A1SA 1C29B 1H42A 2BGKA 2EERA 3IUQA 4HGNA 4B6JA 5CLFA 2N47A 5A9SA 5FDFA 1QG0A 1J7JA 2X6RA 3FCEA 1SMKA 2X5JO 1U7ZA 2DQSA 4TV8B 1PV2A 1JXQA 5EQFA 1SUAA 3G85A 2YYZA 1B93A 1X87A 2X2OA 1ZOIA 3IKLA 2CJYA 3LUKA 4QGFA 2VF8A 2I91A 3ZU3A 3BZWA 2WSIA 4JOQA 1IQ0A 1OBCA 3E84A 1N3IA 3EEFA 3H5RA 3KUDA 3OFSA 1EK6A 2GNAA 4UMDA 3VR2A 3KCQA 2XWQA 1C9DB 5FBKA 1CJVC 4BLOA 5D1NA 2ILTA 1LQ2A 2WHPA 1YR6A 1V5IA 3ZQ4A 3Q72A 1RWKA 1SN7A 1ZM4A 4U8HA 2QUIA 4RX1A 1I32A 1CP2A 3AY3A 4URHA 3IE0A 2WYUA 3PT5A 1W36D 2L17A 2A58A 1AQLA 2FEOA 2ZBQA 1DX6A 3CS3A 1FRVA 3PPYA 2OBBA 3UAGA 1YVPA 4IFEA 1P2FA 4QUBA 1ISPA 3OE4A 3F5MA 2J33A 5DNVA 4XAQA 4ZVUA 2QD4A 3NHAA 2V7PA 5JAHA 1UFKA 3HCRA 1AZTA 2VLBA 4RF3A 3LP6A 1UWKA 4AWXA 1ZMTA 3IURA 4XLLA 1J24A 5FO0A 3U44B 3UXYA 4Q9AA 2PWBA 3DHNA 5LOVB 3PR3A 3FN4A 3O8QA 1OWPA 3ZK7A 1FYVA 4LF8B 1SVKA 1X1EA 3OPMA 3KCNA 3ETDA 1EWQA 1CUAA 2R66A 1N0UA 4RTNA 2P9ZA 1YNOA 2GK4A 1IHPA 2K2QB 2ZJOA 3KV3O 2WB4A 3ICEA 1UBTS 4KAFA 4O4HA 5AP9A 1XVUA 4KQ1A 2FJUA 4QDJA 5BNTA 4R51A 3GLVA 2TMDA 2AW5A 2R11A 4M9UA 1TUGA 1W2HA 1MQAA 1XXLA 1QPGA 4AJNA 5BR7A 3SMQA 4EY7A 5KYXA 5F76A 4PG8A 4DV3B 5DLPA 1QKKA 4AKIA 3IJPA 2D7JA 2BZ1A 3M6FA 4MKFA 4O6VA 4YMVA 1TO2E 3MA0A 1X42A 5KDDA 2YJTD 3ZU6A 4RXTA 4CLHA 2HKIA 4QBKA 2WWGA 2YV2A 1QS0B 2QRZA 4QPNA 4BE9A 2H7CA 5BRJA 1KWKA 4W5OA 2XT6A 3P1JA 4ETWA 3JZFA 1T0HB 1M0TA 2WTNA 3W7AA 1EFPB 2EOAA 4U39A 2GFIA 2HWUA 2NYUA 1GFWA 4IH1A 4MV5A 1V11B 1N6LA 1TJ3A 2AJDA 3JYOA 4TX1A 7ABPA 2DPYA 4P84A 1YB2A 4RY8A 1RWNA 1U98A 5JVDF 1J2YA 4LTMA 2R7LA 1MR3F 1ZMBA 2FSFA 4EEZA 3B1XA 2D06A 3FZYA 5FD8A 2JVKA 1H5UA 3UJBA 2WHEA 1QTQA 3AILA 2C8VA 3Q6IA 4K26A 1AE1A 1W75A 4DLLA 5JI3E 4NXMB 1JRLA 3HRKA 3HDVA 5LLTA 2Q4DA 4P4UA 4PHGA 1N6PA 3HE3A 2FUCA 2H5EA 1B3RA 5JAZA 3BTOA 5EE0A 5TMPA 1N8TA 4X65B 4R9NA 3T1OA 1EPUA 2VZLA 1QC5A 2J7KA 3VC1A 1VYTA 1G21A 4CLRA 3OEEA 4FFNA 1PBNA 2WWHA 4J2TA 1KDZA 1JSZA 1WPXA 4ZVRA 3B8HA 4AP5A 4KIWA 3T3MB 3A06A 4F04A 1RPTA 4WBNA 3DW3X 2CJPA 5KSWB 2XQGA 1C2TA 5JT1A 3CJTA 4MHTA 1GAEO 4ZA2A 3QH4A 3AI3A 2G3YA 1Q3HA 1VIMA 4TTJA 1W52X 2N42A 3Q11A 3QPVA 1ZNQO 1VLQA 3GD7A 2IHBA 4RGQA 3K1JA 4PLGA 5JOQA 2P9HA 4DAOA 4WGFA 2V7UA 4Q7KA 1OT3A 2K2WA 3GQBB 1I3KA 2WINI 1AUQA 4PX5A 4WOBA 3N0VA 4DS3A 1M6VB 5GZ6A 2XLCA 3KKOA 1T8UA 1C9KA 4ARZA 4M6WA 1FX0B 1YZYA 2OY0A 1T8RA 4PM4A 1Y33E 1SBIA 4XWAA 4R5HA 2EL9A 5BR4A 3IIJA 5DOZA 1LEHA 2IBTA 4BNDB 5DV9A 3AEXA 3NALA 4PZUA 4KPGA 1Z56C 3LMKA 1TKCA 2HK9A 3EPPA 3GNQA 4BP9A 1MIOA 1E77A 3JWHA 2VHUA 4YJDA 5C35A 5E4TA 4CIAA 4WL0A 1GUDA 3EXG2 2XMCA 1C7IA 4QFMA 4IUYA 5KC8A 3S1SA 4AZ0A 1VJ0A 3MRVA 4BTLA 2PL9A 4BDSA 5EPEA 1MB0A 2P6PA 3JYHA 4JY7A 4U3JB 5DTMA 5LZ5A 2LWIA 2IYQA 2ZIAA 4Q3DA 1D7OA 1SR8A 2C9CA 1EFHA 1R15A 1I4EB 4NR0A 4WZAA 4D43A 2IXDA 3PE3A 1V8ZA 1ZSNA 3LU1A 3ND9A 1KZHA 1VSQA 1JJVA 2HSJA 4C2UA 1XQVA 3V3KA 4AJJA 4OP1A 3RSFA 3H5VA 2HHCA 4EZBA 1N3YA 1ICEA 2QTNA 1GUYA 4E31A 4Y2SA 2BGTA 4A6XA 2JA2A 2PFKA 1ZWLA 3BRSA 3E8XA 5GM2A 3S99A 1CDDA 4HLDA 3ER8A 1T1IA 3U19A 3A6DA 2H5IA 3DZFA 4BO7A 1Y7LA 1UC8A 1O5TA 2NOAA 1PD1A 3L82B 4RA6B 4TV8F 1K7SN 1G2PA 2DCMA 5F21A 4TL9A 3JYLA 4A16A 3GUUA 1L5WA 2RC6A 4M1TA 3M2TA 3SY8A 4EQ6A 3F5SA 4J03A 2DPGA 1MTZA 4X3PA 1R0LA 2AQIA 1AK2A 3IVGA 5HDBB 1PJQA 1QUEA 3PPXA 2QLNA 3GVPA 2XGOA 1KFCB 1A2KC 2A0KA 2JFOA 2PKYX 3LX4A 2ISQA 1XP8A 1XRQA 4X00A 4YMUA 1I7QB 4G0YA 1TJPB 1QYXA 2NNWB 2Z8YA 1LK0A 4D0GA 4GT1A 1ZISA 4Y7CA 3RBVA 1P3DA 2UDPA 3SG0A 1CUUA 4KBGA 1O54A 1IUOA 3OFNA 4NAHA 4L3OA 1TIBA 2J3MA 4CLEA 2H2IA 2F8MA 1VPDA 5KHOC 3BFPA 3MMXA 3DLAA 4MO2A 3SIRA 1GPDG 2FR8C 3STTA 1I51A 2R00A 3HABA 1NBMD 4JJZA 3SN6A 3LTNC 1RABA 5CGZA 1HT0A 2CNWA 4BJHB 4HGZA 2Q9UA 1NTRA 1JLLA 2WA1A 1V7ZA 4E51A 4C6TA 2ZQYA 2JCVA 1CFZA 3AIKA 2Q3LA 3N70A 4N8EA 5ERYA 4EIWA 2HRDA 4X45A 1L5OA 5FNVA 4IIBA 5GTDA 3B3FA 3F98A 5LOVF 1DTWA 3SQLA 4OHUA 5CJ2A 1QJCA 1EXWA 3LHIA 4IDGA 2AQKA 1FW6A 2IPXA 3R3UA 4JC8A 4K1LA 3KQYA 2OBXA 3CA8A 3UPDA 5B30A 4M7OA 4RHCA 2SICE 4QC2A 1NMXA 4AUKA 4H3SA 1GGHA 4YK7A 3ZZTA 4FDUA 3WLQA 4P4TA 3MAGA 3FZNA 2J08A 2IFTA 5EPUA 2WG1A 1L7NA 2Z9BA 4MGKR 5IG2A 2YW9A 1Q7CA 2FUG6 1Y3FE 2EZ9A 2B25A 2X5KO 4D0SA 3Q3HA 5IASA 2W4IA 2P6OA 3GAAA 2V7TA 2JFGA 2H1FA 3HKBB 1G8YA 4IQ4A 2XUJA 3K32A 4DGSA 4E5NA 2B6NA 1W4AA 5EA2A 2WF7A 1YFZA 1D2GA 4XYMA 4UUPA 5K3SA 3ILVA 4OMDA 4NEHB 4PBTA 1FSSA 1U3UA 4A10A 5A0TA 1Z74A 3EGEA 2FTKE 3UA4A 2AC4A 2CXPA 4QWWA 3D3QA 4GGPA 3L0PA 3CXUA 3H99A 3RKUA 4FPXA 4H7PA 3BAZA 2QT0A 4COKA 3H0EA 4HB4A 5A4DA 4OY3A 2YVQA 1LC0A 1YD7A 1OIVA 1XFAA 3FVTA 3JRNA 4K0KB 3MMPA 1DAEA 1Z5ZA 2GDJA 4M1KA 3F9IA 4K40A 1VIYA 2R87A 2ZR9A 4N1AA 4PLHA 3SU8A 2W48A 4OA8A 3Q1LA 3C3KA 3AUSA 4HGYA 3T5BA 1Q6YA 521PA 1REQB 4QVIA 4FKMA 5BQOA 1CQJB 1GPMA 4GBGA 3TB4A 3GLIE 1XTTA 2B4RO 1K7FB 2ZSFA 4FILA 4JX9A 5J5AA 5I4IA 3P0HA 2VXOA 5C9ZA 1DKQA 2RSLA 2E4ZA 4HDSB 3HSKA 4UBOA 3JX9A 3CINA 4IXTA 2AJ8A 4TRNA 3EDYA 4K9PA 3G68A 3KSBC 2XB2A 2GFQA 3F5QA 4IX1A 3BFKA 2BFAA 2BR4A 1TZMA 2UZ0A 3CT6A 5DHFA 4P7JA 4XDHA 5AUQA 5ED0A 1SXPA 3JQGB 1ZAKA 1CC1S 1L7XA 3JQRA 4C7BA 3L7OA 4I1SA 4HY3A 3OEHD 1L4GA 5F51A 8GPBA 3WV4A 4QM6A 1XALA 2JS7A 2OV1A 2H29A 3AFHA 1YFJA 5DGIA 1UQRA 3W3AH 2OQRA 2EJCA 3MC1A 1Z17A 4IDCA 1QAOA 5ELMA 3SEAA 1JBQA 3MG9A 3T5MA 3A9VA 1SVNA 4AN1A 1G64A 3BGDA 4BVJA 3CNHA 5KYKA 1GNLA 3HV0A 1GT6A 1T2VA 4XIFA 2YWEA 1PSWA 3WDKA 4IIJA 1FVOA 3A36A 4KKVA 3RVPA 2JJ8A 2I1LA 4UQLA 5KQPA 2PRZA 1JSXA 1LBTA 2AEFA 5TS3A 3VNRA 1Z4KA 3L4BC 4Y8VA 4DLTA 4FS8A 4JI2B 5FHRA 5CD9A 1KAEA 1G63A 3SDSA 3WGQA 2H59A 4C08A 2FKAA 1RQRA 1OLUA 4D41A 2F3QA 3GRFA 1JVBA 4PZLA 5T4FA 2ZE6A 1WUHS 3JYNA 3STUA 3HP1A 4BVLA 2ZTUA 5JJBA 5FA5A 1GG2A 4QRIA 3NRCA 1E58A 3WBJA 3MTAA 5KC9A 1UT6A 2YJ3A 1FP7A 5MGBA 1FFEA 4NLLA 2I7VA 2QTFA 2I2XB 8AT1A 2CLEB 2MR5A 2PT9A 1COWA 1P18A 4B5KA 2HXSA 4S2UA 3OG9A 2VUUA 4L9AA 4FGKA 4M8NE 4UDYX 4W1RA 4GM0A 3RVBA 2VXYA 3QX7A 4KTTE 1BD4A 3L8ZA 2QRPA 1PFQA 2WP8J 4D82A 2ZI9A 1G4UR 1OPXA 2LUOA 3GCXA 3QBEA 4DZZA 3HKEB 1RRMA 2RGYA 4ZMBA 4WLOA 1TMYA 2XCOA 4I5FA 3TQTA 2C5HA 2ATCA 3CLRC 4G0MA 1SU7A 1AV7A 4YQFA 4EJSA 1T8WA 2BMJA 3FLEA 2BT4A 3U6BA 3QUQA 2REQA 3LBHA 1KZ6A 1V7CA 4ZYUA 1EINA 2AW3A 4AU1A 2QV0A 3VR0A 3EFEA 3L6CA 3OIYA 2IPLA 4RMNA 1R9NA 3QJGA 4P38A 1DIGA 5BN5A 1DB3A 3HNRA 5DHSA 3FLBA 1ATIA 2CF5A 2P4UA 2B98A 2A57A 1Z83A 3IV7A 2X76A 5M04A 4BGUA 4DYHA 3PEWA 4RZ2A 3LVQE 4P5EA 5JXHA 5ENZA 2R7MA 1VL6A 3AIOA 1JG2A 4OG2A 4KH1A 3MBOA 2ZR7A 4CL8A 1XPUA 4DRYA 1A71A 2NQ2C 1AXRA 2ZBUA 3AVVA 2Z09A 4CTNA 1IG3A 4IEEA 4MR8B 3OTIA 4LYDA 1MAVA 2P2NA 1JAZA 4PCAA 3LGSA 5EMHA 3U7EB 2BM8A 5FX2A 4QATA 5TGZA 5C5CA 2IYLD 3D54D 1XRLA 5AW2A 2XYRA 3A2LA 2OXIA 1A9PA 2IHZA 3IDSA 3IPYA 3L1JA 4LSWA 5JDIA 2D5IA 5BVGB 1LBEA 2UYOA 4D9EA 1T2DA 3ZK8A 3VQTA 4PNHA 4ERXA 2XNSA 4WHMA 4X97A 2HYIC 1P7WA 4B75A 3E22A 4FZ3A 4CBVA 4D9GA 2H4HA 4AX8A 4JLAA 3L6DA 1K7YA 5J43A 3GLKA 1L7EA 1ZJ6A 5H9VA 5JASA 4UMEA 1IZ7A 2A35A 1EHYA 1JDBC 2PBLA 2DKOA 4N54A 5KTNA 1KAMA 1RR6A 2CD7A 1P4GA 5BWMA 4RJLA 5HOQA 1W5SA 3CZRA 1QTNA 4ND3A 1KC1A 1GQOA 1Z2NX 1HDRA 3GK3A 4WPGA 1U1IA 3W90A 4BNXA 5B5SA 5K8VA 2FP3A 5AJZA 3QI2A 1C8VB 4YRFA 3ZTYA 4NZMA 4B8ZA 1GG8A 2R5NA 3P9PA 3FXAA 1PG2A 3BWYA 3FYUA 4R7ZA 3FRIA 4J8PA 2FRXA 1GZDA 4RZQA 3RWOA 3CHYA 1BHQ1 3IQEA 1JGTA 2BE7A 3QOYA 2RK4A 3FSJX 3TRFA 5C8YB 4HVLA 1FFXA 4OXXA 4ZZ2A 1X2BA 4DRZA 1AX9A 2DKFA 2WIKA 4V1CB 3MWYW 3G7NA 3GLGE 1PD0A 1N78A 2A3NA 1RPNA 2O2HA 2B9VA 3U4QA 1IN8A 4EY3A 2EKBA 3HZOA 1XD9A 1UM9A 4OB7A 3PG5A 1R3UA 1G4HA 2CK3A 1J99A 2GWHA 3B51X 4G0QA 4NU8X 4PLWA 4JODA 4Y2YA 1K27A 2DYKA 4OJQA 1DVRA 2OCAA 4PEVA 5IDVA 3AM5A 3GFPA 3EPRA 3GX1A 3J81A 2HBZA 1ZVQA 2X6TA 3ZVNA 3E81A 4HWPA 2WICA 2YS6A 4WBSA 5EMJA 5JD4A 1WSWA 1JHXA 3E35A 3TQRA 4BGEA 4ZOEA 4QFBA 3HFSA 1XNJA 4RL6A 3OZXA 3KDSE 4LDQA 3SFTA 1Z4PX 3OLZA 3D6JA 3NMUF 1G17A 1JWAB 4IILA 1GNTA 1QUFA 5HF5A 3NV9A 4GGMX 5G0TA 4DAEA 2EW1A 2B3TA 1AUOA 2PMFA 2OB2A 2WOOA 3D7NA 3FSGA 3IIKA 1BVUA 1T36B 1GPUA 2ARKA 1XZDA 2BI7A 2GLUA 3ZU5A 3ZWCA 5LQNA 2VA8A 5GV8A 1R4MA 1N3BA 2YMPA 3JXEA 2IBMA 2A67A 1QVWA 1UJBA 4G0OA 5IJZA 4CEJA 1W4LA 4HLCA 2QUBA 1HNNA 1WRBA 1WHTA 1I4WA 1Q0SA 3N1UA 4LRQA 2ECPA 3IOBA 3QX8A 1W88A 1Z88A 2J6BA 4LZOA 2H2DA 3FTCA 3NR2A 5K4AA 2V5UA 2IITA 2Y1OA 3HKDA 5EJAA 4YUWA 4IKOA 1Z0ZA 1KRXA 2ZYSA 1E4YA 3FZEA 1QGOA 4D4LA 3HWRA 2GBIA 1M7BA 3BMCB 1HDZA 1PHRA 4C4YA 1T5IA 1E6UA 2IIBA 4UVEA 5EKTA 2R1UA 1XEXB 1BJTA 1PZGA 1FVFA 1L5RA 2D2EA 2IYZA 2D1TA 1G5RA 2BZ0A 2HNBA 3ROZA 4D9NA 3PSAA 2ZJAA 3ZLTA 3DHWC 4IIVA 5GADl 3PUZA 2VF7A 3DLHA 4UZFA 1KU0A 1J06A 1GILA 2XA2A 5HQ3B 3AF6A 4LIPD 1RWMA 1O4WA 3DE0X 2FWIA 2RCYA 3OQHA 3ST7A 3VR1A 4FFBB 4Y0VA 4D4KA 5CD1A 2FZWA 1LRKA 1VJTA 3KSZO 1IBLB 3AP3A 1P8JA 3G1TA 4ZQEA 2ZXEA 3D02A 5AK6A 5EIEA 1V2HE 2CNDA 1NVXQ 1BMFD 1JU9A 1JTEA 2LRHA 1PJAA 2XMRA 3RKRA 1T3SA 3U0VA 1MHTA 2XNHA 2BZGA 1ID8A 4RLSA 3QV2A 4G1UC 3I0ZA 4INZA 1A9SA 4MQUA 4MVWA 5FPPA 1AKRA 3VR6D 2NO4A 4WFIA 1LI5A 1PL8A 4Y9DA 1LLDA 4L16A 4NV3A 3F5DA 3SZUA 3CIOA 3IEUA 4PAWA 4EKYA 2AZ4A 1Z82A 4K6GA 5BWLA 4POOA 1Z29A 4PFJA 3GCWA 4P54A 2PH3A 4E1VA 1SXJE 1MRZA 2HHAA 2WTEA 5KKAA 1NQ5A 3LIIA 3LCJA 5NLLA 2Z2IA 1YMVA 5JZMA 3PQEA 1KKUA 1TTHA 4R41A 1DFHA 2X19A 4NCKA 3B13B 1XVLA 3GJXC 5IJ0B 4HWKA 4F4FA 1U1GA 1KBZA 1QRAA 1F3OA 2XF2A 1JZSA 2VSNA 3A1VA 2A1TR 2JGJA 4WW0A 1E4EA 1ZJ5A 4V0ME 3RUIA 2FPMA 1GRVA 4CM4B 3UHJA 1GGNA 1KDVA 2HBRA 5GVRA 1E5XA 3HVJA 3K5IA 3LXMA 3NOOA 4BL5A 2C4HA 5JEEA 4DNOA 2FK8A 4ZVQA 1BO6A 1RAEA 4GE0A 4F60A 1W47A 3LOQA 1GFZA 3NC0C 3O8LA 4OFWA 1ZR2A 1LTKA 2SHKA 4DB4A 1PT9A 2Y68A 1F38A 2WSBA 2QVYX 1YE8A 4TKVB 2JAWA 4RPCA 2Q0SA 4C4XA 4N3CA 5BVHA 5K0JA 3N3BC 2ZULA 4B6FA 1GPLA 3DLPX 3PEVA 3CH5A 2YJ5A 2WTAA 2AXQA 2GJKA 2G09A 2VNAA 4C9BA 4PZYA 4MV0A 2QMYA 1EUQA 1P81A 2YQZA 1DKNA 1DBIA 2FN4A 2RARA 5GPBA 5B55A 2J8ZA 4HC4A 1QBKC 4PSUA 1YRQA 4XCXA 5C32A 2OMEA 1MP0A 3F8WA 1F2TA 1N8KA 2XLBA 3M7IA 2IPMA 3QF4A 3ISTA 3W05A 5F4BA 4HLNA 5LIRA 2UYCA 1GGFA 4BVHA 1HDGO 2PX3A 4KMRA 3VO1A 1R6TA 1ZPDA 4N41A 2GCOB 3N2EA 3SJUA 2XXJA 4P5DA 4PFKA 1R4NA 2VPPA 3T7JA 3TTTA 3OM9A 3V6LA 4IIUA 3VZBA 5E4JA 1T3GA 2XCSB 3CNEA 1VFPA 5IARA 2A3RA 3M81A 1CY6A 1KY5A 2GKGA 3IELA 1EBBA 1FLDA 3M4XA 5DHAA 1AA6A 3DZGA 1BDHA 1X7YA 3FMFA 4MB2A 2R00C 4NRDA 2WUFA 1KXZA 5C8YF 2IS6A 4A2WA 2BCJQ 5AW6A 2PWAA 2Y1LA 4A0QA 3RUCA 3EPJA 1JEAA 3R3ZA 5JDCA 1EE2A 2EEPA 1DE0A 4X20B 4EITA 5DBFA 2PUEA 2HD4A 2RHBA 1I7NA 5CNJA 4TVOA 2GBPA 1XMVA 2B37A 4BMNA 4U2BA 3P32A 3GEDA 1GCOA 1AJEA 2P9QA 4WY8A 1BVYF 3R8CA 3CW2A 2I6SA 4NIMA 2XB4A 3A4MA 3DWGA 2QUHA 1UXKA 1GQQA 3FNQA 3QVOA 3TLZA 4NFHA 3KPJA 2HOQA 3PITA 1IYZA 2A0UA 3EG9A 2D8MA 2C88A 1M2EA 4LBWA 4AI6A 1HC7A 1KYTA 2B8TA 3R20A 4BVBA 4EYSA 5HPYB 4ZQCB 1KOGA 4OBWA 1SCUB 2FOLA 1NR7A 4FCCA 1G42A 3E1SA 3LO8A 1CSEE 2QN2A 4A4DA 3L8CA 3LQ1A 2JFUA 1SVLA 3PYLA 4Q16A 4X64B 3H4MA 3KZNA 4DCSA 3WJ1A 2OBLA 2VK2A 4JJKA 3ZY4A 2D0OB 1KI8A 4P7BA 1YI8A 5HE9A 1BQ3A 1IAQA 1VGVA 1Z5UA 1I2DA 3EXIA 4IS2A 4UKDA 1HT2E 1FP2A 4OKNA 4P81A 1UBSB 2H7VA 5KQSA 4MROA 5IAGA 2OZKA 1OPRA 4UHHA 5BRNA 1CIJA 3QVGB 1P2UA 3CF4A 4UAUA 3CN9A 3UW3A 1LB1B 3KUCA 4WFQA 5ITVA 3CG0A 4A23A 4OJTA 2YHIA 4PSKA 1W4ZA 4WK0B 1K3FA 3VH1A 2NSHA 1CJBA 1GZSA 4G41A 5KYNA 3TI9A 2LV8A 2LIPA 2PHZA 3W04A 3ZI0A 3U7HB 1QMGA 3HXLA 4YJ3B 2B61A 2IOFK 3RTAA 4BJ5A 3F6CA 3TW4A 4D4HA 4UUQA 3RFCA 4W8GA 1JDTA 2Q0HA 4LYGA 2OCPA 4MYTA 2ZI4A 3IBFA 1KVRA 1C0PA 2SCUB 4NDZA 1RXVA 5BR8B 2C1ZA 5HUHA 4WOCA 2FW9A 1SUEA 1YJXA 2YIJA 4BMZA 1DIOB 1EKXA 4GMDA 1T1SA 3RIEA 4ACBA 1XZKA 2CEKA 4PHCA 4YXWD 1Z6TA 2GXSA 2H16A 3RYCB 2GBFA 1O9BA 2UYYA 5AH0A 3UN1A 3GMDA 4YV2A 5M29A 1DUVG 2F43B 5IT9A 4WNCA 2FPIB 3CZPA 4D92A 1QPZA 4MQ6A 4B7CA 4HYQA 1BTOA 3BXFA 3F46A 3OOYA 1OAKA 2O0LA 1R3DA 2A5DA 3MD9A 2V6BA 4YPVA 3P5BA 3MJ4A 4UZEA 1ZLXA 4NF2A 3LRPA 1AN0A 3FOZA 4C2TA 1TKRA 4URYR 3EZ7A 3CUYA 4MLZA 3GDFA 5DYWA 2ON6A 1CHDA 2WYOA 1WX1A 3OJXA 4Q3CA 1USVA 1O08A 2I67A 1OFTA 4PFSA 3WX0A 1NQUA 1F7VA 1T5HX 3BH6A 3VNSA 1WR8A 1II8A 3PWKA 2P3OA 1PQPA 2F64A 2WV7A 5C18A 2ZCJA 4B6OA 1BDMA 1MAAA 2HTFA 1OX4A 3JAKB 1YJ5A 2I54A 3KT6A 2DFKB 1Z6XA 1LNSA 4PXYA 2PUTA 4XGIA 2X0KA 1U2DA 5LPNA 2UZ1A 1JQAA 2P2DA 2VQDA 5DE3A 1TYEB 4DR6B 2PT7A 3OCZA 4LHVA 1JQLB 2A5JA 4HB2A 3EXFB 4R8MA 5BQ5A 3UMRA 4NICA 2R65A 3CYFA 1UBRS 1NASA 3A7DA 4IVPA 3LBAA 4Q82A 4RKWA 4QWMA 1KSGA 3ZWWA 3ZDAA 1U8YA 5JANA 4UOEA 3ORFA 2XW6A 3GVIA 1FJHA 4B6PA 4BUJA 1XJCA 1FK8A 2WIBA 3W0LB 3O94A 3RPEA 3X43A 1UZAA 3VTAA 4MPRA 1G8FA 3AI2A 4R8RA 2OYRA 1A82A 2K7ZA 3ONFA 4CT4B 2NPOA 2B34A 4J0HA 4PPYA 1HEIA 3WKAA 1K86A 2JKVA 1NX6A 1WCIB 3G0GA 2XTZA 3OF3A 3C5VA 4KXNA 5DB4A 1R0RE 3F3KA 3FUXA 3MJHA 1Z2OX 1CRLA 1VB3A 1YE5A 2JLVA 1NUPA 3L02A 2V8OA 4NX2A 2HCBA 2IY7A 4PN3A 4CF3A 4RZHA 5ALUA 3U1BA 4DM3A 3ONDA 1XJ0A 2JLQA 1Z8DA 5D85A 1JIKA 3GFOA 4HAIA 3BA1A 2P5YA 4MP3A 1DJLA 4H3KB 1UJMA 5G3YA 3QOFA 1TLTA 2AF3C 2GK6A 2IKSA 3ZY6A 5CDSA 1GPWB 4H6XA 1WY7A 5AJYA 4EJSC 5JIBA 2WQ6A 4LDNA 1U1EA 2XUZA 2VVTA 2YZ2A 3QU7A 2VTBB 2ZRQA 1ZBQA 4LZJA 4MVJP 3IQZA 4B40A 2AT1A 3K5WA 4NNOA 1P73A 2GK7A 4GG1A 4Q4HA 3RC1A 5LP6B 3TX6A 3WRVA 3PD0A 4PBSA 1W59A 4AIIA 4YPOA 4ARVA 4GC9A 5JNUA 2XQFA 3BXPA 1I7PA 1MX9A 3NNSA 4D0NA 4YMTA 3C3BA 5BMVB 3F6BX 3OO0A 4Z0TA 2A0YA 4PWZA 2P2SA 4TLCA 1LDEA 1CVLA 1M7HA 3LKBA 1XNRB 4CEIB 1O97D 2ZRMA 3RSZA 2IIPA 3N6RA 4BFTA 5D7BA 1XL0A 4N5NA 2FUNB 5JBNA 1YDMA 3AERA 1O0BA 2ZRPA 3UCEA 1NAHA 2XTNA 4FFVA 3OIFA 2H8GA 1XLUA 3K5PA 4FW8A 4HWSA 4II3A 4NZZA 4Z9FA 5FPQA 4U6NA 3TLGA 4RC9A 3WLMA 1UP7A 1GDTA 3HO6A 1P9WA 2Q3FA 1X8LA 3FFBA 4LC9A 2E89A 2YTZA 3F4LA 5AVQA 2PLWA 4M3NA 2NWQA 3BIXA 2JZOA 3G79A 4OQYA 1E5DA 1EMDA 1R6XA 4GNKA 4WTOA 4WSOA 3DE4X 5AK5A 1USKA 4F5WA 3GEIA 1I0LA 1L7PA 3JR3A 3T7CA 1PAUA 4ZOQI 3BPSA 4B34A 2X8WA 4RSGA 1CE8A 5KTYA 3OU7A 1NGSA 3AR9A 4M1EA 1QQBA 3LQRA 1GITA 4AN0A 2B8WA 2TS1A 1FFDA 4EG3A 1EVQA 4CFSA 1QLHA 3ONNA 5K8IA 1P62B 4P5PA 2WT8A 1A2OA 5FHQA 3GH3A 4H3HB 3KJZA 4DM7A 1CS0A 3I6BA 5KNCA 5E1DA 2VAVA 2V7GA 3N2YA 4M1WA 3IO3A 4YRNA 3G2KA 3H8SA 4FUQA 3WL4A 1X7ZA 1NUTA 2GXQA 1TD9A 2E85A 4A2CA 5JH7B 4LFAB 4G8DA 1ZM3A 2YHBA 1I4OA 3IB3A 4R2HA 3B82A 4ARCA 3JQAB 1XTRA 2B1JA 3A14A 4KB5A 3WLTA 3M4NA 1SHKA 4TT3D 3LRXA 4RTKA 4K8RB 4TL6A 5AYVA 5JXIA 4LTNA 4S1OA 3TTSA 1R5BA 5TNXA 5J2TA 4Q6BA 1DHTA 3N3AC 5IC6A 1SA0A 3FYUC 3IUSA 3NNNA 4KSBA 1IMJA 3G2IA 3B6ZA 4TKZA 1YTUA 5J63A 3KSDO 3SDBA 4TRRA 2R1VA 2YIVX 1GKKA 1RPAA 2QORA 1K3TA 1QO7A 3DE7X 4KFTA 3IPRA 3UF0A 3VPBA 5GV7A 2PQMA 3MHTA 4DN6A 2PUDA 2AE1A 2PS9A 5AR1A 4E2ZA 3R7NA 3SDZA 1A8UA 4L2IA 4Z3KA 2IS1A 3KALA 2ZAMA 3OQIA 1YA4A 4RL4A 2D0IA 1DJQA 1U0SY 3SICE 3OIVA 4GU5A 5DM60 2DOKA 1JEYB 3TLCA 3OCYA 2HEGA 2ZUEA 5AW3A 1YZHA 1T4GA 3A3YA 1UL1X 1PX2A 3DBVO 5H0IA 4R81A 3RFUA 3U4HA 2GO1A 3IP6A 3Q2IA 1X80A 1IVNA 1HKUA 4B82A 4A7PA 4MMYB 3I4CA 1F3LA 3NNDA 2X41A 4RBNA 5FFMA 4HH1A 4BN4A 3UYLA 5K0TA 4M7RA 1XZNA 3R3JA 1M6EX 2EGGA 1OLSB 1H9BA 2C29D 1T9GS 2FW6A 2VSXA 4CMAA 1HR0B 3S2ZA 3W5SA 2GA8A 4EB6A 2H2HA 1N2GA 3C6BA 1DARA 2ZW9A 4YGYA 5IPFA 3TQQA 4ND4A 3A6KA 2BDEA 4MPDA 2Z08A 3M3DA 4DREA 1KAOA 4S1TA 2YW2A 1MB3A 1E9FA 3VZRA 4D8TA 1NJ8A 2IF0A 1TIPA 5CJJA 1Y7TA 4ZAXA 3O2SB 4WJKB 2YC2C 4LJ9A 2ZYTX 2KB0A 3BHIA 3JQPA 4MS1B 5KYYB 1K9VF 3HU1A 2EP5A 3D6MA 2I76A 4KDCA 5K2MA 3UGKA 3Q8KA 3ISVA 3HDQA 5AT1A 4XYLA 1AVTA 5H3CA 2O2ZA 3IERA 4YRGA 4FLFA 3VAZA 3DOHA 1P7VA 5TS2A 2BKLA 4G86A 4ROTA 1EGMB 2IE0A 1NX9A 2KM1A 4QU8A 4C4OA 4BNIA 2UZ3A 3B20A 1OKKD 4NYJQ 4OMUA 5B1HA 3EY4A 4BRUA 4DR4B 1XHLA 1TUEA 2EJVA 2A84A 2ISCA 3AP2A 5MF6A 2O4CA 3EWAA 2I4MA 3CH4B 4CKWA 4U2CA 1VXRA 2I6XA 3SZLA 3FPAA 1CR6A 1H8ED 3ZVRA 3KWLA 1YK1A 3GD5A 4G4GA 2AXNA 2CLSA 2EWMA 4KLCA 1JEQB 4M0MA 1LZLA 3RJTA 1QGZA 2P6NA 5TPWA 4E2YA 2OHGA 3EZLA 5JQGA 1CR1A 3DEJA 4LSMA 2GD2A 5DXFA 1ADJA 1DADA 1DQYA 3RU9A 4L8LA 1MV5A 4BBAA 4M53A 3TQCA 4DV7B 2PN1A 2HU7A 3WZLA 1YBVA 4DCPA 3OH8A 4ZVOA 4W7SA 3AO0B 3KBOA 3KXLA 3ZHYA 2NPIA 4TRMA 4GKAA 1IK4A 2HA4A 4KW7A 5ALEA 1GU0A 1GCIA 3OA0A 4GSYA 1UMCA 3ZN2A 4R1NA 3ESRA 4BQOA 1CP3A 2ATIA 3RWBA 4EPRA 1UBEA 3IVCA 2VJMA 4RDIA 2PVPA 4PZDA 3BGWA 5LP6F 2HIMA 3GZNA 4RIEA 4EQZA 2CV2A 1I3CA 4NE2A 5BSUA 5T6BA 5L4NA 4N7BA 1SWVA 4BQNA 2E21A 3L93A 4XDZA 5BMVF 3N8GA 5I9NA 3TGLA 1AZLA 3KJGA 3DBLA 4JP2A 4B3TB 5HFJA 1MDFA 2ODEA 4Q4CA 2Z04A 2EFHB 2QMQA 3RWMB 1JJIA 4W5NA 3ON5A 3C85A 4AZWA 4L9RA 4YT4A 5LZ2A 1QIDA 3UTCA 3HGTA 4X1OA 1Y5NA 3LC7O 1I7DA 1V9CA 2O7RA 3NRBA 2CHVA 4NS4A 2O7SA 1F0PA 2GPAA 3F49S 2OENG 5KTPA 3RRBA 4N0MA 5DGHA 5HM8A 4LW8A 2ZT7A 2JGDB 4DKJA 2V9PA 5CBPB 3MMZA 4ZDIA 3MT7A 2ZUSA 1DZ3A 3KKMA 1RVDA 4OSPA 3EOBI 2PGNA 5TMDA 2W8ZA 1X13A 2YMMA 3CUTA 3QVXA 3RREA 2W2VA 2VL7A 2OFFA 1VHJA 4DIMA 3PJEA 4LV5B 1T8SA 1RLOA 1JB1A 2G71A 3EA5A 4IINA 4LZWA 4AWBA 4EUNA 1FRQA 1OZ0A 2I62A 1GA4A 1L5KA 2AFRA 3A6ZA 2RHWA 4O3MA 3TKLA 4CIBA 2QLMA 2W58A 4QQNA 3IXQA 2XYHA 1WQ4A 2P9JA 2ZRDA 4GH5A 4KPYA 2KHZA 2QEQA 2Z4TA 3MZ0A 3URMA 4QGAA 2QUKA 1B8OA 2EV9A 2MYTA 3PNQA 4JQSA 3ZY2A 4B7AA 5EJ5A 1DLJA 2NU9A 1ECBA 1RPZA 4BFLA 3C74A 1I3MA 2XKJE 4E46A 1S3FA 4IVRA 3OPYI 3NAMA 1BCRB 3G0DA 1FDSA 4OXYA 2VQ3A 4MO9A 4RW0A 4KRFA 5L4LA 4W5RA 4GEKA 2FPGB 4HK4A 3JARA 3IAXA 4KR6A 1KJZA 2BISA 3GN1A 4NU0A 5JO0A 2ONZA 2NQTA 3KFLA 4PCLA 1F2UB 1PT7A 4ZCMA 4O8CA 1T6ZA 2GM3A 3BIOA 1A9TA 2K7FA 3CX6A 4M37A 3ORSA 1XZPA 3I53A 3KV1A 4DABA 2PCJA 5HDQA 1C0LA 5F1PA 4GUDA 3CH7A 3HB0A 3VMMA 1YAHA 2VAPA 3ENZA 3I1IA 3L4KA 1KJQA 1UDBA 2X1LA 1IQRA 4DA6A 3VMFA 1WP4A 3B48A 2P30A 2RIRA 1BEEA 2GEKA 3CX8A 3RTGA 1RYYA 1UZUA 2C00A 3D7SA 4GBJA 2G9VA 1CUWA 5A71A 2G1AA 1FDWA 1I80A 5ALYA 3U31A 3MS7A 4BMOB 1Z3IX 2ORVA 5JDCC 2QMEA 1LQTA 2VR1A 1RRFA 1EGQA 3HI4A 1T5BA 3SC3A 1XYGA 2CLKB 4F8EA 1E61A 1P2TA 4KXWA 2J6IA 2R8PA 1VJ1A 1VJDA 2ZR8A 3HY6A 5REQB 3H6KA 2GF2A 4GI3A 4QJIA 5THKA 4IV8A 3R76A 2C9MA 1L4YA 4NCBA 4LJ4A 1Q15A 3IAM1 2ZBRA 4JB0A 1V3VA 4PLFA 4ZV9A 3M2PA 2P4EA 2PO5A 3ZGLA 1BNCA 3KTAB 4EHHA 3ORRA 2VBGA 3N6XA 3D8TA 5DYNA 4L08A 4M1ZA 2GI4A 3WLJA 4YCLA 2EVWX 2CXXA 2ZITA 2JGEA 4C89A 4K03A 2JD0A 3VOTA 4LRTB 1EP1B 5FUMA 1S3GA 2ZU0C 2HBQA 4JJ6A 3V55A 4D56A 3PSHA 3DVLA 3E5RA 4L8VA 1HTBA 1NVVQ 4P08A 2IBSA 2PUFA 1JDZA 4XM2A 3BB4A 1BWRA 3K4PA 3MIIA 4LMBA 2FHSA 1BXRA 3U4IA 2Q1TA 4FFLA 4EFLA 3EGDA 1LX7A 6REQB 1WMEA 2ID7A 4INJA 1S2MA 1KVSA 3JALB 4LXGA 4LF5B 2WLTA 4LVNA 1KMIY 4E94A 1E32A 1MRSA 1Z7BA 3AR6A 3ZOZA 1VP3A 3CG4A 2HK7A 1ESZA 2CXNA 3M6VA 3V6MA 3BE4A 3OBIA 3R0VA 1M1NA 1J09A 4HS9A 4ZKEA 3KX2A 5HUJA 3I3OA 4TTQA 4FP9A 2F3RA 3KKEA 4QOIA 3UJ8A 4YXFA 3L05A 1PFGA 1KSJA 2PL3A 3TIGA 5HKAA 3DKPA 3M83A 3Q9NA 2FMHA 1WE2A 3DCNA 3EC2A 4RH1A 5ER9A 4EUHA 1TJYA 2AMYA 2PZLA 2E48A 3KB8A 4F8YA 1LX6A 1V6CA 2ZVQX 1XKTA 5CM9C 3UAWA 2HAEA 3K73O 4M1MA 1YQDA 1VTKA 4ZT7A 4DIDA 2RI1A 3X0DA 3L6OO 4HAYA 4IDOA 4LRXA 1EJBA 2D1YA 1XSEA 4HNTA 5AIAA 3DMTA 3I5XA 1NE7A 1H0KA 5KPDA 2XRMA 2B4QA 2NSJA 1GXSA 3K2BA 4JLJA 5DLDA 1AURA 2DTDA 4R0NA 1L7MA 4CKYA 1TA0A 2ILVA 5JS1A 2X8BA 3EW9A 4MHSA 1MOZA 5EIBD 1DXOA 1UMBA 3OETA 1E64A 3WL8A 1M1ZA 4D45A 2P1DA 4G9BA 4U4AA 1AN9A 4Y1RA 2C3PA 5BOVA 4ABTA 3KUUA 4HNGA 2A1TS 2O3RA 3FFTA 4FFSA 3RC7A 2UUCB 3TG2A 1FSFA 2WU3A 2Y0PA 4ER3A 4CNQA 1TT5B 1PJBA 1Z26A 4PPFA 3AESA 1UP4A 1ZHHA 2YINC 4QFCA 5SICE 4LJKA 5GIPE 2EIHA 2J85A 3ASYA 3UJ7A 2J7PA 2ZBVA 5D84A 5KNCH 1PR4A 4NYIQ 4UU1A 4RF5A 2I78A 1DELA 3EXG1 3NIDB 1MD9A 1ZL2A 1L5LA 3RQIA 1U2DC 1VYHA 1YDGA 2F48A 3BK2A 4GM1A 4GI2A 4Q9IA 4JXJA 4B4WA 4D74A 2DHEA 1CS4C 3UJPA 1FU7A 2R86A 4ND1A 4C5CA 2AEMA 1ZG3A 4MKXA 1X1AA 4AJEA 1EH5A 4YWJA 3I2GA 4MAMA 2FPPA 4Q4JA 1OWNA 2HJ9A 4QXRA 4XX0B 3S3TA 3ZDEA 3AYXB 1LK7A 3STHA 1TD1A 1SM4A 3ZDCA 4JUBA 4JBXA 1US8B 3QY0A 2X5NA 4TMFA 4PBRA 1H0RA 3R75A 1U7UA 2XZTA 1H1LA 5L3ZA 2CFSA 5CVCA 1PDVA 1Z5WA 1SHTX 1DJNA 2HJWA 3A1CA 4P3PA 4YRRA 3JQCA 1H23A 2Q1SA 3ABQB 4IGEA 4Z86A 1Z13A 4EECA 2GDZA 1ESDA 4FNOA 3FKSD 4ZYVA 5FUYA 1Q0TA 3EQ2A 3B1VA 1IM5A 1SD5A 2OGUA 2XUPA 1OXKB 4OH1A 4QTUB 4KREA 1ISHA 1VL8A 4NBWA 1THMA 2H18A 1TO6A 1P4JA 3HR7A 4HFMA 3FWNA 2BM9A 3O0DA 3Q3JB 5TT0A 2C3YA 1NF3A 4PLYA 3PWZA 2DUWA 3HJBA 5CX4A 5CXXA 2I4TA 2WF9A 1NLYA 1EX1A 1E5VA 3IB6A 3QMVA 1P77A 1PTJA 3HKCB 3PEUA 5BWBA 3NFYA 4EF5A 3A3NA 4LBVA 3PR1A 1KI6B 3E03A 2C78A 3ZWPA 1FDUA 1Z22A 3UYKA 4CL3A 5IW8A 3RAJA 3ZYCA 3DMRA 3O4JA 3IILA 2H3HA 3BM5A 4NESA 4DMRA 2AFHB 3IYLW 2G0NA 2KX7A 3EIUA 4YHBA 1RXYA 5BNFA 1K8ZB 2CXOA 2PBFA 2W11A 1M34A 5BN4B 4YR9A 3HYLA 5L53A 2ZSHA 1ZVMA 1PQUA 2ZROA 1ENOA 3GJTA 5CYGA 2H6EA 3WVNA 3OLVA 1UBJS 3IQHX 1B0ZA 1NC3A 1I5RA 4Z7OB 2CVFA 3ROKA 2VDNB 1J0CA 4H60A 1E1CA 2VRCD 5AUNB 1I1QB 4OMCA 4ZOBA 3COJA 2LZ0A 5TVKA 4F2DA 2YZ7A 3L40A 3K05A 2HQBA 3UBMA 1Z5OA 1DOHA 4CNBA 3A6EA 3JVEA 3AI7A 2Y1DA 4MLCA 3OKFA 3O8NA 2RDMA 3PZRA 2QE6A 4GLLA 3U13A 3I30X 4O1IA 1GRNA 5DGTA 5JAOA 2W6QA 2WSLA 2X0DA 3VU9B 1FJ2A 3DVQX 1DT3A 2H17A 1HNZB 1U9IA 3EZNA 1CRQA 3RT9A 1ZXBA 1HF3A 1ZRHA 2IELA 3OEYA 1DC3A 2O3QA 4S1VA 5LQJA 5EKSA 3VH3A 4B7XA 5GONA 2GAOA 1BYIA 3E8SA 1NYRA 3WFIA 5COQA 3CWQA 1N2CB 1UOOA 3K0FB 1KO1A 2O0HA 1FPMA 3M6WA 1DTEA 3QXCA 4W4TA 4XM0A 4V0RA 4D8WA 2RJOA 4DZTA 3N2GB 2XUAA 3O73A 5JUWA 1KO8A 3NDBB 1GEEA 1DO2A 3D81A 3JQEA 4MI1A 4TWIA 1ODKA 4WZAE 4H1UA 2OPBA 4L0MA 4YPFA 4B4VA 1E7WA 5FWXA 5KEIA 2W4QA 4KAAA 1ZY2A 2E82A 3RS8A 4G4SP 1R9MA 3AHIA 1G20A 3I2JA 4IHKA 2JJ1A 2PMKA 2KMLA 4BQEA 1WO8A 2ZP1A 2BL4A 4KVAA 5F12A 4EJFA 4FB5A 4N7MA 1A2QA 2WUVA 1KF0A 4RJIA 1P6XA 3NC4A 1SOMA 3UQYS 1U1CA 2H1SA 3DP9A 5K8JB 3GAMA 3BEDA 5FI3A 3GRVA 1CVIA 3Q6NA 3LK6A 2I4OA 3UC5A 1JQEA 2G5PA 2NO7A 1JHZA 3DKIA 5TMBA 3WMWA 1JJAA 4JSRA 5A4FS 2R4QA 2PG3A 5K3BA 1ONOA 4KQJA 4JCCA 1XD2B 2J9YB 2LKDA 2FRDA 1U9CA 4LC1A 4YRPA 1E62A 2CWDA 3WWDA 1BGWA 1MT0A 4CV2A 4DSTA 3GT0A 4GP9A 1IVSA 3QTLA 3OESA 4JMPA 4NJMA 4ZJYA 1S2LA 3NHWA 1N2BA 4Z1MD 4OAOA 2J31A 2RAVA 1FLNA 1DEXA 4I46A 4M1OA 4KMSA 5CNKA 5CLLA 4RZIA 5JJLA 4L8FA 2WIJA 3DMPA 4GXQA 3IS3A 1D0VA 3OX4A 3NVAA 4UTPA 1G0NA 2WAOA 2OKGA 2NPFA 4BXOA 2C2OA 2G5GX 4YT8A 4LEIA 1BRTA 4RM2A 4UCQA 3S2YA 4BU0A 4NJOA 5BUSA 1LK5A 4LF9B 5L6LB 4KXVA 2BGLA 3NOXA 1QKIA 4LOAA 5T7BA 3EC7A 2DKNA 5TQJA 2JEYA 5EUBA 1Z5NA 1CY4A 3AB7A 3CLVA 1HMYA 3EIXA 3ITEA 4WK2B 4XE5A 1KFEB 1RJWA 1Y5RA 4E5SA 5IDQA 2Q28A 3G82C 4NCXA 2VSQA 1F20A 1PR6A 3K94A 5AOBA 4ZC8A 5ALIA 3OZUA 3TOSA 3K6SB 1B4DA 2R97A 3SQWA 1G8JA 2OZEA 4K6FA 4H7IA 4K6HA 3SYNA 4PSVA 2ZTVA 2ZWOA 1YZLA 4LF6B 2VSOA 1H8HA 1U7XA 2C59A 3EXEA 3Q7RA 4JJEA 4JCOA 2VUIB 4REMA 3V7UA 5ALQA 5CCBA 4JYBA 1L9XA 4D02A 3HVRA 3TKYA 3U37A 1I4LD 1S01A 2VDPB 2YV4A 2BHRA 4FEYA 1SK8A 1MJGA 1KEEB 4ROSA 2AOTA 2YMQA 1XKXA 3AUAA 5EMLA 3CNQS 4V3CA 5FTNA 4AB1A 5L3VA 4Z8YA 3NTXA 4WXHA 4DCMA 4EENA 5KYVA 5EHGA 3IUMA 4R71A 3MYYA 2PQ2A 5ERXA 4MQLA 1NVAA 4EHFA 1UBUS 2QUJA 2AG1A 4AX4A 4QXAA 1SBQA 2XQKA 3GCZA 2ZB7A 3H6GA 2WUGA 4ZXPA 1N0VC 3K71B 1Y1SA 4JI3B 5EJFA 2O8FA 4LJ6A 3F47A 1EESA 3O3OB 4X84A 4ANFA 2CXSA 2ZAYA 5JCZA 1NG9A 4N48A 3TKAA 2QQFA 1KYQA 2LD4A 2IIQA 3EVZA 1HYQA 4DJFC 4RDXA 3JYPA 3C43A 3QRWA 1KHHA 1NW6A 2QT1A 4EX6A 2P69A 3EH2A 3IAS1 4GWLA 2ECOA 2H7YA 5JNWA 3MERA 5C37A 2E37A 4ZTZB 1BMDA 4W8HA 1VL1A 3V8BA 4CI0B 1OIXA 3JWJA 4HQLA 3TRHA 1WUTA 1OIWA 2AG5A 2CVZA 1OBHA 2A1UA 2O6LA 3I3SR 3MJVA 3OZRA 4TTIA 4RH3A 2V55B 1BN7A 3TDNA 3QVUA 4II7A 4HZUA 4EPXA 2FWNA 1DFGA 1Z9BA 9LDBA 1DIBA 3SOZA 2PGDA 3WRYA 4YMIA 4BV2A 2XTJA 3PXBA 2KSQA 1RXIA 1DKMA 3H1EA 1T3LA 1WULS 3IAM6 2Q3JA 1WVGA 2QAJA 4GOLD 4ZI7B 5FKJA 2I3BA 2FWJA 2G06A 5A04A 3HP7A 3X1DA 3V32A 3G9QA 1GZUA 1YS9A 1G41A 2CXTA 3IP7A 5KYWA 2PX2A 3NHZA 5B7NA 2PM8A 2FZ4A 1EFRA 4H27A 3ADBA 1QRUA 1XCGB 4PCVA 1NJ1A 4DANA 1DX4A 3JATA 3NU1A 1E0DA 3K6SA 3EFBA 4IJQA 4AJHA 5J4VA 2H07A 2J46A 1LXCA 1ACMA 4XWKA 4FU0A 3GF4A 2ZI5A 3IR5A 4PGHA 2R85A 3EG5A 2WFLA 1TF2A 2Z1MA 3B3AA 2WWTA 3GRPA 1SELA 1SURA 3DOUA 3L06A 4QOSA 3BK7A 1NWHA 1NL3A 1S5PA 2ID9A 2VRWA 4HEQA 3NWPA 5ICEA 5ALNA 1DIHA 2OD9A 5KS2A 1LSSA 2XUHA 4F7DA 1H9CA 1K3UB 1R88A 2JJQA 4JVNA 3BBPA 4D8UA 3CB4A 4FR2A 4DDHA 2BBSA 4UARA 1FVHA 1TC1A 1J00A 2ODPA 5C8XA 2HNAA 1QK3A 2PR2A 2VT3A 2YFYA 3PNSA 4TTTS 4DG9A 3KU4A 1KI4A 1SXIA 4QELA 1J42A 5AI9A 4EBFA 3CZCA 2YWCA 4CCYB 9LDTA 3B5EA 4BNHA 1EIZA 3T0IA 5G3ZA 2GTPA 2LVBA 4XARA 5HQJA 2QYSA 2W2MA 1PW5A 3KS9A 3KP1A 3RC9A 3GJQA 3BSSA 5A6SA 4G23A 5BR1A 1EFCA 3CVYA 1DQNA 1YUNA 3QNMA 4UHCA 2CL6X 1Z0UA 2CXRA 3C5HA 1I6KA 4M22A 4PFQA 4TTSA 1E8DA 1D2AA 1QYRA 2AN1A 5INTA 5I48A 3IMGA 4WOKA 3IV6A 2VPQA 3E6AA 1A4UA 1G3MA 2O2YA 3D3KA 1AY0A 4U7WA 4LYAA 4GR4A 3A9TA 4PR3A 1QOZA 2J9ZB 2X8JB 3NWEA 3I8XA 4UBNA 4WDQA 3TMKA 4CF7A 2AV6A 3O74A 4WJZA 2WAYA 3GP5A 3MGGA 2H4WA 3SJBA 2QROA 1F0KA 2RHHA 5DISB 2Y93A 3NUGA 3KVOA 4HRXA 4MW1A 2I8LA 3QFTA 3ETLA 1YASA 2FU5C 5EZYB 4FDTA 3TPFA 3ZCRA 1F4PA 4AD8A 2C97A 5B3JA 1TC2A 1P2GA 4PO3X 1CY0A 1Z12A 2QK4A 3DPUA 5L3QB 4J3NA 3VDQA 1BCSA 5CLJA 4BVAA 5CFPA 4OIMA 5KQGA 4ND8B 3NIGB 3FM9A 3NWJA 3UT5A 4WKPA 1MT3A 2BYTA 4ZGBA 5BV2P 2UXBB 5A9RA 2PSDA 4FXOA 5EZ6B 3U4GA 3L0ZA 3TLBA 4P2BA 1VKHA 3LOUA 3NDJA 1VKOA 3K1TA 1FIUA 2DR2A 1Q0QA 2CLLB 4ABYA 1ZUHA 2BHNA 1JYEA 3QNWA 1Y6FA 2P7IA 2RBKA 1NJ2A 1BIFA 1YZTA 1KYWA 3R3YA 1MO3A 3JAMA 3GROA 4RK4A 1GR1A 3CLSC 2G4CA 1N5KA 3ANNA 2V3WA 5H7XA 4G5RA 4POAA 4XD7D 1D2HA 3S2SA 3GLQA 1EJ6A 4OXNA 1Z33A 2HT1A 1N5JA 1KK3A 4EABA 4BO6A 2HADA 4E03A 5LXTA 3Q12A 4EG1A 7GPBA 5KWIA 4JL8A 3MRSA 3UUGA 1QKJA 5HGJA 3P52A 1MH1A 4RUKA 4ARIA 2FHPA 3I9NA 1OWMA 4S0XA 3EASA 2GRJA 4LXUA 2PMBA 1F9EA 2A14A 4FOLA 1ZBDA 1YHZA 4LRSB 5IEBA 5JMOA 3D8RA 3AR2A 2OAGA 1DI0A 4FYPA 4N6NA 2YFQA 5TV2A 1CRWG 1Q0LA 1ZXLA 3N86A 1L7VC 3HUTA 1ECLA 1Z4NA 1BDJA 1MAUA 1NE2A 1IL0A 1TQHA 3A25A 3ACDA 3NLLA 4AC9A 4OBBA 2GAIA 5B3KA 2C7OA 5JWRA 1V5WA 4KN8A 1EXMA 4JT4A 2ZUVA 5CXSA 4B33A 4DLXA 4FI3C 2G08A 2ZFUA 2G9UA 1NLZA 2HDOA 3V8PA 3GHYA 3LUHA 1XAIA 2IV7A 4MSUA 3VU1A 1LJUA 2A8YA 2PS3A 4OXKA 4D3YA 4KNYA 4NL4H 2OZLA 4U7FA 5ALFA 2V7QD 3F0TA 3HMQA 3NYRA 2DQZA 3DDSA 3DMTC 3KE9A 4X6YA 1I1OA 3FPGA 1I4TD 4Z7JA 5K0FA 4KCGA 2FN9A 1IATA 3FE2A 1U8XX 4ZT4A 1HLGA 1DRUA 1I8TA 3NBAA 3NETA 4Q3EA 4HV4A 4NZNA 1L5HB 3IQGX 2O8FB 4C21A 4CFYA 5KOJB 1IBKB 5JS6A 3K1ZA 1XUOA 2ATEA 4HADA 4XKJA 1PHPA 4AJ1A 4KFCA 1Y9JA 1ORIA 1O1YA 1RW4A 4YUYA 2BSAA 5CAEB 1Q44A 5BN3B 5IJAA 2HLDA 1XZGA 2WR8A 4NABA 1MEJA 1C1XA 3GLTA 3IEVA 1QVZA 3ZHQA 2QAGA 4ZI7F 4NU5A 1AXGA 5IDWA 1YVUA 3A2KA 2C4VA 2I99A 3PCTA 4H7EA 3RIYA 8MHTA 1DQZA 1CG6A 3ZBTA 1NRXA 2GH1A 1GTG1 2O50A 2XB8A 3ZWNA 3HHEA 3DTTA 3QZUA 3RIHA 3J7TA 4E15A 3DA8A 3KZ1E 4HQ6A 1IJKA 5JAUA 2IZ7A 3K0BA 3NXKA 4MKIA 2FZCA 4U7HA 1SK9A 4X7MA 2QBYB 4W9NA 3WGOA 3NHPA 4PLVA 3ZZUA 5K5EA 2CCKA 3C15C 3E0QA 3O4IA 3P20A 5TQ0A 5I7HA 3RVDA 2W5UA 3D0RA 4Q9LA 5LUAA 3ZCXA 5LBTA 4GBED 1OHHA 5U4XA 2II6A 4DG5A 4B3SB 2V58A 3AF5A 3EGOA 1XWWA 4BS9A 3AY6A 2MSEB 2Q7OE 5KNBD 3KYJB 1C8LA 4G5YA 1KY3A 4NCAA 2RB5A 3HQ4O 3SHQA 2DXIA 3MAJA 1Q77A 1NNSA 2O2IA 4BYMA 4FDMA 1GR0A 4F21A 4N7RA 2VQSA 3LIPA 3KSAC 1Y9DA 3GLUA 1ZMRA 1TNDA 3EBLA 1P4RA 1QHXA 2AC2A 2Q5CA 2ZSDA 3RHFA 2FVXA 1JG4A 1E2DA 2RG1A 2W2KB 3ETGA 4GOMD 1FUUA 4V3BA 4KQ9A 5DNWA 5DTQA 3TZHA 2MSWA 4NQRA 2QRUA 4XR4A 2WIDA 2A1IA 3E3OA 1U4NA 2PEZA 4PQFA 3MJDA 5HBGA 2GBLA 3P9SA 5AD1A 4AAYA 5I7UA 3AKZA 2BJHA 5JPDA 4G5GA 1SCDA 1W85B 1Y4UA 3IUBA 1BOOA 4QHYA 1WHSA 1TJ4A 3IPAA 5KHLB 3ADPA 3GJ7A 1G60A 3REOA 2YDXA 3OA2A 3MOIA 1WZCA 1J9GA 4PNZA 4X9XA 2VYVA 3URKA 4DLAA 2G70A 1C80A 1PTJC 4XUDA 2NTNA 2X8LA 2M6LA 5KIAA 2BUBA 2D5CA 2YBEA 5DCYA 3ZIAD 2JLUA 2DE0X 4INOA 5JMTA 3DMDA 2XNDD 1L4MA 1QLWA 1JEDA 1OQAA 5EZYF 3V97A 3V4OA 3RDPA 2CLMB 3U7RA 2Q0QA 5CB4A 5A06A 3EUAA 4PO8A 4V02A 1NNEA 4MYDA 3MTGA 2V4UA 1JIQA 2X0NA 2ACKA 3HUDA 3MQ4A 5C7IO 1BXGB