2ZCUA

Crystal structure of a new type of nadph-dependent quinone oxidoreductase (qor2) from escherichia coli
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
283
structure length
275
Chain Sequence
MIAITGATGQLGHYVIESLMKTVPASQIVAIVRNPAKAQALAAQGITVRQADYGDEAALTSALQGVEKLLLISPQHRNVINAAKAAGVKFIAYTSLLHADTSPLGLADEHIETEKMLADSGIVYTLLRNGWYSENYLASAPAALEHGVFIGAAGDGKIASATRADYAAAAARVISEAGHEGKVYELAGDSAWTLTQLAAELTKQSGKQVTYQNLSEADFAAALKSVGLPDGLADMLADSDVGASKGGLFDDSKTLSKLIGHPTTTLAESVSHLFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized oxidoreductase ytfG
publication title Crystal structure of a new type of NADPH-dependent quinone oxidoreductase (QOR2) from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 95
structure length 275
sequence length 283
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2007-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2zcuA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2zcuA02
5FI5A 1Q7CA 4NHEA 1BHSA 3GVCA 4Z0HO 1MLDA 2HJSA 3ZHBA 2ZKLA 1SEVA 2EF1A 4MOWA 3ZWAA 5EIOA 1CETA 1KS9A 4OIMA 4D45A 3G0OA 4I9HA 4DMLA 4EUFA 3B6ZA 2QZ9A 3IKVA 5AVOA 3JQ9C 3VTZA 3E9MA 4GQAA 1U4SA 3PHLA 4U6QA 1LDGA 3EY4A 3DZBA 3OP4A 4BB6A 3DBRA 3E82A 2ZYDA 2OBYA 3TRIA 4TZTA 4DMMA 5L51A 2F1KA 1H6CA 1N1GA 3JQGA 3C1TA 3HUDA 4AJKA 2QQ5A 4YACA 4E5PA 5I9NA 5JMPA 4RVGA 2VT3A 1QV6A 3AM5A 3H9JA 1C1XA 1D1SA 3JYNA 1GUZA 3KEOA 4B4VA 5A5FA 1D3AA 4RPGA 1R0KA 3ETDA 4M55A 3NDIA 3E48A 1WLYA 1Y9AA 1CEQA 4RDIA 1T24A 5IDWA 3VZQA 1A4UA 5CEJA 1G0NA 2G1UA 3ST7A 2YFHA 4ZN6A 1ISHA 1FDUA 4WE3A 2C59A 1I3KA 1D7OA 4CODB 4DGSA 5EJ2A 4RORA 3M1LA 4GVLA 1JU9A 5JCXA 4TQGA 3RC7A 2VWPA 3RUDA 1UP4A 4A27A 3JD4A 4KQWA 4XCVA 3PP8A 2C5EA 3BYZA 1BW9B 4XEHA 5AXAA 4ALNA 3IJRA 1U28A 5IAAA 1WP4A 4XDYA 1DAOA 3ICPA 4XGIA 4YVFA 1UAYA 2WYVA 5K6AC 3K2BA 3PWKA 4PN3A 4C7JA 3AOGA 2C07A 2X0RA 3DOJA 1U2DA 4XJSA 3PHIA 3PJEA 3WR5A 3GG2A 3ONEA 3DBVO 3PLNA 1A5ZA 5L53A 1YB5A 1CYDA 1DIHA 1B0AA 4UEKA 2GGSA 4CLRA 3JD1A 1QRRA 2QYSA 3UF0A 3D1LA 4ZGWA 3DAPA 5IDYA 3BMCA 3UFXA 2FMUA 2VNAA 3TZ6A 3H7AA 5GZ3A 3D3EA 3PZRA 3GEGA 2C2YA 4GH5A 3LF2A 2PD4A 5COBA 4R41A 1XKQA 3GUCA 1IPFA 3AY7A 2HLPA 5COAA 1EVZA 4LMRA 4EITA 3OSUA 4UREA 4WLFA 4BKRA 2ZJ1A 3VH2A 4A5OA 1P1KA 1SAYA 3FTNA 4GKVA 1WDKA 2AMFA 1HT0A 1BSVA 1P77A 2LDBA 5L7TA 4IJUA 4D79A 4EUEA 5JO9A 3NX4A 3FNHA 3JV7A 4UVGA 3U3XA 2BI8A 3LLSA 1UZLA 1LDEA 1LC3A 3I4FA 3SC6A 3PYMA 2UUOA 4NG5A 1I2CA 1SBYA 4YJHA 4ND3A 2O4CA 1UJMA 3DZIA 5JLAA 1T25A 2A92A 4FJ1A 1ISFA 1N2SA 2NTNA 4XB1A 2HQ1A 2PLAA 5B1YA 1B3RA 5TF4A 1M6HA 2QX7A 4U6SA 2OOSA 3E5MA 4ROSA 3GHYA 5FI3A 3RCBA 4ALIA 4CM8A 3RIHA 4LCJA 1X7DA 5H83A 3GZNA 4JQCA 4XRRA 1QKIA 5EL0A 3NAQA 2EG9A 4IGFA 3V2UA 4Q3DA 1LRJA 2H9IA 4YJGA 4PLPA 1I2BA 1Q7GA 2PNFA 4URFA 4AJHA 2HO5A 4YAJA 4HWKA 4J4HA 1RYDA 4JJFA 4DC0A 2WD7B 3H65A 3NGLA 4DREA 4B4OA 1GFSA 5I8WA 3C85A 1ZVMA 3IP1A 5HA5A 3RUCA 4XYBA 4WEOA 3X2EA 4YAEA 1R0SA 5CPBA 5EMHA 2OP0A 3ZWCA 1VKOA 1DC5A 2JHGA 1MFZA 1PZEA 1TB4A 2FPPA 5AXDA 3WTBA 1VL6A 5KVSA 1NWHA 4D41A 3HDJA 4R16A 1N7GA 1HRDA 1UAGA 1I3MA 1NQ5A 2X9NA 4W7HA 1OMOA 4XYMA 4EUHA 4M8SA 1U7TA 3TF5A 4CUKA 4MIOA 3PJGA 3UN1A 4TSKA 3BXXA 1B7GO 4FFNA 3K31A 1C0KA 2IYOA 4CJXA 1MGOA 1JDJA 2BH9A 1LSOA 2GLXA 3HQ4O 3UKOA 3NYWA 4TRJA 5IN5A 2GN8A 3U4HA 4WLUA 1E6UA 4CLEA 4CR6A 1DXYA 3PYLA 3CMMA 3WG9A 1F0YA 4TZKA 1YOVB 3GGPA 3ZI0A 1XLTA 4M87A 4LK3A 2TMDA 1XGKA 1P1JA 2D1YA 2X0JA 2X1HA 2ZTVA 2ZQYA 3AJRA 3ZNOA 1YGYA 3GN1A 3SJ7A 3JQ8B 4WLVA 1LBEA 1P0CA 3QQPA 1ADCA 3PGXA 1ZSVA 4EEZA 4R1TA 1Y1PA 2NUAA 4W9NA 3TDKA 2Q2WA 1RM0A 2Y05A 3HE3A 3N74A 1WVGA 3N58A 4Q3NA 1JAYA 2P9GA 1YB4A 1ISGA 1C1DA 2YHIA 4BO2A 3ZCXA 2NVUB 1VI2A 1X7HA 4LSMA 2Y1OA 3CTMA 4F6CA 2YYYA 4CQLA 4HADA 4AJIA 3FR8A 3U49A 1E3EA 3C7AA 3VVBA 1KVQA 2O50A 2B83A 3VDRA 3GFGA 3M2PA 4FSHA 4CQMB 5TIIA 2PGLA 3IP3A 3NKLA 2C7GA 2E82A 3PIDA 2YHUA 1LDMA 1NBOA 4NBWA 3OA0A 3SEFA 3PHGA 1IYZA 3E9QA 5ITVA 5CDGA 4W82A 4BKUA 3GRKA 1EDZA 3C1OA 2X7HA 4GMFA 2Y66A 1GYQA 1Y6JA 5TT1A 2YFQA 3GNQA 1PJ4A 5DF1A 5CHEA 1K6JA 3IDSA 4WLEA 3H6KA 3S2FA 4PG6A 1K0UA 5T57A 4N5NA 3W6UA 5DP2A 2ZTLA 2UUPA 2EWMA 3MOIA 3PJDA 4PLWA 4BO7A 2Y0CA 3QP9A 1BXZA 2JD0A 3F1KA 1EEHA 4FJ2A 4CMIB 4DUPA 5JY6A 5JY1A 3I5MA 5TJHA 2XOXA 1RWBA 2Q45A 2VRCA 4CUJA 2OP1A 2CZCA 1Z45A 1E7WA 2P91A 1ZK3A 3L0DA 2DBQA 2HK7A 3TN7A 5FFFA 1P74A 5CEFA 1Y8RA 2GYYA 2QRJA 4IINA 3SX2A 1CJCA 1X1TA 4NJMB 1AHHA 3FWNA 4EBFA 1LNQA 3DL2A 4J91A 3FWZA 4CLOB 4TKLA 1E7SA 3GAFA 3BIOA 3UCXA 3GPIA 3ASVA 3JQFC 4CMHA 3LYLA 1I32A 4JP2A 3PI7A 4RF4A 2E48A 1L1FA 4QTZA 3W1VA 3BTVA 3BHIA 1FDSA 2B5WA 4J9UE 4I1IA 1JN0A 3GLQA 3E03A 3OIFA 4U7WA 1ONPA 3DBHB 4ZHSA 1FK8A 3GUYA 2Y0DA 3L4BC 4CMCA 2IODA 4ITUA 2W2KA 3K92A 1M66A 3QA9A 2EKPA 4XZ3A 5ES3A 3GFBA 3H3JA 1DIBA 3LK7A 1L7DA 3MOGA 2JL1A 1UP7A 3L9XA 2NU8A 5BSFA 4FC6A 3KYDA 1IE3A 4HBGA 4IJKA 1CRWG 4QECA 4YB8A 4EDFA 5JMWA 5L45A 1YJQA 4FOSA 3UUWA 2DTDA 3I6IA 2PV7A 2EP5A 3JQDA 4KTTE 4WK6A 2GZ3A 4GSLA 3RI3A 4E2WA 2ZB8A 2X23A 1GEGA 1H94A 2H5LA 4HXYA 5K9ZA 2CF6A 2WEKA 4IBOA 1PQPA 1PL8A 3IUSA 3OQ6A 5DNAA 4ESOA 2HUNA 3Q3CA 3RU7A 2VRCD 3RFTA 1C1XB 5COQA 3MWEB 1DIAA 1GQ2A 3P5SA 1GZ3A 4IMPA 3UICA 1LDNA 2FSSA 3WBFA 4ALJA 2GO1A 2JD2A 4AFNA 1NPDA 1D4FA 3ZWPA 1ISIA 3GHHA 3KYBA 3DMYA 4LGVA 1GUFA 3RBZA 1J0XO 1CIVA 3EVNA 4KDEA 4AJPA 2J3HA 3QVWA 4NBUA 4Z3KA 1P1IA 3V1UA 2YV1A 5CDYA 2GN9A 3WMXA 1GCUA 1Z7EA 2PK3A 2V7PA 4J2HA 2EV9A 1IZ9A 4BHTA 2BRUA 2O3RA 1QYCA 1R37A 1O0SA 3D64A 3HG7A 1HEUA 1RM4A 2NQTA 4RPHA 1QG6A 1RPNA 3O8QA 1OI7A 2NU9A 4NZ9A 3PGJA 2J8ZA 4OYRA 4BNXA 3EDMA 3S2EA 3QLJA 3GNSA 3BMQB 4FPXA 1N7HA 2AEFA 1OFGA 1PTJA 5AYVA 3TFOA 1KERA 3ASUA 5TT0A 4DPKA 2IEDA 1R0LA 3K73O 1DRUA 1DO8A 2FN7A 3B70A 4GX5A 3C24A 3WS7A 3WMWA 3ZWYA 5EN4A 1KYQA 1NYTA 2OZPA 1ID1A 4R5HA 1LJ8A 1YWGO 3HDQA 3RFVA 3JQAA 3PEFA 4ZQGA 4ILKA 1DAPA 1EFKA 5JAZA 4YYZA 3WOHA 1VE9A 4RV9A 2RH8A 3KYCB 4DYDA 1PJ2A 4JLWA 1OAAA 4FFRA 3VH4A 3NGXA 2AEMA 4P4LA 1M2WA 1Z6ZA 3D5QA 1K6XA 1ENOA 1QYXA 3ZV4A 4A26A 1BXGA 3E1KA 1YDEA 2P5YA 4II3A 3P7MA 2B0JA 4KP7A 1YL6A 4DA9A 1A9ZA 1Y9EA 1LXCA 3HN2A 2PGDA 4O63O 4L9RA 1H2BA 4E2YA 4JX8A 4HFRA 3ROMA 3VAZA 4IDGA 3GGOA 5G0UA 5JSFA 2D0IA 4BL5A 5TX7A 2PKQO 4WOKA 1ADBA 1M6WA 3WFIA 2Q1WA 3F6YA 4NFYA 4AJ4A 1TLTA 1DDOA 3HWRA 3TSCA 4XX0A 3S55A 1S6YA 3K96A 1UXIA 1UZMA 3LLVA 5G4KB 3RJ5A 1LX6A 1NQOA 1GQYA 3GOHA 1Q1NA 1JVBA 1SO8A 5I7EA 4RGBA 4HFMA 2Y1DA 3D7LA 4AG3A 5A05A 4WKGA 1GL3A 4YJGB 1CF2O 5BSEA 3IUPA 3TOZA 2FZWA 4IDEA 4XIYA 4XGKA 4PLGA 4DC1A 1QYVA 4L0QA 2B69A 4Z3DA 4CMEA 1ORRA 4L4SA 2DPGA 3TWOA 4BV8A 2C7VA 2FR1A 1DB3A 1UDAA 4PG4A 4C7KA 4J3FA 4PRLA 1K3TA 1BXKA 1E1NA 3QSGA 3ZWXA 2NVWA 4B8WA 1M76A 3NTQA 1NQTA 2EIHA 1X15A 2NACA 3JQAD 4QT0A 4BNNA 4BNYA 2P2SA 4DVJA 3FI9A 1O95A 2GN6A 3DTYA 4K1LA 3ZN2A 1JA9A 4MVJP 3LU1A 1QMGA 4FCCA 5F1PA 4IMRA 5F1OA 4B4UA 1JWAB 3BMNB 3SJUA 3FPCA 1K89A 1YS4A 1EK5A 3UCFA 1GCOA 9LDTA 4X54A 1B8PA 2CY0A 3OHSX 2GF2A 2BF7A 3JCZA 2BHLA 1YBAA 3B1FA 4DBVO 4J7XA 5KNLA 2D2IA 2VCYA 2DUUA 1MP0A 1IULA 4WCFB 3R6DA 3ENKA 1A7AA 2NWQA 2CMDA 4G5HA 2Q3EA 4OGWA 1LLUA 3NDRA 3TOXA 1BVUA 2E4AA 5IF3A 4BS9A 5H81A 4PG7A 4XQEA 1NAIA 1PGQA 1XELA 4PLCA 3UCEA 2ZCUA 3F4LA 1XQ1A 5A9TA 1H6DA 1E5QA 4EJ0A 4CL8A 1KC3A 3RUHA 2ZB3A 4S3MA 1HYGA 4JP3A 1XEAA 4AJ2A 1ULUA 4CM4A 3O4RA 3L77A 1WDLA 4M86A 3ZW8A 3AFNA 3RQSA 4E31A 5H82A 5A9SB 4UVDA 1NVGA 3CINA 1W6UA 3HZZA 2WYWA 3ON5A 1HYHA 1PJCA 3L07A 5DBGA 3QWAA 4JBGA 3RUEA 2VN8A 4R9SA 4INAA 2O3TA 3P2OA 5DN9A 2C0CA 2VQ3A 1QLJA 1CQJA 4JIGA 3UXYA 1UR5A 3Q11A 3Q9UA 5KKAA 4YRAA 4BNFA 4R3NA 2H1SA 3PRJA 1JVSA 3AM4A 3HDHA 2ZATA 3UW3A 2HDHA 5J23A 2Q2QA 2VHVA 4CUZA 2V6BA 4BNZA 3V1YA 4E21A 2G76A 1GYRA 3KM0A 3ZHXA 1XDWA 1XYGA 2NTJA 4GI2A 4KQXA 1O8CA 1T2FA 2AE2A 4RPJA 3Q6IA 2DAPA 4UVHA 2RHRA 1PEDA 5JS6A 3GEDA 5KKCA 2J5KA 3BA1A 1O5IA 3IOYA 3PFFA 4J0FA 4RVFA 1DIGA 5HM8A 1N1EA 2LDXA 3PWZA 3ETEA 3OQBA 2WDZA 3VKVA 1EFLA 1R4NB 3BHMA 2BD0A 3INGA 5JCJA 8LDHA 4DBZA 3ITKA 1VRWA 4YA6A 4Z9FA 3EVTA 4I8XA 5TSDA 4XYLA 1V3VA 3GK3A 5JYEA 5U1PA 1KVTA 2V6FA 1R16A 4WNIA 5FYDA 5ILGA 4IDAA 1Q0LA 1TA4A 3C3XA 3KOUA 3MTGA 5JNLA 1I2ZA 3T4XA 3QE3A 4QQRA 1U4OA 2DU8A 1ML3A 5AXCA 1HDOA 5T64A 3S2GA 2X4GA 2FP4A 1E3IA 3STHA 5L7WA 3RUIA 1VJTA 3LT4A 5IFLA 5KJEA 1T1RA 3AFMA 2HMSA 3DC2A 4PG5A 4E0BA 4GAEA 1WZEA 4Y67A 2Z1NA 4PG8A 1KY4A 1J49A 1PJBA 5GZ6A 2YDXA 5CG2A 2AW5A 4ZA2A 5CEEA 3HJAA 1DC4A 3AOEC 3WYCA 2YUTA 1ZK2A 1T4DA 3VDQA 3GA0A 1HE2A 1ZBQA 2OMEA 1Y7TA 4GPD1 3OEYA 3ROKA 3A4VA 4F3YA 2P68A 2AHRA 2VHZA 4RF3A 4CMKA 2O4UX 1QXSA 2EGGA 4IUYA 3OIDA 3HDYA 4KUHA 3OJOA 3QJ5A 4AVYA 3BTOA 1U3TA 3F5QA 2AE1A 1GTMA 3U4IA 1ZUD1 3QW2A 3E8XA 4IDDA 1N9GA 2JJYA 2J3JA 1LRLA 4K9DA 1H9AA 3Q0EA 3I9NA 4CMEC 2HRZA 3ORFA 4MJLA 4ND4A 4JXKA 1PZHA 1ONOA 2C5AA 1T2CA 3WFJA 5JCJD 3BMOB 1BG6A 3I3OA 4Y6PA 3SBOA 3DFZA 4MINA 4BO3A 4CMAA 4J49A 5ENVA 1HWYA 4ND2A 4YEDA 1IHYA 4UVEA 4DLAA 1NAHA 3G49A 2VTDA 2D4AA 3H8VA 3FTPA 2W90A 4I9NA 5T8KC 4DTIA 5B12A 1BMDA 5JPIA 2O23A 3GZ4A 4J1SA 1AE1A 3RAJA 4MVJH 4ZVVA 2CD9A 3H9UA 4RLSA 3TPCA 1ZMOA 4DQXA 1NTOA 4KTVE 4H16A 4BOYA 4J90A 3AI3A 4HKTA 4YT5A 1PZGA 1V8BA 3O8QB 2Y0EA 4JBHA 4CLHA 2I6TA 2PKRA 2R00A 5B4UA 1B2LA 3GC6A 4NIMA 3TZQA 4GWKA 2X22A 2IZ0A 4CMJA 2WM3A 4XB2A 3W8DA 3O38A 4RPKA 3ZH2A 4ZICA 4BQRA 5HS6A 3TJRA 5ER9A 3FRJA 1QR6A 1I01A 1KVRA 4UULA 3PPIA 1DJQA 4GLOA 4MKZA 5JBIA 4W99A 4CM5A 3I4CA 4BNWA 3KSZO 4R1NA 4IQGA 3WNVA 5BR7A 5LCXA 2Q1SA 4ZQBA 5DCWA 1LRKA 3LQFA 1JKJA 3INRA 3KZVA 3KTDA 4MIEA 4FJ0A 3WYBA 4OQYA 5FF9A 5BSHA 5EQDA 3WXBA 5A03A 3VVCA 5EERA 1DBVO 1FMCA 3I9OA 5A06A 2VYNA 4AJLA 1F06A 4GLLA 1MC4A 1XIVA 4TMFA 4PRKA 1GAEO 4YJFB 4R68A 1HSZA 1V6AA 4OOEA 3JYLA 1NASA 5F21A 1LTHR 4G81A 2W2LD 1ZCJA 1EVYA 1X13A 2OORA 2JFGA 3NT2A 1XR3A 2IXAA 3KLPX 1KEWA 4NBRA 4ALKA 2VWGA 3DBLA 3ITDA 1ZIDA 1X0XA 3DOCA 3TL2A 3ZHZA 2FR0A 3EC7A 5F5LA 4CR8A 1VKNA 3D5TA 4BO5A 1JAXA 4ALLA 1EBUA 2OXIA 1O6ZA 3M6IA 2GUGA 2WE8A 3V2GA 3OBBA 5T67A 1AGNA 1ZNQO 3MCVA 4E30A 4IS2A 5KVVA 1F12A 2P4HX 1QYDA 2X58A 3JQBA 3JQ7B 4LVUA 2AG5A 1KEUA 1BDMA 1I36A 1OZAA 5I9MA 1HF3A 1FF9A 1BTOA 4D0RA 5L4NA 4OM8A 1W0CA 3ZU2A 2PTGA 4K26A 1ZK4A 4W7IA 5L40A 1E3WB 1F8FA 1G1AA 3ENNA 5L95A 3U4CA 2BGKA 2HK9A 3L6OO 3NDJA 4KZPA 2PZKA 1E3LA 1SNYA 4MVJF 3R1IA 3OJEA 1PZFA 3WB9A 3WWZA 4CLDA 3AU8A 2GZ2A 4OJNA 3H9QA 1UXGA 1P9LA 2B35A 2VT2A 4RVSA 1IHXA 5DCYA 3FNGA 1IZ0A 4FIZA 4BUCA 2PGJA 2Q4EA 3JD3A 4BMSA 2HMWA 4PFJA 3ADOA 4HY3A 3D4NA 4R3WA 2JHFA 2ZIZA 4RJTA 5HBRA 5A04A 1KEVA 1WXDA 4FD3A 3GAZA 4A2CA 3WQRA 5THQA 3CXRA 2VYND 4B7XA 2O48X 5IJZA 3DZHA 5C7IO 1BWSA 1DIRA 2X5KO 3RC1A 5TRTA 3KRTA 1GQQA 4NU5A 2VTEA 5GMOA 3E6AA 4GGOA 3VZPA 4E32A 1B8UA 2OO5A 4FGSA 2JFHA 2E37A 5TGDA 2Y99A 1GPJA 4Y98A 1R4MA 2AQ8A 2X0IA 4IDCA 3D3WA 3SXPA 1Y5MA 3GEMA 1DSSG 4L76A 2QZZA 4Q3BA 2VHYA 1VPDA 2CFCA 2FWMX 1V9LA 3NRCA 4BV9A 1ZZEA 3I9JA 2DT5A 3JYQA 2EW2A 4UUMA 1PJLA 1Y5RA 2UDPA 3Q1LA 2EXXA 2HMUA 4Y9DA 5A9RA 4IS3A 1UDBA 4I5FA 2D5AA 3NEPX 4CM1A 5A4DA 3HN7A 4RPLA 1P33A 4KUGA 4RL6A 1NPYA 1M67A 3OJLA 4XQ9A 3FR7A 5G0VA 4F6LA 3F9IA 3I9MA 2E6UX 2X6TA 3WJ7A 4NBVA 4IPTA 3EZLA 1AHIA 2BFAA 5G0TA 1FDWA 1KVSA 3LZ6A 2HCTA 1GYPA 4AJNA 3DB2A 4NDNE 5KJFA 1NXQA 2WWRA 4OXNA 3S2IA 5DT9A 5DZSA 3WWYA 4PZDA 3KB6A 1PSDA 1U3WA 1UP6A 3G79A 1ISJA 3ZNPA 1DRWA 3AUTA 3OA2A 1CQIA 4PLTA 1UUFA 1PGJA 2PD6A 2PZMA 4MP3A 1G6KA 3F47A 5BQFA 4YQZA 3GMDA 2J5QA 4HP8A 3VPXA 1Y8QB 1TT5B 3QWHA 2GD1O 2BI7A 2WMDA 3KSUA 2JCXA 2VWHA 4WEQA 3E5RA 4IM7A 4J1QA 2R00C 1M75A 3X2FA 2I66A 1LDBA 3AWDA 1ENYA 1H93A 5A3JA 2VOEA 3AM3A 4XR9A 3MZ0A 1DC3A 1GZ6A 2CVZA 4N5LA 4O6VA 1E77A 4E5MA 5A1TA 3IS3A 3F1LA 3GG9A 1PJQA 2Y67A 3PHJA 2HAEA 4RF2A 2GPTA 4FR5A 3RBXA 3OMLA 2Z95A 3HB5X 3NV9A 4D3FA 1DFIA 5CPFA 4F46A 3LC2O 4QFCA 3GR6A 3RU9A 1PL7A 4IJWA 1IUKA 2WE7A 3CUKA 4DIOA 4P4GA 1P1FA 1VJ0A 4NBTA 1N5DA 3FNEA 3ZWBA 2AA3A 4PZCA 3ZDFA 2ZYGA 2Z1MA 2GSDA 3DBRB 3V8BA 4BNHA 1QYWA 4N18A 2BKAA 4IJVA 4II2A 3KUXA 3DAGA 2HSDA 4J16A 3LF1A 2O2YA 3CE6A 3JQGB 4NK5A 1NR7A 4JNKA 4DYVA 1LLDA 4OXYA 1HDRA 1Z73A 5BNIA 3B1KA 2DBZA 5JYDA 3LC7O 4CPDA 2CUKA 2JFFA 4FGWA 5MDHA 1RYEA 2FOIA 1DLJA 1MA0A 3BHJA 5KJ6A 2HJRA 2Y1GA 4WJZA 3RD5A 2ZYAA 4NJOA 4B79A 3RROA 4GMGA 4L73A 2ZJ0A 2FY8A 1RJWA 1DHTA 4GKBA 4ZQEA 4D46A 2DVMA 2DBVO 4L74A 1ONNA 1T4BA 2DFVA 3JQBC 4FBGA 4OKNA 3UOGA 1PJ3A 4BNMA 1GDHA 2PFGA 4XIJA 4EEXA 3GQVA 1PGNA 1UZNA 1PWZA 5EQFA 1QLHA 5DULA 1B8VA 2QRLA 5DOVA 2BGMA 2I67A 2IRWA 4RQTA 3RUAA 2XXJA 5TJ9A 4K6CA 4HX5A 4OH1A 4YBZA 2PY6A 4FS3A 4RVDA 3PFWO 3TL3A 1DEHA 2PWZA 3OEWA 1XSEA 2I99A 1PL6A 1GUYA 3DAFA 2YV2A 5JFOA 1ZKMA 4W9NC 1F17A 2FZEA 2VUTA 3QVOA 1NHWA 2AXQA 5BT9A 4CLRB 2BLLA 1PQWA 2H63A 3JSAA 5CP8A 4IDBA 3RVDA 4ID9A 4OSOA 5DBIA 4Z0TA 1IY8A 1WPQA 3C7CB 4PGFA 5L4SA 1WDMA 1ZH8A 1ARZA 2EKLA 3BMCB 3KO8A 5T6BA 1LLQA 3PJFA 1MFPA 4B4WA 1EK6A 1EVIA 4MDHA 1DFGA 3QY9A 1WZIA 3E18A 4BNVA 1DRVA 3RSHA 2NADA 1SOVA 2OHXA 4Z0PA 3TNLA 2A9FA 2Q46A 3EZYA 1KY5A 1E7YA 1Q2XA 3KVOA 4A10A 2BMAA 4KWHA 2YW9A 3ZU4A 4BNGA 5AXBA 5K0ZA 3MJTA 1GD1O 3JYOA 3ZU3A 2I9PA 3JQ9A 3RWBA 2Q99A 1LLCA 2ZTMA 3DEYX 3ZWMA 3FHLA 3F5SA 4I9UA 5IXSA 4YJHB 2WD7A 3VKUA 3PWSA 3ANNA 4XYGA 4CV2A 4D42A 4UAGA 2ILTA 2NU7A 4BGEA 1YQXA 4G65A 3OJ0A 1O9BA 3FPLA 3G1UA 2O3QA 5DDIP 4GWGA 1VC2A 1DFHA 4PVCA 3I1JA 2WYUA 1W4ZA 3IJPA 6LDHA 4J4BA 1TEHA 5JDCA 1HE3A 1X1EA 2CDCA 3CZRA 4CM8B 1E6WA 1YXMA 2I76A 4W6ZA 8ADHA 3GZNB 3HB4X 1PJTA 1PX0A 4N7RA 4BNKA 1NVMB 5JO0A 3MJVA 4J6FA 3C7DB 1VSUA 1RM3A 2PH5A 3F3SA 3ROQA 1P44A 4MVJG 3VHRA 1HE5A 4WECA 3UAGA 3H5RA 3I6QA 2CF5A 2B4RO 2NV6A 1C3VA 1FJHA 1LI4A 3W4IA 3ZWVA 3DOOA 4U8GA 1FXSA 5L9AA 3WQSB 4LISA 3Q9NA 1SEPA 2B4TO 1QP8A 5U9CA 1FDVA 3W8FA 5G0WA 4YPOA 4QO8A 3GVPA 1VL8A 4D3DA 1PJSA 3INTA 3L6EA 3OECA 1V3TA 1EZ4A 1YOVA 3DHYA 2WSBA 1E1MA 1SPXA 2UYYA 4J1NA 3G3EA 4UEOA 4LSWA 2BFMA 3RUFA 3JQ8A 4DIBA 4K6FA 4EYEA 4YTEA 4AL4A 1GADO 1H6AA 3DO5A 4I5DA 3ANMA 4R54A 3R3JA 4BGVA 3K2EA 3PLRA 1U1IA 4M54A 3C8MA 4CMGA 4YT2A 5IXYA 2NVUA 1I10A 1DHRA 2C2XA 4FFMA 1VJ1A 3FF4A 4GX2A 2ZB4A 3MWDB 2Q1TA 4PLFA 4H3VA 1ZSYA 3PDUA 5TC4A 1VL0A 2O3SA 4IIVA 3QIVA 4RZIA 4CQMA 1YRLA 4FQ8A 3HFGA 4J1TA 3TZKA 4RZHA 3VPSA 4DRYA 1H0KA 2X86A 1NVTA 4ND5A 2E49A 2WJPA 1PS8A 4IGEA 4MKRA 4ALMA 1U8FO 4BB5A 3F4BA 4I5EA 1WMAA 3DZFA 1QORA 3D4PA 3AK4A 3LC1O 3K5PA 4R1SA 2YDYA 4KUEA 4DPLA 4IQ8A 3NJ8A 2YHIB 1C1DB 3GH3A 1S7CA 4XYEA 2XPCA 5A02A 3PVZA 3ZV6A 1F8GA 1GV0A 2OBNA 4CQLB 5HTOA 2R6JA 4BO6A 1EQUA 4N54A 4CV0A 1E6EA 2NSDA 4FFOA 4MVJE 3PQEA 3EK2A 2B5VA 3U9LA 3GMSA 5LDGA 3PXXA 3QVSA 4CMIA 4EZBA 1R4MB 3WSVA 4B8ZA 4PLYA 3LT2A 2R2GA 3CH6A 5B4TA 3WGHA 4D3SA 1P3DA 3OETA 2CVOA 4E33A 4IZIA 4MP8A 3E9NA 5C3MA 5KWEA 1TI7A 2FPIA 1JLLA 1EE2A 3K8ZA 4AJEA 3L9WA 4NJMA 1T2EA 4WNCA 5ER6A 5ICMA 1HL3A 3AY3A 2OFPA 4HFNA 4CLOA 2X5OA 4WCDA 4IIUA 4OMUA 3ZU5A 3TQHA 2EGHA 4YAIA 1IOLA 1X7GA 3WQQA 4G2NA 1H2HA 2NM0A 3LDHA 3R0IA 5JAQA 2GN4A 5JC8A 4R4JA 4YAKA 4XR4A 3OICA 3K9QO 1MX3A 3HNPA 3TFQA 4EGFA 4YRBA 3GDGA 3A9WA 1E92A 4BO0A 4CQMD 4UUNA 5TQVA 2ZTUA 4LVCA 3H9EO 3WLEA 3FNFA 5T5QA 3DBHA 4DWVA 1R12A 4EW6A 4Q3AA 4DXHA 1HZJA 3DDNA 1B3BA 2Y1CA 3V2HA 1Y8RB 3RBVA 5C7LO 1HKUA 3CSDA 2HU2A 2GZ1A 3KLMX 2VZ8A 5CDTA 1P1HA 3ETGA 4GBJA 2HRBA 4OQZA 2YJZA 1E3JA 3WGOA 4UUOA 1Z7BA 3CMCO 4HFJA 4J7UA 1MG0A 2O7QA 2RCYA 4YJDA 3WGTA 3AU9A 4TRMA 3B20A 3GT0A 2B36A 2YQ5A 5G4LA 2GCGA 4QX6A 1C0PA 4WGGA 2Y1EA 5IN4A 4PLVA 4XGNA 2UVDA 3JYPA 4AICA 1HDYA 4BMNA 4XKJA 1KEPA 5DCUA 5C5IA 1YE3A 3C1AA 1EDOA 4FOOA 1EUZA 2V65A 1CWUA 3AI2A 3FD8A 3NTRA 2EJWA 5JDCC 1UH5A 2GRAA 5G0SA 1OC4A 2X8LA 2QYTA 2W2KB 4QFDA 4L8VA 3AUUA 4ZU3A 5I8ZA 1WMBA 2XAAA 2NTVA 5B37A 4RO0A 4YCAA 1Y81A 2EW8A 1OC2A 2JKVA 5IDXA 1SOWA 4MVJM 4M49A 4F45A 3ONFA 5JAIA 2YZ7A 5C37A 1TVEA 2A94A 3KYDB 3NT4A 3PK0A 1H6BA 3AUSA 3U5TA 3AUAA 3IAHA 3ZW9A 2VZ0A 2O2SA 2ZCVA 3AW9A 3OH8A 4J7CA 1AXGA 4HNHA 4EJMA 1R6DA 4P8RA 2DBRA 1XA0A 3MJSA 3PTZA 3QVTA 2IXBA 4R01A 4W4TA 2W2LA 1U5CA 1IB6A 4NMHA 3U62A 3GY0A 5A5EA 4QSMA 2DTXA 4BIIA 4J9VA 1K6IA 9LDBA 2SCUA 2EEZA 1U5AA 3LVFO 4YT4A 3BMQA 3U0BA 1H5QA 2ZK7A 5JAMA 2CDBA 1KETA 3LT0A 2PH3A 3H2SA 2P9EA 3VPHA 4CM3A 2Q4BA 2RAFA 3ZWNA 2QHXA 4NQZA 1YBMA 3EMKA 4GVXA 1T26A 3KXDA 1EVJA 4OXKA 2G17A 3U4DA 3PZBA 3ZGYA 1H9BA 3H5NA 4A0SA 3Q2IA 1W8DA 3WX0A 2C20A 3MTJA 3W6ZA 1DJNA 2A4KA 4BMVA 5ILOA 1QSGA 1YL5A 3A14A 5ITWA 3GDFA 4DIFA 3KYCA 3U09A 2C29D 4YRDA 5GY7A 1LA2A 3LT1A 4P22A 3CZMA 3A06A 3SLKA 2BFPA 4RLHA 3DONA 1QV7A 1YL7A 4MO2A 1HDCA 1A7KA 3RJ9A 1GZ4A 1WNTA 3A1NA 3VPGA 1YQGA 2O3UA 2F00A 5CAEA 1V35A 1PR9A 4E5NA 1EMDA 1BVRA 3JQFA 1E7MA 5KOIA 1YDWA 1PQUA 2IZZA 3GVXA 4JK3A 3OIGA 5DBFA 5JW6A 4RDHA 3VZRA 3B1JA 1I3LA 1PIWA 3V1TC 1CERA 5CDSA 4XQGA 2PZJA 1XU9A 1Z74A 3JQAB 4WASA 5IDQA 1I3NA 1JW9B 3EHEA 2P4QA 1VM6A 2JCYA 3L4BA 1OOEA 4J2OA 4NH4A 1A27A 4TVOA 5DOZA 3JQEA 4NNJA 1HYEA 2J3KA 4ZD6A 5G4KA 3GGGA 4FFPA 3ANLA 4L4XA 3GN2A 3S1LA 3KHUA 5B4VA 1BXGB 4C4OA 2OUIA 1VLLA 2EERA 1P1RA 4FN4A 1EBFA 1ZEJA 3CPSA 3P19A 4J0EA 1HZZA 1I8TA 2VZ9A 3WSWA 4HV4A 2A35A 3RC9A 3ZV5A 4S1VA 4OAQA 5JDIA 3H3FA 4AJ1A 2FSVA 1PU2A 1ZK0A 1DLIA 2AG8A 4D0SA 1ENPA 4CM7A 3IL2A 3QV1A 4D7AA 1HE4A 3OFSA 2X0NA 1RKXA 2IDZA 4RF5A 2Y1FA 2GR9A 3WDSA 1E1KA 3ADPA 4GSKA 3EUWA 1MB4A 3M1AA 1XG5A 2GASA 1ZW1A 3BMNA 3DR3A 4LCEA 1XU7A 1JWBB 4JN6B 2FRDA 1IL0A 3WGQA 1SMKA 3WBBA 4R69A 1I0ZA 3OM9A 5THKA 2G82A 5TLSA 1MXFA 3EAGA 2VOJA 5EESA 2Q49A 1KBZA 2BELA 2GDZA 5DP1A 5EINA 3WNQA 1XQ6A 1KVUA 4UVIA 4WCFA 4BO9A 2W8ZA 4BNLA 1SZJG 4CM9A 3PQFA 1HDXA 5FWNA 3ULKA 3K6JA 1E5LA 4PLZA 4DQUA 4PCVA 3MEQA 5GZ1A 3DHNA 5BSGA 5CFZA 4A7PA 1R66A 4B7UA 4BGIA 4HNGA 3DMTA 4E2XA 2P5UA 4OL9A 3I9LA 1J4AA 3ICCA 4QO7A 2EHDA 3JD0A 4DQVA 5BNTA 1KOLA 2Q2VA 4HUJA 4FC7A 5EPOA 3DHEA 1BRMA 1I30A 2PR2A 2QRKA 5A9SA 1NWCA 4J43A 4NI5A 2GERA 1D1TA 4A73A 1E0DA 4D44A 3UGKA 2FHSA 4CV1A 4E13A 5KJ1A 1XWFA 4D43A 3MJEA 3EGOA 4XDZA 2VYVA 4U0KA 3D4OA 1V3UA 3H4VA 5JE8A 3RFXA 3PHHA 3WIDA 4DLLA 5KVQA 1CDOA 2G5CA 1MG5A 4JBIA 3ZNNA 4YT8A 2X9VA 3F46A 3SVTA 1HDGO 2WTBA 3COSA 4M89A 4UEJA 3IKTA 2DFDA 2DPHA 2HK8A 3NJ4A 4MVJI 5HWSA 1B14A 5ICSA 3QWFA 1YH3A 2CNBA 4CM4B 1DC6A 5HS4A 3JQCA 1G0OA 6ADHA 1ZJZA 2DTEA 2W98A 1NQAO 1LSSA 4CMBA 1I33A 1JKIA 1GY8A 5F3RA 4O1MA 4B7CA 4MKXA 3QRWA 2I3AA 4GX0A 4TROA 2VNSA 4KOAA 3W8EA 1K2WA 2D5CA 3WLFA 3DTTA 4LW8A 5KCZA 2QIOA 4B3HA 4CM9D 1R4NA 4Z9XA 4XA8A 2VRBA 2G0TA 4E5YA 5LDHA 4GL4A 1HLPA 2Y93A 3EW7A 4R1UA 2RBEA 3N7UA 4E2ZA 3L4SO 4JJGA 2EP7A 4BNUA 3MJ4A 2QG4A 4JROA 2NQ8A 5F5NA 4EJ6A 5ADHA 3FSRA 5KTKA 3DZJA 3ZHYA 4BNIA 1VSVA 1A4IA 1B15A 4KDFA 3NT5A 5KIAA 1BDBA 1U2GA 5IG2A 3KETA 1E1LA 1YO6A 1ZSNA 2I5PO 3ZWOA 4ZJUA 1OBFO 1LQUA 1O94A 1RM5A 2P9CA 4BNTA 2UV8A 3W4KA 1HDZA 5G2OA 2D8AA 2VYVD 1L7EA 4H7PA 5CDUA 3I52A 3I83A 3WGZA 5AOVA 3TZCA 2CSUA 2HMTA 2VWQA 2X9GA 3WICA 3DZKA 1DPGA 4OOFA 4MPDA 2DC1A 4PVDA 2POQX 1UDCA 2IE0A 5L4LA 1UXHA 3GRPA 1GU7A 3WGIA 4WLNA 2PZLA 5IZCA 2VUUA 3DWFA 2PA3A 3SC4A 1BW9A 3JD2A 1T2AA 4CR7A 4BQPA 3KEQA 4U5QA 1ADFA 2AQKA 3RKUA 1KC1A 1NFQA 4ZRNA 1ZEMA 4PZEA 4U0JA 1ENZA 5I7FA 1KIFA 3H2ZA 1P31A 3CIFA 2VHWA 4XQCA 2CDAA 3GVHA 3P2YA 1LUAA 3VPFA 2NLOA 3BTSA 1ZXLA 3G17A 3LSYA 2Y68A 4JCOA 1B16A 3FBTA 1N8KA 1UXJA 5LC1A 5JDIC 1ZO8A 5U4QA 2JAPA 3BTUA 4Q9NA 4RCVA 4BO8A 1NFRA 3G1TA 2PKQP 1Q0HA 4DPMA 1WW8A 5FEUA 3BMOA 5I9LA 2DLDA 1HETA 4NR0A 4YXFA 5CG1A 2VUSA 1ZMTA 3KV3O 4ND1A 1SB9A 1C0LA 3UHAA 7ADHA 1YJ8A 2NU6A 2I65A 4NPCA 1K5HA 3HFSA 2DKNA 3L6DA 4Q3CA 4WOJA 4XRGA 4H15A 5L7YA 1N92A 1YB1A 2C82A 4L4RA 4Q39A 3TZHA 1PGPA 3K30A 4P38A 3ZZNA 4E4YA 4B3JA 2RIRA 1X14A 4YWJA 2NVBA 4L75A 3BZUA 4QUKA 3NUGA 3IIEA 1NX6A 1D8AA 1N9GB 2VHXA 4WCFC 3ONDA 3VOSA 4P4NA 1T2DA 4CL3A 2XF8A 3JQ6A 3AY6A 2NNLD 1W73A 2IZ1A 1J5PA 2ET6A 5TNXA 1JQBA 1EUCA 4LMPA 4MVJA 2AQIA 3DMTC 1WWKA 3WIEA 1IPEA 3BAZA 3QWBA 4K28A 1SC6A 4NU6A 3GPDG 4YAGA 2FPGA 1EQ2A 2YY7A 1HTBA 2D3TA 4TVBA 4B3IA 4J4TA 1HLDA 3OF2A 2O7SA 4FFLA 4E5KA 4Y6RA 3RASA 1U3UA 1GPDG 4TKMA 4OHUA 1PGOA 1HSOA 1YQDA 2IYPA 5JC1A 1MXHA 1AN9A 3T7CA 3DQPA 4A03A 2W4QA 4FW8A 2Q1UA 5ENDA 2HMVA 2JAHA 2GNAA 1MV8A 4KWIA 1GV1A 4DLBA 3MJCA 1NM5A 4YJFA 2DQ4A 5F1KA 4MIYA 4CV3A 3OJFA 1ADGA 3ROPA 3WGGA 2B4QA 2H6EA 4YQYA 1LU9A 4CLXA 4OO3A 4O59O 3CKYA 3WYEA 3H5AA 1NPTO 4NFHA 1WAMA 1I24A 4MP6A 2JD1A 3DFUA 3WTCA 7MDHA 1DOHA 1ZXBA 4Y8VA 3T4EA 1XHLA 2EKQA 3GNTA 4WLOA 4XJTA 3KBOA 2RHCA 1GEEA 2V6MA 4ZQFA 4OSPA 4NK4A 3PIIA 3DXFA 1PS9A 3SLGA 1TXGA 4Y6SA 4BKQA 4IDFA 1PR3A 4TRRA 3AOEA 5KVCA 1UXKA 3JQ7A 3QHAA 2ZQZA 4IZHA 2TMGA 1JKFA 1NR1A 4DL9A 2EJVA 3T7EA 3O03A 3PQDA 1P0FA 3HHPA 1NP3A 1X0VA 1E3WA 4MVJD 3UVEA 1B26A 1ULSA 3FCOA 3H9GA 4M1QA 4TRNA 4ONEA 5K6AA 1U9JA 4N5MA 3DBLB 4IQ0A 5MGBA 1HXHA 2CVQA 1Z82A 4IXWA 1U7HA 3I9KA 3HADA 3JTMA 2I3GA 3M2TA 1PWXA 4GX1A 1XCBA 3UH1A 2IEBA 1I5RA 2AQHA 2PD3A 4Q3EA 4OKIA 4QXMA 4YR9A 3W4JA 4AJOA 5AQ1A 3O9ZA 2HKIA 1E7QA 2C54A 4IXTA 1LQTA 5BNFA 4BO1A 2BFOA 4WUVA 4BGUA 4AJJA 4JJIA 1ZK1A 4BNJA 1O89A 3OQ1A 1ZJYA 4PLHA 3PDJA 3Q2KA 2JCVA 3ZV3A 5IZ4A 4E3ZA 4R51A 5C7OO 4KMSA 4FDAA 1FDTA 1V0JA 1A71A 1LSUA 4BVAA 5IZCC 4BO4A 1SCUA 2O3JA 4PIVA 4FB5A 3A28A 3HSKA 4QEDA 3V5NA 4I5GA 3AI1A 2RH4A 2Z5LA 4LN1A 3QWIA 5T8KA 3GF4A 4JGBA 5KJCA 1MUUA 2BGLA 4BKPA 3VC7A 4E6PA 4Z6KA 1LEHA 3FBGA 3VH1A 1J6UA 1GR0A 3S8MA 1C0IA 1LDYA 3FN4A 4Z9YA 1YONA 1LC0A 3CEAA 1Q0QA 3D0OA 3I23A 2B37A 3QVXA 1T1SA 1LSJA 4WPGA 2X5JO 2QW8A 3DZGA 4ZRMA 1AUPA 3ABIA 1JTVA 2V6GA 2XXBA 1Q7BA 1EUDA 1TT7A 2AEJA 3EYWA 3KSDO 4UUPA 4E12A 2FR8A 2OGUA 4BKOA 1PS0A 2D59A 1MC5A 1NNUA 3D3WB 3WGYA 5TS3A 3ZWWA 3VH3A 3IMFA 4NFSA 4RVHA 5HRUA 4R5MA 3RC2A 3IC5A 4GGPA 1YBVA 5L3ZA 1E7RA 4I08A 3VZSA 1Z75A 4EI2A 1U3VA 4TWRA 5I7VA 2J5RA 1EE9A 2UAGA 3GVIA 1ZFNA 1AXEA 1SB8A 4ZQHA 5I7SA 5JXWA 1A9YA 2Q50A 2J3IA 3IQDB 1BGVA 1NFFA 1Y8QA 4XD2A 4YDRA 1TT5A 2YV3A 4LRTB 4O5OA 2WD8A 1YVEI 2OL4A 4LRSB 1C14A 1U8XX 3NTOA 3R3SA 3ZNQA 1ISMA 3PYXA 1YKFA 4RQUA 2J6IA 3GDOA 4IY1A 2YQ4A 1R15A 3RKRA 1NHGA 4XWYA 2DM6A 4O0LA 3O26A 1A72A 3VTFA 3WJAA 2DUWA 1E3SA 2ZB7A 1P45A 4CM6A 5A3VA 4RVUA 4R9RA 1F14A
chains in the Genus database with same CATH superfamily
2AOUB 4IVQA 3RAEC 1TCAA 4NHEA 4DGQA 4BQIA 4PSAA 1F2DA 4G36A 3UMYA 4YI5A 1QIKA 1SEVA 2EF1A 1CR4A 4KSYA 4MOWA 4GZ5A 3ZWAA 4EATA 2GBIA 1E9VA 2YVKA 3BEOA 1KS9A 4EUFA 5JWHA 1YZTA 1XAGA 4FVTA 3V4SA 5BN3A 1ZH2A 2QZ9A 5BOVA 4UOQA 2HYIC 3VTZA 3R6LA 1KE1A 1EINA 2CDNA 1DAKA 1U4SA 3IB6A 3P71T 1OZ0A 3RRBA 4IV8A 4BB6A 4W5NA 3B1ZA 1KWGA 1GUDA 2FEMA 3VR6A 4HYYA 2CCJA 2JHAA 3BRWD 1FZTA 4BIMA 1MAVA 5EMKA 1H69A 3H8WA 1XVUA 2OFWA 5FUXA 2OLEA 5CD9A 3SAJA 4YACA 2ADFA 2ZVPX 4DLXA 3WAJA 2D7DA 3NTUA 4RVGA 2VT3A 1QV6A 3H9JA 3V1LA 1VDZA 2X5NA 4LQ4A 1BX0A 1LFDB 2PFSA 4B4VA 2O8EB 2QLMA 3GIDA 5KI6A 2QLNA 5TQ0B 1J00A 3M82A 3WLQA 3LE8A 4EG7A 4FXOA 4QGGA 3ZH9B 3ZDAA 1JT9A 3ZUGA 1GA4A 1TF5A 3CN9A 3DE0X 4LOJA 4CEIB 4TYWA 1A4UA 3G9UA 4ER0A 3ST7A 1A2BA 4YRFA 1GARA 1W36B 5FI0B 3SXJA 1FDUA 4D9CA 2IS2A 4HGZA 4LXHA 4CODB 1W88A 1XDSA 1FX0A 2CLLB 4LGMA 4P31A 4OPMA 1EIWA 4GVLA 3D8RA 3BD8A 4ZCPA 4B6JA 4BMPB 2VWPA 1IY2A 1UP4A 4UNSA 1U0RA 4KQWA 2R68A 4ZO7A 1BW9B 1W5EA 3IJRA 5KWIA 1SXGA 4OBEA 3CVOA 2W58A 3QA3E 1Q0SA 3ICPA 1M2OA 4XGIA 3ZVRA 1SQ6A 1UAYA 4DF3A 1HTWA 5BMVB 3PWKA 3OCYA 3KKOA 2GEDA 2NYVA 1RZUA 3RU2A 3LPNA 1W9MA 3JPWA 4FI3C 4KQ6A 3B52X 2C07A 5A4AA 3DOJA 2ARKA 3PJEA 1H4TA 5LBIA 3SDSA 3PLNA 3WR5A 1QR2A 1J2EA 1WB5A 1UJBA 3FYUB 5ELMA 2TYSB 3EMVA 5GVRA 2VP0A 2ON6A 1YB5A 3HVUA 3IP7A 4MYTA 4L1KA 2XDQA 3GJ5A 1U9IA 3R0XA 3MS7A 1HEYA 5TPWB 3BWDD 5J4VA 3NBXX 2ACWA 2C5FA 2H16A 3DR5A 1UPFA 3OD5A 3UF0A 3V8NA 3CS3A 2REXB 2WIFA 3D1LA 3IP6A 4GM4A 5A0FA 3FETA 3SFTA 4X24A 4BQSA 1CUAA 1T0IA 3E0QA 6GPBA 5AI5A 5FP0A 2V6JA 3BMCA 3UFXA 2G1PA 1TUIA 2VNAA 1EH5A 3H7AA 1JLSA 3DHVA 3TZ6A 5SZIA 3AKDA 2HLDA 3VR6D 1R0XA 4MAFA 4ZZ1A 3I04A 2I55A 3BKWA 3VR1A 4BVLA 2X40A 2PVPA 5FL7A 1DKOA 3L0BA 3MUFA 1UC8A 3AJ9A 2AK3A 2VF2A 4LMRA 5G53C 2O5VA 3WP1B 1N57A 2OXRA 4WAUA 4CDRA 1GRVA 4ZGBA 1OFHA 7AT1A 3N9IA 3F5DA 3V8PA 2AMFA 1BSVA 2LDBA 4ZVKA 4PPYA 1Z4PX 2PS0A 5AVXA 4YRNA 3H87A 3CVVA 4DUZB 1L7QA 1UJ5A 1UT5A 4UVGA 3V4VB 4RYDA 5JAPA 2EZ4A 4FDMA 5F64A 1T4CB 3MD0A 1BRTA 2R7LA 2DWQA 4JYCA 1CT9A 3I4FA 5FOTA 5KC8A 2C7PA 2QTFA 2JBAB 2UUOA 3IHLA 3CZQA 4O2BB 3Q8LA 1KRXA 2ZWOA 1PR4A 4UHKA 3BIXA 3DZIA 4UEWA 5JLAA 3DFFA 1LX7A 4Q16A 2XOEA 2J9FA 2ZVQX 2JAOA 2OPHA 1S1CA 3EWNA 2B8NA 1CQXA 2Y2UA 4EHAA 3CKMA 5A4MS 1AS2A 3HSSA 5IANA 4HDMA 4MDEA 3L92A 2FAXA 5B1YA 1B3RA 2HXYA 3A0UA 3IX7A 4HUQA 1M6HA 4TV8B 3RRZA 2VHCA 2FR8C 2OOSA 3FFTA 2BPOA 4CM8A 1VG0B 3L8ZA 5E4JA 3DEZA 3COJA 3GZNA 4XRRA 3C5CA 5EL0A 4JLPA 4C9BA 3C14C 4JDPA 2XCRB 1RRMA 5BMVF 1DX4A 1OWPA 1RLMA 4Q3DA 1U2QA 1TYCA 3G2PA 5AJZA 4C6TA 3QLUA 1CYEA 3FWPA 1A9QA 1W44A 1N9ZA 2PPLA 3TQIA 4HNVA 1X1RA 2B6HA 2J3LA 3PR3A 1JQEA 3FPSA 4HWKA 3ZTWA 3KZNA 3H65A 3VNRA 4DREA 4Z7OB 1GFSA 2NU7B 2W4MA 1E0SA 5ALEA 5NULA 4EFLA 1WY5A 4F8EA 1U2TA 3RUCA 4PRZA 4IHAA 1DC7A 5DNCA 3F7TA 4P4TA 2HLDD 4QYSA 5F7ZA 1PTKA 1WHSA 2Q5EA 1RZ3A 1VKOA 2JH8A 1TZBA 3F7MA 1OWLA 3IHKA 2IYFA 1OI3A 3TGWA 2GZMA 4GMHA 1N6LA 5FL7D 3A3NA 1E98A 5CB0A 1EFHA 3WTBA 1NWHA 1RAFA 4ZQCB 4D41A 5IT4A 3B7WA 4NF2A 4FE7A 1HRDA 1Z5PA 1NQ5A 4W7HA 3TW8A 1M2JA 4UU0A 1CPYA 4PC3A 3RSGA 2O52A 1E4EA 4M1YA 3TF5A 4FGJA 4Z3OA 5BWMA 2ZE5A 4XDHA 3QEAZ 3BXXA 1B7GO 2I78A 4X92A 5F4BA 5CFLA 3B3JA 1MGOA 2YC4C 4MGEA 5CNJA 2IHYA 1LSOA 3UW1A 2FU5C 2GLXA 3NBKA 3WYAA 1TMGE 4X6UA 5FFNA 3B60A 3U4HA 2ODTX 4EKNB 4R81A 4AI6A 3QEMA 2EJTA 1DXYA 3U7HB 4JUCA 1VRCA 4KO3S 4O2BF 1YOVB 2RI0A 4HX9A 3U17A 5I4BA 4P7GA 5KX5A 2TMDA 3KZ1E 3IQZA 3M8KA 4HGOA 1KJNA 2X1HA 1QAMA 4KYUA 5A71A 4C4AA 1USUA 3JQ8B 4WLVA 1LBEA 1P0CA 1ADCA 2A9KA 2ZS9A 5AW3A 1WMEA 2V0GA 1IY1A 2RHDA 1I7SB 4W9NA 3I28A 1E9BA 4TV8F 3SHWA 1RM0A 2OXEA 2QWXA 4J0KA 1SQGA 1E9EA 1W29A 4FEEA 1W1IA 4K9SA 2P9GA 5DPMA 4US0R 1ISGA 5SZKB 2Q5JA 4LSMA 4OI4A 3K0HA 2G1KA 1MAWA 2WIKA 4Y7CA 2YYYA 4Q18A 1CIJA 1ZNXA 2UU9B 3C7AA 1NU8A 5CTJA 1XYYA 3ETHA 3M6VA 4ZO8A 3VDRA 1KH3A 3M2PA 3CX7A 3F74A 2O8FA 5PNTA 3O8CA 3ZVNA 2BFBB 4KWTA 4QATA 4YP6A 5FNZA 5JTUA 1C3OB 4BV3A 3MELA 2P0EA 1FUUA 2CCKA 3BQ9A 3ETCA 1AD2A 3PIDA 4JELA 5C9ZA 1NBOA 3OCXA 3IDZA 4NBWA 2WJGA 5EY5B 2ONKA 3JZMA 3RTGA 2QTRA 2CK3D 2JJ2A 3KCNA 1YTLA 3NB0A 1K5DA 4CMCA 4HH4A 1U2DC 2ZAOA 4BQFA 1Y6JA 3D3KA 5LMUB 5BWOA 4IILA 1C30B 1EWVA 2WWIA 1Z16A 2YFQA 3P4YA 4GQBA 3K9LA 4YRRA 5DF1A 3ZV7A 1XMOB 2PUGA 5K3OA 4WLEA 3HFJA 5H16A 4CCSA 1Q20A 1ZL2A 3DMHA 5HRAA 2ZW9A 3PKJA 1YMUA 2VTBB 3I42A 4I55B 2P2CA 1L4UA 1L5YA 3I1FA 2ZTLA 1YAJA 3ZHOA 3O5AA 2GAJA 3PJDA 1XMVA 1VLQA 1ZL0A 4AN4A 4BO7A 1LFAA 4PYOA 4QJ5A 5BW5A 2J85A 3QP9A 1BXZA 2JD0A 3F1KA 1EEHA 2PMFA 3GGJA 4MROA 3VR4A 3AEKB 5JY1A 3BG5A 3HA2A 2XOXA 1XQXA 2VRCA 4HS4A 4CUJA 2XUGA 4YAUA 2AKAB 2P91A 3A6PC 3EFOB 1L5VA 2RHOA 5TF0A 4Z5XA 2HUPA 3D2BA 5CEFA 4YCJA 3DAYA 4ZVLA 2GYYA 1GGMA 3DMFA 2O19A 4RQAA 1AHHA 4EJ2A 2Z2IA 4HLDA 1LNQA 2CLIB 1AC5A 3F8WA 4C7VA 1YK0A 3P1JA 2QN3A 4CMHA 1L4BA 3W05A 3WK6A 3ASVA 3RTDA 3LYLA 5A2QA 2LR0A 3NTXA 1WVMA 4QODA 2QUZA 2CLHB 3DDWA 3M5CA 3BD6A 1ZLYA 1AY0A 2QN7A 1S0UA 5B53A 4NYMQ 3NJRA 2B5WA 2BR5A 1VIAA 1R8QA 2ODPA 4I1IA 3H1AA 4OJQA 3KWLA 2V7VA 1AV6A 2HBQA 3KJGA 3P0FA 2ZUCA 2CXSA 3E03A 4KLAA 4PHTA 4J0GA 3HDGA 3HJRA 5C8VA 4N5DA 1ONPA 3DBHB 5AOBA 4ZHSA 3TRDA 5KU7A 3GUYA 3OT1B 5KYVA 1EFPB 1DU4A 1PCXA 1QRDA 2I2BA 1N7JA 3AWIA 3MCWA 2OBMA 3QNWA 4K3UA 4OB6A 5AK4A 5KYUB 1WSBA 4DB4A 3ZHRA 3OOSA 1QHIA 2B98A 2ZIWB 4I4TB 4P82A 5ES3A 5CX1A 2JJ2D 3GFBA 3H3JA 1JU3A 2HJWA 4QQFA 5CLHA 1DWQA 3A36A 4ZI7F 4RIHA 1UP7A 4NTZA 1IQUA 4OM7A 2IZOA 4HBGA 3WIVA 3ADDA 1XZLA 2F43A 3VPCA 5DHPA 1FSGA 4CT5A 1YR3A 1RLIA 3G9TA 4RHXA 3SSAA 4EDFA 4OMCA 3WSTA 5JMWA 5EP4A 2PH1A 2ABWA 3UUWA 4D9NA 2DTDA 4D4KA 4RIIA 3DVSX 4KTTE 1NRJB 2EP5A 4AQDA 4P32A 1DQSA 1VMDA 4COKA 3M4JA 2ZB8A 3QEJA 1GEGA 2H5LA 3VR4D 3QPWA 3GLFB 1RXVA 3AH8A 1J22A 3DMNA 5F78A 1N7IA 2OO7A 3QUQA 1CUIA 3SMQA 2VRCD 4RJKA 1IY0A 2UXDB 3HP1A 4L8GA 5COQA 2Q3LA 3N07A 4IL5A 4XGQA 3AEXA 2XUPA 4CEJA 3K70D 5CM2Z 4EX6A 1NV9A 5IBCA 2GO1A 2JD2A 3EUFA 4ISBA 2VXOA 5BUQA 1ZH4A 2ONCA 1JE0A 1I1OA 5D8DA 5HFAA 1OB2A 2G0AA 2WQZA 1E66A 4B9AA 1CIVA 3EVNA 1KBQA 3ABRB 3NBMA 1OAOC 4GEKA 3QVWA 4KDEA 2H48A 4AJPA 4AKIA 2WT8A 5LOVB 1CUJA 2IEZA 3KL2A 4LJKA 2QMOA 3WMXA 4YRPA 2Z8YM 2JG3A 3UPTA 3HZRA 1VHQA 3REOA 2EV9A 4LV5B 4BHTA 1NUUA 3D64A 5KOHA 2I0FA 4CZ2A 3CF2A 5EJ4A 3CZPA 2IYYA 1JHYA 1BE1A 1QG6A 1KFCB 1ODKA 1OI7A 3GJQA 2BDUA 4BGPA 1YIAA 1I3OA 3I01M 3UGTA 3FTFA 4J07A 1JMKC 2J8ZA 4U9UA 4ZFNA 2XIJA 4BNXA 1L5ZA 2MR5A 2CFIA 2HRDA 3QFHA 1SCDA 4YP1A 2CMKA 3CR3C 3G0BA 1AQYA 2YYSA 3GNSA 3BSWA 3TD9A 1ESZA 2AEFA 1WUYA 2W93A 3DLCA 4YP5A 2PFKA 5AYVA 4YREA 2W0SA 4BX9A 5CA1B 2ZM6B 1M7BA 3G59A 3ASUA 4G56A 3TSYA 4EGCB 1AKRA 1R0LA 3OQIA 3X1WA 3WS7A 1HG1A 1OY1A 2ZJBA 4RTLA 3ZWYA 2P9YA 3G8AA 2FEKA 1O6FA 1THMA 5EN4A 4CVNA 2CZQA 5BVHB 4IJSA 2OZPA 2QX9A 3REQB 5J4KA 2N1MA 4R5HA 3T3DA 4EECA 4HDRA 1KJ9A 1L8OA 1OD6A 2FYTA 1S8NA 4EVRA 2QY9A 4QXAA 4TUYA 3T3GA 5BXQC 2I33A 3WOHA 3VMMA 2FEAA 1HNWB 1YV9A 1ZITA 4MGZR 2ZIUB 4QVKA 4UNRA 4JLWA 1J5XA 3VH4A 2BFCA 2BUAA 4P4LA 2QL9A 4LI0A 3SU8A 3U1VA 1Z6ZA 4WXEA 4LRXA 3D5QA 4WA7A 5J9FA 3FM9A 2P5YA 4XFDA 1W4RA 3HLKA 4HTFB 2QUHA 5CCXA 1SD5A 1DEOA 2PXAA 3FCEA 3PNSA 4KP7A 3EDYA 4NJEA 3KR1A 1TZKA 1YL6A 1A9ZA 3HN2A 2PGDA 4O63O 1OREA 4M37A 3DG9A 2WPNA 4L9RA 5ICGA 3UHPA 1KZ9A 3QU2A 2ZAMA 1JPUA 3IUBA 3VAZA 3ROMA 4C1BA 5C8XA 4JKOA 1QANA 3FMVA 5JSFA 2P9TA 3AESB 4BL5A 2BHSA 3ZDZB 2IBSA 2PKQO 3F98A 1B6TA 1VLVA 3LL7A 1ST3A 4NFYA 1KHHA 5KYWA 5LOVF 1F3OA 1DDOA 1TLTA 3VFDA 1HQKA 2I6QA 3ORSA 4HPWA 1S6YA 1L5QA 3LC0A 3LDGA 4FGUA 3RJ5A 1RRKA 3ET4A 3TIIA 2WC1A 2ZI6A 1PD1A 3HCEA 4ZVMA 4X85A 1GQYA 1MIOA 4PBTA 2WB2A 3V4LA 4W8HA 3P9PA 2FUEA 5HJ5A 5I7EA 2G67A 1E0JA 5FA8A 3RGGA 2ZRGA 3ANYB 4PAWA 4WIAA 1OKKA 1M8FA 3BKXA 3HA7A 2C2WA 3NHYA 1D9ZA 1FRFS 2D1TA 1V7PC 1ZJWA 5K0SA 2FZWA 1ZVQA 2PO5A 1HORA 2GKGA 1V16A 3EBLA 4XGKA 4XIYA 2PUBA 1QYVA 1PFWA 3MCAA 4LPKA 3HGQA 4Z51A 3QKSA 4RJJA 1H2XA 3TWOA 2C7VA 2O7VA 4ZXFA 2R97A 2YWRA 2NXNA 2ZUWA 1P8JA 4Y1GA 4B87A 4DLZA 4B8WA 4GEGA 4QPNA 5C32A 3NTQA 4YRMA 3A9UA 4ZTUB 1STOA 3N1UA 4JS0A 2Q41A 2PLRA 2WTUA 1HOTA 1A50B 3ENZA 4DVJA 3D2LA 1O95A 4HQ0A 4B7ZA 3V6MA 2AN1A 1WMSA 3CUWA 3LU1A 1L5MA 3OX4A 4O1IA 5ECDA 3U3DA 4FCCA 3WL7A 5F1PA 5ALSA 1QPZA 3EPLA 3BMNB 3SJUA 1K89A 1AXRA 1RZVA 1YS4A 3EQ6A 5EWMB 3ZQUA 3K72B 2HPVA 5GJBA 2F64A 2G4VA 2GAIA 2GBCA 2ZITA 3GUHA 4QARA 1F3LA 4X54A 2CY0A 1ZNYA 2ERYA 4XI9A 1UMBA 3ZEIA 2BF7A 3MMPA 3JCZA 2BHLA 1YBAA 3LMKA 2HIMA 3CH5A 4J7XA 5C8YA 3ABQB 1RPJA 2D2IA 1TU4A 2RMKA 3H13A 4Q4LA 3SBXA 1MP0A 2GNPA 2JW5A 2QQEA 3KVYA 4WCFB 3ZEAA 2AWNA 1V26A 5BOSA 2NWQA 4YRLA 1N5LA 2CMDA 3QFCA 1NMYA 1ODFA 3EARA 1H1LB 1OLSA 2Q3EA 3EXHA 3NDRA 4YQEA 3RV4A 4U00A 3STWA 1NRXA 4KN8A 1N5IA 5LZ4A 3NUZA 2E4AA 4M9QA 5ADUS 3D8HA 2EX4A 2P1RA 4QDUA 1M2NA 1XELA 3E5NA 4B3SB 3EXAA 3PPWA 3P9CA 1DPFA 2UXCB 1HE1C 3E81A 5A9TA 2FDCA 2H07A 4CL8A 2BCJQ 1KK1A 1FL9A 2A1IA 3OQOA 1CZKA 5AHOA 1J2RA 1HYGA 1QQAA 1S3FA 1XEAA 3NAZA 2J1LA 1DQPA 1ULUA 4RADA 5K0FA 3CPHA 4MVYA 5AH0A 4CM4A 3DBIA 4CDGA 4HAOA 3TOSA 4N40A 5K3DA 3ZJUA 3AFNA 2XDWA 3RQSA 2UYHA 3LPDA 1C9NA 3BSYA 4RHFA 3AERB 4FFBA 3IVGA 3PSHA 1NVGA 4FZ3A 4JL6A 2BEJA 1JXQA 1N2CB 1BCSB 3IEIA 1QOZA 3PD0A 5LUBA 3HYSA 3OLQA 4JC5A 4WD3A 3TUJC 1OKKD 1ZA1A 3HZOA 4JBGA 8ATCA 5HKOA 1Z0SA 1QV9A 2H7YA 1X8XA 2FW0A 4BFYA 4JI6B 3ROTA 4R31A 3P2OA 4ARBA 2ZJ6A 1GZ5A 2C0CA 2VQ3A 1MB2A 1CQJA 1I6MA 1RNLA 4KKVA 3UXYA 3Q11A 4D4MA 5AKEA 4YRAA 1TQ6A 3GRYA 5FHQA 3SIWA 4AQ7A 5DO9A 3QZUA 1XZFA 4R3NA 2DKOA 3PRJA 1T2NA 2FKNA 3A11A 4P3XA 3AM4A 3LX5A 1SKAA 3UW3A 4BEJA 3GT4A 1D2RA 1CHDA 4CUZA 1O95D 1LD3A 4BNZA 1DV1A 1KSHA 1ZQ9A 4E21A 4TL9A 1SIBE 1E9RA 4NE2A 1S4QA 4L6IA 1HFWA 4FS8A 3WLMA 4GPEA 4MMXB 2KBFA 4RKYA 4RLFA 4WZBA 3GEDA 1D5CA 3QX7A 3TK1A 1PTJC 2WUVA 3ND8A 5DX0A 2ZE7A 4IIFA 3O92A 4J0JA 2R7AA 4J0FA 2HSJA 5HM8A 5EVJA 1PT7A 1N1EA 4PO9A 4IWYA 5J40A 4EKIA 3WRYA 2FTKE 1D09A 1GR1A 1F4LA 2ZRNA 3OQBA 3C2QA 1TUEA 2IDKA 4ZYZA 2MINB 3INGA 3DKPA 3H5TA 4UNIA 1ISSA 1VRWA 3OUUA 4Z9FA 1UM8A 5JPCA 1EDBA 4L16A 4BLVA 4I8XA 4XYLA 5LUAA 2XMZA 1P4RA 5LWHA 3EMDA 2NT3A 4J0HA 5JYEA 2RH5A 1YZLA 5ALPA 1EBBA 1KKUA 3AINA 4WNIA 1XFDA 1SC3A 1VMAA 1ZN9A 4B45A 3E3NA 1Y1SA 3N59A 1Q0LA 3C3XA 2PUTA 3KOUA 5JZVA 4OI0A 1RYNA 5AFSA 3FOZA 1EX6A 3EVFA 2VG8A 1APBA 4BPBA 1YZGA 1FNBA 1IM2A 1IG3A 2J09A 4U3JB 2DU8A 3O3MB 4EUKA 5CJ2A 1CZOA 1HDOA 4S0XA 2QU7A 1GPAA 1YR6A 4LECA 4U7FA 2FKAA 2E0IA 2P5TB 5I4KA 1MZPA 2CJWB 3ECCA 3STHA 2MU1A 1ODLA 2XQVA 4C5CA 4X9XA 1G42A 2D6FA 3CH7A 1A2KC 2VLIA 2HMSA 2F7SA 3VUEA 3A10A 4GAEA 1IK6A 5HKAA 3GPBA 4Q1EA 4ZT3A 2ZM5A 3JX9A 4X7PA 1VSBA 4Z0HO 1R10A 4BUJA 3TD2A 3A6HA 3JWHA 2YDXA 1W1WA 4M9ZA 3RHZA 2EQ5A 3AOEC 3DCYA 3WGJA 3ED5A 3WGVA 1T4DA 2GCPA 2FZCA 1YDMA 1E5TA 2OMEA 4U7HA 2XNSA 1F2UB 5JASA 1NI3A 4FMDB 1YKGA 2VDLB 4F3YA 4Z7NB 3X1ZA 1UFVA 4GG1A 4HJRA 4IX9A 5JNVA 1FLAA 5ECWA 2E87A 2VHZA 1UC5B 2C84A 3G5TA 2VR1A 1SUAA 1GGEA 3O90A 5ALTA 3VV2A 5EJIA 1TKCA 1NT2A 1G7RA 3ZLVA 1TKRA 2QENA 2JFPA 1M5TA 2AMJA 3QJ5A 4AVYA 5K0BA 2AR7A 4JGIA 4XTRA 3IHTA 3PUXA 1U3TA 3ZIUA 5BORA 2QE6A 3L0OA 4DCUA 1VI5A 2AE1A 4G2TA 3QVVA 3Q1KA 5FI1B 1FP7A 3E8XA 3N86A 4C4YA 1C7JA 2WKSA 4FQ7A 4K9DA 1EJBA 2IS1A 3I9NA 2HRZA 1NL3A 5BW4A 1JFFA 2C5AA 3Q41A 1T2CA 1SC1A 3UMVA 3EVZA 1ND5A 1OIWA 1UOPA 3MSXA 1BG6A 3I3OA 3O8OA 4HRAA 2AD1A 4LZLA 2KX7A 3Q7RA 4W63A 2JZOA 3NWOA 1DUSA 1PJZA 4LK2A 5DHSA 3U4AA 3IXQA 3H19A 3QKRB 2ZZNA 5KINB 4Q12A 4A82A 4DLKA 1KDRA 1TF7A 2NU6B 2R66A 2RHLA 1SHKA 3DUFB 2QROA 3G49A 1WEHA 3KFVA 3O3OB 1OFVA 4PNPA 4JFAA 1T0PA 1ZCBA 2JCGA 4L7QA 4LC9A 4PFQA 1F51E 2W2QA 3KXKA 3TR6A 1DT3A 4BZZA 3AUXA 1BH6A 3SX0A 4G1EB 3FWYA 3AVTA 4DTIA 1KQNA 3T5GA 4CW7A 1BMDA 5REQB 2O23A 4Q3KA 1AB6A 4MHOA 1I1HA 1PWEA 4PQFA 2QVBA 1C9YA 2IOFK 1BDJA 3MUNA 4EGAA 2HX1A 2P11A 1VKZA 3NRBA 1R6UA 2I1VB 3BEDA 4C4PA 3VV3A 4KTVE 4AKSA 3R7WB 4CKZA 3EZ7A 1KZ7B 4BX8A 5LNK6 2CBZA 2WF7A 3QVLA 1RYBA 1V8BA 4UCFA 3O8QB 3Q5DA 4GUAA 3JW8A 3OU7A 4JBHA 2QZPA 5EWJB 2PKRA 2K7FA 2CSXA 3P2JA 5I7AA 1B2LA 1PFVA 4NICA 4NIMA 4GWKA 4S0ZA 4CMJA 2WM3A 3GDHA 4MYDA 3AIIA 3W8DA 5D5HA 1Q7TA 2JH9A 4LHZA 3ZH2A 1QH0A 4IWNA 3PV0A 3R5KA 2FPGB 2W6PA 1I2AA 5ER9A 5HS6A 3TDMA 1OWMA 2HPZA 1T6YA 2ZVDA 1DO2A 5C1DA 5I9SA 4FMDF 5I4CA 1KVRA 3MWYW 4AN0A 3M4XA 3HM2A 3PPIA 2DMRA 4MRVA 5GM1A 2I87A 3I4CA 3R7FA 4BNWA 4IQGA 3FI0A 1KDYA 3ER6A 2Q1SA 1MRSA 5LCXA 1LRKA 1L7AA 3LQFA 3INRA 3VNUA 1L8AA 1UK7A 1ZI8A 3KTDA 3QXJA 4IVNA 4XM2A 4Q01A 3WYBA 3KQKA 4LF5B 1NDUA 4UE2A 3RS2A 5EERA 2C3MA 3I9OA 5A06A 3E7FA 4QRIA 4HDKB 3IAFA 4O33A 2CVFA 4NCIA 5I7RA 1MC4A 3GROA 4D26A 1MMFB 3A31A 5DGTA 4E1AA 2MCFA 4ZEOA 2Q21A 2V55B 2M32A 3LQKA 5F21A 4LVNA 3KKPA 3ELWA 5IM5A 2O06A 3UK6A 2YZNA 1RTTA 2OV3A 2XTAA 3AV0B 5LR6A 1IEXA 2IIBA 1XR3A 2DHQA 1PNTA 2QAGB 2XITA 4NBRA 2VWGA 3RJTA 2HU7A 3LXXA 2FPRA 4EHHA 5H1YA 4MLDA 3D4LA 3EC7A 3SGLA 3PICA 2O2ZA 3D5TA 2WFZA 4UEQA 1RABA 3L04A 2J08A 1OLUA 5K0LA 2JIBA 5B36A 2O8CA 2OXIA 4UHBA 1B8NA 3IBFA 1H85A 4NNPA 4R9UC 2WE8A 3VI3B 1T0HB 4KPGA 5T67A 1E2EA 5EJEA 1AGNA 5IUKC 3FW1A 4E30A 4IS2A 4IIDA 5EXEA 3EIWA 1QYDA 1RWQA 1VQ1A 3Q98A 2I6XA 2W11A 4QREA 3AYXB 2E4VA 3CNEA 3FY4A 3L0SA 4FCTA 4XUDA 5ALYA 1KEUA 3T1YB 1BDMA 4JCCA 1ULZA 2GAFA 5DFAA 1YZVA 4MV6A 1HRKA 3TTWA 4XX0B 1W0CA 4ARZB 2V1UA 3GLFE 3O73A 2H08A 1DKQA 1ZK4A 4LRUA 1E3WB 1F8FA 1G1AA 4KXWA 2IIVA 5AKLA 1ZGBA 5L95A 1OH6A 5E2IA 3L6OO 2WM9B 1RLOA 1LI5A 3ORHA 3GOQA 4K9QA 3AZQA 4R05A 4MVJF 4TGLA 3R1IA 3OJEA 1AJEA 1KL7A 1XTRA 4Q37A 3AU8A 2GZ2A 4OJNA 1V1MB 2GHRA 4IJQA 1C7RA 5B3JA 3FNGA 1CS0A 1Z28A 5BUCA 1IZ0A 2JGNA 5D5QA 1UM9B 3CNLA 4TQUS 3GV0A 2Q4EA 5IP5A 4IEFB 3G2JA 5DMHA 4ZOCA 3V2IA 3ADOA 4HY3A 3IPCA 1NI5A 1GPH1 2I4NA 2JHFA 3SK0A 1UPUA 4GP6A 3T7RA 4RJTA 5LD2B 5A04A 1JEEA 1DTEA 4A2CA 2R3SA 5THQA 3GLRA 1ZISA 1TVKA 1H2AS 4ME6A 1P5JA 1TGYA 4HEA1 5K3BA 1BWSA 1VFPA 1HQCA 5TRTA 3HI4A 1L3IA 3L0YA 3DLHA 5EGSA 6REQA 2WHRA 3BCRA 4JC8A 4Q19A 2Z2JA 2A4MA 4DCOA 3RRXA 3C3AA 4EJSA 1G6OA 4FW9A 1OFUA 5TGDA 3DDHA 3DOUA 4TPKA 1ORWA 1MZVA 4Y98A 3U9SA 3C0KA 1U7ZA 4ID3A 4IHKA 3D3WA 3FTDA 2YXDA 3BGVA 3C48A 3UNXA 3HNRA 1DSSG 3K0AA 3QMWA 1XNHA 2Q1XA 2VHYA 1KFEB 1INLA 1UWCA 2XQGA 3QUAA 4FU0A 1T36B 1ZZEA 1CP2A 3KU4A 3ZGOA 2JFUA 2LUOA 5AI6A 3PC2A 1V6SA 4Q4JA 4UUMA 1PJLA 1Y5RA 4LE0A 2OQ2A 2MYPA 1FQKA 4JJ6A 4DUGA 2LNDA 4Q66C 1XCPA 1MEEA 4BAUA 5A9RA 3MCUA 1GNVA 3T34A 5D85A 3PDIA 4QYIA 4U5XA 5DTRA 3VDMA 3VR2D 4ARAA 2QMEA 3EC1A 5L6LB 2FUG1 1FYWA 2YS6A 4NAVA 1O6GA 4KUGA 1NPYA 1IDN1 1XZ8A 3CX3A 3N5CA 3OJLA 2O9JA 4I36A 4XQ9A 5EUBA 3NHFA 3I62A 3PCXA 5JVDB 5CIWA 3F9IA 3I9MA 1Y8CA 3I12A 3WJ7A 1JIXA 1JG7A 2ZG6A 4ZGGA 4Y2JA 2Q9CA 1AHIA 4U2EA 2N42A 3BJZA 5DRYA 1CY6A 2IEAA 2F1IA 3RS8A 3M89A 5IKOA 2HCTA 1GYPA 1VIVA 2EJUA 3O4HA 4M4SA 4M0MA 3DB2A 4XSGA 4AJNA 3A37A 4D6YA 5KJFA 1OU0A 3S27A 3P9NA 5J1TB 2NOAA 3VKFA 3N76A 3WWYA 2BEKA 2RK3A 4EPVA 1L4GA 3CUUA 1E0AA 2M1ZA 1PVDA 2YBEA 4ER6A 1KQ3A 3ESBA 5DK6A 3OA2A 1CQIA 3BE8A 4OD0A 4TMZA 3S5JA 3JARB 3K1AB 2PZMA 2R6HA 2ZBFA 1NQUA 5DWVA 5HCNA 5BQFA 1QIDA 4YQZA 2OVFA 1CHNA 3IE2A 2J5QA 3PNPA 3VPXA 1HTTA 3U5TA 1DGQA 2GD1O 2ZRKA 3LBAA 3X3HA 2ZEJA 1AM4D 3KSUA 3P9YA 4ZDJA 2JAUA 4X1KA 2NT4A 2GESA 2GOYA 3K0CA 4HRYA 2QV0A 1DOAA 1XKLA 2XE4A 3CNNA 3LRXA 2R00C 3MB5A 3O74A 5IPFA 2I66A 3IR5A 3FUTA 3HC7A 4UE6A 2RGRA 5FTLA 2P27A 5LMCA 4URUR 2VOEA 1YC5A 1TD9A 3CRRA 4HQOA 4BRSA 2XX3A 3UB3A 1Z4OA 3MCTA 4XR9A 3MZ0A 4DT1B 3C6QA 4P54A 4N5LA 4PZZA 5JH7F 5A1TA 1B1CA 1LBIA 1GPUA 3IS3A 1Y37A 3K4PA 3GG9A 5TMPA 1LW6E 1PJQA 3PHJA 4G0UA 1YB2A 3FNQA 4O4JB 3H1TA 3TNYA 5AW7A 2X3FA 2NV2B 1O87A 5G1PA 3HB5X 3W1EA 4DRXB 3UOWA 2XYRA 3UMMA 2VF5X 5AUQA 4KPEC 2K6GA 4DUGD 3GR6A 3RU9A 2BJHA 3DZDA 1PJAA 5BN3B 3L79A 2WYIA 4DIOA 3TNFA 1VJ0A 3C5WP 5BSRA 1N5DA 5LP6A 3ZDFA 3MMSA 1Y7HA 3V8BA 2JASA 2DHRA 5F9FA 1I7PA 3WAKA 5BPFA 3CONA 2PQ6A 3A25A 1T9GS 1W87A 2FW9A 3LF1A 4CKXA 2H2DA 2W6NA 5U4XA 2O2YA 4ZZ3A 1HT2E 5AKGA 2WHQA 1EK0A 2CNKA 2HDOA 3C41J 4NK5A 4BYMA 3OMXA 3L06A 5JVDF 4C2UA 1JNYA 2WZBA 4R2KA 1KRWA 3CZ5A 5FWYA 5DTQA 2JAXA 4OXYA 5BNIA 1Z73A 3OD1A 1Y1LA 1SQSA 3IEPA 4OP1A 4TN5A 1C7FA 1PDVA 4UM9D 3G5AA 3LC7O 4FFDA 3SYLA 5JYDA 2CUKA 3OE4A 4LOLA 4K46A 4RJLA 1S9DA 1MA0A 3BHJA 2Y1GA 1M1YA 1P8AA 2FEXA 2AUMA 2ZYAA 4WJZA 5F7JA 4GI5A 3RD5A 3RROA 4B79A 5D3ZA 2QSZA 3L1VA 2F3QA 1B8OA 1DTSA 1NN3A 1XQWA 1Y3IA 5T4BA 3S28A 4DIEA 4D46A 2HWWA 2IH5A 3V33A 4LYHA 2IEIA 2H17A 4RKWA 2RBKA 3AKZA 1PJ3A 2W4IA 1W88B 2ZSKA 1FX0B 4RBNA 4F96A 4UM5A 3V8QA 4IDXA 4XIJA 1CNEA 1YE5A 1PGNA 2C8LA 2G3YA 2ZSFA 3PVSA 4V0MA 1PWZA 1JSZA 1EA7A 3P2IA 4P3OA 4XJXA 6NULA 1K8YB 2I67A 3C3MA 3H5IA 4BP3A 4EX7A 3GQBB 5TJ9A 1M2OB 4IFEA 3E8SA 3WL3A 1KI6A 1QNLA 1H4VB 5CYPA 1KWKA 4TTQA 4J75A 4WQMA 1P80A 4GD3Q 3OEWA 1XSEA 1N2CE 2EL9A 1PL6A 4H7HA 4LBWA 4MYHA 5EC8A 3V6LA 4BJHB 1XI2A 2LBPA 4NZMA 4XB6B 3A1FA 3O8BA 1IQRA 2IV3A 4B4DA 2YV2A 1XTTA 3HBJA 5JFTA 5HDBB 4C76A 2FZEA 5DLQC 2VUTA 3QVOA 3STVA 4YNBA 2SKDA 2XDQB 4U2KA 5F77A 3K8QA 2BLLA 3AZOA 1PQWA 4F9TA 2ANBA 4UXJA 1SHTX 4GOLD 3AR6A 1P4JA 4UTPA 3VAAA 3KKZA 1HC7A 4M8NE 1Z2AA 1WPQA 3C7CB 2BCEA 2OAEA 4M9SA 4MGYR 2QYOA 4DSNA 3L6BA 3BMCB 4AY6A 3UFXB 1LLQA 3EGXA 1MFPA 3BRQA 1T9HA 1EK6A 1EVIA 1OBHA 3KKKA 2X6QA 3ONNA 3QY9A 1QO0A 4XVUA 3INYA 1K7YA 1ZZGA 4M38A 5DTEA 4BNVA 5LBUA 1LWOA 4L50A 3RC3A 1B0ZA 1NSYA 4BXOA 3AZPA 2A67A 4NAHA 1UQTA 3JQRA 5EMMA 5BN1A 5SYNA 1L5FA 2ZSEA 4HI0E 2XECA 1Z6TA 2WUFA 2QW1A 1VDMA 2XB9A 4IX1A 5K0ZA 4ZI2A 2BYTA 3MJTA 4IH9A 3ZU3A 2NVUB 2OFOA 2Y3IA 1I14A 1NW7A 1XMSA 4L6AA 3O84A 4ZPJA 1LLCA 1OV6A 2MSCB 2MT9A 1AUVA 2Q9BA 2R11A 2FEPA 3DEYX 3PG5A 1VXOA 3FHLA 2G5PA 2ZJFA 1OXBB 4YGXB 3WLHA 1BU8A 1Z47A 2ILTA 5CNMA 2G70A 2OCXA 2J9FB 1ULAA 2J9ZB 5DIFA 3WJ1A 4AF7A 4BGEA 4EEKA 3U5ZB 4LOIA 2CN1A 1O9BA 3OJ0A 3G1UA 1USKA 2O3QA 1HDIA 2PMCA 1DQZA 2BEVA 4G5YA 4PTZA 1U2SA 3ESRA 3TBFA 2WYUA 1Y9DA 4FGLA 4Y1EA 6LDHA 4HUQB 1WSAA 4FNAA 4N8SA 4Y2GA 4GR9A 4DNXA 4ZODA 2WG0A 4CM8B 2XBLA 3S1SA 3G5LA 2I6SA 1PFUA 2M98A 3GZNB 5I6DA 2HV8A 2W7TA 1GG8A 1RLJA 5BQOA 3MJVA 4A0FA 3C7DB 2WP0A 1VSUA 3TNJA 4L51A 4MGKR 4C3UA 1XZCA 5K7SA 3G82C 4JENA 5JSKA 1J9EA 1V37A 3H5RA 3GGDA 2CF5A 2EJCA 3I6QA 1L5KA 2B4RO 4C6TB 5KQRA 1FJHA 1N0WA 3ZWVA 2Y9MB 1U63A 4U8GA 4K2AA 5L9AA 3NFRA 4F5WA 4ITRC 3WQSB 3TKLA 1AZTA 2V96A 1FDVA 1TQHA 1UMCA 5LQSA 5CA0A 3LYUA 4CBVA 2VQFB 3AVYA 4ZCLA 4E6EA 4POOA 3A9TA 1PJSA 2EFHB 5M34A 3L6EA 4QLAA 3ZY3A 3RSCA 1L5WA 2WSBA 4QT4A 2C0PA 3R6WA 4D9KA 4J1NA 2UYYA 2R86A 2JCBA 4FYIA 4I50A 3DO6A 4B3CA 3F5FA 1WHSB 1ZG3A 4O4IA 1JP7A 2CUNA 3RIXA 3ICVA 4IJ5A 2IYUA 4EYEA 4AL4A 3NCHA 1ZJ6A 3N0RA 3RBAA 3TG2A 4R54A 3FDJA 3LUCA 3R3JA 1AHPA 3B6KA 1QE0A 5MN4A 3FUXA 4CIBA 4YP7A 2WNIA 3TW8B 1H3NA 3V1KA 1RQ2A 5K8LA 3CT6A 3ZHVA 3HO1A 2IYXA 1E4EB 4FLMA 3F4KA 5A5GA 4AW9A 3K71B 1Q0ZA 2H18A 2GZSA 4FFMA 3E8MA 1JKXA 5LZ5A 4RY8A 4KO2S 5FO0A 4US2R 4LF8B 3OQHA 3AW8A 4QBTA 4A4DA 1Z26A 4HL6A 3GAMA 2CUZA 1W36C 4OUDA 1DAIA 2PL9A 2ZDQA 4CYMA 5TC4A 2O3SA 3MK31 3VU0A 3QEMB 1ZVJA 2GH1A 2GHIA 2OPBA 3FDZA 4FQ8A 3SBEA 3VPSA 1D2HA 2VYQA 3R77A 3IILA 5EKUA 2X86A 1MVOA 1S8AA 2H59A 2IKSA 2J0EA 2P7HA 5BWBA 5KX5B 1ECBA 2BZ1A 2DF8A 3DP9A 3LLMA 4MULA 4LXUA 4DE5A 5JHHB 2YXEA 2ORIA 5H5JA 4IGEA 4PHFA 4CKEB 3UAZA 3S2YA 3RSLA 2BGIA 3QUTA 4XVHA 1USVA 1ZBDA 4KYTA 4ZT2A 3I5XA 1QAOA 2OYSA 5K99A 1N0HA 1P9OA 4WJLA 1CVLA 2YDYA 2PPVA 3E22A 4PHHA 2ATVA 4PR3A 3AVVA 4A0GA 2CJYA 2I03A 3GH3A 3FYUC 4YO7A 3T7JA 2Z6QA 3HXQA 1J7JA 5A02A 3PVZA 3ZV6A 5LIPA 4LHYA 1WUKS