4EPXA

Discovery of small molecules that bind to k-ras and inhibit sos-mediated activation
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
170
structure length
170
Chain Sequence
b'GMTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas
molecule tags Hydrolase
source organism Homo sapiens
publication title Discovery of Small Molecules that Bind to K-Ras and Inhibit Sos-Mediated Activation.
pubmed doi rcsb
total genus 63
structure length 170
sequence length 170
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4epxA00
2ZTSA 4I1VA 1XNJA 1QRAA 2JLRA 4WZBE 4B74A 2ZR9A 2FGKA 2NQ2C 3CR7A 2HUPA 4WOPA 4JYBA 4IDHA 3NEJA 2J46A 3FOZA 3F3YA 1GG2A 1Z0JA 4WXPA 3ICEA 1Y3AA 2HYIC 4URYR 4Y0AA 4MITA 3AGQA 3NC0C 2QTHA 5DHFA 3ADKA 3TVDA 1ZYUA 4UNSA 2HLDA 2WMNB 1ZJ6A 1TNDA 2CLSA 3AM1A 1KO5A 1E9CA 2JLWA 1GNPA 2QP9X 4UKDA 1HQCA 1U2RA 3JVVA 3KJHA 4RKFA 1NL3A 1X8JA 1VG8A 3NH9A 4TYPA 2IYWA 4H1VA 1E0AA 1WBDA 2ASEA 2GVZC 4TLCA 2YWHA 1F5NA 1UDWA 1S0UA 1N6LA 4OL0A 2Q3MA 4DVGA 4ZI2A 1UAAA 5GJWC 1FPMA 2CHGA 3DDCA 3ZH9B 2V8OA 5GVRA 2ZREA 2RGCA 3CZQA 2C04A 2FWRA 1BKDR 1N6IA 1N6PA 1UKVY 2ODBA 4NCHA 3GJ6A 5KTYA 1NY5A 2FJUA 3X1WA 1RE0A 1CR4A 4O2RA 5DI9A 4B32A 3OIUA 5DI3B 1VCMA 3OIVA 3IO3A 4QC2A 2Y8EA 4R9UC 1YJ5A 1YZKA 3NHBA 1QVAA 2HYDA 2YV5A 1ZM4A 3K9GA 4TL6A 4GT1A 4IOMA 3B6EA 3OE7D 2WM9B 1U9IC 5EJEA 3U3MA 4YMTA 3QJYA 4DZZA 4B3CA 4TTPA 1G7SA 4ZCIA 4M21A 2WSSD 1FP7A 2ODEA 1T5IA 2YOFA 4RD4A 1CJMA 2GBLA 1IJEA 1OLOA 3CWZA 3GLIE 3G82C 1VYVA 5CYOA 2O8EA 2HJVA 1YZGA 2CE2X 1E2EA 1G7RA 3AF0A 1KJYA 3AVUA 5CB8A 3K9NA 3RRMA 1QHXA 1YKSA 2OXCA 3MCAA 3MMPA 3QXXA 2C99A 5F2EA 3K0AA 2LKCA 2QA5A 1IN8A 2VSXA 4OQNA 4ZCMA 1CBUA 1OXTA 4DSTA 3JVUA 2QEQA 3ZYCA 3EAQA 2YHSA 5IDVA 4N3NA 4DLVA 4KO8A 4TMKA 2FV8A 2IX3A 2RB4A 4F4IA 1S1CA 1XZPA 3TUJC 1N0VC 1T91A 1MR3F 1E94E 2ZRKA 1Z06A 2QRZA 1JPJA 2V9PA 3NBYC 1KY3A 4LJ4A 2J41A 3VKGA 4B76A 4ARZB 1HUQA 3RC8A 2V7QA 1R0XA 2VHQA 1COWD 1Z0AA 1JAHA 1EG7A 3DKVA 1S1MA 1X86B 4HB0A 1R4AA 4BZQA 1CEEA 1GWNA 2K5UA 3D3QA 1W0KA 2WWFA 5JHHB 4TL9A 3RS3A 4E07A 1Z22A 4AYWA 1Q44A 3QVUA 2ZJYA 4BRUA 1F2TA 3B1YA 4FMCF 1CJUC 1N5JA 1Z6XA 5CLQA 5K8TA 2VF8A 4Q1DA 4BFUA 2CEAA 4RD6A 4BWYA 1FNMA 3H86A 5FUYA 3K0CC 4MQBA 1HH4A 2FOLA 3RWMB 1OIXA 2I1VB 4Q4LA 3DVLA 4QFMA 1VIAA 3AQ4A 1BMFA 1JR3D 1E2LA 2C95A 1D8TA 2AX4A 2WTUA 2UKDA 3D31A 3FGNA 5EP3A 4JVLA 4QJ4A 1XXHE 3AUYA 3P32A 2N46A 2BCJQ 2HEIA 4PO8A 4DBLC 5FBRB 1XPOA 2OLJA 4IJMA 4IRUB 3QKSB 4TSFD 5L8VA 3MLEA 3GLIA 1SHZA 2FE4A 1OB2A 2QENA 3NTUA 3DL0A 4TMTA 1UBEA 4D80A 1PLKA 1Z08A 3OAAD 3EZ2A 4EPXA 3GLFE 1WP9A 2OFOA 2VA8A 4RSGA 5IF9A 1OH5A 3C4JA 1NLYA 3HYTA 1Q21A 2CJWA 3NBFA 4B3XA 3KKNA 1XPRA 3GFOA 5KSYA 1G18A 4M53A 4F4CA 1OKKD 4KSBA 2IYTA 4NCNA 2LCFA 4AKHA 1QHYA 2W0SA 2G9NA 1GDDA 2WOOA 2QPAA 2GTPA 3KXIA 1EESA 5FPKA 2UZIR 4HLUA 5KHOC 5G3YA 4KFTA 521PA 3ASYA 4LPKA 4BZPA 5JI3E 4IEEA 2F1RA 3EZFA 2P3SA 1ZW6A 4P33A 1KI2A 4XVRA 3W3AA 1MH1A 4EJSC 4KFSA 2EFDB 4LBYA 2IYUA 1OPXA 2RGNC 5C4GB 2QQ0A 4LCBA 4MGYR 1ZNYA 3KKOA 1VECA 2SHKA 4PC2A 4AK9A 2DFNA 2JCSA 1X1RA 5FPHA 4DCNA 8OHMA 1DADA 1XEWX 2A78A 1Q1ZA 3TK1A 3I3SR 3BWDD 4B34A 1U0JA 4KBFA 2ZYVX 2YWGA 1II8A 4FMDF 2O8CA 3U44A 1OHHA 3AVXA 1XMSA 1XWIA 3UWOA 4RFSA 4WIAA 1KI9A 4HUQB 4M1TA 3E5HA 1E69A 1N3BA 2ZE7A 2GF0A 3KXLA 1M8PA 4MUAA 4DLRA 5C18A 3HPQA 1R8QA 4MGIR 2ZEJA 1O87A 1OXSC 1VYTA 3K0FB 1EFHA 1YZLA 3CNNA 4BUJA 5EXXA 2PLRA 3FMPB 1PVOA 3K9LA 4FIDA 5BYKA 1UBCA 2PJZA 4XVUA 1W36D 2ANBA 1F3OA 1SKYB 4HSEA 2NIPA 4LBVA 1OXUA 4D4LA 2IS2A 5DGXA 4M1YA 4LC1A 4UXIA 4XIGS 4HLUC 2XSZD 4TWZA 4CEIA 4BRWA 4QGGA 4B44A 4DIEA 2GZAA 3HU2A 4KCGA 4NCJA 5JJLA 3HR7A 5HCIA 4QKQA 1M7BA 3HDTA 3WP0A 4URUR 5AJVB 1G3UA 1X1SA 5E7JA 4ZIRB 1LB1B 5KNBA 1P73A 3PENA 4Q00A 1DVRA 3GP8A 3W9YA 1YZNA 1NG9A 2O8BA 3U7EB 2RCNA 4GMXA 4M1WA 4US2R 3RS5A 1XPUA 4YXWD 2IXEA 1ZIOA 2R62A 2OESA 2ZE6A 4MYHA 3ONWA 3LW7A 4Q9KA 4MYUA 5FI0B 4ZDIA 4V0KA 4G5QA 3WHLA 1YR6A 4OJKA 5CITA 3Q85A 5JMTA 1XF9A 4IDPA 3BH7A 4LJ9A 3ZZUA 3PEYA 1N6OA 2BCGY 3CX8A 1D5CA 5BWMA 1DARA 5HCNA 2C5LA 2OLKA 4PR0A 1V43A 1ZRHA 5KPJA 4Q5IA 1IM2A 1E32A 2VRWA 2J87A 3H1TA 2OCBA 1KI4A 1Q3HA 4ZCLA 3BGWA 4FWTA 2QQEA 3KXKA 2EW1A 3EIHA 2RGXA 1CR0A 1M6NA 2NTYC 3ZLJA 5KYKA 1KIMA 2W6JD 2AN9A 2HT6A 1I2DA 3A37A 1GKUB 4PHGA 1M1YE 2IC5A 3N5CA 3T5DA 4S35A 4D26A 3UATA 3CPEA 1E9EA 2X19A 3U60B 1E79D 5H1YA 4CF7A 1G8HA 3LFUA 3TH5A 5UKDA 1T6NA 1CLUA 1SVWA 5KDOA 3RVBA 3C8UA 5J5CA 4B6EA 1SQ5A 4NYMR 3WP1B 1E9RA 1CR2A 2Z0MA 5DNYB 3DZDA 2R44A 1OFUX 2ZRNA 4ERNA 1NBME 1CJTC 1JBKA 1VKJA 4Q9IA 1X8LA 1G19A 3SBEA 5C1BA 4PQRA 1RYFA 1KDPA 3D8BA 2HXYA 2ZE5A 3IILA 2OCPA 3PXGA 4ZDWA 4M22A 2QPOA 1JJVA 3CX7A 3UANA 1W44A 4RD0A 821PA 5HZHA 3B9PA 3A1WA 1S9DA 3TNFA 4KYIB 1KY2A 3R7WA 3QF4B 3GLFB 5AJXA 1W2GA 2XNDA 1P9NA 2XX3A 2ZRIA 3L0SA 4HZUB 3IQXA 1KI6B 3I8XA 3IUYA 4PFSA 3WBJA 1KI6A 5JCZA 3W8RA 4JBWA 3TW8B 4DUGA 3QKTA 1P3JA 4Q9HA 3QG5A 2VYFA 4DEYA 3UG7A 3TR5A 2D74A 3VFDA 3I61A 3EARA 1R0YA 4OQFA 3FPAA 1T8TA 1FZQA 1BYUA 3W6PA 6Q21A 4TYNA 2VPPA 2J0VA 1XD8A 3KQHA 3QE0A 2CMKA 4IDNA 4LRWA 5BN4A 4I1OA 1KOFA 2BJWA 3SFVA 1BYIA 2OE2A 3RDPA 3QKRA 5KUTA 2C77A 2FSIA 3BBPA 3CBQA 5EUMA 2YINC 2WWIA 2OAQ1 1YQTA 2P0EA 2QBYB 3E2IA 1Q12A 2DFLA 2GCOA 2GJAA 1QDEA 2IS1A 1PLLA 3SNHA 4AKIA 3VKWA 2V3CC 2HDNB 2HCJB 5CJPA 1NMZA 3EA0A 3S1AA 2Q0HA 2XZLA 1GUAA 3CB4A 1RRFA 3BH0A 3JZAA 4G01B 4LJYA 4PTLA 5TVKA 2PBRA 3RAPR 3NC1C 4IHQA 3THYB 1GNRA 1OIVA 4PHHA 3UMRA 4XWOA 3NHAA 5EP1A 2G3YA 1E1QA 2OG2A 3TSZA 5JWOA 1KAGA 5E95A 1CJVC 2ZR0A 3TUIC 3L8YA 3CF2A 1T0JB 4QL3A 3B13B 2EVWX 3CPHA 1KKMA 1L4YA 3TRFA 5HKKD 1CF4A 2HV8A 1VTKA 1Z29A 2R6GA 4S2EA 4TLBA 5C46F 2GXAA 4GOJA 4M2LA 1EFRD 2BDTA 2PEYA 3PV0A 1JEEA 5AUOB 2GZHA 2FFQA 2VTKA 2O8FB 4JSYA 1DO2A 5FL7D 3ZZ0A 3LXRA 1L7VC 4UNNA 2GF9A 3T61A 4AY2A 1W4AA 2V54A 2ZYWX 3FTQA 3K9HA 4JT4A 2IWRA 3DKPA 1CULC 4D0NA 4DSOA 4WBSA 2O8BB 4MA4A 4TMWA 3TJZA 2WIAA 5EQTA 4CW7A 3QKSA 3OIWA 1ZNWA 3QSYA 3GLHA 1WB9A 4F4JA 1K8RA 3ZGXA 2WZQA 1NN5A 3EASA 3EC2A 4DT1A 3ZJYA 4C0LA 1US8B 2ZS9A 1KO7A 1Z3IX 2QMOA 1FTNA 2HJGA 4O3MA 2VP0A 2GDJA 4AKGA 4PXAA 3BD9A 5B58C 4P31A 4BLRA 4ESHA 1E0JA 2VHJA 1A2BA 4OHWA 5DH9A 3FFAA 4YONB 3CRMA 5DSZA 1QHNA 4NPHA 5EE0A 5TB5A 3UG6A 4B75A 3I5XA 2CXXA 2QU8A 3GEHA 4D4MA 3ZIAA 721PA 1VPLA 4YMWA 4DSUA 1UBGA 2J3EA 4JS0A 2FPLA 1E6CA 3DO6A 3M6AA 4D81A 3B60A 1KSHA 2BMEA 2QGZA 4QOSA 3PUZA 3W34A 1M7GA 1E9FA 4NCKA 2GEVA 3BOSA 2VHCA 3TQCA 1GKYA 5F9FA 3GJ0A 3PUVA 4Q03A 4IOJA 3UMSA 1P4SA 1W0JD 3GCGA 1XRJA 2WJGA 4RKEA 2CLCX 1KK1A 4QHYA 2BKEA 4QJ5A 3U6KA 2D7CA 4EDHA 4GPTA 1CIPA 1ZD8A 1D9XA 3EA5A 1QHIA 3F8TA 1XTQA 4L15A 2XXAB 5H68A 5LDDC 3LWNA 3THOA 1UKZA 4Q02A 5AJWA 2HT1A 4Z51A 1Z0KA 4IOLA 4G5RA 1P5ZB 2FF7A 1K5GA 4LHVA 3SJBA 3VHLB 3BRWD 3RC3A 1P75A 4MKFA 3A8TA 3ZDQA 3PJRA 1WCV1 3BFXA 3KUCA 1GM5A 2BIFA 4W5WA 3KFXA 3L0OA 1W4BA 2X77A 1FUUA 1WRBA 3MAAC 4GI7A 3RYTC 5JWRA 2XNSA 2GCNA 5TV2A 2WPDD 4Q7JB 5HZKA 1G3MA 4LOAA 1ZM7A 1YR9A 2R9VA 2GJKA 4CT5A 4CEJB 3QY0A 2CNWD 4QHTA 1H8HA 4GZLA 1JNYA 2RGDA 1ZM9A 2BVNA 4QHSA 4FI3C 5TDHA 3ZVNA 4TT3D 1TL7C 3HYRA 4HAWA 3NWJA 4GRAA 2H7VA 1OV4A 1WDTA 2CLDX 4G0NA 3PVSA 1EX7A 3IBYA 2B21A 4QBGB 1NF3A 1KSFX 5B2ZA 1SVKA 1IN5A 2GXUA 2ONJA 3RS4A 1X6VA 5FTMA 1FX0A 4BFSA 1TQ4A 2DFTA 3BJIC 2P6RA 3CRRA 5JSZA 4QG7A 1LFDB 2ZI5A 4C2UA 1HEIA 2QNRA 4TTRA 1UF9A 4EQ6B 3C5CA 2FEMA 3B9QA 5LBIA 1E2PA 3FB4A 3CRW1 4GNKA 2UZ3A 2XTNA 1NVUQ 4UXHA 3SEAA 1NN1A 4DUGD 4LC0A 2PJRA 1G3IA 1T5LA 2IYVA 1XEXB 3P27A 1G5TA 1G8PA 1MKYA 1R5OA 3EC1A 1TADA 2ZUBA 3PQCA 2EYQA 2G1KA 4QM7A 2FSGA 1XB2A 4FMDB 1XD2A 2CK3D 3GJ7A 1TEVA 1XZQA 3WNDA 1F2UA 4OI2A 1ZCAA 4PAQA 2ZUDA 2ZPTX 3OFND 4P4SB 1OHHD 4CDGA 1SVOA 1XX6A 2VL7A 1Q1QA 4MKHA 3NKVA 2QE7A 4BEJA 4PAOA 5TY0A 2Q3FA 2UVQA 1Z83A 4LJ8A 2JLYA 3IIKA 1ZP6A 3R9XA 5L3SA 3V4FA 4JLJA 5AUNB 5LPNA 5JEEA 4X8HA 5TARA 2V1UA 4ACBA 3PG5A 1U81A 3LLUA 5FR1A 1JAIA 2C03A 2ORIA 3U3RA 2VF7A 4DCSA 4AG6A 1OJLA 3SS8A 4IEIA 3KQKA 1GILA 2F3RA 4HAZA 4JVSB 4JT2A 2FZLA 3U5ZB 2ZE8A 5E3HA 5AJYA 4HI0E 2GJSA 3PR1A 3UXMA 1NKTA 4PZZA 1M2OB 2Q9BA 4D82A 4HDQB 1GIAA 4O0MA 2BMDA 2H92A 4D4KA 1N5LA 3TGPA 2BEKA 1E0SA 2ZYUX 3VR3A 1EK0A 3WXMA 4C7OB 4JIMA 2GCOB 4JVMA 4FXPA 3TAHA 3MWKA 1R8SA 4D2IA 3K70B 2BBOA 1R2QA 3AB3A 1E4VA 5L3QA 3HWSA 3GLGE 1T3HA 4PC7A 3L2OB 3B1WA 3RS7A 2J1LA 1II0A 2C8VA 1CRPA 4DDVA 2YWEA 3IPXA 5FOTA 3QG1A 2ZSFA 3AP2A 4MRPA 1ZMXA 2IUSA 1G9XA 3B8HA 3IBGA 2JDIA 2YOHA 4JMPA 2BHRA 2WKPA 5IRCD 2G77B 2REOA 3LNCA 3GFPA 4CZ2A 2QP3A 1TU4A 2FNAA 3WNBA 4BEBA 1DAEA 1WA5A 1W36C 2WWYA 2W2VA 2RAPA 5BW8A 3VNUA 1DBSA 5FOUA 4EPVA 1RZ3A 4IOKA 2IYLD 3QOFA 2AR7A 1P2TA 4XWKA 5KO2A 3LBIA 1G8YA 4V0OA 4NU0A 5GVSA 2QT0A 3DEFA 4LBWA 1A82A 3SC3A 3TMKA 1W1WA 3KKQA 2YNMA 3VHXA 1BO6A 4GMDA 5FPSA 3FHTA 2VBCA 2ZSEA 1DAHA 1GL6A 3AVPA 1SGWA 3TIFA 2O8DA 5KNCA 2P6NA 1ELOA 2MSCB 4W7SA 4Q4AA 3VU9A 2A30A 1WE2A 5IK2D 3H0KA 1LS1A 3TQFA 5KSZA 3KTAA 2IXGA 3HR8A 4L5BA 4LJ6A 2Q6TA 2AKYA 1YRAA 1D2MA 4BLPA 2BBWA 4MKGA 2F55A 3M4YA 2O8FA 1ZIPA 3UWKA 1S8FA 1SVLA 2V6IA 3AVVA 2QTVB 3Q72A 4QBHA 1OH6A 2J59A 3NDBB 1XEXA 1LF5A 5AWFC 1FOEB 1FMLA 3P1JA 4P3YA 3C7KA 1W4CA 1XJCA 2ZU6A 2O0JA 3V4RA 1EWRA 3FE2A 4M9XA 3ZQ6A 3T15A 3CPJB 1EWQA 4KVGA 2R2AA 3VMFA 3PFIA 4AURA 3ZD6A 4MYTA 2J0UB 4HUTA 4FCVA 1HYQA 3C15C 3GLIB 4BGDA 1GZSA 2QRNA 2FU5C 1XBTA 4C3ZA 5JZVA 4A6PA 3CRQA 4YMSA 4B71A 4PQFA 4D25A 5DIFA 1G4UR 4B6FA 1G5PA 3WNCA 2A7QA 1ONBA 2XSZA 4LSGA 421PA 1U8YA 2BWJA 4DSNA 3L0PA 4D0LB 2B7CA 4TT3A 3LX5A 1Z63A 4QRHA 1C1YA 1NRJB 4Q7LA 4WAUA 4AWXA 4A0RA 2DWOA 4Q18A 2OT3B 4A4DA 5KPDA 2HF9A 2CDNA 5BQ5A 4LHXA 2JATA 4MDFA 4A8JC 2CJWB 2WAYA 1XJ0A 1Q1EA 2L0XA 1EFCA 1EGAA 1UEIA 2X8AA 4FINA 4LYFA 2NO0A 1FFHA 2H8KA 3QPWA 1JQJC 4LZZA 1IN6A 3LQRA 3TAUA 2W2TA 1I2MA 3CH5A 3D7MA 4I1SA 4NL4H 4C0JA 1XTIA 2R6DA 3BC1A 3VKHA 3BK7A 3U3JA 2OAP1 3CWQA 2XXAA 4X8LA 4CEIB 5EXTA 1F6BA 4PC3A 4GBMA 1W5SA 4XD7D 1T3LA 4NP6A 4NDZA 2JLZA 4HZUA 1GKIA 4A15A 2OCYC 2YC2C 4RZUA 4B73A 1HE8B 3PCRB 3RWOA 4OBEA 2DYKA 1N0UA 4LGMA 3MRSA 3V9PA 5CYPA 1U99A 3TBKA 3BXZA 1TUIA 3IPYA 4O2LA 1N5KA 4FCWA 1SXJE 3MUFA 1G41A 2QGNA 1GP2A 4XSHA 1XTKA 3SQWA 4B3GA 4YXWA 4URWR 4KFRA 4DB4A 3Q7PA 4WA7A 1IN7A 4EPTA 1KSJA 1EXMA 3OFNA 2NPFA 1BIFA 4X8MA 2XTMA 5A4JA 1P9WA 5CDFE 5DI3A 3RABA 5FL7A 2ZRGA 5CLLA 2Q9CA 4B2IA 2MMGA 3UKDA 3TSOA 1G6HA 3QEOA 4Q4HB 4QGHA 1E2FA 1GVNB 1TQ6A 3KJEA 3NEYA 4A0GA 1KZGB 2O5VA 3CF6R 3B1ZA 3FMIA 2BM1A 1UEJA 1SVIA 3EWAA 4LV6A 3SU8A 4AC9A 1LS6A 2WHXA 3QBVA 4KLZA 2C78A 3GLHB 3B1XA 1RW4A 1DAIA 2QZ4A 4K8OA 3WY9A 2OEPA 2OUKA 1AZTA 1LVGA 2LKDA 2QG6A 3KQUA 2FMXA 2P5SA 4M0LA 2F1HA 3A1VA 3O8BA 2I3BA 2CK3A 5CIWA 5L3VA 3SBDA 2W6ID 1E3MA 2QN6A 1XMVA 2D3WA 3AH8A 2Q3HA 5G3ZA 4C4PA 4DJTA 5FOWA 1J2JA 2R8RA 3QXHA 1SKYE 3U4QB 3BORA 3LY5A 4NONA 4Y0VA 1WQ1R 3OIYA 3FHOA 3GJ3A 1OXVA 2OILA 1JXOA 2WSMA 4OJQA 2YC4C 4C0AC 2OCAA 3UPUA 3AF4A 2F9LA 1DAGA 3CW2A 3QXCA 2D2EA 3F5FA 1Z0IA 4DLZA 2NMVA 2ZRMA 3KFVA 1Z07A 1U0LA 4KXFB 1A7JA 3TE6A 3FKQA 3VR6A 1KMHA 4QGAA 1HA3A 2BM0A 5EZ6B 4Q19A 2F9MA 4TQ9A 3UK6A 3QENA 1W5TA 3CNOA 3Q3JB 3BE4A 3QPVA 1E2GA 1E1RD 1HT1E 4RVCA 5E7IA 1WXQA 2H1LA 4N0DA 3O47A 1ZD9A 4PANA 1B23P 1HE1C 2JIZA 3T06B 4R2IA 3TLXA 4KAXA 5JS7A 1G7CA 2IBMA 1N6NA 2ZJBA 4OI0A 3ZQJA 3MJRA 1QHGA 2ZRFA 2CNWA 2WJIA 4GFDA 1WBBA 4TZ0A 2EFCB 5H70A 2VIIA 1N0WA 2VP6A 3KL4A 5ELXA 1AA9A 4HAUA 5LB4A 1KMQA 2F1IA 2ZJAA 4FWIB 1GRNA 2F43A 3RSOA 4BZXA 5CB6A 3BB3A 1KDOA 1D2EA 2GILA 4LJ5A 3WYFA 1KO1A 3AF2A 3M1IA 1E2QA 2WKQA 3IEUA 2EQBA 1TU3A 4TLAA 4ZV4A 2D4HA 2ANCA 2AK2A 2QORA 3BFKA 1Z6GA 2W58A 3VTKA 4PPFA 3B7GA 4FD2A 4AIIA 4AD8A 1XP8A 4V02A 3AP3A 3I92A 4TQAA 1NVWQ 3I8SA 1S4QA 1SXJB 4FCTA 4M1KA 3EPHA 2F43B 3A1UA 3LVQE 2JLSA 4P4TA 2IYRA 3EPLA 1BH2A 3EIQA 2H17A 2DBYA 4PO1A 1VCNA 3U7FB 3FDIA 1TEXA 5J40A 1E9SA 4H1UA 1MO4A 1AS3A 2DR3A 1J7KA 2BOVA 5CM9C 2E1RA 3C41J 5JWHA 4IVPA 1XD9A 1T9HA 3CH4B 3K0FA 2REXB 4NYMQ 1GRRA 4OHYA 4Q21A 4XTRA 1N25A 5EZ5A 5JFGA 5JRJA 5JJIA 2FDCA 3KQNA 2XEXA 2WAXA 2N1BA 4F91B 5IHPA 4V03A 2YVUA 1BMFD 3Q8XB 4OHXA 2QSYA 4EPRA 3SHFA 3W8NA 1E99A 4LPSA 3HJNA 3U2QA 2YZ2A 3HU3A 3KTAB 2Q9AA 3KB1A 1VG1A 1BOFA 2JGNA 1VHLA 2GKSA 1EX6A 1SKQA 3CLVA 2FX3A 2PT5A 3CRVA 2OBMA 3VNVA 4UNPA 1CR1A 1U98A 1D9ZA 2PMDA 3RSLA 3BAFA 3ECCA 4DLYA 2KE5A 1V5WA 3IGFA 3SDZA 5JEDA 5J4VA 1G8GA 1U90A 4KHZA 2MSDB 4OK3A 3ND8A 3ZD7A 1M7HA 1Z0DA 3A58B 3AEZA 4UJ5A 3A4LA 2EU8A 2PZEA 4Q47A 1MO3A 4HB2A 3BB4A 4YC7A 2A5DA 4FMBB 4P4SA 1GL7A 3VR5A 1FUKA 1G20E 3TVTA 3SN6A 3LBHA 4I1UA 4TL8A 4DWJA 1H8ED 4ZIRA 4TYWA 1RVDA 3SI7A 1N6RA 4M8NE 1IXZA 3TR0A 3O8DA 2O8DB 2VO1A 4UQOA 2DWPA 2WWXA 5CK5A 3U6BA 1TMKA 3TW4A 3O8RA 1KHTA 4DCTA 4XD7A 3LX8A 1RIFA 1SULA 5FTKA 4AKEA 3P4XA 3QXSA 2Z6VA 1W46A 1KJZA 5EE1A 2GVDC 5HR5A 5F3WB 2ZI4A 2DHRA 3SOPA 2MSEB 4DDWA 5KNDA 2ZRAA 5AK0A 4Z54A 2EWWA 3AF3A 3R20A 2C2HA 4F93B 4ASUD 2CHVA 2DCUA 2QM7A 1L2TA 2OFXA 1PZNA 4NZYA 4WZAE 1GSIA 2I4IA 3KB2A 5BXQC 4XWAA 3RRNA 4Q66C 2A5YB 4QBFA 4MGZR 4Q1FA 3A36A 1FX0B 4A6XA 5KDDA 5JCPA 4RZ3A 2QAGB 2FPKA 1XJQA 1Q57A 2OSBA 4V0ME 3EPKA 1RC8A 5K8IA 4B47A 1D2NA 4V0LA 1OE0A 3AKYA 4GDFA 2QROA 2IF2A 4D4JA 2J7PA 5JS8A 2CCKA 5CK4A 4BFXA 2OZEA 2R6FA 2YWFA 1TF2A 3U3KA 4U7DA 3T1VA 3EZ9A 3FFBA 4UNQA 4HATA 4RD1A 2JASA 3GPLA 4M1MA 4KITB 2OBLA 4MRSA 1AKEA 2W00A 2WWHA 4NTZA 3GJXC 5BN5A 3B5JA 2EFEB 3AVQA 2H16A 1W36B 1K6MA 2ZUCA 3C16C 1KK3A 1JR3A 3LD9A 1CJKC 4Q4JA 1A4RA 1DAKA 2JA1A 5K8LA 1ZM3A 2O0KA 2AKAB 1MABB 3F0TA 1Q20A 4DKXA 5J47A 2ERYA 1J99A 2IYXA 3DMDA 3AVYA 3X1XA 4B35A 1ZUIA 1N6KA 2ZJOA 4TTQA 5AUQA 1P7CA 5FUXA 1XMJA 3IKJA 4HUQA 3AVWA 3R7WB 3GLFA 4JKYA 2BC9A 1YE8A 1I4TD 1Z6YA 5HE9A 2HF8A 3ZS8A 1IAQA 3KJGA 1KNQA 4ASUA 2IUTA 2VQSA 1Q22A 3V00A 4MRRA 2XB2A 1NIPA 3R9WA 2Z43A 1RRGA 1UM8A 3ZVLA 3GLGA 2PX3A 4RZ2A 3RS2A 4C7OA 2RGEA 1O3YA 2JIZD 2OHFA 2R65A 1NLZA 4PZYA 3PITA 5D3QA 5EUQB 1IJFA 2BJVA 5KU1A 2O8EB 2IEZA 4PZLA 2HXSA 5FTJA 1AS0A 1OYYA 1G5RA 1PUJA 1Z2CA 3OEHA 3OHMA 3FWYA 3DZ8A 2FSFA 2P5TB 4IVQA 3I72A 2GETA 4A1FA 1GOTA 1ESMA 3CONA 4L9SA 1ZU5A 1AQYA 3FVQA 4CEJA 3GEEA 5DLQC 4ZKEA 1XFAA 4POAA 4DLTA 4Q9LA 3N2IA 4ABYA 1JPNA 4J0QA 3WMGA 3U4QA 4MH0R 2AHOA 1AZSC 1KK2A 1JXMA 3X1ZA 1OSNA 2XAUA 3M0EA 5GADl 2GA8A 3L8ZA 4KYUA 4JLDA 4DC9A 2VHTA 4BECA 4LK2A 3A1SA 2ZRBA 1DG1G 2E9SA 4R2HA 4B43A 2QAJA 3IIMA 4IDQA 4JLPA 4R98A 3QEJA 1J8MF 1JI0A 2IHYA 4CT4B 2FG5A 4YMVA 4URVR 1RKBA 2CVHA 2A9KA 1MRSA 3NIBA 3ZZTA 1OW3B 1XMIA 4BFZA 3I73A 3LLMA 4DCUA 2MMCA 1VYUA 1TQDA 1AGPA 3H2YA 3TKLA 3KQLA 3OEHD 3CKLA 2VP5A 1HQYE 1YR8A 4RZXA 4B3FX 3LDAA 1QBKC 5FOVA 1RYHA 3RANA 2PMKA 4P32A 1RPZA 2WSSA 5CJ2A 4TMZA 5JSZB 4GOKA 1E4YA 2ZR7A 4KVAA 4BFYA 2ORWA 4F92B 4G5GA 3DOFA 5D3MA 1CU1A 2PX0A 5B30A 3ZS9A 3MGCA 1NBMD 3QKUA 1RRPA 2W2XA 4NE2A 2ZSBA 5JI2E 5B57C 4JLMA 221PA 4YDSA 2OO7A 621PA 1J8YF 1S2MA 5FFMA 3EW9A 1S96A 4LWZA 2KBFA 2QAGC 5DN6D 3LVRE 1FP6A 1PLJA 1T4GA 2GZDA 1G64A 4ESVA 5EE3A 1R0ZA 1JR3E 1HTWA 4LYJA 3IDQA 2R6CA 3R8CA 2WMOB 3QUSA 2J0SA 5BYJA 1KYIA 1GITA 2H18A 2G83A 1XCGB 2ZQ5A 2ZI6A 5CDFA 2C9OA 4V0NA 1DAFA 4K46A 3T12A 1GNQA 3MSXA 4RFSB 1NJGA 4GOXA 1DO0A 1LF0A 2WV9A 4PSVA 1HURA 2I1QA 3QF7A 3I62A 1TF5A 1KI8A 4JBYA 2D62A 1JEDA 4BLSA 1ZU4A 1TTTA 4TSFA 1MOZA 2ZAOA 2D7DA 2JLQA 1ZCBA 1CRQA 5FBQB 1E1QD 4KFUA 2KBEA 3K09A 2VP9A 4W5HA 4A2PA 3B2EA 3BS4A 2J45A 1NKSA 2AXNA 2OBNA 3KJIA 4O25A 5FPTA 3T1QA 5K8UA 5FOSA 1P61B 1NLFA 5L3QB 3VR1A 4DT1B 3K0SA 2FEOA 2ATXA 1H65A 5HKKA 4OK5A 1W48A 1US8A 4PSKA 1UADA 2R6AA 4PX9A 3LAWA 4BFTA 1IN4A 1QZXA 1IHUA 2ZS8A 3SHWA 1E1RA 3CF0A 4Z1MA 1HT2E 1AQUA 1U9IA 2QY9A 3B85A 4TMXA 5J4HA 1T3SA 3BERA 4MYCA 2J0QA 2VH5R 4D0GA 2AD1A 4EAQA 4XTCS 4EKDA 2GBLC 2ZRJA 4CRWB 4TZ6A 4NYIQ 4OI4A 1QHHB 4P0TA 3LH5A 1QHHA 5SZKB 3ADBA 4QGFA 4W9MC 4EUNA 1F60A 2FGJA 2JJ1D 4OQMA 4II7A 4JKIA 4BE7B 4Q1BA 1ODFA 1ZNZA 2VSOA 3BH6A 3PEUA 5EXSA 1NVVQ 4ZO4A 1S3GA 1KNXA 1W2HA 3WYAA 2FFHA 4JBXA 4DEXA 5J4YA 4HZIA 2GJ9A 4ACAA 2AFHE 2CHQA 2XOKD 4RD3A 1G3RA 1E9BA 5M04A 4QM6A 2V55B 4DXAA 5FL3A 4E22A 3VR2A 2A3RA 1HV8A 4LYHA 4Z1MD 2X1VA 3K0CA 1YZQA 5FBWB 3K09C 4JYCA 1G1MA 1JB1A 2J0UA 4OHVA 2BV3A 4C0HA 1E2IA 4QNMA 2F7SA 4KSCA 1DAMA 2RGNA 4RCYA 4Q4AB 3VU9B 4Q7MB 4K81B 2JDID 2CL0X 2W0MA 1E2KA 5GJVC 1U0HC 4F38A 1G8FA 1XXHB 3DPUA 3W6NA 4GL2A 4TYYA 1SVMA 4ON9A 4EQ6A 1UJ2A 5FR2A 5EP2A 1T8UA 1DE0A 4YQFA 2AFIE 1M74A 3ADDA 2QAGA 3Q7QA 4TN1A 2QP4A 2XJ9A 4IW3B 3SJAA 3VX3A 2KJQA 2REBA 5L3RA 4EPYA 3J81k 2RH5A 4Z8XA 1GFIA 5AR1A 1YU9A 2XOKA 2AK3A 2IW3A 1MT0A 1W0JA 1KJWA 1T0HB 1ETUA 2ZYTX 4DLWA 2ECKA 3OEEA 4KBGA 3SR0A 2XZOA 1MABA 4NYIR 1PV4A 2GK6A 3K0EA 1W0KD 1OT3A 2NO6A 3NVAA 3SE0A 4B3BA 4A2WA 3FHCB 2PEZA 3QF4A 4FW9A 3WYGA 3EIEA 1NJFA 1KI1A 4LY6A 3HU1A 4OQXA 1NVVR 3I32A 4LV5B 2XTZA 4C0QC 4LBZA 1IBRA 4US0R 1YRBA 1J70A 4MRVA 2CVFA 1Q0UA 4JZKA 4BQSA 1E9DA 2NOAA 2NPIA 2RKOA 2W83A 3THWB 2CL6X 5BN3A 1NP6A 1KDTA 4EFLA 4PPQA 3RLFA 1QHSA 1LV7A 1E2DA 2WPDA 4LHZA 4AG5A 2G6BA 2Z83A 2D06A 2WWWA 3QKRB 3U7HB 4UNRA 4DDUA 5DYGA 5FPYA 1IOZA 5DISB 2GRJA 1S3SA 1YR7A 3OEED 5ANRB 1OH7A 1Z0FA 2PLFA 4OQLA 1PUIA 3K0AB 5EE9A 2XJ4A 4NH0A 3MFYA 4DRZA 5EE5B 3GJ8A 4NMMA 4OK6A 3W5JA 2D2FA 3FMFA 5P21A 2IUUA 3ND9A 4V0MA 1F2UB 4G1UC 5JJKA 4CYMA 1JECA 4I99A 1MO5A 1UFQA 2GESA 1F48A 2ZJ5A 4Q4HA 3TUZC 1NY6A 4G5OA 5AJZA 3TSWA 2OV2A 4HAYA 5G53C 4DLXA 5F9HA 3OZXA 4B3DA 5DHAA 1ZNXA 3CZPA 5HE8A 3RHFA 4JL6A 2IF0A 3L0IB 2DB3A 2ZITA 1CXZA 1RJ9A 2ZVPX 4JLKA 3ICQB 2ERXA 4M9ZA 2PCLA 2IYQA 1EFUA 1WMSA 1M34E 2EFGA 2DY1A 2G0NA 3LBNA 1QF9A 1VMAA 1QG4A 2CE7A 3IQWA 4M9QA 5B64A 2GAAA 4B48A 2AWNA 2GCPA 2O52A 4WXRA 5JLJA 2ORVA 5C4MA 1KSGA 1G17A 3GJ5A 4HDOB 3PIRA 3S1AB 3AKEA 5HPYB 5F98A 1P72A 5DN6A 1W4RA 1ANKA 2JAQA 4UJ3A 5JBQA 4GP6A 1HY3A 1Z8FA 3FKSA 1XU4A 3LXXA 4XSGA 5DO9A 2XNDD 2QBYA 3DMNA 3P20A 2ZI3A 1OIWA 4RFVA 3HPRA 2XGJA 1IY0A 3CM0A 4WW0A 1NG1A 3AF1A 1FQJA 4XVQA 3ADCA 4KLNA 2RGAA 4QNRA 2KB0A 1F2TB 3QVVA 2QMEA 5H8WA 3I4LA 4M4SA 1R10A 3EXAA 4HB4A 1MO6A 2OM2A 2EWVA 2WBLC 4ZPXA 1AKYA 3KX2A 3N70A 4B2PA 2VP2A 3MJHA 4DLSA 4KV9A 3RRYA 4F7WA 4IKEA 5FBLB 4ZKDA 3FYHA 3WRXC 4AI6A 2QSZA 3GLHE 1G7TA 1L8QA 3QXJA 1XXHA 4OKSA 2B8WA 3IO5A 3IHWA 1KGDA 1RFLA 1NSFA 1FNNA 1E98A 1DTSA 1PJRA 4EJSB 5FTNA 2ZS7A 3T1OA 5GJBA 4KJZA 2GEUA 4B2LA 1XTSA 4ITRC 4XOIA 4L9WA 3L82B 4GP7A 1JR6A 3WRYC 1H8HD 3DOEA 4W5JA 4ZDJA 2GXSA 2DFKB 3GQBA 1P6XA 2JEOA 1KAOA 2JJ1A 1N2CE 2FN4A 5J4KA 2IEYA 3QIAA 5SZJA 1VIYA 4OYHA 5KOYA 1XEWY 1VG0B 3EZ6A 3AVOA 4Q1EA 3UIEA 5TMPA 1P2SA 4A0HA 1E2NA 2ZU0C 4C0BA 3K70D 2QUZA 2CBZA 2PT7A 3WBKA 3K53A 4E09A 3P26A 3B82A 5EXPA 3B1VA 1LTQA 1KZ7B 3PUWA 1Z2AA 2ZM5A 1ZUNB 1ZVQA 3KKPA 2G1JA 4HAVA 2W6IA 1R5BA 4Q7KA 3L43A 4AYXA 1AJEA 4PPGA 1UKYA 1G6OA 2BBTA 1OF1A 1I4DD 4C30A 4RD2A 4DIDA 4BPBA 5KSOA 3RNLA 2B6HA 5KSPA 3SZRA 2AWOA 1DEKA 2FSHA 4MDEA 4G5SA 1LNZA 2AXPA 1VCIA 3CUEF 3Q9LA 3U44B 3WMEA 2B8TA 1G291 2B92A 1LW7A 4CEHB 4HLDA 3I5YA 3K8YA 2FA9A 3WHKA 2N42A 4A92A 1W47A 2IYYA 2KI5A 3A1TA 3PUYA 1P2UA 1XEFA 1ZD1A 3GEIA 4TLDA 1WF3A 5L3SB 1VHTA 5IK2A 3U61B 2PL3A 4PQYA 4UXJA 2GK7A 1ZC4A 4N1AA 1EFRA 3ETLA 1KO4A 4ILEA 4HLQB 2ZANA 1U94A 4A8JB 2KSQA 3KKMA 2WOJA 1TPZA 3E1SA 1DG3A 2AD5A 2V6JA 1E0KA 1NNEA 3OF5A 2A5GA 3NH6A 3A4MA 2JJ2D 3PEWA 1FQKA 1B0UA 2DWQA 2QMHA 2VSFA 3KZ1E 2ZRDA 3R9IA 3X1DA 1JQLB 1SXJC 1TQ2A 3AKDA 5FUVA 3UMFA 2NZ8A 3ZIAD 2WVJA 4EFNA 4MKIA 1QG2A 2GAOA 1AN0A 2JJ8A 2Q21A 1IXSB 4QJ3A 5LB2A 3W90A 1NBMA 2KWIA 2PZGA 3X2SA 4IFBA 1J90A 2C98A 5DE3A 1XCMA 1I4LD 4PAMA 4PHFA 2CCGA 1AIPA 1XCPA 2B7BA 1RJ9B 2VHUA 3LA6A 4U02A 4DHEA 1IY1A 4CVNA 2GHIA 1SHKA 2V1XA 4NYJQ 5D3MB 1G16A 1JJ7A 3RRZA 1Z6AA 3T34A 3MG9A 3U3OA 4HYYA 2G88A 5G41A 4C0KA 1A2KC 1VCOA 2Z5FA 4JL8A 5AUPB 2ZRPA 4PC1A 5SZHB 3DM9B 2ZAMA 2WJVA 2QMUA 2QT1A 2O0HA 4JL5A 1D6JA 4YDHB 2IWHA 4HEJA 3T35A 2NO9A 5C2JB 2P6UA 1K5DA 4XH9B 2BBSA 4LJ7A 5EP4A 4KU4A 1CP2A 1DOAA 5FUWA 3A4NA 3VX4A 4DCVA 4L4UA 2A5FA 3DM5A 2J5XA 2PH1A 4C9BA 3THXB 4A0FA 1FL9A 4IDOA 3GD7A 3QPUA 4IXNA 4NHOA 2RGGA 2FPMA 4ZI3A 2H57A 3OESA 3WMFA 2ZI7A 3HP1A 3QNUA 2P65A 3C5HA 3ZVMA 3LO5A 1NI3A 1P2VA 1II9A 1ZUHA 3CNLA 4YMUA 1DPFA 2QPTA 2V4ZA 3AKCA 4RCZA 1GAJA 1H8EA 1U8ZA 2YYZA 3CR8A 1Q3TA 4US1R 2CCJA 4IXMA 2EFHB 4MUBA 3AV0B 2IA5A 5IT5A 3NXSA 1CTQA 1AGRA 1NMYA 4PPNA 1KI7A 2HCBA 2YJTD 4BLOA 2GXQA 4NYJR 2QI9C 4MRNA 2NZJA 3AP1A 4Q4JB 4WVFA 4Q1CA 4JLBA 3LRPA 3ZVRA 1CS4C 1XD2B 3EWSA 5E4FA 2JLXA 3SQXA 4LHYA 4XJXA 4JLNA 3CIOA 2IT1A 1UPTA 4URZR 1E96A 4A36A 1YHNA 2IK8A 4HB3A 2O8CB 1GL9B 4MGKR 1ZC3A 2QTFA 1NVXQ 1R5NA 4D6PA 2XITA 1TAGA 4LDJA 2ZXUA 3NDPA 2ZSDA 1R7RA 3QQ5A 3EPJA 4M9SA 3RS0A 5JECA 2IXFA 2LWIA 3I1FA 1BS1A 5CM8B 2F1JA 3EX7C 2WKRA 3THWA 2ODNA 1KTVA 3AUXA 1EFTA 3LW8A 3T1TA 2OFWA 4C2TA 2BEJA 2TMKA 1ZM2A 4PSAA 1XTRA 4EFMA 1JALA 3D6TB 1VG9B 3G5UA 1SXJD 3W5IA 2ZRLA 4DB2A 3THYA 1DELA 2ZETA 1P60A 2J7PD 4N0EA 3OE7A 2WWGA 4JJZA 2IL1A 3NG1A 4BLTA 2IS4A 2NO1A 4NCIA 4JLAA 2FH5B 2QM8A 5HTKA 3W3ZB 1R0WA 1Z28A 4KI0A 2NO7A 3SYKA 1IXRC 2WJYA 2VEDA 1A5TA 1OFHA 4NKRA 2BMFA 1ZBDA 1FTSA 4FMCB 1IQPA 1L4UA 2AL7A 2P67A 1N6HA 3MWYW 1FW6A 4AYTA 4CEHA 4NBSA 1Z47A 2F3TA 1KI3A 1Q1BA 1ZAKA 3BIFA 1S9HA 3IEVA 3U7GA 2GNOA 3IIJA 4L16A 3KUDA 2WIBA 5FBVB 1UKEA 2IYSA 1X3SA 4LYAA 2P2LA 1P62B 1R6BX 4QBIA 2ZIAA 4TL7A 3O8CA 2IS6A 1NIJA 1KK0A 3N2EA 3C14C 4JLOA 1TF7A 4JVNA 3KDSE 2RHDA 1G3QA 5G40A 3MWLA 3LV8A 5CIQA 5LD2B 4I4LA 2ZRCA 5TXGA 1NN0A 4KODA 4PC6A 5FI1B 1OH8A 5A5GA 1QVRA 2IHBA 2OXRA 4LJAA 4H9GA 4M1SA 5E7MA 2E87A 2RMKA 5KDLA 2ODWA 4OI1A 4OHZA 3SYLA 2QL6A 1G21E 1LY1A 1GRQA 5A0FA 2YKGA 2C9YA 4LUCA 3VQTA 1OFIA 5JHGB 2EYUA 3P4YA 1KMHB 1UDXA 2ZJZA 1VDZA 2XB4A 3FMOB 1SXJA 4PHTA 3X1YA 1SZPA 3AGPA 1E2JA 2Z4SA 1NSTA 3K70C 1A1VA 4FN5A 2FZ4A 3EG5A 3REFA 2ZVQX 3H84A 3BFVA 2JLVA 4X8OA 1W7AA 2X2EA 4LHWA 3BB1A 3SFZA 1C9KA 4I81A 1AM4D 1Y63A 2G0TA 2XZPA 3Q5EA 1OFTA 3NBXX 4JSTA 1KKLA 4M1OA 3SJZA 1Z6TA 4A2QA 3SJCA 1MV5A 3B78A 3G0HA 2Z4RA 4EPWA 2FFBA 2NG1A 2V7QD 2WJJA 3GFTA 4A9AA 1COWA 2RHMA 1E2MA 2A2ZA 4BFVA 2F6RA 2JJ2A 1NN3A 2ZJ8A 1DS6A 2BKUA 4HAXA 1ZINA 4IFEA 4WZ6A 1G4AE 3VR4A 4BLQA 4RY2A 1AS2A 3AVTA 1C4OA 2A5JA 4R7ZA 5LD2C 3FKSD 3NBZC 4TLEA 4GZMA 3IHLA 4E5UA 3OAAA 1U8AA 1W49A 3MD0A 1II8B 1XTJA 4IVRA 4URXR 2NGRA 3H4MA 2J7KA 5DYIA 5GJCA 121PA 1RRCA 3EZ7A 3K1JA 1GTVA 4GSYA 4DDTA 3LQQA 5JRZA 2C96A 1IONA 1CKEA 2IYZA 4YLGA 2W6JA 1MRNA 1YZUA 3CX6A 5FOXA 2BMJA 3E70C 3REGA 3ASZA 1P9RA 2FFAA 1UBFA 2ZI9A 2ONKA 1KO8A 2ZJ2A 3DHWC 1OYWA 4Z8YA 4CIDA 1OB5A 1E2HA 2VP4A 1YVDA 2PZFA 4G3XA 4R71A 2VLIA 4Q1AA 3MWJA 2ZRHA 2CL7X 1X8KA 3GJ4A 4A8JA 1E9AA 1YZTA 1SVSA 1KDRA 1XDBA 3A6PC 2ZSAA 4LI0A 4CGZA 4Q01A 3VAAA 4EJSA 3PUXA 1AK2A 2RGBA 1OKKA 4Q48A 2C9CA 2JLUA 3W6OA 2PCJA 4BASA 4Q9JA 4E03A 4A82A 4JLVA 4ARZA 3JZMA 4P4UA 4L8GA 4U5XA 2J9RA 5SZIA 2H5EA 4TMVA 4PO9A 2YOGA 1Z5ZA 1E79A 2WICA 2GWHA 3R8FA 4LX0A 3CO5A 1TX4B 1N5IA 2HLDD 3QI2A 1NMXA 1ESNA 4QXAA 4EIWA 4HLCA 4RJLA 3GMTA 4ZDKA 2WJHA 4BFWA 4U00A 3QBTA 4TQUS 2QE7D 3T5GA 2ATVA 1IY2A 3SYNA 5FH9A 2DPXA 4B33A 4DLUA 4HDCA 4C0SA 3THXA 5J4LA 1TUEA 3GLGB 3PEVA 2ZROA 2X2FA 1FMJA 4JJKA 4LV8B 4TYQA 5FTLA 2GEDA 3Q5DA 1OXXK 2GJ8A
chains in the Genus database with same CATH superfamily
5CA0B 2JLRA 4FDMA 2C1EA 4B74A 3NVMB 4G36A 5DASA 4D3XA 3CR7A 3EVZA 4AM8A 1W73A 1K7CA 4BC1A 3HN7A 1HQDA 4IDHA 3NEJA 5EIBC 2P68A 1VJRA 3DB1A 3F3YA 1GG2A 1E5TA 5IKXA 1Y3AA 4YT2A 1GXSA 1DEHA 2HU7A 1LU9A 4MITA 2HU5A 4JODA 2FPIA 1P8JA 1YZ3A 3M5CA 3MYRA 2WMNB 2IOFA 2QPLA 1XROA 2IPOA 1R8YA 4XGRA 1QTQA 2BP7A 1E9CA 3ZIUA 2Y2VA 3EE6A 3RFXA 1U2RA 5E6UB 4TV9A 1UBTS 4YP6A 1QFZA 1SU4A 3U4AA 5CA1F 1X8JA 1X1BA 2JFVA 4TYPA 2IYWA 4H1VA 4TKVA 4HZGA 1H42A 1NNI1 1L4MA 2GVZC 5BPHA 1UDWA 2Q3MA 2ZQZA 2CBGA 3E9MA 4DQDA 2CHGA 2AFIB 5GVRA 1DBWA 3OCXA 4LOKA 2ZREA 2RGCA 2J31A 2G5GX 1Z25A 4COKA 4YAOA 1ZAYA 2VJDA 2I2DA 1N6PA 1UKVY 2AOVA 2Y67A 6ABPA 1ZD3A 3IBFA 5DM4A 1U3FA 2CMGA 3KZOA 1ORVA 5CNMA 1I7LA 1DINA 9GPBA 3AM4A 1UWLA 2Z09A 3DFUA 2PFKA 5DI9A 1BWRA 1OC4A 2X0DA 1ZM4A 3WBBA 2F8SA 4GT1A 5HF8A 1MD9A 3VNRA 3VMMA 4ZT6A 4AJ1A 1HGXA 2P2DA 2WM9B 2NNLD 4QPJC 4OIMA 5DF1A 5AKLA 2QS9A 3V3TA 1J21A 2C2XA 4IIUA 1Z39A 1XLWA 2DFPA 3INRA 4AJHA 2RDMA 3KCNA 5IDXA 4GI5A 3U1VA 2AGVA 4IYRA 2RIRA 3GLTA 1J1UA 1FMTA 4M21A 3EYWA 4DJFC 1FP7A 2VJLA 3P52A 1C29B 1T5DX 3EXIA 4HPXB 1K3TA 1IJEA 1L4EA 4OQPA 1P3DA 2Z2ZA 3DWFA 3GLIE 3G82C 2YIVX 3OOYA 4UEOA 2HJVA 4UFPA 3UGTA 2AF4C 2CE2X 3GQVA 1E2EA 1G7RA 2HPAA 4ZRMA 3L92A 1N36B 1V9CA 4I6JA 5FA5A 4IGKA 1NDUA 1H9AA 1YKSA 1PW5A 2OXCA 3DNMA 3VYRB 2C8JA 4CODB 3QXXA 1T25A 4OHPA 2BHTA 1QC5A 5T5QA 1QOZA 1ZITA 1NBAA 2V98A 2VSXA 1V2HE 4L5JA 5TVGA 2AG1A 2VDKB 4JELA 3EDCA 4HRAA 4RPCA 3KAPA 4CLXA 4U2FA 5HQJA 1CBUA 1J0CA 2DLDA 1OXTA 1E7SA 1LWOA 1AT1A 2JIMA 3EDYA 3IE2A 3JVUA 4WTOA 4B8ZA 3ZYCA 3D1LA 3EAQA 3H2SA 3LBAA 2QKYA 1XCBA 2RB4A 1X13A 3NRBA 3N86A 2NU8B 4K3VA 4JDUA 2OYSA 3IP3A 3K16A 1R74A 4KI7A 2ZRKA 1M1UA 2QRZA 1JPJA 3PHGA 4MP3A 4LJ4A 3T3HA 1X9HA 2J41A 3BXHA 3HABA 3P94A 3TB4A 1HUQA 1SHLA 3IYLW 3WHPA 1WQ4A 1J20A 1ZSNA 3QW4B 1Q17A 5DLDA 3DKVA 1O6FA 2VQ6A 3RYIB 4MW1A 5FP0A 1R4AA 1O9HA 1O6GA 3UAVA 1L5VA 4BZQA 2H4ZA 2QXTA 5JMWA 3ZJTA 1DI0A 5C0OE 1W0KA 5JHHB 3NV9A 4R01A 1KYTA 4S1NA 2VFAA 4AYWA 1Q44A 3S99A 2XCLA 2W8ZA 2QTMA 4TM8A 1QV6A 1DIBA 3GGSA 1P1IA 4EA7A 4P08A 3GEDA 1ISJA 3ENKA 3QVXA 1E3SA 4BWYA 5C35A 5CVDA 2GCGA 3VSEA 1EQUA 1JHPA 2PMFA 4W5TA 5FUYA 5C8YF 3GVHA 2FOLA 1Z9BA 5HYVA 1GUZA 1VIAA 3AQ4A 3EA4A 1UKCA 1KWGA 4LYEA 4UDNA 3TBHA 3BWCA 1P1CA 2DQZA 2B0JA 1A50B 2WTUA 3HJFA 2UKDA 1V6SA 1H9BA 2Z2KA 3UMMA 2G7ZA 1M2GA 4GI2A 4E21A 5A3VA 3P32A 1Z75A 4LF9B 2M1ZA 1R4NA 3AILA 3JWPA 1P0QA 3GLIA 1L7MA 5L8VA 4J07A 1OB2A 3NTUA 3DL0A 3AUKA 1UBEA 2P27A 1PLKA 1HXHA 3EEBA 1BDJA 3NWOA 3EZ2A 3DYIA 1ORIA 1I94B 3N8KA 3A4YA 1CQZA 2UZ1A 2ZJ7A 2WLSA 2I3GA 2VA8A 1OH5A 4M0KA 3IQGX 1PDVA 1NLYA 3AQIA 1EHIA 4EO4A 3FD8A 3HYTA 3MBKA 1GGHA 1ZSYA 3RU9A 4JJEA 2PKYX 4B3XA 3GFOA 5KSYA 4HLNA 4EG6A 1E8NA 2JZNA 4UUPA 4EM6A 1P0CA 4KSBA 4DIUA 4NCNA 4G0PA 4L4YA 1N5MA 3DOOA 2OCGA 5JD4A 3MIZA 2W0SA 2XE8A 1M8FA 3GVCA 4HXEB 2ORYA 3R6DA 5JROA 3ZY5A 4RVGA 4CQNA 3QPCA 5BWLA 3C3XA 2AFHA 3BPSA 5FPKA 3B2QA 2YQZA 3GRAA 3ASYA 1URPA 4F21A 2DSNA 1WY7A 3MTIA 3JALA 2YASA 2V7PA 3L5OA 1ZW6A 3O2SB 1XMPA 5KNDD 1JKJB 2PRYA 3GYBA 2VAXA 3WNZA 5BVHB 1RPJA 3G0DA 3A32A 3CNEA 2EFDB 1P4AA 3O4VA 4ALJA 4XPIA 4LBYA 1ZGZA 2IYUA 3LGAA 3LP8A 4AF8A 4B3RB 4EHNA 2QQ0A 4UCWA 2DECA 1OAOC 3CZCA 3H8SA 3JTMA 4EO9A 4G8CA 4O8CA 4YK7A 1EDOA 2A6PA 4OU4A 2O54A 1VECA 2SHKA 3Q9SA 3EDMA 1D2HA 3ZCPA 4G6ZA 1U8EA 3AYXB 2JCSA 3QBJA 3C6KA 5FPHA 4DCNA 1DADA 1XEWX 2A78A 1Q1ZA 2YRWA 3HO8A 5AH0A 3I3SR 4QTYA 4B34A 3VOAA 1RBYA 2ZYVX 3MMZA 4S0XA 5KQLA 1Q0LA 1C9DB 4XYBA 1BD3A 4FMDF 3QOYA 4MQFB 1OU0A 2O8CA 3W06A 1QQTA 3AVXA 1R0CA 1U8TA 1XMSA 3E15A 5ERYA 3UWOA 2YS6A 1KQGA 1KI9A 4HUQB 1E69A 3HY6A 3JYHA 1VE5A 4WOCA 2GF0A 3A6EA 3KXLA 5BYBA 4IDFA 1K6XA 1LI5A 1ZMTA 4YCMA 5C18A 4PZAA 3UTDA 5KCZA 2AC2A 4IRMA 2VATA 1M73E 4MGIR 1O87A 2I0FA 4IWXA 4FHEA 1UIMA 3WL3A 3FDXA 5EFZA 2BEWA 2PLAA 1ISIA 1ADFA 3FMPB 5IM4F 4ZAWA 4FIDA 3RUFA 1AUPA 5BYKA 4XVUA 1VMEA 3DZCA 4HSEA 1DJLA 3TEMA 4C4TA 1OXUA 2R8OA 3LWDA 2HMAA 3MSCA 2GBCA 1ULSA 1UMBB 3CN7A 1IWOA 4OV6B 3PXCX 4XIGS 3ZG6A 3L1VA 4HLUC 4FFRA 4N03A 4BRWA 3L7MA 3JWJA 2B61A 3VZSA 4E31A 3ANTA 3KOXA 4D5EA 1XHLA 2PBFA 5H3CA 4Q24A 4Q34A 5PNTA 4KCGA 4NCJA 3UT5B 1M2FA 3HR7A 3KDAA 3AHJA 1YK1A 4HDSA 2DH6A 4ZN6A 1JDUA 1T6ZA 2DU8A 1JG2A 2NZ2A 3CA8A 3LPAA 5IZCA 1MG5A 5ALKA 3PZRA 1G3UA 1X1SA 4ZIRB 3FSJX 3UK7A 3HCDA 5KNBA 1BC5A 1P73A 3K1TA 5EOVA 3I0ZA 1ZHFA 2I34A 3EMVA 3K2EA 4R41A 3S3TA 1IQRA 3LX6A 3ZLVA 1TAQA 5A9SB 3MA0A 4IILA 4A3SA 1DQSA 4O1HA 1MAHA 3EZLA 3KQQA 4LQ4A 3OT1B 4M38A 3OA2A 5T8KC 2ZE6A 4WXYB 4O4LA 4OMUA 2JBAA 1TZBA 3AIKA 5IVIA 4U7HA 4L4RA 4V0KA 5I9BA 4P4GA 3WHLA 3RUEA 5JMTA 4ZOLA 1ENPA 1TOAA 5BT8A 4U8GA 2J85A 2A94A 3PEYA 3CX8A 2BCGY 2LP4Y 2PKWA 3H5AA 1R6XA 2ZJ4A 1U4NA 3RJ5A 1LK7A 2ETXA 4X1KA 3DE4X 1V43A 3NCTA 3TRHA 3FBTA 3NONA 1EDZA 1ZBQA 1VGRA 1IZYA 2A14A 2J87A 3PI6A 2OCBA 4UPDA 4EY6A 1I3MA 2CNDA 1U0FA 4ZCLA 4B6RA 2P9JA 1IK6A 3OP4A 1O6CA 2EJWA 1CUIA 3EGDA 3QMPA 3H9CA 4ZAXA 1FLNA 3EIHA 5F1KA 1WR8A 4FB5A 5HNKA 1EK5A 4HQRA 1WZUA 4OBBA 2QXUA 3FTPA 2A57A 4ZCPA 3ZLJA 5LQCA 1KIMA 5ARDA 3PQ3A 4KVZA 1PD1A 1UK7A 1YDHA 3R44A 2HT6A 3NGXA 3A37A 2Q45A 3N5CA 5DGTA 4B2YA 4REQA 3P9QA 3UATA 4J75A 4LEIA 1E9EA 4C7MA 1PT5A 1XCJA 2H4WA 3GELA 2FPXA 3FPJA 3DBRB 3BSSA 1E79D 2X6TA 3PWTA 4U7JA 2QTZA 3D4OA 1WMBA 4IJVA 4PCAA 2XQVA 1T6NA 1OVGA 4JGGA 5LXTB 1KU6A 3PEFA 1L1RA 1JEYA 1GTRA 4B6EA 3OTHA 3W2GA 5DNYB 2Z0MA 4LXYA 4XUCA 5B7GA 3HG7A 5DOVA 5KB3A 2R44A 1ISHA 4ZEWA 3DFMA 1FP2A 2EAUA 1FFDA 5A5DA 3HCRA 4KQ1A 1KDPA 3KPJA 4XPIB 3II6X 5C34B 1AQJA 4EG0A 2HXYA 3PE3A 5ARBA 3ZDAA 4PYIA 2OCPA 3PXGA 2IPNA 4ZDWA 821PA 4UEJA 3T52A 5EMHA 1GZDA 2OBBA 2C1ZA 2QYSA 4AJNA 4ALNA 1JLHA 1SIUA 1Q16A 3AWIA 1WP4A 3R7WA 3QF4B 4KK3A 5AJXA 1STOA 2G07A 2JANA 2XNDA 2XX3A 3VHRA 4IP0A 5CB4A 1TM4E 4PS0A 3IQXA 1XF1A 3QBEA 4PFSA 1LDYA 3LC0A 1EUCB 3CCBA 1V5FA 4M55A 2JFOA 4L78A 5EAIA 5JCZA 1HYGA 2W2KA 2AN1A 3PS9A 2GS9A 4L57A 4FR5A 4LY0A 4TV8F 3LQ2A 5IH3A 1PR3A 3RVNA 1VLLA 1Z12A 2D74A 3BE8A 4G25A 1O57A 3QEAZ 2FFJA 2O9JA 2Z2JA 2CMDA 4HN9A 2HT1A 3W6PA 3D6HA 3T3NA 2J0VA 3KQHA 3UWMA 3G2HA 2CMKA 2NACA 3QPBA 2YMQA 5J1SB 4ESEA 1HFEL 3PWKA 5CAEB 2BJWA 1BYIA 2XMGA 3JWEA 4B81A 4GICA 1SK9A 1G55A 2FSIA 1YZVA 4LXTA 5JQGF 3CBQA 3AR6A 3DVSX 1CUVA 2YINC 2K2WA 4DSZA 3KOYA 4JDPA 4GU5A 5AW0A 3F49S 2QBYB 3OTWA 3R74A 2GJAA 1RWMA 1Z74A 1QDEA 2PKEA 4XARA 1FRZA 2V7TA 3QVGA 2D1TA 2VDJA 1X77A 1P1FA 1YUNA 1D2CA 6CHYA 2HMYB 2V3CC 5EMKA 1OTXA 3KHTA 3T7KA 3S1AA 1K75A 2XZLA 2V59A 2YTZA 2JGRA 3CJTA 5HSGA 1XU7A 2OK8A 1RRFA 1HDCA 3T5BA 1Y1TA 3E3OA 4EL5A 1UPCA 1EE9A 2COKA 5FOQA 1GNRA 3SX0A 4DR7B 3ER8A 3LYHA 4PHHA 4YNBA 2NUAA 3B3QA 1QAOA 2D5BA 2I3ZA 1EM6A 1QC5B 1ZVKA 2G3YA 3E7DA 5DW3A 4BMSA 4F11A 4YJ3A 1Y3DE 1Z7EA 1KAGA 1RWXA 1RAGA 2HI0A 1NNSA 1ZJ5A 2Y68A 2OFFA 3H1FA 3L8YA 3WG9A 3CF2A 2WFLB 5ICMA 2PUWA 1ILEA 4DR5B 4CNQA 2HRDA 3RYHA 2IQIA 4FC7A 2RE8A 3WKBA 4WLEA 3OOHA 3ZDFA 3ILHA 3CE6A 3AJ8A 3K5WA 2JGEA 3CZ9A 4L8LA 2H3EA 1Y1LA 4Z3DA 1Z4JA 3F7NA 4FNGA 4QAJA 3V4OA 3PV0A 3OE1A 4UUBA 2PKRA 2HD4A 3RJ9A 2GNPA 3UMCA 2FFQA 4QWMA 3HB1A 4R05A 1A7KA 3UQYS 4YRNA 4UNNA 3TCNA 2TECE 1FDIA 4BQFA 2V54A 2Z1MA 3PSHA 1EHYA 3CLUC 4FFVA 4B80A 1P39A 2E49A 2PD4A 4UC0A 4NOMA 3VJMA 4D0NA 4WBSA 4DSOA 4MA4A 4A1OA 3TJZA 3ZDZB 5CVVA 1XCOA 3DAPA 1M1NB 3G0OA 4CW7A 2AMYA 1ZLYA 2NV2B 3PK0A 5JCJA 4EMTA 2Q8NA 3QSYA 3GLHA 2VJCA 1K92A 5FNVB 1EWTA 2VZ8A 1OX4A 1NN5A 2QXYA 3EC2A 2WR8A 4AMZA 2EBWA 1RD4A 5ETJA 1UM9A 4C0LA 4Z7QB 1US8B 3L49A 5THQA 2ZS9A 1KO7A 4KLCA 1CIVA 1YIOA 4HQNA 1SC4A 4GE3A 4PRYA 1CJCA 1PFYA 5CXSA 1BCSB 4ESHA 1E0JA 3MM4A 5IC6A 1A5ZA 3V4VB 3ORHA 2UZ4A 5BNIA 3LHIA 1YU6A 5E6UA 1PGJA 5EE0A 2F3PA 1YGYA 3BL8A 3I5XA 1PJCA 3FZGA 5H59A 3EJ6A 1ACJA 2VN8A 2D1QA 1VL6A 4ZCTA 1KMMA 4YMWA 5IDYA 5GGXA 4Z9FA 3BXXA 5BN3B 5L7YA 1TMYA 3FVTA 1R9MA 3RG2A 1AUQA 3KQVA 4JS0A 5J5VA 1OZFA 2Y0EA 4UQPA 4D81A 1KSHA 4QOSA 5LUAA 4UTPA 3P2KA 1KAEA 3ZDBA 1E9FA 4MHOA 4WY8A 3WGYA 1N2XA 1PHPA 2JFXA 1CV2A 5JSKA 1ZJJA 4MW0A 3ENQA 1JAZA 4NZ9A 1TKAA 3RTDA 4TWIA 2C20A 1RAHA 5JNLA 4Q03A 1U0SY 2FQYA 3D3WA 3DT8A 3PUVA 5JU6A 3GCGA 2P91A 1XRJA 5DNUA 2J8ZA 2DR2A 1DIAA 1Q0QA 4V3CA 1KK1A 3NTQA 4QJ5A 4R54A 2D1YA 2D7CA 3OHSX 1RXYA 5GZ1A 5IANA 2R1ZA 1QHIA 5AKJA 3ZWNA 1IFXA 5H68A 1PR4A 3LWNA 1NASA 1U8UA 3JARA 4RZHA 1HG0A 1DTWB 4M3NA 4R40A 5JBNA 3RUCA 4ZPJA 1CY1A 3PRJA 3SX2A 4PZCA 2RGRA 3FTNA 3JSAA 4ND7A 4Y7CA 3ZTWA 4LHVA 3VHLB 5JBIA 2NU6A 1PSDA 5JPDA 1PQYA 2IP2A 1XYGA 5KX5F 3PJRA 1U1CA 2IODA 3HWX1 4JYPA 2X41A 4OXIA 4ZRNA 3CH7A 4H4DA 4CQLB 5IVHA 1IB6A 2PNFA 1J2TA 2FEPA 3GOHA 1FUUA 1USWA 3CKYA 5K2OA 3QX7A 4GI7A 2YIJA 4GD3Q 4BNXA 2LIPA 5JWRA 1KARA 2XMBA 2E3JA 4M0EA 3SK0A 2WPDD 3MT7A 3HR4A 3AF5A 3PGMA 4LOAA 1QIFA 4A8TA 2A0XA 1AZLA 2FWPA 2HY7A 4EDFA 1MC4A 4LWPA 1X7ZB 4C14A 4CEJB 4QHTA 1H8HA 1Z34A 2YJ6A 1JNYA 2J3MA 3C48A 2BVNA 3JV7A 2G71A 3ZVNA 1TL7C 4HAWA 2OV8A 5ESRA 5TF0A 3PC4A 2QRMA 3RQIA 5P8WA 4D0RA 1OV4A 5JO0A 3RBXA 2GD1O 1Z4QA 2BUAA 2NTNA 2FMIA 2XNKA 3FWPA 4OOFA 2CLLB 3RTEA 3DLBA 4QBGB 2FB9A 1JFSA 5HMLA 2VT2A 3GRZA 5ADVA 4YAWA 3RS4A 2I6FA 1UK6A 1FX0A 1XMQB 2PPLA 3F1KA 2L82A 4BFSA 2VT7A 3QLVA 4ZJPA 1U2DA 3E7WA 3BJIC 3OPYB 3CRRA 1R5JA 3JW8A 4B4OA 3D8TA 1V4BA 4QG7A 1E1CB 1QOPB 4TV8A 5AOBA 4R6XA 1MG0A 4O2BA 3BFPA 5IKPA 1HEIA 2LDBA 4LMPA 1IXYA 2WP8J 5ILQA 3EG9A 3FB4A 2YX1A 3UTCA 2SCUB 1FDSA 1PX2A 4GWGA 4UXHA 3CY6A 1LQ2A 3U7QB 5I4KA 1YCFA 3ORFA 2JIQA 1O95D 1NN1A 4WFKA 3TL3A 3WJ7A 4EBBA 3SMQA 4IIDA 3VTAA 1C1HA 4BP3A 2C82A 4DA6A 4RTSA 1HTTA 1G3IA 1T5LA 1Z4OA 1QKIA 2ADFA 2EP7A 4K9NA 4N40A 4PZPA 4Y9SA 4P98A 1G5TA 5E6SB 1RM3A 4BQRA 2IIVA 5JQGA 3PXXA 4G0VA 1UPFA 2M98A 3C7CB 2BUCA 4QM7A 3W8DA 2UUCB 2H2WA 1M6WA 1XZQA 1YI0A 1TFRA 4PAQA 1SBQA 2O2IA 3AJDA 5LXTF 3BX1A 3S81A 2D2XA 2ZPTX 3OFND 4P4SB 5JLAA 4MCHA 1XX6A 2DJ5A 4J0CA 3PNMA 2IKQA 1QXSA 3ESYA 4IGAA 4CF4A 2WT9A 1P6UA 3BTUA 2UVQA 3VAZA 1K7FB 1NLUA 1ZP6A 1NV8A 1AK1A 1AQIA 3EGVA 1C8LA 4OVKA 3KOMA 2R86A 4PGAA 2A0KA 4NARA 1C4KA 3U3DA 3QE3A 1E1LA 4NG4A 1PL7A 3LLUA 4KB5A 3HP7A 1PNQA 1KEVA 1TVMA 3IT0A 4FOOA 4HDRB 5DKFA 4GXRA 1OI7A 1Y9JA 2CVZA 1WULS 3M34A 4HJXA 2L69A 2VF7A 4LNHA 5IXJA 3SZOA 4LE0A 5DX1A 3TQOA 2F3RA 7GPBA 3DLAA 2I55A 5JXGA 3U5ZB 3E8MA 5E3HA 3ZVKA 2GJSA 1WW8A 1C9JA 1KMNA 2AEMA 5AI8A 2AC4A 4RAOA 5ULLA 4DGSA 4F2GA 4IJWA 4O0MA 4G4GA 2VQ3A 1L5SA 4YP0A 3U1BA 3TGPA 1ABFA 5FNVF 1JA1A 1EK0A 4F6LA 4C7OB 4O6VA 4AQYB 2GZ2A 4FXPA 1A5BB 3JR3A 4I8IA 5CFQA 4Y98A 2Y9MB 5D7NA 4B87A 4CMGA 4MCJA 2IVZA 4GEKA 1T3HA 3DCNA 4PC7A 3WICA 1TZ2A 3B1WA 1KR2A 5EHNA 5I9TA 2C8VA 2VUUA 3DNPA 2O0MA 3I39X 3PFGA 4F96A 4DDVA 5JZBA 4KQXA 1CPYA 1Y9EA 3ROQA 4UTNA 1H22A 2DKNA 1OLSB 3QG1A 3T9DA 2WQ6A 2AHRA 3PTZA 1G9XA 3VV3A 5KYGA 3KUKA 2WTMA 1JSCA 2YOHA 2X1MA 3GUZA 4LG1A 1DAEA 1F6DA 1LEHA 2VDMB 2C8KA 2W2VA 4C3VA 5CAEA 3LHDA 2BGMA 3LBYA 5BW8A 3TO5A 2IELA 1YQWA 5CX1A 4ROSA 3QWBA 2YYYA 5EZSA 4B0PA 3ZDCA 1RZ3A 2H1SA 4IOKA 4B4DA 1P2TA 5KO2A 2F00A 4EKEA 4YY3B 3L7KA 1XQ6A 1Z17A 4AL4A 3SC3A 3E1KA 3HC7A 3TMKA 3UHPA 5EKXA 2YNMA 4WUVA 4GMDA 5FPSA 2WB2A 2YHIA 4YYEA 3P9SA 3QUAA 3PX7A 1RYBA 2P6NA 4CHGA 2MSCB 2XZTA 1V1JA 2A30A 3DVRX 3NLLA 3P97A 3PC3A 4QARA 1LS1A 2MR5A 3WOVA 5IK2D 2IXGA 2QAIA 3ROKA 1A7AA 1J5XA 3EC7A 4LZLA 4Q3EA 1X9IA 1JT2A 3CUYA 4Q93A 4J43A 1EVQA 2F55A 4YRCA 1PFQA 4EOGA 1P19A 1K08A 2O8FA 1ZIPA 1NC3A 1YB4A 5TQ2A 3UWKA 4OXQA 1SVLA 1U28A 3AVVA 2QTVB 3Q72A 1OH6A 5FBKA 1P0FA 3KC2A 4QZVA 3QUCA 1EIZA 1GA1A 2OL4A 1KH3A 4P3YA 1NUTA 2QN1A 3ABQB 4UZFA 1KJJA 2CF5A 3MGGA 1RXSA 2ZU6A 3SC2A 2PVPA 3V4RA 3FE2A 2IJGX 4ICIA 4D41A 3FKJA 1EWQA 2BGRA 4KVGA 5EJ4A 3WZLA 5CDGA 2J0UB 3V33A 1R0LA 1LZKA 1YJQA 4JQYA 4Q16A 2QRNA 5IH7A 1DCTA 3WGNA 1MJHA 5DIFA 3C6BA 1G4UR 2IEBA 1XQXA 3PC8C 3HEBA 4RLQA 5IAGA 2A7QA 1ONBA 4N7JA 1HEUA 2H4XA 5GM2A 2NM0A 2NAFA 3U31A 5JC8A 5CRIA 4DZTA 3NOVA 5GM1A 1CDOA 1I3KA 6GPBA 3HBJA 4IV5A 5E3IA 2BSAA 1AQNA 1W4ZA 4O3FA 2UYCA 5AMXA 4BX0A 3KKKA 3S5UA 4MWCA 4QRHA 5KTPA 4F45A 1G42A 4L22A 4AWXA 4A0RA 5K0BA 4HFJA 1JDBB 1NF2A 4Q18A 4C76A 4A4DA 1GQRA 4KHPB 3LDUA 3IT3A 1UBRS 1NMEA 1AC5A 3VYSB 3KG2A 4A8JC 1C1XA 3WGIA 1U0EA 2WAYA 3PQ4A 1I3OA 2H06A 2L0XA 3OKPA 3IA2A 1EFCA 2OMEA 1EGAA 2NO0A 1JQJC 4BN4A 4CM8A 4YH1A 2W2TA 1I2MA 4I1SA 1JG7A 4C0JA 1XTIA 1K8QA 3SHVA 3W8FA 4R8VA 1ACLA 3MCZA 3BK7A 1NM5A 2E21A 3CB2A 4BKMA 2XXAA 1QP8A 2WT8A 4X8LA 1G63A 1QE3A 1HKUA 2ABWA 2XCQA 2YYAA 3CEMA 3LSTA 1TVKB 3GJYA 3NHLA 4GBMA 1OBVA 1SR8A 1W5SA 4H31A 4J1TA 3EQ6A 2WU3A 4UVEA 3AWDA 3TRIA 4HZUA 4BGUA 1OTHA 3VJRA 1O95A 3JYQA 3W77A 2NO5A 1D2RA 2OCYC 4RZUA 5FA8A 4A15A 4BU1A 3PCRB 3RWOA 4U39A 5K20A 3SLRA 4F8EA 1WQ3A 4LGMA 1YFJA 4ZQIA 3E27A 3HVJA 3JQDA 5EGNA 3ZW7A 2ZWOA 3M9WA 1RLJA 3FPHA 2Z3VA 1U2GA 3LDFA 2AW3A 3JSXA 4O2LA 1EX1A 1SXJE 5CD1A 4XWYA 2FYTA 3STXA 1JL3A 5DTIA 4BNNA 4WKCA 3ICCA 1GP2A 3MFQA 3GXOA 4LA4A 5G4KB 2ZAGA 3FYUC 3VSBA 3H4TA 2JKVA 3ENWA 1X19A 4DB4A 2RD2A 2M2IA 2XIJA 3OFNA 5EZYA 3A6KA 4I1PA 1YMVA 4BDSA 1SOUA 1QKJA 5A4JA 3AHGA 2VCHA 4HNVA 2A9VA 2O3JA 3RABA 3QU2A 3G6WA 1WJGA 2ZRGA 5FL7A 1E8MA 1WUHS 3SBOA 5EHIA 4B2IA 1OLUB 4Q4HB 3L3BA 3LRTA 1GSAA 1E2FA 4QU5A 3KJEA 1USIA 1NBEA 3UAXA 2WE8A 4KR2A 3AOGA 3CF6R 1H1DA 1N5DA 2WU4A 1PZMA 2BM1A 4AS2A 5J2TB 4AS1A 1V48A 3V1LA 2Z5VA 3R3SA 4LV6A 1EJ6A 2E5FA 3SU8A 2IYPA 4AC9A 4DJEC 2J9FB 4ND2A 2GERA 3GC6A 1C2YA 3FYSA 2QLMA 4HK4A 3HZOA 4GX1A 5HK8A 1X2EA 3WY9A 1ZN8A 2JI4A 3D0QA 2LKDA 1UFOA 2W93A 3TLBA 2F1HA 1VGQA 3A1VA 4I6EA 1QRTA 5CIWA 3PXAA 4L3OA 2R5WA 1Z0ZA 4G86A 4N5IX 2BKLA 1GTSA 2W6ID 1SQFA 2FUEA 2QN6A 5JDCA 4L8FA 2N0SA 4C4PA 4R68A 4Y7DA 3I64A 2H2HA 3BZWA 5EIXA 1O58A 1SKYE 4GMHA 4JI4B 3BORA 4Z4FA 2Q9UA 5H9WA 4INJA 4Y0VA 1AU9A 1DC8A 4G85A 2GYWA 3ZJ5A 4LCEA 4OJQA 3GJ3A 5ESDA 1X7XB 2OCAA 3O6VA 1LKZA 2VRCA 2XWQA 3A26A 4P3NA 1O03A 2V7UA 3UPUA 1RWBA 1JLLA 2D2EA 1KPHA 2EBUA 1P29A 3QPDA 2QVZX 2LCIA 4KXFB 1NJ6A 5EPEA 4YAIA 1EQ2A 2H59A 2HQ1A 4WK4B 3VR6A 1KMHA 10MHA 4AN1A 1IULA 2ZG6A 4QGAA 3WBFA 4BNHA 3L4KA 1UXIA 3ZWMA 5A7HA 3BG5A 4TQ9A 1W5TA 2H0RA 3HL0A 3P2YA 1CQIA 2J4FA 3BE4A 3CVJA 1WVGA 1ID1A 3NQ41 4LRYA 3TG8A 4N4AA 1L6RA 3R24A 3G88A 5K7SA 3M2TA 2VK8A 2YFQA 3DYVA 4F3YA 4UE2A 2IU6A 3A2LA 4KAXA 2YQ5A 4C0XA 4ZQHA 2UYHA 1FLDA 4EQZA 3ZQJA 5COQA 2GWRA 1EIWA 4DTIA 1QHGA 2BKAA 1TM2A 2CNWA 2DLNA 3NBQA 3PVZA 5ER6A 4DQXA 2XBMA 4LRUA 4ZZ1A 2IXBA 3OZCA 3OOSA 2OOSA 2VP6A 3D5QA 1I4EB 3PR2B 1XN4A 1OAAA 1AA9A 3QMVA 3QVJA 2F1IA 1UJ4A 3OOEA 2GN0A 4FILA 4KMSA 3H3XA 5CB6A 5IT4A 2H5IA 3NWBA 4AXXA 1P4JA 2P7HA 2WKQA 3IEUA 4TTTS 5DHTA 2ZYDA 2PJDA 3TFOA 3RYCA 2D4HA 4BL5A 2V6BA 4J3JA 1L7RA 1JTEA 2AK2A 2EJTA 1KZ6A 1S8OA 3KJXA 4MWTA 5DTRA 5GV8A 2OGSA 4C6HA 1KC3A 1KZ4A 1CZHA 2R47A 1Z6PA 1WEKA 4TLMB 4X93A 3I92A 3SPXA 1KA9H 4TQAA 3SGLA 1CUZA 4DJJA 1SXJB 4FCTA 2ZRQA 3ZDRA 3PHIA 1GTMA 2P1RA 2F43B 3K96A 4DNOA 4XDHA 1SBIA 2IYRA 2V6MA 4QULA 2ZUVA 2H17A 1VCNA 3ZOKA 1QJCA 3UV6A 1TEXA 2JK0A 4KAFA 1AS3A 4Q1VA 1YWGO 4D0SA 5AD1A 4RWEA 5SV2A 4G4SO 1RRVA 2I22A 3C41J 4JH0A 5CM9C 1W9MA 5EWMB 1XD9A 5FWYB 3RKSA 3K0FA 2REXB 1QFMA 2XGMA 5CCBA 2CJYA 3KQNA 1IEXA 1EJ2A 1HE3A 1U9CA 1U8CB 2DKOA 3H8VA 3I1JA 3SEFA 2AOTB 2YVUA 4W5QA 4UCQA 1GT6A 3DL4A 4Y67A 3U1TA 4NBUA 2XI4A 3GGGA 3L7DA 1E99A 3QJ5A 3HJNA 3IV9A 3D6NB 2ZCJA 5BN4B 2H4YA 3KTAB 3I6IA 1H05A 2CVPA 1MF7A 5FBZA 3V8VA 3DKIA 4QG3A 2V03A 2IE0A 4C3OB 5KYWA 3MF4A 2YWBA 2PBZA 3B3JA 2FX3A 4LZWA 2W6OA 4E15A 5C8YB 5HVNA 3RG8A 4YIHA 4DCPA 3I5AA 2LGJA 2WM8A 2RG1A 4P7FA 3BDAA 4ALIA 3G0CA 4ENUA 2XVAA 2B8NA 3WQBA 3WFJA 3SDZA 3I3OA 3HSKA 3T5TA 1Y3BE 5J4VA 4QAQA 5MGNA 5J2TA 1FF9A 2MSDB 4OK3A 4WWHA 3P9PA 1M7HA 5H80A 3W1EA 1V8ZA 5AQEA 3ZD7A 3AL3A 3WV5A 1L5NA 1MO3A 1SMKA 4FTWA 3WWYA 1NXXA 5ALNA 4PG5A 3ABSB 4EY8A 3KB6A 4FMBB 1DHRA 4P4SA 1F38A 5D5PA 1XL1A 3G9ZA 5JS2A 3UEOA 2J5BA 1C7ZA 5DFAA 3SN6A 5JARA 2A9PA 3A9WA 3LKDA 4I1UA 4ZIRA 1H8ED 3B53X 3Q5GA 1TJYA 3PE4A 4OFWA 4WNAA 1T3GA 4M8NE 1CNEA 1P5RA 3HN2A 3GT4A 3OJWA 3PPYA 2BFBB 3O8DA 4HXYA 2FPWA 4M7WA 4NBTA 3VNQA 3Q3GE 2DWPA 4FNOA 1CDDA 1E3JA 1V25A 4EFDA 3O8RA 1JZTA 5T4EA 4LXIA 1E3LA 3LX8A 4AKEA 1NURA 2C5EA 4IR7A 2C4TA 2GVDC 1G1AA 1DL5A 1UBNA 3BJRA 3FUUA 5EE1A 1OPRA 4PG8A 1BA3A 5MN5A 4G0UA 4O2BF 5AK0A 4Z54A 1NVMB 1F3LA 2OHHA 3AF3A 1MVOA 2CHVA 1PSZA 4B09A 3CLTC 1TYDE 1OFVA 1SB8A 4K7JA 2AMFA 3AJAA 2RIPA 1W75A 5F1OA 1XDUA 3CSUA 2PRSA 3JWHA 2QVYX 4ALMA 2DP4E 1SBTA 2A5YB 1D1TA 2WTNA 1MCZA 4QBFA 2BMWA 1WXGA 4G81A 1FX0B 1D1PA 1T4CB 2V7VA 5DU2A 2I6QA 2RGUA 4G5HA 4Y9RA 3UCXA 5M2QA 2FLKA 2NZVG 4AJ9A 4TS3A 3A1NA 3NFRA 2OOKA 4F56A 5I9LA 1UDBA 4EKYA 2R2GA 4E46A 2IF2A 5MFZA 2F8TA 3M2PA 1TCVA 1EFVB 1H1LA 1R50A 5JS8A 1GNVA 4QYWA 4BTLA 2OZEA 3AL2A 4TMFA 1TF2A 1GCIA 3WV4A 2EEPA 2IYFA 3FFBA 8ATCA 4CMIA 4UNQA 3LUCA 4HATA 5ES4B 3DF7A 3RJMA 2B3DA 4OQDA 5AM5A 4HYQA 4IG4A 2OBLA 1GGEA 5HDBB 3Q1LA 3P2JA 4FONA 1AKEA 2W00A 1FSZA 5BN5A 3F9IA 3GJXC 2JBHA 2QRLA 1VHWA 1ZS9A 2H16A 3MEQA 3OLQA 3SAJA 5IUJC 1FSSA 2ZUCA 3AY3A 1W36B 2A0UA 1WVIA 4I8DA 2PA3A 1PWYE 2C3UA 3LP6A 2V3WA 5K8LA 2AKAB 2DUJA 3IULA 1NVGA 3ZJVA 1JIIA 1MB4A 2ERYA 1J99A 1H66A 1IQ0A 1DC5A 1ZA2A 1V96A 4GM0A 1ZUIA 4RVOA 1B6RA 2NU6B 1P7CA 4OMCA 1XMJA 3L6DA 1J8DA 1J2RA 1E5VA 4P7BA 4K5QA 4XUDA 4IHAA 4JKYA 3RBZA 4JLUA 4ND5A 1TTHA 4PLZA 1SUBA 4UBKA 1ZEMA 3TM4A 4RTKA 1MQ8B 2HF8A 4NBVA 3ZS8A 1IAQA 3KJGA 2C5HA 1WSAA 4LVCA 2VPQA 4WZAB 1OJ7A 2VXCA 4MP6A 4UMDA 5CT9A 5BWCA 4Q37A 1QORA 1NIPA 2DQSA 3R9WA 5TQ2B 3RVQA 5A5FA 1SJ9A 3ZVLA 4BNTA 1YS2X 2JD0A 1WSDA 2OHFA 3REQA 4BB5A 2BSXA 4E30A 1NLZA 3KLPX 3QW2A 5D3QA 3I09A 4BMDA 5EUQB 1LK5A 1K06A 2BJVA 2PU5A 1BE6A 1VB5A 2AQ8A 4IJKA 2WAMA 5KU1A 4GDMA 1ORTA 1U3DA 4FZ3A 2CUZA 4PZLA 1YJ8A 4N49A 3V7NA 4RPJA 3VOTA 2PY6A 1OYYA 1G5RA 1PUJA 1QGUB 2KLHA 2WJ3A 3FWYA 2B98A 2FOIA 3OHMA 5AM3A 2YXNA 1KEEB 2RH4A 4IVQA 2HSEA 5ICCA 1C50A 3F6RA 2XCSB 4HCJA 2AB0A 3CONA 3PUIA 1U2DC 3IUSA 4G89A 1OLXA 2NUPB 2ZSJA 4MPTA 2EKBA 3U4QA 1YBVA 4P84A 3RS9A 1DPGA 5CX1B 2AHOA 3P0FA 4ZQCB 1DX4A 3K1AA 1OSNA 1T4MA 2XAUA 2ZIEA 3GGCA 3NJ4A 2GA8A 3TKAA <