4EPXA

Discovery of small molecules that bind to k-ras and inhibit sos-mediated activation
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
170
structure length
170
Chain Sequence
GMTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Small Molecules that Bind to K-Ras and Inhibit Sos-Mediated Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords GTPase KRas
total genus 63
structure length 170
sequence length 170
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4epxA00
3OIYA 3VNUA 1DO0A 3QG1A 2NPIA 3K8YA 2ZE7A 1W36C 2V6IA 2YWGA 1UDXA 1VHLA 3CF6R 3RC3A 5KUTA 1R5OA 2IYVA 2JLSA 1Z0DA 1T8UA 2RGAA 3GCGA 4Y0VA 3B1ZA 2OILA 1DOAA 1SVSA 1RIFA 5KPDA 2DR3A 2ZSBA 5EP4A 4PSVA 4Q03A 3KB2A 3EASA 4NL4H 2CL0X 2MMCA 5AUNB 4PZLA 2Q6TA 1OIVA 2GBLC 3BERA 4J0QA 5B58C 1W4CA 4I81A 2CK3A 2XSZA 3KZ1E 5L8VA 1OXTA 1IAQA 2MSEB 4V0NA 2GK7A 1OXSC 3SC3A 1XEWY 4JLBA 1LVGA 4CEJA 1KMQA 4ZIRB 1IJEA 2GHIA 2IXEA 1RRFA 2O8DB 4M9QA 1ZM9A 3ZIAD 1XCGB 3MGCA 1W0JA 1F3OA 2A9KA 3AF3A 4PPGA 5JCZA 5JI2E 2GCNA 3TH5A 3O8RA 5F9HA 2IYZA 3OFNA 1KJZA 1S3GA 1HUQA 1HEIA 1ZINA 4N3NA 3IEVA 2O52A 5DE3A 2ZJ5A 1HE8B 1US8B 1U99A 4C0LA 2VP6A 2P0EA 2VF8A 2WZQA 3OESA 2X8AA 4KFRA 3U60B 3SYKA 3CPHA 1E9CA 1U9IA 3T15A 1UKYA 2C9YA 4DLZA 2CMKA 2NO7A 2VQSA 4D4MA 5SZKB 3L0PA 2D06A 4DHEA 4HZUB 2W00A 1KO8A 4E07A 1UBEA 5JRZA 4NE2A 1YZKA 3ICQB 2GESA 4F4IA 5JEDA 5KSOA 2JDID 4MH0R 2J0UA 4XSHA 3ADBA 4CGZA 4B3XA 1JNYA 1DO2A 4A8JA 1HQYE 3NEYA 5EZ6B 2BKUA 3KUCA 2RHMA 2ZREA 4IDHA 2XTMA 4RFSA 3UWKA 3LFUA 3HU1A 3UXMA 3B6EA 4PHFA 4A4DA 3EXAA 1G3IA 2KJQA 4RY2A 3X1DA 2HEIA 3NBZC 4LWZA 1FP7A 1JXMA 2ONKA 4BZQA 3IO3A 2QA5A 2NO6A 4OQFA 3C5CA 5FL7A 1KK0A 5DGXA 2FF7A 2QBYA 1E1QD 1FUKA 1TMKA 4Q4LA 5CM9C 4DT1B 3P4XA 4DLRA 1FTSA 1T3LA 4DJTA 2HCJB 1A2KC 2ZPTX 1QZXA 3OIUA 4ZDWA 1G41A 3EZFA 4MKFA 4Q7LA 3LVRE 3O8BA 2ZI7A 5AUPB 1QHSA 1VKJA 5AJVB 3QSYA 4B3CA 1W44A 5IK2A 3TR0A 2DB3A 2P6UA 4V0KA 1JXOA 4YXWA 1IM2A 2SHKA 3CW2A 3UMRA 3GP8A 1GOTA 4PC2A 2E1RA 3IIKA 5KPJA 4R71A 4R7ZA 3AKCA 3HYRA 4R98A 1DAHA 4DBLC 3ASYA 4ESVA 1OKKA 2QP9X 3DEFA 3AVVA 4OI0A 5JJLA 1KIMA 1W4AA 1AS0A 3FFAA 3U4QB 2W0SA 1MKYA 2PLRA 4C7OA 3WMEA 1BH2A 1YR9A 2R8RA 4TMTA 1EWRA 1X8LA 3THWB 2WIBA 2G3YA 4D4KA 4EPYA 3C16C 3ZZUA 3J81k 4QGGA 4Q7MB 3V4FA 4WOPA 2FFHA 1NKSA 4Q00A 3QVUA 2FE4A 5FTMA 1DAEA 2B6HA 4HAUA 5BQ5A 5AK0A 2ZSDA 3U61B 4DCTA 2DPXA 3RANA 4JBWA 5A5GA 3O47A 3AEZA 2VP2A 5FTKA 4L4UA 5HCNA 3UANA 4B32A 4KHZA 2FN4A 2PL3A 1AA9A 2YNMA 2HXYA 2REXB 2VHJA 4EPWA 1TPZA 1XPOA 2GILA 4V03A 4MRSA 4ACAA 4WXRA 1RPZA 1Q20A 1Q1BA 3IDQA 2ZAOA 1L7VC 2JJ2D 3QXJA 4P4SA 3I72A 3NTUA 2VP4A 4L8GA 4TYNA 1VYUA 2XB2A 3A4NA 2WVJA 2IT1A 2XX3A 2NO9A 4HZIA 5FR1A 4B47A 4QM6A 2ZYTX 4EFLA 1N6LA 1ZRHA 1RJ9B 2A3RA 2ODWA 3E5HA 4CRWB 1EGAA 2ZS9A 1XMSA 3PR1A 2LWIA 4KJZA 4KSCA 1MABA 4F4CA 2G1KA 3I3SR 1XZQA 4EKDA 4A36A 4PR0A 3PEWA 3QOFA 1NN3A 5AJXA 3B85A 1CLUA 1R0XA 2ZRFA 2ZRCA 4NKRA 4IVPA 2IYLD 1KDPA 3VR3A 3R9XA 5L3RA 4FI3C 4V0ME 2AFIE 1W46A 1QHHA 1WB9A 1OV4A 3PITA 2EYQA 4XVQA 4TWZA 2G6BA 2Q3HA 3I1FA 4D4JA 1UJ2A 2YJTD 4YMSA 3RWMB 1X3SA 4EFNA 3SS8A 4HZUA 4DLXA 4PSAA 3KQHA 3IKJA 1GVNB 2ZRPA 2GZAA 3EPJA 2GVZC 1NBMD 2ODEA 2ZRLA 2YVUA 4JL8A 3SHFA 4CW7A 4KFTA 3SDZA 2OFOA 1UAAA 1E98A 4EPVA 4LJ9A 3JVVA 3QY0A 3LQRA 2VHCA 4BLOA 2HF8A 4B6FA 1XCMA 2QPOA 2QU8A 1KOFA 1I2DA 4GPTA 5GADl 1G3RA 4TYQA 1ZCAA 4UNNA 3TSWA 4C4PA 3QPVA 4D80A 4CF7A 4L5BA 1LW7A 3U7FB 2Z6VA 5J5CA 2JAQA 1UPTA 1GWNA 2CL7X 3THXA 2R6AA 4RKEA 4KLZA 3D6TB 4RVCA 2O8EB 1NN0A 5FTNA 3IILA 3NC1C 3AVPA 4PFSA 1S9HA 2KSQA 5EZ5A 3R7WB 3ZJYA 3QBVA 4WVFA 1J90A 5JSZB 3K0AA 4ITRC 3TUIC 1FW6A 2V8OA 2BMDA 1P7CA 3EG5A 5DISB 3RS0A 3UG6A 1CJTC 1E2JA 2FSIA 2OBNA 3H2YA 1X8JA 4PAMA 4AKIA 4H1VA 3RS7A 1Q3HA 4LY6A 3L43A 2XZLA 3QPUA 1E4VA 3WNDA 2ODNA 4Q01A 3K70B 1CS4C 2OSBA 4IFEA 1KKMA 5B64A 1NIPA 3MUFA 3UMSA 1FNMA 1OXUA 2HV8A 5H68A 1FX0B 4Q48A 1OIXA 2AK3A 5L3QA 5E95A 1RRGA 1XU4A 3D7MA 1IXRC 3Q8XB 1QHHB 4M1MA 3AUYA 1XNJA 4OK5A 4ASUA 1BIFA 1D8TA 4PX9A 1R8SA 1ODFA 2H18A 4P3YA 3AV0B 1EX7A 4PQRA 4B33A 4BUJA 2QE7D 2UZIR 5TDHA 1M74A 4MGZR 2WPDD 5C46F 1R8QA 2CDNA 4GMDA 4FINA 1GSIA 3GFOA 2WAYA 1JPNA 2JJ2A 4DDVA 1R2QA 1C4OA 3ZQJA 1VCOA 1GRRA 3K0SA 2ZE8A 2L0XA 2WTUA 3BFXA 2RH5A 2CE2X 4RFSB 3GJ4A 1S0UA 2A2ZA 4FMCF 4V0OA 2D74A 1T9HA 2F3TA 3H84A 2EYUA 1EG7A 2GXQA 4JSYA 1EFRA 1J8YF 1R0YA 4JVMA 5C1BA 4CIDA 5KDLA 1J8MF 2J0SA 5EE0A 3FGNA 1JR3D 2DFNA 2PMKA 4D0NA 1P9RA 2EFEB 4HLUA 3JVUA 4B3GA 1GNRA 4IVRA 4NONA 4C0JA 5TY0A 3AGQA 1DAKA 3SJZA 4LC1A 2H17A 4E03A 2ZJAA 2P6NA 1YR6A 4I1SA 1VTKA 4K46A 2HXSA 1TF7A 4IVQA 1TQDA 1G3UA 1MH1A 3P1JA 1MRSA 3WNCA 2ECKA 1OH6A 2KBEA 3CZQA 1ZNZA 1CJKC 4TSFA 1UKEA 2IC5A 6Q21A 3EX7C 4MA4A 1AGRA 2AD5A 3RSLA 1YHNA 3VFDA 4U5XA 3MWYW 5EJEA 3H86A 2R2AA 2JIZD 2ZIAA 4FXPA 3A1UA 2ANBA 1NVUQ 4KV9A 1J70A 1K6MA 4MYUA 4ERNA 4CEHA 2VH5R 3T34A 2O5VA 2GCOA 5K8UA 4LBZA 2H8KA 1RVDA 1Z8FA 3CRVA 4X8MA 2EFDB 4EPRA 5L3QB 1P6XA 1Z6TA 3IQXA 4PO9A 4QRHA 2QP3A 2NPFA 1NBMA 1KDTA 1OFTA 2OFWA 5JS8A 4RD1A 4CZ2A 5KTYA 3LXRA 1CRPA 1U0HC 2NZJA 3QF4B 1S3SA 2VTKA 5EXPA 4EQ6A 3U7GA 2XGJA 2P65A 5D3MA 1KI6B 4UXIA 4A2PA 3B5JA 1NG1A 1R10A 3DO6A 5J4LA 3OEHD 3LA6A 4M4SA 1W47A 4TQ9A 1RJ9A 4EFMA 2HDNB 2QP4A 1OKKD 4KVGA 2GRJA 3K0FA 3GLHB 5UKDA 2BJWA 3QIAA 1A82A 3B1YA 1Z0AA 3DVLA 1GILA 3GJ6A 2G0TA 4KAXA 4A8JC 3WHLA 1U94A 3PUXA 1E2PA 2FEMA 1DELA 5C4GB 2V54A 1KY2A 1XCPA 2F43B 4MUBA 1G8PA 3R8FA 2OEPA 2F1JA 3F0TA 3BH0A 4NCIA 4DWJA 4PAQA 4A6XA 1KI1A 3ZVMA 1M1YE 1PUJA 3PCRB 2ZS8A 4LPKA 3GLGA 1X8KA 1G19A 2IS2A 1IBRA 3TAUA 4OHZA 1B0UA 2CLCX 3THWA 2PMDA 2DHRA 3I73A 1U0JA 1CP2A 2BOVA 3FKSA 2BV3A 1TEVA 2JLWA 1ZMXA 1WQ1R 2ZI6A 3OF5A 121PA 3BS4A 4US2R 1KAOA 2YC2C 2LCFA 4NCKA 1OH7A 4JJKA 4N1AA 2JLVA 5J40A 3Q9LA 2WWGA 3MJHA 2ZYVX 1E1QA 1FQKA 4MRPA 4NMMA 2I1VB 3W3AA 2ERXA 3L0OA 1JR3E 5J4VA 1BO6A 4W9MC 1OH8A 1YZTA 2JDIA 3E2IA 1AKYA 5FUVA 4BFYA 1KSHA 2PH1A 3QUSA 1JQLB 1VHTA 1XF9A 1XJ0A 3VR2A 2VL7A 1P61B 3SOPA 3KTAA 1Q12A 1UEIA 4MRRA 1W36B 4A2QA 4OL0A 1Z0KA 5FI1B 4IOKA 5LDDC 3PEYA 2OAQ1 3LO5A 2QSZA 1YKSA 4NHOA 2QI9C 2B7BA 4Q9LA 1Z2CA 1AS3A 5FOTA 5B2ZA 1OHHA 2GBLA 2XOKD 4YMVA 4W5JA 1GKIA 4AD8A 5A4JA 2V55B 1W1WA 1JECA 1JI0A 3CWQA 3IPXA 2J3EA 5DN6A 1KTVA 2ZU0C 5JS7A 2V3CC 1T6NA 1NG9A 1IXZA 2IA5A 1N0WA 2BMJA 5GJVC 3MLEA 1P2SA 1Y3AA 2GA8A 1XD8A 2VSXA 1E3MA 5FR2A 4QJ4A 2XZOA 5J4KA 1F60A 2QPTA 1S1CA 1HQCA 1L2TA 1G8GA 1XTJA 3MWKA 4B75A 4PZYA 2UKDA 4Q1AA 3TLXA 5FI0B 4PQYA 5BXQC 4MQBA 3OEED 4QFMA 4LYHA 5DO9A 3SE0A 4TL9A 2GEUA 1W2GA 3VAAA 4MITA 3D31A 1GNQA 1G8FA 3LBNA 2ATVA 1JAIA 1ZYUA 2Q9CA 2RGGA 3KQUA 1KKLA 2OXCA 2QQEA 3FOZA 4LYJA 1WA5A 1E2MA 1VCMA 2WSMA 3C15C 2ZRGA 3SYLA 1W48A 2EFHB 4E22A 3GD7A 3K0CC 2ANCA 2FDCA 5H70A 4LHVA 4P4TA 4XTRA 1E79D 4PHTA 4Z1MA 1TAGA 3EPKA 3PV0A 4DLWA 3DKVA 1S8FA 4NH0A 4C0SA 1YVDA 4RD6A 1RRCA 3DM9B 2PBRA 4BFSA 1MO3A 1UEJA 3CH4B 3NHAA 5L3SB 5GJBA 4Q1EA 1V5WA 3MD0A 3HP1A 2IBMA 1T91A 2QQ0A 1E96A 1GG2A 3ASZA 4W5HA 2CNWA 5FUXA 3UWOA 1H8ED 1VCIA 3BH7A 4WZAE 2A5YB 3TUZC 1N6KA 4B48A 4CVNA 1G7TA 2JGNA 3W90A 3IO5A 1A4RA 4Q9JA 2J9RA 1AK2A 3RRZA 2ZROA 3UIEA 4IJMA 3RS4A 1F48A 2VSOA 1JJVA 1WRBA 1GL9B 1Z6GA 4EJSA 3GJ5A 4MGIR 1KHTA 1SKYB 1H8EA 4FIDA 1G7CA 4D6PA 3FMPB 1T0HB 4IW3B 3VX4A 4RKFA 4YDSA 2XZPA 2ZJBA 1P75A 3QXCA 4TMVA 3D8BA 2JA1A 4URVR 1YQTA 4D26A 5F9FA 4DLSA 3A1WA 3IQWA 4RZ2A 4DLVA 1XDBA 1Q21A 1KDOA 4ASUD 1E2HA 4QGAA 5F2EA 1UKZA 3RVBA 4GL2A 4B73A 4IKEA 4KCGA 4M2LA 2F9MA 4RD0A 2WM9B 4C0HA 2IHYA 2QM8A 1O87A 3C41J 3IIJA 1AZTA 3FHCB 4X8HA 2E87A 2OBLA 4G5OA 4HAYA 4BEBA 1E94E 2Y8EA 2OESA 3Q72A 1W5TA 1DARA 2QAGB 4HAXA 4LYFA 3WYAA 2FGJA 2AKYA 2AFHE 3QKSB 1QHNA 2C2HA 3SNHA 4HI0E 4KLNA 2PEZA 2OHFA 2ZI4A 3T5DA 2OAP1 1LFDB 4BE7B 1FFHA 1W7AA 3GEEA 5JCPA 2NOAA 1N5JA 4P4UA 3IPYA 2FSGA 3AUXA 2C04A 2V6JA 1GDDA 1W49A 1IOZA 1E69A 2EWVA 1G64A 4D0LB 5DI3B 3TSZA 4OI1A 3L82B 1E9RA 1TADA 1XTIA 3LVQE 4R2IA 5AUOB 2O8BA 1SVOA 5FPTA 1E9FA 3DM5A 4YMUA 1II0A 1LY1A 1NVXQ 1G5RA 2F43A 3BOSA 4Q9KA 1YZQA 1HYQA 5DN6D 4JLPA 4FCWA 2BEJA 4BZXA 2CCKA 1V43A 1S96A 1Q1QA 3KDSE 5FOXA 4LI0A 4BEJA 5CLLA 1G3MA 1SHZA 3GEIA 1XTQA 4JLKA 2G88A 2VYFA 2AXNA 1DBSA 2BWJA 2WJYA 3OE7D 4FN5A 4GI7A 2ONJA 4XD7A 2D2FA 2PX3A 4Y0AA 1PLKA 1NF3A 2FV8A 1ZIOA 4CT5A 4AC9A 5BW8A 3ICEA 3EWSA 4OHWA 3TW8B 1ZJ6A 2WSSD 4TTQA 2HCBA 3OEEA 1UBCA 5E7MA 4DSTA 3IIMA 2Z4SA 2ASEA 3CPJB 1E2LA 2J41A 2R6FA 3I8XA 4PC3A 1E1RA 2FPLA 2WAXA 3N5CA 3UK6A 3B9QA 2QGNA 1TNDA 5IF9A 4JLOA 1M8PA 2QROA 3ADKA 5HZHA 4UNRA 3KL4A 1KY3A 1PZNA 2QT1A 1XD2A 3CLVA 4JT4A 2G83A 1ZW6A 4XWKA 3WBKA 3ECCA 1JAHA 4EIWA 3FTQA 1AKEA 1ZNXA 3AH8A 2ORIA 3SBDA 1SVLA 2AXPA 4P4SB 5BN4A 1HY3A 3RRNA 1N5IA 1QHXA 5IK2D 4ZDKA 4O3MA 3VR1A 1IN7A 3BXZA 4D25A 4JYCA 3VHXA 4Q4HA 1NIJA 1ZD8A 3KFVA 4QJ5A 1NKTA 4EUNA 1CEEA 3ZH9B 3K9GA 1U0LA 4MYHA 1M7BA 3BH6A 1EFRD 3SU8A 1PV4A 3TNFA 2HT6A 1ZM3A 1E2EA 4RZ3A 3RDPA 5B57C 5FOSA 2YZ2A 4O0MA 4URYR 4HATA 4HB0A 4URZR 5HE9A 5A0FA 1BYUA 2P6RA 1YZUA 1G7SA 4A0RA 2PJZA 4KXFB 3DZ8A 4NPHA 4Q4JA 1UM8A 1SVWA 1F2TB 2HLDD 2CEAA 4FCVA 3ZVLA 1D2MA 1ZD9A 4A6PA 1E32A 1NVWQ 1E1RD 2CCJA 3EZ2A 4JSTA 4B34A 3PUYA 2VP5A 3Q7QA 1WBDA 1Z29A 3GFPA 4XOIA 1Z2AA 1CKEA 2BEKA 5P21A 2P67A 3A36A 3U6BA 3PJRA 2A7QA 1JALA 4S35A 1P2VA 1KSJA 2BCGY 2GWHA 1N6PA 3TJZA 4B3BA 3NBFA 4MDFA 3CX6A 1RZ3A 3PENA 3ND8A 1XWIA 4LJAA 2LKDA 2QTVB 5JLJA 4TLCA 1W5SA 3A8TA 2OLJA 3WMFA 4URWR 2V1UA 1BKDR 4OI4A 3DKPA 1UBGA 2GXAA 1D2EA 4IRUB 1SXJB 1L4YA 1HT2E 4LBYA 4YMWA 1XZPA 2YKGA 1XD2B 2WJJA 1KK2A 2VBCA 3MWLA 5J4YA 3R9IA 3C7KA 5IRCD 2ZUDA 4EJSB 3SR0A 3HWSA 3U44B 3WP1B 1IQPA 3I61A 3X2SA 2AKAB 2VHQA 3I5XA 3RSOA 2ZYUX 3DMDA 2B8TA 3WP0A 3O8CA 1VDZA 1IN5A 3NDPA 2N46A 4GBMA 4OI2A 5EQTA 3ZDQA 3E1SA 4DCSA 2OUKA 4RCYA 4PPQA 4WIAA 5JFGA 1TTTA 1X6VA 1I2MA 2H92A 5D3QA 1VECA 2DFLA 4OQXA 4A0GA 3KB1A 2CLDX 3B60A 4GP7A 1SGWA 2AWOA 4LUCA 4Q02A 2RHDA 3ZVRA 1XMIA 4ZDIA 2OG2A 1SVIA 3IEUA 3LNCA 4FMDF 4Z8YA 1KK1A 3K53A 3V00A 4KBFA 1JJ7A 1P73A 3QXXA 2RB4A 3Q5DA 1QDEA 3B1WA 4G0NA 2WSSA 2C78A 1OW3B 4QNMA 3OIWA 3O8DA 4A0FA 2I1QA 3W6NA 3VR4A 2WWHA 3AKYA 2X2FA 1E9DA 1TX4B 2OT3B 4AY2A 5FOUA 1Z6AA 3AKEA 4MKHA 3SQXA 2I3BA 1W4BA 4QHSA 4EDHA 1Z06A 2PJRA 4OHYA 3DL0A 2OCAA 1GL6A 1H8HA 4OJKA 4QHTA 4V02A 3TGPA 3EC2A 3QI2A 4YLGA 4R2HA 4DCNA 1TQ6A 3VKWA 1G3QA 1QVAA 2A78A 3EZ9A 4M9SA 3KJIA 2F55A 1AZSC 2GNOA 1NVVR 4II7A 4O2LA 2V1XA 2K5UA 1QHGA 4HLQB 4M1SA 5LBIA 1CXZA 3NWJA 4HLDA 3FWYA 2JIZA 3VQTA 2QMUA 4Q21A 4C0QC 5JJIA 1MRNA 1JPJA 3K70C 3U3MA 3PEUA 1UADA 3BD9A 1XMJA 4ZI3A 3B2EA 421PA 3S1AA 2JLUA 2AD1A 1T0JB 4M21A 1Z6YA 4A82A 1XTKA 3TK1A 3QEJA 3TQFA 2HJGA 1NSFA 1UKVY 2P3SA 4RCZA 1I4LD 1YR8A 3KKNA 1KI4A 1TL7C 4PC1A 3T12A 5AJWA 4ZV4A 3CNLA 4V0MA 1KZ7B 4MUAA 4PHGA 1AQYA 4RZXA 2XOKA 1NJGA 3RAPR 3SZRA 1RC8A 2HUPA 3TVDA 2R65A 4BFUA 3K0CA 2J7PA 3K0FB 4QNRA 4LJ7A 4UNSA 2YINC 3F3YA 1F6BA 3HPQA 4HLCA 2QRNA 4D2IA 5KO2A 1PLLA 2J0VA 3Q5EA 4QOSA 3ZQ6A 1P2TA 4TLAA 4PC7A 3WRXC 4BRUA 4CEIA 1EXMA 1WBBA 1TF5A 3CONA 1SZPA 2C03A 1G6HA 1BS1A 3FMIA 1A7JA 2ATXA 2RKOA 3VKHA 1ZC4A 3CR7A 3SJBA 1NLYA 2DWOA 1K5GA 2RGNC 3TRFA 1IY1A 4EAQA 4IDPA 2PEYA 4HSEA 4HAZA 4QG7A 3NH6A 3KX2A 2GJSA 1J7KA 2VLIA 2WHXA 5FTJA 3B7GA 1NN1A 4CDGA 1G5TA 3FMOB 1D2NA 3RS3A 4GOXA 4K81B 3WXMA 4A92A 3LLUA 2Q3FA 4M0LA 3W6OA 4TQUS 2Z4RA 2CCGA 4Q7JB 4X8OA 4Q1FA 4MRVA 1GZSA 4F92B 1SQ5A 3P26A 2J1LA 4LX0A 4JVLA 5FOWA 4B3FX 3ZD6A 3H0KA 1MO6A 521PA 1QHIA 1XEFA 4TTRA 4UQOA 1E9EA 1N0VC 4AIIA 3VU9B 4QXAA 3ZZ0A 4JMPA 2ZUCA 4TYPA 5KOYA 1IY0A 1P4SA 2FWRA 2JLRA 3AP1A 4QC2A 1PUIA 3UPUA 1BMFA 4C2TA 3U2QA 5BN3A 3CBQA 1T3SA 1H8HD 2DYKA 4NU0A 3NVAA 3GPLA 5G3ZA 2ZSFA 3GLIB 2FFQA 3WYFA 1M6NA 4NCJA 4URXR 1OB2A 1AGPA 2R6GA 3KFXA 3MMPA 5E7IA 1A1VA 5EXXA 2QMHA 4WBSA 1EFUA 3A1TA 1J2JA 4E09A 4HAWA 2PCJA 2DFKB 1L4UA 1GRQA 1KZGB 5IDVA 5DIFA 1OT3A 4DEXA 2VEDA 4NP6A 3AM1A 2QRZA 3CRMA 2GZDA 2OFXA 3PG5A 5GJCA 1R6BX 1E0AA 1N2CE 3QF7A 4EPTA 1NN5A 2O8CB 4GSYA 2FZ4A 2H5EA 5FL7D 1E6CA 3SQWA 1NMZA 4KITB 5J47A 5HE8A 3VNVA 3DMNA 4O25A 3RLFA 5FUYA 2C77A 1LTQA 1ZM2A 2YHSA 1FNNA 2WWIA 1R4AA 2G77B 3B9PA 4Q4HB 4A9AA 5CK4A 2R62A 3TQCA 1CBUA 3L0IB 4TMXA 5KHOC 3ETLA 3PUWA 5HKKD 4NTZA 2FEOA 5JRJA 4TMKA 4TZ6A 1GAJA 2IF0A 5HR5A 2A5FA 5J4HA 3K1JA 2KWIA 1ZAKA 3RC8A 4TLBA 4NYMR 4MGYR 3GLFE 5KSZA 2ZI9A 2ZRJA 1SKYE 5KNCA 1U98A 3LD9A 3FKSD 1Q1EA 2AK2A 1DPFA 2NGRA 3CM0A 3PFIA 2W6IA 3T06B 4NYJR 1G6OA 3CO5A 1EFHA 2AR7A 4HAVA 2FFBA 4L9SA 5CYPA 3VU9A 2WOJA 2RGBA 2QGZA 1OXXK 1MR3F 3MFYA 2YWHA 4L16A 4MKIA 4WAUA 5FPSA 4DEYA 3FYHA 5C4MA 3LX8A 2AL7A 2GVDC 2Z83A 1T5LA 1KNXA 5E3HA 1QVRA 2NO1A 1KAGA 4XVRA 4CEJB 4IEEA 4G5SA 2GAAA 2WIAA 4PPFA 3B1XA 1N6NA 1Z3IX 3SEAA 4BPBA 5DNYB 2IXFA 2BDTA 2RCNA 1G5PA 1DAGA 5GVRA 1TU4A 5DHFA 2VIIA 1OH5A 1KYIA 1HTWA 4RZUA 4E5UA 2IW3A 1JEEA 4Q66C 4DRZA 2QZ4A 5CDFE 2WWFA 3OEHA 2C96A 3U3OA 3A1SA 3FPAA 1TF2A 3OAAA 1HT1E 1YZGA 3T1OA 4AI6A 1MV5A 1K5DA 3N70A 4HDCA 3EARA 2ZRBA 1HV8A 4LV5B 3CNNA 3ZVNA 2ZE5A 4KU4A 2NQ2C 4I1UA 2FG5A 1E2GA 4F4JA 1E9SA 4M1TA 4WZ6A 4Z51A 1KJWA 2FOLA 4A2WA 3KXLA 1SXJE 2QUZA 4C3ZA 4BRWA 1FMLA 4LBVA 4DXAA 2WKQA 1G16A 1G18A 3OIVA 3QXSA 2P5TB 1XXHA 3GJ3A 5FTLA 2X1VA 5FBWB 3AVOA 4BWYA 2ODBA 2C9CA 2QT0A 1IONA 2GXUA 3CUEF 3VMFA 4QM7A 1OPXA 2H7VA 3KKMA 4DLUA 4NZYA 4QGHA 3C8UA 3W34A 4L15A 4KVAA 1BMFD 2ZRNA 4Q18A 4C0BA 4XWOA 2ZM5A 1I4TD 3THYB 3AKDA 4OHXA 3SFZA 4XWAA 3QE0A 3Q85A 4GZLA 1G4AE 3U4QA 4OK3A 4DC9A 1GKUB 5FUWA 3WY9A 2GJKA 1CF4A 2CNWD 3QKSA 2W2XA 4LV8B 1W0JD 2AHOA 2QBYB 5FBQB 2IWRA 1VPLA 2YV5A 3RRYA 1IXSB 1EESA 1OE0A 3M1IA 2X77A 4KFSA 3MRSA 1XB2A 3U3JA 1N5KA 4UXHA 3ND9A 4M53A 4TTPA 1DG1G 1LV7A 2W2TA 4QHYA 1E2QA 3L8ZA 4RJLA 1G20E 1KI8A 2QY9A 1CTQA 1E0SA 3CZPA 3ZYCA 1N5LA 5KYKA 2NIPA 4C0AC 5EE5B 3W3ZB 2XTZA 2W58A 1DAMA 5TVKA 2TMKA 2CHVA 4TZ0A 1W0KA 3HU2A 1E99A 4Q9HA 2G9NA 2CVFA 4AK9A 3K9LA 4C2UA 4M9XA 1G17A 3EA5A 3NKVA 2GF9A 3UATA 2D7CA 1OFIA 1XTRA 4BGDA 3R20A 4WZBE 3ADDA 2CHQA 3I5YA 1NBME 3GLIA 5HCIA 4NCHA 1TQ4A 1E2KA 2YOGA 3G5UA 3QKUA 4UNQA 4IDOA 4AURA 4C9BA 2HLDA 2OCPA 3M6AA 4LV6A 1JR3A 4LC0A 3LW7A 4LHXA 1KO5A 2ZI5A 4HEJA 1D5CA 1GTVA 4DKXA 2O8BB 1T8TA 2NO0A 4DB4A 4A15A 1B23P 2A5GA 2GJ9A 4C0KA 3LWNA 4Q19A 3L2OB 1CU1A 2IUSA 5JWHA 5IT5A 3FMFA 4JLDA 4RD2A 2F3RA 2GZHA 2O8FA 2F1RA 2CE7A 3KJEA 4C30A 4D4LA 4EPXA 1GITA 2IHBA 3A37A 4DVGA 2ZETA 3EIQA 2Q3MA 2QAGA 4LJ6A 3ZIAA 4BASA 2EWWA 3EAQA 3KUDA 4W7SA 2Z0MA 4PQFA 4YC7A 2F1HA 3A58B 4BFVA 4JT2A 4TT3A 3LAWA 3DOFA 1A5TA 5JWRA 2FFAA 1U8ZA 3DHWC 1CR0A 3N2IA 2VSFA 3AP2A 3Q3JB 5L3VA 3FKQA 4I99A 4ABYA 3GLGE 1BOFA 1LF5A 4H1UA 4KSBA 3NG1A 1SVMA 2WMOB 3LRPA 4G3XA 1DG3A 3I32A 1GFIA 4PC6A 1VG9B 4HLUC 4M1KA 2CXXA 2ZITA 3RNLA 2HJVA 1IN6A 5GJWC 2OM2A 1TUEA 2QTFA 2HT1A 1ZD1A 2JASA 5HTKA 2E9SA 2FSHA 3W5JA 4Q4AA 2REOA 1YRBA 2JEOA 3DDCA 1E2DA 5CIWA 4GDFA 1AN0A 5EP1A 1OFUX 4P33A 2OCYC 2LKCA 3C14C 4QL3A 2YWEA 3X1ZA 4AKGA 2QMEA 4OBEA 5TXGA 1KMHB 1RYHA 1VG8A 1HH4A 2FJUA 2VP0A 2WBLC 2VA8A 3IGFA 4F91B 1GKYA 4X8LA 3R9WA 3K0AB 1X1SA 4V0LA 3VR6A 2BMEA 2DWQA 2YOHA 1XMVA 1S2MA 2AWNA 3GFTA 4BLPA 1D9ZA 1JB1A 3W6PA 2ZRKA 1U81A 3D3QA 5LB4A 4B2PA 2WJGA 2Q21A 4HDQB 4US0R 5FPYA 3MAAC 3CRW1 4YXWD 3CNOA 2QM7A 1N6OA 2VRWA 1YRAA 2KE5A 2O0KA 3A4MA 2MSCB 3GLHA 4LGMA 2ZXUA 4BZPA 2VO1A 3EA0A 4JS0A 3ZS8A 2AN9A 4AYWA 5JI3E 2KBFA 3NIBA 1BYIA 1FX0A 1LF0A 3I62A 2FMXA 2GK6A 5C18A 4XTCS 3NEJA 1NL3A 4DDUA 2C9OA 3ZLJA 4MRNA 4IXMA 3P27A 3C5HA 1G1MA 1XEWX 3K70D 5EXSA 2EVWX 2IYXA 4JL6A 2ZUBA 1G4UR 1Q22A 2J45A 4ILEA 4ACBA 1YR7A 1AJEA 4M8NE 3QBTA 1S1MA 2GJ8A 5E7JA 2IF2A 3EPHA 2IS1A 5G40A 1CJUC 3OE7A 3WRYC 3KJGA 1VMAA 2OZEA 2REBA 1E0KA 1E2NA 1ZUHA 2DWPA 4GT1A 1U8AA 3TVTA 2ORVA 3GMTA 3FHTA 1ZM7A 2FZLA 5K8TA 1K8RA 2OCBA 1MO5A 5LD2C 4TL6A 1SXJA 1CJMA 2JJ8A 5HZKA 2QORA 4KO8A 3MJRA 4TT3D 3AGPA 1UBFA 1XXHE 1TEXA 4XD7D 2Q9AA 4I1VA 4DCUA 3THYA 2H57A 4TN1A 2GAOA 1AM4D 1ZCBA 1KI2A 1TUIA 1OFHA 4JZKA 2ZRDA 1P60A 1N25A 4AKHA 3ZZTA 3HR7A 4BQSA 3R8CA 4TYYA 3OFND 2QNRA 2PZEA 3QF4A 1KJYA 3SYNA 4EQ6B 3K09A 1DE0A 1WE2A 4POAA 4DSNA 1W4RA 1XXHB 2ZJ8A 3FB4A 2OV2A 3BGWA 4ZCIA 4BLTA 4ZIRA 4B76A 2MSDB 2OXRA 2BHRA 3A1VA 2R44A 3FVQA 1R0ZA 2ZTSA 3Q7PA 3EIHA 3H4MA 2AX4A 3IBYA 3EWAA 4GNKA 3THXB 1F2TA 3KKOA 3QEOA 5CITA 2IK8A 3W8NA 2YWFA 4TL7A 2IWHA 1DS6A 1WF3A 1U8YA 2WWWA 5CB8A 3WMGA 1WP9A 2A5DA 4TL8A 4P31A 3CH5A 3AQ4A 3PUVA 5D3MB 3BJIC 5FOVA 1DEKA 1NI3A 3HU3A 1AS2A 1RW4A 4M1WA 5HPYB 1LB1B 4B44A 2ZR9A 3U3KA 5EP3A 4QBHA 1CRQA 1KNQA 1N6IA 1M7GA 1XEXA 5EUMA 3EZ6A 5LB2A 4ZCMA 2GEVA 5F3WB 3A6PC 1SULA 1E2FA 2B7CA 4N0DA 2J0UB 5DSZA 4Q5IA 5DYGA 2BMFA 3AB3A 4JLNA 3U7EB 4QKQA 1PJRA 1NVVQ 1IHUA 3TBKA 1ZIPA 3EC1A 3W5IA 3ONWA 1TU3A 3GLIE 4JLAA 1XPRA 3REGA 2BIFA 3VR5A 2FSFA 5FPHA 4NYJQ 3RHFA 621PA 4NYIR 1OSNA 2C5LA 4M9ZA 4Z8XA 3KQNA 2VPPA 2ZRAA 2P5SA 1D9XA 1TQ2A 4U02A 2XNDD 2W0MA 3HYTA 2RGDA 1NNEA 1E9BA 1NY5A 5TARA 1E4YA 2ZEJA 5KDDA 2D62A 3TIFA 1FZQA 4B71A 5C2JB 1MT0A 5JHHB 3U7HB 4ZI2A 1ANKA 1KI9A 1XFAA 4LPSA 4DT1A 1WXQA 2KB0A 1RFLA 2IEZA 5IHPA 1S4QA 4YMTA 2N1BA 2XITA 4Q1DA 4IDQA 1ELOA 3P4YA 2PT7A 1KSGA 4HB2A 5JEEA 4PSKA 5CJ2A 5KSPA 2NTYC 1II8B 4UNPA 3GLFA 1ONBA 2GDJA 5EE1A 3PVSA 1O3YA 1JQJC 3LQQA 3RABA 1GM5A 4CT4B 4JBXA 2ZSEA 4Z1MD 5BWMA 3LBIA 1JEDA 2D2EA 5JWOA 2EU8A 3C4JA 1N0UA 2EQBA 5DYIA 5DH9A 4BFWA 2FH5B 1ZNWA 4KYIB 3VX3A 2A5JA 4M22A 5AJZA 4B43A 3U44A 2HYDA 4JBYA 3CF0A 4JLVA 1CR4A 2EFCB 1NLFA 4ZKEA 2O0HA 3BRWD 2ZS7A 1OF1A 2WOOA 3IBGA 1ZM4A 1G291 4M1OA 3H1TA 2GCPA 2VHTA 3AVYA 3G82C 2BC9A 4R9UC 1PLJA 1J99A 2YC4C 2JLXA 2CBZA 2XNDA 2KI5A 2OBMA 1CIPA 1YZLA 4MYTA 4GZMA 4IOMA 2QENA 1N6RA 3GJ7A 3KTAB 5TB5A 3T5GA 3ZS9A 5BYKA 2JLZA 4UXJA 4XVUA 1GRNA 2XXAA 4TLEA 1P5ZB 4DUGA 4WA7A 1MOZA 3AVUA 4OJQA 1JR6A 4ZKDA 2WJHA 2ZRHA 1ZBDA 3BWDD 5G3YA 1ZUIA 3B1VA 5TV2A 1UF9A 1YJ5A 1Q57A 1EFTA 1US8A 4LHYA 3HR8A 2CL6X 5KU1A 3UKDA 5B30A 1SVKA 821PA 2W6JD 2IYYA 1U90A 2BBSA 3U6KA 2Z5FA 2BJVA 3NBYC 1QRAA 1Q1ZA 4KBGA 2EFGA 2DBYA 3AF1A 3R7WA 4OKSA 2FA9A 5SZHB 4PANA 2OLKA 1VG1A 3GJXC 2D7DA 1Z08A 1AIPA 2F6RA 3SBEA 2G1JA 1U2RA 1XP8A 1KGDA 4RFVA 2IYTA 5DI9A 5BYJA 4JIMA 5JHGB 2ZVQX 3K0EA 4RD4A 3VHLB 1N3BA 3AP3A 4KODA 4D82A 1II9A 4OYHA 2O0JA 5AR1A 1CR2A 4M1YA 4BLRA 2QAGC 2JJ1D 1XJQA 4FD2A 2V9PA 1SKQA 2A30A 2Q9BA 1FUUA 2B8WA 5JECA 2IEYA 1ZU4A 2GEDA 3BIFA 4XSGA 4IOJA 2ZQ5A 3MG9A 4G1UC 4OK6A 3EIEA 5G53C 4C7OB 5L3SA 3MWJA 1DADA 4JJZA 4LJ8A 3ZGXA 1D6JA 3B13B 1G8HA 4DLTA 1M7HA 2C98A 2H1LA 5TMPA 3LX5A 3LY5A 5BN5A 3T35A 3K09C 2W83A 2QG6A 3I92A 3UMFA 3G0HA 1RE0A 4FWIB 3B82A 3WNBA 2FPMA 2ZR0A 3JZAA 1OIWA 4YDHB 2XSZD 4KYUA 3DZDA 3NH9A 1P9WA 4F93B 2RGNA 4CEIB 4DCVA 4OQNA 1II8A 1ETUA 3AVWA 3GLFB 4NCNA 4OHVA 1T4GA 1ZUNB 4LK2A 4PO8A 1CULC 1IN4A 4G5GA 2VF7A 2R6DA 2PCLA 4Q7KA 5G41A 1AQUA 1CR1A 1G9XA 2IL1A 5JZVA 4TMZA 2ZJ2A 3OZXA 1CJVC 2PLFA 4DUGD 4JKIA 5CK5A 1T3HA 1F2UA 1HURA 3F5FA 2NZ8A 3RYTC 2D3WA 2GXSA 2XEXA 3QNUA 3QPWA 3SN6A 5H8WA 5KNBA 1VIAA 5DI3A 3QENA 4F7WA 4LBWA 5M04A 5EE3A 2XJ9A 1G7RA 1NRJB 4NYIQ 4ZPXA 5CYOA 3KXIA 1JBKA 1XTSA 2IXGA 2PZFA 2N42A 3I4LA 3EZ7A 2JATA 2G0NA 1R7RA 2ZRMA 1IN8A 2QN6A 4G01B 4HUQA 4LSGA 2CK3D 4ESHA 4QGFA 1Z22A 4XJXA 2C95A 2I4IA 4IOLA 4I1OA 4UJ3A 4LJYA 1SHKA 2W6ID 2X19A 1P2UA 3GLHE 2F1IA 4HDOB 4W5WA 1NP6A 1VCNA 1EFCA 1NLZA 2C8VA 3AF0A 3EPLA 4RD3A 2JCSA 3HPRA 4DIDA 2QEQA 4BLQA 4S2EA 1MABB 1VG0B 3REFA 3TUJC 1VYTA 2ZYWX 4FMCB 4GOKA 4OQMA 3VTKA 5SZIA 5K8IA 1COWA 3KKPA 2XTNA 4B6EA 5FBRB 2O8CA 4U00A 1R5NA 3CX8A 3PEVA 1Y63A 2F7SA 5KSYA 4MKGA 4LCBA 2GTPA 4NBSA 4QJ3A 5ELXA 3A4LA 2J5XA 721PA 1OB5A 1NMYA 3WYGA 4TLDA 1Z0FA 1ESMA 2NMVA 2BM1A 1COWD 5FPKA 3ZD7A 2GKSA 4MDEA 2IYRA 5E4FA 4BFTA 5FFMA 3AVTA 4AKEA 4LHZA 5DHAA 2CJWB 1XEXB 3K9HA 3N2EA 1OHHD 3CPEA 2JLYA 1HA3A 1QF9A 1RYFA 1SXJC 4PZZA 1Z0IA 3PQCA 3B8HA 5F98A 2RMKA 1RRPA 3GJ0A 1E2IA 1ZC3A 4PPNA 3U5ZB 1E79A 2PT5A 2IYQA 4JVNA 4U7DA 3CR8A 1GL7A 1XPUA 3L8YA 1NJFA 1ZVQA 4PO1A 3W9YA 4NYMQ 3AF4A 4PTLA 2XAUA 1FPMA 2GCOB 2ZR7A 5FBVB 2HYIC 3KKQA 1FP6A 1EK0A 1Q44A 1VIYA 4AYXA 4B3DA 3KQLA 5CLQA 2CVHA 3GEHA 2FU5C 3PUZA 4QBGB 2UZ3A 2J46A 4IXNA 2R6CA 2IS4A 3LDAA 4OQLA 1P72A 1U9IC 5SZJA 3SHWA 2ZE6A 4AG6A 2IUTA 4G5RA 3CIOA 4CYMA 4XH9B 3NHBA 2FPKA 4Q1BA 2B21A 4LRWA 3QKRB 2OE2A 4L9WA 4B35A 5KNDA 1DTSA 3LV8A 4QBFA 3TSOA 2YOFA 3T61A 4LJ5A 4MYCA 3AVQA 2XB4A 4BFXA 3AF2A 3OHMA 3U3RA 5CM8B 4NDZA 3GJ8A 1I4DD 2NG1A 3I8SA 2WMNB 2B92A 4ARZB 2ZVPX 5ANRB 1Z07A 3HJNA 4Z54A 1Z6XA 1LS1A 4IFBA 2ZI3A 3QVVA 2O8EA 3BC1A 3P32A 3FDIA 1T5IA 1Z0JA 1M2OB 4PHHA 3CF2A 2QAJA 3F8TA 1E0JA 1GIAA 3CRRA 2BCJQ 4TMWA 3X1WA 4FWTA 1NSTA 3M4YA 4JVSB 4AG5A 4BFZA 3L0SA 4TQAA 4DSOA 1XJCA 3GLGB 1SXJD 2YYZA 3CWZA 4KI0A 4ON9A 3K9NA 1N6HA 2QMOA 3WHKA 3QQ5A 1GNPA 2J7PD 1G21E 2VHUA 4DDTA 2CLSA 1EWQA 3IHLA 4FCTA 2IUUA 1IJFA 3W8RA 4HB4A 4WXPA 4FMDB 4RSGA 1UFQA 4B2LA 1EX6A 4PXAA 4BLSA 2XXAB 2WWXA 4D81A 3SI7A 4TYWA 2IS6A 3SJCA 1DVRA 2V7QD 2C99A 2QE7A 3CKLA 4JLJA 3T1TA 4LYAA 3FHOA 4Q4JB 2BM0A 1OLOA 4P32A 2BVNA 4LZZA 2PX0A 5EUQB 1OJLA 1QG4A 2OO7A 3VKGA 2ZRIA 2BKEA 3BE4A 2IX3A 2Z43A 3X1XA 1A2BA 1P3JA 1RKBA 2WJIA 3T1QA 2VP9A 3QKTA 5EE9A 1H65A 2XJ4A 3FE2A 2X2EA 4B2IA 1KK3A 1KI3A 3BB4A 2Q0HA 2ZU6A 4I4LA 1DAFA 3MCAA 1WCV1 4IHQA 4JL5A 4D0GA 5CB6A 4F38A 1GP2A 2XNSA 4FMBB 3ADCA 5FBLB 3LBHA 4A1FA 3AVXA 2O8DA 3BK7A 2WKRA 3NXSA 3QXHA 3IUYA 1XX6A 4PAOA 4JLMA 1F2UB 3BB3A 1XD9A 2ZJOA 3BAFA 5EP2A 3DOEA 4GFDA 1Z28A 3PIRA 4IEIA 3CB4A 3CX7A 3FFBA 4US1R 2ZJYA 3E70C 4CEHB 3LH5A 4GRAA 4O2RA 2MMGA 4TSFD 3X1YA 4N0EA 1F5NA 2IYWA 1FQJA 2J7KA 1KI7A 4LDJA 5LD2B 4GOJA 4JKYA 2GJAA 1QBKC 2UVQA 4URUR 2J87A 2ZAMA 2BBOA 3RS5A 2ZJZA 4B74A 4DZZA 2DCUA 3THOA 3BORA 1IY2A 1FMJA 4GP6A 3S1AB 2D4HA 4DSUA 1KMHA 1KI6A 3UG7A 3P20A 2RGCA 1E9AA 5EXTA 2JLQA 4ZO4A 5K8LA 4HB3A 2WKPA 2WJVA 3QKRA 1C9KA 2JJ1A 1Q0UA 3TR5A 3TE6A 4GMXA 1YE8A 2CHGA 3BFKA 4AWXA 3TW4A 1FTNA 1ESNA 1KO7A 4Q4AB 5AUQA 4DLYA 2O8FB 2RAPA 1UDWA 4LJ4A 5FL3A 4ARZA 4UJ5A 1C1YA 1LS6A 4G5QA 5AJYA 2BBTA 4MGKR 2FGKA 5CDFA 3NC0C 3GQBA 1W36D 1W2HA 5CIQA 4EJSC 1NMXA 3M0EA 3LXXA 1R5BA 3RS2A 1QG2A 4Q1CA 3B78A 3HDTA 3LW8A 3TKLA 1WMSA 1YU9A 3SFVA 4AYTA 4DDWA 1PVOA 4K8OA 4A0HA 3JZMA 2IYSA 2IYUA 1Z83A 5H1YA 4A8JB 5JBQA 3EW9A 1MO4A 1QHYA 4ZDJA 2BBWA 1R0WA 2GETA 4KFUA 3RWOA 4DB2A 1KSFX 8OHMA 3KXKA 1FOEB 1VYVA 1ZP6A 3TMKA 5JJKA 2FNAA 4HUQB 1KO1A 2QTHA 3NBXX 1DAIA 5LPNA 4QBIA 1P62B 2P2LA 1GUAA 3KQKA 2H16A 5CJPA 5HKKA 4ZCLA 5GVSA 2V7QA 3QG5A 1L8QA 2QL6A 2ERYA 2RGEA 2GF0A 1FL9A 1Z63A 2FX3A 3WBJA 4IDNA 1W0KD 3CRQA 4FW9A 2J0QA 1KO4A 1X1RA 2DFTA 3MSXA 3OAAD 2W6JA 3DPUA 1XBTA 5FH9A 1S9DA 2R9VA 2WICA 2WPDA 4P0TA 1M34E 2ZANA 1ZU5A 3SJAA 1Z47A 5KDOA 3KJHA 2F9LA 2J59A 2QSYA 1Q3TA 3NDBB 1OYYA 4YONB 4Q47A 3QJYA 3BBPA 2WWYA 2ORWA 2ZSAA 4JYBA 2V4ZA 1X86B 5AWFC 1NY6A 1G8YA 4LHWA 3IHWA 1LNZA 221PA 4H9GA 2RGXA 3V4RA 1HE1C 1XRJA 1WDTA 3PXGA 2CJWA 4BECA 4Q9IA 4WW0A 4DIEA 3V9PA 2EW1A 3LLMA 1KDRA 1OYWA 3TAHA 4LOAA 5JMTA 2DY1A 5JSZA 2WV9A 4HYYA 2PZGA 4HUTA 4UKDA 3BB1A 2QPAA 3RRMA 3BFVA 4YQFA 2W2VA 4XIGS 3T1VA 1P9NA 1ZNYA 1YZNA 5DLQC 2HF9A 1Z5ZA 1OXVA
chains in the Genus database with same CATH superfamily
3OIYA 3PVCA 3IB6A 4JLWA 3GIWA 1TCBA 2ZE7A 4OQ4A 2X2OA 1W36C 5DTEA 2MSKA 2WW8A 3RC3A 3W2IA 1R5OA 2EW8A 1UQRA 1M6WA 2ZJFA 4AM8A 1T8UA 2C58A 2RGAA 3W5SA 4HVCA 3OLZA 2OILA 1I13A 1S6YA 4NX2A 5INTA 5JCXA 5EI5A 3PD1A 1F0YA 4IJQA 5JSFA 2CL0X 3NTXA 1FK8A 2MMCA 4G86A 1X9IA 5G0VA 2FMKA 2ZIXA 2Q6TA 2PGIA 2XMQA 2GBLC 2XQJA 2IEGA 3BERA 3DBLB 3JYOA 3BCRA 4I81A 1J2YA 5JTTA 4EG1A 4DMRA 1N9KA 4UC0A 4IDGA 1QS0A 1IAQA 2MSEB 4L2IB 5FEMA 4BNUA 4F56A 2GK7A 1XVLA 1CUIA 1ORWA 3C48A 2GHIA 4CEJA 2YUIA 1T5DX 4IX9A 2I99A 1RLTA 4I4TB 1ICIA 4BMXA 4ALKA 1PR9A 4A6DA 1XZEA 4G07A 1JEYB 5JCZA 1IDOA 1L5HA 1U0NA 5A04A 3W79A 1MNQA 3E03A 1CUZA 4IDDA 3E8SA 3PGVA 4RMIA 1ZINA 1TGYA 3I2YX 4G4GA 4WK0B 1FU7A 1TD9A 2PN1A 2COEA 3Q7TA 3H8JA 4E14A 4CKZA 1U3TA 3GRVA 3IVRA 4YK7A 1BA3A 3WK9A 1U99A 3JATA 1DX6A 2P0EA 1RLJA 3M5PA 4WBNF 3QYFA 3GH3A 4KFRA 4ESOA 3CPHA 3N87A 1PNVA 2GX6A 2OCIA 3OLCX 3ZKWB 5DNCA 2NO7A 1J09A 4FDMA 4F45A 1ADCA 3L0PA 1MNAA 3WIVA 2YVQA 1HYEA 4N7JA 1FFBA 2YQ5A 2ZB7A 1BX0A 3LP6A 4NE2A 1EVJA 5IBCA 3ICQB 4X61A 3VPDA 4F4IA 1A9PA 2PLAA 3H6GA 3G2HA 3N8KA 5KSOA 4CGZA 4JC0A 4XSHA 3ADBA 4F04A 2QX4A 3ZWYA 4B3XA 3IQGX 2P3QA 1E6WA 1RS0A 5JMPA 4HVAA 2W6NA 1XE3A 3I0NA 3P0IA 1KYWA 3NEYA 3W1EA 4RF4A 3WI7A 4EUHA 3PGA1 3R9XB 2BKUA 3KUCA 1L5NA 4C07A 3HDHA 2QJRA 2ZREA 2QD5A 3HKBA 1J49A 1Z4MA 4MVJP 4WNYA 3RIHA 2IPNA 3HU1A 3B6EA 4QELA 1AKQA 3KP1A 3EXAA 1CD5A 1M3SA 1V8FA 1MAUA 1DBRA 4FP9A 4MWDA 5JVDF 2KJQA 5IM5A 2HR1A 5GAJA 3ONVA 1V3QE 3TF5A 3T3OA 2BFEB 2EXXA 2G8LA 1DLIA 2ONKA 3ND5A 4KLRA 4CG3A 4G97A 3WLOA 4YUYA 3FDFA 3C85A 2XDAA 3C5CA 2J3QA 5BSRA 2VJLA 4W9RA 4KXWA 4E51A 3LRXA 2A0YA 3C8MA 2IPMA 1KP3A 1CE8A 1K2VN 3BMXA 1R4ZA 1Y8RA 1ZWKA 4R9RA 5PGMA 1SPBS 3B5EA 1QFSA 4A27A 4EMSA 4CL0A 1QZXA 4ZDWA 1FDRA 4XW2A 3I30X 4MKFA 3R40A 3RJMA 1I94B 4P54A 4TKMA 1QHSA 3GRYA 1ADYA 5JO0A 1V25A 3MJDA 1CZKA 3RU3A 5IK2A 3TR0A 4COKA 3D0OA 2P6UA 2DB3A 3A3PA 4PSCA 1IM2A 3TOXA 3GP8A 1OI2A 1QO9A 3PGKA 3DF7A 3K0HA 4R71A 1O89A 4RANA 5BWCA 3KHSA 4DGSA 4M0PA 4DBLC 3LUHA 3GPCA 3ASYA 3IE0A 2QP9X 4TTAA 5H83A 3WWZA 5LXTB 1G38A 3P0EA 3KT6A 1WVIA 5KTTA 2XGGA 2VDLB 4ZT4A 3FR8A 1FSGA 3KM0A 4Z6KA 3FYUB 1Q14A 2PKRA 1MKYA 1RAEA 1RWQA 3C4QA 5TMDA 1YR9A 2GK4A 1PQPA 4RV5A 1X8LA 2XIQA 3AB8A 3KCNA 2QRHA 3W9UA 4QOFA 3ZDZB 4WZAA 5F2KA 3C16C 1BWRA 3G7UA 3RR2A 2ZT7A 1NKSA 3I6ZA 3QEKA 4QWMA 1L8LA 3OT5A 3QVUA 4MV1A 5FTMA 1DAEA 4HMPA 3LX4A 3LO8A 5AK0A 3U61B 3G1UA 5KU7A 2O20A 4UHBA 2BGTA 5CFOA 1X7XA 3I2FA 2Z2IA 1UJ4A 4OFZA 4KQ1A 4UTZA 4LDAA 5FTKA 1QB8A 4IPTA 2ZSIA 2HQRA 4LZLA 4KHZA 3A31A 1AA9A 1SUEA 3HDQA 1SQFA 4NF2A 4S1PA 5CR9A 2VHJA 3SD7A 3UENA 1FY2A 4NG5A 3V8QA 4CCWA 5JCJD 5IU6A 4NENB 1TPZA 1UMKA 4LGYA 2NUTB 5I5EA 3A27A 1TMYA 4U1RA 5LFAA 1RPZA 1Q1BA 3IDQA 1L7VC 2ALJA 2XNHA 4UQLA 2O06A 5AW9A 5BRJA 3AG5A 4PGGA 4H6XA 3WVNA 2AA3A 2Z04A 4GPBA 4RA9B 3ZOKA 1OFVA 3JQBC 4QM6A 4EFLA 4GM0A 4G89A 1UBOS 2EG5A 4UD2A 3WL6A 1I80A 1OA0A 3OY2A 3SOZA 2BFFA 1XMSA 5DYTA 2FPGA 3ETEA 4IIEA 1MABA 5LP1A 1NXXA 3JWEA 1LZLA 2DBRA 1H2XA 3I3SR 4YHHB 3G8BA 3OX3A 4FFLA 5IVKA 3MS2A 3UAOA 5EWMB 4MVJF 3NUZA 3VA7A 3ILVA 3QOFA 1H4TA 2F17A 4JGBA 3V8RA 4YRAA 4WVLA 4TX1A 4XYBA 1O94A 2IUYA 3WAJA 1KDPA 1L7MA 4LVCA 3R9XA 1G6Q1 2AFIE 2P9ZA 3PA6A 4G37A 3EXHA 1JXQA 1PE0A 3PITA 3TB6A 3LCJA 3WRVA 4PSDA 5CFMA 4TWZA 2G6BA 3LPNA 4O1IA 4S0XA 4EBBA 4KFCA 3VJLA 5B7GA 1C0PA 1OZAA 1X3SA 3O2JA 1MXHA 1JDSA 3U7IA 4HZUA 4CCAA 4F2PA 1AMNA 1QVVA 4DKJA 4BDSA 3K0BA 5CEJA 3CW9A 2ZRPA 4LY9A 2BF4A 1NBMD 2CUNA 2ODEA 2ZRLA 3P2EA 5BN3B 1E3EA 2YCLA 3LTEA 1AUPA 2EL7A 1LWNA 3C7AA 1T8YA 4GW3A 2G1AA 3NIFB 2YMPA 1AUXA 1JT9A 4OMUA 4B6FA 2R1UA 2QPOA 2QU8A 4HMQA 4LNHA 4DV2B 1BX1A 2X4DA 3DKRA 1SKAA 3RUAA 4D8UA 4BKOA 2EKLA 3TSWA 3TGWA 3MTJA 4ARVA 1SMKA 4HWSA 3SP1A 4X41A 1U8XX 4UM7A 4CF7A 1H4VB 4N3AA 3U7FB 5KC8A 4OPMA 1OTYA 4RGBA 1PYOA 2F64A 2OZKA 4JB3A 3T7EA 3JAKB 3THXA 3AI2A 4RKEA 4B6RA 4MQUA 4POOA 4ZAVA 1CS0A 5FTNA 3R7NA 3AJ9A 3T7KA 3KYCA 1BE6A 5KBYA 2H1FA 5HF8A 5I3CA 2VPQA 2HSEA 3K2BA 1HDCA 3HSSA 4YQEA 3QBVA 4AJOA 3HBFA 1W88B 3S40A 4FLMA 4JJAA 3I2KA 2B3TA 3JXEA 5JSZB 3FLMA 1FW6A 3AETB 1N2SA 2YWCA 3E2MA 3MYRA 1B15A 2YMLA 5DISB 4I7EA 5DKFA 4CKEB 1R50A 4YROA 3VZSA 1NRXA 4KAJA 2O2ZA 3T9DA 2OBNA 2O6LA 3A28A 3F6EX 2VCEA 3PUHA 3UHAA 3TKAA 1D4FA 4KMMA 4LY6A 5DJ5A 2B2XA 3IOEA 4F4DA 3ZE6A 3BMOA 5JS2A 2RGWA 5JXJA 3WL5A 3K70B 1DCKA 1B8NA 1E8MA 1KKMA 2GA9A 4YMHA 1UXOA 1NIPA 3MUFA 3WGYA 1FNMA 1K2WA 3ER9A 3MYYA 3VRHA 1DFIA 4EDFA 5EWJB 2DERA 3TEJA 1V6AA 1X74A 2GBPA 3D7MA 3I5UA 3R5HA 3H13A 1KEZA 4MW1A 1SCBA 4GX2A 5CVVA 3PI7A 3SMVA 2B69A 1XNJA 4DBLE 1RTKA 3P0HA 3D54D 2H18A 3MUOA 4P3YA 1ISJA 2WQZA 4NMLA 4UAJA 4B33A 4BUJA 3G5MA 3O91A 5CVTA 1DC5A 2L2QA 3QU2A 1MUUA 1HZZC 1M74A 3AY7A 4FOOA 3IT2A 4O5OA 1SUBA 4ROSA 4BN0A 4CMBA 1JVNA 2WPDD 5C46F 1R8QA 2CDNA 1W8DA 2AJTA 4DUYB 2W2OA 3CU5A 4GMDA 4WI1A 1Z17A 2HWYA 4FINA 2C5SA 2VRCD 3TO5A 3W1WA 1NUQA 4BNIA 1OU4A 4DJDC 4DDVA 2QMQA 1HNZB 1ZO8A 2WT9A 4EY6A 2O1WA 5BVHB 4H4CA 2L0XA 3OJ0A 2JKVA 2A2ZA 4FMCF 5C81A 3GXBA 4BEBA 4BO9A 2EYUA 4GXTA 3PDUA 3TZ6A 2WUFA 4KEAA 1AQLA 2K7ZA 1RXUA 3DL2A 3FG9A 3UXHA 2VF5X 3T3IA 3RADC 1EQUA 4XM1A 4CIDA 1IXKA 5T57A 1Y4UA 5EE0A 3FGNA 3D1LA 3O9ZA 1ESDA 5H9VA 3L7CA 2EFEB 4HLUA 2YX1A 3DE2X 2BN4A 3JVUA 5LDGA 4C0JA 5GIPE 4B3GA 3IPAA 3NKFA 4OG2A 2XWJI 3SJZA 4E03A 2H17A 2ATEA 1DPGA 3PXXA 1VTKA 1WEKA 4I1SA 4IMIB 4NJEA 1TF7A 1A5ZA 3DEAA 1ZN8A 1B6SA 1FTWA 1N3YA 3BGVA 4GBED 1MH1A 2QRVB 1MRSA 3A4YA 1PD0A 3FRJA 3QX7A 4UUMA 5FNVB 1MVOA 2J8ZA 1B7GO 5ICSA 1CJKC 2B4TO 4TSFA 4PIPA 1UKEA 2IC5A 2VDUE 4RIGA 1CG6A 4YP0A 1BXRA 4PGHA 3HRHA 2HREA 3AETA 3IBTA 4KP7A 3VFDA 1MVLA 1GGNA 3KKLA 1ZR2A 2WTEA 4U5XA 4WUVA 3MWYW 2PS3A 1X2BA 3D4BA 4KYVA 4RSMA 3TM4A 4EA7A 5EJEA 3TVYA 1E7QA 4HFRA 3H86A 4WACA 2QVYX 1V48A 3N59A 4LHEA 1ATIA 4FXPA 2WIJA 3A1UA 1PT9A 4MVJH 4QUIA 1J70A 4MYUA 3HY3A 2YL2A 4N5MA 4OJNA 2WVGA 3I04M 1X0XA 4P5EA 5AXCA 2E6UX 5K8UA 4LBZA 2H8KA 4C2BA 3FX2A 1Z8FA 1EX1A 3PF9A 3S2GA 4BVFA 4CR6A 3HHPA 3RC1A 2B0CA 4V1CB 2NO5A 1Z6TA 3C98A 4QRHA 1XHFA 2F2TA 2A9VA 3JD1A 2E4ZA 3UQZA 3WIEA 1NBMA 3PC4A 3T9CA 3BEOA 3IUSA 2YIVX 1QTRA 3LXRA 2R3SA 2XA1A 1U0HC 3EA4A 2VK2A 3N28A 3U7GA 2NNLD 5JMWA 3DDUA 1Z45A 2P65A 5A0VA 1KI6B 2DAPA 1SIOA 3B5JA 3AUUA 3GAFA 1HYHA 4C89A 5J4LA 2XW6A 4TQ9A 4LDRA 1G66A 4DCUA 1UM9A 4H7FA 2HM7A 2QP4A 5JANA 5C8YB 1KJQA 4DQUA 4C7VA 4N0QA 5TF4A 1UDCA 3GLHB 5DT9A 2HFKA 4LCEA 5T8KA 1KMMA 1CDZA 2Q6VA 2QUAA 1GILA 3DVLA 3R7DA 2G0TA 1P29A 3A6JA 4XJVA 4HYQA 3NFYA 5ICMA 5EIBD 3SWWA 4FS8A 3B6MA 3PC6A 5CT8A 3CZCA 2HA4A 3F4LA 3SHTA 1KY2A 3O73A 3RU2A 3U0BA 1X7WB 4AECA 1ISSA 3MWDA 3QFSA 1NR1A 1UPXA 1MFPA 2UZ1B 4J16A 2RDMA 1TFUA 3BH0A 4IO0A 2X7HA 4QUJA 3L7BA 4PAQA 1ZAYA 2V45A 2QGFA 3ZVMA 3OZFA 2WHYA 2DKNA 1T13A 2X0KA 3CGWA 3LQ2A 1FFSA 1TKBA 2CLCX 2J6HA 2DFPA 2PMDA 3Q41A 5ARBA 4YT8A 3N2KA 3WLRA 5ALPA 2C82A 1BU8A 2QJWA 1RWMA 5AHOA 4EHLA 1DBWA 4IJVA 4BO5A 4EI7A 1PYGA 1WLYA 1RXVA 1S89A 2XI4A 1DJPA 1D1QA 2YMQA 3DF9A 4PR3A 4MP6A 2GHTA 2HHAA 1Q0LA 1VL1A 2P40A 1WX1A 1UBLS 2VWHA 4GR5A 4HNAB 3O95A 1P7ZA 1U5CA 4N1AA 1UKCA 1RFGE 3KB6A 3EWNA 3EVGA 4P82A 4ZYZA 1FQKA 2YQ4A 3WSTA 2RG7A 2I1VB 1GSAA 1PNTA 3W3AA 1RYMA 4RM3A 4QGSA 3OETA 3THSA 3KPUA 2XCUA 1YZTA 2JDIA 5FUVA 3L7KA 3ZZNA 4MI6A 1KSHA 3QUSA 1XF9A 5IKPA 4A73A 5IX8A 2CHUA 1U1DA 2R7KA 1FNSA 4BNMA 3TAXA 4JP3A 5JAQA 4LZNA 1FX1A 1Q12A 3GO4A 3H9BA 1RYBA 1SNYA 1C1DB 3ORRA 1CETA 2FWPA 3AI7A 5DTQA 3TTTA 4MB2A 4NZMA 3LRTA 4OL0A 5HOEA 4IOKA 2X5KO 5FBZA 4MKXA 3PEYA 3TFQA 4QUEA 1X8XA 5EIEA 1OOEA 4NHOA 2ECPA 2QI9C 2ZJ6A 3WB2A 2Q6KA 2RBKA 5KEIA 4RK4A 1PGNA 3OQOA 2OV4A 2GBLA 5F78A 4BNZA 4YMVA 3PNVA 3FSGA 3E9MA 2OKCA 4E5NA 1QGUB 2R4TA 2V55B 1JECA 3ITNA 2J3EA 2QQGA 4QG3A 4QDTA 5HHTA 5JS7A 2V3CC 4KN9S 1V6SA 2FWMX 2XD9A 1RWWA 1XZIA 1P2SA 3L0ZA 1A76A 1R74A 2PS1A 3MRXA 4KTTE 3DVSX 1U5BB 2FSSA 1DINA 1T9BA 5AVWA 2K7FA 2C88A 2ZG6A 1XTJA 1HSOA 1G8GA 2WIKA 3STWA 1LJ8A 4R3WA 2UKDA 4R6WA 3DEJA 4Q1AA 4ZOCA 5KVCA 1EK6A 2AMVA 3D3KA 4AQ7A 4OHFA 5JJ5A 2PFSA 4MQBA 1X9HA 1RM0A 5B1SA 5DO9A 4LYHA 5B4VA 4EY8A 4DMMA 5CW2A 1PD1A 4HDRB 4RGQA 1UC4B 2V6FA 3VAAA 5AVZA 1GNQA 1G8FA 4GE3A 4R2LA 3OM1A 3TOCA 5MN4A 2BHSA 2RJNA 4PXYA 4UFNA 2H1SA 3DAYA 3QFHA 4CQMB 2C7PA 3UOAB 1KKLA 2QQEA 1AKMA 3FOZA 3K8ZA 4IICA 2NZ2A 4LYJA 1TYAE 2HIGA 1DB3A 2ZSUA 1VKOA 3TNDA 3C15C 3HA3A 3TQOA 1CY1A 3I83A 3SYLA 4KRFA 3PNBA 1QH8A 1M2NA 3W8FA 2WM3A 2XE7A 1FFCA 1MO2A 3BM5A 1DJOA 5AM5A 1T2AA 2Q2QA 3LPDA 4CDMA 4YAGA 4P4TA 2I7DA 3H99A 3NJ4A 1U9JA 5FNVF 1QYWA 3FNEA 4Q16A 5EZYA 5LZ4A 1TAGA 3I58A 4NBWA 2TS1A 3S8EA 3V4PB 4F1KA 2YJ4A 4X1OA 5GQSA 4NH0A 4EO9A 4AUEA 4FMPA 3COSA 4KGZA 1A5SB 2B4RO 1BN7A 2W6QA 4RMNA 1XQVA 4BFSA 1LBIA 2FW8A 3RTDA 4DS3A 1R9NA 1UL1X 2ERCA 2JAHA 1ZSNA 4FHEA 1J1ZA 1V5WA 5JS1A 4AP6A 2FQ1A 4HFNA 3GDOA 1NP7A 1E96A 4ZAGA 3IHKA 4OGFA 4I1YA 5FUXA 1H8ED 3BH7A 3KEFA 2J3JA 2E5FA 3Q3VA 2PL9A 2NU8B 1O6GA 1A9YA 1L5YA 3IXMA 1BE1A 2A3NA 3IVMA 4F3YA 3MQ2A 3TZKA 1AH2A 3H8SA 1ENOA 4KO2S 2VDOB 2X42A 2ZROA 1MU0A 1X1QA 3ET5A 4G5HA 4IJMA 3AEUA 5ECDA 3RS4A 1SCJA 3GLQA 4KPGA 4LVNA 2W7TA 3EDYA 4EJSA 3VC2A 4BGIA 3DAOA 1KHTA 4MGIR 1Q3KA 1RPAA 2QRLA 4FIDA 4KB5A 4OVKA 4EGQA 3FMPB 4IW3B 1M6HA 4L27A 2ETXA 4RKFA 3VX4A 5JYBA 5LZ5A 2VP3A 2IIBA 4QICA 3TLMA 4DBVO 4OB6A 2II6A 4JEUA 4INJA 1VYHA 1P75A 1GTZA 3QXCA 3VUEA 4TS1A 1JIIA 3DOOA 3NOVA 3TLBA 2QWXA 1V1RA 3PLNA 2H07A 4D26A 4L6CA 3H4TA 2QQFA 1PHPA 1QYXA 1Q21A 4A7PA 1J2EA 5F2EA 2Q3CA 2OSVA 4MXDA 1ZEMA 3CR3C 4GL2A 1WUKS 4G24A 1U80A 3O93A 4IKEA 1TT5B 2B82A 3EMDA 3K9FC 3GJSA 3C7TA 2JGAA 1Z8NA 3HABA 4EHHA 4AN4A 4RHYA 2F9MA 2CVZA 3ZJTA 2GBIA 2WM9B 3M6VA 2IHYA 2EW2A 2QM8A 3IIJA 3PTAA 3BWYA 2E87A 1B8PA 1RLMA 3SIXA 3PNSA 2C7GA 1M8GA 1DARA 1IUKA 4KIJA 1GGMA 2FRDC 2GYVA 2FGJA 4B46A 2AKYA 3QKSB 1F1JA 1U0RA 3FN4A 3O4JA 3PVZA 5E1MA 1F0KA 3RB8A 2Z8XA 3ZE8A 4ZGWA 5ISMA 1OFUA 3D6VA 4KLNA 2XPCA 3W8EA 2PEZA 1I32A 1PFVA 2OHFA 4EH1A 2PX8A 2V74B 3DSRA 4ZVSA 1E4OA 1BH6A 3GEEA 5JCPA 4OUDB 1LPOA 4P4UA 1RLIA 5K03A 2FSGA 4OYLA 5LDHA 5KIAA 2V6JA 3O7MA 3RBZA 5HBGA 1K8ZB 1L8AA 3PQDA 2B4KA 1O57A 4Q3KA 1IATA 3AT1A 3RVMA 3H5NA 3E18A 5EJ7A 3ABQB 2AV6A 3L82B 2PBZA 3PHJA 3N8GA 1SVOA 5FPTA 4GHWA 3J81A 4Q3CA 1II0A 2PIDA 5HQJA 4D42A 5KYWA 2F43A 3GUVA 4BBZA 4PLVA 5DN6D 4FCWA 2GM3A 4HDRA 2R7AA 4RHXA 3CEJA 4ENRA 4TUYF 1Q1QA 1XVIA 1DJQA 1SC1A 2EBFX 4HY3A 4J75A 4BEJA 3C74A 2IOYA 4PBTA 4OHPA 2VRCA 3LZCA 3Q3EA 1O9BA 1F7UA 3IJPA 4WSOA 1MJGM 3FUWA 1NMEA 4LF5B 1DBSA 2BWJA 2WJYA 3OE7D 1FIUA 2HJHA 2WWRA 2D2FA 5FHQA 1GPMA 4RDCA 1GPBA 3WBBA 4CT5A 4AC9A 5AW7A 4LF4B 1ZJ6A 2BISA 2WSSD 3FDJA 4X6LA 1HT0A 1XWFA 3OEEA 4GICA 1V16A 2FRVA 4UD6A 2CLIB 3H5OA 1BE0A 2ASEA 2VDKB 3UK6A 1QQ5A 3ELYA 3P0JA 1ECCA 1VFPA 4PC3A 1PZXA 1Y98A 5K0JA 2NYRA 3W5AA 3B7WA 2FPLA 3VXKA 4DCJA 1YS7A 5KTPA 3N5CA 1CDOA 2D00A 4RXTA 3FNFA 3IQZA 4OH7A 3DBIA 4X44A 5FBHA 2DUMA 4ALNA 5HZHA 2V65A 3RVKA 1ICEA 2FVXA 2QT1A 3H7AA 1L6RA 3D7SA 3Q6NA 4JT4A 2XZDA 4AICA 3ECCA 4EIWA 3FTQA 1AKEA 4M0UA 2GZSA 2JHGA 4B45A 5JDCC 2GO1A 2WKWA 1SVLA 1VE3A 2AXPA 2JFVA 3JYQA 4OMFG 3S2SA 3WZLA 1TYBE 2G76A 3DVRX 2DQSA 2XUOA 1VHQA 3M5WA 5AVTA 2R84A 4LE1A 3P2OA 3BFJA 4RIEA 3ENNA 4HGZA 5JYEA 4D25A 1ZD8A 1B74A 4G4JA 1H2HA 2GFQA 3I1IA 4MQ5A 5ALMA 3UMMA 1PEDA 2VWQA 3ZH9B 1M1ZA 3MMZA 3UGJA 3CV3A 3T3HA 3SU8A 1EFRD 2NAFA 5A5VA 5AVUA 1QNLA 2ZTMA 5E6UA 1ZM3A 5A3SA 4TGLA 2GM4A 2TMDA 3RDPA 3AQIA 3JRXA 2CHFA 4W5QA 2GOYA 5TPZA 4URYR 5HE9A 2IDKA 4HNAA 4QPZA 2WWVD 1I1NA 3BCUA 1BYUA 2P6RA 5C3UA 2IQ5A 1YZUA 1DV2A 4V3BA 1QTNA 2PJZA 3L7OA 1SQ0A 2WZBA 1NM5C 3DZ8A 1GCIA 1V9LA 2HF7A 4MV8A 2F9FA 4XUDA 1F2TB 2NADA 4NSNA 3JQ7A 4RE6A 1QAMA 1D2MA 1ZD9A 1Q95A 2D1FA 4HQNA 4YAWA 3T38A 3ZVLA 1E32A 4GQIA 3GDHA 2HMUA 3A4TA 2EIHA 3PUYA 3PHCA 3TLAA 1Z2AA 1ISPA 2WU8A 2BEKA 3KWFA 1UJCA 1JA1A 3PDIB 1P2VA 4OF4A 4UPDA 1RP7A 4J7UA 3VO2A 1T1SA 4MDFA 5EKSA 3HCEA 1V3TA 5FWXB 2IZ7A 2ZQZA 1SHUX 3ND8A 4OU5A 4BHTA 4C6SA 1XWIA 3LFHA 4RNCA 2LKDA 1X92A 2G28A 5TRTA 4EYEA 4H35A 3WMFA 1VXOA 1HOTA 2H4ZA 2UVPB 1A3CA 3DKPA 3CEAA 1T1JA 4IRUB 5ALYA 4NDAA 4R0MA 2PUFA 1HT2E 1N5MA 4LBYA 4YMWA 4XAQA 3ROTA 2WJJA 2YKGA 3UJ8A 4LWPA 1EDZA 4I14A 1MORA 3OOEA 3DBOB 1FVFA 4O4JF 4KL8S 4M38A 4ALMA 3KZCA 3MGKA 1LQTA 1U0GA 2Y4OA 1JQEA 3M34A 4M9RA 4OSPA 3P52A 3TRDA 3SR0A 5JSHA 4TOIA 2PL1A 1TAUA 1P45A 3E3OA 3KBOA 3U44B 1IQPA 2IZ1A 6ABPA 3CMMA 4JEHA 4UDXX 4ZK2A 3LT2A 2Q1YA 3KR0A 4XJSA 4YXWD 3RSOA 1I6KA 1Z7GA 2FWAA 2QTRA 2VNHA 1KP9A 1IJKA 3I45A 3LWBA 3IXLA 5TVGA 3TTVA 2DTXA 3OSUA 3ZX4A 4ENPA 5JROA 3UJCA 3KSAC 4GBMA 1N7IA 4IGEA 4MZDA 5EQTA 3QMVA 5JVDB 1PEAA 4DCSA 4RCYA 4WIAA 1ZK2A 1X6VA 1ZRNA 1WXGA 2DUJA 1VECA 2DFLA 2Q2NA 4OQXA 1EQAA 1W94A 4YYEA 3KB1A 2CLDX 3P9KA 4O2AF 1WCIB 1N5RA 1SVIA 3IEUA 3ANLA 2PY6A 4M3NA 4L57A 3LNCA 1U2DC 5I48A 4MQFB 1NLUA 4U2KA 1RPNA 3WA6A 2QMZA 3PNOA 4KBFA 5JH7F 3QXXA 3SVZA 4DMCA 2ZP1A 5I4BA 3CT4A 5JNSA 1HYBA 4L95C 1NM5A 3HR4A 4MQEB 4ARBA 5JSUA 3O8DA 4A0FA 4RVUA 5AW5A 1SG0A 3L77A 1MAHA 2WWHA 3AKYA 1UJMA 5EQFA 1L7PA 3HYLA 4UU8A 4R1OA 1KY5A 2JIQA 2QRVA 2BFFB 4HEQA 2AUNA 2UZ0A 4WBNB 3HCCA 1CQIA 1UBNA 1W4BA 1M1YA 2H00A 1Z06A 2WJ3A 3PJEA 4AZSA 1DRJA 1GARA 2BHLA 4NOMA 1VPTA 5EJGA 1BWQA 4B4VA 4OHYA 4V02A 3TGPA 2D1QA 1KMIY 4OAPA 3QI2A 4AAYA 3H2JA 1YMUA 2IYFA 4R2HA 3F97A 4X90A 3I0ZA 2A78A 2H5JA 2HOQA 3KJIA 2B9EA 4FPXA 2AC4A 2J48A 1NVVR 1ZZGA 5DM60 1JHYA 2O2IA 3U39A 4A10A 4BNLA 4TTTS 1R0KA 1OX4B 2CLMB 3HP7A 4HLQB 4NV1A 4DMGA 5K7SA 5KNCD 4KE7A 2FQXA 3G68A 5JNVA 1CXZA 2W6MA 3NWJA 4NV3A 4MMZB 4HLDA 4I9FA 4NNPA 3FWYA 2Q41A 3EGDA 4ND1A 3HB7A 2JIZA 2QMUA 4Q21A 3U3DA 3QUQA 4TV8F 3AWDA 3OD1A 3U3MA 1CY2A 4AN0A 4DQKA 4TM8A 3PEUA 1UXIA 1ZGAA 4O59O 1LC0A 3INRA 4J2OA 5HQTA 4E5KA 1IIBA 3S1AA 1XWWA 3SZMA 3HXQA 4QOGA 4CNBA 3ST7A 1L5RA 3BQ9A 4U2DA 3ZXIA 5KNCH 3TQFA 5TLSA 2R68A 4C4SA 1K7CA 3WFIA 1Y7LA 4RCZA 1I4LD 3LMKA 4ZT6A 3RVJA 3TZEA 4S1TA 3CNLA 3V1TC 4V0MA 4IMPA 3M4NA 2Q49A 3SZRA 5HSGA 1NJGA 1X1EA 5CB4A 4J29A 3TVDA 1KQNA 4JVOA 1TA4A 1XZJA 3K0CA 4PG6A 3V6LA 1EE1A 4UTVA 4LJ7A 4BOYA 1Y6RA 1ZGCA 3KE8A 4CM7A 4NC9A 4KVZA 2HHJA 1XNGA 5KO2A 3Q5EA 3VSAA 3ZQ6A 5AW8A 1PUXA 2XUJA 2YASA 4TLAA 4TLMB 3SR3A 3B3JA 1ZMTA 2BFAA 5E4TA 3C1AA 3Q11A 1ETHA 1QG6A 1SZPA 1WBBA 4RVGA 5LYYA 4L72A 2RKOA 3VKHA 2PSJA 5K0CA 5IPFA 3TRFA 4BX8A 5TC4A 3OI7A 4KLCA 2PEYA 1I7NA 2DZDA 3NETA 3GROA 3OX4A 4QG7A 3FY4A 3NH6A 1NOIA 3IUPA 1M34B 1NI4A 3B7GA 1EHYA 3CUSA 1ILWA 5B58T 4CDGA 3FMOB 5BSVA 4DAOA 1M10A 1ORRA 2QTNA 3SQOA 4GOXA 3LHDA 4MO2A 4WCFC 4A92A 2DFVA 3MINA 3W6OA 4L7VA 3UXYA 1BQ4A 1VE7A 4ZVTA 5HF6A 4ZVVA 2QYOA 2FZKA 2R4UA 3RUFA 3EUAA 4BQFA 4KUGA 3OZSA 3C3EA 3A06A 3DR5A 2J9XB 4F92B 2VAWA 3CPSA 3GVXA 4JVLA 1ILEA 3RUPA 2EFJA 4P6VF 1NVKA 4G0XA 1EDDA 1BS9A 3C5WP 4H7DA 521PA 1B6RA 1XEFA 3SHOA 3FD8A 5H7XA 1E9EA 3V4OA 2P9CA 2P3OA 4TYPA 4M0DA 5KOYA 1EXVA 2JLRA 1QV7A 1YL6A 4QC2A 1BMQA 5IAAA 1BDJA 1BMFA 4YRNA 4C2TA 1AF4A 4OL9A 2NZUG 1MGOA 1T3SA 4XFDA 2XRZA 3N1UA 4J0CA 1G8AA 2GEJA 1Z4KA 5G3ZA 1G2OA 4BMDA 1OAKA 3GLIB 3NHZA 4FBGA 3RAFC 5CEEA 2LBPA 4H7IA 4QU8A 5A4IS 5HXAA 5F7JA 4N18A 3WYFA 2C8LA 5KNLA 4URXR 2R6GA 3KFXA 3MMPA 4HGRA 5E7IA 3H5RA 3EMBA 3ZCVA 1SEPA 4YRRA 3A1TA 4HWGA 4ZCTA 4HNGA 1YS9A 3KQOA 4JP1A 4HAWA 3AB7A 1GRQA 1L5ZA 3FDZA 4X92A 1X70A 3CA8A 3M3HA 1ZWLA 5DIFA 1U6IA 4AJJA 4B9EA 2W2LA 3P9SA 1LSSA 2OFXA 2P4EA 2PS9A 4XFKA 4CTJA 3NXKA 2WHEA 5EYPA 2GPYA 5EWLA 3QF7A 1GZDA 2NLOA 2FAXA 4BQRA 1XMPA 2O8CB 4ZICA 4P80A 2H5EA 3SQWA 1LNSA 5ALTA 1TW3A 3F90A 5DXJA 3H87A 2B98A 3OO0A 1V8BA 4O2BA 4IIBA 2VLBA 5ALEA 2QW8A 1M6YA 4CCYB 3B9PA 2G77B 4R1PA 2A94A 2R62A 3TBFA 4B4OA 5CCDA 4U9IS 2FEOA 5DHQA 5BR1A 2CFSA 3HL0A 4IIJB 5TQ0A 2O5CA 2F4NA 1QQTA 5EIAA 3LCMA 1WOYA 3M9WA 3QY9A 4TUYB 3W6ZA 2PUEA 3ILHA 3D7RA 1WUTA 3TNYA 3TW0A 3RK1A 4NYMR 3STHA 3WLEA 3GLFE 3GBVA 2ZI9A 1ND5A 1DWPA 1E6LA 3V1LA 1MPXA 3C2QA 4HQ6A 2PH3A 3LKDA 2YFKA 3T3GA 3X3HA 1JX6A 2G9RA 1KQOA 2X9LA 3FWPA 4GEKA 4WLVA 1Q1EA 1RJGA 2AK2A 3LYHA 5KQRA 2FR8C 2PWBA 2BEVB 3HSKA 3WDLA 3T06B 3L1VA 1SD2A 3SC4A 2AR7A 4HAVA 3UHFA 3R3YA 4RU1A 1CUBA 5FCDA 4ALLA 3MGGA 4N8DA 2XADA 5DHUA 1YACA 3LLCA 4X9XA 2BHNA 2I78A 4ZOQI 2CV0A 4L16A 3MM4A 1XRQA 5ADUS 4K6OA 1PR5A 5A3JA 4WQMA 4MJXA 4KNYA 1T5LA 3ZGYA 2NO1A 2NPOA 1KAGA 4WJKB 4AY4A 1AV6A 5HFJA 2C4NA 3IQFA 2WIAA 4P34A 4MWGA 5E2IA 5C8YA 2JBWA 3SEAA 821PA 3N53A 2VTBB 2IUEA 2ZFUA 2BDTA 2C2XA 2BGNA 2OV3A 2HD4A 1G5PA 2AZ4A 2QTVA 3GJQA 3JRWA 2YN0A 1TM1E 3ZGZA 5JTUA 1TU4A 2XB9A 1HG0A 1NBOA 1Z25A 1AZLA 4FDVA 4F2GA 2CWWA 2V97A 3DT6A 1T36A 1DO8A 4G26A 2IW3A 4YS6A 1LRJA 4DREA 3ICEA 2YMMA 1Z3CA 5KWSA 1E5DA 2C96A 2VQEB 1GPDG 2WVAA 1TF2A 3VC3A 2AFRA 3OAAA 3D9QX 3I9NA 2QZZA 3PT5A 4AI6A 1SQ6A 2JBAA 1K5DA 3GCWA 4RPJA 3SIWA 1KJ9A 1UFKA 2ZRBA 3NOOA 4TXMA 4RK6A 2QHXA 3RSQA 3I9FA 3CNNA 4LVUA 2ZE5A 4KU4A 3KYIB 3DQQA 3K7EA 1B1CA 3D3NA 2FG5A 1JR4A 3E2PA 3LC2O 7AT1A 2B4YA 2E89A 4WZ6A 2C29D 3AHHA 1YI1A 5C8VA 2YXEA 4G5YA 3GVCA 1LI7A 5TQ0B 2ET6A 4FK8A 1YBHA 3QELA 4DXAA 2QPLA 3QXSA 4GNRA 5EIOA 5CFZA 1XXHA 3R3XA 1TJ3A 1JIJA 1UFRA 2X1VA 1PGOA 2X8BA 4MV7A 5NULA 3L6OO 1M2FA 5AKHA 4OQZA 3FOFC 2QT0A 3O0DA 5DSXA 1JN0A 3RYIB 3VMFA 4ZN6A 1W5BA 3KKMA 2W70A 1EUDA 4R01A 4RF3A 2VHWA 4C0BA 1BMFD 3TNJA 4XWOA 4I1PA 4FR2A 1GNLA 2QD1A 3DC2A 1T43A 3FETA 2ABWA 5EYPB 3ZNQA 2UYQA 1J8FA 4RJIA 5IJWA 4C5AA 3D0QA 5IC4A 3QHAA 2FW1A 2GJKA 2VYND 2ZAGA 5TT0A 1I9CA 2Z2XA 1XAIA 3AR7A 5BSWA 1Y9EA 1W0JD 3DBRB 2GPJA 4LV8B 4UU0A 3IDAA 5FBQB 3ZXSA 3ELBA 4KDCA 1IXSB 4WOCA 1ORTA 3F3MA 3A6ZA 1TW2A 4KFSA 5FLKA 3R0QA 2EQ5A 3TLJA 2ZCVA 3QLTA 5BR7A 3MGAA 3ND9A 4M53A 4TTPA 3VVLA 5KS2A 3M5DA 4HXGA 1I4WA 5IH3A 4MUNA 5HFNA 4XASA 1EBFA 4RSHA 1W6RA 4DA6A 5JNTA 1EP2B 1G20E 1MIOA 2NUAA 2LE0A 3DFUA 2GAFA 3FAZA 4IHJF 4MI9A 4WHMA 1IHYA 2ZT5A 5B1HA 5J59A 3OFSA 1VSVA 3WLPA 1DAMA 3GVHA 4X7BA 5TVKA 1C3LA 4ZJPA 2TMKA 2J5RA 4HH1A 1W0KA 3HU2A 3ER8A 3ENZA 1ZCJA 3LC0A 4LRSB 1A98A 3R5KA 3WLJA 3I28A 2XMPA 3E3AA 5DX1A 2QYSA 3NKVA 2GF9A 3ZBPA 2NXCA 3TFOA 3WYD<