4KK4A

Ywle arginine phosphatase - c7s mutant with phosphorylated active site serine
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
152
structure length
151
Chain Sequence
MDIIFVTGNTCRSPMAEALFKSIAEREGLNVNVRSAGVFASPNGKATPHAVEALFEKHIALNHVSSPLTEELMESADLVLAMTHQHKQIIASQFGRYRDKVFTLKEYVTGSHGDVLDPFGGSIDIYKQTRDELEELLRQLAKQLKKDRRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for recognizing phosphoarginine and evolving residue-specific protein phosphatases in gram-positive bacteria.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase
molecule keywords Low molecular weight protein-tyrosine-phosphatase YwlE
total genus 60
structure length 151
sequence length 152
ec nomenclature ec 3.9.1.2: Protein arginine phosphatase.
pdb deposition date 2013-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4kk4A00
2LPMA 1KGSA 1Z2EA 4PICA 4G0XA 4LE2A 3A10A 5TPZA 4W5NA 8ABPA 5CNIA 1DRKA 4MR9A 3CHYA 3O21A 2R4QA 2KYRA 2QW1A 2PL9A 4EY3A 2PE5A 4B09A 2P4UA 1Y1LA 5TQ2B 4MRMA 4MQFB 1DJMA 2H0AA 1H9CA 5TQ0A 1J56A 3TMYA 1F51E 1D5WA 1BDIA 3O74A 4NV3A 3H5LA 4HNRA 5JNRA 4F11A 3RVMA 4HYEA 4LE1A 2JVKA 5DCLA 5T3YA 1KRXA 4NCBA 4LX8A 3N0WA 5ABPA 4RKQA 5JNSA 2L19A 1DG9A 3Q41A 3H6GA 2GI4A 4L85A 3FFXA 5CNMA 1CYEA 2RJNA 4YGXB 3C97A 4RXTA 3EAFA 2FKAA 4ZMSA 4EVQA 5TPZD 5JS1A 2ID9A 4LZLA 4MLCA 4D6YA 5JNWA 4RK1A 4KV7A 3SQNA 4Q6BA 2IPNA 7ABPA 2FQXA 5JNTA 3OLVA 3N0XA 1IIBA 3UK0A 5F64A 3I45A 3H1FA 3H75A 4ETIA 3FFTA 3GBPA 5CNJA 3JVDA 3OQNA 1EAYA 3IP6A 3FGZA 1W25A 3DLHA 1ZN2A 1L5ZA 3GL9A 1K66A 2JBAA 2FTKE 2HQOA 3GYBA 3HUTA 2QU7A 1QP0A 2PUEA 3QEMA 2PUGA 5KQPA 4RZSA 1Z12A 3JTEA 2PLNA 3GV0A 3Q7TA 4FE7A 3SM9A 3N6VA 2FMKA 1UDRA 4JB2A 1D2AA 3JPYA 3TD9A 4XLTA 3KSMA 1D1QA 4JP1A 3MF4A 5JS2A 4XAQA 4OG2A 1TMYA 3OQOA 5GQSA 1FQWA 1ZAYA 3NNSA 1BDJA 1Z15A 1U8TA 5KQGA 2JB9A 5C5EA 5IULC 2JBAB 1ZH2A 3LUFA 2QXYA 2E4VA 4YS6A 1LBHA 3GA5A 3K4HA 4GPAA 2CHEA 3QK7A 5EWMA 4FE4A 3DZDA 3OLYA 4JOQA 2IOYA 4RK7A 4IMIB 1FFGA 4H3KB 3EULA 5ED4A 4QICA 4RK6A 1Z17A 2X7XA 3E3MA 4EUKA 1EWVA 1ZGZA 4EYKA 4WT7A 4NQRA 4E7OA 2JRLA 4EGSA 5JNVA 2MYNA 1ZY2A 2FQYA 2AYXA 3KKEA 2AYZA 3MA0A 4Z99A 2B4AA 1GCGA 1ABFA 4MS1B 1AB6A 3N53A 1NXWA 2L18A 2FEPA 1L5YA 4RK0A 3IP7A 4JASB 1MAVA 2PMCA 5B3JC 1YIOA 4QPJC 3TO5A 3W9SA 1QMPA 1ZESA 3KYJB 4CBVA 5JNUA 3LUAA 4MR7B 4RK4A 5DKFA 3HVRA 1LK0A 5BRAA 3BBLA 1USIA 3QEMB 1QO0D 1ISSA 4NICA 5CNKA 2JK1A 4IILA 3RQIA 1ZITA 1P2FA 4EYGA 1LJUA 3N8IA 2IPMA 3O1IC 2MYTA 1T34A 3L49A 2PJUA 1ZVVA 1NXSA 3IP9A 3GBVA 4HNSA 2N9UA 1YK1A 3GRCA 4F8JA 4F3TA 1D4ZA 3LUDA 3I09A 1YK0A 3HM9A 4ETNA 4KK4A 1F4VA 4H60A 4N76A 3URMA 1SXGA 3HZHA 1PNRA 3F73A 5GOTA 1QP7A 1DCFA 2PKXA 5BQ3A 4ZYLA 1RZRA 4N0PA 1Z26A 4RU1A 2FMIA 2MSLA 4YCSA 1CEYA 4Z9BA 4G0PA 3LFTA 2NUBA 4MAAA 4WXEA 4F06A 5DTEA 1M2EA 1RNLA 5HQJA 3MYYA 3MM4A 4YV7A 2FLKA 1A0OA 2FN9A 3KCNA 1DBPA 3QX8A 5TPWA 1S8NA 1Z16A 5TQ0B 1JLKA 2JVJA 1C0EA 1DZ3A 3CG0A 4XARA 4Z0NA 1KMIY 3I42A 1LBIA 4QYMA 4EYOA 4Z4EA 3P9YA 3OLXA 1GUDA 1TJYA 1DCKA 1EFAA 1A04A 3E61A 3H5IA 5EWJA 5T7BA 2QSJA 1YS6A 3EQZA 2DRIA 3F6PA 3OM0A 3QEKA 3RVOA 3HV2A 1QP4A 3CU5A 4RY9A 2MSKA 2PL1A 3RVJA 2IDMA 3LUJA 1KRWA 3A0RB 2FW0A 3C6QA 3H1EA 4MS3A 3T38A 1QQBA 3EQ2A 1JWLA 3CTPA 4G0OA 3LOPA 3UKJA 1XHEA 3KLNA 3EDCA 4KZKA 4UHJA 1MVOA 2HPHA 1BA2A 1YVUA 4RDCA 3RVRA 3B2NA 1JFSA 3OO0A 2A9RA 1DBWA 2F8SA 2L2QA 4E7PA 4EYQA 2TMYA 3HEBA 1XHFA 1PNTA 3CFYA 5C5CA 1USGA 4N41A 2W42A 3M9WA 3OLZA 3Q7RA 4RKRA 2WB4A 4P1ZA 2FEWB 2A9QA 3SNKA 5EWLB 3TX6A 1QKKA 1D1PA 3FMVA 4YP9A 2E4YA 1YMVA 3CZCA 1JBEA 3QLVC 1EWTA 4G86A 4IGAA 4OTZA 3HSYA 2LIVA 1P6UA 1Z13A 3D02A 3H5TA 2QVCA 4P98A 4W5TA 4O5AA 3EJWA 3DBIA 3LUHA 2PUBA 5FBHA 5EWMB 3SAJA 4WUTA 4D6XA 4G0YA 4Z4HA 5KQLA 4PE5B 3C3KA 1NTRA 1QNLA 1MIHA 1M5TA 4RWEA 1YTUA 1VKRA 5B3JA 3HJFA 3OMXA 2RJOA 3KLOA 3Q7SA 4IRXA 3BRQA 4RXMA 5IBQA 2E4UA 1Z2DA 4RXUA 2VK2A 4Y9TA 2FLWA 3M6MD 3NHZA 2ID7A 3IP5A 4MR7A 4N0QA 5HM6A 2FSPA 2VYCA 3ROTA 3BRSA 2PUCA 4QYWA 1FFWA 2FXIA 1DRJA 4LDAA 4Q6WA 1NATA 4MR8B 5IX8A 4NCAA 1URPA 3DLBA 3HDGA 1DC8A 4MR8A 1U2QA 4ETMA 4Z4FA 2PUFA 1E6MA 1SXHA 3MIZA 5FWYA 6CHYA 4KMRA 4W5OA 2NZVG 3H5OA 4RY8A 1RXEA 1PUXA 4RV5A 2E4XA 4ML3A 5IEBA 4LE0A 2VUHB 1JH9A 1RXIA 4WXMA 1EWKA 3O2SB 1CHNA 5BRJA 1QO0A 1AB5A 1BVHA 3H6HA 3MMNA 3OM1A 4RK5A 3SY8A 4ZJPA 4YWHA 5IUNC 2RGYA 2HQRA 3HXMA 2HJ9A 3OLWA 1SRRA 1USKA 5IEJA 4DQDA 2ZWMA 4PZ0A 2QVGA 4XXHA 4Z9AA 2BGGA 4Q7EA 1DC7A 2FMHA 4GNRA 1NXTA 3NBMA 5KI6A 2QR3A 3RVQA 3UUGA 1ZDMA 3NNDA 1JFTA 1C4WA 1Z25A 4KK3A 1RPJA 1ABEA 3CRNA 3O1JC 1U2PA 4N03A 4RSMA 4XFKA 1RZRD 3DGEC 3KYIB 2CWDA 4EVSA 4LDZA 4TLMB 4MQFA 3LKBA 1GUBA 2NT3A 3DGFC 1SXIA 4G97A 3KJXA 3HS3A 5TPWB 4MR9B 1MB0A 2R25B 3EGCA 2QZJA 5D2CA 3JVIA 2IKSA 3N0RA 3O75A 3O1HB 1JX6A 5I4CA 5FBKA 1GCAA 2QV0A 4RS3A 3G85A 3QLUC 1PHRA 4KRFA 1JYEA 1JL3A 3KG2A 3IPCA 4N47A 4KNYA 1NXOA 3CKMA 4MS4A 4DN6A 1NY5A 1PEAA 3IDOA 1ZHHA 4TLLB 3NNNA 3RVNA 3SG0A 4KREA 3VNAA 5HSGA 5EWJB 3ILHA 3LUGA 4W5QA 2Q5CA 3QELB 3HDVA 3F6CA 4UHKA 2FQWA 3ROFA 1HEYA 3NHMA 4DADA 1LJLA 3OMWA 3F7NA 9ABPA 5CHYA 1NXPA 3BILA 3BREA 3LKVA 1ZGGA 2JCGA 5HKOA 2E4WA 1TVMA 3IPAA 4S05A 5FWXB 1JHZA 4YR7A 4S04A 4O1HA 3LUCA 3T6KA 2H3HA 2ZAYA 3TB6A 5FWYB 2NZUG 1FFSA 3C3MA 4O1IA 3Q9SA 2CD7A 2IYNA 3KS9A 5IUKC 4HNQA 4Z4IA 2PAFA 1JDPA 2JVIA 2E4ZA 1NXVA 2YHBA 2WJAA 2LUOA 3CLKA 3H5WA 4ZMRA 2WY2D 4MPTA 5KC9A 3T8YA 2I6FA 3RVKA 1B00A 4WZZA 2MYPA 4XASA 4W5RA 1VRVA 2A9OA 5EWLA 2A9PA 2M1ZA 2IPAB 3ILYA 3O2JA 3CG4A 1R8JA 4IF4A 3C3WA 5PNTA 2PUDA 2FVYA 1E6KA 1U0SY 5FWXA 3S99A 3D8UA 2NT4A 3HUUA 4H3HB 4EVRA 2R48A 1TM2A 4YRZA 1SD5A 1P6QA 3HCWA 3L6UA 4WWHA 2O20A 5BR1A 4JA2A 3T95A 1A2OA 5TE9A 1VPWA 2RDMA 4KQCA 1BDHA 2VUIB 1OXBB 4TN5A 4KFCA 1VLZA 4MS3B 1YMUA 4OLBA 1E2BA 5DGCA 2OENG 3QX9A 3H1GA 4G0QA 1WETA 4OLAA 4FB4A 3KTOA 1Z18A 1JFVA 3GT7A 3Q15C 4LRQA 4MLDA 2PUAA 4OBBA 3RVSA 2F8TA 1EHCA 3JY6A 2FEKA 3VNBA 4F12A 2XDYA 5DLEA 3I5AA 3OQMA 2P9HA 3KHTA 2GX6A 1E6LA 4M88A 1BAPA 2OQRA 1K68A 3RVPA 1W9HA 2M98A 1U04A 3LMKA 3FDFA 6ABPA 4IMJB 2GKGA 4OATA 1ZH4A 1PEYA 3JS5A 3N75A 3HO1A 4Z4CA 2WRZA 3K9CA 2CHFA 4MYRA 4ZPJA 3JPWA 5TQ2A 1P8AA 2IPLA 2R47A 3QELA 4KPYA 1M5UA 2YHAA 3RH0A 2HQBA 4RY0A 5TQJA 1DBQA 3A3KA 2MYUA 3H5VA 3CS3A 1QQAA 2V0NA 3QLUA 3RVLA 2LBPA 3QLTA 4JAVC 4PEVA 1APBA 2FMFA 3G1WA 4YLEA 1YS7A 5IUJC 4MS1A 4L4UA 3O2QB 1ISRA 2WJWA 3OO1A 4KQ9A 1FSPA 2GWRA 1GLGA 3HK2A 3A0UA 3LTEA 4YO7A 4MQEB 2WMYA 1NXXA 3LUKA 4TMYA 3EODA 4MQEA 5IC5A 5E3JA 4G0ZA 1QPZA 5KC8A 2L17A 3GWGA 2WWVD 4D74A 1JYFA 1XWWA 3FFWA 2B1JA 2HSGA 4Z4GA 1M2FA 2MSWA 4MRMB 1JDNA 2LP4Y 1I3CA 1JF8A 3R0JA 1DP4A 3CNBA 4KVFA 4PYRA 4MGEA 5KQMA 5KWSA 2FN8A 4MS4B 3M9XA 3CZ5A 1DCMA 1MB3A 2GBPA 4G0MA 3QLVA 3MQ4A 2J48A 4JB0A 1OXKB 1TLFA
chains in the Genus database with same CATH superfamily
4ZOAA 3ONEA 2HSWA 3QFSA 3G79A 1Q5PA 1YKGA 1GPLA 8ABPA 3GGCA 1KR2A 1G2IA 4J91A 3L92A 3H2HA 2KYRA 3N74A 2NU6A 2PL9A 4S1PA 3VC3A 4JI8B 5TQ2B 3KDPA 1E3TA 2FEXA 3U9TA 5JRZA 3SXPA 3D6MA 3NKVA 3H2KA 5JSZB 2LKDA 1PFYA 2QQEA 2EWMA 2ZLBA 3JQAB 3KZNA 1FXWF 1NZJA 4HNRA 4KE6A 3TLMA 4I9FA 2WJIA 2CFCA 3EEBA 1JDUA 3NBAA 2OY0A 3FUXA 5JIBA 2OWEA 1ZPDA 1SUDA 3TFOA 4OKIA 4N4AA 1U8EA 3FTPA 3E05A 2XV1A 4RKQA 1Y7PA 2PH3A 1C7QA 3LECA 3OJ0A 2ZSEA 4N3CA 3RFUA 2HSJA 1PJ4A 2OGWA 1Z22A 4CV3A 2GI4A 3C1TA 2WWGA 4IGFA 3IRUA 4I3GA 2QD5A 4J0FA 4PWYA 4PV7A 4D6YA 2RGBA 2GZHA 1X42A 1I4OA 1ZNQO 3EAQA 5I9NA 3OLVA 1YDHA 3IIEA 1R6AA 2GEBA 3AJRA 2UYOA 3NPAA 3QJ5A 4MRAA 3H1FA 3RS8A 1E9DA 4NPAA 2ZBFA 2AGVA 2YCBA 3H16A 1UFKA 3OX4A 5HCNA 2IYPA 1E96A 4HXEB 4KR2A 2BHLA 2OC4A 3CEJA 4ID3A 3PE6A 3QOYA 3LY9A 3FMIA 3G2QA 1TUGA 5B6IA 2ZM5A 3F4KA 4ERNA 1DLJA 2QE7D 4HPXB 4RQBA 4E5UA 5REQA 4X6XA 5A4KA 3QWBA 1TKCA 1XCOA 4JNCA 3CWZA 2FMKA 3MLAA 1QU2A 1P1HA 4UTPA 1XVLA 3FJ1A 4ZO4A 2X23A 1QS0A 2F9FA 3TD9A 4JVMA 3LLCA 1VLMA 2WSMA 3PVCA 4TTIA 2CLKB 3DKKA 3LV8A 2DTEA 4P0PB 3KKQA 4M36A 2OTCA 3T5AA 2VP2A 1L0BA 4AQYB 2CDBA 1UBKS 2V96A 3COZA 3TH5A 3V7NA 4QPZA 4XQ9A 3JX9A 1YUMA 3CUUA 3KWMA 4OHWA 4I6JA 4RKWA 4ZCIA 3HJFA 2D1RA 3AV3A 1IG3A 2VJDA 3BXZA 2QTAA 1KSGA 4ZAYA 2QIOA 1NDUA 5LB4A 4BNXA 4PFKA 2QAGC 1TCUA 4RCYA 2QQ0A 2HPAA 4IKPA 1I4LD 3NHWA 5IT9A 2XQKA 3IILA 3NT2A 3EULA 4Q18A 1TCBA 4DMRA 3ZWCA 1COWD 3RNLA 5JARA 1LBTA 1IN8A 1A9YA 1G20B 2R79A 3I23A 4L28A 4LMAA 2Q2OA 2O3JA 4IX1A 2R7MA 3PQ2A 3FZEA 4EW2A 1Z07A 2BBSA 4XB6B 3SGLA 2HRDA 4M76B 5AQ1A 1TK2A 2NQ8A 3L04A 2AZDA 3LA6A 4I1YA 4TUYF 5DGXA 4JASB 4Q7QA 3RRXA 2IA5A 3EBOA 2O8FA 1V2GA 4U0JA 4Z3OA 1H1LA 1ZO8A 2QGFA 3GGJA 5F33A 3JRXA 3ROMA 3U3RA 1BQ4A 3B6ZA 5JNUA 4YP6A 3U4MA 4MKXA 1ODSA 2QTLA 3BBLA 4I9GA 3DZBA 1RHJA 2ZAMA 4NICA 1GITA 2G70A 4TX1A 2QUZA 3JAKA 4URYR 3NDJA 4BBAA 3DM9B 2JK1A 3AW8A 4O4LF 4YIHA 1VL2A 1PZGA 1WHSB 4R8VA 3SKYA 4G1CA 3SYLA 3TQFA 1EIZA 2ISSD 3TTVA 3I4CA 2BKEA 1TW2A 1A7AA 3J81A 2ONKA 3DC2A 4OD0A 4JJ7A 4CM6A 3GBVA 4QJ4A 4UTOA 3RTEA 5I9LA 1T8PA 3NV9A 2HLDA 2PT7A 1PAUA 5KOHA 1NLZA 3GFRA 3RLIA 1N2BA 1OT3A 5CLLA 3DT8A 4ZZ3A 4TT3D 2OO5A 5COQA 1E2IA 4ME6A 5GM1A 1A8QA 4FNOA 4GRDA 4LC0A 2INGX 2CGEA 1W76A 4L27A 1IMJA 1C7IA 3ZY4A 4Y1FA 1DCFA 1U0TA 5AVTA 3VBCA 3GGDA 1HH4A 1MPTA 1CIPA 1BE8A 4AZVA 1ZM3A 4EW3A 3ZHTA 3KJQA 4UUMA 2C9YA 2GPWA 2J5XA 5ITSA 1TYBE 5H3CA 1X87A 1E9SA 1RLMA 3DKIA 3G3EA 4MPPA 3PFNA 3LLUA 4PZZA 4ZQEA 2CHVA 3U4DA 3IAEA 2H5LA 2O0KA 4F60A 3FHOA 2X41A 4AX8A 1YO6A 6REQB 1Z9BA 9MHTA 2PUWA 1R10A 1J70A 1Z6TA 2CK3A 5CPBA 5I51A 1GTG1 3CG0A 5TMDA 3FUCA 2X0JA 1AHPA 3AWDA 1BX1A 2AZ4A 5DWVA 5M04A 4TV9F 2A67A 4GOND 3TKAA 3PQ8A 2JAWA 4TYQA 1KOJA 4IUBS 4OHVA 1OFHA 2HD4A 3H5IA 1E0SA 3CZMA 2QEQA 5CLQA 3WSWA 3ZS9A 4Q05A 1QG0A 5EMNA 3GVHA 1JEQB 2R65A 2BHSA 2EYQA 4NMHA 1ORTA 4PSUA 1B7GO 4PN3A 4WLVA 3QI2A 4NLLA 5AXAA 2CVOA 2VRWA 1M2KA 3A4TA 1IPFA 3OCJA 1DO0A 5K8JB 4I5IA 4JJIA 2PV0A 3TAHA 2QM7A 1EVJA 4DNQA 4QBIA 4EGQA 4YV0A 4PF1A 3EZ2A 2J45A 3UNXA 4C7MA 1RC8A 3EFEA 4WK6A 4DIMA 1GUAA 1Z8NA 1WUYA 2CD9A 3QP9A 3PNSA 2W2KB 3OO0A 1T0UA 3LOQA 1IHPA 3A14A 1Y34E 4JU9A 4WKNA 1ZA1A 3P27A 4KXQA 4OIFA 2R1VB 4QULA 3ZG6A 5E2AA 3KB2A 3QHQA 4WIAA 4N41A 3DZIA 1R8SA 3W06A 2CHUA 2WIAA 4TMFA 3WE7A 4CTOA 4EL0A 1YB2A 2X9NA 2QI9F 2EG5A 4NYMQ 1IB6A 2XYGA 1R00A 1UFRA 3OBBA 4GXNA 5AQEA 1D2CA 2R751 2DLDA 4KITB 5IJWA 4QBGB 1I3NA 5EJ2A 3MOIA 3UAOA 3PGJA 5BYKA 4KR3A 3KSUA 3EXG1 4DNFA 3A1NA 3ZNOA 1DBRA 2ZRKA 1ACLA 3E15A 1GVHA 1O0BA 2CNKA 4Y8VA 2BUBA 3LUHA 1U3GA 1YJQA 2JGDA 2Q4TA 1U99A 2QUBA 2OV4A 3K0BA 2RCNA 4IX9A 3WIDA 4AJEA 5JADA 2QL5A 3SR3A 1LNQA 1UQUA 4H7KA 4HFRA 4IRUB 2XQJA 3DTVD 4JEIA 2NXEA 3FLBA 3U7HB 1ZK4A 3KQVA 3TRJA 4EUEA 1J2YA 3O7WA 4BYGA 2VSFA 4X1KB 2VK2A 4H1VA 1G2QA 2FLWA 3M6MD 2XZTA 1M2GA 3DF9A 1KHHA 2YOGA 3A3YA 4NRDA 3NEJA 1OX4B 2VNKA 3ZNNA 1KJNA 4WY5A 2QMZA 4NG4A 3WY9A 2EBHX 4HN9A 4TXJA 1GPMA 1F14A 2Y1OA 2D6FA 2ISQA 621PA 4P7GA 1ZJWA 3PEVA 1VIYA 4Q6WA 4MR8B 4PO1A 1QHYA 5BOSB 2JFQA 3K9WA 2XA1A 1URPA 3VH4A 3IKLA 2QXUA 3FF4A 4GYJA 1ZD4A 1SXHA 1XZJA 4HGOA 3U5ZB 1FW6A 2HJGA 3EC2A 2ZSUA 3LRTA 2Q3CA 5FT9A 2JGJA 2X4GA 4LDQA 1AKQA 1S5PA 1VCHA 2B6HA 2UVQA 4BRWA 1MDBA 2FSHA 1YQUA 1Z0KA 1GGHA 1WO8A 4UU8A 1KJ8A 4QTXA 5BRJA 1SG0A 2OXEA 2Q3JA 4HFJA 3LSYA 1AIPA 3MCUA 3B3JA 3FN4A 3SQMA 3CLUD 3PVZA 4G5RA 3M3DA 3R20A 2YINC 1WS6A 1KKUA 3M4NA 2VQEB 3CZRA 1PLKA 3MLEA 4XPZA 1JMKC 3RM3A 4DIDA 1P2GA 2IYOA 2ECKA 3QPAA 2HJHA 4KYTA 3RKRA 2C88A 4LRXA 3TR0A 3NBXX 2YR0A 4GL2A 1K7YA 1KY3A 1Z62A 2I80A 1PDWA 2XUZA 3KVYA 1IEXA 3KOXA 1F2UB 5DE3A 4HWKA 3PUHA 2QXTA 1IY8A 4Q3KA 4QVIA 4E6PA 5TX7A 5A0VA 1J0DA 2B1RA 3H87A 2EKPA 3BWVA 4LF8B 1UM8A 3LHSA 3BZBA 3R8XA 1RE1A 4N8DA 2OC9A 4QGSA 4EVSA 3HQ4O 4LDZA 2QLLA 4QDKA 1O58A 4B43A 1XN4A 4ACBA 3ANMA 3WXBA 3PRHA 2N0SA 1AN0A 2Z3ZA 1Z0AA 5ECWA 5IFLA 4XWOA 3GDHA 4Q0MA 2XBUA 3HE3A 3T5CA 3TLZA 2HBRA 1KS2A 1V35A 5F2KA 1YQQA 1M8JA 1EEXB 1JX6A 2Y99A 3VTFA 3K4PA 3SJZA 4RS3A 4CM9A 4B6QA 5I5EA 3H86A 3C8DA 3LX6A 4CXMA 1RWXA 3DG9A 4N7RA 1YFKA 4B87A 1ZSVA 3BFXA 2O8VA 4RHXA 4TL6A 1MC1A 2QL7A 4CIVA 1A9XB 1N2CA 1Y8CA 2LCQA 3WHLA 3TUIC 5BMVB 2AJTA 2M6LA 3RTGA 3O8QA 1O7JA 1N8KA 2DSTA 3HDVA 3C7DB 4PGMA 1WDKA 3CLUC 1USVA 3LPMA 4JUDX 5CT8A 1DJOA 1K89A 3I9OA 5LWQA 1RBZA 4I3FA 1ZOLA 2PQ6A 4KQGA 2O8BB 4X3OA 2X7HA 3FROA 9GPBA 3SVLA 1BYUA 3QOXA 4FKZA 4UE6A 4JQSA 1VSBA 2OCXA 3Q9SA 4JC0A 2IYNA 3KS9A 4YWJA 4AAYA 1PU2A 4C4AA 1YB6A 2J0EA 5FQOA 4CN8A 3KQHA 4NMXB 5TEWA 4C04A 5HRAA 5C8YA 2F3TA 4LGCA 3GUYA 4J4HA 4LOIA 4MUMA 4PAQA 5J3JA 3SLKA 1SUBA 1P77A 2IU4A 2VSXA 5BN3B 5E7JA 3RJ5A 1V45E 3BMCA 3JW8A 3JV7A 4OH7A 5AVYA 3DXXA 2FH5B 4HWOA 5EWLA 2NUTA 4Q16A 2BKUA 1IN5A 1NVGA 3DUFA 3R3UA 4P38A 1D2HA 1WY7A 3MWFA 8ADHA 5L8VA 3HCPA 3U1VA 4LVCA 1THTA 1CYDA 1QHHB 2ZIXA 3DDWA 3CCCA 1K08A 4H3HB 1VBNA 1CZUA 2N47A 1P31A 3A4LA 4ITVA 4DMHA 2NU8A 2C5GA 2JGLA 4CCAA 4JA2A 3TXXA 4LOLA 1GRNA 5HR5A 4URUR 2X0FA 3Q0EA 1QHFA 2VPZA 2DB3A 3R9XA 1IVNA 1Z2OX 1L7VC 3JQEA 4QT0A 3RWBA 1L7DA 4FI3F 4KBFA 4ZK6A 1ST2A 2ONCA 2HI0A 3CN9A 2A9KA 2YW9A 3NIBA 1YGPA 3BULA 3T0IA 1DKPA 1F1BA 2GHTA 2OE2A 4MPRA 2C07A 2HEGA 1H23A 4WESA 5GVRA 4BRUA 3MXOA 4L76A 2JA2A 1XZNA 2XMCA 3NBFA 2COUA 3H1GA 1M2WA 4N7BA 4W8HA 5LP6A 4B6EA 3THYA 5FI1B 2JARA 4AROA 1V1RB 2YWBA 2F8TA 2BY4A 1GDDA 2QLMA 2W6IA 2IYFA 4AJOA 4IHJB 3U6BA 1XKQA 1Y3FE 1NBWB 3KAJA 4G56A 1XDSA 2X1VA 3UJNA 3I5AA 4LV5B 3L4BC 1EUCB 2YXPX 4P3OA 1QORA 1Y8QB 2XXBA 2M98A 2P9FA 1CP2A 1NQOA 3I0ZA 1W36C 2RB4A 4GT1A 5B7QA 1IVYA 4GOLD 4G5OA 4P54A 1PJCA 5DNAA 1UWVA 2Z2XA 4JSTA 4P4UA 2O1XA 2UZ3A 4RPKA 4O02B 1D3AA 4CG1A 1H69A 5B4UA 5D3MA 1ECFA 2IODA 4FZ3A 3FVQA 2QW0X 3IUPA 3K9FC 3I73A 1XZAA 1C3VA 2YHAA 4OQFA 2YWDA 3ZGXA 2Y77A 2VCYA 1L1QA 1YACA 3UGQA 3L7CA 1YR3A 2WMOB 5A3JA 2G25A 4JOBA 2ZRCA 5EZYF 2P1DA 2VAVA 2XDQA 4IO0A 3HU5A 2R68A 4YT5A 3RU9A 1QHSA 3G9UA 4EJMA 3ZY2A 5DNDA 3I6QA 3GFSA 1W52X 1X94A 1Q1NA 2WJWA 1XZLA 3A2MA 2X2PA 1L7QA 4W7HA 2HMVA 3TW0A 3A0UA 1L5FA 4W4TA 4WERA 1T9BA 4A5OA 4HV4A 2FX2A 1JZSA 1N7JA 1W0KA 3DF7A 3HLKA 4E4TA 3TGPA 4Q4LA 2V3VA 4BP8A 3PE4A 4RHFA 5A04A 4ENWA 1ZFNA 4U63A 3ZGNA 3DFFA 3T94A 1A5BB 3PC4A 3A8TA 3LIIA 4G25A 4D74A 1BN7A 3ST7A 1JYFA 1XWWA 3C70A 3FFWA 1I2ZA 3B3AA 3FPBA 5JYCA 1TTTA 1DT3A 1OFTA 3LYAA 2BZGA 2PH5A 4IJ5A 3HKEA 4JBYA 5A4JA 6Q21A 2HL6A 3FX2A 4M8NE 4F2DA 1XPOA 5J1SB 2DM6A 3ZDRA 2AX4A 5IRCD 4PYRA 3SK0A 3KSRA 1YBVA 4US1R 1ESCA 2XE6A 4KYVA 1VL6A 3VR6H 2YV1A 1N5KA 3OEYA 4OL9A 3V97A 1VGVA 4YT8A 3N9IA 3VNVA 3AFOA 3KXLA 2B82A 1FLNA 4NXNB 2WWHA 1JQLB 1NONA 1OXKB 3W05A 5AO9A 2XUAA 1T4BA 3AFIA 1J90A 5KNCD 2YMQA 3DWEX 3VPFA 3FTDA 1YFZA 3VR6A 5AHWA 2ZT7A 3O21A 2R4QA 2C2HA 2QW1A 3O84A 3ND6A 4U7GA 3KALA 5I5GA 2P11A 4F86A 3SLGA 5JEEA 1E3SA 2LV8A 3KQPA 3H5LA 1TVKB 3SJUA 4RFSA 4DY4A 3QLEA 3VU3A 3GP8A 3IPXA 4PS1A 1PD0A 4YBZA 3T34A 4RA9A 4NCBA 3AR6A 4G63A 2AZMA 3ON5A 3KOMA 2G1AA 4G9EA 4OHOA 3NM6B 4U2KA 4MEBA 1U7WA 1Z2NX 1DPGA 3WV5A 1IOZA 4JI7B 3PLNA 1T1JA 5C8XA 1GXSB 2EBUA 2HLPA 3WRYA 3R09A 1MAUA 2N1MA 4MUEA 5EE1A 3CVYA 4RTRA 5HRCA 2W0MA 1J07A 4WBSA 1R8XA 3M2TA 1BWSA 3PEWA 4JODA 2ZTSA 1JW9B 3PC7A 5WRFA 4WOCA 1Z7GA 2ACWA 4URWR 3RC8A 3OC0A 2HA5A 4KSYA 5DYWA 4B44A 1RC1A 1W46A 1QX4A 4OXKA 5I7VA 5J4HA 4UMDA 1NBME 3LCJA 4QHYA 1R4MA 2E5LB 1E9BA 1E4EB 4R7ZA 3R9IA 4NCJA 3L77A 1J5PA 2JBAA 2WPNA 4FHZA 4PAOA 3K1TA 2JDIA 3NS7A 1XHLA 3X44A 2GZMA 3E5RA 5CVUA 3GJRA 2V97A 1PT5A 4MRSA 3WL5A 3LIPA 4J03A 2ZZKA 4TWBA 3W6UA 2G7MC 1I2AA 3LCCA 1DVRA 1TU3A 2P4SA 2QSYA 1Z0JA 1TCVA 1HDRA 1UC9A 2A5JA 1G59A 2XWPA 4ZJZA 1G8YA 3DEKA 5GQSA 3M6XA 2REOA 4RL4A 5KO2A 1Q50A 1W1WA 4HRVA 4BNWA 2FX3A 2X8JB 1LD3A 4GLLA 1Z15A 3L8EA 1OH6A 2W5UA 2W6ID 3BZUA 3EPJA 3B1XA 3ZW8A 5JMTA 3F5FA 1P39A 2B2XA 2P6UA 3MFQA 3O82A 4XVRA 1XCPA 3R7NA 3FY4A 5ALJA 4ZAGA 4YB8A 2NUPA 1IZ7A 1UWCA 4RCZA 3RYCA 1A97A 1QGYA 5KS2A 1U0LA 2WA1A 4PZPA 4IH1A 2KQUA 2AEJA 2XHZA 2ZJ2A 1PJBA 1Z17A 4ZAXA 2QVYX 5HE9A 4NBNA 1THMA 4HX9A 2DQSA 3BJZA 1IUNA 1IZ8A 4I8IA 4R2KA 3E9CA 4NSNA 3BC1A 2BHNA 2PLRA 1IM8A 4B40A 1MJGA 1NE7A 2W4MA 3LPAA 1UADA 1ABFA 1WF6A 3N8HA 2V5AA 4MS1B 4PHTA 4U1RA 5FUWA 1ZNYA 1HDIA 2R4UA 3UJCA 3EK2A 4BJ1A 4UM5A 3LBYA 4BKRA 4RW0A 3UAZA 1ZJ6A 4M0LA 2QX7A 2H2AA 4ZVLA 1YIOA 1UKAA 3UMCA 1Z7EA 1VL5A 3AERA 4GP9A 4WEOA 5JI2E 4MYDA 1U4OA 2WNHA 2YFHA 3KQMA 3LUAA 4FGWA 4IJUA 4IQGA 1RYFA 3NJRA 4Y1EA 2XMRA 4CG2A 1Q15A 4H1WA 4P4SB 2D2EA 1BE6A 1PTKA 2Z30A 4RZQA 1SQ6A 1A3CA 1A8UA 1V5IA 1EXDA 1U7OA 4X6YA 4E12A 1ECBA 3WTCA 1U8CB 1EQAA 1T9ZA 4RM2A 4PRZA 1E79A 3K71B 3A3NA 5T4FA 4AMUA 3MCTA 3KB1A 2N9UA 1QV9A 2E6UX 1UT5A 1XU7A 3KU4A 3L40A 2E2WA 4RBNA 1E61A 4JR1A 4LJAA 4YJDA 4ZAVA 3ZKWB 2VPQA 3BHNA 4D9NA 1H5UA 3JTMA 4M1OA 2AOTB 5T67A 6AT1A 5AUQA 3GAFA 4HXYA 4E09A 4CMAA 5IVHA 1D2EA 4D3ZA 2JI4A 1RZRA 3Q72A 4D3XA 1E8NA 4LRSB 3EF1A 3ZHBA 4H7PA 2H2HA 3FCEA 1N2ZA 3FKSA 1IXRC 1WX1A 2WM2A 2X8BA 3BSYA 4MDHA 1PUJA 2ORYA 3G0OA 1E0DA 1YDMA 4W9NA 4EG7A 3K0CC 4MAAA 3DJFA 3RS4A 5B55A 1CUWA 3EQ9A 1V7ZA 3T3PB 2WUEA 3UH1A 1KSFX 4K9SA 2R84A 1LQUA 5HQTA 1M66A 3IVXA 5KVCA 3QWHA 3FRHA 3PL5A 4OHPA 5LBUA 1E8MA 1JUDA 1MJFA 1DTSA 2Q3EA 3AU9A 3GFQA 3W1VA 3THWB 5E0KB 2YOHA 1C0EA 3G6KA 1DZ3A 4MW7A 4K9LA 1DEAA 1XRJA 3CINA 2GERA 5DI3B 1E89A 4E94A 3FOFC 4GWGA 3OCZA 4NKRA 1FNDA 3V4ZA 1E3MA 1FRNA 3OE7D 5CCXA 4HEJA 2QL9A 1YZ3A 1BZYA 1NKTA 2JFHA 5EKXA 3WLQA 3DKPA 3QKTA 1CQJB 4PLYA 5K7SA 3L1UA 1E8DA 1ADBA 5BQOA 4K6MA 2HKIA 3LUJA 4Y1RA 1AHIA 1TAGA 3FA2A 2J0SA 3Q3JB 1NN3A 1NXQA 4D02A 5TGZA 3DDCA 4EB6B 3LW8A 3LBFA 1MUUA 4NH0A 3EQ2A 1ZJ5A 4P4NA 3OLQA 1MOZA 1KFCB 2CZQA 3ACDA 4D3YA 4RKYA 4E5VA 3K9NA 2ST1A 4N8SA 4UHJA 3CISA 4JI1B 1RYHA 4YAGA 2PPVA 1NJGA 2I4LA 2SKEA 1ZZEA 1QCZA 1SVSA 4YRLA 4CLDA 3ZZMA 1BQ3A 1WXQA 2A9RA 1NWHA 2BMDA 1NMZA 1PR0A 3COSA 4NEQA 2PLFA 4X20A 3JATA 1KL7A 3HBNA 5B1EA 2FUG6 5BWMA 4IXDA 1MX9A 1XJQA 5FL7D 5CFZA 3RRFA 1D1SA 4NCXA 5CB6A 5HOEA 3BEDA 4RIIA 5ILOA 1PJSA 5CCEA 4XTRA 4DNOA 5EWLB 1JV2B 2FPGA 3T3NA 3AETB 4YP9A 3T7JA 2O48X 3TCXB 4GSYA 1I2MA 2BFDB 1A96A 3CH4B 3NWOA 3KK0A 5AH0A 5K51A 4IOLA 3FPEA 1SUIA 4M98A 5I3CA 3CX4A 1RWNA 4OXXA 4BO6A 5LLDA 4WVLA 3ZCUA 2Q5QA 3LUPA 3K0HA 2PUBA 4P9NA 2XTMA 2QN7A 4KFSA 2DR2A 3FVWA 3H0KA 1VFNA 1W8DA 1PV2A 3OTHA 2EX4A 5K0GA 1JSZA 1PZEA 1YU6A 4YYZA 4AW9A 1QIJA 4IRXA 4DB2A 3D3QA 4H9GA 3K2QA 4MO9A 1Z6YA 3KXDA 2ID7A 3MCZA 5JJLA 2DLCX 1M6YA 3R0IA 5A5VA 3QWFA 1NG1A 2H31A 4M0FA 4BO2A 4QX6A 1QU3A 1EJBA 3EMBA 3C3EA 3NEAA 4K2HA 5DB4A 5ALUA 4LJKA 4C0WA 3UJ3X 1GKKA 3V42A 1DDIA 1KMMA 3ONFA 5LUAA 1ENZA 5IZ4A 3CVVA 3R4CA 4F92B 1NVVR 3DWIA 3K92A 4ZCPA 4K9RA 2P6RA 3OTIA 1RLOA 1U2QA 1D04A 3FVVA 3E82A 2A4MA 1M6WA 5KIAA 1Q0SA 2IF0A 2ZQZA 3BTUA 4KO3S 2JANA 1WQ3A 4IJKA 5DN6D 3K2IA 3MN1A 1WMEA 2NZVG 4P31A 4C76A 2PZFA 2VKTA 4DQUA 4B4UA 4MHTA 1HOXA 3R3XA 3N58A 4BJHB 1OYWA 4OA8A 4AL4A 4HDMA 3G0HA 3SBDA 3VNQA 1JH9A 1NF2A 2VPYA 2ZI6A 1X92A 4NJEA 1BU8A 2JFPA 4ZT6A 1E6UA 2O8BA 1XMVA 1FFCA 4J0JA 6NULA 2I54A 1KI8A 2RAPA 3ZU2A 3KQLA 3U3XA 4DLPA 1U3FA 1ZMTA 1EGAA 4X63A 4MKHA 2XB4A 4H3VA 4NOMA 3UGKA 5BSRA 1CXZA 3G02A 4LSWA 4OYLA 4RPGA 3I53A 2BGNA 5EE3A 1WPGA 1Y3BE 4ZREA 1EG7A 1FYXA 1G5IA 3AFGA 4M46A 4ENSA 1HPLA 1JT9A 2AWOA 3JAWA 3V00A 1GDTA 3TVTA 1RQXA 2ZUUA 1RP1A 3WWCA 5C8YB 3TOXA 1YFJA 2VHZA 1S1CA 4HNUA 4L02A 3VBEA 4E32A 2G1PA 2CXPA 3WMFA 3NEPX 1EFHA 2WWTA 3PXBA 3RAGA 3TOSA 4BX2A 2VC2B 3AEUB 1GZUA 3KYIB 2HA4A 3NBUA 4S1NA 4HT3B 1V9CA 3F71A 2ORVA 4FFNA 4ZVRA 3REQA 3IP3A 3LKBA 3X3HA 3EARA 5IFKA 1II8A 1FSSA 1US8A 2Q1YA 3HS3A 4IF6A 4LAFA 2PSJA 2MCFA 3OCVA 4LNUA 2XWJI 2EDAA 3DB2A 3A27A 3U2QA 4UE3S 4BS9A 4OQPA 1DEKA 2WWRA 3IBGA 4LXXA 3HU1A 4X44A 5CVCA 5I4CA 5DDIP 1TZCA 3AJ8A 1ITZA 2ZSFA 3G85A 5GVSA 4F4DA 4DNPA 1GGVA 3HZOA 3U17A 1AKYA 4CKWB 2ZSDA 2B25A 1UXJA 3AF0A 1I9GA 2GBIA 3AUKA 3BAZA 3AR2A 2FA9A 2NGRA 1CNMA 4OGKA 3HI4A 5TDHA 5I45A 4FZJA 2WD7A 2VATA 5DLPA 1FP4A 3AB3A 2ZJ0A 4TV9A 2O06A 3S1SA 3PLAE 2CLLB 2ZJ5A 3LWDA 1E18A 1T4GA 2YN4A 5DYYA 5HSGA 4ZTZB 1S4QA 1XKTA 1DC3A 1HK7A 1V95A 3FCAA 3WQQA 3OF5A 2G72A 1ZM2A 3PJEA 3RASA 4TTRA 2GEDA 2PZGA 1B14A 2H2GA 2GM9A 2X1LA 3DVAB 3NH6A 3DNFA 5CHYA 1NQWA 5CURA 1ZC3A 4CT0A 1EUYA 1A95A 4C6TA 5YASA 4UBNA 1Z6AA 4EY8A 2MR5A 2IDZA 3IEIA 2VCEA 3ONDA 4DV1B 1FPMA 3NIFB 2VWHA 4TL7A 2O4CA 4MK4A 2O7QA 3BHJA 2IXDA 4YRTA 1H9BA 2NO5A 3IURA 3QXXA 4LRWA 4HNQA 4PC2A 3E5MA 1DEOA 1GNVA 3EYWA 3MWEA 1NVTA 4UVDA 4Z4IA 1JDPA 5G1PA 5LYJB 2FPOA 3EN0A 2ZRDA 4DIOA 3UVEA 1ESDA 4AP9A 5B1IA 1LRJA 1CHDA 3CB2A 1BHJA 4BNMA 4L0MA 4E2ZA 4HB4A 3U7FB 4MIKA 1X1CA 4W5RA 4K1XA 3MYRA 3TZBA 3VR6D 4N9WA 1MJ5A 3OAAA 4E46A 1KDYA 1WVMA 4JN6B 2UUAB 2BFBA 4FR2A 3UWMA 1BKSB 1ACMA 1PK9A 5HF9A 1LLDA 1XQWA 1U0SY 4R1UA 1WZ2A 2ZBUA 2W2NA 1HZJA 2PVSA 1DI0A 1ZK0A 4J7AA 4KDCA 3ELBA 3RWOA 3TX2A 3H8JA 1JWBB 4M3NA 5BPHA 2VF8A 3M1YA 1MT3A 4LEIA 1EZ1A 5JRJA 2XUGA 3QPWA 3AJ9A 5KINB 1W9MA 2OOKA 4G2TA 5CVTA 4F91B 1E9FA 1H3EA 3LBAA 4P5PA 3ASYA 3II6X 4KQCA 1U90A 4ZYWA 2H4XA 3WNVA 1JQAA 3PU6A 1PTJA 1YMUA 5K0ZA 4P7BA 4EGJA 1XLUA 2VDMB 3QX9A 3P9QA 1H2AS 4LJRA 1G1MA 1QCCA 5LN1A 3CRZA 4XQGA 2WG2A 1Y7TA 2HN9A 1ZRNA 4TGLA 3CRVA 4MYCA 1EB8A 3EH1A 3ZPXA 2OQRA 3OPQA 3IQWA 5AOCA 2BRUA 3LXXA 1E9CA 4QEZA 4NIMA 5C81A 3ZWYA 3GGGA 3F49S 4R1QA 1PEYA 2O0MA 4ZHQB 2Q6OA 5A0TA 2PTGA 4PLWA 3WGUA 1A7JA 2WRZA 3OTOB 4MYRA 3SXJA 1M6VA 2A1UA 5CU7A 4G85A 1TO1E 5A9RA 2ZB8A 3OVMA 2QRMA 5JDIC 2IPLA 3NALA 4FONA 4KPYA 2ZPUA 3A6LA 3ANXA 3D4PA 1SUCA 1HDZA 1UZAA 1X1EA 3DAOA 3HNRA 3C6ZA 5FJJA 1FU8A 2J6BA 5FFNA 1HT3A 2NOAA 4HEQA 3WJ2A 4AM8A 2ABWA 3GX1A 1N8TA 2NV6A 3KKMA 3QLUA 4QQNA 4DKXA 1WF3A 2OSVA 2WBLC 2QTGA 2J59A 3LXUX 2IE0A 1YS7A 1DQNA 4G9GA 5LD2C 9ATCA 2E1RA 3L8FA 1O8BA 4MWOA 3UJ9A 1YBFA 2I4OA 5JG7A 2HMWA 1QYCA 3LQRA 1XPJA 2FETA 3GMDA 3KEQA 1Z7BA 2IY8A 3OJXA 1U8AA 4R3NA 1OFUA 1A76A 4Y67A 1SOUA 3C3JA 3ZDFA 4IIEA 4X1OA 2CF5A 3GGSA 3GRKA 1P0QA 4N82A 1FSZA 1F3OA 3HA7A 1R0KA 4JBIA 4R9SA 3ZXIA 4DY6A 4U8HA 4NMLA 3H5RA 2BEUB 4ZOCA 4Z4GA 1M2FA 1XL0A 1IHYA 3BWCA 3IO5A 4EHNA 3H4IA 4B3HA 2C03A 5KCMA 4CU2A 2YWHA 8OHMA 1O94A 5LQNA 4BQFA 2ODNA 4G07A 4J43A 4GR5A 4TKVA 3AESB 1HTBA 1OXXK 4ARVA 3BL5A 2GZAA 1KWKA 1K9VF 3BJEA 2REQB 1ISGA 1FRZA 1NFFA 3LZDA 2FN8A 1GPKA 4F2GA 3NKLA 4ZGBA 3AKZA 4TZ0A 3VZSA 3GK3A 3QYPA 3QXHA 4K9NA 1J49A 1RM4A 1K4KA 2AFVA 3AHGA 4FYIA 2HK9A 3ITKA 3DL2A 4R68A 1SR8A 2FPMA 1XTUA 1M2HA 2WZDA 4AJJA 2VQDA 2F55A 3COVA 3E7DA 4M8IA 2PD4A 3OPMA 3PNBA 2P30A 4R9VA 5KNDH 2WLTA 1J5XA 4M1WA 1Y1LA 4H35A 4BGUA 3TMYA 1E7QA 1NUPA 3S2GA 2MU1A 3D4NA 4J4BA 2CUNA 2O07A 1OB5A 3LKZA 1UBOS 2GTPA 1I10A 4KXLA 4UEQA 1FMLA 2OO7A 1SVLA 2FFAA 1VCOA 1YMQA 5T3YA 1LKZA 2ZIFA 1AZSC 2PKWA 2DKOA 4OXNA 3ZKAA 7ABPA 3WQSB 5LOVF 2EKZA 2DFKB 4D4HA 5CB8A 5HS4A 4DDTA 1CE8A 1TLTA 3WK8A 2XKKA 2AA3A 3UUWA 3VAZA 1E2FA 2J3KA 2YX1A 2HPZA 4UQOA 1IDOA 5CNMA 3LT1A 5LPNA 4MB6A 4CHTA 3G0DA 2AC7A 3ND9A 4AKIA 3VJKA 3A1DA 4AP5A 4PAWA 4X7MA 4EG8A 3SQNA 2GZ2A 1VYVA 1KKMA 2GPYA 4FDVA 1MABB 5BXYA 4G8DA 1PWHA 5A71A 1XDWA 3H8WA 3JQAD 4AXBA 3AVOA 1ODLA 3K09A 5G3ZA 3WZ2A 4EG0A 3IP6A 1WV0A 3DQZA 1VHDA 4GOJA 4KI7A 5I7OA 1DL5A 2KW5A 1DKQA 1WXHA 4K40A 3TJMA 1A72A 3SE0A 4MRPA 1XCJA 1QP0A 1Z34A 5AI4A 5H9VA 2I2XB 4YRNA 2DUNA 2FOIA 1YDEA 4FGKA 1KGDA 2W98A 3N6VA 2F90A 4WK2B 4KQXA 4YT2A 3A6JA 5J9FA 4YMVA 3AI7A 2ODPA 1TPYA 3H9QA 3P96A 1BOFA 2JI8A 4M83A 2ZUCA 3UV3A 1W73A 1U0HC 4XJSA 1ONOA 3ZU5A 1P80A 2KBEA 4H1HA 1ISMA 4N40A 4RYLA 4FCCA 2WFAA 1XNRB 4BLVA 1LPOA 3OFND 2IEBA 2Q6IA 1SCAA 3TDNA 1ZLXA 2ARKA 2GXSA 2A8YA 2QVBA 3I39X 3FBTA 3ZGYA 3SQWA 3GA0A 2CUTA 3D6AA 3GUHA 1STOA 1G8KA 4ITRC 3TW8B 4GZ3A 4JR0A 5D5PA 3F46A 4L3VA 4UHEA 1RHRA 3G2IA 4DNXA 3TDKA 3N5CA 2Q5FA 4P36A 3P0IA 2JLSA 3GD7A 4P5EA 4PC1A 5B4VA 4TKLA 1N7IA 1ZJYA 2C95A 4G89A 2P9JA 4OV6B 3UWOA 2ORED 3WQHA 2PH1A 2QM8A 1WQ1R 1ORWA 4ISBA 1XZMA 2LCFA 3GG9A 5H83A 1DO8A 3UT5B 3Q6MA 3QE2A 1PG2A 4FCVA 4WOBA 3RT1A 4LNAA 3C5HA 1U5BA 3ESZA 4QPPA 1K6EA 1TE2A 5FBRB 4HAZA 1IN4A 1LS6A 3G7SA 1RJEA 5L3QA 4YJ2A 1IK4A 1NMEA 1X9GA 3ESQA 1ZUIA 2Z8YA 4CM8A 3GDFA 3IBTA 4GLJA 5A6SA 4L2IB 2W2KA 5B53A 4QHTA 5AKXA 3U40A 3W8NA 1L8QA 3HVRA 1XTQA 2HEIA 1XJWA 3N0VA 3RRJA 1IY2A 1NW6A 4H77A 2C2ZA 1KE2A 1KEWA 1XRNA 4Y2PA 1P2FA 3LL7A 2FEOA 2RKWA 4GBED 3MWDA 1QVRA 4CMHA 1MTOA 1JLLA 1XP8A 2AHRA 3PPXA 1EFVA 1B8NA 1NPYA 2PYZA 2QD2A 1VJTA 2ZVQX 3ZH2A 1ZVVA 4RFLA 3GT4A 1YK1A 2ZSHA 1U5AA 5J5VA 4MZDA 1QIGA 1WABA 4RGVA 3RD5A 3VH3A 1W85B 1TEXA 2JFGA 3FNRA 1O94D 2HADA 1IM5A 2BSAA 2I7DA 3FCCA 4GM4A 5DP1A 1P81A 5EESA 3SVTA 1RHMA 2CUKA 2VK8A 2D5IA 4I3HA 3ISVA 1GPYA 1HETA 1KK1A 3I9MA 2CL7X 5FWAA 3S0JA 3QEJA 1RJWA 3MS7A 3GP5A 4OK5A 4X93A 1OVGA 5KMGB 4UZFA 5GIOE 5IM5A 5KYUA 2ZSAA 4QXQA 1TA4A 3KVNA 2H4WA 1GYPA 4V24A 4TUYA 3DL7A 2OBMA 1TF7A 2CJFA 2XRFA 4KE7A 4B5LA 2XZLA 2YNMC 4HDRA 1W44A 1M2EA 3WGJA 3PCRB 4PO3X 3Q8XB 1H3NA 2DKNA 1VG8A 3EZ9A 5A1TA 3JCZA 4L8GA 2XIQA 1IBCA 1V71A 2VDVE 4II3A 5AXDA 5HDBB 1O54A 1J99A 5TQ0B 1M0SA 1Q3TA 1OBFO 3OX2A 3FLAA 3A6GA 4Z0NA 3HJCA 2DTDA 1H4QA 2YNMD 1NPDA 2ZWPA 1RJGA 2VHVA 1UCFA 3HBMA 2IYQA 1T36A 1H22A 4I5FA 1Q44A 2R8RA 3NYQA 4ZWNA 1PV1A 4L8WB 1HQKA 1XVVA 1Z56C 2BE9A 4J0KA 1E20A 4INZA 2CJWB 3PRJA 4DTIA 5K8UA 4BWFB 3PA8A 2OO5C 3MWLA 1EFPB 4PAGA 1E60A 4QIHA 3ZHRA 4BVFA 2PKCA 4M60A 1FNCA 3FRJA 3O3OB 4DWOA 4EF5A 3KR9A 4ARBA 3F3KA 1JH8A 3IEPA 2I99A 2M6SA 3MRTA 1TIBA 4O59O 3RUHA 1YHYA 3B1YA 3TZLA 4GPD1 3VJLA 2O3TA 1P0CA 1D6MA 3KLNA 4Q1VA 4FLEA 3R7WB 1TB4A 3UEOA 4KH0A 2TECE 3L07A 2Q2NA 2ZRJA 1E94E 4HQNA 4L9RA 4GE3A 5D1HA 1W5FA 2N75A 2WU3A 3O92A 4DIEA 4XD2A 4Q48A 4A6XA 4QUEA 4XQEA 1SUAA 1IVSA 3GFGA 4UCXA 2JKZA 4AC9A 1UKZA 4IDNA 4E5DA 3LY5A 1FP4B 1PJAA 2E3JA 1Q1QA 3OLZA 3ZWQA 2J3EA 3R7FA 1SEVA 1U2ZA 2VHWA 3B48A 1G20A 4AMBA 1DGQA 4A15A 1Y4UA 4QUKA 4G4JA 2WU8A 4YQFA 3E7XA 1R6BX 3FFBA 1GLVA 1P75A 1D7AA 1HYQA 1QAQA 3UC9A 2X19A 3FSRA 4ANFA 5EJEA 4O5AA 1XT6A 4R2WA 2ODQA 3L5KA 3ENVA 4EJSA 5KTOA 1I7QB 2B5VA 3ZBQA 1OGJA 4OH1A 3TCNA 3BFJA 3KUXA 3ZI7A 1NTRA 4OFZA 1MIHA 5EZ6B 1K5GA 1YTUA 2F1RA 4KO1S 2RJOA 5AJHA 1NI4A 2RH9B 3B6KA 2VTBB 3RBVA 1FDUA 1MVNA 2EL9A 4B45A 2EJCA 2J3LA 1XXHA 2H2FA 1JG2A 1GLNA 4FSDA 2A4KA 1JGTA 4L16A 1JHPA 5CLGA 5EXPA 3T9BA 5H02A 4A26A 4QL3A 4AMYA 1I51A 5J2TB 2GPNA 5AW7A 1Y80A 2QTBA 2EZUA 2H29A 3EQ6A 2Z56A 2YWCA 2I6GA 2JA1A 2VSOA 4HC4A 4ARZA 2GSWA 2ZJ3A 3I37X 1NATA 2I4MA 4M9UA 5DLQC 4B4DA 5FPKA 5DBEX 2XBLA 4XUEA 3HXOA 4PZCA 4GM1A 3DV0A 4FUTA 2RGUA 2ZIWB 3A1EA 3D0QA 2WIBA 3FFAA 1Z0IA 1QCDA 2VNSA 3OZUA 4FHGA 4KB5A 4ND3A 4XX1A 4ZI7F 1G8GA 4OHUA 4KPUA 4QARA 4XYBA 4KZPA 1BDMA 2QA5A 4X5OA 2BMVA 1BSVA 3ZLBA 3ZIAD 3RYCB 2IHNA 4LOAA 1H85A 2FPPA 1UT6A 4RV5A 4PC7A 3D0OA 4TS3A 3QVTA 1QYDA 4M1KA 4N3GA 4MKFA 1E62A 3BORA 3K70B 3TSZA 1F8XA 4QA9A 1UKBA 1USUA 3O2SB 3TM4A 5FOQA 3QKUA 1CUVA 2Q45A 2A78A 1LVGA 2G5TA 3GLTA 3R24A 2ZTVA 4KMOA 5NULA 1WZCA 2FK7A 1SIOA 1USWA 4UUQA 1MX5A 4TVBA 1RJ9A 2CT8A 2HA7A 3CF4G 1WZNA 3KR1A 3IAUA 4WN9A 4ZRMA 4DC1A 1PKXA 4UPDA 4IQ8A 2XOKD 1P7YA 2X8LA 5DNVA 3NP7A 3RS7A 1Z74A 3A1TA 1OH5A 1W88B 2EJVA 2ZRBA 3F9CA 1RZVA 3K5WA 5CITA 1DWUA 1YTLA 4PGGA 2EIHA 1M1XB 3OLCX 4INPA 4K88A 1U0BB 3E27A 4RORA 5IKEA 2VP9A 3U60B 4N03A 1GVNB 1P8JA 1YA4A 3MAAC 3PDCA 1C30B 3JQ8B 2RJ3A 1ZNZA 2C9OA 4O08A 2O7SA 4FHEA 3GFBA 3CONA 2WIFA 4U2EA 1AS3A 1JSLA 4CLEA 2YUIA 1M6VB 2A1UB 1Y3CE 1TJ4A 2H5IA 1CDEA 1ND5A 2GRAA 4IAOA 2OXFA 1I1NA 4UNQA 4AMGA 1EDBA 5JPCA 1ZL2A 3FR7A 4J3NA 3O8OB 3TQQA 3QPDA 2OSBA 4Y2VA 2J9YB 2VPTA 4KRFA 4CKBB 3GJ7A 5KWSA 4BEJA 3MIIA 2DZDA 2CLHB 3Q6IA 1UBGA 1UFQA 4BATA 3PUKA 4DF3A 4UTZA 1UDAA 1T15A 3T12A 2G9VA 4CL8A 4DN6A 4EBFA 5KTNA 3P19A 3RS5A 2RD2A 3ZDAA 1TM1E 3PUVA 4DLNA 1E6WA 3R9WA 1E5VA 1D2NA 4X61A 4BKOA 3DBOB 3RO7A 2HMYB 2X3FA 3CT6A 3MERA 1N4AA 2BEVB 2C4KA 4PQEA 5GM2A 3ZV6A 4B4VA 5JXHA 2JCBA 4L8VA 4ZOBA 3KZVA 5EP2A 1C7JA 1E3WB 4KE9A 1SC3A 4JYAB 4E2YA 4MGKR 1WLSA 2RIPA 3V2UA 2ZAYA 2X58A 1U11A 3A31A 3MNFA 5DOZA 4UQLA 4W6QA 4BIMA 2ZJBA 5F35A 3AILA 4YONB 5IUKC 2XNCA 5IJZA 4C0SA 1GO2A 3LQ2A 2V4MA 4QLAA 4ZXFA 4BWGA 1NLMA 1GTL1 3W6ZA 4HAYA 3RIHA 1KYXA 2IL1A 3CJTA 3W7BA 1KY5A 1NXVA 3FCOA 5BV7A 1T6NA 2VDJA 1F2TA 1I0ZA 2W6JA 4LOKA 5LB2A 4M8KA 4RACA 2CFOA 1XMOB 4UNSA 1VMEA 1SIUA 2MYPA 4JXXA 1C3OA 3A28A 2G9QA 3QKRB 2Z5FA 3CJQA 1NIPA 4WXYB 1DKLA 5LQKA 1CDDA 1H5NA 4UD6A 2J6CA 3VHXA 3PSAA 3IUYA 4XCQA 1U2GA 2EZ9A 2BCJQ 2R00C 4LTMA 4PR3A 5E95A 3T5TA 3V4OA 3FGNA 5FLEX 1D09A 4XFJA 2AHOA 4EHLA 1EG2A 4JMPA 2NXJA 4TKMA 5CH5A 1VE3A 4LHZA 3N1UA 2DR3A 4HGYA 3X1KA 1JHXA 4H0FA 2ZATA 1LDYA 2Z2ZA 5L3ZA 1VPWA 2QAIA 2CDAA 4K8RB 2A5YB 4PYMA 2C78A 4QPDA 3B3GA 1NOKA 3QYJA 1XKLA 1CQIB 3TIFA 3DFKA 1AXEA 2V7WA 4FFWA 1QC5B 1IHDA 2VZEA 3G5UA 4H18A 5TR9A 4G0QA 4LJ7A 1BN6A 4HWTA 4LBZA 4OHRA 1B8VA 2AS0A 2CNNA 1NL3A 3RVSA 4NVRA 3C3PA 2BAGA 1NYQA 4HB3A 4P82A 3KKLA 4K6HA 1C8BA 5AYVA 5L6LB 3H3FA 2PSEA 2P9HA 1S3SA 2PGXA 1FE8A 4WMLA 4CQLA 4EYEA 1WHTB 3O73A 3UH0A 3H9UA 1BH2A 5IVIA 1SK9A 1XTIA 2JDID 4RD2A 2X6RA 3H5NA 4B7XA 1Z7WA 1QLJA 1JQBA 1QIKA 4D9JA 3TNYA 4TLAA 4D26A 1AQJA 1Y1QA 3JQFA 1UBEA 3H17A 1BX0A 2P67A 3CR7A 3HRIA 2C82A 4ZAFA 2VZ8A 4JC8A 4ZANA 4BC1A 3OE4A 1WQ4A 2B4QA 2P2GA 1XZPA 1UDXA 3JQ7A 1CERA 1EUZA 2PTHA 2QJRA 3FNFA 3OU6A 2QENA 2JCXA 4FSXA 4NZZA 4RY0A 3B36A 4YMLA 6ADHA 4JZYA 3THYB 1POWA 4DVGA 4KL8S 2JZNA 5DHSA 3WLNA 3UPUA 1NSYA 1ZQ9A 7ADHA 2FEMA 3EW7A 1GWNA 4J2HA 4DOMA 4TT3A 3EVTA 2DFLA 2E85A 2FSFA 3CLVA 4LUCA 3O0DA 5DI9A 3FYSA 3AM3A 4PAMA 1K2WA 5K3BA 3U4QB 1GLGA 4EATA 1YOVA 5TMEA 3QUTA 4XUGB 4DILA 4OB7A 2OUIA 4E88A 1F6BA 4AO6A 3VR4D 4DJDC 1AS2A 2VYND 2Z2KA 3CVJA 3FUVA 4LVNA 4GFDA 4NWIA 4JWTA 4XR4A 4BTLA 1ZONA 1G8MA 3IV6A 5KC8A 2VQ6A 5AI6A 4KWTA 4DMMA 4ZOLA 1T3GA 2Z6AA 3TJRA 4YJ3B 2X8JA 3BD8A 3P8ZA 3N39C 4GOOD 4PINA 1DIBA 4E51A 1VIDA 4DA9A 5KEIA 4AI6A 1SOVA 3KPVA 3RFXA 5HPYB 5IDVA 4CPDA 3FHTA 4TL8A 3VU1A 1LBEA 4MPJA 3CPEA 5KDLA 2GBPA 3UK1A 1S02A 5GOZA 2PG3A 3FAKA 1A9ZA 3L8HA 1CF4A 3MT9A 1H5QA 4UAUA 4I50F 1KGSA 5F73A 5CVEA 4MB2A 4L0DA 1QVVA 1RI5A 1CVRA 1MOQA 5CDFA 5ADVA 4PYJA 1H94A 4GBMA 4QXRA 3DOEA 1G1AA 2B78A 3V1TC 4NR0A 1KFJB 2H0AA 3OPYA 4PLHA 2Q5OA 1N34B 3BN3A 4YCBA 1YB4A 3I1IA 1Q57A 4WECA 5EL0A 5FV4A 3KTFA 2PVCA 2VTDA 5HUHA 1GPDG 4KEAA 4EA7A 3IEVA 2FE1A 3M82A 3LYHA 4TWRA 3WDMA 1EQUA 2OCBA 1ZI6A 4BAUA 3D2BA 2P9GA 4C0BA 1RYYA 4DUGA 2XYVA 4MULA 4DEYA 1T4DA 2EJWA 1AV6A 5IC4A 3THXA 2FMUA 3ICQB 2H4ZA 2WWWA 4M38A 1COWA 2XOXA 5K2MA 3PI6A 4JLKA 3E0XA 2EYUA 3MGCA 4UOEA 3ZWNA 2FJUA 1E9EA 3VU9B 3JRWA 1Y89A 4PG7A 2OCIA 1QB8A 1T9GS 3CTMA 1KBOA 4BE4A 1CY7A 4NHOA 1WZUA 4ROSA 2ZRQA 3F9RA 4IIDA 4ZRNA 3TAXA 4A0SA 1R8YA 2ZBPA 4WOJA 2M32A 4CM3A 1W36B 3DDOA 3GMTA 1BEUB 1GTZA 4Z0HO 5L3SA 1I7NA 4DREA 4RIEA 2R1TB 4RFVA 2MIIA 3H13A 3WLKX 2R6JA 2Z2YA 1JXQA 3WWEA 1XRPA 4I8XA 3GLIE 2AJLI 3ZI4A 3A1WA 1NRIA 3ZIAA 5JWRA 1BIFA 2VBFA 5J2UF 2CXRA 1EKXA 3BD9A 4WY2A 4V1CB 4BMXA 2ZBVA 1E3LA 3JQ8A 1RABA 5HGJA 2DKFA 3KJNA 4UJ5A 4CTJA 3DLCA 1C8KA 3IHWA 4JSRA 2DR0A 4C43A 3LP5A 4R2LA 2WTNA 3RS0A 1E3EA 2OBYA 2WKPA 4F3KA 2F6RA 2NP6A 1L8OA 2ZXEA 1WCV1 4XJTA 1IM2A 4QFDA 4EENA 1D1QA 4K8OA 3SXUA 2FPGB 4B80A 4RQAA 1P4JA 2W2QA 1H8ED 4GLOA 3W8DA 3PD1A 4A73A 1KVQA 2Q7XA 4R8KA 4C0KA 4LC1A 5ISMA 3R5SA 4FGUA 3RSQA 1VG9B 4CL2A 1PIWA 3LUFA 1V1MA 3K96A 4X20B 4LWQA 2P8JA 4OY3A 3A1UA 4EPXA 3K70D 1Z38A 3SI7A 2RGWA 3GWZA 4FE4A 5JCPA 3TUZC 3PF9A 4LHWA 1Y6JA 3PC3A 3W3AH 2PXXA 2IXGA 3KX2A 5GADl 3MBOA 4QICA 5I3ZA 4RK6A 5TSDA 2O2ZA 2ZULA 4UTNA 4DLUA 1DWQA 4OQQA 4EYKA 2HF7A 3KJIA 1AK2A 1V48A 4UAVA 1CUZA 3VRHA 1MIOB 4LYDA 3UC5A 4QAJA 1TM5E 1GGMA 1OI2A 4NNJA 2P3SA 3HGMA 3FBGA 1LGYA 3IE2A 1ZY2A 2HGZA 3FZQA 1ODIA 3MA0A 1G21E 2JLQA 1ZL0A 2C94A 2A94A 4U02A 4HUTA 1H4VB 4KBYA 4HDQB 5TLSA 1HEUA 1L8LA 1GG9A 1KRHA 3EA5A 1LK5A 3DVLA 2CXOA 1BXKA 2QT1A 3QHPA 4IKEA 1J8MF 5LYYA 1ZGBA 2HWKA 1DB3A 2IC5A 4HPWA 3ZR4B 1UBCA 5A06A 1OROA 1XTBA 2VQSA 2PMWB 5REQB 2FWIA 4X62B 4XIFA 1LPBB 3RYHA 3TG8A 1DG3A 3IVRA 5DU2A 3EZXA 3VHLB 4EYGA 2V7PA 2OVFA 2X0KA 3BERA 3ODGA 2M9MA 4JLWA 2QR2A 2XWSA 3KB6A 1G60A 4N39A 4EPTA 3Q0IA 4NBKA 3IP9A 4HNSA 4M9RA 4GDFA 4DM7A 3FG9A 1XWIA 4F8JA 3I04A 5FIUA 1TJNA 2VS1A 2Q5JA 4YYEA 3FPKA 2X14A 4C7KA 1YK0A 1GQQA 3VR2A 2WA2A 4ETNA 4FJ1A 1FP2A 1L4KA 1WD7A 3HZHA 4IDEA 1OWLA 3BKWA 2NP7A 1CD5A 1KI2A 3FIUA 5GOTA 1QP7A 2I6UA 2QTCA 3LO5A 2Q4BA 1LDEA 2P0AA 4ZYLA 4ARUA 4OL0A 2EATA 4V1CA 3N2GB 4Q19A 5AI8A 1TMOA 2JAOA 2WMDA 2QX4A 3BRWD 4B7UA 1M74A 3MB5A 5JR3A 1O77A 1KA9H 3DDHA 4H59A 2ROQA 2YV2A 1RNLA 3M5PA 1X0VA 3HSSA 4NMWA 3UJ6A 2R6AA 3MM4A 4P22A 2FLKA 4I5GA 2GAFA 2BR5A 3IUBA 3WL7A 4ASUD 4EITA 2VT3A 1NQUA 1EVIA 5EJ9A 5LFAA 2DERA 3I0NA 3KCNA 1IZ9A 2PVPA 4JCCA 5ADHA 4ZRDA 1CR6A 3F7OA 1DJPA 1E3WA 2V4ZA 4HFNA 4JHLA 2VUTA 1LBIA 3LFHA 5DGTA 3HYSA 3TPFA 4MIEA 2XVMA 3P9YA 5L7TA 3HY4A 4ZQGA 1IY1A 1ZH8A 4GW3A 3E81A 2J0VA 2R5FA 2ZYUX 3HDYA 4BGDA 1Z4NA 2RK4A 2HIAA 2I4IA 4FYXA 2CXXA 3RIYA 5ESRA 5K03A 3VMMA 3A4YA 4FOTA 3H2YA 4RVSA 2FZCA 2ZIGA 5KX5F 3IR5A 4CMJA 1JWAB 1NU8A 2AOUB 1XFDA 4FFPA 4M7RA 4QDXA 2R7AA 4TSFD 3REGA 5B64A 1X7HA 4F5WA 4HADA 4WCVA 1Q92A 3KOOA 4NJEB 1XQYA 4UW9A 4G2NA 4JX9A 4MS3A 1QQBA 3E3AA 4WV3A 1SHLA 2EP8A 4MVJE 3H2GA 3TVYA 3A36A 4I99A 5LZ4A 3ORHA 2ZJOA 4WBXC 1QX3A 2EWWA 1JJ7A 1DU4A 1R0RE 4TMWA 5FOSA 3IUMA 5B58C 4HWGA 4ZEOA 3REFA 3ZE6A 4LF9B 2HK8A 3FNGA 4KXVA 1V3VA 1LX6A 2YYAA 4GEGA 3LXRA 1F2VA 1FXSA 4DDHA 4HN2A 4Q4DA 4FCTA 1YS2X 4B71A 2WU0A 1OJLA 3L02A 3RTBA 3WRXC 5KNBH 4XWGA 1OLUA 2GBLC 3S7TA 2HFKA 3KLMX 2EQAA 5FBZA 5TC4A 5TT0A 4MKRA 1QPBA 1KQNA 3EIXA 4O2LA 1PN3A 2C29D 5DW0A 7YASA 5FUQA 3IUEA 4PZ9A 1GGFA 2E4YA 3GFPA 2AEEA 5CDGA 1R12A 1N9KA 2XGGA 3ENKA 3P9KA 2GEFA 4HCJA 4IGAA 1SHKA 2IVFA 3BXPA 4RUKA 5DPMA 1K7CA 2LIVA 4ER5A 1EK5A 2ZU6A 5M34A 5AJUA 1M34A 4X8HA 5H8WA 1RXWA 2GXAA 4ZCQA 4OI0A 2CSUA 2P5UA 1ZVMA 2XA2A 2C77A 3B9RA 3W2HA 4LRYA 4CWAA 3V4RA 1RIFA 4AJLA 1QNLA 1GUZA 2WICA 4RWEA 4WH0A 1CKEA 2FB9A 3CLRC 2YXLA 1MAHA 2V7EA 1PLLA 2E4UA 4DQVA 1IMOA 2HJRA 1GD1O 3LDFA 1L4NA 1MG5A 3B7PA 1ZNXA 3IAHA 1N3BA 4GVXA 5AHKA 2D2FA 4IFEA 2VZ9A 5BN3A 1V11A 3CUKA 1G9XA 1W581 2YFQA 1L8AA 2C5AA 2QRJA 1E9RA 3MWYW 1HZZA 1UJ6A 3GLIA 3WLAA 5FR1A 4RIGA 4HF7A 1O6CA 4J0HA 2NWQA 5DI3A 1RYMA 4GI5A 1P17A 3NIDB 4HAXA 4WNCA 5H68A 4Z4FA 2C9ZA 4UCQA 5CB4F 3MRVA 2XADA 4UAGA 3VISA 1TMKA 3E6AA 4Q21A 1RWVA 4UHCA 3PUXA 4AJ1A 1MEEA 2XQFA 3UGJA 3J81k 4L4RA 2AI1A 1FFHA 1M83A 1ZR4A 2PGDA 4GZMA 4YREA 1EP1B 1M2OB 1PUXA 2RHWA 3UMFA 1P9RA 3R3JA 5JTUA 1KZHA 4RMNA 2EQBA 4HNHA 4ZQBA 1NRWA 5DWDA 4MMZB 3VDMA 1XYYA 1IPEA 1QO0A 4V0KA 2ECFA 3JAKB 4EKDA 3NGXA 3DE7X 3HADA 4KMMA 4ZJPA 1T6XA 4OJKA 5FB3A 5JLJA 3AUFA 3FTQA 1Y1KE 5BSMA 2HCBA 4W5JA 1SRRA 4EUNA 2OYCA 3IEMA 4FOPA 5A4FS 4GGPA 3PDJA 4FJ2A 1XLTC 1OWMA 4KWCA 1QBGA 1SZJG 4D4LA 1RKVA 1KOFA 1MXHA 2PO5A 3F6SA 3V46A 2X7JA 1D4AA 1A2BA 3NDIA 2QYOA 5IAGA 3ZDYB 2V7TA 2QHXA 3BB3A 4X1IA 1PR1A 2C57A 2VSNA 1CUHA 1RQLA 2SBTA 1PVVA 4FZVA 5JXJA 5MHTA 1AKTA 3NUQA 4CEIB 1US8B 4EFKA 1CZNA 1QMGA 2ZIUB 4FR0A 4G5HA 3TTXA 4BLRA 5DNCA 5DGDA 4MR9B 3UFXB 1KMHA 5IW8A 2R8OA 1R0LA 1ENOA 2ZTMA 3CEAA 4NXMB 1XOIA 2O0HA 4Q4HA 5EYPA 3I64A 5IYZB 1GCAA 3MUFA 1JDJA 3WHPA 5EIEA 5ITVA 5JFGA 3HXQA 1RQNA 5KMGA 5L3VA 4N47A 1Z6ZA 2BVNA 3UK6A 3MCVA 5JPIA 4Q9JA 1C14A 2QW8A 4BMDA 1BYIA 2OBLA 1LPPA 2ZS8A 3HI6A 3TN7A 3RUEA 3OJOA 4YJGA 4F85A 4CM4B 4NZOA 5I9IA 1HV8A 1WE2A 1KIFA 3QELB 1MBZA 1VP9A 2C3OA 2G0TA 4MP8A 3WDSA 1YVDA 3KQOA 4D8XA 1IQ0A 1EE1A 1ECJA 3IQZA 1UP6A 4Y6RA 4B34A 3O9ZA 1PSZA 1IB0A 1S3GA 4JJ6A 5L9AA 3KFLA 1VMIA 3ZVKA 2VJMB 1SC6A 1V5FA 2O2GA 5CGQB 3ROGA 1PD1A 4L5BA 5FWXB 1Y5RA 1EA7A 3FYDA 3GLGE 1CUFA 2CKMA 2AZXA 4L3OA 2NZUG 4DJEC 3MK31 2R1TA 2LW7A 3KELA 3AW9A 4EEKA 2DPGA 4MARA 4E5YA 1YQGA 1MHPA 4C88A 2GF9A 4LC9A 1RLIA 1LI4A 5BYAA 1VB5A 1PS9A 4HGPA 4ZVPA 2A9FA 4LCEA 3PWTA 2H1RA 4QO7A 5GAJA 2VYFA 3VZRA 3AJEA 3USZA 3R6TA 4OJQA 4LYFA 1SBZA 2WD9A 3DW3X 4PPQA 4KCGA 5HCUA 4TMKA 4K5QA 1Y1RA 1N1GA 3QBDA 4D4IA 4RTQA 1PJRA 2JLWA 2F3PA 2GKOA 2BFWA 3ZQJA 2IZ5A 3EXEB 1X8LA 2B8WA 2WJ6A 3OZVA 1V8ZA 1ULTA 2IELA 3NOOA 2YJ5A 1KAMA 1VPLA 4G5QA 4ED9A 3KT3A 4RHTA 3V2IA 2FZ5A 2ZB3A 3QJYA 2W2MA 1LWNA 4WZBA 4ZTUB 1G38A 4RANA 5K6TA 4P08A 4Z86A 1AQLA 5TE9A 4LMPA 2OV8A 2PS0A 4YJFA 2GK4A 1OCEA 5FI0B 3LGAA 2RHRA 1O03A 4C3OB 2HF9A 3F90A 1HQCA 3KDSE 2VDLB 2Y8EA 4OHZA 3RIGA 5EFZA 3HPQA 4YECA 2ODBA 2B4TO 4XSGA 4BHTA 2I6TA 2QZ4A 5EXDA 2GF0A 4BE9A 4YRGA 1UM9B 3ULKA 2Z3WA 3ZU6A 3TR5A 1PJQA 4H6PA 2VTKA 4DGSA 5EIBD 1C41A 5AKGA 2VAPA 2WM9B 3I72A 5E6RA 2NSDA 3H9CA 1N2HA 1O6FA 2ZGVA 1YE5A 3HYCA 1BAPA 1FC0A 3RHTA 3TSWA 3V4LA 3C3YA 3RVPA 4DCSA 1UMDB 4INOA 4HFMA 1KWGA 1MZVA 2GLXA 4MKGA 1SCUA 2HGSA 1N9GA 3L0SA 1G6KA 4R40A 2NO1A 2NO9A 2DUMA 2B20A 2YWJA 3N75A 5BT8A 4P3YA 5CFNA 4RVOA 4JI6B 4I4CA 2JH9A 3K31A 4GUAA 1NM5C 2A58A 3N2GA 4FFLA 4WADA 5JROA 2BJVA 3PHLA 2JW5A 2GARA 3QELA 2FW1A 2BPOA 1AKVA 1T9GR 2GNPA 4FYHA 5DXAA 3PR2B 2G67A 4OBXA 2CVZA 4E5SA 1LZLA 2JD2A 4KO2S 2OLEA 4RVNA 4CDMA 2ECQA 1OLXB 2O4UX 4DXHA 2OGSA 5BV8A 2LBPA 1NYLA 1ZR2A 3IBYA 3B82A 4D0NA 1Y81A 2XUJA 2XZOA 4I1SA 3O2QB 3WBBA 1ISRA 1ID8A 1CZRA 2BDTA 2LDXA 4N54A 1WEHA 1M3SA 1GTJ1 1X7WB 1XAIA 4I55F 4HJXA 4UNPA 1U8XX 2FRXA 2WUVA 4QNMA 3HK2A 4RVHA 2FZEA 3GQBB 2ZIEA 5K3CA 4L51A 4YBRA 2B9VA 3TIXB 3UYLA 4DLXA 3EPHA 4RPLA 4JYZA 1ZN9A 4PPGA 3VYSB 1JTVA 4DEVA 3G0CA 3T7DA 1PFQA 1JTEA 3TZEA 3QE3A 5ESWA 1HXHA 3EIWA 1LLUA 3F8TA 4GKAA 4QOJA 4GECA 4B2PA 2W8ZA 1T9HA 1W0JD 3IIMA 1IXSB 2WSLA 4AK9A 2MJLA 4S1WA 1ID1A 1B1CA 3ZOZA 5D3KA 3TSOA 2AL7A 2PKQP 3D6FA 2GT1A 3ZGOA 1II9A 2QTMA 4HGNA 4YCNA 1U0FA 2RG1A 3GEBA 3LF1A 1RLJA 3WL4A 3PXUA 3GLGA 2BUCA 3OE7A 1UBRS 3DSRA 2W11A 4NU5A 2YVAA 2VTVA 3SC4A 1CT9A 2WKWA 2Y3IA 3NTQA 5AM3A 1DFIA 4JJKA 3W3ZB 3DBHB 4FEGA 1LQ2A 1P72A 1MX3A 3IUQA 3MS4A 4ND7A 4PU0A 4RZ2A 5KYYB 1AY0A 2Y4OA 2HWWA 5DF1A 3RQSA 4U7TB 4MWCA 4GR9A 1U2TA 2CF6A 2Q0HA 3HP4A 3LY8A 1WCXA 4FOSA 4P6VF 5HJ5A 5I6DA 1WUTA 3AF6A 2I34A 2ZPAA 1N6OA 4EWLA 5EJ5A 4Z1OA 4QUDA 1TQ4A 1L5HB 1YZFA 2BC9A 5J47A 1KRXA 1PSDA 1NBAA 5TGTA 2BM1A 1OJ7A 3G2KA 5J2UA 4DPKA 1LBQA 3VDXA 4F3RA 4X7BA 2D1QA 3LVFO 3WK5A 1P1CA 2W2PA 4PSCA 3QVKA 3ICOA 1GZ3A 2A9VA 3FFXA 4ZCSA 3C87A 3U4IA 4RMIA 2M2IA 3MTIA 3TRKA 1VLHA 3RRZA 4Q24A 3STVA 3VZDA 2IPNA 1ADCA 4XCXA 1C0KA 2BGJA 1XP5A 1FK8A 3LK7A 3N0XA 4HJRA 4PCVA 4XVHA 4LBYA 2KB0A 3RYFA 3UOAB 2QIPA 3CZ4A 1NM5A 1HFWA 2YRFA 3GBPA 2PPLA 3T9CA 4RCVA 3FH0A 1RJFA 4DBLE 4DUGD 5DNYB 4F5ZA 1SU6A 3G7NA 4S1OA 4XSVA 5ALKA 3K05A 5HG0A 1L5ZA 3Q3GE 1U8ZA 4GPZA 4A2CA 3C4QA 1WOYA 1IUPA 4CUJA 4WPGA 3H19A 3UXEA 1XTJA 3HCNA 1IEQA 2COEA 4H6XA 4NECA 4D9MA 4UTVA 1SPXA 4M8SA 5EINA 2IEAA 3V8RA 2XCRB 1U7ZA 3EQ7A 1JG4A 3JR3A 5AUPB 3AR8A 1RHQA 3E9NA 5JJCA 5K8IA 2CNBA 2Q9AA 4BB9A 1L7EA 2A92A 4IIUA 1P0MA 2IHJA 3P0HA 1JQJC 1OOEA 3UT0A 2EHJA 2Z98A 4OG2A 4R5MA 2XVXA 4NF2A 3CZPA 4B83A 3M5CA 3DKRA 3FWHA 4R69A 4BNUA 1JIKA 3SJ7A 3HL4A 4I50A 5KQGA 1A5AB 1SRQA 2I7TA 2P69A 1FP6A 2JBAB 4DBZA 4IIGA 5IK2D 4HQRA 4ARAA 4EW1A 4QU8A 4PYOA 2FG5A 3K4HA 1N8NA 2JI7A 2L0XA 2C8VA 2OORA 3O47A 3OQ1A 3P9IA 4KVGA 4M0PA 4EY4A 5ITZA 4P0QB 2DCMA 4QTUB 1TUIA 4ABTA 3G2JA 1AKRA 4P32A 5G4KB 1PYDA 3E48A 1EGHA 5IJAA 4U2CA 3T0GA 4I81A 3AJDA 3WGOA 3MEQA 4JJEA 5B3KA 5JDCA 2JATA 4DV7B 5AVZA 1DNPA 3HFJA 3K70C 5CK4A 3TJZA 1GCOA 3EXHC 4BO9A 1W7AA 3IUJA 5COAA 2EF0A 2TMKA 5LXTF 2OT3B 2WAOA 1FYDA 2FFJA 2QF7A 2B4AA 1GCGA 1KS9A 2GAOA 3O8BA 2V6IA 3KO8A 4YMSA 1DXHA 1OU0A 2HT6A 2W37A 3BQNB 4HN4B 1TK9A 4RK0A 4HH0A 4IL5A 3NHBA 3AEKA 1LQTA 2B34A 4Y2GA 5IK2A 1VLQA 1E1YA 2J8ZA 3HJUA 5FULA 5HFNA 4YT4A 3O83A 2VNAA 1I24A 1QMPA 1YB7A 1LSOA 2IP2A 2E4AA 3I2HA 3KEMA 4RH1A 4CBVA 1RADA 5DKFA 3JAMA 4LI3X 4EK9A 4GMDA 4GRAA 2C8JA 4BKUA 3CN7A 3F3YA 5LQSA 5JW6A 5KB3A 3PT9A 2JGIA 3PPYA 1BXRB 1NV9A 4AZ3A 5COBA 1ADJA 4RZXA 4HNTA 4YAJA 2F1KA 3DE1X 3KBBA 4KH1A 3SJAA 2D54A 3RIEA 5I8PA 2EFHB 1QGZA 2BISA 5A0FA 4BNDB 3NR2A 3AQIA 1KI4A 2C3PA 3N2YA 4PBTA 1E1RD 2FEAA 4HUQB 4QAQA 5K99A 4TTTS 1A9RA 5TGDA 4CQNA 3TKYA 1LS1A 4F5DA 1ZHOA 1UPFA 3BCHA 4X24A 1FYFA 2XE4A 3DMHA 3JD2A 3TRDA 5AVUA 4MB0A 2IBTA 3BG5A 5TXGA 2XNDA 1Z33A 4OK3A 1ZI9A 3U16A 4IS3A 3THOA 5J2TA 1CEYA 4HVTA 4WNIA 2NVBA 5BWLA 2QZ9A 3PFHA 2JNWA 2D3TA 1XXHB 4O4IA 4QQFA 5HQJA 3RIMA 3CRW1 3BH7A 4O4HA 4ZOLB 4XM1A 1QFXA 3B7WA 2ATIA 4YV7A 5JYBA 4X8LA 4EA6A 2RI1A 1GDHA 4MDEA 3AVTA 1U9YA 1AF4A 3LNTA 2JVJA 2VJPA 4JUAA 2V3WA 3A4VA 3EEYA 3K6KA 4UE2A 2CHQA 1JR3E 1RRVA 2KWIA 9LDBA 1IDN1 4WFKA 3T1QA 3P52A 2G6BA 4MWSA 4ZZ1A 3FMPB 1M2NA 1H1LB 4FXPA 3C0KA 3FR8A 2OK7A 3GFOA 1X86B 3LP6A 3MWKA 4KIWA 4BJ3A 1XLVA 5LU9A 1OASA 3A7DA 4PSKA 4G5XA 3F6PA 2DRIA 3QNMA 3WS7A 1KI7A 3VR5H 1J2JA 4KXNA 5CIQA 1YONA 3QQ5A 4RY9A 2CNLA 3NFRA 4V02A 3U62A 2QAGB 4WKCA 1WP9A 1MA3A 5DYGA 4Y6LA 3RVJA 4CV2A 4DQKA 3GLFB 5FTNA 1QHXA 3DBLB 3IAS6 2VHQA 3C3CA 2HU5A 4NYJR 1E66A 1ZD5A 1UBSB 2ZPTX 4TTQA 3IESA 4B09A 1J9GA 2YH2A 2V45A 5EJ4A 1PNOA 1MVOA 2JGDB 5JAOA 5KBYA 1QRAA 2VHJA 4QM7A 5EVCA 2AQKA 3FSJX 3LSTA 4D46A 1VG1A 2AT1A 1OTYA 3KSAC 3KKZA 1LW6E 1ZD8A 3G8DA 1IG0A 1M2OA 3HBFA 3M0EA 1AZLA 1NNI1 4XR9A 2IIPA 4ZO8A 5ALFA 2I6QA 1M6EX 2TMYA 3SVZA 4C0JA 1QTIA 2E7ZA 2SHKA 3CM0A 3NIWA 1G7SA 4GD3Q 5ECGC 4C22A 1GTRA 2I4RA 4JQZA 1J0BA 3SNKA 2WB4A 4XEHA 4AF6A 4HWRA 1VKJA 1Q7EA 3BBPA 5ARCA 1E1DA 2ORIA 1B8OA 5G53C 1PL8A 4US2R 2H63A 4LYJA 2FW7A 4U6SA 4Z7JA 4NARA 3QFHA 3UANA 2C7VA 2JAUA 1IWBB 3WBFA 1YE3A 3W5UA 3L0PA 4B3BA 1O1YA 1EMDA 1G66A 1J5EB 3M4JA 4AY4A 5FBHA 1E1QA 3TSCA 4Z4HA 2CYCA 1Z6GA 3I1YA 3CLSD 1NBHA 1QHEA 1WZIA 3GJSA 1YJCA 3Q5EA 1ADFA 5JBIA 2FYTA 4QXOA 4IWYA 5B4TA 5JALA 1IBLB 2OQIA 1P4SA 2EIXA 3HP1A 1JJAA 3TEMA 1DAHA