2ZCUA

Crystal structure of a new type of nadph-dependent quinone oxidoreductase (qor2) from escherichia coli
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
283
structure length
275
Chain Sequence
b'MIAITGATGQLGHYVIESLMKTVPASQIVAIVRNPAKAQALAAQGITVRQADYGDEAALTSALQGVEKLLLISPQHRNVINAAKAAGVKFIAYTSLLHADTSPLGLADEHIETEKMLADSGIVYTLLRNGWYSENYLASAPAALEHGVFIGAAGDGKIASATRADYAAAAARVISEAGHEGKVYELAGDSAWTLTQLAAELTKQSGKQVTYQNLSEADFAAALKSVGLPDGLADMLADSDVGASKGGLFDDSKTLSKLIGHPTTTLAESVSHLFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized oxidoreductase ytfG
molecule tags Oxidoreductase
source organism Escherichia coli
publication title Crystal structure of a new type of NADPH-dependent quinone oxidoreductase (QOR2) from Escherichia coli
pubmed doi rcsb
total genus 95
structure length 275
sequence length 283
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2007-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2zcuA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2zcuA02
3TQHA 1PGOA 4D46A 3L9XA 4PLPA 1B8VA 2AEJA 4XQCA 1VRWA 4RQUA 1QRRA 3H5NA 4RF5A 1CERA 1I3KA 2AE1A 1PTJA 3F4BA 4BQPA 5A5EA 3TOZA 2AQHA 5L40A 4I1IA 2X4GA 1PS8A 5AXAA 1DAOA 2F1KA 4XRGA 2YFHA 1CQIA 1K5HA 4GMFA 5TX7A 1VM6A 5J23A 1ONPA 2ZCUA 1PGNA 4D44A 1LDEA 3RUEA 3WWZA 2W2LD 1I2BA 4PVCA 1XHLA 5DOVA 3GMSA 1OMOA 3BMOA 5DNAA 1FXSA 1KEVA 3I9OA 4E31A 1GYPA 5KKAA 1QP8A 3WFJA 3RFTA 3U3XA 4ZQGA 2JAHA 1B3BA 2DTXA 2D0IA 4YDRA 4QQRA 4XCVA 3PWSA 1T2FA 4FW8A 4TZTA 3U4HA 4GH5A 4PCVA 2XOXA 2A4KA 3H9EO 3ZW9A 5IDQA 1Q2XA 4KWHA 3ORFA 5CDSA 1GY8A 3D4PA 2BFOA 4R1SA 1B0AA 1BDMA 1D3AA 1XGKA 3VDQA 2NWQA 5DCYA 4YQZA 2EJVA 4R41A 3WYCA 4Z3KA 3JD3A 1EBFA 1V3TA 3AY6A 4AFNA 5A03A 4NI5A 8ADHA 4E5PA 6LDHA 4BGVA 3IS3A 2GRAA 3IOYA 1U28A 2VUTA 4N5NA 1QYDA 1EK6A 4WEOA 1PJ3A 4CJXA 4ND5A 1YOVA 1UAYA 3FTNA 3W8EA 4FQ8A 1W0CA 1D8AA 2P4HX 9LDBA 3WG9A 2W8ZA 1FMCA 2GF2A 1Z45A 3EC7A 4CLRA 3A28A 4GWGA 5TLSA 2WYUA 3VHRA 2HJRA 4CM6A 4JJGA 2WSBA 3PDUA 3P2YA 3BTVA 3CMCO 3DL2A 3GZNB 4B8ZA 1HZJA 1JKIA 2C82A 4FJ2A 4RVHA 2DBRA 2Q1UA 1HETA 3KLMX 3OQ1A 4YCAA 1NFRA 2BMAA 3KYCB 1P0FA 3SVTA 4BL5A 2C5EA 1OI7A 2QRKA 2X0IA 4J7UA 2EV9A 3GEDA 3WGOA 3OBBA 2FN7A 1HEUA 1NQ5A 3JYPA 9LDTA 3RJ5A 3K73O 1BMDA 3KO8A 2GGSA 2Y93A 3D4NA 4JN6B 3HDJA 4AJ1A 1U7TA 4U7WA 5LC1A 4IQ0A 1RM5A 3FR7A 3NAQA 5G0VA 4TKLA 5JO0A 3HHPA 3HDYA 3ANMA 4L75A 4IBOA 4BO9A 2Y1GA 4BGIA 4GX5A 1HTBA 1DJNA 4FD3A 2IXAA 3OIGA 2AHRA 2NU6A 4PZCA 5I7FA 1H5QA 4DREA 1XEAA 2PV7A 3KETA 1NM5A 4HWKA 2IYOA 4G2NA 2YDXA 3P2OA 5FYDA 4XIJA 4E4YA 2FZEA 1KVRA 1U5AA 1CIVA 5F3RA 4RO0A 4CLOB 2P9EA 1GV0A 2PZMA 3L4BA 4QEDA 1DOHA 1UH5A 2NUAA 4PLYA 2NVBA 4ESOA 3LLVA 3GGPA 1RJWA 3DMTC 3UUWA 4AL4A 1PJSA 2PGDA 3JQFC 4UVEA 3PDJA 2PWZA 2QG4A 1NQAO 2EHDA 3RKUA 3UHAA 1AUPA 1YB1A 3HUDA 3O8QB 3DOCA 3RUFA 1SEVA 1HLDA 1C1XB 4NHEA 4TROA 1T2DA 1ZUD1 2VQ3A 2Q2WA 2X9VA 1KS9A 1ZSYA 3E18A 2X0JA 4RL6A 4Z9XA 4QFDA 4BNMA 1Y1PA 5C7OO 2O3SA 3ZU5A 3VVBA 3AI1A 2CVZA 1OBFO 4ZRNA 4F3YA 3SEFA 1I3MA 2Q1SA 1F8GA 1XU9A 3TFQA 3ZW8A 5T67A 4IINA 2E4AA 3MJEA 4IJUA 4GX0A 5G4LA 4BMSA 4HX5A 5MGBA 1ZSNA 1ORRA 2O4UX 1ZW1A 1BXZA 1GU7A 3MWDB 4CLEA 1PJ2A 1MB4A 1ULUA 5KVVA 2YHIA 3EK2A 4BO4A 3CE6A 4E5YA 4Q3AA 5K6AC 1KVUA 4Y6RA 3UFXA 1R4MA 5JCJD 1HYEA 1E1LA 2VWHA 2GZ2A 5F21A 3K9QO 1YL5A 4I5EA 4RVFA 5B4UA 3U09A 5BT9A 1N8KA 2G82A 1TT5B 4OGWA 4XQGA 3WBFA 2HK9A 4XX0A 3MOGA 1ZKMA 3TF5A 3DBHA 3F6YA 4OYRA 3KRTA 1NXQA 1DEHA 3ZHXA 4A7PA 1LDNA 1VC2A 5T57A 2BGLA 3H65A 3GNQA 2O4CA 2P2SA 4XRRA 4XJSA 4RGBA 3E8XA 1BGVA 2WEKA 2A92A 4DQVA 2V7PA 3DWFA 3TN7A 1E1NA 1E3EA 3RIHA 2YDYA 3K31A 1GEGA 1PZEA 1OC2A 5JCXA 1RPNA 5L45A 2C07A 3KEQA 5LCXA 3PVZA 4DBVO 3C1AA 5EQDA 1VL0A 4LMRA 1U4OA 3RC2A 1RM3A 4I9UA 1HXHA 2H9IA 3LC1O 4N5MA 4TRJA 1E3IA 4E2ZA 5A9RA 4R9RA 3HDHA 2GCGA 3GGGA 4ALMA 4MJLA 1DRUA 2QZZA 3CPSA 3KSUA 3MTJA 3IC5A 5EPOA 4FB5A 2DBQA 4EDFA 3R3JA 3OICA 1HE5A 5C3MA 5IF3A 3JD2A 4IGEA 3WTCA 1QSGA 4UUPA 4BHTA 4OKNA 4GLOA 2G5CA 4MP3A 1C0IA 1K6IA 3QVXA 4E2WA 4I5GA 4TKMA 1L7EA 3JSAA 4B4WA 2I65A 5JPIA 1ENYA 1IHYA 3OJEA 2D3TA 1R0KA 1E77A 1Q0HA 4JLWA 5COQA 2JAPA 4NK4A 5L51A 5JMPA 5ADHA 3DZGA 4BIIA 1P33A 1VPDA 4YJHB 2EIHA 3SBOA 1E3LA 1NHWA 3O38A 4I5DA 4GLLA 1CRWG 4W6ZA 3GVXA 4UUOA 1ISJA 4CUJA 4ALLA 2DT5A 1AE1A 2J5RA 1P1FA 4PLWA 2UUOA 5CEFA 3K6JA 4XGKA 1EUZA 4AJ2A 3A4VA 2EKLA 5AXCA 5KJEA 2HU2A 1BDBA 1DFIA 3JYOA 3CINA 1GV1A 3GFGA 2VHZA 4J7XA 1IPEA 2PLAA 4DPLA 5JC1A 1GUZA 3EAGA 2BF7A 3DOOA 1NAHA 3JTMA 4KTTE 2GPTA 2J3KA 4P38A 4J49A 2JL1A 1U2DA 3NT5A 3BMOB 2ILTA 4MVJH 4BNHA 4DIBA 3B1FA 2EGGA 4MPDA 4A27A 3I9KA 5CPBA 5BNFA 4DYDA 4BMVA 2WTBA 1FJHA 3L0DA 3ZWOA 1NYTA 1ID1A 2PR2A 2HJSA 4BO1A 2YYYA 4IS3A 4G5HA 4BNZA 3K92A 3RI3A 3WSWA 2JD2A 3GK3A 2Q46A 2BFMA 5IDWA 4Z0HO 3RFXA 3ZWNA 3FN4A 3H4VA 5AXDA 5DF1A 5IXYA 2C7GA 4E30A 1JAYA 4BNUA 2OP0A 1Y81A 4XQEA 1ADBA 5L9AA 4L4SA 2IDZA 5F5LA 4E3ZA 1LDBA 1YOVB 3GN2A 3GG2A 3EHEA 3GG9A 4XJTA 4PG8A 4UUMA 1B8UA 2CF6A 2XF8A 2PKRA 4IDEA 4YAKA 4DC1A 1I01A 1R66A 1T24A 2NU9A 1V6AA 4CMHA 2AQKA 4CLRB 1H6CA 1LDYA 3I23A 2AEFA 4UVGA 3WNVA 4HFRA 4CMEC 1J0XO 1QORA 4OSPA 2GSDA 1QYCA 1XQ1A 1KYQA 1N5DA 4AJ4A 4NZ9A 1CF2O 3PHHA 3QV1A 2BI8A 2O3UA 3D7LA 3PTZA 5ENDA 1UR5A 2NQTA 5C7IO 5THKA 4RF4A 4Z9FA 2AW5A 5FF9A 3ITDA 3L6OO 3ASVA 3FI9A 3B20A 4IPTA 3U5TA 1UDBA 2R6JA 4YR9A 1E5QA 3PQEA 5EINA 1HSZA 2P4QA 4PFJA 2EGHA 3AOGA 4FGSA 3DZIA 3I83A 1R37A 4FFRA 5DCWA 3FBGA 2ZTVA 2Y68A 4LSMA 2G0TA 4YPOA 1SZJG 3DONA 3NRCA 2VRBA 4MKRA 4CLHA 3PQFA 3TJRA 5ILOA 1GQ2A 3RUHA 1QV7A 3GMDA 1GEEA 1E92A 2GN6A 1ULSA 5U4QA 3GLQA 4J16A 4PLZA 5BNTA 3E5MA 5IDYA 1A7AA 4U6SA 4DPKA 3TNLA 1EVYA 3PJDA 1DIGA 4OOFA 3DBHB 1PJBA 4QT0A 1U5CA 4BNVA 2FP4A 5CG1A 2ZJ1A 1GCUA 1QKIA 3CMMA 1I33A 4NU6A 5C5IA 2W2KA 1E3SA 2CSUA 3I4CA 4BNKA 4RDIA 1PQUA 1IY8A 4NBTA 2JHFA 5CAEA 5KIAA 4GX1A 1Q7GA 3K2EA 4UAGA 3QQPA 3JQ7B 1TVEA 2O3JA 1CDOA 1ENOA 3DBRA 4QXMA 3ITKA 4JK3A 4RPGA 1QMGA 3S2GA 1QLJA 2HMWA 5ITWA 5T64A 4B8WA 1YWGO 3PHGA 3ONEA 5L4LA 1D4FA 2B5WA 1A7KA 4CR6A 4ZJUA 5C7LO 3SJUA 5JNLA 3SXPA 4HFNA 8LDHA 1Q7CA 1O6ZA 1P9LA 3BZUA 3AM5A 2JHGA 3ANNA 1RKXA 3ZWMA 1HE2A 2OO5A 1LJ8A 2DBZA 2PTGA 3KHUA 2G17A 3U49A 1HT0A 4GGPA 3X2EA 1LLDA 5B1YA 1YQXA 4FFOA 4I5FA 4MIYA 3TDKA 1QR6A 2R00A 1NASA 3CTMA 1NR7A 2D59A 3F5SA 3FRJA 3ICPA 4GBJA 5I7VA 2Z1MA 4KQWA 5G0TA 4CLXA 2AQIA 1MG0A 1PL8A 3DR3A 1G0NA 1ZEMA 3ZWXA 1F8FA 4IUYA 4IGFA 2FR1A 4OSOA 1PR9A 1UDAA 2V6GA 3FNHA 3ONDA 3KZVA 4OL9A 1PS9A 1X1EA 3DTTA 4JBIA 1NBOA 2YV1A 3DZFA 5JY6A 4OXYA 5THQA 2JCYA 1E7YA 4M49A 2NV6A 2RCYA 5U1PA 4RF3A 3QWIA 2NM0A 4IZIA 1EQ2A 3LLSA 4WLUA 2OXIA 1QV6A 3C24A 1F17A 5AYVA 3RVDA 4B4VA 3JCZA 2B4RO 2EKPA 1PWXA 2HMTA 2RH8A 2VT2A 3JD4A 2X0NA 3MJCA 4L4XA 3WGZA 1PS0A 2PNFA 3O8QA 1E6WA 1EE9A 2VHXA 3JD0A 3KSZO 4Y98A 1J5PA 3KUXA 3MEQA 4LN1A 2H1SA 3Q9NA 3VKVA 3ZHYA 3ZNPA 3GNTA 3ZWWA 5JDIA 1DB3A 3ULKA 5L95A 4WPGA 3EY4A 3LYLA 2ZATA 3HWRA 1SB9A 1DIBA 3VH3A 1XIVA 1YJQA 4YT5A 1PGQA 4BNWA 4DQXA 1MA0A 1P3DA 2FPIA 1LC3A 3AI3A 5G4KB 4BNXA 4PVDA 3U4IA 5G0UA 1VJ1A 3V2HA 4IDCA 4B4OA 3H3JA 3RBVA 4CV1A 1EE2A 3GOHA 4ZHSA 2J6IA 2VHVA 4ZA2A 3D5TA 4J9UE 3G0OA 1S6YA 1PGPA 1Y5RA 5H81A 1WXDA 5BSFA 4QFCA 4CM5A 4GWKA 2Z95A 2TMGA 5EERA 1XYGA 3JQBA 3MJVA 4IDDA 3DBLB 1XELA 5DN9A 4LGVA 2X7HA 3PFFA 5I9NA 4W9NC 2QW8A 3AUTA 1ZK1A 5HRUA 2YJZA 2EW8A 1JLLA 3W4IA 2DPGA 3R3SA 4IXTA 1MP0A 4Z9YA 5L7TA 3D0OA 1AXGA 1LSUA 3A9WA 4UEJA 4J3FA 5I8ZA 1CWUA 3ICCA 4DLBA 1P45A 1ISFA 2IEBA 2O23A 2DAPA 3PRJA 3DMTA 1LNQA 3DZBA 4XEHA 1DJQA 2YZ7A 5DP1A 2BLLA 4NNJA 1UZLA 4KWIA 3QRWA 4J2OA 4FC7A 3ANLA 1T1RA 3ON5A 5CEEA 5JW6A 4K6FA 3W6UA 1YDWA 3OEYA 3LU1A 4OXNA 1PJ4A 3ADPA 4O5OA 1KVTA 1DBVO 3C7DB 3JYQA 2HRBA 3M2TA 1XLTA 5IZ4A 4NMHA 5JDCC 2ZQYA 3HG7A 4S1VA 2P5UA 4YAJA 2R2GA 2ZTLA 2EW2A 4D0RA 1DHRA 3Q2KA 4CMKA 2DUUA 3N7UA 1SEPA 4BNFA 4OAQA 3OIFA 3TOXA 3UOGA 4BO7A 4Q9NA 2NU8A 3VKUA 1X14A 4GSLA 1PR3A 2ZIZA 1KIFA 2Q2QA 4NR0A 1ZO8A 3V1YA 4YAIA 3HFGA 4WNIA 2C54A 4XR9A 4XYBA 4CV3A 2DPHA 1JU9A 1PGJA 5JAMA 3JQAB 2C29D 3LZ6A 5T6BA 4ZU3A 3EVNA 3DTYA 1RWBA 4YEDA 1ADFA 5A02A 2Y67A 3NDRA 4TRNA 1XG5A 4N18A 5EIOA 1J4AA 1HSOA 1WW8A 2Y1CA 1Y8QB 4DXHA 3EMKA 4PZDA 3RC1A 2VZ9A 2VRCA 1VSUA 3GZNA 3UW3A 3NDJA 3GZ4A 2EXXA 1WP4A 1EVZA 3QE3A 5FEUA 4KP7A 3WQQA 4OXKA 1ZK2A 2HMSA 3P5SA 1P0CA 5A06A 5LDGA 1H93A 4UVIA 4E2XA 1E7QA 4IQGA 4NBRA 1ZZEA 1HYHA 2I3GA 1U7HA 1SCUA 3MJ4A 3UN1A 3FR8A 3WYEA 3AJRA 1EDOA 3BTSA 1I10A 3OJOA 5FI3A 3KM0A 5BQFA 2CMDA 3WNQA 1EFKA 3ZV3A 1ENPA 5EMHA 1AN9A 4RDHA 3C85A 4RV9A 4W99A 4TWRA 2I3AA 1N2SA 2W4QA 4CQMD 3MWEB 3W1VA 4LK3A 1LRJA 2VYVA 4E2YA 4JXKA 4TRMA 1JVBA 5DBGA 3F1KA 3BHJA 1YGYA 1IHXA 1YKFA 3ZWAA 2VYND 2FOIA 2IZZA 5ILGA 1PJTA 1GUYA 4MVJI 3D5QA 3VTFA 4CM7A 3L4SO 2ZB8A 3KTDA 3KLPX 3ZDFA 3ZN2A 4DTIA 3ABIA 1E7SA 2IRWA 4I9NA 3WIDA 1UAGA 4CMIB 1N1GA 2ZTUA 1BXGB 1YH3A 1QLHA 3R0IA 5JE8A 3INGA 5A04A 4PLTA 4MVJE 4FFLA 4OM8A 4BNJA 3GRPA 4RVGA 1GTMA 4YRBA 1UJMA 2PGJA 5CPFA 2JFFA 4U0JA 4NIMA 1H0KA 3IIEA 4WE3A 3RD5A 3RFVA 2PGLA 2NTNA 1ISGA 3EW7A 3PK0A 2WMDA 3BMCB 4JP3A 3HQ4O 1BWSA 1C14A 1DC3A 5JDCA 3R6DA 4EUHA 5DT9A 1TI7A 3DOJA 5A9TA 1R4MB 4II2A 1EK5A 3JQ8B 3QVTA 2VZ0A 4PRKA 1EQUA 3FPCA 5TS3A 5KWEA 3KBOA 5JAQA 3VDRA 1H94A 3PLNA 4JX8A 2AEMA 2DFDA 2HMUA 4MVJD 2FZWA 2FY8A 3INRA 4IDBA 3WXBA 3H5AA 2D5AA 3E82A 4U0KA 2O7QA 1HDYA 2GZ1A 1AHHA 1ZK4A 4I9HA 3S1LA 4NG5A 3WJ7A 1GADO 1A27A 3ROMA 3B1JA 2WD7A 3ZWBA 1B15A 4NJMA 3WGHA 1LDGA 3HNPA 1XCBA 4BOYA 4BNTA 4ZD6A 4J4TA 3UICA 4BUCA 4FFMA 2H6EA 1DRWA 3GPIA 2GO1A 2NSDA 2YHIB 1EVIA 2D5CA 3RKRA 4K26A 4EI2A 5I7EA 2AE2A 2QRLA 1A9ZA 3H7AA 1ZVMA 3V8BA 3FSRA 1VLLA 3TZCA 1MG5A 5KCZA 5L4SA 1YJ8A 4LRTB 3OIDA 3QIVA 4PZEA 1O95A 4Y8VA 4HV4A 1NPDA 4OJNA 4XGNA 5TJHA 4H16A 3DZHA 3RC9A 3ETDA 3UCFA 2QHXA 1DFHA 1P74A 4UULA 3VPGA 4R68A 3VPSA 4ZGWA 2JJYA 3KSDO 3F3SA 4MVJG 3W4JA 3TFOA 3QWAA 1O5IA 3WSVA 1SNYA 5IFLA 2B83A 3IL2A 2Y99A 2C0CA 3NT4A 1E7WA 1YONA 1ISHA 2PD4A 4D42A 1KBZA 1D7OA 4BO3A 1D1SA 4B3IA 3RASA 1KY4A 4CM9A 4FDAA 1ZK3A 2CNBA 4CPDA 5KTKA 4F6CA 4HP8A 4NPCA 2FHSA 2A35A 4CM4B 1MXFA 1H9AA 2XPCA 3I9NA 5CDTA 3O4RA 2VNSA 4GKBA 3MJSA 1W4ZA 4BKOA 1M67A 3QVOA 3K8ZA 4PG7A 1Y9AA 2DUWA 1Z7EA 1LC0A 2O50A 1KVSA 1BVUA 3UAGA 4PLGA 4DVJA 1DAPA 3AY3A 3Q2IA 1FDTA 2Y1FA 1DIHA 2X9GA 4FJ1A 2NNLD 3OP4A 3K30A 2QYSA 3V1UA 1JN0A 3OH8A 1K3TA 2VZ8A 4A73A 1LX6A 2FSSA 1DRVA 4HNHA 2EKQA 2GZ3A 4NH4A 1GYQA 5F5NA 3I6QA 1HDCA 2HCTA 3K5PA 3WR5A 5HWSA 3A14A 4OKIA 4IJKA 3T4EA 3GVHA 3WWYA 4M8SA 4PG4A 2B4QA 4JQCA 1CETA 3N74A 3GRKA 4LMPA 4EW6A 1YBMA 3QLJA 4XR4A 3BIOA 3AFNA 3Q3CA 3JQ9C 4YJGB 1KC1A 1NTOA 4MVJM 5KOIA 2EJWA 5K6AA 5CP8A 3SX2A 2C2YA 2WDZA 4PG6A 3IKTA 3DEYX 4PG5A 4CL3A 4RVDA 3TL2A 2AXQA 3OMLA 4BB5A 3PHJA 2PA3A 4FOOA 1GYRA 2B4TO 3D3EA 1NWHA 2HLPA 1HRDA 4GPD1 1GL3A 2O48X 5L3ZA 2I9PA 4D3SA 4IDGA 4J2HA 4R5MA 2P91A 3FNEA 5EQFA 2IXBA 4CMCA 4DQUA 3HB5X 5HTOA 1C1XA 4FGWA 4RCVA 1YB5A 2VWGA 1EUDA 4ALIA 2QQ5A 1GDHA 3PJGA 4GI2A 4O6VA 4XYLA 4FC6A 4J1SA 5AOVA 4MIOA 1ISMA 3JQFA 2GR9A 5EESA 3ZZNA 4WASA 2FPPA 4E0BA 4XKJA 1MLDA 3LVFO 5IZCC 4IMPA 4L73A 2CVQA 2FSVA 2ZKLA 4ITUA 3L77A 2E82A 3ETGA 3L9WA 5KKCA 5BSGA 1UP6A 1ZBQA 4M87A 1I5RA 1U8FO 1X7DA 5TQVA 4BNYA 4IY1A 3L07A 1W73A 3EYWA 1YBAA 1YS4A 3OECA 4JCOA 1ZXBA 2I6TA 1YL6A 3S2FA 3L6EA 1VL6A 3S8MA 1IULA 4BKRA 4R4JA 1OFGA 4DL9A 3Q9UA 3DHEA 2QYTA 2UV8A 3DAGA 1EUCA 1O0SA 1U3UA 4NFYA 3ROKA 5IN4A 2NADA 2XXJA 1R12A 4IIUA 3WBBA 3ZWYA 2HDHA 5BSEA 5CDGA 1U4SA 4CM8B 3VPHA 3GH3A 5GZ1A 4BNGA 4BGUA 5JMWA 4NQZA 4BV8A 4ND1A 4D45A 5CG2A 2AG8A 2X58A 3H2ZA 4N5LA 5CHEA 1Z6ZA 1K2WA 1NVGA 4R16A 1E7MA 1YXMA 1X0XA 2ET6A 4U8GA 2Q2VA 1V3VA 1HYGA 4I08A 4WGGA 1HLPA 5MDHA 4A0SA 3H5RA 3T4XA 4WCDA 3FF4A 2YQ4A 3H9GA 3WLEA 2UDPA 2X8LA 3QHAA 3OSUA 2Q49A 1MGOA 1YE3A 4ALNA 4ALJA 3JQ7A 2V6BA 2V6MA 3PIDA 4CQMA 1PIWA 5IXSA 4EYEA 3FPLA 4CMGA 2FPGA 4W7HA 2GLXA 1B16A 2CFCA 3LQFA 2IZ1A 1BXGA 3TZKA 1Y9EA 2B0JA 3FBTA 3QVSA 1E3WB 1W8DA 1C3VA 2C5AA 1N9GA 1LA2A 1VSVA 3GVIA 2EERA 3LT0A 3QSGA 1ZK0A 5H82A 4CMEA 1SO8A 2VT3A 4KUHA 3WQRA 3BXXA 2X22A 2W2LA 4YQYA 5IJZA 1CEQA 3PJFA 4P4NA 3ZCXA 1P1JA 5FWNA 1BXKA 3GA0A 1PWZA 2E49A 3IMFA 4MVJF 1A71A 3ZWCA 3JV7A 2YUTA 3IJRA 5KJCA 3E9MA 3H9UA 4ZQHA 3GHYA 2WJPA 3Q6IA 3ZU4A 1QXSA 1B26A 4AJJA 2QIOA 1GAEO 3HN2A 4MIEA 4H3VA 5FFFA 2J5KA 4FPXA 3AW9A 3KOUA 3BTUA 4WJZA 1ZH8A 5COBA 1VJ0A 3DB2A 4NK5A 1E5LA 1JTVA 2Z1NA 2ZCVA 4JIGA 4XWYA 3TZQA 4CODB 3C8MA 1FDWA 3VC7A 3VH2A 1IE3A 4YT8A 3GVPA 1SOVA 2PKQP 4J4BA 2CY0A 1K0UA 2DC1A 4R1NA 2UUPA 1ZNQO 4OQYA 4BVAA 3OQ6A 3MZ0A 4CV2A 3PJEA 4WKGA 1NX6A 3FCOA 4R3WA 3RC7A 4BKQA 1WAMA 4G65A 2JCXA 3MJTA 4IDFA 4YXFA 3GY0A 2TMDA 3D4OA 1B3RA 2JCVA 4NBUA 1Z73A 3KB6A 5B4TA 1X1TA 2VN8A 4IJVA 3IDSA 4CQMB 1O8CA 3UKOA 2FR0A 3L4BC 5TGDA 4J91A 5U9CA 4WEQA 3DAPA 1IYZA 3LSYA 3RSHA 1NFFA 2FRDA 3JYNA 1NR1A 3CKYA 4QO8A 5A9SB 1E6EA 1DC4A 5JYEA 1WZEA 2I66A 1Q0LA 3F9IA 3PI7A 2B35A 4JROA 2HQ1A 3C3XA 3JQDA 3KV3O 2NVUB 4FIZA 1PEDA 1O89A 4K9DA 2VOJA 2HMVA 4EITA 3Q1LA 1A9YA 3FNGA 5CDYA 4PLHA 1QYWA 3OEWA 4MP6A 1H9BA 5DOZA 2C59A 2PH5A 4BO8A 1UUFA 5G4KA 3KVOA 2OFPA 3DDNA 4J7CA 3OA2A 5TT1A 4YT2A 4PGFA 1KEUA 1UXGA 2OUIA 4GGOA 3DMYA 1R16A 4YAEA 2Y1OA 1RYEA 4TRRA 2B37A 1V3UA 2HO5A 2Q4BA 3GUCA 2QZ9A 3RROA 4B7XA 2Y1EA 5HBRA 1HL3A 4K1LA 3I6IA 1PQPA 5JFOA 3GHHA 2BKAA 4CM3A 4Y6SA 2X5JO 3NTQA 2GN4A 1JQBA 4OMUA 4B7CA 1PJCA 3BMNA 1HWYA 1XQ6A 2Q4EA 3ZNNA 2JKVA 1GUFA 3OETA 3WX0A 3AOEA 3AU9A 4FS3A 3WDSA 1WVGA 2JFHA 4AJHA 1UDCA 2X1HA 1FK8A 1E1KA 1Q7BA 3H9QA 2BD0A 4M86A 3DQPA 3I1JA 3CIFA 4NFHA 3PP8A 4O1MA 3WS7A 4J1QA 1UXKA 3WMWA 4F6LA 2RIRA 3CUKA 3EGOA 3PGXA 1K6XA 3JQAA 1F0YA 2Y1DA 1VE9A 3GGOA 3HDQA 5JCJA 2VHWA 3GN1A 2ZYAA 1XU7A 2SCUA 1CQJA 1N9GB 3U4DA 3DBRB 4BNIA 3MOIA 4D43A 4GMGA 2ZB7A 1Y8QA 1R6DA 4M1QA 2XAAA 4IMRA 1LDMA 1FDVA 4M54A 4WOKA 3AUUA 4WLFA 2BELA 5EL0A 3ADOA 3O03A 4KMSA 1Y8RB 3S2EA 2FMUA 2D8AA 3HADA 2E37A 2ZK7A 1HE4A 1M6WA 3JQ6A 4X54A 2YV3A 3AUSA 3ONFA 1XWFA 2HAEA 4DBZA 1P1KA 4HNGA 2P5YA 3W8DA 4YWJA 4GVLA 4ZQBA 5ITVA 1F12A 1LSJA 3DHNA 4FFPA 1SB8A 3G17A 4R54A 5CDUA 1TXGA 3KYDB 2E48A 3T7EA 3UGKA 4N7RA 4D3FA 2X0RA 4TMFA 3IP1A 2DLDA 4EZBA 1MXHA 4KOAA 3ZV5A 4ZQFA 1LEHA 4AJLA 1GQYA 3OJ0A 4ID9A 3WYBA 4A03A 2OGUA 3H2SA 1LSOA 2Q50A 3CZRA 4RORA 3AWDA 5ICSA 1WDLA 1M2WA 1YVEI 1MV8A 4NDNE 3E9NA 3PYMA 3VH4A 1PQWA 2C20A 1X7HA 1ARZA 1NVTA 1U8XX 2ZTMA 4WECA 4CM8A 2NACA 4H15A 1Q1NA 4GAEA 4LRSB 1UZNA 4ILKA 3PYLA 3WQSB 4B3HA 3PIIA 1GQQA 2RAFA 3NEPX 3IQDB 2P9CA 1RM0A 1X0VA 2Y0CA 3JQGB 4KUEA 4YVFA 1LI4A 4KDFA 5F1PA 1SOWA 4B4UA 4DLAA 4Z6KA 1G0OA 3C1TA 2YHUA 4GX2A 4XZ3A 3INTA 5A05A 1HDXA 1TA4A 3OHSX 1ZJZA 3HB4X 3EZLA 2GERA 4LSWA 5B37A 1GZ6A 2CF5A 5TIIA 4EJMA 3D64A 3OA0A 4XYGA 3EZYA 1I0ZA 2OP1A 3WGQA 2OORA 1IL0A 3VZPA 3RBXA 3S2IA 4LCEA 3SC6A 4RPHA 5C37A 1NQOA 2NVWA 2ZJ0A 2V6FA 1EZ4A 4UREA 3RU7A 4CMIA 3B6ZA 1NFQA 2ZB3A 5IG2A 3NGXA 3PGJA 3QJ5A 1K89A 5EJ2A 3SJ7A 1HDGO 2PZJA 4E5MA 4R1TA 2CUKA 3Q0EA 1TT7A 1E0DA 4L76A 4ALKA 5H83A 1XR3A 1LSSA 5TT0A 3PZRA 2PH3A 2NLOA 2WD7B 3GEMA 1OZAA 2Z5LA 1JW9B 1TT5A 1DHTA 1SC6A 3BMCA 2PZLA 1GCOA 2X5KO 2VRCD 4BGEA 2WM3A 1LRLA 3ETEA 4FFNA 4BNLA 4EJ0A 1A4IA 5ENVA 2VHYA 3NV9A 5DULA 3IAHA 3E48A 1CJCA 5JO9A 1IPFA 1NQTA 2HK7A 2GN9A 4WCFB 1GFSA 1X7GA 2EWMA 4BNNA 1T2EA 3R1IA 1J49A 2DTEA 3RUAA 2POQX 2Y05A 4R69A 2NU7A 1KEWA 4IIVA 2B69A 1LXCA 3I9MA 2YFQA 4C7JA 2GDZA 3ZNOA 1C0KA 3QWHA 4BV9A 3WGIA 1FDSA 4YJFA 2O7SA 4CMBA 1DXYA 1I2CA 3COSA 1R4NA 4DYVA 3DFUA 3JQGA 4J6FA 2O3QA 4E13A 1P1RA 4L74A 1V0JA 1NPTO 3HFSA 3M6IA 2A94A 1E3WA 4FJ0A 4OIMA 1O9BA 1ZXLA 1ZIDA 2BGMA 1NPYA 4XB2A 1ZCJA 2HSDA 1M6HA 1E6UA 1UXIA 3I9LA 2HKIA 3DZKA 5G2OA 3P7MA 1ISIA 3W4KA 4YRAA 2GNAA 3WIEA 4EEXA 3AI2A 5HS4A 2NTJA 4JJIA 3QWBA 5JLAA 5KVCA 3GDFA 1ZSVA 4HFMA 4HUJA 4QECA 3F5QA 4MINA 4Q3EA 4WCFC 4DLLA 4WK6A 4AJOA 4ND3A 1R0SA 3V2UA 4PLVA 3RUCA 2RH4A 4RF2A 4YAGA 3K2BA 3AOEC 5DDIP 5DZSA 4FSHA 2CDCA 3PWKA 3WMXA 4AJKA 2YQ5A 3FTPA 2J3HA 4W82A 3NJ4A 4XIYA 2OL4A 3BTOA 3IUPA 1BVRA 3STHA 3PYXA 3LF2A 2Q3EA 3PWZA 2OOSA 2GASA 1Z75A 1LRKA 3IKVA 4AJEA 4HADA 1Y5MA 1ZEJA 1BSVA 1EFLA 1LUAA 5FI5A 4YJGA 2PKQO 2RBEA 3A06A 3RCBA 2IZ0A 4WLEA 2X86A 2BFPA 4OO3A 4E5KA 4O59O 3NT2A 4D0SA 3ST7A 2EF1A 1YRLA 4P8RA 4U5QA 3NTOA 3BA1A 1EMDA 3OF2A 3KYBA 4JBGA 4AJIA 2B36A 4RLHA 4HFJA 4QTZA 3ZV6A 4EUEA 2I5PO 3DFZA 4MVJP 1VL8A 4PN3A 4EBFA 1DSSG 3GF4A 1F14A 4E21A 3F1LA 5I9MA 3IP3A 1GD1O 4FBGA 1HF3A 3UH1A 4JP2A 1PJLA 2IODA 5JDIC 4XYEA 4UEOA 3UXYA 3QP9A 3I52A 1A72A 2H63A 1T2AA 1G1AA 2OBYA 2O2SA 2W90A 2C2XA 1ONNA 4GVXA 1X15A 4BB6A 5JXWA 2VOEA 1IOLA 1BRMA 2HUNA 1OC4A 3RJ9A 4A5OA 1LLUA 3AM3A 4IZHA 4RJTA 3AY7A 3BMQB 3E03A 4LW8A 4XGIA 4L8VA 3I4FA 3DO5A 4IDAA 4Q3NA 4BS9A 4O63O 1NHGA 4E33A 4ND2A 4RQTA 4E5NA 4DGSA 2F00A 2VYNA 2W98A 5T5QA 5JSFA 2VTEA 3VZSA 4DIOA 2X6TA 1BW9B 4NBVA 5KJ1A 5GZ3A 4MKZA 4CUZA 4WNCA 2GUGA 2UAGA 3BMNB 4LVUA 1ENZA 1BTOA 4LCJA 2PD6A 1ZMTA 4KQXA 4GKVA 1M66A 1UP4A 4LISA 1H6AA 4L4RA 2PZKA 4RVSA 2R00C 4XB1A 3DBVO 3PXXA 1VKOA 2DFVA 3B1KA 1LTHR 2I67A 3C7AA 1LQTA 1N92A 1DIAA 1XA0A 3KYDA 3L6DA 4WCFA 4P4GA 5A1TA 1N7HA 5JY1A 1Z7BA 1PL7A 2YW9A 4S3MA 2AQ8A 3G1TA 3KYCA 3PHIA 3MCVA 2WD8A 3NKLA 3JQEA 1E7RA 4PIVA 1NVMB 4AJNA 5B4VA 4ROSA 1KEPA 2BGKA 4JGBA 3NTRA 3VAZA 3JYLA 3QA9A 4YACA 1UXHA 1PZHA 5IAAA 1PJQA 4QUKA 2JD1A 4J90A 1FDUA 1R0LA 5A3VA 2GYYA 2Q1TA 1J6UA 1KVQA 4ZQEA 4M55A 4KZPA 4K6CA 1AGNA 1PU2A 3HN7A 3V1TC 4D41A 1LLCA 3S55A 2BHLA 1GPDG 3PZBA 3V5NA 3WGYA 1P1HA 4W7IA 3TL3A 3ZU2A 1GZ4A 3EDMA 2CDAA 4URFA 1KY5A 3W6ZA 3OJFA 1F06A 1NP3A 3GFBA 4TVOA 3FNFA 5EN4A 1B7GO 5JC8A 1WMAA 3OM9A 2X5OA 3RU9A 3VH1A 4IXWA 1GZ3A 4F46A 1KC3A 3JQCA 4B7UA 2IEDA 2X23A 4PRLA 3D1LA 3WB9A 5A3JA 5A5FA 1ML3A 1SAYA 1JVSA 4DMLA 4CR8A 5KJ6A 4XDYA 2WWRA 4OOEA 1XDWA 5JYDA 5KNLA 1HDRA 2DM6A 2FR8A 4YB8A 2OHXA 3VPXA 4CQLB 7MDHA 1GPJA 4J1TA 2QRJA 2QX7A 1IUKA 5I8WA 1LBEA 4QX6A 1YDEA 3BHIA 1D1TA 2BRUA 1DLIA 4M89A 3U62A 1TB4A 5AXBA 1L7DA 4MDHA 1KERA 3GC6A 4ONEA 2CDBA 1T25A 1HDOA 4E6PA 4ZVVA 2AG5A 3F47A 4MOWA 2EG9A 3G79A 3GDOA 3AK4A 2DTDA 4RPKA 1EDZA 1JKJA 4TVBA 5HA5A 4B79A 1B8PA 3VTZA 1LLQA 1I30A 1VJTA 2Y0EA 4Y67A 1EBUA 4EUFA 1P1IA 1A5ZA 2G1UA 3LC7O 1JWAB 3VOSA 5T8KC 1T26A 3WGGA 3RUDA 1I3LA 1M75A 3ZWPA 3TZ6A 4J0EA 3GUYA 1LQUA 1Z74A 3I5MA 5JBIA 1B14A 4II3A 1QYVA 2V65A 5B12A 5KVSA 1RYDA 1ADCA 3I9JA 4IQ8A 5ES3A 1T1SA 4BQRA 5F1OA 1HKUA 4YBZA 4DMMA 5TNXA 2BI7A 2EEZA 4PLFA 1BG6A 2JFGA 1I36A 1VI2A 3E9QA 2IE0A 3NGLA 4Y6PA 1PSDA 4J1NA 4BKUA 1DC6A 1SPXA 2CVOA 2E6UX 2PY6A 4U6QA 1DLJA 3HJAA 4WLNA 4EGFA 5IDXA 1HE3A 4DWVA 2Q45A 1R15A 3WFIA 3QY9A 4L0QA 1PZFA 2LDBA 2NVUA 3NYWA 1JA9A 1EEHA 4DC0A 3O26A 1WDKA 2IYPA 1BHSA 3ROQA 2DQ4A 2J8ZA 4GSKA 4CUKA 3B70A 1Y7TA 4NJOA 1YO6A 3DC2A 1TLTA 1S7CA 2VWQA 3PEFA 4P22A 4CQLA 5HM8A 1GR0A 3ZGYA 4YJHA 2AA3A 3TRIA 4DPMA 1MFZA 3QW2A 2RHRA 4MP8A 4F45A 2Y0DA 3VPFA 2GD1O 2CZCA 4YJDA 5GY7A 4DA9A 1KOLA 4UVDA 4C7KA 3FWNA 1CYDA 3LDHA 3LT2A 4Q3BA 1SBYA 4ZICA 1U3TA 4KTVE 3ZV4A 3FHLA 1Z82A 3ZHZA 3AU8A 3ZNQA 1WMBA 2J3IA 4CMAA 2WE8A 5ER9A 3E5RA 2VUSA 2XXBA 3ROPA 3WTBA 1ADGA 4XYMA 4MO2A 4R01A 5CFZA 3I3OA 4D3DA 3CEAA 1VKNA 7ADHA 3DAFA 1FF9A 4RZHA 2O3TA 3UCEA 5JAIA 1XKQA 3WLFA 3E1KA 3RWBA 4R3NA 3G3EA 2D4AA 2ZYGA 2P9GA 1ONOA 5COAA 3RQSA 4G81A 3DZJA 4J9VA 3NX4A 1WPQA 1U3VA 3GVCA 3CSDA 3QVWA 3JQ9A 4GQAA 3T7CA 1WLYA 4DIFA 1I8TA 3V2GA 3ENKA 1WZIA 4YA6A 4KDEA 1P77A 1A4UA 4QSMA 3GT0A 3UF0A 2BFAA 4H7PA 5LDHA 3F46A 3O9ZA 2Q99A 3PLRA 1AHIA 1K6JA 2VWPA 3ZHBA 4R5HA 2ZB4A 4KUGA 2PK3A 5KVQA 1H6DA 1N7GA 4UUNA 3NJ8A 4JJFA 1U1IA 1P44A 3RAJA 4YT4A 1U2GA 2B5VA 4Y9DA 4CR7A 4A2CA 3NUGA 1DO8A 4FR5A 4RVUA 1OAAA 2O2YA 2BH9A 1H2HA 2YV2A 3ZI0A 1MC4A 2W2KB 3U4CA 5ER6A 4IM7A 3EUWA 4NU5A 3H6KA 3LT1A 3LT4A 2J5QA 4C4OA 1Y6JA 1WDMA 5L4NA 1DDOA 2P68A 4YTEA 3LF1A 3G1UA 1I2ZA 4JBHA 1Y8RA 5I7SA 4R9SA 2UYYA 3VZQA 4AICA 2ZQZA 2JD0A 4J0FA 2WE7A 2VUUA 2LDXA 4FN4A 3FWZA 3ZWVA 1AXEA 1TEHA 4CM1A 2EP7A 4R51A 4W9NA 3QWFA 3BMQA 3PPIA 3CZMA 1E1MA 1EVJA 1MFPA 4OHUA 1LU9A 1DFGA 2Q1WA 3E6AA 2DVMA 2O3RA 3TSCA 5K9ZA 4Z3DA 4D79A 5AVOA 1YB4A 1H2BA 2NTVA 3CXRA 4L9RA 4AVYA 4Q3DA 4WLOA 4J4HA 4ZN6A 3LC2O 1BW9A 1IB6A 5T8KA 1C1DA 3AUAA 3WOHA 5BSHA 4WUVA 3JQAD 5L53A 1XSEA 3DXFA 3GAZA 4BO2A 1ZJYA 1V9LA 1U9JA 1WWKA 1UZMA 3AM4A 3BYZA 3W8FA 3JQ8A 1IZ0A 4DRYA 5BNIA 4AJPA 5GZ6A 4CL8A 3EVTA 1W6UA 3H9JA 3VVCA 1MUUA 3H8VA 4FOSA 1DC5A 1HDZA 4CMJA 1E3JA 1DPGA 1HZZA 3SLGA 2I99A 3C7CB 3WJAA 2YY7A 3OFSA 4CM9D 5DBFA 3GQVA 3TPCA 4QO7A 4A26A 5JAZA 4IJWA 3ZH2A 2DU8A 4INAA 4XD2A 2OZPA 2G76A 4TZKA 4I8XA 4OQZA 1MC5A 4W4TA 4YRDA 2VTDA 4HBGA 3KXDA 5F1KA 2C7VA 1T2CA 4CLOA 1I24A 5TRTA 3OQBA 4PLCA 4WLVA 5TF4A 5DP2A 1T4DA 5ICMA 2RHCA 2X9NA 4ZRMA 1PL6A 2OMEA 3ZU3A 1JWBB 3M1AA 4A10A 2VNAA 4Q3CA 2VCYA 3SC4A 1V35A 5TSDA 3SLKA 4UVHA 1C0PA 2AMFA 3MTGA 3ASUA 2PD3A 4B3JA 1UXJA 2PFGA 1Q0QA 1QG6A 4NFSA 3HSKA 3G49A 4E32A 4XDZA 4NBWA 4LVCA 4JNKA 1MX3A 4TQGA 3NDIA 4ND4A 2VYVD 3UVEA 4MKXA 2NQ8A 4K28A 4BO0A 4YYZA 3KEOA 1YQGA 1N1EA 3PQDA 1JKFA 2FWMX 1C1DB 3VZRA 1WNTA 3C1OA 3GDGA 3F4LA 3TWOA 4J43A 4O0LA 2WYWA 3X2FA 5TC4A 4CM4A 3JD1A 4Q39A 5AQ1A 1V8BA 4D7AA 1O94A 4CV0A 4BMNA 1P31A 4P4LA 5JS6A 3D3WA 1C0LA 4NJMB 5HS6A 5DBIA 5BR7A 3WICA 1UP7A 3UCXA 1X13A 5DCUA 3PFWO 4RPJA 2I76A 5TJ9A 4IS2A 3N58A 1R4NB 3D3WB 4HXYA 4YJFB 1SMKA 5A4DA 1IZ9A 4HY3A 4RLSA 3H3FA 2J3JA 3CH6A 2Y66A 1G6KA 4GL4A 5K0ZA 2HRZA 3IUSA 3P19A 3HE3A 3U0BA 1ZFNA 4UEKA 2EP5A 1NAIA 3OJLA 2WYVA 3HZZA 2DKNA 4RPLA 1M76A 1NWCA 4TSKA 1PZGA 1DIRA 4BO5A 4MVJA 4AG3A 4Z0TA 3GNSA 6ADHA 1OOEA 1ZMOA 3GR6A 3M2PA 1I3NA 3RBZA 2GN8A 3A1NA 3M1LA 5IN5A 4BO6A 1U3WA 5L7WA 5KJFA 4R1UA 4BKPA 3WGTA 1RM4A 3GPDG 3BHMA 4HKTA 4N54A 4EJ6A 1B2LA 4CLDA 1YQDA 3AFMA 4FCCA 1L1FA 2DBVO 5L7YA 1T4BA 4XA8A 3RUIA 1H6BA 3DBLA 2HK8A 3GEGA 2CD9A 3PHLA 3LK7A 1KETA 1YL7A 2ZYDA 4OH1A 4RZIA 5G0SA 5A9SA 4Z0PA 2D1YA 3Q11A 5G0WA 4XQ9A 1JAXA 2UVDA 4E12A 4WOJA 5CEJA 1YBVA 1QYXA 1I32A 1PX0A 3JQBC 3GAFA 3K96A 5GMOA 2A9FA 5IZCA 3IJPA 5I9LA 4DUPA 3FD8A 3ENNA 3TZHA 4EEZA 2D2IA 3U9LA 1NNUA 2H5LA 1JDJA 3DHYA 2OBNA 3BAZA
chains in the Genus database with same CATH superfamily
2GHIA 2BSQA 1PGOA 1OVGA 4K2HA 1RADA 1Z2AA 3KR9A 1Y82A 2AEJA 4PLPA 1M34A 4XQCA 4BLWA 3C98A 1BHJA 1FVFA 1QP4A 1YI0A 1KO7A 1PTJA 3PUWA 2IDKA 1GGMA 3TOZA 4BYGA 4FQ5A 2C9BA 4I1IA 2C88A 4NULA 1JB9A 4TS9A 3U44B 1T9GR 2ZRFA 3EGXB 2N9UA 4TV9F 5BSRA 3VKGA 1CQIA 2ZT5A 4GMFA 1FX0B 2FP3A 3IESA 1ONPA 1WS6A 3TW0A 3IQGX 4RX1A 3UEOA 1CUDA 5BW8A 1LDEA 1ISPA 4OFBA 4L8FA 2DF8A 4N3NA 3SYKA 4D0LB 1P4AA 1UBFA 1J8QA 2R47A 2HDOA 2Q8NA 2W6MA 2ZSUA 4IIXA 5CVCA 1DL5A 1OMOA 3BMOA 3HCAA 3LA8A 5HIAA 3AJAA 5A0VA 2OHIA 3I9OA 3IVCA 1US8B 2HF7A 3L7AA 4JWKA 2EKZA 2QN1A 5ALWA 2F1JA 2AG6A 4XTCS 2GCPA 4OUDB 1B3BA 3F78A 1XX6A 2Z04A 4MRVA 2QSYA 3H11A 3N53A 1ZJWA 1QO7A 4QQRA 3PWSA 1OIXA 1T2FA 2H4XA 3UA4A 1WTCA 3CNNA 4PCVA 3MPOA 3N2LA 5IDQA 4UDXX 3ORFA 2PXAA 5JVDB 1GY8A 2QXUA 1RSZA 5ALKA 2HNBA 1D3AA 1XGKA 2LVBA 5BUQA 2EJVA 2FRDC 1W29A 3DL4A 4IWYA 2OHGA 4RZ3A 3EC1A 3OE4A 4FP9A 4NI5A 5GONA 1K6MA 6LDHA 3N07A 2GHTA 4N5NA 1SD1A 1RQNA 2OQ2A 4REOA 1PYOA 1UM8A 4AX4A 1MEEA 4CJXA 1CQJB 1X3SA 3KR2A 1YS1X 4RZQA 2A84A 3IPYA 4C30A 1P5JA 3X43A 2Q27A 1RRCA 1VSQA 1FFWA 3AV0B 4EWLA 5JSKA 4UOQA 1I5OA 1Z88A 4RSHA 1WL8A 6Q21A 1TF7A 4ZMRA 4EL5A 2I2AA 3L84A 4KG7A 4N1AA 3K4HA 1TZMA 3AF5A 3AEQA 2FMIA 5BV1A 3VHRA 1YAHA 4MICA 1OUMA 1XJCA 3K9NA 3U9SA 1Y89A 1RQ2A 4LYDA 3WC4A 3TKAA 1AQYA 1NLZA 4WNAA 4QWMA 3GZNB 1NYQA 2KSQA 2YASA 1BA3A 1NUQA 4KJXA 3TE7A 3AZPA 5GM2A 1AJEA 1EE1A 2BOVA 1Z4KA 2W71A 2DBRA 3NTUA 1HETA 2AH5A 4YCAA 3DDHA 1NFRA 1E79A 1RYZA 1RZRA 1J0DA 4BL5A 3LL7A 1U02A 2A5JA 2X0IA 4M46A 2KYRA 3C97A 3WGOA 3M4NA 3H75A 5ALHA 4CKYA 2ZPTX 1NQ5A 1T8TA 2FW9A 3QUTA 3EF3A 4N47A 3TGPA 1UBNA 3I9V1 1ZUIA 4BWGA 2I71A 2XUIA 4NV0A 3KO8A 3MQFA 3DDUA 1DV2A 2EJTA 2Y93A 3DV2A 1ND5A 5AWFC 3I2IA 5C8YB 1YKGA 3ZOKA 3FR7A 1X7ZB 4Q3OA 1WV1A 2JGJA 3TAXA 2YVUA 4TKLA 4MVCA 4HWOA 4KGDA 2QK4A 4G5OA 5D1NA 2O8FA 2DWPA 3AMVA 1QB7A 3EN0A 1JIJA 2QD5A 3HYLA 5CJJA 2YN4A 4JP5A 4PZCA 2AHRA 2NU6A 4M1WA 2H1RA 5FBZA 5JQGB 2DHRA 2PV7A 2OBFA 4JC4A 2H54A 2JBAB 1NM5A 3OURA 2GTPA 4HJRA 1XMIA 1QIEA 3L0BA 3LIPA 2VJCA 4XIJA 3SU8A 4E4YA 1U5AA 4Q47A 1CIVA 1NRIA 2RKBA 1ECGA 1KJWA 4RO0A 5F3RA 4CLOB 1VMEA 5I4BA 2P9EA 2CMGA 1E66A 1FNCA 4ZEXA 4KU4A 2G25A 2X3UA 2REXB 1DOHA 2WVHA 2NUAA 2QNBA 3AESA 3IUYA 3P8ZA 4PLYA 1KO8A 5EKUA 4ILEA 3JQRA 4EA6A 4EHAA 4L72A 1G3QA 3EA4A 3GGPA 3LBFA 4WACA 1XZBA 2LPMA 2C9CA 3N8KA 4CYMA 2QG4A 2MTBA 1P0PA 1RRGA 2IBMA 3N6XA 4HRAA 1TAUA 3RKUA 1AUPA 1YB1A 2YNMA 5B7PA 2HIMA 1SEVA 3RSZA 4BGPA 2IV7A 1NVFA 2BTOA 2Q6OA 3EGDA 1IXKA 1ZUD1 2BT4A 5FOQA 1K6EA 3QK7A 1I7QB 4JI7B 4O4HA 4QFDA 4HATA 3AFIA 3PQ7A 3IMEA 1KDVA 5A62A 3ZU5A 3MAJA 4YCSA 1P29A 3L7IA 4E7OA 1EVEA 4ZXFA 1DWOA 3ACCA 4F3YA 1O5OA 1G18A 1ZH2A 5FAXA 1I7LA 1T6BY 1ZONA 4RAQA 2QLBA 5AK5A 5LR6A 1MZPA 3K1YA 1K63A 1NOKA 1T3TA 2ZI9A 4JYBA 1G21A 4N0PA 5G4LA 3VSDA 3ZKWA 4BMSA 3MWDB 3N6RA 1HFWA 2AFHE 3ZE7A 4CLEA 5AICA 4GRAA 1ZHFA 3DVLA 3D3NA 2HQRA 5AKIA 3LW7A 1QE0A 4WOBA 2YX1A 3K0SA 3FHJA 4Y6RA 3RVKA 5JCJD 1HYEA 2XNDD 4IVQA 3DOEA 1HA3A 4K3UA 2A59A 3K9QO 1RAIA 3OPMA 4F9FA 3JRXA 4F4CA 2R25B 1JTFA 5JWOA 2D7JA 2QVLA 3ZZUA 1LV7A 1QQTA 3G9XA 1OA0A 1VG0B 3LNTA 4B33A 4KPYA 4Q3LA 3I5YA 1U0BB 3DBHA 4I50B 3TAHA 4BQNA 1NXQA 4O5AA 1QH1B 1TEZA 3ZHXA 1VC2A 2PRKA 3E3MA 3QVMA 4LWPA 4MA5A 2O4CA 4G0QA 5CVUA 1E2GA 4QOJA 3K5HA 4DSZA 2GMWA 1GJRA 1AGYA 1QFMA 3WHLA 3TRHA 5H3CA 4FEGA 2WEKA 3ADKA 2A92A 4DQVA 1QFZA 3DWFA 4BVEA 2PKCA 3DWIA 3LHDA 2JFPA 5LJLA 2Z09A 1JG7A 3NIBA 5ALDA 5GQSA 1QRTA 2QGZA 2GM9A 3BJEA 1OTXA 1T0JB 1TF5A 1T5DX 1X1CA 4TLBA 3WZLA 3IYLW 1Y3IA 2YIJA 4S1OA 5JCXA 3VJMA 1RPNA 1Z3CA 2WSSD 3HJFA 1WV0A 1N2GA 5CGZA 4UMFA 1ZD3A 1TEVA 2I7XA 2F55A 1V47A 5EQDA 2XZOA 4QYIA 4LMRA 3W5BA 3OQOA 1LPPA 1SBQA 4Z2AA 3AVPA 3E70C 4KQ2A 3AVQA 4YCCA 1HXHA 1W2HA 3LC1O 4AKGA 2X8JA 2B94A 4HSEA 1GKLA 2HDNB 3I8XA 3HDHA 2GCGA 1FVXA 3FWYA 2FPIB 2ONYA 4R9RA 4GLBA 3SJCA 1DNPA 1GVHA 2QZZA 3CPSA 4IF4A 1AQNA 4LZLA 2V0CA 2ZS7A 1BEZA 1QVRA 4F9EA 5KX5F 1ZIOA 4QG3A 4EYGA 2ZI5A 3OICA 1AUVA 3D8TA 3OWXA 2IP4A 3HMKA 4LE0A 2QPLA 3EXHC 1JPNA 4IMJB 4CHTA 1KSHA 4UUPA 4BHTA 1NLYA 3DGFC 3LLMA 1K1EA 4O2LA 4NC9A 3MAAC 3PNSA 4AX8A 3M33A 1T0UA 3HY3A 4EKYA 4C5CA 1U7PA 5JPDA 4MP3A 2F64A 1K6IA 3QVXA 4OJMX 5BV7A 2BDTA 5JECA 2DB3A 5JJKA 1U7OA 2CXXA 4L0MA 3OU2A 1PLLA 2I65A 1ENYA 5JPIA 1IHYA 1PYDA 4KE7A 5CCBA 4BXOA 1J0EA 3HNRA 4NK4A 1J1ZA 1GIAA 1U8AA 5L51A 5M7EA 2LWIA 3AFOA 4Q4HB 3R23A 4TM7A 5HG0A 3S99A 2HRQA 1E3LA 2IYNA 1WETA 3HK2A 3KEMA 1NUHA 3OT1A 4GLLA 4POAA 1P7YA 1CRWG 4KR0A 3NBQA 1TPYA 1XZIA 1KFBB 3JX9A 4Y2PA 5HXAA 4ALLA 3MCAA 2BWJA 2GPNA 5EE0A 1X42A 4GPIB 4W9MC 1FSPA 2CUZA 4MUBA 4PC6A 4PLWA 4YUYA 4FM9A 3RSCA 1Z12A 5TY0A 3K6JA 4HT3B 4NG4A 1W94A 3ABRB 1D2RA 2ZVPX 1AKWA 3LO5A 4O2AA 1BE8A 4QBHA 3I2GA 3MUFA 5KJEA 3ZLVA 2HU2A 2C9DA 1DFIA 1SUAA 1RFLA 1R0CA 2KS6A 3EODA 1X80A 4QT4A 2ZUEA 1BN6A 2OV4A 3NM4A 2F3RA 1JEEA 2LV8A 2R2AA 2VHZA 4J7XA 4PAMA 1IPEA 5JC1A 4NEGA 3ZTWA 4BN0A 4C0KA 1WXHA 2BF7A 1EWQA 3TKLA 3JTMA 1MB3A 4KTTE 4LI0A 3BXHA 4P38A 4QBGB 5KTSA 1U2DA 1Z56C 2ILTA 4N01A 3GFSA 4BNHA 3HLKA 1FYWA 4JLKA 1R10A 3V33A 5CPBA 5BNFA 3D6UA 3TCNA 2IPLA 2AJCA 4TWBA 2A5YB 1FJHA 4M99A 4QYMA 3L0DA 1ZM9A 4Y0NA 1J09A 2IOFK 3PFNA 3HLTA 1VJ5A 2I4OA 3ZJVA 2DETA 1NBWB 1XRNA 3NETA 4S1NA 3R8CA 3TQCA 4KN8A 2O2IA 1ZN2A 2FSHA 2MR5A 2HJSA 1T0PA 2PR2A 1F2UB 1ONBA 2YYYA 4GPTA 4JYMA 3SPXA 4LF6B 4JR1A 4G5HA 1V5FA 2SHKA 3K92A 3GGDA 2BGUA 4MMXB 4TL7A 3RI3A 2OFWA 3NKFA 4CF3A 2AJBA 4A9AA 4Z0HO 1BS1A 3QHPA 3EJWA 4WUTA 4EUNA 1SBZA 4HYTA 4DARA 1OT3A 1NNEA 4WCVA 4E30A 1JAYA 2ZFUA 4WDQA 3W5HA 4XQEA 3DULA 1OBVA 2Q5QA 3IE2A 4HB2A 4QOHA 1IUOA 5L9AA 3BL5A 4RTKA 4E3ZA 1GARA 3GN2A 2AUMA 3EHEA 1QOPB 2BKLA 3O3NB 1OXVA 5IKPA 2XVMA 1WF6A 2PKRA 4YAKA 5K3OA 1ZUNA 1R00A 1T2NA 2HJWA 3FSGA 1R66A 3A58B 2NU9A 1V6AA 3FZQA 4ZARA 1Z0ZA 4YMIA 4AKIA 4CLRB 3G0DA 5AVWA 3N8HA 3CLRD 3A1CA 3G2LA 3BCSA 4MI3A 2NZXA 3SZLA 4D4GA 4EABA 1XQ1A 2QTFA 3SZUA 2PCLA 1N5DA 1NF3A 2ORYA 2FCRA 5D3ZA 4MS3B 4R1PA 3PHHA 1IQUA 1U31A 2CLKB 2DUJA 3F74A 3N3AC 4PGMA 4ATNA 2VZEA 5CFRA 2PUBA 3IAFA 1M6EX 4H77A 3THSA 4Z9FA 2QSUA 3C45A 1AHPA 5FF9A 4L78A 4BGVA 3UKJA 4WSOA 5SICE 3B20A 4IPTA 3S2YA 4YUWA 4KCGA 5BP7A 2O59A 3OO1A 2R6JA 3EXFB 4YR9A 4TYNA 1IBMB 2RFLA 4CZ2A 1G2PA 1QV9A 1H2EA 2OLKA 4NOJA 3CYFA 2PXCA 1GPLA 4K5QA 3P9YA 1NRWA 3KQNA 4FR2A 2EGHA 2BGNA 2IH5A 3HYNA 3DZIA 4P1ZA 5A6VA 3WK8A 3JATB 1R37A 2PRYA 3U7GA 5DCWA 3VYTB 3FBGA 2BONA 2BGJA 5FUQA 4GM0A 3IT3A 4RABA 2IXFA 2VRBA 2WIKA 3PQFA 4PYLA 3NBAA 1GTJ1 1WUKS 2VXOA 2DYKA 4RM2A 1IBRA 1GEEA 3OKFA 5ECDA 1ULSA 1NYLA 3KT3A 3FE2A 2CBXA 1LLFA 1S96A 1V37A 1N2HA 2HC9A 4ARSA 4OMCA 4ZGGA 1O96A 3KE9A 1EVYA 1E4EB 2CXSA 3DBHB 4JMPA 3H7IA 2FP4A 2OCDA 4KVFA 4BFTA 1RZVA 3CMMA 1P5FA 3TGLA 3STVA 2CSUA 3LCMA 3PX2A 4BNKA 4RDIA 1WOMA 2R97A 4ARUA 5KIAA 4GX1A 1Q7GA 4KNYA 3K2EA 2FE4A 3QLTA 3CY6A 1XE3A 2VBFA 4YDSA 3KIPA 1TVEA 2PZFA 1CDOA 3BFPA 3KWLA 4RKYA 4JUCA 2QZPA 1N7IA 3DE4X 5GV7A 3TJMA 1M0WA 3K0EA 3IO3A 4MW6A 4M38A 1M10A 3T5PA 3TI9A 3VSBA 1FEZA 3SR4A 4MR7A 1WNFA 2R1UA 4JIMA 5T64A 1GWNA 2CXNA 3RAGA 4MB0A 4B8WA 3J81A 3GJXC 5A4FS 3D8UA 2IDJA 5KWSA 3A9TA 3A25A 3NP9A 1FFHA 1ZS9A 1A7KA 4G5GA 3OOYA 3SJUA 2EP8A 4MS3A 2P6OA 3ISJA 3SXPA 4DMFA 4ZOEA 2QD4A 3OZ7A 5BW5A 8LDHA 4AP5A 4UTRA 2YC2C 4BPBA 1U2ZA 3BWCA 1KH3A 3SX0A 1PEYA 1OYVA 4NCHA 3G2MA 3JVEA 2JHGA 4K9PA 1RKXA 1KYXA 3UUGA 2PTGA 2G17A 4QPDA 2VXBA 3X2EA 1A8SA 1UDRA 4FYPA 1KQ3A 1IN7A 2CNNA 1AKQA 1OXBB 1UMDB 4C4TA 821PA 2IS4A 2K7ZA 4O8CA 1L5YA 1O97D 4BJ1A 4B6QA 4LF5B 1GAWA 5H0IA 4EFDA 4O2BA 2ZSAA 1MG0A 1U0LA 3ONVA 1PL8A 3RVBA 4MV0A 1G0NA 1ZEMA 3ZWXA 1F1BA 3KT0A 4DMHA 4PAWA 2ZI4A 4IGFA 2LBPA 2A78A 5BMVA 1KZ1A 3DEAA 4ETWA 1TZCA 1MH1A 4HAZA 4OB6A 4DCMA 2YV1A 1WB5A 3DHVA 2YJTD 5T4HA 5IABA 3KD2A 1WKCA 4X8OA 4QNMA 1YRYE 4GPAA 2ATVA 2NV6A 2X8AA 3PBKA 2IQIA 1RLIA 1NXOA 3H1AA 3FPKA 3X2SA 1D8TA 2JZNA 3LHKA 1EFCA 1T6ZA 3MXOA 4RMGA 2C4UA 3R5TA 1RS0A 4C6SA 2RGCA 1JQ3A 4IXMA 2YOFA 3C24A 4KK3A 1RE0A 2Z6VA 4BJ5A 3JCZA 4MH0R 1KOFA 3IUMA 3T61A 4L4XA 2MCFA 3EWAA 1GAQA 4X6UA 1PS0A 1J90A 4LSZA 3UYLA 1JDUA 3S0JA 2JCBA 3KSZO 5EP2A 4MCAA 4XPIB 2W2XA 3K0CA 1PAUA 3OQJA 4KK4A 2VG8A 3D7NA 3T5BA 3EY4A 5M5BA 3HWRA 1I4LD 1SB9A 1U2RA 4FBMA 5J58A 5K7SA 1DIBA 3U4QA 3GFTA 5HCNA 1POXA 1PVOA 4HGQA 1PD1A 3AJ9A 5DW0A 4DQXA 5C2JB 1PR0A 1SRQA 3OEHA 2G1KA 3AI3A 3EVDA 2IU3A 3CZQA 1G7CA 2ON6A 3U4IA 2I4IA 1VJ1A 3KNZA 4LC9A 1DADA 5G0UA 4B4OA 3B2QA 4CV1A 2XADA 5K0GA 1ULZA 4PS0A 2J6IA 4NBSA 4UM9D 1WP9A 4JJEA 4J9UE 2OZVA 4EGAA 3FG9A 4OGLA 3ROTA 2ZJAA 4TXHA 2GXUA 4B17A 3N0WA 4Z86A 1W36B 3DEZA 1R7RA 2GVZC 3DNMA 3F0TA 3EZ7A 4GWKA 3T52A 1ZN9A 1OBOA 2TMGA 3BORA 4AKEA 1I0LA 1XELA 4RJKA 1FNNA 5CA1A 4TZ6A 2C03A 3E8SA 4F9TA 3E5NA 4Q4HA 3IIMA 3O8LA 2G5GX 2JZOA 1ZK1A 1Y4SA 3AHCA 5IH7A 3CT6A 2ZSFA 4K81B 4N6OA 3W4IA 3DMNA 2DPGA 2WB2A 3O73A 5AIBA 4MLDA 5FO1A 3LUGA 1OH5A 1RRVA 1ZNXA 3STYA 4QU5A 2NU9B 4UEJA 5I8ZA 2ZWPA 2M1XA 1CY8A 4ZXPA 4BCCA 2O23A 2IEBA 3B85A 3VU8A 1UL1X 2DAPA 4PINA 1TLFA 1XZDA 3DMTA 3CX7A 3O9VA 4JP8A 1IEVA 4AULA 1QH0A 3B6IA 5ICCA 5JNVA 3IUEA 5ABPA 4IDPA 3YASA 1ZIYA 1UZLA 3MFYA 3RVNA 4FC7A 1XTUA 1T1RA 3D6VA 3KJGA 1BRTA 3LU1A 2YZMA 1TFUA 4RHEA 5HVNA 1L3CA 4O5OA 5KYXA 2PZ8A 4OLFA 1OBHA 2A5GA 3WO0A 1U0NA 1DC8A 1DBQA 5IZ4A 3KKNA 3OWHA 5TMPA 2ZBPA 2Z2YA 3QUSA 4YAJA 3KEFA 1U99A 2R86A 1FX0A 3HU2A 4XJXA 4D0RA 1ONSA 2O8CB 2R7NA 2EKBA 1L5WA 2AG1A 2CCKA 2NU8A 1X14A 1Z0IA 5D6NA 2IQ5A 1UC8A 3IEKA 2GVNA 4FGLA 5B53A 4YUZA 1G8GA 1V7PC 3SDSA 2PBFA 3ROXA 3DPUA 3ZE9A 5HQTA 1RXVA 4KMRA 2DPHA 4FZ3A 5HILA 3DE5X 2WR8A 4LHEA 4LV5B 5KYVA 3JQAB 5HK9A 2P2GA 4KXXA 3LQQA 3WL4A 4RCZA 5FBHA 3ERCA 4DNFA 2Y67A 3NDRA 4Y9TA 3WJ1A 3OZIA 4RW0A 2I6QA 1J4AA 5D3MB 2VHJA 5JRZA 2Y1CA 3GGCA 2AOXA 1D2MA 1QGUB 3MUEA 4DXHA 1BHQ1 3BXZA 4H1HA 1VSUA 1EFTA 2HEGA 5CTJA 4OHKA 5LQUA 1G2OA 1NLMA 2B6HA 3VHQA 2YS6A 2FW7A 4INZA 4RMIA 1VHLA 2FG5A 3QE3A 2VJLA 3T34A 4I1SA 5GJWC 1KDZA 4DBLE 4B73A 1NW7A 3KTAB 4DZZA 5HF9A 2VJMA 3W05A 1OILA 5FR1A 3ZZMA 4I46A 3L4JA 2FN8A 2AMJA 4Y1RB 1X1RA 2B2NA 2EF0A 4UVIA 5THXA 4QSHA 4RBNA 5KKNB 1ZZEA 3IQXA 5KYYA 1HYHA 1U7HA 2IZ5A 3MJ4A 4IJMA 3R7BA 3UN1A 4C0LA 1CD5A 2G9ZA 1OZGA 4AZ3A 4K9RA 1I10A 3B13B 3N76A 4U6NA 2ERCA 1GGHA 1GPUA 1KDRA 3ND5A 3WXMA 2WWYA 2A6PA 4RS3A 2XOKD 2IKSA 4Q21A 4WK2B 1JYSA 3LNCA 4H08A 1ENPA 3ESRA 1AN9A 2Q7OE 4JEIA 4KXUA 3DDSA 2WJAA 2A33A 1GP2A 2NU6B 1K4KA 3I01M 4RDHA 4TWRA 2ZI7A 3RYHA 5CFPA 2H16A 2WNIA 3W1VA 3QXSA 2VYVA 2VPZA 2E87A 4G01B 1VGRA 4TRMA 1JVBA 3RG8A 4DYHA 3VVMA 1YGYA 1ORHA 1WCXA 1NMQA 2JGNA 3IDOA 2FG6C 4G4GA 4HLUC 3V7UA 2R6HA 2WINI 4ADSG 3BFJA 5JZMA 4KWEA 2FOIA 4RTPA 2CLLB 2H4ZA 2VBCA 2ZJ2A 4DCNA 1Q0RA 3O83A 1T9HA 5CFQA 3D5QA 4Q93A 3W5UA 3G8CA 1YKSA 2G4VA 5TMBA 1FP6A 1Z13A 3KTDA 1IG0A 2Q3FA 4KIFA 1WB6A 4HAXA 2G5TA 3DJFA 3BPSA 1IXRC 3ZN2A 3CB4A 4JI5B 4CWAA 4MHOA 4O3FA 1NBMA 2OZLB 3FBWA 3EPPA 4JB3A 1E2JA 2UVPA 1NW4A 1AS2A 1P5RA 2OC4A 2ZTUA 3MWLA 4E4RA 3I5UA 1BXGB 4EVQA 1NZDA 2RSLA 2YV5A 3R0XA 4MGKR 5IJ9B 3RC3A 1PKEA 4U2GA 5DGTA 3P52A 2FKNA 2VJYA 3KHTA 5EZQA 4BNJA 5I51A 1FTWA 1UJMA 1JF8A 1GL9B 2PGJA 2XGMA 3F6CA 4U0JA 4XX1A 4OF4A 1IEXA 1G16A 3F8WA 3IP8A 3IIEA 1G21B 3NCTA 4MWZA 4WZZA 3RIXA 3WRYC 4D9BA 1ABFA 3K0HA 4JP3A 1XTIA 2Y0BA 1GG5A 2VO1A 3T1YB 1BWSA 1DC3A 3W3AH 3NAGA 4PYJA 1GPAA 1E5XA 4LGYA 5HIJA 3I1YA 4L02A 5AW3A 1UT8A 2D5LA 1H94A 4PZ0A 1N5IA 1KAGA 2AEMA 4PU0A 3UBMA 1E2EA 2CLDX 1Y9DA 2D5AA 1LVHA 3E82A 4U0KA 1WR8A 2PYIA 2WMOB 3LD9A 4RK4A 1HDYA 4XM1A 2GZ1A 1ZAYA 1ZK4A 2VBIA 4G8DA 3VO1A 3ROMA 3WJ7A 3B1JA 3H99A 1K7XB 3H3XA 3MWYW 4OXQA 4FKZA 4LC1A 5CHYA 1MAWA 3RTCA 1NBME 5FB3A 1P62B 1DDGA 4BUCA 4GE3A 4FFMA 1JPJA 1M2OA 3OLWA 1D1PA 4I4TB 1XWWA 2C5HA 3TAUA 1R2QA 3UT6A 1M6NA 4DILA 4DZTA 1ZW6A 1NW5A 3HXLA 4HN2A 2BM8A 2GJ4A 2YHIB 3ZY5A 1ZY2A 2QTMA 2D5CA 3GUZA 3X1WA 4PX2A 1OASA 3CTPA 5FNVA 3NMUF 5IT5A 2R84A 2HHHB 4IUCS 4XWAA 2O6HA 1NF8A 1ZVMA 3TNFA 1VLLA 1G3RA 3TZCA 1QQ6A 5IM4A 2O2JA 1H2ZA 1GZHB 4OIFA 4TM8A 1S1MA 2JGRA 1C3OA 1IK6A 1YS6A 2IWHA 1I7DA 1NPDA 4X24A 4KB5A 4LWQA 4OHOA 5TJHA 3VNSA 4DA7A 3ETDA 3FTQA 1MQSA 2A1UB 2PKEA 2P6UA 2QHXA 5KREA 4UULA 3VPGA 2D4HA 2J4DA 2ZRPA 1T6XA 2JJYA 4MVJG 3TFOA 3T7JA 1Z2PX 4UQPA 1GUDA 1H2WA 3JASA 1HNXB 1WMFA 2P11A 3RTDA 1QX3A 2MSLA 3KQPA 3RJZA 4ZVUA 1NJ2A 2B83A 5C8VA 4EI7A 3IL2A 2QL5A 1Q21A 3L0ZA 2C0CA 4EPRA 2XX3A 3L04A 2PO5A 4UU0A 4BBAA 5KHOC 4TX1A 1RQPA 1T6NA 2IHNA 3CXUA 2PD4A 5FKJA 1GG9A 3ZVKA 2GPJA 3VC2A 4B3IA 1KY4A 1ST3A 1OFUA 3K32A 4KYUA 3ETLA 5HBGA 5REQB 1ZVJA 2CV0A 3NDBB 1X1BA 1KOGA 3CN7A 4XWTA 4YONB 4AZTA 2CDRA 1ST2A 1U8CB 4R6WA 2WD9A 3IBSA 1QGAA 5CT6A 4OI2A 1O57A 2QE6A 3O4RA 3HCDA 1M7BA 1K75A 3NP7A 2GEVA 5CVJA 4YXWD 4EF4A 5KNDH 1MAVA 1OZFA 3NH6A 3KT6A 2ILVA 5A5DA 2HGSA 3AVXA 2HCBA 2P2LA 5BR4A 5MN5A 1Y9AA 1IIBA 5B2EA 3AVWA 2V7QA 1RI5A 1FCJA 1KVSA 4V02A 1R5BA 2DG2A 4PLGA 4UEWA 4DVJA 1EHCA 1E1CA 1G5TA 3K7EA 2PU5A 1U65A 3AY3A 4GXTA 5HQ3B 1VPLA 2D06A 2X9GA 4O3MA 4UARA 3K30A 4UKDA 4ZCLA 4A73A 5HF6A 1Y80A 2XB2A 2B3DA 2FSSA 2XLCA 3TIGA 4UTOA 2CHEA 1KPGA 1YR8A 1HDCA 5DI9A 3K5PA 2WWTA 5CLQA 3ZWDA 5HWSA 4KREA 3OCVA 1BVHA 3HI4A 4IJKA 3I04A 3ZVMA 3P9RA 4RQAA 4WFJA 2MR6A 2VJQA 3WRYA 2YXNA 1W36D 4KIGA 3GU3A 4ZO9A 4Z7OB 4UBLA 1D0IA 4LMPA 3UV3A 2GEFA 3O47A 2VEOA 2WTEA 1HQKA 2BEVA 4IV0A 3QLJA 3ZJ4A 3BIOA 3AFNA 2QP9X 4YJGB 2CNKA 3G7UA 2OYCA 1TCUA 2QTLA 4QUEA 4DSNA 1KC1A 1YI1A 2WP8J 4MVJM 1T1EA 5HJ2A 4LZNA 3AL2A 5K2OA 5LSAA 3NHPA 1NW3A 3NHYA 1SKYE 4OGGA 3KSMA 3SX2A 1JVNA 2C2YA 2PPVA 2REBA 1AV7A 3EXIB 4ZMSA 4YIHA 4RVDA 3RW9A 2IEYA 3TDNA 3S6JA 2ZVJA 4BB5A 2XUJA 1HNNA 4C05A 4FOOA 1X77A 5AESA 1CZUA 1D2CA 1O4VA 3V8RA 1QHHA 3DLIA 3I3SR 1K2VN 1HRDA 4XXHA 2VCEA 2A86A 2FK8A 2ZPUA 4IJQA 4RD4A 1S3IA 3GLIE 1VYHA 3EH2A 1N33B 2EQ5A 3DV0B 4ABYA 3V2IA 1Q3KA 2ZRGA 1XD8A 1KMCA 3FNEA 3KAKA 3N9IA 4PPNA 4UCQA 3VVLA 2QGNA 4J29A 4W5JA 3HB5X 1YVDA 1C1XA 2W4MA 1RWKA 2ZU6A 3KOXA 1YB5A 2VWGA 4RCVA 1EUDA 4CG3A 4EJFA 3W3ZB 1OR8A 3E27A 4QGGA 4L07A 1G8AA 3KYJB 3KB1A 4LGCA 1Z18A 5EI5A 3ZCTA 4XYLA 3GPLA 3K9GA 3FKQA 4I4CA 1MRSA 4NH0A 4RD3A 2IYZA 1WPRA 3KQQA 3Q72A 4EAAA 3EWIA 1WXXA 5EESA 4WASA 4QOSA 3WMFA 1DKMA 2FPPA 4E0BA 4WHMA 5D87A 3LA6A 2OD9A 2NNWB 3LVFO 1G5IA 3AHFA 5IZCC 1ZH4A 2GBGA 5IAOA 3Q40A 1G8YA 3REQA 4UDYX 3CVUA 3ZHQA 4QU0A 5HM6A 1BKSB 2Z4TA 1NXSA 1RJ9B 2JLXA 4N3AA 3TTVA 3VR1A 4BNYA 4QBFA 1IJBA 1FUYB 2YTZA 4PBRA 3EYWA 3OCJA 4YRPA 4EPXA 4ZOQI 5EJEA 4CEIB 1ZCBA 2TMKA 3QTBA 5LD2B 2YOHA 1QTIA 5DSTA 1YR2A 3L6EA 3IPLA 3S8MA 1IULA 3E7XA 1IWPB 5PNTA 3VTKA 2H2IA 2YXEA 5FNVB 2VQ6A 3DAGA 1SU4A 5EWJA 5FPTA 7GPBA 4E5DA 4F5WA 1EHIA 3G5LA 3WDMA 1ZITA 2YVLA 2NADA 2LR0A 2XXJA 4KQ6A 3WBBA 3BM5A 3SDBA 5FOUA 3UPUA 2HDHA 5BSEA 3U5ZB 3SBEA 1XTBA 3PXBA 3GH3A 5DBHX 5F2OA 1GNPA 5K0LA 5FBKA 4BGUA 4BV8A 1PG2A 3N3BC 1VYTA 1C3OB 4D45A 3GLFE 1DZ3A 2AG8A 2WFZA 2IKQA 2X58A 3FSGD 3H2ZA 1K2WA 1L2TA 3PDIA 4KIWA 5B6PA 5CRIA 1R3UA 2KLHA 2XXAB 2D2VA 1XTJA 4KAJA 3JR3A 2KBEA 2MYUA 4LBZA 1HYGA 1VKZA 4I08A 1R4AA 3RYFB 1M2OB 4WGGA 4DLPA 1XKLA 2B6NA 3EDQA 1BCRB 3MT7A 4K6HA 1A9PA 2UDPA 3TS1A 4QGFA 3PDIB 1MAHA 4ALNA 2YRXA 1OIVA 2FEAA 4AUMA 4YCLA 4DJTA 4HCJA 2V6MA 4AXBA 3BWEA 3PIDA 2J6BA 4DDWA 1KO5A 2Y4NA 4X3CA 1PIWA 1U9YA 1JHPA 2HFKA 4YAFA 1A7UA 1L5KA 5AW6A 3HXKA 4GNRA 5CB8A 2YWFA 3C6QA 3A6KA 3ELBA 5ETJA 2AF3C 4DY6A 2JI4A 1MX1A 1WXIA 1JECA 2GWRA 2FW6A 2HMYB 3TZKA 4D5EA 2XUDA 1SVMA 4PV7A 5CUQA 3KPJA 1C3VA 2C5AA 2H3HA 1N9GA 2WPDA 3COZA 4JQOA 1OXUA 2EX4A 3HB1A 2ECPA 2XT9A 1ZK0A 1VHDA 1SO8A 2H17A 2XQIA 3WQRA 1EGAA 3BXXA 3ONWA 3TGWA 2CEAA 4ENTA 1FNBA 4P32A 5LQKA 1N32B 3R24A 1CEQA 3EQ8A 1ZI8A 4P4NA 3KDAA 3X3HA 4CDMA 3SR0A 3J81k 3BHNA 5FWNA 3V55A 1KWGA 3DLPX 4YV1A 3IMFA 2R85A 3MGGA 5K05A 4UNIA 1PWEA 3A1SA 1CUSA 5JR3A 5KJCA 5IYZF 1JV2B 3HN6A 5BRAA 1MJGM 3Q6IA 3GRUA 1JEYB 4WY8A 1GPKA 5EP3A 2EBHX 4EPYA 4F4IA 1E2UA 1GAEO 2G67A 1MDBA 4H0CA 4NE7A 3A0UA 2Y2VA 2FFHA 3AW9A 3ZKWB 4C7OA 2I6UA 1E5LA 5DE3A 1TM1E 2M6SA 2HL6A 3LXXA 4QFBA 4PW0A 2HA7A 2ZGVA 4CODB 2JIZD 1PFKA 4X1KA 4TL8A 3AKZA 4MYDA 1IE3A 1RHRA 1USIA 2VS1A 4XAQA 5EWMA 3GVPA 5K0SA 1K8ZB 4J4BA 3K8OE 2CY0A 1QIKA 4QAQA 3DO6A 5KYTA 1MQAA 2QLMA 3LPMA 4LFCB 1VTKA 1ZX1A 1SXJB 1FL9A 1ZN8A 3J7TA 6YASA 1RQRA 4R1NA 4WWHA 3UAOA 4LRUA 5K6TA 1JYEA 3OQ6A 2HM7A 2FE1A 1A9OA 2MYTA 4BKQA 3T94A 1RZ3A 2DFLA 4G65A 1F3LA 5FRDA 5DYYA 1H5NA 5T4FA 4YXFA 1N0IA 2MSCB 3FFWA 4KLAA 1YZYA 5DMXA 5ICGA 2QMEA 4NBUA 5JNTA 2IY7A 3HR7A 3S7ZA 3WLKX 3NVKI 4RTOA 1E9VA 3QXHA 3L6BA 2HLDD 3L4BC 5TGDA 1VLQA 4J91A 4ERNA 3KQMA 3EIEA 3QTTA 3ZK7A 4M9CA 1NDQA 4RDCA 2R0QC 5C35A 5EJ5A 4LDAA 4P98A 4C7VA 1RMQA 5JXIA 2AI2A 3BBPA 3ILYA 1FJGB 1TOAA 4QO8A 1E6EA 1X7WB 1OLXB 2G4LA 3QNWA 4DV6B 1JDTA 3W3AD 1W76A 3WGLA 4GD3Q 1Q0LA 1QP0A 3F9IA 5KAPA 2B35A 2GXAA 2AZMA 2FGKA 1N5MA 2OWDA 3BCUA 4TYMA 2IW1A 1YGPA 2YXBA 2AVNA 4FIZA 4PRYA 4AZSA 4EI9A 3PTLA 3G8AA 4LJSA 4MJ7A 4ZK6A 1KWKA 4V03A 3SSOA 1G9SA 3O6VA 1N3IA 4FE3A 4LQCA 2W4IA 2ZZKA 4LJ8A 2HWWA 1B73A 3B2EA 2QJTA 2V5AA 2G63A 5DOZA 5KB3A 4E14A 1GPYA 2C59A 5A2GA 4RIGA 3OE5A 5BRNA 2HYDA 5E0KB 5ERGB 1CLEA 3T9BA 1Y3CE 4BO8A 5SZHB 1UUFA 2HX1A 4Y1EA 3UMGA 2C5FA 3DDNA 3EIOA 2RGYA 3O1IC 5TT1A 4WK4B 4PGFA 4ER0A 1N77A 1Z4PX 1KEUA 4J75A 3SCZA 2NYAA 3I64A 4LHXA 3GUHA 4MGZR 4BMOB 4LOJA 5HIMA 3DMYA 2X19A 3NVMB 1R16A 4YAEA 2PYDA 1RYEA 2Y1XA 4TRRA 5EA2A 4DBLC 3CVVA 1E99A 2Q4BA 3QPWA 1N6KA 4B7XA 1NUTA 1NXVA 5HBRA 3KVRA 1ORDA 3GIDA 3IOBA 2PX2A 3BILA 4OLHA 4G86A 4C0XA 1XLWA 4U3JA 3D4LA 4W5TA 3DCNA 3BN3A 4YGYA 1E5VA 1JQBA 1ECCA 4P08A 3BMNA 2EFEB 3FUTA 2DJIA 3QU2A 4QYSA 3BJRA 4ZI7A 1DX4A 1LH0A 3DPSA 2Q4EA 4FI3C 4PTZA 1BVYF 2JKVA 3IE0A 2FLVA 3IIJA 1KNQA 3FY4A 4N6NA 4A6DA 3AU9A 5KYXB 3K05A 4MUEA 1ZR4A 2JFHA 4G2TA 4OQMA 3IQIX 5B6JA 3H9QA 3AHIA 3CWQA 4QUGA 1BMQA 4B71A 4DR5B 2BHSA 3ZLUA 4TTRA 4KR6A 1ECBA 2QSJA 2R11A 2Q5OA 1AO3A 4ZI7B 1X1DA 1KO1A 1COZA 3MUOA 4LK2A 4PHHA 4BLQA 1NA5A 3ZKAA 3DLCA 8OHMA 3FWKA 4MUNA 1B0UA 1UXKA 4EH1A 4HZUB 3PRHA 2WU8A 4F6LA 1QK3A 2O2GA 3KQHA 3A26A 4GI3A 4KMMA 2O8EA 1F0YA 3FROA 2PUJA 4JLBA 4DGQA 1S3GA 4JVNA 4JKIA 5EXXA 3MMPA 3O9MA 1L7PA 5C32A 1IIRA 3WLLA 1MVLA 2X76A 3QENA 3M81A 3QELB 5EZYA 4N3GA 5F4BA 3T3NA 4X44A 1Y7IA 3SG0A 1IY2A 2VDUE 4PPGA 4RPIA 4WJKB 4BX8A 1ZD4A 1ZM7A 1VI5A 3DBRB 1Y5IA 3VSEA 1DX9A 4DV3B 2ZYTX 4MYSA 1Y8QA 3D8BA 1QMPA 1OX4B 1T4CA 2SICE 1R6DA 1Z38A 4BV2A 4M1QA 5H9WA 2DWUA 5IMBA 4ASUD 1FDVA 3L8YA 4MI9A 1ES9A 4WOKA 5B1EA 2JEOA 1IY0A 3NBUA 4IFIA 3C3AA 1SA0B 1RE1A 3A9VA 3ADOA 3OIVA 4OA8A 5CA0A 2COUA 3O03A 2RHLA 1FTSA 3LG2A 4KQMA 4YAOA 5DNCA 3T3HA 2FMUA 4YRJA 1OX4A 1T4CB 3HADA 3PEYA 2IHYA 2ZK7A 1HE4A 2J7KA 2DP4E 1M6WA 1PLJA 2YBEA 3JPYA 1HY3A 2NGRA 3JQ6A 1O3YA 1W0KA 4IV5A 3I12A 4X54A 4X95A 5FT9A 3RK0A 5FA5A 4DBZA 1W47A 5TPWA 4ZQBA 4IF6A 1VLJA 3TTYA 2IHUA 3CPHA 4KPGA 4FFPA 3PC6A 4DLSA 2I8AA 2V45A 1HMPA 3KYDB 2E48A 4BFYA 2AMLA 4N7RA 5F76A 2X0RA 2JLVA 3G2PA 2DLDA 4EZBA 1MXHA 2BFEB 4F2HA 3P0HA 3ZV5A 3T7TA 2AZXA 4ZQFA 2XTAA 3N8GA 5TF0A 3WDLA 3PEUA 3C3MA 3H86A 3KL2A 4Y3UA 3QYPA 1GQYA 2YY5A 4ID9A 1BA2A 4GKJB 1TUBA 5FBRB 1EAYA 1VE5A 2P35A 2O05A 1J9ZA 2OGUA 1LSOA 5FOWA 3RLFA 1A69A 2GN0A 3MBKA 4BNDA 1XZNA 2CJPA 4NKRA 4G1FA 5ICSA 2CVPA 3IR7A 3L43A 1V48A 1ZRSA 4DV5B 1VJRA 1JLHA 1EK0A 5H9VA 3E9NA 4BFCA 3TTTA 1U1FA 4LOLA 4H7IA 4WECA 3PPYA 3TEJA 1GO2A 1L7RA 2BCEA 1NBIA 4K6MA 3R76A 1Q1NA 4LRSB 2OV2A 1X8XA 1RJDA 2ZPAA 4ILKA 4OLJA 4EHHA 1WDTA 4P92A 4GXRA 3NWOA 4CN8A 3H9CA 3KPVA 3KZNA