2H07A

Crystal structure of human phosphoribosyl pyrophosphate synthetase 1 mutant s132a
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
311
structure length
305
Chain Sequence
NIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHAAQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Ribose-phosphate pyrophosphokinase I
publication title Crystal structure of human phosphoribosylpyrophosphate synthetase 1 reveals a novel allosteric site
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 305
sequence length 311
chains with identical sequence B
ec nomenclature ec 2.7.6.1: Ribose-phosphate diphosphokinase.
pdb deposition date 2006-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13793 Pribosyltran_N N-terminal domain of ribose phosphate pyrophosphokinase
A PF14572 Pribosyl_synth Phosphoribosyl synthetase-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h07A01
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h07A02
1JLRA 1XZNA 4JITA 4F8EA 5KAPA 2VFAA 3NAGA 4ZFNA 3G6WA 1O5OA 1PZMA 1NONA 1ECCA 4X45A 1MZVA 2C4KA 1CJBA 3O7MA 1L1RA 4TWBA 1A4XA 1NULA 1BZYA 3OZGA 1DQPA 1G9SA 1TC1A 2HCRA 1TC2A 4M0UA 5EUCA 2AEEA 4X44A 1ECJA 1A97A 1R3UA 1HMPA 1QK3A 1Y0BA 3GEPA 1WD5A 3ACBA 5KAMA 2PRYA 4P81A 4RACA 1UPUA 4LYGA 2YZKA 4PAWA 1UFRA 4RV4A 1QCDA 1U9YA 4RHXA 3M3HA 2FXVA 2JI4A 2H06A 3KB8A 2PRZA 4LZNA 4WMLA 5BSKA 2PS1A 4RHYA 5ESWA 4IJQA 3LPNA 2IGBA 1Z7GA 1XTTA 2JBHA 1I0LA 4RABA 4RQBA 4P3KA 1ZN9A 4QYIA 1STOA 1QK4A 1DQNA 1BD3A 1YFZA 4RADA 1L1QA 2E55A 1P19A 1ZN8A 5K51A 4P83A 2JKYA 1OREA 1I0IA 4P84A 1LH0A 1HGXA 4M0KA 4P86A 1FSGA 1VSTA 1UPFA 5JV5A 1GRVA 1QCCA 4LZAA 1DBRA 1ECBA 4Z1OA 2XBUA 3EFHA 1U9ZA 1V9SA 5E38A 5HIAA 3QW4B 2WNSA 1G2PA 1O57A 1OROA 4M0PA 4RAOA 1AO0A 3MBIA 3OZFA 1G9TA 3S5JA 1A98A 3GGJA 1W30A 1D6NA 3H83A 3ACDA 1QB7A 1QB8A 1IBSA 4JLSA 1ECGA 4RHUA 4P80A 3DAHA 5IAOA 1I13A 3GGCA 1JLSA 2JKZA 5BQOA 5BRNA 1XZ8A 2H08A 1A95A 2P1ZA 1ECFA 1VDMA 1VCHA 2DY0A 4QRIA 4RANA 1BD4A 1P4AA 3DMPA 4KN6A 1XTVA 2GEBA 1I14A 3LRTA 5JSQA 5HKLA 1GPH1 1DKUA 4WN3A 4PFQA 5ESXA 4RHTA 1A96A 5BQPA 4RQAA 4S2UA 2H07A 3MJDA 3OHPA 4OHCA 1J7JA 2EHJA 1G2QA 4P82A 4LYYA 1OPRA 3DEZA 4MB6A 1XTUA 1QK5A 5IPFA 1DKRA 3HVUA 1ZN7A 3N2LA 1P18A 4QYIB 1A3CA 4LZOA 1P17A 4FYMA 3ACCA 4RAQA 1I5EA
chains in the Genus database with same CATH superfamily
3QNMA 4G5HA 4WY8A 4FLMA 3OPNA 4G25A 1ATIA 1PEDA 1TIBA 1E1QA 5KTYA 1FVOA 2A0YA 3WQRA 1A9RA 1E8MA 1W4RA 3A2MA 3BIFA 4AKGA 1B8UA 4WKCA 1PNRA 2FB9A 1AQYA 2W2LA 3I52A 3O4IA 4G5OA 4I14A 4I6EA 5FLKA 3ZWCA 1I5OA 3D5EA 5ICEA 1NG9A 4Y2RA 1U63A 4KK3A 4Z8XA 2WWGA 2HLNA 5JD3A 2LPMA 3UK6A 1CB7A 2LDXA 4WCFC 4KREA 1LK7A 2NXWA 1QFYA 4MKFA 2CXSA 4WNAA 4JQYA 5FBLB 1P39A 1HF3A 3AH8A 4TZKA 4B3JA 1DZIA 4X92A 5HZMA 1V4BA 1WXEA 4HL6A 2BBSA 5BSRA 5KNBD 3Q6MA 3U39A 2EQ5A 1UBLS 4XD2A 3EC2A 3KCNA 2OB1A 4BQSA 4KRXA 3AVWA 4LYAA 3GEIA 4F04A 4O2AA 4AMGA 5IDWA 3EIXA 3KT0A 4BLWA 4TM8A 4L5BA 5IC6A 5CDTA 1XDDA 1FYEA 3C4QA 1OGIA 1TMYA 2GYVA 3GW8A 3M0EA 4M8SA 1B6RA 1X0VA 1IXRC 3QVWA 1O8BA 1KQFA 4ZO9A 3WGJA 3MYRA 2GBIA 4MYCA 5F7XA 5ALYA 2QZ4A 2GI4A 5GJCA 3L1IA 3SCZA 1ZVJA 3CEJA 4B6FA 4U1RA 4GR4A 4QTZA 1YDWA 2J0SA 1PL6A 3DMTC 3T9CA 4EITA 1BOOA 1T1RA 1WB4A 1N57A 1W96A 1X80A 1Y5RA 4I08A 4BV9A 2HJRA 4MS3A 3I5XA 5FR1A 2QQ0A 4B4KA 4QGAA 2AD1A 2FEMA 3IPXA 3OE5A 3O8OA 1CY0A 4Q9LA 2HZ7A 1EGQA 5AK3A 5TS3A 2PD4A 2FX5A 5AI4A 3REQB 4NIMA 3EZLA 4FHGA 2Z4SA 3TRFA 1MIOA 3BB3A 4G3XA 5ED0A 5EMNA 5F9HA 2F8SA 3E58A 3FZNA 5HKKA 3NWOA 5TT1A 2OENG 4I50A 3S2FA 2OBXA 2IYNA 3PI6A 4XGIA 5B2EA 3NHZA 4QTXA 1IXSB 3WQSB 3IVRA 3ZGYA 1A8IA 2GM9A 3I4LA 2A1UA 5LA6B 2VJQA 1MH9A 4TYPA 5HQ3A 4EHAA 4QNNA 1E6UA 4P4SA 3H7AA 5F3RA 4Z2YA 4V0KA 4FEYA 1Z4NA 3AKDA 1SAYA 4XSHA 4B4DA 2CFCA 3UXHA 3LGXA 4AO7A 2ETXA 3HYTA 2X7HA 1JJVA 3ZI4A 2FFRA 4OHZA 1DT5A 4RWZA 1J6UA 1XWWA 1E3JA 1NNEA 2WTMA 3AP3A 1NPDA 3Q9NA 2JFQA 3R09A 4L5JA 2FUNB 2CE2X 3FDXA 4ZCQA 1RCTE 1UXHA 1P9WA 2QORA 2PGDA 3KYDA 3KQUA 2ZZNA 1V5GA 2C9DA 4K6CA 3UJPA 3ED5A 2NYUA 5DN6D 2ZIVB 1JHDA 3ADKA 4BO0A 4MUKA 4A1FA 5KYGA 1LI7A 1U99A 4GMFA 3RTCA 1Y1TA 2BEUB 4Q18A 2BGWA 2OZVA 3FOBA 2CNWA 1ZLYA 4N41A 2ZTLA 4QOEA 1O94A 1KXZA 2WSSA 2A84A 3B13B 3MYYA 1D2GA 1F2DA 2I65A 4FR5A 1T8PA 1PZEA 2VTDA 3O2SB 1Z62A 4FT4A 4B35A 5KJ1A 3CWQA 1W0KA 3T1NA 2QLJA 4B7ZA 2IF2A 1E6LA 3M1LA 1E2LA 4NV0A 3FDFA 1TZBA 4HWPA 4RCVA 3NYIA 3OZVA 2HMTA 2O5EA 1N9KA 2J0UA 3MOSA 1FYDA 2D5AA 4LDJA 2P3SA 4AQYB 1UPTA 1U5BA 2I2AA 2GN2A 4RKWA 1BEZA 1Z0AA 4DJJA 2ZVQX 3ZDCA 3LWDA 4MCHA 5AM5A 1VJCA 3WKEA 4ERXA 4KW7A 2RBKA 3UQYS 1RQPA 3OC0A 1SVIA 3B3AA 4WKNA 1VE3A 3EY9A 2HQSA 3CW8X 5GV7A 1C7FA 4YJFB 1E2IA 2EJUA 3LXMA 1OU4A 2ZSUA 3Q9SA 5AHRA 2N9UA 1DAGA 1WTAA 3R4CA 4JKYA 3ZHRA 4J0KA 4I1VA 1ODSA 1JIIA 1UXKA 3CNNA 5BNFA 1GYQA 3IOYA 3VR3D 1NFRA 3QELA 2KQUA 2VRCD 3W9YA 5HOQA 3U5ZB 2G83A 3OE4A 4U5QA 5J5CA 5CD1A 1E92A 1ZNXA 3RUFA 4MV5A 2FEOA 2FCRA 1L1EA 4HN4B 3P94A 3IBYA 4ZIRA 4LFAB 1NE2A 2ISQA 2VHXA 3KV3O 4HADA 4KIWA 3FCEA 3TQSA 5JJIA 2VNSA 3HNPA 1UBEA 2HSDA 4GPTA 3WNBA 2VATA 3ZWYA 4FD3A 2GXQA 4ODIA 4Y9TA 1A4IA 5DIZA 3ZDRA 3QXGA 3IEMA 2IS2A 2WA1A 3HABA 4MI9A 2Z9CA 1S6YA 2FMHA 2H7YA 1ICIA 4P3OA 1KY3A 1D04A 1QGDA 2QW1A 5C2JB 5AW8A 1WMFA 2FP4A 2H59A 2SKDA 2FPPA 1GZ7A 4G8BA 4OKIA 2W48A 3FI0A 1RBQA 4EG8A 4BNYA 3B85A 1XZGA 2GZHA 3TD2A 3PB3A 4YMUA 1XTKA 2QQEA 1HURA 4UEJA 5HIIA 4ARSA 1OROA 4IH1A 5COQA 4LOKA 1USIA 4L4XA 4PQYA 2V6GA 5JV5A 3GPLA 3UBTA 2IY8A 2V5AA 4JJ8A 4YAJA 3VR4A 4UNSA 1ZI9A 1W19A 1XR3A 3A31A 3JWGA 1JDZA 1ICEA 4IICA 2TS1A 1QB8A 1UFVA 2H11A 4F5ZA 3EAQA 3W5HA 2ZJ7A 3GFQA 3GUYA 4X54A 4M46A 5E4FA 4DMMA 5AVSA 4A10A 2BT4A 4HEQA 1XXHB 3H6GA 1DXYA 1I6WA 5I3CA 1V7QA 2A0WA 2AX3A 1T9DA 3C98A 4KITB 3VV3A 3IEVA 3N8HA 1ODLA 2JFOA 4C7BA 4EUKA 1RRPA 5B3JA 3I2HA 2NU8A 4HQNA 5LQRA 3G0GA 3DMHA 1OW3B 1B8VA 5COAA 2C1EA 1V95A 3I32A 1T4CB 4MGYR 5ESXA 1X2BA 5FB3A 5MN4A 3OQHA 3OLQA 1U4NA 5IABA 3C7CB 4FZ3A 3Q11A 2ERXA 2F3TA 3VDXA 4EOGA 1JFFA 1X3SA 3EXG2 2D5LA 3GUHA 1Z73A 5JALA 2FETA 2JVKA 1XMOB 4GUAA 3C7TA 1OD6A 3HVHA 1U8CB 5EWLB 3FUXA 6GPBA 3T9EA 3QMPA 3NBMA 1YMQA 3HWSA 5FEMA 1T2VA 4FD2A 4NI5A 3ZGOA 4RENA 4B0PA 3LX4A 2OBBA 3BRWD 2BI7A 1RAIA 1U2DA 2X19A 2ZI3A 4GRDA 1M0EA 1TDJA 1K1EA 3CEAA 1BHQ1 2ISCA 4C3UA 3ZV4A 1T91A 4DR7B 2V65A 3UQZA 1MHTA 1Y63A 1SKYB 1RPJA 2HQOA 3QW2A 1GGNA 1OX6A 3TJZA 2ZIGA 1CHDA 4IDCA 4ZEMA 3LTNC 3T3MB 4N9QA 5SZHB 4OJTA 3HO6A 4OQPA 4AURA 3DM5A 4CNBA 4O0MA 3E3OA 3ZKWB 1L5RA 1WXXA 1K5GA 3NT2A 2Y05A 4CT0A 1OI7A 3MB5A 4PXSA 1UQRA 1EYZA 2IYQA 4CG1A 2DPYA 3NNDA 2OHVA 4TN5A 3UWOA 1ECJA 4LQ4A 1JIXA 5JSZB 1VE6A 1U2GC 3VHXB 4O59O 3HCFA 2YMPA 1GNLA 3B2QA 3KQQA 2PKQP 3HXQA 1ULZA 3ZV7A 3SNHA 2M98A 4J0QA 5TR9A 3U9LA 3Q0IA 4MUIA 3MPOA 4Q4JB 2JFBA 3W4JA 4TYQA 1KSJA 3MEQA 3PI7A 1EGVB 4IJKA 1H6AA 3EARA 2C3UA 3QMMA 3T61A 3JATB 5DLYA 5L3SB 2XHZA 5JXJA 1OT3A 1W4ZA 2W2KA 4TPKA 1SXIA 4EY4A 1NUUA 2HSEA 3AB3A 5F98A 4X0EA 4M2LA 2O1EA 1UMBA 3IERA 3KHUA 4GMKA 5EKTA 2XOXA 1STOA 3H8SA 5G3YA 1NW4A 4PPQA 4L16A 4AMYA 3DV0A 1UEJA 5BNIA 5JTUA 1VKJA 2VTKA 1XU9A 3VA7A 4DJDC 2FW9A 1EUZA 1QHHB 1I2BA 1TYEB 1LDYA 1XHFA 2H57A 1VMEA 2X4GA 2HK9A 3N5CA 3NEAA 1VMAA 4JOBA 4TV9F 2XNSA 5DOVA 1I33A 1H0HA 1Z7BA 3DE4X 3F3MA 3L0CA 2E4XA 2WIKA 1HQKA 3AIOA 5LP6C 2B94A 4I7EA 5JAMA 1KJIA 1BC5A 1KI2A 4UMDA 3EVEA 2TMKA 2QM7A 1SK9A 1D1SA 4CKBB 5I6DA 2CNWD 3E9MA 1G9TA 3KRTA 4I19A 5DNYB 2COKA 2OECA 3A27A 1KNQA 1PJLA 4PEVA 3RKUA 3ZTYA 1Z8NA 2WSSD 3U1TA 1IBSA 1E2KA 5F7ZA 4BQNA 4ZI5A 2RHRA 2PLFA 1TYZA 3RFVA 3VYRB 1PN3A 1W0KD 4ZT3A 3DHYA 1E94E 5HEKA 4FOLA 2QA5A 4I9GA 2EX4A 2J9FB 5TF0A 3W7AA 1ZXBA 5C8YF 4E46A 3TIIA 1JMYA 3FBWA 1GDDA 5EGNA 5ES3A 3HUFA 1FNNA 3OIWA 3V3TA 2XUKA 4D3ZA 1AGNA 3DCJA 1EGAA 1QG4A 4UREA 4BRUA 2ECKA 2EP8A 3KQPA 4MWGA 5J43A 2P41A 3CJRA 1TB4A 2E4ZA 5C53B 4IIVA 2CKMA 2GRAA 3B60A 4JJKA 4YCSA 2CNBA 4IZOA 1MVNA 4GI7A 2CZGA 3VXKA 2BKXA 3GWZA 3ZHXA 3M6LA 4AN0A 1ZM7A 2A9OA 1V1MB 4N47A 3FYUA 1PQWA 4X9XA 3T5DA 1EE9A 4FFPA 5E7MA 3GEEA 2Q45A 3U3RA 4AZWA 4ESEA 4IQGA 1RPAA 1GDTA 2G4LA 1KEZA 1NKSA 1F5SA 5BSMA 3WWEA 3UGQA 3ENWA 1F7UA 4BNJA 2IDMA 3R3HA 1E62A 4GW3A 4V3CA 3EIFA 3AL0C 2Q7DA 4AB1A 3ZVNA 5HIMA 1M8FA 2VPQA 3H11A 3INTA 2JHAA 1ZITA 3M82A 3HWRA 4OCZA 5CX4A 2QP3A 1A2OA 2BPOA 3Q3VA 4JVOA 1SUWA 2XUIA 4RXMA 2IVZA 3C3JA 4P7JA 4ZRMA 3IKMB 2Q7OE 4CLRB 5F52A 3UG6A 4DLUA 4GECA 2CMDA 4KTVE 1Z5WA 4O2BB 1F0YA 1M2VA 4ZVMA 1RAEA 1FRZA 1E7SA 4DNFA 1Q92A 1Y80A 3NOVA 2R1ZA 4F71A 1SD5A 3VR4H 4TV9A 2QSZA 4R2WA 4QYTA 4OYYA 4PWYA 1ZO8A 4INJA 1JEQB 3FFTA 4LPSA 5BVHB 5H16A 1TM1E 4C7JA 1IN6A 5GZ3A 1OFGA 1V9LA 4Q00A 5LDDC 1C1XA 2I4LA 3CF2A 3ETLA 1T15A 1RJGA 3JTEA 1J8FA 2QPLA 3FXAA 4Q9NA 4L0CA 1OWNA 3ZD9A 1WCYA 1W76A 4DREA 3KL4A 4PO9A 1L5HB 4FFNA 4XM2A 3PNOA 3E05A 5D6NA 1QP8A 1Y37A 4TV8F 3DBLA 3JD3A 4KUHA 5I8PA 5K9ZA 1IC6A 2XZPA 1A69A 1E61A 1YNSA 2GF0A 4X6UA 4HMQA 3MCAA 4X3PA 3KZCA 4RQBA 1I3KA 5C8YA 3C70A 4PS0A 3SZGA 4LDRA 4NEQA 1MJHA 4WAUA 4TS3A 4D80A 2G9ZA 3H2JA 3L5OA 3WLFA 3C3KA 2DP4E 3H5OA 1D0VA 3PNQA 1CNMA 4UVDA 3RE1A 3WWDA 4TZ0A 4C06A 1MDFA 1FF9A 3O4FA 1I0IA 4YDHB 3CLRD 1DIAA 1QC5A 5BV8A 1BVRA 2QIPA 4G1EB 2Y77A 4W82A 2ZRNA 5DGTA 1IBMB 3D2BA 4LV5B 3F7NA 1CQPA 5LR6A 1DKLA 1FP2A 4XLZA 4YRJA 1CQJB 4ZO8A 3WL3A 4CR6A 1DQRA 3C4VA 1UKBA 5JFGA 3QEBZ 4DBZA 2OHGA 3NDJA 9GPBA 1ND5A 2ODBA 4GYKA 4K5QA 4EPRA 2WTBA 3Q85A 2Y1XA 4HWSA 5CBKA 1G0NA 1KIAA 1MOSA 1XVLA 4IDNA 2MJLA 4JBXA 5FO1A 5DHAA 1HQYE 4OUDA 4H6VA 4G5YA 2W6CX 4DB4A 3LPMA 1VTKA 2E85A 4NMHA 3RVDA 4B17A 1P1CA 2P4EA 3CA8A 3BL8A 5F12A 3GGCA 2V6IA 4FE3A 4PFSA 5GVSA 2QGNA 4OH1A 3EUAA 4NFHA 3WNZA 2QM8A 4GLLA 3L2OB 4WKPA 4ON9A 5E4TA 1DJMA 4AX8A 5FTLA 3JARB 4E2WA 3HN6A 2X5KO 3AEQB 1P8AA 3DFUA 4F12A 3KDSE 1KR5A 4A7PA 3TECE 2C9ZA 3RYHA 4DR4B 3NYWA 2K2QB 3RH0A 1VKZA 2W6MA 5AVTA 2YOHA 4ENWA 2F1KA 4HNSA 1HDEA 2B37A 4FBMA 4UDXX 3VR1A 4X62B 2WMDA 1HV8A 2REQB 1V96A 1LPBB 1Y9ZA 1ZH2A 5IG2A 1VG1A 1RMTA 1FS5A 1G7SA 4NU0A 4IDDA 4OAPA 2EBFX 4YMIA 2J67A 1KK2A 4KJZA 3KYBA 4ZWNA 1YULA 1E0JA 2ZKLA 5PGMA 3WLEA 4R1QA 1V5FA 1I30A 5K4GA 4WBNB 3ZW7A 1M0SA 4TV8A 4QPCA 2XT0A 2NPIA 3LBNA 3ZGXA 2B36A 2JB9A 3F6SA 5I47A 1PZMA 1UBKS 3PJFA 2Z98A 1ZD5A 4KDEA 4DPKA 1UM8A 2C4KA 3GOHA 4EHHA 5G41A 1V6SA 4D0LB 4TZ6A 4ZI7B 3U60B 4N7JA 4HTFA 1NVAA 3HXKA 4D8VA 3VYSB 4OQXA 1S96A 1CY6A 2P9BA 4LDNA 1O97D 4I55B 4RTLA 2Q49A 4HVLA 1QHSA 3AC0A 4E4RA 5DE3A 4E7OA 4EG1A 1H3EA 3KOMA 1R74A 4GYWA 5ALMA 2QV0A 4O4JF 2XA1A 3FSGD 1NJ1A 2I6SA 2J5KA 4BU1A 2VZ9A 5D3ZA 1HEYA 1PI3A 3LXUX 4GX2A 4D2IA 1J2YA 4E08A 5AVXA 1T3TA 4CMEC 1XEAA 3VUEA 2Q21A 4BX8A 1SM4A 1MQ9A 1N2IA 3EIHA 2RGXA 4RHYA 5FA5A 4D9NA 2BONA 3HTXA 1KP3A 4B32A 4IAOA 4JNCA 3ICOA 3DQZA 3QU7A 4CU5A 5JBQA 1E3TA 1SVNA 1JQAA 2VH1A 2ZRKA 4LC1A 5FQOA 4CKCA 3AV0B 1F8UA 1LDNA 5JCZA 3O1IC 4EUFA 1UEIA 1OVGA 3JWHA 4DA9A 3T1YB 1NOJA 2BP7B 3DNMA 2B30A 3QA3E 2I8CA 4C6TA 5EY5B 1XAGA 4KR3A 5SY6A 4ZYXA 3L07A 3RNLA 5F9MA 1KAGA 3LAWA 4F8YA 3SXUB 2FFHA 1FDIA 3CGWA 5LQAA 2QUBA 3A1WA 4BGVA 4MHSA 3H1AA 4D9EA 2YS7A 5TSDA 3OJOA 3FMFA 5K0NA 4ETMA 1L5YA 4TYYA 3I6QA 3DWIA 1NFFA 1G55A 3PNBA 3AERA 3H0CA 3CF4A 3S2UA 1QGUA 4MWCA 4QICA 5K2OA 4IZHA 4TXJA 3GEMA 1Z6TA 2EJVA 4GVXA 1KFCB 2VJMA 1UZLA 1W93A 2B92A 4RZIA 1FYWA 2OWEA 3H4IA 4KQ9A 1MAHA 3OX2A 1AA6A 1VHQA 2VHTA 5AFSA 3QWBA 3EAFA 2F17A 1VOTA 1DBSA 1T0IA 4M4SA 4U2GA 2IE0A 1VFPA 3VOTA 5JQWA 4RFSA 2WAYA 4II3A 3RSLA 1LI5A 5JSQA 4WN3A 1VG0B 5JCOA 1U2QA 4RPIA 3VU9B 1ZJJA 2CJXA 3JD0A 2UXBB 3BMCA 2A0FA 1L8LA 5C8DA 3OTOB 1FNMA 2XKKA 2OGSA 3SOPA 3O47A 3V7NA 1U5AA 1PKXA 3HN7A 4O4JA 1C0PA 2XF8A 3CC8A 1MTZA 1XP8A 3CT6A 1XTUA 3LHIA 3OU7A 3PR3A 4HLDA 1WHTB 5IAKA 1CRWG 1CUUA 1A50B 1WD7A 3WP0A 1G5PA 1MJGM 2QZSA 4QYIB 5KU1A 1TLTA 3M6AA 3GP5A 4DDKA 2OMKA 4ALNA 1D8AA 4RV5A 4JXJA 4LHSA 3WQBA 4RJTA 5KX5F 1J33A 3HU1A 2XDQA 2A5FA 3IO5A 3WGHA 5K6AA 4IXWA 4NJEB 5L6LB 1YQDA 3NTOA 3GFSA 6REQA 2C4MA 4DCUA 2ATIA 3AF3A 5ADHA 1K2WA 1VHWA 1E1LA 2BC9A 4BXOA 2ZFUA 1KEEB 2QTHA 3H7IA 3PD0A 2BJVA 2D0IA 3H9CA 3R3YA 3WE7A 2PXAA 2A9PA 3E7DA 5I9MA 4CDMA 3BMQB 1Y9EA 1JEOA 3R7SA 1O6BA 2ADMA 2J5QA 4URWR 2WV9A 3D4NA 1DQYA 4JAVC 3ZZ0A 3V8RA 5TRTA 2JJMA 3WBFA 1VYHA 1OC2A 2IL1A 4JCCA 4QOFA 1RXWA 3D1LA 2HRBA 1GCAA 4IMIB 1XA3A 2VHUA 1JR3A 3DMYA 3KT6A 5H68A 3WQQA 4BNKA 3ZVKA 2BKVA 4QPZA 1X70A 2D1TA 2PGXA 1CD5A 3FHLA 3RVOA 5FOUA 1F14A 5LWQA 5ED4A 2GARA 2HMYB 5T5QA 1GGJA 2RKBA 1Q7BA 4KQWA 2YVUA 5A5FA 2CNLA 5DBHX 1A8PA 2D1QA 4WXHA 1KA9H 1ZD2P 1OH8A 4R1SA 1BGXT 3K9CA 3LUFA 3PYMA 4XE5A 2BHSA 4QECA 1DC6A 4TMKA 5A7HA 1CY2A 1BHO1 1RWNA 1XCGB 1WUIS 4I6JA 4D9CA 3J80A 1BO6A 4BZWA 4PTLA 2R8EA 4RTNA 4PZLA 2I4TA 4ZJYA 4FCVA 4RABA 4YECA 1NVVQ 1DCKA 3AR4A 3F46A 4FOPA 4X97A 5HIJA 1GUFA 1D7AA 4GBED 4KC0A 2WIAA 1F0KA 5H82A 5KZMB 4QBHA 1Q77A 2QPTA 3W2FA 2YN4A 4E13A 4PN3A 2E55A 2VNKA 3K73O 4JLKA 3ELWA 1J70A 4R5MA 1PSWA 5DNVA 5BN3B 5IK2D 4L6IA 3B51X 3J7AC 4MP3A 5JZOA 1NOKA 2OXCA 1DIOB 1JL3A 3DDWA 1Y6GA 3FVTA 2A2ZA 3Q7EA 1U9ZA 1XZQA 4Z9FA 2V9CA 3TW6A 3OKFA 4LHEA 5EIWA 4ZVKA 1OB2A 5K3EA 3DOFA 4K2AA 4NBVA 4E2YA 4UATA 3SOZA 2AZXA 2YXDA 4GOKA 2OCBA 1E77A 2WVJA 5JNVA 2XQGA 4G37A 4CL8A 1N5IA 1WNFA 1WXGA 2AFIB 2FW1A 4NZYA 5JRZA 4WPGA 3HDQA 4HWKA 2Y1GA 4Z86A 3PDHA 5JZSA 4RKYA 2I33A 3E9RA 4JK3A 2DUNA 4Y6OA 5ENZA 5KX5A 5DBIA 3OEHA 2FQWA 3VZRA 3ZQUA 2Q9BA 4HFRA 2P2SA 4DCPA 1FDSA 3AONB 4MI3A 3RM3A 4UBMA 4TL8A 3BCSA 2DHRA 1WKCA 3IQHX 2GPTA 3OQIB 1EM6A 4PCAA 1YF3A 5LUBA 5TPZA 5JZVA 5LQUA 1EFRD 1RJ9A 2GA9A 4UEQA 2C31A 2YHSA 3URMA 1Q1AA 4HUTA 1CDOA 3K6SB 2H18A 3PFFA 4PZEA 4PLHA 4RHCA 4Y7DA 4EW2A 3VKGA 2M1XA 3BZUA 4Y67A 4OV6B 1IK6A 4LQCA 1RHQA 4COKA 4AJHA 1OPXA 1E18A 5AVKA 3AHEA 1C9EA 1JX6A 1G9XA 1ZQ9A 4TLAA 1P1HA 2E9SA 4MMXB 2ESRA 3M6VA 4MLCA 4ZOEA 3ZWDA 3RJ5A 4UBOA 2YTZA 3JZFA 4B2PA 1NW7A 4UJ3A 4HQFA 3DV9A 1RRGA 3LI2A 5BN5B 1SD1A 2QN6A 4QVKA 3IPRA 2W8BA 2WJVA 2ICAA 1ULBA 1TD9A 3A9WA 3GD7A 3EGEA 4ZOQI 5EJEA 1PVOA 1T9GS 2OCPA 1ENYA 2CF6A 3DTNA 1N5RA 1KQPA 4LXGA 1JWBB 1Q14A 2IEBA 4H7KA 2Y0PA 1SCAA 3R0VA 1BIFA 3D5QA 1T1JA 5J47A 1D2NA 1I7NA 3JXEA 4DLXA 3UPDA 2B4AA 1PR2A 4V2IA 3X44A 1YJ5A 2A9QA 5I7OA 1HDOA 1JLKA 2AXEA 4IG4A 4WLNA 4XCVA 4CL3A 2HCFA 2ZWIA 4L7VA 3K16A 5EUMA 1AN9A 2O8CB 3OPYA 4RA6B 2GCIA 4TRJA 5ALJA 1GU0A 1W6UA 4B3XA 5H4GA 3CH7A 5KVQA 4WTOA 1M7HA 2IHYA 1O6CA 3OLXA 1I2AA 3UWSA 1DBPA 1E3WA 4XQ0A 1AKEA 2QXYA 5F77A 3WI7A 3V9PA 4RELA 5EXDA 4MAAA 3RF7A 3SBOA 1UFRA 4KU4A 1FK8A 3SVZA 1UBFA 3O8CA 4Q4HB 4D9BA 4QWMA 4WXYB 3NAQA 4X8LA 3IMGA 3IQEA 1UF9A 2PS1A 3GLQA 2R6AA 3MGCA 4FFDA 3KDPA 1DB3A 4KQHA 4WN9A 4FTWA 1MMFB 2Q9UA 2GUWA 2J4FA 2FQ1A 1KDOA 1VRCA 1VSBA 1F4LA 3WJ7A 2IGBA 2IWHA 1RCFA 3BJMA 3CEMA 3H2ZA 3EISA 4ZT7A 3R7AA 4BGEA 3LW8A 4J16A 2OILA 1EXMA 1E9AA 2Q28A 3GZNB 4QODA 3ANYB 3GQVA 2CK3A 5FTKA 2VYNA 4C3OB 1C7JA 4HFNA 2GYYA 2ZI4A 5AW4A 1KMCA 2XB9A 5A6SA 3E2PA 1Q7TA 1J07A 5FCDA 1YDGA 2Q2VA 3GA5A 2M9MA 3EVZA 3RREA 4U9UA 3OBIA 3P9CA 3CV3A 5C8VA 1IEWA 5I51A 3EN0A 1UMCB 4QAQA 3EY4A 1FQOA 5IUJC 5P21A 2VQ6A 3ZN2A 5ICGA 3LBIA 1YBAA 2PIAA 4OI4A 4ZVRA 1I10A 2AR7A 2EL9A 2OFPA 3IPAA 1RZRA 3IUBA 4QDOA 4YRTA 3QE4A 3WYAA 4HOYA 4OOEA 1NAHA 2TYSB 4AFNA 1SVUA 1KBOA 1G21B 1E6CA 5AKKA 4ZYUA 1P8JA 5LYYA 4OGWA 3TX6A 3HZZA 3VV2A 2ETVA 4MEAA 5ITZB 3FOCA 4BU0A 4ZVTA 1MB3A 4MMYB 1UJ6A 3IR6A 3FY4A 3BL6A 1IN1A 2PZJA 2Y9PB 3EZNA 1M2KA 3MUFA 2QVYX 5HSGA 1KR2A 1K89A 1ZCBA 3F0TA 1SKUA 2QR2A 2ZRJA 1WB5A 1NZDA 1N8SA 1QH9A 5K6TA 3SQXA 4KR7A 1YGPA 1JLLB 5KYVA 4MVYA 1LJLA 2D4AA 3P9QA 4BNHA 4UKDA 3I23A 3QPVA 1AUPA 2EQAA 1WDKA 3R0XA 3CZQA 5AW7A 1T3SA 3F78A 3TLGA 3OZAA 3TM4A 4NCAA 1JR3D 4WKOA 1BW9B 3CR7A 3GCWA 4HRYA 4MIOA 1RABA 3PICA 1SUSA 4X1YB 5GJVC 3TNFA 3I0ZA 1EHCA 3QVXA 1DXOA 4L08A 1JFTA 2OC9A 2QJFA 2VZEA 1S2MA 4UBIA 1FUEA 1G5FA 1N9GA 3PGA1 4MS1A 2ZI5A 3GPDG 3NHRA 5CM9C 1X6VA 3FVWA 2QMOA 2FQQA 2FA9A 3AFOA 2XNCA 3G2NA 3DL7A 4W5QA 5KWIA 3KSZO 3DFIA 2C3PA 4YBRA 3VU1A 3W7BA 4PSKA 3K94A 1B73A 5GGYA 1AV7A 2QD1A 2NNWB 3CSSA 1OBFO 2DM6A 4M7PA 3G23A 4YXFA 4LF8B 2EFGA 2DOKA 2FLKA 4IP0A 2MSEB 1VPVA 4XX0A 2OCGA 4HH0A 5B6IA 3NV7A 3TNDA 4YRGA 3A1SA 2E5LB 1GG9A 3N39C 3PFKA 1QKJA 2MSKA 4AL4A 3JQ7B 4N39A 2IV2X 1RAHA 3DO8A 4CLXA 1ENZA 4JQSA 1K6IA 3CTPA 3QVSA 5BSVA 3G02A 3LRPA 2J6HA 2C2MA 4CM8B 1YDFA 1K7YA 1E2PA 3EUFA 3R7WB 4Q3EA 2XUDA 3EF1A 3KZNA 4EGAA 4JROA 2B4QA 3QZUA 1EWQA 3KYJB 1HOTA 3OEWA 4PFJA 3ZUPA 4US2R 5DPMA 4R16A 3SF8B 4IJQA 3G59A 1R27A 3RUCA 3PSAA 3DB2A 1C7RA 3MJSA 2NUTB 3OEHD 2J0EA 1KRHA 5LOVF 4W5WA 3WK6A 1XZEA 4P3KA 1KOLA 4Q4LA 5ICCA 5DBOA 3G7NA 5TPZD 3JAKB 4LJ9A 3MMSA 2BHNA 2QQ5A 4YFYA 5CJPA 2C2ZA 5IT0A 1V47A 4E88A 1OIWA 4PGAA 3U4GA 4YRLA 4BE9A 3PX3A 1C5KA 4J1TA 4CV1A 2XUPA 4FGSA 1Y6QA 4EA7A 3JVDA 1RJWA 3HO8A 1DBRA 1ECBA 1I6MA 3W3AD 3CZPA 1B6SA 4JX8A 1UINA 1FJ2A 4J0EA 1W47A 5EJAA 4FFRA 3DZIA 3RS9A 5K05A 2H5JA 2RH4A 4OK3A 4LCEA 1W9HA 1Z0KA 2MSLA 3OZFA 2WM8A 3H9GA 4HGRA 4B5KA 2IY9A 3OM0A 4AWBA 2BMJA 1WE2A 3HCAA 3ZY5A 3W7VA 2GM4A 4XD7A 2VYCA 4M7OA 2BGNA 2XUZA 1JKJB 1JWLA 1VP9A 1YJCA 4G1UC 2PS0A 8OHMA 4C7OB 4TT8A 2REBA 4MPJA 1GPJA 2EZ9A 2G70A 3MTGA 3VC1A 4CFZA 4PAOA 4Y1FA 1EB9A 121PA 2V7XA 4PLZA 3PXUA 3I83A 3QFTA 1X1SA 3OP4A 3ZD6A 2FW7A 3GA7A 4JT9A 4QNRA 5TVGA 2EW1A 4RY0A 1BYUA 1FP1D 2C9MA 3DVQX 3LHSA 1WVIA 1SG0A 4UUMA 4DCSA 5CITA 4K87A 2NQTA 4KEAA 1I7LA 3F97A 2HB6A 4TQ9A 3QV2A 1FOEB 2VTBB 5BQPA 4DR3B 1IWOA 2CDBA 4NS4A 3HEMA 4G5GA 3BSSA 1BRMA 2EX0A 3LTEA 1W29A 1NQUA 2Z5LA 3PVCA 5DYYA 4Z3DA 3WB2A 5T57A 1Y4ZA 4CEIA 5BSTA 3OJXA 5AVVA 4MOWA 1MW9X 1E0SA 4M1MA 3SR3A 1FTSA 2FZ5A 1JEEA 2FU5C 4G0MA 1T5TA 2C96A 5JJCA 1TK2A 1GSHA 1F38A 3EGXB 3P19A 2Z4RA 5E6SB 1LDEA 3UAXA 4JITA 3GMSA 4F8EA 2A0XA 2BRUA 2WUDA 1K6XA 3MWYW 3R5TA 4RQUA 1KFKB 3UAOA 2YYYA 3C48A 5LOVA 3C6BA 4I4TF 2X6QA 3P5BA 1ZUNA 1YHZA 5B30A 5ARBA 1FQWA 3OFNA 4OYRA 1CJBA 4KQGA 2X3FA 2FHPA 1C1YA 2CK3D 2ZAYA 1O95C 1QM5A 5CX1A 5JSYA 2V7WA 3DLCA 4RULA 4TSFA 2FPGB 2PMDA 2IA5A 2JIMA 1TT5B 3HM2A 5THKA 2ERYA 2B78A 2H2FA 2K87A 3L40A 3N2GB 4N3BA 5KNCA 2ZTMA 3ES9A 3ZV5A 3R5FA 4RTRA 3GMTA 3AHIA 5JSKA 2E2WA 3D3QA 1XTZA 4JJAA 3K0BA 1RTKA 2ONKA 2B7LA 1G38A 4QQKA 4Z0NA 5TGTA 5TQ0B 4WLFA 1ODFA 2PR2A 3OF5A 3HCEA 4UNPA 2BKLA 3RK0A 4E5PA 3LP5A 2WTUA 2WT4A 3LF1A 1ZH4A 2M6KA 1XN4A 2B1RA 4RXUA 1KSHA 3GLVA 4IIHA 5JDIC 2ZYHA 3GT3A 5JARA 1RZRD 1W36D 3FKQA 1H8HA 4FDAA 3SHWA 3C41J 4MVJF 4I5IA 5JZ9A 1RYFA 2WWVD 4W8GA 1JG4A 4GWGA 2OCKA 3RSZA 1II8B 4PR3A 2OFFA 4MP6A 2ZRHA 3CUUA 4YEDA 4WLOA 3D3WB 2PVPA 3GRZA 3WDSA 4J2HA 2J0VA 2Z9BA 5REQB 1SN7A 2C5AA 2DZDA 1KO1A 4PE5B 3OOYA 3OLYA 2RSLA 4ARZA 3SC2A 3CNLA 3NNNA 3DAOA 3ILSA 3CUEF 3G7SA 5IKXA 1JKMA 4RD1A 4ONEA 1L3CA 2ALJA 2FW0A 2GN0A 4P35A 5GONF 3RFCA 3VPBA 1E0AA 5ALRA 3ABRB 4FGZA 1VGRA 2DUUA 4L27A 1HLPA 1TRHA 3QTTA 5ANRB 2YWRA 2R85A 4HDKB 3CINA 4KO8A 3V7YA 1QKKA 1U65A 4BBZA 5EIBD 5LQCA 1XPRA 1Y1LA 3OTWA 2BMAA 3WLOA 4NABA 1RWVA 4MGHA 5AM2A 2O4UX 3RUDA 1RVDA 4ESVA 4ARIA 2DRIA 1A7AA 1XF9A 4E2XA 2E3JA 3N3AC 4BNWA 2VNJA 2FPIB 5TEVA 4F1WA 5AOBA 2OC4A 5CURA 1ZZEA 4I4TA 3QKSB 4R8MA 4TXMA 4DLKA 5H02A 2A0UA 4IMPA 3RVBA 4AD8A 2VPXA 3RC8A 2GILA 4NG4A 3BXPA 4FX5A 5FWYB 1A9SA 3U3DA 2BM0A 3VZDA 4CDNA 5K0LA 5FUVA 2F9LA 4LUCA 5IJ9B 1QS0B 3QPAA 3WLHA 4FKZA 2WSMA 1D3AA 3BVPA 2HIGA 3SIXA 3I61A 2D2IA 3OETA 4L4RA 4W8OA 2WJGA 4C14A 1CDEA 3AJRA 3HDTA 4HS4A 3C8DA 2XWSA 1H2YA 1LSUA 4MW5A 3HVUA 1B0ZA 1TYBE 2NO1A 2KLBA 2QR5A 4C5BA 1ACLA 4O1MA 4RCYA 3M49A 5A4MS 5EHZA 1TECE 3UN1A 4AIRA 4B48A 4QJ4A 4EIWA 1GFSA 4H7EA 4ETNA 1L5SA 4IJMA 4BMXA 2RKOA 1AX9A 4MVJA 5FPTA 1FZTA 1ZKDA 3PHLA 4JNKA 3T4EA 4AUEA 1O5OA 2FW8A 1QDLB 4D3YA 1XRQA 3TO5A 2VCEA 4OXRA 1SCIA 1DWPA 1VE1A 1Z17A 2DX7A 3I09A 3PFWO 4M0CA 5AVOA 5DH9A 2FVYA 3V42A 3VTZA 1A4XA 1H5NA 1KO5A 4HB4A 2LIPA 1TF7A 2BZSA 4BLVA 1VA5A 2W8ZA 3GVPA 4CCWA 2JIBA 3H1PA 2FZLA 3AQ4A 4FEAA 2PT7A 1X7DA 2IYRA 3ZDAA 4DKJA 3KQMA 3R40A 3PQFA 4RTKA 4TTTS 5GONA 3RV4A 3VBEA 4GVPA 3FWPA 4W9RA 2VK8A 2CD9A 2YBDA 2J3JA 1J90A 2JLYA 4NECA 1NMSA 3K09A 4A36A 2ADFA 1VL6A 5DRTA 3JQ8B 4NU5A 2FWIA 3H2IA 2R7LA 1OZFA 4JKOA 4MS4A 4A6PA 1HZZC 1ZIYA 2P0EA 3AKZA 2VF5X 4XD7D 1POWA 2IEYA 4F3TA 1W0JA 2OP0A 3FUVA 2HA6A 1ISRA 2WD7A 2K6GA 4K46A 1L7DA 2ZIAA 4UU8A 1NASA 4BZQA 2FWRA 1ZIDA 1FX0B 4G56A 4QRDA 3T12A 4FCTA 1LFAA 4GMGA 1OVMA 3THXB 4RD6A 2BJWA 4MW7A 4KOEC 4C29A 1BD3A 3LT0A 5G4KA 3S2ZA 2V3VA 3B2EA 2GT1A 3TCXB 2FAXA 1FSSA 2WTXA 3NDRA 3UT0A 3VX3A 4D74A 4Q9KA 3VJRA 2GHQA 4Q4AB 2LUOA 1LQUA 4OBBA 4BWGA 5KWJA 1JAYA 4TWIA 5AJXA 5CDGA 5F21A 4QUIA 5T8KA 1PQ4A 3RRYA 3Q7SA 1M5TA 3D0RA 1WMEA 2AEJA 1NLYA 5G2OA 4FGJA 5J5VA 1PR4A 1H4SA 1RT9A 1DMRA 2Q5QA 2VP9A 4H4DA 1Z7EA 2P8JA 4ZVNA 4DJAA 3PXEA 2EZTA 4MEJA 1QRSA 3HLYA 5FQNA 3GP8A 1A7UA 5CCDA 3GBSA 1FFWA 4L6CA 2J85A 1EUCB 2QP9X 4HRXA 1CRPA 2OQIA 4QFDA 1OZGA 1H4VB 3MINB 5KNCH 2Q5EA 4P38A 1JEYA 3SYNA 2QOEA 1I8TA 3ETCA 1CUDA 4RO0A 1EX9A 3OFND 3AVYA 5A03A 2YHBA 4QUGA 2G80A 3U49A 4DMCA 2QSJA 4ETWA 1PWYE 5IU6A 1IVYA 2H29A 3PA8A 5AIBA 1UCFA 2GBFA 1DO0A 2PVCA 2RGBA 3L0YA 2LNDA 3DOHA 2H1RA 4R68A 5KDDA 1KEKA 2XADA 5J59A 3U4QA 1XU7A 2VBIA 3GO4A 1I9GA 3T34A 4L57A 4DQVA 4TMVA 3WC4A 2NTYC 2BZ0A 3PQ5A 3MN1A 2WUWE 2PX3A 3RG8A 3VI3B 1V7CA 2HLPA 4X71A 4YV1A 3ONDA 2D1YA 3UJ3X 2FRDA 3CZRA 3I5YA 1GZDA 1N0UA 4HP8A 4TKUB 4XTRA 4DEXA 2A30A 4UFNA 3DUFA 4RK7A 5JI2E 1LNSA 3V4SA 1TUIA 1P17A 3I6IA 5AW5A 2XCSB 1NTRA 3LC1O 2W22A 2XE6A 3IC5A 1H8HD 1A5TA 2Q0XA 2SCUB 2YVLA 1YS4A 3HNRA 3LPAA 1KF0A 4JJFA 4KWHA 5CT9A 5ES4B 1JA1A 1KERA 4DHWA 4H15A 2UV8A 1ZK4A 2OSVA 4EGSA 2DXIA 1TQ8A 2F1OA 1BDBA 1SBCA 5FNVB 1MNQA 1OT5A 1FLDA 2REXB 2MTBA 2R7AA 5F78A 5AVZA 3RIEA 3H16A 5FBRB 5GAJA 2D7JA 2AYZA 1I94B 3ZQJA 4EGFA 1IOWA 3ESXA 4JDUA 3EXHB 4E32A 2HMSA 3MMNA 2B98A 4YI3A 4BO5A 5IHXA 4L9WA 8LDHA 1PT8A 3UENA 1JG6A 3VAZA 3BXHA 3LLVA 4PHGA 2VBCA 5JCXA 1CZLA 5CYGA 4ISBA 1K8YB 3OLVA 4DLSA 2ISSD 3ML1A 3RD5A 4MO9A 3A4TA 3KKOA 2IZ1A 3WBBA 1P1JA 4RV4A 1SMKA 4J7CA 3DOCA 1UJ2A 2WTEA 2OZEA 4R51A 5B64A 6NULA 5CIYA 3DMRA 4MV0A 3U44A 3OOHA 1EP2B 4D9HA 1YRQA 1GA4A 2W4IA 1L7XA 2BN4A 2Z09A 5LSAA 4OP2A 1OKKA 2HSZA 5FF9A 5I01A 4UPEA 2R1TB 1RE0A 2HLHA 2EXXA 2RJOA 1SCNE 2H92A 3I34X 1BEEA 3KWJA 1Z22A 4G5SA 2IU4A 2IOQA 3UMBA 1YZTA 4GI1A 4G63A 3SYMA 2C9YA 4XJSA 4F4UA 3ZHVA 3WWCA 1UKEA 1POXA 1QIEA 3NR2A 2N75A 1QFSA 5HRCA 2XODA 4HDMB 3Q5GA 4YQEA 1K63A 3WLKX 1E2GA 1GRVA 1L8QA 1ZRSA 3HUUA 4OHMA 3AEUA 2ZQZA 3I5AA 1JYEA 2QENA 4H7JA 4KR0A 1NWCA 2YW2A 1YB1A 3CUKA 4MVJH 2AOUA 2QTWB 3NUZA 3ONEA 5FTJA 3E81A 3IAM6 4N54A 5C3MA 4N5NA 3DT9A 2ADOA 1BX0A 1XJQA 3MBIA 1S8AA 1VMDA 3RGWS 1Q1NA 5C1DA 1A8HA 1QAMA 3PHCA 3TQOA 1XMSA 2ZWPA 3ADCA 3LGAA 4P33A 5EPOA 1XDZA 2GEVA 1XNGA 3BGSA 1MB4A 1NDUA 3IMEA 1IJBA 4QUAA 4X1KA 5DHTA 4EL0A 1LQ2A 4MVJD 1J0BA 4CT4B 2IZ6A 2HJSA 3IP1A 4JENA 1SRRA 1FNSA 2CMHA 3F5MA 5DBEX 5ERXA 4W9MC 3AUXA 4B82A 5IN4A 3TXYA 1A72A 2ZB2A 3I1YA 4KYVA 2IPNA 3N0WA 1WXHA 2PUHA 3B6JA 5DNEA 4QRIA 4CMIB 4H08A 3U37A 1E2NA 3LHFA 1R9MA 1YR2A 1L4NA 2Q3FA 3VDNB 3SAJA 3KQKA 3K0HA 5DI3A 4JLBA 2F4VB 3HU3A 2V45A 4KSCA 3U4AA 1GVHA 1CZKA 3ZY4A 1YJQA 3RU7A 2B8JA 4BWFB 1ZHOA 4HNAB 3ONVA 1YRWA 1AB5A 2EHJA 1WW2A 1CS4C 1VGQA 5JVDF 1W5BA 4JR0A 3FNRA 3KFXA 3N2NA 1Y1SA 3ESDA 3GLTA 4JYAB 2FOIA 2CB0A 4JI5B 1ORHA 4YUWA 2BEWB 2EQBA 5JJKA 4MV3A 4B4VA 3ZGVA 2WM2A 2O59A 1DUSA 1SHTX 5T4BA 4ER5A 1CQXA 4EG0A 4AQ7A 1JBEA 1ZW1A 1E7QA 3IKVA 1N5JA 1W0JD 3RADC 3SF0A 2OD2A 1JHYA 4D8XA 1TFRA 1XNQB 4UXJA 1XK7A 1DXQA 4LJYA 4ALIA 4BJ1A 1PVDA 2JFHA 1IBLB 1XFAA 4PICA 5AJTA 2OKCA 2X9NA 3LSYA 4WK2B 4B7CA 2BFCB 3WIEA 1DO8A 3PTLA 2GZ3A 1TLLA 1XJWA 3GHHA 3DXZA 1Z4KA 2H54A 2HJHA 4FZRA 1SELA 2FZKA 2FG6C 4N7MA 3IXQA 3QG5A 3KC2A 4MQMA 4JSYA 1SXJB 2OLEA 2X2OA 2BOVA 4OMUA 2PA0A 3KAJA 2UXCB 5HTKA 2MYNA 3HM9A 2ZXEA 3I01M 2AL7A 5AW0A 5HZHA 3WYGA 2B4RO 3F90A 1DAMA 4ZOAA 4CKEB 1XDGA 3GLIB 2HA4A 5SY4A 2JDIA 3ASZA 4F9FA 1ZXXA 3EZ6A 4DF3A 3RIMA 4ZYVA 2I3GA 1U3VA 3AGPA 2PH5A 3MERA 2A5DA 1QGZA 3U7JA 1ZGAA 2OBLA 3QU5A 3H19A 1SZCA 5KJ6A 4K6MA 2H8KA 2JFUA 2GBGA 3NHAA 5LIPA 1Q12A 3RFTA 3V8PA 1NRJB 1WETA 6ADHA 4ZVUA 1X8JA 3LOPA 4FFWA 4PZDA 3I39X 2QZ9A 3UIEA 5U9CA 1U1CA 1GJRA 1VIDA 4B6SA 3ZS9A 3MTJA 1QXSA 4HGOA 2ZU0C 3EZ2A 1F06A 2DSTA 5T4FA 2QN9A 5AI9A 1Z2OX 1UM9A 1ZVMA 4WT7A 4BO2A 5ADVA 4HPXB 2JHCA 2GOYA 2YWXA 4KXXA 4M8KA 5CBPB 2ASEA 1BSVA 1DO2A 4J43A 4MIKA 5T41A 3FCXA 3T0IA 5JZMA 3QF4A 1ZK2A 1PG5A 2YFHA 1GEGA 5JVDA 1UAAA 2WPDA 1DG9A 1YU6A 1ZI8A 4R2IA 2AQIA 3SZOA 4RAOA 4DEVA 1HE1C 1DJNA 5C32A 1AO0A 2OBFA 1JAIA 3WZLA 3F3YA 1V4VA 1LA2A 2ID4A 3GGJA 2QLBA 3LUAA 4I66A 1XCJA 1R6UA 3NYRA 2RBGA 4FOTA 3L05A 3SKYA 5KSWB 3HBLA 4D45A 2DFVA 1FNCA 2ZSFA 4RF2A 4RHUA 4AUMA 4MRNA 4PHHA 5BWCA 1JHOA 2ZB8A 2DYKA 3AEYA 3NPAA 2TMDA 3B3FA 3OQJA 4MAFA 3CVUA 3M70A 2R11A 5IAOA 3NT5A 2QG4A 4QYXA 5LBTA 1XZ8A 1ITZA 2CVZA 2OO5C 1DOAA 3KOWA 4IMRA 3WGMA 1TKAA 2FN7A 5CIWA 2R3SA 4M54A 1SVOA 1PVVA 4G4SO 4HQ6A 4MGZR 3OESA 4RZUA 1AZWA 1FVHA 2VP2A 1X1QA 3O5AA 3Q88A 4Q0MA 3VFDA 2HCJB 4LGVA 3T1HB 3V4OA 3M81A 4FMCF 3AIMA 1EWRA 5FTWA 2QT0A 3DFKA 3NB0A 4W63A 4XRRA 3SN6A 3ZY3A 2IZ5A 3QFRA 4FHFA 1LBIA 5GQSA 1YJ8A 2PSFA 3SSNA 3UVEA 3CH6A 1QU3A 4QDTA 2ZBQA 3JVUA 3IIEA 5JAHA 1G8YA 2RARA 4OXNA 1KC3A 3RFUA 4BLRA 4AG3A 2C9CA 1R16A 1N6NA 3O92A 4TT3D 2F8LA 2JGDA 5AHKA 1L3BA 3SJBA 1V11A 4GZLA 1VPDA 3KKPA 3PUIA 4C0JA 2NXJA 1OKKD 2VRBA 3GDFA 2NYRA 1NPYA 4FQ8A 4RY2A 2VWGA 3PFCA 2BM8A 4JP2A 2XMQA 3I37X 4P8RA 2DHCA 3LUPA 2Y1FA 4ZOLF 4EG4A 1F8YA 1T25A 1TZ2A 1XZPA 3WDLA 2JVIA 3CXRA 2Q8NA 4KVAA 4PYJA 4OOFA 4JI0B 4URXR 1XMPA 5DTRA 1P7ZA 3Q9LA 3QIVA 5HQJA 3ST7A 2I87A 4HB0A 4E1VA 5M2QA 4RH3A 3KZ1E 4I9FA 1MGPA 3AF5A 4CQJA 5JXGA 4OHWA 2PBLA 1E1NA 4CI9A 1EFVB 1V0JA 4G4GA 3WTBA 4N5DA 3KKEA 4U9IS 4PVDA 4KH1A 5JAQA 1TCVA 4NRDA 2O8FB 5IEJA 3QKUA 3U4MA 1Y8CA 4IO0A 5LNK1 1O9GA 1E1YA 4KP7A 4OFXA 4EDHA 1ZEMA 1RXVA 1CVIA 1P62B 3R0QA 4YRAA 1TAUA 3IB6A 3JV7A 1M1YA 1F4VA 3I12A 1BKDR 1BX3A 3QJGA 1KVSA 3VSCA 4QGSA 3RS8A 1L7MA 4Q1FA 1DPFA 2ZYIA 3A9TA 4KQFA 3TSWA 3RHSA 3K70B 4HAZA 1ST3A 3JY6A 1GU7A 3OPYI 1AKVA 1CERA 5AXAA 4XPIB 4LY0A 4XB2A 1UPBA 3HH8A 1U98A 4J6FA 1GZVA 1LDGA 2AH5A 2PY6A 3NIWA 1MN6A 3TIXB 2JKYA 2ZSEA 3BZBA 4RL6A 2G9NA 1ESZA 2VK2A 3OY7A 5DFAA 5H59A 3V8EA 2VLIA 4D4KA 2QNRA 4EGCB 3ZHUA 2XCOA 1R8YA 1R2QA 2WYHA 3WJ2A 2JC3A 4AP6A 2IYWA 4RVCA 3IOEA 1NJ8A 2ODTX 2QEQA 3OZ7A 4OXYA 4E5NA 2QT9A 3I2FA 3Q7PA 1WHSB 2X4IA 2ZUDA 3LP6A 4J7AA 3RUIA 2BBOA 4BGIA 3KP1A 3C0KA 2VHVA 2VO1A 3R8XA 2PJRA 3J81k 4M9ZA 4PCLA 4TRRA 5EZ5A 1ISJA 2ZW9A 2YWGA 5ALGA 5FADA 4B0OA 5C37A 1YBMA 2O1SA 4XQCA 4AX4A 1KTVA 2IPOA 5KQGA 1BWQA 4EB6B 3NEJA 2IBTA 1GZ4A 3KVYA 4YR7A 4CIDA 1NFQA 1U3GA 1S3FA 4EFLA 2TSYB 2HADA 2V7TA 4HSGA 2XUQA 3K9GA 2A7QA 3C3CA 1SBIA 2NT3A 1E7MA 1PT5A 2Y1LA 1Z2PX 3BIXA 1GGHA 4JB8A 4G0OA 1XTVA 4ZOLA 3VC2A 4BZPA 4PZ9A 1KY5A 1EJ0A 2AWNA 2LE0A 4DDHA 5JCJA 1I4LD 1IG0A 1JV2B 2EJBA 2HEIA 2WM3A 2AJTA 3CG4A 3K7EA 4ZI3A 1NC1A 4Y6SA 3RK1A 3ZLUA 1IB0A 2ACKA 2H07A 3BE4A 1BVHA 5HIKA 3UZUA 4DLYA 4N3AA 2L2QA 3RR2A 4DUGA 2ACEA 3DEZA 3L0ZA 4X94A 2HRRA 3QEAZ 5JDCC 3H0EA 2HV8A 2ZTSA 4UTVA 5KOYA 2QAGB 2C0CA 3IMFA 1GSOA 3LV8A 1A9XA 2NP6A 4J8PA 4Z51A 4CCSA 4DILA 1G1MA 1QIHA 2W7TA 1N6LA 1E4YA 3JZMA 3NVDA 3OICA 3OQBA 5DTEA 2I2BA 5IBRA 2VN8A 3P8ZA 1A1SA 2I6GA 3ELUA 1TM5E 3D7MA 3GRUA 3ODPA 3G6WA 1RKQA 4PQGA 1TYAE 1OMOA 2FOLA 3OJLA 3LX8A 2RGCA 2Y2VA 2R8ZA 4OAOA 2E6KA 4FFVA 1C7QA 4GGMX 1Q0PA 3D6HA 3IT2A 5LB2A 2UYCA 2PL5A 2MSNA 2VJCA 2CHEA 2Q1WA 3TB4A 4YRPA 4IJUA 3E9NA 1Q22A 3GDHA 3PNLA 4KO3S 4LJ7A 4X3CA 3EMVA 2H0RA 2BSAA 4KXLA 1GKKA 4PG4A 2DHQA 2GKSA 2CUKA 3L5KA 4OVKA 4UCFA 2BDTA 2XXBA 4AECA 3VPHA 3X2EA 1M67A 1QOQB 2WPDD 2VYQA 3LA6A 4J4HA 3URKA 5A3QA 2H2WA 4TSKA 3HK2A 2EW2A 2A35A 3HKBB 1B26A 4Y1GA 1H0KA 3RIYA 4N7BA 4BQEA 4QWWA 2H4XA 3WKCA 4TS1A 4HVTA 1VIVA 3FBTA 1LDMA 2C2GA 4MQEA 1ORVA 5CYPA 4RLFA 2I80A 2DGDA 4I1RA 4GC5A 5JWOA 1DRKA 4ZCPA 1C3VA 4CQLB 2XE7A 3OCUA 4Z54A 2CCKA 4ZANA 5IKOA 4Z49A 2PH3A 4QOHA 3HKDB 3FNQA 4D98A 3LVQE 5JZBA 4K26A 4EEKA 1JHVA 3IDAA 5E9QA 5K01A 4IZIA 4KWEA 3UPUA 1RM5A 4R5HA 4JFAA 3P0JA 1BH2A 2UU9B 1Y6ZA 4M1TA 5F5NA 1CJUC 1G7RA 1F8GA 2Y92A 2C4HA 2ZDQA 4CQMA 1EZ4A 1KPIA 3NV9A 3MM4A 2JASA 1P1BA 3EK2A 3RJTA 3PHJA 1D1PA 1KPGA 1RXYA 3CLVA 4QPPA 5AKIA 5KVAA 4LN1A 3CCBA 2Y8EA 2A7XA 4LRYA 3OMXA 2H6EA 3BKXA 5JCPA 2C97A 4C4TA 4TVSA 1DC7A 1QH8B 3UUWA 1LZLA 1YUMA 3RTDA 3SFVA 2A1TR 1JEDA 1RM4A 4Q6WA 1Z83A 3EXG1 4QG7A 4D46A 3E1SA 5JADA 1WPXA 2I2XB 3HY4A 5GWXA 3WK9A 1EK6A 3GJRA 3HB1A 2IF0A 4GQBA 2CF5A 2I3ZA 4Z0TA 2VZ0A 7YASA 3KPJA 4HX5A 4GZ3A 3FFBA 1UDRA 1J8VA 3FTPA 3PF9A 4RUKA 4B9EA 2BMDA 3PIRA 1VMKA 2CHUA 1P0PA 3KWMA 3K53A 2XD9A 3L93A 3LPCA 4TQUS 2AKEA 3KQLA 4UE2A 5AVUA 2OV6A 2NOAA 1RZUA 4R71A 2PUDA 4B85A 1M2GA 1X87A 4S2UA 2GTPA 4Q16A 1TEHA 4ZEWA 5U4XA 2B5WA 4RZQA 2PS3A 4MYSA 5KTKA 1WZNA 1MV8A 3QOYA 4C2UA 4QXOA 5J2TF 3U2QA 3AFHA 4KX5A 3NUQA 2C8KA 1Z6ZA 5HMMA 4GBGA 3ZIDA 1OAAA 4YJGB 1G4AE 3IAHA 4IYRA 3NT4A 2A9VA 1QGED 1WS6A 4L15A 4GLFA 3V1NA 5F2NA 4CN8A 2JCSA 3ANLA 3CKMA 4REOA 2I8AA 1QIKA 4LYEA 1XEXA 3V6LA 4MROA 4LBVA 3SZLA 5FR2A 1O08A 1U0SY 4HYQA 1GDHA 1MRSA 2I2WA 2ZAMA 3K2QA 3QE9Y 4QREA 4AKHA 3IBCA 3HB0A 1Z2CA 1CY1A 2WW8A 1G8PA 1RRKA 3OCCA 5M3BA 4V39A 1PJ8A 3PDIB 1OZAA 2GB4A 2Q6TA 4PPGA 3ABIA 2JAQA 4R4JA 4CMBA 5I9TA 5B1DA 4X61A 2C5GA 1SQSA 3MMZA 3S2EA 2A5JA 3D8TA 3PR2B 2B1QA 3RB8A 1Y89A 3A1UA 1OBCA 1E9VA 1TTHA 1SUBA 2CDNA 2EBWA 2FVXA 3EIQA 3I9LA 1L2TA 2OVFA 4OHVA 4RACA 5FFFA 4PAWA 2P6NA 1Z5NA 1ZM9A 3EQ7A 4JASB 1MOQA 3QLTA 2JEOA 1C9JA 3FTQA 5FBVB 3BE5A 3ETEA 3UYLA 2VHYA 1XQVA 3GLFA 2W90A 1ZSVA 4P2GA 4Q7JB 4C4SA 3F6BX 2O8EA 1ZNYA 2JI7A 3D7SA 3MOIA 3W78A 2ZJ4A 3L8HA 2OP1A 1R66A 3I4CA 3TGWA 4ZAGA 1E69A 1OWMA 3EA0A 4ZO6A 4ZV9A 4DW8A 2CZQA 2GAOA 1QDEA 3L84A 4NICA 1E20A 4HCJA 4ZCSA 2WWHA 2LTAA 3H5LA 3EX7C 1BKYA 2IHBA 3LVFO 1EWKA 1GQQA 4PRKA 4A2PA 3RKRA 3CX8A 4H35A 2ZS7A 2PX8A 2WKSA 4K8OA 1ML3A 3V8BA 2VJDA 4DMUB 2FRVA 1YL7A 3DZGA 4KPEC 3Q5EA 2XDAA 3QLEA 5E0OA 3ZD8A 2ON6A 4C1BA 1JA9A 1YGYA 1QR2A 2R47A 5EXEA 1I6LA 4BYGA 4ZJUA 4DUZB 5HRAA 1PD0A 4Z4FA 1C1DA 1QZXA 3TLAA 4AZ0A 1XB2A 3X1XA 3DL2A 2NGRA 3IUMA 5A0FA 2EEZA 2GLTA 3W8FA 4LOHA 2ZBDA 4DUGD 4XVUA 1G17A 2ZT5A 4EUEA 3BFVA 4GMXA 4F38A 5J2TA 3AZPA 5IWAB 1WNTA 4I9NA 3JQAB 4MGIR 4MX8A 4UC0A 2UZAA 3FG9A 1M2EA 3H97A 1DWOA 2O3JA 1M7GA 1KOFA 3ROPA 3WP1B 4N18A 1T0UA 3K4PA 1OTYA 1BFKA 2JIRA 3A26A 3KR1A 3ESBA 1UKYA 2ONYA 4OEHA 2PRIA 3GF4A 2MINB 3D7NA 3SS8A 1E64A 2ZGVA 3BJEA 3STTA 2AX4A 2X5JO 1IN8A 4HATA 2FI1A 2E37A 3BHIA 4LJ4A 1KY4A 2HF8A 3W5VA 3L6DA 4FMDF 5AVRA 2YFQA 5LZ8A 2FFAA 1E3QA 3WRXC 2X0FA 4I46A 1DAOA 2DBRA 2W43A 1AGPA 3HE3A 1KYTA 2HZBA 1N5LA 1EVYA 1ZMBA 4IV5A 2WT9A 1OASA 4V0LA 4EWLA 1IQUA 1ZBQA 2UZ1B 4PC3A 4K6FA 1QV9A 2F3QA 3M1AA 4BQOA 1E63A 1YHNA 2DG2A 1YB6A 3TBFA 1KMQA 1UZMA 1NATA 1LV7A 4KYTA 2W2MA 1MC1A 4OQDA 3NHYA 4B4WA 3WLLA 3JZDA 1VJDA 1VYUA 5MF6A 1YA8A 3HBAA 4DMRA 4ML3A 2OFXA 2NIPA 3ENKA 2BWJA 2EW8A 2F4NA 3AR5A 4QVGA 4EHDA 4UQLA 4ER0A 1JLRA 1XEWX 2JAHA 3I9OA 1HQDA 2W71A 3QEKA 4REQB 2IY7A 2WJWA 3VZSA 3UWPA 1OWPA 1ZX1A 3NWPA 3T06B 1EK5A 2QHXA 4BFXA 1YDHA 1YR9A 3E6AA 3RQIA 4LZLA 4B6EA 2P2NA 2IVFA 3KSBC 2YIJA 4ZAWA 2DQKA 2GGSA 4YREA 3ND7A 3VO9A 2HXSA 3W5AA 1Q20A 2PT6A 5E9WA 1LS1A 1JTFA 1VC2A 3WRWA 1XTJA 1Y8QA 3O3OB 4LI3X 3AZOA 2HSWA 4WZ6A 3VSAA 4GOJA 5KOJA 1WF6A 2IEZA 4O8CA 2VTVA 4KV7A 3ZG6A 3BXXA 4DGQA 2PZ8A 1V16A 2YHUA 4JR2A 4LC9A 4NEHB 4NXNB 3IOCA 4MVJI 3BTOA 2BTQA 3U7GA 3AKCA 2VKQA 5E8RA 5F33A 3RVKA 1H85A 2FPXA 2CUNA 4E15A 4O4IF 4QELA 3JSXA 4BLTA 1EA7A 2OQRA 1NURA 1X8KA 1CV2A 2R00A 1NHGA 2JD1A 1B42A 1GGEA 2RIPA 3KK0A 4RIGA 4MQ4A 2E49A 4RIFA 1N2CE 1Z39A 2XUFA 3DEHA 3MVEA 3QLUA 2R1VA 4PLPA 4WKGA 1KL7A 3U3JA 3W90A 4WJLA 4HH1A 4NYIQ 4Q7KA 5CH8A 5CVTA 4ETIA 1FP6A 3OIYA 4NKRA 2JGMA 4RADA 4EY7A 3LD9A 3CUYA 5CD9A 4CTNA 2QDXA 1J09A 1L9XA 5C34B 3WRYC 3WDKA 4MKIA 2YFYA 3ABQB 3KLPX 4LYDA 4NESA 5DWVA 1VL5A 1K7SN 2HMAA 5ENVA 3UG7A 3FMVA 1V3UA 3D64A 5BURA 1G4HA 8MHTA 2RGAA 3ZWVA 5IKEA 4CQNA 4UDYX 5IC5A 3W8RA 3JPWA 1L5OA 3FHOA 1J39A 4JOSA 4BZXA 4AJLA 2QQGA 4Y0NA 3FCAA 2FTKE 2Q29A 4YMGA 5KVVA 2PK3A 1CZRA 2A6PA 2GD0A 1PJQA 3KOYA 4ZRNA 3W0LB 1VM6A 2J7PA 5DBFA 5TGZA 2P2CA 3FZGA 4YJHA 2X14A 3DE2X 1DJQA 4RX1A 5AK5A 2PLWA 4C4OA 4CMAA 2HTFA 1MC4A 5IVIA 4V0QA 5FLEX 1SU6A 1FTGA 2WFLA 4G5XA 4WLEA 4B81A 4YRZA 2QRVB 4EFKA 1RIFA 4WECA 3RAGA 3VYVA 2O8CA 3ZZTA 1C4WA 4HRAA 3QTLA 3GXOA 3P9PA 5D51S 3JALA 5IJ0B 1KDTA 4WCFA 2AK3A 3NIGB 1DTWA 2HQ1A 3UFBA 4RKRA 2E7ZA 2ZB7A 3AZQA 1P2SA 2YIDA 3BIJA 1DKOA 3Q9UA 3QUCA 4JT2A 4WZAE 2BELA 4Y6LA 1GKIA 2XBMA 2FRXA 2CL6X 4WW0A 1G8GA 3DH0A 1D2AA 4HAXA 2FEPA 3OJEA 4IV8A 4DQLA 3KIPA 1DS6A 1M83A 3AVQA 2XLCA 4M0LA 1PK9A 5CK5A 4BNFA 1T5SA 4NBKA 3FJ1A 2ZZKA 2WK1A 1UXOA 1GARA 3KPWA 1G41A 4X20A 4MB6A 4GLOA 4YHHB 3CFYA 3KAKA 1QTQA 1RE1A 1W6RA 3CF0A 3EUEA 4DSTA 1MO5A 1FLNA 3B7PA 1M1NA 2H4HA 1B41A 2J31A 3IAM1 1HNNA 4H1HA 4BB6A 2NTVA 3AHHA 4MUYA 1NI5A 2N42A 3CX7A 4FFMA 1XTPA 3DMTA 4DOMA 4DV7B 4O4IA 1IXKA 3FHCB 4CKYA 1GIAA 2HJ9A 3M5DA 8AT1A 2F90A 2P9CA 2PZEA 4LWZA 4RDHA 3R75A 4C76A 1SXJC 5KYXA 4EG7A 2XB4A 2ZRGA 1XRRA 2BUBA 1I2DA 4WZZA 1XRPA 3S40A 2P6MA 3G2LA 4GAEA 2Q07A 1PX0A 1O03A 2JFGA 2HW8A 2J7KA 3AUKA 5ENDA 5TQJA 4ZYLA 2EGUA 2BSQA 1HFEL 4YC7A 1HMPA 2IWRA 4DR5B 3KYCA 4DMKA 4UDNA 1AQLA 3DF7A 4PNPA 4F6RA 4UPVA 4WOCA 1IY1A 3KAQA 4XEHA 5GIOE 3OT4A 4WNCA 1Q44A 2PJDA 1JHQA 4ZZ0A 2BFDB 1YTUA 4R31A 4AO8A 1KO8A 2YJTD 1KYQA 3ZS8A 1T6XA 1ISGA 1YE8A 1YNOA 4HXEB 2FXVA 1VG8A 3K1AB 2CYCA 1C3OB 1VSVA 4NZ9A 1Y8AA 2QM3A 1TX4B 4YNBA 3WLAA 5K99A 5CEFA 1Z29A 4BGDA 4XI9A 3PT9A 1VB5A 4M1SA 4BNNA 4TTSA 3X1KA 3E9CA 3SY8A 4B9AA 4MHOA 5EE1A 2Y99A 3K20A 4KWIA 2Z5GA 2C04A 1OGYA 2D2XA 5IX8A 1IOVA 3CWCA 4HDSB 2CB9A 3ZV3A 5A3JA 3M9LA 4QASA 1AQUA 2B4TO 3TFQA 3Q0TA 1ZDMA 4ZEXA 1W1WA 2XVZA 4FVTA 4F4HA 2KW5A 4V0RA 2IHVA 1XK6A 5BW8A 1RKVA 2WAMA 4ANFA 3OBBA 1ZW6A 4K1XA 2OXIA 5BNTA 5JYEA 2Z4TA 4LS3A 5IWCA 1NU8A 1ZCFA 1FFDA 2CCGA 1KJ8A 1ODTC 1OA0A 1QP4A 3O8LA 1MABB 1Y3DE 1WKBA 4DLPA 1A8UA 1T2UA 4HQ0A 1XZAA 4IEFB 2ZK7A 4WNIA 2E18A 2AXPA 3D7RA 1CEQA 1CR4A 2J33A 1KOGA 1YVUA 1PJTA 2P6PA 2P7HA 2X5XA 5E2AA 1N2EA 4JEIA 4X91A 1E1MA 4QDKA 2BFFB 3L0IB 5FAXA 4IJ5A 5IZ4A 3E8SA 2QTAA 3DHNA 2JGJA 1MIHA 1DIGA 1E9BA 1L5FA 2XGOA 2PGLA 3KUKA 5AXDA 3DZHA 3OOSA 1MAVA 2G1KA 3LKVA 4QTUB 4TS9A 1RIIA 3T3GA 2I91A 3NOXA 3PQ3A 1A95A 4ZU3A 1SG6A 1Q0SA 4EQ6A 2HF2A 1OBVA 1O77A 2WE8A 4G4JA 1KFJB 5C9ZA 2IH5A 1TJYA 1W25A 3TKLA 4A6EA 2RIRA 3ZVMA 1R4MA 4G97A 2B1GA 3C2QA 1OFHA 3HG7A 1J0EA 2MR6A 2PZMA 1TCCA 1WSWA 1IPFA 1HYGA 1PZHA 1BGWA 2XT6A 3GJSA 1WABA 3IVXA 1QLJA 3M2PA 1IZZA 2VH2A 1SCQA 2DSNA 2RK3A 2IXBA 3I72A 4CW7A 5B3LA 1BXKA 3A9RA 3HA2A 4HK4A 3UW1A 1W4CA 5JOQA 4R1MA 5HUQA 1DG1G 1ZMTA 1UFQA 4YJ2A 4MUAA 4C88A 3E9DA 1SC1A 1UEXC 4QJBA 3S1LA 4G65A 1VJ0A 2WBLC 3V7UA 1V9CA 2CLEB 2CLDX 4YYZA 2B69A 1R37A 4KQ2A 1YJXA 4WNAB 3LQFA 4IPTA 4LHYA 3TB6A 4WXMA 2HJVA 3VTFA 1CCWA 1K0UA 3DTYA 2QLMA 1PFWA 1THZA 4UBKA 5CB4F 3P2KA 3E48A 1H2BA 1PJ3A 3B89A 3F7MA 4GEGA 4INOA 4WK4B 5I7WA 3ZIAA 4F2GA 3BH7A 5B6JA 1SGWA 4A2WA 3MQ4A 2NU6A 1ADFA 1I5RA 2HIMA 2P6OA 1BXRB 3B1FA 3OH8A 4X90A 1YCGA 1HRKA 3BBLA 3WYCA 6LDHA 1ZD4A 1J8DA 3CE6A 1EU1A 2Q5LA 4J0IA 2MMCA 4KPUA 3D81A 1GNPA 3PUXA 1GADO 1XQYA 1W5FA 3AO0B 1KP2A 1R4ZA 3NU1A 1OYYA 2IP4A 2O7SA 2W0SA 1T0PA 3AJEA 3OCZA 4RA9A 4WFJA 3ZH9B 3CZ4A 3RHZA 1K9VF 2HBRA 5HJ7A 4MUBA 1JHUA 2AOTA 1EINA 4FWBA 2R48A 3U9TA 1M10A 3K70C 1NW5A 3NALA 2XWJI 4FU0A 3D8SA 4MS3B 2HMWA 4Q9JA 1X7WA 5B58C 1DC8A 2LKCA 1DRVA 1OLXB 1T4DA 2VQSA 1SQGA 3C6MA 2ZR7A 3S2GA 1WM1A 2J7PD 3M6IA 3QFFA 1AKUA 3C3PA 4XUDA 2V0GA 4G6ZA 4D9IA 1PDOA 3HYRA 3T5MA 1MIOB 3UM9A 3CVJA 1U7DA 2IYVA 2OBYA 1TA9A 3OQVA 5GJWC 1HUQA 3CNBA 2COEA 4I50B 4WOKA 1DVRA 1QTRA 5G0VA 2BHRA 2B34A 3DHVA 5CTAA 2V7GA 4RF4A 5A0TA 2OGWA 2A1UB 2C20A 5LP6F 4P83A 1Q21A 3BTUA 4UNRA 4ZHSA 5BWMA 3DGFC 5HQ3B 5MGBA 5C80A 1LH0A 3HFGA 3QEMA 1L7NA 5DM2A 1X7ZB 1VJRA 8GPBA 3HJGA 4LNHA 2Z3WA 1JPJA 1WUKS 2GNPA 4XSGA 1FFXA 4Y2QA 4JYZA 1J1ZA 1K7CA 3CY6A 1VPLA 2DCMA 3PNYA 2H1WA 3DAGA 5KBYA 3DF9A 4PNZA 3YASA 1NXWA 3OPXA 1U8ZA 2MMGA 4PC1A 1D6NA 5EWMB 4KPFC 1QYIA 4JFRA 2YMLA 3EXAA 4IVRA 4KFUA 1Z4IA 4DSAA 2BCJQ 1H2FA 2XR1A 1ECGA 3HB4X 1SOUA 4Q34A 3TTYA 3E27A 2WIBA 4BJ3A 5IBPA 5CU7A 1TPZA 2GNAA 1T34A 3FGOA 2EBUA 1DEXA 1YB7A 4TVBA 3DTVA 3L6OO 5CB4A 5J4KA 2YY6A 3OTGA 4WVLA 2P9QA 4RQTA 4R84A 4IZ6A 2FW6A 5B4UA 5CVCA 2WLTA 4TROA 1U2GA 4XAQA 5ELMA 1Y7TA 1YS6A 2FZVA 2OCYC 4ZEOA 2QAGC 4UTXA 5EG5A 3WMRA 1P7CA 2ODQA 4OMFG 4X1IB 4DBLC 2W93A 5LU8A 5CDHA 4WJZA 2IYTA 1IOLA 2Q50A 3HFSA 3TFOA 3QU4A 5HW0A 2VNIA 1DL5A 1XQ1A 3C3BA 4WGFA 2PAFA 4HKTA 3BDVA 1N0IA 2YZMA 1U5BB 3OURA 2FZEA 1KHHA 3CW2A 3FMGA 3L4JA 5ELXA 1V7ZA 4MV7A 2NZXA 3Q3CA 4YN3A 1JPNA 3T4PA 4BKRA 4B84A 2YZ7A 4BC0A 3IXMA 2UUBB 3E7PA 1A27A 3CR8A 1ZM2A 3LWBA 4CIXA 4MMZB 3RVNA 4AJPA 3ET4A 1NVUQ 4DY4A 4P7GA 5IAJA 3VO2A 2FUCA 1RWXA 2QLTA 3IDQA 4B8WA 4JBNA 1JYFA 1ECCA 5EQDA 1ZM3A 4EJSB 2YXBA 5JFTA 2QRLA 1BZYA 2HXGA 1TZJA 3QI7A 3G5MA 4I4LA 2YIVX 3HV2A 3OU2A 3QELB 4G1BA 4WK6A 3O8QA 4XGQA 1T2EA 2ZBPA 1S02A 1S5PA 1DRWA 2BE9A 2AN1A 2CLKB 3AF0A 3C74A 3GLHB 1NJ2A 4IFEA 1U7WA 2O06A 4KODA 3H5NA 3X1ZA 1E60A 2G07A 4OGLA 4ND4A 3WX0A 5MN5A 4H0NA 3I9JA 1TVMA 2QI9C 4P4NA 3MUOA 4BN4A 1H2HA 1R1DA 2O50A 3AM5A 4DKXA 4WD3A 4JP3A 3QP9A 3ZUGA 1T8SA 1JJAA 3NIBA 5DLQC 2BFMA 3V48A 3VH1A 2A3RA 3WB9A 1GCUA 5K6RA 3W2GA 1MC5A 2JLRA 1UZAA 4RE6A 2P4QA 3UKDA 4NZNA 4WFKA 3RW9A 5J1TB 1IBCA 4YAIA 2WQ7A 1H5QA 1ZG3A 3T0FA 3C1AA 3KVNA 2CJPA 2PGJA 3M7IA 2AN3A 1H8EA 2EX1A 3C5CA 1P2VA 3EGIA 2DPGA 2HA5A 4CF4A 3RANA 4Y2YA 4DAOA 3HJCA 2HWKA 5FULA 2H4FA 5CXXA 5K51A 1NV8A 2JFYA 1WZ2A 3C1TA 3KEQA 3TQQA 1QE0A 4FMBB 4MV6A 2G76A 1NC3A 3AM4A 1CUHA 2FZWA 3I2IA 3AYXB 4HFJA 4QD3A 1JHZA 2CZCA 1G8JA 4R9SA 2Z57A 2FG7C 3I1IA 3ELDA 4FYKA 4CKWB 3MJ4A 2RGDA 4Q9AA 4Q47A 4BVEA 4JLUA 1YQUA 3N28A 1F0PA 2NU8B 2NU9A 2GEJA 4YV0A 1ZZGA 4L4UA 3ZDFA 4DSUA 1KSGA 4Q3LA 4QZVA 1BQ3A 4L75A 4DV2B 2NPFA 3GRKA 2NZ8A 3EGVA 4UD6A 4UZEA 4BKOA 4C0XA 4M36A 4IS3A 4MR8A 3CRQA 3EJ6A 3QOXA 4K9RA 3CEHA 4D0RA 1J8QA 3B3QA 1ST2A 3K92A 3KEOA 5DCUA 4D79A 1JLSA 1GT6A 5P8WA 5KKNB 3L0PA 2IS1A 1IZYA 2Y4OA 1ABFA 2BD0A 3B6ZA 3HDYA 1N1DA 4ALJA 3HS3A 4DDMA 4NXMB 2OHXA 4MGEA 4V1CA 2WT8A 1T9HA 4NZMA 1JJ7A 2HHCA 2WUEA 3OEYA 3ZIAD 4C4XA 3KVOA 1ONNA 4GM0A 2OA0A 1E66A 2KPOA 4A0GA 3BJIC 2Q3LA 1X7GA 1KYXA 2IIBA 4CTJA 1PCXA 2EIHA 1KMHA 1N8NA 2R6CA 1IZ7A 1Z5OA 1K3TA 3TZLA 1E32A 2F64A 2RDMA 1DC3A 5H4HA 4JD5A 5L45A 5GJBA 2A1IA 1AKNA 1WLSA 4INPA 5SZIA 3ICVA 1B8OA 2HO5A 2QN7A 2ZIWB 4XB6B 2Y71A 3B53X 5JDCA 4MDFA 3N2LA 3I01A 4LVOA 3BCHA 2W2OA 4DJEC 3BKWA 5EKXA 2AA3A 4QHTA 3REGA 2RAVA 2CVOA 2YWBA 4B1FA 2EV9A 1Y4UA 1EVJA 3PPXA 3QX8A 4N4AA 4GDMA 4YRMA 4R9UC 2HRCA 1G5IA 4YO7A 1LEHA 3GT4A 3LE8A 4I1IA 3MGAA 4WRRA 2WMNB 2JCVA 1DKNA 3BF7A 1ZA2A 4PLWA 4ZO7A 1SHUX 3FWYA 1B6GA 3EAGA 4ZCIA 2Q0HA 3GZTB 1YQXA 2OY0A 2NO0A 4MRMA 3IEUA 4C4PA 3LQ2A 2RH8A 2W2KB 1EJBA 2ZVPX 4TRMA 4RZXA 1ATZA 1DAIA 1W88A 4Z3OA 3RRJA 3U6BA 1CJCA 2NXCA 4P81A 1UMBB 1WCXA 4WL0A 5H0IA 2E21A 3UB3A 3BIWA 1CQZA 3BRQA 5EJIA 1HTBA 3DV0B 5JECA 1HT0A 1LPSA 1NJSA 2V4ZA 3TBHA 3D0QA 3EPJA 2PT9A 4JY7A 3GJXC 4NU8X 4GPBA 3REFA 5AW9A 2CLOB 2SKCA 3IQXA 2R751 3DW1X 5BWNA 5TX7A 2I4IA 3S8EA 3B78A 3L7LA 4FDTA 1S0UA 1XCPA 3A6JA 2P2YA 4FS8A 1GQYA 3AVOA 3PIDA 4FILA 4GH5A 2G5GX 2E82A 2LCIA 2K5UA 5ALZA 1JZTA 4QL3A 1V3TA 5A3SA 5JE8A 2GZAA 3DTVD 3T94A 4YT5A 2AOXA 3U3MA 1KJYA 2BBWA 4U3JA 5DSTA 3IB3A 1Y4AE 3NG1A 1MC8A 4K86A 1PTKA 1CDZA 5B5SA 3ZLJA 2K4MA 3PITA 1COWA 5TQVA 5JD4A 1Y8RA 5F4BA 5GMOA 1VSQA 3I5MA 2V54A 1BTOA 4R6WA 10MHA 2O3UA 1XVAA 3ZHOA 3JQQA 4C22A 3PUZA 5IARA 1KZHA 1LVGA 3ZH2A 5JTTA 1F8XA 1JMKC 2PMWB 2VXOA 2XTMA 4I9UA 1JLMA 3AUTA 2GKOA 4J1QA 1QGOA 4PQEA 4C0WA 3HB9A 2HR1A 4KJXA 3KUXA 4PIPA 3W5BA 1P0IA 3FDZA 1G8MA 4B6GA 1PV2A 3BEDA 1AKQA 2HMVA 4NCIA 2EAUA 3E3MA 4J3NA 1BX1A 1WAMA 2DT8A 2QXUA 3HR8A 4FR2A 3EVDA 4U8GA 3PNVA 4WE3A 3TW8A 4D3FA 1ONPA 4Z9XA 1N7HA 3SZUA 4Q7EA 4WLUA 4DNXA 4DYHA 3FYUB 3COZA 1IUKA 3GNTA 3T3PB 3RYFA 1C14A 3WOHA 3AYZB 2V6BA 3MG9A 3B5EA 4NCHA 1AGXA 4QDJA 2R6JA 3RFXA 3IAS6 1NYTA 2AS0A 2AEFA 1O96A 1VRWA 2FF7A 4P7FA 4LXXA 1U7PA 2ROQA 4MINA 4E31A 4HGZA 2JAUA 5AMXA 4H60A 4KQJA 2JHFA 3L0SA 3A2LA 4KFRA 3TM5A 4K2HA 1TL7C 2XV1A 1RXIA 4ES6A 2WG2A 2BFBB 2PUWA 4CMEA 2JEYA 4XGKA 3U9SA 5IKPA 1WSBA 4FQ7A 3ZXUB 4AP9A 3FKSA 1Z15A 1UJ4A 4B87A 1T4GA 3A6PC 2YMMA 3HXOA 2VQFB 3ZCRA 3D8BA 5BWOA 3SHTA 5C5DA 4C43A 1N6OA 3PF8A 3NCHA 4MW6A 1FSFA 2GA8A 3LXXA 4LMPA 2C4TA 2H2GA 1DBVO 1EP1B 4NU6A 2EBHX 4R1PA 4S24A 2FZGA 2UKDA 2VFAA 3COVA 3COPA 3H4MA 4IH9A 2GRUA 2AV6A 2HOQA 2LVBA 3M9XA 3NLLA 4NYIR 4EFMA 1SKQA 2DWQA 2LZ0A 4CTOA 4DLBA 2VK4A 3HMKA 3QX7A 1H8ED 4BMOB 1M8KA 3ZOZA 4BPBA 4ZT2A 3AJ9A 2AF4C 3B6KA 3TTTA 2P6RA 5C1OA 3K8YA 1TC1A 4M0UA 4PZUA 3DBLB 2F00A 1EVEA 2YOFA 2YV5A 4RLHA 5FNZA 2RAUA 1X94A 1WMDA 3LT2A 4FLFA 3U7IA 3VPDA 5JT1A 1TO2E 4L2IB 5C8YB 3K9FC 2CV2A 5M29A 3DVAB 1DBWA 3Q2KA 2AJCA 1G20B 1MOPA 2EIXA 4JOCA 1UMDB 2A4MA 1KS2A 4L3VA 5TMDA 3PFHA 4C87A 4PSVA 3SQWA 1U7HA 1VJ5A 4Q82A 4EHKA 2DFDA 5JUWA 4QBFA 4XJVA 2ODPA 3N2YA 5A02A 3FZEA 2QMUA 2YZGA 2GESA 3RT1A 5A4AA 1GYRA 3QG1A 4V3BA 1P7VA 2Y67A 3F5DA 3OKPA 4MJ3A 1Z7GA 3QKWA 1AKYA 2BVNA 2GJKA 3N5KA 4RVOA 3D8UA 5DP2A 5A71A 1M33A 2CUZA 3DW3X 3MWEA 4D3DA 4EJSA 3AVUA 2X0JA 2I6UA 1BKSB 1TK9A 4C0QC 1ULHA 2NM0A 3DO5A 2VF7A 5LA6F 3RRNA 2QAJA 4KNWA 1J56A 4NOKA 4KSBA 4OXKA 4D5GA