4KK4A

Ywle arginine phosphatase - c7s mutant with phosphorylated active site serine
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
152
structure length
151
Chain Sequence
MDIIFVTGNTCRSPMAEALFKSIAEREGLNVNVRSAGVFASPNGKATPHAVEALFEKHIALNHVSSPLTEELMESADLVLAMTHQHKQIIASQFGRYRDKVFTLKEYVTGSHGDVLDPFGGSIDIYKQTRDELEELLRQLAKQLKKDRRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Low molecular weight protein-tyrosine-phosphatase YwlE
publication title Structural basis for recognizing phosphoarginine and evolving residue-specific protein phosphatases in gram-positive bacteria.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
total genus 60
structure length 151
sequence length 152
ec nomenclature ec 3.9.1.2: Protein arginine phosphatase.
pdb deposition date 2013-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4kk4A00
2B1JA 4B09A 4E7PA 2FQWA 2LPMA 3H5WA 4IILA 2VUIB 3OQOA 1Y1LA 4Z4GA 1SXIA 3GYBA 4KV7A 4W5NA 3FFXA 5KQMA 4MR7A 5TQ0B 5D2CA 3MMNA 1KGSA 1AB5A 1M5UA 1NXVA 3GA5A 3RVJA 3FFTA 3CLKA 1S8NA 3GT7A 3GWGA 5HM6A 3UK0A 5TQJA 4IGAA 4Q6WA 1ABFA 2E4UA 3LUGA 4NICA 4DADA 1VPWA 4YGXB 3LKBA 5HSGA 5IULC 1EWVA 5FWXB 3N0XA 1RNLA 1Z13A 2LIVA 5KQLA 5IUJC 3MYYA 1EWKA 3NHMA 3DLBA 4H60A 3GV0A 3Q9SA 3K9CA 4OTZA 2FN8A 1W9HA 1EFAA 5TQ2B 1L5YA 4EVSA 5F64A 1MAVA 1TLFA 1P2FA 4N0QA 3N75A 3NBMA 4RK7A 1ZITA 4XLTA 1U0SY 3RQIA 2LUOA 1USIA 1ZDMA 2QU7A 1QKKA 4OBBA 1YTUA 3JPYA 3NNSA 5IUNC 1E2BA 1PNRA 4G0ZA 5EWLA 4Z4IA 3SG0A 4XASA 5CNMA 4H3KB 3H5IA 2KYRA 3QEMA 1OXKB 3TX6A 3E3MA 4Z99A 1P6QA 5PNTA 1KRXA 3C6QA 4H3HB 4TN5A 3R0JA 1Z2EA 4EYGA 2NZUG 1ZH2A 2ZAYA 3GL9A 3OO0A 4FE4A 3RH0A 3OLYA 7ABPA 2GKGA 1NXXA 4WXMA 3RVSA 3H1GA 1DBQA 4L4UA 3KLOA 4OLAA 1U2QA 3MA0A 3SM9A 1M2EA 3KSMA 4RS3A 1B00A 1DCMA 1DRKA 1A2OA 4RV5A 3NHZA 4M88A 4MQFA 5CNKA 3ILHA 5KQPA 4S04A 2VK2A 3LUAA 2MYUA 3GBPA 9ABPA 4Y9TA 3M9XA 1DCFA 4W5RA 3LKVA 3LOPA 1QP7A 3NNDA 5TPWA 1RXIA 5HQJA 5EWJA 3HDVA 4EYQA 1IIBA 1Z2DA 1GCAA 3CG0A 3QLTA 4XXHA 3IDOA 2WWVD 4JP1A 1ABEA 1FFWA 4HNSA 5T3YA 3MM4A 3D8UA 3HDGA 3O2QB 4NCAA 3OM1A 1DP4A 3O2JA 3OQMA 4LE2A 3C3MA 3DGFC 4MLDA 2QZJA 1BDIA 2N9UA 4Q6BA 3QK7A 4LDZA 5HKOA 3C3KA 4PZ0A 5JNUA 1E6LA 3I5AA 1JH9A 2RJOA 1FSPA 2FVYA 4RK5A 4QPJC 3SQNA 3HUTA 1NXSA 4LE0A 2R25B 3N0RA 4MR7B 3T38A 3N0WA 5T7BA 1NXTA 4RXUA 3FFWA 5DKFA 1MB3A 2PKXA 2PMCA 3FGZA 1D1QA 3MIZA 4ETMA 4YP9A 3JVIA 4MR8A 4WZZA 2R48A 3OLXA 5BRJA 3F6CA 4G0YA 1DBWA 2CHFA 2MYTA 5DGCA 1SXGA 3HS3A 3IP5A 5FWYB 1ZGZA 5KI6A 2YHBA 1YMUA 3N8IA 4LE1A 4MS4B 2FEKA 3W9SA 4MAAA 3OO1A 2JVJA 3C97A 4WWHA 3CU5A 4Z9BA 2FMIA 5IUKC 3CG4A 1Z17A 3HZHA 2VYCA 2MYPA 1I3CA 3MQ4A 1SXHA 3HV2A 3RVRA 2L2QA 1U8TA 4OLBA 4IMIB 2A9OA 2GWRA 3BBLA 1M2FA 2CD7A 1BDHA 3H6GA 1Z16A 3H5LA 3JY6A 5TPZD 4G0OA 4QYWA 1WETA 2IPMA 2A9RA 3URMA 1M5TA 3HM9A 3HEBA 1EWTA 3SAJA 4WT7A 3HK2A 4KQ9A 2J48A 2IYNA 4D6YA 5I4CA 1LBIA 3OMXA 2QVCA 5EWLB 1H9CA 5FBKA 4MR9A 1LJLA 2JBAB 1KMIY 1U2PA 3IP9A 2CHEA 2E4ZA 2F8SA 1NXPA 4IMJB 4N76A 4KFCA 2FMKA 1MVOA 2HQRA 4YR7A 2PLNA 3LUHA 1F51E 2FW0A 1EAYA 1PUXA 4N0PA 2WY2D 2E4YA 2PUFA 4MS1B 2I6FA 4Z0NA 4ZPJA 4EUKA 2FEWB 1UDRA 3H5OA 3CTPA 4N41A 2M1ZA 5DCLA 4KMRA 4YLEA 1R8JA 2ID9A 1ZESA 1TVMA 2QW1A 5CHYA 4JOQA 3G1WA 1SRRA 4PE5B 2HQBA 3IPAA 4OATA 5GQSA 3CFYA 3RVKA 4P98A 4ZJPA 4Z4HA 1SD5A 2QXYA 5IX8A 4G0QA 2IPLA 4RWEA 2QSJA 4W5TA 1C4WA 3QEKA 3QX9A 4HNQA 4IF4A 3CZCA 2HJ9A 4QICA 2MYNA 4ML3A 4RKRA 3EAFA 6ABPA 4RDCA 4RSMA 1QO0D 2NUBA 2WRZA 5TPZA 5BR1A 3D02A 3LFTA 4G0MA 2R47A 4KZKA 1K68A 1CEYA 4YWHA 3VNAA 3O74A 3DGEC 2YHAA 3HVRA 3DBIA 1FFGA 3TB6A 3TD9A 4RK1A 5DLEA 1FQWA 3IP6A 4JB2A 1E6MA 3KKEA 5TQ0A 2TMYA 4RZSA 1LK0A 3P9YA 3QELB 4KNYA 3O2SB 3Q15C 3CZ5A 4EVQA 1YS6A 1T34A 3EULA 5JNTA 3HUUA 4EYOA 2PL1A 4GNRA 2IKSA 2PAFA 3HXMA 2W42A 2WJAA 4OG2A 2MSWA 5EWMB 1A04A 4NQRA 5JNVA 5FWXA 3FDFA 1BA2A 1DCKA 3KCNA 1JFSA 1JFTA 1QMPA 1DBPA 1FFSA 4RK6A 4ZYLA 1YK1A 1Z18A 3EODA 1XHEA 1A0OA 1ZGGA 1NXWA 5BRAA 4F3TA 3OLZA 4EY3A 1CHNA 1DRJA 3KG2A 4O5AA 2FKAA 5TQ2A 4KQCA 1RZRD 3CS3A 4YS6A 1JDPA 2WMYA 2IOYA 4F06A 3A3KA 4HYEA 5B3JA 1YVUA 3I45A 3EQ2A 4MRMB 4TLLB 1JBEA 2L17A 1YS7A 3KYIB 3Q41A 1KRWA 2WJWA 2FLKA 3MF4A 1GUDA 4HNRA 4JAVC 1APBA 1D1PA 1QP4A 3LUKA 4KVFA 4XARA 1HEYA 3LMKA 3GBVA 4P1ZA 3DLHA 4MR9B 4ETIA 5C5EA 2FQXA 4G97A 1L5ZA 3H1FA 2PUAA 2VUHB 4IRXA 5ED4A 4G0PA 3JTEA 3QX8A 3KTOA 1J56A 4TLMB 3CKMA 2RGYA 1F4VA 2LBPA 3H6HA 4YO7A 3EGCA 3RVLA 4NCBA 3JPWA 1GCGA 4EGSA 2FXIA 3LUCA 1GUBA 3HCWA 4YV7A 2QV0A 1PEYA 2FMHA 3OMWA 4CBVA 3T95A 5JNRA 1YK0A 2PUEA 1RPJA 5TE9A 3Q7SA 4PYRA 5CNJA 1VLZA 1PHRA 8ABPA 1MIHA 5KQGA 3HJFA 3RVPA 1ZHHA 1JWLA 1PNTA 2IDMA 4S05A 2L18A 4QYMA 4MQEA 4RKQA 3O1HB 3SNKA 3TO5A 3N6VA 3O21A 3Q7TA 3QEMB 1QNLA 3L6UA 4RY0A 5JNWA 2FMFA 3JS5A 3ILYA 4RXTA 2ID7A 2E4XA 4UHJA 2X7XA 2DRIA 2Q5CA 2A9PA 2HPHA 4Q7EA 4WXEA 4RY9A 3I09A 3VNBA 5IBQA 1JFVA 4E7OA 5B3JC 1U04A 3IP7A 4D74A 1JYFA 2PUGA 2O20A 2JK1A 4UHKA 4KRFA 3BREA 4EYKA 3F6PA 4MQFB 1PEAA 4N47A 3A10A 4G86A 3KS9A 1D4ZA 1LJUA 3I42A 3T8YA 3M6MD 3KJXA 3QLVC 4JA2A 6CHYA 3KYJB 4NV3A 5TPWB 5E3JA 3O1JC 4F12A 1NTRA 4RXMA 2F8TA 5EWJB 5FWYA 4KK3A 4KREA 3EDCA 1DJMA 4MS4A 1Z26A 4Z9AA 2JVKA 2M98A 3H75A 4LX8A 4WUTA 3B2NA 1E6KA 3BRSA 4JB0A 2QR3A 1Z25A 3UUGA 2A9QA 1JL3A 4GPAA 3RVQA 4RK0A 3S99A 2JVIA 4DN6A 2PL9A 4PEVA 1YIOA 3NNNA 1XHFA 3N53A 4MS3A 3C3WA 2JRLA 3CNBA 3FMVA 1ZVVA 1XWWA 2GI4A 1D2AA 5C5CA 3T6KA 5IEJA 1TJYA 3TMYA 1QPZA 4FE7A 4MGEA 1AB6A 4Z4EA 4RY8A 1MB0A 3QLUA 3H1EA 4RU1A 3E61A 1CYEA 3A0RB 4G0XA 4EVRA 4YCSA 1JYEA 2JBAA 4ETNA 1JF8A 1VKRA 2P9HA 2BGGA 4F11A 3F73A 2GBPA 4L85A 1NY5A 4FB4A 1RXEA 2GX6A 2JB9A 3LUDA 3OM0A 4MR8B 1USGA 1LBHA 1EHCA 3O1IC 4MPTA 1Z12A 1ZAYA 1ISRA 2H3HA 4TMYA 3SY8A 3HSYA 3H5TA 4PICA 4MS1A 2V0NA 4MYRA 3H5VA 1D5WA 2FTKE 2WB4A 3RVNA 3CRNA 2H0AA 3O75A 3L49A 2FN9A 2PUBA 1BDJA 3KLNA 3BRQA 5JS2A 3RVMA 4JASB 3HO1A 1VRVA 4Z4CA 1ZN2A 2FEPA 4W5OA 3OQNA 1JX6A 1QO0A 1JDNA 3OLWA 4MQEB 1Z15A 1NXOA 4DQDA 1ZY2A 2FSPA 3LTEA 2HSGA 3QLVA 4O1HA 2PUCA 2P4UA 3EQZA 5BQ3A 3K4HA 1TMYA 5JNSA 2R4QA 3A0UA 1QQAA 1DG9A 1QQBA 2LP4Y 3GRCA 4RK4A 2PUDA 1P6UA 2NT4A 3OLVA 2NZVG 4KPYA 2JCGA 5JS1A 4XAQA 3G85A 3JVDA 4MLCA 2RJNA 5KC8A 1GLGA 3BILA 1TM2A 1JHZA 4LRQA 4ZMRA 5KWSA 3ROTA 4F8JA 3LUFA 3EJWA 2FLWA 1QP0A 3M9WA 1JLKA 4N03A 3DZDA 2CWDA 3QELA 2B4AA 2MSLA 3QLUC 4XFKA 5GOTA 4W5QA 1DC7A 1C0EA 3UKJA 2RDMA 2L19A 1ZH4A 1DC8A 1K66A 1YMVA 5FBHA 2XDYA 5EWMA 2IPAB 2PJUA 4Z4FA 1NATA 5DTEA 5KC9A 2OENG 5IC5A 5ABPA 1W25A 1RZRA 5CNIA 2FQYA 2QVGA 4LDAA 1P8AA 3RVOA 4KK4A 2NT3A 3F7NA 4O1IA 1ISSA 2PE5A 2MSKA 4ZMSA 2ZWMA 1BAPA 4LZLA 3KHTA 2OQRA 3CHYA 2E4WA 3IPCA 4D6XA 4YRZA 3Q7RA 2AYZA 3ROFA 1USKA 4MS3B 1BVHA 2HQOA 2AYXA 1OXBB 2E4VA 3LUJA 2IPNA 4MRMA 5IEBA 1DZ3A 1URPA
chains in the Genus database with same CATH superfamily
4E7PA 4PZUA 1PT8A 4FHGA 3IBTA 4O8CA 3L3BA 4UPVA 1N2BA 1NRJB 3CZQA 4KV7A 3T9AA 4B80A 2GHRA 3AEXA 2V5AA 3MCVA 1RYEA 1QIKA 1U7PA 2FN3A 1NXVA 3ZE7A 1JSRA 4JUAA 2HO4A 2GBFA 3VC1A 3EZLA 3HCBA 1OYYA 2IU4A 5HJ2A 4OGKA 2DFTA 2HM7A 3T1HB 4CLEA 5JEDA 5HWSA 3G9UA 1Y98A 2PSFA 4LQ4A 4AB1A 4KXWA 3EGOA 3K0CC 2JIZA 4LYEA 2VT7A 1ZM3A 2K87A 4RVOA 1JWAB 3ISTA 3MWDA 3NDRA 4Z4QA 2EV9A 1YGYA 4YJ2A 2I1LA 4PO3X 4P54A 2O2CA 4ILKA 3QW2A 4RPJA 4JI2B 2PX3A 3DLBA 2PKEA 2QRHA 1I4LD 2FN8A 1WD5A 2HV9A 4PX2A 4KXYA 5LJLA 1UMCB 2XUIA 3VV2A 1DIRA 1QFYA 4QQ8A 4MKRA 3TBHA 3BFXA 3JATA 1P2SA 5H82A 3LQFA 2GM9A 3ZZMA 3MWEA 4WESA 4Z1OA 1ZL0A 3HO6A 2JZOA 3EVCA 3HXQA 1EWRA 1XX6A 3DWFA 4HP8A 4IRMA 2O19A 4WDRA 2P2YA 4OBBA 4U5XA 3ZI0A 1RZUA 2ECQA 2OFFA 1US8A 2FE1A 5LQDA 3NCHA 1TKRA 2VCHA 4X5OA 4Z4IA 2QN7A 4FGKA 1R6XA 4QNNA 5AVOA 2QY6A 2RJ3A 4QRIA 4CF7A 2I54A 4EI7A 3JSXA 1NDUA 2IEAA 2FSGA 2X2PA 5J2TA 1FK8A 1PRYA 3C6QA 4WQMA 3BQ9A 2HXGA 4H27A 1DPFA 4O2AA 4QUHA 2AXQA 2NZUG 5EQJB 3OI7A 4R9SA 3R76A 1DX4A 4C2AA 4EQZA 4TLEA 4PSKA 5IXJA 2ZBPA 5CXQA 5JZOA 4MP8A 2RB5A 4TYWA 3PWSA 3PUKA 4PRYA 4AQ7A 1DT3A 1PZXA 1WD7A 1TRHA 2JIRA 3LHFA 5EL0A 3BMOA 4DPLA 3CA8A 3BL6A 3ZX4A 2Y2VA 4KNWA 2BMWA 4W63A 4TUYA 1YQDA 3JR7A 4Y6PA 1NT4A 4DLRA 4EW1A 2XXAB 3WLFA 3AC0A 3K2IA 3Q2KA 1IEVA 1SBIA 3ORFA 3QTTA 4UHHA 1ZI8A 2H1CA 3AKCA 2I67A 1KDOA 2W6MA 2P5TB 4Q9JA 1YCHA 1TJ4A 3NDJA 4RABA 3LOPA 5KMGB 2O5CA 3HFJA 2VK4A 3VKFA 2BHNA 3KHKA 2CJXA 3AKZA 2OPBA 2REQB 2FEAA 1A5SB 3TB4A 3DDUA 5LB4A 5CXSA 4BO1A 2QRPA 3HUFA 1SZJG 3WQSB 3CG0A 1XQYA 4NEQA 3GJ8A 2ZYGA 4FP9A 4UVDA 5HXAA 2CXQA 4BPBA 1N9ZA 4JP1A 4C7KA 1P3DA 1M6EX 4LJ5A 3LT0A 5DWVA 4OMCA 3DBLB 1POWA 1Z62A 2XZDA 1T3SA 4PWYA 3I6MA 3LDUA 4NCAA 1KPIA 2LGJA 4H4EA 3SLKA 2C88A 1EJ6A 2XUOA 3KB6A 3FSRA 1W88B 3TD6A 1MFZA 4HTFB 4UDOA 2X9LA 2FSIA 1PVOA 1RKBA 1LTHR 2H85A 1WXGA 3TRHA 3TL2A 3D5EA 4M98A 4CMEA 2ZQZA 5LBUA 1E4VA 2J0UA 4TWRA 1WHTB 4PC7A 3F9RA 1T0UA 1FX1A 4E5MA 2HWWA 2DLNA 1XMXA 3PEWA 2JH3A 3UB2A 2PU5A 3ZE2B 5I4KA 1RC8A 3KKQA 2P0AA 1Y1KE 4F04A 1N34B 3OZBA 3U56A 4K9OA 1CLUA 1DADA 1YB6A 4O08A 4EG7A 4UEWA 2XB4A 4ETMA 2YJZA 4WH0A 3QWBA 4JXXA 5DWDA 2W2KA 3BICA 4BJHB 4AKGA 1AO3A 4CT5A 2AK3A 3FROA 3L7OA 5DGXA 4IZOA 3VR5A 3RAJA 3X1XA 5H70A 3CRZA 2HDHA 4PN7A 4HFNA 4UCFA 1LLDA 3NU1A 1U2DA 3MRTA 3SIPA 2DFKB 1XDGA 5IUKC 3UENA 4UTPA 2PN1A 3G0IA 4OEHA 3RJZA 4L5IA 3AP2A 1D4FA 4B76A 2ZCUA 3G8AA 3LBYA 4MUHA 3SQLA 1XCOA 3ZCVA 4J7UA 4P4UA 3EEYA 2AN4A 1M2FA 2QMOA 2YWJA 2UUPA 5EHGA 3COJA 1X7YB 2ID4A 3WMRA 1CUFA 2V55B 3KOOA 2C9DA 2IOHA 2QTMA 3G79A 4IP0A 4YAWA 1FLDA 1ZVJA 3EVEA 3IKLA 5EINA 2GBLC 2CJYA 1CT9A 3IH5A 5KIAA 3LY5A 1VP9A 3OE5A 4KO1S 3PL5A 4YA6A 4F2GA 4A0QA 1YE5A 1EA7A 1UAAA 4MQ4A 2Z9CA 4HI0E 4KFTA 4B4UA 4V0QA 4D4MA 4OMUA 3VDXA 1JB9A 1FSZA 3MQFA 1Z82A 4M4SA 5ISMA 3LDGA 4OF4A 4MS1B 3UMFA 4ZPJA 4IXNA 5DCLA 2HNAA 2ZE6A 1B2RA 2GXUA 3AUTA 3AUUA 4EPVA 1X1RA 1Y5NA 4MGHA 3ECSA 1GKLA 2OCLA 1VYUA 3WNVA 2VYVA 4J0JA 4EM6A 2GLXA 1H8ED 1AH2A 4Y0NA 4ZXPA 3EF0A 1VBNA 3DHEA 3F6YA 3WIDA 4F60A 4FONA 5GIPE 1EUDB 1PKEA 2KMLA 3DYBA 5DM60 4E6PA 4YT2A 3WHLA 3NJ8A 4DG9A 3STWA 3N8DA 1A9TA 3MN1A 5EP1A 5TEVA 3EUFA 4OFBA 5LL6P 3RSGA 1VSVA 1VIMA 5IVKA 1E0AA 1GUZA 1YA6A 4RSMA 2VXBA 4HADA 2QRNA 4W5HA 4WA8A 1M1NB 3E3LA 3D8BA 3M81A 1HSOA 1EFVB 1QCCA 1HV8A 1U3CA 2WHYA 3FUXA 4MRVA 3U3DA 2BKEA 2KSQA 4DV4B 5DN6A 4JOSA 3WLSA 4HXGA 1V3VA 3HB5X 1JAZA 4JOCA 4CEJB 1SY7A 3AIMA 2PQ6A 1ENZA 4LMPA 4W8OA 5BVHA 5JWOA 1QJ4A 4HYYA 1GPBA 2ZR8A 1WB6A 4L6CA 3G2LA 2G40A 2XE6A 5EXPA 2B25A 2O07A 3FI9A 3IV6A 3A1EA 3CZ5A 4GP9A 1PQWA 4QO7A 4AG3A 3DEKA 1SUPA 1QBGA 2FE4A 2XQGA 4N9WA 3ZBQA 1NV8A 4GLBA 3QEOA 1W73A 1E0JA 2IITA 2PMBA 2XLCA 4XCVA 2HBZA 3ST7A 3SC2A 3D4BA 3GP3A 3KCNA 5LA6A 3T1NA 1G21A 4K9DA 2OCKA 4ZQCB 3TLXA 3FD8A 5LN1A 1XHEA 2HIAA 3AF3A 3WRXC 2C00A 4F3YA 4IJ5A 4ZZ3A 5A5EA 3RU7A 3ZDZB 1K92A 1Q15A 1M6YA 1RZRD 2EU8A 2QI9C 4H9GA 4KXQA 1WXFA 1OAOA 4M7RA 4X8LA 3LBIA 2X0DA 4L7VA 2NXCA 3KPYA 1PV2A 1NU6A 2VNIA 3H83A 3VZBA 3I45A 1E7RA 3OFNA 3NQ41 3QFHA 1ZQ9A 4B85A 1O6BA 1I1NA 4TTIA 3AEUB 3RFTA 5LNK6 4MUGA 1PNOA 4QUDA 1LF0A 5KKCA 1ECPA 3CH5A 5B4TA 3GBVA 5DNWA 5JSHA 3QF7A 1EFAA 4PQFA 5EXEA 2QIPA 1AZLA 3H2ZA 4CR8A 1A76A 5M2QA 2YJTD 2WP8J 2R85A 4N6OA 2OV8A 5JXWA 2Q6IA 3U4IA 4OHVA 3ZHTA 5HJ5A 2XODA 1GYPA 2P90A 3O4IA 4AWBA 1Q11A 4Y6GB 5KTSA 1L6IA 1RWPA 2ECOA 3L6OO 2L42A 4MVJD 4UU0A 4Z49A 4CM7A 1SPXA 1SVMA 5IDYA 5H1YA 1MC8A 4PYOA 3SWWA 2V03A 3FNQA 4LBYA 4XJXA 4BWFB 5DP1A 4GXQA 1XLTA 4HB2A 2R68A 1Q1AA 2EFCB 2ZR9A 1V1MB 4JBLA 2OO5C 3GVIA 1W48A 3GW8A 3NO4A 1RBZA 1E5QA 1E5LA 4JLSA 1LSOA 2Q2NA 2EBFX 2ACVA 2Z0MA 4R16A 4ZAFA 4OI1A 3CIOA 4D8TA 4K2HA 1QG2A 1B6RA 4BBJA 3FPSA 2FXVA 2P2DA 1OIXA 2JARA 2QRLA 3AR2A 3QYJA 4Z1MD 3Q7EA 5C9ZA 2G6BA 2H92A 4Q3KA 4RKQA 1NURA 5BN4B 5K8VA 5AVJA 1TKBA 4OJMX 4Z0HO 3UKOA 4ZO8A 1YO6A 1IN1A 2DWQA 3QY9A 4OFZA 1CZKA 2YXLA 4NZNA 2IH5A 1NW4A 3LLVA 4RXTA 1MD9A 2W2LD 2OE2A 4F5YA 2GDZA 3L6EA 3V97A 3TRDA 4XPZA 3V7NA 3U31A 3OKFA 4NBNA 4A2CA 3F9CA 3C8HA 3LPDA 3I09A 4O25A 4M7WA 1JFVA 3G0CA 5G0VA 3SQWA 1JKJB 1DAKA 1OYOA 1ZR2A 1V39A 1QZXA 5DYNA 5HOQA 4QPZA 3DDOA 3OX3A 3UEOA 4E4TA 3I2KA 1ZK2A 2A8YA 3MJEA 3NGLA 2D4AA 4A9AA 1LFDB 4QBHA 1Q0HA 4X66B 1CUIA 1R10A 3AR6A 1H8HA 4DR1B 2BLLA 4JA2A 1CY6A 1XYGA 2Z4TA 1ORIA 4I55B 2ZIVB 3WRWA 2CV2A 2F1OA 2VK1A 1TQ8A 3FRHA 4CTNA 1N5DA 1UPBA 3DT9A 3DE1X 3ZU5A 2XWPA 1KIMA 3KAKA 2EG9A 4KREA 4AKIA 4O2BF 4QG7A 4D9IA 1ODKA 3SS7X 2M98A 1XN1A 1XXHA 1GPH1 1JXQA 2P8SA 5E6RB 2F3QA 1NE7A 2BFBA 1IXSB 1F8FA 4GPAA 3ZBUA 1P81A 2J8ZA 4DLNA 3VU9A 3NVKI 3D81A 1YIOA 1K9VF 1GTMA 4NNPA 1N7GA 5JWHA 4UNRA 5BY2A 2C31A 3P2EA 1JAXA 2QD2A 4CM8A 5FNVA 2BSXA 3OCWA 3HYSA 5IEJA 4CLOA 1X80B 1WEKA 2HU2A 5BSEA 1I7QB 1QGDA 5B7PA 5EZ5A 3AW9A 4YPVA 2J7PA 1KAGA 1I32A 4XFDA 3ONVA 3PQCA 3HPQA 5LLSA 2MU1A 3ZZ1A 4HH3C 3OCCA 1AUOA 2A5JA 4HV4A 4DJEC 3GLKA 2XDWA 4N6NA 5IHXA 2V6MA 1QRDA 1M54A 2C94A 3PLRA 2H16A 1ND5A 1V8FA 4K6CA 1A1VA 4UMEA 1NVMB 3AESB 3TKAA 4C29A 1AQJA 2PDAA 2QL6A 4U7JA 1SD2A 2ZPAA 1L5LA 4E5VA 4AO6A 4FFPA 1ZAYA 5CU7A 3R44A 1AMNA 1VZ3A 3CCFA 1Z88A 5BSVA 1CZLA 2PT9A 4EHIA 3OZUA 4RVCA 2HC9A 4PONA 1D5WA 1P45A 3CGGA 3IB6A 4Y0VA 1HTTA 1ZFNA 5JCXA 1UUFA 4BP9A 4Y18A 3TL3A 1EB8A 2WNIA 3LHSA 5H4GA 2ZJ2A 4EA8A 1Q74A 3ZHVA 1IM5A 3PC6A 4L3OA 1BQ3A 1JJAA 3DOUA 4PCLA 3WL8A 1Z4MA 2J3JA 3HHPA 4IW3B 1J8QA 1G7RA 4JBNA 3IC5A 3C15C 2CKMA 2WV9A 4OB6A 1YL6A 1W44A 5HGXA 1HX7A 2IEZA 1SKMA 3PUWA 1X0XA 4OK5A 4RYLA 4B2LA 3BKWA 4IIBA 4HS9A 2XYHA 2AMVA 3U7FB 3KHUA 4DXAA 4MQEB 2FUCA 3ILXA 3UUWA 4X1IB 3AR5A 3RS2A 2NVBA 3O92A 4P81A 1AHPA 3CF6R 4F3CA 4M53A 1M2WA 3MWJA 3COVA 5LKAA 4ZCSA 1STOA 3SQOA 8OHMA 3V46A 4ADSG 3KU1A 1CJVC 3DP7A 3NTLA 1KFCB 4HGRA 4B7ZA 4R51A 5ALUA 5J23A 2CBZA 4L5AA 4OGGA 1B0AA 2R8YA 4L2IA 4OL0A 1U3GA 5CW2A 5EUQB 3BJEA 2YN2A 3FTPA 3A4TA 4NEGA 1QIIA 3SZLA 1I7LA 1ORTA 1DQNA 3UV6A 3ZKAA 2YWRA 3ANXA 5KNCH 5L4SA 2DF8A 1T35A 4GC5A 3RREA 3CJRA 1KXJA 5DEIA 3DZDA 3QLUC 1NBWB 5CVDA 2O8DB 4BE4A 4NNOA 3SVTA 3ECAA 1EU1A 4HRVA 2ONCA 2W22A 3LBNA 4O1MA 1Z0FA 3RIGA 3T3EA 3BTOA 5T4FA 4F9FA 4LMRA 6REQB 2O5EA 3B7PA 4UVHA 3O4JA 4RIIA 5REQA 4UCXA 4E1VA 4G9GA 1TCVA 2AG8A 1GNQA 1PTKA 4R1TA 2G9NA 3GQVA 3UYLA 5ABPA 5JQGB 2RGBA 2WF5A 5DM0A 1L4LA 1GR0A 1R0KA 2I87A 1J9ZA 5FL3A 3LLUA 1HORA 2Z3VA 3IFSA 1AUVA 4TTJA 4MYUA 1Z5WA 2JAXA 3R7DA 4I4LA 2B1RA 4G1EB 2F9LA 4MKXA 3RUEA 4CVNA 4RD3A 1KU0A 2C8KA 1NHWA 4QU5A 5JPCA 5HQ3A 2X9VA 3MXTA 4KZPA 1MV5A 4KR7A 5JD4A 5LP6C 2C2BA 3RWMB 1T6BY 4GX2A 1G8JA 1HO3A 4E5NA 3EC1A 5L45A 1N78A 3PQFA 4PVCA 3ZDCA 3QENA 4NAHA 4ZICA 4W5NA 3PX2A 3MJDA 2XYVA 3F6RA 5DTMA 1DB3A 1SB9A 4U6NA 3IUMA 2Z1DA 1KS9A 2JBHA 1KGSA 5A06A 5J47A 1ESEA 1QVRA 4TS4A 4XQEA 3HR4A 1KMHA 5LP1A 1M8GA 1UXGA 2RHHA 3HBAA 1ST2A 2PEYA 3MCTA 4ZQEA 4ZJYA 4DADA 4CG1A 5EMKA 4FWBA 5ITWA 3KSBC 2OB2A 5AQEA 3DOOA 2Q49A 2ZI4A 1T5HX 5FOUA 2OCYC 5G02A 1N2IA 1M2VA 2LIVA 2B35A 2ZIGA 2ZP1A 4FXPA 4KB5A 3GEEA 3KAJA 3SR4A 2XRZA 1CY1A 3O93A 4M7OA 4JWKA 3S68A 4ZK6A 3GV0A 4DUGD 2Z8ZA 2XA2A 4ARZA 4BP8A 1ENPA 1ZNWA 1DLIA 2Z4RA 3OZGA 3TNLA 4BFZA 1KI8A 4BGEA 5AW3A 5KWJA 3CEPB 2Q29A 1QQ5A 2EP5A 2I3DA 5HBRA 4ED9A 4MWZA 3LWZA 1EFRA 4G84A 4CXMA 5K8UA 2BTEA 1C1DA 2OP0A 4ZXFA 1CEEA 2Z95A 2VF7A 4FKMA 4XGNA 3UGQA 4FMCB 4PWZA 3T7KA 2CXNA 2JFNA 3VHQA 2XADA 3G7SA 1PGNA 2G1AA 4C22A 2IHKA 4HRYA 1DEHA 2P4QA 2VCEA 3GDWA 1AZTA 3L1UA 4KV9A 1ZJ6A 4KYTA 2NPOA 3LPLA 4BQSA 1U1DA 1KRXA 4AJOA 5KOJB 1BROA 2ODAA 1W30A 1SA0A 1HEIA 2OAP1 3OTWA 4UCQA 1R9NA 4FNGA 3OO0A 2N0SA 1XZJA 4XLZA 2YYAA 3PIDA 1L4GA 3M82A 3J7TA 4ILEA 1LWNA 3PJRA 2D1QA 1JRLA 2I66A 1P9RA 1W2WB 2ZSIA 4RS3A 3SDSA 3BWDD 1V1JA 1CDZA 4S1NA 3VR6H 2PYIA 4FPXA 4Q9AA 3UJ7A 5C7OO 2B30A 4HCJA 2K4MA 5FUXA 5LU8A 2D3WA 2YRWA 3TCXB 5MN5A 1EXMA 4F8YA 4CEIA 4L4RA 4V1CB 5JDCC 3GJXC 1ZD3A 4G2TA 3UHOA 4C1BA 5HCIA 5ADHA 3X3HA 1VCIA 5J63A 3S2SA 4DAOA 5L3ZA 3ONFA 2RKBA 1M0WA 3AONB 5I8WA 4J0GA 1QM5A 1BRMA 3VPCA 2ZSKA 1CYDA 3A06A 5A1JA 1IQRA 3GROA 3LWDA 2HSJA 3R6GA 2NSYA 4FDVA 1U0EA 2F9MA 5TF0A 3ZJ4A 4DDWA 2E5WA 2B3DA 4BMCA 2WICA 5DGHA 1SIWA 1ZMXA 1G8PA 3P4UA 2BMJA 2NXNA 3OM1A 1VL0A 1SZCA 2HV8A 4GL4A 1HR0B 4BCBA 2Q8PA 4B3XA 2O8NA 1U4SA 3U4AA 1I13A 5DCYA 2B34A 4NFLA 3LHKA 1S2NA 4R8RA 5HKOA 2WJGA 4WK0B 1UBKS 4DKXA 5JNUA 1X1CA 2CB9A 1O6ZA 1ZD4A 4I2NA 1E4OA 2AMYA 4PHGA 4PR0A 2ZAOA 1MNQA 2P41A 5H4HA 5AW6A 1JH9A 2N1MA 3PVCA 4J9UE 3L7DA 4F3KA 1M5RA 3KXDA 4IEIA 5IYZF 1VJDA 3BORA 4DMMA 1FDIA 1JKMA 3IDZA 5B1YA 3HU2A 2ZCJA 2RHLA 4CM4A 1TZ2A 2CFSA 3GRZA 4OK6A 4EG5A 5DBIA 4ZZ0A 2J3LA 4N5LA 1QRRA 1CLEA 1GCIA 3MIZA 4CF6A 5C5DA 2VDWB 4ZA2A 3MJTA 3HLTA 5JJKA 4JVOA 5EIAA 5JYBA 2NPFA 3VVLA 4NZPA 3PU6A 1F60A 2A86A 2VTEA 2Y0DA 1PUIA 3IP5A 4FHZA 2Q9CA 4MRAA 7MDHA 4RF2A 1ZD9A 2PXAA 4DOMA 3W9SA 1RYDA 4PNHA 4C0KA 3V5NA 4KC0A 4YRLA 4LYJA 1Z6GA 1WVGA 2C57A 4ZOLA 3WK8A 4DV7B 1R74A 1CNFA 4ZIRB 2CDRA 2RAFA 4N4AA 5FOXA 5HMLA 1ZK3A 1RRMA 2YZMA 1SXHA 3EXHB 3D5QA 3HV2A 4PO8A 2C03A 2D59A 5CFPA 5KYXA 2Q1XA 4UD6A 1UOOA 1LVUA 3F98A 2RSLA 3KJGA 4MV1A 3ESYA 4X85A 5AM4A 4E31A 5IHPA 1LPOA 3MBKA 4BQRA 3ZR4B 1VJTA 1U02A 2VYNA 2OR3A 1KPGA 1U8UA 3C5EA 5TS3A 1BX3A 4Y6QA 3ICOA 4WFKA 5JPDA 4TTPA 1T3LA 2FY8A 2RH4A 4NE9A 4HUJA 4NL4H 4XZ3A 4LFCB 3DPUA 4C2TA 2PVCA 4O4HB 4UUAA 2MSNA 3R7SA 2ECPA 3AVYA 1D2EA 1LQ2A 1Y7HA 4LNAA 4MVJM 4OLHA 5HF5A 2HHJA 2VHVA 3NATA 1YU9A 2NYRA 3HCAA 1SOUA 4BNDB 4RDXA 1G6HA 1KP2A 2ZJ0A 4GU5A 5A0FA 1KDYA 1JIXA 2W90A 4XWTA 4XYEA 1Q1EA 5JC1A 4DL9A 4YVFA 3ZD6A 1Q7RA 2R2GA 1QFSA 2QB5A 4WBNF 1NHGA 1PUXA 1U0JA 3EIUA 1D6MA 1TAQA 4MRRA 1PJRA 1GG9A 2X2FA 3FFAA 5TDHA 1O94C 3Q1LA 4Z0NA 4QBFA 3RW9A 1XG5A 1PR3A 3KXPA 2JI9A 4YLEA 1A9RA 2EJBA 1ECLA 2DUJA 1HDYA 4Y9RA 2QW1A 3S2ZA 3MJCA 1AIPA 5MGBA 1DOHA 4JOQA 4JN6B 3QE9Y 2HQBA 5KTMA 3PFCA 1T5OA 1YDEA 4GF5A 4YX9A 4ZYYA 5AUNB 1W47A 1CEQA 2R96A 4V0NA 5GVRA 4JGBA 1ADBA 5A9SB 3K1AB 4ND7A 4MHOA 1S6YA 3ELUA 5J5AA 3RC9A 3SR0A 3EBLA 3DV0B 1CY8A 4B6SA 5BWCA 3OT1B 4F4HA 1G55A 5ARDA 4QG3A 3CX7A 2BELA 2C98A 1QE5A 1T9GS 1QO0D 3U3OA 1G291 2X7JA 3TS1A 2ZZKA 2YS6A 4JC8A 2JEOA 2XVXA 1ZSYA 3IDQA 3NAQA 1ZOLA 3BK2A 3GD5A 1VGRA 3CZ4A 4M1OA 3F2IA 4JSTA 5ALSA 3SVZA 5I9LA 1X7ZA 5JFGA 4UCWA 1E94E 3VNAA 5JH7B 5K0GA 3DBIA 4GYJA 1R16A 3FGPA 4Q1DA 3ROMA 3UWOA 3WRYA 2YHIA 3A9SA 4DXHA 4QYIB 1EZZA 3AG5A 4NYMQ 5IT9A 3O90A 2YWEA 5KX5A 1SQ6A 4NG5A 3RRJA 4EO7A 2V8OA 4OAPA 4ZHQB 2JAWA 1YDHA 2E6UX 2R7AA 4ZPXA 1CQPA 3OJWA 5JNTA 1PR9A 4IIJB 4KE7A 2VIIA 3BF7A 3DZCA 3ZCRA 5BOVA 4MKGA 5ILQA 3LX4A 3HXMA 4CI9A 4NSNA 2JHAA 2HA6A 1RQNA 2O05A 3RRMA 1A5ZA 5CFOA 2QG9A 3A4VA 2O7NA 1A7KA 1G17A 1U81A 1BA2A 4RCYA 2FU5C 1HYBA 3NP7A 1BGWA 3GMIA 1NXWA 4HDKB 4U7GA 3QWIA 1ISGA 2FJUA 3IO3A 3IKJA 3BSYA 4K03A 4H0FA 4YDHB 1DAHA 2I34A 4HT3B 3DF9A 5JLAA 5KYWB 1GRNA 2GNPA 1XQ9A 2JKZA 5E9WA 4HYEA 4YRTA 1YVUA 2QG6A 2P3QA 2PS1A 4ABTA 2I7CA 5K3BA 3UMSA 1TFUA 3Q41A 4HD8A 3COWA 4D8YA 2D6FA 5L3QB 1PDOA 3ANMA 4AYXA 1AQYA 3W90A 1U8ZA 3C45A 3KPUA 4YMIA 3LMKA 4Y6OA 4G5SA 3RM3A 1GAWA 2CKDA 3P19A 4MR9B 2WU1A 3RASA 2GZHA 3EMBA 4S0ZA 3SD7A 1WLSA 2GR9A 1ULSA 4WEOA 1IOZA 3PNKA 3O8NA 3M6VA 4PG7A 3RQSA 3U44B 3DZJA 5HJ7A 3A6KA 1I6MA 4TS3A 3FYTA 5IVPA 1T5SA 2ABWA 1SBCA 2CK3A 1TM7E 3DQZA 1YCFA 1T9ZA 3NAGA 2D1TA 3VSAA 4TLMB 2P6MA 1W6UA 3C85A 3DOEA 1XNQB 5BPFA 4C9BA 3G0OA 1N75A 1SVWA 2XNSA 1JTFA 2AB0A 1ODCA 3WB1A 4IDHA 4JI5B 4YV7A 1Q3TA 2WUGA 3P27A 3TDKA 1N2CB 4D9KA 4DMCA 2ZI3A 1Z8NA 3QFTA 2BD0A 4HVTA 1SMKA 3T9DA 1RPJA 3T95A 1AV7A 2RG1A 1GFSA 3NTVA 4Q7MB 1N57A 1Z6QA 2P6OA 3JATB 3UWPA 2UUAB 3MWEB 4OHOA 4WESB 5FR2A 1U0GA 3GHHA 4BX3A 4AF6A 4CKBB 1PFUA 3ZYCA 1JH8A 4NYJQ 2QAIA 3AIKA 3ANLA 5DBFA 1JWLA 3AHIA 1XZIA 1LDGA 1WPRA 2ZRPA 1US8B 3AGQA 5D3QA 4LF7B 3LCMA 2EIHA 4F7DA 1CRZA 4IEEA 3EQ6A 1RXYA 1UJMA 4N5MA 2XF2A 3K9NA 1XNHA 3TTYA 2A9JA 1B16A 3IMKA 1XA0A 4OMDA 4LYGA 5J2TB 3AHJA 3VOSA 2EFGA 1O96A 4O2AB 1ULAA 2GK3A 3EIQA 3JAKB 3K30A 2OHVA 3OOWA 5ER6A 4QT4A 3H13A 3IT3A 2DRIA 1U2RA 4FGUA 5FIUA 2A9PA 2AT1A 5EGNA 3GMDA 3NOXA 1YH3A 3PFFA 3ND7A 4L6AA 3F5QA 4F3NA 5LP6F 1HNZB 2HLDD 2P1RA 3BMOB 3GRYA 4D3ZA 4KRFA 2OOKA 2IEGA 3OLCX 1JAHA 5T4BA 3VOBA 2WIJA 3PXBA 4KXUA 4C08A 1EFTA 1PEAA 2OXEA 4ZV9A 1RM5A 3M4NA 2HR1A 1OBVA 1BWSA 2CUKA 3IHTA 2IZ0A 4U8GA 1QV6A 3RF7A 5AK0A 4JJ8A 1C8BA 1BWRA 1ZQ1A 1L6RA 3QVXA 1ISMA 4AJ1A 3PD0A 4GP7A 3PC7A 1MXFA 3WNZA 3U4HA 5IFLA 3DG9A 3K71B 1FDWA 4LDQA 4RVDA 1UK8A 3DE5X 2O2ZA 1HNNA 1QK5A 1RZVA 3B85A 5DT9A 3ZWMA 4LEIA 2PGLA 3UJNA 2QPTA 3PFHA 1RJGA 1B73A 2ZRCA 1XNJA 3HYNA 2BSQA 4L8VA 3SHWA 1HZJA 3ZNQA 4RTNA 3A1SA 2B2XA 2Q3DA 1ACMA 1IXZA 2XCIA 4D9EA 1THZA 4UM9B 2OYRA 4YRMA 1I7PA 1UMDB 4TTSA 5F76A 3NIBA 3GAFA 2GB4A 3TLGA 4D9GA 2FWPA 1ORDA 3F7MA 4M0KA 3RO7A 2Q6KA 4TRRA 1PI3A 4Q1EA 1BOFA 1J0AA 4PQEA 3D4NA 3VPGA 4F6LA 1R0CA 4RNDB 2L0XA 4R0NA 4DLXA 1K4YA 1X9IA 1Y8AA 2W93A 2J0UB 4HDOB 2JGFA 4YJFA 5AM3A 2ZM6B 2W43A 2W2LA 3PDHA 1IZZA 1GNLA 5A3SA 3GYGA 1UZUA 3BH0A 4Y9UA 5EE5B 2D5BA 1FZQA 4FFDA 4FKBA 1GJRA 5IC6A 4XWGA 1PW7A 3QUAA 3ZV6A 2H2AA 2WW8A 1GXSA 5AQ1A 3GLRA 2PKCA 2C2GA 4ZCRA 3QP9A 1P2VA 2XYQA 4FHFA 3V4VB 4MEJA 2BZSA 2W2KB 4E5KA 4HFMA 5JY6A 2HWUA 1NJ5A 1O9HA 2W4QA 4LPSA 2Z6UA 3A1NA 3WWYA 2H3HA 1N0UA 2W71A 3FHTA 3IPXA 4D8XA 1TUBB 3HB7A 3NG1A 3W5DA 1A8PA 1PS8A 2O7QA 5E7MA 5LXTF 3BJMA 1BE0A 3BWCA 4GOND 1Y0BA 3NV7A 2H0AA 4C6TA 2D7DA 4MV7A 1I24A 3L49A 2W2VA 4IIFA 2QX9A 4V0LA 4MRNA 5AP9A 4BNZA 1C41A 3HDTA 4CMHA 4EECA 3AOEA 3KLNA 4NBKA 4HXYA 1HT1E 3IUEA 5CCDA 5JS2A 1BKDR 1IG3A 1KVSA 3B12A 5ECYA 4ZV7A 2H9AA 3R9KA 3RC2A 2NN3C 1CDOA 1WEHA 5AJVB 1WUIS 1R5BA 1DOZA 3EDQA 4Q9LA 3VH4A 5DHRA 2Z3WA 4WOKA 4BNVA 4IJWA 1X7WB 4IGEA 1BJRE 1T1GA 4OYHA 4Q24A 1RXSA 3GHYA 1ONNA 4L3VA 3AFGA 3EQZA 4TLBA 4C89A 3MRSA 3D3NA 5IK2D 2Z5FA 3GMSA 4OH1A 3SOZA 5I8ZA 5KNCD 1HDOA 2FCAA 3RRXA 3A9WA 4MVJI 2VQ3A 1FJ2A 4I5FA 5DNCA 3OLVA 1ZW6A 2YWBA 5JS1A 2GNAA 1NNEA 4IS2A 2QLFA 3Q10A 2FZWA 4XGKA 4C0QC 4K88A 4LVOA 4YBZA 5AI0A 3RV4A 5JANA 2G9QA 4D0LB 3T1VA 1NLMA 3CLSD 3KR1A 5HRAA 1GKUB 5JY1A 2F6RA 3TE7A 5GOTA 4AF8A 4FT2A 4W5QA 3EG5A 2QVBA 3ZHCA 4V39A 4UVGA 4DIOA 2Y99A 1F9AA 1JMKC 1S7CA 3E70C 5INTA 10MHA 1YVRA 1WSDA 3KR0A 4AZ3B 5K0CA 1FUUA 2CDAA 4ANFA 3M1IA 4D9JA 5CFQA 5K0SA 1IWBB 1J2TA 3DOIA 5KC9A 3QIVA 5IANA 3G5AA 1BMFD 1Q0RA 4BOYA 4LF4B 5F9HA 3OU6A 1RWMA 2QYHA 2GUWA 4DSNA 1OB5A 4CGZA 3OPMA 4ZRNA 2V7GA 2WF6A 2AOWA 4U2CA 1RLUA 1SXJD 3AJEA 3JRWA 3QZUA 4J2HA 2QUZA 3VH3A 5P21A 4ICIA 3O3CA 3K2EA 1PYDA 1YAHA 4N3GA 3VHRA 2VNSA 2IPNA 3R7NA 2C7RA 4R8SA 1XTKA 2MMCA 4LJYA 4A8JB 3H5WA 2XCQA 1Q57A 2QUBA 3WX0A 5HZHA 1CS4C 2YY5A 5BSUA 2I5PO 2CBXA 2EKPA 2QR5A 2ZREA 3P96A 2FWJA 2I4TA 4OBWA 1K6XA 2J87A 4K86A 3TR6A 4DB2A 4DIKA 3QOFA 4QPDA 3ZHRA 4LMBA 3JWHA 5GV7A 4KIFA 2VF5X 4BV8A 3U9LA 5GOZA 2FW8A 2GERA 4P7FA 4O4IA 1L4BA 2WVHA 2DHDA 1XUOA 3ADKA 4PSAA 3HB0A 4MW6A 3ESCA 5FEUA 3G8DA 5HSGA 1P1JA 3SC2B 4LWPA 2OV4A 4ISBA 1G21B 5LA6B 5JBQA 5JO9A 3V8VA 4X7RA 1TOAA 1L4MA 4H7DA 1TEZA 4LWZA 3NHMA 4K2AA 5CFNA 3Q9SA 2ODWA 3R4CA 2NUAA 4BVAA 4XWOA 5DNUA 2AFRA 4W99A 2CC2A 1XMQB 3H7AA 1NX9A 2AOUA 5I48A 4JR2A 3NWOA 3T4PA 3HXTA 3R6WA 3GLVA 4E2WA 2ROQA 3EISA 3FNHA 1FFHA 1H3FA 1TLLA 1CS0A 2EBHX 3WHPA 2QU7A 3RE1A 2QAGA 2XJ4A 1OU4A 4OUDB 2DJIA 4X20A 4DSUA 1E2BA 4CKXA 4A8TA 4XDHA 1GQYA 4IDFA 1PDVA 1W4LA 3KKOA 2AJ8A 2RC6A 3SZUA 2FDRA 2DFNA 2VJLA 4TRMA 3KKPA 1YE8A 4YGYA 4JUDX 4BB9A 1L5WA 2EJTA 2YL2A 3U40A 3GLGE 5LZ4A 3EGDA 3MTQA 5A3JA 2XCUA 5BMVA 4KUHA 1Y6GA 3RG8A 4JELA 2GPSA 3PFBA 4LI0A 1S01A 1I80A 1NVXQ 4UREA 4ZI7B 2JCXA 4Y2PA 2V45A 3DMTA 1F06A 2XVYA 3A3YA 4A26A 3SM9A 1M2EA 5F1OA 5C7LO 3KPJA 4RH3A 1A2OA 3GJ0A 2YXPX 3T9CA 4BIIA 1A9YA 3MGAA 4FZVA 2R97A 1W1UA 1Z3CA 2PUWA 3ROZA 4AYWA 4PG5A 4BWYA 1XCLA 1AKEA 3L8FA 5J2UA 4S04A 2G82A 1KAEA 3C7CB 4J0FA 3WWDA 5LPNA 3ZVKA 3AH8A 2MHCA 4QUKA 9ABPA 3GLUA 4BRWA 5L8VA 5KWIA 1R5OA 2AWNA 3OOHA 4Y2JA 2ZJ3A 3Q9UA 1X1EA 2O1SA 2Y1CA 1XE3A 3PE4A 3TW6A 1RBQA 2IYPA 4GOXA 2LR0A 3NORA 4D9NA 4EGQA 3SC3A 2HRRA 5H16A 3JQ6A 1SU6A 2AHOA 4RA9A 4OBXA 5DGIA 4D6PA 3DKKA 2BR4A 4HNSA 1RI4A 2I29A 3LCCA 3LM8A 3K2BA 3HDGA 4N49A 1U7WA 2IHUA 4F46A 3LECA 2OCBA 5CLIA 3TMKA 1HNWB 3K35A 5KNBH 2O4CA 2JIBA 3GAMA 5LMZA 3FUCA 1Y1RA 4YN3A 4NR0A 1E69A 3PQ5A 1ELOA 4B3TB 4HUQA 1DGQA 4BU1A 1BFKA 1YHZA 1E6LA 1G2IA 2WM8A 4YMWA 5AUQA 3WQQA 4Z7QB 1WABA 1NVKA 3WJ2A 3I32A 5C4GB 1P60A 2ZTHA 1MQAA 1PT5A 2ZCVA 5CG2A 5KJFA 3N0RA 1IN8A 1Z4OA 4WOCA 2FUEA 4FGZA 3KCQA 1OXVA 1MX3A 2PSEA 3DOCA 2M9MA 3GG2A 3KOUA 2YVLA 4GWLA 3SX4A 3WOVA 2I91A 1U9JA 4BQQA 2IBMA 2ZIXA 3U6KA 2PO5A 5COQA 3UA3A 4BGUA 4TTVA 1DX9A 2HA0A 2X5KO 3DC2A 3N8IA 4TSKA 4UU1A 1VECA 3P2IA 5D51S 3RBAA 5A71A 1IRIA 3D4OA 1IN4A 1KZ7B 3MOSA 3P9NA 4P7JA 5FR1A 3WY9A 4EUSA 3WRYC 2BFBB 3CY6A 3NYRA 1COWD 2A9KA 3J80A 3LF2A 1FMCA 4BASA 2ONJA 1CG6A 3NDBB 4CIXA 2BRUA 3KL4A 1KZHA 3FYHA 4QAJA 5BR4A 1J2YA 4CM8B 3QJYA 5FNVB 2HSZA 4JLDA 5DGTA 3H6GA 4CLOB 1GAEO 1UP4A 2J3EA 2VOEA 4BRUA 2UZ0A 1E9BA 1YZLA 4H16A 5CH5A 3OJXA 3WLRA 1YC5A 2J48A 4XDYA 1P1IA 4D6YA 1WF6A 5EWLB 3ZOKA 1LX7A 1HL7A 3QA9A 4ME6A 3SIRA 4DMHA 5MGNA 1E20A 1EXWA 1IDOA 3GJSA 3IX7A 1E2PA 4JYBA 5CVJA 4M54A 4EB8A 3K15A 4LXHA 4GPTA 4QDTA 3WMEA 1N2SA 4RSGA 2FRXA 5AFSA 3C3EA 5FI3A 4PS1A 1U8CB 1RYZA 2P75A 2YFQA 5JUWA 2FR8A 5H7XA 3L7JA 3TGWA 4X0EA 3W9UA 2QRZA 4UATA 1VRWA 2E4YA 2PUFA 2HRQA 3KAQA 3RDPA 2WIGA 2FPMA 4EHAA 3KBOA 4DIFA 4INPA 3RS0A 2W6OA 3KDAA 2ID9A 1U1GA 1CUVA 1SUSA 3NC4A 4OHRA 4RORA 3VJRA 1XK7A 4CL3A 3V4OA 1XNRB 1YZGA 4S1PA 3THSA 3NKVA 1U7OA 2VC2B 4RLQA 4WZAE 1ATIA 1CIPA 1EE2A 2H9YA 3DTVB 3OPNA 3RVKA 3DLCA 2J3DA 2W2OA 1YL5A 3T06B 3JQFC 1NG9A 1GV1A 4LC0A 3TAXA 1F2UA 3FE2A 3KOXA 4JP2A 3AUAA 5D3MB 5TEWA 2QLLA 3BFPA 1C4WA 3N2LA 4H1TA 4YAKA 4NFYA 5GIOE 1QMGA 3EZ9A 3EAFA 1NYLA 3RU3A 3V1TC 3UWDA 3NXKA 1JLLA 4GYWA 1MW8X 3RCBA 3B2QA 4GPZA 2WKWA 4YWHA 4ER6A 1J5EB 4L2IB 4BQEA 2JJ1A 2EIXA 4C0JA 4CN8A 2HK6A 1XMSA 5EC8A 4DDTA 4M55A 1EX1A 2P65A 1CERA 4QUAA 4WCDA 2YFHA 5BV0A 1ANKA 3PLNA 5TQ0A 2XRMA 1XI2A 1LK0A 4BX8A 1IUKA 2AJTA 1ZZGA 4KXFB 1HKUA 1N5KA 4G5RA 1NVWQ 2ZIFA 2A92A 1WZEA 2ZYRA 3AX6A 5HK8A 3VC3A 4G1CA 2AWOA 4FR2A 1PNVA 4R1UA 3UZUA 1R64A 4GSYA 4OG2A 3DNFA 4EJSC 3P0FA 3NYIA 4AO7A 5REQB 2P4SA 2GBCA 3E1KA 4MWTA 3Q8MA 3FTQA 4K87A 1N6HA 3KLBA 1NUQA 2VTDA 2FB9A 2WV7A 4YNBA 2OHHA 3ES9A 2FH5B 2ZR7A 3GZ4A 1SB8A 2Z98A 3EA4A 3M83A 3PHCA 4YQZA 3ZE8A 2R60A 1S3GA 3EXFB 1OFUA 3PWTA 3LS2A 1VCHA 2D74A 4PXAA 2FEMA 3I9KA 2OBXA 5CM2Z 4U9UA 2HPAA 2JLAA 4IOLA 4WVLA 1ZOSA 4R1NA 2BDEA 3TRKA 1KXZA 3AI2A 5T57A 4ZJUA 3IEKA 1EPUA 5D3ZA 1MU0A 1U80A 3FMPB 5FV7A 4M2LA 3S70A 4BXOA 3GGCA 4B0OA 4PLTA 3EVAA 1GTSA 3K5PA 1KP9A 4OMFG 2VQDA 5A5GA 5LU9A 2Y6UA 4C7OA 1D1PA 3DMYA 1E1NA 3OFKA 2DQZA 4MIKA 3SXUA 5E7IA 4LIPD 4MB0A 1MRSA 3D31A 3VPXA 4DANA 5A7FA 1V5WA 4R4JA 3WKCA 4OCZA 5J1SB 4P1ZA 1II9A 3PFKA 4UZEA 3EWSA 4IDOA 3U3ZA 4CEHA 3AUSA 1MT0A 1VRCA 5DLQC 4G97A 1YCGA 4A4DA 3Q8KA 3KSZO 4UARA 4X61A 3VV3A 4CIAA 5JSKA 3REGA 1RYBA 2AMFA 3AYXB 4G8DA 4G0PA 3M6AA 3MZ0A 4PS0A 1V6SA 2GTPA 3E22A 3QMVA 3GGGA 1IPHA 2XVAA 3Q87B 1JQDA 4UQOA 2H5JA 2A5YB 3TW8A 1GM5A 4JJFA 1M2VB 1LZKA 3CKMA 4Q4LA 5E0OA 3N59A 3MINA 4K9NA 3DVQX 3TEMA 4JL6A 4V3CA 2Q3BA 1YQWA 3EVBA 3MQ2A 4RAOA 1VKNA 4C7OB 2G4LA 4ARZB 1TU3A 1LPNA 3SBOA 3IRVA 3ESAA 1C4OA 2P2NA 1VKZA 3AF6A 3OPQA 5H68A 3G1TA 2FKNA 4G36A 4URWR 3R8CA 1TO1E 2QE6A 1TTQB 2QS9A 3CWZA 3LA6A 3AGPA 4ZC8A 5TB5A 3M4JA 2ZDQA 2ZJ6A 5CYOA 3SFZA 2GM4A 2XA9A 4BNIA 4NOMA 1UJ6A 2BHLA 2Q2WA 1YAJA 4ZVLA 2OG1A 2IDMA 1E2FA 4G8CA 4BMXA 1JE0A 4P3PA 4AKHA 4F91B 3P9KA 2GKSA 4Y2HA 3WBJA 4C3UA 4I4NA 4I1IA 2YV2A 1HLDA 4PYLA 1RJ9A 4Q7LA 4OFXA 3RSLA 2AH5A 3R2JA 2Q0QA 1EQAA 1K88A 1RRGA 2Z2KA 3DE4X 3TOVA 4BCDA 4I9FA 4PYQA 2V0GA 1RAAA 3I2JA 2NVOA 3L8GA 2XT0A 1M1XB 2HPHA 4Q4HB 2V6GA 3CUYA 3DDHA 3AIIA 4WXEA 1WXXA 5GMOA 5BVGA 3BMCA 5BSFA 5KU7A 3GD7A 4QHYA 1ZIYA 3WYNA 1WXQA 3A6GA 2C9MA 1ETHA 1O89A 4ZAWA 3ZDFA 2YWDA 3BB4A 3HB9A 2PBZA 1NT2A 2EOAA 4GDMA 4KWEA 5E2AA 5K3OA 4TN1A 5LDDC 2JGDB 4EEZA 4TMZA 1A97A 4INOA 3DKRA 5DOVA 3QXHA 4KSBA 3TXXA 1X1BA 4ZCQA 4XVCA 2XUJA 4RVGA 4UU8A 4G07A 4A73A 2HFJA 2J3MA 4WASA 2DQKA 2JJ2A 2X1HA 4G1MB 4OQYA 3B6EA 4H1UA 4WJZA 4WUTA 4WV3A 2D2EA 3EHEA 3WIEA 2QJOA 5LUAA 4HDRA 4F84A 3Q3IA 2YJ5A 3RTGA 3DW1X 4BB0A 1JHRA 1YBMA 4IX1A 4E14A 2NX2A 1DWOA 3CUWA 4RA6A 4XA8A 5C5CA 1JEOA 1SCBA 5C8VA 2G5CA 3E9QA 3VPFA 1RI5A 1CB7A 3RU2A 3PFGA 1AB6A 2GVDC 1HLGA 3G0GA 3L5OA 1SG6A 4INJA 4KUGA 4LOIA 4E03A 3FWPA 1H85A 3GARA 5ALWA 3O7WA 1CYEA 3A0RB 4PBTA 5GJVC 5CLFA 4ZDKA 1C3OA 4RF4A 3SZMA 4AJEA 4YCSA 2KS6A 3RUCA 5IM4A 3DR3A 4YRCA 3W6ZA 2R8BA 3JQ8A 4QT0A 4F11A 1OD6A 2GBPA 2HF8A 2QDKA 5H81A 1XD8A 3UMRA 2N1BA 1T4GA 5FORA 4RZ2A 4N0DA 5HTKA 2ZYTX 1KL7A 1TKCA 2OZLA 4F5EA 1BHSA 4XPIA 4E3ZA 4P2BA 1D4OA 1K7XB 4UVEA 5FOSA 2XEXA 4INZA 3R24A 2PH3A 3PFWO 1IBKB 4KIJA 1Z0JA 5DT2A 5HP4A 2G6TA 1LUAA 2AC7A 4JQOA 4S1WA 4HOYA 3ETJA 1IMJA 3O73A 1XD2A 4KFUA 4EKDA 5B4UA 3GLGB 1AJEA 2XQFA 3KOWA 5IU6A 3FNIA 4I5EA 1UJCA 2JLUA 1KY2A 1RKQA 4PCAA 1RRVA 3Q8LA 5LCXA 2GF9A 2GZDA 1XXLA 2PH1A 2Q46A 5A1TA 4MUBA 5FBWB 3N2GA 1YRAA 3P52A 2BFEA 2CFOA 3S1AA 3I34X 1PZGA 1JX6A 2VSYA 1PYOA 1SCJA 1EG2A 4D80A 4K28A 1OBCA 5D5HA 4CRWB 2Q1YA 3LTEA 4O1HA 1XNGA 1JG4A 5G40A 5U9CA 5JNSA 1TYBE 1JDBC 5FOQA 2DC1A 3N39C 2N46A 3GUCA 2H1LA 1K2VN 4B8ZA 2YDYA 2DSTA 4N1AA 4QBKA 2JCGA 4XAQA 2XYRA 4BVKA 1DEOA 3HXPA 4I2VA 3BRWD 3VR4H 4YP5A 4NJOA 5TJ9A 3DCIA 3D5TA 4HQ0A 2OBBA 3EJWA 4FDLA 4YP7A 4E2XA 1DV1A 3A70A 1QGYA 1CRPA 4L5CA 3NBQA 1LD3A 5D85A 2GYUA 4RPIA 4ESOA 5EIEA 3PNOA 3HH8A 2OEPA 2C0QA 3TPCA 3L6DA 1HETA 1GR1A 3DUWA 4JUIA 2NU8A 1QFMA 1OZGA 5FLXA 2VWPA 1GZVA 5K01A 4AC9A 4L27A 4R8KA 3JWJA 1RHJA 3NRCA 3UG6A 2PX0A 5H5JA 5EWMA 2CNWA 3ADOA 4WXRA 1EMDA 2JEZA 3UK6A 1Z37A 2OQ2A 3TKYA 3IQGX 1OC2A 4L4SA 2HLHA 5FHRA 1QKIA 2ZWMA 1GUAA 3DMTC 5GJWC 3KHTA 4J75A 4GKKB 1JQ5A 2GZ3A 2H1VA 1W49A 4A2PA 3BAZA 4MJ3A 4B6PA 4ERXA 2GN2A 2W70A 1TADA 5JXHA 3IUSA 5ECGC 4MTLA 2TYSB 2HQOA 4QM7A 1XKXA 1PHPA 5JNLA 1R4ZA 5GP1A 2W6JD 3I73A 1F17A 1DZ3A 5BRJA 2YJGA 3A9TA 2B1JA 1E3TA 2CLSA 3EWIA 2F8MA 4IILA 3VYTB 3OE7A 4ZVOA 4EH1A 4Z4GA 4MDHA 3PDWA 4L8LA 2YHIB 1SXIA 5F3RA 5ARBA 3C6ZA 3MS4A 1KYVA 1HBJA 5JAMA 2Q5IA 5D2CA 3T7DA 3QBTA 1F3LA 2BFOA 3GA5A 3FFTA 4HZUA 4K3VA 3EGEA 4YJHA 3TIVA 4LGVA 2XRFA 2OBFA 5BN5B 1GL9B 1Q3KA 4IGAA 1GADO 3AWDA 3ITNA 3R0IA 1G4UR 2OLKA 5JSYA 4WZBE 3SE0A 1UZMA 4BVBA 3B7WA 3NI2A 3LQ4A 1SCUB 4CKYA 4AJ4A 1JHMA 1L4EA 1U28C 1Z13A 3K9QO 1H2RS 2FGKA 4PLWA 2IELA 3HVHA 2XOKD 4NMXB 4MQ6A 1SWWA 3SC6A 5HTOA 3V7FA 2RGNA 1EDZA 4BO8A 1C9EA 1KDRA 1SBNE 5L6LB 4OKNA 2JCBA 5E9QA 1RAHA 5KYTA 3BGSA 3GEHA 4YP0A 2NO7A 4RK7A 1ZH6A 3U4GA 3RTDA 2AMLA 4MGKR 1DKQA 4LJRA 1BMTA 3OUTA 1XZKA 4PQRA 1M1ZA 5I5EA 3KEOA 2PMDA 1SAYA 1ZCJA 1E9RA 2OSBA 5E6SA 5IWCA 4RELA 3HR7A 4A8PA 5KNLA 1IZ7A 1JHUA 2H1IA 3EZYA 1NJ2A 3M5PA 3SSNA 2FFQA 1VM6A 2COKA 4AJ9A 4YUZA 2H7YA 3U09A 3MAJA 1JIJA 2PS9A 2ZI6A 4E5YA 1RQ7A 2O48X 2ZAYA 3L06A 3G1UA 4KNVA 4Q1VA 4ZQBA 5I9IA 4HVLA 2HU7A 1NI4A 1X7HA 1H6AA 4WXMA 2R8EA 1FPQA 3BHIA 4L4UA 3BL5A 1T9DA 1KARA 2X8JB 5C37A 1NVVR 4NEHB 4K9PA 1GPMA 3ZQJA 3NHZA 1U6IA 3RBXA 2MR5A 5F1YA 2J0EA 1NE2A 4KQIA 2G0NA 1KI3A 1EAMA 2NIPA 2CLEB 4QOJA 2A59A 3TJZA 3OA0A 2GEKA 3QPCA 2H29A 3HNOA 5B64A 3MT8A 1PGQA 1W52X 1ADCA 2AKYA 2XCLA 3C74A 4BFCA 2O8BA 1NP3A 4KH0A 3DMPA 3RVLA 2QPLA 3IELA 1W87A 3CVWA 4XOIA 2X0JA 4U9IS 5NLLA 2VP0A 3R09A 1XVLA 4WFIA 3SE7A 3PWKA 3KYDB 1WAMA 2R5WA 5CDSA 3L7MA 1A4RA 3KQHA 1WZ2A 1B8PA 4BYMA 1PR2A 3GOHA 1Q6ZA 1W59A 1MPTA 2FUNB 2O2XA 2WIBA 3IERA 4BO3A 1ZX1A 2P9GA 3BZWA 5CDHA 4ZO9A 3ZGOA 4WAUA 2B4KA 2Q8QA 1L7BA 1E2NA 1IVNA 1QR6A 3B9BA 3EXHC 4L07A 4C7JA 3E4DA 1U5AA 2HF9A 4TYQA 1FIUA 1SU7A 5AOVA 4DCUA 2NUPA 4D25A 3FNRA 1D3AA 3C3KA 2PZKA 1IXRC 2IUEA 1QZUA 2WHEA 1JG1A 3AF5A 2W6ID 4IEFB 2YHSA 3AJAA 4LSGA 2H5EA 4RCZA 5THQA 2XJ9A 3ADDA 4MR7B 4Q3CA 3E9DA 3VR3A 2W6ZA 4F93B 4H3SA 1KI2A 3GEBA 3TZKA 4Q01A 4AXBA 5DKFA 2AFHA 5G4KA 1DAGA 2R6JA 4JJZA 1U31A 4BVGA 3H4VA 2ZGVA 4S2UA 5FO0A 1Z0SA 2ADFA 5AVWA 4I8IA 3SMQA 1YUNA 2GARA 1X9GA 4F4FA 3EX7C 1DBWA 2MYTA 2QRGA 1NMQA 2IWRA 3SI7A 5JAZA 4P82A 4D4KA 4TVOA 1E1CA 5D5QA 1B41A 3CX3A 4HAWA 4WL0A 4JUCA 3E9ZA 1D1TA 4M9QA 4PO1A 4P3XA 1LXCA 3MAGA 3FGOA 4ZCTA 4NXNB 3P7MA 2BI7A 1Z4PX 1I2ZA 1RP1A 1U2ZA 1RFLA 2OHGA 4C7VA 3QYPA 1OLSA 1YOVA 2HHAA 3B6ZA 4A6DA 3GLIA 3TLGB 5BQOA 1YRYE 2R6GA 3OQJA 1GPYA 4UZFA 1REQA 2HNBA 4KQ6A 4BKQA 5JALA 2QTNA 4QYWA 1PGOA 4REQA 5IKXA 1SN7A 3ZWYA 4I55F 4HGOA 1M0TA 3I64A 2DP4E 4GQAA 1SH7A 5HZMA 5JVDA 3GPIA 4YJFB 1QHEA 1L7VC 1SEVA 3PNQA 3LQRA 4CV1A 1XF1A 2H65A 2O2EA 3V8BA 5JQWA 2F67A 2X9GA 1L4KA 3TECE 2JIQA 3N7AA 2E4ZA 4Q0MA 5TIIA 1BCSB 1A9PA 3EF1A 4M38A 1GXSB 1I3OA 1C9NA 1KDTA 2OESA 1QIEA 1PFGA 3TOSA 3W5SA 1EK2A 3A11A 5K6RA 3IR7A 1FNDA 1O97C 2ZKLA 1AUXA 5JAIA 3RWBA 2ANBA 3BZUA 3F6SA 3ZXIA 2YY6A 3MWFA 4QXQA 3MRVA 5IKEA 3A1DA 1CE8A 2HPZA 1LY1A 3GJRA 4ZAZA 4PW0A 1SKAA 4D46A 4QVGA 4D0NA 1Z07A 4ZGGA 2ZQYA 2OBYA 1DU4A 4C6TB 3U7GA 2DFVA 1KQGA 3GA0A 1AF7A 4HEQA 2J09A 4I08A 1GSOA 4QYSA 4BAGA 5K05A 2JD1A 3G1WA 5ENVA 4JR0A 1IK4A 4KX5A 2BJVA 2R5FA 1E5DA 1FY2A 3VJKA 1KQFA 2HIMA 2J33A 4MITA 1FDUA 3QEBZ 4A0GA 4X8HA 2QR2A 4J90A 3KZKA 1DTWA 4NU6A 5CX1B 3VHXB 4IH9A 4L76A 1I3KA 2RK6A 3UT0A 5LZ5A 5HIIA 2CSUA 4IF4A 1EXVA 2X6TA 3S8YA 2QM0A 3BA6A 3I2YX 1UJBA 1ZUNB 1L5GB 4YMGA 1KOFA 2GJKA 4HTAA 2DAPA 1V4NA 5LYYA 1XL0A 1KKLA 4CCAA 2CL7X 4G0MA 5JRDS 1XKQA 2B94A 4NDNE 4IO1A 1KETA 1W4ZA 4AKEA 2PQMA 3MD9A 3PXXA 4G9EA 3VI3B 4C4ZA 2R00A 1UBJS 3QKSA 1MUUA 1MX5A 4Q39A 3ZDQA 1RI1A 3LI2A 5FUVA 1NVTA 1HMYA 3FYDA 2QRQA 2RKOA 4G0NA 4JT8A 3D7NA 5E95A 4B6GA 3N07A 5AKKA 1PJ3A 4DMGA 3PR2B 2IHBA 2G5TA 1NBMD 2HRCA 4MA0A 4ZC1A 3ZVRA 2OCDA 4IJMA 3UT6A 1UZLA 4EAAA 2WIKA 2C8LA 4C05A 1UQRA 1X13A 1GTJ1 2ENWA 2EFJA 5FUYA 1GGFA 2VRCA 1UODA 5A62A 5JROA 4NYIR 1VMEA 1L7MA 3ORQA 2JBWA 4DCCA 4PZLA 2FPXA 2AN9A 4KQHA 3FWYA 3LRTA 3UW3A 4X7PA 3RJTA 1BW9A 1VJ1A 2I55A 2J5BA 4JWTA 3BXOA 4JVSB 1VDZA 2ODTX 3HSKA 3OQVA 5JW6A 4B6RA 2FPRA 1J33A 1DUIA 3DYVA 3H9QA 2JHGA 1TNDA 3EC2A 4MUFA 3WYCA 4YUWA 5A7HA 2I9KA 5KVSA 4M83A 1EFDN 4M9XA 1BS9A 1KI6A 5CT4A 1GTL1 3GFRA 3UHFA 5AI5A 3K05A 4XX0B 5IMBA 1UJ5A 3KJQA 4GT1A 4FOSA 2YTZA 3SICE 2WTAA 4IICA 4ZTUB 1G5IA 5CD1A 4PFKA 1UFRA 2WIDA 3QVMA 3AMVA 1IN7A 3I2GA 4OP1A 3ZCXA 2RGRA 1NX6A 2RIRA 3I4FA 3H18A 4ZFNA 5LOVA 1SHJA 1EKXA 5JQGF 1LRKA 4IH1A 3ZU4A 3BD6A 4JKIA 4H7FA 2JGNA 2DPHA 4FIDA 3L7CA 1NNUA 5B1DA 1P75A 1L5MA 3CLRC 2WIFA 2VOJA 3TRFA 1C4XA 3C8MA 4QOFA 2F43B 1E9AA 2H11A 5ERXA 3FWHA 4C01A 4QGGA 3T3PB 3ASUA 3JW8A 3WDMA 3IP1A 1T1JA 5KSWB 3LVBA 2IZOA 3MT9A 4N40A 2IYLD 2WQZA 5CB6A 1W0JD 3RHZA 1Y5MA 3NH9A 3JQBC 1XTJA 2E2WA 2FSVC 4DM7A 4PC3A 1TYEB 1LLCA 2PUEA 4CBVA 4IF6A 4DCPA 3T5GA 3TNJA 5TE9A 1F6DA 3NTXA 4CLDA 3LOQA 4ZDJA 5A6SB 2X8AA 3C3JA 3A4YA 2GBGA 1CS0B 2R4TA 2Q5OA 3WWEA 1WUKS 1ZHHA 2DHCA 1KK1A 2ZDHA 3CNOA 5TJHA 2QAGB 1FCJA 3QF4A 3RHTA 3TUJC 3VZPA 3PTAA 1KK2A 4IOKA 3D6FA 4IIGA 1DKPA 2D13A 2Q3JA 1H1LB 3BH7A 2J07A 3ENWA 3O1HB 4KACA 4ALNA 4C04A 1DRUA 4UTOA 3N6VA 1M66A 1QHXA 3K70C 1F8YA 4WBSA 1AQ6A 5HKBA 4RY0A 2JZCA 2J59A 2QZZA 3TDMA 3TE6A 4O4JA 4BDSA 2Z5VA 1NJFA 1K63A 2PPLA 3MTJA 4JKOA 3DS8A 5BMVB 3WLHA 1R4MA 2X7XA 1T9BA 3FJYA 4B74A 3HDJA 2PA0A 2BFMA 2WTBA 1H6CA 4FYXA 3L1JA 2GLUA 4R98A 3AT1A 2HHHB 3QKTA 1I33A 1EVLA 1KC1A 1W5BA 3FYUB 3GGJA 3KALA 3KWFA 4I9UA 1KVTA 5JAOA 1L4YA 3LZCA 3OZWA 3N7TA 1EXNA 5EZYA 3OE4A 4FMCF 4I1RA 3CZPA 5ERGB 4IYJA 3L8DA 1I2MA 1OVGA 2GD1O 2ZYUX 3U60B 3QE4A 1AGPA 2B3TA 1XDWA 2AA3A 4QTUB 1G66A 3V8RA 4E08A 4RLHA 1LWOA 4TPKA 1CJBA 1Y37A 5CDTA 2OAEA 3V2UA 1KWKA 4BKRA 2ORYA 3AB8A 3FR7A 2I9PA 3H9EO 3DONA 4P8RA 4FYPA 1IHYA 1QHGA 2V4ZA 3DTTA 3RYFB 1HSZA 1RBMA 2A9QA 4GRAA 2Q4EA 5MFPA 2HT6A 3DE0X 1THMA 4DN6A 2PKWA 3T3OA 3NNNA 3G68A 4BZWA 4MS3A 5CDUA 4M21A 1ZVVA 3DSRA 2H57A 1S96A 2E85A 1CK4A 2E55A 4EB3A 4OJKA 5LUBA 3ZWVA 1FP4B 1QG6A 1Z4KA 1IEXA 3TMYA 5GAJA 1NW6A 4HUQB 3SHFA 5FPQA 4PNPA 2LW7A 3GJ5A 3OTGA 4K3UA 5K0JA 2XECA 4XVRA 5K1ZA 4EL5A 2WT9A 1ZO8A 2OLJA 2Q4TA 3KDPA 4JXZA 4MW4A 1FFXA 4MRPA 4TKVB 1AOXA 2GHQA 5G0UA 4D2IA 4PF1A 1NVGA 1Z7WA 3S3TA 1F20A 4D8WA 3LPCA 1KJZA 4LQLA 1TQHA 3NM5A 2BMFA 1G9XA 1ZVKA 4TMYA 4UTXA 3UAWA 3UJBA 1HG0A 1Z29A 5AXAA 2AG1A 1T4CA 2J5KA 4FZ3A 3V80A 3W77A 3ZCTA 1UDAA 4EYSA 4RL4A 4OQQA 4PGHA 4GZ3A 1QG4A 4NOJA 4CU2A 1EM8A 1GQ2A 1SKYE 4CI0B 4CM9D 2BHRA 3IOEA 3KQOA 3MEQA 4J29A 5DHAA 3ZZNA 3OEHD 4MV4A 2Y1LA 1Q91A 4PCVA 2KLBA 1N8KA 4DILA 3N87A 3R3ZA 3GMTA 3FB1A 2QVXX 3C16C 4ZAYA 3SDBA 4HB4A 4CETA 2RC5A 1XTPA 4GL2A 3P9PA 3VU1A 1OY1A 1G5PA 4YROA 4A15A 2PNJA 2ST1A 1HYEA 3RAGA 1T9CA 2PL3A 1FYDA 5LSAA 1P91A 1NZFA 2FSPA 3VR4D 3E3NA 3TLJA 3VMFA 3ASZA 3K1ZA 4U2FA 3GNTA 4XYGA 5M7EA 1DG9A 2ZUSA 1IU9A 3MCAA 2PUDA 4MWOA 2NZWA 1QV7A 3BFJA 1FRVA 2E49A 1T5IA 1AKWA 2A5GA 2V7QD 3HY6A 1D0SA 5BRNA 5JJ5A 2CV0A 2GRAA 1Y1SA 4LRQA 3SZOA 1HDZA 1XOIA 3PNVA 3ENNA 1ZKMA 4F8JA 4A8JC 5IRCD 2BY4A 3H5NA 3FTFA 4S1OA 1E79D 3TBKA 2BIFA 3H2IA 2H0RA 4RHTA 3R7BA 3QXCA 1UXIA 4ITUA 1TIPA 4N03A 1SXJE 4B31A 1F4LA 2MSLA 3ZDRA 1RLMA 4QBIA 1ZM9A 1IDN1 2OHJA 2BFFA 3HBFA 1W4AA 2FRDC 1B1CA 4H1VA 3KOZA 1H2YA 4O4HF 3GPCA 3CZAA 1HGXA 3HP4A 4M49A 4ZOBA 2BMDA 2HB6A 2GJAA 2FPIA 3F3SA 3WFIA 4X8MA 4G81A 1DQYA 3EPLA 1H0SA 2F3UA 4IHJA 5KDOA 2QNBA 4DV2B 1Z2OX 1F2UB 2ZPTX 2LVBA 4O1IA 3R7FA 3AW8A 1WTAA 2MSKA 5H3LA 3UBTA 2ZRLA 2EVWX 3LCUA 2GCGA 4FT4A 4TZKA 4UJ3A 1A9XB 1ND6A 5FCDA 5FA5A 3RYHA 2Z30A 3V6MA 4D3DA 3RSFA 1FFEA 1JLLB 1RSZA 2HDOA 1Z4IA 3LC2O 1D0IA 2IF2A 2P6UA 4P4TA 1L7AA 1G8GA 1TCAA 1VJGA 1ZC4A 4PG6A 1WKBA 3NVDA 4RPLA 3D7MA 4FDMA 1NNSA 3GFVA 4E46A 3ELWA 3K32A 1YR9A 1J70A 1BDMA 4YMTA 1V5EA 1RDFA 2ISQA 3GGDA 1WWKA 3VPHA 1O03A 1P61B 5TQ0B 3ZZ0A 4ZYXA 2V5VA 4PC6A 4U7DA 2HYIC 3ZQUA 1S2LA 1GYRA 1EM6A 4TMTA 3RT7A 1GG8A 3ROXA 3F7TA 5JU6A 3PXUA 3HKEB 2IS2A 1RWQA 2FSSA 2XMZA 3MGCA 1X15A 1S2DA 2A5FA 2RGWA 1N2GA 3OECA 4PY2A 4Q6WA 3V8MA 1MJGA 2W00A 5JSFA 2EX0A 2O0JA 4QEZA 3R5XA 1KSGA 1LRLA 1OI7A 4HBGA 2KBFA 1M2GA 3AF0A 2WJVA 3QOYA 2HWXA 1SOMA 1G8SA 4FEGA 4BLVA 1IVSA 3CV3A 1R12A 1J9GA 1TUGA 6AT1A 2X4DA 1JFRA 5JH7F 5KJ6A 4PG8A 2AHRA 4EL0A 4DE5A 5JECA 2WTUA 1RXUA 4CF4A 2FNAA 3GZTB 1C3XA 4LBVA 4JKYA 4WN9A 1XTSA 3H2JA 3BWBA 2FZGA 1YZFA 2JZNA 3VSBA 3H99A 4M1EA 4ZHQF 1U0SY 4KP7A 4HWOA 3QMMA 5IP5A 4IIJF 1QKKA 4PZYA 1X86B 1VLQA 2AE2A 3E05A 3JPYA 4KYUA 1IOWA 1DXOA 1KYTA 3D3KA 3K2QA 4LK2A 1K8QA 3NBYC 4DCNA 2FW9A 3IPLA 4KQGA 4BHTA 5DB4A 3K8YA 1J6UA 2MCFA 1ZPDA 1JLSA 1Z28A 2OO3A 3TX6A 1ZMRA 2JJ8A 4JJ4A 1P6QA 3TEFA 3TZCA 5JZSA 4CEHB 4B3RB 2WYWA 1DBIA 1S5PA 4CDGA 3ZCSA 1DJPA 2I0FA 3MJ4A 2VHUA 2GJ9A 1SCQA 3SPXA 3CN9A 3RH0A 4Z0PA 7ABPA 3E22B 2NAPA 2P9EA 4JBWA 3I5YA 5IBRA 1JI3A 1HZZA 3F3YA 5CD9A 2FP3A 3IEUA 1EUYA 2XE4A 5F5XA 3VPDA 1N8TA 5B36A 3MINB 1Z4NA 1GILA 4TSRA 4J4HA 2WF9A 1W9MA 1Y34E 2WOJA 4Z9YA 4ZU1X 4TL9A 1F3OA 1KI9A 2VDKB 4RTJA 4F96A 4B1FA 4OO3A 4CTOA 1ZSVA 4QELA 1CIJA 2C4MA 1U7TA 4Y7CA 4JEHA 4H0CA 3D6JA 1AD2A 3R0VA 4MUXA 4OA8A 3WGLA 4CE6A 1DIHA 2C78A 3NOOA 5SY4A 2QM3A 4MCJA 4RTPA 2BEVB 5EWJA 1OXXK 1YJBA 2B6HA 4Y1RB 4D26A 1WKVA 3GO4A 4AI6A 1GGNA 1XAGA 2IEDA 4BGVA 4KVZA 2BGTA 5DTJA 3RS3A 1HE4A 4YJ3F 4HPXB 2LDBA 2FW1A 2GK7A 2DPGA 4J4BA 4A5OA 4ESEA 3I2HA 1ABEA 1RHRA 3PF9A 1KE2A 1RJ9B 2JA1A 1OH7A 1H4QA 4OYLA 3H84A 4LFBB 1ICEA 2ZRMA 3G0HA 2PSJA 2IX3A 1WVMA 2W58A 3DQQA 1OBOA 3N8NA 5FTWA 1KAHA 2QZJA 3UKDA 4NAUA 4AJKA 2OB1A 3ENQA 1CUWA 2HPVA 2IYEA 2N9UA 2ZSHA 3HBJA 3KUKA 4FBMA 1WXEA 1ZR4A 4ENRA 3KWMA 2HEGA 4FEAA 1SBYA 3BMCB 3K4PA 3WQHA 3DKVA 4D5EA 4HNUA 1CULC 4RK5A 3ZWXA 1SHLA 4HLUA 5CM8B 4BEVA 1UC8A 1Z8FA 4LE0A 1IN5A 3HQ4O 4RHYA 4WY2A 4D56A 1FTSA 1H65A 1HPLA 1P7PA 3CONA 4FX5A 4TMKA 1JR3A 4ZT5A 3PKIA 1LLFA 1P5RA 2QRVA 5ARCA 3TH5A 4AS3A 3P9RA 4YV1A 1N4AA 3UJAA 1GP2A 2EX4A 3THYA 1IN6A 1ZJJA 2IUSA 3C87A 1TA4A 3HVKA 4DVJA 1OHHA 3W8EA 3UJ6A 4AJJA 1K0FA 2JNWA 3G2MA 5FBQB 2ZWAA 3KZ1E 3QUBA 4RL6A 2WTMA 5I9BA 3T7EA 3JU3A 4O2AF 3Q5GA 4BPRA 1NPTO 2IOQA 3L84A 5BSHA 4DUZB 3KZXA 1GPAA 4R2WA 1LNZA 4YCNA 3EPKA 4BLWA 3FDZA 1NBEA 3LOUA 4A0FA 4F4DA 5I01A 4E1AA 3IJPA 3KIPA 3EIXA 3TM4A 4FWIB 2Z58A 4CG3A 4J9VA 3BMQB 4L5BA 1WB4A 5EHQA 5G3ZA 5F5LA 3RROA 1P29A 2XH8A 4DMRA 4IMIB 4RA6B 2QJTA 4U5QA 2CY0A 1ZGCA 4G0OA 1Y7LA 5AM0A 3PF8A 4HDMA 2XGOA 1AS3A 3VZRA 1KERA 2QM7A 1EVYA 3KQTA 2I6SA 3SF8A 5JS6A 3GRKA 1C7JA 5BUCA 1QGAA 3KE9A 1LBIA 4WGFA 5KPJA 1JNXX 2RK4A 3O7MA 2NQ8A 3LYHA 3PGXA 1RQXA 2WU8A 5HZGA 3TNYA 1YA4A 5L3VA 1P5ZB 3IP9A 4WMLA 2IH2A 2H9IA 1RHUA 2V9PA 4XR4A 4UQPA 3B89A 1XCGB 2WFAA 4OP3A 1V0JA 2NO6A 2OZLB 1R6TA 3H2HA 4XPIB 3TI7A 1A72A 2HQRA 1K5PA 2OA0A 1F14A 1GL6A 1KYWA 3KO8A 3R3XA 5C1PA 2OZPA 3G7NA 1DRVA 3EAQA 1KC3A 1C2YA 1GIAA 2JDID 2ZYHA 4RHXA 4EUKA 3H5OA 4UEJA 3U26A 2P2LA 1DC5A 1XD2B 3GUHA 3X1KA 3VRHA 4LOJA 3WS7A 3H8SA 3QE2A 1Y9ZA 2VNKA 5GJBA 2RHDA 3DEAA 1JIQA 1FMLA 1IHXA 1YRWA 3W9BA 2HRZA 2JW5A 2TECE 1MP0A 2SICE 3FCCA 3FZGA 4WCFC 4DGQA 1D2CA 3TSWA 1BJKA 1OOEA 5B4VA 4I5GA 3U4QB 3N2GB 2NMVA 5K6TA 3QSGA 3S1AB 4YASA 1FMFA 2NG1A 1K7EB 5C8XA 4Q7JB 1NRXA 2ZYSA 1TX4B 2G80A 3K0KA 4X7BA 4K1LA 2OV6A 4M0MA 2QAJA 5FD8A 2O1EA 4W5TA 2XCTB 1HNXB 1RXWA 2VRNA 2GN4A 1QFJA 2MSDB 3PSAA 4GOKA 4R71A 4ESHA 1Q1BA 5EXTA 5BSGA 1FSGA 1WCIB 2MOKA 2R86A 1KTIA 5TGZA 3FHLA 4U2DA 4QHTA 3MUFA 2CGEA 2IH4A 4B87A 4K6MA 2BFCA 2CBGA 2PJZA 4ID3A 4Q15A 2AJBA 4AZSA 3DGEC 5JG7A 5KCMA 1O6FA 4J0IA 4ZMBA 4TXMA 1MVLA 3DWGA 1A2BA 4HGQA 4RK1A 1E64A 5DLEA 4CT4B 3IP6A 1YB4A 3B9RA 2JI6A 3WHKA 4DDVA 3UMYA 1WV0A 4URFA 4BJ1A 3B78A 3G2PA 5DLDA 2BGJA 4P0PB 1DZIA 4K46A 2P2ZA 1UAYA 1RPZA 3Q15C 1O77A 2WMNB