4KK4A

Ywle arginine phosphatase - c7s mutant with phosphorylated active site serine
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
152
structure length
151
Chain Sequence
b'MDIIFVTGNTCRSPMAEALFKSIAEREGLNVNVRSAGVFASPNGKATPHAVEALFEKHIALNHVSSPLTEELMESADLVLAMTHQHKQIIASQFGRYRDKVFTLKEYVTGSHGDVLDPFGGSIDIYKQTRDELEELLRQLAKQLKKDRRLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Low molecular weight protein-tyrosine-phosphatase YwlE
publication title Structural basis for recognizing phosphoarginine and evolving residue-specific protein phosphatases in gram-positive bacteria.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase
total genus 60
structure length 151
sequence length 152
ec nomenclature ec 3.9.1.2: Protein arginine phosphatase.
pdb deposition date 2013-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4kk4A00
3M9WA 4N0QA 4KZKA 3EODA 3QLVA 5FBKA 4EVQA 2GBPA 2PKXA 3F6PA 5EWJB 1MAVA 1M5UA 4H3HB 2PUCA 1D1PA 3CRNA 3OLVA 1U2QA 4G86A 1Z16A 2X7XA 4MS1B 4YV7A 1Z2DA 1GUDA 1LJLA 4EGSA 4ZMRA 5TQ0A 5JNRA 4QPJC 1ZN2A 3FDFA 4G0YA 3HM9A 4MQEB 1ABEA 2QW1A 5JNTA 1U8TA 3P9YA 5TQ2A 2JVIA 4EVSA 5DTEA 3RVNA 1DC7A 2JVKA 1K66A 5JNSA 4IILA 4Z4EA 2WB4A 4S04A 4NCAA 2H0AA 1MVOA 2FXIA 3ILHA 4OTZA 4YCSA 5FWXB 3CFYA 3DLBA 4W5RA 1YK1A 1DC8A 1E6MA 2ID9A 4KK3A 3D02A 3DGEC 4H3KB 2A9QA 3IP7A 3HUUA 3ILYA 4F11A 3TMYA 4S05A 3L6UA 3L49A 2JCGA 1H9CA 5D2CA 1LJUA 3M9XA 2IKSA 2OENG 5JS1A 3CNBA 3N8IA 2VYCA 2YHBA 3F7NA 3NNNA 3LMKA 3MM4A 4RDCA 5HKOA 2FMIA 2FW0A 3GA5A 3EULA 2IPMA 1R8JA 3KKEA 3T38A 5TPZA 1BDJA 3GV0A 3NBMA 4WXMA 2PUFA 3A3KA 2PL9A 1ZH4A 2R25B 8ABPA 3CS3A 3LUCA 1SXIA 4RWEA 1RNLA 3T95A 4KVFA 3R0JA 3KJXA 3URMA 2JVJA 3OLXA 4LDAA 1YK0A 3N0XA 3O1JC 3CZ5A 4LZLA 4KPYA 1APBA 2MYNA 1Z18A 4HNRA 2FLKA 3QK7A 1NXPA 5IEBA 1OXBB 4MGEA 5EWLA 3GBPA 4MQFB 1DP4A 1NXWA 4MAAA 1ISRA 3CG4A 2E4WA 3CZCA 1QO0A 2DRIA 3CU5A 3DGFC 3OO0A 4MS3A 2WJWA 4JASB 4O1HA 5BRAA 3QLUC 1D2AA 1QP0A 4YO7A 2JBAA 4WT7A 3RVQA 5KI6A 4YRZA 2M98A 4EYOA 3LTEA 2E4ZA 2IDMA 2VUHB 1P6UA 2FQWA 5TPZD 2LUOA 4PYRA 3RVLA 2JB9A 3N0WA 5IULC 1YMUA 4GNRA 4N0PA 1GCAA 1ZAYA 1AB6A 5IUJC 4Z4IA 2CD7A 1Z13A 5ABPA 1EFAA 4LRQA 5IC5A 4YLEA 3CHYA 3MYYA 1EAYA 3A0UA 1CEYA 1YS7A 5JNUA 3FFTA 2QV0A 3GWGA 4TLLB 1M5TA 4RK1A 1ZY2A 1C0EA 1SRRA 4KRFA 5CNIA 1P2FA 3I5AA 3QELA 1HEYA 3GBVA 5TQ0B 1C4WA 4XARA 2FEKA 4G0ZA 4KFCA 4IRXA 4RY0A 1ZH2A 5GOTA 1F51E 3C97A 4LE1A 1PHRA 3HDGA 1Z12A 1QMPA 1RXEA 3HDVA 5TQ2B 4WWHA 2HQBA 4MPTA 4YP9A 6CHYA 3ROFA 1E2BA 1E6KA 3HS3A 4RV5A 1S8NA 1PEYA 3LUJA 2HQOA 1JWLA 1BAPA 2GKGA 4MQFA 1RZRA 2PE5A 4H60A 1MIHA 3MMNA 4RKQA 2AYXA 2ID7A 4MR8A 1BVHA 2FN8A 2AYZA 4MS4A 5IBQA 4HNSA 4KQCA 3H5WA 1Z17A 2ZWMA 3QEKA 5HM6A 1XHEA 4Z0NA 1GCGA 3LFTA 1CHNA 4IMJB 1YMVA 3JVIA 3O2JA 4EYQA 4DADA 1KRXA 4P1ZA 3O1IC 1JYEA 4PZ0A 4W5TA 3TD9A 3HCWA 3HSYA 1TMYA 1PNRA 1GUBA 2RGYA 2R4QA 3KLNA 4EVRA 3F73A 3IP5A 1D1QA 3I45A 2IPLA 4G97A 5CNMA 3A0RB 2R47A 5FWYA 4Q7EA 2GWRA 4NV3A 4Z4GA 1A04A 4LX8A 2WMYA 4WZZA 1E6LA 3N0RA 3IP9A 4RSMA 5TQJA 5KC9A 4OLAA 1QPZA 3Q7TA 2PUAA 2GI4A 4FE4A 4JP1A 2LBPA 2QZJA 3B2NA 3DZDA 3KCNA 3QLUA 1EHCA 4L85A 3SM9A 3EAFA 4L4UA 4MLDA 1D4ZA 3OMWA 5BQ3A 3HO1A 2MSWA 5KC8A 2QXYA 1A0OA 1FFWA 2MYPA 3C3MA 3JPWA 1EWVA 4WXEA 2L2QA 4PE5B 1TM2A 1ZHHA 1SD5A 4RY8A 4MR7A 5ED4A 1QP4A 3N53A 1W9HA 4GPAA 3C3KA 3JPYA 5EWLB 2FEWB 4RU1A 1FFGA 3UKJA 2XDYA 3C6QA 1ZDMA 1PEAA 3K9CA 1MB0A 3LUKA 4MS3B 3RVRA 3H5OA 3RVOA 2JBAB 3H1EA 2IPNA 1DBPA 3Q9SA 4G0XA 1MB3A 2CWDA 4Z9AA 5EWMA 2QR3A 3Q15C 3TO5A 1JF8A 3HXMA 3RVMA 4KK4A 1YVUA 4WUTA 1ZVVA 1LK0A 3HEBA 4G0MA 2TMYA 2RJNA 4OATA 3LUAA 5DGCA 1GLGA 4N47A 1QP7A 1NXSA 3HZHA 2RJOA 3O74A 3O21A 3BREA 2WWVD 3QELB 3UUGA 3M6MD 3LOPA 1RPJA 2FKAA 1ISSA 1NATA 1JLKA 4ZMSA 4HNQA 2HSGA 4G0OA 2Q5CA 3H6HA 4QYWA 3GT7A 3E3MA 1SXHA 2LPMA 3EQ2A 4RXUA 2VUIB 1T34A 1EWKA 1NXOA 3BRSA 3Q7SA 4G0QA 1ZGGA 2A9OA 3KYJB 9ABPA 1B00A 2W42A 5DCLA 2HJ9A 3KYIB 1PNTA 4RXTA 3VNAA 2FVYA 4MR8B 2PUDA 1JDNA 4EYGA 5KQMA 5BRJA 4MS4B 2IOYA 3KG2A 2P9HA 1YTUA 3HK2A 5IEJA 3HJFA 1ABFA 3O1HB 3IP6A 1ZITA 3NNDA 3KLOA 3NHMA 4F12A 3RVPA 5FBHA 3BRQA 4JAVC 3JVDA 4N03A 1JFTA 2E4XA 3KSMA 4RK0A 4EYKA 3QLVC 3BILA 5FWYB 4DQDA 4KQ9A 1JFSA 3GL9A 1SXGA 1P8AA 3TX6A 4Y9TA 4B09A 3NNSA 4TN5A 1WETA 3KTOA 1NXTA 3G1WA 1VKRA 3OM0A 4NICA 3UK0A 1NXVA 4W5NA 4ZYLA 2FEPA 4W5OA 1Z2EA 1TVMA 1J56A 5B3JC 1M2FA 2MSLA 3LKBA 2QSJA 2A9RA 4RKRA 1QO0D 2H3HA 4TLMB 2JRLA 5T3YA 1DG9A 2IYNA 4MR7B 2FMFA 5TPWA 3D8UA 2A9PA 4QICA 1JHZA 2QVCA 1QQBA 4NQRA 3H75A 5IX8A 1JFVA 1QKKA 2FMKA 1YIOA 1Z15A 2VK2A 4LE0A 4MRMB 1K68A 4EUKA 2I6FA 2CHEA 1DCKA 3CG0A 1I3CA 1L5ZA 1XHFA 2NT4A 3GYBA 1UDRA 4MLCA 2KYRA 2IPAB 3DBIA 3SAJA 5EWMB 1ZESA 3H5TA 2O20A 3Q7RA 3CKMA 1TLFA 2NZUG 4XLTA 4QYMA 1W25A 4RZSA 3OQOA 3F6CA 4JB0A 4MR9A 4JA2A 2N9UA 4Q6WA 1FFSA 3HUTA 4RS3A 1QQAA 5JNVA 4M88A 4OG2A 1DBQA 5DLEA 3NHZA 3MIZA 2F8TA 4IF4A 4PICA 2WY2D 3SY8A 3KS9A 4MYRA 3SQNA 1LBHA 3OLYA 3CTPA 3I42A 1DZ3A 3EJWA 2NZVG 3LUGA 1RZRD 1LBIA 4RK7A 3VNBA 2MYUA 3H5LA 1IIBA 5GQSA 1FQWA 4G0PA 4LDZA 4YGXB 3H1GA 1USKA 3QEMA 4KMRA 2V0NA 2FMHA 1JDPA 3IPCA 3LUFA 4PEVA 3TB6A 4YR7A 2LIVA 5HQJA 5IUKC 4YS6A 4MRMA 3BBLA 2QU7A 4FE7A 3RVJA 4RY9A 2RDMA 2YHAA 1A2OA 1FSPA 4XAQA 4Z99A 2HQRA 2PUBA 3O75A 5B3JA 4D6XA 4UHKA 5BR1A 5KQLA 2E4VA 1RXIA 1XWWA 4ZPJA 4E7PA 3MQ4A 4JOQA 4Z9BA 2FQYA 3EDCA 1BA2A 3O2QB 1DRKA 5JS2A 1D5WA 3HV2A 2PAFA 3DLHA 2LP4Y 4Q6BA 4XASA 4TMYA 2CHFA 4P98A 2OQRA 3FGZA 5CHYA 2R48A 4F06A 2FTKE 2GX6A 3OMXA 1TJYA 1KMIY 3KHTA 2L19A 1QNLA 4Z4CA 1U04A 2PUGA 1NTRA 5TPWB 5T7BA 3N75A 4NCBA 4RK5A 5E3JA 2FSPA 1ZGZA 7ABPA 4LE2A 2ZAYA 3H1FA 3H5IA 2M1ZA 4OBBA 3H5VA 1VRVA 3JTEA 4D6YA 4O1IA 3K4HA 2FN9A 4RXMA 5EWJA 3C3WA 5KQGA 3HVRA 1DJMA 1CYEA 2MSKA 2L17A 4MS1A 4KV7A 1Y1LA 4IGAA 3RVKA 1Z25A 5I4CA 2PLNA 2B1JA 3IDOA 3W9SA 4MQEA 2NUBA 4ETIA 2PJUA 4MR9B 4EY3A 3JS5A 3FFXA 3QX8A 5F64A 5JNWA 2FLWA 4E7OA 1KGSA 4W5QA 1USGA 3A10A 1VLZA 3LKVA 5FWXA 3OO1A 4D74A 4Z4HA 4RK4A 2HPHA 4FB4A 2P4UA 3FMVA 3OQMA 3EGCA 3I09A 1U2PA 3JY6A 4ML3A 5PNTA 5C5EA 3OQNA 5CNKA 4DN6A 2L18A 5HSGA 3Q41A 3RH0A 4IMIB 3SNKA 3G85A 3LUDA 1JYFA 2B4AA 2QVGA 3QEMB 3QLTA 4ETNA 1VPWA 1YS6A 3T6KA 4O5AA 1BDHA 5TE9A 5KQPA 1AB5A 1DCFA 2E4UA 1DCMA 4HYEA 3EQZA 1NY5A 1NXXA 3ROTA 4YWHA 1OXKB 1L5YA 3H6GA 3RQIA 3OM1A 4F3TA 1EWTA 1Z26A 4ZJPA 3FFWA 1P6QA 3OLZA 3SG0A 3E61A 4KNYA 2WRZA 5DKFA 1F4VA 3N6VA 3T8YA 1URPA 1JH9A 1KRWA 1JBEA 3RVSA 1BDIA 2E4YA 2F8SA 2FQXA 4JB2A 6ABPA 1JL3A 5C5CA 4N76A 4OLBA 4RK6A 4Z4FA 4XFKA 2JK1A 1USIA 3LUHA 3MF4A 3O2SB 4CBVA 3CLKA 4F8JA 5CNJA 5IUNC 5KWSA 4N41A 3IPAA 3MA0A 3QX9A 4KREA 1JX6A 2PUEA 3GRCA 4XXHA 2WJAA 4ETMA 2PMCA 2BGGA 2MYTA 1DRJA 1PUXA 2NT3A 2PL1A 3OLWA 3S99A 4UHJA 2J48A 1U0SY 1M2EA 1DBWA
chains in the Genus database with same CATH superfamily
4ENPA 3M9WA 1EFVA 2IE0A 4TTSA 3U4MA 4XYLA 4OQLA 4FIDA 2EZ4A 5DYYA 3MLBA 4DWWA 2H16A 2HRQA 4M86A 3DAYA 5CVEA 5ILOA 2I8AA 4LAFA 5F2OA 1P72A 1S01A 2JGKA 3OLVA 3VPDA 3SIWA 1C0PA 1Z2DA 5M5BA 1AS3A 1FYFA 2FOXA 5GGYA 3B7PA 1TUGA 4R8MA 2O0MA 5CTJA 5L53A 1DJQA 1Y1RA 3R41A 3A9RA 2IP1A 1S2OA 3B8EA 5BSFA 4AI6A 1WXGA 4LGYA 2EFCB 5JNTA 1U8TA 3PWSA 4XYMA 1XTZA 1BXRA 2E1RA 4NKRA 2VHZA 2XRYA 2ZRIA 1YCDA 1YR2A 4HB2A 3WICA 2AEJA 2JK0A 3Q9UA 4C07A 4CMJA 5JH7A 4S04A 4OX9Y 2OESA 1AS0A 2QGNA 1O4VA 3VVLA 3PUWA 4MO2A 1OX4B 6YASA 1DC8A 4G1CA 1G41A 2CNWA 2VDMB 1UP4A 2XY4A 3T41A 3O47A 4L6AA 2BMFA 4F11A 1DBVO 4QGGA 4YCJA 3WLEA 4DRYA 3OIUA 4MYDA 3SJAA 1ORRA 2NN3C 3NNNA 2XYQA 4AW9A 4DNQA 3AKDA 3I4FA 3JVVA 1BFDA 2J59A 3OOWA 3I83A 4MWCA 3O2NA 4ND7A 3COZA 1CR4A 3ASYA 5G1PA 4IBOA 2NZYA 2PD6A 1B8VA 2JGDA 3T38A 4OQYA 4AJHA 1XN1A 2QRJA 2ZJ8A 5DNDA 1ZJ4A 1NX9A 1P7VA 2AZXA 5F3DA 2IYZA 2GILA 4PR3A 4WOPA 4F4IA 3EMBA 1FQKA 3C7AA 4FGWA 4RTQA 4RL6A 3I5XA 3RAJA 3E2MA 2F9LA 2XOXA 3KEGA 3V8BA 1R0CA 4Y2RA 2SHKA 4JLAA 1BJKA 3NIDB 2ORWA 1VZ2A 5C8VA 1PJCA 2XCRB 3NASA 3QVMA 4D3XA 3BXXA 3ONVA 3EIFA 3EVFA 5A4JA 5CCXA 3W04A 4LV5B 5B36A 2YN0A 1TOAA 1NN3A 4G4SO 2WUGA 1TUBB 1SU7A 3LYAA 3NHLA 4MAAA 3W06A 3THYB 1N0WA 2A0UA 5F1OA 1GM5A 4C7OB 4X1YB 3ZQKA 4GOND 1SBCA 4TXJA 5BRAA 3EDOA 1D2AA 4C6TB 1T4GA 1V41E 4QBHA 2TMDA 2PWZA 3DPSA 4WLNA 5HUJA 2Q0HA 2WD9A 4Q9KA 4HDKA 1LLDA 1IDN1 1XTIA 2YJ3A 1RZVA 5BOVA 5TPZD 5ADVA 3AG6A 4G65A 1E5VA 2J9GA 1U2DA 3VI4B 4MEBA 4B44A 4BRSA 3TR5A 4D46A 3FCYA 3L0IB 4PC3A 4EG4A 10MHA 4KXNA 2W4QA 4FQ7A 4BNYA 3I9V6 4P3YA 3FFTA 1DOAA 3PXBA 4C2UA 2H51A 5CK5A 5ADWA 3HDHA 5H8WA 2Q5JA 3PD1A 2QN8A 2ZYWX 3F4KA 1EJ6A 3QFFA 3AVXA 4U3JA 1QU3A 4PFSA 1BRTA 3D1LA 3K6RA 3NO4A 3HCEA 3AFGA 2OBFA 3IRUA 4R1OA 3AT1A 5TQ0B 1YQUA 3DWGA 4DF3A 1T6ZA 3NGXA 1V95A 1YASA 3HUDA 3M3HA 3H9GA 2PBRA 1U3TA 3NM6B 4R2KA 3C97A 4W1PA 2DFLA 4YONB 5GOTA 3K96A 1P1KA 5IVPA 2O5VA 1QMPA 1VJ5A 4QPZA 2ZIEA 1KI6B 3GQVA 3ROFA 1P9NA 1W85A 2NO5A 3EPJA 4RMJA 4M0PA 3SZLA 4BZPA 4LRWA 3SDZA 1PS9A 1E3MA 5IJ9B 1X7GA 4F5YA 4ECAA 5IXJA 1OLUA 1XLUA 2PMFA 2RKWA 3D2AA 3W2IA 3JASB 2OGWA 3BH7A 3G8DA 4UVDA 2BIFA 1TI7A 3G79A 2VLBA 1F9EA 4AJ1A 1AMOA 2H9AA 2ZWMA 5HM6A 1MT3A 4F1KA 2HJHA 4GOKA 1K75A 1YMVA 5TGDA 3UUWA 3SIRA 4P4LA 3WX0A 3L0DA 1LF0A 2AD1A 3I0MA 3RYHA 2R0QC 1TMYA 3GR6A 4WASA 5BT9A 4D8YA 3ONWA 4F46A 4NBUA 3WLPA 4MW6A 2E6UX 2HBRA 1BXGB 1CW2B 1VZ3A 2YIVX 3KKOA 4WN9A 4Y2XA 4ZAVA 2GWRA 3FPKA 4BAGA 5JI3E 3C1AA 5FA8A 5KWIA 1E0JA 4GVPA 4NZPA 3UGQA 2VNIA 4MQ5A 1GG8A 1T0JB 1GXSA 2HJVA 2G5CA 1RWKA 2IOFA 2QL5A 2WAOA 2PGNA 3LVFO 3OFSA 4L85A 4MYUA 4RIHA 5F78A 5FTNA 4PQEA 1WMFA 1GTG1 2R7MA 1G6Q1 5CYOA 2HF9A 1CG6A 1MABA 2QXYA 2MYPA 1GAWA 3JPWA 4KODA 2VL7A 3FIJA 3QP9A 4RVCA 5LD2C 2C9OA 4RY8A 2YCBA 1AJEA 1Z5NA 4ZYUA 5LJLA 2GN1A 2RH9B 3H04A 5L4NA 4DILA 2LWIA 1OD6A 3BSSA 1BS1A 4GC5A 2GUWA 4JLKA 3SEQA 4LJ6A 5I47A 1NWHA 2VJQA 1PJBA 2RHCA 2XMSA 1I4EB 4D3ZA 4YMLA 4YQEA 2D5BA 4ONEA 4I4TA 5H1YA 3B53X 3T7TA 3H5OA 1DAGA 5C8DA 3KXPA 5ESXA 2WU0A 4UM9B 1LBQA 1YKSA 1LDYA 3BB3A 4Z9AA 1GU1A 3CV3A 2WUVA 5EP1A 2Q6LA 4FN4A 4CODB 3Q15C 1SC3A 1H8ED 4ZVQA 3VOTA 5D7NA 4J2HA 3QPAA 3IKMB 3PEWA 3FPGA 3JQ8B 4PHCA 4P3XA 1SQGA 2BI8A 1H3NA 3K9HA 4HLDA 2V6JA 4E2YA 1T24A 2ZRBA 5I3CA 4WUTA 1AG9A 3HKDB 1D03A 3B7WA 4EY6A 3UMSA 1RXSA 1I33A 2BMDA 2TMYA 2YWRA 3A4TA 3LUAA 4BMNA 1H6BA 3KLPX 2WG0A 1OI2A 3T9EA 3GCWA 3A26A 4NE2A 1YS2X 3O74A 2GDZA 2EGUA 5ALXA 3Q7QA 4LGMA 4MZXA 4D3YA 5JNLA 2ZBFA 5HZGA 4IWYA 1CE8B 5JFTA 1KP2A 4OHPA 5DE3A 3T3MB 2FKAA 2WKQA 3E3NA 3IQDB 1D9ZA 2OBYA 3QYPA 4UHDA 2PPLA 3ABSB 2FFQA 3D8HA 4FMCF 1YTLA 3R4CA 2DM6A 4YO8A 4I08A 1UBLS 3D2BA 3ZU2A 1AVTA 2HLHA 1U8UA 4XPIA 4Z0PA 4DA4A 1Q2XA 2B20A 5J2UB 1ICIA 4BJ6A 2OD2A 4AP9A 4BO3A 2ZVQX 4RY2A 4CLXA 4W9MC 4WKCA 1M34B 1D4FA 2ZI6A 2HJ9A 2AE2A 2OCXA 1RWOA 2FPXA 1ZP6A 1C8VB 2Q5HA 4EYGA 3H8SA 1T15A 4MS4B 5BRJA 3ZD7A 5JY1A 1NV9A 1WO8A 1SY7A 5KVQA 2QUAA 1PQYA 5FPHA 2CFTA 1CUYA 1X9HA 2H57A 3HB1A 1UC9A 3BGWA 4W1RA 4XEUA 2VZEA 5K8VA 5L3SB 2O8EA 3T0FA 2CVOA 3C5CA 3NHMA 2WIDA 5DTJA 4X60A 5IMSA 5IKXA 3M4NA 1THMA 1HE8B 2IYFA 1LV8A 4XVHA 3OHPA 1Z22A 5HKAA 3TDMA 3IQZA 2P6UA 2PSJA 3QLVC 5T6BA 4E12A 3HYCA 3IVRA 2EQAA 2ISSD 2EEZA 2QRGA 2W6JD 4O0LA 3TX6A 2QE7D 1KE2A 1M6YA 3TTUA 3W9YA 2HPAA 2C5HA 2FEPA 3DEFA 3WNDA 2EF0A 4QPDA 4QUIA 3V4ZA 1K6EA 3L77A 3DYVA 4Q1DA 1XJ0A 4HNTA 3C3XA 4IIJF 1NDQA 1NTOA 3QXHA 1S2GA 1Y5RA 1L3BA 5KMGB 5L4SA 2H3HA 3NWJA 2PZFA 2QG4A 4DXHA 3VV3A 1D1SA 4B45A 3F1KA 5HQTA 2A9PA 5BXYA 1JHZA 2F1OA 5JCJD 2GEFA 1S3FA 1QF9A 1A9OA 1R0YA 2CDCA 3VNRA 3CBGA 4BB6A 5J4YA 1UC5B 1EXVA 4IDQA 4BUZA 4PBSA 2C9MA 4UMVA 2P30A 3A05A 3DAPA 3TZKA 1G0NA 2IOFK 2YHIB 3P0HA 4E1AA 4QAQA 1N6KA 2ZYVX 2R8ZA 1JHRA 4ZZ0A 1DBSA 3FCEA 3ZHQA 3QVGB 2XA2A 1V43A 3H5TA 2O20A 3TBFA 1GZ7A 3ZR4B 3VH3A 3V55A 1G21E 2FSHA 3JD2A 4ZQFA 5I9BA 1NVDA 3CPEA 1DX4A 1M75A 4MWSA 3BMOA 2QLMA 4MA0A 2PU5A 2KMLA 3UB3A 1RHKA 2YS6A 4JIGA 3INRA 4BE7B 2PRYA 2Q3JA 1GR1A 1XQ6A 2GN8A 2P9CA 4DC9A 2PLAA 3KALA 1DUSA 2YVQA 3D64A 1GU7A 4QYIA 1JDJA 1M1YB 2GS9A 2H5LA 1POXA 4O2LA 4YRPA 4OSEA 4W4TA 4DV3B 3WJ2A 4ABYA 2JGMA 3U7QA 1Z6ZA 2FMTA 1RABA 1OW3B 2DQYA 6LDHA 2VDRB 2LCFA 3HO6A 3ZLBA 5J43A 4OEHA 2PGOA 3CUTA 5G3YA 3S27A 4UEQA 4FEEA 5IF9A 1Y4ZA 1GPJA 1W36B 1R9GA 4G0NA 4N7RA 2VDWB 1CB7A 3GJQA 3O73A 1EM8A 2IYEA 4JH0A 2VHYA 1RHRA 4P7KA 4CDMA 1B6GA 3DLIA 2EKPA 1FDOA 3K5PA 4ARIA 2V7PA 4W8OA 1MX5A 3KJZA 1H22A 1QO7A 3ELBA 5DNYB 2V7QD 3MAJA 2V9ZA 2CLLB 4P31A 4OL0A 4YP1A 4DCSA 4RY9A 1KJQA 3DVAB 2VTDA 3P9CA 2HMAA 4QC2A 1JJBA 1XZAA 4UOEA 2HQRA 4HEA6 1Q6YA 4GPZA 1PWEA 4HQ0A 4JOSA 3TAXA 3LV8A 1KOGA 4ZD6A 3GHHA 3NIFB 4B3JA 1XVVA 4ZARA 5AM3A 2ZZKA 1WJGA 2Q6TA 2PV7A 3KZMA 3TSAA 3EDCA 1Z4LA 5B1HA 5JZOA 1NMQA 2OCKA 1VMKA 2Q3BA 2QP9X 3W6ZA 1HETA 1YA4A 3KZCA 4NPHA 4P4SB 2AG8A 2OXCA 2RBKA 4WDQA 3AVVA 3L4JA 4XDZA 1AA9A 1O95D 2DHCA 2LP4Y 2WM9B 4RA9A 3DLHA 2O52A 4BEWA 4HOYA 5CRIA 1DL5A 1CQWA 2GD1O 2PRKA 2Z4RA 4R1UA 2NVUB 1AMUA 1E7SA 2ZRAA 2XMRA 4YXWD 1H2HA 1P3JA 5G0TA 1FTNA 1Y6ZA 3OMXA 1KMIY 3ZZUA 2YQ4A 3SGLA 3UFBA 4BGIA 1JSXA 1M67A 4LOJA 1KPGA 4J1TA 4QNMA 4US1R 1VL2A 3B48A 3RGWS 4EMTA 4NK4A 1QGZA 3HWSA 1ZGZA 1CUVA 3L6BA 1WHTB 2ZVJA 4YRFA 1E2JA 1U0BB 4CLRB 4D96A 1MNQA 2HJGA 1ZSVA 1H93A 1TQ4A 3L8HA 2HTFA 4IFBA 2P68A 4MJ7A 2A57A 3O0DA 2CBZA 1EBBA 4L5IA 4LY0A 1UJCA 3AB3A 3K0AA 4OFXA 4RVUA 4YP5A 3O9ZA 5EZQA 3VH4A 3EVZA 1YC5A 3UW3A 4DZRA 2ZM5A 4NYJR 3EA0A 3FDIA 1W35A 2RGNA 3RVKA 1G20A 3DOJA 3RTCA 3LBNA 4NENB 2V55B 3PQ8A 2Y0CA 2R6R1 2Z1NA 2C7RA 1E7MA 5FHQA 5SYMA 2Q4EA 4GOLD 2D5CA 4JP5A 1H2EA 2QQ0A 2YVLA 5AW4A 3OT4A 3F7MA 3NU1A 1W52X 1N2CE 2RC5A 5B6PA 4JIMA 2IUSA 3N2ZB 4PO3X 1D9XA 1Z39A 2PX2A 1JFFA 1GLNA 4Z9XA 4E14A 1Q3KA 2VUTA 4HYQA 1CS4C 1UOQA 1FJ2A 4C2BA 5F51A 2XADA 4LHSA 4ARVA 3EVGA 2X77A 1LSJA 1JFLA 1YR8A 4DLYA 1RW4A 1MCZA 4OHFA 3L9WA 5EEHA 4C6HA 5G02A 2O7SA 1VGQA 3D7NA 4ILEA 1HI9A 4HPXB 3KO8A 4Q05A 3IPLA 1MR3F 1R5BA 1EK5A 1HE2A 2ZETA 3NTVA 4IMIB 1NQWA 4PSKA 4DV2B 1XC7A 2YJ6A 3IELA 1ZOLA 3FMFA 4RA6A 4IG9A 4C29A 1KJZA 2JJ2A 5IZCC 5A03A 3M1YA 2AS0A 1D0SA 1VJGA 2QVYX 5E1DA 5DXFA 4ARZB 2O1SA 2WTBA 4ERXA 4EO7A 4OGFA 2D1TA 1PP4A 2WDZA 2NYAA 3FTEA 3FPEA 2CZCA 2VOEA 4J6EA 2PXAA 5ALJA 4ZGGA 1CJCA 3IR6A 3H6GA 2X7JA 3MCWA 5EGNA 4XR4A 3FSGD 2AFHE 3GJ8A 2YH2A 5THXA 1OFIA 1L4KA 1ISFA 1O5OA 1NOIA 1QGUB 2QOEA 2VT6A 2OC9A 2G1AA 2H4ZA 4G41A 2YASA 4N1AA 5F1YA 5K3SA 4Q9AA 1I3LA 3F6YA 3JYQA 2VG8A 4Q3DA 2PKEA 3U26A 1QE3A 1OY1A 1P7WA 2VQ6A 4LTMA 2D0IA 3LIPA 4PIMA 3LHIA 3TLJA 4NJEA 3NAGA 4P32A 5T4FA 1ZC3A 1LZLA 2ZYDA 2QRLA 2Q8QA 1NKTA 2IV2X 2R44A 5C5CA 4AP6A 4Z5XA 4KR0A 3Q5EA 1JFRA 1X7WB 4G09A 1GJRA 3AUSA 5DTQA 2L82A 1WWKA 1L7XA 1UBNA 3B3GA 3PR3A 3QBVA 5IXSA 2OFWA 3AHIA 5JDCA 2X5XA 1GVHA 4M8KA 3QMWA 3JRXA 2PEYA 5EKTA 3TAHA 2EGHA 2WM3A 2HHCA 3ONFA 5EXTA 1DQSA 1Y9DA 4RZXA 3COPA 1PG2A 3OC6A 1DBWA 1WXHA 4P8RA 2CMKA 5F33A 4GFDA 4I1OA 4W82A 5LN1A 1CJKC 2C84A 2RHLA 4F4HA 3DR5A 3GAZA 2CW5A 2Z5VA 3HUFA 2PUCA 4ILKA 1AKMA 3FWHA 2F3SA 4HLNA 2CFRA 4IJWA 4TYQA 3AU9A 4XIYA 5AIAA 1H2BA 1TF5A 2FW8A 3TXYA 4HMOA 2WFZA 1ZBDA 3HCBA 1U3DA 1WU8A 1IMOA 2IUYA 2QAIA 2Q4BA 2HO4A 3ABRB 3COWA 1I3OA 3HACA 3N59A 3DULA 3ZG6A 1KI7A 3AJEA 4ZOLA 4K87A 2OHOA 2QMEA 4LDQA 5CJPA 1QRTA 3FI9A 4R9RA 3WIBA 4K2HA 1DB3A 1MO4A 4QSMA 2YHSA 1X1EA 3T7RA 2BMWA 1GQOA 3Q0IA 4YASA 1NUSA 1XF1A 1ZEJA 1YBFA 2BGKA 2J46A 2HLDD 5IMBA 4REOA 4G84A 3TIXB 2G6TA 2RH4A 5DXJA 1B3BA 1M2JA 1OAAA 4NZOA 4EF5A 1M1XB 2VDQB 4QOEA 1L5RA 3WBFA 1P1JA 2I5PO 1K92A 2GAAA 2ZIUB 1YKFA 1CETA 3K09A 3NKVA 4TQ9A 1H4QA 3BQMB 1TJNA 3PITA 3DFFA 1XRMA 3DBRA 4PIVA 3AILA 3LT0A 5B1EA 1LI5A 5GWXA 5B53A 1J8FA 4YP6A 4M36A 3VVMA 2HDOA 2VOJA 3LMKA 4I9NA 4HLCA 1TAQA 2IITA 4ZPXA 2Z6VA 5KSYA 1GL3A 1PF7E 4F3CA 2PZMA 4RJLA 2I2XB 3WQBA 1E2PA 5C51B 4NH0A 3Q2IA 4M9ZA 1LW6E 3ZHRA 4GBJA 1FTGA 2F43A 4B73A 4E30A 5DM2A 1YCGA 4HAYA 4C4YA 2O8FA 2PNFA 3EH1A 4RWEA 3AF6A 3RHSA 1CT9A 1FTWA 1BO6A 2X15A 3TKAA 3I64A 1O2DA 3O8BA 3KB2A 3MTGA 2Y93A 1RS0A 4YV1A 3TTTA 1IJKA 2DUNA 3CLTC 4QUGA 4XWYA 3UMFA 2K87A 4JD5A 4MKXA 5EMLA 1MUUA 3I9NA 3HHPA 3LQFA 2P2YA 3CRMA 3CRRA 2JIBA 4R40A 3TWOA 4ARAA 1KHTA 1ULUA 4YJ3A 2JD2A 4NHEA 4WK4B 5IK2A 3S2IA 3FZNA 4DV1B 3CURA 3F0TA 4MUGA 5HX7A 1JKFA 1F2TB 3L8YA 4DB4A 1DXHA 3EIUA 3PD7A 1O97C 4UUNA 1EA7A 3EX7C 3I9LA 3H2KA 1FJXA 1MJHA 5ALZA 4ENQA 4Y7DA 1QV9A 1SU8A 4PYRA 1OJLA 2BTQB 1U7TA 1YMUA 1Z2PX 2BELA 3MBIA 4FUQA 4ZV7A 5AFSA 2NXNA 2B9VA 2AXPA 1GZ3A 2EJVA 3OU7A 2B94A 4LRQA 1KDYA 3E9NA 3OIGA 4D92A 3W79A 4BJHB 2J3IA 1ORVA 1EAYA 3V3KA 1XQWA 2RAUA 3C15C 1Q0QA 1DKMA 3U7GA 2AF3C 2AJTA 5ITZA 4KRFA 1C0EA 5ADHA 1IY8A 1P2FA 5DYNA 4B87A 4CETA 2CXSA 3CVYA 2AFIE 5B3KA 5DF1A 2WHQA 4EENA 1J8YF 1UZUA 4AJOA 2VJAA 4PG4A 4KFCA 4Q1EA 3A58B 1LV7A 1ESMA 1UDXA 3T3HA 4Y2HA 4Y7CA 2JEYA 2XV1A 1RQPA 1RKUA 3A1EA 5K03A 4M7OA 4TYMA 3WRWA 1SC9A 1ZI6A 4EX6A 2SKDA 1MH1A 1W6UA 4KXWA 2RGGA 2ODBA 2RARA 1ZM2A 1AKNA 4G5YA 3HU3A 1NVEA 2WNSA 3AGQA 4KP7A 3NKLA 4OJKA 4JP2A 1B42A 4RKQA 1INLA 1K7CA 2I4LA 4LXXA 4XD7D 3DDZX 2XT9A 8MHTA 5ES4B 1OX5A 4CE6A 1N6NA 5FI0B 5JC1A 2B25A 2VPIA 4TUYF 3GEIA 3NCHA 1P91A 4DEYA 4AKIA 2UUBB 3ND5A 4FDLA 4JT4A 4DLXA 3KTDA 2X3YA 5J5AA 4B1FA 2YWXA 4KWHA 4DADA 4J0FA 3NHBA 4FBGA 1GPMA 1NN0A 1NQAO 2VPXA 4OXNA 2ZVPX 2GXQA 2R4QA 4EZBA 2H4WA 2UYGA 3VUFA 5GONB 4GPBA 1YB6A 1G3IA 1IXKA 1HNNA 2VA8A 4N3NA 3DJFA 4QLAA 4CV1A 1D2RA 5AVYA 3IAS1 2ZU0C 1NYLA 2YV4A 4PAGA 4F2GA 5HM8A 4TZ0A 3Q7TA 3LHFA 4GXQA 1H1LB 4M9UA 5EMMA 3AESB 4HWSA 1EP3B 1SXJD 3P45A 1TVKB 1P5HA 4QREA 2DR0A 4G5OA 3C3YA 2XECA 4NZ9A 4KC0A 4QRDA 4RZQA 4L0DA 4BEVA 1QZZA 2WD8A 4C01A 2IH4A 4TWJA 3MUNA 3BJIC 4HJXA 4GPAA 5WRFA 2REBA 4FYPA 4BECA 4EX7A 1JQJC 3DFMA 3R6TA 1XZIA 1RADA 4IO1A 3SMVA 4D4GA 2ECFA 2XWPA 1NNSA 1RRKA 5G4KB 1LK7A 1I5RA 2HXYA 2BJVA 3GUCA 2WKWA 2QLJA 5AVQA 5C8ZA 4YPVA 3KX2A 5DYGA 4CN8A 1ZGAA 2ZIZA 1ISPA 1W96A 2ZXUA 2HDNB 4RVHA 2CWDA 4FBLA 4TSKA 1JDTA 4PLYA 2VPYA 3D6MA 4CQJA 4J0IA 2XYPA 4XKJA 5IAJA 4FZ5A 1IMJA 5BMOA 3KT3A 4X95A 3BULA 1U80A 3NBUA 3RWOA 3TRKA 1E4YA 1MO5A 4O6VA 4W9NA 5TMDA 3PXUA 4RD0A 1KI8A 2ZUCA 2OO7A 2XH8A 5EKUA 5FULA 5KTTA 4J3JA 1T2UA 1R9NA 4GH5A 4LBZA 1Z62A 3DPIA 4Q1FA 5EIAA 3HZHA 4Y1EA 1KYIA 1J06A 1B6SA 2RD2A 5AH0A 3VU9A 5EG5A 1L4GA 1PV2A 4ZMBA 1E1QA 1H42A 5SZHB 2V3CC 1C30B 1GITA 1H2YA 1V48A 2VH5R 2XUHA 5GJBA 4LX0A 5L45A 1B14A 3P5SA 2ANBA 1XCOA 3BXEA 3USES 5LQAA 2XKAA 1RPJA 1GUYA 1AKQA 3ER9A 3NIGB 3QH4A 1NX6A 2Q5CA 2WR8A 4TTIA 5EMNA 2GFQA 4WXPA 3FR7A 3D1VA 4RZ3A 3VYVA 4ER3A 5KWJA 3T3EA 3ER6A 1ISHA 5LCXA 4UTPA 3ZGZA 1IHPA 1MW8X 2DEUA 1ZK4A 4WJKB 2YVUA 2A9OA 5JQWA 2IXGA 1Y7PA 4HD8A 3K3PA 2JZCA 2FVYA 4RAOA 3SYNA 2Z8YA 4FGKA 4IGKA 4IIXA 3EZ9A 4LRYA 4CTKA 1RJWA 1SMKA 2C1ZA 2D5AA 2Q1TA 3IBSA 3NV9A 3QKIA 5CM2Z 5E2BA 4EL5A 3K70C 3NDIA 3OOHA 4KVGA 4LJSA 4LMBA 1D4OA 1HTTA 3Q40A 4ZZ1A 3FKSA 1D09A 2NACA 3N3BC 5B2ZA 3ZN2A 4ICIA 4PC6A 4YECA 4FXPA 1KS2A 3O8CA 1SIBE 4AB1A 4I8XA 4DCUA 3LT4A 1DKQA 1QYWA 3PNPA 4DNFA 4F8YA 1YULA 1A9XA 1MW9X 2GTHA 3HKEB 4IS3A 4UVIA 4BO0A 5LDHA 1WB9A 4CMEA 2FPGA 3BKWA 2F8MA 1YACA 4WVLA 3RTDA 1EFHA 2GF9A 3TZBA 3UUEA 3JZMA 2O2DA 3HRKA 5JBNA 2B34A 1XMJA 4Q4HA 2PO7A 4DYVA 2H6EA 5AW5A 4Z0HO 3UK0A 5CFPA 4W5NA 3JYPA 1EZ1A 1G60A 1SK9A 2P0AA 2HU5A 2R6DA 1EUQA 1UBGA 1XNHA 3CRQA 3E84A 4I3HA 4TLMB 1M1UA 1Q1GA 1YI1A 2YN4A 3EIXA 3VOSA 2BFEA 2DPXA 5J63A 1SPBS 3IT3A 4QICA 3S2EA 5IJXA 2TYSB 1IY2A 5G0WA 4FYKA 7AT1A 2XXJA 1S8OA 2ZJBA 3UWKA 1M0EA 4DQUA 1DG3A 1NSTA 4EG3A 8LDHA 4XFJA 2C4VA 3TAUA 1S2MA 1QIMA 4FOSA 3VDMA 4OX9B 4DDHA 5F5XA 3AGPA 4YAEA 2HT1A 3AM1A 1KVSA 2R79A 2W2OA 4F5ZA 1CJSA 3R7SA 3Q8MA 2RI0A 3H1AA 2QDKA 3QXXA 4B79A 5CT6A 2KLHA 4DWJA 1SEPA 2JJYA 4JVMA 3HA5A 5MN4A 3EXAA 3G8BA 5T67A 4UHFA 1I1OA 2VDJA 3R9IA 2YN2A 4JENA 4ZVKA 5IRCD 1WKVA 4FGSA 1TFRA 3GP8A 4D81A 5EIHA 5JNVA 1K4KA 4DAEA 2YKGA 4QIHA 2X5KO 2WUDA 2Q8PA 3TL6A 3I8OA 5LQJA 4XB2A 1K5PA 4PICA 1J6UA 5KTRA 1G9TA 3CF4G 3UCXA 3AJAA 3U3JA 2LRHA 1KQPA 2ZR8A 3H97A 5IT9A 1E96A 5FTJA 4Z7OB 2MYUA 2B21A 4XYGA 4KVZA 1OZ0A 3OOSA 1QWOA 3VJLA 4HXYA 4P0PB 3K20A 1RQ2A 5FUQA 3MSCA 1OGJA 5IT5A 1II9A 2P67A 3B2QA 2IZ0A 4RACA 3X1KA 2XTMA 1DTSA 4D57A 2PZ8A 3S55A 3KXLA 3TJRA 4E6EA 3UWSA 4CIXA 4Z53A 4BZWA 2CUNA 5DM4A 1JNYA 4KIGA 4QU9A 4DCGA 1RQRA 1X6VA 2ADOA 3N7UA 2KW5A 3OT1A 4QXQA 2C00A 1TM5E 2GD2A 1X2BA 4L5YA 1RD4A 3U7RA 2W48A 4LWOA 4B33A 2B1RA 4EUFA 1T9DA 3G0OA 5FF9A 4CMKA 1PKEA 3U7EB 4I81A 1K86A 1GPYA 4P5PA 2IVZA 4ZVMA 5LU8A 3BRWA 4NNJA 1Y6JA 3UMBA 1MIOA 3PFBA 1DX9A 2YMPA 1DHTA 4HNHA 2B6NA 3LUBA 3HV2A 5FUYA 4A6XA 2JEOA 4PTZA 3LZDA 2QLNA 3B1XA 2QYOA 1IZ9A 5BVHA 3UB2A 2HGSA 1OVMA 3WR5A 1E3WA 1JA9A 2VFAA 4Y30A 1G291 2ZE8A 1I4OA 1EGAA 2W2KB 3CWCA 3E3OA 3ICPA 1JDBC 1OBCA 2QAGB 1COWD 2OB1A 5JSKA 5BN4A 3AEKA 1ARZA 4LQLA 2DCMA 3SFVA 2X0DA 3AEQA 3C3CA 5CP8A 4A5SA 3FROA 5F2KA 1ZNZA 5HOQA 1CJMA 2AN5A 5E3JA 3ASVA 3WNZA 1CEXA 2ZS8A 3M6AA 4AJIA 1ONBA 2D5LA 3H5VA 1GO2A 1UAYA 3FPHA 3EG9A 3KKLA 1K1EA 2FN9A 1CUSA 2XWQA 5ER6A 3WBBA 4TKLA 4LSWA 3JARB 1RMTA 3ZVLA 2QZPA 1ZICA 2RKBA 4GX0A 1OPRA 3C6MA 3HCCA 3SZ3A 1U02A 2BGTA 3V34A 2IYXA 4BX2A 1Z25A 4IZIA 5JT1A 1RI1A 1Y8QA 3UFXA 3TTYA 5A6VA 1Z6GA 5K3FA 2YY5A 3ZVMA 3PNOA 3ZZTA 3G1TA 3HJUA 2C1EA 2ZWIA 2YUTA 3KJEA 3QHPA 4OO3A 5AP9A 5AYVA 3ZHVA 4ZT4A 3QE4A 1DO2A 1XJQA 2B0CA 1KZYC 4FGJA 3ZW7A 3H1BA 4GR4A 5JS7A 3MUFA 3RSGA 2ZTMA 3LQ4A 1FUIA 4P86A 4C0HA 2QEQA 3W5HA 1TMKA 5B6IA 2XCTB 1E63A 2QUBA 4ZRNA 5KTSA 3ADBA 4WOCA 2IZOA 1UXKA 3QSGA 2EFGA 3PICA 4A8JC 1HDXA 4JEUA 2DLCX 4FI3C 5C8XA 3FYUC 3CLSC 3R6GA 3R3SA 4S24A 3T1VA 4JITA 5CMLA 1NR5A 1CUHA 2E37A 5F76A 1Z82A 5K4GA 1EPUA 2B6HA 4P81A 1YBHA 1ZGCA 2BHNA 3GLIB 2DHQA 3CF0A 2Y68A 1UFQA 1Z0ZA 4LMAA 1MOSA 2ZYSA 2D2XA 4OIFA 3WGHA 3QY0A 4R2HA 3AINA 2YHUA 1P4RA 2FV8A 4HX9A 4DIFA 3K94A 1CFJA 1RU3A 1SC6A 3WIOA 2I4IA 3R5XA 1DAHA 3K1YA 5DGDA 4OU4A 1QIKA 3T5MA 1NU6A 1MKYA 2GLUA 2P2ZA 2Q4OA 4B48A 4CT0A 1QZXA 3PQ5A 1JIUA 2YXPX 4GKBA 4TT3A 1HMYA 4AJLA 4BLOA 4DCPA 2GO7A 5HUHA 1Z26A 2OZEA 4HRAA 3B20A 3N2GB 3SOZA 1Y98A 1SZCA 4QJBA 2BEJA 2ZAOA 3LPAA 3RS8A 3FFWA 5CR9A 3L84A 4ZV9A 1CJUC 4ENVA 3T1TA 2RHJA 3D3WB 2B99A 2WRZA 2P1RA 2H4YA 3DEYX 1EVKA 1DX6A 4O25A 1CY6A 5IFKA 5ILGA 5IAGA 2J9XB 1YVDA 2QG9A 1BDIA 1KRWA 2O0HA 4EW6A 4N0DA 1T4MA 3KOUA 4CMAA 3QG1A 4N76A 2F8SA 3GRFA 1JHUA 3LUHA 2C83A 1Z6PA 3G17A 1SELA 3A1VA 4KREA 4M83A 4AYXA 3QPUA 5BN1A 3PC6A 3U3MA 5LOVA 3GIDA 4YROA 1O8BA 1O08A 4V3BA 1DRJA 3GBSA 5HF9A 2BGGA 1TT5B 5JASA 4ACBA 4NCIA 1N75A 4IV0A 2D1RA 2J7PA 4RH1A 5DTRA 4QPPA 2P77A 2OMKA 3EISA 3G5UA 1YR9A 4U2KA 1DINA 4XA8A 5KSOA 1WG8A 1E4EA 5EWJB 4G5RA 4CQLB 1M1NA 3PLRA 2A1UB 2DY0A 5K0SA 3W6PA 5KDOA 1YB2A 3WHIA 2O8FB 1WPRA 5H9WA 4KGZA 3GVPA 4FEYA 1RHMA 3K1ZA 5JNRA 5I6DA 1JAXA 3PA8A 1PQ4A 1THTA 5C4IA 3CH4B 3K5IA 3NWEA 4FLMA 4C4TA 1LK5A 4EA9A 3UPUA 4W1SA 5AXDA 4H7FA 3S5UA 3HJRA 4GX2A 4E51A 4IDOA 5LFAA 3TECE 4RDXA 4UCQA 1AZTA 5EEGA 1AKVA 3RVNA 4ALNA 2DUJA 3D7SA 4XGIA 3FWKA 1CUWA 1U7OA 1EFUA 4M9RA 3BHNA 4TTQA 4NYMR 3BYZA 2FXIA 2V5VA 1F1BA 3BE6A 3GG2A 5ES3A 3ZDZB 1NPYA 4UUQA 4BVAA 2O2ZA 4KK3A 4R1LA 3OIFA 4H3KB 3RU3A 1BGXT 4YEDA 4AJEA 3M0EA 3EDMA 3IVMA 1KFJB 3L8MA 1DGQA 5JS1A 3ZCRA 3GRRA 3RWBA 3P9SA 4TMFA 1G4HA 3ZVKA 1VB3A 1JEYA 1XAJA 1Z0UA 3G2PA 2IPMA 2Q7OE 4X7PA 1ZS9A 3VJKA 1VI2A 4ZCSA 1XL0A 2N1MA 3CWZA 1GTMA 1FMLA 2QN3A 1NT4A 2AVNA 2JARA 2JIDA 3PGKA 3MJ4A 1GTRA 3K05A 2TSYB 4QDUA 2VQ3A 3KZOA 3VO2A 5KSPA 2DBYA 1KAOA 3T95A 2W5UA 2ODEA 5B7NA 1Q74A 3CF4A 4WN3A 3AOEA 1E3LA 1JWBB 3HMKA 3OLXA 4RVFA 2Z8ZA 5IC6A 3TDNA 5JXHA 3EFOB 4A16A 1YAJA 1XE3A 1Z4JA 2JW5A 3QWHA 4KUEA 4DA6A 3QJGA 2QX8A 1WQ3A 4MGEA 4ZYYA 4RIFA 2ZSJA 3IGFA 4G81A 2JI7A 4NZZA 5AM5A 3NC4A 4GGPA 3CZCA 3LP6A 4C30A 3R0IA 1TAHA 2CLDX 4KAFA 5HMMA 3WI7A 2AJLI 9GPBA 1E1RA 2O8DA 4JC8A 1LPMA 1L4YA 1QS0A 4WT7A 1J2RA 3UT5A 4BKOA 4ZO8A 5LJIA 1ZJ6A 3KKNA 3MJRA 1E8NA 2O8VA 1L3IA 2WTAA 4YJ2A 3TN7A 1NMEA 2HUPA 1NBMD 4MH0R 1US8A 2QL9A 4LDRA 4ZVOA 2ZDHA 1AF4A 1DV1A 3AMVA 4WDRA 3T5PA 3ZI0A 5MHTA 4DZTA 1CY7A 4S1TA 3ND6A 5JVDB 2OWEA 3P9PA 2O2HA 3Q88A 3A0UA 1IM5A 2IY9A 2PYIA 4BO2A 4D5GA 4K46A 3LC2O 2WWGA 5DNCA 3G88A 1ULHA 3GRUA 2C2HA 4BCDA 1OYYA 1SM4A 5CNIA 1AUOA 3MCVA 3W34A 4NBNA 2EZUA 3PC2A 2Z5FA 4U00A 1RYHA 4MW4A 4TTVA 3R74A 4RY0A 1NUAA 3C5HA 1F5NA 1U9JA 4M99A 3C41J 4BAZA 4BVKA 1HNXB 2FQQA 2ZSDA 5LP1A 3ZDAA 1E2BA 3BHJA 2HV8A 2JHFA 3OJ0A 1GR0A 2QQEA 4R9SA 5DFAA 2ATCA 1TEXA 2C31A 5JD4A 3KELA 2CBGA 2EW2A 3HR4A 3VSAA 4F2WA 3WMXA 2IBMA 1RVV1 1UIMA 3GD5A 2R66A 1JIJA 1F0KA 2QPTA 1ZM7A 3O9MA 4JJFA 4B8WA 4UU8A 3U56A 4XZ3A 2QP4A 1AGRA 1IAVA 3E03A 1C2TA 1FXUA 4RKEA 3MJVA 1CS0A 1GCGA 1GPKA 3CONA 3EEQA 3GMIA 5TGTA 4Q4DA 4EEXA 1P81A 4NS1A 1G3RA 3O1IC 4W5TA 1Y0BA 5DASA 3HSYA 2H5EA 4MMZB 5LA6F 4JVSB 4YR9A 4NC9A 1D1QA 3R6LA 1P1BA 4S0XA 5C5DA 3TDKA 2VRBA 1ZUWA 4R1SA 1FNMA 2MSNA 3NORA 4JJKA 4BWYA 1E6LA 5FPPA 1NBAA 4F5EA 1GG2A 1IVSA 3C5VA 4JROA 4ZO7A 3KCNA 3QLUA 4GRAA 4QARA 3OPYI 4A73A 2B7LA 4EPXA 2BCGY 1WR8A 5JTUA 4PNEA 1DAOA 4JK3A 5EZYA 1OAOA 5K0NA 1A0OA 3VKVA 3GLKA 1L5FA 2XMQA 1N2XA 3NI2A 5ED4A 1CRLA 1D7OA 1L7OA 4TV8B 3L5OA 1PWHA 1LVGA 4HS4A 4UHHA 3NM5A 2CBXA 4XD2A 5LIRA 2FEWB 3D6NB 3E2IA 1K8ZB 1TA4A 4ER0A 2JH8A 3FVRA 4W5HA 3FETA 3TD6A 1NW6A 2OXEA 4BGUA 1UBRS 3GMDA 2WU8A 3BIOA 2GTIA 2QROA 4ZAXA 1NW9B 2H85A 5KINB 2JBAB 1FX1A 2J3KA 3H1EA 3L43A 4TMTA 1UFOA 2BKXA 4PCVA 3RIHA 2ATVA 2P4SA 1XCPA 2K4MA 2B8WA 4DMCA 1BWRA 4ND3A 3UAOA 4CMCA 1OILA 2OVBA 3EEBA 5AO9A 4BZZA 1UK6A 2A1TR 4E3ZA 4RTNA 4BB5A 3R5TA 1NFQA 4MICA 4WBNA 1UM9B 3F3YA 3DJYA 4GLJA 3HEMA 1ZJJA 2TMGA 3DQPA 5EIWA 2H3EA 5DGCA 4PFKA 3DO6A 4UQLA 1AV7A 1R2QA 4LS3A 3OEYA 3O21A 1K3UB 1FP7A 5FV7A 3O83A 3V7NA 1I2DA 2PTGA 3BREA 1ZQ9A 3A3PA 3L07A 4D3FA 2QVZX 3B6MA 3CRVA 3FOAA 3INTA 2PCLA 1ECBA 1B16A 1QGAA 1UJMA 1XNJA 2PUVA 3FLMA 3HN2A 2B2XA 4LMRA 4TMWA 1CUXA 4IUDS 4EQZA 1R4NA 5CFMA 2QSYA 2OKGA 5FBQB 3H6HA 2YX1A 3FWPA 5IYZF 4KQFA 5JV5A 1FVHA 2DR3A 3ESRA 2NG1A 2WVHA 3FNBA 3O3MB 2F3QA 2HT6A 2BT4A 3H2BA 4FQ8A 4P7GA 4LZZA 2Q27A 1NXOA 3U44B 1A50B 3DAOA 4NBLA 1G21A 1B00A 4C0WA 2Y1GA 1TKBA 4UULA 4A5OA 1KYYA 1VB5A 2PUDA 4D02A 5IVIA 1E60A 3DOIA 2IOYA 3MQ2A 1P62B 3UJPA 3GGPA 4JLBA 4EH1A 4QGBA 5IEJA 5F77A 2Q1XA 4FDUA 1QGED 5AKLA 2BFDA 4WKBA 2JCXA 4WZAB 1F2VA 4ZYZA 3Q3IA 4X1KB 3G23A 1X92A 3DMNA 2C57A 1G6OA 1SC1A 2W11A 4RKWA 3AR2A 4UHEA 4N3AA 2IYYA 3V42A 1TK2A 2PJZA 4AQYB 2X0JA 3DP9A 5AJUA 3MXOA 5JZSA 1B6RA 5C4GB 3WQQA 4NU5A 3ZIDA 4DG5A 3PCRB 4HQOA 4IV8A 1FLVA 1IY9A 1EINA 3VR4H 1KKMA 3BUSA 3KKKA 4K1XA 1YQXA 5IG2A 1EB8A 3DD1A 4W7IA 5CIQA 1DTWB 2I7CA 3ZYZA 3QKRB 1GL6A 1TVMA 4L8WB 1XQ9A 1SZDA 3I73A 2X0KA 4X41A 3LKBA 3HLTA 1AK1A 2IBSA 2CYCA 5LA6B 3UJHA 2BEVA 2VHJA 4MUYA 3S68A 3EZ6A 4MR7B 3NVDA 1UKZA 4JU9A 1V1MA 1J70A 2WAAA 4EW3A 4WUVA 1L4HA 4Z0TA 5TS3A 3HKBA 2PBFA 3RYIB 1QPGA 2FPOA 4KX5A 1A1VA 1X7YA 1ZI9A 5ALVA 2CJXA 3G2IA 1EA5A 1L5OA 3I9JA 1TMOA 2CLSA 2QVLA 3G6WA 3Q0TA 3VZDA 4DIBA 2WFLA 3L93A 1I5EA 4V0KA 3AL3A 1J20A 1Q3TA 3CA8A 1L5ZA 2FR8C 3GZTB 4JL5A 1HDZA 4KLNA 4PW0A 1MV8A 2X4GA 4QUBA 3MWGA 5K3BA 1SZPA 2XOKD 4IJKA 4PG7A 4S2UA 1U2SA 4CHGA 3EY4A 3STHA 2XZTA 3STXA 2HRDA 3Q7RA 3H8JA 4B4UA 2I6XA 3ZCSA 5ICEA 1AH2A 3C39A 5AHWA 1OBFO 2R8PA 3MZ0A 4RZSA 3OTQA 2G1UA 1JPNA 1BS9A 4HLUC 4GI3A 4Y6SA 1F8XA 1A5TA 1VGVA 1FFSA 2PY6A 2FOLA 4YK7A 1IEQA 1NDUA 4ZK2A 2OQIA 4RS3A 5CH8A 4OG2A 5CAEB 2IV7A 3PTAA 4RQBA 4JJEA 2B4QA 4CKWA 1E9BA 1P9WA 4QFBA 4AFNA 1K7SN 2WY2D 4ZIRA 1MNAA 5ALDA 3CUEF 4MYRA 5K3OA 2XTZA 3G5TA 3RLIA 1LSOA 5HIKA 2O3JA 3WC4A 5K0CA 1O5IA 3SSAA 1P4HA 2V3WA 1N8NA 1PR1A 2GXSA 5JWOA 2BRUC 3OF5A 5K05A 2C58A 2ZIVB 4DMGA 2ZJ4A 4EJSB 1AKEA 1WE2A 3UAWA 4JXKA 1Z6XA 2IHVA 4GOMD 3KEFA 2J3DA 4GLBA 3PE4A 4A3SA 1U9IA 1XN4A 2G88A 4CKEA 4R2LA 3H1PA 5CCBA 2GMWA 5AK0A 3EZLA 2GPTA 2C98A 3C6YA 4LYDA 4R1MA 3TLZA 3UMVA 4L2IA 3SNHA 1PT6A 2QU7A 3TXXA 1QFSA 4OQEA 1N2CA 4MA5A 4FDMA 2RI6A 2VCHA 2YHAA 4RPCA 1IAQA 3O7MA 5AI0A 4YV2A 1BMFD 1B74A 1F8UA 2XE6A 2ECPA 4HTFA 4UHKA 4IOKA 1CQPA 1R10A 2FJPA 1UBJS 5BR1A 4YJHB 5IYZB 3BFPA 3H2ZA 4JKIA 1D3AA 1XWWA 3DMTC 2NSJA 3VR3A 3ZNOA 1QIEA 3QFCA 3IDQA 5DXAA 1GNSA 4R0NA 5JS2A 3OQIB 3NHSA 4BE4A 4F4DA 2C7PA 2QQGA 2OQ2A 1UDBA 3X44A 1JG1A 4ALLA 2MOKA 1KC1A 1G8HA 3N8HA 1VL8A 3KXKA 3G7NA 1EFLA 2GAIA 2YNMA 3B1VA 3QZUA 4TLDA 1JALA 2AQIA 3KUCA 4XASA 1I13A 3PL1A 1KYWA 2XX3A 4O29A 4P98A 3DLAA 3MJFA 3QXGA 4EPTA 2ZFUA 5ELLA 3QEBZ 2PX6A 4G5SA 5SY6A 5F3WB 2IODA 1ZUHA 5CXQA 2D62A 2NSLA 1E99A 3HNOA 4BN5A 3V8PA 4EHFA 7ABPA 3B6EA 4LRXA 1G8MA 5LBUA 2LZ0A 1EK1A 4FYJA 4OBBA 3R7WB 1NJFA 1QG2A 3V4VB 2W0SA 2XCQA 1Q0TA 1YU9A 3GZNA 1HG1A 4RXMA 4F6RB 4FYVA 4M1ZA 5I48A 4L4SA 3N39C 1LDMA 4EY7A 1DJMA 4A0QA 1IATA 2P79A 2QRMA 2XDWA 1E18A 3I92A 3QF4A 4CM9A 4DJDC 4MWZA 1XZ8A 1QOPB 3EH2A 1LTHR 1X8LA 1JB9A 3O8OB 4MS1A 1NP6A 4EKIA 4XGQA 3CW2A 3HNPA 3RG8A 1N2OA 1Z36A 4YIHA 5M04A 4K0RA 1XZDA 4FFBB 2C97A 1IXRC 6Q21A 4IIDA 5HRAA 4OP3A 3W1VA 3P5BA 5H4GA 1G38A 4INPA 3WQHA 3JRWA 2W2LD 4LSGA 2VHCA 1QRAA 2R8OA 3M5WA 4EM6A 5DI3B 4BXOB 1HDCA 2KX7A 3GH1A 3W5IA 3WGMA 4AZ3A 4W5QA 6REQA 4E33A 2XMBA 1UZLA 2IXFA 3EVCA 3LKVA 3AXTA 3EPHA 2UKDA 3BTUA 1I24A 2GVNA 1NVVQ 3AUJB 5A62A 3GLQA 4DV0B 4FB4A 2G25A 4JA0A 3WSVA 2IOQA 4LHZA 1VPTA 2JAXA 4LF9B 3SS7X 1KSHA 3N0VA 4OK3A 2C2ZA 2JCSA 3B6IA 3F5SA 3ASZA 5KTOA 4BC0A 3HB4X 5JTTA 3T3GA 1PUIA 2B4AA 3PDWA 1PWZA 4JXJA 3LPMA 4HK4A 5M3BA 3T6KA 2IVFA 3G2LA 4QDXA 4I6EA 1ZRMA 2R86A 2I76A 4RAQA 3UV7A 3OURA 4J7UA 4ODIA 1Y6GA 2F3TA 4TTAA 2YC2C 3NXKA 4CW7A 4D9MA 2C07A 2FF5A 3FNQA 1SB9A 3PL5A 4V2IA 2G4CA 5I7AA 1GGHA 4FOOA 3UC9A 2ZYGA 2OHGA 1CPYA 3IE2A 5D3QA 2EG9A 2X9VA 1XMVA 5TLSA 4NCHA 4PC1A 4WECA 4LJAA 5EXEA 1I1NA 2ZCVA 4JR1A 5F1PA 1RQGA 2Q1WA 1XZJA 1M73E 1TZBA 2PS3A 3CJRA 1ATIA 1ODSA 5AXAA 4EG0A 4B3GA 3L6OO 3PS9A 1GARA 4AO7A 3SQXA 1X0XA 2FPUA 1JL3A 2HTEA 2I4MA 4GT1A 3KKPA 4RJIA 5HGJA 3SEAA 5JBQA 4Z4FA 4QRIA 3R9KA 4GL4A 1SUFA 5IUNC 2GEUA 5AI8A 1Z83A 4CEHA 3IPAA 3T3OA 1HQCA 3D7RA 3AHDA 2IU4A 3FUCA 3KUDA 2AX3A 4JZYA 4K3UA 2FG5A 3E22B 1CZOA 3ZXUB 4KXVA 2AI3A 3GLUA 1A2KC 3EPRA 3HGQA 2DX7A 2G40A 5EXPA 4RTOA 5K4AA 3VHRA 1ZNXA 2E7ZA 3W2HA 4RSHA 3V4OA 2DVMA 2IF0A 2A1IA 3QHAA 3JZAA 1Y9JA 4TRMA 1TKCA 3UQYS 4EVQA 2HR1A 2HQSA 3GEGA 1KO7A 4NH4A 1KDZA 5HJ7A 1IN5A 2E5FA 1QG4A 1M5UA 2QN6A 4NY1A 2PGJA 1E8DA 2C8LA 2FI1A 4KLZA 1T0IA 4JHXA 2JLZA 4FFLA 3I23A 3H11B 5JMWA 1G2QA 2O1XA 1SXQA 1SA0B 4AP5A 4OB8A 1IN4A 4U0KA 4UFNA 4I0WB 1U9YA 3W8EA 5FI3A 4A8PA 4P35A 1T35A 3Q7IA 4C3UA 3BFVA 3AM5A 3P9YA 4KQ1A 4RX1A 4XM1A 1GZDA 5ALKA 4HXFB 3TPFA 1PFUA 3AIIA 2J0UA 4N49A 4AO8A 3PQ3A 1A9YA 4IILA 5CPBA 5E6SA 1RR6A 4FQ5A 1XEAA 4DA8A 1KDRA 3KL4A 3R6WA 1U8EA 4V0RA 1FK8A 3OEED 4OTZA 3OUUA 2X19A 3CFYA 2Q28A 3BK7A 4XB1A 4LNHA 3JQFC 2GN0A 3NTRA 4KEAA 5HS4A 2WTUA 1N0IA 3BF7A 3DUWA 3AJDA 3IO5A 4LV6A 3IP7A 3WGOA 5FNVF 1U3WA 1FZTA 4Z3KA 4N6OA 1BHJA 1JB1A 1P29A 5IAKA 4A4DA 4MA4A 5EHQA 2VH2A 2JKVA 5KAMA 5HKKA 1ZAYA 1OZHA 1GDHA 2AFIA 4FZVA 1JZSA 1DUVG 3TLBA 1YE3A 1F6BA 3SXJA 1KEEA 1X86B 5LUBA 2FVXA 1MOPA 4G24A 5H7XA 1Y4DE 4B4KA 3SEFA 1QTNA 2IUEA 3CLRD 4DLWA 5JBIA 1M6HA 4QVKA 1DDIA 4TKUA 2I78A 1U94A 1M6VB 1HZZA 2VKQA 3MJTA 2ZBQA 2P3SA 1OYOA 4GKVA 1D6NA 4J9VA 3FTQA 3CS3A 3A27A 3DBHA 3O0TA 4RSRA 4BQSA 1ZD5A 5J9FA 3WXBA 1BU5A 3R3UA 5EXXA 1EWRA 2Q6IA 1I6KA 1FRFS 3PLNA 1ZXBA 3W3AD 3FPCA 2F9MA 1V5IA 2H2DA 1SCJA 1U8CB 2ZRQA 4TS3A 5ILQA 3AY7A 4A0RA 4F8EA 2VS1A 1W34A 4W99A 2H48A 1PL7A 3WKAA 2ZIAA 1AXRA 3TQQA 4KAJA 2AJDA 3D4OA 4MK4A 3ZVRA 2ZE5A 3F96A 1HURA 3IX7A 2OZLB 4YMSA 3VU8A 1IOZA 1AMNA 3VU1A 1XBTA 1TU0A 1FJHA 1SQSA 3IUNA 4JASB 3VKWA 5HQ3B 5JZVA 2WE8A 5C1PA 4U8GA 4OB7A 4RD3A 3UIEA 3VH2A 5ITVA 1IOLA 2IKQA 2JAWA 2EFEB 4FHFA 4GM4A 5FLXA 3DC7A 4XWKA 4HPJB 2PAAA 1FYEA 3JQGB 4H1UA 4MWOA 4L22A 4YCAA 4DG9A 5HIAA 2G09A 2DTDA 3DE6X 3BMNB 4BMVA 2WIFA 4RCZA 1Q14A 2QMZA 2WA1A 4MGIR 1Z13A 5IXYA 5DM1A 4AS1A 1P5RA 3KQSA 4URUR 4JI2B 1E9EA 5EYPB 4QUEA 1DBRA 2D7JA 4PZPA 1YS7A 2FCRA 4FWIB 3K6JA 2VNJA 3GUZA 1I01A 2L0XA 5E0OA 5GPBA 2QV0A 1U28C 2X2FA 3VHLB 3MWFA 1R3DA 1Y3AA 1THZA 1OIWA 1XTRA 2FZGA 1DIAA 1ZY2A 2VPQA 1JDUA 1PN3A 1SRRA 2B5VA 3GCGA 1L8OA 1SVNA 2VJMB 3F90A 3HM2A 3BGOS 3JQ9C 4WJZA 1U98A 4MI9A 4RQUA 4EELA 2Z8XA 1IUNA 3PX7A 4DCVA 2XJ4A 2ZE6A 3TLXA 5A04A 2ZIXA 4HQ6A 1KH1A 2BGWA 1ID1A 1KZ4A 2V6BA 4UARA 3SZUA 1F51E 1ZM3A 1I80A 3C1TA 3ITDA 3T94A 3MT8A 2PZGA 3TIFA 1ZGJA 1HUQA 2LNDA 4HGRA 4J1QA 4OJYA 2BC9A 2HQBA 3BWXA 5EHNA 3SXUA 2QZ9A 3CEJA 4Y9UA 3SJZA 1RKXA 3OY2A 1BAPA 1VKOA 1W48A 3HWRA 4IIEA 4MQFA 3V8QA 2IDKA 1D8TA 1KJWA 4TS4A 1I2ZA 2O2SA 5FUVA 4B5KA 4C4SA 4EGAA 3RI3A 4D45A 3A3NA 4UTVA 4LUCA 4NEHB 2VK4A 4ISCA 4KQCA 1XU9A 4YRNA 4ZCMA 2K6GA 3U4QB 4JI0B 3VDRA 3RS5A 1XHEA 2QMOA 3WG9A 3H0CA 2E9SA 1I3NA 3HE3A 3HXPA 1BCSA 2HKIA 3CEMA 4IMJB 2IHTA 5G2OA 1OKKA 1VIYA 1W36C 5BWMA 4WRRA 1Y6FA 3I28A 4KX3A 1DRWA 2IDJA 1JKIA 3HCWA 6PFKA 1PNRA 4ALIA 2UXBB 3JQEA 4EVRA 1DVRA 2WKRA 2JA2A 5T4EA 4Y6LA 1TJ4A 4G97A 4J1NA 3WA6A 4OGWA 5I8WA 2GJAA 5KIAA 5FWYA 3P9IA 1SZJG 2ZTLA 1I36A 3I39X 2VPWA 1FLAA 2NQ8A 3R3WA 4II2A 4X93A 4I9HA 4YHBA 1DIRA 1UC8A 1QPZA 1TCBA 2PUAA 4N7JA 1RLJA 3LDGA 3FAKA 4ZCQA 2GF2A 1V16A 4OKIA 4PN7A 2X8LA 1ICEA 2HIAA 1CQJA 1UMDA 1L8XA 5EGSA 3UJNA 1K89A 1XTUA 1YDWA 1Z47A 4ZT3A 1V5EA 2AOUA 5AUQA 1XK7A 2IBTA 3AL2A 1QCCA 1UOEA 4COOA 3DV0A 1ODCA 3N0TA 1U99A 3OQBA 1Q20A 1SD5A 3E3LA 4G1FA 5AOBA 5JJLA 1NOJA 1LX7A 2PK3A 4RU1A 1MOQA 1FDRA 3N9IA 2XNKA 3HA2A 4IQFA 2Y1OA 3ZDXB 1VXRA 4DNPA 2R7AA 3VZCA 1WABA 4JUAA 1L4NA 1ES9A 1WB4A 2GPJA 2X8BA 4H7EA 1M72A 5LZ4A 3BXHA 4UEJA 3TR6A 1MB3A 4I50A 4HAWA 1RE1A 4XRRA 3EWSA 3GPBA 4KRGA 3VC2A 1KAGA 4X6XA 4B7CA 4F7DA 3R9XB 2ECKA 4KQWA 4YUYA 3ELYA 3K4PA 3Q3GE 3HLKA 4CKBB 3HXMA 2TRSB 5EA2A 4AKGA 3EFHA 4LOAA 4EHHA 4D8WA 3KWMA 4P7BA 3VZBA 5GADl 3L01A 4NDAA 1A69A 3HCRA 3B1WA 4E09A 2Q5OA 2FZWA 2WTXA 2X9GA 4OQQA 4TSRA 1J07A 4YCCA 2ZPUA 1HMPA 1ZXXA 1ECPA 3C8ZA 1MENA 2W90A 2V7XA 1E9SA 3CTMA 3CBQA 3QELB 1Q3HA 4IO0A 2DMRA 1YQ9A 4UXIA 4TYPA 4G6ZA 5KKCA 1H2WA 5BSTA 1MQ9A 1J23A 3UK2A 2BR5A 4EAAA 5I7HA 4K9QA 3U1VA 3W7BA 1G3MA 2QTGA 4G0OA 1K6JA 3LKDA 4QYWA 1G8KA 1X80A 2FEMA 3E3MA 5K8JB 1RZ3A 3WLHA 4H31A 5DM60 5BSHA 2QN9A 5DP2A 1LRJA 4INAA 1A9PA 2WHXA 5ECGC 1S9DA 2VUIB 2RHGB 3SYKA 5JQGF 1SKBA 3HI6A 3I58A 1U5BB 2XE4A 3HWWA 4GICA 3QBJA 3WV5A 2XZLA 2UZ1B 1DIHA 2XITA 3BGDA 3WJAA 2CE2X 4MR8B 5T64A 2FNAA 1R18A 3BFXA 1JIVA 3FI0A 3AUUA 2QK4A 4MW5A 1AZLA 1DWPA 2CLCX 3WAGA 4ZN6A 5H68A 1ZOSA 4I99A 5SYNA 5M34A 2HCJB 4V39A 3UT0A 5BORA 2DYKA 5EKSA 4AG6A 2CLOB 2UYHA 2FW7A 3ESXA 4HB3A 4K6OA 2PR2A 3FDXA 2R7NA 3ORQA 2Y6UA 5FBRB 1KTIA 1OYWA 5HJ2A 1ZKDA 5IFLA 1UWLA 2WABA 3K0HA 2XRFA 1JFSA 5DNWA 1UXOA 1K8QA 2BMVA 3K0FB 3A6LA 2ZT6A 2CDNA 3LIIA 1O94D 3LDAA 3OM0A 3SF0A 1H3EA 3L82B 1D6MA 2GESA 3VAZA 3OTIA 5EUMA 2X1LA 3LCCA 4Y2SA 5JMPA 4WTOA 2RJ3A 3BSYA 4JJZA 4PANA 4RD1A 1BYUA 1E7YA 5P21A 1EU1A 2EL9A 5AK6A 1W8DA 2OHHA 2PD4A 4NE7A 2ZDGA 3V1TC 3ZCUA 3UV6A 2K5UA 5IBCA 2V5AA 5H9VA 4K8RB 3WGUA 1T3HA 2WSIA 4X1IB 2BN4A 3PI7A 3CCBA 4IDAA 1JFVA 3FF1A 5DT9A 4F04A 5L7WA 3W9UA 4FWBA 2QSUA 4B0PA 2CHEA 3TZHA 3ZDQA 3KETA 1SG6A 1XHFA 3IOYA 4QXOA 3LHDA 4LYYA 2XQIA 2DBZA 1HFWA 1NJGA 1QAQA 5MDHA 1Z38A 2G80A 2OG1A 4JQSA 4YCBA 2XD4A 1EH5A 1YRHA 1Z5UA 2HX1A 4GGMX 5BW5A 1S2NA 4FHDA 4KUGA 4PQGA 4TYYA 3KQHA 4B6EA 4PN3A 4G4GA 3RBZA 1HYEA 1WNFA 4B2LA 1PJRA 3TB4A 3HCPA 1JU9A 4ED9A 2M6SA 2R1VB 4HN4B 4HR7A 1WMBA 3UAZA 4LOKA 2VTBB 3T99A 5FAXA 3WNCA 4I4TF 1R4ZA 5D1NA 5HZKA 1QBGA 2VTVA 1PHPA 3GGJA 3UG7A 1XEXA 3I42A 5CBKA 3CKYA 4JUDX 3VNUA 2X8JB 2IU3A 3VNBA 1QH8B 3IBGA 1YVEI 5ETJA 4GP6A 3V8VA 4LDZA 1YL7A 3WSWA 2BFFB 2WJZB 2ZRJA 2Y4OA 3V7FA 1T9AA 2V3VA 2AFHB 3WIVA 3QEMA 2AWOA 1TCCA 3IPCA 4MVXA 3QU2A 4YPFA 1ZBQA 2H63A 4AIRA 4MIKA 2OBXA 3OCZA 4GXNA 1FSGA 1TD1A 1KIMA 1GYPA 2BFMA 1XZEA 3GO4A 3QTBA 2WWIA 4OHOA 1L4EA 5NLLA 3T3PB 5L8VA 4MRPA 2ONCA 1QBKC 4RGVA 3TNFA 1E2LA 1FFHA 3JWEA 1S8AA 4XWGA 4KZPA 4NL4H 5B1SA 3L4KA 2BBWA 5I7UA 5KQLA 2VSQA 1U2DC 4PPQA 2E4VA 4K05A 4AF8A 1NRXA 4MUXA 3OOEA 4QQFA 2JBWA 3FFBA 5FO0A 4AXBA 3KTAA 4J0DA 5JQGB 1XPUA 4M0EA 2YWDA 3MJHA 1DC3A 1X1DA 1RM3A 2BFCB 1AKUA 2C20A 4BCCA 2HJRA 1DAPA 4NQZA 1DOZA 1KNQA 1ZIPA 3FN4A 4TWBA 3T1NA 4D3SA 2CHFA 3V9PA 5I45A 2J07A 4Q15A 3B1ZA 2EJCA 2J5BA 4F06A 1ZK0A 1TJYA 2GQ0A 3QI7A 1GVNB 5KVAA 4WV3A 3MCTA 3TUIC 2FXVA 2V9CA 2ZRKA 3QVTA 4RUKA 3V1UA 4U7DA 2EKBA 3EPPA 5CH3A 1MJ5A 1XZMA 3K7EA 4TWZA 4WI1A 5C7LO 3KZXA 1OH7A 4MB2A 2CL5A 3H5IA 3K92A 4LWPA 3ZUPA 3TQHA 2OSBA 4PLHA 2H00A 2Z04A 5SY4A 1E8MA 2Q3LA 3B89A 4Z3DA 3VKFA 3LLSA 1MXFA 1I4TD 5IJAA 4DARA 1W29A 2VP4A 3R0ZA 3PE6A 3WVNA 2GOYA 2WAMA 3MCAA 1Y1LA 1N32B 2ZRGA 3IQWA 2OBMA 1EK0A 2C5GA 2G77B 4W1QA 1Q77A 4F97A 5JROA 3WIDA 4Q3NA 3ZJTA 2R62A 3MPOA 5SV2A 4ETIA 3HDYA 1NI3A 3TH5A 4MR9B 1Q17A 2JAUA 1DAKA 2MIIA 3LDFA 1PZMA 2ZRNA 4CIBA 1I94B 1YS9A 1M0SA 5JNWA 1BG6A 2AI2A 4JYMA 5HILA 1BH6A 2M6KA 1T6NA 4EI8A 4IUYA 3C1OA 4LJKA 4ZICA 1ZOPA 5FWXA 2VAPA 1MVLA 5TJHA 1E92A 1YZKA 3DUFA 3KJNA 5CGZA 1FMJA 1BW9B 3UJBA 5BMVF 2WT9A 2XUJA 1MPXA 5FWAA 3RUCA 3FPJA 2IYWA 1R66A 3K9QO 3GNTA 1FRNA 1BE0A 5KKNB 4V0LA 2R2GA 3LXUX 4ATNA 3HPRA 2I4TA 2ZIFA 2R87A 4MHTA 4RHXA 3EOZA 5ALYA 1UPFA 3PFCA 4NFHA 1E1CA 5FAKA 3JAKA 3AJ9A 1BQ4A 3LWDA 4HX2A 4XB6B 4ND2A 3RAEC 3GFOA 4LPKA 3ZE1B 2ATXA 3B9PA 2PQ0A 4Q0MA 4MDEA 2XHEA 3FLAA 2WP0A 4UBIA 4MDYA 2EWWA 3JWPA 1QGDA 1B8PA 4RD4A 5JCPA 4LG1A 5FA6A 3DL0A 2Z43A 3KPUA 3L41A 3EY9A 1BDBA 1AQIA 1QHGA 1ZD3A 2OV3A 3GGDA 4YJFB 5DU2A 1SC4A 2QNIA 1GGJA 2WHYA 1UK9A 4I4LA 2G08A 2VNAA 4PONA 5KYYB 1WMDA 1R6VA 2P11A 2PL5A 1SBQA 5K2OA 1NA5A 3RVDA 3U0VA 1D2GA 4MVWA 2BGMA 3R5SA 1GQSA 3OJOA 5E1MA 2CXPA 3G2OA 2IELA 2O8CA 4JWTA 4QODA 2OGTA 4GYKA 4R01A 2CE7A 5AMXA 4WERA 4JSYA 3VXKA 4JB2A 4D99A 2A5JA 3ETDA 3IQXA 2ZJ6A 4B85A 5JFGA 1S5PA 1TXGA 1L5LA 2WOJA 1W5AA 3NYQA 3G8AA 2CCKA 1GT91 2HNBA 2RK4A 1REQA 3MA0A 2OILA 1S3SA 1EI9A 3A6FA 4OV6B 1JKJB 3DVSX 3GRCA 3UENA 1TKRA 2H8GA 1WTCA 2FPRA 4IJQA 3FOBA 3DOHA 3N2YA 1F17A 2NT3A 3BX1A 3CT6A 3EQ7A 3OX4A 4FYHA 4IZOA 4MJLA 3D81A 5I7FA 3EHDA 5K0ZA 3AF2A 3U81A 3NEAA 1YJCA 2I67A 3NLLA 1T5BA 3BFKA 4R2MA 4DQLA 1WZCA 1RWXA 2NLOA 3NOXA 5ECYA 3TZ6A 3G8YA 4G86A 3EXIA 8GPBA 1AT1A 2JCYA 2P6NA 4HQLA 4BN4A 3JQCA 3NB0A 5IVKA 5JEDA 3BS4A 3ON5A 3OECA 4WKNA 1EG2A 1RI2A 3LCMA 1GV1A 1KZ6A 1G5RA 3HM9A 3R40A 1WIWA 3V9AA 1DV2A 1JBKA 4G8CA 1I6MA 1YR6A 3HZOA 3ZX5A 1NVKA 1K9VF 1JUDA 1DC7A 2JVKA 3B78A 3X1MA 5KOHB 4D25A 3QBEA 1V71A 1II0A 1CVLA 1HT2E 3EYAA 1FTQA 2NTJA 2VDPB 2A0XA 3I1FA 3MWEB 4PRKA 5E4FA 1VPVA 3IL2A 3GRYA 5KJEA 3TUJC 1Y8RA 1UOOA 2HAEA 1MC4A 3CVOA 5KNCA 2ZB2A 4H6XA 1LLFA 3IAXA 3OSZA 2CUZA 1KAEA 3PZBA 3AEYA 3GVCA 1LDBA 1CUGA 2GCPA 3GLVA 3PQ4A 4J4HA 3KDPA 3ZLUA 2QDXA 2ATEA 2XMGA 2X2EA 3C3DA 4R8SA 4ZCTA 4WZBB 1Z9BA 3FUTA 4D4MA 3KKEA 2AFRA 1NKSA 4XM0A 3WHKA 3R7FA 1RSZA 3WWPA 4CM8A 1G8AA 1UEIA 3OA0A 3EGXA 3OBBA 4QGAA 4DIUA 2ZB4A 2C4MA 2L69A 1I0IA 3CH5A 4QTXA 4EQ6B 1T9KA 5BMVB 4JYZA 3TBKA 1WEKA 1XMXA 4AO6A 1QFXA 4JFRA 3A7EA 4NMHA 4EF4A 1J2EA 1SXIA 4FMDB 3AUKA 3EXHB 5BQXA 1Z6QA 4CFYA 3URMA 3ML1A 4OK5A 4GPD1 2CXNA 3FF4A 3QX3A 2CNBA 1P7CA 5EJ9A 1L8LA 2MYNA 4CGZA 3RRNA 4D9BA 1NXPA 4CKXA 2BE7A 2F3PA 3ACBA 2VSXA 3R3VA 4MQFB 5B30A 2I6SA 5H82A 3PE3A 4E6PA 1N9GB 1QO0A 1FVOA 3QFSA 1RTTA 3T3NA 4MS3A 3X2EA 4UCWA 4AUEA 1FU4A 3OZXA 2Q5FA 1WUHS 4ZT2A 4H27A 1B26A 4CM5A 1YQEA 1Z4QA 4XQEA 3VPFA 5FFNA 5HRUA 4NEQA 1PV1A 4X8LA 4LVNA 3FXAA 4TTRA 3WZLA 3FHJA 1AB6A 2ZI5A 3KCQA 7MDHA 4V38A 5CDYA 4Z4IA 3TZLA 1VHWA 5IC5A 3B1YA 3EGDB 4R54A 2HSEA 1VE6A 3CHYA 4X6LA 1J8DA 3S0JA 2ADFA 3TSOA 4EZIA 1T25A 1KYVA 1V6CA 1YGYA 1BHQ1 4P3PA 1MDBA 3FYHA 3GB9A 1KFBB 3OICA 3UM9A 3IKVA 4IEFB 1D6JA 1KVQA 4PLVA 3I1IA 1OFHA 3IPXA 2ZBGA 3UK6A 4F1JA 4H15A 1KK0A 3GCXA 3FUWA 2H1VA 4XIIA 3UGTA 2JEZA 1G6HA 1GHTA 4TMXA 1MJGA 1LVHA 1L5HA 1YI0A 1UBMS 4PAWA 2QD1A 3A1CA 3EXFB 1JSRA 4XVRA 1DJNA 3HDTA 1ESEA 4U2FA 1VL0A 2DR2A 4M1QA 4HZUA 4BNLA 2A78A 2ZUSA 2ODPA 2NOAA 3SE0A 3F98A 3WMEA 4EI2A 3RU9A 3EZ7A 4OHZA 2W6CX 1GAXA 1V3VA 1CVIA 3CB2A 3EBOA 4H60A 4QEZA 4GDFA 3MMNA 3RD5A 1WUIS 3GJ4A 1TIBA 2BHRA 5HEKA 3WNBA 3OH8A 1T10A 2IQ5A 5MN5A 1FRQA 1JG3A 3CZMA 4BNNA 3BIJA 4XUCA 3OPXA 3R44A 4CUJA 1ND5A 1LU9A 1JHPA 2JJ2D 3M7IA 4J16C 4J8PA 5ALTA 4D0SA 2QUHA 4XGKA 1KRXA 2ZPTX 3FB1A 1X19A 4ZGBA 3IP5A 1XK6A 2CFIA 2DWQA 3BTSA 3U17A 3EB9A 3MD0A 4YYEA 1FPQA 3THXB 2C4UA 4FZ3A 1JHMA 4Y98A 4CT5A 1A04A 2XGMA 5LZ7A 4JXZA 5TQJA 4RSMA 4CM3A 4R9NA 5ALRA 1E3JA 2QZJA 4OJTA 1XHLA 3RJ5A 2RGNC 3OLCX 4FEAA 2I91A 2OG2A 1DAMA 3OMWA 4Y2TA 1X94A 3QLJA 3GLGB 1Q1NA 3GFRA 1YVPA 5IH3A 1S7GA 3SP1A 1AN0A 2X9NA 3FPLA 3AHCA 5DI9A 3AVQA 1ZCBA 3NP7A 2ST1A 4HRYA 5DX0A 2ERXA 1MG5A 2FPIB 3C3KA 1ZC4A 2PUJA 5EJ2A 5I9TA 7ADHA 4M6WB 1RBQA 5E3HA 1DT5A 2QAJA 1YJBA 2PRZA 2D0OB 2PSEA 4QECA 1QU2A 5JRDS 1GPBA 3RVOA 4BJ3A 2XXAA 2DPHA 4J03A 3N8GA 4LK2A 2P9ZA 4RV4A 5C80A 4A0GA 2B1QA 1YHZA 1HOXA 1Q19A 3IIJA 1XPJA 2XF2A 2VP3A 3HVUA 5AICA 3WAKA 1M34E 4R9UC 4A23A 1U8XX 3ZCTA 5AW2A 5BN3A 3T5AA 1P7PA 3AEUB 1ORDA 3HEBA 4NFYA 1WUJS 3K9BA 4OATA 1QB7A 2JD1A 3LUPA 4J6FA 5JD6A 2A7XA 3CXUA 4FUTA 5J4LA 4PSUA 2OMEA 1UZNA 2REQB 3N07A 5U1PA 4E2FA 3C24A 4QXAA 1L5GB 4EPYA 5JZ9A 4BUJA 3MFYA 2NZWA 2YWCA 3ZDBA 1BMQA 3IIMA 4RF3A 4HGPA 1JWAB 1WPGA 1IYZA 1P0FA 4IMPA 5D86A 1WHSB 1R0RE 1G5TA 4NMMA 4I1IA 1RYNA 2Z4SA 1JP7A 1FSZA 2XNHA 3AHEA 1A4RA 5EXDA 1KRHA 1QK5A 2F00A 9ATCA 1EWKA 2JLXA 1QHFA 3F4BA 3U9SA 5LNK1 4EBBA 1SHKA 4GSYA 5FD8A 5ALNA 3OP4A 1GFZA 2FZKA 4BB0A 4ZJZA 2H2FA 3AP2A 1AV6A 3VDNB 3AQIA 3ESDA 4QUHA 2ECOA 4CUZA 1RRFA 1CUAA</