4EPXA

Discovery of small molecules that bind to k-ras and inhibit sos-mediated activation
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
170
structure length
170
Chain Sequence
GMTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GTPase KRas
publication title Discovery of Small Molecules that Bind to K-Ras and Inhibit Sos-Mediated Activation.
pubmed doi rcsb
source organism Homo sapiens
total genus 63
structure length 170
sequence length 170
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4epxA00
2GCPA 2RH5A 2BCGY 4A15A 4HATA 1IOZA 4GOXA 2FSIA 1KO7A 1G1MA 4BFVA 2DFTA 4OQLA 1P9NA 3ZZ0A 4AYWA 5JRJA 3CZPA 4D0LB 2HYIC 1ZD1A 2YC4C 4US0R 1Z63A 3OIVA 4F92B 5BW8A 2ZE6A 3OESA 1A5TA 1ZCAA 1A7JA 1E2JA 2GEVA 3QE0A 4MKGA 1JECA 2ONJA 4YMSA 1CJVC 1G18A 1OPXA 1A2BA 2GXQA 2OT3B 3DPUA 3RWOA 5TDHA 4Z54A 1S4QA 3QUSA 4QXAA 4GPTA 3WMEA 2ZI3A 1IN7A 1YRBA 2KWIA 4Q21A 1F6BA 3RDPA 4AG6A 2CMKA 5K8LA 1SXJA 2GWHA 4V02A 3WBJA 1UKEA 1UBGA 521PA 4F38A 1IY2A 2QP4A 1HUQA 3MMPA 3L8ZA 5FPKA 1DOAA 1VYVA 4G1UC 5EJEA 1XXHE 3SNHA 4EPWA 4P4SA 4EPYA 4PPNA 3B6EA 2BM1A 2CK3A 2G3YA 1XTRA 4LYHA 2OFOA 5LDDC 3N2IA 4LJ8A 1NSTA 5FBWB 1NJGA 2AFHE 2C8VA 2JEOA 2P6NA 1JXOA 3WXMA 4Q1BA 5FBRB 2FG5A 2RGBA 4Q7KA 1VYUA 4B3XA 1NLZA 2ZRIA 3NHBA 4HAVA 4PSAA 1YZGA 3QEJA 2BM0A 3TNFA 5AUQA 1U0HC 1YZTA 2JIZD 3EC2A 3FKQA 2Z43A 4AKEA 4GP6A 4LOAA 2XB4A 1A1VA 2FPLA 4GOJA 2YOGA 2C96A 3AF0A 1J2JA 3B9PA 3TAHA 2QN6A 5KSYA 2V9PA 4IFBA 1P6XA 1W5SA 3CR7A 3IO3A 3QXCA 4O2RA 1CR4A 1Z07A 4FWTA 4TL9A 4E22A 4XD7D 5TY0A 1PV4A 5FUWA 4CEHA 4IEIA 2PCJA 4FMDF 4OK6A 2F7SA 2XNDA 2D2FA 2IYUA 3MWJA 1NMZA 4OI1A 4BLTA 1TUIA 1ELOA 4XH9B 2ZAMA 1VG9B 5J4VA 4B35A 3BJIC 1NMYA 2R44A 2O0KA 4UXIA 2HCJB 4NHOA 3L0OA 3OIWA 3RRYA 3HJNA 2ZYVX 2CXXA 3B1YA 4ZI3A 1OV4A 4LHWA 2FMXA 3CO5A 4WXRA 2OCPA 2PT7A 2QPTA 4M9ZA 1KMQA 2OCBA 2BBSA 2O52A 1NP6A 3HPRA 4IEEA 1W5TA 4OHWA 3P4XA 2ZRAA 2RGAA 1SXJD 4H1UA 2EYUA 3CF2A 3R8FA 3BGWA 1GL6A 1N0VC 3I32A 4MRNA 2GHIA 1W49A 4DLTA 1OXVA 2VP6A 4HEJA 4GNKA 1HT1E 1N6HA 1F2UB 4DCNA 2PX3A 4TTRA 3AGPA 2CK3D 1E79D 1GKUB 3WY9A 2H8KA 4DKXA 5F2EA 2A5FA 2J5XA 1G8YA 1ZNWA 2GZHA 2WIAA 5TV2A 1OFHA 1G21E 2IS4A 3VKHA 2V1XA 3GJ8A 1VKJA 1Q21A 3CX8A 4OHZA 5DYGA 4LV8B 2I4IA 3QSYA 1A4RA 3TJZA 4TMWA 3V00A 2Q3FA 1TAGA 4Q4HA 1K5DA 2OG2A 4OHVA 2CLSA 3GEEA 3IHWA 2G6BA 3LY5A 1S0UA 1KO4A 5CJPA 2F1JA 2WMOB 3KTAB 2C03A 2NZ8A 5BN4A 3PJRA 1PUJA 1RRFA 3RS4A 2GETA 1N6IA 1VECA 1XCGB 2RAPA 3IKJA 4JBWA 4QNMA 4YQFA 3KZ1E 3ZQJA 2FH5B 1KI7A 1P2TA 1UM8A 4QHYA 1OH5A 1MO5A 1KTVA 1KI2A 3I8SA 3L8YA 4GZLA 3Q5DA 1T5IA 3NC1C 2J0QA 2GEUA 2BKUA 3FMOB 5JMTA 1R5BA 3U7GA 3KFVA 621PA 3U3JA 4YMVA 5HPYB 2IK8A 5L3RA 1U0JA 2W58A 2GNOA 2P65A 3GCGA 3QXXA 1OIXA 1XD8A 3AF3A 3U2QA 4MGIR 4EFMA 4EPVA 2H57A 4G5SA 3FTQA 3NH9A 1W4RA 1WQ1R 2F43A 1QG4A 2VP9A 3CZQA 3QG1A 4IDQA 5EE0A 1VYTA 1KDPA 3ASYA 1KK1A 4B43A 1E2KA 4AWXA 1KO5A 1E9AA 4II7A 4EIWA 2PJRA 3D31A 4ZCLA 4UNPA 2MSEB 2V8OA 5DI9A 3MWLA 4OQNA 4OQMA 2EFHB 4PC3A 3VX4A 1K5GA 1NN1A 2WJIA 5HZKA 4KYUA 3BRWD 1D2EA 4OK3A 4JYCA 3L82B 1Q3TA 3CRVA 3PEWA 4QBHA 1NSFA 3X2SA 4DWJA 2GK7A 4EJSA 4JT2A 4RZ3A 3KJEA 4NPHA 4KFSA 4NYMR 3VR5A 5JI3E 4IOKA 3K09C 3W34A 1SGWA 4CIDA 1CIPA 2AK2A 3QIAA 2WZQA 3TVTA 2VTKA 2XSZA 2ZI5A 3FMPB 1ZNZA 1JB1A 1E2NA 2JASA 5GJVC 2HDNB 3A1TA 4N1AA 2BBOA 2NO7A 1GRQA 4B71A 2I1QA 1GSIA 1X3SA 1HTWA 1UKYA 2FPKA 1SHKA 3GLFE 5DHFA 2FFAA 3ETLA 3B8HA 3P20A 2GF0A 3GFTA 4MYHA 3VAAA 3AVXA 3VKGA 4OHYA 4FMCF 5JJIA 1WF3A 2FOLA 2UZIR 2DFKB 1RRCA 4LHYA 4M9SA 4PAMA 4PPQA 5FL7A 4D4MA 1Q44A 3MWYW 4BFTA 2JAQA 1E2PA 4LYFA 4R9UC 1E9BA 2QMUA 3BB4A 1OB2A 3CH4B 3RS3A 2XGJA 3UWOA 1KSFX 2LKCA 1G7SA 3HU2A 4URVR 1JI0A 4ILEA 3W6OA 1OXXK 5J4HA 1OIWA 2H5EA 1KSHA 2WM9B 1ZC4A 3NDBB 4IXMA 1RC8A 2AR7A 2E9SA 1VDZA 1FW6A 2R62A 4DLWA 3RSLA 1Z2CA 4C0KA 1JJ7A 1UADA 5FTJA 3T5DA 2XTZA 4C2TA 1H65A 4NCJA 2E1RA 2HYDA 3I61A 1QG2A 2CL6X 5KYKA 4RD2A 2FV8A 1P62B 2GCOB 4LK2A 2ZSBA 3TUJC 3GLGE 1XJ0A 3LQRA 3DOFA 2AN9A 4IFEA 3ZLJA 4TYPA 1KDOA 4C2UA 1Q12A 3RS5A 5JCPA 1TTTA 3TVDA 3QOFA 5K8UA 1F2TA 1FX0A 1MABA 5CIQA 1KGDA 2NOAA 1UJ2A 1P4SA 1CLUA 3A37A 4A0HA 4C0AC 4M1OA 4BQSA 4V0ME 1P2VA 1JEEA 4RFSB 4XJXA 2C9CA 5FH9A 1X8LA 1W4CA 1HE1C 2D74A 1OE0A 1OT3A 4MRVA 4ZV4A 4V0NA 1O87A 3LV8A 1P61B 4C0LA 4DBLC 1BYUA 1E6CA 3K0AB 4ZDKA 4KSBA 1RJ9A 2HJGA 4I1SA 4IDNA 4JSYA 2GJ9A 1G3IA 3W3ZB 1TMKA 2G0TA 3A4LA 1TUEA 3O8DA 2BCJQ 5L3QB 2IEZA 4RZ2A 1KI3A 1L8QA 1E99A 3H4MA 2KB0A 4JBYA 2QMHA 5FL7D 3FPAA 4DB4A 4A82A 2O8CA 3OHMA 2WPDA 5G40A 4OI4A 4A6PA 2X77A 2HXYA 4MDFA 3CBQA 2XITA 1P3JA 2FEMA 3ONWA 2XB2A 1Z6YA 2GVZC 5FPSA 2ZRPA 4D4JA 2A30A 1JAIA 3T35A 3NBZC 1LNZA 2ZJ5A 3BIFA 3EZ6A 3K09A 3QKSB 1IN4A 4V03A 1Z8FA 4E07A 3MJHA 3HYRA 3B5JA 5K8TA 3K0FB 4A8JB 4F4IA 1L2TA 4W5WA 4CEIA 4G01B 1XB2A 3TUIC 1KDTA 4PO8A 421PA 3UPUA 5LB4A 1MR3F 2P67A 3RNLA 3AVWA 4XSHA 2I1VB 1PLJA 3WYGA 5FOVA 4M2LA 1MOZA 2MMGA 2Q9BA 3CRRA 2SHKA 3TW4A 2R6GA 3AKDA 3DM9B 1XMJA 4KI0A 3AVTA 2ONKA 4D6PA 3EZ7A 3PXGA 1WRBA 1XEFA 3E1SA 1W0JD 1D8TA 4CF7A 3DHWC 4FMBB 2JJ8A 3B9QA 4K46A 4KODA 4GL2A 2IS6A 3TKLA 2YWFA 3GLHB 1E1QA 1U9IC 1LS6A 4WIAA 4URWR 2C9YA 1US8B 3K70D 4FWIB 1ZUNB 3UMRA 4ZIRA 4AYXA 3TSOA 1GAJA 2J0VA 2Z0MA 1Q22A 1DAEA 2NGRA 2DWPA 3ADKA 4TL7A 2AL7A 1RE0A 3TSWA 3DEFA 1IAQA 5KSPA 4FCVA 4OHXA 2FEOA 1VIYA 2PCLA 1FMLA 5IDVA 2AD1A 2WPDD 2CCGA 4DJTA 1IY0A 1AKYA 3NXSA 4HLDA 3BBPA 3REGA 3UANA 4XVQA 3FE2A 3THOA 1PZNA 3IIJA 4NYIR 3DVLA 1NVVR 2ZJ2A 5IT5A 1YRAA 5GVRA 3A1SA 3B1ZA 2QSYA 2JLWA 5FPHA 2VRWA 2WMNB 4TLAA 3VNUA 2CCJA 3W5IA 1EESA 4Q1EA 1P72A 5CM9C 3QEOA 3P32A 2OCYC 3CPEA 3D3QA 2WHXA 3BFXA 2ZJ8A 4L15A 3QF7A 3W90A 2QEQA 1ZM9A 4B44A 5KTYA 4CEJB 4DRZA 2IYZA 3DZ8A 2KI5A 3SU8A 2J7PA 2RGGA 4M1WA 1RRGA 3BC1A 5E7MA 4TL8A 1KYIA 1R0YA 2GZAA 4RZXA 1ZCBA 4B32A 2BEKA 1NL3A 2HUPA 1CR0A 5AJVB 4HAZA 3VMFA 2QORA 3REFA 3N2EA 1R0ZA 4L9WA 2ANBA 1BO6A 4PC6A 5C4MA 3CUEF 1B23P 4IRUB 3VFDA 4Z8XA 1F2UA 4Q19A 3CIOA 3DKPA 1FPMA 2ZJZA 1E1QD 1NIPA 1JR3A 1W1WA 5B64A 3THWB 3WP1B 2FE4A 4Q48A 3R7WB 1CRQA 1G8PA 1UF9A 2GXSA 4GRAA 1XTKA 4HSEA 5BN5A 1A2KC 3QXJA 4DUGA 4GFDA 3AKCA 4I1VA 4B3DA 2QTHA 3Q9LA 5DISB 1S9HA 5JEEA 5JHHB 3SN6A 2IYRA 1M2OB 4MRSA 4BGDA 3HR8A 4ACBA 2F3TA 2FFHA 2IXEA 2WWGA 1DELA 1EG7A 2CVHA 5H1YA 1MO3A 4DT1B 1DS6A 4TMKA 3AEZA 5JBQA 2QMEA 4DCTA 1TADA 3FYHA 4QKQA 4G5RA 1CJMA 4WOPA 3B78A 4X8LA 1RZ3A 2ZI9A 3KXKA 5BXQC 1GP2A 3PFIA 1GITA 4D25A 3QKRB 1GG2A 1IY1A 2CNWA 1OH7A 2J0SA 5EXPA 2AFIE 1NY5A 2EYQA 1Z06A 2D7DA 2OE2A 2C5LA 1SQ5A 2IYWA 3CNLA 1U9IA 5KDLA 3HWSA 2B8TA 1IONA 1E2QA 5B30A 4TLBA 1Y3AA 3NTUA 2J7PD 3FFAA 1LW7A 3CW2A 4ZI2A 3Q3JB 4AKHA 5HCIA 1HQYE 3BFKA 2KE5A 5FFMA 4JL6A 2FZ4A 1UAAA 2ZUDA 4Q1FA 2G9NA 2WJVA 2N1BA 1OJLA 4URZR 4X8MA 5EP3A 2B8WA 1LF5A 2BEJA 2N46A 1N6KA 2ZE5A 4KFUA 2W0MA 3SZRA 4QGFA 2WAYA 1ZAKA 1LV7A 5FR1A 5AK0A 4GI7A 2R2AA 3TK1A 3U6KA 1W48A 2V6IA 4FD2A 2O8DA 1JR3D 1JJVA 3RC3A 4B33A 1SHZA 4HYYA 1DARA 5EZ5A 3AUXA 4PTLA 1M7HA 2DBYA 4I1UA 1UPTA 4DUGD 2BVNA 2QPOA 1NBMA 2W6JA 4QG7A 4WBSA 4HDCA 3BFVA 2E87A 2VHQA 1B0UA 1OHHA 2QL6A 4JZKA 4LHZA 4PHHA 1NVUQ 4A8JC 2IS1A 1XRJA 4C30A 4KSCA 5JSZA 2WWYA 3NWJA 1JXMA 1LVGA 1Z6XA 1H8EA 4R7ZA 2IS2A 4M9QA 3WYFA 1KSJA 3QENA 2XOKA 3ZGXA 5DI3B 3A1WA 1G8GA 3DL0A 5EE1A 2BMFA 1XXHB 3N5CA 2GVDC 2ZI6A 1ZP6A 4LGMA 3IIKA 4EKDA 4FI3C 4X8OA 3AQ4A 1S9DA 4POAA 4KBFA 5D3QA 5JWOA 1CF4A 4MYTA 3HU3A 3K0EA 4QM7A 1G7RA 2Z5FA 1OB5A 2IC5A 1EX6A 2JLQA 1OH8A 1HE8B 3QKUA 1HEIA 1C9KA 1VG1A 4PPGA 4A2PA 1E0AA 4M1MA 1XZPA 3QVVA 2CNWD 3AVUA 3AVOA 1MO4A 2OFXA 1Z22A 4M1KA 1XPRA 5KPDA 2ODBA 3Q7PA 4O3MA 1IXZA 1UDWA 1XF9A 4YDHB 1MT0A 2P0EA 3THXA 4BFZA 1T0HB 5KDOA 3ICQB 1VMAA 1QRAA 1ZC3A 1BYIA 2BWJA 4G5OA 4Q00A 1UEIA 3PG5A 1N2CE 4BECA 821PA 4Q4JA 4DLRA 4HUTA 4WW0A 3IGFA 3PCRB 2GJSA 4TL6A 2GCOA 1DAMA 4I1OA 3AF2A 4HDQB 3VR1A 5JRZA 3GLIE 1EFUA 4ZCIA 1G7TA 3AP3A 3B7GA 5EXTA 1XD9A 3LA6A 3SYKA 4CYMA 2ZRFA 3VR4A 3WNDA 2EU8A 3N70A 3I72A 4IHQA 2QRNA 3AF1A 4QGHA 4P33A 4D80A 3IEUA 4RFSA 4Z8YA 1NBMD 2W6JD 5FL3A 3ZVNA 2VHCA 4HLQB 1OHHD 4O25A 2EFDB 4PSKA 2ZM5A 4N0DA 4P32A 2QGNA 4LJYA 3VTKA 1H8ED 2AD5A 5FOUA 1G17A 1TEXA 1GNRA 1WMSA 3E2IA 4LYAA 4MYCA 2XOKD 4ITRC 4JJKA 2VQSA 1SVLA 2NO6A 4AYTA 1IBRA 4IW3B 4DZZA 5L3QA 2WKPA 5J5CA 4EPRA 2PBRA 4NU0A 1R10A 1SULA 2EWWA 3PQCA 5F3WB 1TPZA 2QY9A 4M53A 3K0CC 1LTQA 1G4AE 4BFSA 4B2PA 5F9HA 1ZINA 2DR3A 1R7RA 4Q7MB 3MLEA 2BIFA 5G3YA 1IN5A 5E4FA 3U7EB 2G88A 2W0SA 2QA5A 3TBKA 1OXSC 5AJXA 4ZKEA 5JECA 4V0KA 1EFHA 2AKYA 3DOEA 1VPLA 1FQJA 2DWQA 3KDSE 2V55B 4C3ZA 4PZZA 4PX9A 2UZ3A 4JVSB 4TLEA 3OZXA 4PANA 3AB3A 3C15C 1HA3A 2IA5A 3QKSA 5C18A 2EFEB 2DFLA 2W2VA 5JJKA 1G7CA 4U02A 1F5NA 3K0FA 4A8JA 2XAUA 3MSXA 4GZMA 2GZDA 3WMFA 3G82C 3ZVLA 4WZBE 4HZUB 2PEYA 2FSHA 3KKQA 4PO1A 2BBWA 5C4GB 2V54A 2R6CA 1E2DA 1I2DA 2Q3MA 4DHEA 4FW9A 2VHUA 1CJUC 4ARZB 2RGXA 1XEXB 2BDTA 4IVPA 2ZXUA 4LX0A 4Q18A 2XTMA 4AIIA 1Z6GA 3HR7A 2V4ZA 2QROA 1J90A 3RS7A 4Q4LA 2ZSFA 2F3RA 3BB3A 4BEJA 2F55A 1US8A 1CXZA 1BS1A 4URXR 4DEXA 5TB5A 3EWSA 2OBLA 3IQWA 2JATA 4CGZA 1CJTC 2IT1A 4US1R 1QVAA 2DWOA 3I73A 1E2IA 2GXUA 3U61B 1KKMA 4C0SA 3QBTA 3NEJA 4TYNA 1E9DA 4C0BA 1DE0A 5FOXA 2WIBA 3E70C 6Q21A 4B74A 1T3SA 2KJQA 2HV8A 3ZD6A 3BOSA 3SJAA 1JPJA 1L4YA 2D06A 2ZRBA 5E95A 3NVAA 1E0SA 1XX6A 2ODWA 4Q47A 5AJYA 1OF1A 4TQ9A 4BRUA 2F1RA 4PHTA 1P9WA 4F4JA 4DCVA 4TMZA 3ND8A 1NVXQ 4Q1DA 4Q9LA 1P9RA 3MGCA 4F7WA 1YJ5A 2ORVA 3TMKA 1X8JA 3QF4A 1E1RA 3LW7A 4P4UA 4QJ3A 3EA0A 3GLFB 4DB2A 1A82A 1FTSA 3I3SR 1DO0A 2IXGA 3ADDA 2PJZA 5TMPA 3IEVA 2R65A 2FWRA 4DSUA 2HT1A 2ZQ5A 4LUCA 1ZMXA 4CDGA 2DB3A 3KUDA 1XEWY 4DCSA 1E98A 3T15A 3HYTA 4PAQA 3TE6A 4AK9A 1IM2A 1RFLA 3NIBA 1IXSB 1G3MA 3SHFA 3U6BA 2XNDD 3UG6A 4BWYA 4A1FA 4BLSA 4RVCA 1YE8A 2TMKA 1S96A 2QNRA 2BBTA 2PL3A 2RGNC 3ADBA 3NEYA 1SVSA 2B21A 3K0CA 3FOZA 1N6LA 3AUYA 1P2SA 3C41J 2LKDA 1HV8A 3I92A 4UXHA 2XX3A 4HAYA 4F4CA 2ZTSA 3L2OB 4KHZA 5D3MA 4KLNA 2ZE8A 4D82A 3THWA 2F9LA 4QFMA 2ZSAA 3FHTA 1N5KA 5IF9A 5FUXA 5G3ZA 5L3SB 2NO0A 4MA4A 4NTZA 5KPJA 2O0JA 1OFUX 2ZRKA 3QI2A 3GLGB 4ZDIA 1FOEB 4I4LA 4NYMQ 2BOVA 1FP7A 2DCUA 5KHOC 3ND9A 4ESHA 1YU9A 1WCV1 4EQ6B 3EAQA 3WMGA 3GJXC 4FCTA 1DG1G 2RGDA 2XXAB 2C9OA 4KFTA 3C16C 1AGRA 1QHNA 4OYHA 2ASEA 3PR1A 2OBNA 2IX3A 3EPHA 1T91A 2R6FA 3EIQA 2AXNA 4AC9A 2YYZA 1ZBDA 5E7IA 3KJIA 3C14C 3EIHA 3KQHA 1YQTA 2ZSDA 3EPJA 3QKRA 2G1KA 4TN1A 1E1RD 1RPZA 2HXSA 4I81A 1XEWX 3SR0A 1J99A 4UXJA 4ZDWA 3WRXC 3WYAA 1VG8A 3H0KA 4BLPA 3U3MA 3OE7A 2AWOA 2CJWB 4Z51A 1U2RA 4Q66C 3BH0A 4V0OA 5JS7A 2BJWA 1XTQA 1RVDA 4YMUA 1FMJA 2FZLA 5UKDA 2FF7A 5C1BA 1TQ2A 721PA 1KI9A 1OXTA 3KQKA 4UJ5A 3G5UA 3UIEA 1NI3A 3SEAA 4NMMA 4B73A 4BPBA 2ZJAA 3U4QB 1SVOA 3AH8A 2ZITA 3T61A 1X86B 2J87A 4GT1A 4QNRA 1EFCA 4L9SA 1ZM7A 2H1LA 2IYXA 3PV0A 4E5UA 4Y0VA 3U7HB 3E5HA 3CWZA 3AKYA 2CL0X 2KBFA 2QUZA 3AV0B 2YWEA 4CT5A 3SC3A 1FZQA 1GM5A 1MO6A 2ZRGA 3L0IB 1Q1BA 1TF5A 4B34A 1Q1QA 1TF2A 4LJAA 1XDBA 3F3YA 1W7AA 2YOFA 3EPKA 1AJEA 1KI8A 2EW1A 3A4MA 5DI3A 1IN8A 4KFRA 4WZAE 3BXZA 1T3LA 4A92A 1NN5A 4IVQA 1KAGA 4OL0A 4UQOA 2VSFA 1XXHA 3V4FA 1ZYUA 2NO9A 1KNXA 3C8UA 2A5GA 3B1WA 3QPVA 4S2EA 4HUQB 5IRCD 3IUYA 4JVNA 2XSZD 5KNBA 3CR8A 2YOHA 2QP3A 5EQTA 3U3KA 1TNDA 3O8RA 1RRPA 2ZAOA 1SKYE 1ONBA 4MKHA 4TTQA 4PQYA 1U98A 2Y8EA 3M4YA 4KLZA 1DTSA 4C7OB 3RLFA 3CX6A 221PA 3H84A 5J40A 2D3WA 4WA7A 3VU9B 2V1UA 2JJ1A 3OAAA 1NBME 4PAOA 3B2EA 1G6HA 5G41A 3KJHA 2NPIA 1DAIA 4YONB 2RCNA 3OE7D 5BQ5A 2ECKA 4LBYA 1E2FA 3EPLA 2ZI4A 5EP2A 4QJ4A 3SYNA 2HLDA 4DIEA 2O8FB 1CKEA 2WWWA 1Z28A 2QM7A 2C78A 1R5OA 3MCAA 2ODEA 2OBMA 3B1XA 5DSZA 2O8EA 1N6OA 1T3HA 1VHLA 1R6BX 1EFTA 3A1UA 4R2HA 4ABYA 3KXLA 2EQBA 4PPFA 5FR2A 3CH5A 4DSTA 1XBTA 4DSOA 1IXRC 3KQLA 2GK6A 1J70A 1KI6B 1XTIA 1II8B 4B6EA 4NKRA 4O2LA 5JZVA 3U44B 4RY2A 1R0XA 3A58B 3T12A 1N6RA 4B75A 2ORIA 1Z2AA 1G3RA 3MFYA 4TZ0A 3H1TA 1KK2A 1XMIA 3M1IA 5IK2A 2UKDA 3LNCA 3LWNA 3MJRA 1G64A 4UNQA 4EAQA 3K53A 1Z0IA 2R8RA 4RD6A 3ZVMA 4AURA 2RKOA 4LYJA 3OF5A 4TMTA 1NMXA 3MG9A 3KJGA 3GP8A 1QHXA 2BKEA 1V43A 1UBFA 2B7CA 2IEYA 4LBZA 4LRWA 4OI2A 3QY0A 5AJWA 3HP1A 2QAGB 4BUJA 4HB2A 5F98A 3P27A 4IOJA 3NKVA 2ZRNA 3C4JA 4PQRA 2YVUA 2QTFA 2OESA 5EZ6B 3P26A 4M9XA 1WE2A 1SZPA 4Q5IA 5FBLB 2OCAA 2V3CC 5F9FA 5KUTA 4YMWA 2Q6TA 4R2IA 4QBIA 3PUVA 4MGYR 1XPOA 1NG1A 4JLMA 2P5SA 1JNYA 5GJCA 3KL4A 3GMTA 4A2QA 2OEPA 2LWIA 2VF8A 2WOOA 1R8QA 1L4UA 1UEJA 1XNJA 1UBEA 1X8KA 3TGPA 5FOWA 3OAAD 4NYIQ 4B3FX 4IKEA 5CLQA 5ANRB 1M7BA 1NVVQ 1W4BA 3AVQA 2OFWA 2ZS7A 2GDJA 3T34A 4B47A 4G0NA 4JLKA 1EWRA 1SXJE 1YHNA 2HLDD 3FGNA 4Z1MA 3W5JA 2QP9X 4K81B 5TVKA 4C4PA 3NC0C 2IYLD 5JJLA 1G4UR 3QKTA 2JLZA 4A6XA 5H70A 2IW3A 1AK2A 3D8BA 1JALA 5G53C 2MMCA 2P2LA 3A1VA 1OW3B 4RD3A 2DYKA 3KUCA 1O3YA 3K0SA 4ZO4A 3LQQA 3CRQA 3DM5A 1AGPA 4HZUA 3U3RA 3MWKA 3LDAA 3LAWA 3EWAA 3SQXA 2JJ2A 2NZJA 4NCKA 4D26A 2D7CA 2VEDA 4R98A 4ARZA 1XD2B 2BC9A 1XEXA 2VHJA 5IK2D 5JFGA 4YMTA 1W36B 2PMKA 4NDZA 3T1VA 2CBZA 4EFLA 4TZ6A 1T9HA 3TR5A 2H18A 3CNNA 2O0HA 4XWKA 1QBKC 2J59A 3L0SA 2QT1A 4AG5A 5CLLA 5P21A 3RYTC 2A5JA 1HQCA 1EK0A 1GDDA 1R2QA 1S1CA 1M74A 3ZD7A 1G5RA 3CRMA 4KYIB 4NYJR 3H86A 4LJ5A 2G0NA 4L4UA 3DO6A 5H8WA 4BLQA 2BHRA 2IYVA 2YNMA 1MRSA 1NLFA 8OHMA 2WWFA 2PT5A 1J7KA 4WVFA 2JLRA 3X1YA 1FNMA 2ZR7A 4M0LA 3R9WA 4TYWA 2W2TA 5C46F 2OAQ1 4UNNA 5DH9A 4FN5A 4JLAA 4IJMA 1D5CA 1NY6A 4Q4AB 2BJVA 1CS4C 1W4AA 4F91B 1N0WA 4M1YA 4NONA 5EP1A 3UATA 1KNQA 1DAHA 2WJYA 3RSOA 2QE7A 2FGKA 1MKYA 1P5ZB 3QPWA 3VR6A 3ZZTA 1GKIA 1XPUA 3CPHA 2ZSEA 2R9VA 3QBVA 2XZPA 2XJ4A 2F43B 1XP8A 4RJLA 2IYYA 2J41A 1Z0FA 3EA5A 2P6UA 3KTAA 4MDEA 3CNOA 4Z1MD 1DO2A 1XMSA 2X19A 5DHAA 4ESVA 3JVVA 2EVWX 3A8TA 4KU4A 3CRW1 4BASA 2GJAA 4TMVA 1G3QA 4A0FA 121PA 3THYB 1P2UA 3SBEA 2QBYB 2WTUA 2J0UB 3SQWA 1OIVA 1E9FA 3C5HA 4EJSB 1ZNXA 2JJ2D 4M1SA 1PLLA 4NL4H 2ZUBA 3KQNA 3ZIAA 1EX7A 1G3UA 1V5WA 1NVWQ 3A36A 2ANCA 4OBEA 1MV5A 1KO1A 5E7JA 4AKGA 5CB6A 1VG0B 1F48A 1U81A 2OHFA 3CM0A 4M4SA 5TARA 1E9CA 5HTKA 4RCZA 2OZEA 3D6TB 1GNQA 3IPXA 4KAXA 3LVRE 4TYYA 2C95A 1G20E 1LS1A 1ZD8A 5CB8A 4JT4A 4DLXA 3EZ9A 4KITB 1R8SA 4PC1A 4YC7A 3SS8A 1Z0KA 1TEVA 3LX5A 5L3SA 1ZRHA 4BFYA 3GLIB 2REOA 2VSOA 1AKEA 4D0GA 3GLGA 4V0LA 2XEXA 3MAAC 4TLCA 3RAPR 4OQXA 2V6JA 2WSMA 4Q03A 1IJFA 3WHKA 4UNRA 1PJRA 3U7FB 1YZLA 2FSFA 4LC0A 4AD8A 4EQ6A 1T8TA 1OKKA 3GFOA 3I8XA 2A7QA 2ZVQX 2W6IA 3CX7A 4QJ5A 1ZVQA 2FA9A 5B2ZA 4PC7A 4V0MA 2XXAA 4AY2A 3H2YA 2CLDX 4J0QA 5EXXA 5J4LA 2QE7D 2ATVA 4JIMA 1XFAA 2QTVB 3RANA 2CVFA 1EXMA 3OEHA 2WSSA 1VCIA 4DEYA 3UG7A 2P3SA 4ACAA 1N6NA 5KU1A 3P1JA 1JEDA 3QNUA 4JLJA 3FFBA 1EWQA 3IBGA 1QF9A 3W8NA 1TU3A 1EFRA 4DC9A 2FU5C 2C04A 2QAGC 1E32A 2VBCA 3IIMA 5AUNB 4TT3A 1XCMA 2W2XA 2WKQA 4TQAA 1EGAA 3W9YA 2ZRDA 1E4VA 4RD4A 4WZ6A 3CPJB 3Q7QA 1G8FA 2CJWA 4DVGA 3NH6A 4A0RA 2C99A 4LJ7A 3RS0A 3TSZA 2YINC 2IL1A 1MABB 2D62A 5BYKA 2WKRA 4PZLA 3JVUA 4D4LA 3UMSA 3A6PC 5LD2B 4OKSA 1RKBA 1HT2E 3S1AB 4BRWA 1KDRA 3DDCA 3SFZA 3ZIAD 2IYQA 3PUWA 4PXAA 1W0KA 3CONA 5FBQB 2W83A 3R20A 1HYQA 3L0PA 5DN6A 4JLPA 3GPLA 3WBKA 3K70B 1PLKA 4JLBA 1COWA 1TF7A 3K9HA 5AJZA 3NBXX 4MITA 1C1YA 2D4HA 2H92A 5FUYA 2PZGA 4M21A 3R8CA 3WHLA 3FMFA 1ZJ6A 1DPFA 4Q9KA 1CJKC 1JQJC 2XNSA 5EXSA 1CRPA 2VP0A 4B48A 2WOJA 2VPPA 3QG5A 2JLUA 1W2GA 1VCNA 1UKVY 5JI2E 4MQBA 1HURA 3AVVA 1E2HA 2R6AA 1JR6A 4NBSA 4DLUA 3LXXA 5EE9A 5BN3A 2XZLA 2ODNA 1YZUA 2OM2A 2W00A 5EUMA 4QOSA 4XTCS 4H9GA 1OKKD 4TSFA 1SVMA 3FHCB 2W6ID 4ZKDA 4WXPA 4JL5A 3LVQE 1E2MA 3UKDA 2ZRHA 3RHFA 4GSYA 2YV5A 2WSSD 1NIJA 3OEHD 4HUQA 5EUQB 4BFUA 2PLFA 3PENA 1YZKA 1W36C 4W5HA 4P0TA 2OLKA 1Z5ZA 3K0AA 1NKSA 4DLYA 2AK3A 4C0HA 5KNDA 2QENA 4C7OA 4K8OA 2A5DA 2NG1A 5FTNA 5A0FA 3WNBA 5IHPA 2ZROA 4HDOB 1SKQA 4P4TA 3EC1A 4CEIB 3HU1A 5KDDA 1EFRD 1XZQA 2MSCB 3VU9A 1ESMA 2QI9C 5BWMA 4TT3D 1ZW6A 2ZREA 1KK3A 1Q20A 2AX4A 4JL8A 5J4YA 4RD1A 4B3GA 3SOPA 1FUUA 1TQDA 1OYYA 1AN0A 2JCSA 2ZIAA 1GRRA 4JVMA 4KVAA 4KVGA 3ZDQA 2L0XA 4CW7A 1CU1A 2O8FA 1YZQA 4MGZR 1TQ4A 3IPYA 4PFSA 4A9AA 1NF3A 4DIDA 4W5JA 5EP4A 4PZYA 1NG9A 2ZYUX 3KFXA 3J81k 4FCWA 2C2HA 2IYTA 3B85A 2YKGA 1W0KD 4WAUA 4XIGS 1G6OA 2ZUCA 3DKVA 4NH0A 1E79A 4HAXA 4A4DA 3B13B 1KI6A 1QHYA 1QHGA 3C7KA 5DN6D 1II8A 1QDEA 4MKIA 1AQUA 4Q7JB 1COWD 4ZIRB 4B2IA 2I3BA 3OFNA 2DHRA 1IHUA 1K8RA 2GKSA 2VSXA 3L43A 3RWMB 3U44A 2B7BA 3K9LA 2CE2X 1Y63A 3A4NA 4U7DA 4F93B 2G77B 2OUKA 2GAAA 5B58C 3OIYA 3R9IA 2QSZA 4JJZA 3ZS8A 4JYBA 1GNPA 4EFNA 4XOIA 4XWOA 4Q9HA 1N25A 1ZNYA 4GOKA 4TLDA 5JWRA 3SBDA 3SHWA 4ZDJA 1VHTA 5CITA 2AXPA 5KSOA 1GKYA 4JKIA 3TW8B 2QAGA 1KI4A 4TSFD 1J8YF 1G41A 2ORWA 3KB1A 2XTNA 3G0HA 1OYWA 1M8PA 1GL9B 1N3BA 4EJSC 3DMDA 3UXMA 1YR8A 1M7GA 3BB1A 1IN6A 3T1TA 3GLHA 2IXFA 1Z6AA 4QRHA 2X2EA 2JGNA 1KI1A 2VO1A 3RVBA 2O8BB 1Z0DA 2MSDB 4E03A 2VF7A 3TUZC 1BKDR 1DVRA 1LB1B 2PX0A 3M0EA 3FMIA 1VTKA 4W9MC 5L3VA 5LPNA 5DGXA 4DLZA 2GF9A 3LRPA 1T0JB 3SI7A 1KJWA 4LV6A 5TXGA 3I62A 3X1XA 4HB4A 3BERA 3PEVA 4B3BA 2A3RA 3LBIA 3AKEA 4GMXA 2QQEA 1KZGB 2VP4A 1QZXA 1TL7C 1WA5A 3HDTA 3W3AA 1E9SA 3I4LA 1KSGA 2ZRJA 3I5XA 4TTPA 3ZQ6A 2IHYA 2ZJBA 1FNNA 1AZSC 1MRNA 3LD9A 4DLSA 2Q0HA 1NJFA 4QGGA 2DFNA 4QBGB 3F0TA 3OEEA 2BV3A 2N42A 1GRNA 1ZM3A 4RZUA 3LLMA 3EZFA 3OFND 4HI0E 1II0A 1Z29A 2FDCA 4CEJA 2R6DA 4CZ2A 1LFDB 1Q1EA 1XD2A 5JLJA 4Q9IA 4HB0A 5KNCA 1D9ZA 2C98A 4L5BA 1E69A 3RRMA 1ETUA 1N5IA 3U3OA 1KAOA 4US2R 2CHQA 1KHTA 4A0GA 2VHTA 3GFPA 4LSGA 1E9RA 3CF0A 1CP2A 4A2WA 4IDOA 3BH6A 3GEHA 1DAKA 2GA8A 4BZPA 4IOLA 5CYPA 1ESNA 2BMEA 4FXPA 4QM6A 1KK0A 1OH6A 4KBGA 5LD2C 4XTRA 1JBKA 4U00A 4DDWA 3TAUA 4BFWA 5HZHA 5GJBA 3EXAA 3F8TA 2CCKA 3BE4A 1M1YE 3D7MA 1YR7A 4NCHA 4LC1A 4NZYA 5K8IA 1PVOA 3R7WA 2QG6A 5EE3A 1VCMA 3F5FA 2J9RA 2OV2A 1C4OA 4LZZA 2EFCB 4O0MA 4Q4AA 3K70C 1G5PA 1S3GA 1YZNA 3NDPA 2F9MA 3LX8A 5J4KA 2XJ9A 2VLIA 4S35A 3KKMA 4IDHA 5JS8A 2F1HA 5FI0B 3TLXA 1N5JA 3PEUA 3T1QA 1JAHA 1AZTA 4CT4B 1FFHA 2VP5A 4LY6A 3EG5A 5ELXA 1CULC 5FUVA 2BMDA 4RKFA 4G3XA 4IDPA 4DT1A 2RHDA 1U94A 4ZCMA 3FB4A 1ZU5A 2FX3A 2WWXA 4URYR 1DAFA 1H8HA 4HAWA 3THYA 1BMFA 4QHSA 3T1OA 2ZANA 4EPTA 1WB9A 2GRJA 2HF8A 1SKYB 5CDFA 4TQUS 3ZYCA 4B3CA 2O8DB 1KKLA 1JR3E 3KX2A 3EZ2A 2VA8A 2QBYA 4NCNA 2J0UA 2NPFA 3OEED 1P73A 1KO8A 1KMHB 4EDHA 1MH1A 3KKNA 3WNCA 4TYQA 1N6PA 1GOTA 1E4YA 1YKSA 4BE7B 2GJKA 4MYUA 4Q02A 2PH1A 1W36D 5JSZB 3NBFA 1CBUA 2FN4A 2YJTD 3FDIA 1KJZA 2HJVA 1NN3A 3O47A 1U8ZA 1W44A 4UNSA 1I2MA 3SE0A 1ZUIA 2ZJYA 2CEAA 4W7SA 2OXRA 1AS3A 1N0UA 1IQPA 4LCBA 3B60A 2ERYA 3GLIA 4DDUA 1AS0A 2GTPA 5DNYB 4AI6A 1XJQA 5GADl 2VH5R 5DO9A 3LBNA 5DE3A 3ZVRA 1DAGA 2CL7X 4JMPA 2K5UA 3ECCA 4JSTA 4DSNA 5CK4A 4LI0A 1Q3HA 1QHHB 1U8AA 2VYFA 5HE9A 2O5VA 4MH0R 4OK5A 3P4YA 5FOSA 2NIPA 1OXUA 2REBA 1Z0AA 3UWKA 3VNVA 2RMKA 4GMDA 5FBVB 5J47A 5CYOA 3THXB 2IYSA 4PR0A 2B92A 4BLOA 4XWAA 5GJWC 4A36A 4Q4JB 1GTVA 2GBLC 4E09A 4BEBA 1DADA 1R4AA 3B82A 3PEYA 4Y0AA 1E3MA 2REXB 1S2MA 2ZYWX 1QVRA 2YHSA 1AQYA 3GQBA 4JBXA 4Q1AA 1H8HD 2XZOA 2J1LA 4GBMA 2AKAB 4LPSA 2Z6VA 3KKOA 4DLVA 1BMFD 2YWGA 1FTNA 4D2IA 1Z08A 1Z3IX 3LLUA 4UJ3A 4XVRA 5DYIA 1D6JA 2JLVA 2GXAA 2WWHA 3VR2A 2RGNA 3Q85A 2ZEJA 2VL7A 3QQ5A 2EFGA 1T6NA 2J3EA 4IVRA 3S1AA 3O8BA 1N5LA 4QHTA 1W0JA 4H1VA 3FHOA 2J46A 4IOMA 1XU4A 2ZJOA 2ZRCA 3MD0A 3QXHA 2QRZA 1P7CA 1HY3A 1X1RA 3PUXA 3QVUA 3IO5A 1NLYA 2ZE7A 5SZHB 4BZQA 1QHSA 3EX7C 4DCUA 5CIWA 1SXJB 3W6NA 1CTQA 1K6MA 2P6RA 3BS4A 3GJ7A 3LO5A 4JLVA 2G83A 4BLRA 2ZU6A 3IHLA 5B57C 4YXWA 3QJYA 1D2NA 1HH4A 1E9EA 2UVQA 2YWHA 1R0WA 2CE7A 4JLNA 4P4SB 2WVJA 4L16A 1G9XA 4KJZA 3UK6A 5JHGB 1X1SA 3DZDA 1AS2A 1II9A 4I99A 1RIFA 1TU4A 5CJ2A 3VKWA 3X1ZA 5FTLA 1AA9A 4D0NA 3RC8A 2ATXA 2JLYA 1S3SA 4LBWA 1WBDA 2RB4A 2HCBA 1PUIA 2OXCA 3RRNA 5AUPB 1ZD9A 2HEIA 2ZPTX 3AM1A 4HLUC 2NQ2C 2Z4SA 2Z4RA 4LBVA 3FVQA 2GESA 4BZXA 1F60A 4G5QA 3Q8XB 2OO7A 1W2HA 1XMVA 1G8HA 2QZ4A 3EIEA 4DXAA 1S1MA 3VHLB 2NTYC 1Z83A 2A5YB 3KQUA 1UDXA 2RHMA 2WJGA 3O8CA 2ZR9A 2IF0A 4HAUA 3NHAA 4MKFA 2FFQA 3K9NA 3JZAA 4OQFA 1ZM4A 4OI0A 1RYFA 2IHBA 1VIAA 4GP7A 2H17A 1SVIA 4CEHB 1OLOA 3DMNA 4ASUA 3HPQA 3R9XA 1I4LD 2HF9A 2WBLC 2D2EA 1E2EA 3LFUA 1NRJB 3LBHA 4YLGA 2WWIA 1I4DD 2H7VA 5CM8B 1YR6A 2OAP1 2JJ1D 2KBEA 4PHGA 2CLCX 4EPXA 3Q5EA 1GIAA 2YZ2A 3VHXA 1X6VA 2VP2A 3MUFA 4PSVA 2DPXA 3RS2A 2QT0A 2RGEA 1GL7A 1GZSA 2FJUA 1M34E 1NNEA 4JKYA 4PO9A 3W6PA 4LHXA 2ZI7A 4ON9A 3X1DA 3IQXA 4YXWD 3TQCA 4RSGA 3SDZA 3IILA 3ADCA 1W46A 2LCFA 2V7QA 1LY1A 3Q72A 1SVWA 5EE5B 1WP9A 3BWDD 3SJCA 4LJ6A 2GBLA 4ERNA 4OJQA 1ZUHA 3RRZA 5BYJA 1ANKA 1RW4A 3K1JA 1GWNA 1E96A 1Z47A 2AWNA 4OJKA 1GVNB 1KY2A 1JQLB 4QL3A 1AM4D 4KV9A 4Q4HB 1ZIOA 3U60B 1Z0JA 4LV5B 4UKDA 5E3HA 1CEEA 3AGQA 4NYJQ 3BAFA 5SZJA 3CLVA 3FWYA 1G16A 1Q1ZA 5FPTA 2GILA 1FL9A 3IBYA 3QF4B 2J7KA 2O8BA 1JPNA 2PLRA 1S8FA 2ZVPX 2IUUA 1BOFA 2ZRMA 3JZMA 1ZM2A 4MGKR 1U99A 3T06B 1FQKA 3K8YA 2WJJA 4P3YA 5M04A 2F6RA 1WDTA 4QGAA 2NMVA 1I4TD 1LF0A 5FI1B 2DY1A 4ASUD 5KOYA 3CF6R 2PEZA 5L8VA 1XCPA 3EW9A 5FOTA 3W8RA 2OILA 3KKPA 4QC2A 4LHVA 3U5ZB 3PUZA 2Q9CA 5HE8A 3BD9A 2PMDA 4JLOA 4NCIA 1YR9A 1CR2A 1KJYA 4P31A 3VQTA 4NE2A 2J45A 3AVYA 1BIFA 1U8YA 4RCYA 3ICEA 4DDVA 2ZS8A 3SFVA 1NN0A 2IF2A 2OLJA 5KO2A 5A5GA 3TH5A 2WAXA 1G5TA 3I1FA 4MRPA 3GLHE 4TMXA 1T4GA 2X8AA 5DIFA 5D3MB 2C77A 3EASA 2Q3HA 4Q1CA 4EUNA 4GDFA 4RKEA 1D2MA 4CVNA 3GD7A 4FMDB 3GLFA 4HLUA 3CWQA 2ZU0C 3TR0A 1L7VC 2FGJA 4Q01A 5JWHA 3CB4A 2X1VA 3GJ4A 1KZ7B 2QAJA 4NP6A 2IWHA 1ZIPA 3QXSA 1RYHA 4B6FA 1KOFA 2ZRLA 3K9GA 2V7QD 2QQ0A 1J8MF 3PUYA 4Q9JA 3AP2A 5SZIA 1Q57A 1Q0UA 2JDIA 2CHVA 2ZS9A 1M6NA 4MRRA 4D81A 2JLSA 2A9KA 3ASZA 2WICA 3VR3A 5DLQC 3TRFA 4G5GA 2KSQA 3GJ6A 2BMJA 1W47A 2G1JA 3PIRA 4URUR 2GEDA 2WJHA 1U90A 1E2GA 4X8HA 4PQFA 5SZKB 4RD0A 2FSGA 4LJ9A 4C0QC 4JVLA 3PITA 3GJ5A 5JEDA 1SXJC 2F1IA 1DEKA 4KO8A 1DG3A 1U0LA 2CHGA 3I5YA 5KSZA 4HLCA 2IWRA 3SJZA 4TWZA 4M1TA 1KIMA 3PVSA 3SYLA 2ERXA 2H16A 1E2LA 3KXIA 3LW8A 1UFQA 3GJ3A 5HKKA 2NO1A 2Q21A 1KY3A 2OSBA 3ZJYA 4XSGA 4B76A 4B2LA 3FKSA 1XTSA 3IDQA 1XJCA 1TX4B 2ZR0A 4IXNA 3GEIA 1WXQA 1UKZA 4LDJA 3UMFA 5FTMA 5GVSA 1YVDA 4PC2A 2PZEA 3B1VA 3GJ0A 4HB3A 3QPUA 2QU8A 5AWFC 3AP1A 1WBBA 4L8GA 1IJEA 1AIPA 3ZS9A 2QMOA 4C0JA 1FUKA 1CR1A 3WRYC 5CK5A 3TIFA 1QHIA 2Z83A 3X1WA 1GUAA 1OFIA 1NKTA 4N0EA 5AUOB 1KMHA 3EARA 2PZFA 3VX3A 4LWZA 3ZH9B 2GCNA 1E0JA 1F3OA 3C5CA 2EWVA 2WV9A 3RABA 3LXRA 3LH5A 2RGCA 1T8UA 4AKIA 5FPYA 2B6HA 1DBSA 2IBMA 2CDNA 4C9BA 4JS0A 3T5GA 1F2TB 1FX0B 3TQFA 4D4KA 5LB2A 2FFBA 4YDSA 4JLDA 3MRSA 2A78A 2JDID 5HCNA 3WP0A 4XVUA 2ZETA 4HZIA 2AHOA 2GJ8A 2P5TB 5AR1A 4N3NA 4KXFB 2ZYTX 5C2JB 1SVKA 4BFXA 1GFIA 4MUAA 1ZU4A 3KB2A 1D9XA 2JA1A 3AVPA 2X2FA 2FNAA 2QM8A 4MUBA 4PHFA 5JCZA 3U4QA 2YC2C 3BH7A 4RFVA 4DDTA 2VIIA 5CDFE 5A4JA 1RJ9B 1QHHA 4QBFA 2A2ZA 4LJ4A 1VCOA 4M8NE 3BK7A 5H68A 3V4RA 4ZPXA 2JLXA 1UBCA 4M22A 1R5NA 2FPMA 3ZZUA 1E0KA 1G291 2IUSA 1XTJA 4KCGA 2GAOA 2HT6A 4LPKA 1GILA 3AF4A 2O8CB 2QPAA 4FINA 4U5XA 1OFTA 4CRWB 1FP6A 2JIZA 1P75A 3M6AA 5HKKD 1G19A 1P60A 5LBIA 1OSNA 2IUTA 5HR5A 2Q9AA 1Z6TA 4Q7LA 3FKSD 4R71A 2O8EB 1T5LA 1BH2A 3V9PA 1E94E 1XWIA 3CKLA 3NG1A 3OIUA 5FTKA 3SJBA 1TQ6A 4FIDA 4XD7A 2QGZA 3NBYC 1ODFA 3BORA 4FMCB
chains in the Genus database with same CATH superfamily
2GCPA 2CFSA 4H16A 4HN4B 1WUJS 3WLFA 5ILOA 2RH5A 4FR0A 4P80A 2G72A 1IOZA 4A15A 1NP7A 3OI7A 5K51A 2FSIA 2NAPA 2YHIA 2BY4A 4OQLA 5EESA 3HZZA 4DW8A 4HEA6 2AN1A 2YC4C 1J1ZA 1EM8B 4US0R 3RVDA 4F92B 2CY0A 2V0GA 1NBIA 3T3OA 1E7WA 5BW8A 5A9SB 2VF5X 5IBRA 2DFDA 3SIWA 1B8NA 4BNXA 1G63A 2GM3A 1UZAA 3RWOA 3DPUA 1OPXA 1ZICA 3J81A 2I78A 2JH8A 4ZJYA 5JMOA 1R4MB 3VO2A 1ZWLA 3WMEA 4HPJB 3G7NA 5CA1A 1PJSA 1RPNA 2JGMA 4Q21A 2C5SA 4CM3A 5K8LA 4YNBA 4E5MA 3OCUA 1NXTA 4ZV7A 1UBGA 3GHYA 4WKNA 2JIQA 521PA 4F38A 2HEGA 3EGDA 4ER3A 1LZLA 4FHFA 1G5QA 2B2NA 1SK8A 1VYVA 1LPOA 3DMTA 4EPWA 4P4SA 1I6KA 1PGJA 4BEWA 5JALA 1AO0A 4W5OA 4IV0A 4ZD6A 4HQ0A 3MWGA 2FG6C 3S7TA 1H1TA 1QOQB 4I5IA 1JDBC 2PSDA 1UT6A 3DHVA 2PRIA 2HXGA 1ES9A 4LYHA 2BFFA 3D8HA 4GF5A 3E9MA 4E30A 2WWVD 1JHXA 1IH8A 3EULA 4IZIA 1CY7A 1L4LA 1F14A 1SN7A 1U5CA 2BHTA 3DMPA 3VI3B 1U0GA 5D1HA 5A6VA 5EMHA 1LDEA 4L75A 1AHNA 3GPCA 3EZYA 4Z2AA 5CH8A 4X3PA 5H4GA 1MQ9A 3H0CA 3NHBA 4GPZA 4DLNA 2YZMA 2EC5A 2X3YA 3GAZA 2M1ZA 3PCTA 3FKQA 3AYXB 1IN1A 2QX7A 4LHEA 2IP2A 3PNYA 4GP6A 3HADA 4NPAA 4QXMA 4ZOAA 1OI7A 1KXJA 1DCFA 1RI4A 3N2LA 1YL7A 4K9QA 1Q7GA 3NQ41 3OF2A 5TQJA 2C2ZA 2C96A 4QG3A 2B2XA 5CAEB 4F3NA 4CTKA 4MVXA 2DHDA 2R7MA 5KSYA 1PFGA 1W5SA 3IO3A 4O2RA 1Z07A 4WLOA 5DBIA 1JLHA 1D0VA 3H6HA 3E3MA 4CEHA 2NSYA 1EQAA 2QV7A 3L1UA 3DD5A 4FMDF 3GMSA 2XNDA 2IYUA 1QVVA 3MWJA 3PSHA 4OI1A 1TUIA 3NV7A 2P9EA 3LP5A 4LA4A 1YU6A 4YYEA 4XH9B 2ZAMA 1E1CB 4ZT3A 4Z5XA 2NP7A 5ECDA 3FMGA 5KYUB 2R44A 1NWCA 2HCJB 2OWEA 5AYVA 2WABA 5FA5A 4ZHQA 1IEVA 3EGVA 5A4DA 4OQEA 2H1WA 4EG1A 2FMXA 3CO5A 4WXRA 1X42A 1FNDA 3NTQA 4FE7A 1WXWA 4HRXA 4RORA 2BBSA 1NF2A 3U37A 3HPRA 4CIVA 4DM4A 3FJOA 1MAAA 4IRXA 4LF8B 1W5FA 1JG1A 1P33A 3W05A 4BDSA 1BFKA 2NZXA 1EAMA 4IIEA 2Z6AA 3L0BA 2G08A 4ZARA 3BGWA 2JIDA 4F9FA 3BJRA 1Z4LA 3OWXA 3QX9A 4BKMA 2WA1A 3ETDA 3CVOA 3QV2A 4DNOA 2VP6A 3A9CA 4WADA 3BRWA 4U6NA 3ZHRA 1DKRA 3H9BA 4GYWA 4TTRA 1BMQA 1CDZA 3ZOZA 3DYIA 3EGXB 3TLKA 5MFPA 2EWMA 2DUWA 2KHZA 4YDRA 4DKXA 5J63A 2J5XA 1G8YA 1LPPA 2GZHA 1PFQA 2J4DA 3Q3GE 3HCEA 4PYRA 1DJMA 3SKXA 1HG1A 1N3YA 3L1JA 3UKJA 2EKPA 4YJ2B 3MILA 3N74A 2JL1A 3RJ5A 3TD6A 1H3EA 3H11B 2G07A 2W4QA 2OFPA 1R8XA 2V7XA 2P8SA 2VC2B 5DYGA 1PZXA 4LV8B 4B6PA 1R6VA 1EVYA 4DF3A 2DWUA 3TJZA 1PDVA 3D6HA 4YRSA 3DFIA 4EARA 3FCAA 2CLSA 3U3ZA 2G6BA 3LY5A 2NYVA 5ABPA 1KO4A 3DZGA 1B76A 1BX0A 3D3NA 2WMOB 4EG0A 4KDFA 3NVKI 2ZYHA 1RRFA 1GZUA 3KSMA 1O94A 2PWBA 3H5WA 4TTAA 2G09A 1N6IA 1VECA 2RAPA 4FYXA 2JAUA 4QYIB 5C7IO 3I2FA 2FRDC 2OP0A 3R23A 3ZBUA 1Y37A 3B1FA 5LMZA 3KCNA 2FLWA 2WV7A 1K7SN 4QHYA 2WT8A 5LP6C 1MO5A 2OV4A 4NV1A 1N1EA 4C78A 1KI2A 3ZWCA 4Q34A 1XG5A 2NNWB 3GFRA 4UD2A 4AX8A 4BE9A 3LPDA 2J0QA 3NZEA 4ZODA 5AVOA 2GEUA 1Q92A 3QLVC 1R5BA 3U7GA 2Q4BA 3C74A 5HPYB 3A06A 4LAFA 5CHEA 1ZZEA 4YMVA 1O97D 4PHCA 1G8MA 1T2VA 2CVOA 1HG0A 2R97A 5LR6A 2GNOA 3QXXA 3WWZA 1OIXA 5AI4A 1C3XA 4EEXA 1WDWB 3V1KA 3V42A 3P19A 2B8NA 4U3JA 2CXNA 3NH9A 5G4KB 1Q0RA 2R8PA 3HNRA 1DBQA 4FNOA 1BXGA 5JNWA 3ROKA 1P7YA 1TJPB 5EE0A 4D5EA 2Q8QA 4N3BA 2QM3A 2XMSA 1NPDA 4E2XA 3J7AC 1YIOA 4E3WA 1KO5A 3DOJA 3DLBA 5AM4A 2QJRA 3FSRA 4IO1A 4NRDA 2X9LA 4FFSA 2PJRA 3GPDG 4C6RA 1Z4QA 5K20A 3W3AD 2V8OA 4X9XA 3Q0EA 1JDVA 1NN1A 4I8DA 1YS1X 4KYUA 1D2EA 2CZCA 2GF2A 1QAQA 3L82B 1EXVA 1ICEA 1YCDA 1NVEA 4QOGA 2Q41A 3ZDBA 1E6WA 3ESXA 1V4NA 2G5TA 2Q49A 3KJEA 3EAGA 3WQHA 1V37A 2NX2A 4KFSA 1T0BA 9ATCA 1HO3A 4IOKA 3K09C 4CQNA 1SGWA 2PKYX 1CIPA 1ZD5A 3Q87B 4CIDA 2XYVA 3DQPA 3L8DA 4BO8A 1DFHA 3NHFA 4JITA 2VTKA 3E5MA 2ZI5A 1ZK4A 3ETJA 4JXKA 1UBNA 4NQZA 4UAUA 3R76A 1JB1A 1E2NA 2HJ9A 2M32A 4E13A 3FD8A 4IZOA 3A1TA 4ZT2A 2BBOA 1J9EA 1JYSA 4BTVA 3M4XA 5ESRA 1LK0A 2Y68A 3GLFE 5I6DA 2XUJA 1W0CA 3VKGA 1M1UA 4FYJA 4I36A 2XCQA 1WF3A 3IP9A 4Q05A 5CFLA 3I2GA 4PPQA 3UNXA 1U63A 4WLUA 4CG1A 2V4MA 3FF1A 5CHYA 4BFTA 2Y9MB 1E2PA 4LYFA 4TZTA 3BB4A 5L4NA 2GAFA 3RS3A 1SU7A 1U0NA 2UVPA 5KWIA 4HWGA 3OQIB 3KTOA 1RHUA 1FB5A 4FKMA 1WU8A 4K8RB 4LY9A 4URVR 2EATA 3MBOA 5HQJA 1CZLA 1A8PA 1HZZA 5EKDA 5JG7A 1WPGA 4MIYA 4TWAA 8ADHA 1PKEA 4E32A 1NM5C 1Y1RA 4WMLA 3DE4X 5BPFA 5EWMA 1FW6A 1UKCA 4MKXA 2YMQA 5GOTA 1JJ7A 5E1BA 1E6LA 2PWAA 5LQJA 1FX1A 2GARA 3T5DA 4DARA 2DXIA 1QBGA 5I4KA 2AJDA 3AFIA 2VQFB 2RH8A 4DKJA 3LZCA 1YK0A 4RD2A 3D1VA 2WQZA 1PYGA 5HM6A 4ETNA 1QONA 3CZCA 3GXBA 4YRJA 3REQB 4UD6A 1MNQA 2VUTA 3T38A 1L7PA 5A06A 4MLDA 1OT5A 2HUNA 4XIIA 4C2UA 1QIMA 4HVCA 1W96A 2ZK7A 1NPYA 3QOFA 4Z9AA 2YV1A 5JSYA 3SSNA 4BVJA 3WMWA 4C21A 4ENTA 1GAWA 1UJ2A 2NOAA 4IDCA 2JS7A 3A37A 4C0AC 3I3OA 4KAFA 4D9HA 4V0ME 1P2VA 2K2WA 4N7BA 4XJXA 4Q3CA 2H5LA 5K3BA 2ZB8A 1FYFA 4Z0NA 2QL9A 4K5QA 3VTFA 1OT3A 2PRJA 2ECFA 1XLUA 2DY0A 1RAAA 2ZYRA 4ZV4A 3AJ8A 3WB2A 1L7MA 3ZXIA 1W6RA 1O87A 1OTXA 1VE6A 4XX1A 1VPVA 5LYJA 4C0LA 3K0AB 4ZDKA 1SBIA 2HJGA 2PBZA 1Z5VA 2GJ9A 1G3IA 1DXOA 3NTRA 1ZI8A 4GKVA 2G0TA 3JXEA 4CV1A 8GPBA 4RLFA 2IEZA 3L77A 1TJ3A 2I6QA 1E99A 2P2SA 2FW1A 2VBIA 3AOEC 1Y5MA 1B74A 5FL7D 1CQZA 4O4JB 4C7VA 4A82A 2O8CA 1QZZA 3OHMA 2YNMC 5G40A 4OI4A 4QJBA 1PR9A 3VI4B 4F60A 1MOPA 4A6PA 4NJMA 5EJ8A 2CVZA 4R5MA 1KA9H 4LMBA 1LI5A 3H19A 2QJFA 1KEUA 5IKPA 1F6WA 1SIWA 4FYHA 3T5BA 4XGNA 4YV1A 4MDFA 3CBQA 4J0CA 3GROA 1R0CA 1XU9A 1SC3A 4I4CA 4HX9A 2BFPA 4CMHA 4D0RA 4ZMBA 1HETA 3P4UA 3SXPA 1LTKA 5C8XA 5IUNC 5CNIA 1EA7A 5HDQA 2GVZC 2XYHA 3TTSA 3OZBA 4URFA 4AZ0A 2ZRPA 1ZGCA 1E60A 2HSWA 3B1JA 4IUYA 5IX8A 3CZAA 5CX1A 2ZJ5A 3EVBA 1V4VA 4YP5A 1O95C 1IN4A 2CZQA 3NORA 4BZWA 4V03A 5AI9A 1CB7A 2Q99A 3W2GA 3P9PA 1G60A 5K8TA 4FZ3A 3T54A 3WWCA 3AU9A 5E6SA 3IQIX 3L1HA 2EJUA 421PA 3AM3A 3GRYA 1VLVA 1SPXA 3GBVA 1WX1A 4II3A 5I8ZA 2I6GA 3C24A 1R6XA 1ISSA 2Z2IA 1GZ6A 1XZDA 4KWCA 4U9UA 5FFNA 5JNLA 1UC5B 4RADA 3WDLA 1AC5A 4MHTA 4HNVA 4L3VA 2MMGA 3KR9A 1RP1A 4HP8A 4OGKA 1F8FA 4LIPD 1JV2B 2R6GA 3AEKB 4IH1A 3CB2A 5FWNA 2RGUA 1EFPB 2ZTHA 3UAOA 1V2GA 2RARA 4YRKA 2PA0A 3I9MA 1MQ8B 1XEFA 3C8MA 5EI5A 1RMYA 3ZN2A 1NVGA 2J09A 1D8TA 3HGMA 3DHWC 4FMBB 4K46A 4NBVA 4GL2A 2YXDA 3C3JA 3PC8C 2W11A 3QA9A 5B37A 4O4HF 2JIRA 5LMCA 1T3TA 1KDVA 2Y1LA 5AVRA 4YUZA 5IKEA 1U31A 4X64B 4M8LA 1GAJA 1P0QA 2JHPA 2Z0MA 5JC8A 2K4MA 4ENQA 2DWPA 2FPRA 2OYCA 5C8YF 4YACA 4ZTZB 1IIBA 3WL6A 4A26A 1QCCA 3AHHA 1DBPA 3DEFA 5EERA 1QV6A 3ZHUA 3QEBZ 1PR6A 2C1EA 5TEWA 1OZHA 2PCLA 2YCLA 1OC4A 1F0NA 1FMLA 4PYIA 4K0KB 1YQ9A 3UH1A 3ML1A 2WPDD 2O5EA 3HVKA 3IBFA 5IP5A 4HLDA 3BBPA 3U26A 5KJ6A 4K7JA 4Y1EA 4XVQA 3Q11A 1PZNA 4XZ3A 5HBGA 4UE6A 4RAQA 2QL7A 3B1ZA 4HWSA 3MMNA 4PINA 2DGDA 3H1GA 2Z8YA 5JNVA 1HTBA 5KI6A 3FVRA 1VGQA 4E5SA 3I45A 1C7QA 4Q1EA 3HLKA 5FV7A 5CM9C 3QEOA 2OCYC 4EKIA 1H2RS 2YWCA 4E12A 2VYCA 4RHCA 4ETWA 4EW3A 1KARA 2Q0XA 3S3TA 5B7QA 2V98A 2Z04A 2ZJ8A 1GY8A 3QNMA 5JASA 2QEQA 2YUTA 1EVLA 4P9NA 5KTYA 3AL0C 1V39A 4RQAA 1K9SA 1P5HA 3DB2A 3E3OA 3H5OA 1AK9A 1OAOA 5AM5A 5G1PA 4C7MA 5LZ9A 1UBJS 2RE8A 2CBGA 3VH4A 3N05A 3BC1A 3O4IA 3L1IA 3TO5A 3GPBA 1ZCBA 1B8OA 3HWRA 4Z86A 5AJVB 2XUIA 4YJKA 3REFA 1MBZA 2JZCA 1T5TA 2X0RA 4NFLA 4GPIB 3ZI0A 3MHPA 4Q0MA 2OXTA 1PFKA 1UT8A 2ANBA 3LT5A 7GPBA 1KS9A 1B23P 3ABSB 4TSRA 1F2UA 3BXPA 3NBQA 3CW9A 4C4XA 2D8MA 4WOJA 4GG1A 1PGQA 1MNAA 4I66A 3VRHA 1D2RA 1JR3A 1W1WA 5B64A 1SOAA 4FBLA 4H0FA 3ORSA 2VSYA 3GDOA 1SKAA 3BL6A 3MJSA 4Q48A 3R7WB 4CIXA 4GRAA 1TYEB 2YVAA 1XTKA 4HSEA 3U1VA 2P91A 1X1CA 4DUGA 3WNQA 1LCIA 2WF8A 4I1VA 4B3DA 1S9HA 3I6MA 3CN9A 4AIRA 4PTYA 5GONA 2VHYA 4FR5A 2IYRA 1HKUA 4YJHB 5REQB 4PNEA 4TV8A 1EJBA 2R1VA 2IBSA 2AZ4A 2LCIA 3RFVA 1H3FA 3K1YA 4ARAA 3Q8LA 5FAXA 5LBUA 1SCUA 2FFHA 1JYFA 1OBHA 3DTVB 4FOPA 1BJKA 3QX8A 5H1YA 3M3PA 1Z73A 1DS6A 1JG3A 1Q17A 3OG9A 3I5MA 4M9UA 4PRZA 2PGIA 1L3CA 5H3CA 2PS3A 1P6QA 3UJBA 5CCDA 1TADA 3FYHA 4DCTA 4EVIA 4QKQA 5A5FA 1KWGA 3B78A 4L7VA 4X8LA 3HCPA 3C3XA 1RBMA 3DAOA 1SZJG 1U2SA 2CGEA 2ZI9A 5GWXA 1ZN2A 4BLWA 2XRZA 1TIKA 5NULA 3DHEA 5MHTA 1N5RA 5EJ2A 2J0SA 1XZBA 1HDIA 1OI4A 1NY5A 3ZY3A 2O2XA 4RH3A 4L78A 2BYTA 5ALNA 4V3BA 4MV1A 2JZNA 1IVYA 3DUFA 3NAMA 3ZHQA 1Z82A 3KPUA 4CCWA 3D9QX 3BK2A 5KDLA 4AECA 2B8TA 4OXRA 2Y0BA 3SYTA 5B30A 4TLBA 1VSQA 4O1MA 3FFAA 3IUJA 4DHWA 4ZI2A 3Q3JB 3HCCA 1TKAA 4Y6RA 1HQYE 2PUJA 3BFKA 4YT2A 2KE5A 1UAAA 4JL6A 3FOFC 2QK4A 2WKSA 3O8LA 5ITWA 2DTDA 4GX1A 2WJVA 2N1BA 4QYXA 1XTBA 3LI2A 4GMHA 4P7FA 1E6MA 5K4HA 3IT3A 5JU6A 3JYPA 4LS3A 2HU8A 1EK1A 4HR7A 1GT91 2J9YB 5TJ9A 2W0MA 3VISA 3UO8B 2QVZX 3EDYA 5FT9A 1N4DA 1JLLB 1LV7A 3IHTA 3R3XA 4R2MA 3ZYZA 1ULTA 5JD5A 1W48A 2V6IA 1RWBA 2B69A 3TTUA 1ACLA 1GHTA 4HMQA 2O8DA 3BE8A 1IBKB 2XA9A 1JJVA 4B33A 1RDFA 4P3PA 4ZVSA 1K6IA 3CE9A 3ED1A 5A4MS 1DARA 2EBWA 4PZ0A 4XGKA 5ALKA 1WCIA 3AUXA 5EZ5A 5B4TA 4HEA1 1Y6FA 4I1UA 1UPTA 4GI1A 4A0QA 1KQOA 2BVNA 2PQMA 2QPOA 2O9JA 4PFJA 3E0QA 5F21A 1GFWA 1FTWA 4LZJA 3BFVA 2E87A 4I1IA 2QL6A 3L4BC 4R9SA 1CLEA 1P2DA 1A8QA 5DV9A 2PMWB 1NVUQ 1NI4A 2E82A 3K6JA 4C30A 5JSZA 4ALNA 2JRCA 3ENNA 4OQ4A 1Z6XA 1O95D 4GOOD 5BQXA 2IS2A 1OFUA 1VL0A 1TQHA 4IIJB 4M9QA 1KSJA 3ROTA 2XOKA 4EA9A 3TNJA 1JKJA 4XJSA 5DI3B 4DCPA 4KMRA 1CNFA 1XSEA 5F4ZA 5LP6B 1Q0LA 4EHHA 5IUKC 3ND6A 1UP4A 4K2HA 2ZI6A 1ZP6A 2XUGA 3A6EA 1XRSB 4LGMA 2DM6A 3P71T 4FI3C 4EKDA 3AQ4A 3EG9A 4QTUB 4EMSA 1FJGB 5JWOA 1J9GA 1QFZA 1H69A 4CQLB 1ST3A 2PZKA 4U2KA 3ZWMA 1KP9A 2OQRA 4IF6A 4ZQEA 5J5VA 4RDHA 3U16A 3QKUA 2QYOA 2WTMA 5JNRA 4A7PA 2PAFA 2XKJE 3GXOA 1N2IA 2CNWD 4MR7B 3RD5A 1CY6A 5ICMA 4H4CA 5F78A 3AVUA 2OZPA 3DNMA 1MOQA 2CV0A 3OPMA 3S99A 4M1KA 1XZJA 4M49A 4IL5A 2ODBA 5DRTA 2DRIA 3DL4A 5A3VA 2OO3A 1QH0A 3FPEA 4P34A 5A02A 2FPOA 1MT0A 2P0EA 3GUHA 3O95A 4PW0A 1T0HB 5EMJA 3S4YA 2SECE 3WGUA 5JAMA 5JXIA 1VMAA 1QRAA 1ZC3A 2OZLB 4QT0A 3ROXA 4RHYA 1Y8AA 1N2CE 3I39X 1JFLA 3MWEB 1T2CA 3JYOA 1IVSA 2JK0A 1TVMA 2E5LB 1UJ5A 2VNIA 4MCIA 4QUBA 2JJQA 5F33A 2JIMA 1U3CA 4Y30A 3SQDA 5CFOA 4FD3A 2GJSA 1U3VA 3BXEA 3WJ2A 1KE1A 2GCOA 2Y3IA 4UPDA 3VR1A 3E03A 3D2CA 3ZNNA 1CQJB 5L4LA 3GAMA 3AP3A 4EJFA 2YV4A 3B7GA 3GJTA 1GADO 3KETA 1XD9A 1T5OA 3K9QO 3VR4A 4KKVA 4YAFA 5C1DA 2E89A 3JQFC 3I6YA 2R7NA 2AFRA 2RHHA 3NS7A 4IHQA 2QRNA 1JPVA 4RUKA 4RETA 1N5OX 1MMFB 3DBRB 7YASA 3X3HA 4PGGA 4TXMA 1XL0A 4LVNA 3ZVNA 2VHCA 4XB6B 2FSVC 5GOZA 1BWPA 1QV9A 2WNIA 4N7MA 2VTBB 1RQLA 2IU3A 1M34A 3P2JA 1U2GC 2QRPA 4MP3A 1D3AA 1CJBA 2AD5A 1NX6A 4RK6A 3T99A 3VHRA 3VTKA 4LYAA 1QC5B 4Y2RA 1C2YA 4HAOA 1DL5A 4JJKA 2VDQB 2Z8YM 1J0DA 1U1EA 4KQXA 1PS8A 1TVKA 2BTOA 3DMGA 3OO0A 5LZ7A 3HB9A 2JEZA 5KCMA 3VNAA 4C43A 4CBVA 2WKPA 3QE9Y 3B6JA 4PX5A 5G0TA 1HYGA 1N57A 3T5TA 2XV1A 3WB9A 5IC4A 3HKDA 1Q11A 1ULAA 1WQ3A 3PQCA 1TPZA 1K92A 3BWMA 3R9XB 1TM1E 4ODIA 4BFSA 4B2PA 3QLUA 2DR3A 1R7RA 1RLUA 2V0CA 4YCMA 1O8BA 3UFXA 3PXEA 4H7EA 3WKBA 2WFAA 3MLEA 2G67A 5IKMA 2XODA 2HRZA 3OD5A 2O5CA 3TDMA 1Z6PA 4DLPA 4TS4A 1LI4A 4ISBA 3NPMA 2IV3A 2DLCX 1WKBA 2BI8A 2YZ7A 4R01A 1X2EA 1VPLA 4C05A 1PQWA 1FQJA 2DWQA 2J07A 3K9BA 2V55B 1NDHA 1THGA 2UZ3A 4BKPA 1LRKA 1XA4A 2BKAA 4RZHA 1DZ3A 4WGFA 3WSVA 1JQEA 2PIAA 3C15C 3KOWA 2AGVA 3PFGA 1HA3A 4G2TA 2L2QA 3G23A 4KGZA 3S29A 2WRZA 4KITB 2W2VA 1CETA 1M2KA 3EPRA 3MS7A 1K27A 1F5NA 3TQSA 5CCEA 5CYGA 3GJYA 3GRRA 5K6AC 2GZDA 1PWZA 3FNIA 3G82C 5E0OA 5KYWB 1Q0TA 5U1PA 3H1EA 3U80A 1ISJA 1N5DA 3RC9A 1P1IA 1MHPA 2NU7B 4H3SA 2GD0A 4MGEA 2IHJA 5CVTA 2WZBA 2B9EA 4CMGA 4RA6A 2PRSA 5FUQA 2O05A 4X7RA 1Y8QA 5BNWA 2BDTA 3I12A 3L3BA 4IVPA 1GG5A 2XCIA 3DC2A 2Q2OA 2VYVA 2XTMA 3FHLA 5BSTA 1E3TA 1C7IA 1Z6GA 2F8MA 3D5TA 1FSPA 3ZKWA 4GYYA 4M0UA 4BOYA 1J90A 3RS7A 3ZE0B 4DZTA 4BEJA 5CA0B 3K3PA 3OLWA 5DTQA 5MN6A 1US8A 1TCCA 3GRVA 4N12A 1BS1A 4ZGBA 2IPMA 1L7BA 4RH0A 4A8TA 4URXR 2J3QA 3CZRA 4BNDB 1O8CA 1PF7E 5FFFA 4YX9A 5IJWA 1Q84A 2IEBA 1RNLA 5DWDA 3N8GA 3I73A 1E2IA 3GB9A 2FJPA 5E7QA 1I1OA 4OLAA 2A94A 3KUXA 4ZCSA 1FMTA 3M9WA 3OSUA 3ETNA 2I8LA 2REQA 2JRLA 3CLUC 1GPYA 4YP1A 3VH1A 3QVXA 5AMXA 4PZAA 4UHEA 4ZZIA 1UPCA 3OQJA 4GM0A 2WIBA 4TWRA 3GGCA 3OFKA 4REMA 4K6OA 2HV8A 5I7OA 4WCFB 5F73A 3SJAA 2X0IA 3OPQA 3U1BA 2WHYA 3PQDA 1XX6A 3O74A 4WECA 1BMTA 5EZQA 5EJAA 1Z56C 3VPFA 5ARCA 1A9OA 1Y1QA 4PHTA 3WK8A 5BWNA 3CUWA 4TMZA 4DCVA 4O5AA 2CXQA 4RWZA 3ND8A 3PQ2A 1Y6QA 3CR3C 1YJ5A 4PVDA 1PR3A 1TW2A 4RQBA 3UBMA 5KHLB 1X77A 3TMKA 3QF4A 3LW7A 5K4GA 2NVUB 2NADA 3D7NA 2XZTA 3KALA 2DHQA 4IP0A 5FWDA 1FDVA 5TMEA 1KU6A 5TMPA 4C7JA 3ZPXA 4DSUA 3P2IA 3G5TA 1UBTS 5AOVA 4CDGA 1XEWY 1YAJA 3R7SA 5HJ7A 2BKLA 2Y1DA 1P1JA 3HYTA 4PAQA 4PF1A 5EWLB 3TE6A 1BGXT 4UVEA 1D7AA 1ORWA 1IXSB 2M1XA 3DCJA 4K6KA 1I13A 5M5BA 1XQ1A 2C94A 1H1LB 1U3FA 3KZCA 3PNBA 4IHJB 2MINB 2A33A 3OOWA 1JT9A 2TMKA 1S96A 4N9WA 3D4NA 4CKWB 3RWBA 3L18A 1FQWA 2PL3A 4H18A 2EP5A 3AONB 1MB3A 2PUHA 3ADBA 2B21A 3B6IA 3L6EA 4R1UA 2AUMA 1ZCFA 4DM7A 3C41J 4MUGA 2LKDA 2H2DA 3RT9A 3I92A 4ZAYA 2BKVA 2QG4A 2XUQA 1XELA 5AVJA 1SD1A 3RE1A 5D3MA 3T3PB 5CDYA 4KLNA 3THWA 2FVYA 4QFMA 2X5KO 2ZSAA 3DZKA 1HL3A 4BIIA 1PJBA 4HADA 4J75A 4TMYA 3UAWA 2NO0A 3AI2A 4NTZA 3R0JA 1PJZA 1X13A 3S1SA 2BGTA 2X8WA 4UASA 2NUPB 4UM8B 3EEFA 4MZXA 5DHQA 2BOVA 1N2GA 4ZOLF 2NPOA 1C0KA 3ND9A 4LGVA 3VVMA 3KD2A 5CIYA 2VRCA 3WMGA 1DQRA 4MVCA 1XQVA 5AI8A 4CL8A 4R69A 4FCTA 4J7UA 4JOSA 2RGDA 2G8NA 2XXAB 1TTHA 3E18A 4KFTA 2Z4TA 3JYLA 4D74A 1EUYA 3KOUA 1H85A 3ZCXA 5AW4A 4MCHA 3VU1A 2A1UA 4OYHA 1FF9A 4BNHA 2QLFA 1SUWA 2O2YA 5EIBD 1YQGA 5AT1A 5IEBA 2IV7A 5B1YA 4J0GA 3EPHA 3KB6A 3OPYB 2AXNA 1RLJA 1A97A 3F6EX 1VB3A 3N9IA 4RXTA 1ZBDA 3QK7A 3KQHA 5FB3A 1WUHS 3ESDA 4O2AB 1G0NA 3NIGB 3ENKA 3QKRA 4GHWA 2OQIA 2D0OB 1A8HA 1E1RD 3W8DA 3WK5A 2VXCA 4K3UA 1W36B 1E5XA 4F06A 2V7BA 4KE8A 4NZMA 1OXMA 3EQ8A 1HE2A 1W4LA 4LRSB 4ZDWA 2HGZA 1SAYA 2E21A 1UKBA 2QTBA 2Z2XA 3IV7A 4XIFA 3WYAA 2CSXA 3OE7A 1A5ZA 4Z51A 5I51A 2WE8A 3PE6A 1RRVA 3P7MA 2JFOA 4J6FA 1H0RA 3RH0A 1NX9A 1XTQA 1CSEE 3FN4A 2VHZA 3JZDA 4M9RA 4YCNA 5UKDA 2FF7A 2LP4Y 3SLRA 2POQX 1ZCZA 5TR9A 5FORA 4EGFA 2O1EA 4U7WA 2MYUA 2I7TA 4JFRA 4ND6A 8ATCA 1B0ZA 4OQZA 4ZOQI 2XB6A 1ADGA 1IHXA 3O4GA 4KRFA 1SVOA 1I2CA 4QDTA 3VAYA 4X45A 3TVYA 3NHWA 4KYTA 3EHDA 4G0YA 1IHDA 4L9SA 4LKRA 3T5AA 2H1LA 1R8YA 1SIBE 3IMEA 4LOJA 4UU0A 5HILA 4O59O 1NUAA 3U7HB 3GT7A 1TA4A 1THMA 2KBFA 4LNUB 2YWEA 4CFZA 1Z7WA 1JA0A 3KTFA 3SCZA 3SC3A 3AJDA 2X2PA 4B17A 4CT5A 5KOIA 5BN3B 1RMQA 1Q1BA 1TF5A 4JKOA 3WJ1A 3DBHB 1MC5A 4K9RA 5LOVF 3QMWA 1E3WA 1VJGA 2GZ2A 3P52A 1W7AA 4TQGA 1V1MA 2EGUA 1AJEA 5CM2Z 2EZTA 3VPHA 3LT0A 3VR5D 1S89A 2PX4A 1VJDA 1KAGA 2UZ1A 3B3JA 3UXEA 3O7WA 1XXHA 5SYAA 3T94A 3V4FA 4BN5A 3EEIA 4E5KA 3FVVA 3GPIA 5AJUA 2AVNA 2NU8B 4JVNA 3MCTA 5KVQA 3AILA 5AW5A 3CR8A 3NJ8A 1S01A 5EQTA 3U3KA 4YAUA 1TNDA 3O8RA 2I9PA 2CT8A 1SKYE 4ZAZA 3PICA 4UHCA 1M0EA 4KLZA 5KYYA 1DTSA 2JCVA 1SU4A 2BISA 3H84A 1EGHA 1U0SY 2RHBA 1S8NA 2X5JO 2E37A 1GGEA 3CUTA 3OLVA 2JJ1A 4PSDA 5G02A 3ZDFA 1NBME 5JISA 2WTNA 1G6HA 1J25A 1TW3A 2NVBA 4CT0A 1AF4A 3T3HA 3V7UA 3TRIA 2RCNA 1N2JA 3E4DA 2K7ZA 2ECKA 3ELDA 1E2FA 1PX0A 5EP2A 4DR2B 2Y4NA 1F9AA 2HLDA 3FDZA 1CKEA 2WWWA 3TCKA 5FX2A 1SC6A 2X0FA 1IU9A 3MCAA 4U0JA 2DR2A 3FSGD 1LSUA 2EDCA 3EGDB 1N6OA 3KU1A 2P75A 1JDUA 1T3HA 4NY1A 5D3KA 1VHLA 3QUCA 4R2HA 1U5BB 4X00A 1KZ9A 3NBMA 2I62A 3CH5A 5FWYB 1I10A 4DSOA 3MCZA 4QO8A 1KI6B 4Q82A 4GD3Q 3H5NA 1E6UA 1XTIA 3UUFA 4B4UA 5ADUS 1II8B 1JJFA 3PNSA 3JWHA 3PC6A 4AQDA 1RYNA 2OQVA 1XXLA 2G36A 5E2AA 2ONCA 4H7FA 5BR7A 3Q8WA 3U7QA 5LJLA 1R0XA 5E2IA 3T12A 1N6RA 2HK9A 2ORIA 3ZE8A 4B75A 5J3JA 5FO0A 1TUGA 2IVFA 3HB0A 1KK2A 1XMIA 3ILHA 3MFYA 4RU1A 5IK2A 5K3DA 1UMBB 4PGFA 2ZSJA 4KZKA 2Y1GA 1Y6JA 2R8RA 5CCBA 3I6QA 4TROA 1P6UA 5JAOA 1NMXA 2R8ZA 2B8JA 3E7XA 1W8DA 4RPLA 1JSZA 1UBFA 4ENUA 4FIZA 2Q6IA 3T7SA 4NF2A 3L06A 4K6FA 2DLNA 4DJDC 3LY9A 2NP6A 2QAGB 3P27A 3I83A 4IOJA 4D3XA 4UVIA 2IY8A 3KKKA 3K1AB 4S05A 1VMIA 4YRMA 2OESA 3ODGA 3QTTA 3DEIA 4U7GA 4D9NA 3CKYA 1DIAA 4I19A 3DDZX 5ENDA 4Q5IA 4TWJA 4NDNE 3B5IA 5KUTA 3WRWA 3GHHA 3BXOA 4YMWA 3ZDDA 4MNTA 3C43A 2G5GX 1CUGA 3RSGA 3PUVA 5DSXA 4MGYR 1QFYA 3IKTA 4RMGA 2YQ5A 1G21A 4JLMA 1JNYA 3RYCA 3NV9A 4JFAA 3G59A 4QDXA 3GMTA 1U2QA 4MUNA 1UINA 2G4LA 2OEPA 1PT5A 5TPWA 3T4UA 3HCBA 3L79A 4ZHQB 1UOOA 2VG8A 2WOOA 3HY4A 1N78A 3P0RA 2PYIA 3KXPA 2Y0EA 5AKHA 4D9IA 5I8PA 4Q4CA 4OL9A 3TGPA 4ND5A 4H6WA 4MEJA 1VMKA 3B3GA 3WOVA 3AU8A 2SNIE 2DH6A 3QPCA 4DILA 1ADYA 1QAOA 5CLQA 1M3SA 4BCDA 5A0TA 2R5FA 3WQRA 2QN2A 2GDJA 2XR1A 3KAQA 1T8WA 1V7CA 1NW4A 4TKVA 1YHNA 2J9FA 3WLQA 4Z1MA 1XQYA 2QLNA 1CRLA 3EB9A 3W5JA 3DO8A 2P9TA 1PG0A 2GBIA 1CQXA 3QYAA 2ZRQA 2IYLD 1K3FA 2FKAA 3NC0C 1FIUA 4JYAB 5JZSA 2BEWB 3V7FA 1SVNA 4TTIA 1A9XA 1RSZA 4EEZA 1JIJA 4OATA 3EF3A 2D8AA 2MMCA 3FWNA 2P2LA 1L6RA 2JBAA 4DMGA 1N7GA 4IJKA 5D5HA 2DYKA 4B5LA 1O3YA 3DM5A 1XZCA 4HZUA 4O63O 4P54A 5DX8A 1UH5A 4GXRA 3SNKA 3LAWA 4PONA 3SQXA 2NZJA 4NCKA 1Z5OA 4IQGA 4D26A 1JNXX 1VE5A 1QB8A 1YQUA 1QNFA 2UV8A 3I4FA 3TZQA 5F1KA 4F3CA 2R8BA 3I42A 1DINA 5ITSA 4ARZA 1U0OC 1E2UA 2BC9A 2VHJA 3O3OB 3QGMA 1G0OA 4HC4A 5IBQA 2JGJA 2PMKA 3N8NA 2PS1A 4EFLA 1MG5A 3L0YA 4O29A 5TPZD 5ALWA 2O0HA 4XWKA 1SZDA 2J59A 2B61A 2VWGA 1L7XA 1NI5A 1SO8A 2QT1A 3AWDA 3HXKA 5P21A 3F96A 4AG5A 5ELLA 1R2QA 1UODA 2H7CA 3A6KA 1NURA 3C3CA 4XYEA 4YLYA 3ZD7A 4KYIB 1FJHA 4UDOA 1YA8A 1JHOA 1EFVA 3CF4A 4D9MA 1KBOA 4BLQA 2R87A 1J42A 3LF2A 5CFNA 1CUJA 4W5TA 1GU1A 1GO2A 2PYDA 2PT5A 1J7KA 2WWFA 3U39A 1FNMA 2ZR7A 4TYWA 1HE4A 2H11A 2E3JA 1TAUA 2Y1EA 5DH9A 4FN5A 4YYZA 1E8DA 4IJMA 2VSQA 2GEKA 2D0PB 2BJVA 2VI5A 2WG1A 4J16C 3EOBI 4NONA 4F56A 1UXHA 2P9BA 4F91B 4RZIA 2BEUA 4X0EA 5HW0A 4A27A 2WJYA 4BJ6A 2FGKA 4JP8A 5DP2A 1MKYA 1IUPA 1P5ZB 5ADHA 1XPUA 2VATA 3V3KA 4MS4A 1Q1GA 2MHCA 3KEMA 3VV3A 4M38A 4C01A 1JA9A 2GKOA 5FPQA 2C3PA 1ENPA 1Y98A 3N8HA 2B4TO 1LJLA 2IYYA 1PJ3A 2J41A 2BGWA 1YR3A 3LCJA 4FDAA 4JHLA 1IK6A 4ESOA 3EA5A 2P6UA 1OX4A 2HD4A 3HKEA 4GZ5A 1KWKA 3IX7A 1Z7YA 2EBHX 3TLZA 1YGYA 1XZNA 3COWA 4XE5A 3JVVA 2XVYA 3R6DA 3A8TA 1QFJA 3CRW1 4BASA 2ZWAA 1E62A 3THYB 5EINA 2IZ1A 1QH8A 4PY2A 2X5XA 4WFKA 2R5NA 3GY0A 1L1EA 3SBEA 3BQ9A 4F5WA 5HK9A 2J0UB 1HNXB 1WJGA 2R00A 3DE2X 4BMDA 3ZHYA 1L5QA 4M1SA 1T5BA 1PLLA 2ZTUA 1G3UA 1V5WA 2FMHA 1NVWQ 1NU8A 4YCSA 4YJFB 1P1KA 1JF8A