3DQZA

Structure of the hydroxynitrile lyase from arabidopsis thaliana
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
256
structure length
256
Chain Sequence
RKHHFVLVHNAYHGAWIWYKLKPLLESAGHRVTAVELAASGIDPRPIQAVETVDEYSKPLIETLKSLPENEEVILVGFSFGGINIALAADIFPAKIKVLVFLNAFLPDTTHVPSHVLDKYMEMPGGLGDCEFSSHETRNGTMSLLKMGPKFMKARLYQNCPIEDYELAKMLHRQGSFFTEDLSKKEKFSEEGYGSVQRVYVMSSEDKAIPCDFIRWMIDNFNVSKVYEIDGGDHMVMLSKPQKLFDSLSAIATDYM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-hydroxynitrile lyase-like protein
publication title Hydroxynitrile lyases with alpha / beta-hydrolase fold: two enzymes with almost identical 3D structures but opposite enantioselectivities and different reaction mechanisms
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Lyase
total genus 90
structure length 256
sequence length 256
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.10: (R)-mandelonitrile lyase.
pdb deposition date 2008-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3dqzA00
2W6CX 4H0CA 1ZGBA 2RIPA 4LXHA 3WZLA 3F8SA 4UHFA 5HFAA 4X95A 1L7QA 4LIPD 3R3WA 1AKNA 5JALA 3ANSA 3VXKA 1XLUA 1MT3A 5DLPA 2PKYX 3ICVA 4MXDA 3WK7A 5LKRA 4X92A 1BEZA 1GGVA 1BE0A 2AJLI 1XKTA 3H18A 5CBKA 4FBLA 2VJDA 2LIPA 2FJPA 3CCCA 3O9MA 2GZSA 4UHCA 1CUDA 5D7BA 3GFFA 3GELA 5K3FB 4BVJA 5JASA 5SYMA 5FV4A 3BIWA 5A62A 3CN9A 1BRTA 1VOTA 1CRLA 2PUHA 2ZYRA 1JMKC 5I7UA 4IH9A 4B9AA 2XUFA 5ALYA 2O2HA 2W22A 3IUNA 4DNQA 4BCDA 1YAJA 1DU4A 1IUOA 4QDUA 4G8DA 4S0XA 2V98A 5AM3A 2BUBA 2O7RA 1R9NA 3L1JA 3D2BA 3W9BA 4CCYB 4RNCA 2H1IA 3IUQA 3E3AA 2XUHA 2WFZA 1DWOA 3PFBA 1HLGA 3H04A 3DJYA 5IVDA 1G5FA 3ZV7A 4B83A 4W1PA 4YX9A 1F0NA 3QMWA 2BKLA 1WPRA 4A23A 5A6VA 3F67A 4C4XA 4BC1A 5AKLA 1CUJA 5CT5A 3FYUC 1K4YA 2WLSA 4B6GA 2AXEA 1DWQA 4I19A 3V1LA 3A6ZA 2OCGA 5AM2A 5AKEA 4X90A 4P93A 1P0MA 3O0DA 2QR5A 5C8XA 2QJRA 2CJPA 2R8BA 4G8CA 2X76A 4HAIA 1E66A 5JADA 3FLEA 2GYWA 3I6ZA 4C6HA 4Q3KA 5T4FA 2FJ0A 3ZPXA 4X6XA 2VJAA 2WIJA 1AQLA 3RARA 1UWCA 4DMCA 3K6KA 5K5EA 4Y2QA 1J1IA 4X93A 5CH3A 1ZICA 3H2JA 4QLOA 1XZMA 4KRXA 2AJBA 2XMSA 4ROTA 1LPBB 5LZ2A 3H19A 2QUBA 2HA0A 1R88A 5EHXA 3OM8A 5KREA 1X70A 3DEAA 3QPCA 1EA5A 1P0IA 2HIHA 1DINA 2EDCA 4DYHA 5LZ5A 3JWEA 4OYLA 1K8QA 3FVRA 4B0OA 4PO3X 4B82A 2WJ4A 1XZHA 4PW0A 3W06A 1GPNA 3KWJA 1GXSA 1ZD5A 3FYTA 4UHEA 1I6WA 1U2EA 4BZWA 2QVBA 3WWCA 1X2BA 2OGTA 5C81A 3WI7A 4RGYA 1EINA 3ZLVA 5CT4A 3DYIA 4U2EA 1AMNA 2VSQA 1K6EA 2VT7A 1JJBA 4FLMA 3QH4A 5AP9A 4IH1A 5AK4A 1C7IA 3C6ZA 2HA6A 3IDAA 1LZLA 3S8YA 1T2NA 4N8EA 3R3ZA 1N8SA 3HABA 4H7FA 4KE8A 3QYJA 1TIBA 1VXOA 4K6KA 3PI6A 2DHDA 1XZFA 2C5GA 4IHAA 4WFKA 3I28A 5BWBA 4QDOA 4JNCA 5AKHA 1THGA 5HQ3B 4EY8A 1GT6A 4X6YA 1O6FA 1HPLA 5LIPA 1QIJA 3YASA 4BE4A 2HFJA 5I9IA 3IUJA 3D0KA 2XMQA 1NU6A 3C5VA 4QNNA 3VVLA 3WK8A 2HA2A 5A7GA 5FRDA 3QITA 3GA7A 5KWJA 4G5XA 4HXFB 1CUIA 2B9VA 3WIOA 1O6GA 2XT0A 4F5ZA 3EQ8A 5E4YA 2XUJA 5CH5A 3STVA 2XMGA 3O4JA 1BN7A 1EH5A 3FVTA 4H77A 1CUAA 5AK6A 5ALRA 3OURA 4JYPA 2RI6A 5DYYA 5JAUA 2P8SA 2YH2A 3WWDA 1YCDA 1TCBA 3V1MA 4GI1A 3I2HA 3LS2A 3KDAA 3O9VA 3W05A 1CUHA 4CG2A 3LP5A 5YASA 4BCBA 2FX5A 4B80A 5A71A 4X85A 1U4NA 4L0CA 3I2KA 3WWPA 2XI4A 3NOXA 3WK4A 2VT6A 4EB0A 4QZVA 1MX9A 4MJ3A 5HF5A 3FWHA 3CXUA 2GBIA 3FYUB 3FSGA 2XQJA 2OQIA 3MUOA 5JYCA 3FLBA 2G4LA 4PSCA 2E3JA 1QIIA 1QTIA 4WDQA 1CUUA 1P0PA 2XUPA 4C89A 2WQZA 4Y2YA 5AHXA 1LZKA 1AUOA 4HXEB 2XUKA 1UK8A 1ORWA 3M81A 5EGNA 2G5PA 2WG2A 1ZIYA 5T4HA 1J06A 3N0TA 2WG1A 3FBWA 3QMVA 1XZAA 4AN0A 1JJIA 1F6WA 3WWOA 3H17A 1H22A 1HKHA 4QDTA 4OSEA 5T4BA 2C7BA 4AZ3A 1ZJ5A 1ZD3A 3ZWQA 3WL8A 1UT6A 1TCAA 2HU8A 5J3JA 2EEPA 2WIFA 3ESAA 2CEKA 2WIGA 2YASA 4MEBA 5BV7A 4FLEA 4EY4A 3I2JA 4K6GA 2QKYA 3U1TA 3AFIA 4HXGA 1QIHA 1ZI9A 5A2GA 3ANTA 1QIMA 2WJ3A 4UBJA 2I03A 2Q0XA 1ZIXA 4OD0A 4Y2XA 1XFDA 1EK2A 2HA7A 4P9NA 4EY5A 3WJ2A 1XZGA 4IQ4A 3B3QA 5A7FA 1XKLA 4FKBA 1J2EA 1U65A 1THTA 4CI9A 3G0IA 3WK5A 1UK9A 4JYMA 3STUA 1IMJA 2VJBA 1A88A 4WDRA 1GKKA 4IO0A 5ALFA 1Y37A 3H2IA 5EIEA 3WWEA 1DQZA 4KE9A 2HM7A 1QFMA 3H2GA 2JGJA 4X7BA 3ILSA 2Y2UA 1LPPA 3D2AA 5AKXA 1QIKA 2FUKA 2WHPA 1XZDA 3HACA 3IIIA 4MWTA 4BB0A 2HL6A 5AKZA 1XZIA 1YSCA 4M0EA 2B4KA 3O4IA 2ACKA 2PSEA 1TAHA 4W9RA 3R3VA 4QA9A 4D9JA 3C45A 3STXA 5ALWA 3WL5A 2PBLA 4BAGA 2JGIA 2HU5A 4KEAA 4ZGBA 1MPXA 3F9CA 1YR2A 1W75A 1YASA 1XQWA 2XMBA 5AOAA 4Y2UA 1JFRA 3QPDA 3D3NA 4C4YA 5AKIA 2QTBA 5AICA 3UMJA 4X00A 4LYEA 5JAHA 1XRQA 5HF9A 2X5XA 5JZSA 1FFBA 1LBSA 3H2HA 3GUUA 2O2GA 3E0XA 5FOQA 1M33A 1JJFA 2C4HA 1ZOIA 5HKAA 5LZ4A 4HRXA 3W04A 1VE6A 2PSDA 3M82A 2WTNA 1CUSA 1OILA 1HDEA 1CUZA 3WL6A 5HKBA 4LXGA 1BCRA 3RLIA 1F0PA 4WCVA 2PU5A 4X71A 1E3QA 4N8SA 5DYTA 3WIBA 5HFNA 3K2IA 4K5QA 4DTCA 1UKCA 3WA7A 2WTMA 3IA2A 3Q0TA 2ZJ7A 4MYDA 3R41A 1Y7HA 4EUSA 4GEGA 5HK9A 4TPKA 2UZ0A 1TKRA 4OYYA 4Z49A 1L7RA 4XWGA 4FNMA 1BS9A 1WM1A 5I8PA 3IB3A 4CG3A 4XJVA 2PL5A 1PFQA 3DNMA 5IH7A 1JMYA 5ALEA 4ETWA 4X97A 1CUBA 1QGED 3BDIA 3WKDA 2Z8XA 2Z3ZA 3AZQA 2H7XA 4Y2TA 3I2FA 2GBFA 3OTQA 2Z3WA 3ZI7A 4MEAA 2ECFA 4BE9A 4J3JA 1KU0A 4M0FA 1WB6A 1XZJA 3AJAA 4WFIA 3EBLA 2ROQA 5C8ZA 2WFLB 4BAUA 1RP1A 5AKYA 3QBJA 3RKSA 4G9GA 1ORVA 2DR0A 5FPQA 2WUGA 3ESBA 3H2KA 5AI0A 3H0CA 4A5SA 4BC0A 4U2CA 2HRQA 2OAEA 5EI5A 1SCQA 1ODTC 3VJMA 3E4DA 4W1RA 1CUXA 2BGNA 1UZAA 1ZGCA 1XROA 4TGLA 3MVEA 3WKEA 5CT8A 2WU3A 5ALOA 4W63A 5HCUA 5CT9A 2BFNA 4L9AA 2QXTA 3MUNA 4AMZA 5HF6A 5LZ9A 2XUOA 3FAKA 3JYHA 4BAZA 2C0PA 2ZSIA 3IVMA 3EIOA 4GHWA 1SOMA 4FNGA 2X8BA 5ALTA 4GXNA 4FLFA 1LGYA 3HI4A 5K3AA 1CEXA 1TQHA 2IITA 2Y6VA 2B61A 4XX1A 2PSHA 2XUQA 3WA6A 2ZYSA 2OCKA 1EVEA 5DTIA 3TJMA 3C43A 4OUKX 2RGUA 4UHDA 3FSGD 5ALKA 4F60A 5ALIA 3PUIA 1NU8A 1SC9A 2Y2VA 5AI4A 2DQZA 1XRPA 3T52A 2D5LA 5JAPA 2PSJA 3UUFA 2XE4A 5FKJA 5AO9A 3DKRA 1EDEA 1UFOA 4DMFA 1TK3A 4LHEA 5CRIA 4RE5A 5EIHA 4INZA 4ZXFA 4E11A 1QO7A 4FOLA 1MX1A 3DL7A 5DTJA 3ESCA 2WILA 4B9EA 2XDWA 3M83A 1MAHA 4Y7DA 1ZD2P 1QE3A 3DD5A 1QLWA 4QEKA 4J0HA 3G9ZA 3STWA 3DS8A 4AXBA 2ES4A 4KJXA 1AC5A 3DQZA 3BXPA 4FHZA 5AIAA 5ALNA 3R40A 5ALGA 5JARA 4N8DA 5JD5A 5DNUA 3PF9A 3R3XA 2OPHA 3BE8A 5AI6A 2EDAA 1FFEA 2Y6UA 4OB8A 3BF7A 4B7ZA 2QXUA 2OCLA 2HA3A 3WK6A 1D07A 1UOPA 1U8EA 3EQ9A 2JF0A 4HTAA 1GQRA 1N5MA 3STYA 1A8SA 4CCYA 4JUIA 1FJ2A 1G66A 5JANA 1FFAA 1UXOA 3LLCA 5E4TA 3G9XA 5ALHA 5AI9A 1VJ5A 3V9AA 4EY6A 2OXEA 1MO2A 2HU7A 1OXMA 4QE3A 4ZREA 4MQLA 1XZBA 5ALXA 2O7VA 2XB6A 5CT6A 4XIIA 2XQKA 4ARBA 5CH8A 3QVMA 4WY8A 3A2LA 1KU6A 1USWA 2IX9A 2OGZA 3OPMA 2JGKA 4CIBA 1MJ5A 5EHNA 3G8YA 1E89A 2XUAA 3IUMA 4I4CA 2V96A 4PSUA 3DYVA 1UK7A 1A7UA 1MNAA 1R9MA 1YB7A 2VAVA 2V9ZA 5CW2A 2JGMA 5AK3A 2XLBA 2XUDA 3WKAA 1ACJA 3W2TA 4H18A 2DFPA 3L1HA 1IVYA 1A8QA 1EB8A 3BL8A 2XLCA 3AINA 1C7JA 2GYUA 4NMWA 2WUDA 2ZJ6A 2HA4A 1H23A 4PV7A 1JU4A 3C8DA 5F4ZA 3W9UA 1VXRA 4FBMA 3S2ZA 4ZRDA 1CV2A 4WY5A 2WHPB 1CUVA 3O4GA 4EY7A 1Y7IA 5LKAA 4ZI5A 1R3DA 1XQVA 4X6UA 4BATA 4A16A 1LPSA 1KEZA 4G9EA 1MX5A 5DYWA 3AIKA 4M0MA 3AIMA 4BP8A 2CBGA 4AZ0A 1QIDA 4BRZA 4GWLA 5CURA 5EFZA 3UUEA 1H2WA 1GZ7A 3I6YA 4OU5A 3JW8A 4K2AA 4MYSA 1YS2X 3FCXA 2OCIA 5JD4A 3OC0A 3IULA 1SCKA 1XQXA 1DX4A 4E14A 2YYSA 4F0JA 2XMDA 2BGRA 2ORYA 5IVKA 6YASA 4AQDA 5AJHA 5HQ3A 4BVLA 1E8NA 3I2IA 1EXWA 2WM2A 4HRYA 1AZWA 2ZJFA 4U2GA 2VQ6A 2R11A 4J7AA 5CMLA 4BP9A 2VTVA 4Q34A 2JEZA 4EZIA 4Y9SA 4DNOA 3HLKA 2GBCA 5A7HA 3B5EA 4P08A 1S8OA 2QS9A 2XQFA 1K63A 5AH0A 3SC2A 3HZOA 4J0JA 4UBMA 1WHSA 3C6XA 2H7CA 2XUIA 1JI3A 5KBYA 3WKCA 4UHBA 1SCIA 3A70A 1WB4A 1DX6A 1E8MA 4K6HA 3L1IA 4OCZA 2BAGA 1TCCA 1QIEA 3R3YA 1UK6A 1DWPA 3WL7A 5ALLA 2JEYA 1VZ3A 1LPAB 3KXPA 5E4JA 1XRMA 4UPDA 1QIGA 4J0IA 2NW6A 1A8UA 2XQIA 1GKLA 1VZ2A 5JZ9A 1WB5A 5ALDA 1F8UA 4UBIA 2PPLA 3DCNA 4G4JA 5LLSA 1H2XA 3FYUA 1N5RA 5IVIA 3G02A 1Q0RA 4PSDA 3LIIA 4L3WA 3TEJA 4AO8A 1MN6A 2PU7A 1CFJA 3RK4A 5D3KA 3QM1A 3KD2A 2HADA 3LCRA 1EI9A 4JH0A 5K3DA 5T4EA 4G8BA 5CXUA 5ALJA 5LZ8A 4X94A 1W76A 1W4LA 2VEOA 1EHYA 2PX6A 4F21A 1GPLA 3HYSA 4PQEA 3WYNA 3SX4A 4ZWNA 1Q84A 2QZPA 3G0DA 4DLNA 3WKBA 1PJAA 3OOSA 2HFKA 1AURA 4P92A 1R4ZA 1L7AA 1QFSA 3HEAA 2RHTA 1H2ZA 4J0CA 1BCSA 5ESRA 1UOQA 4OB7A 3IBTA 1JKMA 1Q83A 4H35A 4Y2RA 4H7KA 1RYYA 1EVQA 4U2FA 1CLEA 2OGSA 3WQHA 4CIAA 5AM4A 2YXPX 4GECA 4UBOA 2ZYIA 3NWOA 3WK9A 3DOHA 2VF2A 2VATA 5FDFA 2HA5A 4AMYA 2BUCA 2PUJA 1IZ7A 3LIPA 4BCCA 5EHQA 1YS1X 5AM1A 4BBZA 3V48A 5FXMA 4H7JA 4XVCA 3K9BA 5DNWA 1EB9A 3KWFA 3D4LA 2WU4A 3U0VA 2WUFA 1EDDA 1X2EA 5AI8A 4Y2PA 2OAGA 2VJCA 4BDTA 1W52X 2HRRA 1CIJA 1C4XA 3PE6A 2DHEA 3G0GA 1XRNA 4TVKA 2GBGA 3C87A 2RAUA 1UKBA 5JD6A 2AJDA 3HRHA 3DOIA 3C70A 2C58A 3H1BA 4UBKA 1VA4A 1MNQA 1JU3A 4C4ZA 4DGQA 3NGMA 1BN6A 2WJ6A 4EBBA 3H1AA 3OG9A 2WIKA 2XUGA 3DDUA 4X3CA 2DCMA 5ALZA 1P0QA 1XZKA 3I1IA 3O4HA 4FTWA 1W6RA 1WHTA 4KYVA 1IUNA 5FPPA 1EK1A 4AN1A 3C8HA 1RWQA 4BYMA 5K3BA 3TRDA 1CUGA 1ODCA 4KACA 2Y1KA 1UKAA 2CZQA 4N5IX 1ZD4A 4KE7A 3AIOA 4Q82A 1AX9A 5CTAA 3D5EA 1WOMA 3AZPA 3MGAA 2WHRA 2J3DA 4MQMA 3G7NA 3HC7A 2AJ8A 5KWIA 3VDXA 5D6OA 1N1MA 2CKMA 5EIAA 4V2IA 3F98A 3FCYA 4C01A 2RONA 3V1KA 2ZYHA 2Z5GA 1CUEA 1XQYA 3N2ZB 2C0QA 5E2IA 3BJMA 2I78A 4FFVA 4HVTA 4U2DA 2GYVA 4NZZA 1YA4A 1NX9A 1YB6A 3ESDA 4C87A 2QUAA 1G42A 2WKWA 4OU4A 5BOVA 3I6MA 4NVRA 4PNZA 3QPAA 1LPNA 2WFLA 5FUMA 5IKXA 1QIFA 1T4MA 1XLWA 1VLQA 2JBWA 3KSRA 1GQSA 2B20A 3O95A 5LZ7A 5K3FA 4KE6A 4W1QA 5LYYA 4BRSA 4CG1A 3D59A 1AGYA 5JIBA 4DSAA 3FNBA 1E5TA 4AO7A 2RHWA 4QDXA 3VJKA 4QDZA 3E1GA 3VVMA 4DMHA 5ALSA 3R0VA 4RPCA 2XMCA 5JAOA 5ALUA 1QOZA 1XRLA 3D2CA 3G0BA 1QONA 1CUCA 2J4FA 4FWBA 4BVKA 1YA8A 5C8VA 2ZVDA 1LLFA 5HZGA 2JGFA 1HQDA 1MU0A 4YASA 2BJHA 2WSLA 3DL4A 4YPVA 3F97A 1BEEA 3QMMA 1CVLA 2QM0A 4C88A 3ICWA 4RE6A 2G5TA 4UFPA 1E8DA 4GLBA 4KAAA 1FSSA 7YASA 1ETHA 2OG1A 4QLAA 4ARAA 2DSNA 2O2IA 4X91A 1CQWA 1VA5A 3BF8A 2H7YA 1HBJA 4CFSA 3PFCA 5AK5A 4B0PA 1XZCA 4BTVA 1PV1A 5HF8A 1K5PA 2BUAA 1MAAA 2PSFA 3PDCA 5AOCA 3TGLA 1XZEA 4H7DA 4B81A 4AO6A 4Y2VA 1VKHA 2GZRA 4BTLA 3D7RA 3BDVA 1UOOA 5AM5A 5FP0A 4KR0A 5DWDA 4OPMA 4WFJA 4W1SA 4YK7A 3EF3A 4OB6A 4DM7A 4UFNA 4Q3LA 3GZJA 2PM8A 1DT3A 5ALVA 4E46A 1B6GA 5K3CA 1IZ8A 5BWCA 1WPXA 2H9YA 1CUFA 4AB1A 5AI5A 4BDSA 2ZSHA 3M3DA 1LPOA 1BROA 4Y2JA 5DNVA 4GW3A 4NS4A 4J0KA 5K3EA 4UBNA 1Q0ZA 3R3UA 4ZV9A 3C6YA 2WFMA 5CXXA 3FOBA 4PF1A 2AJCA 4KAFA 4LYDA 1JT2A 5H3HA 1HL7A 4BZZA 1YAHA 4Q3OA 1QZ3A 2IIVA 3CCBA 2QOEA 1J07A 3EQ7A 3VKFA 4E15A 1ISPA 3RM3A 3B12A 2JGLA 5D3ZA 1XZLA 3Q8WA 2WUEA 5ALPA 5AKKA 5AM0A 4AX4A 1CPYA 2HHAA 1SFRA 2DQYA 3F96A 4ZV7A 4CCWA 5JZBA 3VISA 5FLKA 2XMZA 4Q1VA 5AOBA 3GROA 4EHBA 5JATA 2I3DA 4FMPA 5AKGA 4J0DA 3WLAA 3WJ1A 1MTZA 2C5FA 1B41A 4KRYA 4KAJA 1ODSA 5DJ5A 4L72A 3ZLTA 3NUZA 4QWMA 4J03A 4H7EA 4HZGA 3G9TA 3X3HA 1OCEA 2QT9A 3AUKA 1GPKA 1W1IA 1XRRA 2V97A 5ALQA 2OLEA 3P2MA 5ALMA 5C7YA 2XMRA 2K2QB 2XQGA 1CR6A 3DLTA 4H7HA 3A2MA 4ITVA 5EHZA 4UUQA 5SYNA 1TRHA 1H2YA 3QZUA 4GBGA 1Z68A 4G4GA 2G63A 1BU8A 3WMRA 5ISMA 3IURA 2I3ZA 2OQVA 3WYDA 2QMQA 1ZJ4A 2JGEA 4H7IA 2HDWA 2ACEA 4O08A 3AZOA 1ZI6A 1EX9A 1WCYA 2ONCA 1R1DA 3SWWA 3VJLA 2DHCA 4I3FA 4DNFA 4FFWA 4GDMA 3PUHA 1IUPA 4DSZA 2BCEA 2WG0A 3WZMA 3AILA 4U2BA 5HK8A 3CN7A 1FFCA 2VA9A 4DMKA 2VAXA 4HS9A 1ACLA 4G1FA 4LXIA 2D0DA 4LKOA 4MWSA 3GBSA 3PICA 5AKJA 1LNSA 2Z8ZA 3ED1A 3A2NA 3G0CA 1LPMA 2WIDA 3V1NA 1DTEA 1FFDA 1LBTA 3G9UA 4IH4A 3BIXA 4EA6A 2JIDA 4G4IA 1QO9A 4DIUA 1QTRA 1DQYA 4Y2SA 2CB9A 1VE7A 4J0GA 5AIBA 1DT5A 3STTA 1EDBA 3SK0A 3C5WP 4UBLA 1CQZA 2QJWA 1CUYA 2J3QA 4Q05A 3ZLUA 1CUWA 3HXKA 5IVHA 3FLAA 4N5HX 2QRUA 3I2GA 2CUTA 4B85A 3HSSA 4FDMA 1G4HA 3BJRA 3BWXA 3PF8A 5LP1A 2WHQA 4WJLA 3KOOA 3C6BA 4UFOA 3HJUA 4B84A 2J4CA 2PVSA 4UHHA 3T4UA 1QJ4A 4DNPA 3DKKA 3I1YA 1XLVA 1R50A 4QWWA 2CMFA 1ZI8A 4JEIA
chains in the Genus database with same CATH superfamily
2W6CX 3WMEA 4W5TA 1ZGBA 2PXXA 4I1OA 5FL7D 5BN5A 1UJCA 2WWFA 2BGJA 2VK2A 3BMOB 1ABFA 4L0QA 3E9MA 2AVNA 2BGGA 1TTQB 3EXAA 3LDGA 1JG2A 4ES6A 5LCXA 1J0BA 5HFAA 3KQYA 3VHLB 4D25A 4LIPD 5J43A 5JALA 3Q4GA 1E6LA 1JKJA 2BGKA 4YV2A 1PLLA 4CDRA 3E5HA 1N2ZA 5BXYA 1MZVA 3ISTA 4HWKA 4CNBA 4EYOA 4CLXA 1KI6A 3PQDA 3UHJA 1EVJA 3JATB 2PKYX 2W6ID 1F2UA 2EP7A 4MXDA 4NENB 1R0KA 1SIUA 3S44A 5CLFA 5HIJA 2H5LA 2Y27A 1EK6A 5I5GA 1T0BA 2ZYDA 3HPQA 4KDCA 2R6DA 1KQNA 2OKCA 3WK7A 4F7DA 2ZJBA 5LWHA 4X92A 1G19A 3FUCA 2Q1SA 4HDNA 1XKTA 4MI9A 5CBKA 3HJGA 2FSSA 4PG6A 2QGZA 1S6YA 4YALA 1T36A 5F7OA 1L6RA 3WL4A 5JT1A 1XV5A 3FDFA 5JEEA 3O9MA 2GZSA 4JJKA 2WKQA 4MV4A 4R0NA 1CUDA 5D7BA 4ZYYA 1L5KA 1T5LA 2K4MA 3D3JA 2WEKA 3BWEA 5JASA 1ZR2A 3CZ4A 1GQ2A 4EUEA 2W4QA 1N0HA 3I9V6 3QNMA 1Y3AA 3P5BA 3JYQA 3B6IA 1BHQ1 1OU4A 1ZH6A 3GJTA 5BRNA 4BX3A 5LL6P 3K0EA 3W6NA 4JC8A 3GGSA 4P4SA 4I1PA 3KQMA 1RABA 1XL1A 2PKXA 1FYEA 2DWOA 4MR8B 3OSUA 5CX1A 5IT0A 1I7PA 4ZYVA 2YY7A 3ZHRA 1NRXA 3R0QA 4Z4GA 2IK8A 1ESCA 3JD2A 3QMPA 4MMZB 3FDJA 5G02A 1YL7A 4LY3A 1PJBA 2O3TA 2XB2A 3ZZ1A 4KXVA 1UMDA 4JVSB 2W22A 3IUNA 4DNQA 3LWBA 1YAJA 3C1TA 3PT5A 1KMIY 2IZ6A 4IIYA 4MS3B 4X63A 1Y6JA 3UUGA 4ER0A 3T95A 3PHJA 4M1SA 3M2PA 5J47A 3OVMA 4MRNA 5AXBA 3WB0A 3ZE8A 3JVVA 2R60A 1P31A 1Z06A 3HDYA 4I4TB 2WWYA 2LUOA 2B6HA 2O7RA 4DTIA 2Q1YA 1R9NA 1SCBA 3L1JA 3R76A 2LRHA 1TU4A 4LXUA 3GR6A 4XVHA 4YRPA 4BMOB 1PRYA 3WDSA 3IUSA 2AF4C 4HAUA 4L27A 4RNCA 4KQMA 1I4EB 1IEWA 4QO8A 5DM4A 3KPJA 5AJUA 1M2WA 1Q7RA 121PA 3PC4A 3IC5A 3H04A 2FEWB 4ZT4A 3ZJ4A 2N75A 3ZV7A 1I7NA 3FIJA 4MOWA 2WY2D 1U0FA 3DLAA 1ISGA 2PQ6A 4E7OA 1F0NA 1JZTA 4A23A 5LA6F 4ZIRA 1AUPA 5HXAA 4I50A 3SSMA 2BCGY 3U09A 3OFND 1E1CB 1UC9A 3KHTA 5AKLA 2OCYC 2UXDB 1A9RA 2C2KA 3UPDA 2XODA 3BT7A 4L50A 1CUJA 4RA6A 1I3OA 3TZEA 2WQ6A 3QW4B 3KQNA 2NXWA 2OCBA 5AW5A 2IKQA 2IPNA 2XXAA 2SKEA 3IXQA 3T7IA 3ZHUA 3QUBA 1WKCA 1DWQA 4FNAA 2UXBB 2G80A 2F1OA 2QSYA 4F4DA 4JZKA 9ABPA 3RS8A 3I64A 3DHEA 5HEKA 1GGNA 5AM2A 1YB4A 1LRLA 1VPTA 1Y1KE 1ZD1A 1RJ9B 2BF4A 2QR5A 3FUTA 3VV2A 4GG1A 1EGHA 4FGKA 1PNTA 2D8AA 2QF7A 2X76A 4HAIA 4YI5A 2LPMA 5L45A 3FLEA 4V0LA 1OYWA 4RF3A 5HTKA 1Z8HA 1UFRA 4C6TB 4Q3KA 2FJ0A 3ZPXA 2AFRA 2XCUA 1NQOA 1TAGA 3ITDA 1PZFA 2JGNA 3S2EA 3OY7A 4A0FA 2P4HX 2Z6QA 1I0IA 4FOPA 4HUQB 2JJ1A 1W0KA 4N1AA 4B3MB 2WIJA 4IDQA 1KFEB 1Y1RA 4WK4B 5EZYB 3RARA 5EE3A 2JHGA 3IE2A 4C7MA 1ZJYA 2PQ0A 4FUTA 2FMTA 3KPVA 1CEQA 3ROQA 3V4VB 2GPYA 4A8PA 4QPCA 4KC0A 4ZU1X 1FP6A 3IT1A 2DLDA 3K8QA 1L4KA 2ZYVX 3SU8A 1B74A 1XZMA 4OBXA 2YJZA 5K6TA 1P74A 4Q9AA 3EDQA 5E1BA 4Z0NA 4ARVA 3V3KA 5P8WA 4ZDWA 1NJ2A 4ZZ2A 4AYWA 4G5GA 3PCXA 5KREA 3PR3A 4QX6A 5HKLA 1VYVA 3MEQA 3OE7A 2OWEA 4RL4A 3TTUA 4KIFA 1KO7A 4D3XA 4YYZA 1I0LA 4ME6A 2GD2A 1FFXA 3RHFA 4JUAA 4BMPB 1EFDN 1NF3A 4IGKA 1M1YE 1ADYA 4REQA 3VZDA 4A6EA 5JFTA 1TPYA 3FNGA 5LZ5A 5JZVA 2JKVA 1L5MA 1TJ3A 4OYLA 1OKKD 4M2LA 3FVRA 4C7BA 2WD9A 1IY8A 3CO0S 3OQIA 2GWHA 4II3A 5CLQA 5D00A 5DHAA 4AUNA 3IPXA 5FBRB 3SYNA 4B82A 2NADA 5KYWA 1JEJA 1EG7A 3IXMA 4LYYA 1E1QD 4A36A 3GGCA 1NG9A 2QYTA 3B85A 4LJ8A 3E22B 5CIYA 2HPAA 1ZD5A 3SPXA 2QD3A 1H0RA 3EK2A 3HFSA 1I6WA 5JPCA 2AFIA 4TT8A 4D7AA 2QAGA 1K6MA 2IU4A 3F6EX 4QBFA 1F48A 2QNRA 4N54A 1SCNE 4N82A 5F4BA 3S99A 3UAWA 3PTZA 2OZPA 1E2KA 3HCFA 3VH4A 3M1YA 1GN9A 4NFYA 3WI7A 2HMWA 3JTEA 3EXIA 1EINA 3FHCB 3A31A 4U1RA 2WUWE 2A30A 2GVZC 4LDRA 4R1MA 4XDZA 1LV7A 5F2KA 3JVUA 1K4KA 2AC4A 2QTAA 2WTAA 1LDBA 3WRWA 4C0QC 3OUTA 1TZ2A 1E99A 5KQPA 3PEWA 4RAQA 2C96A 2RGDA 3PA6A 3R0IA 5E6UA 3KOZA 5AHKA 4G4SP 2W2NA 1K6EA 4B4OA 5C1PA 3Q8MA 2Z2YA 1LW7A 3QFTA 2O1WA 3JS5A 3QOFA 3EAGA 4E30A 1BX0A 1S7GA 2E37A 4EKYA 3FTPA 4UTOA 4E5UA 1GVNB 1X7ZB 1G55A 2AMJA 1Z5NA 1K7FB 3AP3A 2QT1A 1K5DA 4BGDA 1HO3A 3F4KA 2MYPA 3OTIA 4WZAE 1VRCA 4DMMA 1BVUA 1LZLA 3OZCA 4I1VA 1IXZA 3SF0A 3VYRB 2RH9B 4V2UA 4QGAA 1UZLA 2P67A 5HVNA 4KDFA 3A1NA 1ILEA 3L5OA 2G1AA 1IY1A 3AFMA 4YY3B 2WJVA 5KTYA 1GTRA 1TI7A 4K6OA 4Q3AA 3ZNNA 2PMKA 3QYJA 1T1SA 1TTHA 4IJVA 3ZXXA 1HDCA 4IVPA 1Q0PA 2EFJA 1ZNQO 3SBOA 1OE0A 3IAFA 4YAEA 1XZFA 3WV4A 1G63A 2P5TB 2XYQA 1BMTA 1EJ2A 2H52A 2IKSA 4K87A 5DN9A 2IU0A 3U4AA 3W5BA 2PJRA 2REBA 4EF5A 1Q11A 4HTFA 2C4TA 3BWCA 4QDOA 3VBEA 4E12A 2AK3A 1DAOA 4URYR 1JFTA 1N6LA 1SBIA 1XNQB 3KNZA 2Y67A 5EJ5A 5HRAA 5MN5A 4ZHQF 5MFPA 1E9BA 1RWNA 5HQ3B 1R6VA 1FYWA 2O57A 1WSBA 1NT4A 4KQ2A 2Z1MA 5JDCA 4EUKA 5I4CA 2NSYA 4OHOA 5ED0A 4FB4A 4AYTA 1WLYA 3SN6A 2MYNA 3I1FA 3LC7O 5EJ8A 4LQCA 2A9VA 2G07A 4BE4A 1MC4A 1WVGA 2B5VA 3CB4A 4X54A 4CM4A 4QYIA 1XHLA 2P11A 4B79A 2D3TA 3D0KA 1D7OA 4IIDA 3HV0A 1Q3HA 2EBFX 2XMQA 4YN3A 3RSLA 2BKVA 2P4QA 4RZIA 2J6CA 2OMEA 1WVIA 1JPVA 2C5BA 2DERA 1N92A 3GWZA 4KXUA 4NOKA 4DM3A 1WP9A 4ZYZA 1NU6A 2QTNA 2A9QA 3WK8A 1CY0A 4AK9A 2FOXA 3GT4A 5FRDA 1E7YA 3QITA 1CQJB 4BJ6A 1EFUA 2QRQA 1Y7TA 4N49A 1PQ4A 4LJLA 3T0GA 1MJNA 5KWJA 3H83A 1AHPA 1BEUB 1DKRA 1NJ6A 5GWXA 3VQTA 4CL8A 1INLA 1FL9A 1C7RA 1KH2A 4G1BA 2FH5B 1ZM9A 3ZHXA 1R5JA 3CNNA 2R8OA 1YZYA 3M6UA 1YBAA 4D9EA 2C3UA 2GFHA 2XUJA 3EOBI 5CH5A 2ZRFA 5DVZA 3VUFA 4MR9A 2GD6A 4LXYA 3STVA 4B3JA 1NSFA 4JS0A 1GZUA 3IP9A 5TNXA 3FVTA 4K8RB 1CU1A 2R7NA 4INPA 3KX2A 4OQ4A 2CVZA 5ALRA 2AFHA 4TXMA 3OLVA 5JVDB 2AWNA 3OURA 1TEXA 2CY0A 4N03A 5C1OA 5HZKA 1L9XA 1QHEA 5U9CA 1XNGA 4AKSA 4R3WA 1AQNA 2P8SA 2Q0QA 2ZIUB 3WWDA 4WX2B 3TTYA 2HK9A 1WXQA 1Q6YA 1GKUB 2C5LA 1M2VB 3RC9A 4Q4AA 3UPUA 4GI1A 2AX4A 3I2HA 4M3NA 1Y81A 3NBZC 4KK4A 5FWXB 1NJSA 1CT9A 4PPNA 2X19A 3C14C 3MCUA 4KKXB 2JAQA 4HWSA 1BHSA 2UZ1A 5GM1A 1AKVA 1PVVA 2HT1A 4W8OA 2OV8A 4HV4A 1U7DA 4WBNA 3RYFA 1XB2A 4RFLA 3U7FB 4I08A 4UEWA 4EHAA 4J3NA 1O4VA 1H4TA 1PLKA 1ZU5A 1SURA 1GNLA 3LY5A 4CG2A 5CB4B 1U9JA 1PUJA 3JZIA 4UUNA 5CITA 2HR1A 2AQIA 1HYBA 5FTLA 2YJGA 2XYVA 4PLWA 1ZIOA 2B7CA 5LOVB 1G5IA 1W4BA 5AK0A 2F17A 1U28C 2YFQA 1GL6A 3FMPB 4JR0A 1MH9A 3RT7A 1NIPA 4HOYA 1UH5A 3NV7A 5HA5A 3UFXB 1KZ7B 3WWPA 4NECA 4G84A 3WK4A 4EPTA 5IANA 1KYWA 3IJPA 2VT6A 1XEXB 3FA2A 5E6SA 4QZVA 3BRWD 4MJ3A 1JHQA 1B6SA 1OJLA 1QCDA 3TMYA 4KR6A 5CVDA 1ZH8A 2TS1A 2PS9A 3CRZA 2GBIA 4WESB 2RHCA 2ZSFA 3FYUB 4LV5B 4Q93A 3V34A 4WBSA 1MEOA 2G09A 3UXEA 4FYYA 1YWGO 2I9KA 2E3JA 2ZRQA 4PSCA 2B82A 3E18A 1QIIA 4EF6A 1EP1B 1ZUWA 3RFXA 3F6CA 4IHJA 4Z51A 3H1TA 2XGJA 1BSVA 1N7GA 3BFKA 1X42A 3PXEA 1G17A 3TUZC 4G01B 4RLQA 4OGWA 4XUGB 4WDQA 4HFRA 1CUUA 1HQCA 1P0PA 1X9HA 2ZSJA 1BO6A 5H68A 4MKZA 2ZUBA 5AHXA 1A97A 1W5AA 4M76B 2JJ8A 2MMCA 3C8ZA 1AUOA 3TB4A 2J6HA 2G77B 2W9XA 1ORWA 3FWKA 3MWJA 4IOKA 3LK6A 5EGNA 2DFVA 1U2GA 1DAKA 1ZIYA 2G5PA 2J8ZA 5EG5A 2IODA 1QV9A 2JFHA 4CMGA 1KC1A 2O7SA 4YAKA 2BI7A 1FU7A 3GJ3A 3WIUA 3QMVA 4ONEA 1ZGJA 4ZPXA 1B43A 2B2NA 3L01A 4AN0A 4BRWA 3GD5A 2QQEA 3H9GA 2FLVA 4OEHA 1LLCA 1H22A 1XVTA 1B8UA 4FHEA 4KQHA 3TQFA 4UHKA 3HEMA 2CYCA 4F6RA 4ND1A 4BKOA 1IE3A 5MF6A 3E9YA 5CX4A 3NMUF 2A1IA 2VSOA 3C7CB 3VR4D 3L05A 1XMIA 1MFZA 2C2WA 2L17A 4MS1A 4DLBA 1ZD3A 3QI2A 1X7HA 1M6YA 3B7WA 2J3LA 2I3AA 3KWMA 3BJZA 1I4LD 3L43A 1T0UA 4YP6A 5JBIA 1RC0A 3GGOA 3FOZA 1XELA 2GKGA 4F2DA 4EI7A 1JKIA 3P0RA 1YQDA 3IEUA 3ESAA 2E4XA 3JASA 3KQVA 3AHCA 2JD0A 2P9CA 4EY4A 4K6GA 1NXSA 2QKYA 4RXMA 4DQUA 3BSSA 4JDUA 3MRTA 1ZN2A 1ZY2A 3AFIA 1GRRA 4PTYA 2WTEA 4TYPA 4FYMA 4B3GA 2I67A 1M6VB 2QBYB 5A2GA 1EFVB 4U9HS 1DIGA 1JG6A 1SC3A 2O7NA 3BQ9A 2QLMA 4HN4B 3DKPA 1PWXA 1U3TA 1OTXA 1JP7A 2WJ3A 2ZSUA 3JVIA 3QEKA 2I03A 4GBMA 4IIVA 4R9VA 5FBQB 2Z2ZA 3N2IA 4NQRA 4TWAA 2QY6A 5E3IA 5IG2A 4S1OA 3BC1A 4K9OA 1NVFA 4UNNA 1ZIXA 4LX8A 2GESA 1TKBA 1GEGA 3H1FA 3CC8A 4OD0A 1CLUA 3T4EA 4IMRA 1NXQA 4D6PA 5IXYA 5KSWB 1VECA 4P9NA 3NEPX 3TEMA 4JY7A 4DC9A 4OJTA 3M1LA 1Z6XA 4ISCA 3UMRA 3MYYA 4Y1RA 4IQ4A 3CCFA 2WC1A 1XG5A 2YWCA 5EP4A 3P2KA 3WVNA 3I0ZA 1DCFA 3B1JA 4MIYA 4AS3A 3ED5A 5JJKA 1Y4ZA 3K9FC 2Q2OA 2WSBA 3L6RA 2YHIA 4EI9A 4CI9A 1SG9A 5IM4A 1HNWB 1COWD 1UK9A 1M2GA 1USUA 2JVJA 2VL7A 4NMMA 4QEZA 4B2IA 2OFOA 1VG9B 1BD3A 1MVOA 1GKKA 2I54A 4MJ7A 4ZA2A 4I2NA 2FE1A 2NUTB 3RVPA 3H2IA 3KE8A 2WTBA 5JW6A 1LEHA 4JYCA 4AMYA 1DQZA 4KE9A 5K0FA 4RACA 1QFMA 1ID8A 3LECA 4EH1A 1JDUA 2VXBA 4LZLA 1T4BA 2JGJA 4JBIA 4Y2GA 3NHMA 4QBHA 4X7BA 1PFVA 4I4TF 3UW3A 3JD1A 1C1XB 2ZSBA 3EF0A 1R8XA 2WHPA 2P6OA 3EZ6A 3QYFA 3NT2A 1GZHB 4CW7A 3GUVA 5DF1A 4BMCA 5L40A 1M3SA 1TD9A 1A72A 5AKZA 3U49A 1DOZA 2EZ8A 3EXG1 4QYWA 3BUSA 4M0EA 2IYRA 1QGZA 1XMSA 3BYZA 4P7KA 1C9JA 1GIAA 2WVJA 3SR4A 3KU4A 4HDQB 4OI4A 2AOTB 2X6TA 3DD1A 3G2MA 4Q0MA 3A28A 4QA9A 3Q1KA 4UMEA 1K7CA 1SWWA 5ALWA 1SEVA 2J7PD 4FIZA 5ECYA 4C0AC 5HJ5A 2Y4NA 3ICOA 1SUIA 2HU5A 3GEBA 4KEAA 3VR6A 3WGUA 4GKAA 4YR9A 4KDEA 2OHHA 2CLIB 3L6UA 1PT7A 1V5WA 1NR7A 3I9MA 2NZWA 3L7JA 3QNWA 4OYHA 5JS8A 2SHKA 1Z56C 2UV8A 1HZZC 3K0KA 3SC3A 5AOAA 2EWWA 1UBMS 4Y2UA 1ZHOA 721PA 1JFRA 2ZLBA 1K2VN 3HEBA 3QPDA 4RD1A 1QRUA 2X9GA 3L04A 3P19A 4B34A 3UMJA 4XQ9A 3HG7A 4GGMX 3WLOA 2CNNA 5HJ2A 4CQLB 1ISJA 2GEKA 3MWLA 4NMLA 2AWOA 5LJIA 1DTWB 1XRQA 2Q6VA 2FMKA 3BZUA 3PD7A 4O2AB 3A9SA 5HF9A 1GPBA 3K09A 3L7MA 2X0IA 2P6UA 5D3QA 3ZE0B 4YJGB 3FNHA 3OOWA 3GUUA 1YXMA 2HK6A 3U0BA 1G3MA 2JBAA 1KL7A 2G1PA 1L2TA 3G5MA 2YCBA 4F4UA 3ETGA 4XPIA 5CEJA 1M33A 2GPBA 2AQKA 3GCDA 4PLFA 2YJTD 3COZA 3UHAA 3R4VA 4W8HA 1RM5A 4D9CA 5LZ4A 4HRXA 4R8RA 4TMTA 4FILA 4C04A 3AR2A 3FFBA 2N47A 3G5LA 2CD7A 3MW8A 4ZOLA 2VZ0A 3KZCA 3WLLA 1RD4A 3GJXC 3UJ6A 2EJUA 3TMAA 5FWYA 5D84A 5FO1A 4FR0A 4X20B 1VMAA 3KKOA 2FWJA 2Z08A 3CX6A 1WW3A 2VJLA 4X71A 1TGVA 1KR2A 3MK31 1Q3KA 1CJBA 2C99A 1VYHA 2ZAGA 4LC0A 5C3MA 1BGWA 2QN8A 1NXOA 4HYEA 4QQ8A 4IDOA 4JI5B 4U7TB 2IYUA 2WTMA 1TF5A 2BL4A 3PHLA 4OJNA 2IHTA 3GBPA 5D3MA 3D3KA 3TLXA 2ZPAA 1O95C 3H5LA 3E2PA 2IPAB 4AUKA 2AZXA 1JVBA 4HBZA 4RK1A 5TJHA 1O97D 4B3SB 3L7DA 2X0JA 1MORA 1PR4A 2H63A 1E5XA 4JQOA 4WWHA 1TKRA 2M6KA 3NP9A 4X1YA 3K8OE 3SQMA 3AF1A 4Z49A 1B0ZA 1DBVO 1LVHA 1POWA 1VLHA 2HIGA 2VPXA 4WVFA 5DBIA 1WZIA 2HMTA 3M1IA 3SZUA 2FWBA 4DWOA 1YONA 1BS9A 4RENA 1CZNA 1JI0A 5HDQA 3ZH9B 4BP3A 1YZ3A 5I8PA 5IHXA 3UTDA 3H1PA 2A84A 4MUXA 1EK5A 2QQ0A 4UULA 4CG3A 3GJZA 2WM3A 2PMEA 3VR3D 1G3UA 5AQEA 3NRBA 1PFQA 1GJRA 2XD4A 2YHAA 4KBYA 2G3YA 2R1UA 2VXOA 3H2SA 1Y3FE 5EJMA 4Y9RA 4ETWA 4WPGA 1Z83A 3BBPA 4PANA 4WERA 4DLAA 3G0HA 2JFFA 2PRSA 3PD1A 1E18A 1HY3A 4MV8A 3Q15C 2QX6A 1FTNA 1JYFA 4NONA 2ECPA 3DFMA 4G5RA 1AXEA 1XR3A 2E82A 3MHPA 2WLTA 2QL5A 3N0VA 4BX2A 4F97A 3SMVA 5BWLA 3EA4A 2PO7A 4Y2HA 5JY1A 4Z4FA 3CGWA 3Q9LA 1KYIA 2Z8XA 2HXSA 2X3UA 2EJCA 2HSEA 3GLRA 3AZQA 3CGGA 1WP4A 3ZJVA 2H7XA 4EW1A 4G23A 5EINA 3KQOA 4TLCA 4KMSA 4CEIB 2GBFA 2V7UA 2AEMA 3OEED 4ZRNA 1N75A 4MEAA 2OESA 4PCUA 2OP0A 3ZV3A 2VHJA 1E32A 3G8DA 3OUUA 1GU0A 1FMCA 2XGMA 3RVLA 5GONA 1ZR4A 4WOCA 2SKDA 4HAOA 3WHPA 1KU0A 1WB6A 3GXBA 5U1PA 5AW1A 4M98A 1XZJA 5LD2C 4JWKA 2OECA 1T1RA 3NM5A 1LRKA 1Z0SA 3SIWA 4PN3A 4KQGA 3EVGA 3TIGA 4YPOA 5HPYB 3A9CA 3EBLA 4PX2A 3HU3A 3BD6A 3HXOA 2ROQA 1KIMA 3CEAA 3QVVA 5C8ZA 2WFLB 3JQBC 4D4KA 1Z5ZA 2OMKA 5K6AA 4MRVA 2ZI3A 2DHQA 1PNQA 2E9SA 3NNDA 2PWPA 3DE3X 1TEVA 4MP8A 5KTOA 3RIGA 2P9GA 1EGMB 1EG2A 4FXPA 1FRZA 2JRCA 3DO6A 1U5AA 4G9GA 1ORVA 4IS3A 1KJWA 2DR0A 1H3FA 1KI3A 2GF9A 2IYFA 1GSHA 2GH1A 2RH8A 2UYQA 3BA6A 4KZPA 5CHYA 3S3TA 2GAIA 3ZK7A 5GVSA 3LCMA 2YFKA 3TQQA 4BQQA 2GNAA 2VRBA 1P3Y1 1VL6A 1K75A 2EHDA 3DHVA 4M49A 5DNDA 3NKFA 2VDUE 3GYBA 6REQB 3H9BA 1PSWA 3AV0B 4U2CA 2AG0A 2WYWA 2AN1A 3ID6C 5BRAA 5EKSA 4EYKA 2W2OA 1AS0A 2TYSB 1L5FA 5K0ZA 1QP0A 1C9DB 2FPMA 1S02A 1SPXA 3JWIA 5EXEA 3TIIA 1D5CA 1K92A 3QOYA 2CXHA 4MKRA 2E6UX 3ESYA 3B1ZA 3BD7A 4J29A 4QU5A 3UG6A 5EE5B 1CUXA 3EFHA 3IAS1 2QG9A 3I53A 3R5SA 4CQNA 5C3UA 3OF3A 4X62B 1TK9A 1RBMA 1T8UA 1UZAA 2JFOA 4JJIA 4NG5A 5H83A 5B1IA 3DTVD 2E2WA 3ANXA 3MC1A 1SXJC 4KXMA 3G2NA 3PXXA 4LZJA 4P5PA 3TD9A 4UVGA 3UV6A 3ZZNA 5ALOA 4W63A 2O0LA 4Y6GB 3SZGA 3L4KA 2PUBA 1Q1ZA 3DW3X 2QE7A 4PLGA 5CT9A 3UPTA 2ZXUA 1WKBA 3GAZA 3H9JA 5MGBA 3KZOA 4RD4A 2BFNA 3BJEA 3R6GA 4Y9DA 4QJ5A 4HGPA 2Q46A 1U1CA 3ZOZA 4CUJA 4IILA 5AVTA 1E7MA 3SFVA 4BAZA 3IVMA 4I5DA 4RV4A 5IKMA 5KVVA 3DE5X 1TUIA 2QP4A 3AESA 3EIOA 4O0MA 4GHWA 1RPAA 1GUZA 7ADHA 5AOVA 1U1IA 4YRFA 2GXAA 2C42A 2F8LA 4EB3A 5BV0A 1TMOA 2AGVA 2CBZA 4PG5A 1G8FA 3JZMA 3OLXA 5HMLA 4EHKA 4CRWB 1X7YA 4DYDA 3MJEA 5K3AA 1JN0A 1TK2A 1D0VA 4YMWA 2FQ1A 1CEXA 1IB6A 3AFOA 3KTDA 1NLZA 3W90A 4BNGA 4QQKA 1XTBA 3E9DA 2JCXA 4XX1A 5TQ2A 4DREA 1XI2A 3IH5A 3DT9A 3UKDA 4FPXA 5FF9A 3EC1A 3DBRB 1JH8A 1K98A 1V71A 3IBCA 5HJ7A 2A1UB 2QRPA 3ZGYA 1V37A 3L07A 4HKTA 4B45A 4UUBA 2DRIA 3R3JA 4GR9A 4Q9KA 1L7PA 4GM0A 1FYXA 1NVMB 2AYXA 2NU9B 1LK7A 3HUTA 3IDQA 2XCSB 1YTUA 1C1DA 1T4GA 1Q74A 2A5GA 3C43A 4YP1A 3V6LA 4OUKX 3LUAA 4ZTZB 2ZIGA 2RGUA 2DR3A 3I62A 4N0QA 3CSDA 4N5DA 1NNI1 3I2YX 4AU1A 3ZKWB 2PGAA 3GLTA 5JFGA 4HNQA 5ALIA 1Y4SA 2AD5A 3NHRA 3PUIA 4MYRA 3E3OA 4WOBA 4AS2A 1WXWA 5H0IA 3EDRA 1Z75A 1ODFA 2RB4A 4M55A 4Q9JA 2IV2X 3RB8A 5CB4F 2QM3A 3KQKA 1XBTA 2YBEA 2Y05A 1SC9A 1VBFA 3AEQB 3MFYA 1JKFA 2BZSA 2FEAA 5AI4A 1EFKA 1IDOA 3AERB 4ND2A 4WXRA 2GM4A 1M76A 5DOZA 4TRMA 4DEXA 1AKUA 4E6EA 5KNBD 4HAXA 5LOVF 5F35A 4L4RA 2G5GX 3ABIA 2PRKA 2D5LA 3KJHA 3PWKA 3UUFA 2P3OA 3ER6A 4LDPA 2XE4A 2QQFA 2VH1A 3SGLA 2EGUA 4JJ8A 4MVYA 3GVPA 1UZMA 5AO9A 3ZZ0A 1EDEA 1T9DA 3A32A 3WYFA 5KB3A 5G4LA 3E81A 3RUPA 1P1FA 2E21A 2HGZA 2Q7OE 2M32A 1ACMA 3LQRA 1GYRA 4AZVA 4F9GA 1OLUB 3VYVA 1C9KA 3WGTA 3TECE 2C9MA 3QE9Y 1Q16A 3CG0A 4LHEA 5F5NA 3EPHA 4OBEA 2P9FA 3BX1A 3R0XA 5EIHA 4D9NA 5L3RA 5BVHA 4N7JA 2YWGA 1KNXA 1LLUA 1VJGA 3CT6A 3KXDA 4MQ4A 1PTJA 1EVKA 2O19A 4KLCA 1G5HA 1QO7A 1CK4A 4BNWA 1RCUA 4UCFA 1JJ7A 2C4UA 4D9BA 4Q3DA 1BTOA 1R37A 1FP4B 2XADA 1I01A 2B7LA 1ZK4A 3KSMA 2Y92A 5B2FA 3ESCA 3JX9A 1XTSA 3D8BA 3GYGA 2FP4B 4UAVA 2AZDA 1RRVA 4GDFA 4EMSA 1X87A 3BG5A 3H6KA 3LC1O 4CLEA 4B9EA 5AHRA 2V0CA 4N5LA 4XQCA 1QGUB 1DIAA 3EZGA 3M83A 4HSGA 2NV6A 4LZPA 5JHGB 4D8TA 1JF8A 4HPXB 2JFZA 4Y7DA 3UJ9A 4YP7A 4N6NA 3V55A 1IULA 1MRNA 4MWDA 3DD5A 4N0MA 3MSCA 3PUZA 4YRTA 4QEKA 3U7QA 1XD8A 4I5FA 3VC2A 4ZCTA 3G9ZA 3KBOA 3V4ZA 1G2PA 3FLMA 2GHQA 4TVSA 3STWA 3MT9A 4ZANA 2ZUDA 2F1JA 3HY4A 4NBVA 4U00A 5TRTA 1LLDA 3VU8A 1TJ4A 4RVNA 4UM5A 1AC5A 2W2PA 5FUWA 3DQZA 1KOLA 3VHXB 5JHHB 1Z0FA 3SCZA 2I7CA 2ILTA 4H27A 5A9SA 5ALNA 4JP1A 5E7QA 2O8DB 2PUDA 3KL4A 1GGEA 1AQUA 4TXJA 1KDVA 4ALLA 5EIOA 4BB6A 3NUGA 1UUFA 1XTIA 3UC5A 3GPLA 1W2WB 3OCYA 2AG6A 2PGDA 3OUZA 2FZVA 3MIZA 3SDZA 1KBOA 1PX2A 1VIMA 3O8QA 4N8DA 4O0LA 4CF6A 2IXTA 5JD5A 3PF9A 1AA9A 3IQXA 4GP7A 3HKEB 3R3XA 4HH3C 1N6OA 5DGIA 4DL9A 4MULA 3RKRA 5KYVA 2EDAA 2EZ9A 1X7DA 3IX7A 4NENA 4ZQBA 3LTNC 3GC6A 1KO5A 4B7ZA 4C3VA 5IRCD 4EAAA 3GLGA 5G40A 3A9RA 1PNRA 2PT7A 4JEUA 3PRJA 1G1MA 1QYVA 4F8JA 3P1JA 3WRXA 4D3FA 1GOTA 1DC7A 1UOPA 2PKCA 2HUNA 3EQ9A 4UE3S 3ZLJA 3LLVA 2JF0A 3DB1A 3M6IA 4GMKA 4HTAA 1N5MA 1E2HA 1VKJA 3ZDAA 4NCNA 4RZXA 2I1VB 3HR7A 5BQPA 4OFZA 4CCYA 3UUWA 1FLDA 2JAOA 1L8QA 3DONA 3HGMA 1FFAA 4ERXA 3X1KA 3UMCA 1MVNA 1PJ4A 3EHDA 3IQWA 3LLCA 1HORA 1Y42X 3GRAA 1QYXA 4M37A 1Q7CA 2CLEB 3CS3A 3KJFA 4B3RB 5AI9A 3PQ3A 1VJ5A 2AUMA 5GONF 1RE1A 1TE2A 1AZLA 3V9AA 3LAWA 4EY6A 1YZNA 2EU8A 4LJSA 5F64A 3ZR4B 3FHTA 1OXMA 1DBQA 1JHOA 1K7XB 4DMUB 4RVGA 1NNUA 1SBHA 1KORA 2FZEA 1LX7A 2WJGA 3LKZA 4B3FX 5IBRA 3IOMA 3MT0A 4B87A 3CZCA 5HOQA 1XZBA 2QU7A 2FOIA 3NCTA 2O7VA 1UBTS 1XKQA 3FAZA 2I2WA 3CNQS 3FM9A 2BHTA 4LXQA 1W94A 3OCVA 1Y9AA 1SVMA 3SSAA 3TI9A 2XB6A 1V8OA 2BRUA 1JDBB 1SBCA 2MU1A 3LCVB 4XIIA 1CZLA 1TB4A 4L9WA 4KIGA 2C7OA 1BVYF 4JOBA 2BSAA 4PAQA 3L6OO 1IQ0A 5EKDA 1MKYA 1YK0A 1HOTA 3AIIA 4XIGS 2VJNA 1YS6A 2VHYA 2C7PA 2Q8NA 1ZJ6A 4AMVA 4RU1A 1E0SA 2O3SA 1KJJA 2GHIA 5LDHA 2NO0A 5LQUA 5C5CA 4OXYA 1B3BA 2ZAOA 2PRJA 3PL1A 4MV1A 2BONA 4XYEA 4BJHB 1R5NA 4NEQA 2XUAA 1H6CA 3UVEA 2COUA 4I4CA 1ZVMA 4MCHA 1E2DA 1CTQA 2HJ9A 4V1CA 3MGBA 3D6AA 1FVFA 4YXWA 1PV2A 3WYBA 4NESA 4PAWA 5BSEA 3R7WB 5GZ6A 1VI2A 1QE5A 1C4WA 1YB7A 1VKNA 2VAVA 1Y63A 4AMGA 1RXEA 1ENPA 3D8SA 4DNXA 2ZAYA 4R41A 3L6DA 5I6DA 1JDPA 4JITA 2V9ZA 5EY5B 2YJ4A 5I7HA 3SEQA 1JHMA 1XC7A 2C20A 4H18A 1XDDA 1CDDA 1U1DA 1CJTC 3HYNA 3MXTA 2QPOA 4IBOA 1TVMA 1JIXA 3TTVA 4DIOA 1UPXA 2XSZA 3EFBA 4INJA 4DDHA 2ZM5A 3OPXA 4GBED 5DCWA 1C7JA 2GYUA 3P7MA 1VPLA 2E5WA 3RVJA 2ZJ6A 3Q7EA 4LF5B 2H1CA 4AG5A 1JU4A 5F21A 3C8DA 3CIOA 5F4ZA 5ICSA 4FBMA 2GCOA 3FZEA 5B3KA 1CV2A 5BRJA 2XY4A 1GAQA 2PPVA 3NAQA 1CUVA 4AP6A 1OX4B 2IUTA 2PCJA 5J4LA 1P1CA 3A7DA 4I5GA 4TM7A 1R3DA 1THZA 1QZUA 1K66A 2F3QA 2BKXA 2IY9A 3MLBA 4LJ6A 3ZWDA 3STHA 5AW3A 5EUBA 4RCZA 1N9GB 1KEZA 3OX4A 2C0CA 3C85A 1V47A 3G2KA 4FB5A 4ZICA 1GD1O 5TB5A 1U80A 3AIKA 3BORA 1K8XB 5A04A 3AH8A 3KUKA 1V8PA 1XAIA 4F72A 4EPVA 2VDWA 2GEUA 3QE4A 2CMKA 3MILA 5CFLA 4UATA 2LZ0A 3M6LA 4US2R 1GNVA 1WZEA 3DOEA 4AZ0A 4KPUA 1I0ZA 1QIDA 2HNKA 3BXXA 1UP6A 4ALIA 3PJDA 1F0YA 2EF1A 5EFZA 1U7XA 1M6NA 1QHSA 3JW8A 2QL7A 4FEEA 1QX4A 1LQUA 1HURA 1F20A 1FNBA 2BMJA 2VHCA 3NO4A 3SDBA 4MJXA 2YNMD 1ULSA 3B2NA 3VGPA 4TKLA 1Q0QA 2VBIA 1UMBB 2D59A 1V2HE 3Q2KA 3WYAA 2JLAA 5KSOA 2MINA 3JQ9A 1L7EA 4RK6A 1W0JA 1YDGA 2XV1A 2IYWA 3P9XA 3IKLA 1QYRA 5BP7A 2Z6AA 4RTQA 1S89A 4XVRA 1FIUA 3DPIA 3E0QA 2OY0A 1SUEA 4HFJA 3NP7A 4EHFA 1CDEA 1SU7A 3QWIA 4FMCB 4LRUA 4F0JA 4X7MA 5H8WA 5AJWA 4COKA 2EFCB 1A4RA 1AKYA 1A9OA 1U1EA 1R7RA 3IAHA 1GGJA 4TS9A 1W47A 1XCGB 3II6X 4LOLA 3LDUA 5IVKA 5TMBA 4IDAA 4A4DA 1CNEA 2ZEJA 3E5RA 1ZRHA 4HQKA 1JAHA 4YH1A 3S2SA 4FFSA 1QQTA 2ODWA 3TQRA 3SAJA 3KVRA 5E4FA 2IYYA 2Q6KA 4DCUA 5JSZA 3QXCA 4F4HA 1BJKA 1NVDA 1PR1A 2P68A 5G1PA 4BVLA 3LDAA 3CRQA 1QH8B 1KWGA 3D3EA 4MV3A 1E7QA 4GI7A 1IN7A 1YZQA 2WM2A 3CR7A 3QVGA 1TT7A 2OD7A 3C3BA 3QWBA 4FFLA 4MCJA 4RIIA 5C4GB 4PAMA 2WA2A 4U2GA 4D6XA 2VQ6A 4J7AA 2AXPA 5CMLA 3U9LA 3N2GA 5CBPA 4G0XA 4O4IB 4EZIA 2CV2A 2ZRPA 3ZG6A 2X8LA 1M7BA 1S8FA 2H1HA 4Y9SA 5CA0B 2GZMA 4OJQA 3A7EA 3IAXA 3C6MA 5A7HA 8LDHA 1K3FA 1I2CA 3J80A 1J20A 3U4GA 3VPXA 4P08A 4LPSA 4D82A 5JXWA 4EGAA 3QXGA 1JDTA 1W30A 2A94A 1YDWA 4JT2A 3P4XA 1EWQA 5BMVB 5CDUA 2HF9A 2YIMA 3L1KA 1Z5VA 4KXNA 1CG6A 5E6RB 1I2BA 2QN9A 5HMMA 4C4SA 4HLDA 1Z82A 3TLMA 1Q91A 5MDHA 2EV9A 1SKYB 4DRYA 1SH7A 1QUFA 2OM2A 1WBDA 1EE1A 4RHYA 3SC2A 4MKHA 5JQWA 3QVSA 1U81A 5JDCC 1OU0A 2AOXA 4M0LA 4FW8A 3LUDA 4UBMA 1EWTA 4JJ6A 2H00A 2CLHB 3OLCX 3ZYZA 2ZTMA 5KVCA 3GLIB 3C6XA 1C80A 3LUHA 2GPJA 3TEFA 2P9QA 5DKFA 2EKPA 4AJ9A 4H3VA 4HX9A 3AM3A 5IN5A 3S4YA 3WKCA 4CMEC 4F84A 3V4SA 4RQTA 5IDQA 3BN3A 1WB4A 2VYVD 3AOEA 2UYGA 4MGEA 1AQIA 4FYKA 5J2TF 4IDFA 1N32B 4K6HA 4D9HA 1EX6A 3KQPA 3TM4A 1V3TA 1HG0A 4BUCA 2IH2A 2EVWX 3L1IA 1KO1A 3P52A 2BAGA 4D8VA 1QIEA 3MS7A 1TAQA 2J33A 1MEJA 4I4IA 3D5QA 1C3JA 5DI3A 4F5EA 1ADFA 3WL7A 5F1OA 5LLDA 3BJIC 4X60A 2FN7A 3FGPA 1C0IA 4G56A 1LPAB 3WLAA 1EVYA 3IR7A 3PVZA 4LA4A 2RKBA 3KXPA 4KVFA 3SKYA 4B35A 4OQDA 1T0HB 1XRMA 3UO8B 3IL2A 2YMMA 3BMQA 3D6HA 1II8B 3OM0A 4J0IA 4CMJA 1C1HA 1WXFA 1CHNA 3I5UA 3OKCA 4KFRA 4CLOB 3W34A 1FDRA 5BNFA 1SA0B 3F5QA 5I3CA 1X14A 4QAQA 1T0PA 1M2NA 4RVDA 2HPVA 2ISCA 3WG9A 3NHUA 3K1YA 1NBEA 2V1XA 2W48A 2OVFA 4NS1A 5KAPA 4EKDA 1OSNA 2QYSA 4HDKA 4UZSA 2H4WA 2OUIA 4BKUA 1N8TA 2PPLA 1IHOA 5GJWC 3W2FA 2O2XA 4HJXA 3LDFA 4E5KA 4NTZA 3PCRB 2VDQB 1T6ZA 2CVPA 3G02A 3GJ6A 5LXTB 3ZCSA 3DVRX 2Q5FA 5EC8A 5B3AA 3GJRA 4ZOBA 3OOJA 4YP5A 3RFFA 3LO5A 2VPYA 1YRWA 1ZM4A 4AM8A 1H9BA 4LVOA 1OXUA 1F3LA 3P9ZA 4R71A 4QTZA 1AZTA 1FFWA 2PU7A 5GINE 1KJNA 3AY3A 3W78A 2CHQA 3WAKA 2W0MA 5TEVA 3I30X 3RK4A 3SG0A 4PC6A 3HDVA 5D3KA 3CUKA 2PJZA 2JZNA 2A1TS 3T7CA 2G7MC 4DA7A 1V41E 3T5AA 2UAGA 3FPEA 5G0SA 3PGMA 1VIDA 3T1OA 3B70A 4XSVA 3K70C 2UVPA 3FZNA 4HB4A 5J58A 4DKXA 2PMFA 2C2BA 3UK2A 3TX2A 1P5RA 3FPFA 5EIBC 1Z4NA 5KHLB 2VDKB 2ZRDA 3SJUA 2M98A 5HIIA 4GI3A 3P94A 1U6JA 4UM9D 5DLEA 3AX6A 4OX9B 3SVLA 4JNKA 1T15A 1W4LA 1JHAA 2I3BA 4P7GA 1HDRA 1EHYA 1GPLA 4LRTB 2Q62A 5KTKA 1I10A 3K4PA 4RQUA 5BW4A 3DCJA 2GWRA 2I3GA 1E4EA 2PY6A 1Y8QB 1YS9A 2ZAMA 4G07A 5BN3A 1VSBA 2ZB2A 1FDIA 2R6ZA 3D5TA 4IW3B 3OE5A 1EZZA 3EXEA 4HDMA 2VNHA 1PJAA 3AR8A 3GNTA 4A0QA 5KJ6A 2VP3A 1AURA 4J4HA 3D7LA 2W2LD 1NYTA 1U3GA 3EC2A 4PQGA 3VH2A 4YJ3B 3X1WA 3JAMA 1NDHA 2HF7A 5A2QA 3DUFB 3BHJA 3JXEA 1Z0UA 4X6LA 5F9HA 2NTEA 4AN4A 4ZARA 4MWGA 1R6TA 1H2ZA 3GPIA 1KY3A 3ROXA 5L6LB 1XDWA 3I01M 3OJEA 1YK1A 3ZIAD 4ZCPA 3O83A 1U2GC 1P19A 5DHRA 3U80A 4YUZA 1LXCA 4H16A 3B5IA 1Q83A 2NO9A 1OZFA 4H7KA 2PZ8A 3F7TA 1NSYA 1UQUA 3I05A 3PDJA 4ARZB 4YRAA 3N8IA 1E79A 1TT5A 2RH4A 3H5TA 4HB3A 5F1YA 1ZH4A 4EGJA 1XJ0A 1L7MA 4CMKA 5AM4A 3JYNA 1HFKA 2P62A 4UBOA 3CE6A 4F8YA 5F1KA 3JQFA 5BQFA 1R4AA 4Q6WA 5I47A 3U4HA 4XQ0A 1SR8A 5KOJB 4BLTA 5A3RA 5EKTA 3VR2D 4ATNA 5BVGB 2Z57A 3BHMA 2BMFA 4GRIA 1II9A 1JEQB 1SXHA 1YQUA 3MWEB 3VC7A 1D6SA 4BKQA 2HA5A 2XT6A 1R2QA 2P6MA 2C00A 3L92A 1KMQA 2PA0A 1KS2A 4XX0B 2ZE5A 3VPBA 1A5ZA 2BYTA 4L4ZA 1YT5A 2PUJA 3OZGA 1M1UA 2ZKLA 4YT8A 5HUQA 4EG7A 1IZ7A 2H9IA 4KV9A 5FI0B 2BKUA 4PIVA 2QYHA 4ZU3A 5EXXA 1UXGA 1Z12A 1YS1X 4QHTA 1XA3A 2Z5LA 4J16A 3QBDA 3GQBB 5F78A 4LBZA 3V48A 1GAJA 4LJAA 4QRDA 1LJLA 2H31A 4XB6B 1UF9A 2R84A 4H7JA 1IOVA 4XVCA 3K4QA 3MUFA 3FRHA 4U3JB 1GXSB 2RAFA 5DX0A 3M6FA 1V11B 2B69A 3ETLA 1U8TA 3NBUA 3PS9A 4PZLA 3PENA 5EZ6B 4KRFA 3ZY6A 2WU4A 4KQCA 1JS1X 3VH3A 1GPJA 4D9KA 3LUPA 3PKZA 4C2TA 3HZRA 1PR0A 3TZBA 3AB3A 4NLLA 1U0TA 5HGJA 1JT9A 5JZOA 2UYYA 3SE0A 5HQTA 4NDNE 3ABOB 2D0OB 1B4DA 1T25A 4IJKA 3C3YA 5KVAA 1W52X 1QG4A 5T7BA 4BQPA 1WKVA 1TM1E 3TLEA 1CIJA 4MW2A 1ENZA 1AY0A 3NHWA 3VZSA 1WRBA 4IVRA 4YB8A 1TUEA 5BV2P 3SOZA 1XRNA 3ZV6A 3U9TA 4ZT2A 3GLHA 1Z6YA 4TVKA 4UAUA 1TEHA 1PN3A 2CF6A 4PVDA 5T8KA 4KR2A 2RAUA 2C95A 2BFWA 3N6XA 2XIJA 4HZUB 1DSSG 2AJDA 3F3YA 3RVOA 3ADBA 1FLAA 5EJIA 2RC6A 4CVNA 2C58A 1KRWA 4DA6A 1J5EB 2FMXA 1OWLA 3UQZA 3U5TA 4OIMA 5HBGA 4XGIA 3EJ6A 5AUQA 1XVUA 1PQPA 2DHRA 2R8YA 4UZFA 1JU3A 1KDZA 3WO0A 3UGTA 3ZCVA 3NGMA 4BJ1A 2G28A 4TMKA 3WLMA 4F5WA 1FVHA 1DBWA 1DS6A 4OATA 3ZWXA 2DFTA 4EBBA 5BUZA 4WN9A 3DDUA 4O4HA 1JZQA 1IJKA 1ZNXA 2G82A 3TSYA 5BSFA 3DDNA 3WRVA 3TZHA 2ATCA 1J49A 1Z8NA 3VI3B 5ALZA 3LF1A 1XAJA 4YDQA 3AXSA 1XZKA 1ZOPA 4ITRC 1FX0A 3BIOA 1IAVA 1NUQA 1XOIA 3DT8A 4YT5A 3I1IA 1L1FA 3LRXA 5L3SA 1N2GA 2Q2WA 3ZGZA 4U5QA 5ENZA 5BYKA 1EVIA 2OFPA 2B8TA 2UVDA 4R7GA 1HKUA 3QXJA 2ZBVA 1KYZA 4HQ6A 3FJ1A 1V95A 2CLCX 2AMYA 2EJWA 5J59A 3S5JA 3TH5A 3BIFA 3HL4A 3JQ8B 3RS3A 7REQB 5IAOA 2AFIE 2OV2A 3C8HA 1ZGZA 5CG1A 2H59A 4O02B 3TCKA 3KSUA 4WOPA 5CIQA 4HH0A 2NUAB 2NPFA 3U48A 5K3BA 3CVUA 2OA0A 1DEXA 3DBVO 1BA2A 4CM3A 1JYEA 1P80A 1PGPA 5G1OA 2ZQYA 1H0SA 1XZNA 4KMOA 3PRKE 5ARBA 4N5IX 2GN2A 2B2XA 4FU0A 1AJEA 5K45A 4P7FA 3VC1A 2J4DA 1QH0A 1W85B 3GT7A 4O4LA 4MV5A 2H9AA 1C30B 5EJ4A 2ZUUA 1OBFO 3AY7A 4OL9A 2WAYA 1AXGA 2A33A 4AKGA 2PL3A 2JPDA 5KWIA 1WF6A 4JQCA 2PEYA 3G7NA 2AJ8A 1NZJA 2VA8A 5BSTA 4R40A 1FP2A 2ERYA 4PIMA 3ZU3A 1DCTA 2CLFB 3RRJA 5CDSA 1I3LA 1YCHA 1L4UA 3UAZA 3PEYA 2CKMA 4LHYA 1EFTA 1FTQA 4B4WA 1CY4A 3V7NA 1CR1A 3I5MA 2MMGA 5EPEA 1JHYA 4JIGA 4C01A 5FUYA 1Y8RB 2RBKA 5J23A 4MRMB 2O5CA 3KJGA 1MJGM 1U9YA 2C07A 3H9UA 2JCVA 1Q1QA 4H1UA 4IV8A 2J7KA 4ZAFA 2QTVB 3C7DB 3C7TA 4BO4A 2FAXA 4MVJD 5UKDA 3INGA 4RGVA 1NG1A 1VGRA 3ADOA 3OU2A 4H60A 1JBQA 1X1AA 3FVQA 3N2ZB 5EYPA 3REOA 2WUVA 2G67A 4FFVA 1QE0A 2VEDA 4G65A 1E3DA 4IEEA 1KZHA 4U2DA 2IOFA 3DO8A 4HEA1 3FYCA 3QTLA 3RH0A 5CA1A 1V4VA 2GGSA 5CCDA 1YA4A 4EPXA 4Y67A 2C88A 3CJTA 5CW1A 1FUEA 2NU6B 1GA6A 3BIJA 1QZTA 1WO8A 2Q7DA 3OZWA 1D6MA 5FADA 4Q3NA 3FGNA 2P7IA 5DU2A 4K9LA 4TMYA 2IX3A 5BOVA 2DX7A 3FKJA 3AFHA 3PX3A 1HE4A 2M6LA 4AKTA 4Z86A 1AMOA 1V16A 2QUKA 2B4TO 2R86A 3KSZO 4II2A 3QIVA 1LPNA 1MR3F 3LYUA 3ETHA 2AG1A 3LRPA 2AB0A 1LUAA 1PZGA 4EB6B 1G6HA 1A1VA 2FMFA 5H7XA 5IKXA 1PS9A 1E6CA 3AW9A 4MRSA 2O6HA 4XB2A 1XLWA 4DAEA 2Y1LA 1GQSA 2B20A 3M4NA 2CHFA 3BD8A 4PBRA 2OV3A 1GGHA 4ZD6A 2NIPA 3ZW7A 4FXOA 2QMZA 5LYYA 4DZRA 1A5TA 2P0YA 3A1VA 3RDPA 4RWZA 4TMFA 2O2ZA 3P2EA 4J4TA 4LVUA 2FPWA 5LWQA 3K6SB 1OZAA 3KSAC 3UWDA 4DSAA 1H4QA 1LTKA 1Z7EA 5AYVA 3QSGA 1G64A 3MMXA 1SUPA 5CFMA 5FHQA 4UOZA 4I4LA 4KSYA 3LBYA 3RC3A 2C2OA 1FS4A 2JZCA 4JI6B 3CPHA 3RRBA 4TQUS 5B7NA 1NBMD 4YMTA 5EVCA 3A6PC 1RZRD 3FKSD 3JAWA 3W6UA 4O29A 1PX0A 2OXTA 3VTKA 1RYNA 3VJKA 3ZD7A 1R4MA 1XUOA 3E1GA 3EZYA 4CTKA 1XZQA 5LYJB 1I5EA 4QFCA 4M0UA 4G09A 4IG4A 1B8VA 2ECQA 3NONA 4NC9A 5JWHA 5BWMA 5K6AC 4JV5B 1BYUA 3MG9A 4AIRA 2WR8A 3M4XA 2ZPTX 3T0IA 3LLUA 5JXJA 1P1RA 4NMXB 1CY6A 5JTTA 1BVHA 5L53A 1F8FA 1XRLA 5TMEA 3B2QA 3SQLA 5DHQA 4DJEC 2AFHE 3LNTA 2HW8A 5GJBA 1QPZA 3KUXA 4MQEB 5SZHB 3WY9A 2CZGA 2M6RA 2NGRA 1U3DA 1A9TA 3TD6A 1XXHB 2ZIXB 3IEIA 4WLVA 1YUNA 2BFPA 2QQGA 4IGIA 4LWQA 3PDUA 4UUMA 4F6LA 3AY0A 1XWIA 2XIQA 2I4TA 1RQLA 2V7BA 1M8FA 3E70C 3QBEA 3FF1A 1PT8A 4I1YA 4NBNA 4QUHA 4X1IB 4BVKA 5C8VA 2D7DA 3PTLA 1T2UA 1UT8A 1Z4MA 2EYUA 3AJRA 2FOLA 2AW3A 1VSTA 4RIHA 4QOEA 1CE8B 2BFDB 1G0NA 1GKIA 1VE1A 1USGA 1Z0DA 1Z22A 1Y5LA 3FVWA 3H75A 3NWEA 2J3IA 5D1NA 3RIXA 4YASA 4AAYA 1F7UA 3GT3A 3AM4A 3MJCA 1XA4A 3QELB 3GMSA 3NHJA 5FR2A 4AZ3B 4RMHA 3EGXA 4M36A 4L5BA 4BNKA 4JI7B 4BL5A 3QJGA 2P6RA 3RBZA 1KJQA 1BEEA 3F97A 5LUBA 3VV3A 4YPVA 2O8BB 2FPGA 5FAKA 2JHPA 3LBAA 4LQ4A 4RTPA 1NW9B 4A2WA 1DTSA 3KLPX 4GMXA 3NM4A 4CMHA 2N1BA 2ZJ0A 4Q9NA 3H0EA 2P30A 5DSXA 2CLOB 2DB3A 2NZVG 1RJ9A 1RWPA 1CULC 4CTNA 1RXUA 4PZEA 4DJ5X 5CB0A 1TQ8A 3GIWA 3PIRA 4UNQA 1XFAA 5AT1A 2P77A 3K1ZA 2BISA 1NL3A 3UOAB 4QC2A 2WYHA 2PBZA 4ND7A 1PYDA 2WWGA 3LM8A 4DJTA 4D6YA 2WVGA 2ZS8A 2RK3A 2QIPA 2X86A 4HPJB 3UG7A 2XCOA 2FKAA 4LHXA 1GSIA 4HUQA 4MUGA 4FR2A 3VR1A 3ZQKA 5EZYA 1E3TA 1N3LA 1PV1A 1YS4A 5FBWB 3VBCA 4N3AA 1PQYA 1QHFA 1QM5A 5BW5A 4C2UA 3QYAA 3KPWA 1IN6A 2K6GA 2PNJA 3PXBA 2II6A 1NQVA 4LG1A 1AS2A 2QRKA 2CSUA 1X7WA 3SHVA 3TGLA 4DCVA 3PXGA 3VX4A 1D1TA 4PRYA 4TVBA 1OWPA 4Y2VA 3V9PA 1YZVA 4OHYA 2I2DA 2RHOA 4UARA 1SOVA 2Z2KA 2ZYTX 1T4CB 5J2UB 5JCJA 5DNEA 4BTLA 4CR7A 1D1QA 5DHSA 1FRNA 4FNOA 2ZKIA 3HDJA 3OU7A 5COQA 5KU1A 2YZKA 2R6JA 4PFKA 3ORQA 4KIJA 4ZVSA 4E5PA 1YE3A 3BDVA 4O25A 1N6KA 3D8RA 1ORTA 2QTGA 2YBDA 3VRHA 4M0KA 4HMOA 1XMJA 3KE9A 5DNCA 1Q1EA 4O4HF 2X8AA 3FHJA 3Q3JB 4FCCA 3EF3A 3FH0A 1NRWA 5BN4A 3UGKA 1ZMBA 5C4IA 2WE8A 4DM7A 2C5SA 5KVSA 3OQPA 3LYAA 4YPFA 4C20A 3F5FA 3WV5A 1BHJA 4X9XA 2PUEA 4HS4A 4DUGD 3JQGA 3KJQA 2AR9A 3GZJA 3GFGA 2BM8A 3O84A 3OTWA 2V9CA 3EIXA 1DT3A 4RVHA 4FEYA 1X8LA 2JH3A 1E9VA 4BVEA 2J9XB 3LBIA 4IAOA 4RPLA 3RKUA 4CDMA 2IEBA 2AR0A 1IZ8A 1CFZA 4E7PA 3OZEA 1WPXA 1M2FA 3I3OA 3IPCA 4S1TA 1CUFA 1HX7A 1P0CA 9ATCA 1WSDA 4UC0A 3Q0IA 5DBEX 1ECLA 4UDOA 4YYEA 4ZDIA 5JS7A 1KSFX 1ZVJA 3QBTA 3BSWA 3L1UA 1REQB 4Y2JA 2PGLA 4BO8A 5I7WA 2HY7A 4J0KA 4OQNA 3OAAD 1Q0ZA 1ZJZA 5IC5A 3N3AC 4DS3A 4XLLA 3TQTA 4C4OA 4FQ8A 2EKQA 1DIOB 1XCPA 4QUJA 3LKVA 2O3RA 2GBLA 4E03A 2Z6VA 2WTUA 3BWMA 2BR4A 2CFSA 1T3ZA 4WCDA 4KAFA 1E1KA 2FPSA 4LW8A 2QM7A 1Z18A 5IDXA 2GN4A 3HUEA 2XPCA 2Z5FA 3OPVA 1W8DA 2F90A 2PR7A 5JV5A 4NHOA 2F1RA 5FTJA 4YP9A 2UXCB 4FFOA 3IKJA 4LOKA 4EWLA 4M53A 3SE7A 3H97A 3ZDRA 3NJRA 4B6FA 5BN1A 2XAAA 3H7IA 4HVCA 2IIVA 3CCBA 1BD4A 3K9QO 5JYEA 1NQUA 2VSXA 4X61A 2KLHA 1GA4A 3EQ7A 4NMHA 3HXTA 4OHZA 4NJEB 3RU2A 1OTHA 2CVOA 2XEXA 4E15A 1ISPA 3G2IA 3QX8A 3KR9A 3OZXA 4M46A 3B12A 1PBTA 2B7BA 2D06A 2IUYA 3EW9A 4H4DA 4CIYA 2ACVA 4YLGA 1AIPA 1RYEA 2P2GA 3LW7A 2WUEA 1E5LA 5ALPA 5CA1F 3C3DA 5THKA 3RS5A 4KW7A 2NQTA 2VHVA 5DXJA 3JALB 3AGQA 4IZIA 1SFRA 1YU6A 3BGVA 3F96A 3DDOA 1RRGA 2PSSA 1IM8A 4JEHA 4CCWA 1BFDA 4Y6OA 4UTVA 4LMBA 4BNDB 1N2CA 5G1NA 3VISA 4R16A 2HU2A 4Q1VA 4W4TA 5CCEA 1OH7A 2NVWA 4K9RA 4ROSA 2BLNA 3ZHCA 3DHWC 1M1XB 4Y9UA 1I30A 1N9KA 4BMXA 1QP4A 1R0LA 1SNYA 2W6OA 4JP8A 4WV3A 2P41A 3Q12A 3SZMA 4GIBA 2VUUA 1GPWB 1RE0A 4TLDA 1CVIA 1SBZA 4K7JA 4HYTA 5DTQA 1NUTA 1FFHA 2Q99A 3USES 1YQGA 1PJSA 2J3HA 3WJ1A 3WRXC 1Q7BA 4J94A 1L5NA 4L2IA 3O93A 2G9NA 8ABPA 1WETA 1CQJA 3WYEA 4J9UE 1D04A 3ABSB 1P18A 2NSDA 2A4KA 2GAFA 1Z0ZA 4L72A 1IM5A 4YAJA 3VPAA 1W59A 4QWMA 4J03A 2PH3A 1WS6A 4PO8A 1P4JA 4LWPA 4IQGA 1BKSB 2DJIA 4OGGA 3FZQA 2QTRA 3TK1A 4EENA 2QT9A 1BJTA 1GPKA 1KOFA 2MJLA 4KTTE 1XRRA 2YZNA 6NULA 4J3FA 3VSDA 5IAAA 3DMGA 5JMOA 2YOHA 3O8BA 3T9EA 4JL6A 1EXNA 2LV8A 3TCNA 2EJTA 3EFOB 4I55B 2PFGA 5JS1A 2J48A 5K0NA 5CDFA 4A0HA 2Y1CA 3W77A 3RHSA 3DXFA 5ALMA 1FA9A 2LDBA 2XMRA 3KTFA 4E5SA 2BRUC 2B5OA 4BQFA 5KNDH 2WE7A 4I5EA 4BASA 4DADA 3DLTA 3SQOA 1OHHA 1Z33A 3A2MA 3UV3A 1WMEA 1KAQA 3EEQA 4ITVA 4LNUB 5F3WB 5FWXA 2O8EB 3B6EA 3ZBTA 3IIJA 4DLYA 3GQVA 4RLSA 4UUQA 1RZVA 1SMKA 5BSUA 1H2YA 4F45A 4JDPA 1ZMOA 4GBGA 4QHSA 4URXR 1UWKA 4R2IA 2CSXA 1AGPA 1ZUD1 1FNSA 2I62A 3P32A 4EDHA 3DNPA 2JIBA 4PO1A 3EZLA 3TN7A 3WMRA 3AP1A 4GBJA 1BMFD 1R3UA 4MW7A 3RU3A 4EITA 2JI4A 3VNSA 3BICA 2ILVA 2GZ2A 1J25A 1KAMA 3TSZA 1GGKA 1H93A 1L4GA 1Q0LA 1PI3A 2QZZA 2JGEA 2R5NA 3UJ3X 5C34B 2P9YA 1SHUX 2HDWA 3VO2A 2RJOA 2JLWA 4HH4A 4R1UA 2FE4A 4KYUA 1YJ5A 2PLAA 2RBGA 3OQHA 1UFVA 1EX9A 2PWBA 1T6YA 2PANA 5KX5A 1BX1A 4CGYA 3SWWA 3CB2A 3UFXA 2OPBA 1O94A 1AN9A 2XWJI 1HNNA 3L77A 4ZGGA 4WGFA 1P1KA 3PUHA 4BWVA 1IUPA 4L8LA 3A1SA 1Z2EA 4OKNA 3CY6A 3GDHA 4PS1A 4BV2A 5ESWA 2BFFB 3KLMX 4PR0A 3ONDA 1DG9A 3TNFA 1GCAA 1SULA 1U0GA 2QRNA 4TKZA 3SD7A 3UT5A 3F6RA 2X42A 4F04A 5HK8A 3CN7A 4G4SO 4PYIA 1JECA 1FFCA 3JZFA 3URKA 3WDMA 2B0CA 2ZRHA 4DMKA 4K9MA 3OLZA 3DMFA 2VAXA 1W19A 3D1VA 5L3QB 1JFFA 4G1FA 2B2CA 4EW3A 4ARIA 4L6CA 3TB6A 4TLBA 3F3SA 4MWSA 1PEYA 5T3YA 4KO4S 2JIZD 2PBFA 3ZW8A 2VHEA 3O2JA 3Q8XB 2W6JA 1GGMA 2GEBA 4B76A 4S2UA 5AKJA 4AMBA 1LNSA 2Z8ZA 4K81B 5CLLA 3ZD8A 4DB2A 3GRUA 2CXTA 1LPMA 4ID3A 5KCMA 1THMA 4R98A 3WLIA 1PK8A 3VNUA 4EA6A 4IH4A 3PRYA 5B30A 3RS2A 3FNQA 3KLNA 4G4IA 4YRCA 1ZL2A 4NCKA 4BO6A 2A5FA 4UU7A 4YRRA 1ZEMA 2QSJA 3LUKA 4R83A 3T7RA 3N87A 4ASUD 1FW6A 1QTRA 2CNDA 4MQ5A 2CB9A 2Q3BA 3MPOA 4W6QA 3LXMA 3VPFA 3HKBB 5AIBA 2P6PA 4I4NA 4HVAA 3IE0A 2RJNA 4LE0A 3R74A 3UB3A 4BQOA 2VTBB 1DT5A 3AF2A 3J7AC 3P20A 3STTA 2PX2A 3GEMA 4IDEA 1K86A 3K92A 1UIRA 1EDBA 3RF6A 5JQGB 3SK0A 1DARA 2AZTA 2WICA 5EP3A 3RTDA 1I2ZA 2YUTA 4XB1A 5IUNC 4GR5A 5TPZD 4BJ5A 1IZ0A 5LQDA 1WJGA 3N9IA 2IXGA 4PAGA 1JE1A