4EPXA

Discovery of small molecules that bind to k-ras and inhibit sos-mediated activation
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
170
structure length
170
Chain Sequence
GMTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Small Molecules that Bind to K-Ras and Inhibit Sos-Mediated Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords GTPase KRas
total genus 63
structure length 170
sequence length 170
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4epxA00
1OV4A 3RWOA 1CJKC 4TTPA 1D9XA 3KKNA 5UKDA 3NBFA 4F91B 1DBSA 1P4SA 3PIRA 1EFHA 3W34A 1H8HD 1QDEA 2C5LA 2FNAA 3TUIC 2GJAA 3OIYA 5DSZA 4JLAA 3DDCA 2EFGA 4FMCB 4AI6A 2ORVA 2J9RA 2HCJB 2QSZA 4LWZA 1ZD8A 2GKSA 1AKEA 3LW8A 4JBWA 2XEXA 1CRPA 3RS7A 4YMUA 2JA1A 1A2KC 5AUPB 3B9QA 2IT1A 3LLMA 5EE3A 4DC9A 1JR3E 2OSBA 3F0TA 3ZZUA 1E0JA 2FEMA 4YXWD 1UKEA 4IOJA 2VP5A 4M9XA 4D6PA 3CIOA 3FB4A 5KPJA 3AF1A 1BO6A 1L4UA 1E2MA 3KKQA 3GJXC 4PQYA 2Y8EA 4XWAA 1U99A 4ZCLA 1W4CA 2QROA 1M8PA 2BJVA 221PA 4ASUD 1XEXB 4HAZA 1X8KA 1S3GA 5GVSA 3GFOA 2WOJA 1I4TD 2P2LA 5C18A 1L4YA 4MDEA 4GZLA 1A1VA 1ZP6A 4AKEA 2VTKA 1KNQA 5JCPA 1DVRA 1X1SA 4Q9LA 2MSEB 1G3MA 4F92B 1SXJD 3MLEA 4JT2A 1UBCA 3OE7D 5EJEA 2PH1A 1YQTA 1JXMA 2QQEA 1E9BA 2OCBA 5EXTA 3SBDA 4DT1A 1E1QA 1NN1A 1VHTA 1PLKA 1EXMA 2CE2X 3SJZA 1TEVA 1GSIA 3QVVA 1KI9A 1N5JA 2JCSA 2QN6A 3F3YA 1U81A 5SZJA 4EPXA 1WXQA 3M1IA 2ZETA 1D5CA 4A0HA 5B58C 2AHOA 1R0ZA 2ZSAA 3IKJA 4DCTA 3RLFA 1TTTA 3QOFA 2FSHA 3W5IA 3QKSB 3B13B 2XAUA 1FUKA 2ASEA 4GMDA 3OEED 4D0NA 4ZKEA 5JWRA 3AVYA 1M34E 2CEAA 2YOHA 2ZRJA 2J41A 5L3QB 2ZTSA 1XPOA 3FYHA 1N6HA 4P32A 3SFVA 3TJZA 5DN6D 4BLSA 4NHOA 4URUR 4MUBA 2ZRGA 3C5CA 4BEBA 4C7OB 4H9GA 2RGAA 5BXQC 1NN3A 2REBA 4J0QA 3LX8A 4NPHA 3VHXA 2HXYA 2BIFA 4EIWA 4DT1B 2QRZA 3GFPA 5FUVA 2IYUA 2ZEJA 2CLSA 4ZI3A 4HB4A 1ZBDA 3X1ZA 4GSYA 3QVUA 4B34A 1GILA 4HI0E 3UMFA 1OFIA 3K09A 3MJRA 3ZJYA 2W00A 3OEHD 4F4CA 3OIWA 1E2PA 1G9XA 3GLHB 3LQRA 1E69A 5FPHA 1JALA 2IS6A 2BCJQ 1XEWY 1XTQA 3CW2A 2JLRA 3QXCA 4GP7A 2WJJA 4HZUA 2W6IA 3TIFA 2ZRHA 3HJNA 4NYIQ 3U3JA 1A2BA 1Z07A 1C4OA 1Z6XA 1NVWQ 1XEXA 2QQ0A 1CLUA 3PQCA 2B21A 4AD8A 3KJEA 4Q4HB 1XEFA 1W2HA 1CS4C 3AVQA 1KIMA 4MH0R 621PA 2FJUA 5FH9A 4NBSA 1TF5A 4GT1A 4WVFA 1XTJA 3B9PA 1WRBA 2ZJOA 4I99A 3EWSA 2HCBA 4D4KA 1P9WA 2X77A 3L0SA 3EIQA 2ZYWX 4B47A 2CVFA 3LLUA 1D9ZA 2PT7A 1W5TA 5FR2A 1ZU5A 2XNDD 1W4RA 4HYYA 3PJRA 2O8BA 2R6GA 4CEHA 4TYNA 1TEXA 1T3SA 5J4HA 1NLYA 1G291 5KNDA 3UG7A 4DB4A 1EFRD 1Z83A 2ZJ8A 4CW7A 1DAMA 4HDOB 2R8RA 2Q3FA 1JEDA 1BH2A 1Q0UA 2GCNA 2ZRAA 1CRQA 1G6OA 5EZ6B 1W5SA 5JI2E 3NEYA 2QM7A 5AJZA 3EZ6A 3CF6R 5EXSA 3KQHA 2QUZA 2DFNA 4C0LA 5C2JB 3D6TB 1YZTA 5B2ZA 3QBVA 3ZZTA 1GZSA 1FTNA 5FBQB 2R6FA 5J4LA 2NZ8A 3KZ1E 2FWRA 2RHDA 4OYHA 5EP3A 1LTQA 2VO1A 4MKFA 4M1YA 1EESA 2BVNA 4WXRA 3QPUA 4E03A 3LVQE 1ZM7A 2RMKA 3GEEA 5L3QA 3LX5A 2R6DA 4IFBA 2ZRLA 3H1TA 5EE5B 4B73A 4HSEA 1JNYA 1CKEA 1MV5A 1U98A 4Q21A 4CT4B 1HE8B 3LRPA 4KYIB 3J81k 2NMVA 1E32A 2V4ZA 4IDOA 4LRWA 4FCWA 3IGFA 2I4IA 2O0HA 2O8FA 3GLIE 2YWFA 4ARZB 1ZCAA 2O8BB 1GKYA 3A4LA 4C0HA 3TSZA 4IVRA 2BOVA 5EQTA 3PVSA 2C78A 4FD2A 1U0HC 4HLQB 4KVAA 4HLUC 2D74A 5DHAA 1Q1QA 2NO7A 1Z6TA 5B64A 2AKAB 1FNMA 4M1TA 1CULC 4PHGA 1XZPA 3PEYA 1EWRA 4QHSA 3MJHA 2J87A 1UJ2A 2C95A 2JAQA 3A1UA 4R2HA 4AG5A 3ICQB 2X2EA 4DDTA 1XD9A 1XD2A 3CF0A 4Q1FA 4WZ6A 3TK1A 4JLPA 5BN4A 1FFHA 2ZI4A 2ZE8A 1FP6A 5FBVB 1T3HA 2IYZA 3Q5EA 1NY5A 4FW9A 3U6KA 1BYUA 4NYJQ 2IX3A 1Z5ZA 2AKYA 2JLYA 2ZJZA 3O8BA 2IXEA 3P4YA 2YHSA 1UKZA 3PV0A 5LD2C 2DFTA 3QF4B 5FI0B 3C14C 1BKDR 1P2VA 5CJPA 4GRAA 4X8MA 4A6XA 5FL7D 4MRVA 4JLKA 3SYKA 3SS8A 1ZAKA 4MRSA 3U3OA 3B2EA 1N0WA 2Z5FA 2FZLA 1Q1BA 2BCGY 5FOWA 1TQDA 2F9MA 4DEYA 4PO1A 1A4RA 1KZ7B 3U7FB 1OE0A 4PQRA 2P6RA 1US8B 4LI0A 2ZS8A 1VHLA 1XNJA 1YZGA 1HH4A 4A0GA 2RGXA 2VEDA 3VFDA 1XJCA 3U7GA 3ZYCA 4M1KA 5E3HA 4NMMA 5JSZB 4QGFA 3OFNA 1ZU4A 1N0VC 2P6NA 4RFVA 2PJRA 4QBFA 1NVXQ 3QPVA 3P20A 2W0MA 2ZROA 1CF4A 1LB1B 2ZE5A 2QENA 4Q03A 1UF9A 4U00A 4JT4A 4GBMA 3B1VA 3AEZA 4BWYA 2LKCA 5G53C 1YR6A 1NN5A 4A6PA 3GLHE 1P7CA 5DI3B 4ZPXA 2WIBA 1KK3A 2GF9A 1XPRA 4BUJA 4KI0A 3A1SA 5ELXA 1TADA 2YWEA 3I8XA 2D2FA 1KI7A 3X1XA 2G1KA 3T1TA 2WKQA 4HAWA 1GVNB 1PJRA 4POAA 4PZLA 2VIIA 1COWA 3A6PC 1CR0A 4IHQA 1EGAA 4XVRA 3DKVA 4ABYA 3H0KA 1ZRHA 4Q4LA 4ZI2A 2VHTA 1MH1A 4GOKA 2ZYVX 2IEYA 4LJ5A 4LDJA 2AK2A 1GIAA 4Q1BA 3FFBA 4HUTA 2QP3A 1BOFA 4OQFA 2ZJYA 1D8TA 2BWJA 3BK7A 3GJ3A 3X1WA 4DKXA 2AFHE 4LC1A 4MKIA 2WPDD 1Z3IX 1RIFA 3CZPA 4II7A 4PC6A 1OXTA 5H1YA 3AKEA 4PFSA 1UAAA 1RFLA 2A5DA 4Q4HA 3PUZA 5CYPA 5JS7A 2O8CB 5KNBA 2GETA 3FWYA 5KSZA 4GDFA 2WICA 4F93B 1W49A 3HYRA 2NO9A 3CKLA 4JSYA 3CR7A 3TW4A 3DO6A 1IONA 1HUQA 1G4UR 1MKYA 2KJQA 3SQXA 1BMFD 4EPYA 3EAQA 1MOZA 4TT3A 2FZ4A 1N6KA 5K8IA 4HLDA 2P6UA 2EWVA 1NSTA 2OFOA 4B6EA 2GCOB 3AM1A 3U3RA 4NYMR 3DMDA 2X2FA 3BWDD 3NBXX 2QMOA 1R8SA 3R20A 2RCNA 4C9BA 1TPZA 2IXFA 1ZUHA 2BMEA 1DAEA 4OK3A 1RRCA 1HQYE 2NZJA 2WWWA 3FMFA 4BE7B 2KBEA 1RC8A 4E07A 1JECA 4DSOA 4XVQA 2ODWA 1V5WA 2EQBA 4IVPA 4Q7MB 3KKMA 4TSFA 1ZM3A 4CEJA 1QHHA 1LF5A 1Z08A 1JR3A 1AZTA 1AQYA 4B75A 5DLQC 2FMXA 2GNOA 3A1VA 4B3CA 4BASA 3W8RA 4KYUA 1NVUQ 1N2CE 2ZJBA 3N5CA 4I1SA 5JS8A 2HV8A 1NKTA 1IQPA 3D8BA 3W9YA 3B1XA 5CK4A 4A0FA 4ZCMA 4B2PA 1NY6A 3AF2A 3B5JA 1XDBA 1A82A 4I1VA 1ETUA 4TLAA 2JLSA 5JEDA 4NYMQ 2X19A 4HAVA 1QF9A 3K70C 4W5HA 3SYLA 2ZRKA 4LJYA 2DFLA 2OLJA 3SN6A 1KO5A 2WWXA 5IHPA 1YZUA 1NIJA 3LDAA 4C4PA 5DO9A 4HATA 1DAIA 2AN9A 3HP1A 2NPIA 1P62B 4R9UC 5F3WB 2F3TA 3T15A 3F5FA 1NN0A 3U60B 3EXAA 1CR1A 3K1JA 4WA7A 4ILEA 3BH7A 4P4SA 4Z54A 2GAOA 5CJ2A 1CXZA 1RJ9B 1TF7A 2AK3A 3IEUA 4HB2A 3VKGA 2VSFA 3HR7A 5HZHA 4A8JA 2QBYA 4MYTA 4KFUA 4XWOA 2VPPA 3MFYA 3VU9B 1MABB 2R9VA 4AURA 4DRZA 5DI9A 2WTUA 1R5BA 4Q9IA 1QBKC 1S1CA 2VH5R 4KLZA 2V54A 1F3OA 2X8AA 1PZNA 3EA0A 4JVSB 5JJIA 5GVRA 3R9IA 5FTKA 2XZOA 4US2R 2YKGA 3K9GA 2G9NA 1OH6A 1OPXA 1GNRA 2FN4A 1OFHA 2VHQA 3ZD6A 2VSOA 1OFUX 2QAGB 3ASYA 4WIAA 1E0AA 4B3DA 3WRXC 1ZVQA 1OSNA 2G0TA 3HR8A 3TUJC 5JHHB 4Q1AA 3H4MA 3PXGA 2RB4A 5KUTA 1QHHB 1TMKA 2ZRBA 4UXJA 1DAGA 4RVCA 2E1RA 2ZS7A 4L15A 1W36B 3U3KA 3T35A 2IWRA 2CHVA 1YR9A 2ZU0C 2W0SA 2CJWB 2ZVPX 3WXMA 1K5DA 4AKHA 1SXJB 2ZRPA 1DELA 2H16A 5SZKB 3R8CA 2RGDA 2WWIA 2FU5C 4W5JA 1G20E 4HLUA 2YWGA 3MGCA 3BFVA 2HLDA 2J7KA 1W36C 2R65A 1J7KA 5KDOA 3GJ7A 1W4BA 4HDQB 4KITB 1G16A 4DDWA 4NP6A 4YDHB 4OQNA 3GLHA 4EJSB 1HA3A 3KJIA 1E99A 4JL5A 5EE9A 1VYTA 2OBLA 3GPLA 3KTAB 3LWNA 4HB0A 2J7PD 3RS5A 3UIEA 2NQ2C 1GRNA 1XTKA 4A36A 4OBEA 5CM8B 2D7DA 3CPJB 4DLWA 1G8YA 4DBLC 1VCMA 1QVRA 4A1FA 2PCLA 3GLGA 3UWKA 3KB2A 3LY5A 3CNNA 3CPHA 1XCPA 4JKYA 2E87A 2O8DA 1Z0KA 5L3SA 3UWOA 4DVGA 4C0KA 4X8HA 1Z29A 2VHJA 2RGBA 1VECA 2ECKA 1S8FA 4MITA 1X3SA 2EYUA 4EQ6B 2ANBA 2F3RA 3I92A 1VDZA 4GPTA 1IAQA 2VYFA 4PSKA 2F1IA 3MG9A 4IOMA 4JSTA 2OBMA 4OI2A 2EFCB 1G8PA 3W8NA 5JJLA 5BYKA 3RVBA 2QPAA 4NDZA 1E9CA 2DR3A 1XB2A 1OFTA 1T5LA 1SQ5A 1UDWA 2OCAA 3CWZA 4Q18A 4RD0A 2ZQ5A 5TB5A 4B48A 3TH5A 4KLNA 4PO9A 1M2OB 4LHXA 1WB9A 3O8CA 4R7ZA 1N6LA 4LPKA 3PITA 1Z8FA 3GJ0A 4BFTA 4MGYR 2OAP1 2QMHA 1W4AA 3IUYA 4DLSA 1S9DA 3HPQA 1MO4A 2GZDA 2Q0HA 1NI3A 3GLGB 3K0CC 4HAXA 1P6XA 2XXAA 4TQAA 1KDPA 1NMZA 3P27A 3SOPA 2VSXA 5P21A 2C8VA 4LUCA 2BJWA 3OESA 1HTWA 1E0KA 3OE7A 3EPJA 1N25A 4HLCA 5KSYA 2GXSA 4OJKA 2ZS9A 3BH0A 1OYWA 3R8FA 2JGNA 4Q9JA 4EPTA 1G8GA 3RABA 2C04A 2CCGA 2IYVA 3FKSA 3QG1A 2GJ9A 4P4TA 2VA8A 1R8QA 1NG1A 4TLCA 4LHWA 3P32A 1E9AA 1XJ0A 4WZBE 2DCUA 3QI2A 3L82B 3L8YA 2PJZA 5FBWB 1GOTA 3FHCB 4URVR 3BB3A 3N70A 2GVDC 2FPMA 1IN4A 1UDXA 3R9XA 1NBMD 3I72A 4PHHA 2EFDB 4F7WA 3OF5A 4IFEA 3R7WB 2RGNA 2VQSA 2N42A 3QF4A 1OHHA 1GNPA 1OIVA 2ZI6A 3FHOA 1R7RA 4HAUA 4NCHA 3TSWA 2KE5A 3IQWA 2H7VA 4TYWA 1I2DA 4P4UA 2JASA 2PMKA 2WKRA 4B74A 5CM9C 3U4QA 2OILA 4G5OA 4M0LA 4URZR 421PA 3NHAA 2HYIC 5TMPA 4EPVA 3EA5A 1FQJA 1GDDA 1W0KD 2Q21A 3GEHA 3A4MA 4GP6A 5AK0A 1Z6YA 4OL0A 1DO0A 1KNXA 2HDNB 2O52A 1CJUC 3C4JA 2AR7A 1XZQA 2DFKB 4DB2A 2BBOA 1Q3HA 3MRSA 4X8LA 1KOFA 3QIAA 2G6BA 4Q1CA 1T6NA 3U44A 4AKGA 1J8YF 1SXJE 2ZI5A 2W6ID 2XSZD 4M4SA 2QRNA 1IBRA 3PUWA 3TR5A 2VLIA 4JLMA 4WZAE 1T3LA 4V0LA 4KU4A 4IDNA 4WXPA 4ZO4A 2XTMA 4UNNA 3VR3A 1D2EA 2PZFA 1P2TA 2IHYA 2QE7D 4URXR 3CM0A 2NPFA 1II0A 3EG5A 1XRJA 4EJSC 1CP2A 5EUQB 3SJAA 1TF2A 2GEVA 1WDTA 1XJQA 3QXJA 1ZNYA 2UZ3A 4QJ4A 2Z4SA 3BGWA 3D31A 4AKIA 2BM0A 1SVOA 1AKYA 5AWFC 4N1AA 1PUJA 2WWYA 1VCOA 4B35A 2IL1A 2IUSA 3M6AA 3UG6A 1E2IA 1IN5A 2AXPA 4N0EA 4Y0VA 2GWHA 5JRJA 1G7SA 3L8ZA 1N6RA 1E9EA 4ZIRB 2Q3HA 1G7RA 2ONKA 4JMPA 4M9QA 4QJ5A 5FOVA 1C1YA 2CK3D 4G3XA 3U6BA 4U7DA 3ADBA 1OKKD 1KI6A 2IYRA 3HU3A 5JEEA 1E2KA 1LW7A 4GOJA 4TMZA 1WMSA 3IO5A 4WAUA 4TTRA 2PEZA 4LJ9A 3RSLA 4TTQA 2A3RA 1XXHB 2P65A 3S1AA 3THYB 2QP4A 4TMXA 3MSXA 4O0MA 1XFAA 1NL3A 3KTAA 1E4YA 2HF9A 3LBHA 4DCUA 1UBGA 1U9IC 5DE3A 3TGPA 5E7JA 5HKKD 2A9KA 4FI3C 1GRQA 1Z2CA 4XD7D 4Q4JA 2ZANA 3CRQA 4TWZA 1ELOA 2ATVA 4V0KA 3SI7A 3GLIB 5C4MA 2Z83A 3TNFA 1G19A 1SKYB 4WW0A 4DLTA 2WMOB 3FFAA 4PC3A 4BFWA 4EAQA 4Q48A 5L8VA 2JLVA 1G3RA 1Z0JA 3PG5A 5J4YA 1OYYA 5JWHA 1OIXA 4RD1A 1JI0A 3WMEA 3KDSE 2CHGA 4Q4AB 3W6NA 2PZGA 3QJYA 3U61B 1R5NA 1GL9B 2GJKA 3B60A 1GP2A 1US8A 2DBYA 4NCJA 2AL7A 2V55B 4BLQA 1KO4A 2BMDA 3RS3A 3FOZA 5IK2A 1GUAA 2VP6A 3QKUA 5BN3A 3LW7A 3MCAA 5K8LA 4LZZA 4DLXA 2OBNA 2V6JA 3FE2A 4KFRA 4TLEA 5HE8A 1E2GA 2GF0A 1BIFA 4GZMA 3W6PA 1G8FA 1M6NA 5KNCA 1AGRA 2J0UB 2GRJA 1G5PA 2AFIE 1P3JA 4CF7A 2YZ2A 1XD8A 2QAGA 4XTRA 5C4GB 3CZQA 2GEUA 1Z6GA 5GJWC 3LBNA 1R4AA 3GLIA 3GLFB 2WJVA 4JJZA 3QSYA 2PBRA 3BORA 3UMSA 4F38A 3EARA 4QKQA 4RD3A 4Z1MA 1TL7C 2ZRNA 2RKOA 3EZFA 3AF4A 5CB6A 4NCIA 5IDVA 4M1MA 2WKPA 2NG1A 4YQFA 5EP4A 2W2XA 2W58A 121PA 5FPTA 1HV8A 1H8EA 5H8WA 5AJXA 5LD2B 4LPSA 1E96A 3NKVA 5H68A 2H18A 1F60A 1P5ZB 3HU1A 3CRW1 4ARZA 4MRNA 4B44A 3Q72A 3RRZA 2ZSFA 2KB0A 1FX0A 3AB3A 3LBIA 4OHZA 2OM2A 4PSVA 1GFIA 3T06B 2H92A 1F2TB 3OHMA 3ZIAA 2IHBA 2Q9BA 3LXXA 4V0ME 2OZEA 2OXRA 1DTSA 2RGEA 4G01B 3THXA 4NH0A 5F98A 5SZHB 4B32A 1T0JB 3D7MA 4HDCA 4JBXA 1VYUA 3ZS8A 1FX0B 2WJGA 2ZI9A 4TMVA 3T34A 1OIWA 3KUDA 3Q85A 1YZQA 4O3MA 4KHZA 3SJCA 4Q5IA 1COWD 1NLFA 1FMLA 3LO5A 1II9A 3RSOA 1TX4B 1YZNA 5KTYA 1M74A 2C96A 1NRJB 3IQXA 5JCZA 3A1TA 3A4NA 4LBZA 4XVUA 4V0OA 3KL4A 1IY1A 1GL6A 1NKSA 3DMNA 4NL4H 2PEYA 3RC3A 1NBME 2Z0MA 2Z6VA 3L2OB 2MSCB 2V8OA 3OIVA 5AR1A 4L8GA 5D3MB 4NE2A 2GESA 3RS4A 3CLVA 4D2IA 1E2NA 2HXSA 1G3UA 1XMSA 1E9RA 4PXAA 3ZGXA 4M2LA 2RHMA 3V9PA 4TMWA 1SHKA 4IOLA 3FMIA 1VG1A 2QSYA 4H1VA 4B76A 2J0UA 5JLJA 2A78A 1GWNA 3SHFA 3WBJA 2A5GA 3DHWC 1I2MA 2ZE7A 4EDHA 4TL6A 1UFQA 3BJIC 2QMEA 4A0RA 4DDUA 2ZM5A 4W9MC 3RRNA 1SXJA 1NF3A 5FPYA 1SGWA 2YOGA 3MUFA 2HEIA 3L0PA 1II8B 1QHIA 3JZMA 4D0GA 5A4JA 4AY2A 4RSGA 1G5TA 3I4LA 1X6VA 2WIAA 5DHFA 4DLYA 2R2AA 4JYBA 4MGZR 1RW4A 1E1QD 1J90A 5BYJA 3C8UA 2KBFA 4EPWA 3ZQJA 1GNQA 4N3NA 2B8WA 5FPSA 2IYWA 4FMDF 2QU8A 2F1RA 1IXZA 3GLGE 2WJYA 3ADCA 4MYCA 1GITA 4BFSA 5DISB 2JLXA 3CH4B 1QVAA 3QE0A 1HQCA 4GI7A 1T5IA 1J99A 1UPTA 2LKDA 4US1R 3FGNA 5FTJA 5AJWA 2C9CA 4XTCS 2GZAA 2RH5A 4IDPA 2CL7X 3QBTA 4AYWA 1OH7A 1G18A 2JDIA 1XU4A 3BOSA 2FOLA 2WMNB 4M8NE 2WWGA 3CR8A 5G41A 3RRMA 1GKUB 4A82A 1TU4A 1PVOA 1P72A 5CK5A 1E9DA 3R9WA 1KJWA 2GEDA 2YYZA 4V02A 1UEJA 4UNQA 4NTZA 2IS4A 1UKYA 1FQKA 2B6HA 2BBSA 2QAGC 1R6BX 2CLDX 4UXIA 3KQUA 4L5BA 1G64A 2H17A 3EZ2A 3QXSA 2H57A 4YLGA 3VR1A 4CIDA 1DAFA 2JJ2D 4LV8B 4O2RA 3EIEA 4CEIB 1JEEA 4BLPA 4DSTA 2FDCA 1Q20A 3KFVA 4PZYA 4BFVA 2XB2A 1WE2A 1OW3B 3T1OA 2QEQA 3EZ9A 5EUMA 3ZH9B 2FX3A 3OZXA 2GXQA 1NMYA 3BAFA 3EIHA 3MWKA 5M04A 4LHYA 1E2LA 4AG6A 1SXJC 4FIDA 2VP2A 3UMRA 2DYKA 2F1JA 4LJ4A 4EFLA 2ONJA 4BLRA 1D6JA 2UVQA 5KSOA 4A4DA 3NWJA 4A9AA 3RWMB 3O47A 4B6FA 2FV8A 3X1YA 2W6JD 1Z0AA 3PEWA 3WNBA 4JL8A 2R6CA 2ZUCA 4G1UC 2QL6A 1FPMA 4JL6A 3A8TA 3AF0A 3FMOB 4A15A 2CCJA 4QC2A 4ZCIA 1Q44A 2XNDA 2GCOA 1FTSA 1VG0B 4JYCA 3K53A 4YMVA 5IRCD 1F6BA 4JVMA 1GL7A 5IF9A 1VCNA 4QBGB 1S1MA 1SVWA 1U9IA 4DUGD 2FFAA 4P3YA 3BFXA 3I1FA 3NC0C 4UQOA 4CEIA 2LWIA 3L43A 2XOKA 1EFUA 3DVLA 5BN5A 4PHTA 2GILA 2A5YB 2YNMA 3IIJA 4C2TA 1Q21A 3RNLA 4B3FX 4K46A 2HJGA 1E79A 2FPLA 1JXOA 1YU9A 4JLDA 3PUVA 1D2NA 3ECCA 2Q9CA 1FW6A 2YJTD 4PX9A 3IO3A 2J45A 2HJVA 2O8EB 2OHFA 2FG5A 3TSOA 1KSGA 2D2EA 1N3BA 3ZVLA 2PLRA 4M9SA 2FGJA 3BERA 4M1SA 1XMJA 4ON9A 4TYYA 3W5JA 1YKSA 2BMJA 3BBPA 5A5GA 1M1YE 3QG5A 1E1RA 2IC5A 5TARA 5JI3E 3BRWD 3LAWA 2HLDD 4FCVA 1KI4A 1RKBA 1AK2A 2MMGA 1KGDA 4A2QA 1ZJ6A 4D80A 4D4JA 3ZD7A 4Q66C 4XH9B 4FXPA 2Q3MA 1AM4D 4NZYA 4QM7A 3T12A 4RZ2A 3TLXA 3P4XA 2BBTA 4IJMA 3AVPA 4IDQA 1WQ1R 2CDNA 3SNHA 3QY0A 4RZ3A 1JQLB 5CIQA 2PL3A 2J7PA 2V7QD 5E7MA 5KPDA 1ZC3A 3F8TA 5E95A 4JVNA 5JECA 2BV3A 1VIAA 3GLFE 1CU1A 3PUXA 1ZM4A 4RFSB 3FVQA 1OJLA 1K6MA 4AYTA 4IOKA 2OEPA 2FF7A 3BC1A 3EZ7A 4WOPA 1D2MA 3QENA 4HB3A 1P61B 3WNDA 2XB4A 4B3BA 2IEZA 3HYTA 4HZUB 821PA 4YMSA 1XXHE 4PAOA 4V03A 5SZIA 3QEJA 2L0XA 4PR0A 2B7BA 4JVLA 3GCGA 1JPNA 4ACAA 3CONA 2ZSBA 3C41J 4ZDJA 1AN0A 2YV5A 4PANA 3REFA 1OH8A 1ZW6A 3NBYC 3RS2A 4ESVA 1OT3A 4H1UA 2J0QA 1IM2A 4DHEA 5EP2A 2AWOA 3NDBB 1N6IA 1EWQA 4G5QA 5FBRB 1U8AA 4R98A 3VKWA 1NSFA 4DLRA 4TQ9A 4ZIRA 4LHVA 4FMBB 4QGHA 4A8JB 1B0UA 2QBYB 4LYAA 1N5LA 3AVVA 4MGIR 2QA5A 1ODFA 3I32A 4DXAA 1H8HA 2OT3B 3LA6A 4A2PA 4Q19A 4BEJA 3TUZC 1G3IA 4B2IA 1KAGA 3H2YA 3U5ZB 3THWB 4MDFA 1LS6A 1W0JD 4Q1DA 4DSNA 3E70C 2V6IA 3PUYA 2IYQA 3JZAA 3NHBA 3W3AA 4S35A 3RDPA 1SVKA 1OXVA 5DYIA 3SR0A 3VKHA 4XSGA 3NG1A 1ZNZA 1QHXA 1ZINA 1TAGA 2NIPA 3NDPA 1NVVQ 4YXWA 1G1MA 2EWWA 1SKQA 3K0FB 1Q1EA 3CB4A 2PLFA 4XIGS 2H5EA 3UANA 2IYTA 1B23P 2JIZD 2ERXA 4OKSA 4QM6A 2V1XA 2O0JA 3HDTA 4ASUA 4NCKA 1XTIA 2RAPA 4KBGA 5KOYA 4LJ8A 4UNPA 1GKIA 3SEAA 3GJ8A 3HWSA 3TQCA 2CL6X 3ONWA 4BFUA 3SBEA 1YJ5A 5E4FA 3K0CA 5C1BA 2QGZA 1VTKA 1XTRA 2F43B 5JWOA 1HEIA 4LY6A 4IDHA 1SZPA 1VG9B 4U5XA 3UPUA 2ZI7A 2ZYTX 5DNYB 3VQTA 3THWA 2D62A 1T8UA 2XNSA 3WMFA 3P1JA 1XBTA 4IRUB 5HCIA 3QXHA 1R5OA 2DWQA 2ZREA 1YHNA 4PPNA 2QG6A 4QJ3A 1N5IA 3PEVA 4MKGA 4I1UA 5FOTA 4X8OA 3CWQA 4ERNA 5BW8A 4D25A 3WRYC 4D82A 3MAAC 3VX4A 1CR2A 3DOFA 3GJ5A 3IBGA 3PR1A 3Q8XB 4F4IA 5LB4A 1YE8A 2ZR9A 2BHRA 3IBYA 2I3BA 1KI8A 4BZXA 3PCRB 2XX3A 3ADDA 1F2UB 4M53A 1E4VA 3T1VA 5C46F 4QXAA 5TDHA 2OXCA 1IY2A 3RAPR 1E2JA 2K5UA 3NVAA 1I4DD 1P2SA 4GL2A 4JIMA 2XTNA 3RRYA 3P26A 3I8SA 1J8MF 3TMKA 3O8DA 5GJBA 3ICEA 5FTNA 4TL9A 2A5JA 2WSSA 2D7CA 4IEEA 1R0YA 1OB5A 4RD4A 4ZDIA 4Q9KA 1JBKA 5F2EA 1LS1A 1J2JA 2XSZA 1AGPA 1KSFX 1WBDA 2CHQA 3C7KA 3V4RA 1WCV1 2AD5A 3DZ8A 5D3MA 3TAUA 2O8FB 5EP1A 3KFXA 3EASA 2ZRFA 2CNWA 4BFXA 1DPFA 1QHGA 3OEHA 2QE7A 1S4QA 1TUEA 5J4VA 1RPZA 3V00A 4UNRA 5FBLB 1IJEA 3ND9A 5B30A 1KI6B 1NLZA 4ITRC 2RGNC 5L3VA 3C5HA 2EU8A 1XEWX 1S96A 4OI0A 4C0SA 4C30A 2FH5B 1CBUA 2C9YA 3B78A 4KAXA 1VG8A 1G17A 4U02A 2GJ8A 2ZR0A 5CYOA 4B3XA 1IOZA 2KI5A 4GNKA 4RKEA 4LBVA 1Q1ZA 2IYXA 1G8HA 2WHXA 4RD6A 3CX6A 2BKEA 1JR6A 2CXXA 3KJGA 1Z2AA 4RCYA 1GAJA 4AWXA 2FFBA 2JLZA 1IXRC 2GK6A 2ZYUX 3EPKA 3CF2A 3AGPA 4OQLA 5CLLA 4LV6A 1EK0A 1KDOA 1OKKA 3AQ4A 3CO5A 3ASZA 4OI4A 3W90A 1X8JA 2P3SA 1KDTA 1IHUA 3T1QA 3OIUA 4Q7KA 4LYHA 4HEJA 1EFRA 1DEKA 4M1OA 4OJQA 4PSAA 1KAOA 3I61A 2H1LA 4QNRA 3NEJA 5AJYA 1KO7A 3QPWA 4JLJA 4OQXA 3AVWA 1XCMA 2IWHA 2EW1A 1NMXA 4D4MA 2C77A 4TN1A 4LV5B 3KQKA 5KO2A 4CT5A 4BPBA 3FKQA 4M1WA 3IPYA 4MYHA 1A7JA 5EXPA 4MUAA 2R62A 3BD9A 3VX3A 2PX3A 1EX6A 2UZIR 3IIMA 3B1ZA 4G5RA 4B2LA 4UNSA 1II8A 3EPHA 1G6HA 4R71A 4OHVA 3VNUA 3MMPA 1OF1A 1EG7A 1CTQA 4BECA 3U44B 4TLBA 4FMCF 1W1WA 3IPXA 4UXHA 1L7VC 4B43A 1N0UA 1RVDA 4LJ7A 2ODBA 5CDFE 1AA9A 2JJ1A 3VTKA 1XXHA 3S1AB 4GFDA 4OHWA 3THYA 1LY1A 2XXAB 1KTVA 1CJTC 2XITA 3ZDQA 4CDGA 6Q21A 1P75A 4JLVA 4CVNA 3GJ6A 3I5YA 3B1YA 3VR2A 2VL7A 2DHRA 4L9SA 2PMDA 1RYHA 3W6OA 1E2EA 4OI1A 1MRNA 3TW8B 4DDVA 3AUYA 2IYLD 1M7HA 4KBFA 5FOSA 1YRAA 5LBIA 3RHFA 2UKDA 4JBYA 4EFMA 4AK9A 5F9FA 2E9SA 3OAAA 3Q5DA 4WBSA 4HUQB 3CX7A 2DWPA 1P9RA 4US0R 2Q9AA 2ORIA 1E9SA 2G88A 4S2EA 5TV2A 3H86A 3G5UA 1NG9A 1QG4A 2BDTA 2R44A 3B85A 1W46A 4C0BA 2C2HA 1RYFA 3WY9A 3CH5A 2GCPA 1OXXK 4E09A 3EX7C 2XJ4A 4HZIA 4D0LB 3RC8A 4QBHA 2CVHA 1NP6A 2PT5A 4EUNA 3BB1A 1YZKA 4RZXA 2NO6A 2BKUA 5KHOC 2OV2A 4JS0A 5IT5A 3M0EA 1PUIA 3NC1C 4ZKDA 3K9NA 5G3YA 1H8ED 3MD0A 3HU2A 4FWIB 4MYUA 2FSIA 3B6EA 5HR5A 3VR5A 2OCYC 5TXGA 2NOAA 3L0IB 2O8CA 3K0AA 3SE0A 3ZLJA 1AQUA 3KXIA 3Q3JB 3I62A 1NVVR 4KSCA 1ZYUA 4TL7A 4OK5A 1E98A 2P67A 4PPGA 2I1VB 3ZIAD 4G0NA 4Y0AA 1E94E 1IJFA 4PAQA 3MWJA 2OUKA 1L2TA 1VMAA 3GFTA 2QTFA 5L3RA 3SC3A 3GQBA 4DLZA 4FWTA 1MO5A 4AYXA 3K0AB 1QHNA 5FOUA 1DO2A 3BB4A 4JLNA 2J1LA 4A2WA 4ESHA 4C2UA 1GTVA 3KUCA 4Q4AA 1P73A 8OHMA 4PO8A 2GBLC 3B82A 4KVGA 3BIFA 4R2IA 2W83A 4E5UA 2PZEA 4NONA 1ZIPA 2HF8A 1XMVA 3BFKA 4KCGA 2ZJ5A 3I73A 1ZC4A 2MSDB 4IEIA 5AUNB 2ZUBA 2FPKA 4PC1A 1OH5A 2IUUA 3BXZA 1F2TA 4LJAA 5DH9A 2XZLA 2O0KA 4TLDA 2ATXA 4A8JC 2V9PA 2DPXA 4C7OA 2CCKA 1FL9A 4QRHA 5KDDA 2IS2A 3Q7QA 3E5HA 1MO3A 3EPLA 4IXNA 1WA5A 3QUSA 1R0WA 5K8TA 1TQ6A 2FE4A 4LC0A 2ZPTX 1MRSA 3DM5A 2REXB 3KQLA 2MMCA 3KKPA 4PC2A 3TE6A 3NTUA 1UBFA 3K8YA 2OFWA 3SHWA 4PZZA 1RJ9A 3SYNA 2F7SA 4TYQA 4V0MA 2J0VA 1S9HA 2WSMA 3FHTA 1S3SA 4XJXA 2BBWA 2HUPA 2WWHA 3LNCA 4AIIA 1N6OA 4L16A 4LBWA 5AJVB 2ODNA 1TU3A 3MWYW 3DM9B 3VMFA 4QL3A 4TL8A 2WPDA 2D3WA 4A92A 4NYJR 1U8YA 1KDRA 1SKYE 2R6AA 4MRRA 3D3QA 4P31A 1S2MA 1X1RA 1E6CA 3FKSD 2ERYA 3TKLA 3QQ5A 1JQJC 2RGCA 4UJ3A 3RS0A 2IF0A 3X2SA 4B3GA 2AWNA 5GJVC 3N2EA 1KY2A 1YVDA 5CIWA 2GA8A 4PPQA 1KZGB 1LNZA 4NKRA 1BYIA 1G41A 4TT3D 2VP0A 1NBMA 4TZ6A 2W2TA 3AV0B 3BS4A 4JKIA 1IY0A 3VHLB 4DJTA 5BQ5A 2HT6A 2JDID 2VRWA 3K0FA 1U8ZA 4QOSA 3EW9A 1XTSA 2WAXA 5GJCA 1XF9A 1ZNWA 1K5GA 2WAYA 1RRPA 2QPTA 3B8HA 1KK0A 4Q7JB 1W48A 2B7CA 2EYQA 4Z8XA 3NXSA 3OEEA 4FINA 1KI2A 4DCSA 1VKJA 4LYFA 2SHKA 2TMKA 1XWIA 3CX8A 1IN8A 1E9FA 1F48A 1W0KA 1Z47A 3THXB 4URYR 2J46A 4LSGA 3KX2A 5AUOB 1JR3D 1PLJA 4CRWB 2C03A 5DN6A 1C9KA 1KJZA 3JVVA 4KV9A 4PC7A 1XMIA 2PCJA 1DG3A 2NO1A 1HY3A 1ZMXA 4MA4A 2GXAA 2JLWA 1JJ7A 2A30A 4QGGA 1E0SA 2FGKA 2GHIA 1Q3TA 2BC9A 2J5XA 2YC4C 1P60A 1CJVC 3LFUA 3AF3A 3ADKA 3WYFA 3NH9A 1DARA 2G83A 3LXRA 2W6JA 5CDFA 5EE1A 1Z28A 2B92A 1KSHA 1KI1A 2QT1A 2ZSEA 4RFSA 2OO7A 3W3ZB 3DZDA 1KJYA 1JPJA 5DGXA 5FUWA 1NNEA 1E2FA 2ZRMA 1UBEA 2BEJA 2QMUA 3QEOA 2RGGA 4ZV4A 4DEXA 1OLOA 4P0TA 2F6RA 3TVTA 2IYYA 1ZCBA 5G3ZA 4AC9A 1WP9A 1W36D 5J5CA 3ZQ6A 4W5WA 4OHYA 2ORWA 2CK3A 1AS3A 2IA5A 4QBIA 1AZSC 1E2QA 5ANRB 3R7WA 4ZDWA 1G21E 2ZITA 1X86B 4TQUS 1E2DA 4EFNA 2CMKA 1Z06A 2OLKA 5HCNA 2FFQA 2O5VA 2WBLC 3V4FA 5K8UA 3K0SA 2GZHA 5J47A 5JBQA 1SVSA 1DG1G 5FFMA 5CLQA 1KSJA 2A2ZA 2QM8A 2GAAA 2C98A 2JEOA 4RKFA 4QNMA 1LFDB 5FOXA 3QNUA 4EJSA 4TZ0A 5A0FA 5HKKA 3LD9A 1X8LA 1YRBA 1XP8A 1Z0IA 4IXMA 3U7EB 4DLVA 1KK2A 2ZXUA 2J3EA 2GBLA 2ZAOA 1E1RD 3GMTA 4XD7A 3AVUA 4FMDB 2QPOA 3X1DA 2QGNA 3ZVRA 1K8RA 1HT2E 3AKYA 1DADA 3B1WA 3GEIA 1U2RA 3IILA 1P2UA 4B71A 1AJEA 1Z0DA 3PFIA 2X1VA 3IEVA 3VR6A 5JMTA 1Z6AA 1G5RA 3KXLA 4GMXA 2BEKA 2V7QA 3ND8A 3PENA 3T5GA 2OE2A 3THOA 4I1OA 5CITA 4QHTA 1CIPA 2F1HA 4FCTA 1IN6A 2C99A 3NIBA 3DL0A 2IBMA 1AS2A 3NBZC 2CL0X 1A5TA 2A7QA 1S0UA 4Q4JB 4MQBA 4P33A 1T0HB 2YOFA 5JFGA 1U0JA 3FDIA 1IN7A 1DS6A 1Q57A 3Q9LA 5F9HA 3SFZA 2ZVQX 1N6PA 3TVDA 5JSZA 2Q6TA 4RJLA 3QKSA 2G0NA 3JVUA 5FR1A 3VU9A 2D06A 1MABA 2VP9A 2OFXA 3AUXA 3B7GA 1ZIOA 1W7AA 4C0AC 3TR0A 2CLCX 2QZ4A 4D4LA 3G0HA 4PQFA 5FL7A 1Y63A 2OAQ1 2ZSDA 2WOOA 2A5FA 1KY3A 4GOXA 5G40A 1LVGA 2KWIA 4C0QC 3RYTC 1LF0A 1M7GA 1XD2B 5J40A 3CRVA 2O8EA 5D3QA 1W0JA 3WHLA 1RRFA 2DY1A 2QTVB 2ANCA 4NYIR 2REOA 2EVWX 2WZQA 1SVMA 2WVJA 3TAHA 2EFHB 1R0XA 1DAKA 2FA9A 3KJHA 4NCNA 2VHCA 2WJIA 1ZD1A 3I3SR 3AP2A 3WYGA 4OK6A 3OFND 2Z4RA 2ZJAA 1WBBA 2G1JA 4DIDA 1FOEB 2AD1A 2J0SA 1E3MA 3K0EA 3CNOA 5FPKA 2I1QA 2NGRA 2YVUA 4G5SA 3MWLA 2JIZA 4JLOA 1GG2A 4M22A 1U0LA 3GJ4A 4JZKA 4NU0A 4Q1EA 4YDSA 2W2VA 3QKTA 1U94A 2QT0A 1G3QA 5JHGB 1KMHB 2JLUA 2JJ8A 3KKOA 1SULA 2H8KA 1BS1A 4Q47A 1VCIA 1QHSA 2QAJA 1ANKA 1RZ3A 2PX0A 1KYIA 4BZQA 1OB2A 3DPUA 4XSHA 2N1BA 521PA 1TQ4A 2FEOA 3ZVNA 1ZM9A 3EC1A 3BH6A 3AH8A 5E7IA 1MT0A 1G4AE 3A1WA 4KXFB 2YINC 2QI9C 4URWR 1MO6A 5TVKA 3WNCA 2P5SA 1T9HA 1O3YA 1NJFA 2XTZA 3LH5A 2V1UA 4ZDKA 4LGMA 4I81A 2XGJA 4RY2A 3EC2A 4RCZA 4YMTA 1SVLA 2ZU6A 1RE0A 1RRGA 3AKDA 1JAIA 1ONBA 1XCGB 1ZD9A 2VBCA 3UATA 3AVXA 1N5KA 3N2IA 4M9ZA 4RZUA 4JLBA 3VAAA 4D81A 4KFSA 2XJ9A 4LJ6A 5DI3A 1GRRA 2Z43A 3A36A 5GADl 1KK1A 2KSQA 4TMTA 3E1SA 4E22A 3EWAA 5FI1B 2VP4A 4UJ5A 4MGKR 2O8DB 1R2QA 5L3SB 4Q9HA 1Q22A 3AVTA 2WJHA 2GDJA 2IF2A 3AKCA 1T8TA 4N0DA 3CBQA 1QG2A 1OHHD 5JJKA 1M7BA 2VHUA 5EE0A 1KI3A 4YC7A 5LDDC 1IXSB 1FZQA 4YONB 3CRMA 5LB2A 2VF8A 3REGA 1SHZA 2FSGA 2OG2A 3CNLA 1VIYA 5FL3A 3GD7A 3QF7A 1Z22A 3DKPA 2WSSD 3DEFA 2IS1A 4BFZA 5KDLA 4DSUA 1SVIA 2ZUDA 5DIFA 4DIEA 4CGZA 4CEJB 4TMKA 1JJVA 5JZVA 5J4KA 2J59A 3A37A 1QRAA 4HAYA 5HZKA 2OESA 3WP0A 5JRZA 1QZXA 2DB3A 1BMFA 1F5NA 3VR4A 2CNWD 1KKLA 1UADA 1W47A 4OHXA 4Q7LA 4XWKA 1F2UA 5HPYB 1CEEA 1ZUNB 1UEIA 1OXUA 4RD2A 4EKDA 3C15C 2P5TB 2IW3A 3LVRE 2JLQA 1EFCA 1FMJA 4BLOA 4O2LA 1OXSC 3K9LA 5FUXA 1KO8A 1KMHA 2WV9A 3SQWA 2N46A 4LOAA 3K70B 1TUIA 4CEHB 2QP9X 2NO0A 3GP8A 4C3ZA 5BWMA 1GM5A 4IW3B 5FTLA 2WWFA 2GJSA 4QG7A 4FN5A 1VYVA 4TSFD 5FTMA 3ETLA 1JAHA 2JJ2A 1PLLA 1LV7A 2CE7A 5DYGA 1R10A 3WBKA 2G3YA 3E2IA 3WMGA 4QHYA 1EX7A 4G5GA 2FSFA 4IKEA 3UKDA 4B33A 4DCVA 5B57C 4QFMA 2ZAMA 2XZPA 2BMFA 3L0OA 1J70A 3FMPB 1KKMA 2QTHA 1ESNA 2D4HA 1L8QA 1PV4A 2AXNA 5KU1A 3C16C 3A58B 4DLUA 2F9LA 1ZUIA 2V3CC 2P0EA 3QKRB 4MKHA 4XOIA 3UXMA 2EFEB 1NIPA 2LCFA 2GK7A 3ZS9A 1ESMA 3GLFA 1MR3F 3ZVMA 3I5XA 2IYSA 1DAHA 1EFTA 3IDQA 2G77B 2IUTA 1I4LD 1VPLA 3U3MA 3Q7PA 4M21A 4W7SA 721PA 2B8TA 4L4UA 4MRPA 4C0JA 2CBZA 3LQQA 2QY9A 3BE4A 1T91A 3AVOA 4LX0A 1G7TA 3FTQA 3QXXA 1XPUA 2VF7A 3K09C 3WP1B 3KB1A 4PHFA 3RANA 1Z63A 4DUGA 2GTPA 2JJ1D 4DCNA 5LPNA 1WF3A 2XOKD 4ACBA 1H65A 2HYDA 4L9WA 4KO8A 3AP3A 3SU8A 1YZLA 4DZZA 1XX6A 1ZNXA 3K9HA 4V0NA 3VNVA 1E79D 3O8RA 1HYQA 4LYJA 5EXXA 2DWOA 1JB1A 1U90A 4PAMA 3K70D 4O25A 1KMQA 1Z0FA 3IHLA 2ZRCA 5FUYA 2ZI3A 1AS0A 2GXUA 2JATA 4QGAA 5TY0A 4CYMA 3U7HB 4Q01A 3CPEA 1UM8A 4P4SB 4K8OA 1Y3AA 4PTLA 2GVZC 4EQ6A 3WYAA 1N6NA 3OAAD 4JJKA 4LBYA 3UK6A 2ZIAA 3TBKA 5EZ5A 4EPRA 4DWJA 2F55A 3DOEA 2QORA 4D26A 3TRFA 5IK2D 3ZZ0A 5HE9A 2BM1A 3H84A 5KSPA 1TNDA 1CR4A 1HT1E 1KHTA 2YC2C 3SZRA 4I4LA 1HURA 3IHWA 3NH6A 1P9NA 2WM9B 3FPAA 4BQSA 1FNNA 1KO1A 2C9OA 2IXGA 3PEUA 2YWHA 3LV8A 1YR7A 1ZM2A 4BGDA 4BLTA 2HT1A 4KSBA 2FFHA 3WHKA 4Q00A 4KJZA 1O87A 2ODEA 2ZRDA 4LCBA 4YMWA 1YR8A 5HTKA 4F4JA 1V43A 2ZR7A 3QKRA 3SJBA 3T5DA 4BFYA 4Z1MD 2OCPA 4Z8YA 1UKVY 3IIKA 4OQMA 1FP7A 4BRUA 2F43A 3AP1A 3M4YA 1AIPA 1E2HA 1CJMA 2NTYC 4HUQA 3T61A 4KODA 4CZ2A 1Q12A 4LK2A 4BRWA 4IVQA 5CB8A 1DE0A 3HPRA 4K81B 3SDZA 3U2QA 4Z51A 2IK8A 3KXKA 5AUQA 1G7CA 3AGQA 2ZRIA 5KYKA 1NJGA 4LHZA 2ZE6A 3TQFA 1HE1C 2CJWA 4UKDA 1FUUA 1T4GA 4PPFA 2AX4A 4TYPA 3KQNA 4KFTA 3U4QB 1DOAA 4BZPA 3CRRA 2QNRA 3CUEF 3G82C 1QHYA 5H70A 1W44A 2ZJ2A 1W2GA 4Q02A 1TQ2A
chains in the Genus database with same CATH superfamily
1Y8QB 1CJKC 1NTRA 3E3MA 3SWWA 1R37A 5AH0A 3IAFA 4TTPA 3VSCA 4CQLA 3AUUA 3UQZA 2XEDA 4DQ0A 3IL2A 1DBSA 5CG2A 3IKLA 2FNAA 2O3RA 1CVRA 2ZJ1A 3IQIX 2C4TA 2WJPA 4JLAA 4FMCB 1NI5A 4DJEC 2RHRA 3VR5H 4OB7A 1CWUA 1YDGA 2IXDA 4BFLA 1Z74A 2HCJB 4PG7A 4AO6A 4C7MA 2QSZA 4RAOA 3DOJA 1L1QA 3HZHA 1XT6A 1DC7A 3L1KA 4C06A 4JBWA 4I1IA 5AW0A 4PSUA 1X1AA 3GEDA 2IT1A 1DV2A 5DTEA 4KR9A 5IAOA 1JR3E 1AQ6A 4BO3A 1E0JA 3VHRA 1QCYA 4F4UA 4AQDA 1PHRA 4AS3A 2Y1EA 5KPJA 3N5KA 2WAMA 5I7AA 5J5AA 2CEKA 1L4UA 1E2MA 3AIIA 4L0MA 4LRYA 4XDHA 3TTUA 3UB3A 1U99A 5A3SA 2FK8A 2I34A 4ZVUA 3T5CA 2I22A 4Y2GA 221PA 4YT2A 2JS7A 4NRDA 3ZE8A 2DY0A 5TGTA 3QVOA 4HAZA 1NRIA 1K7SN 1S3GA 1X8KA 3GFOA 3UMJA 2M1XA 3GRUA 4LAFA 4JJ7A 2H2DA 3R7FA 4LZWA 2F3UA 2P3QA 4MDEA 1A1VA 1ZP6A 4F04A 5FWAA 2VTKA 3C7TA 1DVRA 2IOQA 5ITWA 3WOVA 3GGGA 1QIMA 1UBCA 3GLQA 3PXDA 4JP8A 4KSYA 4OP3A 4XARA 3S44A 3T0IA 4U39A 4ENRA 3UV6A 2BH2A 1JXMA 5D8DA 2IW1A 2X76A 1CW2B 5DYYA 1OWLA 2QN9A 3G85A 3H83A 2JGRA 3M34A 1QTRA 4MIKA 4IX9A 3MJSA 1DWQA 4H7IA 3SJZA 1KFEB 3F4KA 1UINA 4ZO9A 2VT2A 1I6MA 4OAPA 3HB5X 1GCGA 4EUEA 2VLBA 4RTOA 3H97A 3VAZA 5FYDA 1P3DA 4D6YA 2AC4A 2L18A 2TSYB 1LSSA 2QRJA 2ZETA 3A26A 4M87A 1J2UA 4A0HA 3FKJA 2QRKA 4ZMBA 4RO0A 1Q84A 4EHJA 1L6RA 4GU5A 2FUEA 2W2QA 3ZCXA 5B7PA 5GV7A 1TTTA 4CLEA 5IDXA 1I4OA 4PQEA 3K1YA 3QKSB 1WHSA 4GMDA 2NP6A 3O0TA 4ZKEA 1B8PA 4OM7A 1S2NA 2P9EA 1M34E 5HK8A 3LPNA 4CCAA 5JWRA 3PRKE 4JYAB 2H0RA 4PLVA 2ZRJA 2J41A 5L3QB 3W5AA 1XPOA 1YCFA 2LCIA 2UVPB 5KHLB 1N6HA 2X9QA 3VHQA 2DMRA 4AWAA 1GQSA 2VDQB 4OIFA 3E48A 3KKZA 3F4BA 3EDMA 3SFVA 3PQDA 4NHOA 4BLSA 4L50A 4MUBA 2W22A 4BEBA 5JTTA 1SQ6A 4MTLA 5BXQC 4LNUA 3VJLA 3HUDA 3WBJA 5AKHA 3UXYA 2Y9MB 3AJEA 4NPHA 2Z3WA 4N65A 3EN0A 4XLLA 2ZYIA 3QBJA 2QJFA 2YV1A 4MW5A 1H2EA 1UJ5A 1WUIS 4DIFA 2IYUA 1ZEJA 2ZEJA 3HEBA 4ZI3A 4HB4A 4BO2A 3X1ZA 3GNTA 3FBWA 4QGBA 1GILA 3DMFA 1YF3A 1I13A 2RH4A 2W00A 3OEHD 3S6JA 4BVHA 3DH0A 1E2PA 4MV5A 5FPHA 3LQRA 1E69A 4XGQA 1YZ3A 5K4GA 5ELMA 1FFYA 4DZTA 3LZ6A 2IS6A 2BCJQ 2AXQA 3CW2A 4C89A 2JLRA 4GP7A 4R83A 2OGZA 2WJJA 5I5EA 1S7GA 5BWBA 5LYYA 4DQDA 1V1JA 3AIKA 3URMA 3JRXA 2VPQA 3ITDA 1QIEA 1XEXA 2KLBA 3RUEA 1U63A 5AW4A 3KJEA 1ZSNA 4XCQA 1W2HA 3AVQA 3EQ7A 1RXUA 2PQ2A 1TF5A 4GT1A 4X24A 4WVFA 3R7NA 2RDMA 1E5XA 4UAGA 3EPRA 3O84A 1C81A 4I99A 3BBLA 4R8SA 2HCBA 1OI2A 4J0GA 1P18A 1MH9A 1G20B 4PGFA 4C6TA 4GXRA 4WNIA 5AVQA 1T34A 1Y8CA 4ZOQI 1FBTA 3G9ZA 1W5TA 3PHIA 5E3JA 2SICE 1W4RA 2XNDD 3L49A 3QMWA 5FR2A 4AJEA 3PJRA 4TYNA 3AJ8A 3D5TA 1DIBA 1A1SA 1PT9A 3UT5B 1NDUA 2W6OA 1XVLA 2FPPA 3FGZA 3UG7A 4DB4A 3WZLA 5HJ2A 1DAMA 5JROA 1YO6A 3E82A 2R8RA 2D5IA 1Q0UA 1W59A 2WIJA 3EHEA 2QZSA 1G6OA 4B6JA 1QGOA 3NTQA 3OTQA 4ZOLB 3V7UA 1JJBA 3EVZA 3CJQA 4H59A 1UBJS 2Q5JA 2IHVA 4H4CA 1EQ2A 4F60A 5EXSA 3HS3A 1JA9A 4GX2A 4MP3A 1ODLA 4GQAA 2WIDA 4L76A 3ZI4A 1H3EA 9GPBA 1YZTA 1C8BA 2Q0XA 2YIDA 2EGHA 3QBVA 3ST7A 3U0BA 3U48A 4F6RA 5J4LA 4IZIA 2RHDA 2PUWA 2GFQA 4X00A 2PPVA 4MUNA 3UK7A 1HFKA 4RF2A 2BVNA 4WXRA 3IPRA 3QPUA 3LVQE 2GO7A 1L8XA 1MQ9A 1NQOA 2RMKA 1B7GO 3M83A 2EOAA 4P3XA 1IHPA 1Y3DE 3LX5A 5KVCA 2FDXA 3TNYA 3P2IA 3SC6A 1XA0A 4RANA 4Q21A 4CT4B 4Q3DA 4KYIB 2HDHA 3J81k 1F8FA 3K0BA 4LRWA 4CT0A 2AI1A 5FOQA 2NMVA 3IGFA 3ORYA 4Z9FA 3ZE1B 4ZO7A 4ARZB 1ZCAA 1QV9A 3K9FC 3VR6D 3A4LA 1R0RE 4D92A 1U7WA 4IVRA 3CINA 3DULA 5DXAA 5EQTA 3FPJA 3PYLA 2C78A 4Q7QA 2VHXA 4KVAA 1TCUA 5AKIA 1RMQA 2A0YA 2I6XA 1AC5A 2WA2A 1Q1QA 1LDBA 2X1HA 3L1JA 3TAXA 2JD1A 1LPSA 3I4CA 4L08A 5EQDA 3GRZA 4YT5A 1G21A 4O1MA 1ZUNA 2QLTA 1PS8A 1XZPA 4K86A 1EWRA 2FB9A 3MVEA 2CSXA 2JAQA 4FZVA 1GZ5A 1G2PA 1YCHA 2X2EA 1OD6A 5AKGA 1V3VA 1XD2A 3RJMA 1HE4A 2PXCA 3QLUC 4I9GA 3ZGNA 4DS3A 4DV2B 1VLJA 1T3HA 3Q5EA 2JEYA 5CXXA 3U6KA 1BJTA 1BYUA 1Z3CA 4Y9SA 5CA0F 2IX3A 1B6SA 2XMDA 4IPTA 5IAAA 2OHIA 2ZJZA 3UNXA 2J08A 3O8BA 4X1OA 3VJRA 4RGBA 2YHSA 1GO2A 2WZDA 3UUGA 1JFVA 2DFTA 2PUHA 4ZU1X 2DBQA 2Z57A 4Q3KA 1JBEA 4KRYA 1BKDR 2FZEA 1B74A 1EB9A 1P2VA 1T2CA 1T4MA 4FYYA 5DNWA 4F3RA 2FRXA 1YRQA 1KEWA 1ZAKA 2CC2A 5CH3A 5DHPA 2IU4A 4JBGA 4LKOA 3SS8A 5I7HA 3HA7A 2ZT5A 1Q1BA 1FLNA 1NV8A 1V11A 1CJBA 1VIMA 4LZPA 3PGA1 3RE1A 3V4PB 1OE0A 4OG2A 5T4EA 2IP4A 4GPIB 3OOYA 4LI0A 3W0LB 4N4AA 3GT4A 3CH7A 4I9HA 1L0BA 4O4IF 3FNFA 2B5OA 4JD5A 4OGGA 4OXNA 4W5QA 3B9BA 1OILA 2M1ZA 3GT0A 3HMQA 5K3CA 4YYEA 1FE8A 2VPIA 3HZRA 3OFNA 4IIJA 4OTZA 3UT6A 3GFVA 1QVZA 1NT4A 1I1OA 3LY9A 2J5KA 3LWZA 4C7BA 2J9GA 1I9GA 4QBFA 3AI2A 3IAS6 2FKAA 4JXZA 1KJ9A 2W0MA 3DR3A 2XODA 3TOCA 1CF4A 2I55A 4XUGB 1JG4A 2H4XA 3TNLA 1UF9A 3CGWA 4IUBS 1EXNA 2C2YA 1DXOA 3GBVA 3IJ5A 3FAZA 4N8EA 3LLCA 4PYIA 5EVCA 4ZQBA 4BWYA 1YC5A 1KPGA 3G68A 1P45A 3HXPA 4D9JA 3H42B 1KVRA 4A6PA 3GLHE 3AERA 4ZPXA 2COEA 1KK3A 2GF9A 1IB6A 1SOMA 2PD4A 1UMKA 2PH5A 1JBQA 1E5TA 3KD2A 3P2KA 3T3IA 3PD7A 4BTLA 4HFJA 2G5CA 1TJNA 1M6EX 1LX6A 4RV4A 1FQWA 4EW1A 2D2FA 2BFNA 2E89A 4X85A 1UK7A 2G1KA 3MC1A 4G8DA 4GYKA 1R16A 5IM4F 1TYDE 2G07A 2PWBA 4RBNA 3PC8C 2ONCA 3OE1A 3Q9NA 3H2BA 1PJRA 1X1DA 4MQ5A 4PZLA 3L92A 1YCGA 5A71A 1COWA 3OJ0A 4P7BA 1WQ3A 4P58A 1CIJA 2F64A 1JI3A 4ER3A 1MHPA 3M5DA 4R2KA 2YUIA 3DKVA 4MUXA 1GPH1 2YJNA 3EWNA 2WUWE 4FDUA 4R1PA 3UFXB 3WK9A 4ABYA 3IAS1 4IMIB 5BYAA 4LF6B 5KNCH 1ZRHA 4KFCA 2J6HA 1LGYA 1L5VA 2ZYVX 1FSGA 1S2IA 3O8LA 3V1MA 4YJ3F 4UFOA 3RUDA 4L6IA 4GOLD 2E5FA 3G9QA 1N2IA 1E3LA 1PNTA 3BREA 4L5YA 4XI9A 3D4BA 4Q1BA 4F46A 3OQVA 3L93A 5AQ1A 2OBBA 3R7SA 4CV2A 4RPIA 2ZJYA 3R7AA 4ZWNA 5SY6A 3OLWA 1NFFA 2G8LA 3NIFB 2ZXFA 4PBRA 1T4CB 2CXUA 3E2PA 2G1PA 5CIYA 1Z3IX 3PDJA 5IG2A 2F8TA 2HRBA 1RIFA 4PC6A 2GBGA 1Z4IA 4N49A 4DCPA 1GNTA 3AKEA 4PFSA 3W1WA 1P1HA 3ZV6A 4G1MB 4F3TA 1D1QA 4LZNA 3PUZA 1ADCA 2GETA 4UUBA 4GDFA 4CIXA 3N0VA 4L5CA 4F93B 3KZKA 3ROTA 3CR7A 1MGPA 3ICWA 5LKAA 3DO6A 1TK3A 1C3VA 2VN8A 5CA1F 2ZJ7A 2KJQA 2ZIGA 4EYGA 4UEOA 4EPYA 4BB9A 3SQXA 3ZBTA 3LT0A 4GYWA 1UDRA 3MXOA 4JR2A 4MUFA 1HDYA 1T2EA 2FZ4A 3OC6A 4NAVA 3ZCSA 2NTEA 2F67A 3MD9A 4HLDA 5J2TA 5CVTA 5D00A 2GCOB 3DZHA 3AM1A 4NYMR 4R1TA 3DAGA 2X2FA 5MN4A 1JJIA 2QMOA 3CE6A 2I7CA 5EIWA 4AZ3B 1R8SA 4J1SA 4ZVLA 5M7EA 1TPZA 4AJNA 2IXFA 1QB8A 3ITNA 2R7MA 3OBBA 3FLAA 1SD5A 2PO7A 5KREA 1WV0A 3FMFA 4QWMA 3AOGA 4YJ3B 3C8DA 5FWYA 5CLJA 3N87A 3PHJA 5KYUA 2VYNA 3H5VA 4RNDB 1XMOB 4XVQA 2ODWA 3GDGA 4C76A 1GR0A 4IVPA 1JQKA 1FA9A 3ILHA 4CEJA 2H85A 2PAFA 3DF7A 1W6RA 2X1LA 1PG0A 1Z08A 2LBPA 4PGMA 1AZTA 1AQYA 1TU0A 3LUDA 4KRGA 1KJNA 2FMXA 3QUQA 5K9ZA 2OTCA 3HEAA 5A2GA 5BPHA 3EF1A 4PNZA 2FWNA 2PFSA 3FCYA 1UXKA 1UMCB 4UVGA 3HBFA 3K6SB 2EV9A 2YJZA 5J9FA 5IJZA 2P2GA 2Z6QA 3E5RA 4D74A 4RH1A 4A0FA 5JADA 2QL7A 1LA2A 4IDFA 4NBWA 3ELBA 5EYPA 4ZCMA 4N5MA 3ROMA 3NUQA 1LPAB 3CLHA 3WRVA 1A82A 1D7AA 1QIDA 2JLSA 5CEEA 1SBYA 2X19A 5CTAA 3V4VB 4W5HA 3SYLA 4C5CA 4NG4A 1E1DA 1N2XA 3K6JA 2VDKB 3LPLA 4JYMA 2DFLA 3MILA 3OZDA 2CLMB 3D8NA 4ZYYA 2WWXA 1WSAA 3I0NA 4GDMA 3U62A 5EMMA 3ZGYA 3W6ZA 1Y7HA 4ITVA 1GTMA 1J9EA 4HATA 4O4HF 5T67A 4C4PA 3M1LA 1ID8A 2NPIA 5AW2A 1L9XA 2F3TA 4JENA 2J4DA 2WTXA 1ISRA 2J4CA 1PJAA 4UPDA 3RFUA 1CR1A 4WA7A 1PGNA 4KYTA 2NXWA 4XCVA 3PKZA 2OD2A 2FXIA 3B7WA 2GN9A 1WLYA 2AG0A 3HUEA 5HZHA 4A8JA 2O5RA 3BWXA 4MYTA 4KFUA 2G4VA 1TVMA 4F5DA 2VPPA 3G2HA 1MA3A 3MFYA 3VU9B 1MABB 5IVKA 4BNGA 2WTUA 3T4PA 2FP4A 4DLNA 3EOBI 4NVRA 2IUYA 2VYQA 1S1CA 2IEGA 5LQUA 5BSHA 3H2SA 2LXNA 3DD5A 2X8AA 3IR6A 1PZNA 3EA0A 1D07A 4JP1A 3SX2A 4JVSB 1RPJA 4X84A 4FHGA 3BHIA 1IOWA 4CCSA 2WUDA 2Z3VA 3AYXB 2ZIXA 3D81A 2BHNA 1Z6ZA 3NR2A 3W9BA 4QGSA 1OFHA 2CMDA 2OPBA 3BQMB 3KUUA 3KOWA 1XLWA 2VSOA 4JQOA 4O8ZA 3V1LA 4XPIA 2IOFA 5BORA 1NQ5A 3F97A 3BRCA 2HU5A 4B3DA 3R09A 3DFZA 3WRXC 1EQAA 1ZVQA 5T6BA 1U28C 3TUJC 4ZJZA 5LR6A 3PFNA 1IJKA 3KEMA 4B7CA 4YCCA 5JFOA 3PXGA 3CUUA 3EQ2A 4DJFC 1UAGA 1ONSA 1TMKA 1XZJA 2W2NA 3QJGA 4F96A 4AJ2A 1G66A 2HBQA 1NKVA 1TDJA 1XKQA 2E1RA 4U2KA 5EWLB 3FWNA 1XQWA 5LC1A 2W0SA 1AMNA 1K7XB 1CY0A 5FEMA 3KTDA 3RGGA 2ZRPA 5ALFA 1DELA 4AKHA 3TL2A 1X7DA 2HRCA 2WWIA 3D3EA 3OPNA 4WNAA 4HLUA 4TSKA 3DLAA 5A1TA 3E53A 1K08A 3BFVA 2K7ZA 3D2AA 3LCMA 2J7KA 4LTNA 4PNPA 1CUSA 3WRYA 2R65A 2C1XA 5KDOA 4BNUA 3GJ7A 1TRKA 4HDQB 3G2JA 5EKDA 5TMBA 5GTDA 3NNSA 1PTKA 3GJSA 4MW4A 2G8NA 1HA3A 2NAFA 1E99A 1GGJA 4JL5A 1VYTA 1OU0A 3H2GA 5CUQA 1UZLA 3FGOA 2VNHA 3T7TA 2QUKA 2AJLI 3MTIA 3CG0A 1K75A 2FKNA 5JD3A 2JVJA 2Q4OA 3FUCA 1NF9A 1XRMA 4HNHA 1DKPA 4RZQA 4EX7A 1UBNA 4C7VA 5F9MA 2ZBRA 2C8JA 1KEZA 4DBLC 2XGOA 4RTSA 4MQUA 3T4XA 3LU1A 4EF6A 2HA6A 4DG9A 3U26A 1JQ5A 2VNJA 2FQ1A 4FUQA 4GS5A 1HSOA 4KVZA 2D8MA 1TT5A 4O4JB 5AXDA 3VOTA 3WLKX 1U6JA 2ON6A 4CM4A 3UWOA 4B3MB 2NZWA 1W76A 2BGLA 2AA3A 2DECA 4FNMA 2O3QA 5EJ8A 2YZNA 4OA8A 1ZD4A 2PT6A 2RGBA 4EKNB 2EJVA 1D1SA 3U0VA 2KLHA 1EQUA 3JYOA 3OOSA 4B5LA 1VC2A 2OUIA 1C8LA 2EYUA 2KS6A 5EHXA 2DH5A 5ECYA 1V3TA 4GYJA 3PNSA 5ITZA 1CUWA 3OURA 1O97C 3AQIA 4EYQA 5HQ3A 1RYYA 5DHTA 4JSTA 2J33A 3U4HA 1CZOA 2OBMA 2EFCB 3D6VA 5JJLA 1NYTA 1U2ZA 2JI7A 1PNQA 4RA6A 1KEVA 1UC8A 3UB4A 3QU2A 4NDZA 2IGBA 1E9CA 3SOZA 3ER6A 2OCAA 1OFTA 1K06A 4FFRA 5ESXA 5F5NA 4Z1OA 3U80A 5C51B 5HHTA 2WQ7A 2JZOA 4KLNA 1ZGGA 3CT6A 4LHXA 5TNXA 3H9JA 9ATCA 3TOXA 2I29A 1XSEA 3RUFA 2BKAA 4XDYA 4RV9A 2Q2WA 3W5DA 1N6LA 1TYEB 2A9OA 3R3WA 2QXUA 1NHGA 2OG1A 4BFTA 2OV6A 4DLSA 3STYA 2QJWA 5IKEA 1VB3A 3IAXA 5D5PA 3ZC3A 1VIVA 2IY7A 4XQEA 3A9TA 1A8SA 3IMEA 4H17A 3EUAA 5GV8A 5ULLA 3CZAA 2P2SA 2VH2A 4NC9A 1FU7A 1NMZA 2WV7A 5AW9A 5BWLA 2VSXA 2VTDA 3HP7A 4D8XA 1FRZA 3HV0A 3KJNA 4LUCA 3PQ7A 4J4HA 3OESA 2DG2A 1E0KA 3R0JA 2VOJA 1N25A 2Z4TA 4DMCA 2Y1GA 4CE6A 3DW1X 3ZYZA 4WUVA 3RVKA 5GZ1A 4Q9JA 4OHRA 3GZ4A 2B5VA 1UC9A 2CBGA 3AXTA 5DP1A 4KHPB 3UJ8A 3GJZA 4GR4A 4EZBA 1W75A 2QYHA 1ZMOA 3FCCA 1K8ZB 2X3YA 2YXBA 2GJ9A 3ZZNA 1N34B 3IJRA 4RA6B 2P5YA 3P32A 1Y3IA 3KHUA 1EUYA 2O2XA 10MHA 3D7RA 3L82B 4XE5A 3AESA 3R41A 4U2GA 3O9VA 1N5RA 1RJFA 3BB3A 2XF8A 1C9DB 3WNZA 3T95A 3MHTA 4BB0A 4GI3A 1SQSA 3AI7A 4LN1A 4GLBA 1UWCA 4MVJG 1KC3A 3BVPA 4HQOA 2H4YA 1XMXA 3QF4A 2JGKA 3DDOA 5M29A 2DP4E 2GBIA 2PKRA 1B4DA 1GNPA 1OIVA 1PFVA 4G2NA 4ZZ3A 4IFTA 1R7RA 4CMEC 2PR2A 1CG6A 1DLIA 2H7VA 1I2DA 4P4UA 2JASA 2PMKA 1GADO 1ULSA 2Q28A 2WKRA 2XMGA 4YCAA 2EL7A 5CM9C 4YALA 1RXYA 1UIRA 3ILVA 1GYRA 3UJAA 4EKYA 5C5DA 2IOHA 1R6UA 1W34A 2EX0A 5TMPA 4EPVA 3JQ7B 1BMQA 3DMTC 3EVAA 3P9CA 4EKGA 5AK0A 1Z6YA 1W19A 4JB3A 3W06A 2HUNA 3AK4A 3VBEA 3T7SA 2PU7A 3BULA 4BYGA 2FVYA 4YO7A 2HDNB 1AQLA 1LRLA 3QUBA 3C4JA 3SIXA 3MJVA 4WL0A 1J2RA 4LXYA 3DG9A 2YV2A 1I3KA 4O5OA 2BBOA 1NR7A 2XBLA 2XD9A 1YDHA 1Q3HA 2WFLA 4BKOA 3RAGA 2E5LB 3P45A 3L4BC 3KQQA 1R6VA 4IJVA 2XSZD 3FYSA 1ZJWA 4LQCA 4M6WB 2VLIA 2X6RA 2I65A 3J7AC 2FVXA 1N1EA 2OZVA 4GX1A 3DJFA 3NX4A 4WZAE 4CLRB 1RRMA 4D9IA 5HRCA 4ZO4A 2XTMA 1JWBB 4UNNA 5LXTB 5FAXA 1NQXA 1TQHA 5TMDA 1R0BA 2BZ0A 2QE7D 4PLWA 3IMGA 3QKIA 4TM8A 3NPMA 2NPFA 3AUAA 1VPVA 5B1YA 1A88A 3EG5A 1XRJA 3PDHA 2YFYA 1D2GA 3DE1X 2X8JB 2WQZA 4WK4B 5EUQB 2LPMA 2GEVA 2YZGA 1XJQA 2AR0A 4GG1A 4ND1A 3SJAA 4MVJA 1AGYA 2UZ3A 4XYGA 2Z4SA 2CFCA 4YP0A 2W6NA 2R86A 2A67A 3JASA 4NICA 5TF4A 4LRUA 4S12A 3QRWA 2X0RA 3EEIA 1PUJA 3RAFC 1AQIA 1QIIA 4B35A 2UZ4A 5HJ7A 5ARDA 3IQEA 1Q7EA 3M6AA 3HP4A 2BF7A 3WKBA 4JI7B 4KQ9A 1XHFA 2BY4A 1M67A 1UT8A 3MM4A 2RGYA 3PC4A 1XDSA 4FX5A 4K26A 2VDPB 5JRJA 5JAHA 2QG4A 1BC5A 4X6LA 3HRHA 3OCCA 4QECA 4M9QA 1E64A 1YS7A 4ER0A 3U6BA 2HNAA 1RACA 1DUVG 3D3NA 4ECEA 3OUZA 4ARIA 1OKKD 1KI6A 3EXG2 2GCEA 2DUNA 3HU3A 3LTEA 3R40A 3WNQA 4DRXA 4WCFA 4QT4A 4RPHA 4UBMA 1BRMA 1CQZA 4TMZA 5FD8A 3EVNA 4KPFC 4OYRA 3IO5A 1KH1A 3UJCA 1T2AA 1ZK3A 2PEZA 4EB6B 2OCKA 2FMIA 1XXHB 5CCXA 3THYB 4HK4A 2GHTA 1KJJA 1W85B 1X1TA 1H9AA 4WSOA 1WJGA 3KOZA 4KGXA 2M9MA 4O0MA 1Y6GA 3H1FA 3FWZA 4NK4A 1NL3A 2HHLA 4MJ7A 3ZV3A 2QRLA 4AS1A 1E4YA 4ETIA 2ACKA 3LBHA 4QXRA 1GSAA 1ZH2A 2GT1A 4BX8A 3HKDB 2Y1CA 2P8JA 3TGPA 2UYCA 1GY8A 2W11A 2YX1A 2I0FA 3DUWA 3FVWA 1NQAO 2YMMA 1HR0B 4FI3C 1CF9A 3L5KA 1FK8A 3M2PA 5ALSA 4DTIA 1YFLA 1Z2CA 3A4VA 1V16B 3ER8A 3F1LA 3R0XA 2H7XA 3DTVA 3I9LA 3P0RA 1JU3A 4GLOA 4GL4A 2IDMA 4V0KA 1ZSYA 2DR0A 3VSDA 1A95A 2GK4A 1I5EA 4MINA 3B6ZA 1F8UA 1G19A 1SKYB 1H66A 4G84A 2H00A 1HNNA 4OP1A 3RV3A 2DQ4A 2IDZA 1CYDA 1OZ0A 3FFAA 3ZV7A 1YRYE 4BFWA 3BDIA 2BRUA 4GX0A 1M2JA 4PONA 1CUHA 2DQZA 3Q1KA 4MJXA 3PG5A 3UAZA 1OGJA 5JS1A 5J4YA 2VHWA 3LIIA 2E55A 4MPDA 4P38A 1KH2A 3EZYA 1U5BB 2BFWA 3WL3A 3JTMA 3KDSE 2CHGA 3M4NA 4Q4AB 5LL6P 2PZGA 2VTVA 3QJYA 3U61B 1N77A 4KNVA 5B1HA 3WLFA 1A9ZA 2R5WA 2XB8A 3GX1A 3GGOA 4HXYA 4LZOA 2V55B 1YD7A 1KO4A 2R8ZA 1L5HA 1ULAA 4BLQA 5KYXB 4YRGA 3EFOB 2MT9A 1RZRA 1GUAA 2VP6A 3QKUA 5BN3A 2QX4A 4LZZA 3WHPA 4KFRA 3M6WA 3PTAA 3HRIA 2C1EA 5EYPB 2Y92A 4A27A 1G8FA 1M6NA 1QGZA 1AGRA 2FMHA 2Y71A 4MB0A 4NFSA 5FXMA 3RJZA 4FWBA 5HKAA 4FFWA 4R9VA 1WMAA 3TZCA 1W5FA 5TS2A 1QE0A 1RXCA 1SU4A 1Z5PA 4FHDA 4HYTA 2OYCA 5AFSA 3Q3GE 3GLIA 1HDXA 4MS3B 2WE8A 3O4RA 2CUNA 4TKZA 3JU3A 4EK9A 4I5DA 4L72A 5K99A 4KUHA 1XU7A 3QHPA 4RD3A 2HQ1A 1TL7C 2XAAA 4CG3A 2ZRNA 4TTIA 3WA6A 3G8AA 2Q5FA 2GWRA 3M3DA 3NATA 5CB6A 1BHSA 5JNSA 5IDVA 1DL5A 1U3TA 5L53A 3A6HA 2NG1A 2FE1A 2O48X 1GVHA 4W63A 2W58A 1KAMA 3E22A 3H4VA 2JHPA 3KDPA 3ZNPA 2EHDA 4NOJA 3UOAB 1E96A 1DKRA 2CFIA 2PRSA 3NKVA 4KXXA 4DCGA 1F60A 1P5ZB 2H1IA 1OXMA 3HU1A 1D5WA 4TWBA 2XUDA 3GOQA 3JQGB 1KVSA 2FPWA 3JQRA 3Q72A 4MRNA 3RRZA 1FZTA 2O14A 2OO5C 3AB3A 4RIFA 4ER6A 3LOPA 2VEOA 3ACBA 3T06B 5HCUA 1F2TB 4TT8A 4UBKA 2XXBA 3FPKA 1QG6A 1LPPA 3LXXA 5H02A 3HNRA 1PVDA 4BX0A 2UXCB 5F3DA 4JN6B 5EFOA 3FH0A 2PRKA 3PUJA 2G9UA 3FPHA 2C07A 2WNIA 5JPIA 4A6DA 1N2OA 4HDCA 4TVBA 2H5JA 3NTRA 1V4NA 5EWMA 5EKTA 2VJPA 4JR0A 1P5FA 4G81A 4MEJA 4TMVA 3TPZA 1RC1A 4XAQA 1FSSA 1LFAA 1QFZA 2ZR8A 4WKCA 3WGNA 1TB4A 2EBWA 3IQXA 3A1TA 4QOFA 1U5BA 3KT8A 1PWYE 5AOVA 4LBZA 1H5NA 3E22B 5IAGA 1XRQA 3DQQA 1IY1A 1GL6A 5CAEA 4DUPA 3LTNC 4NL4H 2PEYA 3WAGA 1FX1A 2Z6VA 3L2OB 4HWOA 3AYZB 3TIVA 4HX2A 4S05A 5D3MB 4NE2A 3RS4A 1E5QA 4J0FA 3NV9A 3T5PA 4PYJA 3KAKA 1G3UA 1FFCA 4KIGA 1DJQA 1XNGA 3TINA 3VYTB 3KOXA 1N4AA 4EHLA 1MG0A 3BF7A 5LBTA 1XZ8A 2RHMA 3FY4A 1D4ZA 4DC0A 2XE6A 3PXCX 4YP9A 1YQDA 5B7GA 2DUMA 3JYHA 4G07A 3EJ6A 4FNAA 4EB8A 1Q0RA 2QSYA 3MRXA 4H1VA 4HPWA 2J0UA 3A28A 5FPQA 4B76A 1QU2A 3E35A 1GKKA 1SB8A 1SMKA 2HHAA 3DHWC 1Y8RB 4K9OA 3M6LA 2RC6A 4XEHA 5IDYA 5ICSA 1EDDA 1RXVA 3BCUA 1Y82A 1XDZA 3WR5A 3VU1A 2WF5A 3DVQX 1M0EA 1M2KA 2J6BA 4FZJA 3CE9A 2AG5A 2XMBA 3BIXA 2GF2A 3INYA 5FPYA 1DEHA 2AQKA 2YOGA 3B51X 2HEIA 4LI3X 3JZMA 1QHIA 3L1HA 4U7HA 4ZODA 5I7OA 1AOXA 1RMTA 3I4LA 1KFJB 1C7IA 8MHTA 2R2AA 1K2VN 4JYBA 1SQ0A 4FS3A 1E1QD 3SIPA 1J90A 2YXLA 5BYJA 3DMHA 2CHEA 1XZKA 3M5PA 3C8UA 4OYYA 3ZQJA 1GNQA 4G41A 1A5ZA 3W6UA 2QU8A 3FNBA 3AU8A 4AJIA 4B81A 4U7PB 2VH1A 4U5QA 4JNCA 2PO5A 1NUQA 3N53A 1NRXA 2HGZA 5DISB 3TL6A 4EA6A 1OXBB 2ID8A 3CH4B 4Q15A 1TUGA 4GI7A 5IP5A 1UPTA 1GGVA 4DMRA 1JSZA 4F72A 4L2IA 3SXUA 3VU0A 5FTJA 4Y30A 3ADOA 4BUZA 4KR6A 1IQ0A 5IJXA 2Z1NA 4Q0MA 4EWLA 4UUOA 2OBXA 1JDUA 1KP3A 2G82A 3AHFA 4IDPA 1TO6A 4GXNA 2CL7X 4DLAA 3EGVA 3R6TA 4EI7A 4FMPA 2ZT8A 3UAYA 1H0SA 1SUPA 2WMNB 2WWGA 2XZDA 4MX8A 5C52B 1PJ8A 1WEHA 3V1YA 5CBPB 3VJKA 1AUPA 5ERYA 2BZSA 1Z34A 1YQEA 3DCJA 4NJOA 4OREX 1E1CA 4F56A 3PIIA 4OVKA 3MTQA 4YP6A 4UNQA 4HT3B 1AHPA 2B6HA 2GR9A 2I99A 1J5PA 4RHTA 2Y27A 3E0QA 2C84A 4UXIA 3KQUA 3GP3A 1WXDA 2G4LA 1Q14A 1O2DA 3FG9A 4CQLB 4BN4A 5LU8A 1X7ZB 2C29D 1UZUA 2IOYA 3N07A 4N0QA 3QTBA 4O2RA 5T4HA 3EIEA 3JSAA 4WCDA 2MINA 2RK6A 2FEAA 2XA2A 3BKXA 3I39X 3LQKA 1WG8A 1FPQA 3MHPA 2FDCA 1Q20A 1TEZA 4QUKA 4WK2B 1ZA1A 4Q3BA 5EUMA 1VFPA 2W93A 4A5SA 4AKSA 4AX8A 3TKAA 4UBLA 5HM8A 1W88B 3QVLA 4PNEA 3LHIA 1MGOA 1SXJC 3G79A 1BWPA 2WC1A 5FDFA 2O19A 4NXNB 2JFVA 4OPMA 3Q2KA 4D43A 2WJZB 4EHDA 5KWVA 1FJ2A 4B45A 2D0OB 4DBLE 1Q6ZA 3NWJA 2PWZA 2DSTA 1DCTA 4AP5A 3EPHA 3WDKA 2W6JD 1YQWA 3TPFA 3X2EA 4JL8A 2R6CA 3VGPA 4G1UC 2QL6A 3L8FA 3U3ZA 3COVA 3JWIA 2L2QA 4K6HA 3AF0A 3GVHA 2ONZA 5IFKA 4MQEB 2CCJA 2O7NA 4RGQA 4QC2A 4ZCIA 4QQKA 1O97D 1Q44A 3BZWA 3TB6A 4NOKA 3O8OA 1C3XA 1VG0B 4YMVA 2W2KA 5IRCD 2J67A 2MDTA 4JVMA 1FC0A 1GL7A 3IRUA 4F9EA 1VI2A 3O1LA 5FWDA 4FQ5A 4C88A 1S1MA 1DIRA 1SVWA 4YR9A 3M82A 4MI3A 1MB2A 3W2IA 2DKNA 4FDAA 1RYEA 2AMJA 4K03A 4EHAA 1F8XA 4UQOA 3NJRA 3T8YA 1ZITA 1SUFA 2IPAB 3CLSD 2B69A 2XT6A 3G2IA 2BLNA 2XCUA 3L43A 4EJ2A 4NPAA 3IT1A 1XE3A 2YNMA 3LUAA 4YJDA 5E2AA 3RQSA 1PQYA 4GKBA 1GTZA 1VHDA 4C2TA 3RNLA 4Z6KA 2F8SA 1FDSA 1W88A 1N2GA 1T1IA 4YACA 3MINB 3SXUB 4B8ZA 1E79A 4URFA 1AF7A 4PBSA 3WWZA 2F8LA 3HN2A 3B6JA 4OKIA 4HDMB 2FR8C 1MC1A 2ZCUA 1Q91A 4TKUA 4B4DA 1Q92A 4ETWA 1FW6A 1F3LA 4PX9A 4L4RA 3IO3A 3ZD8A 3Q1LA 5JC8A 3DMTA 3K1AB 3RFCA 4REOA 2O8EB 2OHFA 3GWGA 3P52A 5E6SB 3MTJA 3ZE6A 3Q88A 5F7XA 4M9SA 3QEMB 3I05A 1RWKA 1GFSA 4JWTA 3CKKA 4HDKB 2BMJA 1ZXXA 3NONA 3CN9A 3IP7A 4DW8A 3BBPA 1NW9B 4Y9RA 1M1YE 2FUKA 3KJFA 1E1RA 3NI2A 1T36B 3DD1A 3QGMA 5K7SA 2QXYA 3LAWA 2HA7A 1SZCA 2HLDD 1RKBA 1AK2A 1L4HA 1KGDA 3N0XA 4X95A 4A2QA 4RE5A 4BGIA 4BV2A 3ZD7A 1GKLA 4FXPA 2EKDA 4R9NA 2N75A 1VSUA 2ZTHA 5LQNA 4YX9A 4RZ2A 2HDWA 4GC9A 2BBTA 1N32B 4IDQA 4FYPA 1WQ1R 1ADBA 3EAGA 1FLVA 3RH0A 2Q3LA 1CD5A 3ZU6A 2VG8A 3TIXB 3QY0A 4B4WA 4RZ3A 2VBIA 1O77A 1XQVA 4G9EA 3CUWA 3EVDA 2JRLA 2OAEA 1YACA 1M8FA 2WD7B 3B5IA 3KCNA 1EZZA 3AR8A 5HUJA 5JECA 2HPZA 3DCNA 1V8BA 2X0IA 2WF6A 1JKMA 4JOBA 1N57A 4TMFA 4YJ2F 1V4VA 2NSYA 2QR5A 1RFGE 2E85A 4HB3A 2BP7B 2DQKA 4QVIA 1MX9A 1P61B 4HOYA 4YGYA 1IB0A 2DLNA 2VKQA 1L1RA 3HYTA 4YMSA 5JNUA 4PFQA 3QEJA 2UUPA 1AG9A 3FOBA 1G8KA 3H4TA 4PR0A 3JQBA 4M0EA 1JPNA 3ZBPA 1C1HA 3G9TA 1QAOA 2RHOA 4ACAA 4W7IA 4B7XA 4C7KA 1AN0A 2YV5A 2CXTA 3KNZA 2EKQA 4HEA6 3AF5A 1JDJA 5BW6B 1AQNA 2AC2A 1OT3A 3BZBA 3CN7A 5FO1A 4FKBA 4QJBA 5JQWA 3NDBB 2NT3A 5AKJA 2H29A 1IDN1 1NSFA 4DLRA 4E7PA 2VBFA 3D7SA 4FMBB 4LHVA 1XP5A 1B0UA 4M0MA 2QBYB 3GJQA 2QA5A 4M55A 4MGIR 2PKQP 4TMYA 4QG3A 1CZLA 1GT6A 1GZHB 1H8HA 5EJAA 1NW4A 3IV9A 3CX3A 2EDCA 1JKJB 1YDFA 3QSGA 2WU0A 1MOPA 1M1ZA 2CJYA 3HG7A 3UT5A 5DX1A 4NU6A 4MTCA 3VPBA 3BIWA 5I7EA 1WL8A 4ZPJA 4E13A 2JBWA 2P41A 4Q1DA 1J09A 1XQ9<