3DQZA

Structure of the hydroxynitrile lyase from arabidopsis thaliana
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
256
structure length
256
Chain Sequence
RKHHFVLVHNAYHGAWIWYKLKPLLESAGHRVTAVELAASGIDPRPIQAVETVDEYSKPLIETLKSLPENEEVILVGFSFGGINIALAADIFPAKIKVLVFLNAFLPDTTHVPSHVLDKYMEMPGGLGDCEFSSHETRNGTMSLLKMGPKFMKARLYQNCPIEDYELAKMLHRQGSFFTEDLSKKEKFSEEGYGSVQRVYVMSSEDKAIPCDFIRWMIDNFNVSKVYEIDGGDHMVMLSKPQKLFDSLSAIATDYM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Alpha-hydroxynitrile lyase-like protein
publication title Hydroxynitrile lyases with alpha / beta-hydrolase fold: two enzymes with almost identical 3D structures but opposite enantioselectivities and different reaction mechanisms
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 90
structure length 256
sequence length 256
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.10: (R)-mandelonitrile lyase.
pdb deposition date 2008-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3dqzA00
4WY8A 4LIPD 3TGLA 1QIHA 2J4CA 2XMRA 2AJBA 3PI6A 3QYJA 1QJ4A 5AM2A 4UHHA 3ESBA 3R3XA 5JANA 4PSCA 4B82A 3G0CA 1H23A 3WL8A 4M0FA 1JMYA 3PF8A 1B41A 1T2NA 2ZYHA 5E4JA 1P0MA 2EEPA 1TIBA 4Q1VA 1EDEA 4FFVA 2BUCA 1G42A 2XMSA 4MEAA 4CI9A 5K3CA 1JU3A 1Q83A 4FMPA 5EHQA 1QFMA 2I3ZA 2VQ6A 4DNOA 6YASA 1QO9A 4AO8A 3DKRA 2WHPA 3KD2A 4FLEA 4J0GA 3D59A 1AUOA 4OU5A 5AKYA 4BC0A 1YB6A 4G1FA 4UBNA 4ZI5A 5JD5A 4I4CA 4CCWA 2HA4A 3IDAA 5AK3A 3G0GA 1UWCA 1HDEA 2O2IA 1VZ2A 1BN7A 4Q05A 4OB8A 4X6YA 4X6XA 4E46A 1MTZA 3D2CA 2PL5A 4L9AA 3UUFA 4FBLA 2FJ0A 4DNQA 5HK9A 2PSFA 4F60A 2O2GA 1XRPA 1KU0A 5DNVA 1AQLA 4ARBA 5E4TA 3UMJA 4P08A 3TRDA 1XROA 2J3DA 2XUQA 4Y2QA 1DT3A 3RARA 1XQXA 4KYVA 1BU8A 1E8MA 2DHEA 3QMWA 4U2DA 2XQKA 3E3AA 4BCCA 2ZSHA 5ALIA 1QZ3A 5AI0A 4UHBA 5AK4A 1XZDA 3FWHA 2DHCA 1GZ7A 5JD6A 5KWIA 1VLQA 3R3VA 4UBMA 5CH5A 2QT9A 1CUXA 1TCAA 1N5MA 1NU6A 2WTNA 2WIDA 5I8PA 2WIKA 3GZJA 2XMCA 1W52X 2XUGA 3G0BA 3F98A 5AI8A 1T4MA 4CG2A 1QIMA 1LPOA 5EGNA 4AMYA 2RAUA 1CUVA 5LYYA 2VTVA 4KRYA 4GECA 1X70A 4N8DA 5AKHA 5FP0A 5AKEA 3D5EA 1EB8A 3M83A 5AP9A 2HA6A 2B20A 3A70A 2WJ3A 1HL7A 5D6OA 1MT3A 4BATA 1JJBA 4EY4A 3O4IA 5CT8A 4Y2YA 5FXMA 3SX4A 3DOHA 4XX1A 4XVCA 5AK6A 2VAVA 2AJ8A 4JYPA 3DEAA 4WFKA 5AKZA 1XZGA 4GBGA 1IZ8A 4F0JA 1LPNA 4KACA 4X85A 5ALJA 1MU0A 2OXEA 3H2IA 4FTWA 5BWBA 2I78A 3H1BA 3H2JA 2JEYA 1X2EA 4NMWA 5HKBA 3SWWA 3O0DA 3O4HA 4GXNA 4X6UA 3B3QA 5AKLA 1WOMA 4X95A 3A2LA 2QUAA 3C43A 2IIVA 2AJDA 2FX5A 2JEZA 5CTAA 2OCLA 3FYTA 3DQZA 2QUBA 4G4JA 2C4HA 1QLWA 2DFPA 4QDXA 2JGFA 1TQHA 3OOSA 4Y7DA 3WIOA 1IUNA 5JIBA 1KEZA 2WIFA 3IUMA 4ZWNA 3HYSA 2GBGA 3L1HA 4HAIA 4G8DA 4FOLA 2WU4A 1F0PA 2JGMA 3G02A 1BE0A 5K3FB 3M81A 4EUSA 1CEXA 1U4NA 4WCVA 5CMLA 4BDTA 2VJBA 5AK5A 4U2EA 1E8DA 4DLNA 2H7CA 3T4UA 5AKJA 1UT6A 1ZD3A 2PU5A 4MJ3A 4FLMA 2K2QB 4M0EA 1ZGBA 1QONA 1WB4A 1CVLA 3DD5A 4GI1A 5D3KA 4CCYB 1YCDA 3CN7A 2GYUA 4B9AA 1Q0ZA 3C5VA 1ZJ4A 5JALA 4HTAA 1TAHA 3AIOA 3KOOA 2ZJFA 1CR6A 5CT6A 3YASA 4QE3A 2C5GA 2RIPA 2WM2A 3IVMA 5BV7A 3G7NA 4PQEA 5FKJA 2HDWA 4DMFA 1LGYA 4N5HX 1LPAB 4E15A 4RE6A 5KWJA 2WKWA 4GDMA 2RHWA 5JADA 2XMDA 3SC2A 2QVBA 3H04A 3BF7A 2B9VA 2C0QA 3BJRA 5CURA 3IUJA 3O95A 4AZ0A 2Y6UA 2XUJA 3ZLVA 4ZV7A 2X8BA 2PKYX 5CT5A 3STWA 1SC9A 3G9XA 1WB5A 3WKEA 3BIWA 5AM0A 3A2MA 1K8QA 5CH8A 3FCYA 4PSUA 3I1YA 5ISMA 5LP1A 1QO7A 4TVKA 1VJ5A 3IULA 4OYYA 4BP9A 2JF0A 3LLCA 4DYHA 2XUOA 3B5EA 5T4FA 4Y2RA 5CH3A 4P93A 1PJAA 2RGUA 2R11A 5EFZA 1JJFA 3V1LA 4AN0A 2ORYA 1ZI6A 4H7DA 3L1JA 3C6BA 4JH0A 1YAHA 3V1MA 5A62A 3F67A 4QWMA 1ZD4A 5DYYA 1QTIA 4W9RA 1A8UA 2WFZA 4BAUA 3QBJA 2WG2A 1MNQA 2VA9A 3FSGD 4G9EA 1ZD5A 4JNCA 3HEAA 4YK7A 3WKAA 1KU6A 2FJPA 1H22A 4DNPA 1Z68A 4GWLA 4KE6A 5AKXA 3IUQA 4LYEA 4X71A 4ZGBA 4U2BA 4E14A 1R50A 1TCCA 3HI4A 1TK3A 4B0PA 2YYSA 2WTMA 2V96A 5AM3A 5DNWA 1MPXA 3WYDA 1VA5A 4OB6A 4J0CA 4OCZA 4A5SA 5JAHA 1OCEA 2BCEA 3CN9A 4GW3A 1VOTA 3TJMA 5JAPA 3WKDA 3PUIA 1GPLA 2HA3A 3ICVA 1CUEA 1FFAA 4UFNA 4MQMA 5HF8A 4ZREA 3FNBA 2PUJA 3BE8A 1TKRA 5JZBA 1EK1A 2Z5GA 2D5LA 2HU7A 5HF6A 4C87A 3O4JA 4H77A 4A16A 3R41A 3B12A 3DOIA 4TPKA 4QA9A 4JUIA 4UFPA 3WKBA 1LPBB 3ZI7A 5K3EA 4PW0A 1CUJA 5E4YA 2XQIA 4BCDA 5JARA 1GPKA 3G9UA 1ODCA 3AJAA 3V1NA 5BOVA 2JGJA 4AMZA 4J3JA 3ZWQA 2RONA 2VJDA 1QTRA 5EIEA 4X00A 5ALSA 2E3JA 3Q8WA 3WK8A 7YASA 4ITVA 2HU8A 4ROTA 5FUMA 3H17A 1HKHA 4WFIA 3AZOA 5JAOA 4C6HA 3CXUA 4L3WA 1DWPA 5C8ZA 4IH1A 5AKKA 5CT9A 3W05A 4BVKA 1AURA 3F97A 1IUPA 2BJHA 3ED1A 4DSAA 3FSGA 1U2EA 2QZPA 4WDQA 3I2FA 3JYHA 2WIGA 4Y2VA 4MYSA 3I6YA 5SYNA 1BROA 4H7KA 1LZLA 2Q0XA 3HSSA 5HQ3B 1XKTA 2UZ0A 2PSEA 5ALQA 4Y9SA 3E4DA 1VZ3A 5CT4A 4BVLA 2XLBA 4H7JA 1UKAA 3QITA 3WA7A 4S0XA 5HZGA 4CG1A 5LZ2A 1CUZA 3NWOA 4X92A 1XQYA 1LPPA 1XRQA 5ALDA 1MNAA 2PBLA 4UHFA 3DL4A 2OQIA 2XUKA 1UOPA 4B83A 3VJKA 1WPXA 2C5FA 3PF9A 4ZXFA 1DWQA 2XMZA 3OURA 4Y2SA 2JBWA 4J0JA 1U65A 3FLAA 4TGLA 3KDAA 4J03A 5FRDA 2OAGA 1DQYA 2BGRA 4CIAA 4U2FA 2XT0A 4DGQA 1G66A 2HA0A 5ALKA 3IURA 4N8SA 4G5XA 1YB7A 1R9NA 1DTEA 3K9BA 4BP8A 4BYMA 1WB6A 3DCNA 4AN1A 5AI4A 3R3ZA 1K4YA 4AB1A 5AOCA 3R40A 1VE7A 3CCBA 2CUTA 4QDZA 5JZSA 1E66A 1XFDA 3ANTA 3I28A 1SFRA 3HLKA 2G5TA 3G0IA 3GELA 5ALFA 4BC1A 4BB0A 1DQZA 1JI3A 1YS1X 4FNGA 1L7RA 4CG3A 1AMNA 3GROA 5K3AA 2P8SA 4OU4A 1GPNA 1BRTA 5I7UA 2C0PA 5D7BA 5A6VA 1Y37A 3D7RA 4HZGA 4J7AA 4Y2PA 1SCKA 4N8EA 1QIEA 3STTA 5CBKA 1EDBA 2VEOA 4XWGA 2WFLA 1ACLA 1ZD2P 2WJ4A 5DYTA 3DL7A 1O6FA 5HK8A 3KSRA 4RPCA 4KR0A 4I19A 4QLOA 1HBJA 3EQ9A 3W04A 1DX4A 1R88A 2FUKA 3R3UA 4WY5A 4DM7A 2ES4A 2Z3WA 3GFFA 3FVRA 1G4HA 4XIIA 2D0DA 5HF5A 1UK9A 4BBZA 2QR5A 5K5EA 3AZQA 3DKKA 3KWFA 3CCCA 1ETHA 3WKCA 3H19A 2HU5A 2Y2UA 4Q3KA 4EY6A 4PF1A 3I2KA 1XRNA 5IVHA 3QMMA 3H2KA 2OPHA 5AIBA 3D4LA 3C8HA 1PFQA 1F8UA 1GQRA 2WG1A 1E8NA 2Z8ZA 1E3QA 4P92A 4UPDA 1ODTC 2XQFA 4FDMA 4AO6A 2WUDA 4HRYA 2OAEA 4J0DA 4B0OA 3D2AA 1A8QA 2CJPA 3EQ8A 5FDFA 3PDCA 5JD4A 1DINA 1UK6A 2RHTA 3ZLUA 2XQGA 4K6KA 3O9MA 4X93A 1QIDA 4NZZA 5LKRA 5CRIA 4UBKA 3KWJA 3C8DA 2X76A 3C87A 1SCQA 2QJWA 3OTQA 5AKIA 1OXMA 1VXOA 3C6XA 3FYUA 1EVQA 3AILA 3WLAA 5LZ4A 4FKBA 3WJ2A 1U8EA 1CUIA 4Q82A 1UOOA 2XB6A 1XRMA 5ALEA 4Q3OA 5ALMA 4K6HA 1USWA 3LP5A 1THTA 3EQ7A 3WWOA 4YX9A 3WZMA 1VA4A 4X94A 3WWDA 1GGVA 4BE4A 3OPMA 2BFNA 5LZ5A 4UFOA 1FSSA 5AKGA 4QEKA 1YAJA 2WHRA 2G4LA 3ICWA 3ESCA 4DMKA 3I2HA 2DR0A 3H0CA 4FHZA 4X7BA 3MVEA 4BDSA 5FPPA 3N0TA 3NUZA 1EH5A 4U2CA 5CW2A 5AHXA 4DNFA 4RGYA 1ZGCA 4MEBA 1C4XA 3LIIA 4NS4A 2GYVA 5DJ5A 3VISA 2C58A 3IUNA 1ZI8A 2DQZA 1GQSA 4IH4A 4KAJA 4UUQA 4B9EA 2QMQA 2B4KA 3OG9A 2W22A 2WUGA 4G4GA 4ARAA 3W06A 3G9TA 5A7FA 1Y7HA 3OM8A 2V9ZA 3ZV7A 4UHEA 4BAZA 2ECFA 3I2IA 3VXKA 3HACA 4QDOA 4OB7A 2Z3ZA 4WFJA 2HIHA 2BUAA 2VATA 4BZZA 4OPMA 3HC7A 5BWCA 1P0QA 1QFSA 5CXXA 5SYMA 1THGA 1HPLA 3LCRA 3BXPA 4L72A 4KE8A 3RLIA 1F6WA 1CUHA 2HA2A 5ALWA 3H2GA 3UUEA 2WQZA 4FNMA 3BDIA 2GZRA 1DWOA 2HM7A 4CFSA 4KRXA 1UKBA 3D3NA 1CUUA 2J3QA 3PFBA 5EIAA 5K3BA 5LKAA 1WHSA 4NVRA 3U0VA 1XLVA 5ALLA 3WL7A 4B81A 1L7QA 5LLSA 5JATA 5HFAA 3PE6A 5ESRA 5A7GA 3W9BA 1EB9A 5AM4A 1XZFA 3A2NA 2QXTA 3STYA 3ZPXA 1H2ZA 4N5IX 5AM1A 4BTLA 2VJAA 5HCUA 4IHAA 2PU7A 1GT6A 5AI6A 2HFKA 1F0NA 1QE3A 4H18A 5C7YA 3QMVA 5HQ3A 5AH0A 3H18A 4EY7A 1JU4A 3EF3A 1CUWA 2QJRA 1Q0RA 4BAGA 5EHZA 5ALYA 3AUKA 1S8OA 1ISPA 2OLEA 4AZ3A 3QPCA 3GA7A 4LXIA 1IZ7A 1XZIA 3QPAA 5K3DA 2OCGA 2QXUA 1J1IA 3DDUA 3ESDA 2XUDA 3BL8A 5A7HA 4MYDA 3VKFA 4Y2JA 5YASA 1BEZA 3WWPA 2GBCA 2OGZA 3PUHA 1EXWA 1A88A 3PFCA 1FFCA 2QM0A 4PSDA 2XUPA 3WJ1A 1G5FA 4G8CA 1QIIA 3V9AA 1CRLA 1ZICA 2JGKA 1LBTA 3FVTA 1CUDA 2WILA 1DU4A 4KEAA 1B6GA 3DYIA 1MN6A 4V2IA 1CQZA 1XZAA 3DS8A 1ORWA 4JYMA 2DSNA 5FOQA 5C8VA 3WA6A 1UOQA 4KAFA 5DLPA 5AM5A 4OUKX 3RK4A 1CUSA 1XLUA 4UBIA 1FFEA 5JZ9A 3O9VA 1BS9A 1AGYA 2XE4A 2XDWA 2B61A 3FOBA 1R3DA 3T52A 1AC5A 4MWSA 4W1PA 3H2HA 1EHYA 4QDUA 2HRRA 3NOXA 1MX9A 2PSDA 3H1AA 1AKNA 5H3HA 2W6CX 3JW8A 3QPDA 3WK4A 1K6EA 3TEJA 5LIPA 3I6ZA 4HRXA 3GUUA 2R8BA 3MUNA 1ORVA 1EK2A 2VF2A 4FBMA 4GEGA 4H7IA 2WSLA 1N8SA 1XZBA 5ALRA 5AO9A 2PPLA 4QDTA 1OILA 4DTCA 3EIOA 4LXGA 2CKMA 3JWEA 4H7HA 3LIPA 1QGED 1CUBA 3D2BA 3VJMA 4YPVA 3FLBA 4L0CA 2DCMA 5FLKA 2H9YA 3BIXA 3E1GA 4W1QA 3BJMA 3SK0A 3A6ZA 3QZUA 1ACJA 3R0VA 1UXOA 2HL6A 5ALTA 1UZAA 4XJVA 3W9UA 1MX1A 4H35A 1CUCA 3C70A 5HFNA 4LYDA 2EDAA 1JMKC 1YS2X 4B7ZA 4EHBA 4PV7A 1W6RA 1YA4A 5AI5A 1N1MA 4W1RA 4MXDA 1K63A 3E0XA 3WIBA 3M82A 4G9GA 3WK9A 5EHXA 2Y6VA 4B6GA 2I03A 2ZJ6A 3WZLA 4MWTA 1MX5A 1QIKA 1CFJA 5FPQA 5DNUA 2QRUA 4BTVA 1IVYA 1D07A 1WCYA 5AI9A 3WK7A 4EBBA 1J2EA 2ZYIA 4MQLA 2HA5A 4DIUA 3AIMA 3VVLA 4EY8A 5LZ9A 2XUFA 1CUGA 1A8SA 1FFDA 2WJ6A 4QNNA 4DMCA 3O4GA 1XZKA 4I3FA 2AJLI 1H2YA 4WDRA 1XRLA 5F4ZA 1JJIA 2RI6A 4B84A 1UK8A 4EB0A 2VAXA 4JEIA 5ALGA 1RP1A 1XZCA 5KREA 2O2HA 4QZVA 2CMFA 3MUOA 2XI4A 5I9IA 4UBOA 5C81A 5K3FA 4Y2UA 1MAAA 3R3YA 5ALHA 1GKKA 1R4ZA 4J0IA 5AOBA 1DT5A 3IIIA 4BE9A 4X91A 2CEKA 3I6MA 3M3DA 3QM1A 5T4BA 2HFJA 1FFBA 1XZHA 1DX6A 2Y2VA 2WLSA 1GKLA 5E2IA 3WL6A 3Q0TA 1SCIA 4O08A 2XUAA 5AOAA 3RKSA 2QS9A 3S8YA 2QOEA 4CCYA 3S2ZA 4K5QA 3STVA 3VVMA 1I6WA 1W1IA 1ZIXA 3EBLA 1ZJ5A 1WM1A 4AQDA 2JGLA 4AXBA 3I1IA 3BDVA 2VT7A 3FLEA 4EZIA 1VE6A 1P0PA 5AJHA 1YASA 1XZJA 3X3HA 1YA8A 3IB3A 1YSCA 1XRRA 4HS9A 1Y7IA 3HABA 2ACEA 2XQJA 2ZYSA 4OD0A 4C4ZA 2PVSA 2WUEA 1YR2A 2WHPB 1EINA 4HXEB 5ALNA 1J07A 2HHAA 2PX6A 4BVJA 1EDDA 3NGMA 2O7RA 2Y1KA 5KBYA 4FFWA 2OQVA 4Z49A 4KE9A 1AZWA 5T4HA 1JKMA 5ALVA 1X2BA 1PV1A 1EX9A 4UHDA 1UKCA 2PSJA 1K5PA 4X97A 2XUHA 4RE5A 1CQWA 3L1IA 1LBSA 2XMQA 4G8BA 1LZKA 1J06A 2GYWA 2OGTA 4LHEA 1CPYA 3D0KA 2ZJ7A 3LS2A 3C45A 3C6ZA 1LLFA 1EI9A 2BGNA 3HZOA 3V48A 3WYNA 1EA5A 3GBSA 1CIJA 4QWWA 2HRQA 3R3WA 4Q34A 2YH2A 3AFIA 2CBGA 4J0HA 3P2MA 1LPSA 4QLAA 4EY5A 4Y2XA 3WK5A 1LPMA 4W1SA 1TCBA 3VJLA 4BZWA 1MAHA 4YASA 4ZRDA 2BKLA 3DNMA 1BCRA 4C01A 1BEEA 2BUBA 4LKOA 2Z8XA 2VT6A 2WFMA 4OSEA 5IKXA 4X90A 4H7FA 1BCSA 2WFLB 4Q3LA 3K2IA 1C7IA 1ZOIA 1RWQA 2ZVDA 1BN6A 1EVEA 2GBFA 1UK7A 3WWCA 4C4YA 4KJXA 3RM3A 2QTBA 4W63A 4ZV9A 4UBJA 1XZMA 2WIJA 2ONCA 3DLTA 5EHNA 4DSZA 5IVDA 4RNCA 4FWBA 3ZLTA 2V97A 4INZA 2I3DA 4Y2TA 4BCBA 4E11A 3STUA 3FBWA 1Q84A 1WPRA 3FYUC 5DTJA 1R9MA 4GLBA 1O6GA 1MO2A 2H7XA 1HLGA 1H2XA 2ROQA 1XZEA 1ZIYA 5HKAA 1W76A 2ACKA 2IITA 2JGEA 2G5PA 3WMRA 2PM8A 2PSHA 2BAGA 3VDXA 4B80A 1RYYA 4KE7A 2YASA 4AO7A 1SOMA 1R1DA 1VXRA 4P9NA 1N5RA 4GHWA 2VSQA 5DWDA 4U2GA 3IA2A 4H0CA 4BRSA 3AINA 3OC0A 3DYVA 5C8XA 4BRZA 3G0DA 2JGIA 4D9JA 3C6YA 3N2ZB 1QIGA 5ALPA 4C89A 3AZPA 4K6GA 4PO3X 4OYLA 2GBIA 3F8SA 5AIAA 2CZQA 3QVMA 1NU8A 5FV4A 4B85A 2XUIA 3I2JA 4PNZA 2VJCA 3HXKA 5DYWA 3DJYA 4CIBA 3BWXA 1QIJA 3FYUB 2WUFA 2WHQA 4HXGA 2WG0A 2WU3A 3U1TA 4H7EA 1W4LA 5A71A 1XZLA 1E5TA 4X3CA 2NW6A 4EA6A 3G8YA 2YXPX 1A7UA 5JYCA 3K6KA 3FAKA 4FLFA 4KAAA 3WWEA 2JIDA 2EDCA 1P0IA 1TRHA 3F9CA 3G9ZA 2H1IA 3ESAA 2PUHA 3F96A 4WJLA 2C7BA 5ALXA 1W75A 4UHCA 1E89A 2AJCA 2XLCA 5LZ7A 5IH7A 1ODSA 5JAUA 2LIPA 5LZ8A 1IMJA 3C5WP 4LXHA 3HRHA 1QIFA 5JASA 1UFOA 2GZSA 1CV2A 4K2AA 3STXA 5A2GA 2DQYA 2X5XA 1GXSA 5ALUA 1CUFA 5ALOA 1CUYA 1NX9A 4C88A 2DHDA 5EI5A 2OCIA 4AX4A 5DTIA 3V1KA 2ZYRA 5EIHA 1IUOA 5ALZA 2HADA 1AX9A 5AICA 3FCXA 4IQ4A 2QKYA 1M33A 3PICA 5IVIA 5HF9A 4G4IA 2H7YA 3WK6A 4HXFB 2CB9A 3I2GA 1FJ2A 1HQDA 4IH9A 3ANSA 5T4EA 1CLEA 4ETWA 3HJUA 1H2WA 1JT2A 1JFRA 2J4FA 1ZI9A 4J0KA 4IO0A 1XKLA 1CUAA 3KXPA 1L7AA 2HA7A 1MJ5A 1QOZA 2ZSIA 5D3ZA 2XMBA 2OGSA 4C4XA 2IX9A 2XMGA 3IBTA 3WI7A 1C7JA 1LNSA 1VKHA 5CXUA 2AXEA 1XQVA 2V98A 3BF8A 4F5ZA 1WHTA 3MGAA 3QH4A 2OCKA 3AIKA 2G63A 4A23A 3WL5A 4HVTA 2O7VA 3ILSA 2OG1A 5J3JA 3WQHA 1XLWA 1XQWA 4F21A 5IVKA 4M0MA 4DMHA 3W2TA 4UBLA
chains in the Genus database with same CATH superfamily
4QYXA 3NBMA 2PXXA 3Q5GA 5I8ZA 3RCBA 5K8JB 1SA0B 4QJ3A 4FD3A 2J9XB 2VP9A 4KGVA 1JLRA 2OQ2A 1G4AE 1GGHA 1Q1NA 4D9BA 5DIZA 2C2WA 1QCZA 1ZS9A 5AM2A 2BBOA 1RRKA 5AW4A 3M6WA 1SC3A 3GG9A 3ZDBA 3ERCA 1K5HA 1X1QA 1KGSA 2ZI5A 4L8FA 3H42B 3L01A 4OJKA 4DA8A 1Y8ZA 3F6BX 5A5GA 3TTWA 3BCRA 2RJ3A 1ZU5A 4B82A 3LFHA 2XNSA 1RE1A 1D4OA 2PXCA 3G0CA 1FX0A 5E8JA 3RYHA 3S1SA 1BHSA 1E98A 1ZPDA 4LMBA 4EG6A 3EDQA 3L7OA 5C3MA 1UADA 1NW8A 1GILA 3A1WA 4CIVA 2R62A 3HBLA 1SEVA 4RIHA 4BLQA 2IP4A 4B47A 3VR2D 1E2HA 3VZSA 3G2PA 1XKXA 3N58A 3RWOA 5B6IA 4G1EB 1OU0A 1DQSA 1PJRA 5DU2A 1TLLA 1NKSA 5IHXA 2WF7A 3ZQ6A 1N5IA 4FJ2A 2VCEA 2PH3A 5HE8A 3W5UA 3E3LA 4YAOA 3X0DA 2G9QA 4DF3A 3T3MB 1B41A 4HVAA 5KTSA 1L9XA 3OZXA 4MKFA 3WDLA 4G2NA 2UU9B 4GBED 4MV4A 5L3RA 1EFLA 3B20A 4QUBA 4FR5A 5E4JA 4XYGA 3DMFA 3ZWYA 1YVUA 3MMPA 1BVYF 2V55B 2YIDA 3BE6A 1TIBA 1TJYA 2D2VA 4OATA 2P75A 4YNBA 2BUCA 1CQXA 3T3GA 3BD9A 3THYA 4CI9A 3CKMA 4M8SA 3II6X 3IPCA 3S8MA 2QROA 3G79A 1XPUA 3LCVB 2ZREA 4CMGA 1D3AA 1UOEA 1Y8CA 2PX4A 3IAUA 3FROA 4TMFA 2ODTX 2P7IA 3GUCA 3OM0A 4YCDA 5JY1A 1T1GA 2VQ6A 4JASB 4QGSA 3OQPA 3V9PA 1JH9A 4BXOA 3GGPA 3Q7SA 4K6OA 4YY3B 3ES9A 1QO9A 3NWBA 4LCEA 4AO8A 2RGDA 4BNKA 4MOWA 4OVKA 5JC8A 4TQAA 1PL0A 2JAWA 1GL9B 1UBKS 2PGDA 1CD5A 3CNQS 4GXRA 4AG3A 3ZK9A 1YR3A 3ET5A 5IAGA 3D59A 4OU5A 4FS8A 5AKYA 5D1HA 3TDNA 2N47A 5ADVA 1KBQA 2Z4RA 3DOEA 4BC0A 3NVAA 3KEGA 3WGHA 5HGJA 1EVIA 1ZWLA 4CTKA 5TQ0B 3GJ8A 4JJKA 3CW9A 3K20A 5REQB 2WEKA 2ZS8A 1ZGJA 2DBRA 5BN3A 2QLTA 2AC2A 2DKFA 4PX2A 1LWNA 2QN9A 2O1WA 2YNMC 3BH7A 1YU6A 5DTQA 3RFVA 1MGOA 1G2QA 4KNWA 1UWCA 1HDEA 2O2IA 5I7RA 1BN7A 1X39A 5KYXB 4ZCPA 1N5JA 3FGPA 1Y6FA 5TT1A 1PF7E 4BKQA 4BMNA 1MW8X 5AW6A 3PL5A 1EFTA 4MJ7A 4V0SA 4RKYA 2EWVA 1V26A 2I67A 4E46A 3FBTA 4D4KA 3D2CA 3SYMA 3KFLA 2VDQB 1L1EA 3T34A 3DLIA 4GYKA 4JC5A 2YV5A 4WXEA 5JDIA 3L92A 5DYNA 4QXMA 3LA8A 1H4VB 1WPGA 5F78A 3U7JA 2C61A 4I5EA 3PSAA 3ER9A 3TEFA 2E5WA 4G0QA 1VJDA 1TGVA 2HMYB 2SBTA 3NIBA 3PE3A 4Q9JA 1NBME 2WPDA 2H4XA 1KU0A 5HZHA 1XD2A 5EWMA 5EN4A 3LYUA 3DP9A 4NYMQ 1CP3A 2ZQYA 3G82C 1TX4B 4YLEA 5HM6A 3KT8A 3DMDA 5DSZA 4P08A 3HBAA 4FFBB 4L5JA 4WFQA 1XROA 1S7GA 5CUQA 2DUMA 4JQCA 3OJFA 2XUQA 1E5DA 2V6JA 3D4OA 3B7GA 3E7PA 4EW6A 3RARA 3CNNA 4R05A 2H3HA 2Q6VA 1XQXA 4QRIA 1CYEA 1BU8A 1ECFA 2F1OA 4R8LA 3GB9A 2ASEA 4LMPA 3D4IA 3NV7A 4GBMA 2XHEA 2FN4A 1YIAA 4QTUB 4YAFA 2OV6A 3NYQA 1PTJA 1YFZA 4FZ3A 3S27A 5AI0A 1G1MA 3LCUA 5DCUA 4G84A 1OH7A 2PQ6A 2FCAA 3N05A 2VS1A 1DXOA 2WM8A 4NYJQ 4RC9A 2BJWA 1LK0A 4D97A 5KVAA 1NRWA 2Q2VA 3ESQA 2XOKD 3PC8C 2QTVB 5CH5A 1NGSA 2IU0A 3SD7A 5DM60 4CE6A 1N5MA 3D54D 2WTNA 3PV0A 3DZ8A 3EGXA 3PLNA 2C2BA 4JOCA 5D51S 5EKSA 1TQ6A 2WIKA 4LOIA 4ZGGA 1IHYA 3EPLA 1JTFA 4DM4A 2XMCA 1E6MA 4N03A 1JEQA 2XUGA 4WE3A 4D4HA 3CIOA 3G2NA 2OFOA 4ZTZB 3TQSA 4KOEC 3VR2A 3RG8A 4DV5B 1FFGA 1Z2AA 3CZRA 3TL3A 3CURA 4PAMA 4X41A 1CUVA 4JJEA 2IP1A 2IZ7A 3NEPX 5LYYA 3SYLA 1GLVA 2A9KA 1P77A 4KRYA 1GTRA 2W5UA 4N8DA 1AV7A 5LBTA 1T1SA 3WOHA 4OUDA 1A96A 1HRKA 3R0ZA 5F2OA 1FK8A 4WNAB 3VNQA 1UR5A 3WRYC 721PA 2PJRA 3RC8A 4M60A 4Z7OB 1NM5C 4JBHA 2PV0A 3M83A 1A2KC 4B3BA 1QGZA 2G83A 4PBTA 1M72A 1HQYE 4LBVA 1HV8A 4Y1EA 3GVHA 1V43A 2I2XB 1UDCA 2BI4A 1NUQA 1ZK2A 3PHHA 4IDBA 3TXXA 4NOMA 3ZQJA 2ZUEA 1JLHA 3IUEA 3AKDA 2V8BA 2XY4A 3RC2A 4IRXA 4C30A 4YJ2B 1KOFA 1M2NA 3P9QA 3CT4A 1BDMA 1PGPA 3EZ9A 2XCIA 4R1LA 2QN2A 4BATA 4F2HA 4EY4A 1BDIA 1OJLA 1DKMA 1G6HA 2DT8A 4JUDX 3EXFA 1IM2A 3O7MA 1ULSA 1DAMA 3FETA 5AXAA 3R9XB 3B9RA 3DOHA 1KY5A 4XX1A 3MD9A 4EGCB 4XVCA 5LU9A 3CXRA 1XJ0A 3UIEA 1BXKA 5AK6A 3AR5A 3KM0A 3AL0C 5ESXA 4L6IA 3TW6A 3DEAA 3RS2A 2IY9A 1Z6PA 3Q7IA 3HY4A 5E1DA 4C4OA 1U04A 4R9VA 4F0JA 1HXHA 2RGAA 2Z6VA 2J3KA 1DMSA 2I65A 2P3LA 1FMJA 1YUBA 4X85A 5FULA 3WTBA 1G6OA 2QZ9A 4XVRA 3SGLA 3SSMA 4ER0A 3U4QB 1G8HA 2OXEA 3H2IA 3EC7A 4RY9A 4LE1A 4XCVA 1IOZA 1JDBB 3PA6A 1I1OA 1QQ7A 3GLIB 3V5NA 2HD4A 3H2JA 1ORIA 4H0NA 3W8RA 1X2EA 2G25A 4KXMA 1IJKA 3W5CA 1S5PA 3JWIA 3O4HA 3E9DA 5AKLA 4NBLA 1QE5A 1D5CA 5CA0B 2QJOA 2I7CA 4YP9A 4BNIA 2VPQA 2I80A 1CZUA 3L7NA 1TVKB 3AM5A 1RI2A 2QUAA 4JB8A 4CMKA 1SD2A 5HVNA 4FDAA 3C43A 3OVMA 4WZZA 1WXXA 4ZOLB 1U5BA 4ZI7F 3EARA 3GF4A 4JC8A 4RDHA 2F00A 3IBFA 1G16A 2KS6A 1E99A 1NI5A 1VLJA 1I2ZA 2GPJA 1GCOA 3ASVA 2WJGA 1GQFA 2QUBA 5HEKA 3UJ6A 3E5MA 3N39C 4G4JA 5M2QA 2C4HA 4BN0A 2DFPA 4ZJUA 5TV2A 3D1VA 5L3SA 1TQHA 3WMGA 5THXA 5JEEA 5FBVB 3A11A 2WIFA 1VSTA 2CF6A 3VKVA 2IL1A 3MERA 2E4UA 2E89A 4BQQA 1Y3DE 2GBGA 3BFVA 1W2GA 5H16A 3LMKA 4ISCA 3DDNA 2NT3A 3V32A 2AEEA 4P82A 3LA6A 4LHXA 5JOQA 4FOLA 4C7OA 4G1UC 5FEUA 4K88A 1Y5NA 2DAPA 3F5MA 2FMHA 3MTBA 3FMGA 2P9GA 3G02A 1BE0A 4E94A 4XWWA 4CF3A 1G7SA 3MLEA 4YR9A 3ELDA 4MHOA 1KO4A 3UZUA 4EUSA 1YBHA 3OCXA 3DC2A 4KODA 4DV2B 3DEJA 2DHRA 3IQXA 2JFFA 4C05A 3QF7A 2O8FA 1PGOA 4JOSA 3Q9UA 3CX3A 1T3HA 3KS9A 1UJMA 4MKIA 5EPEA 1ZAYA 1MDFA 4E5UA 3UTDA 1Q19A 1H65A 2XV1A 1VHQA 1Z2OX 3P0IA 2JW5A 2XOKA 4II3A 2VJBA 4AY6A 3CF0A 1L7EA 2YUTA 1P4RA 2VDLB 1IN6A 4LJKA 3T4UA 4EB6B 3FPGA 3THXB 1ZD3A 3H9JA 5K8LA 4KC0A 2A1TS 2Z4SA 4AQ7A 1QANA 1B2LA 1T2FA 3JQ9C 2NZ2A 3LOUA 3HKCB 1GU7A 3EK2A 1S2DA 4O4LA 1CQIA 2K2QB 4M0EA 1WB4A 3V7UA 1CVLA 3FHOA 1P18A 5CFRA 4IUYA 4BJHB 4BL5A 1Z82A 3X1JA 4KN6A 1YHZA 4OJMX 4N4AA 5D3KA 3LP8A 5AUPB 4WKNA 1DDOA 3ETHA 5HSGA 3ICQB 1RM5A 1KMCA 2ZJ4A 1C1DB 1HDCA 3ONFA 1IOLA 4E4YA 5JTUA 3AUTA 1IM8A 4M4SA 2F9LA 3AFOA 4NLLA 2GHRA 1IEWA 2IY7A 3BJZA 3CN7A 3T4EA 4B45A 4CEIA 2GYUA 3TDMA 4DA6A 1JW9B 3H8VA 3AF2A 3KKQA 3R6LA 5G4KB 1ZJ4A 4B9AA 1TU4A 4HTAA 5JALA 1TAHA 4Q3DA 4FE3A 5DCYA 5T7BA 3GQBA 2CDBA 3JQDA 4QE3A 2WM2A 2X8JB 5TVGA 1I33A 1KYZA 2GUGA 4D25A 2J7KA 4NMLA 2NZ8A 2GOYA 5CLHA 4YWJA 4CXMA 5F3WB 1NJGA 3CLTC 3AOGA 4QUAA 4ZGWA 4EI8A 2GMWA 4HI0E 2HDWA 4HAZA 4XIFA 3DWGA 2YWJA 3V1YA 1LPAB 4A7PA 3D7MA 1H8HD 1YZ3A 2H65A 1F7UA 5DW0A 1QHFA 4GPEA 4BQFA 4PLCA 2WKWA 1JQ3A 4GDMA 4GPTA 2AFHB 2JGNA 5C4GB 2I0FA 1TYAE 2B0CA 3H16A 3KO8A 3RSZA 2WUVA 1XDWA 2RGGA 3KOZA 5KYWA 2VDVE 4DCGA 1GQYA 2CLSA 2XMDA 3SC2A 1ZA1A 2VNIA 2VJOA 3OIFA 2X0IA 3M0EA 4MUXA 1XXLA 1CIVA 3HCRA 3BJRA 5CURA 4ZDJA 3IUJA 1IVSA 5SZHB 1USGA 3EVZA 4IJWA 3AL3A 5DYGA 4TV9F 4BU1A 3QEOA 3RIYA 3FYCA 3VTFA 1Z4MA 3UAXA 4AZ0A 1JB9A 1EVLA 5BXYA 1CY1A 1C7ZA 1L5HB 1NN0A 1TUGA 3L02A 3LBAA 1Q2XA 2Q2OA 2JCGA 3OHPA 5L95A 5CG1A 4JXZA 4N82A 3CLRD 4MUGA 5LU8A 3GP3A 3TOSA 2J1LA 4DV4B 3B82A 4CQMD 5H3LA 1UKZA 4ZO9A 1Y9ZA 1A5TA 1WB5A 2X1LA 3UWDA 3WKEA 2EIHA 1JHQA 3JZFA 2ZETA 2XW6A 3PWTA 4OAQA 4A73A 4ZXPA 2CNOA 2IVZA 1CCWA 1Q12A 1XCOA 4FCVA 3DNPA 2ATIA 2QK4A 3DONA 1NBWB 2ZJ8A 1E2IA 4B2IA 1O95D 1BVUA 4XW2A 4MO2A 4TWRA 1N2GA 4OYYA 2CLCX 2H54A 3MGGA 4F4CA 4LJ9A 1UXKA 1JZTA 2AL7A 1T9KA 1UZUA 2JI4A 1G9TA 1L7DA 2P91A 3OIUA 1PD1A 2JIRA 2NUTA 3ZU6A 4DYHA 1QHHB 1KFBB 2E9SA 2VXCA 3FKSD 3O9ZA 1A71A 5FOSA 2ZWAA 3I32A 4KDFA 3AUSA 2FEPA 2QW0X 2JI9A 2FI1A 2GZAA 2YCLA 3MTAA 2R97A 3O6VA 1Z8NA 4QC2A 5DNYB 2NXJA 2IU6A 3T7KA 1G3QA 4REQB 4EVQA 2DUUA 5CH3A 1FPQA 2JIQA 4BLTA 1W46A 5LDHA 1HEUA 3RT9A 2RGUA 4I9NA 5EFZA 1B0AA 2O8DB 5EMNA 2G4VA 1FVFA 1ZI6A 2BFDB 4D0LB 2GN9A 3H9EO 5C51B 1ZONA 2JGRA 1USUA 4LOHA 3KALA 4UEOA 2YWRA 3WDKA 3G8BA 3L8CA 1MO6A 4C7MA 2O3QA 4EYOA 4BFCA 3STHA 4OJQA 5H8WA 3WADA 3ROKA 2BYTA 1PNQA 3DOUA 3TNYA 5TPZD 4GE3A 3K31A 4P38A 5A62A 4PC3A 4YRFA 2HWKA 3QW2A 3F67A 1C1XA 4ECAA 2FMTA 2PCJA 4PLYA 3ZEIA 1ZD4A 1Y9EA 2PGNA 3F6RA 4H2DA 2II6A 5DYYA 5ESWA 3SC4A 4A8TA 4WUTA 3R7LA 4CLRB 3F4BA 3B8HA 1T5HX 4F2DA 3AVYA 3WB2A 3QBJA 2CBZA 3DLBA 2J6IA 3LBHA 1FFXB 1L3CA 1DZIA 4RMJA 2NAPA 1ENPA 2A7QA 1PO7A 4MVYA 4ALJA 2R1UA 4BIIA 2GT1A 2C5EA 1GCUA 5G0VA 1U3TA 2VUUA 3ZW7A 1KQFA 4YK7A 5IVHA 2QG9A 1KU6A 3ZDZB 1H22A 2B1IA 1O58A 2V0CA 2WZBA 1E0JA 4DNPA 1IYZA 1U2GC 4MPRA 3MM4A 4Q4AB 5EMLA 1YNSA 3OMXA 3K0FA 4LYEA 4ZFNA 1R8QA 1NJ5A 1P1KA 3SZ3A 4ZGBA 4YCJA 3UMGA 1Z62A 4E14A 2Q4BA 3R4CA 4HJXA 3ZTYA 4X65B 2D0OB 3SE0A 2C96A 2WE7A 1PS8A 1S3GA 2YJGA 2WTMA 2YYSA 1V2HE 2UVPB 2Q9CA 3BFPA 3EVFA 5HCIA 3U4HA 1XCJA 2ZT7A 1MEEA 4IRMA 2DPGA 1T4BA 1W48A 3OHMA 5LVAA 4KREA 4WH0A 4C0WA 5E6RB 2W4IA 3O21A 2BFWA 1LDGA 3S68A 1N25A 4PAQA 4A5SA 4W5JA 3IAS6 3SF8A 3S29A 4FGWA 2UUAB 4OXYA 5JPDA 2OENG 1ZGAA 1H8HA 1WEKA 2BCEA 3HXPA 3AT1A 3PX2A 2HLNA 4O4HF 4J3FA 1LH0A 1PEDA 3TJMA 3TQOA 4AJIA 1OIXA 3I12A 4JWKA 4QSHA 2WYOA 1F5NA 1N0IA 2PKQO 5JAPA 5JQGB 2IH5A 1QVRA 1LJ8A 1TD9A 3MT8A 3PUIA 4DA4A 2WFAA 4H60A 5IYZA 2QG6A 3AJ8A 3LC0A 3UW3A 2O8CA 1XEAA 2I3BA 4L5BA 4NMHA 4PQRA 4QBFA 3S1LA 3ZD6A 1SCJA 1W36D 5GONF 5L3QB 4P2GA 3KQMA 4RSHA 1AUVA 1GV0A 1JWBB 4LXUA 1PJ8A 2MCFA 3EXG1 1G8YA 3G6WA 5DGXA 4HATA 1KZGB 1QHGA 3AESA 3W8DA 3SG0A 3WJAA 2C07A 1DIRA 3F3MA 2QZ4A 2OZPA 3INYA 4YI3A 4YR7A 3U17A 4CL3A 3D02A 4PZCA 4Q7KA 2H17A 2NTNA 4DLKA 4ESOA 1IK4A 4IIVA 4OBEA 5HF6A 5KEIA 5HRAA 1UBCA 3A7DA 3AGQA 4H77A 3GLIE 3GIDA 2IH2A 5DHAA 3DOOA 5IDWA 2C4TA 2QRVB 2OY0A 1N3BA 4LZWA 1EWYA 3EG9B 3A32A 4CQMA 3L4JA 3AHHA 1M2JA 2BIFA 2ZRGA 1T4GA 2BELA 4JUIA 2PNJA 1V1RA 2CCJA 4PE5B 1YUMA 2G8NA 1BFKA 4PYRA 1CQPA 3UK2A 3WKBA 4UFPA 4YMTA 1UBRS 5EOVA 1CUJA 3E48A 5K3EA 1U2RA 1QCDA 3OTWA 3Q8LA 2XQIA 2F1RA 3FDFA 4TWAA 3HUDA 1WXWA 1GPKA 1ODCA 2VFAA 4IV5A 4D1YA 2CZCA 4D98A 3QKSB 1O95A 4KO3S 1B0ZA 5AJZA 2C7QA 3QVXA 1AE1A 4GOJA 4KV7A 2A94A 3P9RA 5ADWA 2YIVX 3G88A 1VJTA 3CG4A 3NWEA 2FPPA 4NI5A 1GSIA 2RONA 1KMMA 3F7OA 3FKSA 4L6AA 4RTLA 3E9QA 3LLVA 5LC1A 3ENVA 3TKLA 2OWEA 3Q5DA 3GEBA 2I6SA 4MV0A 4EJ0A 1RJFA 1ZW6A 7YASA 3FNFA 1W5SA 3GFOA 2CNKA 2QE6A 4DIOA 2I1WA 4HPWA 4MTLA 4NK5A 3EPPA 4YXFA 1MD9A 1ULZA 2V7VA 3BDAA 4WZBB 2PEZA 4DJFC 1JIIA 4L2IB 2YY6A 3CZPA 3DO8A 4IHQA 4WKPA 1CJKC 1PSWA 3EISA 4MUKA 4ZKDA 4NBKA 3DL2A 1RXEA 4WFIA 3ZE6A 3AZOA 3PXUA 4BKOA 1RQNA 5JRZA 3UMVA 2J33A 3OCWA 4AUMA 1KDZA 3VGJA 5JAOA 4GDFA 4L3WA 2A88A 5JDCC 2FSGA 3A3OA 4FE7A 2HW8A 5FX2A 5AKKA 3LTNC 5TPZA 2EWMA 2AG8A 4YO8A 3W05A 5KTOA 5F23A 4BVKA 1Q0HA 4U9IS 5AVUA 3F97A 3TBFA 2WE8A 2ZXFA 4GSYA 4LJ4A 5E6UB 5C1BA 1ABBA 1KFJB 1F9AA 1YBAA 4FYIA 5ITZB 3GJSA 2BTQA 1PR5A 3HGQA 2PRSA 3G8AA 3VAYA 1SB9A 3EVCA 4ZTBA 4DC9A 1U1IA 4QBHA 2GXSA 4DFDA 3D4BA 3QU9A 4L5IA 2JCSA 4UE2A 4GUAA 1Z35A 3PDHA 5HBGA 5DE3A 1T0PA 2D62A 2ZI9A 4Z7JA 4EF4A 3KR0A 3D9QX 1N5KA 2FLVA 2QDXA 4NDZA 3H9CA 4O4IB 3SIRA 2WIGA 4YQYA 3U4DA 3WLNA 1QH1A 4RHYA 3RABA 2EJUA 1FJXA 1URPA 1BROA 3ROPA 2GJKA 2Q0XA 2YV1A 2ZPAA 4ARSA 1Y6RA 1E5XA 3QSGA 4PC6A 1O03A 4BJ6A 1E9FA 3ONNA 2RHMA 2PSEA 3GOHA 1HYGA 1RNLA 4MR9A 4BB9A 4CQLB 1ZR4A 3A4LA 3E4DA 5T6BA 4DLSA 5E1MA 3L8FA 3MTDA 4KYTA 4FEEA 5CT4A 3P1JA 1M7BA 2CBXA 2XRYA 4DJJA 4MB2A 1EMDA 1R5JA 3QVOA 4H7JA 1UPUA 3OZTA 1AU9A 4EG1A 1QFZA 1T0BA 3QITA 4EKIA 3HO1A 1JPUA 1LBIA 2JI8A 3GCWA 1S2LA 1YR7A 4RLSA 4S0XA 5IAKA 1M73E 2AN9A 5HZGA 1ZGHA 1NQTA 2RGBA 1VYTA 1XQYA 1DAGA 2FPWA 1FRNA 1Z0JA 2H57A 5LQAA 1KP9A 1W88B 4HO1X 3ZVMA 1SHLA 4PEVA 1HQCA 4UHFA 2NPFA 2PKEA 3ANNA 3D4PA 3DL4A 3KEQA 5DEOA 4DJDC 4N76A 1NURA 2AFHE 3SQWA 4YQZA 4HFRA 5FOUA 1ELOA 4YT5A 5A6SB 3OSZA 1M6VB 2EJBA 1SVIA 3EODA 4B83A 1ZUD1 2EZ8A 1OXKB 1WS6A 1ZC3A 5BURA 1U3VA 3ECCA 4DR5B 4GZLA 1PJZA 2ZJ5A 4MUMA 1GG2A 3RKUA 3A1VA 1CRQA 4POOA 4ZMRA 3ECAA 5TEVA 1FTWA 3CNEA 1BHQ1 3V8QA 4O2AA 4DQUA 3H5OA 5E0OA 4A6PA 2XMZA 2Q1XA 2X6TA 3FNGA 3OURA 4RVHA 1KOJA 3OJWA 3EEBA 1VDMA 4E09A 3JX9A 4EEKA 2DPHA 5FWDA 4R8SA 3KWMA 3SR3A 3V2GA 5EXSA 1NQ5A 3VI4B 1WVGA 3UC5A 4B3RB 5DNDA 4ZMBA 3P4UA 4TGLA 4N3GA 4QU8A 3A9UA 2R68A 1DAIA 3KDAA 1NTOA 3LOQA 2PO5A 3Q2OA 4BFUA 1VSBA 2OAGA 3GPIA 5F7OA 1CE8B 2C5BA 4QBGB 1MAUA 1Z47A 3IBYA 1RABA 2BY4A 2NXWA 3C3DA 3L7YA 1R37A 1DBPA 4ZT4A 1TTPB 2FUG6 2CNLA 3HADA 4L08A 5K3SA 5HM8A 4J2HA 2V5UA 4PZYA 1YBVA 1G66A 4K03A 3SR0A 1ZOOA 2HA0A 2JIZD 1G17A 4MYRA 2NU9A 1ZRHA 4GX0A 4QRHA 5E2BA 3RV4A 3ZDQA 1UFQA 4BB5A 4LNUB 1TK2A 3REQA 2ZWIA 3MJTA 3UAYA 4N8SA 2JHGA 5B6PA 1YB7A 2O7SA 2QVGA 3H1EA 4RPJA 2B3TA 4CLOB 3DCNA 3KKEA 3VPFA 1HNZB 9LDTA 3W8EA 2Z2ZA 1O8BA 3EOAI 4RK1A 4TQ9A 1MGPA 1UQRA 4V02A 2FWAA 4ZEMA 2X19A 4D5GA 2QD5A 3HMKA 3RVNA 4YYZA 2O5EA 3Q8MA 3M5PA 5IJ0B 3ZJUA 1ISGA 4NDAA 1CEEA 4HQRA 2Z1MA 3AB8A 3FYHA 2W6MA 4Z9BA 3ZWNA 2EZ9A 5CR9A 1DHTA 2BLNA 2ZBQA 1IH8A 2ZTHA 3R5HA 2XMPA 4ZRMA 2G1KA 3M8KA 1A95A 4K05A 4CR8A 3NATA 1LTHR 1OAOC 4PHFA 3QEAZ 3V55A 3JVUA 4S1WA 3C7DB 1E4VA 1NOKA 2CJWB 1SULA 1D7OA 2G4CA 5JZSA 1RAAA 3OU7A 2C2YA 1X14A 2MYPA 4CV3A 4QM7A 3VO1A 3HLKA 3SVLA 2RI0A 3GELA 5TMEA 3DAYA 3ABQB 3BM5A 5LQSA 1DQZA 1U6JA 4F4HA 4TRRA 1L7RA 1WHTB 5K0ZA 1HNXB 1G60A 3COZA 2Q4DA 4LDAA 1VJ1A 4OMDA 2PLFA 3PXGA 4RVSA 1CEYA 3ROEA 4UATA 2ZYGA 2A9QA 1PWHA 4D0GA 3GFQA 3JYOA 3P52A 3ZD9A 2HJ9A 2QSZA 2BDTA 3AM4A 1MRSA 2WDPA 2ZM6B 3G2KA 3WBBA 4EPXA 4E70A 4QLBA 3BULA 1RYMA 2G1UA 3BIOA 3URMA 2QYSA 3D3WA 3SY8A 1Z38A 1JQKA 5COBA 4MMXB 1C4OA 1GAJA 2R7LA 2ZKIA 4MLPA 3GDGA 3I34X 4OLHA 2Y05A 5EQDA 1VI6A 5T3UA 2PANA 1AS2A 3AF5A 4ID3A 1U2DC 1C3JA 4MI9A 5I7EA 1NSYA 1Q1AA 4MJLA 4BBPA 1AHIA 4X8MA 4PHCA 1HDGO 3DV9A 2GJ8A 4AIIA 1ACLA 1ZD2P 3FSEA 2IEDA 1L4LA 5LXTF 3EAQA 1PBTA 2ILTA 4XYMA 5DYTA 4JYZA 5BXQC 1BWQA 1J0DA 3KSRA 3I6QA 1OSNA 4RPCA 2NZYA 5AW8A 4RESA 1NW5A 3GRKA 1ZUNA 1GCGA 4IXMA 2CMKA 4W5HA 5CTJA 3R20A 4JIMA 4QBTA 4J4TA 5L3VA 2QZJA 3RYHB 1FX0B 4GMKA 2ONJA 2AC7A 3NHSA 4AJ9A 4EPWA 4XSHA 2WWWA 3BQ9A 3WISA 2EJVA 2H4HA 3JZAA 2ZDHA 4FI3F 3UWKA 4DM7A 2FSVA 3G2QA 5JAIA 3X2EA 1CSEE 3MINA 1OWLA 2CJXA 2I7DA 1LC0A 3FI0A 5A3QA 5BQPA 2JJ1D 4OIFA 1NMQA 3KKLA 4XWTA 1YOVA 1LS1A 4WESA 3ROMA 1UK9A 2DWCA 3B3AA 821PA 2BGUA 2C82A 1L8LA 1EFPA 2QR5A 3OKPA 4RPLA 5K5EA 1LNZA 3MMNA 4QTTB 4EQ6A 1J25A 4IICA 3MHTA 2V74B 3C1TA 4O6VA 3T7CA 4DLYA 2HHHB 1ETHA 2QTCA 3WKCA 3ZGLA 4UTNA 5DXFA 1WUHS 2C77A 2GR9A 2VDJA 3N53A 4K87A 2Y2UA 4LJYA 4Q3KA 5IH3A 1B2RA 1B8OA 2PRIA 4I8XA 4XRRA 1XRNA 4PXSA 3GDWA 1SWVA 3WXMA 1UKEA 3CVOA 1FNDA 4D4LA 1NMEA 1VYHA 3KZKA 3QMMA 5C7OO 3THYB 5E7QA 3M6FA 3TVYA 2JVJA 1SPBS 3GFRA 3HXQA 2FW9A 2FUNB 3DBHA 1H2FA 4Z4HA 3IAS1 1KJZA 3OZRA 5FEMA 4CI0B 1SVKA 3HKDA 1RM0A 2HTFA 4EELA 2O6LA 2B37A 3GLUA 4N18A 3E9ZA 1E8NA 2JIZA 2JS7A 4IGIA 2P6UA 4PHHA 4YAIA 3AG5A 4BXOB 1GAXA 5EVCA 3UPDA 4TL7A 1GUYA 1RD4A 4UPDA 5AUOB 5KQMA 2XQFA 2H5EA 3O8QB 4ONEA 1WV0A 4B46A 4J0DA 2O54A 1QV9A 1XAJA 1YZLA 4ARCA 1VPVA 2G06A 4TZKA 1E1MA 4YP6A 1YZGA 4JVOA 3TBHA 1M5TA 3TZ6A 4BVAA 1OV4A 3PDCA 1PNTA 1UZLA 3LD9A 4MQ6A 5KNDD 1DHRA 1HR0B 3RS4A 5I7HA 2W2LD 2NZUG 3OOYA 4GSKA 3ZLUA 5BN3B 4K6KA 4PRLA 5HKKD 3DNFA 1U98A 3ISTA 2VJLA 3ITNA 3AV3A 4QXQA 4WZBE 5FHQA 5KSOA 4IDQA 4EWLA 5F1KA 1GKIA 1TCUA 1SZJG 3KSDO 4K6FA 5JC1A 3ZDDA 3G2OA 1TEHA 3INNA 1QRTA 2B69A 4M98A 621PA 2JG3A 1SK9A 3KKNA 1OT5A 3KT0A 2MINB 3MS4A 4QD3A 4BEJA 4KB5A 3JAMA 6PFKA 1EHCA 1EXVA 1SKAA 1KTIA 1ZR2A 3ZHXA 4R40A 1DG1G 1JKIA 5TF0A 3BE5A 4KO2S 3BHMA 4CODB 1YD7A 1OXMA 4XUGB 4PCAA 5C1PA 1KE2A 4NAUA 2H85A 3WLAA 2C88A 3CJQA 2YDYA 2RK6A 2O8VA 4O1HA 2F4VB 1U8EA 1VE1A 3LCCA 4BMVA 1DIBA 1UBTS 2E4AA 5EWMB 2UUOA 1SGWA 5I9BA 3TW8A 1KI6A 1PLJA 4HN2A 3AHEA 1SUPA 2DY0A 2GCEA 3C48A 4Q3OA 4L27A 2HIGA 4GXQA 1USWA 4A1OA 3C5CA 3QK7A 4HZUB 2Z09A 3LP5A 3EWNA 4PZZA 3TFQA 1P1BA 2CKDA 5B12A 3AVUA 1M8PA 3P20A 4Y0NA 3RU2A 2JFXA 1YHNA 2EZ4A 4EMUA 4GRDA 3EQ7A 3BRCA 4GZ5A 4YX9A 1TM7E 4HP8A 4NJOA 3QPWA 3RQSA 3ZWCA 2E0IA 5G1OA 3ZY6A 2OFPA 3N74A 2Q28A 2ZI4A 3AHIA 1K5GA 4ZOCA 1ICEA 2ZPTX 5CB4F 1OV6A 1GPYA 2E82A 1NLMA 1OGYA 2I4TA 4I14A 3RVBA 3UV3A 4MB0A 1ZJYA 3BGWA 2Q4RA 4J9VA 1PCXA 3PNVA 5BNZA 3U4MA 3KQNA 5K0NA 1SJ9A 4LGYA 1E2PA 2HDOA 3P71T 4PXAA 4B4WA 4UMEA 4EJFA 3ICEA 3GGJA 4WN9A 1V5EA 3BICA 3G7UA 4EJSA 4A91A 1WZ2A 2HCJB 2XAAA 2F1HA 3FHLA 4OYRA 1X80B 3FTFA 1FSGA 5I6DA 4R7GA 4G5YA 2RAFA 2FHSA 3GJYA 2WWGA 1JEQB 1Y34E 3UAGA 3I2HA 1ADGA 5C1IA 2XVZA 1LF5A 2QX7A 1P7VA 1GUZA 1IXSB 3ELUA 1YI0A 1RRPA 4FHZA 5H83A 3WGJA 4E2YA 2JJ1A 3MVEA 4FZJA 1V9CA 5FPPA 3N0TA 1VCHA 1EH5A 3GBVA 3NUZA 4U2CA 5CVCA 5CW2A 1AHPA 1NBIA 5HIAA 3GIWA 3ON5A 1NLUA 1E7MA 4R1MA 4YJHA 1G291 4OUDB 3G85A 2ZZKA 3DSRA 1NUPA 4MEBA 1P7WA 3LIIA 2QNBA 4F5YA 1E6CA 2VUSA 1Y5IA 4MVJE 1P72A 2VXOA 2X3YA 3ZQ4A 3JYPA 1ZA2A 2OXFA 1XD9A 4PO1A 2AG0A 1C8KA 4ZVMA 4F4DA 4DUPA 3OOHA 2PA3A 1Y8QA 3KZXA 1X1AA 4UTZA 4I55F 5JJLA 1ZI8A 4B6PA 2DQZA 2OUIA 3Q0EA 4IRUB 5D1NA 3L4SO 4P34A 2ENWA 1A4RA 4B17A 2ZUWA 4ESHA 1PEAA 5K8TA 4MROA 3LZDA 2W22A 4N7JA 3E81A 4RHTA 3FMIA 4HWPA 3C4QA 4JBNA 2A5DA 1AGRA 3L6UA 2X15A 1C0KA 1LRLA 2VNKA 1BS1A 1ZH6A 1JLLA 5F5XA 4RADA 3W06A 3DMGA 4NZOA 4GM0A 5DZSA 2INGX 2I4RA 1GGMA 2V9ZA 4LTNA 2R6CA 4UHEA 4N40A 1RAFA 5A04A 3I1JA 4QUIA 2ZXEA 4CLDA 4X63A 5CIYA 2ECFA 1TKAA 3CE9A 1AG9A 2FR0A 2Q50A 3T9BA 1BAPA 2P67A 1XAIA 3EZNA 3GRYA 5DRYA 5EHGA 3TLGA 5KNDA 3ONVA 2F55A 2GQ0A 2W2LA 4KQGA 4TL9A 4OYHA 5BV8A 2J7PD 2Z3ZA 3JWPA 1JHMA 2HIHA 5HKKA 2BUAA 2OFXA 3TJRA 1H1DA 4BMCA 2JLVA 2OCDA 1QYIA 1O9BA 4RTQA 8OHMA 3P45A 4XJSA 4KPFC 3SDSA 1GPUA 4OPMA 4EAAA 2ORVA 1M6YA 1N2HA 4LDZA 5IM4A 3L7DA 2WVJA 4BP3A 2Q6IA 3K6JA 5TC4A 4DXAA 1UDWA 4G26A 4Q39A 4IOJA 5THKA 3LRXA 4U7WA 3TMYA 1QR6A 1U0LA 1W93A 2FW0A 3HJTA 4KE8A 5C8YF 5BQ3A 3GMSA 4RW0A 5K2MA 2FUG1 3ZY3A 3GZTB 4CMBA 3ZGVA 1QG0A 3EY9A 1RHKA 3OLZA 4LSWA 2WQZA 7REQB 3KPJA 2Q1SA 3KQQA 2HM7A 2UAGA 4NKRA 5J43A 2QD2A 4RIEA 2D7CA 4Z9YA 1OTHA 4RYDA 3K9FC 1UMDA 2HQOA 2OZEA 2VPXA 3D3NA 3L8DA 4S24A 3WHLA 3TEMA 1EUQA 1CUUA 4D9EA 3GNSA 3RVRA 4EA9A 5L3SB 4DMLA 3S4YA 4ILKA 3PNMA 3COWA 2NV2B 5EIAA 4EO9A 7ABPA 3UJDA 5JAZA 4FS3A 1NJ6A 1Z0ZA 4MNTA 1LDYA 4D79A 2AZ4A 1WHSA 3MFQA 4RZUA 2YRWA 4UCQA 5ALLA 5EGSA 2BKXA 4GM1A 2GVNA 3IHTA 1C30A 5CHEA 3SZMA 3AUAA 2XXJA 3ZWMA 1OLUB 1W4AA 1PIWA 1D2NA 3PE6A 4U2KA 4R3UC 2VSNA 3L0BA 4I1YA 1EB9A 5A7GA 3W9BA 1CDZA 4RVNA 1AIPA 2QXTA 3NORA 4I50A 4JI3B 2XH8A 3Q3JB 2A30A 2YC2C 4PN3A 1R4AA 2O8FB 1RADA 3ME5A 5JS6A 3K0KA 4BTLA 4W5WA 2ZVJA 1QMPA 1RQRA 4IVRA 4YDHB 4DA0A 1T5TA 5DVZA 2QR2A 1Z28A 2OBXA 2QN7A 3BMQB 3PHCA 2GGSA 3QFTA 3GCDA 4KK3A 5CNMA 2IZ1A 4I81A 5D5QA 1DWUA 5DNEA 2PU7A 4LWQA 4YXWD 1GT6A 2EFGA 5E9QA 2H4YA 4URYR 3M7IA 3T1VA 2QVLA 4I8IA 3M34A 1RQ2A 1JT9A 2ISCA 4LRUA 3ZWKA 2YJTD 3EF0A 3LPNA 4LX0A 5BMVF 3VC7A 3GRFA 1PBNA 5C7YA 5L4NA 2GCOB 2A14A 5JE8A 2GX6A 4O4LB 3ICOA 2EP7A 3I9MA 3D8RA 1A76A 4KO4S 2FCRA 1FSFA 2AXPA 4EARA 3BBLA 2IHVA 2K4MA 2JL1A 1E61A 4ZQIA 3VHXB 3HXMA 4O4JA 1ZIDA 4BAGA 4B7AA 2DH5A 4LFAB 5KDOA 4JSRA 4DG9A 1K6XA 3RJMA 1MC1A 3IFSA 2JZCA 3CH5A 1T4CA 5D7NA 3V2HA 4IX9A 3SPXA 3L5KA 2RJNA 4HC4A 4EITA 4CEIB 5M7EA 1YCHA 1XCGB 1CR4A 1NN5A 3QPCA 3SYTA 2A1TR 1P17A 1NVAA 1ZOSA 4LXIA 2BFPA 1IZ7A 1GRRA 1SAYA 2AW3A 2PKQP 1Q92A 1XZIA 3GQBB 3HO8A 3R3HA 4HAUA 4R54A 4FR2A 4Q37A 4RZIA 5DGIA 4AJLA 1OH5A 2FFHA 3FGOA 3ZWVA 2BGTA 4A2PA 5EZ6B 2C57A 2ZE7A 4G0XA 2O5RA 1PR4A 2XUDA 2BJVA 2F7SA 3H84A 5HA5A 3BL8A 4ZRNA 1WBBA 4B87A 2F4NA 4QX6A 4XM1A 1JDPA 4TM7A 5FNVA 5A7HA 1EVKA 4BU0A 4MVJI 5B2ZA 3VKFA 4BLSA 1MO4A 2AG1A 5TQ2A 1YJ5A 4Y2JA 4B7XA 4CU5A 2HXGA 3P4YA 3W5BA 1BEZA 4JU8A 4R1TA 5BUZA 2IXGA 3FTCA 3I4LA 3B1VA 4PGFA 4KFTA 2FA9A 5E95A 3KQSA 3GLHB 2OGZA 3LT0A 5KYWB 5EXTA 3SC2B 1ZH2A 2AKYA 1SUDA 2QLNA 2RHJA 3CUUA 3G5LA 3NM6B 3Q10A 4HHEA 4OXIA 5JFTA 5DBIA 3LECA 1KI8A 4PSDA 1DIHA 3WNZA 2XUPA 1G7TA 5DM1A 4J29A 3V6LA 2JKVA 1HQKA 4LGCA 1G5FA 5DHUA 3WJ1A 1JQBA 2J7PA 1QIIA 3PZBA 4AZ0B 1KOGA 1LBTA 1X1DA 3FVTA 2W6OA 4HGYA 4A0GA 1WVIA 3EIQA 4UARA 2OYRA 4CF4A 2BGGA 2P9TA 3JQBA 2WTBA 2HMTA 3IT2A 4EMBA 4WBNF 4MIYA 4ZDKA 1T8TA 4QHSA 4WXYB 3TQRA 4CU2A 4KEAA 3PPVA 1H69A 1OWPA 4CV0A 3OP1A 4Z0NA 4PO8A 1PP4A 4RHFA 1X92A 1UC8A 1PR2A 2YMQA 3BFXA 1ORWA 4RPIA 2FFAA 4A8PA 2VZLA 5T8KA 2IHBA 3BSFA 1MEOA 4OLFA 2A0XA 5C8VA 3H05A 3RIHA 4YRDA 4FEGA 3PRKE 4LZJA 3ETNA 5DLPA 3BWYA 3RK4A 1N77A 4GI3A 5LA6B 3FPLA 3OTHA 3M5CA 3A26A 4I0WB 5JZ9A 4CKWA 2FPOA 4NPHA 3WRXC 4L9RA 4ENSA 3O9VA 2BH2A 3PI7A 4I1IA 5ELMA 3A4TA 3KUKA 2B61A 2CHVA 1L7XA 2BI8A 2NUTB 3FOBA 1AQIA 1R3DA 3LOPA 2ZB2A 4J7XA 3RASA 2ZR0A 1WMAA 1AD2A 4DCSA 1AC5A 1FUEA 1JPJA 1UCFA 4MWSA 5BOSB 4LK3A 5HGXA 1HK7A 1FXWA 2GD2A 3ZD8A 3TTUA 4WTOA 3R5KA 4DABA 3U7FB 4QDUA 1U31A 2HRRA 4XIGS 1GNVA 3E7WA 4ZO4A 2PSDA 2P0YA 4O63O 1ISIA 3U16A 3QJGA 3Q72A 3P9ZA 4OQFA 4OXQA 4X24A 1AKNA 2EATA 2K87A 1J2UA 2H18A 1KMHB 1OHHD 4UXIA 3WB1A 1N1GA 3DCIA 2JC3A 3CW2A 1T9ZA 3JW8A 2Y1WA 3QPDA 3ABSB 2X0FA 1KMQA 3ANYB 3VR5H 3HWWA 3KOWA 3RFTA 2OZLB 3GHHA 4NZMA 5AOVA 4EJMA 4EW3A 5IRCD 1ENYA 1USKA 1YGYA 3FDIA 2R8BA 1AOXA 2H2DA 4B3GA 3AF1A 2XWPA 4A6XA 1IY2A 1FW8A 1GTL1 2MSWA 2QW8A 4MKHA 1EK2A 2EKQA 1KZ9A 1KJYA 2HPHA 4YXWA 1C1XB 3IUPA 5DASA 5LL6P 2WSLA 3GLRA 4BFXA 2UDPA 4CM5A 3Q6MA 1SXPA 2PL1A 3SHFA 4KLCA 2YV2A 1GQQA 1FXSA 4OK3A 2KQUA 1N8SA 4UUMA 5IXSA 4NV3A 3LQKA 4AMUA 5ALRA 4YJFA 4DVGA 1C4KA 3E61A 4M21A 4ZOQI 3UJPA 3W5AA 2NXCA 3JWEA 3IIJA 1O6BA 3G9QA 4BO3A 3C1UA 3OZCA 2OB1A 3UT5A 5E2AA 1U81A 4C07A 1JF8A 1KK2A 3HCNA 1C5KA 1H0KA 3K0FB 4FFDA 4JXKA 1GRVA 1O95C 1T6BY 5CHYA 2FSPA 3ZHUA 2VSYA 3D2BA 4F5WA 1E60A 2R7AA 3UYLA 3I52A 1JA1A 1H85A 3L7BA 2OXCA 3JARB 4XOIA 1RKUA 2IZZA 1VKNA 3WR5A 3RIXA 3HR8A 4B79A 4XGIA 1EX1A 1IDOA 3AEQA 3FRJA 3E8XA 5FLKA 2CXUA 3DMHA 3KZVA 4W9NC 3EBOA 2DETA 4XVHA 1Z0DA 3AO0B 3BIXA 4JT2A 4EQZA 4P53A 1WETA 1G2IA 4IMPA 4KQEA 4DQ0A 2R66A 3TQFA 1RJGA 3DT9A 3DXXA 1UXOA 2HHJA 4HAWA 4DRYA 1BQ3A 6ADHA 4MDEA 1E2BA 1GL7A 4OOEA 2HL6A 5JSKA 2PYDA 5ALTA 5FHRA 2YZKA 1UZAA 1AKUA 2VAPA 4FHFA 1BO6A 1Z2DA 1AHHA 2DPXA 2RJOA 3HXLA 1G55A 4XJVA 4A0FA 2QX9A 3D8NA 3PRJA 4OGFA 4QREA 5IYZB 1CUCA 1EK0A 2XCSB 5E3IA 2O8CB 3ROZA 3OLCX 4UM8B 4W6ZA 5F73A 4PBRA 2BGIA 1NDUA 4LYDA 1WKCA 4BGDA 2AYZA 1SHZA 3SQMA 1E94E 1TGYA 2ZJBA 3UK6A 5C8DA 2XWJI 2ANCA 2D8AA 3MC1A 4CFZA 1YA4A 3B1WA 3N8DA 1I36A 3ETDA 2J45A 2O5VA 3AESB 1T29A 4GOLD 2B5WA 2GAJA 3TOVA 1Z2NX 2CT8A 4W1RA 4MXDA 5FWXA 2MSLA 1K63A 3LO8A 1W8IA 3PLRA 5CFNA 3NGXA 2VF4X 4JOBA 4M49A 4JI1B 1N1DA 3H5LA 1F2UB 2ZUBA 2JLAA 2VRWA 3CUSA 2DFDA 4G9GA 4B6GA 3I4FA 2G72A 3DWEX 1KWGA 3WZLA 4KN9S 3AU8A 4MWTA 5TR9A 1QZUA 3KKMA 4RETA 5EHIA 1E2FA 1XDUA 3GUYA 3AR3A 1WG8A 3PFFA 4M1OA 4WLFA 5DM4A 2A2ZA 4CQMB 1E9CA 4BTVA 1N36B 1CLUA 1C2TA 1XHLA 3EA4A 3F90A 4ZO8A 6LDHA 4BWVA 3CLSD 5C7LO 1TTHA 1TLFA 5JEDA 2HAEA 1ES9A 2O0HA 2HLPA 5AI9A 1PNOA 3KJHA 1J2EA 3JPWA 1DC5A 1RM4A 2CXRA 1ECPA 1B8UA 2HF9A 4MQLA 3VH3A 4DQLA 1ZLYA 3AIMA 5A05A 1RXSA 2ID8A 1RWBA 3C4VA 3D6UA 3KQOA 1PFGA 5LZ9A 4NU0A 1TL7C 3EDCA 4V0MA 4AJOA 3M5DA 1WY5A 1XDSA 4XEHA 4JI5B 1YE5A 2WJ6A 4NP6A 5TX7A 4ENRA 1RPZA 2FPPB 2YJ5A 2ADFA 4XIYA 4I9FA 4TM8A 1MG0A 3TE7A 5JH7B 4LQCA 2AQKA 4DG5A 4LYGA 3IHKA 1YB4A 4CM4A 1JYFA 4GL2A 3MWFA 4C76A 4RK7A 3RTDA 4HN9A 3IRVA 3AV0B 2ZBVA 4NK4A 2ZT5A 4JLJA 4JSYA 1LS6A 1W29A 1RYNA 2VAXA 1QYRA 2NADA 2OK7A 4JEIA 1JQ5A 2LP4Y 1RCUA 1EE2A 1RP1A 2IP2A 4M8KA 4BPRA 2HJGA 2M1XA 1JV2B 2FFJA 5DSTA 4GOMD 1OHHA 5HF5A 4BEVA 4QZVA 1LNQA 4AECA 4ZHQA 3DG9A 1O97C 1W1WA 1Z8DA 2CYBA 4JI0B 4JL5A 4Y2UA 5IDQA 1FLDA 2ZIAA 1G8PA 1LK7A 1GEEA 1R4ZA 3O8CA 1AS3A 4KWIA 5AOBA 1WP9A 3KTAA 4P33A 5JJKA 2X2FA 2FWMX 4NBRA 3ESXA 5BWLA 3CU5A 1Z25A 4O5OA 5ERYA 1NVGA 3SSNA 4QPNA 2ECKA 1JRLA 2ZBFA 2ZSFA 1OH8A 1J8QA 4TUYA 2VKTA 1TYCA 3IQDB 1X0VA 4MI6A 2FZKA 1FFBA 2BTQB 1VDZA 3EVAA 5HJ7A 5LMUB 3AWDA 1GKLA 2DFTA 2R6GA 1M2KA 1LKZA 4X6LA 3A28A 4M0LA 2D6FA 3AJDA 1N7IA 2AN1A 3DR3A 5DSXA 1SCIA 1BXRA 2XUAA 3BFJA 4RD2A 1LDEA 1G8SA 1WDKA 1WZIA 2QMEA 3HTXA 1WIWA 4XGNA 2XOEA 221PA 2E4ZA 4JL6A 3A36A 2JLRA 1C4WA 3AG6A 2H59A 1QH1B 4M83A 1FFWA 4GC5A 4KMSA 4BJ1A 4HQ6A 3O0TA 4ZVOA 2QOEA 4YP5A 4K5QA 4AF7A 1XTPA 1I6WA 5MDHA 4PANA 2XCOA 3RUAA 4EY3A 3JRXA 2GM9A 4MR9B 2DFNA 2KB0A 1DRJA 1RQXA 4E88A 5TVKA 1HF3A 1TKCA 2J5XA 2V7BA 4AXBA 5I4IA 3R5TA 4ZOLF 5FYQA 1L1FA 3TRHA 2YR0A 1ICIA 4U4AA 1N78A 3RHSA 1EFVB 4TS1A 2VPYA 3AF3A 4UVGA 4ZC1A 2ZB4A 2D2FA 3FLEA 1G19A 3OCZA 5K9ZA 4IL5A 1BYUA 4UTPA 3VNBA 4BFLA 4ZCRA 2Q8QA 3UJCA 3O4FA 3HBMA 2ZTSA 4JYBA 1J70A 2FN8A 3PHJA 1YASA 1U9JA 3VR6D 5BR4A 1IPFA 2ZM5A 3TLMA 3KPVA 1DRKA 1N9GA 4IF6A 3LF2A 1NUAA 8ATCA 1O5OA 4MW0A 3M1YA 1D8TA 2Y27A 4F3KA 1W36B 2VYFA 1YSCA 2I91A 1NUHA 3KZNA 3NM4A 2GCNA 3CH6A 4HQNA 2JK0A 1PD0A 2WF6A 5CJ2A 4NV1A 3MWEB 4MAAA 5FLYA 1U28A 2XQJA 1V35A 3LRTA 5B5SA 4MJXA 3GUHA 3WFZA 3WGGA 2X13A 1K7XB 2HTEA 1PQWA 4QQNA 3AERB 1U0RA 3E18A 1IHDA 4UUOA 1EGHA 4RLFA 3HJAA 3RRXA 1B8PA 4ND1A 2EW8A 4N39A 3L8HA 3JATB 4QGGA 4HT3B 3RUPA 2VQFB 3RRNA 4L5CA 2EW2A 4MKXA 4W5QA 3DBLA 2GDZA 4FFOA 1B1CA 1BXZA 2W70A 1EINA 1E9SA 1OIWA 3ZKWA 5CLFA 1J07A 1V8DA 1IHOA 5EA2A 4W5RA 3NGMA 1WSAA 2QM8A 4D92A 1Z17A 3D43A 1DXQA 3ZHYA 1OXUA 2QVCA 3CSUA 1FBTA 1XRSB 3TAXA 3TNDA 3ZXYA 5KBYA 2JI7A 2NU9B 1JL3A 2AC4A 4H6XA 2PXHA 3B1XA 5JXHA 1U1CA 1AZWA 1LX7A 1UC9A 1CNFA 3QNUA 3HWRA 1DPFA 2VJYA 4KE9A 1PT8A 1HTBA 4BBAA 1YDWA 4CEJA 1U8CB 2QRKA 3LHFA 3MUEA 4B6EA 4OFWA 1EX9A 3PRYA 3USZA 1U0GA 3C3XA 4ZT3A 4GGPA 1DAPA 1UKCA 2F17A 1GNPA 2PSJA 2D59A 2Y1GA 2XUHA 3CZAA 3L05A 1DMRA 1M1NA 1N2CA 1LBSA 2XMQA 2WSMA 1ECBA 5CFQA 3OF2A 1LZKA 2GYWA 1Z5NA 2V6BA 1QP7A 3SHQA 5DMXA 5A3SA 4FFNA 3PDUA 4NCJA 3TAHA 4CTJA 1UAYA 2J0QA 1F48A 4FEYA 1S3IA 4BX8A 3L8GA 5EP2A 3C6ZA 3RS5A 1GOTA 3FE2A 2V7WA 2B25A 2BGNA 2P6OA 4XI9A 4AFNA 3KXDA 4BP1A 3B13B 1ZC4A 1V3VA 3IAHA 4WZAA 1LDMA 1BVRA 3L3BA 3S55A 3MWKA 2I76A 2YHSA 4D9GA 1N8TA 4IZ6A 4YV2A 3OIWA 4ED9A 2JARA 1DCMA 1DQRA 3LH5A 3TD2A 2WMDA 3K2EA 3PQFA 4KHZA 4CM6A 5B3JC 4YBZA 3EH1A 2WPNA 3OZFA 2AFRA 4IZHA 4TXHA 2OHXA 3P2MA 5CAEB 4LFCB 2UZ1A 4V0LA 3KQLA 4TSRA 3P9SA 4KWHA 1GUAA 4K9SA 1MEJA 4L9WA 2ACWA 3QKRA 2FMIA 3GLTA 4DMGA 2XBLA 1TCBA 2PUDA 4S1PA 2GASA 4J0EA 3WVNA 4EYSA 5EL0A 4MVWA 2IFTA 3W1VA 2BP7B 5ADUS 4JS0A 1GM5A 1MAHA 1EAMA 1T2AA 4DBVO 1L7VC 3NTUA 2C4WA 2KI5A 3GX1A 2BKLA 3DEZA 3LBNA 4IXNA 1EM6A 3S2SA 1GAEO 2A5YB 5EQJB 4QUDA 3D3WB 3QXXA 3QEKA 2UZ4A 1FS4A 2O20A 1TI7A 1NVVR 3PX3A 3UMFA 4C01A 5IS2A 4X7RA 3SEAA 3B70A 4H4CA 2ZDGA 3RGGA 1CF4A 4HD8A 1L2TA 4FIDA 3Q3IA 3HN7A 4IIJA 2DGDA 3MFYA 1AT1A 1OGIA 2FNAA 2P1DA 2PLNA 4PS0A 1XUOA 4Z3DA 3PJFA 4S1OA 4A0SA 4A9AA 5BSWA 2FHPA 4R8RA 2G6TA 1RWQA 4FHGA 1O4VA 3LT4A 4G65A 4IMJB 3O8OA 3X1XA 4YROA 1XD8A 2ZAIA 4G1MB 2ZUVA 1I24A 3K92A 1WKBA 4YUVA 3OA0A 5GWXA 1ZFNA 3IGFA 1NUUA 3Q7PA 4X1KB 4NECA 3RM3A 1NBHA 4NNPA 5HJ5A 2H0AA 3VR6A 1KS9A 1RXCA 1Y98A 2ZWVA 2ONCA 3TOCA 4KIWA 4RJLA 3KPUA 3FFWA 4RNCA 4E1VA 1J0CA 2GERA 3N87A 3AHFA 2GJ4A 3ZLTA 1NKVA 5DBFA 2E7ZA 3E7DA 1QUEA 3LDHA 4C0XA 1YOVB 2HV9A 4HYQA 2QUKA 2Q2NA 3VVBA 1UWKA 4Y2TA 1XLTA 2GJAA 2J0UA 2WHEA 2GTPA 2QPAA 3IPLA 3GR6A 4FDUA 3LSYA 5DHPA 3V7WA 3ADBA 3T4PA 4KZPA 1EFCA 1WPRA 4AX8A 5JD3A 2F2TA 1TZBA 1XCMA 4BNHA 2JLZA 4GLBA 3LWZA 4I3GA 3S5UA 1JI0A 3E84A 3QXCA 4HSEA 3JQFA 4LOKA 2ONZA 1IWPB 4B6OA 2Z3VA 5FPHA 3J80A 5JS2A 2OO7A 1VJGA 5AD1A 5HXAA 1KSHA 3OEYA 4LTMA 1XZEA 4CL0A 3C8UA 1NQVA 3NHUA 4PINA 2H1FA 3TZKA 1T0JB 3NIGB 2RB5A 3CONA 1L3IA 3MBKA 4P83A 3WGZA 1WW3A 5JNRA 4BTEA 1TUBA 1U5CA 2ZE6A 2HRDA 3MS2A 4NOLA 1NN1A 2DC1A 4LJRA 2DOKA 2PSHA 1ULTA 2QB5A 2QD1A 4PZ0A 3OZEA 3ADPA 3GAMA 4B80A 2YASA 3OBBA 4XB2A 2IS4A 4LY6A 1ZM3A 2H4ZA 2MYTA 2FQXA 3LWBA 1OI4A 1VXRA 1XTRA 1MIHA 3I9FA 1RYHA 3IMCA 2FB9A 3H4TA 1I9GA 4JROA 2WWXA 3WICA 4AICA 5K8VA 2A86A 1N5RA 4GHWA 4GNKA 1B0PA 4U39A 3UH1A 3VR1A 4YRLA 5FV7A 2OGUA 4LAFA 1KJIA 1AO0A 1D7AA 3J81A 3FA2A 1UBOS 2IRWA 1RXYA 4XA8A 4LUCA 2RBGA 5D87A 3DXFA 4PG5A 4AM8A 5C8XA 3EC2A 4C2TA 4BRZA 3U37A 2B99A 4M1ZA 1GUDA 3IQEA 3PEEA 3ZLBA 4ENUA 5H1YA 3AZPA 1MMFB 4C89A 2RC6A 1UF9A 5K3OA 4I1RA 2IV2X 2Q3JA 1ZYUA 1FZQA 4E21A 3M6UA 2PV7A 1YCFA 1X7YA 3F8SA 3K9QO 1KO8A 4AMBA 4DADA 4WEQA 2ZOSA 4LK2A 4U9UA 5AIAA 4ER7A 1DGQA 3QVMA 4JI4B 3DVQX 3MJRA 1IEVA 2QSYA 3UXYA 2XUIA 1AY0A 4B85A 1RC8A 2DUWA 2XTMA 3HCEA 4OTZA 1R6DA 3JWHA 1DUIA 1PX0A 1JTVA 5JQGF 1R0CA 1JLSA 4Y9TA 3TAUA 3HXTA 4NABA 2JIOA 3L0SA 1J8VA 4I99A 2VDKB 2AVNA 1Q6ZA 2HSJA 3TM5A 5IN5A 4E5NA 5CBPA 2C5HA 3D7NA 1KK0A 2H1LA 2J9GA 2WUFA 3BL5A 4X8OA 3ZDEA 2WG0A 1VMKA 1XQ6A 1P3JA 1QB8A 3QGMA 3OESA 1E5TA 4RENA 3OZ7A 2GEKA 2C9ZA 4TMTA 3TW8B 1KI6B 5A0TA 3ENKA 1A82A 1LA2A 1YK1A 4ZQHA 3ZIUA 2OECA 1TYEB 3C74A 1QQAA 2OVFA 5B4TA 1H6CA 2X2EA 3IQFA 3Q12A 4MYCA 4O0MA 5GV8A 5K51A 3B53X 5CYGA 2WU1A 5B1DA 3NEJA 2X9LA 2AN3A 2NACA 4DNXA 1Z5VA 1HZZA 3WWEA 3F4KA 4QPDA 2Q29A 4NXNB 3UMBA 4PGHA 1TRHA 1C0PA 2HBYA 4JJZA 4AU1A 3G9ZA 5LJLA 4IJVA 5JCXA 2C83A 2PUHA 5E7IA 1Q2UA 3D4NA 2C7BA 4DLXA 2JHPA 5BNWA 5BVHA 1PDOA 1WDWB 1W75A 5LP6A 5IF9A 1Z7WA 2WICA 5ECWA 1E89A 2AJCA 2FR1A 3DDZX 1Z6GA 2I3GA 3OX2A 2PWZA 1NPTO 5TARA 1W25A 2X4LA 3LRPA 5JZOA 2F67A 1RLOA 2AKEA 5IH7A 4YGYA 3W6OA 1ODSA 4WN9B 5JAUA 2HCTA 1CF2O 3GJ4A 4XWYA 1N2ZA 1G59A 4AJ2A 3HP1A 4HX9A 4KGZA 3BIFA 3NNNA 3BB1A 2XGSA 4HWKA 2QQ5A 3ER6A 2CLOB 1NYLA 5PGMA 4ABTA 4BWFB 3W2IA 3G5TA 5JASA 1UFOA 4YP1A 5FBKA 3CVWA 2VDOB 1I5RA 1CV2A 3E35A 1P74A 4K2AA 1JHUA 3P32A 3STXA 3UB4A 3MPOA 4YCLA 1EZZA 2DQYA 4PG6A 1I14A 5I01A 4KRFA 5GV7A 3V8VA 1FB5A 3KFVA 4M36A 4TKLA 4KSBA 4ZQBA 5ALUA 1I30A 1W5FA 2Y76A 1CUYA 1E1KA 3QVTA 2JHFA 2NQ8A 5ALOA 5FAXA 3RJTA 3VSCA 3ZW9A 4CKBB 4YJHB 1WZCA 2HPZA 1FYFA 2RH5A 4RK0A 1T0IA 1TK9A 2OT3B 1DDGA 3WY9A 1BFUA 4FCWA 2AK3A 4K9DA 5EIHA 5HCNA 3HGTA 4V0RA 3GJ5A 4TOIA 2CVZA 1Y8QB 3NGLA 4Q1CA 5KPDA 4JB0A 1B76A 2WK1A 1GPH1 1BXGA 3FPEA 1AX9A 3HYNA 2BW0A 4TKZA 1OX4A 5B1HA 5SY6A 2QLFA 1E0AA 3BWCA 3FCXA 4E7PA 2XEXA 3D3KA 4WX2B 1WUTA 2QKYA 4BEBA 4RZSA 1RKBA 4UDNA 2DULA 4NJMA 1WUKS 4YRQA 5EESA 3N2GB 3F6CA 1IIBA 1OAKA 3UW1A 1EHIA 3JARA 1N9ZA 4RU1A 1JLLB 3OOWA 1I51A 3T8YA 4C5BA 5DBHX 1SUWA 3T0GA 3Q1KA 5FBHA 3UK1A 3AUXA 4MW7A 4EABA 3S2UA 4O4IF 3ITEA 3NTQA 3L7JA 3I2GA 3QFSA 3ZXIA 4DDVA 3D1JA 1WXIA 2A9FA 3H9QA 4CKYA 5IFLA 1YVDA 2ZULA 1VKJA 3T3NA 3IHWA 3TLGB 4FZRA 4HYEA 3VR3D 4ZVKA 2OBYA 4E5DA 5T4EA 1CLEA 1HT0A 3RAJA 4BQRA 2SKEA 3FHCB 3W5HA 1H2WA 2EZTA 4CKEA 3EXEA 4CIXA 3BXFA 3JU3A 1YU9A 1WTAA 3EZLA 1N9KA 3HCCA 1JT2A 4D9KA 1JFRA 4R0NA 4RKQA 2J4FA 5G40A 2DEUA 4UMFA 5SYAA 5BT8A 5HIJA 4X64B 3QWBA 3V97A 3WG9A 4RCYA 4LJSA 3A31A 3UF0A 2ZUSA 4J0KA 4QBKA 2UXCB 1JS1X 4DARA 5JCJD 4G0WA 1T8YA 2C97A 1MQ9A 4IKOA 4OBWA 1XNGA 1YT5A 3DE0X 1FYDA