4KK4A

Ywle arginine phosphatase - c7s mutant with phosphorylated active site serine
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
152
structure length
151
Chain Sequence
MDIIFVTGNTCRSPMAEALFKSIAEREGLNVNVRSAGVFASPNGKATPHAVEALFEKHIALNHVSSPLTEELMESADLVLAMTHQHKQIIASQFGRYRDKVFTLKEYVTGSHGDVLDPFGGSIDIYKQTRDELEELLRQLAKQLKKDRRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Low molecular weight protein-tyrosine-phosphatase YwlE
publication title Structural basis for recognizing phosphoarginine and evolving residue-specific protein phosphatases in gram-positive bacteria.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase
total genus 60
structure length 151
sequence length 152
ec nomenclature ec 3.9.1.2: Protein arginine phosphatase.
pdb deposition date 2013-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4kk4A00
4LX8A 3E61A 2FSPA 1GCGA 5IUNC 1F51E 2GI4A 3UKJA 4OBBA 3RVNA 5PNTA 3T6KA 3VNBA 3ILYA 4IMJB 3CRNA 4NICA 3H1GA 3T38A 3QLVC 3R0JA 3MYYA 4P98A 4Z9AA 5B3JA 1USIA 2IPNA 5FWXB 3MF4A 1Z16A 3LUAA 1Z2DA 3FFTA 3O1JC 1BDJA 2GBPA 3CZ5A 1RZRD 5TPZD 4NCBA 3IP6A 3EGCA 3BILA 3O21A 2QVGA 3H5WA 4N03A 1BDIA 2GX6A 4YR7A 2FW0A 4YV7A 2MYPA 1DCKA 1USGA 2HQBA 3M9XA 1DJMA 2JBAA 4F8JA 3EQZA 5KQPA 2MSKA 3HUTA 3N0RA 4YO7A 1QO0D 5KQLA 1XHEA 3GT7A 3OO0A 1E6MA 4UHJA 4RXUA 1WETA 2PUDA 3TX6A 4OLAA 1L5ZA 3CG4A 3GWGA 1QP4A 3RVLA 3I5AA 4XFKA 4G0OA 1PNTA 3JPYA 4YWHA 5ABPA 3QLVA 2QR3A 2NT4A 3L6UA 3KSMA 4IILA 3HV2A 1KMIY 1AB5A 1SXIA 4EYKA 3A0RB 1SRRA 5EWJB 5F64A 4RK5A 4WUTA 4LE2A 4Q7EA 1QKKA 5FWXA 2FN9A 3MA0A 1DC7A 3H5TA 4F12A 5DCLA 3NNSA 3KHTA 2JRLA 4Z4HA 3JPWA 1JDNA 2FTKE 4FE7A 2FMFA 1MB0A 4N47A 5TQ0B 9ABPA 3FDFA 3GBVA 1DRJA 1E2BA 1QQBA 3LUCA 2FQYA 4MAAA 3DGEC 1USKA 2R47A 3QLTA 4MYRA 5EWLB 1BDHA 3O2SB 2F8SA 5C5EA 2IKSA 4UHKA 1EWVA 3OQOA 3LKVA 2E4XA 1E6KA 2M1ZA 2PJUA 3H6HA 3G85A 5DGCA 4P1ZA 1VPWA 3DLHA 1BA2A 2MYUA 4KK3A 4XASA 1U2QA 1DCMA 2IYNA 2LP4Y 4CBVA 4ZJPA 5HQJA 4O1IA 3N8IA 1QP7A 3LMKA 1YS7A 2HJ9A 2NUBA 3KYJB 3HS3A 4HNSA 4H3HB 4EYQA 2H3HA 2WMYA 3O75A 4YGXB 3EAFA 3T8YA 5BQ3A 1QMPA 2MSWA 2RGYA 4WXMA 4RSMA 4B09A 4GNRA 1ABFA 3C3KA 4PYRA 3N75A 3QK7A 4H60A 4QICA 1ZN2A 2PL1A 1NXOA 3RVOA 1Z26A 2YHBA 4PZ0A 4Z9BA 3LUHA 4RXTA 3KYIB 3RVMA 2FLWA 2QVCA 2JCGA 5EWLA 3EULA 3UUGA 4EVSA 3CFYA 4G0YA 4YCSA 5KC8A 3Q7SA 3Q7RA 4YS6A 2MYNA 3EDCA 2E4WA 1GUBA 2QSJA 3N53A 4Q6BA 1C0EA 1RNLA 1S8NA 4DADA 2B4AA 4OTZA 1JBEA 3OLVA 5CNIA 3F6PA 4W5QA 1T34A 5CHYA 4MPTA 3O2QB 3CNBA 2E4ZA 2VK2A 5CNKA 1JYEA 4YP9A 1M5UA 4EGSA 1NTRA 3TD9A 3E3MA 4PEVA 3CS3A 4TMYA 1YMVA 3Q9SA 2E4YA 2WWVD 4L85A 4XXHA 3RVKA 1QPZA 5IEJA 4MS4A 2XDYA 2JVJA 1RXIA 2KYRA 3LUGA 4F11A 2PUAA 3DBIA 4G0ZA 4LZLA 4XARA 2ID9A 4KRFA 4MS3A 1JFVA 4QPJC 4RU1A 4RWEA 1Z15A 5BRJA 2N9UA 5KQMA 1PHRA 1ZGZA 1D1QA 1A04A 3SM9A 2VYCA 2PL9A 3KLNA 3F73A 1KRXA 4PICA 2RDMA 2ZWMA 2QZJA 3KKEA 4MQEB 1KGSA 3C6QA 4LDZA 1JHZA 2AYXA 4JASB 4MR8A 4MS1B 5TPWB 4DN6A 5KC9A 1DRKA 1LK0A 1PEAA 3C3WA 3FFXA 4FB4A 4RKQA 1OXKB 1RXEA 3EQ2A 4E7PA 5GQSA 1ZH4A 1Y1LA 3A3KA 3BRQA 3MM4A 1K66A 1K68A 4RKRA 3KCNA 3NNDA 3CU5A 1EFAA 3Q7TA 2FEWB 3VNAA 1CHNA 2V0NA 5CNMA 5CNJA 3H1EA 2OENG 1D4ZA 3NHZA 2FLKA 2LUOA 3QEMB 2ID7A 2RJNA 4OG2A 1RPJA 5FWYA 4XLTA 1Z18A 2WB4A 1JH9A 4MQFA 5T3YA 5KWSA 4M88A 4MR7B 1PEYA 3KJXA 2R48A 4WWHA 4HNRA 4QYWA 3GRCA 4EVQA 5D2CA 3OM1A 1E6LA 4PE5B 6ABPA 3GYBA 3O1HB 4EYGA 5IEBA 5KI6A 4D74A 3LUFA 3O2JA 3EJWA 1FFGA 4MQEA 2NT3A 1DCFA 1UDRA 2QXYA 3Q41A 4MS1A 5TPWA 3IDOA 1GCAA 4RV5A 1PUXA 3OLYA 4RK0A 1DP4A 3HJFA 3DZDA 2HPHA 3HDVA 2FMHA 5JNWA 2LBPA 1YMUA 4EVRA 3RVQA 5HKOA 6CHYA 4JAVC 5IUKC 1JWLA 1YK1A 3H5IA 4D6YA 4MRMB 5FBKA 1P6UA 1EWKA 3TO5A 4RY9A 1MIHA 4S04A 3QX9A 4NQRA 1U8TA 5EWMA 1ISRA 1SD5A 4LE0A 3QEKA 3QEMA 2CD7A 1M5TA 3CLKA 1P2FA 2MYTA 1VLZA 4RK6A 2E4UA 2IPLA 1GLGA 3TB6A 1ZGGA 4MR7A 4LE1A 2GKGA 4G97A 3CTPA 3SY8A 5BRAA 2FVYA 5IBQA 1EAYA 3I42A 2FEPA 3GV0A 2BGGA 3OMWA 2MSLA 4ETNA 1NY5A 3KG2A 4HNQA 2P9HA 1AB6A 8ABPA 4RXMA 1APBA 4OLBA 4GPAA 4IMIB 4RK1A 1SXGA 3HO1A 3RVPA 2QU7A 4YLEA 1JL3A 3KS9A 4MR9A 4MS4B 4Q6WA 1EHCA 2P4UA 5JNSA 2FMKA 3S99A 3URMA 2DRIA 3JVDA 3K4HA 3Q15C 3QELA 2L18A 5TPZA 1RZRA 2A9QA 5JNRA 3D8UA 3OLZA 2LIVA 5E3JA 2QV0A 3NBMA 4MRMA 3N6VA 4MS3B 4RDCA 3RVSA 4W5NA 4G0QA 1DZ3A 4WT7A 1P8AA 4TN5A 1ZDMA 1MB3A 4LRQA 2PUCA 2VUHB 1ZVVA 1I3CA 2CHFA 2FKAA 3RVJA 3BREA 3T95A 1R8JA 3IP7A 3FFWA 3JVIA 5IC5A 1ZESA 4MR8B 1OXBB 3MIZA 3ROTA 5GOTA 3KLOA 4N0PA 1JX6A 5DTEA 1ZITA 1ISSA 1J56A 1YK0A 3DLBA 1TMYA 1NXSA 4EUKA 3RQIA 3RH0A 4Z4IA 3H75A 1URPA 3O1IC 4Z4FA 1LBIA 4KV7A 1BAPA 3F6CA 3HXMA 3I45A 3MQ4A 4JP1A 4OATA 2WRZA 1DBPA 2FXIA 3LKBA 1Z25A 1QP0A 5FWYB 5DKFA 1Z12A 1LBHA 4S05A 1QQAA 4MQFB 3K9CA 4RZSA 1DBWA 4MLCA 4Z0NA 4KMRA 1JYFA 1JLKA 2PE5A 1NXTA 5HSGA 1IIBA 3D02A 2JB9A 2X7XA 2L17A 2WJWA 4RY8A 3H5OA 3GA5A 3ILHA 3OLWA 1YVUA 1D5WA 3P9YA 5IUJC 4JB0A 2H0AA 4FE4A 3OQMA 1HEYA 2FQWA 3H6GA 4HYEA 1TJYA 3IP5A 3OMXA 3NNNA 1M2EA 1W9HA 3SG0A 3HM9A 1YTUA 1U0SY 3HDGA 3TMYA 3SAJA 2ZAYA 3CHYA 4G0MA 4Z99A 3H5VA 2NZVG 5T7BA 4E7OA 1D2AA 2CHEA 3O74A 1ZH2A 4G86A 4QYMA 3HSYA 4N41A 1D1PA 2PKXA 4TLMB 5EWMB 1KRWA 3QX8A 4WXEA 3SQNA 3CZCA 3HK2A 1SXHA 2WJAA 1FSPA 2I6FA 2R4QA 4IGAA 2CWDA 4IRXA 2PLNA 2IPAB 1Z17A 2R25B 2VUIB 1TLFA 4RY0A 1JFSA 1DC8A 3BRSA 3HZHA 4KZKA 1YS6A 1U2PA 3M9WA 5TQ2B 3BBLA 3MMNA 2A9OA 1ZY2A 4ML3A 4F3TA 4JA2A 1Z2EA 3SNKA 1PNRA 3A0UA 3DGFC 3N0WA 4MLDA 1TM2A 1XHFA 3NHMA 3UK0A 1NXWA 2HQRA 1FFSA 2O20A 4MR9B 3C3MA 1A0OA 3GL9A 4O5AA 5FBHA 1CYEA 4ZYLA 4RK7A 3QELB 1LJLA 2E4VA 4ZMSA 4W5RA 1LJUA 5JS2A 2FN8A 4G0PA 4RS3A 3OLXA 4EY3A 3HCWA 5KQGA 2L2QA 4Z4CA 4N76A 1DG9A 3LOPA 3LUDA 1B00A 4F06A 4W5TA 1TVMA 2FMIA 4KVFA 3HVRA 5TQ2A 5I4CA 2HQOA 1MAVA 2QW1A 7ABPA 1F4VA 3N0XA 2OQRA 3CKMA 4ETIA 1W25A 3RVRA 1ZAYA 2YHAA 1ZHHA 3FGZA 4KK4A 5IX8A 2PUGA 1U04A 3LFTA 3JY6A 1VKRA 1C4WA 5TE9A 2GWRA 1YIOA 3L49A 3IPAA 2M98A 4YRZA 3IPCA 3FMVA 3LTEA 5C5CA 1DBQA 2A9PA 4KREA 4XAQA 1NXVA 5IULC 4Z4GA 3G1WA 2JVKA 3QLUC 1QNLA 3CG0A 1NXPA 1FQWA 3JTEA 3KTOA 2WY2D 3I09A 3LUJA 2PUFA 2J48A 2NZUG 3OM0A 5EWJA 1VRVA 3W9SA 4RK4A 3IP9A 4Y9TA 2Q5CA 1QO0A 4EYOA 5ED4A 4KQCA 4JOQA 2IOYA 2PAFA 3OO1A 4LDAA 1XWWA 1BVHA 3H1FA 2HSGA 2RJOA 4ETMA 3GBPA 5JS1A 3HUUA 1H9CA 4N0QA 4O1HA 4TLLB 1GUDA 3C97A 4KQ9A 1ABEA 2FQXA 2JK1A 2L19A 1MVOA 2FEKA 5TQ0A 2PUBA 4MGEA 4NV3A 2W42A 3H5LA 4WZZA 1JFTA 3LUKA 4G0XA 2IDMA 1P6QA 3F7NA 2JVIA 3QLUA 3A10A 1FFWA 4DQDA 2PUEA 2AYZA 1JF8A 4KNYA 1EWTA 1Z13A 5DLEA 1L5YA 3JS5A 5TQJA 5BR1A 4JB2A 1A2OA 5B3JC 4ZPJA 4L4UA 3HEBA 4KFCA 3ROFA 2PMCA 4W5OA 4KPYA 1M2FA 1CEYA 4IF4A 3M6MD 3B2NA 5JNUA 4Z4EA 1JDPA 1NATA 3EODA 5HM6A 4D6XA 2IPMA 4ZMRA 4H3KB 3OQNA 5JNVA 4NCAA 2LPMA 2JBAB 2B1JA 2F8TA 2A9RA 1NXXA 2TMYA 5JNTA
chains in the Genus database with same CATH superfamily
2I4IA 1IK6A 5DDIP 5GJCA 1XU7A 4HX5A 2XLCA 3LLVA 2WM3A 2W90A 1F51E 2Y6VA 3MRTA 5AHKA 3PB3A 4X1KA 1O5TA 3JZFA 2OCAA 3IQDB 1H8HD 4GI3A 4UMFA 1KI2A 3IP3A 3RSHA 3STVA 4M9SA 2C1ZA 1IRXA 3M1YA 4ZRNA 2GBIA 4RMHA 4XD7D 1ABBA 1OWNA 2DHRA 3WGLA 4F7DA 3PHJA 1YRYE 3EGXA 3PUZA 4J0EA 4M8SA 4URZR 1BWPA 2PX5A 1KU0A 1S2OA 5IN5A 1LI4A 1CU1A 4GC9A 2IQIA 4XVCA 2VWQA 4HNUA 1V45E 1Z16A 4NATA 5JC1A 4LFBB 3DZ8A 2F1OA 3FYHA 4LY3A 1QF9A 1ZVJA 5SV2A 2XW6A 4N03A 2JFQA 2L0XA 3QU5A 4KO4S 5B57C 1H1TA 2OO3A 2XMRA 3W5VA 1WKBA 4OAPA 4LFCB 2GJ9A 3QMMA 2P6OA 3ACDA 1MF7A 1XJWA 2NVOA 4GBMA 1XBTA 1MJ5A 3FF1A 3FJYA 3HUTA 4MMYB 1NR1A 2OVBA 4U6NA 5AOCA 4BTVA 4FQ8A 4CFSA 1MFZA 3EC2A 5T4HA 1HK7A 3PQ7A 1LJ8A 5JH7A 5HRUA 1E58A 1T3SA 1K92A 3BFVA 4ZO6A 1WCIA 3TNJA 2AR7A 2V9CA 3R20A 5D87A 3RVLA 3I8OA 3GRZA 4EA6A 3L0YA 1QFXA 3C6MA 1BEUB 4HDRA 1QAQA 3D1VA 3QLVA 2ZB8A 4GSYA 4O08A 1T9KA 4HX9A 4PAGA 4LF6B 5EIWA 4XM0A 4MDEA 3HCPA 4EEKA 4I0WB 1QE3A 3UK6A 1PJCA 1WW3A 3KXLA 2Q9UA 2H1OA 4OSPA 4AAYA 4DQUA 1B2LA 1WR8A 2FN9A 3OKFA 4MOWA 4UNNA 1PFWA 1PR6A 3H5TA 3SN6A 4GAEA 3TEJA 3HN6A 4MJ3A 5TMBA 1OZ0A 1TGYA 2QRVA 2EGHA 3DOOA 3SXUB 1E2MA 1RLTA 3DEIA 2KHZA 3QMPA 2XNSA 3J7TA 2DJIA 4K9OA 1M8KA 1J0EA 2IHTA 3JQFA 1WVMA 1LVGA 3NI2A 5LIPA 1E4VA 1MKYA 1VM6A 4P4UA 1H4TA 1AX9A 3GBVA 4CODB 2W6ID 2DETA 2C3MA 4OK6A 3E1SA 2VRCA 2VDRB 5ALLA 4D8WA 2XCLA 2ES4A 3DZIA 5CDHA 4Q3AA 3H84A 4HK4A 3UY4A 4CTOA 1NURA 3I28A 2P41A 1CY6A 1T5HX 4Q1EA 1RM0A 4ZT4A 3W04A 4XASA 2OO7A 3SZMA 2SBTA 3JAWB 3RDPA 5LQAA 5B7QA 4O1IA 4U2GA 3CKYA 3E7FA 1R4MB 3HWSA 3MQ2A 1UKYA 2PO5A 3Q1LA 1V71A 5LUBA 5B30A 3LCUA 4NH4A 1RHUA 4XJTA 4M53A 3JQAD 3HS3A 1G8KA 5IVHA 4H3HB 3ABOB 4KXVA 3PIIA 1GTSA 3ZE7A 2H3HA 5BQ3A 4YJ3B 3MTJA 5DTMA 5CEEA 3G1TA 4HYYA 2C54A 1FE8A 1P39A 2WZBA 1RFGE 3QVKA 3PQ2A 3QW2A 3PLAE 1VJRA 2DWCA 4EKIA 2I2WA 5JY6A 2VYNA 3B6EA 4BLPA 2IDKA 3DE7X 4LYHA 4QARA 2P9BA 3R0ZA 3ZWNA 3IL2A 1EVIA 1I2ZA 5D3QA 1GLVA 1NW5A 2Q5FA 3VJRA 2C7VA 2CXQA 3A9CA 3IALA 4NIMA 1FUKA 4HLQB 2HJSA 4YCSA 4G0YA 1JLMA 3N59A 1RLMA 1ZSNA 1KI3A 1Z5ZA 4QGHA 4A1FA 4BLTA 3QXSA 2IW1A 4CU2A 2FAXA 2VHCA 3LW8A 4HNGA 2Y77A 4JJ4A 5CR9A 3VSBA 4BYMA 1CY2A 1JPVA 4K6CA 4NYMQ 4RFSA 3E53A 4LTDA 5JARA 2A92A 1OV4A 3FOAA 1M67A 1HTWA 2H7YA 4FGWA 1SRQA 2OOKA 3CXUA 2A78A 2XNKA 2VPZA 1YL5A 2WHPA 2IHUA 5F5XA 2OGTA 2D3TA 3SM3A 2CNKA 1YVDA 1OLXB 3STTA 2WVJA 3B6ZA 4ZIRA 1FRNA 4X66B 2HR1A 2ZRPA 1GUFA 3HKBB 3EARA 3QVJA 3EOAI 1DBRA 2DSNA 1T4MA 4Y6RA 4EW6A 2E0IA 2ZPUA 1SUAA 3EH1A 3GGDA 4TTVA 1W96A 3ZGYA 1VKZA 2C00A 2ZVJA 1QXSA 4LDPA 2JDIA 2Y1LA 5CITA 1MVNA 4I9FA 1SKQA 4IHKA 4P38A 4KRFA 2IS1A 2GOYA 3FPFA 3G2PA 2NXNA 4LWOA 4DJJA 5JSFA 2F1IA 2FDRA 2PNFA 3KQQA 3SF8A 3ZHSA 3R7LA 2FWBA 2H5LA 4IWYA 1KDYA 5REQA 3ZDAA 1KRXA 3L4KA 2IXAA 1ZQ1A 2ZREA 4AS3A 3KRTA 3ZDQA 2W2KB 4ALIA 2Z6AA 1EX1A 3ZHTA 4DHEA 4YUAA 4ZOLA 1TI7A 5HCNA 1L5HB 2X40A 2I6XA 1JDUA 1ZXXA 1V1JA 1JI0A 2PNJA 1X7WB 2SICE 3CNQS 2CEKA 1PV4A 3FZEA 2IV2X 1UK6A 1GPH1 1Y1LA 5IARA 1V5GA 5K0SA 5LFAA 3ZIDA 1P1BA 4MUHA 1JSRA 4I36A 5L95A 2B82A 2C4VA 1HE5A 2IU4A 2PQ2A 1ZIDA 3IJRA 2WABA 4HEJA 3BMOB 4Z0TA 1PP4A 1QGDA 3UANA 4F6RA 2X7HA 1ZMXA 4X97A 4ME6A 4LZAA 3LT4A 1V96A 3W6NA 3BPSA 1XNJA 2PKQP 2V7GA 1ND5A 3JWHA 3LP8A 4ER5A 5A4FS 2V5VA 5FUXA 5A5FA 1XWIA 5JY1A 3HXKA 2AZDA 4M7OA 4HWOA 1PEYA 4IQGA 1VPTA 4RPJA 4WWHA 1GSIA 5F2OA 4D43A 1NIJA 4FFBB 4RPHA 1P7VA 1Q15A 3O1HB 2W11A 3CBGA 3QF4A 1A1VA 4R68A 3HYNA 4C6RA 5FD8A 3ZWWA 4QTUB 2IY9A 3KJFA 1UJ5A 2BM8A 1LPPA 2KX7A 4D44A 5JH7F 3OPMA 1M6WA 4ZQGA 1C3LA 3UWOA 3DZCA 5GY7A 3UC9A 4CETA 1W48A 1MQ8B 4I9GA 4X85A 2O9JA 1IU9A 3HBNA 1KZ1A 5JCOC 2IHJA 1SMKA 3TF5A 3ND9A 1W59A 1HYHA 3P9XA 2DR3A 1XU9A 4WI1A 3WWDA 5ES3A 3OX4A 1K97A 2RIPA 4WLNA 2MOKA 2JGDA 4QBHA 4QYIA 4F9FA 5ADVA 3M6UA 1M1NA 1C0PA 3LPDA 1FMTA 4CMEC 2F3QA 3HDQA 3W9YA 1KQFA 1SXPA 2ZWAA 3QWFA 2P2DA 3MMSA 4RK6A 4DV1B 3U48A 4DVJA 4EHIA 2FG6C 4BXOB 4P7KA 3AUJB 3AEQB 5DEOA 4I3GA 4K1XA 2GEBA 4KHZA 1TYEB 4AZTA 3GJZA 4C7MA 3IKLA 1RBMA 1GGEA 1BWQA 5DM0A 4XDHA 5JWHA 1RQGA 4FOPA 2FEPA 4DBLE 3JVEA 1DHRA 4LF7B 1NY5A 1I3LA 1KP2A 2DM6A 3E81A 5AJHA 1V7ZA 3H11B 3EBOA 2YWFA 3LPAA 2GS9A 4NBRA 1OGJA 3H2BA 1RXCA 1ADBA 4PQRA 3IO3A 1E2PA 1E8NA 2HO5A 3FMGA 4Q37A 4HDNA 5BN4B 4AG6A 3MEQA 2OD7A 4ND1A 4KI0A 4CCYA 1YI1A 2PLFA 2Q4RA 2L18A 4NZMA 2UYYA 3R5TA 4HDKA 4PZLA 4NZYA 1KBOA 2YMLA 1G9TA 5IW8A 4N39A 5C0OE 3ICWA 2O5CA 1HRKA 4LISA 1RRVA 1BGVA 1Z2NX 4W9NA 1UAAA 2XR1A 1JMVA 2XUDA 3GJYA 1JA1A 1ID1A 3WB1A 3RF7A 4BO6A 4X0EA 2HB6A 4N9WA 2HT1A 4QLOA 1PR2A 2FKAA 4REOA 3WL3A 5AKKA 3S2SA 2B30A 4Q82A 3ROTA 5JXGA 1THZA 4PC6A 1C4OA 1U4OA 1V1MB 2I4OA 1U9ZA 2ZVDA 2OHOA 3PSAA 4LDNA 4CEIA 1ETHA 4M1TA 1F8FA 3HCCA 4QQNA 3V6MA 2OPBA 1ZK1A 3ADOA 4B47A 1TMYA 3DEHA 4GOKA 5IYZB 5AJVB 1E2KA 1T5DX 3PG5A 2ZSUA 4GECA 5CVUA 1HT2E 5K8LA 3AHCA 1ISFA 1U2TA 2QX7A 4OI0A 1IXKA 3KEGA 2FPOA 1YR2A 1KDZA 4I9NA 2HUNA 4GRAA 1J5EB 4K8OA 1FFAA 3U3MA 1V3QE 1NHWA 3PR1A 2YMQA 3Q10A 4LJRA 1WSAA 1H6CA 4L5JA 4E5MA 1DUIA 2B2NA 1PL8A 3OY7A 3DV0B 4EHAA 1B41A 1R0YA 1JYFA 1XD2A 1XMSA 1Y81A 2CMGA 4HWGA 5BWMA 3K6SB 2AZXA 1R37A 2FX3A 2JB9A 1NJSA 2WJWA 3CF6R 1VZ3A 3DHVA 3JD4A 4KB5A 3FCOA 3U13A 1TD1A 2EKDA 4IVPA 4AYTA 2B83A 3WL8A 5EJ9A 1NN1A 4PR3A 1D5WA 1MX3A 1G59A 3SR4A 4ZT2A 4C3OB 4BJ3A 1DU4A 5A1JA 2C94A 5COAA 5IMBA 4BIIA 3QEJA 1P1CA 1NAIA 2NU7A 3QKRB 3HDGA 4P36A 2WAXA 1UWLA 5JO0A 4G0MA 4IIFA 3EVEA 2AA3A 4LJ4A 2VZ0A 3L18A 1ZMRA 4J1SA 4RHXA 3ZHYA 5KYGA 1M72A 1TTTA 3L7DA 1XQVA 3KB8A 2GVDC 4FBMA 3OY2A 5DLDA 4OH7A 1C0LA 1YVRA 2I6FA 2H6EA 3PXDA 4QBIA 2BFEB 1D6MA 2GILA 4I7EA 1BCRA 4E2XA 2ZJ0A 4ZOLF 4AZ0B 3CNLA 4E33A 3HO6A 3SSMA 5B4TA 6NULA 3H9CA 2GGSA 5TVGA 4YGYA 3SNHA 2BSXA 2QUKA 2V5AA 4FFPA 3H9UA 4OQQA 3DL2A 2OFFA 2QTFA 4IX9A 3TIGA 3WGQA 2PGJA 4FDUA 3WRVA 1KAHA 3IIKA 4N5NA 3W7AA 2XB6A 4OKSA 3JQ6A 4N0EA 1JHXA 3SKVA 1X3LA 5K9ZA 2FZ4A 1LPNA 4JR0A 4OHPA 1E3JA 3VO9A 3SQWA 2GD2A 1SA0A 1BHO1 2C59A 4HTFA 4BRUA 4Z7JA 4AO8A 1Y9AA 1X39A 3UV7A 3WDKA 3GL9A 3V6LA 2B4QA 3Q5DA 4V03A 1MJGA 3LVFO 4ILEA 4I4CA 1J8FA 1A9TA 2I55A 3EBPA 2ABWA 2RGCA 1RJ9B 4RS3A 3HFRA 1GUAA 6AT1A 3IHLA 3I2KA 2PZLA 1S7GA 2V7QA 4KR2A 1QC5B 3AVPA 5LXTF 4QQFA 1CIJA 3CLUD 3M6IA 4DJDC 3DBOB 2DFLA 1GL6A 5F21A 2B7CA 1VC2A 2NAPA 4OLHA 4B6QA 1T9GS 1EINA 3EVFA 4F06A 5MN4A 5CVTA 4D0GA 5E9AA 4LVCA 3D6JA 2HJRA 1X77A 2HWYA 3U3OA 4KLCA 4G85A 1SVUA 3IE2A 3M4NA 2CLFB 2AJLI 1KMCA 5HBRA 1PJAA 3WX0A 1A8PA 5IX8A 2GZ2A 2GB4A 2FUNB 4PZPA 4YB8A 5CT8A 2MSCB 4CEHA 2P2GA 3BD6A 2ZYSA 5IJAA 1UKZA 5CLFA 3CA8A 5FNVF 4MVJD 5CFQA 2IE0A 2Y0PA 3KSRA 1ACJA 1T24A 1Q16A 4QRDA 1QPBA 2G4VA 2HN9A 4L6AA 3WRYC 2UZ1B 1GZ4A 1C29B 2QLTA 4OL0A 3VR6D 4ZT5A 1IVNA 1EG7A 2C4MA 1CS0B 1ULBA 5HVNA 5E38A 3WYCA 2W48A 4XFJA 4Z8XA 3U3RA 3MS7A 4EF6A 3O4HA 5JCJD 1T4CA 2RB5A 2YHSA 3R4CA 4XRRA 4ZOBA 5IZCC 2DG2A 4HQ6A 4KR3A 4EHBA 4UEKA 2IE8A 3MELA 4GI1A 4HAUA 4ZCPA 2DH5A 4RK4A 3ICQB 5K4HA 1VTKA 1OMOA 3JYQA 4UBKA 1FB5A 2V7PA 3ONFA 3ECSA 2NWQA 3AFNA 3HB1A 1OBHA 2ATVA 3TOCA 3IQFA 3RPEA 4ABYA 4RULA 3U5ZB 4K87A 2WU3A 2I2DA 1R5NA 2J4FA 1KY4A 1W0KD 3D4NA 4UD2A 5TGTA 3R3YA 3USZA 2AFHE 3U5TA 2O8FB 2NYRA 1DX6A 2R8EA 1MV8A 3BGOS 1ZM4A 1CY8A 4C22A 3MOSA 1CRZA 4QOGA 3A1VA 4IUCS 3TR6A 4L57A 1JFTA 3EVBA 3FN4A 5LUAA 1DADA 2QI9C 4KW7A 4P7GA 5FF9A 1U7DA 2WG1A 3TNFA 2IDMA 3UG7A 2CJWB 2R84A 4CM8A 3GZ4A 3ZR4B 3P97A 3WGMA 3GEIA 5FOQA 3LE8A 4N6OA 1RHQA 1FBTA 3PUVA 2NADA 2J6HA 4YN3A 4WVFA 1GZ7A 1NF9A 4KR9A 2AZTA 1PT9A 2H2GA 3NAQA 2IXTA 3ZU5A 5B3JC 1XTVA 3AU8A 4QL3A 5BUQA 1S5PA 1X0XA 4LMAA 1CEYA 4YRLA 3K5PA 1HA3A 3OUTA 1ORDA 4Z4EA 3N3AC 2JGLA 1N0WA 5HDBB 2C7OA 4PAWA 3WE7A 3GEBA 4I4TA 1GGNA 4NESA 3GLFA 4NWIA 2CXNA 2RK6A 1IH8A 1NI3A 1EH5A 4EPRA 2Q5EA 5GIOE 3AB8A 1DHTA 1W6RA 1U9IC 4EEZA 3DTTA 2PGXA 3UJCA 3TD2A 4ZEVA 1XZHA 5CDTA 5JZBA 4MV9A 4LDQA 5AVYA 4FLFA 2AUTA 3EIQA 2OORC 3LHIA 4AP9A 1Q7RA 2WK1A 2X76A 2CLIB 3UKJA 7AT1A 3L1UA 1JJIA 2QTRA 3FTNA 5PNTA 3UF0A 3WMXA 2HW8A 4R6WA 3MJHA 4UCFA 3WK7A 2LD4A 4P32A 1CNEA 4B4DA 1P7WA 3FYUB 3MWFA 5AOBA 3AJDA 2WT4A 3NDIA 1ESDA 2BELA 4HJRA 5CB6A 1AG9A 3AR9A 2NU8B 3DPUA 5I9MA 1WIWA 3K5IA 2WU8A 3E1GA 1M8JA 2D0OB 3FFTA 4TV9A 3ZWMA 1UBRS 3DBRB 4TGLA 1RSZA 3QV1A 5JG7A 1IZZA 1I4LD 4FGJA 4NCBA 4R81A 1JG3A 2UUBB 3CCBA 2G28A 3QFRA 1GRCA 2FUEA 2ODAA 2BBWA 1YO6A 2IZ1A 1TYBE 5SZIA 4NC9A 5C7YA 4AKGA 1OGYA 4N5MA 5K0TA 4XWAA 4DFDA 3ENQA 5H7XA 1CUEA 5CBPB 4FHGA 2ZRGA 2O8DB 3BCSA 1RTKA 1L8LA 2C9MA 3EIEA 3UMMA 2J32A 1ZLYA 2O1XA 4LRYA 1T35A 3EVZA 2YYSA 3KB1A 4YO7A 1BFKA 2D8AA 3GT7A 2AK2A 1OIWA 3V1UA 4QX6A 1UEXC 3PDIB 4FXOA 4XIFA 3S7TA 3VO1A 3ZJYA 3PC2A 5BSFA 4CQNA 4L0MA 3TX6A 1EZ4A 1OA0A 4R0NA 5ICMA 4N7JA 2RMKA 3MUNA 2CDAA 1DL5A 3F3YA 2J1LA 2YYYA 4IJ6A 1KSGA 4CMCA 4BV3A 2XB9A 4YWHA 5LCXA 2B4YA 1LQTA 5ABPA 5E95A 4CLOA 2AR9A 3NBUA 4GZ6A 2O0HA 2ZTVA 3B5JA 4DNPA 4FOLA 1CUDA 1AB5A 5L3QB 2WVHA 4E6EA 2C96A 4J16C 5EWJB 5EUCA 4ZDWA 4RBNA 3EGDB 1SQSA 4CM7A 1KO8A 2VJDA 3CUVA 4HSEA 3IQWA 2YKGA 1SJ9A 1YRWA 3OOSA 1EIWA 1Q5PA 2IDZA 3EA5A 3M2TA 1F6BA 1SIWA 5KVAA 3VOAA 4FR0A 3OF3A 1CLEA 3P8ZA 1ZNWA 1LSUA 3AI7A 5EHZA 3ROMA 2OCXA 1AGYA 3E7DA 1OT3A 1L7NA 2BZSA 2BY4A 3D6UA 3CO0S 3AESB 3KDAA 3AUAA 3L3BA 2X9GA 3NOXA 4OCZA 4BO4A 4D4KA 2Q3DA 4I9HA 5BWNA 5KOJB 1F8YA 5IT9A 4EZBA 1R18A 2ZE5A 3MIIA 2BPOA 1R8XA 1PZFA 3B60A 3DTVA 3QKSB 4HDOB 3RV4A 4FFSA 5IC6A 4B6RA 3BXFA 1HGXA 1JQJC 3BHJA 3O1LA 4R2WA 5DGCA 4IQFA 2F1JA 3V2UA 1T26A 3AI3A 4Y2GA 1VJ0A 4G5RA 4ZJPA 5AESA 1QH8A 3C7CB 4RHYA 3BK2A 2BYTA 2Y6UA 1VL0A 4DLRA 3N8IA 4L8YA 3CB2A 4DCCA 3SVTA 2CFOA 2PUTA 2QX4A 1PEKE 2R97A 5AJWA 1LY1A 4AT1A 4JXKA 4U4AA 3MWYW 3E7XA 3CBQA 5H3HA 1CVRA 1IBLB 3OTQA 5DGXA 4D9CA 3RBXA 1Y1PA 3CLUC 5KZMB 2R00A 3CNHA 1ORTA 4PLWA 4TSFA 3TSZA 3U4MA 1HY3A 3VU0A 4TV8A 2CXSA 5TX7A 5B1SA 3OQPA 1AKYA 4HJXA 1VGVA 2VWPA 4H60A 4REMA 4X6YA 5LQRA 2AUNA 1NXOA 2DKOA 4H7KA 1L5LA 1T5BA 1A95A 2O2HA 3KYIB 4LQCA 1GZSA 2G4LA 3F74A 3HA3A 4R54A 1SWVA 3NH6A 1C9DB 3AJEA 1NQUA 3GRPA 2GJ8A 3CGWA 5G0SA 4AF8A 3B1VA 3CT4A 3FFBA 4WOCA 1FSGA 2DY0A 3T7EA 3GX1A 1ES9A 5D5HA 3ZS9A 4LXYA 3HCOA 1FP4B 3N53A 4Q6BA 1WUKS 4YRJA 5JTUA 1QYRA 2DHQA 2PH3A 5ESXA 3G8YA 1N4AA 3KZVA 2LV8A 2YHUA 3PL1A 3WKEA 1W5AA 3ZQJA 3CSUA 3HB0A 3HM2A 3Q3CA 2GK3A 5EP2A 1EUZA 3JD1A 1RI1A 1NTRA 3Q98A 1P3Y1 1H6BA 4H18A 5E2IA 2R6JA 1G1AA 1IK4A 2WIDA 3IT1A 3PYLA 4K9NA 4N3CA 3Q9SA 2E4YA 2YX1A 3IVAA 1C14A 1XMPA 4IJUA 1V9CA 4MV6A 2WWVD 3TLEA 2WG0A 4H9GA 3UZUA 3RVKA 3ZY2A 4UHDA 1SCBA 2OCIA 5FJIA 1FRQA 1LRLA 1NNUA 1NC1A 3EDOA 3E9YA 1K8ZB 3C1TA 2J3LA 2WNIA 3BK1A 1Y5LA 3ABZA 1F8GA 3SFVA 3SX2A 2E37A 2BEVB 4DQVA 3TPFA 5EHXA 3ZCRA 2GYUA 3N2LA 2ET6A 2MINA 3DBIA 4Y9RA 3RS9A 2DEUA 4E4TA 1F2UA 4INZA 4C3ZA 2PZFA 1HDCA 1ZSVA 1A9ZA 3C7TA 5BNZA 2OM2A 2CYCA 1ZI8A 2VSXA 2FW8A 5A7FA 1Y6JA 1PW5A 2Q45A 1T2UA 3C39A 2GPWA 1SWWA 1G20A 4U7JA 1VIYA 3CIFA 3U80A 3WGGA 3LD9A 4UE6A 4J4BA 4RS4A 2Y76A 3VHQA 4P6VF 3DLPX 1CQJB 5C52B 3ORRA 2VQDA 3QQPA 4HO1X 4TMZA 1PEAA 2XRZA 1SVWA 4PTLA 4G1CA 1TK3A 4TL9A 4FB4A 5IDYA 1EFLA 4X8MA 1K4KA 3ZDEA 4B3RB 1VQ1A 3PNMA 2IBSA 2XQVA 5DTQA 1TKAA 1RI3A 4DF3A 3R09A 5HIJA 3Q0IA 3Q2OA 2WUWE 3G49A 1KHHA 1Z5OA 3FETA 4RMIA 5ALXA 4ETWA 5K99A 2IUEA 3EZLA 5DBHX 2W2MA 3NHBA 4DIUA 4DGSA 1U0TA 4OHVA 4PV7A 4TV9F 3GLGE 1VMIA 2ORVA 3A8TA 3ED5A 4NJEA 1VHDA 1PSDA 4XQ9A 1FJ2A 4ZREA 4MR7B 1SXJD 4GU5A 5SICE 1J49A 2B4TO 5K3DA 4HNRA 2PH7A 1C1DA 3CZ9A 4U9HS 1MOPA 3DV9A 4EVQA 2AQKA 4KIFA 4QAJA 2AGVA 2Y8EA 1OJLA 3FTPA 3GYBA 1DC6A 1JLHA 3BEDA 5CA0A 4IWXA 3E9NA 5KEIA 2XCOA 1ENPA 3W1VA 1JQEA 5KIAA 2C2YA 4EBBA 1I1NA 1PL0A 4LHZA 2QX9A 5EJMA 3KX2A 1G3QA 3WLQA 1QHGA 5B1DA 4ACAA 2GXUA 2HU8A 1DP4A 4BJHB 1TO1E 1T3LA 1YS2X 3OURA 2AWOA 4CIWA 5JVDB 3PXGA 3NIFB 3TWOA 4CMBA 1D6NA 4GR4A 721PA 1U6JA 2O0JA 1HC7A 1FYXA 3KVOA 2JCSA 4NE7A 2YIMA 1T1IA 4NQRA 1PFKA 2YVUA 3ROZA 3WRXC 2BEKA 2BISA 1XMQB 2Q41A 4E46A 2IHYA 4ZP1A 3O4RA 1TUIA 3AHJA 2P5YA 1IRIA 3BIJA 1HYEA 4WNYA 4HAZA 1LBQA 3O8OB 2JNWA 2ZUCA 2RHCA 1O9HA 2QD2A 1Q2XA 3KOWA 5KO2A 3F4BA 1BSVA 2I91A 4X24A 2R8ZA 4J0FA 4ICIA 1ISHA 4OLBA 4GGPA 5ALZA 3WGJA 1I7PA 1T2NA 2PKWA 5LZ4A 3AEXA 1FIUA 1JDBB 1IEWA 1JIIA 4MR9A 4HPWA 3MTIA 1ZD4A 1DBVO 3Q15C 4WACA 3RRJA 5EJEA 2VXCA 5TPZA 2Q5HA 4P2BA 1FS6A 2VNHA 5EIOA 1ZD3A 1NUSA 4Q9LA 1GNQA 2ZQ5A 1JBKA 2MMCA 3D6MA 1Y9ZA 2WIAA 2Q9AA 1WXEA 4M21A 2PUVA 3RR2A 3HCFA 2X58A 4X8OA 4UQLA 3SYMA 5BNFA 4WW0A 5FPPA 1D6JA 4EYSA 3DP9A 1U2RA 4WMLA 4C6TA 3IP7A 2GAFA 1XCJA 2VJKA 1E5QA 2PVPA 3PPYA 2OFOA 1UMBB 1D2GA 2YNMA 4QG7A 4R1LA 2VP0A 1LCIA 4GSKA 2WYUA 4ZZIA 4TV8F 4ZEOA 4DV3B 1OV6A 4PXSA 2WVAA 1YZKA 3I62A 4CG0A 3LL4A 5D85A 3PEEA 2OVFA 2E5LB 3SZUA 4ER7A 3L2OB 1T8PA 3T4EA 4IZ6A 4PLZA 4I8XA 5I9SA 3EEYA 4ZHQA 3LY5A 3LCCA 2E2WA 5ARCA 1EZZA 2R7NA 4GYKA 3DXYA 1QP0A 4CUKA 3STUA 5FWYB 1WOMA 5EHNA 2V3CC 4RVNA 2X7JA 4M1SA 4X8HA 3WYBA 1PAUA 2X9NA 4YMSA 1SAYA 3DDOA 4F5WA 5AUPB 2I65A 4FOOA 3IULA 3NX4A 2XECA 3GLVA 4HDQB 4V0MA 4DDHA 1E2HA 3NHLA 1P2BA 5FA5A 5BYKA 3DPIA 5JECA 3A6EA 2YY5A 3AFHA 4JB0A 3JX9A 2XVMA 3P94A 4A3SA 3BWMA 1T5IA 4AX8A 1SKYE 3KXDA 1QYDA 4TOIA 4R8MA 3PICA 4I50A 3RUEA 3FJ1A 5TGDA 4CU5A 4O0LA 3NVKI 3KE9A 1VYTA 3V5NA 5CX1A 2O8EA 4LV8B 4DLZA 5AW6A 3FYCA 3VZPA 1BXZA 4ROTA 2XF2A 5FR1A 1G7CA 3AG6A 5LB2A 2G07A 5K0LA 1VMKA 4IDGA 3RSGA 3VU9B 1X1CA 5FI3A 4V0RA 3H2IA 4RLFA 3RF6A 4JEUA 1SG6A 1Z62A 3BXZA 3QX8A 4X94A 3W1WA 4BKRA 4QUEA 2J3DA 2R4QA 4Y2TA 2CV0A 2BI4A 2OBNA 4LN1A 3HZHA 5JSZA 3PUWA 2GSWA 5FFMA 3STXA 3KZCA 4H08A 3ZZMA 4EI7A 4B3TB 4PYMA 1C0KA 3V3TA 4XGRA 3F8SA 2A9OA 3EMDA 2QQ0A 2C7QA 3ONEA 3FTQA 2QLNA 2FZVA 3I2HA 1B6SA 4A5OA 1CQIA 2QG6A 5BR8B 4UM7A 3F4LA 3CNEA 2DULA 2Q3JA 4HMOA 1OJ7A 4JODA 3UK0A 1DV2A 1X92A 1VJ5A 1NP3A 1TK9A 1P81A 1G8JA 2A3RA 2JEYA 4LGYA 2NUAA 4C4TA 5KNCD 4UAVA 2PS3A 3PV0A 3B1ZA 4R2JA 5AUQA 1KMQA 2G82A 2ZEJA 2IA5A 5AW5A 4OQYA 1KI6B 2FKNA 2HRZA 2XRMA 4G84A 3I64A 4QYSA 4TKZA 2PJDA 5C1BA 4XGKA 2WIBA 5IC4A 4D02A 1G8FA 3HCWA 1JJVA 4HDMA 4JUBA 4R9VA 1YKFA 1Y1RA 4MV0A 5CD9A 1NBHA 3DNMA 1E9VA 4X3OA 6REQB 5CA0F 5COBA 2BM0A 5EKUA 5AO9A 3LT0A 3O3NB 5L3SA 3MJEA 5LYYA 2D5CA 3ND8A 4N76A 1E8DA 1NW7A 5FCDA 3U60B 4JKOA 4PX9A 3CH6A 2Q1TA 3GLSA 2QGNA 2W2LD 1C0IA 5TQVA 2IOFK 1EFHA 4CIDA 4DR7B 3M8KA 2HQOA 1AU9A 1Q11A 2NZYA 3A9RA 4PZCA 5K6AC 1SULA 1W88B 2AN3A 3GCWA 5CLJA 1P8JA 1LTHR 2H92A 4JT4A 2EIHA 5BNTA 3GAFA 1E8MA 2WAAA 1NUPA 4J4TA 4LJ9A 1SXJC 2WQ6A 3K30A 2UZAA 1CLUA 2WM2A 2YW9A 4FINA 4A0HA 1U3FA 4X20A 2WJ4A 1Q0HA 1WMBA 3QUSA 4QYXA 2JH9A 4PHTA 1QRSA 4OMCA 3OIVA 2JGRA 3N7UA 3NV7A 3O4JA 1RACA 1G5IA 2RJ3A 1TZMA 3C3PA 3D2AA 4FHEA 4FOSA 1A72A 4V1CA 2VJNA 2VXBA 2WILA 3PIDA 1N5OX 3TQIA 4HBGA 2OBFA 2LR0A 4XTRA 5A6SB 4DRYA 3BMCA 4OUDB 4Y9UA 4XWYA 1YHZA 1DJNA 1OHHD 1IHYA 2C42A 4EKYA 3TRFA 3HJRA 1GCUA 2VAPA 4U9IS 4WKGA 5EIAA 3IJ5A 1K7FB 1LTQA 2OO5A 3G2IA 5FA8A 2W2PA 5BSMA 1TC2A 1E7QA 3MHTA 1GQQA 3FHOA 3IP8A 3QXJA 2F3RA 1IPHA 1I2AA 2O0LA 3WJ7A 4DABA 2WA1A 3AVXA 1UF9A 1FNCA 3DP7A 2RH5A 3R3VA 5E6UB 3VYRB 1P44A 1RPNA 4WINA 2QD4A 4P58A 4JFRA 3DYIA 3O9VA 1JHYA 2FGKA 4E70A 3LHFA 3ZZTA 1WCYA 1VG8A 1F2TA 1UFRA 2WWRA 3EAGA 4W7IA 3D6HA 4OM8A 2A30A 1ATZA 2PUEA 1NRIA 5BQXA 3VQTA 2A9JA 3PI7A 1J2TA 3QYFA 5TQJA 1QTQA 2QTGA 1A2OA 1GNRA 5JTTA 5LQCA 2PMCA 3N2GA 3ZD9A 5JRZA 1AF4A 1UKVY 4DDWA 1K6MA 1O97D 4ZMRA 4O0MA 2FPPA 2WWFA 1KH1A 2BGRA 5JNVA 4NCAA 2C5SA 1SO8A 2LPMA 1EZ1A 3KQMA 1MX5A 1U63A 3TDKA 4X3CA 4TS9A 3B6IA 4AJ2A 5B4VA 1CERA 5IAGA 3PNLA 3UA3A 3O3CA 5K6RA 1PNVA 1KAQA 1SVMA 3FHJA 5D00A 3AVTA 4HQNA 3R5HA 2QTHA 1HLGA 1XEFA 2PQ6A 3JWPA 3GGGA 1T6ZA 3O4VA 4NECA 4PG6A 4V2IA 4FEYA 3U39A 2NXJA 3VU8A 3PK0A 3ILYA 5SYMA 5JCZA 3K35A 3GAMA 5E1MA 3WLPA 3DEYX 3M5DA 4DRXB 1XTSA 2YWGA 4HF7A 1I24A 1FVOA 1E3WA 1ECGA 3OZCA 4URYR 3A9SA 1QR2A 4KYTA 2IU6A 2ORYA 1M83A 3VR5A 1JH8A 3BULA 1E1NA 3K8OE 1Z2DA 1ODTC 3D7NA 4XR4A 4DUGD 1B3RA 1Z0ZA 4MROA 1DEOA 1ZO8A 2Y93A 3BHNA 3E9DA 3FOCA 3JATA 3PRHA 4NCNA 2J7PA 3GPLA 1CJCA 2DBQA 2ZJ1A 4Q3OA 1O95D 5F73A 3PITA 5IJZA 2P6RA 2HQBA 3AF3A 2GK4A 1CE8A 1QQ6A 3P27A 4XQEA 4L8VA 1HLPA 4KQGA 3PNVA 1IWPB 2HC9A 2R44A 1CR1A 3ZW9A 1VZ2A 4TMVA 1I3KA 1C8KA 5D5PA 3ADPA 4KPFC 3WP1B 1E3DA 4XQCA 3LLSA 2DFPA 1X7ZA 1GV0A 2QAGC 3JPYA 3UG6A 4QUBA 4OSEA 2OB2A 4PONA 4OHFA 4RZ2A 3ZDFA 3FMIA 1QS0B 5C1PA 2J33A 1GG5A 1D7AA 4Q4CA 2CV2A 2ZWIA 4LNAA 2REBA 1U2GA 1SXIA 4RGQA 1MPXA 3SCZA 3UAXA 5F64A 3OZAA 3PQEA 3PX2A 1FW8A 3DCJA 1V7PC 3PSHA 3C1OA 1QKKA 3LBFA 4QBFA 2BOVA 2UVQA 3MA0A 4I5FA 2P4QA 3AETA 1US8B 1KP3A 1IN7A 1OILA 2ZRCA 3VDQA 2JZNA 1VCNA 1QVWA 4MZXA 2WD7A 1R6TA 3EOZA 3MCVA 4M0LA 1D9ZA 1PJ2A 3IJPA 4Q3BA 5KWJA 2XOKD 4C6SA 2C58A 3TQTA 1XDWA 3ID6C 1M7GA 4HDAA 2PMWB 2FDCA 2J4CA 1NVWQ 3G0DA 3JRXA 4DQXA 1QIDA 4ZDKA 5C1OA 1HNWB 5ILOA 3KTAB 1KQGA 3MLBA 1R00A 2D1TA 1OFUA 1W30A 4JK3A 3W05A 2IBTA 2RHRA 3CM0A 5ESDA 3NIGB 2H4YA 1LFAA 5DIZA 4NXNB 2ATCA 1OT5A 4NX2A 3HY4A 3OZGA 3EFBA 4RZIA 5LMUB 1G8GA 2P65A 3DLHA 5DK4A 3QPDA 1PWEA 1AKVA 5EZ6B 1PDOA 4JROA 2XTMA 1RTTA 3FZQA 1VCHA 5D8DA 5HQJA 5CB8A 5CDFE 5JS7A 1GGJA 2FF5A 3ZNQA 1XEWY 2IV7A 3WTBA 4KPUA 2Y67A 4DBZA 4EMBA 2NO0A 2FEXA 4MV4A 4M1YA 5IWCA 1T1RA 2JKZA 1VE6A 2IYPA 1YZLA 4CDNA 4RJJA 1JG4A 1RAAA 5ALQA 4CMIB 3KB6A 3L0CA 1J07A 3B20A 1TF5A 2NTEA 4M8NE 3VR4H 1Q1AA 4LC0A 4YCMA 4CEJB 4Z0HO 1GDHA 1T10A 1Y89A 1BMTA 4Y2YA 4AJOA 5KNDH 4DSNA 5BWCA 4Y1RB 1JQ3A 3RK4A 1ITZA 1BQEA 2ZB7A 4ER6A 1NYLA 3GLTA 3AOGA 4QDJA 2VPPA 4K6OA 3V7YA 1DMSA 2EZUA 4FX2A 4X00A 5J9FA 3VPBA 1Z9BA 5KC8A 3BRWD 3DLCA 2C5FA 3D0KA 2AC4A 1CUZA 1CUFA 2R1VA 2ZFUA 2QVBA 1GUBA 2FPSA 3FWZA 4JN6B 1YT5A 4LPKA 4XDYA 4EHDA 1R8QA 4O3MA 2GRAA 2R5WA 1AXRA 4DPLA 4G4JA 1CCWA 1ZRNA 3EXEA 3HGQA 4GMFA 1O6GA 4EG0A 2O5EA 1Q0UA 1ODFA 4R98A 2PX6A 1GG9A 2XKAA 1JS1X 5FIUA 1E5TA 2Z3VA 4GP7A 4OH1A 3V3KA 3WTCA 4D6PA 4XLZA 4YXFA 5JUWA 4DUYB 2J08A 4ZAYA 3BA1A 4F1JA 3ZCPA 4I99A 2PGNA 4D25A 1V16B 3CVWA 3DFIA 1GT91 1IDOA 2ANBA 2ZATA 2PU7A 2VZEA 4P3PA 5AVVA 2V0GA 4CT0A 5IEJA 1TO2E 2XTZA 3K3PA 5E0OA 2WAOA 2JVJA 4DIOA 3IAHA 5KDLA 2YOGA 4K5QA 5H3LA 4C0QC 1P4RA 4AF7A 4KOAA 4GP9A 4XTCS 1OKKA 3HEMA 3KQLA 3IHTA 1BJRE 1IHXA 5H9WA 1YB2A 1XAHA 1JUDA 3KD3A 4HMQA 4A15A 2HF8A 1XVLA 3GLRA 4JL8A 1NWHA 2R2AA 5EMKA 4OGLA 5K20A 4ND4A 1CB7A 4EUEA 1SEPA 5JZOA 3F73A 1QWSA 4KN6A 4X91A 2IXEA 3HNRA 1RQ2A 4MQEB 3C6QA 3D5TA 4D5GA 1ST2A 4H4CA 3OG9A 1D8TA 4R3UC 1NSYA 4BMDA 3IO5A 2I87A 2K87A 4MS1B 4NPHA 5DVZA 3A14A 1M8FA 5E7JA 4KVGA 1DRKA 1DWQA 4MW1A 5B2FA 4XIIA 2PD6A 3ELYA 1LTKA 5EIBD 3SYNA 4DY4A 4OUKX 3N2YA 4HOYA 1L7RA 3O38A 4QFDA 1T3HA 2OAGA 1GTVA 1I2CA 1L5FA 3FF4A 5CT9A 4H17A 2J4DA 3RU2A 5HOQA 2ERCA 1P9OA 1FS5A 1HEIA 1ZZGA 3WKAA 1E5DA 1EFAA 4WK2B 4C7OB 5CNMA 4ZAGA 4KSCA 4EG5A 1FU7A 1Y34E 1O97C 3U61B 1G8HA 3DTYA 3NHZA 1RVV1 4HH1A 2PCLA 2ID7A 2C8JA 2VH1A 3QHQA 1T6XA 3FBGA 1I1QB 2OILA 3KV1A 2B25A 1A9XB 3JQQA 2XT9A 1WMDA 4LHVA 1PNOA 2QRNA 4IV8A 1U0NA 1RMYA 2GK7A 1KDOA 3E9EA 5FOSA 3ZQ4A 3ZD6A 4TUYB 3GRCA 2WTEA 3M81A 4J7UA 2VHUA 4V0NA 1MEEA 4GBJA 2NW6A 2PLRA 4FSDA 1VPLA 3WBJA 1MVLA 2F7SA 3W5DA 5JYDA 1MG5A 5IEBA 4ZYYA 5YASA 1PFQA 4X6XA 5IDVA 2IGTA 3QA3E 4ZI2A 3S8YA 3U4QA 4UXIA 3SMQA 1I4TD 4RV5A 1EFCA 2A5YB 3CXRA 3KNZA 3TRIA 4MVJP 3P0HA 2P3OA 1RR6A 4WPGA 4H3SA 4BIMA 3MJVA 5LDHA 3HXQA 2P3QA 1NUAA 2G1JA 4KBYA 1Y4DE 2XGOA 3V34A 2OLKA 1YASA 2HHCA 3TZBA 1P6UA 4F5DA 3PFCA 3LO5A 5K8CA 3QX9A 4DR3B 1MB9A 1U81A 1HE4A 2SECE 2ZBGA 1FCJA 2Q2WA 2E21A 2A6PA 1UDBA 2HMWA 2OMEA 4L5CA 5EINA 3BMQB 3QEKA 4DIFA 4M0UA 1P2FA 2K5UA 3BRCA 1PW7A 4JBGA 4YJFA 3Q8WA 2COKA 4G4IA 3OF5A 4P7FA 4P84A 2RKOA 4JVNA 2NX2A 3PCTA 3JQBA 3PTZA 4IHQA 2QMZA 4M9ZA 2GTIA 1EAYA 1EHYA 4MHSA 3SEAA 3B1JA 1Y8QA 4P4SA 3VTZA 221PA 4DXHA 9MHTA 1SCJA 3KYCA 4XX0A 4OYLA 4EJSB 4AMBA 1WDMA 4J9UE 3ZWQA 3ZXSA 3H1PA 4L9AA 5C3MA 1QP8A 4YLEA 1S4QA 1JL3A 2RGRA 4MH0R 2PXAA 2QLLA 3JVDA 3QELA 4HEA6 1V48A 3WAGA 2X5NA 3F3MA 4OP1A 4Q4AB 1SBNE 3Q3GE 2I7DA 4I1OA 4CLDA 4HV4A 1WB4A 4RDCA 2NSDA 2RHLA 2ZBRA 3F5SA 3AR4A 3IVCA 1FUUA 4LRQA 4DEXA 4G8CA 3VGPA 1KMHA 4FNAA 1Q14A 3GB9A 4IS3A 4IJVA 4CJXA 3FSGD 2YRWA 3KEOA 1G0OA 2O7SA 3EDRA 2QUZA 1TAGA 4I6GA 1G2PA 1K4YA 2L69A 4N8DA 1FDVA 4BDTA 3DOUA 2HK8A 5DTEA 4EKDA 4B8ZA 3I01M 3C43A 2MCFA 4AKIA 2M2IA 3U6BA 4WV3A 1BFUA 3T35A 3SWWA 2D1RA 1VBMA 3HH8A 4HRXA 2QDXA 4HUQA 1O5IA 4QU8A 5C7LO 3O1IC 4R8LA 3F7MA 3D4IA 4KO2S 1EVQA 3HBJA 2OG2A 4B9EA 4JIMA 4J07A 4GOND 3AEKB 4E09A 3CEAA 3UPUA 2OGZA 4JX9A 4PRYA 1I7LA 4HAWA 4U2CA 4UHFA 3ZLVA 1QZTA 4U7DA 1QHXA 4WIAA 2EHJA 1TX4B 2DERA 2X9LA 2Q1SA 1LXCA 3MT8A 3B12A 4WNIA 4AZSA 1JLKA 2IYUA 2RD2A 3UOGA 1KC1A 4IIUA 4D79A 2WSIA 2BFAA 3QU4A 2VPWA 3H5OA 3WV5A 4BNFA 2ILTA 4J6EA 3OU2A 5A9SB 1J0DA 4JX8A 1SKMA 2JI4A 1UOOA 1XTIA 2H0AA 4RPCA 3CN9A 3G79A 3GDFA 3EVCA 2OG1A 1T43A 4KV9A 2D0PB 1DOHA 1NUTA 3OMXA 1YUBA 3TUJC 3WL6A 1MOZA 2WZDA 1DO2A 2X2PA 3KSDO 1CC1S 3I92A 1OZAA 1OYWA 5DGHA 4ZAVA 1Z28A 1GFWA 2C2OA 3TMYA 2Z8YA 3ZWOA 1VG9B 1JG1A 1X8KA 1DOZA 4D9IA 1X9IA 3NONA 3E2MA 3KFLA 3X1YA 1TCAA 3A1NA 2EJUA 5CXQA 3ISVA 4HAXA 1VYUA 3MBKA 1G6HA 2WJAA 1N8NA 3IXMA 2XNCA 1PFGA 2W9XA 3FYUC 2I6SA 3BH6A 1DT3A 2WPDD 4P7BA 4R31A 3X44A 1PRYA 4M0CA 1MBZA 4B4UA 5FLKA 1CF2O 1YS6A 4UVIA 2BBTA 5J5VA 4RTJA 3ADCA 1TM3E 3JYHA 4R0MA 3CX7A 4EEXA 1E2DA 4UBLA 3P2EA 5CVCA 3T1OA 1PVOA 1CZUA 1ZY2A 4N5LA 2JK0A 2EZTA 1ONBA 5HTOA 3PC7A 4MW7A 4B5LA 1GL9B 1KPGA 2AIRA 2OBLA 3WLJA 2EWWA 4DTIA 3RYFB 2FY8A 1OPRA 3NXSA 2W6MA 4M6WB 1QFZA 3QVGB 4B7ZA 1UK7A 1VA4A 3JVVA 5TXGA 5I7FA 4MITA 5IJ9A 4FM9A 2FRVA 1UOQA 3E3AA 3L7OA 1DDOA 1O08A 4HEA1 2NUPA 3U1VA 3NETA 3QOWA 1LJUA 2ZR0A 2HH9A 1QU3A 2Q2NA 5KQGA 4A03A 1EFRD 2CHUA 1S89A 1WVIA 5EIBC 3W78A 5CA1B 4YJ2A 2CVOA 5IM4A 3WNVA 3LK6A 5C35A 2BFNA 2C03A 1VKHA 2IEYA 2RGNC 2B8NA 3H5RA 2X1VA 2P9FA 3I4FA 4X7PA 5A4MS 3PFGA 4K9QA 1Y98A 1D1SA 3QX3A 5EE1A 1BWRA 4XEUA 1V4BA 1EBBA 1BGXT 4RIIA 2BFCB 1RP1A 5JDIA 1B6GA 1SH7A 3KQOA 2XE7A 4JOSA 5G0VA 4OP2A 2O8NA 2ZR8A 3QJGA 4D9BA 2XYVA 3W5BA 5KNLA 3I5YA 1H8HA 5KYNA 2JLCA 1JT9A 2GM3A 1S0UA 4UBNA 1C4WA 2J3QA 3DDSA 4LOKA 4XD7A 2QVYX 1L1FA 4HVLA 1KY3A 1KJWA 2HRBA 4GRDA 1PQUA 2NACA 3VU3A 3ZE0B 4YRZA 5BOVA 2QZ4A 4KQWA 5LZ8A 2O8CA 4HLDA 2VJQA 1TEXA 4BV9A 5JCOA 4CL3A 2JGFA 5GPBA 2I8LA 3V7WA 5IULC 1PZHA 1JAXA 1U0LA 3BMXA 3G2QA 5CM9C 1QNLA 5CRIA 4RQBA 5DBIA 1IUNA 2PGIA 5JXHA 3HBMA 5AIAA 3SLKA 1N5KA 3FE2A 1CZKA 2EFYA 3TRDA 2EX1A 4DMCA 1WXGA 1Q0QA 2C5BA 4DM3A 1QV9A 2QSUA 4CMEA 2PSHA 2SKDA 4B6EA 2DC1A 4BNJA 3L79A 4BLOA 1EK2A 3S6JA 5GGYA 2FUCA 4BQQA 1FS4A 2Q5CA 3EW9A 1LBTA 1P3DA 3T9CA 2NO1A 1YQXA 3F6RA 3QLEA 2YWCA 3KDSE 2AH5A 4IL5A 4OX9Y 2VDNB 4WBNB 2QRGA 5LQJA 1UJNA 4C4XA 1MW9X 3ZE6A 2HSGA 3OPXA 5BQ5A 4G56A 3B3GA 5KMGA 1N2CA 4TLLB 1V9SA 2NQ2C 3EPJA 2PRJA 4LZOA 2AJDA 3FBWA 4C20A 2DCMA 4CDGA 1P0IA 1Q0ZA 2NZ8A 3FBTA 3JRNA 3MJDA 1MRNA 5A5EA 1T4BA 2HJWA 1SQ5A 4BJ6A 1JPJA 1PGQA 4TLEA 1XCGB 2CDNA 1XZFA 3W8RA 2J9YB 3V1MA 1RC8A 4BHTA 3PT9A 1EWTA 3Q5GA 4CM5A 4GL2A 2RI1A 2XGMA 3V1TC 2CMDA 2QTAA 1NQWA 3V1KA 3PL5A 1M2OB 1VL2A 3EZ6A 1TYAE 2P4EA 3RBVA 3RRMA 5IJ0A 3A37A 4UDXX 2WP0A 4RACA 5HKLA 4EATA 3PDUA 5I48A 5HM6A 3MB8A 3GCXA 5IN4A 1MT0A 5CLHA 3VX3A 3DFZA 5SY9A 3WLKX 1ZVMA 3NZEA 2UVDA 4Z49A 3C15C 3FOFC 4G5SA 3RAFC 2BI8A 3EW7A 3EYWA 3ZD8A 4GEGA 1NXXA 3C0KA 1NW3A 1DFIA 3PYMA 1WEHA 2HYDA 4QGBA 5I45A 1R3DA 2QT9A 2AKEA 3KSAC 4O25A 1HZZA 3NT2A 3I5UA 1LNQA 4J3FA 5DU2A 1CUVA 3FIJA 1N2OA 5KJFA 2QJRA 3RTAA 4N9QA 1FRFS 1WL8A 2GZHA 4MYSA 4DM4A 3E8XA 5LYJA 1G2OA 4P83A 5EP4A 1I36A 3A04A 4EZIA 1O8CA 2PGAA 4LV5B 3MLAA 5KKAA 5C18A 5LMCA 4M9CA 3MYYA 4A9AA 2ZITA 4R1OA 5EFZA 5F3DA 4ENTA 3TOZA 3OZRA 3ANTA 3TDNA 2OGWA 2GZMA 2N0SA 2C0QA 5HKBA 3M89A 2PWAA 4L4SA 1UC9A 2VA8A 1ESCA 3IP6A 3ORQA 5HRAA 2Q9BA 1W73A 1QU2A 4WL0A 4WVLA 3I72A 3ND5A 1TJNA 1WMAA 3RS7A 2MYPA 1QAMA 4B3HA 3GJ5A 2EVWX 3E9CA 4PYKA 4IVNA 1BE8A 1G6KA 1AGNA 4EFLA 1R4ZA 2Q5IA 5KQPA 1WBDA 2FMTA 4NULA 1GIAA 1ENZA 1DIOB 3HBAA 4S1VA 3DD5A 3EIFA 4FQ7A 4QREA 3EIHA 3H1BA 1E5XA 1RXUA 3HZOA 4M1QA 5HE8A 4EG7A 5AM3A 1QANA 1MUUA 3H16A 4OBXA 1GAXA 1CD5A 1WB5A 1IFXA 2BBSA 3ABQB 3TRJA 1GTJ1 5CCXA 1WM1A 3LVQE 4IF6A 2WTAA 2X0KA 3AJ9A 4R8SA 1WOYA 3E1KA 4IILA 1E0JA 3U62A 3WNDA 4XH9B 2IJGX 3CONA 1UOPA 2R8RA 2D54A 4FVTA 1RXVA 2MSNA 4O4HA 3CX6A 3ONWA 2GMWA 5BSRA 3WGOA 2YZKA 1JQAA 4WUTA 2A3NA 5GADl 4M22A 5FWXA 3O8NA 4Y0NA 3TE7A 4AZVA 4F12A 2P2ZA 4K0KB 3ZGXA 1U2ZA 2JRLA 1VE7A 4G09A 3HKCB 2Z3ZA 4JOBA 1ZSYA 2O8VA 2B5WA 1GLNA 1SCAA 3ORHA 1KEZA 4NMMA 2X1LA 4C30A 2WUVA 3R3ZA 1BW9A 2V6MA 3BIXA 3VSDA 1R4NB 3FCEA 4IHAA 3VYTB 2GJKA 4X61A 4L7VA 5AK5A 2CL5A 1EI9A 1EK1A 1E2BA 3EWNA 1A9OA 1C30A 1ZNZA 4Z9YA 1NQXA 5GV8A 2PMDA 3VH3A 4H15A 5EWLB 4F3CA 3MT7A 5CDGA 1LB1B 2XUAA 1BDHA 4CMJA 2QGFA 1F2VA 2PWPA 3B85A 4C07A 1RHMA 1EWVA 2DFKB 2UYCA 4P5DA 3QU2A 4YVFA 4N3AA 2Z56A 4K40A 3SC6A 1MC8A 3NASA 4EW1A 5LLDA 5HWSA 1DJPA 2XNDA 2XZLA 1NR7A 5BXYA 1E1DA 4HWTA 1YS7A 3O82A 2Q5JA 5CYFA 1U8FO 2VH2A 4MUFA 1U3TA 3FPCA 3MTQA 2A5DA 2JAXA 4LQLA 3Q2KA 1P6XA 3GJXC 3K7EA 2NN3C 1KVQA 2RGDA 2ZI4A 1FLNA 3GRYA 4QSHA 5D7BA 1FTGA 1DE0A 1JWBB 4FI3C 4YT5A 1WW2A 2RAPA 5C8YA 1JDBC 2HLNA 4B0OA 3V42A 4LS3A 2WWGA 3PNQA 4FYWA 1ZR4A 1GG2A 2XDAA 1P4HA 3LUPA 4WECA 1XJCA 2YWEA 3QI7A 1Z08A 3IHWA 2IU3A 3EQ9A 3RJMA 4H7EA 5HF8A 3ZH9B 5C3UA 2FLWA 1TEZA 3OQVA 1EGHA 1FRVA 3CH5A 4R9SA 3TUIC 3UWDA 1L4MA 3IVXA 1ZA2A 1JI3A 2QSJA 3EZXA 4TN1A 4F3RA 1J00A 4P0QB 4X93A 3L04A 1ECPA 5B1YA 4A1OA 3PJEA 2IYXA 3TLKA 3V1NA 4MPTA 3O2QB 1J0XO 2LW7A 4YP9A 5ALNA 2Q4DA 4EGSA 3BWXA 3F6EX 4RFVA 4TXNA 3W5SA 4N48A 1WPXA 1PJ8A 1OGIA 2W71A 2BMVA 2IFTA 1DC4A 2P1RA 2VQSA 5ITSA 2JZCA 4BFWA 4BUZA 3DMRA 5ALSA 2G04A 3UB4A 5DTIA 5D86A 4MRAA 1TYZA 2C2KA 1YZVA 2WICA 4I9UA 1CV2A 2AI3A 1XCMA 2GERA 3DAOA 5JR3A 2CVPA 2R2GA 1Z15A 1QYVA 4JBNA 1CR4A 3BSFA 1PG0A 2KI5A 4CF4A 1T2AA 1BE0A 1DRUA 1RRFA 1HG1A 3FD8A 4MNTA 3D8SA 3NGXA 2VSYA 5TMDA 4DV6B 2DU8A 1T4DA 3JALB 3K94A 1FZQA 2YV3A 4JP8A 4MW9A 1XEAA 4PG5A 5MGNA 3OFSA 2KMLA 1JILA 2YJ6A 2H11A 1N6RA 2B36A 1MRSA 3H87A 5A3JA 3UM9A 4RKQA 2FP3A 4IUBS 4OIFA 1K68A 3O92A 2VJYA 3ULKA 5L45A 4HN2A 1UXJA 3NBKA 2OZLB 2XCIA 4FFNA 4RTNA 1U9IA 2HO4A 4A26A 2HHLA 4EMTA 2HTEA 3OT1A 2FR1A 4DIDA 2YFKA 2E4AA 4MWEA 1GKIA 1O0CA 1FC0A 1ODCA 3GCDA 4YAIA 4TWIA 1M2VB 5IM4F 2OFPA 5GJBA 3NQ41 5TJHA 1DPGA 3GFBA 2WHYA 4WLEA 2X8WA 2ZRQA 3L1HA 4O02B 1YB5A 4Z3OA 2AFHB 3E9ZA 5LD2B 1MR3F 2E5WA 1W5TA 4DZRA 3I01A 2FX5A 4PM4A 2NT3A 1FU8A 2V9ZA 4A10A 3VH1A 4MV1A 2YV1A 3WLSA 2I1LA 4M89A 3ZQKA 3TEMA 1W94A 4FHDA 1UOEA 1QH1A 4JA0A 2UXDB 3DZDA 1QB7A 1W5EA 3ROEA 2I22A 1V95A 3GN2A 1Z29A 5B37A 3T9BA 2RI0A 4K26A 3RRYA 1X80B 2RGGA 2OYCA 3SC4A 1X1AA 2ODPA 4C0BA 2EJBA 2VWHA 2AFIA 1MIHA 3NBYC 2ZBVA 5E4TA 3IT2A 3DZKA 1NOKA 3L5OA 2RBEA 3PLRA 4GPD1 3S70A 3QBDA 3T9FA 1FXUA 3G2LA 3LV8A 3TKAA 4C04A 3DUFB 1X7DA 2WM9B 3AL3A 1U90A 3VKUA 1ZRMA 3NP9A 1M1YE 1TTPB 3EQ6A 3G0CA 1SPXA 4HDSA 2YRFA 3HL4A 3W77A 2GKGA 3OKCA 2NO9A 5L4NA 1O54A 1YXMA 2HSZA 1V8DA 3R5JA 4ESOA 3CVUA 1QVAA 1QRRA 3BAZA 2Z1NA 5COQA 5JXJA 2QROA 3KQKA 4K8RB 1PX2A 2EL7A 1H0RA 3Q9LA 3WFJA 1V7CA 3C1UA 3SQLA 1V3VA 3QZUA 4NEQA 3WKCA 3PWZA 4CIYA 2E6KA 1OVMA 1R0ZA 3HB7A 3EGOA 3T3DA 1E4EB 4O2BA 4P4GA 4ZICA 3HYTA 2NPIA 3S3TA 1I3NA 4XJSA 1XYVA 2H9YA 4QQ8A 2DTXA 2DX7A 3MWDB 2LIVA 1TT5A 4JVMA 4BN5A 4U8HA 1RRGA 3Q5EA 4MS3B 2ZTHA 4JYMA 3CY6A 2ZK7A 1YHYA 3FHCB 3LWBA 1YB1A 3IA7A 3OZTA 1TZ2A 1LF5A 2DB3A 1B8PA 4KG7A 3JZMA 4Y7DA 2YJ4A 3DMPA 4IQ8A 2YC4C 1NMEA 1W85B 1XMIA 3NGLA 4D26A 2IYLD 2IUFA 3CIOA 3CKLA 4L50A 1V8OA 5EYPA 2ZIUB 3A6ZA 5FOVA 1TZJA 5C8YF 4FSHA 4N49A 4JI3B 4YUXA 5T8KA 2A5GA 4HS9A 2BKEA 1YC5A 3DLBA 2QRZA 3K20A 1WZCA 4GM0A 4GUAA 3RH0A 4N01A 3G9XA 3WBKA 3WMWA 4RLQA 2IL1A 1PQYA 3KUXA 1TFRA 1GGHA 4B6JA 2IS6A 2DLNA 3NU1A 1TCCA 3OX1A 1Z74A 3FNHA 4Q4DA 3QNUA 3HKDA 5J3JA 3BFJA 3V4RA 2AVDA 1AK9A 1W44A 2OHHA 1AA6A 1KH2A 3CE9A 3HJUA 4UUBA 3B5IA 3NHWA 1Z7YA 3LGSA 4GKBA 2ZUVA 4Z9FA 1FEZA 3EZNA 3ISJA 1QE0A 1YGPA 2PMKA 3SS7X 1XWFA 2EX4A 3AWIA 3M33A 5A4JA 4FC7A 3ZWPA 1JFFB 2HLPA 1WY7A 2G80A 3M34A 3SHQA 5CB4A 1F0YA 3RUIA 1E1CB 5D3MB 5EPEA 4YRQA 4CTMA 5LQMA 4IIEA 2JJMA 2WD9A 4FCTA 4X65B 1EWQA 3EX7C 3DKVA 3ILHA 4OFXA 3FMPB 4UUOA 1IXZA 4BGIA 5I7HA 1AY0A 1OH5A 1W1UA 1X8JA 2ZSEA 3AUSA 2VSFA 4KQ1A 3OZDA 4P22A 2R8BA 3H0EA 1OC4A 4FE4A 1S2DA 4URHA 3BDVA 3GP8A 3GU3A 3KOZA 5E1DA 4TXMA 1N5MA 4JCCA 3D4BA 3S2EA 3NRCA 1YTUA 1U0SY 1AMUA 2G7MC 2GAOA 3BXPA 3SDZA 2G72A 1H2FA 3OPYI 1GKLA 1L5SA 2UUPA 2CUZA 2ERYA 3OKAA 5DM70 3GLFE 4B6PA 2PX2A 3HFJA 2OEPA 1KRWA 3NTXA 4WXEA 1FPMA 3FWPA 3TE6A 1X1SA 1A71A 3T1QA 4IRXA 3A2MA 4R9UC 4JCOA 3FR8A 5KTYA 4QHTA 1EYZA 1X70A 3A3NA 1V11A 2O3RA 3PQ6A 2Z6VA 3IT3A 5TQ2B 3RTGA 5DLPA 1WU8A 1ZS9A 3G2KA 5H0IA 3PTAA 3WGTA 4ZN6A 2Q3CA 3FMFA 2CFTA 5CEFA 1CIVA 1JJFA 4OHWA 4ML3A 4BZQA 2Z2JA 3KT0A 2B0JA 3OEHD 4PQGA 1RYEA 1UQTA 3SNKA 1YCHA 1K8RA 2B8WA 3RS4A 3MMXA 1O8BA 3C6XA 3O5AA 4WFJA 4A6DA 5KOIA 1KEVA 1V41E 4YJDA 4NKRA 1JP7A 1BX1A 4JJFA 4FDAA 1ONSA 1N6LA 3BSSA 3W7VA 3PXCX 5E8JA 1XZEA 2Q5LA 4ASUA 2OXEA 2RH9B 4J3NA 4O5AA 1J8DA 5FBHA 2PZAA 1G66A 2VJAA 3EXHB 3ON5A 4BMPB 1N34B 2Y0BA 3WGKA 1YDWA 1I51A 5KTKA 1Y4ZA 2P78A 2FSVC 1EJBA 2Q8QA 1C1XB 2L2QA 2XB2A 1LDGA 1NUQA 1JVNA 2V7TA 4O4JB 4PSUA 2XKBA 1O3YA 3SQDA 2RHOA 4Q18A 3UT0A 1N7HA 2ZJ5A 3GFQA 2I6QA 2YN0A 1GAQA 1NYQA 2WTNA 1B74A 1B00A 3H19A 3L7LA 4L27A 3R9XB 2VJLA 3QUQA 2HJHA 3DBVO 4OB7A 5FUVA 1XMVA 3HKEB 3TPZA 5A3QA 3RIMA 2NTYC 3FOBA 1JMKC 2NV2B 1YACA 2R751 2RHTA 2X42A 3DE0X 1AGXA 4OBEA 2W2OA 3IQZA 4PS1A 5BT9A 5C8XA 3QPVA 1PT5A 3CUSA 4YCAA 2WLTA 1BZYA 1JHUA 4F4UA 1DQYA 1Q2UA 3EZ7A 4L4XA 4Q1VA 2PSFA 4F6LA 4BBAA 3IPCA 1W2GA 3WS7A 1AS2A 1E5VA 5TR9A 1B8VA 4TZTA 2N47A 4X3PA 1KVTA 4BCBA 5JADA 2BFMA 1MMFB 5C31A 2H17A 2E89A 2QZSA 1EX9A 3ILVA 1IHOA 2F90A 3ITDA 2FK7A 3UK2A 1OTXA 2B7LA 1EXWA 4IUYA 3QNWA 3RFCA 3OOJA 1NX6A 2IEAA 1JKJB 3DTNA 2H4WA 3OBIA 4HNVA 1VG0B 5JHHB 4WA8A 4LI3X 4BMYA 3HGTA 2DUJA 1E1RD 4EG1A 3JQ7B 3FDZA 4PHFA 2XCQA 3C16C 4XQ0A 1QMGA 4KTTE 3H1FA 4O2BF 1BEEA 1ZEJA 4LA4A 4WGFA 1LLUA 3UWSA 3GLGB 2IOQA 3CW2A 2PV7A 5HOEA 4H16A 1PGNA 1SU4A 2QY9A 1HDOA 1SCIA 1TU4A 3LZDA 3P45A 4YA6A 1EXMA 1GZ5A 4LOIA 3SOPA 1AS3A 2YYZA 2YOHA 1AUVA 4RHFA 1Q57A 2EU8A 2AEFA 2LXNA 2OHFA 3GVIA 3HB4X 3QG1A 4WZAE 3FUTA 4OXXA 3W79A 2ECPA 3B1WA 1QTNA 1JF8A 3AEZA 4B8YA 3JZDA 3WNQA 2DH6A 1U9YA 2JIQA 3S2GA 4UOZA 3ROFA 3P5BA 4XLLA 4PBSA 2GCGA 2H57A 1ESMA 5J1SB 4M8KA 4YRMA 2CJXA 1AM4D 2FFAA 4ZU6X 1BMFA 4C0LA 1AQJA 1E9DA 4EG8A 3QVWA 3HZZA 1JHMA 2XODA 1FNNA 3EUAA 4ZGBA 1QAOA 5LQKA 1NF8A 1V0JA 2GCOA 1GXSA 1Y5NA 2QPOA 1MD9A 2WTBA 1SPBS 1LEHA 4FONA 4ILKA 4Z7OB 3IAUA 3DDWA 2FVXA 1QHIA 4R8RA 5KJ6A 1UBJS 2CD9A 1MXHA 3AP3A 3REOA 4DIEA 1BCSB 2OP0A 3EPPA 1JNXX 2FSPA 4FMCF 3GT0A 5HXAA 4L5YA 3T3GA 1QWOA 4TRMA 4IJ5A 2VTVA 3NCTA 1WMFA 2G88A 2WNSA 3LVRE 3OPVA 3CRNA 4YQEA 5FQOA 3TFOA 2FWAA 2JI9A 5KSZA 1HZJA 1XK7A 2F55A 2VP4A 4WN9B 1XF1A 4LXGA 2CFIA 3ZCUA 4BTEA 4JV5B 4GE0A 1IZ8A 2ZJAA 1P7CA 1P3JA 2NYUA 1SUPA 3JAKA 1OW3B 5FV7A 3BYZA 3RAJA 3ICPA 1X7XA 3X1KA 2A0XA 3LUAA 4NARA 1QGOA 1JBQA 1KYQA 2TMDA 1MABA 1Z8NA 4E5VA 2PEYA 2XXAA 3O21A 5KSPA 3H5WA 3L4BC 3RSZA 4QODA 4A36A 4E2FA 3ROPA 2GX6A 2WJIA 1TF2A 3R44A 1H94A 1G20E 1L7BA 1PIWA 4FYJA 2QLJA 4LJ5A 4JJAA 4WXRA 5DO9A 1VPEA 1IUKA 4HFNA 1B73A 3BTOA 3BKXA 4C3UA 2HM7A 3GJ6A 1HYBA 3R3XA 3I5MA 2AZMA 2BFBA 4HB2A 4PO8A 1KZ6A 1NL3A 1MOQA 2DOKA 3LF2A 1E9SA 4WNAB 1L8OA 4BNLA 1KS2A 3L0ZA 3ZU4A 2GNPA 1JU9A 3GHYA 1BU8A 4NEHB 1E2QA 3EYAA 3IC5A 4B85A 3SZGA 4BCDA 2PA0A 2J5XA 2J6BA 1KMIY 1WUTA 3LDHA 2C3PA 3TCNA 3MJRA 3F2IA 3MJ4A 1CJTC 1FYFA 2PDAA 2QMYA 1XKLA 2VNKA 1MRZA 2FR8A 3PVSA 1DC7A 2ADMA 1WHTB 2ZTUA 4MCIA 3EEOA 1TYDE 2PIAA 5HX7A 2J5RA 3A3OA 3H4MA 1DC3A 2HQSA 3JPWA 1JDNA 3H5NA 2AJBA 1J0CA 3A4TA 4O4IB 4EJ0A 1RM5A 2HRDA 4G8DA 1EXDA 3AUFA 1Y6GA 3GPCA 4IIYA 1FMFA 1GN8A 3H1AA 3TXAA 3L6CA 3CE6A 3DJFA 3KTDA 1A9YA 4Q5IA 1EG2A 1GT6A 2Q1YA 1ZOOA 2PYZA 3RFXA 3F6YA 4GWLA 4U2DA 1E5LA 4I3FA 1UFKA 3H8WA 1CRLA 3FNRA 2FPIB 3SQMA 4CKCB 4J0JA 1AKWA 1KTIA 1HDRA 5DYTA 4PBTA 4DYHA 4EB0A 1FDUA 3PUJA 1TM1E 3JV7A 5DLYA 1UKEA 5JJCA 1TUEA 1NBIA 2HJ9A 5FP0A 1GNPA 5ELLA 4CI9A 5TSDA 2WMYA 2BGLA 2WDPA 3VVCA 5J58A 3U9LA 3N2EA 1C2TA 2X77A 4EJSC 3FUVA 4RGVA 3KUUA 2O4UX 4BNYA 5HR5A 1ABFA 2O0KA 1G6Q1 1M6YA 1Z0AA 1JU4A 1YVEI 3CRMA 3LX8A 3ESYA 5L7YA 1YS1X 1G5PA 1GU7A 1L4HA 1XZAA 3OZXA 3RBZA 1OXMA 2VRBA 1FOEB 2AX3A 4DKXA 2WF5A 2X1HA 2QM0A 3KR2A 1OAAA 3FCUB 1H3NA 2DXIA 1L7QA 1X74A 5AVUA 4IIDA 3T7JA 3UUWA 4DCVA 3ZUGA 4I1PA 3F5DA 1JR2A 3G9UA 2VA9A 1MLDA 4OU4A 3JAWA 1SM4A 2ZBQA 4CZ2A 4D9EA 1X8LA 1B93A 5JPCA 1GCIA 1TNDA 3NWJA 1R4MA 3FVQA 5AP9A 4FYMA 3VUEA 3KD2A 4U6QA 5DWDA 5IDQA 1DWOA 5DHUA 1ZBDA 1ZCBA 1SUCA 5I7EA 4FJ0A 1N32B 5DMHA 3B8HA 5G2OA 3RHFA 4YJ3A 4P86A 3KL4A 4YAEA 3I61A 3SE0A 1FUEA 4E21A 1Z3CA 3E3LA 2VT3A 1V8BA 2D5BA 3I6YA 4LZPA 1ISJA 1Z8DA 2WFMA 2DE0X 4I66A 1K98A 4WERA 1RXIA 1ZW1A 2CVFA 2GDJA 2Q4TA 1NMQA 5HZHA 4F11A 2PUAA 1I5EA 1SKUA 4LZLA 1MB2A 3I73A 1MJFA 4IYJA 3ZGNA 1EGMB 3FVWA 5GOZA 3UJ9A 2Q27A 4BVAA 2PHZA 4BQNA 1O5OA 2ZS7A 4UFNA 1IE3A 2OZKA 3AVWA 5FL7A 3R7WB 4OD0A 5KTOA 2ZZMA 3KLNA 5BMVA 1H6DA 1UPUA 4PICA 5C4MA 2IVZA 2OBBA 2Q1WA 5EJAA 2O48X 3W3AD 3LX6A 4ZKDA 1N57A 2FR0A 4MQ4A 1RI2A 1OU0A 2JKYA 3V8RA 2ZAOA 2OV1A 4TVKA 5FBLB 1FFBA 2O6LA 1TD9A 4RZUA 4V0ME 5EMJA 2XV1A 1J8YF 1H2ZA 4G5GA 5GQSA 1XXHA 3OCJA 5JZSA 3NIWA 1Y37A 2OHGA 1EAMA 1PTJA 2OV2A 3A6KA 3EH2A 3L06A 3QE0A 3IBTA 4NAUA 4PSDA 3TZ6A 1OLXA 4I46A 2RHWA 2Z4SA 1LWOA 4J1TA 3NV9A 1EDDA 3HKBA 5SZHB 2JPDA 2CJYA 2IUUA 3FOZA 4LRSB 4GE3A 2R62A 3QEMB 2RONA 2G83A 3TTXA 3N8DA 2IYQA 3D7KA 4FJ2A 1YE8A 1SB8A 4Y1GA 1WO8A 5KJ1A 1RM4A 1C2YA 1I7QB 3BH0A 3GLHE 4G01B 3W8NA 3K71B 4MRVA 3AVVA 1QF7A 2HA4A 4PPQA 4RY2A 1PJZA 1WULS 5DI3A 4JNKA 3TQOA 7ADHA 4MKHA 5AFSA 1ADGA 1E1MA 4FTWA 5JNLA 4IFBA 1Z6ZA 4HEHA 3RRBA 3OPQA 3BDIA 5DX0A 1WXXA 4F4FA 5KI6A 3HN2A 3L07A 2FU5C 1YUMA 3N2NA 4DC0A 2EW8A 2W2KA 3W2GA 5C37A 1CQWA 4YWJA 5AVRA 1VG1A 3I2YX 4RMJA 1GCAA 4XCXA 4HPJB 5BSKA 2FG7C 4KLRA 1E6EA 3GLKA 1L6RA 1NVUQ 2GKOA 3L6RA 4K9KA 4N40A 3BL8A 2OCGA 2Z95A 2J3IA 3D6TB 2QE7D 4I1VA 3QFFA 5IUKC 3RUHA 1GG8A 6CHYA 3H5IA 5G40A 1J1UA 1F5NA 1K0FA 3QWBA 4RLHA 2HREA 1Y42X 3BGVA 4NNJA 3ZTTA 4ARZA 5FEMA 3RSFA 5EWMA 10MHA 3AOEA 5F3RA 4AJNA 2B69A 5ERYA 2ZIXB 4Z8YA 1LGYA 1CY7A 1MQSA 3TOVA 1I2MA 1FL9A 2IEIA 2OBYA 4K9SA 1Q50A 3MS4A 1L5QA 5KUTA 3GUCA 2FPMA 2GEUA 2PUGA 2QMOA 4MJ7A 3BD7A 2ONKA 1U8CB 1KK1A 4G97A 3MC1A 2VUUA 3I42A 1IG3A 4XGIA 4DG5A 3GV0A 4GWGA 2QTBA 1A82A 2MSLA 3U40A 5DYWA 1B8NA 3OOHA 4A0SA 4MDFA 2HU2A 3PJGA 4CIXA 4MVJG 2OB1A 3MWEB 2ZYIA 1GGFA 2P6PA 2JLSA 4MI6A 4PO1A 4WK0B 3T1YB 1MJHA 3UJ7A 4MS4B 3NRBA 4IDQA 3MFQA 1MAAA 4AJKA <