2ZCUA

Crystal structure of a new type of nadph-dependent quinone oxidoreductase (qor2) from escherichia coli
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
283
structure length
275
Chain Sequence
MIAITGATGQLGHYVIESLMKTVPASQIVAIVRNPAKAQALAAQGITVRQADYGDEAALTSALQGVEKLLLISPQHRNVINAAKAAGVKFIAYTSLLHADTSPLGLADEHIETEKMLADSGIVYTLLRNGWYSENYLASAPAALEHGVFIGAAGDGKIASATRADYAAAAARVISEAGHEGKVYELAGDSAWTLTQLAAELTKQSGKQVTYQNLSEADFAAALKSVGLPDGLADMLADSDVGASKGGLFDDSKTLSKLIGHPTTTLAESVSHLFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Uncharacterized oxidoreductase ytfG
publication title Crystal structure of a new type of NADPH-dependent quinone oxidoreductase (QOR2) from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
total genus 95
structure length 275
sequence length 283
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2007-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2zcuA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2zcuA02
4I08A 2Y67A 3KLMX 4BL5A 3JQ6A 3P7MA 3IIEA 2PK3A 3VPXA 1XELA 5T6BA 3LF2A 6LDHA 1U28A 4KZPA 3WIEA 1QYDA 2AQKA 4YAGA 3UGKA 4IPTA 4E33A 1H93A 7ADHA 3D4NA 5ENDA 2VHZA 2DTDA 4RORA 3KEOA 3TNLA 5C5IA 4ND4A 4M86A 4HFMA 2FHSA 4M1QA 2B4QA 4W7HA 3JQGB 4X54A 3NJ8A 3A14A 4WCFC 1A5ZA 2DQ4A 4J6FA 1XR3A 4BMSA 4CMJA 2QYSA 1YBVA 2YHIA 2FR1A 1HSOA 1SOVA 4BO8A 1UXKA 1R4NB 2ZCUA 3QW2A 4G5HA 4IY1A 3TZ6A 3TF5A 1X7GA 4Y67A 4A27A 3RASA 1YJ8A 2EHDA 5L95A 4L74A 1XLTA 3RUAA 4PCVA 1DIGA 3KYDA 2JD1A 4R41A 4KP7A 4DTIA 2DUUA 2I5PO 3OA0A 4UEJA 4RPKA 3Q3CA 1A9YA 2IXAA 5A1TA 3TFOA 3IP1A 3JSAA 2DTXA 1BSVA 1Y5MA 5IJZA 1PTJA 3ZCXA 1GYPA 1GCUA 4XGIA 1T1SA 3EMKA 1P77A 4MO2A 4CV1A 3H3FA 5CEEA 4OJNA 4YAIA 2E4AA 5A9RA 3DXFA 2BMAA 3WYBA 2O3SA 2V6FA 3V8BA 2QHXA 3DB2A 2Q4BA 3VOSA 3BYZA 1IOLA 5I9NA 4KWIA 1JDJA 1ARZA 1WXDA 2YZ7A 3GEGA 3OMLA 4H3VA 4IMRA 4J7XA 1Q0QA 5I7SA 4CM8A 1J4AA 2IYOA 3GAFA 2Q3EA 3H5AA 4RPHA 4ND1A 2IODA 3EYWA 3DFZA 3RSHA 4EUFA 1NFRA 1I3KA 3FTNA 1ZJYA 3OIFA 2PZJA 3LT1A 5TX7A 4AICA 1DPGA 4JJFA 4FJ1A 2Y99A 4RVHA 4GGPA 3G49A 3QRWA 4XQGA 3PIDA 1WZEA 1GTMA 3TOXA 2JKVA 2FSSA 1NX6A 2HMTA 4Q3BA 1K6JA 1Z7BA 4J7CA 3S2IA 1UP7A 1DC5A 3IJPA 4KMSA 2C2XA 1NASA 1PSDA 2Z1MA 3BMCB 3IJRA 4XCVA 5EQFA 3EW7A 3C3XA 3OSUA 4IDFA 3FTPA 4ALIA 4E3ZA 1Y9AA 5ITWA 3JQAD 3I5MA 2EGHA 1HYEA 5HS6A 5G0SA 4D3FA 5L7TA 4CLOA 4TVOA 3FF4A 4ALJA 3LDHA 4CV2A 1CDOA 1DIRA 3NTRA 4WK6A 5ICMA 1N92A 4XJTA 1ZO8A 4B4WA 3GUCA 3MJTA 1PL8A 3VKUA 5KNLA 1XIVA 2VOEA 1LSOA 1CEQA 3WXBA 4ZQHA 3L0DA 1IUKA 5BNTA 5KOIA 4N5LA 3GG9A 3S2FA 1TLTA 3D64A 2HLPA 3GEMA 4XQEA 3RQSA 1HLDA 2W2KB 2QIOA 4M49A 3DMTC 4Z0TA 2Z1NA 2PWZA 4XR9A 4D7AA 1ONNA 5CDYA 3TOZA 1Y7TA 4XWYA 4AL4A 5JW6A 2I66A 2IXBA 8LDHA 3HJAA 1IL0A 4OKNA 1QYXA 3ZNNA 4LSMA 4QQRA 1YOVA 1P1RA 1PJLA 1H2HA 4LRTB 2YQ5A 4JBGA 3ZWMA 4ZVVA 4W9NA 2CFCA 4MVJA 4A0SA 3OH8A 1LDYA 2IZ1A 1EQ2A 2ZK7A 3B1KA 1AHHA 1LC3A 3TQHA 2W2LA 4NBTA 2AE1A 1EVJA 1D8AA 3DR3A 4BGUA 4NBUA 3C85A 3D7LA 3K2EA 1D1SA 4ZHSA 2AW5A 1PGNA 2AXQA 3HZZA 4XQ9A 2GCGA 3W8FA 2QRKA 3A06A 4E21A 4NU5A 4UREA 3L6OO 2ZB3A 5CPBA 2GZ3A 3BMNA 4JJGA 1DIBA 3BTOA 3VTFA 4E4YA 2PR2A 1MG5A 1PJ2A 1TT7A 3RBZA 2O3TA 2Q49A 4BO1A 3UCEA 3L4SO 2PGLA 1HZJA 1B7GO 4CMBA 3O8QA 3IMFA 4II2A 1KS9A 3T4XA 5L40A 3JQBA 3CIFA 3JQEA 3QE3A 4XYMA 3INRA 4ZA2A 4CM9A 5C37A 1T2AA 3WJAA 1SBYA 3VZPA 4J90A 5L4SA 5TGDA 1ZJZA 2CDBA 3ZNPA 3RBXA 1C0PA 3RU9A 3CSDA 3GRPA 3PIIA 3V2HA 4AJKA 4CMEC 5C7IO 1UAYA 1XGKA 4QSMA 1PQUA 2O3UA 4HADA 4K9DA 3OJFA 1V3TA 3PWKA 1W73A 1J6UA 3DAPA 1EUCA 1W6UA 4PLZA 3R3SA 1U8FO 4UUOA 1BXGA 1IE3A 3WGZA 2I6TA 1I33A 2I67A 2Y1DA 4RQTA 5DBGA 4CQMD 2G17A 4IJKA 3HDHA 3GY0A 2BFPA 5KWEA 3DZKA 3VVCA 1EFLA 3DDNA 4W82A 4YB8A 4BNXA 3OECA 4E5KA 3NT5A 4GQAA 2EW8A 3DZFA 3QY9A 1K3TA 5F5LA 1SMKA 3OQBA 2WTBA 1K0UA 1AE1A 3OJLA 4RVFA 4DYVA 4QO8A 1X13A 1LNQA 4WLUA 1B15A 1YS4A 3QV1A 5JO0A 1GR0A 2J5KA 1U3WA 1HZZA 1TT5A 3OQ6A 3GF4A 1LLDA 2FRDA 5TNXA 3AFMA 3L9XA 4NIMA 3TFQA 3KSZO 3OEWA 4GWKA 5BNIA 3VPHA 2HMUA 5BR7A 1Y8QB 2FSVA 3FWNA 2AHRA 4FFNA 4UUPA 5TQVA 3PGJA 4J9VA 3CPSA 1Q7GA 2G76A 4L4XA 3G1TA 4J2OA 4UUNA 3M2PA 4FSHA 4BKUA 3UAGA 2GZ1A 3AW9A 3OM9A 2EG9A 3X2EA 4FFRA 3V2UA 3RJ5A 3E6AA 5DOVA 5I9MA 1IULA 1GU7A 3OICA 4EEZA 3EUWA 3SC4A 1LQTA 3GC6A 3G1UA 4DYDA 4FD3A 4EUHA 2YDYA 3GMDA 4D44A 3JQ9A 3CE6A 2A4KA 4MP8A 4BO5A 2B5VA 2X9VA 2NUAA 3LQFA 2FY8A 3PLRA 1DFHA 1UDBA 1E6UA 2CY0A 1QYCA 1I5RA 2X6TA 1PJBA 4GLLA 5ADHA 4CQMB 3WS7A 5K6AC 1YJQA 3L4BA 2B5WA 3VZQA 4RPLA 4CM4B 1A7KA 4Q3CA 1PZHA 5G4KA 1ZK0A 4PVCA 4PVDA 4AFNA 4CM3A 2IDZA 3EVNA 1YQGA 4JNKA 3ETDA 4DPLA 2Z95A 3JYLA 1PU2A 4K1LA 3I9JA 4WLEA 1O95A 1YB5A 3U0BA 1UDCA 4PLTA 3GZNA 1GUFA 4J4BA 5CP8A 1DB3A 2JCXA 1NTOA 3ABIA 3FBTA 2H5LA 1KEVA 2AQIA 3S8MA 4D42A 3AU9A 1TEHA 4K6FA 5CFZA 3ZV6A 1KOLA 1NQOA 3H2ZA 3RFVA 1LLQA 3B1JA 1WDMA 3CINA 4JP3A 1PEDA 4YJFB 3PPIA 1PIWA 5L7YA 2O3JA 4UVGA 1ISMA 2I3AA 2VQ3A 1N9GB 1AGNA 1DFGA 1D1TA 1KVRA 2R2GA 3M1LA 3OHSX 5JLAA 2Q1WA 3GDGA 5TT1A 3ENKA 2ZJ1A 3CKYA 4AJJA 1EK5A 1N7GA 2BGMA 5JDCC 2YY7A 5JAIA 1HSZA 4FDAA 4J9UE 4ZICA 1PGQA 3U4CA 4FGSA 1T24A 2P5UA 3WICA 4OH1A 1PQWA 5COQA 2P5YA 4MKXA 4XDYA 5JCXA 2OP0A 3ORFA 3PQEA 4MJLA 3C8MA 5G0WA 2NVUA 1YDWA 3WJ7A 1CJCA 5BSEA 5HRUA 3WX0A 3BXXA 3VDQA 2QG4A 2FWMX 5T64A 3GAZA 1NFQA 1BXZA 1EDOA 1DLIA 5EIOA 2QZ9A 1YKFA 4IDAA 2RH4A 1KY5A 3ZHBA 3EGOA 1W0CA 5L4NA 2O23A 1A4UA 2HJRA 4ILKA 2Q50A 4XRRA 5B4UA 1B8VA 4F6CA 2LDXA 2AE2A 4GBJA 1LTHR 3GN2A 4LW8A 3UH1A 5IZCA 5JBIA 1R15A 1LU9A 1GL3A 5TLSA 4NQZA 3WGIA 3DHNA 3PHJA 3FNFA 4W7IA 4XKJA 3BHIA 5A04A 3C1OA 1E5LA 4KDFA 3U4HA 3QQPA 1U7HA 4YEDA 4XDZA 1P0CA 4BNFA 4JROA 3HDYA 1HE2A 1Z74A 4TKLA 4BB5A 4GWGA 3ZW9A 1WAMA 4A7PA 2PKQP 3KYBA 5H83A 3TZCA 4R51A 1ENYA 3MZ0A 3WWYA 4EITA 3E9QA 4B7XA 3IOYA 3MOGA 1NHGA 2EERA 3GOHA 1SAYA 2YQ4A 3GT0A 4TRNA 5FEUA 1LI4A 3AFNA 2NU7A 3PJFA 4KTVE 3JV7A 3K9QO 4MKRA 3KBOA 2QRLA 4YT8A 4EUEA 4MPDA 4GL4A 1ZMTA 3JQ8A 1ML3A 1W8DA 3CUKA 2B69A 3DZHA 1DRVA 5IFLA 2W4QA 3I6QA 2D4AA 3IAHA 4NMHA 4QFDA 3HNPA 1U4SA 2A92A 4B4UA 2BFMA 2A9FA 1QORA 4BNGA 4BNKA 5IXSA 1OOEA 1DSSG 1PS8A 3Q11A 4MIEA 3PTZA 2JL1A 1IB6A 1P0FA 1KEWA 5COBA 4BO2A 1RWBA 3DC2A 1DC6A 3D5QA 4A10A 2UAGA 3C1TA 2WWRA 3H9QA 4XYBA 3I4CA 4N5MA 1KEPA 2J5RA 3D3EA 1V6AA 4PLPA 4BGEA 5BSFA 3D4PA 1W4ZA 4MIOA 3L6EA 1MFPA 3CMCO 1X7DA 3D4OA 1M6WA 3H9JA 1DJQA 4IQGA 4H7PA 5DDIP 3K73O 4BKQA 2Q45A 3WOHA 4UUMA 3AI2A 1Q7CA 2J5QA 5C7LO 1WW8A 1U5CA 2PFGA 4YAJA 4YBZA 1RYEA 3A9WA 3KSDO 2FN7A 3PZRA 2B35A 4XB1A 4G2NA 3I52A 3FPLA 5IDWA 2VHWA 1I2CA 4EBFA 3HN7A 1F8FA 2X5JO 4IJVA 3H9GA 3ZNOA 1B0AA 3H6KA 4IDCA 3PXXA 3F5QA 3ZWYA 4BGIA 4ND2A 4OM8A 5JY6A 1XG5A 2D0IA 1Z73A 3BTUA 3E82A 5JE8A 2GZ2A 2LDBA 5BNFA 3K96A 2C0CA 9LDBA 1Y8RB 1LJ8A 2EV9A 1YONA 4D0RA 1AUPA 3OJOA 4UEKA 3KYCA 1S7CA 3ZZNA 3Q0EA 4WLNA 4CMIA 1GDHA 2D59A 2I76A 3VZSA 3TJRA 7MDHA 2PV7A 5U4QA 2P91A 1LQUA 3EAGA 4FJ2A 4S1VA 2PNFA 2OMEA 5KVQA 3ITDA 1C0KA 5BT9A 3CXRA 4ZN6A 2VZ9A 4IQ8A 1NM5A 1UZNA 3WMWA 1ADGA 4XA8A 3ZU3A 4JBIA 4II3A 1LRLA 4EDFA 5AOVA 1LRJA 4J4TA 4ZQGA 4BMVA 4CR8A 4FC6A 3S55A 4RZIA 2J3HA 3LLVA 4ZQEA 1LEHA 2NADA 2GD1O 4H16A 1BHSA 3OP4A 4I1IA 5COAA 3KXDA 4YA6A 1YGYA 4WUVA 2WMDA 3I23A 3NAQA 1MC5A 4I9HA 1FDVA 2JFGA 3UHAA 2Y1GA 2OZPA 5G4LA 2B83A 1DC4A 3ICPA 3KLPX 4N7RA 4B3HA 3K92A 4ALLA 2GDZA 4YTEA 4KQXA 4DLBA 3ASVA 4CLHA 3WMXA 5A02A 1NR7A 2C29D 1GPJA 4Q3AA 5G0UA 1L7EA 1ZK2A 1O6ZA 4KOAA 3FPCA 2BKAA 4WPGA 2O48X 3KB6A 1KEUA 4YJHA 2OUIA 1DHTA 4JJIA 3AI1A 1YWGO 3E5MA 3HG7A 5G0TA 1H2BA 5A9SA 1ZSYA 2O2SA 3EY4A 3DOOA 4OIMA 3ZGYA 4Z0HO 2VNAA 2EKQA 3RC9A 4U8GA 1D4FA 1QR6A 1YRLA 3PJDA 4YJGB 1A4IA 2Y1CA 3F9IA 4D0SA 1M66A 2P2SA 4R3NA 1F0YA 3ROQA 1E1NA 2UUPA 1A72A 4IGEA 4OMUA 4C7KA 1FF9A 3IKTA 5KJ1A 1C3VA 1KC1A 2V7PA 5IN5A 3ZHXA 3NT4A 3LZ6A 3JQDA 2X9NA 4FFLA 1ZSVA 5DULA 3IL2A 1MGOA 2P9CA 4MVJE 3P2OA 3BHJA 4GPD1 2VWHA 1E6EA 2PTGA 5TIIA 1BDBA 3H9EO 1V0JA 1U2DA 4DA9A 3D3WB 2HRBA 1C1XA 2HJSA 1Z6ZA 1TB4A 1SPXA 1ID1A 1FDTA 2PKRA 1HDYA 2VUSA 5CG2A 2VHYA 3IUPA 1M76A 5ENVA 3I9NA 1GZ3A 1HF3A 1EUZA 2NACA 4XGNA 1F8GA 3WSWA 4BNNA 3O03A 2Q1TA 1C1DB 1E92A 3E48A 1PJTA 3K31A 3FNHA 4TMFA 2O7QA 1DRUA 4GVXA 3B6ZA 4DIOA 3OJEA 2JJYA 3I9KA 2DPGA 3GVHA 4NBVA 3VH3A 3WB9A 5CDSA 1DFIA 3QJ5A 4ROSA 2Y66A 3AM5A 1PJSA 4NK4A 3HQ4O 1IYZA 5I7FA 5L7WA 3VPGA 4CLRA 2VCYA 5KKCA 3SBOA 3JQGA 1NBOA 2G5CA 2VT3A 2CNBA 3ZWXA 3LLSA 2GN6A 4OOFA 4HKTA 2D5AA 2O4UX 2TMDA 2JFFA 3IKVA 4BO3A 5L9AA 1R4NA 5THQA 1R12A 1CIVA 1HE5A 5JAZA 5IDQA 3NRCA 1WPQA 2QRJA 3PGXA 2AQHA 1H9AA 3G79A 3GHHA 1T26A 1MX3A 1LDBA 4HNHA 2UVDA 5EJ2A 1WDLA 1D7OA 1ZUD1 3P5SA 4R9RA 1ONOA 3WGOA 1FK8A 5JCJA 1XCBA 4E31A 2CDAA 4CJXA 4AJEA 4DWVA 1ZK4A 4RL6A 3DOCA 2ZIZA 2FPPA 3H9UA 4FFMA 4PZEA 3I1JA 2VHXA 3NV9A 4R3WA 3GGPA 4RGBA 5L53A 4L9RA 4UVDA 2W8ZA 1GV1A 1GUZA 5LDHA 3ZHZA 1F17A 4P38A 4B8ZA 2Y93A 2D3TA 3AI3A 1EEHA 3JQFA 1LRKA 1E1LA 3HHPA 1QV7A 4Y8VA 4YCAA 2VRCA 4BNMA 1R6DA 5AQ1A 4E2XA 5JPIA 4J1SA 2FPIA 4C7JA 3GNQA 3Q2KA 3MEQA 3WR5A 4MP3A 2ZKLA 2WD7A 4NFSA 1BMDA 3RKRA 1LDNA 1YQXA 3LSYA 1JVSA 3KUXA 1SC6A 3WLFA 3VPSA 4DGSA 3FR8A 3PP8A 3AOEA 4MVJF 3B1FA 3JYNA 1NQAO 2FP4A 4KUHA 1TA4A 5DP1A 5KKAA 4YQYA 2O3RA 3FNGA 3RWBA 4NR0A 2DC1A 1LXCA 1XDWA 9LDTA 3SJUA 3BMCA 4EEXA 4L8VA 5EL0A 1IHXA 3UCXA 4FFOA 4NHEA 2EEZA 4OQYA 1P33A 3C1AA 4BO0A 1ADFA 3VC7A 2PZKA 1Z82A 3PHLA 4EZBA 1UJMA 3GNTA 4RO0A 3OFSA 3UF0A 2W90A 4BO4A 4P8RA 3GVCA 3AY6A 2DKNA 3DFUA 5EQDA 2XF8A 1NVGA 5AXCA 5JMPA 2VWGA 4W6ZA 3SLGA 3AOGA 1G6KA 1SEVA 4BS9A 2Q99A 4MVJG 2WDZA 2ZTMA 1E3SA 1BVUA 5CG1A 4IINA 2IZ0A 3RAJA 3HDQA 5JO9A 5L51A 4XJSA 4MVJD 1MLDA 5T67A 5KVVA 3TN7A 4QFCA 1QG6A 4TROA 3ST7A 1NFFA 2W2LD 4BUCA 3DMYA 3DBRB 1ISIA 2RCYA 4R5MA 2GSDA 3PYLA 3EZYA 3IDSA 1BXKA 1NWCA 3AK4A 1SOWA 3GG2A 4GKVA 3PQFA 4PRKA 4DQVA 3MJ4A 5I8WA 3ZW8A 4BKOA 1X14A 1C0LA 3GNSA 4RVDA 3RUDA 1E7RA 4BNYA 5TT0A 1UXIA 3PZBA 4CLOB 2OBNA 1P31A 1SNYA 1DOHA 2X86A 1MXHA 3GPIA 1I3LA 2P4HX 1XHLA 4K26A 5A06A 4R69A 3U49A 5DBFA 3SEFA 1JA9A 4XZ3A 4JQCA 3V2GA 1MC4A 2X23A 1OC4A 4LSWA 3WWZA 4CM9D 4DRYA 3AM3A 1GYQA 4B79A 1YE3A 1LSJA 4NDNE 1AXEA 2C5AA 3SC6A 4BOYA 3QVWA 4U0JA 4WNIA 2HRZA 3DHYA 4GVLA 5GZ6A 1UXHA 3PYXA 1GCOA 1ULUA 4EYEA 2HDHA 3JD1A 4OSOA 1NQTA 4E5NA 1O94A 1PGOA 1ZIDA 2AG5A 4FJ0A 4XEHA 1JVBA 3W6UA 5FI3A 5DOZA 2X22A 2EJVA 3JQAB 5A03A 4AJOA 1M2WA 1YOVB 2PGJA 1BDMA 4ZRMA 4WLFA 3PJGA 3GFGA 3F5SA 3PWSA 4BVAA 4BV9A 3ULKA 2ZB8A 4AVYA 3LF1A 3PYMA 2J3IA 5HTOA 1E7MA 4IJUA 3W4IA 3CMMA 4O5OA 4EJ6A 1T1RA 3PLNA 4BNLA 4CUZA 1FXSA 2NNLD 4JK3A 1EZ4A 4LVCA 3C7AA 2BFOA 3TZHA 1HDRA 3BMOB 4YAKA 3QWFA 3W4KA 4ONEA 2NQTA 4I9NA 4Z9FA 4DC0A 3NKLA 5IAAA 4HY3A 1XQ6A 3I83A 2C54A 4CQLB 1RPNA 1H6CA 4O6VA 5IDXA 2FMUA 1ZNQO 4LCEA 3IUSA 3NGXA 5L45A 4D46A 4M87A 4LK3A 2C82A 4PZCA 2VYVA 1G0OA 5T8KA 1ZK3A 4BNIA 4NBWA 3S2EA 1CQIA 3NTQA 4R1NA 3RFTA 2QW8A 1MV8A 4RQUA 2OOSA 4R1UA 4BHTA 2GYYA 2YW9A 1ADCA 4D3SA 4JX8A 2HKIA 3LT0A 4N54A 4DMMA 4F3YA 5I7EA 1C0IA 4HFNA 5TC4A 5KJFA 4DBZA 1QLJA 4E5PA 1YDEA 1IPEA 4R1TA 3UCFA 4RLSA 5G0VA 1ZKMA 1E7YA 3N7UA 5L4LA 2ZATA 2CD9A 2WJPA 2EWMA 1KYQA 1R0LA 1Y8QA 4LVUA 1DDOA 3ADPA 1MB4A 1S6YA 4B4OA 4CLXA 1K6IA 4DIFA 2BD0A 3TWOA 4XX0A 2Q46A 4W9NC 1YXMA 3ZWWA 3ZU5A 2RAFA 3JD0A 4NNJA 1OC2A 4IM7A 4NFHA 2X1HA 5U9CA 4GMGA 1QLHA 4XRGA 3U5TA 4YQZA 1MUUA 1OZAA 4MVJP 1GZ6A 1O0SA 3K2BA 3O4RA 1HXHA 5T57A 3INTA 1GFSA 1BW9B 2HCTA 5ILOA 3PWZA 2UUOA 2DTEA 4OGWA 2A94A 4WEOA 3O26A 3DBHA 3MJEA 5JDIA 5JC1A 3ICCA 2J8ZA 4CR7A 4H15A 1YL5A 3PDUA 3RUFA 4A03A 4YRAA 5TJHA 1U3VA 1E1MA 4LISA 3ZH2A 1Z45A 4CPDA 1B8PA 2G0TA 1SO8A 3JQBC 4QX6A 5ER6A 4CM4A 4Z9XA 5C3MA 1T2CA 1V8BA 5EPOA 4K28A 2E37A 3ZI0A 2C20A 3JYOA 4FBGA 2JFHA 1JKIA 3H5RA 5TJ9A 4YDRA 4N5NA 3RIHA 2YYYA 4R1SA 4E2YA 2EGGA 2PZLA 1YB1A 1E7WA 1EUDA 2JD0A 3OIDA 3TSCA 2X0JA 3QIVA 2QZZA 3FN4A 3OJ0A 2BHLA 1I3NA 1B14A 1LBEA 4MVJI 4PG5A 3OBBA 2CF6A 4NJMB 2R00A 1WLYA 1FJHA 4YJFA 4CMGA 4ZJUA 4JCOA 1N1GA 1UP6A 2Q1SA 2NU8A 1YBMA 2G1UA 1NXQA 1N9GA 1P1KA 3H65A 4DIBA 1T2EA 1HKUA 1NP3A 1LC0A 3U62A 3PFWO 1JWBB 1O5IA 1UH5A 4WLVA 1JU9A 5LC1A 4J4HA 2CZCA 1PR3A 4D43A 3WFJA 4E6PA 5G4KB 3MTJA 4PLGA 4BO7A 4FIZA 3ZV3A 5KTKA 3KM0A 4UAGA 2AQ8A 2F1KA 3MOIA 1VJ0A 5LCXA 1E3IA 3GZNB 2OXIA 3WLEA 3ONDA 3PQDA 2OORA 4E2WA 1V3VA 1VSUA 3IP3A 3LT4A 4A73A 1ZCJA 3WQRA 1AN9A 2ILTA 4DPKA 2GPTA 5JNLA 1U5AA 5I7VA 3BMQB 1FDUA 4Y6RA 2Q2WA 1KVTA 5GY7A 3HFGA 4GGOA 1H0KA 1MA0A 2OL4A 3E5RA 3ZWNA 4FC7A 4WE3A 1WP4A 1OBFO 5CDGA 2Y1OA 3U4IA 4RZHA 3CZRA 4D45A 1EVYA 5DN9A 4J0FA 3W8DA 3LC1O 4PZDA 1KBZA 3RC1A 4ZQFA 4BO6A 3JQCA 4D41A 3I4FA 1U8XX 3WGYA 4F6LA 1EBFA 3ZDFA 4NI5A 1WZIA 4MVJH 2YFQA 3NUGA 3JQ9C 3CH6A 4CLDA 4YJDA 4OSPA 4TKMA 3NDRA 4MKZA 4HWKA 5JSFA 2Y0DA 3HADA 3VVBA 4I9UA 3UW3A 3DONA 1HDCA 1MP0A 2P68A 2JAHA 2QQ5A 3L4BC 1VL8A 4L75A 2ET6A 5BQFA 3BTSA 1VE9A 3I9MA 2BI8A 4CUKA 1GD1O 4E5YA 3RVDA 3GK3A 1Y1PA 4HFJA 4UVIA 5A5EA 1OAAA 4O1MA 3NJ4A 2Q4EA 5THKA 1UZLA 4BNJA 2VRBA 3DL2A 2D2IA 3H5NA 4J0EA 1PX0A 4TZTA 2NU6A 4RPJA 5GZ3A 2DU8A 4M54A 4R5HA 1Y5RA 2EKLA 1XU7A 3FCOA 2PZMA 1GQYA 3ZHYA 1LLUA 3LC2O 5JC8A 3ZN2A 1E3LA 1TXGA 3D0OA 4RV9A 3VDRA 2I99A 3GEDA 1T4BA 5I8ZA 1BG6A 2B0JA 1ZK1A 1Y9EA 3ANLA 5IF3A 3RUHA 5KVSA 2EJWA 1PWXA 4FGWA 1P44A 1GQ2A 4CMKA 3LT2A 1K2WA 3VKVA 1UR5A 4E13A 3JQ8B 2YUTA 4E0BA 5B1YA 2CVQA 5KIAA 4NFYA 4O59O 3MJVA 1NPYA 4Q9NA 4UEOA 2POQX 3R0IA 5AYVA 2YHUA 4R4JA 3GGOA 3F1KA 1RM5A 2NU9A 1Z75A 1A7AA 4J7UA 3W6ZA 4HP8A 2D1YA 4TWRA 5DCWA 3MWDB 3S2GA 1E3WA 4ND5A 4EGFA 3NX4A 1SZJG 2YFHA 4DBVO 4RF2A 1XSEA 1UAGA 5IXYA 1ISGA 3F4LA 4GX2A 5JS6A 3LC7O 1F06A 3OA2A 3GVIA 4CUJA 1ZFNA 3OF2A 4XQCA 5IZCC 3HB5X 4OHUA 5EINA 1SCUA 2NVWA 3D5TA 5DT9A 4L4RA 4J3FA 5T5QA 1I36A 1Y8RA 1SEPA 4J91A 1GY8A 4DMLA 1H6BA 2O50A 3EK2A 4IDGA 1RM3A 4LRSB 4ZGWA 4BQPA 4NU6A 2CF5A 2CVZA 1CF2O 1DO8A 5A4DA 1PZEA 3O9ZA 3EHEA 1I30A 1VRWA 4WCDA 3VAZA 5AXDA 2NSDA 3GR6A 2GUGA 4G65A 4R54A 3R6DA 1H94A 1EMDA 3WQSB 5TSDA 2O3QA 5AXBA 3Q2IA 1GUYA 3F1LA 4PIVA 4Y9DA 4AJ4A 1P3DA 2ZQYA 4F45A 4BNTA 5EERA 4BQRA 3ETGA 3E1KA 1IY8A 3ZWBA 1DEHA 3VH4A 3WIDA 4OL9A 2VUTA 1T4DA 2B4TO 4E30A 2QX7A 1EK6A 3PHHA 4OAQA 4YAEA 2NTJA 1JTVA 4CMIB 4GMFA 2XPCA 1PL7A 3WTCA 1ZVMA 1I0ZA 4JXKA 2FR0A 2FPGA 4U7WA 1HL3A 3CTMA 2OO5A 3HFSA 1B16A 3DTTA 4YWJA 3GLQA 2ZTUA 2WM3A 4DUPA 1VL6A 3DBLB 3VH2A 4GH5A 5CAEA 3JQ7A 2ZTLA 4E5MA 4I5EA 4OYRA 2VYNA 3H2SA 4B3IA 2YV1A 1WDKA 2Q2QA 4CM7A 2CDCA 1XWFA 1V35A 1QSGA 1EVIA 1K89A 3H3JA 2DBRA 3TPCA 4DLAA 4C4OA 1HWYA 4OO3A 2VWPA 5K9ZA 1VKOA 1KY4A 2V6GA 3UFXA 8ADHA 3PHGA 1KETA 4WCFA 3H4VA 3ZWCA 1GPDG 1NHWA 4YJGA 3WTBA 1PS9A 3GUYA 2BGKA 2IEBA 4XD2A 3WQQA 5ITVA 1HTBA 3KV3O 3K30A 3RD5A 3AUTA 3IS3A 3T7EA 2NQ8A 1JLLA 5A05A 4JBHA 4ND3A 3QWHA 2NM0A 2O4CA 4PLVA 4B7UA 4UULA 1ZXBA 3W4JA 3OEYA 5JYEA 1PJ3A 2C59A 1B8UA 3KOUA 2X9GA 1B3BA 4IIVA 3BIOA 4J2HA 1HYHA 1NPTO 5A9SB 3QWAA 3WYCA 4S3MA 2RBEA 5IZ4A 3D3WA 5F1OA 3FRJA 1PGPA 3DWFA 2VZ8A 3FR7A 3RC7A 2P9GA 3MJCA 1WMBA 3E9MA 5AXAA 1HDXA 1IHYA 3G17A 5HA5A 3L07A 3WYEA 2PA3A 2FZWA 4QUKA 2PH5A 1X0VA 1LX6A 2C7GA 3OIGA 1RJWA 1R4MB 4NPCA 3OETA 4RPGA 4AJ2A 1CYDA 4RF3A 2QYTA 1PQPA 4CMAA 5JCJD 1ENPA 2GN9A 3SVTA 3GQVA 3PRJA 5HS4A 4HV4A 3WBBA 4B7CA 3JD4A 1B3RA 1GEEA 3C7CB 4RCVA 4W4TA 4BKPA 2E6UX 2Z5LA 5DCYA 2AA3A 1C1XB 5HM8A 1HDZA 1R0SA 2P4QA 4ALMA 4PLHA 2WE7A 3CZMA 4KWHA 5K0ZA 1U4OA 2DVMA 2EXXA 1C14A 4I5DA 4XB2A 1B26A 3SLKA 1KIFA 3JD2A 3QP9A 1DHRA 3ANNA 2NWQA 2VRCD 4FB5A 1XKQA 4KTTE 4Z3DA 1PL6A 4KUGA 2GERA 1YO6A 1QP8A 1XU9A 1X1EA 3GDOA 4IJWA 3DEYX 1I3MA 4CLRB 4WECA 3R3JA 1N7HA 5B12A 4NJOA 3RFXA 3NT2A 2X4GA 5CEFA 4DL9A 1I32A 2OBYA 2B4RO 1YQDA 2DFVA 2X58A 3N58A 4WLOA 3NDJA 4J43A 1EVZA 3GMSA 2BFAA 2HUNA 2X8LA 5CPFA 4TRRA 1A27A 3DHEA 1NAHA 2YHIB 1ZZEA 1QV6A 1ZMOA 3SJ7A 2ZQZA 1ZSNA 3D1LA 3I9OA 4OXNA 4QXMA 5FFFA 2NVBA 2OGUA 3I3OA 3QVSA 4RVGA 4UVEA 1R66A 4YRBA 4NBRA 5JY1A 5ES3A 5IG2A 3NEPX 2D8AA 4KQWA 4PG4A 5JYDA 1N5DA 3KYDB 1RM0A 3N74A 5CDUA 3QHAA 1DIHA 3GHYA 4M89A 2H63A 2B36A 3KVOA 3CEAA 3Q6IA 4IS3A 5B4TA 4P22A 3DMTA 3DZIA 3HE3A 1E6WA 3M2TA 1BTOA 3RBVA 1QKIA 1X15A 1U2GA 4Z0PA 4QT0A 1LDGA 4RDHA 1ONPA 2HK9A 3W1VA 3AWDA 3EZLA 1D3AA 1JKJA 3GVPA 2E49A 1JQBA 1DRWA 1VJ1A 2EIHA 2NLOA 2JHGA 5KJ6A 1Q7BA 2AEFA 5A3JA 3ZU2A 4IUYA 4PLCA 3ASUA 4CM8B 2WD7B 1QRRA 3HWRA 4L4SA 1E7QA 4GX1A 4RJTA 3ZWOA 2C5EA 2OHXA 1ENOA 1LSUA 1TVEA 3UOGA 4MDHA 2WSBA 1AXGA 3KO8A 1O89A 4MINA 1HE3A 3FHLA 3WFIA 1KC3A 3DAGA 2BLLA 1JAXA 1XQ1A 1NVTA 1NVMB 5DBIA 1VL0A 1NWHA 1MXFA 4W99A 4PG8A 4Z6KA 2DUWA 2H1SA 4K6CA 3P19A 4GAEA 4P4NA 2JD2A 1CERA 1E0DA 3B70A 3F4BA 3GA0A 2BELA 3WSVA 3GN1A 5F5NA 4R16A 2CSUA 3DBRA 5BSHA 3L9WA 3AY3A 1LDMA 4Q3EA 2J3KA 3B20A 4CMCA 1LLCA 1H6DA 2W2KA 3PDJA 3ITKA 3K8ZA 1UXGA 3MTGA 3LU1A 3ZWVA 4CMEA 2BRUA 4N18A 5DP2A 3JYPA 2GN4A 3NTOA 2HK8A 4R01A 3ZU4A 3MJSA 2BI7A 3WG9A 4BV8A 2C07A 1IPFA 4QECA 5JFOA 1DBVO 2WYUA 2VT2A 4G81A 3I6IA 3ADOA 2C7VA 3JQFC 5C7OO 1HEUA 3T7CA 3R1IA 1EDZA 2RH8A 4HXYA 4YYZA 3PI7A 4JLWA 4I8XA 2BGLA 1P74A 2P9EA 4TVBA 1VKNA 1PJ4A 1GEGA 3DTYA 4A2CA 4BNZA 4AJNA 2BH9A 1VSVA 2GF2A 1B2LA 1TI7A 2JAPA 1H5QA 2ZYGA 5FYDA 2ZJ0A 4ALNA 3KEQA 3AUSA 4FW8A 2HK7A 3LK7A 4CODB 3WNVA 4IQ0A 1DC3A 2Y0CA 1P1IA 2GGSA 2AEJA 1U7TA 3TDKA 3AOEC 3QA9A 1HDOA 1HDGO 2IYPA 1G1AA 4TQGA 3JQAA 5JXWA 1P9LA 1WVGA 2VYVD 2RIRA 1I2ZA 2D5CA 2GLXA 3A4VA 4YT5A 4IIUA 2PD4A 4BO9A 3DO5A 2DBZA 2JCVA 1ZEMA 4OQZA 2DPHA 1M6HA 4MIYA 1SB8A 1YB4A 2H6EA 2PY6A 4BGVA 2DLDA 3QVOA 5EMHA 3AJRA 3C7DB 3PJEA 1E3JA 6ADHA 3U09A 4TRMA 2PD3A 3WBFA 4ID9A 3AUUA 1GYRA 3IQDB 3ETEA 1ISFA 3BMOA 1EE2A 3G3EA 4Q39A 5H81A 4WEQA 4PN3A 2Y1EA 5A5FA 4CQLA 4FOOA 4E12A 3QVTA 3F47A 1PGJA 4D3DA 4DQUA 2VTEA 3JCZA 1ZW1A 2V6BA 4EW6A 4Z3KA 5FF9A 3BMNB 3RCBA 4JN6B 4NK5A 1RYDA 4XYLA 5MGBA 4XYEA 2OFPA 3HSKA 4HBGA 4L76A 5GZ1A 5IDYA 3O8QB 5K6AA 4HUJA 4OOEA 1UP4A 2VWQA 1GADO 1N8KA 3OQ1A 1SB9A 4A26A 5EN4A 3ZWAA 1J49A 4KDEA 1EE9A 1X0XA 1I10A 4YACA 4P4LA 1NR1A 3UICA 3VHRA 1K5HA 5B37A 1ZXLA 1QMGA 4YXFA 3NGLA 1DAOA 2X5KO 3EVTA 3LVFO 3QWIA 3VH1A 3JTMA 4DQXA 4TSKA 5F3RA 3WGHA 1CETA 3BHMA 1BXGB 1R16A 1EFKA 1P1HA 2GR9A 2JCYA 1T25A 2XXBA 4AJIA 3DQPA 3TZKA 3GZ4A 3RU7A 1BVRA 1DLJA 4IXTA 3C24A 3DOJA 2EW2A 1I24A 3A28A 1J5PA 4IDDA 1F12A 2V65A 5JDCA 2HMSA 3AU8A 1NPDA 3DZGA 1VJTA 4B4VA 1JN0A 4OKIA 4PLFA 3T4EA 1BW9A 5CEJA 1IZ9A 1E7SA 1TT5B 1DAPA 4RF4A 4IGFA 5ICSA 4R9SA 4EJ0A 3L77A 4PGFA 3SX2A 3M1AA 1HYGA 2RHRA 4B3JA 4IMPA 5G2OA 1XA0A 2E82A 3A1NA 4YR9A 3NDIA 2HU2A 4AG3A 1V3UA 1YL7A 4LCJA 4PLWA 4HNGA 3UVEA 4HFRA 1KVQA 3PHIA 2I65A 4TZKA 4CL3A 1OMOA 4CQMA 5KCZA 3K6JA 2NTVA 1O8CA 1O9BA 1N2SA 2ZB7A 2CUKA 4CMHA 1T2FA 2SCUA 4I5GA 2GNAA 4R68A 1IZ0A 3JYQA 4FFPA 5GMOA 3KHUA 4O0LA 4WGGA 2OP1A 4F46A 4O63O 1FMCA 3VPFA 5DCUA 5TRTA 5DF1A 2DT5A 3DZJA 5HBRA 1LA2A 4WNCA 4NJMA 2CMDA 2UDPA 4HX5A 3WNQA 3DBHB 3WDSA 3FD8A 3MWEB 5ER9A 5T8KC 3UXYA 1KVUA 3Q1LA 1GZ4A 5KJEA 2HMVA 4MVJM 4I5FA 5IN4A 1JAYA 2AG8A 4Q3NA 4IZIA 3PK0A 2XAAA 4NG5A 1Q2XA 2H9IA 1P45A 2Q2VA 4RLHA 4MOWA 3WGGA 3KETA 3ROMA 4U6QA 2IZZA 3NYWA 3VZRA 3ZNQA 5MDHA 4RDIA 3TRIA 2ZTVA 4GX0A 2Y1FA 2X0IA 1FDWA 4LMPA 4ALKA 1YL6A 4RF5A 1EQUA 4CM1A 4ESOA 4L0QA 4Z9YA 5CHEA 2IE0A 3WGTA 2CVOA 3BMQA 3U9LA 4RVUA 1CRWG 1HLPA 2AMFA 4TRJA 4IXWA 1ISJA 3G0OA 2W98A 1I01A 1ZEJA 3ZV5A 4J1NA 1CWUA 1E77A 1NNUA 3PVZA 4WOKA 1HT0A 4Y6SA 2YV2A 2VN8A 3RI3A 3HUDA 4XR4A 4PLYA 4PG6A 5KVCA 2ZYDA 5F21A 1DIAA 1VPDA 4B8WA 1Z7EA 2ZYAA 2PD6A 3E03A 3EC7A 4U5QA 3RROA 3RKUA 4BMNA 3M6IA 4EI2A 2X5OA 1VC2A 3ENNA 3KRTA 2EP7A 3BZUA 4NH4A 2O2YA 4CV3A 2NVUB 3FWZA 4L73A 1Y6JA 3DAFA 4AJ1A 3HN2A 5JDIC 4ITUA 1ZBQA 1K6XA 3ON5A 1R0KA 4WOJA 4MP6A 1M75A 3PFFA 4Y6PA 4Q3DA 3MCVA 3V5NA 1PZFA 1JKFA 3GFBA 1BWSA 2GASA 3QWBA 1E3EA 1G0NA 2PGDA 4FN4A 4QTZA 3GDFA 4IDEA 1DXYA 4INAA 5A3VA 2YDXA 1GV0A 5A9TA 1GQQA 1PWZA 4AJLA 2DBQA 2I3GA 2XOXA 1UXJA 5TS3A 3E18A 2EP5A 2A35A 2G82A 1A9ZA 1VM6A 4J1QA 2PLAA 4GLOA 1U1IA 2TMGA 2IEDA 2Y05A 2C2YA 3GRKA 1HE4A 1OFGA 2R00C 3FSRA 1Q1NA 4PG7A 1H9BA 3KTDA 3SXPA 3FBGA 4E32A 1J0XO 2EKPA 3F46A 4CM6A 4DC1A 2WD8A 3S1LA 3BA1A 3AUAA 4U0KA 5ILGA 1PZGA 3W8EA 2GO1A 3H8VA 4GX5A 1HETA 2X0RA 3RUEA 4BB6A 1ENZA 1H6AA 5F1PA 5AVOA 3RUIA 2VNSA 3ROKA 5HWSA 4UVHA 3STHA 4CL8A 1MG0A 1XYGA 1P1FA 3Q9NA 3UN1A 3VTZA 5FWNA 1UUFA 3DZBA 2R6JA 2FZEA 2I9PA 3E8XA 1L1FA 4EJMA 1UDAA 1NAIA 3V1TC 1U3TA 4WJZA 2Y0EA 2HO5A 3KZVA 1X7HA 5BSGA 3DBVO 3UKOA 2VUUA 4PFJA 3ANMA 1ISHA 3P2YA 3FI9A 2J3JA 2RHCA 2Q1UA 3TL3A 5JMWA 3ONFA 3ZWPA 2ZB4A 5JAQA 4BNUA 5DZSA 2PH3A 3L6DA 4GSLA 3HB4X 1PR9A 1LDEA 4J1TA 1QYWA 4CV0A 5CDTA 3QLJA 4PRLA 2B37A 3QVXA 4M55A 4BIIA 2Y68A 3TL2A 2DM6A 3GVXA 4DLLA 1EBUA 3TZQA 4GKBA 4URFA 2X7HA 4IS2A 3H7AA 1E3WB 4YRDA 2AEMA 1N1EA 4DREA 1NYTA 2V6MA 3F6YA 1LUAA 2F00A 2VYND 4WASA 2XXJA 1NQ5A 4J16A 3BTVA 4KUEA 4CLEA 4ZD6A 4JGBA 2WEKA 1CQJA 2WYVA 2JHFA 4Y98A 1UZMA 1L7DA 2O7SA 3PEFA 4M8SA 4ZU3A 1ULSA 5KJCA 4GI2A 3EDMA 1X1TA 5L3ZA 1BRMA 3I9LA 4FOSA 4JP2A 1MFZA 1ORRA 1Y81A 1U9JA 3JD3A 3KYCB 1ZH8A 4U6SA 2BF7A 1I2BA 3X2FA 3O38A 3RC2A 4ZRNA 3U4DA 4FQ8A 4BNHA 2E48A 1V9LA 2IRWA 4QEDA 2UV8A 3DBLA 4AJPA 1R37A 2DBVO 4XYGA 4BKRA 4YT4A 1QXSA 3UUWA 4IZHA 1WMAA 1XEAA 1VI2A 2YV3A 1VLLA 1YH3A 4YPOA 1P1JA 4IBOA 5I9LA 4DXHA 3LYLA 1RM4A 4NZ9A 5JAMA 2DAPA 4RVSA 1OI7A 1BGVA 2WE8A 4YVFA 3ROPA 3U3XA 4BNWA 1KERA 2EF1A 1LSSA 4XIJA 2VHVA 2ZCVA 5J23A 1WNTA 5F1KA 1ADBA 5TF4A 1JW9B 2DFDA 4LN1A 4IDBA 3Q9UA 2VTDA 3RJ9A 2YJZA 4P4GA 3COSA 3QSGA 3AM4A 1Q0HA 4FPXA 4FR5A 3BAZA 4DVJA 4WKGA 1T2DA 3AY7A 3K5PA 2NV6A 5B4VA 2VOJA 1FDSA 4DPMA 1GAEO 3JQ7B 4LMRA 2WYWA 1PJCA 3HDJA 4J49A 4XGKA 5EESA 4FCCA 4GSKA 3KSUA 5DNAA 3INGA 1QYVA 4E2ZA 4YJHB 1PJQA 2PKQO 1E5QA 4YT2A 4LGVA 3V1YA 5FI5A 2GRAA 2VZ0A 1A71A 4WCFB 2NTNA 3F3SA 1I8TA 4AJHA 1PS0A 3ZV4A 2X0NA 1RKXA 2GN8A 2UYYA 1E1KA 5U1PA 4FS3A 2HMWA 3GGGA 4JIGA 2HQ1A 1JWAB 4QO7A 1AHIA 3RUCA 1C1DA 1R4MA 2FOIA 4CM5A 1HRDA 3GPDG 1YBAA 3ONEA 3V1UA 1KVSA 4OXKA 3WGQA 4CR6A 5LDGA 2HAEA 2HSDA 3E9NA 4XIYA 3GH3A 4D79A 1U3UA 2J6IA 1DJNA 4OXYA 1F14A 2FR8A 5H82A 1WWKA 4ZQBA 1Q0LA 4BNVA 4A5OA 3IC5A 3FNEA 1YVEI 1M67A
chains in the Genus database with same CATH superfamily
2OO5C 5LZ8A 5FOWA 3K1ZA 1M6VB 4QPJC 1TVKA 1C3XA 3CKLA 4XVHA 4BL5A 4US1R 5ENZA 521PA 3VPXA 4FNMA 3COZA 2PMKA 1U3CA 4QUDA 5T6BA 2IT1A 4B5LA 1HQDA 3LF2A 1ZC4A 2AXPA 1U28A 1Y4ZA 3OZSA 3ZLTA 2QAGB 1COZA 3AP2A 3UGKA 2QW1A 3B3FA 3KLNA 4E33A 4YMGA 3D4NA 3QPBA 4BLTA 1AO0A 1VYTA 2JFPA 2VHZA 3HS3A 1GCIA 4RORA 3MW8A 221PA 5C5IA 5K3FB 2GFHA 3NCHA 1EDDA 1Z18A 4EX7A 3R7BA 4M1QA 2B4QA 3OZCA 4BPRA 2PRKA 2C5LA 5LMUB 3VO1A 4J6FA 1SBTA 1XR3A 3PXGA 1NJ5A 2QYSA 3DVRX 3WLLA 1J2RA 2QJTA 1PRYA 5IUKC 2WWVD 4F3NA 4NF2A 3AVPA 4RETA 1W36C 4TWBA 1XVVA 4QDKA 4Q21A 2ZCUA 1IXZA 4KH0A 3TZ6A 1YRHA 3BCRA 4BO8A 2WM8A 2I6XA 1RC1A 3RASA 3NYRA 4DM3A 1G21E 2EHDA 3BKWA 3JAWA 4G5OA 3OQIA 1XLTA 2JPDA 3FNQA 2DMRA 3MCTA 4JYAB 1C2YA 2NZUG 3QMMA 2INGX 3PNQA 3UK2A 5A3SA 2O7VA 2XQKA 2PRIA 5SY9A 1Y4SA 4C4AA 1R8XA 5I4KA 1C50A 3HVIA 4DTIA 1U04A 2DUUA 2I5PO 4FFBA 4JVMA 3TCNA 2A5YB 3TFOA 1T9ZA 3CV3A 1SWVA 4GLBA 2Q3JA 4XXHA 1JXQA 1D2CA 3EF3A 4UMEA 3ZCXA 1PT5A 1T1SA 3EEQA 3EMKA 3V4RA 2HIAA 3R0ZA 3HLYA 4CV1A 5AVXA 4LDAA 1TW2A 4AWXA 4DMHA 3IEVA 3EDCA 4DZZA 1P0PA 5H9VA 2BMAA 5BMOA 5IJWA 2VQ6A 1ZJ5A 3GGJA 1KI7A 1K6EA 1LGYA 1W5SA 3BE4A 4O2AA 2J9XB 4JY7A 4GQBA 1WUYA 5JXHA 1UCFA 4ZYXA 4I14A 1QFSA 1J9ZA 4EI8A 3DT9A 3SBDA 3EEIA 4H08A 4IMRA 2GVZC 5CCEA 2YTZA 4LBVA 2Z57A 1G20B 4POOA 1J5EB 3W2GA 1AKEA 2VTBB 2Q3EA 3IQEA 5C32A 5DK4A 3DFZA 5HJ5A 4FMCB 2ZI9A 4KQ9A 3EA4A 3CCCA 1I3KA 2GEKA 1YR3A 3ZY3A 5IAOA 2O5CA 5KTYA 2MCFA 3FYCA 1WKCA 2PZJA 3OIFA 2EFEB 3IR5A 1E6KA 2Y99A 4S0ZA 1A97A 4IR7A 4JJ8A 2HF8A 1OI2A 2JEOA 2LGJA 3WLNA 1L5RA 3QRWA 4RBNA 5E95A 1GTMA 3AJEA 4QQKA 5AHXA 1QPZA 4G0VA 3F73A 4F56A 3GFPA 5AI5A 1HDEA 4WTOA 2FSSA 1H5UA 2GXUA 3WGKA 1JKJB 1K08A 1KZGB 2HMTA 2V7WA 4DY6A 1N3YA 3LVQE 2BLNA 2J30A 3S2IA 1U0GA 4FW9A 2MR6A 4UHDA 5CGQB 3CUYA 1MA3A 1N4DA 4GPAA 5JAUA 1WXIA 3ETLA 4NOJA 4U8HA 5HJ7A 2C2XA 2BV3A 3ACDA 1UBNA 3K09C 3VU0A 5KSYA 1W8IA 3FTCA 2P7IA 1Q1ZA 2HUPA 2ZYIA 3R5SA 3UMSA 3W78A 1GZVA 2AOXA 4DCPA 1YFLA 3HUEA 3K0FA 3K70C 4LUCA 3KZCA 1R4AA 4YP1A 5KNBH 4KJXA 3VX3A 2CJWA 1ZY2A 3FTPA 1A96A 1M1UA 1W85B 3CO0S 3WRXA 1XCGB 3BOSA 1Z68A 5ITWA 1U6JA 3DDZX 3JQAD 4BX0A 2PU7A 3BJIC 5G0SA 4L28A 3NHSA 4ICIA 3OZEA 4TVOA 3TO5A 3A9VA 3FF4A 2GBGA 1GRVA 5LP1A 4IO1A 5JV5A 5ICMA 3S8EA 2Q0SA 2UZ4A 2L69A 2UZAA 1V5FA 4WXEA 5HOQA 3H6GA 4PBRA 1L5HA 5CNMA 3MJTA 3VKUA 3TE6A 3M6XA 4M4SA 3IUYA 1LSOA 3EXHA 2G70A 3WXBA 2EQAA 2QBYA 1ZRMA 2V8OA 4EKIA 3LWZA 3L0DA 3SSMA 2D8MA 2Q9AA 1E2MA 2ZI3A 4N5LA 3VHXA 1FSPA 3S2FA 4RADA 1PE0A 2HLPA 1INLA 1MW9X 1R1DA 1XZKA 3D64A 3OCUA 1ML4A 3PX3A 1IPHA 2KBFA 4BQFA 2QIOA 3HR4A 2FMXA 3DZ8A 4D56A 4IOLA 1ECGA 2HXGA 4OP3A 4U2KA 3E7DA 3ZVNA 3GT4A 2Z1NA 4X7RA 2C2MA 4XR9A 4D7AA 5FPPA 2Z5VA 1OXBB 1OH7A 4UUQA 1SBZA 4AULA 2WPNA 2CNWA 3I6YA 4AL4A 2ZRLA 3COYA 1U2GC 2HSGA 2IXBA 3RV3A 3QVJA 2O14A 3ZOZA 3PNYA 3W7VA 4CI0B 4DA6A 3OEEA 1AV6A 3M0EA 2UXCB 4FE4A 1QYXA 2A58A 4TLCA 3OKPA 3BJZA 1SQSA 4QQRA 4P7JA 1PR4A 1RRMA 1TQDA 5AOBA 4H7FA 1PJLA 4S35A 1T1GA 4HOYA 3FYUC 3BGVA 4JBGA 4LRTB 3SVZA 1QO0A 2O59A 4W9NA 2CXXA 2JFZA 3A9RA 3WL4A 3O3NB 4HGOA 4UQPA 3OH8A 4A0SA 1VIVA 2VJLA 1SD2A 1EQ2A 4XLLA 1AHHA 4BVLA 4YECA 2W2LA 4DT1B 5A4MS 1ZJ4A 2SKEA 4D4MA 3WL5A 3KXPA 4FE7A 3C85A 3AGPA 3EUAA 3IVAA 2G1KA 2GZSA 2JHAA 1B1AA 3HZZA 4XQ9A 1WW2A 2GCGA 3A06A 4FTWA 4ZODA 2BEJA 4X6YA 1I4WA 2Q5FA 4YIHA 1OI3A 2ZB3A 1Z0IA 3UXEA 1S8FA 1DIBA 1PK8A 2IPXA 3VTFA 4AZSA 3I28A 4FHFA 1PJ2A 4HNVA 1RRPA 4P86A 1H2ZA 5IJAA 1WR8A 1YVUA 2IF0A 2QB5A 4NAVA 1E61A 1HZJA 3DNMA 4LE0A 3U31A 4P2BA 3T4XA 4D57A 4EY6A 2OVFA 1RI5A 1WU8A 3CIFA 3PHBE 5CM8B 1N6LA 3INRA 4ZA2A 1V9SA 4CM9A 5C81A 3WJAA 3GP8A 3GA5A 4FR0A 1ZJZA 5DFAA 4IO0A 5D86A 5FL3A 1HNZB 1I1QB 3FTQA 4EMUA 2WUEA 1ZUIA 4L8WB 2FEMA 5ALZA 5C7IO 1X1DA 4POAA 1XGKA 2XB6A 2XX3A 3EDOA 4GMHA 3G5AA 4K9DA 4QSMA 3OJFA 1CQPA 1V3TA 1Z06A 2AN9A 2E4WA 3GFSA 1RI2A 3GUZA 5JSZA 3PWKA 4G85A 3DAPA 1W76A 5HP4A 1FXUA 1W1WA 3QPUA 4PLZA 2R44A 2C83A 2P7HA 4H0NA 3Q85A 5FWXB 2ZSAA 1KY3A 2B8NA 2REQB 4HAOA 2CCGA 1RWVA 2IDMA 3LXXA 4OB7A 1CT9A 3W6NA 2PZEA 3ZX5A 1U7OA 1I33A 2GJ9A 2H4YA 3C3AA 1E2PA 4RQTA 1AS3A 2P2LA 4CQMD 4HH0A 1FP6A 4IJKA 3DBIA 3HDHA 2ATVA 4M9QA 4P34A 5JJKA 5H4GA 2JK1A 2NSYA 1EFLA 4V24A 4PQFA 3E2IA 4LHYA 3NT5A 4JXXA 1TQ8A 2Q9UA 2EW8A 2ZANA 3QY9A 5TVGA 3D8HA 3VO8A 5LUAA 2BTQB 2J4DA 1EFDN 1K0UA 1XTSA 3LUBA 3ND6A 3OX4A 4B09A 4L5AA 4JASB 4JSTA 2Z5GA 1LNQA 4Q1FA 4CEIA 1YS4A 1Z29A 4OBXA 2J5KA 1U3WA 3EX7C 2WNHA 4AP5A 1DC8A 2XB2A 1KZ9A 1CY0A 3AFMA 3TFQA 1VHDA 1WF6A 1W2WB 2ACKA 2A86A 2Q4RA 2FQQA 2PCJA 1PG0A 1VGVA 2ATCA 1WXEA 4WI1A 1Y8QB 3KHSA 2RARA 4XIIA 3SQLA 2AHRA 4V2IA 2GNOA 5EFOA 3L82B 4DDKA 2R84A 4BV3A 2ZZKA 5LOVF 4U7GA 3W3AD 4A8TA 4WBXC 1KJJA 2ORIA 2XNKA 4J2OA 2M1XA 4Q9IA 1U2ZA 5FI1B 3R5XA 4XX0B 1P0IA 4FSHA 1IWPB 1RLJA 1FQOA 1XF9A 4X9XA 4HUQB 3F4KA 2EG9A 5CT4A 5FBWB 4MS4A 5A6VA 4FFRA 2ZSFA 3WMGA 1L9XA 2RDMA 3LLCA 4LOKA 2CXQA 3GGDA 1BH6A 4Y2VA 4RKEA 3DFFA 5SV2A 2IU6A 1IULA 2OG2A 1GU7A 2OBLA 5MGNA 3NZEA 1XJWA 1F3OA 1LQTA 2O2IA 3AF3A 3G1UA 1VP3A 3D6TB 2L2QA 1S9HA 3JQ9A 2VQSA 1ZIOA 4GMKA 1KI4A 4BO5A 2DZDA 4CDNA 2X4DA 2B5VA 2X9VA 5KAMA 3PLRA 2J0UA 2CHFA 4JVLA 3JWEA 4EA6A 3QU7A 3IILA 3K53A 1I5RA 1ECJA 4CYMA 3AHEA 1VMIA 4PXSA 2RHMA 5E6RB 3PFHA 4NFLA 4AUMA 3CONA 5ADHA 3NS7A 4MA5A 5AW0A 1GPUA 2XUKA 4Q3CA 2R7NA 1G19A 4JC8A 4QHSA 5G4KA 4PVCA 2R8EA 3FX2A 2J4CA 1U0HC 4KO1S 2Z95A 4XDHA 1M2OB 4WLEA 4DPLA 1O95A 4QPPA 4NV0A 2VK4A 1DB3A 5DM0A 3LV8A 3Q7QA 2BT4A 1KEVA 5A0VA 1JECA 1G8FA 2P6MA 3C87A 1ESNA 5CFZA 1TUBB 4PYMA 3ZV6A 1SHKA 1G5HA 1NQOA 4MUMA 3ZHOA 4HDQB 1W6RA 4QPDA 1WDMA 4HXGA 3TBHA 3IMGA 4JP3A 5HE9A 3BCSA 1Y5LA 1QH9A 1TM4E 1LVUA 3PPIA 1EFPA 4J76A 4D26A 3KP1A 1UQTA 5F7ZA 4DXDA 4DM7A 2ZAMA 1KVRA 1D1TA 1NVBA 2XUJA 3E22A 3M1LA 3T4PA 4EVQA 3GDGA 2MMGA 4ZCMA 3OCVA 3DFKA 5BV2P 1NF8A 2ZJ1A 2HADA 4B81A 1ZD3A 1EGMB 1ACMA 1H23A 3HHEA 4PM4A 4OMFG 1HSZA 2A7XA 4CKWB 4ZICA 2RGRA 3U4CA 2Q6TA 5EYPB 2P5UA 3WICA 4OH1A 4B6FA 1PQWA 5FPTA 4RULA 1W48A 2C8VA 3ESRA 5EUCA 1U8EA 1RZUA 1OXUA 4FZ5A 2OP0A 3EGXA 3ORFA 3EQ8A 3C8MA 3IPYA 4N82A 5G0WA 4B82A 3G7UA 5J2UF 5DVZA 3WJ7A 4EHKA 5KNDH 3V8QA 4D4JA 1GQSA 3BXXA 2QG4A 2UYCA 2Y76A 3QBJA 2O1XA 5ERGB 1WZ2A 4K46A 4H7DA 2IELA 1TIPA 1DLIA 2AOVA 2H17A 2H29A 2ODWA 2QZ9A 5EIOA 3OX2A 4WNAB 4ARSA 2H00A 1C7EA 1T4GA 1W0CA 2UYGA 3MQ2A 4LEIA 3TOSA 3DPIA 7AT1A 1A4UA 1YUNA 4AY4A 2Q50A 4YRCA 2LKCA 4IIJA 3OAAD 5HRAA 2ETVA 2LDXA 4LFCB 1RKUA 2AE2A 2IXTA 2PCLA 2RHTA 2DFTA 3DUWA 3Q88A 1HMYA 4BTVA 2QN9A 5CDHA 2QMQA 4N39A 3WGIA 3COVA 1EUQA 2XAUA 3ELUA 4UEQA 4W7IA 1EFAA 4XKJA 4BEBA 3BHIA 4F5DA 5LOVB 3C1OA 3L7BA 2F9MA 3D6UA 3TR6A 3U4HA 4Q1BA 3MILA 1NUUA 3BDVA 3OTIA 2CLHB 4NL4H 4XDZA 2PWPA 2IHVA 1PJZA 2V59A 4YMLA 3KAKA 5JZVA 3HDYA 1QMPA 1HE2A 1Z74A 1OV6A 2Q3CA 4H6VA 5BWLA 2A0XA 1BQ3A 2JFWA 4GWGA 4RKQA 3ICOA 3ZGXA 3ZW9A 1ZD9A 3ZCVA 2C1ZA 1ATIA 1N0WA 5FUWA 4C7OB 2FZVA 5H83A 2XJ9A 1ENYA 1KNXA 3E9QA 1QDUA 4QG3A 3GT0A 2EERA 3GOHA 4JX9A 4B8YA 2QOEA 4URXR 5FEUA 1IM8A 1LI4A 4G8DA 3B6EA 2YBDA 3QYPA 3JV7A 2GAFA 3MS4A 5CVEA 3DH0A 4MKRA 4KR3A 1JE1A 2NV2B 1T4MA 2HXSA 2OKGA 5DSTA 2NMVA 5BYBA 3CLUD 2WTEA 1ML3A 4HDMA 1YS7A 2DPXA 2JAUA 3UMBA 4RFLA 4D6YA 4IXMA 2W4QA 3PC8A 3HA5A 2ZT7A 3LFUA 2JLWA 3RVNA 4JB2A 4BLUA 1F6WA 3I5YA 2NO9A 4LTDA 4H7JA 2R97A 4I7EA 1VE3A 2R6GA 2C4VA 4IGIA 4BNKA 2PGNA 4BNGA 5IXSA 5K6RA 3VNUA 1SQGA 3Q11A 4O4HF 4MHTA 4LSZA 3CPJB 4YRRA 4LYAA 5K01A 1Y3FE 3LOPA 5CK4A 1RWBA 4X1IB 3H19A 2A84A 5CVVA 2UAGA 3FPJA 3C1TA 1KK2A 2WWRA 3PICA 3NONA 4XYBA 4AKHA 5LYJF 4NU8X 4PHHA 3K0BA 2PUGA 4UJ5A 3JW8A 4LY6A 3RT7A 1KZ1A 2YRXA 1HKHA 2P2GA 4DR4B 1P72A 1C9JA 4PLPA 5BSFA 4FYKA 1M2JA 3V6LA 3EWAA 3CMCO 3PQ4A 3PDIB 1X7DA 1DJQA 3QUTA 1OA1A 1ZD4A 3PG5A 4H7PA 2Q8NA 5DDIP 5KMGB 1NG9A 2O5VA 3BGWA 1EWVA 1MB3A 1Q7CA 2J5QA 5E8JA 1X9HA 2IXFA 4NRDA 5CK5A 4YAJA 3D2BA 4BCDA 4A6EA 1G1MA 1T5TA 3A9WA 4FOPA 2FN7A 4R81A 4XB1A 5AJHA 4A82A 1RMTA 4AX8A 1I2CA 3HN7A 2JFNA 4AKEA 3IDOA 2X5JO 1XD2B 2A9JA 3C48A 1PK9A 4O5AA 3UK7A 5IHXA 3H6KA 3KZ1E 5J2UB 3P97A 1YR9A 4TYMA 3K6RA 3PXXA 4IDCA 2OCIA 3JVIA 4DILA 3RG2A 4M0FA 5EWJB 1Z73A 1EFHA 2X42A 3BTUA 5JE8A 3ZJ4A 1IN4A 1EJ6A 2C4TA 3CH7A 2QQFA 9LDBA 1NW3A 1UJ5A 5B1DA 3IH5A 1LJ8A 3HSSA 1YONA 1EJ0A 2GKGA 1AUPA 1FVHA 5HK8A 4UEKA 4ZOAA 1S7CA 1K9VF 3Q0EA 1UODA 4TMWA 4WLNA 3TMKA 1GDHA 2D59A 2I76A 3VNQA 2P2ZA 3VZBA 4E09A 4YPVA 4HGZA 2NO6A 2WHPB 5U4QA 2P91A 1FUIA 5I3CA 2HWUA 3QG1A 3ZDBA 5F33A 2AMLA 4QDOA 3M5WA 1LH0A 2CLKB 5HQTA 1C0KA 1VSBA 1FTYA 1U6IA 2B20A 5BT9A 1U1CA 3IE0A 4R8KA 3ZJ5A 2F90A 3G9TA 4BRUA 3M6FA 1KI2A 3GEIA 2XVZA 1ADGA 3MBKA 4XA8A 3W77A 3K3PA 3PEWA 3PT9A 2I3BA 4II3A 4BLVA 5AOVA 4IKOA 2GLTA 1LRJA 4RY2A 4J4TA 5HOEA 4ZQGA 3UW1A 4BMVA 4INOA 4FC6A 3VYUB 3S55A 4RZIA 5K0SA 5JOQA 2V96A 3C6BA 5EXEA 1K9SA 1PW7A 3GAMA 1BHSA 1NV8A 2ONJA 1FP2A 2QLLA 3H87A 2C03A 3GO4A 1CB7A 3I6BA 2WMDA 4R2JA 2JRLA 3I23A 2AOUA 1H2FA 4G9GA 4QXPA 3R7NA 3W8RA 2YCLA 3TW6A 4I9HA 4MNTA 4DYHA 3BHNA 4JSYA 3UHAA 3I1FA 3EXEB 1GA4A 3KQPA 4JJ6A 2MYNA 5G4LA 1SZCA 1Z15A 2FPGB 2X8JB 3KLPX 4NNPA 2JGKA 3AESB 3T5TA 1NMQA 1AQ6A 4B3HA 1KWGA 1IDOA 5FTKA 3FWYA 1OJ7A 4KQXA 5AJXA 4EY4A 1NQVA 3MQFA 1HX7A 3WL3A 2OWDA 1QHNA 3R6LA 5KPJA 3I9V1 2VAXA 4CQJA 5JTUA 3WA7A 4W5QA 1T6YA 2FZGA 5G0UA 4CW7A 2BYTA 4OQNA 2BM8A 2H92A 2CFTA 2QW0X 2W8BB 1IY0A 3CF2A 3EPPA 4EA8A 4F21A 1XMVA 4O4HB 4WPGA 5TPWA 4B83A 3KB6A 1YA4A 2A0FA 3HG7A 4I4CA 5G0TA 4Z2AA 1H2BA 4LECA 5JNUA 3CLUC 1FS6A 4OIMA 3VC2A 2YJTD 1KEEB 2QL9A 1IDN1 4XI9A 1WV1A 3SN6A 3RSOA 2OOKA 2YKGA 2WDPA 2XZTA 3MFQA 3ROXA 2EKQA 3KKNA 3AM1A 2XNDD 1KDRA 4C4TA 5DHAA 1POWA 1MJHA 1A4IA 4WGFA 3VYTB 4CBVA 4WKBA 4KHPB 2FZ5A 1FMJA 2WF7A 3OMXA 3NHYA 4GBMA 4TXLA 1H3FA 1OGJA 3NR2A 4R3NA 1AY0A 1VCIA 1E1NA 2AVDA 4MV0A 4MI9A 4WZBB 5J59A 2VJQA 2C7QA 1T15A 4DZTA 4C7KA 4US2R 1H05A 1VHWA 1J2EA 3I01A 4KSBA 3AL3A 1P2UA 1X7WA 1TO6A 2YUIA 3VU3A 5LQMA 3QVMA 2DETA 1DKOA 3GFRA 3OLXA 3PUWA 1M34E 3BGDA 2PZ8A 5DULA 2I2CA 2P9CA 3QXSA 1JHMA 5AVKA 1U7DA 1Z9BA 4FT2A 3BHJA 1KI8A 1PT8A 1F2VA 4GPD1 2WPDA 5TIIA 1BDBA 4WIAA 3WDLA 5LZ4A 5GV8A 1V0JA 1CRQA 3A6LA 4DA9A 2V58A 2GAAA 1ESDA 2HRBA 1C1XA 1HG1A 2X8BA 1Z0KA 3T7KA 2HA7A 2R68A 4II7A 3V8MA 3L40A 1FDTA 2PKRA 1HDYA 3ANTA 1GNLA 3S44A 3IUPA 1VRVA 5ENVA 1FRNA 3SZOA 1N6KA 3QPWA 2OQIA 4HYTA 4ND6A 4XGNA 1HI9A 1BHO1 4UFNA 5A02A 5AKIA 1E92A 1ZHFA 3E48A 3M70A 3FNHA 1E2BA 2R8YA 1DO0A 3B6ZA 3NFRA 3OJEA 2I7VA 4NBVA 3GVHA 5EY5B 1DFIA 2IEGA 5JAPA 1VBMA 2OCBA 1PJSA 3HQ4O 3NQ41 1IYZA 2BI4A 3DEFA 4KXFB 4DV4B 4ZAWA 4PO3X 2P1RA 3KR0A 4Y1FA 5KKCA 3LZDA 3T5AA 4RA6B 1N0VC 2YXBA 3TQTA 3BORA 4G5XA 5FWYA 1DKLA 1GITA 1UWVA 4LV6A 4RHYA 1RZVA 2GN6A 3ZWXA 5CU7A 3PFIA 5K0FA 2O4UX 5FHRA 3KT0A 1G16A 4BO3A 4B71A 2IOFA 4QJIA 5AW1A 3D6HA 3MMZA 3N2KB 3L1JA 3MRTA 4L9WA 2XMPA 4URWR 3I9V6 1M3SA 1J24A 4QJ5A 2X4IA 1WPQA 4LY9A 5J43A 5IKEA 5KYUA 1I1OA 4HNAA 3OSZA 3G79A 4IDUA 1KO8A 4CTKA 3ND5A 3TW8A 1QTIA 4RM3A 1P2FA 2GWRA 4HNHA 3WO1A 2F2TA 1ZUD1 4ZOLF 1OX4A 3RAGA 5IPFA 4Z53A 4BEVA 3HCFA 5T4FA 1NOJA 2C77A 1XCBA 2RHHA 3HM2A 4MWBA 4ZI2A 4DWVA 1ZK4A 3QE4A 5H1YA 2FEKA 3K2QA 2ZUEA 3QI7A 4HDSB 1E5XA 1KP9A 4PZEA 1SOAA 1WJGA 2E55A 4AY2A 4ZCTA 2EZ8A 4DUGD 1NL3A 4JIMA 3W9SA 4ATNA 5LDHA 2WG1A 4L9RA 4UVDA 4OGKA 2FF7A 5EAIA 3ZHZA 1ZUHA 1L8LA 1GNQA 4EAAA 4OHCA 1E1LA 3UT5B 3HHPA 4F1KA 3BEDA 3U7EB 3B6JA 3PE3A 2FV8A 3GRAA 1QGDA 3HKDA 4BNMA 2PUAA 1XNHA 3NATA 3HYCA 3N76A 5KYYA 4E2XA 3HEBA 3W2FA 3NHWA 4KO4S 2ZJ5A 4C7JA 3G9QA 3W3ZB 3GNQA 2O8NA 3B89A 2HSZA 3Q2KA 3BN3A 1DXHA 2XE8A 3ONVA 4P32A 3RIXA 2ATEA 4HWSA 5FO1A 1VPWA 4G89A 2ZKLA 3EIOA 4MR8A 4WA7A 3WYAA 1BD3A 5K51A 3VGJA 4Q4HB 2WVHA 4QUEA 3KELA 3ZHRA 4KNWA 5CURA 2E4VA 2WM9B 1QUFA 1Y48E 2SICE 3GRYA 4JC4A 5EVJA 3WLFA 1QZUA 1U0SY 5ALNA 3ZD8A 4A5SA 1Y9JA 1M0WA 3ZE8A 2GHTA 3JYNA 1CW2B 2BZ1A 1FW6A 4DBLE 4GRAA 1B93A 4HYYA 3ZCUA 1U4NA 1ODLA 1MO5A 3F7NA 1YF3A 4FCTA 3OOHA 1FS5A 2FU5C 1ABEA 4TV9A 3W7AA 5J47A 2ZVPX 3DLCA 3MM4A 1XDWA 4QYTA 1YBFA 2VDNB 5DU2A 5B53A 2PKXA 1RHKA 3FMPB 2QSZA 3GCGA 3MGBA 3M49A 5LP6F 1M5RA 1NJGA 1ZLYA 1XZGA 4L8VA 1IHXA 4Q7JB 4TT8A 1YCGA 3UCXA 2C3PA 2JLQA 4EVIA 2IIVA 4BO0A 1H65A 3DOHA 2NSHA 1UJMA 5JS8A 3ECAA 4O29A 4RO0A 2ZYVX 3PUHA 3UF0A 1SA0A 2OCDA 3SPXA 3PEYA 1MABB 5CVUA 3U2QA 3AY6A 1E9VA 4KGVA 3SF0A 2Z2IA 1XEFA 1NVGA 1ZIPA 3CBGA 2UVPB 2VWGA 4ZQCB 3KPVA 5EQDA 5JMPA 3SLGA 4C6HA 4CF4A 5KX5F 4BGPA 1XTUA 2HNAA 2Q99A 3OE7A 2PRJA 1RAHA 4LA4A 1NRIA 4HMPA 4O4IF 3WLPA 2WJWA 4Y2SA 2IXEA 5F12A 2CLMB 3G2MA 3RAJA 1Z3CA 2QU8A 3BJEA 3CRQA 1ZI6A 1UPXA 5L51A 1GDTA 5DMXA 2VH2A 1T6NA 1TZKA 1QIHA 4X61A 4LNAA 2E18A 4OXRA 4YRMA 1PHPA 4MVJD 2MTBA 4QU5A 5HDBB 5GM1A 4QGSA 1GZ7A 3EZGA 2VPWA 3E9CA 4DSAA 2I91A 4LXXA 5DBEX 5WRFA 1LD3A 2JBAA 1S2DA 2DG2A 4QU0A 3EWSA 4GM0A 5K7SA 4R5MA 4HH4A 1BMFA 4C89A 2B25A 3PYLA 1S3IA 3K9BA 3IT2A 4ZK6A 1EX9A 3EZYA 1PSWA 3H99A 3IDSA 1MVNA 4IH9A 4O8ZA 4PZZA 3ROGA 2DWPA 3PQFA 1IG3A 1PTJC 3AUFA 3MJ4A 2IV7A 1TZJA 4BKOA 3D7SA 1U0BB 4EPWA 1C0LA 2F3UA 4GEGA 5IAGA 3TVYA 1W94A 1XAGA 3AETA 3ILXA 3BC1A 4ZOLB 4B48A 2RK3A 1BNCA 2NT4A 3DW1X 2ADOA 3OC0A 3GPIA 4GS5A 4ENPA 5EJ7A 4TZ6A 3TMAA 1USWA 5HBGA 4Q15A 1QCCA 3OCWA 1FFDA 1XTJA 5DBFA 1X2BA 1T13A 3IR6A 3PT5A 3TZEA 4QLOA 1U63A 1QHHA 2OCLA 4EMSA 4AZ3B 1MC4A 4LSWA 1FOEB 3P0EA 4UHFA 3PC7A 1QGAA 2XCSB 1XAIA 5EJ6A 3IV7A 3UTDA 2WILA 5CD9A 3ZDCA 2B99A 4PX2A 3G0CA 1E9SA 3QVWA 4BOYA 5GVSA 3C5WP 3DHYA 4GVLA 5HQ3B 4MYSA 2WY2D 1TJ3A 3IPXA 1UXHA 3ZE2B 1IK4A 2FN9A 3O8LA 5DYWA 4E5NA 1PGOA 4XEHA 1PL0A 3TBKA 1JU3A 1Q2UA 2AF4C 5F35A 1VHJA 4FN5A 1RLOA 1ACJA 121PA 1V25A 2YZKA 5B3LA 2YJGA 1M2WA 4B3BA 3H0KA 4QOJA 2PGJA 4OCZA 1L3IA 2ZRAA 3OWXA 3HXPA 5LLSA 4PX3A 4F1JA 2RIPA 3PWSA 4YV2A 5JT1A 1JHVA 4B2YA 2FQ1A 3RTAA 4BV9A 3V3KA 2XD9A 1KRHA 2ZDGA 3OTWA 3BH7A 4IJ6A 3VDNB 4AVYA 3PC6A 4C3ZA 3HC7A 4JJ7A 2QRZA 3Q7TA 1BS9A 3VXKA 5FP0A 2BGNA 2C9BA 2IYXA 4C0XA 1FXSA 5CVTA 3O75A 2ZIAA 3AYXB 3PNPA 4H6PA 4LVCA 1N6IA 2BFOA 2FUCA 1HDRA 2W6NA 3P2MA 4DQDA 5LP6B 2RHWA 3E9YA 4JJZA 2POCA 3NKLA 4HY3A 1XQ6A 4PO8A 2C54A 4CQLB 1RPNA 4O6VA 4HPJB 2X41A 4WBSA 2HQSA 2ZPUA 1H2YA 4E5VA 4M1YA 4LCEA 2C94A 3PQ6A 4D46A 1UINA 2C82A 4BN5A 4RK7A 5FFNA 3N6XA 3NTQA 3FYSA 4FK8A 2QSJA 1ODSA 4L3WA 3EPHA 1L5ZA 2NW6A 3J7AC 4U9IS 5KYWA 2UYQA 1J20A 4BCCA 5IARA 3MRVA 3R3XA 4O08A 3Q7RA 3LT0A 4N54A 3PEVA 4DMMA 2H54A 4X1OA 1BZYA 1C0IA 4OUDB 4PZLA 1QIIA 2W11A 3EC2A 4EEKA 1A8HA 2WMNB 4RD0A 4DE5A 4DBZA 5LWQA 1QLJA 4E5PA 2DULA 2RG1A 3KT6A 4MR9A 3R7WB 2P8SA 2ZR7A 2OGZA 2PGOA 2DEUA 2DCUA 2R1TA 3M5DA 5CBPA 3HM9A 4RWZA 2XCTB 3DM5A 2E21A 3N7UA 4YCDA 4PO1A 3TW0A 1M73E 5LDDC 2PXAA 1KJ9A 2WJPA 2VDLB 1CTQA 2C4NA 1KYQA 3BL6A 4C4RA 2D74A 3S40A 2AUNA 1T3ZA 4ND7A 1LPPA 1SCAA 4IIYA 4PCUA 2EYUA 2QRVB 3FSGD 4PC7A 1ZCBA 1YR1A 2NZ2A 2XSZD 3NBZC 4AURA 1K6IA 4QVIA 5BW4A 4LJRA 3LUGA 1Q7TA 2X2EA 4AG5A 1KFJB 1XRRA 2PUHA 2BFEB 1IONA 5JYCA 2IEYA 1P4SA 3D6NB 2RAFA 4J94A 3U3MA 2B3TA 2P2DA 2XITA 2G09A 1OC2A 5I01A 2O2JA 4NFHA 4AUEA 1EDEA 1DPFA 4GDFA 4BVHA 3T52A 4WL0A 3AIMA 3T54A 2JH3A 3NC1C 1S0UA 1A5SB 1SQ6A 1SUWA 3A9CA 2OG1A 4ML3A 4YQZA 4MVJP 1APBA 1O0SA 5DV9A 3HVJA 4B3CA 1UC4B 2PVSA 3O4RA 3QVVA 1GFSA 1WXQA 2HCTA 5B7NA 5ILOA 1NVUQ 2PXCA 1XVLA 2VNKA 3VC3A 2A94A 3K0CA 4U3JB 4WEOA 4G1EB 3R9IA 3SQDA 2FE1A 1QB7A 3TIXB 4P5EA 3TIIA 1J1IA 3HWWA 4H15A 3H5OA 1MAUA 1NMXA 1U98A 4A03A 3ZVRA 4AZ0A 3JZFA 1E1MA 2KI5A 3PUXA 1RXVA 4MQEA 4QX6A 1MC1A 3EGDA 1U0FA 4OHMA 4CM4A 3QKUA 1T2CA 1V8BA 1DNPA 2QUJA 1VZ2A 4XW2A 3SEQA 4F97A 4ZTUB 1KZ4A 1X7ZB 3ZI0A 2HT6A 2JFHA 1J23A 4YRKA 1JKIA 5DYNA 4D9GA 2C4WA 3UB2A 3TQSA 2P2NA 3L43A 3B36A 2VL7A 1QRUA 5EZ6B 1NMYA 1HL7A 1KDOA 2Q41A 1KGSA 1Z6XA 3G0IA 3OIDA 3H2HA 3QY0A 1MKYA 4QVKA 3T12A 4PINA 3TSCA 1T9DA 3G6WA 4BB9A 2WHRA 1W59A 4Z1OA 5DXFA 4HWGA 2QZZA 4TUYF 2BHLA 3GQBA 2C58A 5BNZA 1B14A 1LBEA 5HKBA 1NLFA 3N8DA 3PFCA 4ZJUA 2O2CA 2G1PA 1RHQA 2MWMA 1N1GA 1UP6A 1I5EA 5D1NA 4AI6A 4URYR 2G1UA 1H1LA 3ETNA 2PZAA 2AC2A 1P1KA 3H65A 4HWRA 1EP1B 3FWKA 4QJ4A 3SHTA 2OV2A 2JI6A 5KEIA 1O5IA 1ZIYA 1UH5A 4LVOA 1OTXA 4MJ7A 5LC1A 1G66A 1MU0A 3WFJA 2IYZA 4K3UA 4FYWA 3MTJA 3SC2A 5AW6A 1KYTA 1Y1QA 1IMOA 4A3SA 2C3OA 4DIMA 3CF4G 5AUQA 1W29A 2AQ8A 1Q16A 1Q1EA 1VJ0A 2ZRDA 1E3IA 3KWMA 3MOIA 4UAGA 3IHWA 2Q0QA 3GZNB 3SS7X 5DM60 3FGNA 1PZMA 3WXMA 4CN9A 1KOGA 1U11A 3PQDA 1V3VA 1VSUA 4HCJA 2D00A 2FRDC 4GI7A 4MB0A 1KH3A 1NQXA 4HDNA 3PEUA 3RWOA 3TQRA 3ILYA 3W05A 3SY8A 1RXWA 2F64A 4FVTA 4K6OA 3WB0A 1AQIA 1XVAA 1G8MA 3IBFA 2FSVC 3SAJA 2GPYA 4E88A 3E9ZA 2SKDA 3LHKA 3CEPB 4CI9A 2VH1A 4U6NA 1S01A 2X0FA 3UWOA 5INTA 1ZUNB 2Y1WA 4GGOA 1R0ZA 4G1VA 1Z2PX 1UMCA 4OHWA 4EL0A 1NVAA 1ZH0A 3JR3A 3SQMA 3CO5A 3WC4A 4RJKA 3SFVA 4GECA 2YS7A 4IHJB 1WP4A 4MSUA 3BK7A 1L6IA 4E08A 2Y1OA 5EIWA 3OHMA 3FUVA 4D45A 2AI1A 1T34A 3D0QA 4HZUB 3W8DA 2CB0A 2KPOA 2VSOA 2GPJA 4B46A 1MRZA 4DR2B 1W88A 4HPWA 1JI0A 4GRDA 2A9KA 3CURA 1KO1A 1G4UR 1TA0A 4B9AA 2X0EA 4ESEA 1DZ3A 4UDXX 2LNDA 4INJA 2H3HA 3NUGA 4BX2A 3WIUA 1BGWA 1XMXA 3BJRA 4Q3KA 2OZKA 4HDOB 1U2TA 4TKMA 5C2JB 4ZCPA 4MKZA 2CHUA 2OCGA 4HWKA 4L8GA 4Q4DA 3WWCA 2Y0DA 3THXA 3HADA 2RONA 4ZVPA 4Q4CA 1A9PA 3I30X 3LA8A 1EH5A 1PFVA 3DONA 5DGDA 2P68A 2JAHA 2ET6A 1VE9A 2SBTA 2IUUA 3I9MA 1XNRB 1GD1O 1JHPA 1MEJA 4E5YA 1NUPA 2V6IA 1T3LA 3RTDA 1L4MA 3AB7A 4O1MA 3G5UA 1BX1A 3L7IA 4DFDA 4YC7A 2Q4EA 4MUHA 4C4SA 1ZL0A 2I4MA 2Q5IA 3R7SA 4BNJA 2VRBA 1XZDA 4MUIA 4A8JA 1M5TA 4MYRA 4ZPJA 4YY3B 2RGYA 4KQEA 4RPJA 2Q6OA 5EEGA 1ZS9A 4G0WA 1N6RA 4HSEA 4R5HA 3KC2A 2I2DA 3KAPA 2R85A 3FCOA 5F78A 3QMWA 3ONNA 1WCIA 4WJLA 4BMZA 3LC2O 1XK6A 4I6GA 4IUBS 1WCWA 4PYLA 3AFIA 2FSIA 4ARAA 1ZR2A 3DVAB 3VKFA 3L8DA 1T4BA 1MT0A 4UOQA 1H8HA 3WGNA 1V2GA 2ZI5A 1ISSA 1Z12A 4PSUA 5IF3A 1J06A 1BU8A 1H8EA 4MXDA 4C43A 3FPBA 2FG7C 4TQUS 4CMKA 1TM7E 2Q5OA 3DDSA 4Q9HA 1NN5A 1EWTA 4E13A 6CHYA 5JQGF 1NBME 1EX7A 2CVQA 4RENA 5D3KA 3GLSA 3O4HA 3A4MA 2ID9A 3BD7A 2P6OA 2JLZA 1SC3A 3P9RA 5K4HA 1I4TD 3RLFA 5EXSA 1FQJA 5AYVA 1NY6A 2DUNA 2YHUA 2G04A 3OJWA 2IHYA 1S4MA 2JH8A 4U02A 3VNRA 4TGLA 4I4IA 2EZ4A 4EO7A 3W6ZA 2ZRGA 4TWRA 5DCWA 4KWEA 3G6KA 4ND5A 4EGFA 1XNGA 2MSLA 3NX4A 1RC8A 2ZJOA 1XSEA 5CTAA 3B1WA 2O8FA 5IXYA 1ISGA 3F4LA 1U3GA 4GX2A 3EWIA 5I45A 5JS6A 3GRRA 1G6OA 3MXOA 1J8VA 1X92A 1FU7A 1MJGM 4P3OA 3ZH9B 4D6XA 5DLYA 3OF2A 5EUBA 3TS1A 4IV8A 1AU9A 1ZRNA 3PDWA 1E1RD 3AUJB 3EVGA 1ZJWA 3IP9A 1OYVA 4J3FA 2V0GA 1TYAE 1OIVA 4J91A 2IV3A 3WNZA 4QXOA 1H6BA 1HDIA 2O50A 3EK2A 4LRSB 2W83A 2QLTA 3FZNA 5FV4A 1GFWA 1GGJA 2CF5A 4NU6A 4XWAA 1V8OA 1W44A 1CF2O 4GPBA 4KR9A 1PZEA 3O93A 1N5IA 4FHZA 5EPEA 5I48A 1OTYA 4FHEA 1P17A 2QLMA 2AG1A 3ZIAD 4LJLA 5KDDA 1I9GA 4NX2A 4E5SA 4J8PA 3TEJA 1NKVA 4FEAA 3ROTA 1FRFS 4G65A 2Z0MA 2VQFB 2AJLI 1CNEA 1V5EA 4QPZA 2D5BA 4P36A 2O3QA 5I4IA 4UNIA 2FE4A 1ICIA 1GUYA 3Q0IA 4Y9DA 4PIVA 4BYMA 1HORA 1QQ6A 5IYZA 5EXTA 1GLNA 3RHSA 5JWRA 2ZQYA 5CH3A 5EERA 1RAGA 3MBIA 4YHHB 1DEHA 3O83A 4Q82A 1PYOA 3W7BA 3WIDA 4EW2A 4ZGBA 1GKYA 1T4DA 1JIKA 2CCKA 2B4TO 1Z4PX 3BX1A 4NPAA 3OKFA 4UAUA 4DAOA 2QU7A 3MT8A 2AC4A 2AC7A 3PHHA 2G0AA 2ZETA 3BRCA 4TL7A 4CMIB 4GMFA 1T5LA 3RRBA 5FB3A 5EJEA 3BDIA 1JFSA 4KQJA 1KZ7B 4DNFA 1VKHA 4ZDWA 2AYZA 3NPAA 2ZI6A 2IHJA 1TZ2A 3VR1A 4KPEC 4U7WA 3CTMA 3JASB 4S1PA 2OO5A 3HFSA 1W581 5AKLA 1QVAA 3KQVA 1B16A 2P6RA 2J0SA 3DDCA 4YWJA 1SM4A 1CUEA 2ZTUA 3V1NA 2QVCA 2WM3A 4G8BA 1D2GA 2HBYA 4RIFA 4GH5A 2GTIA 3JQ7A 1D8TA 2ZTLA 4GRIA 3P9YA 5HF6A 5GIPE 1V8DA 4E5MA 1SGWA 5KQSA 4I46A 4IMJB 1X80A 1WDKA 4ZDKA 2ZVJ