3WISA

Crystal structure of burkholderia xenovorans dmrb in complex with fmn: a cubic protein cage for redox transfer
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
180
structure length
180
Chain Sequence
b'FKPDARFAWCVTGSGHLLDESIALALELPRADLFLSAAAEEVLPLYGWALPRLRKHFRVFRDNSASGVPVGMLYHGMYHTVVIAPATSNTVAKCAFGISDTLPTNMYAQAGKQCIPGIVFACDTEPTVVTQSPNEWVELRPRAIELDNVERLSRFEYTTLVRSLDELKAALGERLSTLDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative dihydromethanopterin reductase (AfpA)
publication title Structure of dihydromethanopterin reductase, a cubic protein cage for redox transfer
pubmed doi rcsb
source organism Burkholderia xenovorans
molecule tags Oxidoreductase
total genus 62
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2013-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02441 Flavoprotein Flavoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1950 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Flavin prenyltransferase-like 3wisA00
3LQKA 4ZAZA 1SBZA 1MVLA 4ZALA 3MCUA 4ZAFA 1E20A 1G63A 1MVNA 3QJGA 4ZANA 4MWGA 1G5QA 1QZUA 3WISA 4RHEA 4ZAYA 4RHFA 4ZAWA 4ZAXA 3ZQUA 4ZAVA 1P3Y1 4ZAGA 2EJBA
chains in the Genus database with same CATH superfamily
5GM1A 3JWJA 4XAQA 1XVLA 3F0TA 4N0EA 4KR3A 5ANRB 4RIFA 2HI0A 5GGXA 3CZRA 3ETGA 4C14A 1KGDA 2GSDA 1GL6A 5LMUB 4FS3A 1VPEA 1RACA 3CVXA 1OZ0A 2BHNA 3LUFA 3KQSA 1QHNA 5FOQA 1MOQA 2LCFA 1K2WA 4OFWA 1XDDA 2PH7A 3JQGB 5B2ZA 1DI0A 1JMYA 1IH8A 1CY6A 3M82A 2HK9A 1Z6ZA 3OZWA 5LLSA 2MR5A 4R1UA 4V24A 2W4IA 4YVFA 3PDWA 1S8AA 2FW7A 1JQ3A 4J7CA 1PVDA 4EJ6A 2KI5A 4CR6A 4EM6A 4EJ2A 1VE5A 3OZEA 4YCJA 1BU5A 1G41A 2J7PD 4EB6A 3WO1A 2J5KA 3O4VA 4D6XA 4EW2A 1DRWA 4CJXA 3DZGA 5ALHA 3F6PA 2ABWA 3IDFA 5E9JA 4F5DA 1M1ZA 2GAJA 1LI7A 1TW3A 3HADA 1D1TA 3EQ6A 4PSAA 2VUSA 4UM9D 1BE8A 2B35A 3NAGA 3LRXA 4OQYA 3ZXIA 3WNDA 2YV1A 4GLFA 3WBFA 1NJ5A 4L8YA 2CXPA 1TMYA 4JC5A 5E4FA 4YQFA 3O8DA 2CN1A 2QGNA 4MR7A 4XTCS 3CZCA 1MHTA 3BIFA 2AOUB 1WCXA 3SDSA 2GAIA 3EVAA 2VJCA 2O4CA 1IE3A 1L7EA 1NM5C 2P9BA 1FDWA 2Q0HA 4PTZA 4EHLA 3MPOA 2BEJA 3IH5A 2C8KA 1REQB 2X4GA 4IX9A 2I67A 2C54A 4EG1A 1DG3A 3T5AA 5I9SA 3UTCA 1D9ZA 4S0XA 2ZWAA 5GWXA 2WKPA 1JQLB 2HADA 3L02A 1LRKA 4RTLA 5DW3A 2XQFA 1GGHA 4UOQA 4LC9A 4EFNA 3ZIAD 2YKGA 1QCZA 1L4UA 1ES9A 3AV3A 3PQFA 5JE8A 4YREA 5A0TA 1YDMA 1E2EA 4NU5A 1UWLA 2QD5A 4B7ZA 5JECA 1L8LA 4BNUA 3AHIA 3R0ZA 3PC6A 3FKSD 4QU8A 5IC6A 3WLNA 5L6MB 4CL0A 2C83A 4B3SB 2VQSA 1E94E 5HZGA 1HORA 3R3YA 5FPYA 5SZKB 4QDJA 2JH8A 3K1ZA 2C1XA 3QYJA 4WASA 4DA6A 1TPZA 3B5EA 3HDQA 1UBMS 4L0CA 4BQIA 1NXXA 4IUYA 4YR7A 2AOXA 3DAFA 3P52A 4MVJA 5CDTA 1V96A 1IBCA 5B7QA 5D6OA 2YINC 4FI3C 2GFHA 4O59O 5FBLB 2OGWA 2ZYVX 4GNKA 3DVSX 2AZTA 3MTBA 5BY2A 3SVLA 5ULLA 3KM0A 2YXLA 4MQ4A 1YKSA 1M6YA 1ZRNA 1MAWA 1PQ4A 4TWIA 3IBCA 2WJYA 4A36A 4P4SA 2UYCA 3D6MA 3ETNA 1PFKA 1YQGA 3MVEA 2TSYB 2BFBA 3KVRA 4IZOA 3RS2A 3RVSA 3RVKA 4EJFA 3KEMA 5BT9A 1Z22A 4NR0A 1Y5IA 3NTLA 5C5CA 1DOZA 2P2CA 4L02A 3COVA 1TK9A 1F2UB 2OORA 5TJHA 3W5IA 1I80A 4E1AA 4EGFA 2J9FB 1D09A 3IO5A 2Y1CA 3DZFA 3P27A 4QHYA 4ARZA 5FTLA 1I32A 5M34A 5KO2A 2FWRA 3JALA 4AF8A 4V2UA 3RTDA 1G8SA 3NPAA 2OCBA 3SE0A 4R2LA 3CUSA 1DAHA 4KHZA 1J0CA 1M2NA 4PPQA 3WSVA 1SG6A 2LBPA 1W6RA 2P4HX 3V7FA 4G07A 5LQCA 2WYHA 1XZJA 4MKFA 5F64A 4MUBA 2HKIA 2ZPAA 5KINB 4LE2A 3E7PA 1RZRA 1GDHA 4FNOA 3BN3A 4M7WA 4PE5B 4FCVA 4R6XA 2MR6A 3VR0A 2C8VA 2F3QA 5C4MA 1GN9A 4ARCA 4GYWA 3G1WA 1EUZA 1XKLA 2EGUA 3BJIC 3S28A 2X86A 1E3JA 1CQXA 4U63A 3ESXA 4JQOA 1TCAA 4E07A 2FSUA 4UDYX 1R10A 2IYEA 4PIMA 2J3QA 3IPRA 3C87A 1C7RA 2CLSA 1OBVA 1QQTA 2EZTA 2G3YA 4I81A 4IFBA 4JOQA 4KQCA 2R62A 4TL6A 2C4UA 2CNDA 4WOPA 5I9LA 3Q5GA 5E6UB 3PGMA 3RRBA 4C0KA 5C8ZA 5FF9A 4NCXA 5L7YA 5TPWB 2VQ3A 3PXGA 4BB6A 3SYRA 4GW3A 5DHRA 3H87A 2OWEA 2G70A 3AESA 2GEFA 1O95C 1TT7A 1BMFD 4M9UA 1FYEA 1XNJA 2E4VA 2P91A 1KS2A 2XB8A 3TW0A 3V4PB 4CG2A 1CJVC 4D4MA 1ECPA 2CB9A 3LCRA 4I1IA 1G8FA 4OEHA 1SMKA 4R41A 1A7KA 2JBAB 3L0YA 2W2LA 2I6QA 1XU4A 2X9VA 1PK9A 1GV0A 2WSLA 2QPOA 3ADKA 5FNVF 3VAAA 1YS7A 3ZKWB 3B70A 4AICA 2FPIA 3W5HA 2XXAA 4QELA 1YB5A 2GRJA 2V3CC 4C7OB 3N8GA 1UBFA 1B3BA 4TKUB 1PKEA 3HUFA 1KHTA 1ZD5A 1ZNXA 9LDBA 2WM9B 3S2SA 5A05A 4DXAA 2HBZA 5J4HA 2ZYTX 3QQPA 1QUFA 3QU4A 4ZDJA 1OXBB 2X9GA 5JW6A 1UWVA 4CMAA 3QEKA 4TVBA 4IEIA 4P7KA 5FB3A 1OI2A 5IH3A 1WCV1 3N2NA 2VDLB 1V3QE 3HFJA 4KQ1A 1E1NA 1TCBA 1USUA 1UMCB 3DW3X 1H2XA 1P6XA 3T3EA 1A9XA 1S01A 2CFTA 4ZHQB 4UEOA 2X8AA 1A97A 2II6A 5EIAA 5AUQA 1W581 5CRIA 2MYNA 1CRWG 3DVAB 4NPAA 1XK6A 4MGYR 3EBPA 1OR8A 1VCHA 1JKJB 5JG7A 4QM6A 2CYCA 3SE7A 2D0PB 1KVTA 2JD2A 2WFLA 5CPBA 4QGAA 5EJ6A 1OLUA 3VKUA 4MHOA 2D0IA 3HWWA 4L1KA 3NHJA 1P7YA 2PDAA 2FPWA 2RSLA 4ABYA 3BWXA 3UWMA 2ECOA 3IXQA 3QYPA 1WUTA 3PUYA 4GKAA 3O0DA 1WL8A 1KMCA 2D1YA 4YP1A 3IMCA 2GX6A 1R0YA 1XJWA 2MT9A 4JHLA 3LM8A 3V1UA 1D8TA 1T2CA 4X1IA 5ESWA 4I6EA 5TE9A 2DHQA 2Q7OE 5IN4A 4ARIA 3NV7A 4V0NA 2VH1A 3DD5A 5CD1A 1GWNA 3A6GA 3CF0A 4GPZA 2C42A 1OPRA 1P62B 3FMPB 5BN4B 1L1FA 3Q8KA 5F51A 2XSZA 2SHKA 3ICOA 4LOJA 2H52A 3AEXA 1K6EA 1HDEA 4YXFA 5TEWA 3ZZMA 3OTHA 2GKOA 4AF7A 2XQGA 1TQ2A 5BVHA 4FGWA 1MJGA 3KEGA 2Y6VA 3HP1A 4C03A 4CGYA 2EP7A 4P36A 2YNMC 5CFNA 3E3LA 1XA4A 1HOTA 2RHJA 2SKCA 3PNVA 2YCLA 2ZJ4A 5TMEA 4Z4CA 4GBGA 4MV7A 1N2JA 4PCVA 3QSYA 1DTEA 4A6PA 3BG5A 4JVLA 3L7NA 4JLAA 2I7XA 2AGVA 3PE6A 4ESVA 3KHKA 3ORQA 4A15A 1MO6A 1NLFA 5AKYA 2OFXA 2J6CA 1ODFA 3ZUGA 1ONSA 2WZBA 4RTRA 3TOCA 1F2VA 1ZJZA 5CLLA 4YT2A 5KC8A 1W94A 3FTFA 4V03A 3KOXA 4BKQA 2HNKA 1LSJA 3EC7A 3R6WA 5KYTA 4Q7KA 1E2MA 4BGUA 2PYIA 2PUEA 5J40A 3PEUA 4XRRA 2OESA 4Z0PA 2OD7A 1EFAA 1Z4QA 4Z9XA 3M81A 3OLVA 5F33A 1KDTA 3T38A 4AMZA 3U6KA 3DR3A 2EU8A 2IYUA 2NXWA 1YIOA 2FB9A 5AUNB 5GVSA 3QNUA 1BHJA 3LC1O 3W9UA 4YRTA 2WT8A 2WY2D 4E09A 5BUCA 4XB6B 1P61B 3U5TA 2HT6A 4TTAA 2A4MA 3U5ZB 2ZE8A 2RKOA 3AETA 3TF5A 2GCPA 4EDHA 1PX0A 5B57C 4IIHA 2CXNA 4O4HB 4E3ZA 2B8TA 1SUSA 3SR3A 3CF2A 5HGJA 2I29A 1FIUA 2NUAB 3KXKA 1U1FA 2WABA 4RVDA 3QY9A 1DRVA 1ZMRA 4YDSA 2EX0A 5BV0A 4HGQA 1M66A 2EFYA 2ZQ5A 3ZK9A 5B6PA 5LM3A 3EGEA 1U3UA 3PHIA 1J2UA 5AKLA 1UJBA 4XUEA 1YZVA 2F9MA 5AO9A 2ODQA 2G8NA 2GSWA 5TXGA 3QVTA 3H42B 3VHQA 3Q40A 4MS3A 4DIMA 5AUPB 1Q0SA 1WTCA 4DB4A 2GMWA 5EL0A 3QXJA 2J48A 4Q4AA 3VNUA 2Q3EA 2R5FA 1D1QA 3OX1A 4H0FA 3WYCA 1VDZA 3EZ7A 3ZCTA 4HVLA 3ICWA 1QDUA 4O2BF 2AW3A 4OX9B 3ABIA 3GRZA 1HOXA 3GCDA 3ZN2A 1IMOA 4ZARA 1E6LA 4MVYA 3GGCA 2AK2A 3WAKA 1I7QB 2XUJA 3B85A 1NNSA 2XHEA 1M2WA 2PS1A 4EG5A 4FJ2A 3T5CA 1Y9EA 1ZNWA 3EF1A 2H4JA 5J2UA 1IN1A 4ALLA 2RHGB 5G0SA 4CQLA 1WF6A 3DBHB 5AJYA 4RF3A 4H7JA 4AECA 2R7NA 4YT8A 3EA0A 1YZNA 5EKDA 3VPXA 1L6IA 1PV4A 1Z36A 1IXZA 2XKJE 1G4UR 4YJFA 2FPXA 1M1NA 1RE0A 1W2HA 4LC1A 1CPYA 1Y6QA 3Q87B 1WP9A 4QYSA 4ID9A 4KQEA 3M3DA 4K6FA 4JI8B 1GQFA 2AQIA 1W5EA 2PRJA 4FI3F 4DS3A 1RKQA 5BOVA 1UXOA 1XTSA 3IMEA 2ZBQA 3E5RA 4D7AA 1NURA 2V8BA 3ILVA 2V7EA 1NMSA 3SXJA 1QORA 4PRLA 4EPRA 2XLCA 3WWPA 2C07A 3F8SA 4BNHA 3DFKA 4Q7EA 3GBPA 4FPXA 3TZLA 1KOFA 3WHKA 1XAIA 4RSMA 4FGLA 1Y1RA 3EGDB 1Y8QB 1TTQB 1OH7A 1ST3A 1RXCA 1FC0A 3LUPA 3SR0A 1W0KD 1ZCAA 1LDNA 2HQOA 3L7MA 3W0LB 2YRXA 1V6AA 4D26A 5TQ0A 1FJHA 3T41A 1S2MA 3D8TA 4GKJB 4IV8A 3PDIB 4L8GA 1QHXA 1SXQA 4IFEA 4G5XA 5JTTA 1H94A 3H4IA 2Y0DA 4Q3CA 4JJ7A 2QPLA 4GH5A 1MJ5A 4L27A 1KY2A 3RAEC 3GBSA 3P5BA 1VKOA 1Y82A 2ZRCA 4GRAA 4X5OA 3EOBI 3OBBA 1F3LA 2BV3A 3LSTA 1TTTA 2PMDA 3IJRA 4DQUA 2OM2A 1EVLA 4JR0A 4KFRA 2XGMA 2C4MA 5MN4A 3ISVA 1X15A 2QW8A 2DHEA 3E84A 3TLCA 3KB1A 2F1IA 2R7LA 3DTVA 3O3NB 3O6VA 3R5HA 4ZGGA 3UAYA 4XOUA 5HKKA 2IPAB 2PD4A 2V03A 4G0XA 1I1HA 3OF2A 4X94A 1N36B 1OOEA 3DF9A 3NRBA 4BX3A 1IBLB 2D2EA 1MR3F 3N0TA 3OSUA 5BMVB 4KRFA 3IT3A 4CQMB 3CE6A 2HN9A 3ER8A 2XEXA 1HE5A 2WYIA 3CKMA 3DLCA 5T67A 2CEKA 5J63A 1AUPA 3GFTA 1VBNA 2HYIC 1R74A 1H1TA 3KUUA 3O92A 4RXTA 3IA7A 2FPSA 2HHLA 2PX2A 3PHHA 3PR2B 5J9FA 3X2EA 4BL5A 4LZAA 3AKZA 3CHYA 4FHZA 1I24A 3QPWA 1AHPA 4YRKA 4S04A 4TTQA 5DGXA 4JUIA 3ZHCA 1SURA 5HS6A 3ZWAA 3MGAA 1MG0A 2PL9A 3NKVA 3P26A 1X86B 1L9KA 1BX0A 4XFKA 4E5YA 3UJNA 3U3RA 2YN0A 4UNQA 1JH8A 2H29A 1JG3A 1E2PA 4OK5A 5AKEA 5B58T 7ABPA 2ANBA 1AUOA 1BCRA 1T8PA 2F3RA 1O03A 2G8LA 3WB1A 4RD1A 3DZKA 3L6EA 3H11B 4F2GA 2ODWA 2LUOA 4XWTA 5EJ4A 3LE8A 3AR7A 5JWRA 2G4CA 3KR2A 1GCUA 3UJ6A 3RJMA 1XNRB 1DB3A 2C7RA 1CFZA 1C9YA 3PDJA 4IVPA 3L4JA 1OH8A 1H2EA 1Q92A 2IOHA 2JK1A 3DJFA 4Z1MD 1XA3A 5F23A 3HBLA 4C2TA 1QP7A 2C2GA 2FR8C 4IJ6A 2XKBA 4KQFA 4G1UC 3AF0A 1XE3A 3EZNA 3I52A 5BWNA 3UK7A 3KV1A 3PU6A 1OF1A 1ULBA 4MVWA 4YRPA 4IYJA 4DA8A 1QRRA 1RLUA 3HCCA 3INNA 4O4IF 3FPGA 1EEXB 3UH0A 3VKVA 4YCSA 2OV8A 2H08A 1KYVA 5KJEA 4RA6A 3EVTA 4GPIB 3RG2A 1ZUHA 2Z3ZA 2O5VA 3EWSA 1HM5A 3NQ41 4I5FA 4WUTA 4EG6A 5IVHA 4EF6A 5A5FA 9MHTA 1Y34E 2C0PA 3GPIA 3EVFA 1UAAA 4B8WA 5K3EA 3VU9A 3H05A 3LYUA 4Y6SA 1GUAA 1DCFA 3RQIA 3DMTC 4I1RA 4DFDA 2QL5A 3V1NA 2YWCA 2H1RA 5LXTB 1Z16A 3RRMA 2PSSA 3V9AA 4YWHA 5HNKA 2DETA 1U0GA 5BQOA 4TV9A 4LPKA 5BR8B 1R64A 5AUOB 1MV8A 3PNSA 2PK3A 4R5MA 4PX9A 1WHTA 4OM7A 3NOQA 5TGTA 1I3CA 3HH8A 3DULA 3D3NA 4M1YA 2G0NA 3FPKA 5HFAA 3DLHA 4DV7B 3C6XA 1XDGA 3TKLA 1BWSA 3UAOA 2XZPA 4UBIA 3RRJA 3MK31 3OU6A 4RPKA 2HCRA 3SIXA 2X15A 1Q0HA 3TG2A 3B1JA 2D6FA 4HDRA 1PI3A 3IE1A 3T7TA 1EWKA 1XCPA 2L42A 1N5JA 3JQFA 2WJZB 2QVBA 3KB8A 4WE3A 1SC9A 5AVWA 5KX5B 4YY3B 4RQUA 4ZD6A 3KOMA 3TTXA 4MHTA 1SPXA 4HDSA 1E58A 2HLPA 2PWYA 2QM7A 3FX2A 4IDHA 2H1LA 1OFHA 2ID8A 4U2EA 4DLAA 3K30A 3HNPA 4B7AA 5JNRA 1OIWA 1F2DA 3VISA 1CLUA 5KSPA 3TB4A 5DI3B 3RGWS 4GP9A 4ACAA 1MORA 3RM3A 1VTKA 2BHTA 2X9QA 1PJRA 3VVCA 4DGQA 4DLNA 5TNXA 5AM3A 5D8DA 1BX1A 4JU8A 3WIVA 3HKCA 1RYHA 4MUMA 4DLWA 4OHOA 2OXIA 2HC9A 4OUDA 1IWOA 1DEXA 2O20A 2V1XA 4B3GA 1UPBA 3N6VA 3FNRA 1X1RA 4D1YA 4X71A 3DL7A 3W79A 4PFSA 4TUYB 2BTEA 1RWXA 1Z17A 1Z2NX 3NI2A 4HUJA 5A7FA 1FU4A 3FETA 1LQ2A 3KB2A 2ZR7A 1AHIA 1BAPA 3KYBA 1FP1D 1RAGA 1WXQA 3I4CA 2C2OA 1RWWA 4PCUA 3HY4A 3K94A 2D0OB 1MAUA 1ENYA 1HDYA 3KP1A 3SS7X 1T36A 5CLFA 4RD2A 2FFAA 3E23A 2XUQA 3A6HA 5BSHA 1W5TA 2ZJ6A 1MVLA 3NYWA 3O94A 3PX3A 3DHWC 2IIBA 5PNTA 4MV9A 2WPNA 3SIPA 5GONB 3AL0C 2HA4A 2MMCA 2PSHA 4OI0A 3WJ7A 5K0CA 4C88A 3EYWA 4B33A 5TLSA 4D9BA 3CUWA 3TL3A 1ZGGA 1GQQA 3WRYA 3KSAC 1E7MA 3LZ6A 4UM7A 1YB4A 4UXIA 5G0VA 5T57A 4LVCA 4NOLA 4UDOA 3D7LA 4MJXA 1A4XA 4HEA6 3OLYA 3FPHA 5AJXA 1K6XA 1H65A 3IP7A 3LX5A 4KJZA 1TO6A 5HRUA 1DUIA 4M6WA 2VWPA 1V9SA 4ALMA 1CD5A 3FBWA 3RIXA 3CONA 4F9FA 4WZAA 1XPJA 5BUQA 1J2YA 1Z2DA 1Z4MA 2REXB 3OFJA 1BEUB 3GQVA 3SXUB 1Z4JA 3BDVA 2Z1DA 4P5EA 4TLEA 3A14A 1U2EA 1CJSA 4E2WA 5K3CA 7REQB 1F4VA 3VPFA 3VZPA 5CBPB 1OC4A 1DJNA 3E8MA 3D54D 4ZI7A 4RPCA 3TMKA 3BL8A 4CKCA 1SCKA 2PUVA 3RBAA 3NTXA 2RGUA 2W0MA 2WE7A 2W2KA 2YICA 3FPBA 3SPXA 2VHWA 3I8XA 1NKVA 3JVIA 3QA9A 4MB6A 4URFA 1HKHA 3KZNA 2X1VA 4Q66C 2E4AA 3LPMA 1U2DC 3OF3A 4Y9RA 3ZPXA 5F2NA 5K0NA 3SZRA 1CVLA 4KVAA 3ZTYA 3I2JA 1ZK1A 3DOCA 1L2TA 2BRUA 2YY7A 4LGCA 1GGMA 4URZR 5CJPA 3TKAA 5J3JA 1ILWA 3VNVA 4TXNA 3UJ7A 4PHCA 5IKMA 1WXDA 1DUVG 5FWXA 4C5CA 3KUKA 1JIKA 1K66A 4CM1A 4MQ5A 1IEWA 1WMEA 1Z29A 3DE2X 5KOIA 1NR1A 3OEHD 3ENQA 1J8FA 1GZ7A 4J2OA 4UU7A 1NATA 5COAA 2NVOA 2IEAA 3IDQA 3JU3A 2YXEA 4DCJA 3FGPA 2AD1A 3GLUA 3O4JA 3QU2A 1XZLA 4G5HA 2C9ZA 4RENA 4TS4A 4DCGA 4B4DA 2J3KA 4C4AA 3ABRB 1HG1A 3KYCA 3QXCA 4Q4HB 1GFWA 2PUCA 1ISFA 5CAEB 3MS4A 1YMUA 3PXDA 4HF7A 1MF7A 1HGXA 2GXQA 3L4BC 4XPZA 1J33A 2CFIA 4XYBA 5IAGA 2QQGA 4XVCA 1X42A 3C1OA 4YRQA 3JYPA 5IK2D 4RFLA 3MT9A 3LK7A 1RJ9A 3R6DA 4OKSA 5TMPA 3HUDA 2G88A 1YS6A 1CP2A 4JI1B 3FWPA 1KVUA 4ZIRA 4MQMA 1ACLA 1PD1A 4C0SA 5KTNA 1H2YA 3FCYA 3KD3A 1TCCA 3CXUA 3MB8A 5C7YA 3WDSA 2IBTA 2G08A 1TQHA 2J4FA 4E15A 4IIJB 4RTJA 2P9FA 2FPMA 4DKJA 1EFTA 3RODA 3G9UA 4Q03A 5K05A 5TQ2A 1N8KA 3VHXB 4L28A 4RY2A 4ZMRA 1PWYE 4Y6RA 4IICA 5EKXA 1Y42X 3R6TA 1I6LA 4GMDA 4RK6A 1W85B 5LUBA 1DCMA 3O9ZA 2BM8A 2HTFA 3RV3A 1T4CB 1VLZA 4B31A 4BQNA 2XMZA 4JOBA 5TMBA 3PI6A 1P2UA 1A04A 5GVRA 5A5VA 1TM5E 4FB5A 3E5MA 1C29B 1C1XB 1KAOA 2Q1YA 4FTWA 1U3CA 1VPDA 2V7XA 3GRKA 3HCAA 4J29A 1NG1A 1VL2A 3DONA 2I34A 1XTVA 2OP1A 2X1LA 2IHKA 3FB1A 4P3XA 1PL6A 4RTMA 3N58A 4N49A 5BV7A 3USES 3NW9A 4RHXA 5J4KA 4P53A 4DLXA 1DO0A 4JUFA 5B3JC 5K8TA 1K8RA 4OA5A 1H1LA 1Z08A 1QHSA 2H0QA 5B6JA 1UK6A 4LNUB 4BHTA 3Q9UA 1H2BA 1UC4B 1Y5MA 1M2VB 2HSZA 3LLSA 4F11A 3KAJA 3SZUA 1ZH4A 5K09A 1DFGA 1RLIA 3G2QA 3V2HA 4C4RA 1BCSA 4BGIA 3OA2A 4FYJA 5AHXA 4UHEA 3VFDA 3OZBA 2ZT6A 5DX1A 3JAKB 1YTLA 1CF9A 5D5HA 4NONA 1DARA 3LQ1A 2W2NA 2XCRB 4E31A 2ACVA 3QU9A 1ZGZA 3ROEA 5BV8A 9ATCA 5JRZA 2OYSA 3WA7A 3RUIA 2A9QA 3SS9X 1PFVA 1U1IA 3AL2A 5ENVA 2NV2B 3PGKA 4XB2A 1VJTA 2HZBA 1F3OA 1YAHA 1E2KA 4RSGA 4U1RA 3U7QA 3ZLVA 1ND6A 4F72A 1ORTA 3A3PA 2V6IA 2V55B 3LLMA 2VAPA 4ETMA 3VR6A 3WFJA 2NSYA 2P3OA 2I3GA 3KR9A 4BKUA 1OI4A 2FU5C 3CKKA 4GVPA 1K6MA 4YACA 2D13A 3DMNA 3L8CA 2P2LA 4BVGA 3THXA 5CTAA 1D7AA 5CVDA 1N3BA 3UB4A 2JLQA 4A3SA 4HAXA 2CLEB 2PBLA 3VU1A 4ZYLA 1JIUA 3FSJX 3B3JA 2AFHA 3CUTA 4YT5A 4KDRA 1UR5A 4CKBA 1LK5A 1ARZA 4UBLA 2JS7A 2R79A 3A06A 3JYLA 3P97A 4A6XA 3KC2A 4LJAA 5AKJA 5E1OA 5I8PA 3N74A 3PRHA 4IGKA 2CBXA 2B4AA 1KHHA 4J07A 4QBHA 5LA6B 2IC5A 4HRYA 4WH0A 3HNRA 3R9WA 4OI4A 4YBRA 3SIRA 4DMLA 1M76A 4IDFA 1W0JD 4DXHA 4GVXA 4KX5A 3S8MA 2VFAA 5ALIA 1UDWA 1DFIA 2Q3JA 1DKNA 3DWFA 4YJHB 2A1UA 3O90A 3THRA 3FVRA 2Z4RA 4H4DA 5FL7D 2AT1A 2WP8J 3FKJA 4MWGA 1GTSA 4RF2A 2WF9A 4YB8A 3PFNA 4P4GA 3SGLA 4XCQA 1XYGA 1BMQA 4HWTA 1B6RA 1XTZA 2HHHB 4YDRA 4EA9A 5KNBA 1P2FA 2ZIGA 3FJOA 4HX2A 1C0IA 1TM2A 2IF0A 1XG5A 2QVYX 2VSYA 1B3RA 1FNDA 1T8SA 2GF9A 2OUKA 2ZQYA 3H7AA 4PLFA 3GLGB 4MCJA 1IDOA 2YXPX 1YD7A 1MRNA 2HYDA 3F3SA 2FJ0A 4M0MA 3S99A 4MP6A 3PEYA 4BTVA 5JJLA 1QYVA 4I4TB 4FHDA 3NDPA 3FD8A 4KK4A 3JD0A 1FE8A 4PG8A 3UCEA 2DX7A 2R1ZA 1AN9A 4JIMA 5HBGA 1N0WA 3GI1A 5CURA 4MUAA 1ITZA 4J94A 1J2JA 1JN0A 4IGEA 1M33A 2CLCX 1RM0A 5B53A 3DHVA 3S8EA 1WABA 4WCFA 1YE8A 4A0SA 2QJWA 2GZ1A 3PPWA 1QVVA 2J41A 3HA3A 5MGBA 3HRKA 1V5EA 3W2IA 1FUUA 3FOZA 2CNKA 1G9TA 4CMIB 1G3MA 2GJSA 4YJ2B 5IT0A 2WHYA 3DFFA 3UATA 3VMMA 1Z3CA 1NW7A 2O3SA 3MUEA 2AMVA 1NXTA 1NUHA 4M1WA 2ZUVA 1XIVA 5D5QA 1E3DA 1Y8CA 3E9NA 3P0FA 3VV2A 2V3VA 4W9NC 4GPTA 1OKKA 3DEYX 4HQ0A 4QYWA 2N9UA 1W0CA 3U7HB 3CG4A 3ESQA 3AVWA 4B3XA 3PPVA 4RAOA 3LFUA 1GR1A 1N6RA 2FMKA 3AI7A 3GUCA 4HH1A 3UENA 4JP3A 2XTZA 1IVNA 2H1WA 2QEQA 5IC5A 2PN1A 1YS4A 3K1AB 1GAXA 1UJ2A 4GOND 1ZFNA 1N9GA 2WFMA 3RYFB 4U39A 4WOBA 4J7UA 5IYZA 1DLIA 1F4LA 4MYDA 2VYQA 2GQ0A 3F47A 1HMPA 2DUJA 2UZIR 1O94D 5C9ZA 2W6JA 1GADO 4YEDA 1SCAA 3RR2A 3HR7A 3TQTA 3H5OA 5F2OA 5KNCD 2N0SA 1RZ3A 4M55A 5IAAA 2QVGA 3ASZA 3TAHA 1N8TA 2XB6A 3BEDA 3C6QA 4MOWA 5DGCA 2RBKA 1N3LA 1I51A 4O4JB 1FFDA 1DQSA 1ZICA 2R3SA 4HB3A 1YQQA 2LZ0A 1NF3A 3GUUA 4BNIA 2YTZA 4G01B 3DDNA 1P5JA 1G66A 2IYOA 3MWDB 1HTWA 1SVWA 3H2IA 4TYWA 1S2DA 5IXJA 3RS4A 1VHDA 1NUTA 2JGDA 4NICA 5ADHA 4DZTA 2P0AA 2AR9A 1OHHA 4BNVA 4B17A 1NLUA 1ZLXA 2GFQA 5LFAA 4PGAA 4KNVA 4DQVA 1FQKA 1R4AA 4MK4A 1UM9A 3ITKA 4YRBA 5DGHA 5E1DA 1KJ8A 3F7MA 4JK3A 5ILGA 4KN8A 2A35A 1GD1O 1TU0A 2Y1WA 3A3OA 3BIXA 2JLSA 1WB6A 4JQCA 4JCOA 1Y9JA 4WADA 3V4ZA 1THTA 1RSZA 2WAMA 5KTSA 1X77A 1JHZA 2QL7A 1XQYA 3AFIA 1GUFA 4ZT6A 2FZVA 3OJXA 1HDCA 3WLFA 3TPFA 3X1JA 4OHZA 1ZIXA 1XMXA 5IJZA 5L3SA 2VHCA 1EXMA 1XCOA 3GC6A 2ONZA 3GJTA 2Y1EA 4YAOA 4NPCA 4C0AC 3DKVA 3N28A 1J6UA 1VL5A 1MB2A 1ZKMA 3HJRA 5GGYA 3H2JA 4R51A 1J99A 1PJQA 5FYDA 3BIJA 1UKBA 4DRXB 3VPSA 1EB8A 3NBUA 4I4LA 2PHZA 3ZZ0A 2HK8A 1EK6A 3FKQA 7ADHA 1VLVA 1XEAA 4G9BA 1VGRA 4RABA 5K0FA 4FJ0A 4E7PA 5HCNA 1JAHA 5LYJB 1KQGA 3E2IA 4HNRA 5FNZA 3CJTA 1JTVA 1FTSA 3JQGA 5F4BA 1QGED 4JSTA 3OCXA 5LDGA 2OCAA 2L17A 1A9YA 4BP3A 3BD8A 2DQKA 2OAQ1 5JAOA 1SWWA 2QZSA 1J8YF 2R6JA 3OQBA 3ZDAA 1X70A 1YR2A 1W47A 1Y1LA 2GYVA 3AGPA 4YRCA 1ZVKA 4RVFA 4Z9YA 5B64A 1NOKA 1DAKA 2FY8A 1DQNA 5T4BA 1KI8A 5EP4A 1MZPA 3FYHA 2FPGB 3QOFA 2HIMA 1GXSB 2JL1A 4JT8A 3LOUA 1EZ1A 1HG0A 3MWEB 1RVDA 3N2LA 5I48A 3ROFA 4PS1A 3IESA 4MPPA 1PL8A 3STWA 5IDXA 3GAFA 3LT1A 3R6GA 2QMZA 1S2NA 2GZDA 1O7JA 2O2DA 1Y3IA 2ZETA 3I1YA 5CA0F 4JI2B 2H8GA 1RKVA 3Q9SA 2G04A 2YWEA 4DC1A 1V3UA 2CUTA 4HEA1 3WYEA 2RONA 2DLDA 3SMQA 4BMYA 5JEEA 2CNWD 2I8AA 5LN1A 1Y37A 2FPRA 1I9CA 1E5TA 5HIKA 2AOUA 3BJRA 4C4ZA 5DM70 4D2IA 5AK0A 3WLQA 5BRAA 1AQJA 3W34A 1GL9B 2JAHA 2JFWA 3LECA 1KMQA 1I10A 3R9IA 4UU0A 1REQA 2JIPA 2O8VA 3A6DA 4MWZA 4FMBB 1CUEA 2EVWX 4KVZA 4BVKA 1QVRA 3QVSA 2BFMA 3LCVB 4NNJA 3CURA 2XUKA 5LQUA 2FFBA 3NAQA 2GNAA 1F8FA 4FMDF 2XF8A 2Q45A 3A1VA 3JCZA 4X1OA 1HETA 1P4AA 2BZ0A 1B23P 1O6FA 1TT5B 1Y3BE 3H4VA 4YALA 5HIAA 1P2VA 2YRWA 1MB9A 2IP2A 2CL6X 1A9SA 3IURA 3L5KA 3GLGE 2J5XA 1O5OA 3L0IB 2VPZA 4IS3A 1KYWA 1HC7A 2CY0A 2IOFA 3K0FB 3PNMA 5DNAA 1KVSA 1YOBA 3UKJA 1VSUA 2Y92A 3F1LA 5AW3A 3INGA 4LHVA 4ZVLA 4CEJA 1ZUWA 3AI3A 2FLWA 3NRCA 1H93A 3CSDA 2XUDA 1SO8A 4E21A 5LQAA 1OWMA 1RADA 5JJCA 1YR3A 4LISA 4ZPJA 3T5MA 1G1AA 4RQTA 1ZR2A 2HF8A 1E3QA 2BGJA 2WILA 1XQXA 2X4DA 4M37A 1D5CA 1M2HA 1NYTA 4R6WA 2A7QA 3SQLA 3I04A 4QRIA 3VDXA 3LX6A 1ENZA 3DP7A 3ZHBA 2V7QA 4HTFB 3DQQA 4QJ4A 1AD2A 1FYXA 1P74A 1GLGA 3L04A 5KYKA 4DCUA 5G0WA 4BBPA 4ENQA 5EJ7A 1KMIY 1A1VA 2QRQA 1VHQA 3LBAA 3O75A 4OK6A 3ZIAA 5JYBA 1L3IA 3EE6A 2HLHA 2JFBA 2JLBA 1VE7A 3ZR4B 5KVSA 1LV7A 4KR7A 1SD1A 2IU0A 1FW6A 1CUWA 3AUAA 1X3LA 4DR7B 4B5LA 3BCUA 2NTYC 1F2UA 3ONNA 2PLAA 3I0NA 1S9HA 3H5WA 4ND5A 2J9FA 3IKTA 2AA3A 3VGPA 5KWEA 3CYFA 1KP3A 4ZDIA 1Q95A 1KJ9A 5I8WA 1E6KA 1JRLA 4N40A 2TMYA 1FNSA 2PGNA 1DC4A 5HCIA 4ENPA 4UBKA 2R7AA 1RXWA 4FZJA 2CNOA 3HLYA 5H83A 1XNHA 4IQFA 4OP2A 1QM5A 1TLTA 1TZJA 2X5JO 2X58A 4ILKA 4NV1A 2YVQA 2D1SA 4XDHA 2XMSA 3SFTA 3CLTC 1W4ZA 2PA3A 3LL4A 2WD7B 4P3PA 3ZZ1A 2DJ5A 3CNHA 4CMEA 3H0KA 5KS2A 2GBFA 2Y68A 3IMGA 1Q2UA 5BR7A 1ECCA 2EJCA 3IPCA 3MQFA 5BW6B 1U2RA 1M8JA 2B83A 5A7GA 2ZCVA 1V25A 4C4XA 4Y2TA 3WBJA 1DKLA 3T1TA 5BR1A 1SEPA 5DNUA 4DAEA 1E4OA 1T2DA 4NFYA 2Y6UA 1SD5A 1VYVA 2WIBA 1N33B 1FP2A 3FFAA 4ZQEA 5E6UA 2PEZA 5TPWA 1SOVA 3MLAA 1XD2B 3L0SA 2J3HA 5GMOA 4W5JA 1SZPA 1NQTA 1LWOA 3S68A 2XI4A 1FY2A 2GILA 3RFTA 4G63A 4B4VA 4J1QA 2CDRA 4U2BA 3PGLA 4GI2A 3RSFA 1A2KC 1C0EA 1FMCA 3LX8A 4YV7A 2ATXA 1KFBB 4CEHB 3A26A 2JGFA 2ZWVA 3GDHA 5JRJA 1NVMB 4FXOA 1C3EA 2CMDA 2JBAA 1B8OA 4DNQA 4XWOA 3O8RA 5MHTA 2VF4X 2XYQA 4QNMA 3ZKWA 1UP7A 1X39A 3C1TA 2JJ1D 2WTEA 4C6SA 2EW1A 1N1GA 1L5VA 1JU9A 1W36C 2GXUA 2ZATA 1TQDA 4C7OA 5HK9A 4IXMA 4KAFA 4DLSA 2RH5A 1WUKS 2DPYA 1C2TA 1CY7A 1KQOA 1RRGA 1TI7A 2JLAA 4FZRA 4PV7A 1TUIA 1SQSA 3GEMA 2PKXA 4UQPA 2QE7A 4EJ0A 3OLZA 1Z0KA 1X87A 3QU7A 3DXZA 5FI0B 3I4FA 3WBKA 1NN5A 2TECE 4IDOA 1W9MA 1XBTA 2OD9A 2YOGA 4G26A 5DNCA 3VNRA 4Z2YA 1FXWA 1EK1A 3RYCB 5HQ3B 1UMCA 1XZAA 3QUTA 2OHGA 1Y1PA 5JYEA 3NGMA 5KYUB 3PSHA 1Z2CA 4N39A 4ZHQA 1BMFA 5JMWA 2DWOA 1G7RA 1KORA 1X7DA 3DVAA 1I7LA 1RP1A 4IWNA 3ZXYA 4E4TA 1JKJA 1HEUA 1EG7A 1E1MA 1IN6A 3EAFA 1NPDA 4P4NA 2IWRA 1GNQA 3TBFA 5C1DA 2PLFA 3FNEA 3ROMA 3VI4B 4M0DA 1TIBA 1S2GA 1U7PA 3UNXA 3MFYA 4Y2YA 3AIKA 1QWSA 5JI3E 3ZJ4A 3N8NA 4URXR 4RV9A 3AOGA 2PT6A 3GFSA 4LG1A 1MGPA 1GZDA 2R6HA 1VPWA 4HWOA 4OJQA 6Q21A 2X7HA 1T35A 2CVPA 1YWGO 2B7BA 2JAXA 3LUGA 2HXGA 3MZ0A 4KQXA 3RTBA 1II8B 3DLIA 5GAJA 1BRMA 3WL8A 5LQRA 2XZOA 4KDEA 4UVIA 3Q3VA 4JAVC 1IQRA 1KYTA 1LVHA 3DZCA 3QNWA 5I51A 4RHFA 1E77A 2DP4E 4ZVNA 4BLUA 5BN4A 1SFRA 4TRNA 2H4XA 1T1JA 1YB2A 5DCUA 3W2FA 4G2NA 4PYOA 4C3ZA 4TSKA 5B6IA 3LPCA 5ERGB 3U3ZA 4BEWA 4IJWA 1C9DB 4RCVA 3W5UA 1TMOA 4IDQA 2KE5A 5D7BA 3GJ4A 3RLFA 4ENSA 1RYBA 3L3BA 5FOVA 4FINA 2QQ0A 2Q1UA 4ZYWA 2AMJA 2O1XA 2R5NA 2HPZA 3VGJA 1SVKA 2IOYA 2IU4A 5FI3A 1C3OB 3F78A 3Q7PA 4XM2A 3IV9A 1RVV1 1UBKS 3CRMA 3FAKA 4KK3A 1Q12A 2Y2VA 3IDOA 4BMSA 3F73A 2CK3D 4K9QA 4UMEA 3JQAD 4CVNA 1M2OB 3AJAA 4LQCA 3RROA 3RUHA 4QPJC 1NXQA 4A03A 4RK5A 2DQSA 3C4JA 5CHEA 4QATA 2HJSA 4Q9NA 1DKOA 2ZAMA 4FSHA 4E5NA 3PLNA 4YMHA 4EVRA 1E7WA 5DWDA 1FLNA 4IJMA 4DCNA 4QE3A 1Z26A 3FNGA 5FTWA 3WQHA 4B6PA 5JD4A 2FQ1A 1HMYA 4BFSA 1I0IA 4HEQA 4ZU3A 5KQMA 4OHMA 1WZUA 3GFFA 1GHTA 4PG7A 5JAMA 5K6TA 4MRRA 3S44A 3K8ZA 2O6LA 2AEFA 3ZDZB 1FYFA 1AGRA 1YDGA 3MRVA 5K2MA 4YBZA 5IUKC 3FVWA 5H4HA 1U8UA 2JFQA 4QPZA 3REFA 3TRJA 4C4PA 3S5JA 1GL7A 3P2EA 1DC7A 2JK0A 2WINI 3PQ6A 4NULA 5EJAA 3WK5A 4J6EA 5K45A 2HSDA 4NMMA 4A5OA 3RVDA 1IFXA 2P41A 2QG6A 3TM4A 5KYYB 3QW2A 4QUHA 3AO0B 2Q41A 2QIPA 2Q9BA 2ZBDA 4MR9B 3UV7A 4BEVA 4DDHA 2GK3A 1R5NA 3AR4A 1ZCFA 4RA9B 1LNZA 1VIVA 1VCIA 3KKLA 3LTEA 5ALXA 1QHYA 3CA8A 4ZRNA 2C9BA 2PV7A 3UJAA 1EFCA 3OQIB 1FNCA 4O5AA 3RU2A 3JQAB 4O4HA 2GK7A 1W75A 1L5RA 3D02A 4E5SA 2GFIA 5C8XA 4JB2A 3PCTA 5FV7A 3JWPA 2A9JA 2XNJA 2NUAA 3H2SA 4S2UA 5FR2A 4BQQA 4YRMA 3L07A 3OY2A 1QJCA 2P3SA 2VCYA 5EE3A 3K71B 4XARA 5CCEA 1OX5A 3IXLA 1GIAA 1RZVA 1NRJB 2GLTA 2HEIA 3SK0A 1T5HX 1G5QA 1THMA 3NOXA 4G8DA 4P4LA 3QPBA 1KQPA 2MSCB 3HYLA 2ZUDA 4M8SA 4ZCQA 4Q3LA 2GPTA 2VRBA 3A8TA 2IYPA 3O4RA 1KDVA 4YHBA 1W73A 5THQA 4FYXA 4GP7A 1Z3IX 3FVVA 2G25A 4MVJG 1D9XA 1AKVA 2GEKA 3RJ5A 1OZAA 1AS2A 3IJEB 5IVDA 1X19A 3ZWBA 1TZ2A 2GUWA 4EHAA 1WZNA 1MW8X 2PLNA 4R1TA 5CJJA 3I45A 3JPWA 4MLPA 4CLDA 1GCOA 4OLJA 2HDHA 3QTBA 5HZHA 3TQHA 4EKIA 2RCNA 1E9FA 3D3WB 5JSYA 1P80A 1IUPA 4LA4A 3G7SA 3TLEA 4BC1A 3W2HA 2QLTA 2Q2WA 2WSYB 4CHGA 2WQ6A 2CHFA 2J32A 3QJ5A 1KQNA 1PP4A 2ZZKA 4HWGA 1HL7A 4PHGA 2PFKA 5IABA 2AJTA 3DBHA 5H3LA 2IVFA 4HAYA 4TLCA 1EBBA 4MUIA 1H66A 1ZGCA 1J0BA 1QAMA 3CO0S 3T9EA 1IWPB 4B75A 4CHTA 1E2GA 4GHWA 2RC6A 1PBNA 1V7CA 4A73A 4KPUB 1I2AA 4Z99A 1SQ5A 3QMPA 4AFNA 2PUGA 2P11A 4N01A 1TUEA 1IRIA 3PTAA 1B14A 4HB0A 4MO2A 3TRDA 5C1PA 3EEFA 3I58A 2XOXA 1QCCA 3C2QA 1QIDA 4N1AA 1Q6ZA 3UH1A 1LZLA 1IY2A 2J9XB 5JO9A 4YRZA 5BO5A 3EGDA 1Y8QA 2FN7A 1Q15A 2LDXA 3IIIA 1OT3A 2H9YA 3E8SA 2AJBA 1UBOS 2B1JA 5DTIA 1XZFA 4C6RA 4XYLA 2F4NA 4Q05A 3WMXA 1J9GA 5K20A 1NVAA 4K9OA 4W82A 3OSZA 4H35A 1KPIA 1K3UB 1VOTA 3PDIA 3PSAA 2QLBA 3WIOA 4BMXA 1QTRA 2JZCA 221PA 3LWNA 3R0XA 4HAVA 4P2GA 4ZC8A 1WXEA 1MBZA 2HU5A 3OM9A 4QOIA 1JBEA 3CG0A 1JJAA 3SC3A 4JFRA 4CQJA 4LSWA 4O33A 3QLVA 1E1DA 2AG5A 2AOVA 2FH5B 4I1OA 5CVUA 4B6SA 1IZ8A 3I9V6 3BM5A 3RIYA 1U4OA 1EM6A 1Z0AA 2R85A 2YC4C 3NOVA 1N9KA 2PR7A 3Q41A 2PZLA 4NQZA 5AW2A 3I6BA 4FXPA 4QGGA 4J0EA 3MJVA 2C03A 4JJ8A 1U90A 2GN2A 2CVFA 1M5RA 3LFHA 1QYRA 4V0SA 1N8SA 3U7GA 1ZJJA 1RTKA 2ZITA 3ROKA 4EY7A 1OXXK 3KX2A 1VHTA 4NEQA 5HFJA 5BMVA 4CQMA 1YZ3A 2Z6QA 1W0KA 3B13B 4OGLA 5JH7B 3T7CA 4QRHA 5CG2A 2GESA 4ZXFA 3M3PA 2QAIA 4U6QA 4RETA 3L1UA 4FILA 2Y1GA 1H2HA 3ROXA 3NIDB 2RGBA 3TN7A 1L7BA 3JYHA 3REGA 4ZV4A 3ZYCA 1J25A 1EFUA 4P0TA 1LS1A 3OZGA 2O2JA 5AVJA 5FRDA 5FUBA 5FWDA 5TGDA 3VHRA 4RTQA 2JVIA 9LDTA 1SA0B 1V16B 3A28A 1V8PA 1GRQA 2VDUE 5EJGA 2IHYA 5L4NA 1P1IA 2G4VA 1RM4A 4PAQA 1JH9A 1UT6A 3O1LA 1KF0A 1FZQA 1OV4A 2UDPA 4KQHA 5AOAA 3H11A 2UU9B 1TZBA 1TQ8A 2GAFA 1X80B 3COWA 1U0JA 4JBNA 4EKYA 2ZTVA 2H06A 2BLLA 3PUWA 2ZSFA 4V1CB 3GZNB 5DHAA 2XVXA 3DO5A 3NWOA 1CW2B 5BSVA 2NYVA 5ALTA 5CB0A 5AVZA 4EYQA 1OE0A 3GUHA 3KLPX 4NBSA 1Q3KA 1ZAKA 5F5LA 1T0HB 3QEBZ 3RADC 1V71A 2Q29A 1H2WA 1A5TA 2E3JA 2Q5IA 3NAMA 3T8YA 4F46A 3GJXC 2JHPA 2QP9X 2QX8A 4PGFA 3FOFC 3I3SR 2DU8A 3D9QX 1UBHS 4HNUA 2IHVA 3FZEA 3OZ7A 4EENA 5JLJA 1J1UA 2GEBA 3D8SA 2NOAA 3DYVA 2UUCB 3BTUA 5JPIA 1R8XA 3H19A 2X1HA 4LWQA 2Q4TA 3C8HA 4MLDA 4EGAA 2QTNA 4DAOA 3T5BA 1U7OA 3G6KA 1EX6A 3C39A 3V4RA 4N5IX 2FPUA 1ZD4A 1Z4KA 3W8FA 3F98A 4ZKEA 3EEQA 5LXTA 1PSDA 2ACWA 2F55A 5AXAA 3ZE8A 2P69A 2OFPA 4LXYA 5A4JA 2HRQA 3FH0A 4URYR 3EOZA 4O6VA 4YIKA 3UGTA 5ELXA 4DOMA 4YP6A 5AI9A 4MJLA 1M8PA 4Z1MA 2AHOA 2B3TA 5D3ZA 2H2IA 1IZ0A 2VZ0A 2XJ4A 4MQFB 4W8GA 2V58A 1JJ7A 3RLIA 1HKUA 2JF0A 3FIUA 4K3UA 1QQ6A 3AEKB 4BZPA 3EIXA 3W9BA 3A6PC 3EIQA 3DZDA 3MWGA 3QPDA 1TA9A 2VK4A 2YY5A 1GEEA 4NECA 4D79A 5KX5A 5AK6A 4ZVTA 1TZKA 2PSFA 2Z5GA 3DMYA 2OBBA 2WAXA 2IW1A 3TNJA 5HM6A 4QNNA 1QYCA 4CM8B 3MMSA 2QUIA 3NH9A 3OZXA 3EVCA 1DE0A 3O7MA 1G21B 1EVKA 2ID4A 2CLLB 3G0CA 1IJKA 3KVYA 4WCDA 4OP3A 2LIPA 2O5RA 5GIPE 1DELA 4V0ME 5DI3A 1NNEA 1A5ZA 4DXDA 2ZI3A 2XQIA 5KVAA 1YIAA 5A6VA 3E15A 2P3QA 4RM3A 4HOYA 1PNVA 1M0TA 1VL0A 4PO9A 4WVFA 3ZY4A 3KQWA 1EJ6A 1MO5A 1Y63A 4AT1A 2FOIA 4U7DA 4M1EA 1YE3A 1QIIA 3LC0A 1RRCA 1J00A 1G8JA 3MTEA 4UAVA 4V0RA 3CF4A 3SSNA 5MN6A 2VHZA 1ZL2A 4TUYA 4OIMA 1VYUA 4OAQA 4OL0A 3G23A 4XJXA 4QDOA 4MYHA 2D2IA 1R0BA 4OOEA 4OHKA 1NUPA 1KI4A 2WHQA 3SG0A 1T1RA 3NO4A 3B1XA 4BFCA 4DM7A 1DZIA 2ORWA 2Z2JA 3RS7A 3SU8A 3AR5A 1TLLA 5THKA 3K9FC 2B9EA 4IIUA 4QL3A 3VPBA 4LK3A 1VJCA 2AWNA 3GGGA 2VK1A 1GTMA 1SHKA 2Q5EA 3B2NA 3C5VA 4H7HA 4PO3X 3ECAA 4WOKA 3KFLA 1ST2A 3HS3A 4AKTA 2NZ8A 3I6IA 2B0JA 3AKDA 2WJ6A 1SQ6A 4GMKA 4N6NA 3WGYA 5K2OA 3RSSA 3FWNA 5GONA 3VA7A 2FEKA 1K7FB 2CHVA 2Z2IA 4C0LA 1H42A 3WR5A 3NZEA 4S1PA 3JQFC 3DLPX 3V7WA 2JA1A 2WU4A 3P9IA 1UZMA 3DBLB 3MILA 2XGOA 2FEXA 2KPOA 2ZB8A 3E9RA 3QRWA 2PMEA 4C7MA 2PGXA 4DEYA 4PU0A 2D1RA 3OG9A 1SWVA 2F43B 4RNDB 2QRZA 2ZRFA 2AWOA 1KYIA 4DA4A 1HEYA 3RUCA 4KOEC 4L7VA 1A9TA 1QZTA 2GBLA 2WJPA 5IBQA 3WLIA 1OASA 1P39A 2B61A 2UVQA 4KEAA 4QT0A 4UHBA 3ZV3A 4PG6A 1VSTA 2C3PA 4Q1CA 4YV2A 2POQX 1U1CA 4C76A 4FDTA 2BOVA 1EFKA 1GT6A 1U2QA 2Y0EA 4HADA 2MYUA 4KVFA 2Y8EA 3HRIA 2JLXA 3PS9A 7REQA 4P32A 4EL0A 3EPJA 3P45A 1BTOA 5CBPA 1RJWA 1PR3A 2WLSA 4RY0A 1Y4DE 3FSEA 2P1RA 4WJZA 4KWCA 5FBVB 2FCAA 2ZTUA 5E6SA 3MXOA 3TK1A 5JXHA 3H97A 3H9QA 5B37A 4RIIA 5E7IA 3ZW8A 1TYCA 4KSCA 4IWYA 3OM0A 1NJ6A 5F7JA 2QN6A 1QO7A 3GCZA 4HWRA 2N3ZA 1FRVA 1NDQA 3DMPA 1MQ8B 1YUBA 1JIVA 1KAEA 1TMKA 3B6EA 2CNBA 3T61A 1IVSA 3TOSA 3ZWMA 1ECLA 4FE7A 4WWHA 1TCUA 2H7CA 3QVVA 5L9AA 4RH3A 1L5HB 4Y8VA 5KQRA 3UWOA 4Q4HA 4A2CA 4A91A 3LXRA 4AJLA 3K6RA 5CAEA 3X1MA 3CBGA 2WF7A 1XVUA 4EPWA 3FFBA 3C1UA 4L2IA 1NBHA 3T7SA 4W5WA 2VEDA 4W1QA 4IOKA 1PNRA 2DKNA 1G8GA 1EP9A 2YN4A 3FMOB 3K5HA 3NIWA 2GKGA 4C4OA 1CDEA 4I6GA 1KWKA 2OE2A 2ZT5A 3WL3A 3GLKA 4IDAA 1RMQA 4GOJA 1WR8A 4QEZA 4ZV9A 3VO8A 5TT0A 2IZOA 2ZE5A 5K3SA 3EC1A 4KXYA 4L8LA 5DGDA 2W48A 3EXHB 1CNFA 1TRKA 3MCUA 4IIJA 3LYLA 4C43A 1XTIA 5ICGA 3ELBA 2O07A 4I4NA 5CLJA 3A1EA 3ACBA 1VHJA 4C6HA 4F21A 3F3MA 2DFDA 2Q0XA 1MO3A 3VHXA 5A0FA 5J2UF 3GEDA 4X60A 2H1IA 1A9QA 3ZKAA 2I2DA 2WSBA 1KR2A 3K92A 1NQVA 1RAFA 2D3WA 1W85A 3CLHA 4LJKA 1GG5A 1V1RB 2BRUC 1NF8A 4MGKR 4MV6A 1U7ZA 5DSXA 1USIA 1B41A 4EG8A 1MA3A 1W1WA 1D5WA 2BR3A 4O08A 4R98A 2IHTA 3ABZA 3WNCA 1C1XA 4Z4GA 3DEKA 4ND6A 5IK2A 4F4UA 2OFOA 4QC2A 2HREA 4U5QA 6AT1A 4CIAA 3AEQB 2FW1A 3EEYA 4MVCA 5JSZB 3ZV4A 4P4UA 4DWJA 5KDDA 1G2OA 4HQFA 3PD1A 4B9EA 2AK3A 2YV2A 5CIWA 1QTIA 2BW0A 2OXRA 4YC7A 4C6TB 4DIEA 4MW9A 2VF8A 4TYNA 2A84A 4A7PA 1HI9A 4E11A 5FEUA 3OOYA 1PFGA 5I6DA 4JI5B 3P2YA 4G5FA 4IO1A 3HDGA 3QBTA 4I6JA 3SLKA 4LNUA 3GRRA 1NV8A 3AR9A 3EVNA 2ZYDA 2UYQA 1M2VA 1PEDA 4EBFA 1LJ8A 2RE8A 2R4TA 2YWRA 4BX2A 1U3VA 5ICCA 3LP5A 2ET6A 3ADOA 4GKBA 3WKAA 1XJ0A 2XVMA 3DMGA 3KPWA 1RCTE 1OC2A 4ZIRB 3HB4X 3PT5A 4J0KA 5E1MA 5EGSA 2FSHA 1G21E 1USKA 1WOMA 3JWHA 2G9VA 1JZSA 2IEBA 2E48A 4GZLA 2BMFA 2OV3A 2PGJA 3JAKA 3TDMA 4CLRB 4YRRA 1R8YA 2D5CA 1KJIA 2PVPA 2BKVA 3KBBA 4A2PA 2BHRA 2IY9A 1YZLA 1RCFA 3TI9A 4B7CA 3WRXA 2AI3A 1KQ3A 1AUQA 3NH6A 4ZOLB 4V0LA 2ZJ8A 2CVQA 1MC1A 4XR9A 3U31A 3CR3C 1IK4A 4FMCF 2W70A 2DPMA 4QEKA 4UTOA 4C01A 4EHIA 2PUBA 3NHKA 3Q8XB 2O6HA 4L9AA 2RGNC 5IJXA 3GVHA 1VIAA 5CA1A 1YFLA 2EG5A 3ZGXA 3I28A 3T9FA 4BNMA 1P9NA 1QOZA 2P9QA 1CRQA 1KQFA 4I50A 4HAOA 3CCBA 2ONCA 1ZGBA 1ECFA 3PXUA 4J1SA 1HYQA 3ZX4A 3GP5A 3NETA 2FSIA 2YBEA 4KNWA 2OHXA 2R5WA 4D44A 2LTAA 1C9MA 2QTCA 3EWIA 4WKBA 2YZGA 4TTTS 3RF7A 1ISMA 3PHCA 3BKWA 3ILYA 3CW8X 3L9XA 5AMXA 2ETXA 1BDBA 2ATVA 1BWQA 2F3TA 2X76A 3V6LA 1GSIA 1VMDA 2NTJA 3G88A 1KI2A 3HPQA 1O58A 5LC1A 2HEGA 4AB1A 1GTG1 1WZCA 3DVRX 1NVGA 4LYYA 4KRXA 4FFDA 2IZ0A 1F1BA 5LNK6 5BSFA 2DBRA 3WMGA 3HI4A 2XD9A 5FCDA 3K1TA 4RHEA 1E6MA 2PBFA 2ZTHA 4MKIA 5TS3A 3D4OA 5LA6A 4BGEA 3OZCA 2QMEA 3T7IA 1NQAO 1FQWA 1EWTA 1M54A 3I9V1 1NP7A 1Q84A 4G86A 3KLBA 1JI0A 2BI8A 3GN2A 4TVSA 2NAFA 2QRJA 1NYLA 1ZCBA 3ILSA 4YJHA 3JZAA 3MJDA 1V9CA 4D41A 4BFUA 1SCBA 1W34A 3CKYA 4US2R 4Y9TA 2GBPA 2Y4NA 3WGZA 4PXYA 3N8IA 4RE6A 2CLMB 3AF4A 3C3XA 3T0FA 3TQQA 1QBKC 4RU1A 3G2KA 1WG8A 2A59A 3ILHA 3VZSA 5I9BA 1VE6A 3V48A 3PFHA 3I2IA 2JJQA 3SOZA 2F67A 2ASEA 2Q49A 1SOAA 1BO6A 5L8VA 3AWIA 3GLGA 1I94B 1N2OA 4JEHA 5C3UA 1RAAA 1DBIA 1M8KA 4IDEA 4W5HA 4UEQA 3VX4A 4DGSA 3IP8A 5A04A 1L6RA 5KOHB 2IQ5A 3H5TA 2NNWB 1X14A 4I4TA 5CM9C 5HP4A 3CSSA 3ZVLA 1TVEA 2XIQA 5JJ5A 1AX9A 4G8CA 3QV2A 1HFJA 1T29A 2BH9A 1HDXA 3U4IA 3SF0A 3S6JA 2P67A 4BXOB 1YL5A 1W0JA 4CT4B 4C30A 2DGDA 1CJTC 1QXSA 3QKSA 3DVLA 3WNQA 4CMIA 3A04A 4YJ2A 3S2IA 1PG2A 3DR5A 2ACKA 3CX4A 4RHYA 4BMZA 2QAGC 1NBAA 1U02A 4OQMA 3HCDA 1JA9A 3OTWA 3UUEA 3IILA 4HXYA 3T06B 2IPMA 2K4MA 5C81A 3W6OA 4D0LB 3MT0A 4QTTB 2VHEA 3F4BA 2GN0A 4TV9F 1I3LA 2H1HA 1WZEA 1XXHB 2OUIA 3ZD6A 4RY9A 4UKDA 1P44A 2WJWA 4P3OA 4UU1A 1YONA 1TB4A 1OY1A 3BE8A 3AVPA 3LP6A 1ABFA 1Y3AA 1A8PA 3DKRA 3K1AA 3TSZA 4OHYA 4ERNA 3S29A 1S4QA 2ZAGA 4K40A 3RYFA 3ADCA 2ORYA 3H13A 4NCKA 2HWKA 1X1DA 2H2HA 4DSOA 1SZJG 5K3OA 5LP1A 4CCAA 1G17A 5CH5A 5JASA 2DFPA 1N6NA 4KWHA 5IM4A 3TL2A 4BE4A 1XGKA 4M0EA 5CEJA 3VM6A 3R09A 5CW1A 1T6YA 3DAYA 4ECAA 3R9KA 3H04A 5JC1A 1KL7A 4MWEA 1VCOA 1ZPDA 2YFYA 4PZEA 2AOTB 1Z4IA 2OCPA 4O4JA 5I7VA 2BEUB 1QRTA 1Z0DA 1L5WA 1LB1B 3DOEA 1JDUA 2VH5R 3CRVA 2QX9A 2JLYA 4HDOB 3MWDA 2E9SA 3RC3A 4JQYA 2NO0A 4TYYA 1NHWA 2ZTMA 4P1ZA 5C3MA 2WTMA 4WCFC 3TLMA 2B82A 3WDLA 5CDYA 2P2DA 5JS8A 3SSMA 5DOVA 2I22A 3ZVMA 5IFKA 3G0HA 2F59A 3LFTA 4AVYA 3UKOA 2XYPA 3IR5A 3DB2A 4IVQA 3ZWPA 4WW0A 1NF2A 2AI2A 2CF6A 3LQ4A 5CT5A 3IQHX 4YHHB 1FTQA 4RH1A 4B32A 4CM9D 2ZKLA 3L8DA 4OYYA 3P7MA 5DLYA 3CUVA 5K0BA 2RK3A 1T9HA 4BE9A 1O94A 3R4VA 4QX6A 3IIEA 3KVVA 4ZAXA 1O6GA 4BVLA 2V4UA 3QKRB 3WB9A 1NR5A 1QK3A 1BXGB 1HUQA 2A58A 2HF7A 2QLFA 3CZQA 3IE2A 5KNCA 3URKA 2XT0A 4AW9A 4BPRA 3MCTA 1A7AA 1ZRMA 2O2IA 2YJ3A 1U04A 4B82A 4V38A 1OB5A 1QO0D 4HLQB 3SQOA 3TCKA 4Q3AA 2FF7A 4G0OA 2BIFA 3F1KA 4E70A 1UDBA 3TNYA 1KJQA 3GJ8A 4MV3A 1JDZA 1YGPA 5HG0A 3U80A 1JHDA 1HE2A 5C35A 4AZ3B 4ANFA 4DRXA 3B1FA 3MS7A 3AF6A 2ZB2A 2RJOA 2OM6A 4ETIA 3H1TA 4S0ZA 1K6IA 2KHZA 1DAOA 3BULA 1T2EA 1DBQA 4GYYA 2XTJA 5LYJA 3VC3A 1WLSA 4LOIA 4RIGA 1L8QA 2P1ZA 2V97A 4BLVA 3AQIA 3JD3A 2HV9A 1OFUA 2GWHA 4POAA 2VP2A 1U7TA 3BK2A 2LCQA 3K09A 1GUZA 1T2UA 3RT7A 3QFCA 1UINA 2EERA 3FWHA 2KYRA 4UOEA 4UU8A 3TFQA 3HVRA 1XHEA 1QR6A 4KBFA 1ODLA 4U00A 4PFJA 2BSQA 5AI0A 4ZI7F 1DADA 2FVXA 2FPGA 1ZMOA 1GXSA 1QQBA 3MWEA 4OA8A 1YVEI 1V4NA 1LK0A 4KGDA 1F4PA 3RAPR 2XLBA 2C4VA 3HB0A 1V8OA 4DVJA 3C0KA 1IN4A 1NZDA 1UMKA 3HB1A 5LVAA 1WU8A 4BIMA 2Y9MB 4B44A 4W1PA 4PLYA 2YIJA 3QBJA 4BVJA 3TJZA 1OIVA 1PCXA 2VAWA 4F93B 2JAOA 3RC9A 1GAEO 4D02A 4ZTZB 5AOBA 1KEUA 1LDEA 1HWYA 2O1EA 1CZLA 2OK7A 2PJDA 2Q50A 1S1CA 2DQZA 1U8FO 2E1RA 3O8BA 1VP3A 4S1NA 2FDRA 3AHJA 1EHYA 3AW8A 2XGJA 2QY9A 2CXXA 5CFOA 4ZU6X 4IIYA 4KIFA 2EP5A 1ORVA 4RVSA 1M34E 3URMA 4ZYTA 1WBDA 3EIHA 1U8TA 4P0PB 5IF3A 4I3HA 4U7TB 1KKMA 1W5AA 3FNIA 4B0OA 2OY0A 4XSVA 2YIMA 4AUKA 1NMYA 4P86A 4IIGA 1TT5A 1XZBA 3HVIA 3FPEA 5DXFA 1XRSB 1I4EB 5F73A 3E5HA 4RUKA 3TPCA 4AP5A 5I7FA 3KTDA 1I5OA 2FEPA 2KJQA 3K0FA 4IDPA 5FKJA 3U9LA 3VO2A 3GRPA 3P9KA 4J0QA 1KSGA 1OVMA 2O3JA 2P3LA 5E6SB 1Y80A 4KE8A 5ICSA 1SC1A 2HTEA 2QPAA 1A8UA 3CIOA 1FSSA 3B2QA 3DBRB 1JWAB 3Q4GA 3QUCA 4B6OA 1WMDA 5EG5A 3EIEA 1E3TA 3RARA 3VTZA 2OQIA 2I71A 4A8TA 5DISB 4DMUB 2A14A 3QM1A 3F5FA 1SULA 4TV8B 3P32A 5DX8A 1C5KA 1WB4A 1XHFA 3FMFA 4QBKA 3RBXA 3UPUA 4YAJA 2FEWB 4ZTUB 3V8NA 2ZTLA 2BTOA 4K6GA 2R6CA 4BCCA 2JBHA 3KAPA 2WHPB 4HDCA 2LP4Y 4F9TA 1XXHE 4AS1A 1KYZA 2B25A 2OCLA 2OD2A 1EP1B 2Y4OA 4YONB 3R5FA 3TX6A 2OENG 1PJBA 1Z0UA 2ZWPA 1CEQA 3AJ9A 3J7AC 1KZYC 2C2MA 5A9SB 1BA3A 4BU0A 3H1PA 1XSEA 3IDAA 1J1IA 4KLZA 3EPPA 1P2SA 4M53A 1UP6A 3EVEA 3I64A 4QBFA 2PZJA 3FFWA 4XDGA 3VZCA 3TD9A 3QLUA 2Q2VA 1IEXA 2XUGA 1DRKA 1FUKA 1NR7A 2Q28A 1ZSVA 2R9VA 3QFFA 3AERB 1PR0A 2YHAA 4R01A 1P33A 5CT9A 4BBZA 4EO9A 2C2HA 2DCMA 4PAWA 1L4GA 3A4YA 4EUFA 2H48A 3RSHA 3KJEA 1J2EA 3NT2A 3E6AA 1O77A 1Y7TA 4FU0A 1JDNA 3S81A 2NP6A 4KI7A 3WIUA 1O6ZA 3STHA 1QWOA 2I9KA 1IXKA 4DJFC 3IHKA 1U3GA 4CEIB 2QNRA 4RXMA 3ML1A 4L4XA 2BTQB 4WMLA 2DSNA 3IUEA 1UK9A 3L7AA 1KAHA 2XQKA 3E48A 4KQ9A 3SEQA 3K6JA 2EYUA 3DEZA 1QV9A 4INPA 4M1SA 4YMUA 1XZPA 1JFLA 3CLVA 1LF5A 3OM8A 4HL6A 1AB6A 1UFOA 2OBXA 3SX2A 5DF1A 4E03A 4JX8A 5SY9A 1NN3A 3K9NA 2IEYA 1XD2A 3UT0A 5DBHX 1YQTA 3Q2OA 3LOPA 4NE2A 1WPXA 4RQBA 1DG9A 4EUSA 2JLCA 3HJHA 2YL2A 2GK4A 2WJAA 3NJRA 4J16C 3OJFA 4M76B 3JQ7B 3V7UA 4F1JA 3ICQB 2GEDA 4K6OA 3FHCB 2FPLA 1QX4A 2FDXA 4CEHA 5DLPA 5A71A 2I0FA 1U2ZA 4OU4A 3ZWOA 2W2MA 1CZNA 4X24A 3CEPB 2KB0A 3RW9A 5JOQA 1CG6A 1N3YA 1PR5A 5DCLA 5KTKA 2PH1A 2RKWA 1ZUD1 5AT1A 3KQVA 3FPJA 3KXDA 4GR4A 5JCOA 4QXQA 5FJJA 4X54A 1XLTA 3A3KA 4I0WB 1M8FA 3UHJA 1PW7A 3Q2KA 4D42A 1Z8NA 4ISBA 1PS9A 3SQWA 2JG3A 3QUAA 4XZ3A 5JXJA 3GGJA 5KSZA 4KPFC 4RNCA 2PZBA 1ADFA 2A6PA 1Q7BA 1R1DA 2DSTA 3LBHA 4M0LA 3VYUB 2Q0SA 3K9GA 3PUIA 5H82A 1G5TA 2GR9A 2YZ2A 1P0FA 5EKSA 1CZHA 3HMQA 4FT2A 4MO9A 4N4AA 3BIWA 2L82A 3ND9A 1PKXA 1W30A 3NBAA 1RM5A 2J1LA 4M1TA 5HQ3A 3RYCA 2DXIA 3ANXA 4KXXA 2R8YA 5EHXA 1FBTA 1VM6A 5KYUA 1SQ0A 2HMTA 4HO1X 1KBQA 1NSFA 4QSMA 2R11A 2Z4TA 5LB4A 3H5VA 5D00A 4QBIA 4O02B 4EFLA 4JT2A 1CQIB 2MSNA 1KTVA 4L4ZA 1R6XA 4GMHA 1EUYA 5JFTA 3NXSA 3JQ8B 3A1UA 5DRYA 4BO8A 5AD1A 1TEZA 1TQ6A 2JJ1A 3E1KA 1HF3A 4RLSA 4GOLD 1GRNA 3RABA 5JQWA 1C1HA 4HAWA 2PZFA 3KQHA 3VYVA 3SYMA 1LA2A 4LWOA 2H2WA 1YQXA 4ISCA 2NWQA 1N6PA 2J9GA 3OURA 2GZMA 2GZHA 4AN1A 1II8A 3OOSA 4U7HA 1AZLA 2C4KA 3K2BA 4RFSB 4R81A 1BS1A 4QGSA 4RZUA 1DFHA 4IGAA 4PZ9A 3KPUA 5KYVA 5BSEA 2YFQA 4DEVA 1M1YB 2CW5A 1UPUA 4EJSB 1Z34A 1D2AA 1MT3A 4BZQA 4BBAA 2O3UA 2C7GA 5F76A 3ZJUA 5FADA 4YRIA 3W2GA 1BA2A 4U2CA 3PDUA 2IBMA 1X38A 1SHJA 1NW9B 3QOWA 4IGFA 4K46A 3KYIB 2H5JA 2Z0MA 4EMBA 5TV2A 4MWBA 1XVAA 3E18A 4NBKA 3BHIA 4UTPA 4EY3A 1OX6A 1C3OA 3OKCA 2I4RA 4F4JA 4GSYA 2J31A 1W1UA 5MDHA 3I9JA 5B58C 1VLMA 1M2OA 2F4VB 1XZDA 1TFRA 4B81A 3IBSA 2DB3A 4H77A 4UASA 1R9MA 5IYZF 3B3QA 1ESNA 1CJUC 2JIRA 4GZ6A 2VJBA 4N5HX 2XOKD 3RWOA 1Q83A 1E6EA 2E4ZA 1A98A 1Z7EA 3IBFA 1U0LA 3OFSA 2O2SA 2HJHA 5DO9A 4BRWA 1PVOA 4HX9A 4NHEA 1AK2A 3PFGA 4RX1A 5HOQA 1WE2A 4RLFA 2HA2A 1G20B 4HVAA 1KKLA 2D7JA 5F1KA 3WLRA 5IT5A 1KU6A 3C5WP 2IYYA 5H0IA 4AU1A 3UHPA 5LIRA 4D99A 3GFGA 2PFGA 1ZK3A 4KWEA 1CR0A 5F7OA 4XQGA 2OCXA 1SHZA 4BZWA 1CUSA 3CZ4A 1U0BB 4Q18A 5AJVB 3OC0A 1NMEA 3BJZA 4ZMSA 4DA0A 2QUKA 3JSAA 1U0EA 4LOAA 2ID7A 5KYYA 3GRVA 5CH3A 6ADHA 2V0NA 4MR9A 5TC4A 2QYSA 1T2NA 2GN6A 3VC1A 2H11A 4UW9A 1JKXA 4HS9A 2PM8A 4F2PA 4RA9A 1BVYF 2R84A 4W6QA 1YB1A 2TMGA 3R0QA 3G5UA 3G9ZA 3OQIA 2CK3A 2HIAA 1ZOSA 3VSAA 1KDOA 1N9ZA 4YFVA 4B87A 5IFLA 1V1JA 2X0NA 1T3SA 2B5OA 1VE3A 2BFEB 1CR2A 3CWCA 3GRUA 3EW9A 3V7NA 1N6HA 3NHAA 4Q01A 3L0DA 4EB0A 1KYQA 4AUEA 3E9ZA 2TRSB 5CEEA 2O59A 1EUCB 3NXKA 4CF4A 1MD9A 5KCZA 3GGDA 3N1UA 4CN8A 2GM5A 1VJ0A 1RWNA 3OU7A 3IAS6 5LQDA 4QXPA 3OP1A 4IS2A 1RRFA 4I1SA 3KDPA 5K4HA 1YFJA 3I8OA 1EE1A 2JAPA 5M3BA 3WI7A 4BRZA 2P5SA 2CT8A 1WPGA 4IPTA 4MKXA 4B7UA 1Z7YA 3AIIA 3JD1A 4EW3A 1ZCZA 1KY4A 1MJHA 3OT5A 4RKQA 1FW8A 2WU1A 1GA6A 2DLCX 1N5MA 1JFFB 3AFGA 5F52A 4E2XA 4Z0NA 1E7QA 3RU9A 2ON6A 5CLQA 4RTSA 5B7PA 2C3OA 3IOEA 1JXQA 4JHXA 3D3WA 1MV5A 2DPXA 3C8UA 4TXLA 5EWLB 5C37A 3EDQA 1RC8A 4NDZA 4V0MA 1HE3A 3CH5A 1APBA 4CIWA 4B2PA 2H16A 1MPXA 4ER3A 3NEYA 5JSKA 5MFZA 4F4FA 1U11A 2W98A 1YVRA 3K96A 5DCYA 2Y05A 3W8RA 4LYAA 2WTUA 2R00C 4HKTA 2F64A 3L82B 2GEJA 2QMQA 1T1SA 3QITA 4KL8S 1UH5A 1MAHA 2QJOA 3HABA 4ZJZA 2ZIUB 2M6RA 1P1CA 3I6YA 4LJLA 4R8RA 1QK4A 3NC1C 3ED5A 2QA5A 4D56A 1RZUA 3DTNA 1VLJA 2R6GA 2C9CA 2FEOA 3LPAA 4KPUA 1KI6B 3GVPA 3EGOA 5EPUA 1ESCA 2CCJA 3NKFA 3L1HA 4Y30A 2AN9A 3C7TA 5AK3A 1SK9A 2Q4BA 3KPJA 3HLKA 1RJGA 3M4XA 1T9CA 4TLDA 5KTMA 4I1PA 4M8KA 1A5AB 4DNFA 2BM0A 3EY9A 3K5WA 3SD7A 1CFJA 1G291 1PLJA 2I65A 3OIWA 3QOXA 4L75A 3WYDA 2XZLA 1JDSA 1UC5B 2FEMA 3Q12A 4BNYA 1EDEA 2DBVO 2A0YA 3N2GA 3O47A 4UZFA 1U4SA 1UBUS 4Z3OA 4CDMA 1VQ1A 4ZRDA 1XZEA 3BBLA 4DW8A 3LU1A 2QTBA 3LT4A 3MA0A 1TYEB 1L7OA 2QV0A 3WGUA 3U56A 3ZTTA 3HA5A 4NWIA 2EFEB 4H3VA 1E2HA 721PA 4C20A 3TZKA 3EYAA 5L53A 5GIOE 1UUFA 3NATA 1YJCA 1KI7A 2CBZA 5FH9A 1PG0A 4F4CA 3N2EA 4B3IA 2PWAA 1FNMA 2JFPA 2VYNA 1T9GS 2AXQA 2VUHB 4PZYA 2QXYA 1PTKA 1NY5A 3I32A 2FUNB 3WLJA 3CBQA 4DIBA 3EPKA 1IM8A 3B6MA 3LI2A 2JHAA 4LPSA 1JQEA 2X2OA 1XTJA 4CLXA 3IBYA 2VP6A 4UHKA 3H9CA 2DFLA 2ZI9A 1G6OA 3EG9A 4KXMA 4OM8A 3DFZA 2NXNA 2ZSJA 5H1YA 2QBYB 4MZDA 1I13A 2H9AA 1QH8B 5CCDA 3Q0TA 2IKSA 3ZE1B 3D6NB 1QKJA 5ESXA 5TSDA 3WGQA 5BNFA 1YS2X 2FN4A 2G4LA 1IM5A 2XRYA 3CY6A 3G2HA 1D2MA 4TYMA 5L3RA 4QAQA 3SQMA 5K0ZA 3R3UA 3FI0A 1WF3A 4RVNA 1M1YE 4NOMA 4G1FA 4IIFA 4Z3DA 1W35A 1QP0A 1DMSA 4ZREA 1QOPB 4JKOA 4XI9A 1R0WA 4M0CA 5THXA 5FQOA 4E5VA 3PFBA 4I9GA 2CFOA 1NZFA 4UBNA 2B2CA 1U8AA 3PYXA 4FQ5A 4UXHA 1E5QA 1DXHA 2FOLA 4OGWA 1SA0A 4JKYA 5FUVA 1V16A 4ASUA 1D7OA 2EDAA 4XUCA 4CW7A 2HFKA 4JKIA 4ZEXA 3WIEA 2R8BA 1TF5A 3MGKA 1PS0A 3PUHA 4TWJA 4Y6QA 3QX3A 1I4OA 2Z8YA 4C7KA 4CE6A 3RK4A 4LXGA 2CZQA 3C3BA 4URHA 5KWIA 1GFIA 1HFKA 3BMCB 3EUAA 2I1QA 1X80A 3EMBA 3ACCA 4B3MB 4IRXA 3OJOA 4UBJA 4X20B 4V1CA 3DWGA 3ZBTA 3GZNA 3J7TA 4NVRA 5DP1A 4KR6A 4KPYA 3QLVC 4N6GA 1XQVA 4Q37A 2HBQA 2YJNA 1ECBA 2P5UA 1LLCA 3FVQA 1E7RA 3HJUA 3ZDFA 1VMIA 1MMFB 2NO7A 5C51B 4RSHA 2DWUA 2RJ3A 4BVEA 4GBJA 1Z33A 1X7ZB 3D0KA 3LVFO 5BUSA 4D9NA 1ZK0A 5IX8A 4JY7A 3HR4A 4EX7A 3JZIA 4P54A 1SIUA 3RSGA 1LGYA 3MAAC 3UHOA 4KRYA 3UUFA 3DE6X 3L6DA 1J9EA 4MVJD 4WLNA 5T6MA 1U9IC 1G3QA 4M3NA 3T4PA 1ONBA 1I2MA 4LY6A 3H65A 1CVIA 1FRQA 4MW2A 1A9OA 1QANA 3BL6A 3FHOA 1HZZC 3OT4A 1L4EA 2QMUA 5CYGA 4C0WA 3L84A 3EGWA 3IELA 4ATNA 4WZ6A 1F51E 3CC8A 2V7GA 2JAQA 3TQSA 4QG3A 3UTDA 5B36A 2EX4A 5SZHB 5EIXA 1A72A 4RD0A 5L95A 4DDKA 4AY4A 2OZPA 4WY5A 5MGNA 4AJNA 4TKVB 1CKEA 1ZYUA 4D57A 2AUNA 1E6CA 4TZKA 3S1SA 3G85A 3AEKA 5JAHA 2FSGA 2IXGA 3RF6A 1P31A 1XKTA 3BE4A 3SHWA 1P4GA 4P98A 1JZTA 2O8EA 4IYRA 2ZR9A 3WE7A 2XMBA 9ABPA 3FCXA 3JS5A 5JHGB 4FHFA 1ZX1A 2OZLB 5EIFA 3UAGA 3HU1A 3FF4A 2RK6A 4N12A 2MSEB 5IW8A 2QMYA 3PNOA 2RKBA 1XMIA 4CM8A 3D81A 1TK2A 2JD1A 1SXJD 1G21A 4KH0A 3AMVA 2HQBA 2Z57A 1IZ9A 1QAQA 2IF2A 3DAHA 3K1YA 4H3HB 4A0FA 4UUNA 1FXWF 3S7ZA 3B8EA 1GUDA 1CYDA 1DCKA 2P6NA 2HIGA 1OAKA 2C2ZA 2V6JA 2Z83A 3LS2A 3PR3A 4JZKA 1NOJA 3A05A 4LX0A 4ZI5A 3RKUA 4ZHQF 1B43A 4ZJYA 7GPBA 2QTGA 3I6QA 1HR0B 1PJ2A 2CLKB 1WCYA 2WWFA 2YX1A 4MPRA 2HHJA 5IDYA 3RVBA 5ILQA 1NTOA 1JB9A 3VPHA 5H7XA 4GMXA 3LW7A 1VCMA 2A9VA 3GMDA 3LIPA 1I14A 4GIBA 3VDRA 5JY6A 2C3YA 2GM9A 3WNZA 4AX8A 1KTIA 3L8FA 3PC3A 4IV5A 2KLBA 2GXAA 4XJVA 3IUSA 4NMHA 1SXGA 4BVHA 3EUEA 4DABA 3BAZA 3AUSA 3OHPA 2FQWA 1YBVA 2IXBA 3MRSA 2NU8B 2NT3A 2VPQA 3Q0EA 1NVWQ 3TW6A 3CWZA 2P8JA 1O89A 2ZRPA 2BI4A 4AJPA 3FR8A 3K8OE 4N8SA 2OG1A 3D6JA 1EXWA 2XBUA 1SXJB 3M4NA 1ZJYA 1YT5A 3C3PA 4P08A 2GLUA 5K3DA 3IVAA 5E3JA 4RZSA 4ZYVA 1X1BA 2PNFA 4YAGA 3CTMA 2PSJA 3I2GA 4TZTA 1L5GB 5HGXA 1DPFA 1N1MA 2J45A 2ZJ1A 3JTEA 2IPOA 3KSZO 4Y0NA 1EP2B 3LRTA 3P1JA 1SHTX 2XA1A 1ANKA 4XGRA 3DBLA 1RFGE 2AVDA 2GUGA 4H7EA 1P7PA 2AG1A 4HMOA 4NSNA 2C8LA 2HF2A 1GTJ1 3AXTA 1SUFA 4FGKA 5K7SA 3E22B 4KGXA 5KQSA 4REQB 4COKA 2X0DA 2F43A 1XZIA 1CWUA 1Q20A 1VL8A 4MV1A 4YGXB 1IQUA 3FPSA 1TIPA 4PZDA 1CRZA 3TAXA 3N6XA 3QNMA 4ZVMA 1GPBA 1JHQA 1OFVA 2XB4A 4D9FA 2C96A 2CSUA 3DPIA 1YB6A 4FYMA 3BWDD 4AIIA 1B93A 1N6KA 1XU7A 3FCAA 3UT5B 2CLIB 1URPA 2PQ2A 3AF3A 1W4CA 4J3JA 4NJEB 1YRLA 4W8HA 4JLMA 5K4AA 1XHLA 5E4YA 2W58A 5BWOA 3DBIA 1AE1A 4RY8A 1CT9A 1ODIA 3AX6A 3LA6A 3QEJA 1MU0A 4RLQA 4EMUA 4P33A 2JFZA 4L4RA 1KOLA 5INTA 1D3AA 2ZXUA 1Q2XA 4BPBA 4DB2A 3H2GA 5EUQB 4H7PA 3A9WA 1YU9A 3B1VA 4KO8A 3EEIA 4HBGA 1Z63A 4IJUA 4G4SP 1E2NA 3R1IA 5DWQA 3THYA 3WMEA 2W2TA 4BO9A 4HQKA 5CDGA 4ZZ0A 4Z4IA 2R2AA 2RAUA 3ZHQA 3EEBA 5CFQA 5BWLA 2PPLA 5IVIA 4E3WA 3CJQA 2O7SA 2FI1A 1IBSA 3LVBA 2ZBPA 4KPEC 1J07A 1H3FA 1VLLA 4XWYA 4C1BA 1NLZA 4LBVA 4G1MB 3NEJA 1YVUA 4ZMBA 5KC9A 1WETA 5BW5A 5CVCA 4O4HF 4EW1A 4K81B 3GA7A 1H2ZA 2C57A 2NMVA 1Y4SA 2RBGA 1HLFA 4EOGA 1L5HA 5JS7A 2GZSA 5CUQA 1I4LD 3D1VA 3I5MA 2X5NA 4WFIA 2WB2A 2E37A 3JWGA 4UVDA 3KJIA 4ACBA 4JL8A 3NTRA 4L76A 4PZ0A 5ICFA 3MOGA 3AFNA 4JJKA 1T0PA 2E4WA 2OHJA 1S89A 4BJ6A 4GI3A 2GBLC 4AY2A 3OWXA 1HDRA 2ILVA 2EBHX 4MEAA 4J1NA 4O2AB 5ES3A 5FOUA 3GJRA 1H8EA 4A8HA 1CUAA 1QX3A 3SYKA 4PGGA 1OWNA 1TVMA 1UCFA 3Q11A 4X7PA 5KVCA 1JQJC 1WXIA 5H02A 4AMVA 1YRWA 1UL1X 1R27A 2DKFA 2PGAA 2Y0PA 2C5EA 3EXHA 3I83A 2H2GA 4LE0A 8LDHA 5I7HA 3JYNA 4D3XA 5IXYA 1BJTA 4KUGA 4FDMA 4JBYA 2QHXA 4CIVA 1XXLA 4UZEA 2FG5A 1XMOB 2EJTA 5EVCA 3AY6A 3DLBA 1N2GA 5BVGA 2IDJA 1OGIA 2LE0A 3PKJA 1Y48E 4XR4A 1F0KA 1UZAA 2IUSA 4HBZA 3KWMA 2A0UA 4DV0B 3LYHA 2XYRA 2NYAA 1V1RA 1DAIA 3BRSA 4PRKA 3IAS1 621PA 4KXQA 4NRDA 2X2EA 1XU9A 2PGDA 3HDJA 2CXRA 2Q8QA 3PD0A 2XRMA 5E7QA 4JOCA 4D0GA 4BZXA 5BORA 4G8BA 3BH6A 3AEQA 1E89A 4AWAA 2JIDA 4PFKA 5JSZA 3ZDDA 2G6BA 3GXBA 7MHTA 4PWZA 2HWXA 2WJVA 2GCOB 4C6TA 2WBLC 1DAPA 1JT2A 4IMRA 3R3XA 2ZKIA 4NAHA 4LVUA 4TKLA 3TZQA 4K3VA 4CG1A 3L05A 1BEEA 3HY6A 2PRZA 1T0JB 5I7RA 3C3YA 5H16A 3N5CA 1X0VA 4D0NA 5ADUS 4DIOA 1G63A 2XGGA 5EAIA 4AWXA 2FFJA 2QDXA 1TADA 1ZJ4A 3KL4A 1L0BA 5P21A 3RTAA 1KZ6A 3U81A 1QNLA 4RIHA 4MVJE 1KBZA 5EMMA 2Q4DA 3X1KA 3LDUA 3CCFA 4LMBA 5JAZA 3RJ9A 3AUYA 1GNTA 3FJ1A 1X7YB 2C5GA 2MHCA 2ZUSA 1G18A 3CH6A 3JWIA 3WADA 1NRIA 3OOJA 3RRNA 3U1BA 4FX5A 2YFKA 3WMRA 4N7MA 5GJWC 1L7RA 1RMTA 3EA4A 4YRDA 4CLRA 3NMUF 1XYYA 2MOKA 4E13A 5JJIA 3PXAA 1KJWA 2AMLA 3R7NA 2YZKA 3MUNA 4DTCA 4EMTA 1ULZA 1EGAA 3Q3CA 2WMDA 3CXRA 3QMWA