2H07A

Crystal structure of human phosphoribosyl pyrophosphate synthetase 1 mutant s132a
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
311
structure length
305
Chain Sequence
b'NIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHAAQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribose-phosphate pyrophosphokinase I
publication title Crystal structure of human phosphoribosylpyrophosphate synthetase 1 reveals a novel allosteric site
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 305
sequence length 311
chains with identical sequence B
ec nomenclature ec 2.7.6.1: Ribose-phosphate diphosphokinase.
pdb deposition date 2006-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13793 Pribosyltran_N N-terminal domain of ribose phosphate pyrophosphokinase
A PF14572 Pribosyl_synth Phosphoribosyl synthetase-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h07A01
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h07A02
1GPH1 2JKYA 1A96A 3QW4B 1TC1A 3S5JA 4LYYA 4RHTA 3O7MA 5BQOA 1U9ZA 4RANA 5JV5A 3N2LA 1I14A 4MB6A 4LYGA 1O57A 1NONA 1UFRA 1A97A 1MZVA 4F8EA 2IGBA 1UPFA 3NAGA 4QYIB 1QK5A 1DKRA 1BD3A 1CJBA 3MBIA 1Z7GA 1YFZA 5BRNA 1XZNA 5E38A 3HVUA 1TC2A 4RABA 4X45A 2VFAA 1I5EA 1QCCA 4RAOA 4Z1OA 4RHXA 4P3KA 4P86A 2HCRA 3DMPA 1O5OA 1IBSA 1Y0BA 4M0UA 2E55A 5IAOA 1OPRA 1ZN9A 2P1ZA 1ECBA 1G2QA 4RQAA 4S2UA 2GEBA 2WNSA 4LZNA 1A3CA 3G6WA 1A4XA 1HMPA 5BSKA 1NULA 4OHCA 1STOA 4RADA 4RACA 2JBHA 5K51A 1XTTA 3EFHA 1L1QA 1OREA 1JLSA 1QB8A 4QRIA 5EUCA 2DY0A 1AO0A 1DQPA 1L1RA 4JITA 1QK4A 3GGCA 5ESXA 5IPFA 4RQBA 4LZOA 1R3UA 4RAQA 2FXVA 4WMLA 2H06A 4RHUA 1FSGA 1XTVA 3LPNA 4PAWA 2YZKA 3ACCA 4RV4A 3LRTA 4KN6A 1QB7A 1UPUA 2JKZA 2PS1A 3ACDA 1G9SA 1XZ8A 5HIAA 1I13A 5JSQA 2H08A 1V9SA 1PZMA 1VSTA 3OHPA 5BQPA 1D6NA 4X44A 3OZFA 3KB8A 1I0LA 1I0IA 1BZYA 1ZN8A 1A95A 1G2PA 1ECFA 1G9TA 3ACBA 1BD4A 1DBRA 1VCHA 1QCDA 3GEPA 4FYMA 4M0KA 1P18A 4P80A 1ZN7A 5ESWA 1LH0A 1P19A 1DKUA 5KAPA 2XBUA 4LZAA 4IJQA 2EHJA 4WN3A 1WD5A 2AEEA 1DQNA 1ECGA 5KAMA 5HKLA 1HGXA 1OROA 3GGJA 4JLSA 1ECJA 4TWBA 2PRZA 1JLRA 1A98A 3M3HA 1U9YA 4QYIA 4ZFNA 1QK3A 3DEZA 1J7JA 1P4AA 2C4KA 1ECCA 1XTUA 4M0PA 4P82A 1W30A 3DAHA 4P84A 4PFQA 3OZGA 1P17A 2H07A 2PRYA 4P83A 1GRVA 2JI4A 3H83A 4P81A 4RHYA 1VDMA 3MJDA
chains in the Genus database with same CATH superfamily
4I1IA 1G8GA 2NNWB 5FOUA 3ZS9A 3BCRA 1FNSA 2AFIA 3CUTA 4V39A 1OJLA 1E96A 4Y6GB 4AJ1A 4S05A 5T8KC 3BMQA 1P5ZB 1U8XX 2H2WA 1RMQA 3AF5A 1P4SA 1SIUA 3I9JA 5E7JA 1GKYA 2GD1O 2ZWMA 3LFHA 3ZHXA 4B6OA 3IJEB 4X3PA 1FJXA 3JQRA 2BMAA 1LC0A 5D3KA 1U7HA 3G88A 1GGFA 4NC9A 1JGTA 1DTSA 4KV9A 4R5HA 1Z7GA 1AK9A 3IJRA 4Y9RA 4RTMA 2O8DA 2R7LA 4L5BA 2XNCA 5K1ZA 3WL8A 3H5RA 1L3BA 4FP9A 1V5GA 4RY2A 4Z1OA 5GJWC 2VHQA 3JQ8B 3OCZA 2ZUEA 3GLGA 9LDTA 4TKUB 2EX1A 4NE2A 4XVHA 3DE0X 5C8DA 3TW8A 1SRQA 1JF8A 1EA7A 1NJ2A 2BFDA 3RV4A 1A9YA 4QJBA 5GTDA 1U98A 2IBTA 2VNHA 3ZD6A 2M6LA 3AM5A 2XF2A 1NULA 4XH9B 1C9YA 4UVIA 3DHEA 2EBWA 1A88A 3S2GA 4CI9A 4DA7A 5C7LO 1X8LA 4IHJA 4MARA 1V5WA 3GJSA 3CS3A 5CU7A 1DOAA 2AF4C 4LY3A 5ALPA 3IGFA 4PSAA 4AULA 4YY3B 1N34B 1ZJZA 4RKRA 2AJBA 4Q7MB 2YXEA 3KVYA 4B6RA 3LZDA 5FFNA 2XB2A 2O8VA 2RKWA 3GH1A 2WJVA 1OH5A 1FNMA 4XDZA 4F6RA 4KRYA 1H66A 1K6JA 3DTVA 5F2OA 3W8NA 2XAAA 2NUPB 3NPAA 4MQUA 3FLMA 4BV3A 5U1PA 3AUKA 4QUDA 4IIBA 4JLWA 1QHXA 1F14A 1K6MA 2E5LB 3KYBA 3JQ9A 4IO0A 1KDTA 1KF0A 3HE3A 3ZWCA 3LKDA 4ZYTA 2WD9A 4B7AA 4C3OB 4V2IA 3ITNA 3WHPA 4XD7D 4PZEA 3L04A 3H17A 1YQGA 4J91A 1QG6A 3T3HA 4UKDA 5HGJA 2C5EA 3MWDB 1H4SA 2B7BA 2ZKLA 4HYEA 4ZCSA 16PKA 1AUVA 2WYHA 4E13A 1Z2DA 4YUXA 1I0LA 4YMSA 1TL7C 4MUMA 4DIBA 1J8MF 2CXPA 3QOWA 2XA1A 1RLJA 1ZRSA 4MR8B 2X2PA 3BGDA 2Q5FA 1UC5B 1M1ZA 3HHPA 3RTDA 3KZXA 4X20B 1OZGA 3PVZA 1WCIB 5E9QA 4B1FA 1D04A 5CDHA 2WJWA 2J6CA 5JALA 1OLUA 3L0CA 2XBUA 1EK0A 2G6BA 1G20E 1ULAA 2GA8A 3ONWA 4EPYA 1I2AA 4GYJA 3GLQA 2XXBA 2YKGA 3ZPXA 2GERA 3GEDA 4W8HA 3CRMA 3PC4A 4XKJA 1NE7A 4BRUA 1PWEA 3JQAB 4UARA 2AG8A 1U9IC 1OROA 3KQHA 3IO5A 4MDEA 3NBUA 4CG3A 1MA0A 1HE8B 3CRNA 2JLAA 3II6X 4N9QA 4XYBA 3O9ZA 3JQPA 2G7ZA 1U2QA 4C0LA 2WFMA 3THSA 4LMRA 1X86B 5A1TA 3LS2A 5TRTA 4B3SB 1M34A 2WNIA 3AU9A 1FNDA 3VVBA 4F86A 1DEKA 3DZDA 4YI5A 3TLZA 2JKYA 1S96A 1KYWA 4NV3A 2OA0A 1PZNA 1N1GA 4BQSA 4JFRA 2ATIA 2VYVD 1JBKA 4CM1A 5I7UA 1MG5A 5LZ8A 2R2AA 1LSUA 3QP9A 4LBZA 4NPCA 1QP4A 1UKEA 3KWFA 4OP2A 4J1NA 1R4AA 3DG9A 2QDKA 3EXHA 3VDQA 4YJ2A 3Q0IA 1KJYA 3BERA 4HWKA 1HYHA 5LC1A 3HKBA 3SSNA 7MHTA 2IYUA 3PXGA 2CXHA 2D2EA 3MBIA 4F4JA 1DIHA 4CTNA 1KQGA 2JGMA 3VDXA 2W2OA 4MS4A 3AVXA 2JIZA 2WU8A 3I6ZA 3KB6A 2FF7A 3K9QO 3RFVA 1UZMA 5L4LA 3EDRA 3UCFA 2IY8A 2PUTA 3MJRA 4UDXX 3AHIA 1W2WB 4DMMA 1Q0QA 1OVGA 3PYLA 4I1VA 2A3NA 1ZM9A 4K6GA 2K4MA 3MGAA 4MEAA 1RXVA 4DR6B 4AURA 1DUVG 1VB5A 2JEOA 3D7SA 3F6CA 5FV7A 3RT9A 5ILOA 5AJTA 2V3CC 5JD6A 4RACA 4XJSA 1KK0A 2XMCA 3N76A 1OAOC 4GYWA 4WA8A 3IEIA 1ODIA 3D6NB 3LP8A 4NRDA 1FVHA 2FPPA 3L4BA 2V7XA 1OTYA 2NTEA 4MWTA 4OY3A 3SOZA 4CMKA 5JS6A 2G28A 2NLOA 4BQOA 4LI0A 3IV6A 3OU6A 2WU0A 4HX5A 5BW4A 1G55A 4BLOA 3HU3A 2NU8A 1ZM4A 2HJHA 2VDPB 3FDXA 1EBBA 4G56A 5CRIA 3EAFA 5JANA 4IS3A 4K9QA 3CR7A 3KT8A 4YALA 5ARDA 1JR3D 4G5FA 2O6HA 2ZQZA 1RVDA 1I7PA 1G3UA 1TZBA 1ZCJA 2B1GA 2VF5X 5CLHA 4ZD6A 5J2UB 5HOQA 3LCUA 3LPDA 2IXTA 4YJFA 1IATA 4M4SA 2IIQA 4NPAA 3VDRA 4BIMA 2QN7A 4PXYA 2YIJA 3BOSA 4QE3A 1A8IA 2AK2A 2I4MA 5KX5F 3OTQA 2WYWA 4P0TA 3GJ4A 2XXAA 1Z0AA 2FG6C 4PLPA 3DFUA 4XRGA 2CK3A 2D5LA 2REXB 2OXIA 3FVQA 3R5JA 3C3YA 4QFDA 4K05A 4Y6LA 1YBFA 1T1EA 4XX1A 1OYOA 4NG4A 5DSTA 3PF8A 1I30A 2YHBA 3MELA 2DTXA 2DKFA 4R1PA 1YQXA 1HMYA 1UQUA 3AEKB 3H8JA 2XUHA 3QPUA 1HTBA 5K0TA 1J1UA 2KS6A 3KZNA 2OQRA 1T25A 5JE8A 4ZVMA 2VPIA 4DQUA 4YDHB 3KM0A 3TQQA 5U4QA 3P5SA 1W0JA 1SUPA 2A86A 3A1DA 3AUXA 2NYVA 2BGWA 2AZMA 2VQ3A 1ZOPA 2OXEA 3D8NA 1L5NA 3JSXA 1NT4A 3DFZA 4J4BA 3I2HA 1W94A 1TO6A 1PGQA 4YMIA 1T36B 3KKLA 2PZ8A 1YHNA 1CR1A 2ZR9A 4BFXA 4B5KA 3FMPB 3ZLUA 1ZSYA 1VMIA 3OSZA 3DAHA 3VR2D 4EIWA 1E0AA 3VHQA 3EEBA 5ELMA 2B5OA 5PGMA 4QTUB 4YYEA 2H9IA 4OQDA 1K7CA 2AT1A 4PSCA 1AURA 1DAHA 4FNGA 4F1KA 3U4CA 3PTLA 2ALJA 4GYKA 1AHPA 1LFDB 3UWDA 4D4KA 4FQ7A 3VZDA 3IUYA 2ECQA 5C4IA 4Q4JA 3G2NA 2BP7B 2MR5A 3DOUA 4YWHA 1CV2A 5NULA 2XCOA 1KE1A 3KNZA 5HJ7A 5IUJC 4IOMA 2R44A 4IH1A 1NBME 5KEIA 5G40A 3TIXB 5JMPA 3HABA 3NHSA 1MQSA 1TJNA 2O7QA 2WIFA 2QMZA 3N8DA 3PHGA 4HFNA 4O1MA 4A8HA 3KDSE 4D74A 5I47A 3JZFA 1GPBA 2IYOA 1IY2A 3RU7A 5AICA 3RVNA 1AQYA 2AWOA 3LZ6A 4HUTA 1E69A 1JSRA 2HK7A 1IZ8A 2F1KA 5HJEA 3D6FA 3GT7A 1SWWA 1XXHB 2ZEJA 2EZ9A 2PKRA 2Y0BA 4ZVUA 5BT8A 1QRTA 4A8JB 1OXBB 1IQRA 4DW8A 7AT1A 5KVQA 2PH1A 4OHVA 2WKRA 2ZB4A 4B3BA 4BFTA 1JPJA 3LUKA 4RADA 5JJBA 1W7AA 3PWTA 1Q44A 3TEMA 2REQB 4X1IB 1PZHA 3T3NA 3KTFA 4ARBA 1WEKA 2QY6A 3INRA 4PIVA 3R7FA 4AJPA 4D26A 4ETWA 1QQBA 1JEYA 3SC2A 5JAMA 1R5NA 4BFZA 1WVMA 4DARA 4JP3A 5KTTA 3K0SA 1T1RA 3R7DA 4YX9A 3OQIB 2PM8A 5KJEA 1DAEA 4CCAA 1MD9A 3VVCA 1JP7A 3ZWYA 3L8YA 5C80A 1Z13A 1WB9A 2JLRA 2I91A 1TA0A 5CLGA 3K4QA 2EW1A 4GWGA 3QUBA 4OH7A 1OIVA 5JYCA 1SZDA 2FQWA 3SZ3A 4GE3A 4LMBA 4ZGGA 5KTSA 2ZE7A 2BH9A 3PT5A 2CGEA 4RFSA 4F9TA 2J5KA 4N9WA 2OCPA 1TM2A 4UASA 3GY0A 2XUGA 4MJLA 3PEFA 1CUSA 4GD3Q 4DM3A 3D2BA 3HN7A 4E21A 1Q3TA 2KQUA 1XQWA 3N6VA 1DEXA 2YZMA 3PQ6A 1YZNA 4G2TA 4MEBA 4QBKA 4RD1A 3KSDO 2W58A 4B45A 2DR3A 3TZ6A 1FNCA 1K9SA 4MS1B 4CV0A 3BE4A 3G8DA 1I0IA 4LCJA 3S2SA 2GPAA 2F2TA 1R9GA 3CA8A 1HFEL 4IDAA 4DMHA 1N6PA 4MA5A 4TTIA 1MR3F 2XD9A 1T6NA 4UBJA 1RKVA 3RFCA 2R4TA 1FTQA 3VU8A 2IPXA 3RS3A 1Z3CA 3U7QA 2HJVA 1IXZA 2PBZA 2Z8YA 4MV7A 3UFXB 4B3MB 1GPYA 1DQNA 2YHIA 4ENPA 2QXTA 4GXQA 4WN9A 1JQDA 3IVAA 4QGSA 3OJWA 1LF5A 2YN2A 3WLFA 3ZH2A 3EH1A 4KRGA 2VHWA 1JXOA 2W6MA 2CKMA 1LQTA 2AA3A 3MTBA 4G24A 4J29A 3ROKA 3TJMA 3ZQJA 2Z6AA 1DO8A 3AGPA 3UJDA 3DLCA 1LBHA 1MGPA 2AJCA 3HL4A 1JIJA 2IJGX 4S1VA 4KG7A 4S2EA 5CP8A 2FPSA 3A1WA 5FBHA 1K8YB 1RYHA 3LKVA 3MOIA 2V03A 2JJYA 1P0MA 3SBEA 2DSNA 2XPCA 2YWDA 3OIVA 5F3RA 1Z0SA 2AIRA 1VCIA 4XCVA 4XFDA 4BBJA 4EUFA 2ZUWA 4KI7A 1U9IA 1BEZA 4IV5A 4R1QA 3U7RA 1ZIYA 3NC4A 4B34A 4XJTA 3U1TA 2ZYAA 4RANA 1U7UA 2G9NA 5IW8A 2JLCA 4EO7A 3OBBA 4CCWA 4Z7OB 1IUOA 1YJBA 2OESA 1QZZA 1KP2A 3C0KA 3WRWA 4TV9B 4BEJA 5HOEA 1OTXA 2GSDA 3UKJA 3WGGA 1DTWA 2MSNA 2CF6A 2PWPA 2P2SA 2II6A 1Q1EA 1N5KA 1SD2A 5IXYA 1F38A 1ZINA 5EJ6A 1I94B 5L3SA 3VKFA 1FJHA 2HT6A 4O33A 4XR9A 3HXLA 3PC3A 2VXOA 2XEDA 2ZYRA 3L0BA 2C20A 4DB4A 1IAVA 3FGZA 1X8JA 1N2GA 5C37A 2Y77A 1DXHA 3BCUA 3GG9A 3HZHA 1N9KA 5DGCA 2ZREA 1BXRA 5EMLA 2HSZA 3G9TA 1H9AA 1V5EA 2G71A 4AQDA 3FZGA 3LHDA 3DLPX 4I55B 2FRXA 3AP2A 5BQFA 1VLLA 3HACA 3KHTA 2PHZA 2PVSA 4MR9A 1E6WA 2AK3A 3PXEA 3KHUA 3SHVA 4EHNA 2ZT7A 3MJSA 2QI9F 1ODCA 4GPIB 3HJNA 3WYCA 2PGNA 4KUEA 1F2TA 4R2KA 4OA5A 2B92A 3DVLA 1G8PA 1I7NA 5DLYA 3WLQA 1CUXA 1OBCA 4IV8A 5DW0A 1QRAA 4H4DA 3KOWA 2IPNA 2C92A 4F9EA 3LQRA 1Z8DA 1CX9B 2QL6A 4PIPA 5ITVA 2H57A 5K0JA 1S1CA 4YACA 4BLWA 5GZ3A 3KR9A 3GFRA 2QJOA 4BMXA 5A71A 4XLLA 4JD5A 4F97A 2Z1NA 4MVJG 1ONBA 2B69A 1RI1A 1H0SA 4H77A 1H6CA 1AY0A 3G0BA 1RWMA 1N9GB 4DLRA 4PYJA 4F85A 3Q11A 2VS1A 5EZQA 1VYTA 2BKAA 3Q6IA 3UT5A 3L8CA 3ON5A 4I36A 1D6SA 3NNDA 4RVFA 3EXFB 1DJPA 2HU5A 4LHSA 1RZUA 2BGRA 4KLNA 3WIEA 2VF7A 5J5CA 2I6TA 3EULA 4HNVA 5FWDA 1F20A 4E12A 4Q19A 5H68A 1ONPA 2VZLA 3KQYA 4JJFA 4BNTA 4F3NA 3O4IA 1EFRD 1RIIA 1ZRMA 3KQWA 1Z6YA 4KTTE 2RJOA 1F51E 3PGLA 5REQA 1NVBA 3Q7TA 1ZFNA 4WFJA 4F1JA 2FRDA 3K2BA 4EJSB 3BULA 3UQYS 5IASA 1V26A 4D3YA 2QRGA 1YI0A 4ILKA 1U5BB 3CX7A 3L8EA 1KERA 1A5AB 1UZUA 4IMJB 4IJQA 3FOAA 1SOVA 2R2GA 3SQWA 1IONA 4G5QA 4M1KA 3GDHA 1QZXA 4FKBA 1LDYA 1P31A 4KAXA 5ALMA 3EA0A 1CYEA 1E2DA 3ZJYA 1HTWA 3LY8A 2X9NA 3NDIA 3EIQA 4L72A 5C8ZA 1XRNA 1R0XA 2QTBA 1G20A 1VLZA 3JRXA 4PLFA 2E6KA 1PEKE 4YP1A 1L5HA 3ZE1B 1COWD 1ZC4A 2IH2A 1BRTA 3WGOA 5FBLB 4RNDB 2P3QA 2B98A 3N2YA 2PGJA 1TD1A 1JPVA 1WKBA 3NTLA 3RAFC 3HDQA 2HC9A 3H04A 1BTOA 1N77A 1Y1KE 1SZJG 4JLOA 1L7AA 3UWSA 1VDMA 4K6HA 2WWYA 1FSSA 1FU7A 3BHIA 3Q9SA 1KHHA 2XAUA 1E5LA 3GCWA 3MTGA 1SKMA 2G5CA 2YJ4A 4HGPA 4XYLA 1YRBA 1GTVA 3ZVLA 3CVOA 4C0HA 5JJ5A 2X13A 1OLXB 3ZKWA 2YQZA 3QXHA 3C87A 4W8GA 1OH8A 3BQNB 2QTCA 1DRJA 3FB4A 2HH9A 4OYYA 4C07A 2MIIA 3MWKA 4D25A 2H31A 5JC8A 2JVIA 1DTEA 1NJSA 1RKQA 3OJEA 3DEYX 2AHOA 2C7VA 4TTPA 5IVKA 4NJEB 2ISCA 4RPJA 4LYFA 1C81A 3OHMA 4XEHA 3PLAE 2WE8A 1VDZA 3IAUA 1D4FA 1CUBA 3PFCA 5JNVA 3F90A 2AFHB 2J3DA 5IAOA 4JU9A 4BYGA 1AB6A 3ZD8A 1BS2A 1MOQA 2JGFA 4OXRA 4TV8A 1SIOA 4A1OA 3I28A 5JD4A 3DDCA 2ZI3A 3ZHCA 4QVGA 4RPLA 5AVJA 2FPIB 5AHWA 4FGKA 3TUJC 2WWVD 2H4XA 3IQGX 4EDHA 4P2GA 2AOWA 1Q7GA 4JQOA 3JYOA 3W5IA 5DEIA 5E4TA 1SKYB 3SYNA 3JASB 4KODA 3CU5A 4TUYB 3ZJ4A 4NCBA 2AC4A 3DKPA 1LVUA 3VHXB 4B83A 3K71B 1ADFA 1GFWA 2QD4A 1AMUA 3I58A 1ZD9A 1USWA 4D6PA 2IZ0A 3GBVA 2B9VA 1PHPA 2GBCA 3Q3CA 5I8WA 2CLCX 2QN9A 3BWDD 3CY6A 3UANA 3ZWWA 1E60A 4HJRA 2QF7A 3TZEA 2CNBA 5CEFA 4TT8A 3MJEA 1HX7A 1X7WB 3AEUA 3DAPA 4NYJQ 5IAGA 3VZRA 1NYTA 1N2HA 3EDMA 2XBLA 1NM5C 3RSSA 2NPOA 1C30A 1OPXA 4JLBA 4NFYA 4QBFA 3UB3A 3I62A 1Z4LA 2VSFA 3S8YA 1UF9A 1E2FA 4KITB 4EI9A 2OFFA 2IK8A 1BMDA 2PSEA 4FXOA 5LQSA 4DM4A 1PZEA 4IM7A 1PJ3A 4DJJA 4I08A 3AUTA 4MICA 4FPXA 3UF0A 4YRAA 1PKXA 2Q7XA 4XWWA 2FRVA 4LDQA 1PJZA 3PVCA 1A5ZA 1W4BA 4Q3AA 2DHDA 5G0SA 3WKEA 1DFGA 4GG1A 4B44A 5J58A 2FR1A 3AWDA 4CLXA 1X1DA 2NTYC 4FGUA 3DF9A 3NW9A 1DCFA 2WPNA 1IJBA 1NLFA 3LO5A 4PQYA 1QH1B 2P9FA 3ZU4A 4F8JA 2PDAA 2CKDA 4EY8A 5GY7A 2BTQA 4HZGA 1GPKA 2RD2A 2HBYA 2UAGA 3C2QA 3UMVA 5M29A 1WO8A 2PA0A 2QSJA 1PS0A 2N1BA 4PNHA 1I4WA 4HF7A 5D51S 4B79A 4HV4A 2JLWA 3HTXA 4M1TA 2Q9CA 4FI3C 3GUHA 3IEXA 2VBGA 5LB4A 1NBOA 3F5MA 4OVKA 5CBKA 5JRJA 3PNPA 4H3VA 4HGNA 4XB2A 2OD2A 4ZT5A 1MC1A 3Q1KA 1EFCA 5IM5A 3RIGA 2FVYA 3TAHA 4PCLA 3PENA 1FFBA 1LPMA 1O6BA 3MS7A 2Z8YM 3NRBA 4QXPA 1V3VA 1JU4A 1PLJA 1NDUA 3ICOA 2E85A 3KZCA 4P4GA 4FWIB 4D97A 1QHHA 3U4AA 5BN3A 1TC1A 5T3YA 1C1DA 1KYYA 4IGFA 4OI4A 4RZQA 3GB9A 3FCSB 3LWNA 1CJCA 2PKWA 1AJEA 3QV2A 1Y6QA 2VSNA 5D3MA 5IDWA 3LCMA 3NHWA 1H22A 2Z98A 4Y0VA 1DWUA 3V2HA 1HSZA 3LC7O 1LI7A 1NAIA 2C3UA 3F6PA 2JANA 2VZ9A 3BXZA 4B47A 1NX6A 1WUTA 3DA8A 3RC8A 3HA5A 1PJ2A 1Z0FA 4QHSA 5BO5A 4OUDA 2GBPA 3HDYA 1H85A 4L3WA 3GLVA 1L5KA 1JKXA 4CCYB 2QTAA 4YPFA 2BZSA 1JNXX 2TECE 3ENNA 5FA6A 2GN9A 5EIXA 2WJ6A 4P4LA 2X5OA 1NBMA 1BDHA 3DOHA 1T29A 3T5PA 5CDUA 4LKRA 2N0SA 5ADWA 3ZHUA 1U3GA 1NVDA 2G1KA 4WDQA 3NEPX 1E61A 2VBCA 1FDTA 4I9UA 2QM3A 3RREA 1ZH8A 4JYAB 1C3OA 3DFIA 3IQIX 3P9NA 5EVJA 1SRRA 4RTNA 2C0QA 2CFCA 3HWX1 1C8KA 1GPJA 3B6JA 3PX3A 3TYXA 3ZGOA 4D4GA 1GU0A 4IIJA 3U7GA 1GPNA 2CY0A 3HP1A 2HBRA 2Y76A 1M9NA 5EIBC 5CM8B 1B74A 2R7AA 4RK4A 1GG5A 5FLYA 3WQRA 4CM8A 5ES4B 4GOXA 3ER8A 2WKQA 8LDHA 3KSBC 2ZXFA 2VT6A 1QP7A 1E58A 3LX8A 1X1RA 3R6DA 1VMEA 2P69A 1DHRA 3TR6A 3TZHA 1U0BB 1H3FA 3PR1A 1OLSA 3QVTA 1QK4A 3MTEA 3RHTA 4IX1A 3O4HA 4A2QA 5JYBA 1NJ8A 1MHPA 4RENA 3R7LA 2HHJA 4WZBE 2J9GA 4HYYA 3I9MA 3LKZA 4IRMA 3EPKA 4B71A 3CEPB 4R8RA 4HAWA 4RTPA 4WPGA 2FUNB 2I4IA 2NSHA 1M1YA 2QA5A 4S1OA 3OA0A 3ACCA 2EDCA 1KAOA 2BHTA 5D00A 5DGTA 1DJMA 2P9EA 1S6YA 2ZB7A 3FUXA 4ZHQA 4OV6B 2CLLB 4YMGA 5LYJB 2AYYA 5B1EA 4LG1A 2CVZA 2P7IA 1UPBA 5ELXA 3A27A 2AR7A 3HBJA 5ADVA 5JEDA 5ED4A 1EZ1A 3IH5A 3M49A 4XQCA 1L5RA 4LNUA 1P2BA 2OXFA 4X91A 3UENA 5ICSA 4BXOB 3OCWA 1M5TA 1ACMA 2XIQA 5JQGA 4C04A 4NCJA 1JLLB 5JS1A 3ZIUA 4DA0A 2QRZA 4DR5B 2XKKA 1PJTA 2C84A 2VI5A 1KI6B 4UTPA 2IHYA 2PO5A 2ADMA 2D1YA 3GQBA 5FBRB 3DTYA 3NGMA 3Q5GA 3SDBA 4L50A 1ODKA 2Q0HA 2Q1YA 2BGIA 2ZYDA 3VPXA 5LWHA 5JFGA 3ZE8A 1GN8A 1O58A 2H1IA 1XD2B 3I34X 5F1YA 1DAKA 4RLFA 1FXSA 2RAFA 2JF0A 1NW9B 1NFQA 3FCOA 3M3HA 4Y67A 4FFDA 3KTDA 3FCEA 5A05A 5DTQA 1NI4B 1TF7A 2DT5A 3QMMA 1EWKA 3M2PA 1P0CA 3W8EA 1X74A 3C8HA 1O6GA 4UC0A 1P7VA 4H3HB 2CV0A 1S3FA 2I7TA 2PMKA 4U3JA 3PV0A 5HS4A 2I3ZA 4O1HA 1AV6A 2WHPA 1I80A 4L51A 3UK2A 1XPRA 4U2KA 1TQ6A 4WDRA 1GCAA 4UPVA 2NU7B 2G06A 1TJPB 3E3MA 1SO8A 1JQ5A 3TPFA 5KC8A 3TVYA 4QOJA 4Z8YA 4DG8A 4KOAA 4Q5IA 3BSSA 3UV6A 3AILA 3FMVA 3N0RA 4YJKA 1QGED 3D6JA 1T5DX 3UQZA 4KSYA 4RABA 2EERA 2B20A 2H7VA 2XY4A 3G9UA 3V48A 2O05A 1ABEA 1T43A 1NVWQ 4GSYA 1OX6A 1T9KA 4TSRA 2YZNA 3IPLA 3L7AA 1WW8A 1PBTA 2RK4A 3GOHA 1VGQA 3BGIA 4DLLA 5BWOA 3SWWA 3LKBA 4N5LA 1FMFA 2ZU0C 3D3WA 1QFMA 4Y2YA 4P3OA 4WVFA 4IDCA 5CDTA 4KLZA 3H1FA 4QAJA 2GYVA 1NOIA 3AR4A 4LZPA 3VR1A 3R3UA 2D4AA 2BTEA 3RRXA 1L4KA 1NBAA 2AMJA 4J2OA 4DSZA 3QQPA 3VVMA 2GPWA 4YUYA 2GXAA 2QTFA 4HFRA 5CURA 1J2RA 1CK4A 3B1JA 3WMEA 4XWKA 2AH5A 2J9FB 3KB2A 2UXCB 2CLKB 2FGKA 3I2KA 1NVKA 5FEMA 1NVMB 2HGSA 5JXJA 1IJFA 3M89A 2PKXA 3ANTA 4QLOA 4UM7A 1NBWB 1NPDA 4Z4IA 4PYKA 4X6XA 4GYYA 2ZUCA 3T3EA 2FWAA 1TKBA 3AFNA 4EKYA 5KKCA 2O8BB 2OGTA 2JBAB 4PX3A 4ZP1A 4M22A 2LXNA 4YP5A 1MG0A 2EEPA 1JJVA 5BT9A 1VL0A 1G66A 1ZOLA 2WJZB 4NV1A 3V8EA 4URVR 1XTVA 2YWFA 3HG7A 5JDCC 3M6UA 5HE9A 2PX2A 4WESA 3RARA 4OYLA 3HB0A 3ZHZA 2BFAA 2FSUA 3H2JA 3LRPA 1QH0A 5HRAA 2V96A 4ZQFA 1H5NA 1Z6XA 2R6DA 3O8QB 2IYSA 3IKJA 5KVVA 1PZMA 3H0EA 4OU4A 4N41A 1SUDA 3DLAA 4XDGA 1NP7A 4LE2A 4EPWA 2XQIA 3PJRA 2IZ5A 3NM5A 5U9CA 3EJ6A 2IBMA 1N7HA 4DQKA 4HAVA 3SVLA 2B8NA 3D0QA 1ZW1A 3MT8A 2IWRA 1ZVVA 4QPDA 3QA3E 4F4IA 3UBTA 2Y71A 3DTVD 1TQ4A 3U9LA 3I53A 4BUZA 3HXPA 5IU6A 1NX9A 1P60A 3N86A 1GTG1 2OENG 2XWBF 1KNXA 2ECPA 3BSYA 1PRYA 2QX7A 2L0XA 3R6TA 4HAIA 4P1ZA 4WA7A 4QG3A 2EKPA 4Y2QA 3UNXA 4QEKA 2HRZA 4WN3A 3BDVA 4WBXC 4YH1A 5EL0A 3VR5A 1RC8A 3SXUA 1P0QA 3JWEA 4BL5A 2J67A 4KR7A 5HF5A 1I9CA 5EJFA 4C88A 5ECGC 1M6HA 2O2JA 1OIWA 1XTQA 4FOTA 3PFHA 3DEZA 3I64A 5ALEA 4MDFA 1QIHA 2YNMD 3UV3A 4GEKA 2ZE6A 3GIDA 3F98A 4IO1A 4O2AA 4OIMA 4XSVA 2OD7A 1P73A 3ET4A 1XK7A 1F8XA 3QU5A 3QVSA 3VU1A 1TIBA 3OCCA 3ZHVA 3GRYA 2RHGB 3EXG1 3K1TA 4BNKA 2CUZA 4EUHA 2UYQA 3JTEA 4M3NA 5A6SB 1GYQA 2VHZA 4OK6A 2C97A 2WSSD 3UG7A 1ACJA 2DLNA 1N6RA 2VCHA 4PX5A 3RU2A 4MLZA 1PJBA 4FGJA 5AI4A 4C2AA 1EB8A 1KOJA 2X0RA 1YQEA 4DDVA 4O4IF 1MVLA 1TGVA 5JHGB 1LDBA 2JFVA 3DD1A 3RTCA 5E6SB 3IAEA 2ZPUA 5KJ1A 3F71A 2B3TA 2VYFA 3QVWA 5D1NA 3T9FA 3DLHA 1DINA 1S8AA 3FWZA 4G1BA 5DHTA 4RU1A 4YBRA 3AEQB 5JBNA 4BKRA 3V97A 5ALKA 3GARA 5A9RA 2VZ8A 4INOA 4PPNA 3RRNA 3EIFA 3T4PA 5A0VA 3RS2A 4EF4A 3TQTA 1F0YA 4UBOA 1S2DA 4IZOA 4TXLA 1O9GA 2GKSA 3UMBA 1NMYA 3EC1A 4BOYA 2GF9A 2JA1A 4URWR 3HU1A 2XHZA 4LVCA 4AFNA 4OHCA 3PUYA 3CC8A 3LO8A 4RA9B 4UTZA 5K3SA 3TQCA 1T0HB 5FOXA 1ZSNA 2TRSB 4FBGA 3AIMA 2DECA 3CZPA 4UCXA 3BIJA 2HWKA 2O1EA 2J48A 1K3TA 1VKRA 2XYRA 3G3EA 3GGOA 3SXJA 4LISA 1DQPA 2H16A 3ZQKA 3NBZC 1HRDA 4Y6OA 2BFEB 3K5HA 1TJ3A 4BJ1A 4L7QA 1Y5LA 3KPWA 5LD2C 1TEZA 3TM4A 1WDKA 3K30A 5IKMA 1KMQA 3UGQA 4DEVA 1ESNA 1L8OA 3UJAA 4M8IA 2FCAA 3IQEA 3TOSA 1O6ZA 4DG5A 1ECLA 3G0IA 3DB1A 2ZTUA 3AESB 2C9ZA 2TSYB 3N6RA 4KN9S 4N3GA 1MU0A 3KVVA 4CMIB 3W06A 1JG3A 2CXXA 3IIMA 1EFKA 5ARCA 1CEEA 4GPEA 2NVBA 1KXJA 3SJBA 3VO9A 4UXHA 5G1OA 4HDQB 1O96B 2H08A 1P1JA 1VGVA 3LLMA 4OP3A 4WECA 3FM9A 3T3GA 2C42A 2WTXA 1P1KA 2MT9A 2F9FA 3C3JA 3O4GA 5J59A 1D1TA 2Q2OA 2QX8A 4TRRA 1MB9A 1B8OA 1E0JA 5C31A 3ZZ1A 1VTKA 4B32A 4BLUA 4JROA 5CA1A 4GC5A 1R18A 1UMCA 5BWBA 1KGDA 1ULBA 3AJEA 3EAGA 3L6CA 1EWVA 1X87A 4CCSA 3GFFA 4QNRA 1WIWA 5KYUB 3BWXA 3QVJA 2ZUBA 3LY7A 3ELWA 1A5SB 3MCTA 3ICCA 3GLTA 1T2UA 4OAQA 2A0YA 1OWNA 3LL7A 3W6PA 1KAEA 2B3DA 3AH8A 2ZBVA 1OXSC 2R3SA 4AF8A 1R1DA 2B78A 1IVNA 2GVNA 4LSGA 2XUJA 4C1NA 1D2AA 2P2YA 3TFWA 3PX2A 3ZDFA 3L4SO 2FR8C 2A0WA 5LLDA 1VOTA 2QMYA 3KP1A 3JR7A 1LW7A 4B6FA 3VAYA 3EHDA 4PWZA 4CQMD 5AVQA 1C7IA 3MUFA 4RK7A 3CZRA 2K2QB 1M1NB 2IHUA 3IDQA 1EIWA 1GO2A 4A0SA 4JLKA 2YUIA 2A57A 2VQDA 1J7JA 4U7FA 3T15A 3S1AB 3KG2A 2IS1A 4ZTZB 5HS6A 2FWRA 3NYRA 5EHXA 4FOOA 1U90A 3ORHA 1O5IA 2H07A 3OKFA 3MWYW 2OD9A 3EJWA 5TQ2A 4J7UA 5FOTA 1J99A 1K0UA 3GFSA 4D4IA 3T0FA 3T1YB 3FPLA 4FZ5A 4ML3A 4RJJA 3PICA 1Q83A 5MN5A 4XD2A 2I66A 2VH2A 4IKPA 3WNZA 3AX6A 3ICEA 1KDOA 1W5TA 1HL7A 2ZZKA 2G8LA 2DUWA 3GP5A 3UPDA 4NU5A 3JAWA 3B20A 2DLCX 1W19A 3G2LA 2EFDB 5E9AA 2DBRA 1VPWA 2JRCA 4JHLA 3WQBA 3FZYA 4RDIA 4L0MA 3VSAA 3H2IA 4Y0NA 3A1UA 1DX6A 2VK2A 4AJNA 4BN4A 2ONZA 3Q3JB 3AMVA 3HFJA 1MJNA 1G7CA 1MOZA 1ODSA 2RHCA 2RGRA 4GBED 3W5SA 5JH7A 2P9GA 4I0WB 1KZGB 1RBMA 4OLFA 1N1MA 5BYAA 1FOEB 3W2FA 4ZALA 3FVWA 1T4CA 4IGAA 1L8LA 4X61A 3V1NA 3WNVA 4DSOA 5TMEA 4RY8A 1Q57A 3AF2A 1YZVA 2HXSA 3IR6A 4LQLA 1PQUA 1Z7BA 1V4BA 1PV1A 5T6MA 2FP4B 4M9ZA 1SU7A 5K51A 4E5VA 4EYKA 4C3VA 3E81A 4I50B 1NZFA 1I6WA 3E70C 2BELA 2IP2A 3FR8A 3R3XA 1MJ5A 4EKIA 3OO0A 4BRSA 2XD4A 3EFOA 1RJ9B 5KQPA 2DY0A 4BX8A 3OTWA 1PWZA 3I73A 1ITZA 4YO7A 1D8AA 5HBGA 3NRCA 1ISIA 4UDOA 1R5OA 2L18A 3AHGA 3D8HA 3IX7A 4CKBA 1WV0A 1JPNA 4YRDA 4KVZA 3STHA 5KQRA 1AD2A 3AIKA 4OQPA 1GZSA 3G7SA 1L5YA 1ZONA 1AUOA 3C3DA 3FYHA 4WBNF 1FTSA 3QE3A 3U5ZB 5HP4A 4J0JA 4YWJA 1HQYE 3N75A 1T91A 1QIFA 4UHFA 2IZ1A 5AW7A 4D4JA 1CRWG 2BMFA 1WZEA 1YC2A 2AC7A 2EGUA 3E5MA 4RA6A 1JG7A 1B16A 4BTEA 5C81A 1H2ZA 1ZITA 1AF4A 2Q6IA 1EQAA 2XVXA 3DJFA 4JU8A 2DBVO 1T9CA 4R8VA 4CU2A 4HQFA 4W6ZA 1E6MA 4GR5A 4F5EA 2AQKA 3L7BA 3WKCA 3CT4A 2AEFA 5DW3A 3SSAA 2G17A 4QU0A 1RBQA 1VCHA 1SVOA 2P0AA 4Z7JA 5IS2A 4NXMB 3RJTA 2YICA 2JASA 3A4TA 2QZPA 3MUNA 1LRKA 2OQVA 5LP6F 4L0CA 4B3XA 3NS7A 2O3QA 3E3LA 3FPBA 4UQPA 3V42A 1X13A 2ENUA 1G8MA 2PEYA 3M6XA 4GI1A 4NBSA 3QNWA 4X5OA 5IRCD 3H2KA 1YNOA 2OB1A 3QLEA 1RHQA 3FFTA 1HDRA 3E1SA 3VU3A 3ICVA 1DEOA 3BDAA 2OO7A 3ENQA 5IEJA 2K7FA 2QPOA 2PRZA 1BMFD 3FOBA 3KQMA 1WMFA 1JTVA 1KDRA 1RCFA 2I4LA 4YEDA 1YRQA 2QSUA 5LCXA 1SCNE 3KDPA 5WRFA 4BO9A 4EGJA 3ZVMA 3PXCX 3RV3A 4B3IA 3NHUA 2VWPA 2JHCA 2A0XA 1JJIA 1PWHA 1C2TA 1CVRA 4ZVLA 1FNBA 1U3VA 4CEIB 1RCTE 1SCUA 1OIXA 3V6LA 5A2GA 4R1UA 4WX2B 5BUCA 4A10A 2G4VA 3CSDA 4E07A 3O03A 4CM4B 4F4FA 4DV5B 1N1EA 2I22A 2PLWA 4Q6WA 3QEAZ 2R25B 1SCAA 1TEXA 2VDJA 2ZCUA 2FPKA 1FRZA 4IXDA 4OJQA 4UUNA 3DFFA 1DWOA 2N46A 1IBLB 3PNLA 1XSEA 1Z37A 1ZUIA 3EW9A 3GHYA 1PR4A 3OBIA 4FW8A 4ES6A 4ESVA 2O8FA 1M2OB 1V5FA 4RD0A 1QHEA 1ILEA 3DDOA 3DDNA 3BXHA 2OG1A 2VUHB 1U2SA 1Q2XA 4B8WA 1U2TA 2LR0A 4RV9A 2R1UA 3UHAA 5DASA 1XQ1A 1EZ4A 2EGHA 3A9RA 3GQVA 5CFRA 5K7SA 4HUJA 5TF4A 3FOFC 1LNQA 1QTQA 1B3BA 1TC2A 3FDZA 1Q15A 1REQA 4WL0A 3KR0A 3VDMA 2FEWB 1NSFA 3T61A 3GNTA 4ND8B 1X19A 2B4RO 5JD3A 4DLWA 1W35A 5LDGA 4C5BA 4UM9B 3UXYA 1EFTA 4RZUA 5AW9A 3TLCA 1CVLA 1MAHA 2PMWB 4PR0A 1W36C 4BAZA 4KQKA 2XNHA 4S2UA 5CLFA 2NPIA 2XF8A 2V5AA 1MJFA 3E9RA 4HPXB 4BGIA 3Q7EA 5EIFA 4DCOA 2ZULA 2X2FA 1QG4A 5B7QA 5I4KA 2ZUVA 3VZCA 1PR5A 1QAQA 3R0ZA 3ZWXA 2HJRA 2I5PO 3PGVA 4GXNA 3TLEA 3V1YA 3QXXA 1GUBA 4KQHA 2BKLA 2EQ5A 3ESRA 3PPVA 3DOIA 4LY0A 1TEHA 1NBHA 2QN2A 2W6JA 5CVVA 1X1AA 1W52X 2H52A 1ESZA 4UMDA 3RYCB 3K1YA 2WP0A 3BF7A 3LOQA 4F56A 1RLUA 4OU5A 1KZ6A 3ZG6A 3PWZA 3PP8A 4DKJA 5CDFE 4BCCA 2YJTD 3FDJA 1DAOA 3B60A 4JBNA 2QI9C 2ZYUX 1VIMA 1XVVA 2K5UA 2JI8A 4U7TB 5H3LA 1N0HA 3S8MA 3EVFA 3Q7PA 3CH7A 2ERXA 4K9RA 1CIPA 1M0TA 1Q7CA 3NHPA 5BNTA 2ZJ1A 5E4JA 4BASA 1FTYA 4GIBA 3WYDA 4CKYA 4AZTA 1RWPA 2FG7C 1J8FA 1Y5MA 2R6GA 3RUDA 4LPKA 4W8OA 5T4HA 1QH9A 4M6WB 4FINA 3NOQA 1ZMBA 3D5TA 4MWZA 3FFAA 1WXDA 1G5QA 1F4PA 1VP9A 2OV4A 2CXRA 4OHWA 4MUFA 2NXWA 1LSJA 2JAHA 3H13A 3V4SA 5FOQA 4GT1A 3DQPA 4LDAA 4TTJA 4ND4A 2I1LA 5FNVA 2V0CA 5IKXA 2W37A 1LPSA 3WGZA 2FWBA 3DTNA 2DRIA 4AY6A 1BJKA 1JHXA 3E4CA 4ZT3A 5KYWA 2R66A 4XE5A 1VL1A 1VPDA 4Q3CA 4WHMA 4ARZA 3JAMA 2JIQA 3GZNB 4YN3A 1K1EA 1AHHA 1PX0A 5G1NA 5KQSA 2AB0A 1RE0A 3TTYA 1PJLA 4KGDA 2KB0A 2OVFA 4IDOA 1NI3A 2SBTA 1H4QA 3W9BA 1SXHA 4BVKA 1SQGA 1MBZA 3G7UA 2CWDA 3GD5A 5JO9A 1OGYA 2HWUA 4RS4A 1PR1A 3RKRA 1XNQB 5K3FA 1TTPB 1WHTB 1HLGA 2GHQA 1KIMA 1Z18A 3N2NA 3OWXA 4URFA 5G02A 5CH8A 4QQ8A 3EPJA 4MMXB 3VZBA 4WNAB 1XCLA 2POQX 2P7HA 1JDJA 3BTVA 4J1QA 2PQ0A 5FORA 1A96A 1RNLA 2WEKA 4GO1A 4BPBA 4MRAA 4I2VA 1RD4A 1V8PA 2F00A 2V7QD 4PC3A 1I3LA 1KO7A 2YZGA 4X1YA 2F48A 2G72A 3C85A 4X1KA 3KEMA 2PUGA 1R5BA 4YA6A 5AI6A 3C39A 1W4ZA 1UEXC 2G04A 2QAGB 1JXAA 3K8OE 3OQOA 2W2VA 5H9VA 4EBFA 2ZR7A 5LUAA 5FKJA 4D8XA 5FOVA 4Q48A 3KL4A 2F1JA 1QKIA 4F8YA 1BG6A 4OXKA 4CR8A 4JQYA 5AVOA 2C29D 3MEQA 4QRHA 1DG1G 4J3NA 4KRFA 5JZOA 2WSIA 3AC0A 3LT5A 1ADCA 1PTJC 1BKYA 3PHLA 3PE3A 4QA9A 4R8KA 4KWHA 1TUGA 2VTBA 1GGVA 2KPOA 4JY7A 1HEUA 2CDBA 5AVVA 1B8NA 4Y1RB 1CJKC 1CUHA 5CJ2A 1VC2A 2Z2ZA 2I6GA 1YRLA 2CL7X 2IW1A 1WZUA 1CRZA 3HPRA 4UBNA 4P3YA 1ZH6A 3BIXA 3LT4A 4PE5B 4U0JA 5FUMA 1N32B 4J3FA 2AF3C 5EP3A 4BFUA 2FZVA 3K2EA 4MPTA 2C1ZA 1KMCA 1JMVA 4WLNA 2ISSD 1N8SA 2BD0A 3DE2X 3N9IA 3UAWA 2Y68A 4I6EA 1CEXA 4D98A 4HK4A 2RI6A 4IUYA 4I5DA 4F21A 3ADDA 1M8PA 5H4HA 2PG3A 4RAQA 1C8LA 3UKOA 3FNBA 3HBFA 4HH0A 5DK4A 4M9XA 1JDNA 4E22A 1M72A 1KYQA 1W4LA 1JVNA 3CEAA 4GW3A 2XT9A 3VGJA 1CP2A 1XIVA 2PJDA 2XUIA 3OPNA 2XR1A 4WXMA 1DAMA 3EVGA 5E0KB 5GVRA 2DUUA 1A0OA 1H2AS 1XQVA 4FYYA 5IBPA 5LDHA 2WRZA 4KGXA 2FJ0A 5KNBD 3WX0A 1ID1A 2MSEB 5MFZA 4KBGA 1TD9A 1JXQA 5F35A 3QIVA 1TU0A 3NORA 3HXKA 3QLJA 4HTFA 1T34A 3U1VA 2B61A 3SNHA 1H9BA 3MK31 3TNLA 2AYXA 4L27A 4QTTB 1KBZA 1ONSA 3PXAA 4UUMA 2BFWA 2VWGA 3TNJA 1BDMA 3OOYA 3BRWD 3FKQA 3S2EA 1QIGA 1KFJB 2Q0QA 1OYWA 2WSBA 4HRAA 4CL8A 3NOXA 2PBFA 3DOFA 3D3KA 1US8B 2Y9MB 1DJNA 4BKUA 3IKVA 1HDGO 1NU8A 3PS9A 2Z4SA 1J97A 2C96A 3QKWA 4O63O 2XW6A 4MRRA 5JMOA 4TSKA 1QLJA 3DEIA 4MLCA 1D2MA 2GZDA 1L9KA 2OO5C 1P80A 1Z25A 4HWRA 1X8XA 3RANA 1CIJA 2HA0A 1N5DA 3H2GA 3IVMA 5AOAA 1CETA 3C3AA 4A0RA 3HN6A 5TPWB 3DS8A 4ESHA 2P90A 5E6UB 4EB3A 2PQ2A 3A31A 3OETA 1ORHA 3DDWA 2P6MA 4IMRA 4HXGA 1EWQA 1Q19A 3HR7A 4HKTA 1QUFA 2JH9A 1XCBA 2QD5A 1TE2A 2FN8A 1EH5A 1R10A 3ABZA 3E8SA 3M4NA 4V0ME 5FHQA 5SV2A 4OEHA 4R2IA 5HJ5A 3PFBA 5J2TB 3IDFA 3OOEA 2OHFA 4P08A 3GFBA 4H31A 4R2WA 3QVGB 4QTXA 2ZBRA 5ULLA 4HDMB 3COJA 4HL6A 4Q1VA 5TQ0B 2W2QA 1UJCA 3IE0A 4ZQCB 1FUIA 1UBTS 4CMGA 3OIYA 3AVQA 2HQ1A 4OHBA 5KTKA 2AZ4A 3IDSA 4IKEA 1M10A 4LYGA 3NLLA 4DY6A 3B7GA 4B4VA 4KSCA 4CMHA 1C1YA 5HDBB 1UFRA 4XDYA 5I4CA 1Y33E 2IDZA 2PBRA 1SA0B 3AXSA 3UK0A 3CVJA 1BGWA 4WY2A 1DUIA 1QHGA 1JHZA 3R3VA 3R23A 5HYVA 2X4DA 3MTJA 1GZ4A 2QTHA 4I3GA 1XWFA 2WOOA 1AKVA 3ZK8A 1IU9A 1DOZA 1I4DD 3EG5A 4BWYA 1FMLA 4URZR 3OWHA 1DMSA 1E4EB 1N9ZA 3KV3O 2QRVA 4K0RA 4OJMX 5AI9A 4D99A 1ZP6A 5C1IA 4M7PA 3VBCA 5CGQB 3WWOA 2IS2A 1OT5A 3EIXA 5MDHA 1XPJA 2W0SA 1K63A 4B82A 1ZM3A 5IT9A 4UQLA 2DULA 2IKQA 4IAOA 2FUKA 2HBZA 1M67A 3DBRA 3FWYA 5ITZA 5K99A 1I32A 3ZTYA 2WA1A 4HJXA 3A11A 3N58A 5J1TB 5L4SA 3CVWA 5K0CA 2OG2A 1L3CA 4V02A 3HMKA 1LFAA 4MVJI 3Q9NA 4X84A 1JB9A 3JWIA 3OMLA 4URYR 2X3YA 3ZLVA 5C2JB 5LXTA 4B8ZA 3Q8KA 1VXOA 2GHTA 4GLLA 3X44A 2GKGA 1FSPA 5JPIA 5TV2A 3PNSA 1TF5A 2QRQA 3PE4A 1LLUA 1UPTA 2MCFA 3LT2A 3WLNA 5D01A 5AKGA 5FQOA 2VT7A 5IMBA 4WXHA 1NBMD 1U0NA 1E99A 4Y9SA 1XTIA 1BC5A 2YFKA 3SEFA 4CQLA 2OK7A 2D0PB 4NCAA 3B78A 1ULHA 2CZCA 5M04A 2JGDB 4M86A 4K46A 5GOZA 4U9IS 2AI1A 4ZYZA 2BFFB 3BC1A 1EESA 1SC4A 3Q41A 3UK7A 1HEYA 1UUFA 3QBTA 3R0VA 1TVKA 2PLNA 1SVKA 4EH1A 2CUTA 2V6BA 4MRMA 4CETA 1UWLA 2XGOA 3KXDA 3NWOA 4HB4A 5HQTA 4DLXA 4F5DA 5BP7A 3ZDYB 5CK5A 5K8VA 2FKAA 4KAAA 4HQKA 3OE5A 2OXCA 3K05A 3DZFA 4ZVRA 4JR1A 3IBCA 1CD5A 2BEVB 2LCIA 2O7RA 5EKUA 3WLMA 1I7DA 5J9FA 4K3UA 1Z36A 4BX3A 5KZMB 2Q99A 5LQNA 1P3Y1 2OBBA 3OUZA 5HK9A 1RKBA 5K03A 2HMYB 5CX1A 4DBLE 1LVGA 2P68A 1QGOA 1E5XA 3Q40A 3WG9A 5C7OO 3OT5A 2DUJA 3E7WA 3UWOA 5A06A 3CZCA 4DPMA 2O2IA 3EQ7A 1QGDA 1A71A 1WL8A 1YJCA 3HCBA 3M5CA 4AK9A 4I19A 3HJFA 1W88A 5KKNB 3K9WA 5EE5B 1WD5A 2PLFA 1SOWA 1LF0A 1XP8A 3A1EA 3O4RA 4HGQA 2GSWA 1AC5A 1ETHA 5L3VA 4LTMA 4EHHA 2CHGA 3JQQA 1TI7A 1ETUA 3MQ4A 3QWFA 2VBFA 5HUQA 2NAPA 3SKYA 3EK2A 5FPYA 3AVOA 2VXCA 1N2IA 3SDZA 3IODA 2G1PA 4CG1A 2FQXA 3G13A 4YCJA 2X8JB 4OQQA 4LWOA 2MINB 1HE4A 1G8SA 2WICA 4RHEA 4UUBA 4P53A 2GZMA 2PGDA 1EBFA 4WXYB 1C9KA 1J39A 3GLGB 1QG0A 3NC0C 2VA8A 3RTEA 1YRAA 2QN8A 4B46A 4HDNA 3QVUA 4UFNA 1G6KA 3A1TA 1KEUA 4Y9TA 2Y4NA 4FX2A 2CV2A 4A0HA 1NLYA 2RHOA 1JT2A 2G25A 4GWLA 3Q3IA 3WBJA 2PJUA 4YXWD 2BGLA 1EVQA 2HF8A 4G85A 5IWCA 2WW8A 4O02B 4E6EA 4JUCA 3DUFB 4MK4A 2O06A 1N2CA 5TJHA 5JU6A 1KY3A 1JBQA 1Q0UA 2C61A 5DH9A 5TE9A 1HI9A 2IUYA 2QWXA 1Z39A 5CXXA 4Z1MD 5JCZA 4OP1A 2I7XA 2JS7A 3BHMA 5C5IA 2AOTA 2GTIA 3RR2A 4NATA 1P5FA 3PHJA 3R0XA 4X7PA 5BQ3A 4EQ6A 2LNDA 2A7XA 4JQCA 5B7GA 2X0DA 2B4YA 1EB9A 1VP3A 5I4IA 1WNTA 2BN4A 1WJGA 2KBFA 3FX2A 3L1JA 3CZAA 1FS6A 2HB6A 1ISGA 4G6ZA 4ZVQA 1FRNA 1PNTA 3NHAA 1L7BA 4ZOLA 2O3JA 5DIFA 2IOHA 2VJCA 2WWGA 2HY7A 3A6KA 3NIDB 3Q72A 4YQYA 4M1SA 1WPRA 2PS3A 4IH9A 5AXCA 4LF8B 2HYIC 2EKZA 2PV0A 3B82A 4QEZA 2FWMX 4LBVA 1KFBB 1NE2A 2GZRA 5T41A 2BONA 3S81A 4BFWA 2XODA 4HSEA 1AX9A 5BSRA 4O3FA 1E63A 3TOVA 4EFLA 2PD3A 2PS9A 2QZJA 4J90A 4JI3B 1U3UA 1KETA 3C3BA 3UV7A 3PLNA 4LJ4A 3OEHD 3V1TC 2B7LA 4HLUA 4G3XA 1LZLA 1EQUA 2QTVA 5IKEA 3L8HA 1XLWA 4QJ4A 4KUGA 3T7CA 1NMXA 1YOBA 3G9XA 2X7JA 4Q1EA 5GQSA 621PA 2CXNA 3WL7A 1W4AA 2JD1A 1A4RA 1SQSA 2OFOA 4KE9A 2IU0A 1W96A 3HB4X 1YB1A 5TS3A 3M6IA 1RXIA 3QEJA 5BW6B 1XZFA 2VUSA 3OPMA 2OHGA 2G08A 2X40A 1ICEA 2Z2IA 3CN9A 3HGTA 5E9WA 4G5SA 4Z5XA 1A5BB 2WT8A 3HFRA 5CK4A 1DMRA 1IUNA 3L8FA 4DBLC 1GXSB 3KE9A 3NRJA 2XNJA 6AT1A 4J94A 3EPRA 3UPUA 2OAEA 4GOND 1Q1QA 4BGEA 2PGLA 2WPDD 3EUEA 2KJQA 3A6EA 4CLDA 2AKEA 2DMRA 2QD3A 3THWA 1I3CA 1UADA 2A5DA 2BKUA 1KJJA 1S2NA 3P9XA 4MYUA 3KC2A 4F46A 5CVTA 3OZAA 5KNCD 4IINA 1USKA 2G88A 5ALIA 1ZN2A 2G82A 1FX0B 2OZLA 4MB2A 1VSUA 2HIHA 4PEVA 2PX4A 4TV9F 4CIBA 1MNAA 4KDRA 4Z4HA 3CZ9A 3EGCA 1AO3A 4ZKEA 4FFVA 4WLOA 3A2NA 2RGNC 1JQLB 1P74A 3JVDA 3OZWA 3P2MA 1V5IA 1EEHA 1X2BA 4D9KA 1RLOA 3C8UA 1M76A 1U4SA 1DC7A 1YR1A 4MW9A 3TX6A 5LQCA 1AKQA 3QENA 3HVHA 2GBLC 2XH8A 3PQ3A 2PH7A 3D9QX 3WDLA 1GPMA 1LDMA 1H2XA 3ASVA 1NQWA 1V4VA 1JR4A 4MJXA 2ID7A 4DR7B 3O2JA 3MJDA 4RL6A 3U09A 4I55F 1CVIA 1DFHA 5HCUA 3BUSA 4IPTA 1KWKA 3BMCB 4RHTA 4ZVTA 3HXTA 5K4AA 1UJNA 2WKSA 3BYZA 4BEVA 3B3GA 2WFAA 1RRGA 2D06A 2OBFA 5HW0A 1G9XA 1VXRA 1H8ED 2I4NA 4H15A 4ISBA 5B7PA 3BX1A 3J80A 4CZ2A 4BVLA 1EG2A 1U0TA 1P44A 3T4EA 1PK9A 1UDRA 1ULUA 2VHVA 3NFRA 3PRKE 5LR6A 3SEZA 5HWSA 4E94A 2ZSEA 2O5CA 5LUBA 3PUKA 1GFSA 4M0MA 4DS3A 4BO7A 4QXRA 3WLAA 3OJFA 4UHDA 1U1FA 2HV9A 3IUNA 1X1TA 2FX3A 3GJTA 1KK1A 2PUVA 3QKUA 4NYJR 1IDN1 3WGKA 4CKZA 2A84A 5BR8B 1U8TA 2IQIA 4OFXA 4TL7A 2XZLA 5TX7A 3LYUA 2PXXA 1U2ZA 4OM7A 1JTEA 3H97A 4RCYA 5FRDA 2O2XA 5GOTA 4BTLA 5KNDH 5C7IO 1HNWB 3AKZA 4G0NA 1OREA 4YTEA 4F5WA 2JNWA 4KVAA 1RHRA 3MNFA 5DNVA 4CIXA 1DPGA 3GEBA 1R9JA 1KI3A 3UGJA 5DBIA 1LXCA 1NHWA 3BXGA 1XVIA 2A78A 3ESBA 3ANLA 1OBHA 2FPMA 4HNQA 1T5TA 4R8SA 5BUZA 3IEKA 3E9ZA 2Y2UA 3GJRA 3LQ1A 3WGMA 1B43A 2H0AA 2J6BA 2HUPA 1O8BA 2XUPA 4LCBA 4YGYA 1E98A 1JU3A 1LKZA 5AWFC 1YGYA 4YUVA 1POWA 2YZKA 1KDVA 2B0JA 3BWYA 3H9UA 3G9QA 3KCQA 3ZW8A 1MH1A 1Z4KA 4JUIA 4U7DA 5FAXA 2ZVJA 2ETVA 3ITDA 3JQ6A 3FWKA 3ELUA 3R5FA 5DHQA 3VH2A 1XDSA 3KEOA 4QBGB 5GIOE 3M8KA 1EAMA 5CCEA 2KYRA 2ZB3A 3FRHA 5AIAA 1ZLYA 3DKKA 1JI0A 4L3VA 3N07A 5DTIA 3F3YA 3FPEA 3WNBA 4DSNA 1ZN8A 3TD2A 5JWRA 1G1MA 3JV7A 2ZUTA 4U02A 3FH0A 4L85A 1N4AA 3SHWA 3LCJA 1E3WA 3PNOA 3TOXA 1M33A 1FIUA 3DZIA 2YRWA 1RI5A 1W87A 5KTMA 4QLAA 3KE8A 5I7OA 1YULA 5EIBD 2XCUA 3EVAA 4E5SA 4RSRA 2O0JA 3GT3A 1GZ5A 4HG2A 2AZDA 1JPUA 3WBBA 2IUFA 2ZG6A 4U2FA 3L7YA 3MAJA 1RI4A 5KCZA 3CX6A 3GDOA 4B4KA 4J0HA 2H2HA 3WWEA 2YWXA 2XCIA 1I2DA 1C7QA 1VKHA 2Y0PA 1NJ6A 3L1IA 2VAPA 5CIWA 5D3ZA 4CLOB 3EGWA 3D4BA 4B81A 2J6IA 3V00A 4AC9A 4CKEA 3QBJA 4E7PA 1SCBA 4YCSA 1VJDA 5LZ7A 3PD7A 1DXYA 2C5HA 5F52A 1GU7A 1WB4A 3NTVA 3NONA 4J1SA 5JSHA 1I1QB 2WLTA 3GZ4A 2WD7B 4TLLB 5J4LA 5JRDS 1V37A 1NXXA 1YB5A 2ZWOA 2JAWA 3NAQA 3RUIA 1AG9A 5H3HA 3V8PA 3FAKA 4D9GA 4YMHA 1GUAA 2Y1XA 3H7IA 3LPMA 3HKCA 2YINC 3LL4A 1QONA 1NW6A 2GYWA 3AP1A 2WA2A 3JATB 3DZ8A 3QFHA 4JC4A 4B4OA 1OC2A 2BZGA 1TLTA 4CYMA 5KWEA 3DHNA 3LX4A 4IS2A 3HUUA 3SS7X 1TUBA 4TUYF 1TVEA 5LOVB 4KR3A 4QYIB 2QN1A 5A03A 4KR9A 1DDIA 5B12A 3TL2A 4YPVA 1ORWA 4H6WA 1EI9A 1PG2A 1VIVA 2OP0A 2ZDHA 3G0CA 4I5EA 2DWQA 5AQ1A 2AI2A 4BEBA 1BMTA 1UBSB 2HA2A 3WZLA 5KVSA 2KLBA 2VJMA 3A9UA 1QQTA 4OSPA 1EJBA 2XMBA 4BCBA 4FB5A 1W1UA 1XMXA 4UOEA 2G67A 2ID4A 4DV4B 4DLKA 1NYQA 1UBRS 3ZCVA 4RSGA 2C77A 3PUIA 1ZIPA 5JWOA 4IJKA 1QF6A 4QDTA 5DLPA 5IABA 5FWYB 1OX4B 2QRUA 1HFWA 3K16A 4AT1A 4IF4A 2X41A 4PG6A 3DAGA 2G1AA 2QG4A 2J0UA 2ODPA 5BWLA 4EFKA 3T1VA 3UO8B 1DKNA 4QJ3A 2ZTMA 5JNSA 2R8PA 5A0FA 4IHKA 2CLSA 2OV2A 1Q21A 1Y37A 2VYNA 1J9GA 1AMOA 3HJTA 3JWPA 1MABA 2ZTVA 3PDWA 5HA5A 4MV8A 5FYQA 2ZSHA 4PX2A 2AE1A 4J7XA 5EGSA 3R9KA 1NNSA 4N5MA 4O1IA 1T8TA 3UAVA 2C8VA 1ES9A 3H11B 3JQGB 3S55A 3KQSA 4EX6A 4PXSA 1VSVA 4B33A 1KEVA 4JJ6A 4TS9A 3WLIA 1UBOS 1X38A 2WZDA 5AHXA 3C41J 5ETJA 3WL5A 1Y6FA 4XGNA 5CDGA 3A6PC 2ZBEA 3ORRA 2J1LA 5ERYA 2O2SA 4NH0A 3HPQA 4CEHB 1Z45A 2QW0X 1K06A 2XXJA 4G01B 3O47A 4KPGA 1A9OA 5AVUA 1T6BY 4BNDA 3ZNNA 3G5MA 3N8KA 3QM1A 5IC6A 3SXPA 1X7ZA 4G8BA 5JCOC 1YMQA 3IHLA 1WKCA 4N03A 2IEZA 1XRPA 1OILA 1BEEA 2EFHB 2Q4BA 2VTEA 4TL8A 1PTKA 1XALA 2LPMA 3K5WA 1O95A 3G02A 2IXBA 2J7KA 3AVTA 1BA3A 4NEQA 2IYLD 3E3OA 1GRNA 3ZHOA 5JSFA 1QG2A 3KZMA 4V0OA 2O52A 2NQ8A 3D5QA 3DO8A 4NBVA 1OI4A 3OAAD 1VBMA 3HLYA 3P0IA 4PZCA 2D0IA 3B6KA 4XPIA 4MCHA 5DOVA 5MN4A 1CZHA 4FMCB 2YJNA 5HBRA 4MCAA 5EJ9A 1W30A 1EVKA 4K40A 1L7MA 3B6EA 2DBYA 1GM5A 4OPMA 1E0KA 3D8RA 3CVYA 2GN2A 2BKEA 3CT6A 2QRPA 2P91A 5G0VA 2RGNA 2FX5A 3I3SR 4V3CA 3OKCA 4X8OA 4KGVA 1R50A 3RFTA 1IHXA 3EFBA 1RLTA 4K1LA 3FW1A 4CNQA 1H6BA 1WDTA 1PF7E 2D7CA 2ODQA 1SU6A 1YBMA 5G2OA 5GONB 4EAAA 1BFDA 1U3WA 1A97A 2CNWA 2Z9BA 3GO4A 3WGVA 3S68A 3GEHA 1I2BA 4NYMR 1UMBB 2BI4A 4R05A 4ALLA 3FYDA 2IWHA 4FUQA 3CZ5A 4A3SA 5H9WA 1YS2X 1JDZA 3AHFA 4LHWA 1IRXA 3KX2A 4IZ6A 4FSXA 1RWXA 5EXSA 5AIBA 6NULA 3ZWDA 1TNDA 1YBVA 2EX0A 1ZMTA 3MWEA 2IX9A 3B5IA 4WD3A 4KH1A 2PZMA 4LTNA 5HIIA 1QNFA 2AE2A 3CCFA 4BNVA 5LYJF 4R8LA 4O4LA 3RI3A 4M1QA 1BMQA 3AKDA 3NH9A 1VLJA 2ZYVX 3F2IA 4G4JA 3R7BA 4CLHA 1WW2A 1D5WA 2ODBA 2Q1XA 4HNSA 1GZVA 2GFIA 2Y67A 3AEYA 4JEMA 4Q37A 2CJWA 4P9NA 1XMSA 4C7VA 2NG1A 5JJCA 1UOEA 3FFWA 1CJUC 4CXMA 5CYGA 4LVOA 4WK4B 4XQGA 3LXXA 5JCXA 5TDHA 1W44A 1QMGA 1R0RE 2J6HA 3EZ6A 1W76A 2MU1A 4JVSB 1P9WA 4Q9DA 4RK0A 2QBYA 4REQB 3DMRA 5I9LA 3TI7A 2JDIA 3S3TA 3TD6A 1EFDN 3OPXA 4A8TA 2EZ4A 4ZMRA 4I4CA 3NHKA 2CN1A 2JLQA 1E9SA 2FZKA 2ZDQA 3NOVA 4AJOA 3KKMA 4CVNA 1L7DA 2QD2A 1GQYA 2W48A 4B3HA 3UHFA 1GY8A 1T2FA 3QEKA 2INGX 2KHZA 1LTKA 5BUSA 4ZO7A 3R7NA 2E4WA 1H3NA 4GPZA 2JJ2D 4Z8XA 1U02A 4H7FA 5C3UA 4DSAA 5DISB 2PZLA 3ADPA 3HDTA 4D9HA 2YN4A 2CW5A 3X1DA 4WFIA 3C48A 3FHJA 4WEOA 4G9GA 4Y6RA 1EDZA 3P9CA 5DB4A 1K4KA 3R0IA 4M0LA 5HCIA 2UZ4A 4LFBB 2GPBA 4LW8A 1N8TA 1BSVA 2P3LA 5J47A 4M53A 4MYRA 5KS2A 4IMPA 5CYOA 2ZAIA 4GKAA 3FNEA 2F55A 2COUA 4LF5B 3VNUA 1GTL1 2F3SA 2IC5A 5D86A 4EVSA 3USCS 1U31A 7GPBA 3KELA 4FZ3A 1XELA 4LV6A 4JX9A 1T24A 4YMWA 3S2IA 3T7TA 2N47A 1E1RD 1SNYA 5CFMA 1JE0A 2HA6A 4P5EA 5C1DA 4QRDA 3M33A 4CMEA 1PEDA 3GFVA 3IPCA 3DPUA 1QK3A 4HNAB 4J6EA 4Q47A 5A4MS 3NVDA 2ASVA 3U39A 4IDDA 4F2WA 3V33A 3KQQA 1VJ1A 2Q9UA 1J5PA 5JECA 2QE6A 3AGQA 5HKKD 5L7TA 2C2YA 1K6IA 3H5TA 4F45A 3U6KA 1N36B 4L5YA 3VYSB 1VG1A 2GCEA 4W9RA 3TRIA 3KYDA 1SJ9A 1WVIA 5JSZA 2QP9X 2UVQA 2R1VA 4ZAYA 3O7MA 4ZGBA 2IS6A 3LUJA 4BCDA 3UK1A 1FYXA 1Z6ZA 4GBGA 3AZOA 3UW1A 3JQFA 4I6GA 5K3EA 2B35A 4FS3A 3C45A 5THXA 4D0GA 4JJAA 3BZWA 3NHFA 2EG5A 3HA7A 3LOPA 4JYMA 5JXIA 3K1ZA 4U6NA 2M2IA 1AUPA 2G9QA 3PWKA 3HWWA 3WIDA 521PA 1SXPA 2VK4A 4O4HB 4XASA 1ZD5A 3D6UA 4LSWA 4BWVA 3IUSA 4YJ3B 5B7NA 4B85A 3OE7D 2HSGA 1X2EA 4PCVA 2OCAA 5JVDA 3IUPA 3GLIA 2RKOA 3T35A 4GPTA 2CXUA 2DQSA 1NOKA 1G3RA 4JELA 5HF8A 1WX1A 3EZGA 1Z15A 4D6YA 1QZTA 5EFZA 1ZGHA 3ED5A 1ZEJA 3D4NA 3K15A 2WUGA 5FF9A 5C8YB 1WY7A 1GR0A 2XYQA 1GSIA 1KS9A 1PK7A 1V8OA 4UM5A 1U6IA 3VISA 4P4NA 4H35A 3QEOA 5F12A 1B15A 4LRSB 3GRZA 5TJ9A 3R8XA 3RSZA 3O8OB 2X8AA 4YRCA 1RR6A 2QY9A 5CH5A 5DRTA 2JFXA 4ITRC 3THYB 4J7AA 4OGLA 5BW5A 1KY5A 3A36A 1FYEA 1AT1A 1R6AA 3E35A 1KZYC 1N6NA 2NZUG 3I2JA 1H8HD 2WWIA 3FYTA 3R5HA 3GROA 2WIJA 3IUMA 1S5PA 1JJFA 3FNFA 3CUVA 4TMXA 4BVJA 2QGFA 3ZWMA 4DLVA 5B3JC 4TS1A 1ZY2A 1XLTC 4G5OA 5KYUA 2PWBA 3NEJA 4ND7A 4EHJA 3I5YA 4NFHA 3NIBA 4I4TB 2C94A 2H4FA 3IOYA 221PA 1GA6A 1TU4A 2J3KA 4MITA 1POXA 4FZVA 5DX0A 5AKHA 3L0PA 4MA4A 2I0FA 4RVUA 3T54A 1QVVA 1G42A 4JJIA 4PFSA 3QZUA 5K3BA 1VECA 1FK8A 4JJ8A 2E4UA 2F7SA 3LDUA 4DDHA 3PNQA 5M3BA 5DBHX 3MQFA 1OBOA 2PFGA 5H0IA 1E2GA 3HY6A 4P4SB 4ZCPA 2NU9B 1KBQA 2FEPA 4ZK2A 1NUQA 4C05A 2O8CA 3HEMA 4ASUA 2F8TA 1N92A 2P30A 1ZWKA 2B5VA 2WABA 2YXNA 2VZ0A 4GBMA 6LDHA 2O48X 4B7XA 2IPAB 1VE5A 4O25A 4TOIA 3VRHA 1DKPA 4MV5A 2W4IA 4TKVB 5IM4A 1X7HA 5DNDA 4EPXA 1D8TA 1ORIA 5IYZB 5KSYA 1DADA 3TSAA 1Q1BA 3K1AB 1YCHA 1L4YA 1SKQA 4D6XA 4B7ZA 4C1BA 1TT5A 1KYZA 2IHJA 1F2VA 2ZJ6A 1EJ6A 3FPFA 1UM9B 3O84A 4M60A 4AJEA 2A67A 2B21A 1V7PC 2MSDB 2GDZA 4HDKB 3VTZA 2FSHA 5JCOA 1F2UA 1HF3A 1I9GA 1Y8AA 5H59A 3VUFA 1LWNA 2BOVA 2FZ4A 3M5PA 4UZEA 1AOXA 1ZXLA 4BMZA 3GXOA 3MS4A 4AWAA 5F1OA 5AVXA 2AOXA 2DCUA 3EASA 3HJCA 2FOLA 3GW8A 4K86A 3M4YA 5EOVA 3AB3A 4UOZA 3Q0TA 4NQRA 1GRVA 1NMQA 2JJ8A 3WK7A 2QXUA 3E4DA 3ZV7A 5C8XA 1GQSA 3QE2A 4HDCA 3K35A 4E32A 3EGOA 3STTA 3MWFA 1JQKA 1TECE 2PZFA 3JU3A 3N8NA 4OH1A 4JYPA 3PCXA 4AJJA 2WU4A 1SUIA 2G1UA 3KSUA 2EW8A 4QSHA 5BVHB 4QUIA 2Y0CA 3TW4A 2Q3FA 3CWZA 2C9DA 4GZ6A 4KP7A 2V0NA 2X5XA 1TAHA 2AMVA 3F78A 2JZNA 3EIHA 3D7LA 4D1YA 1J25A 2Q2VA 3M81A 2PNFA 4QOGA 3OOSA 4DQXA 2O5RA 3Q3EA 6YASA 2DLDA 2Q8NA 3NAGA 4A26A 4AY3A 4DXAA 4UBIA 1XXHE 4DMFA 3ANMA 1J20A 3ZCUA 4MJ7A 1B0ZA 4LNAA 4BNJA 2QE7D 2C8KA 3BG5A 3PUVA 2ZSJA 4J1TC 2Y8EA 4DDMA 4LK3A 3PNKA 4EMTA 2GEBA 1IN1A 2AW3A 1SUWA 1RWKA 1VFNA 2V7EA 3GPDG 3RJMA 4JNCA 3W04A 4E14A 5FDFA 3DYBA 2YVUA 3P20A 3R5XA 4NCIA 1KOGA 4ADSG 1U7DA 4Z9FA 2GAOA 1PQWA 3BWEA 4FFBA 3RVDA 3LXUX 4AJ9A 3GG2A 1DVRA 5F51A 5DYIA 5T3UA 1V11A 2ZJ4A 3GA0A 2C7PA 3ZIAA 2CVOA 3ZHRA 2Z58A 3C4JA 2XT0A 1XZPA 5I9NA 4CR6A 3QVOA 4QEDA 3HUDA 3D0RA 1P4JA 4UXJA 1JHVA 5K2MA 5I9SA 3SIWA 2R8BA 1NUUA 3E22A 4WMLA 3V6MA 1U63A 3HU5A 2HJGA 3PR2B 2C88A 4LXTA 3PC8A 1FDWA 2A30A 1Q0SA 4M8SA 4NAVA 2OZEA 7MDHA 2ZM5A 4E2ZA 3H6HA 1SCKA 3IURA 3NBXX 4TKLA 3WRXC 1SZCA 4CF7A 4BMSA 3GA7A 2CL0X 1NJFA 1YGPA 1Z5WA 4Y2SA 5EKXA 3K9NA 4EG7A 3DZBA 2UXDB 4MUEA 3AVPA 3TMKA 3H5VA 1L4EA 4KQJA 3K94A 2BF4A 4ZYLA 4JP8A 2MYPA 4R9NA 1G5RA 4G37A 4TYNA 3U44A 1O0CA 3HCPA 4I99A 1RQPA 4OI2A 4XFKA 1NW5A 4Q03A 4D81A 5CM2Z 2NZVG 3B1KA 4DKXA 1KOLA 3A04A 1NYRA 1CU1A 2YHAA 3D6AA 4MQFB 4YJGA 2EJBA 1CERA 2OK8A 1KSJA 4MIYA 3WY9A 2ZJOA 3MVEA 5EZYF 1Z6TA 4DV7B 1ZUNB 3KOYA 5DWQA 4F9FA 2CFSA 4R0MA 1KJWA 5P8WA 4JP5A 1E8DA 5SYMA 3ZHTA 4YQFA 4LDNA 4OLBA 3ERCA 2N3ZA 1YUMA 2GJAA 3VR6A 4FLEA 3QLTA 1HH4A 1NKTA 4LF9B 2Q1UA 1TIKA 3DH0A 2GZ2A 2E4AA 4ZAGA 4U1RA 1NXVA 3R76A 4BNMA 4K0KB 1Q1AA 4KKXB 1TMYA 1DRUA 1VJCA 2GRJA 5H8WA 1M7HA 5IJ9B 3DZKA 3EEFA 5LP1A 3FN4A 5BOSA 1FA9A 4QULA 4DC1A 4EOGA 5I6DA 1IIRA 2QPAA 4QBHA 2JFZA 1A7KA 1NY5A 2VP9A 3JALB 4X6LA 5CFOA 3EGIA 3KYJB 5JATA 5CA0B 1IMJA 1UZLA 4NS1A 3SY8A 3VYWA 2J59A 2VQ6A 3PQ7A 4Z51A 4MV1A 4FFLA 1WW3A 1WTAA 3WGTA 3G7NA 2EWMA 2BJVA 5EE3A 4CF3A 3JTMA 2ET6A 2RSLA 1B76A 3TFQA 5F7OA 4R51A 4FIDA 5DV9A 5DLQC 5J3JA 1USUA 1YVPA 4OG2A 1XROA 1Z82A 1JN0A 2C2ZA 2V4MA 3CR8A 3CEHA 3G8CA 3GJ3A 4K8OA 4PGAA 1G8HA 2I3GA 4UQOA 3K92A 4A8JC 4DABA 3A2KA 1Y9ZA 3K0HA 3RDPA 1GL9B 3CLKA 4KJZA 4PPQA 2IUEA 2A4MA 1IZZA 3PQ4A 2MYUA 5CPBA 3RSGA 4MO9A 3ZWQA 1YZ3A 3V32A 3S40A 1F6WA 2I3AA 5IDYA 1OA1A 1E2NA 2CLHB 1MO2A 2OWDA 4LX8A 2JGNA 4RVGA 5DGDA 3ROTA 3IDAA 3U4MA 4KQCA 2FOXA 3UJ9A 1Y7HA 4DJFC 1HMPA 1A04A 4LSZA 1BOFA 5BSKA 4EY6A 4TMYA 2CNDA 1KFKB 2VWHA 1A9QA 5FTKA 4A9AA 5CM9C 5K4HA 5LQJA 1H6AA 2SNIE 2Y66A 5FBZA 4O5AA 1CS0B 3TN7A 4J0FA 4J16C 1MEJA 3AJAA 1RQRA 4J0EA 4ZAXA 4ZHSA 1YAHA 3P96A 3IT1A 1F0PA 2NO9A 4GWKA 4YAEA 3VJLA 3BAFA 4J49A 4HDSA 3GGCA 4JLPA 1UKZA 4D92A 2M98A 2WJYA 3VZQA 2PRKA 1Y98A 4DB2A 1Z75A 2NN3C 1GOTA 1UJ4A 5JEEA 3MFYA 2VRCD 4RHCA 1K8RA 2IYVA 1XVTA 3B1ZA 2NUPA 3DOJA 1I3KA 3EWSA 1U3DA 2OFXA 5CCXA 1OH6A 1YKGA 1T0PA 1Q22A 2QB5A 1JI3A 2VRWA 1IY1A 5LIRA 5SYNA 1QYXA 1WHSB 1H65A 4QXAA 1N3IA 3CRRA 3DKIA 3L0SA 5B3JA 1FPMA 2P4SA 1XUOA 4HDRA 3RBAA 2EHDA 1AQ6A 4M38A 5FR2A 3WIVA 4QFMA 1TRHA 2FQQA 3BZBA 3AI3A 2Y1KA 3H2SA 5HKAA 4P6VF 3HWSA 1ZA2A 3G1WA 5FQNA 1LU9A 1M2EA 3AG6A 2NZXA 3S28A 1YS6A 3BDIA 3NVKI 1D0IA 3L5KA 5K8CA 2D4HA 4KU4A 2FTKE 4AVYA 3CB4A 5LA6A 4KBFA 3SZMA 1C3VA 3D4IA 2WVJA 4WK6A 3SZUA 5FB3A 5DHAA 1FCJA 3TLJA 2C5AA 5CD9A 5CDSA 1K08A 4LRXA 5IVHA 2LCQA 1WCIA 5JPCA 1GVNB 3HCNA 4GVXA 4L02A 3EPLA 1HZZC 1D2GA 3KK0A 4A2CA 3A58B 1KGSA 2DHEA 2JAUA 1UXOA 4R2HA 2CVFA 4KR6A 2ZETA 4EARA 1QTRA 2NUAA 3LWBA 5CXSA 4GKKB 1KC1A 3TAXA 1T3LA 1ULTA 1P2UA 4MVJH 1RAFA 2IPMA 1VHLA 2CNOA 2EZ8A 2J31A 3RGGA 4AZ3A 1OMOA 3HR4A 3L05A 1JEQB 3BK7A 3LDHA 5TEVA 3MS2A 4HN2A 4G86A 4S1PA 1NRWA 5F5NA 4YV0A 4LYJA 5IWAB 3FOZA 4V38A 4E51A 3THXA 3Q98A 2V65A 4RHYA 3NM6B 1EUDB 3V4RA 3GMSA 3VVLA 1HG1A 4HGRA 1P1FA 3AVYA 1CF9A 1MOPA 1YS1X 2C57A 1E2JA 1ZJ6A 3WMRA 4MYTA 4XM1A 4HWOA 3FNRA 1ND6A 2XE4A 1EK6A 4PGGA 1FS5A 4BMDA 4MIKA 4PPGA 3B2NA 1SN7A 3DR5A 3Q87B 4PZ0A 4YJHA 1H93A 3V7WA 1U7OA 1U8EA 1Y7PA 3TTSA 2WTBA 3C1UA 1Y6ZA 2QP3A 3NAMA 4OQZA 1J42A 2AG0A 3CKLA 1PNOA 1DO2A 1C8VB 3EGXA 4RD3A 2P67A 2J9XB 3WP0A 5DO9A 4MKZA 2AFHE 2KE5A 5B36A 2QTLA 2HQOA 5LL6P 2OSBA 3AI1A 2Q6LA 1QDEA 1ZEMA 4JBXA 2R79A 1UBUS 2Q3BA 4M98A 3S6JA 1TADA 4KXVA 1V16B 4QYSA 1GD1O 3QJYA 4V0LA 2IELA 2HMVA 3X1JA 4FDTA 2ZLBA 3EIOA 5FTJA 2AFIB 4Z4EA 2BM8A 2WT4A 2AL7A 1TRKA 4EHLA 3ZU5A 3BMQB 1FFGA 2QTRA 1E1MA 3FOCA 1HE2A 4J8PA 1YU6A 1Y1SA 3OA2A 3EFHA 1AHIA 1T8WA 3O3NB 4RPGA 3W1VA 3VPGA 2UZAA 5JD5A 4G81A 2VK8A 4J1TA 1B00A 4HMPA 3FOWA 3PUHA 4DLYA 2O8DB 1Z0ZA 1WMDA 2QEQA 2VP0A 4MVJF 2NACA 1BJTA 2YCBA 1JDBB 2VNJA 1IB0A 2IODA 1ESMA 2X7XA 2FYTA 2GM3A 3EDOA 3L6UA 4WK0B 1JQ3A 5C34B 1JZQA 2GJSA 5IC4A 5EXPA 4FFSA 3WKBA 2H06A 3I52A 4PYLA 1VJ0A 2A1TR 4XI9A 3WGHA 2BDTA 4NOLA 5TIIA 5FV4A 1YWGO 5FO1A 3B5EA 2WMDA 4DOMA 1KE2A 1ZYUA 1OV4A 4IHJB 1KZ4A 4NVRA 3OD5A 4YP7A 1BX0A 1LV8A 4ZQGA 4EJSC 3KXPA 3K0CC 1Y9DA 1E6LA 1BQEA 2NV0A 2OCKA 3ABOB 4MP3A 2QVBA 1DEAA 3IRVA 4A82A 4BN5A 1CG6A 1GA1A 4FHCA 3ORFA 5LP6B 2QX9A 1K86A 4HADA 5CT9A 4F6RB 1G9TA 2FMIA 3L18A 4K1XA 3MCWA 4WK2B 5DHSA 3T3OA 1OXUA 3ODPA 1ZJYA 3QX3A 1XLVA 1QUEA 5IAKA 2A92A 1ENZA 1AUXA 1QYRA 2IYFA 2Q1TA 3I8SA 5EKDA 1GILA 3L07A 3DMGA 4US0R 4F84A 1Z0DA 3TO5A 4W6QA 3MRVA 3KQNA 3DDSA 1E0DA 1O2DA 4BJ6A 3FYUA 3TNYA 4AJ4A 2G09A 4EUSA 2V58A 2XTAA 3TRFA 3GLFB 2VR1A 1GT91 3B2EA 2JFHA 1E5VA 4LRQA 4RZHA 1U9YA 1KY4A 5C1OA 1FW6A 1FUKA 3P9RA 3FSGA 1WXXA 3RBXA 1PT6A 5CYPA 3E7FA 5FA8A 3TKAA 3KKKA 5DN6A 2QRKA 4FONA 2CFIA 2JI4A 1CUCA 3LFTA 3D4LA 1OYYA 4JB2A 4IIFA 5IZCC 4Q4HA 3U7JA 2X4IA 3ZWAA 3FPAA 1OLUB 3IBFA 3L77A 1L4MA 1P4RA 2F3QA 2J0EA 4O2BA 4BV2A 4F5ZA 5A9SB 2Y92A 2GHIA 4C3ZA 3K4HA 4C87A 5AO9A 4YGXB 5F7ZA 5KYTA 3HBNA 2HA3A 2ZBDA 1QAOA 2BP7A 3U61B 2PAAA 2WG1A 4LXXA 4V24A 5CUQA 3MWJA 1W5EA 1UFQA 4N7BA 1NNUA 4QGGA 4MHOA 4Q66C 4TLAA 3RCBA 4EB8A 5TPZA 3K0AB 5L7YA 3EBOA 1M34B 1BN6A 3ZI4A 3PNBA 1CLEA 5EAIA 5LFAA 1MAAA 1T4GA 5MFPA 1NQTA 1QOZA 1YE8A 3DEAA 3VJRA 3U3ZA 4FU0A 3DE5X 2J32A 4HEA6 1KMMA 1Z8NA 1FXUA 4FN5A 4JEIA 3SSMA 3K8ZA 5AHRA 1TTTA 3MLAA 1ID8A 2IDKA 2WJAA 1DXOA 3LD9A 1XNHA 3KT3A 4IFIA 3UAXA 1Z4IA 4R3NA 5E1MA 1L5ZA 2BFCB 1XHLA 2J8ZA 3IBSA 3EXHB 3IQZA 3AJRA 3O83A 3DULA 4G84A 4KXXA 4YJ2B 5B58C 3BK2A 5K0ZA 1OF1A 3HKBB 4R3UC 1YR9A 4TVOA 3OLZA 3RKSA 3GK3A 4BMNA 4H3KB 3SX0A 4WUVA 3LPCA 3KBBA 1HQDA 2YFQA 5HKBA 4I4LA 3VH1A 1NASA 3BTOA 1WLSA 3KXKA 1MA3A