3DQZA

Structure of the hydroxynitrile lyase from arabidopsis thaliana
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
256
structure length
256
Chain Sequence
RKHHFVLVHNAYHGAWIWYKLKPLLESAGHRVTAVELAASGIDPRPIQAVETVDEYSKPLIETLKSLPENEEVILVGFSFGGINIALAADIFPAKIKVLVFLNAFLPDTTHVPSHVLDKYMEMPGGLGDCEFSSHETRNGTMSLLKMGPKFMKARLYQNCPIEDYELAKMLHRQGSFFTEDLSKKEKFSEEGYGSVQRVYVMSSEDKAIPCDFIRWMIDNFNVSKVYEIDGGDHMVMLSKPQKLFDSLSAIATDYM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydroxynitrile lyases with alpha / beta-hydrolase fold: two enzymes with almost identical 3D structures but opposite enantioselectivities and different reaction mechanisms
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Lyase
molecule keywords Alpha-hydroxynitrile lyase-like protein
total genus 90
structure length 256
sequence length 256
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.10: (R)-mandelonitrile lyase.
pdb deposition date 2008-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3dqzA00
7YASA 2XUAA 4WFIA 3NGMA 1L7AA 3D2CA 4L3WA 2ROQA 5ALZA 5JIBA 3C43A 1GPNA 5A2GA 1XRLA 3WWPA 1SOMA 3KDAA 4C88A 4H7DA 4RE5A 3WJ1A 5T4HA 1XRMA 4DNFA 2ONCA 1NX9A 1AURA 4KJXA 1XZGA 2PPLA 3G9UA 1BCRA 2XLCA 1KEZA 2PSHA 2XMZA 3MUOA 3R40A 2BGRA 5AOBA 1QIKA 5AM0A 1RP1A 1K63A 4Y2UA 5CH8A 5K3BA 2PU5A 1R50A 5DYTA 5YASA 3ZV7A 1LBSA 4WJLA 2ZYHA 3V1LA 5K3CA 1YAJA 2CZQA 4UBLA 3C87A 3STWA 4X6XA 2CUTA 4JNCA 1UK7A 5ALVA 4ITVA 5H3HA 3PICA 1BE0A 1TK3A 4QWMA 3D59A 4BDSA 3WQHA 4FDMA 1FFEA 1HPLA 4AN0A 1E8NA 5HK9A 4OB6A 3W05A 1RWQA 3RKSA 3QMMA 3WKBA 3C8DA 4H7EA 4BDTA 4J0HA 3M83A 3SK0A 4QA9A 4ETWA 1MN6A 2ZSIA 4EBBA 2OGSA 4FMPA 1SFRA 4B9AA 5IVDA 1F0PA 2QKYA 3K6KA 4V2IA 3FVRA 3KWFA 3ED1A 5I8PA 5ALRA 2PL5A 5AKYA 3ANSA 3C6XA 3ESCA 3W2TA 5D7BA 1Q83A 1NU6A 1QO9A 3VJLA 1H2XA 5IVIA 3R3UA 1EXWA 5I7UA 3NWOA 4N5HX 2FX5A 2WUFA 2XQFA 4FOLA 2PX6A 4UHFA 4UBKA 1AUOA 5AM2A 1PV1A 4X90A 1Q0ZA 3SWWA 2HU8A 1U65A 1GXSA 5FP0A 3SX4A 2HA0A 1N8SA 3DYIA 1F6WA 2OAGA 2XUGA 2WLSA 4UBOA 3BL8A 1VZ2A 3G0IA 4BVKA 4UFNA 3OM8A 1AX9A 2H7YA 4Y2PA 3AIMA 2PM8A 4ROTA 1XZBA 5LIPA 2QR5A 3QPCA 2BUAA 2X5XA 5EHZA 4BZWA 3HACA 5FRDA 4X93A 1MX5A 3CN9A 4NVRA 1MT3A 5AHXA 4C01A 1TAHA 3IDAA 4H7HA 5HF5A 3FYTA 4AZ3A 2VAVA 3H18A 4HXGA 4N5IX 1W75A 4G4IA 5JADA 5HK8A 5A71A 5BWBA 3G7NA 2XUPA 1VOTA 5A7HA 1MO2A 2OCLA 1E8DA 2OCKA 3TEJA 4G5XA 4ZI5A 4IH1A 3V1MA 5AM1A 5E4YA 1K6EA 5JD5A 4G9GA 3DKRA 2WHRA 4OCZA 3FSGD 4UHDA 2GBIA 2ORYA 1G66A 4HAIA 3I2IA 3ZPXA 5JYCA 1J06A 3C6ZA 4AMYA 2H7XA 4C4YA 3D4LA 4B83A 3H2HA 1L7QA 2HA2A 1CUJA 1EI9A 4B85A 1CUIA 2QZPA 5E4JA 5AM3A 3WIBA 4OPMA 1GT6A 5D6OA 1X70A 3GFFA 1E66A 5ALPA 4LYEA 2OCGA 4GHWA 5A6VA 5SYNA 2ZSHA 1N5MA 2XUFA 4HRXA 4Q3OA 1EHYA 2HM7A 2I3ZA 4G8CA 4Q05A 2HA5A 3IUQA 2O7VA 2W6CX 3W04A 5D3ZA 4DM7A 2RONA 4I19A 4LHEA 4NZZA 4K6HA 2Y6UA 1ZJ5A 1GQSA 1QIIA 1FFCA 4K2AA 5AI0A 2ACEA 1OILA 2QOEA 4FBMA 3C8HA 3K9BA 1ISPA 5JZSA 3WJ2A 4AQDA 3FSGA 3H17A 1AMNA 1WPXA 3CCBA 4MWSA 2Z8XA 5CURA 2GBGA 1CUZA 4QZVA 1CFJA 4OSEA 1KU6A 1MPXA 5HZGA 3IUJA 1S8OA 3IB3A 1DX6A 5A7GA 1W52X 3R0VA 3QH4A 4L0CA 2HA6A 2VEOA 3QBJA 1QO7A 3TRDA 1LPOA 5JAPA 5BWCA 3RLIA 4HTAA 1CQZA 2V97A 4YK7A 2WIGA 4F0JA 2BKLA 3QZUA 2DHEA 2RGUA 3IBTA 1AC5A 5T4EA 2OGTA 2XQKA 4UBMA 3WK5A 4B81A 1HBJA 1AKNA 2QM0A 3WIOA 4W9RA 2XMDA 3JWEA 2H7CA 4KEAA 3QMVA 5DNUA 3WK9A 1O6FA 2DHCA 4BVLA 4Y2RA 4EB0A 1MNAA 3AZOA 5AI6A 3OC0A 1CUFA 1QONA 4BTLA 4KE8A 2PSDA 4KYVA 1Q0RA 3IVMA 1DQYA 5DJ5A 2H1IA 5CH3A 4PSCA 2R8BA 5JANA 2XMQA 4ZV7A 5JAUA 1JKMA 4DGQA 4UHEA 1CVLA 4XWGA 4PV7A 4KAAA 1LZLA 3D2BA 1WCYA 1QIEA 3BXPA 5JZ9A 1EDDA 4LYDA 2VT6A 3DD5A 3I2JA 3WWOA 3FYUB 1UK9A 4AN1A 1QIFA 4MJ3A 1ORVA 3QITA 4LXGA 1YR2A 3WL8A 4BCDA 2ZVDA 1MAHA 4G4GA 3FCXA 2PSEA 1WHTA 4U2CA 3DS8A 3I2HA 4BTVA 3I28A 2RIPA 3VKFA 4DSZA 3AJAA 5ALWA 2VJDA 3BWXA 4TGLA 4AO6A 4FHZA 5AKLA 2XMRA 4DNOA 3D3NA 1F8UA 2ZYSA 1JI3A 1IUNA 2B20A 3L1HA 4Y7DA 1EB8A 4HZGA 1IMJA 1HL7A 4X6YA 2AXEA 2O2IA 2C4HA 3BF8A 2WTNA 4U2DA 2DQZA 4CG3A 3WL7A 4FLFA 2PUHA 5JAOA 3I1IA 3L1JA 4WDRA 3GUUA 5EFZA 2D5LA 4X94A 4B7ZA 2XMBA 1XRRA 4U2BA 4X91A 4Y2YA 5LKAA 5FPQA 5JD6A 2AJCA 2PVSA 4NS4A 4H77A 2YXPX 1LPMA 1E5TA 3M81A 1LLFA 5ALQA 3E1GA 4F60A 1UKCA 5ALDA 3UUEA 1CUUA 4LIPD 3PE6A 2QVBA 1MJ5A 4XJVA 1G5FA 4MEBA 4B9EA 4FWBA 4Q1VA 4BP9A 5LZ5A 3BDVA 3O4HA 4E46A 3GA7A 3H19A 2E3JA 1ZICA 1E3QA 4INZA 4X3CA 4BCCA 2CMFA 1QJ4A 2Z8ZA 3H2JA 1P0QA 4J0CA 5AI8A 4ARBA 5LZ4A 2LIPA 4WY8A 5EHXA 3WA6A 1DX4A 1CRLA 1UOPA 1VXOA 3R3VA 4BYMA 4GI1A 5HFAA 3S8YA 2JF0A 2CJPA 3HSSA 4QDZA 5ALUA 4EZIA 5AKHA 3C6BA 1CV2A 4OYLA 2WIJA 4GWLA 1SC9A 3QPAA 1EVQA 1XZIA 2YH2A 1GKLA 3FCYA 2GZRA 2PBLA 5CXUA 4AO8A 2EDAA 4EUSA 4BRSA 2PUJA 5ESRA 3MUNA 1EX9A 1AGYA 5T4FA 3DCNA 5K3EA 2Y6VA 5DNVA 1UK8A 4A5SA 4JEIA 4C4XA 4IH4A 2H9YA 3KWJA 5ALNA 3A2MA 2OG1A 4K5QA 5AI4A 1XLWA 4ZREA 1CUCA 4GLBA 3IURA 2YYSA 4LKOA 4PF1A 5DLPA 4PW0A 1UWCA 3R3WA 1MX9A 1XZFA 3IIIA 1JFRA 3O4IA 2XUOA 3D2AA 1IZ8A 3AIKA 5FOQA 3CXUA 4YPVA 1XZMA 4GEGA 3CCCA 4Q34A 1BRTA 2JEYA 3W06A 5C8ZA 5AK3A 3WA7A 3M3DA 1JJBA 3AZQA 1ZD2P 3NOXA 2ES4A 5F4ZA 2HFJA 4QNNA 1KU0A 5ALLA 4J0IA 4W1QA 4CG2A 3DEAA 2DCMA 2I78A 4QLOA 3PF9A 4EY6A 2CKMA 3ZLUA 1FFBA 3AIOA 1EINA 1FJ2A 2I3DA 3BE8A 4DMKA 2XDWA 1YAHA 1L7RA 5A7FA 4N8DA 3DLTA 1H2YA 5AO9A 3FOBA 4Z49A 2HL6A 5LKRA 1UOOA 4A16A 4G8DA 1CEXA 1ZI6A 5LZ9A 1DQZA 4PSUA 2BJHA 3VVLA 1H22A 1WPRA 3C70A 5EHQA 3WZMA 2X76A 1U4NA 2XE4A 4W1SA 3W9UA 4DTCA 3E4DA 2QRUA 5CT5A 3HEAA 4IH9A 4K6GA 1ZGCA 1N5RA 2QJWA 1EVEA 4U2FA 5FV4A 4BP8A 4X97A 1IZ7A 1E89A 6YASA 2DFPA 1MX1A 1ZIYA 3O95A 1EK1A 5CW2A 1X2BA 5EIAA 4TVKA 2PSFA 4M0FA 2XUKA 4KRXA 4CIBA 1ZIXA 2JGEA 3HRHA 3B3QA 3S2ZA 4AZ0A 3G9XA 4MEAA 3WKAA 2G5PA 2HU5A 5BOVA 4B0OA 1JMKC 2OQVA 4UBIA 4AO7A 3H1AA 3DL7A 4DNPA 4L72A 2ZJ6A 4DMFA 5EIEA 2BCEA 4CIAA 2XUHA 4RGYA 1GGVA 2G5TA 3PF8A 3DL4A 2VF2A 1TKRA 1ZJ4A 2DQYA 4FFWA 1UKBA 2WG1A 5FUMA 2BAGA 3AUKA 1MTZA 4EHBA 4I4CA 1EDBA 4XIIA 5JD4A 2D0DA 1U2EA 2WFZA 3N0TA 5AK6A 1MNQA 5IVKA 3QVMA 3I2KA 4QEKA 4GECA 4BC0A 3L1IA 3FVTA 1CUBA 4LXIA 3G8YA 3VVMA 4ZV9A 1H2ZA 1Y37A 2WUEA 2V98A 1XQVA 2QTBA 2GYWA 1CPYA 2HHAA 2WFLA 1DT5A 1CUAA 3JW8A 1VE6A 5FKJA 1J2EA 1FFAA 1X2EA 3G0GA 1BROA 1TIBA 4OUKX 1LZKA 4MYDA 2WHPB 2WU3A 1VA4A 1DU4A 1XRPA 3RK4A 2R11A 1EB9A 3IA2A 3R3ZA 1ZOIA 2J4CA 5HKAA 3HC7A 1XZHA 4C4ZA 1LBTA 1K4YA 2JBWA 4X00A 2HA7A 5ALSA 4H0CA 2XI4A 2WJ6A 4KE9A 5C8VA 5D3KA 2Q0XA 2C5FA 5HQ3B 5AH0A 2XT0A 5AOCA 4N8EA 5JZBA 1IUOA 4ARAA 1P0IA 1O6GA 5LZ8A 5ALJA 1R1DA 2HDWA 5KWIA 5AKIA 1BN6A 5AI5A 4QDUA 3GROA 1EDEA 5DTIA 1YS2X 4I3FA 4UBJA 4X85A 1USWA 1WHSA 1HDEA 1MAAA 1EK2A 1EH5A 2WIDA 5ALYA 3H2GA 2PKYX 2WM2A 4JUIA 2ZYRA 4ZWNA 2ACKA 1CUGA 1GZ7A 3V1NA 3G0DA 4BCBA 2W22A 4B82A 4W1RA 3EQ8A 4ZXFA 4CCYB 2J3DA 4QDXA 5EGNA 1CUHA 1ZGBA 1JT2A 1ZI9A 5HF8A 3V9AA 3FYUC 1W6RA 1W1IA 2AJLI 4Y2TA 1QIJA 5CBKA 3TGLA 4QWWA 4HXEB 3H2IA 5CT6A 4E15A 1Y7IA 3VISA 5AJHA 1UKAA 1UZAA 5K3FA 4YX9A 2XB6A 4W1PA 5ALKA 4CCWA 2QMQA 1TCBA 3STUA 1CUWA 5FPPA 1CQWA 2CBGA 4FKBA 1E8MA 2GYUA 4P93A 1HKHA 3TJMA 4B80A 1C4XA 3STTA 1XLUA 4EA6A 4Y2QA 5HF9A 2DHDA 3RARA 1CUEA 1QGED 4KAJA 2NW6A 3KD2A 4P08A 3WKEA 1P0PA 4RE6A 2B61A 1CIJA 3HI4A 3IULA 2OPHA 3BJRA 1F0NA 2WUGA 3WMRA 3WK7A 1UFOA 3LS2A 4G9EA 1T2NA 1XRNA 4MYSA 5IVHA 4GBGA 2OQIA 4UFPA 1QIHA 3R3XA 1R9NA 3OPMA 4BAGA 4H7KA 1VE7A 4FBLA 4E11A 4UHCA 4KAFA 3QM1A 4X7BA 3WZLA 5T4BA 1H23A 3QMWA 4J0JA 1DWPA 4KACA 3STVA 3PUIA 1P0MA 3B5EA 1WB4A 2WG2A 4OD0A 3D5EA 1UOQA 3I1YA 2WHPA 2J4FA 2G4LA 2DR0A 4TPKA 4RPCA 3HABA 2B9VA 3D0KA 4IO0A 5DWDA 3P2MA 4NMWA 4WY5A 2OXEA 1IVYA 1QFMA 2JGLA 1GPLA 5CRIA 5FDFA 4MQLA 1TCAA 3G9TA 1YASA 2RI6A 4DMHA 1QTIA 1QIDA 1GKKA 5JAHA 3ZLTA 1CUYA 2XQJA 1WB6A 4OYYA 2JGFA 5AK4A 4Y2XA 3FLAA 3F8SA 4JH0A 1DT3A 2CB9A 4HRYA 3OG9A 2XUQA 3F96A 1MU0A 1NU8A 2QXTA 4HXFB 1N1MA 3DOIA 3EF3A 2VAXA 2GBFA 5ALXA 5DYYA 2Y2VA 3PI6A 3A2LA 3KXPA 3I2FA 5AP9A 2O2HA 2HU7A 3BIXA 2J3QA 4B6GA 1ZI8A 3WYDA 4QDTA 3AILA 4M0MA 1QOZA 3WWEA 3WL6A 3AINA 5A62A 1XZCA 2OLEA 3C5WP 5DYWA 5AKGA 2VTVA 4BE9A 1A8SA 1ETHA 3O9VA 2V96A 1BN7A 4KR0A 3AZPA 3EQ7A 3R3YA 2PSJA 1QIGA 4UBNA 5ALMA 3F97A 3MGAA 3LP5A 3PFCA 3WWDA 1ODTC 5ALHA 4P9NA 3WLAA 5ALGA 2C58A 1B41A 5DNWA 4DMCA 1SCIA 3FYUA 3BJMA 4X71A 5LYYA 3ESAA 2WQZA 3WKCA 2FUKA 2PU7A 3ANTA 1DWOA 4OU4A 1UK6A 3B12A 5DTJA 5FLKA 4FLMA 2JEZA 3A2NA 4MQMA 3C6YA 3ICWA 1SCQA 5ALFA 4AXBA 2BUCA 3WK6A 1Z68A 3GELA 3ESDA 1WOMA 3H0CA 5EI5A 1JJIA 1THGA 4A23A 2VATA 1XQXA 5IH7A 4H7FA 1XLVA 3A70A 1AQLA 2JGKA 1XZAA 4EY7A 3UUFA 5AI9A 5AIAA 3F98A 4MWTA 3LCRA 2EEPA 1VZ3A 2I03A 2QS9A 5AICA 5LZ2A 2O2GA 3CN7A 4U2GA 1R9MA 3U0VA 2VJBA 1VA5A 1XQYA 5JARA 1YSCA 5HFNA 3AFIA 1C7JA 1CLEA 4BAZA 4BZZA 2IX9A 1UXOA 5JALA 3WL5A 3EBLA 4PSDA 5HKBA 4C87A 2ZJ7A 4WFJA 2IIVA 3EIOA 4HVTA 3W9BA 2XUIA 2QT9A 4Q3KA 2BGNA 2VQ6A 1H2WA 2FJ0A 3FLEA 2GYVA 5EIHA 1DINA 1JU4A 1YB7A 1U8EA 4U2EA 2QUAA 5JASA 3Q0TA 5C8XA 1RYYA 2XMCA 4CCYA 1HQDA 1J07A 2RHWA 3DOHA 1XKLA 2B4KA 2WUDA 1QE3A 3ZI7A 2HA4A 4GXNA 1GQRA 1FSSA 4LXHA 1JU3A 3G02A 1ZD5A 5HQ3A 4DLNA 2WG0A 2XMSA 1BU8A 3HLKA 4BBZA 2C5GA 1LPAB 1C7IA 3OOSA 5K3FB 3WK4A 4DSAA 5JATA 4J0KA 4BC1A 1DWQA 4BE4A 3STYA 4J3JA 1LPPA 2AJDA 1THTA 4X6UA 1YB6A 1BCSA 5E4TA 1A8UA 3DKKA 1G4HA 4WDQA 4BAUA 1YA8A 2ZYIA 1XZEA 1LPNA 3WI7A 5E2IA 2WIFA 1B6GA 2XMGA 5AM5A 3K2IA 2EDCA 3QYJA 2XUJA 1VXRA 2JGMA 4FTWA 3R41A 1LPSA 5ALIA 5AM4A 3EQ9A 1TQHA 3LIIA 3DJYA 1FFDA 1OCEA 4KE6A 5AIBA 1BEEA 4CI9A 2RHTA 1R4ZA 4J0DA 5I9IA 1XZDA 3O9MA 2ZJFA 4F21A 2X8BA 5AKXA 1WB5A 2JIDA 4BRZA 1HLGA 3G0BA 2WU4A 4WCVA 2XQGA 4FNMA 4ZGBA 3BIWA 3PUHA 1PJAA 3O4GA 5AKEA 1T4MA 1XZJA 5HCUA 5ALEA 4YASA 5LP1A 1CUVA 4P92A 5EHNA 1ZD3A 1R3DA 2WKWA 2HRRA 4Y9SA 2Z5GA 4QE3A 2VA9A 1A7UA 1A8QA 3H1BA 3VDXA 1Q84A 1TRHA 1GPKA 5AKJA 3C5VA 4JYMA 4DNQA 4B0PA 5C81A 3G0CA 3SC2A 1TCCA 3WYNA 3KOOA 4X92A 2G63A 5KBYA 4BVJA 4CG1A 3O4JA 3ILSA 2XQIA 5LZ7A 1XKTA 3OURA 2Y1KA 1JMYA 1XZKA 3NUZA 2WTMA 3U1TA 3MVEA 3PFBA 1VJ5A 1XRQA 2WFLB 4H7IA 1QIMA 2AJBA 1XFDA 5CT9A 5J3JA 2V9ZA 2IITA 4IHAA 3ZWQA 3ZLVA 4K6KA 4AMZA 2HIHA 2P8SA 3FLBA 3VJKA 4EY8A 2Z3WA 1ORWA 4EY5A 3LLCA 4RNCA 3H2KA 1ZD4A 3N2ZB 4GDMA 3WK8A 1QLWA 1ACJA 3E3AA 4UHBA 5LLSA 1WM1A 2HRQA 3I6ZA 4JYPA 5CMLA 2ECFA 2XLBA 4WFKA 4DYHA 4PO3X 2VJCA 2WFMA 1BS9A 2GBCA 3JYHA 2XUDA 2DSNA 3GBSA 4J7AA 5AK5A 5KWJA 2GZSA 3WKDA 4BATA 4PNZA 4ZRDA 2C0PA 1W4LA 3C45A 1JJFA 3F67A 2VSQA 5AKKA 3BDIA 3DNMA 2CEKA 4AB1A 4UUQA 4XVCA 1ACLA 1A88A 1K5PA 2JGIA 3FWHA 4N8SA 4C89A 3RM3A 4Y2JA 4B84A 3HYSA 4G4JA 2QXUA 1J1IA 1SCKA 3O0DA 4OU5A 3ESBA 1YA4A 3Q8WA 5KREA 4MXDA 5AKZA 1LNSA 3FAKA 4Q3LA 2FJPA 2JGJA 1OXMA 4H35A 1VLQA 4G8BA 5K3AA 5ALTA 1DTEA 3X3HA 4J03A 1XQWA 4PQEA 3T4UA 2WHQA 3A6ZA 1UT6A 1EA5A 1CUXA 2WILA 2YASA 1YCDA 2OAEA 3UMJA 2C0QA 4FNGA 1K8QA 3HXKA 4UFOA 3FNBA 3D7RA 5CTAA 3LIPA 4OB8A 2OGZA 1LPBB 2OCIA 1BEZA 2QJRA 2HA3A 2RAUA 3YASA 4G1FA 1ODCA 3GZJA 4KE7A 3V48A 4UPDA 2QUBA 5ISMA 4UHHA 4CFSA 3PDCA 5CT4A 2BUBA 4FLEA 4Y2SA 3G9ZA 1W76A 2HADA 2WJ4A 3VXKA 3F9CA 2WJ3A 3DQZA 5K5EA 5HF6A 4AX4A 2C7BA 2Z3ZA 4QDOA 1G42A 1IUPA 1I6WA 4X95A 3H04A 2AJ8A 3OTQA 4M0EA 2Y2UA 4H18A 5CH5A 3T52A 1ODSA 3I2GA 3KSRA 2UZ0A 4E14A 2K2QB 1CR6A 5K3DA 4Y2VA 4F5ZA 4QLAA 4OB7A 3STXA 1D07A 3BF7A 3QPDA 4J0GA 4GW3A 1LGYA 2O7RA 1QZ3A 1M33A 2WIKA 3I6MA 4IQ4A 3V1KA 1R88A 3HZOA 3ICVA 4L9AA 4EY4A 4FFVA 1YS1X 1AZWA 4Q82A 2HFKA 4DIUA 5AOAA 2VT7A 3WWCA 1CUDA 4XX1A 4S0XA 3DDUA 5ALOA 4HS9A 1QTRA 1XROA 4H7JA 4C6HA 1XZLA 1QFSA 5C7YA 3HJUA 3IUMA 3I6YA 5CT8A 3IUNA 2BFNA 4BB0A 1CUSA 2VJAA 4W63A 5SYMA 4D9JA 3VJMA 3E0XA 3DYVA 1PFQA 5FXMA 1VKHA 3FBWA 5CXXA 4KRYA 2WSLA 5BV7A 4O08A 5IKXA 1Y7HA 3M82A
chains in the Genus database with same CATH superfamily
2VK2A 5J5CA 1KJ9A 4RBNA 3F90A 4WFIA 2TRSB 3REOA 4YCSA 7YASA 2HHLA 4KG7A 5A4AA 3B89A 4BZPA 2I7VA 4C7XA 4JXXA 3NEAA 2XB4A 2J7PD 2ZUBA 4YACA 1JAZA 1Y33E 3D4NA 2PWZA 3W78A 1DDIA 3D2CA 4L3WA 3HN6A 1NP6A 5KNCH 2M1XA 5ALZA 3TSWA 1ZXXA 2X8JB 3ENWA 3ZU5A 5JIBA 2PUBA 1Q0SA 1ZCFA 1GPNA 5EUBA 5CIWA 4PZPA 1JNYA 1GPAA 2PYZA 1XRLA 1V48A 3VNVA 3I4CA 4IZ6A 4KREA 3TZCA 1SOMA 1VB5A 5FWXB 3H2YA 1OVGA 4X64B 5A04A 1JB9A 1MC4A 3SM9A 3TVYA 1T2CA 1JLMA 4PZZA 2BZGA 2BE9A 1JYFA 2GFIA 5JH7B 1U9IC 4DNFA 1Q17A 4HH0A 3NHWA 1NUTA 2D5CA 4I36A 4NOMA 2VC2B 1KI2A 2CVPA 2A1IA 1P33A 2LCFA 1U8AA 1BCRA 4I1IA 3NNNA 1W46A 1OYOA 3I4FA 1XCLA 1HY3A 3KT8A 1KORA 3PGKA 2PSHA 1DLIA 2XMZA 2FR8C 3O94A 4L57A 4GD3Q 2F8LA 4WBNA 3E5NA 3HVIA 3JS5A 1IWOA 1TMGE 2FUG1 2DJIA 2AX4A 1WXDA 3KLPX 4KFTA 1K63A 1I6KA 1Z7EA 3PHBE 3VOBA 2AIRA 3M3PA 4EQZA 1ECFA 3DNFA 1URPA 2IXBA 2EF0A 4Y2UA 1BWPA 1JPNA 1BJTA 2W37A 3B1WA 5CH8A 2JJ1D 4TZKA 4WESA 4YIKA 1RYEA 3MJEA 2EZ4A 3P9KA 1R50A 4O2RA 2KSQA 4QGGA 5E0OA 4P7GA 4TQ9A 1NP7A 4C21A 2ZYHA 3ZCVA 3FCCA 1CE8A 1JIVA 1SKYB 2F4NA 1SHJA 3DP7A 4MW5A 4B2PA 1YAJA 3ZKWA 2IC5A 2JIRA 2WAYA 4OTZA 3EMKA 3RWMB 1L9XA 3LUHA 3OZWA 1RACA 1PS0A 1QPBA 4JJAA 4CKZA 4XASA 3LBAA 4BL5A 4MW2A 4ZQBA 4Q93A 4X6XA 2IXTA 2LTAA 1DJPA 1RW4A 3FVWA 2YZMA 3HI6A 1EUDA 2PBFA 2W6MA 3KZKA 4L4ZA 4PG4A 4UM7A 5H3HA 4EOGA 3B53X 1OFUX 4BDSA 4GKBA 2ID8A 1GL9B 2JJ2A 2PS1A 1B73A 4ACBA 3ZIUA 2FZ4A 1XMVA 1PQWA 1VSUA 3DULA 4LW8A 3KC2A 4GE0A 1FFEA 3BICA 3QU9A 3B8EA 5E9AA 1HPLA 4EUFA 1Z6GA 4IP0A 1CHNA 1SCJA 2JJYA 4U8HA 4ZHQF 2O3QA 1X1CA 3B2NA 5HK9A 5T67A 3LQKA 2EU8A 3FNFA 4AM8A 5JS1A 1XDBA 3QMMA 4FFBA 3OOJA 2YKGA 2WPDA 4WXMA 2GZDA 3TOVA 3OZIA 5GADl 1RABA 3PWKA 2IYQA 2O50A 1MO3A 4KQ9A 4OVKA 4LUCA 3ZX5A 4BDTA 4DEXA 4FWTA 4EG5A 4K1XA 4QA9A 2EEZA 3HXOA 4BXOA 4BO7A 4JLMA 2YC2C 1ZYUA 4UVDA 5HE8A 1HQKA 4DW8A 1MN6A 2C9CA 4YCDA 5DHAA 1QRTA 3C3DA 4FMPA 4NXMB 1SFRA 2WDZA 5CGZA 3T1NA 1BW9A 3ET4A 3ND9A 4PG5A 4B9AA 5IVDA 4WFQA 1JI0A 1TX4B 3LQ1A 4ZZIA 5LMNB 1DELA 3IDFA 3DBLB 1PVOA 1EVIA 3FVRA 3ED1A 3RRMA 3UC9A 1U5CA 1P4GA 3KUXA 1V9LA 4B44A 2XZPA 4FZVA 1TLLA 2IP4A 4G1VA 5E38A 3C6XA 3EPLA 2EGGA 2P6RA 3H0KA 4PE5B 2I2WA 3IQEA 4HT3B 1A8PA 1JIXA 9LDBA 2VLIA 4UQPA 4BMPB 3TZHA 4DBZA 5CIYA 2IOFK 2PEYA 1OLXA 5FD8A 2Q7XA 2Z04A 6LDHA 1Q22A 2XAAA 2WUFA 3BRSA 4R16A 2XQFA 3QQ5A 4HNHA 1EGMB 2AN3A 3HE3A 4QICA 3D1VA 3WGZA 2FWJA 1T2VA 2GFQA 2OVFA 1DADA 3NONA 2NTJA 3CSSA 3WFJA 4FIDA 2GF2A 1TTHA 2PX6A 3NYRA 3QVVA 4FOLA 4R2WA 2ODPA 4TSFA 4UBKA 4WOPA 5KZMB 4B3HA 3O3CA 4O4LA 1IB0A 3AC0A 1M34A 3CLSC 3E84A 2NU8A 4ND8B 2QM8A 5SY4A 3SC3A 4FDAA 4NK4A 3S4YA 5BSVA 3SWWA 2HU8A 4TMTA 5DX8A 3EW9A 3V2HA 1SOUA 3KT6A 3FCSB 3PPWA 1OV4A 5IUNC 4MDEA 2Z08A 4N76A 3DGFC 4L6CA 2P40A 4FPXA 5C31A 2WM9B 5CX4A 1GNLA 3TUJC 2POCA 1FRQA 1KDRA 2PT9A 3AFOA 3E9EA 3OAAD 1F6WA 3PRJA 4IOLA 4M9ZA 2XZTA 3QW4B 5ITZA 1HORA 3UF0A 3DZIA 1RR6A 4WN3A 4BVKA 1RHMA 3HFGA 3A26A 2QZ4A 1SHTX 3LPMA 2ZE7A 1VBFA 3E82A 5B58T 4B5LA 3Q8KA 2ZRJA 5FBVB 1YI8A 4MKFA 4GMHA 3IC5A 2PM8A 2ZI7A 3W34A 1V16B 4ROTA 2W83A 1G8AA 3VU0A 1JW9B 4MMXB 2SCUB 5KU7A 2PS3A 2QR5A 3QPCA 1P0FA 3KZXA 3HK2A 1JDSA 4J43A 2GPAA 3MPUA 3U40A 1EFVB 5EHZA 4DLRA 1Q11A 1SBTA 2WYWA 1KVRA 1D7OA 1XXLA 4YJ2B 3T1OA 1KMCA 3BE4A 3HACA 1FC0A 4X93A 2X3FA 5DXFA 3IMFA 4X66B 2IX3A 1RC8A 3O8DA 5KTRA 4NVRA 4UNQA 3B8HA 2NT4A 3U80A 2GUWA 5EQFA 3QE9Y 2V1UA 5E2BA 3LGAA 4R7GA 4DY4A 1YDHA 2GCPA 2BFCA 1AUVA 2ZRMA 4K1LA 4AZ3A 3FOFC 5U4QA 7GPBA 2OLJA 3RYCA 3H18A 4AW9A 1LB1B 1LRLA 1XEXA 4HXGA 4GX5A 4QJ4A 4O2AB 2QNBA 4GM0A 1Q3HA 3TDNA 1NN1A 4N5IX 2B92A 5K3OA 1KBOA 1PL8A 3HR8A 5BWBA 2JLRA 2OD7A 3G7NA 1VSQA 3N6VA 3OI7A 1FRVA 4C1BA 3QX7A 4HLUC 1I0LA 2Z6UA 1XNQB 1U7ZA 4RVDA 2Q0HA 1EBBA 4OMUA 1TXGA 1E8DA 3ETHA 4ZVRA 3UAZA 5AUNB 2OCKA 1Y8CA 1G0NA 4JLNA 3H8WA 1C5KA 2DKNA 4MQFA 1RLTA 2YWEA 1Z36A 3U61B 5HNKA 1Y5LA 4HGRA 4IH1A 1SRRA 3AP1A 4RU1A 4J2OA 3OQIB 2NUTB 5TPZA 4ASUD 2VDWB 1DKPA 1BS2A 1J2UA 1KK2A 3KXLA 4YI3A 3ZY4A 5E4YA 3QBVA 5JD5A 1EUDB 4G37A 1AQUA 3THWB 2BGTA 1Y8ZA 2OV8A 3KJZA 3SR3A 1FUEA 4DADA 4NDZA 3FSGD 1RJ9B 3SLGA 3SC6A 4C3VA 3BC1A 2J31A 2P5SA 4HGPA 4RTMA 2HK9A 1E6MA 2GLTA 5JYBA 3NIFB 3PUKA 4GPEA 3NHFA 4DNXA 3GARA 3I5XA 1GQFA 1MOQA 5L7TA 3C6ZA 1LNQA 1AQ6A 4PXYA 3ZGZA 1X77A 1F2TA 1ZH4A 4OGFA 5CDGA 3CBGA 2AMJA 1PW7A 1YR8A 5C3MA 5LYJB 4HDRA 3KT0A 2RH9B 4C4YA 1TL7C 4XW2A 5DGXA 3D4LA 1L5RA 1KK1A 3LW7A 3N2EA 2H59A 4KFSA 5JDCC 5DEOA 5IJZA 4U6NA 1SR8A 3OZFA 1C2TA 1VL8A 1L7QA 3BD8A 4P7FA 3SEAA 2WNHA 3D6NB 1AH2A 1Z5WA 1XG5A 3FAZA 3SSAA 2O3RA 1A82A 4B6JA 3PGXA 3WIBA 1XF1A 2QIOA 5AM3A 2XJ4A 1TZJA 1R5NA 3UWSA 3G49A 2YXEA 2YZ2A 4FI3F 3A1DA 2DRIA 2YVKA 4AJLA 4RQAA 2ZAOA 2YVLA 3WLSA 3REGA 3PL1A 2F2TA 2BTEA 4DKXA 3A6GA 2OCGA 5TDHA 2VIIA 4O2AF 3KQOA 5SYNA 1WXIA 3VTZA 1Z5OA 1KC1A 2P35A 5GZ3A 2WYHA 4P3XA 1G59A 2HM7A 2VZLA 5GONA 1SU8A 1A71A 4Q05A 1ZGAA 1NONA 4YJFA 3SU8A 1ATIA 2EBWA 2O7VA 3B9QA 4YROA 2W6CX 1NBAA 4QVIA 1P3JA 2BP7A 4FJ2A 1YCHA 2G70A 3VZPA 4OLAA 1GGEA 5D3ZA 4DM7A 5IJ9B 2EFJA 2O9JA 4RSHA 2XRYA 3A9CA 1TMKA 4K2AA 1QIIA 1NFFA 1R64A 3EMVA 3W8EA 5J58A 4X20A 3HDJA 1YK1A 4HAVA 2X8JA 3W6ZA 5IAGA 4EARA 2HRBA 1D2HA 1NXXA 4YJ3F 1BE8A 5AI0A 4W9MC 2ACEA 1JDTA 1T6XA 1ZIDA 1ABEA 2PJZA 4A0FA 3WSTA 1BA3A 1VIVA 1WXQA 2P78A 3A1EA 3DMFA 4FJ0A 4OSPA 4RF4A 4XX0A 4YAWA 4AQDA 1WAMA 3SZUA 5C51B 3U4AA 2IHYA 2AOXA 1AMNA 3TSYA 2PNJA 1G8MA 1MH1A 2BM9A 2WWWA 4OJMX 2GBGA 1QP7A 2DPHA 1HO3A 4Q7JB 2UXBB 4BLQA 2Q9AA 1CFJA 3H7IA 3OBIA 2ZRLA 4NRDA 4P4TA 3NTLA 4RD4A 4QUGA 2ASEA 5A3JA 4HS4A 3V1TC 2IHUA 2RK4A 4O59O 4BFXA 4DKJA 3TN7A 4OLFA 2JRLA 3UBMA 1IYZA 1SPBS 2C2BA 2K7ZA 4P1ZA 5I7RA 2MSNA 2DFTA 5HZGA 3RIEA 2OXCA 1POXA 1HM5A 1XA4A 5DXJA 1DX6A 2ZBGA 1O6CA 3R0VA 4Q19A 5BRNA 3ULKA 4ARSA 4R0MA 4UE6A 4XRGA 2MSKA 5KMGB 4OF4A 4XVHA 1E79A 1PJ2A 4DFDA 4TTIA 1NMYA 3UTCA 3NBKA 1A9RA 3FUCA 4CKWA 3FWZA 5G3YA 1EQUA 4BNFA 4G26A 4UU0A 2AFIA 3AQ4A 1CEYA 4KQ2A 2CDBA 4NYMQ 1KF0A 3BIJA 2Z2XA 4BXOB 3BCRA 1J21A 1KY4A 1U1FA 2EARA 2EWVA 3M2TA 3OOYA 3PFKA 4GMKA 4KWHA 3MJCA 4XR9A 4LOAA 3W2EA 4JOQA 3OPXA 1IEWA 2EQAA 1II8A 5MGBA 4W8OA 4YK7A 2CLKB 2WIGA 2YWCA 1SB8A 3QZUA 3TJRA 5HW0A 1MDFA 1RWOA 5CNMA 3CZRA 5BYBA 3AU9A 4MP3A 1ADGA 2ZUFA 2A2ZA 5DGIA 4B34A 4BASA 4WNYA 3EEQA 4N0QA 2J0QA 3WRXA 3DE1X 4XLTA 3WK5A 1VPVA 1HBJA 2IHTA 4F8JA 5IVPA 2QM0A 4OAPA 1U8FO 2Y1WA 4B8WA 4C6TA 2QI9F 4AN4A 5G0TA 3UY4A 1L6RA 4JBHA 2C9YA 1SZDA 3B1JA 4M8LA 3UAYA 1JFTA 2J0UA 3HB0A 3GGCA 2P6OA 2CYBA 4LYHA 3WK9A 3NH6A 3ONDA 4FDVA 1CZHA 4LRWA 2X5NA 5CVUA 2ZB4A 3K5IA 4BVLA 4M0DA 4EB0A 1SVLA 4BFTA 3I04M 1EHIA 3ZWCA 2BZ0A 2PVPA 2VJYA 3HA5A 5K03A 1FQKA 5FORA 2BSXA 2JHCA 1XZQA 4JJ4A 1ESDA 1D2EA 1OWNA 4Q3EA 1VM6A 1NDQA 3OZSA 1U0HC 3N8HA 3TW8B 5LLDA 3VA7A 1Q77A 1X1EA 1B1CA 1WUYA 3COSA 5DJ5A 3I5MA 1U0LA 5E2AA 3A2KA 4LN1A 1PAUA 3L84A 2WLTA 4KVFA 4KN5A 1Z0JA 1QX3A 4RPHA 3C4QA 2CMGA 2VAPA 3L0IB 4FFOA 5JY6A 3ERCA 4TV8A 3X1MA 4B45A 3KEFA 1ZRSA 4RD2A 2IVFA 1KTIA 1CVLA 2H4YA 1YQUA 2Q3HA 2ZR7A 3L7YA 3UUGA 3GYGA 2I3BA 4PV7A 1SH7A 4BMNA 3SZRA 1Z06A 2A78A 2C96A 4Z4HA 2BMJA 5B6PA 4K9LA 2ASVA 1QIEA 1Z13A 2P3SA 1NMSA 1RWKA 3DTVA 3FJOA 2IHZA 5TS2A 5KC8A 3AVWA 1YBAA 1XCJA 3CJRA 3BZUA 2WP0A 4JEHA 3SF8B 1TZMA 3ER8A 4AD8A 4WXHA 4J9UE 2C2MA 3LT4A 1QIFA 4AN1A 2QJOA 3CISA 1WZ2A 2GYYA 4IFBA 4Z9FA 2ZTUA 1QE5A 1WMDA 5SZKB 4LXGA 4WCFB 1U8YA 2ARKA 1FBNA 2NLOA 3K31A 3VMFA 5BSKA 2DWOA 3TJZA 2DECA 1O8CA 2X6RA 4Q9IA 2P9BA 4KQKA 3DGEC 4G4GA 1LF5A 2F3QA 3FCXA 4ABTA 1YONA 2F9FA 1OLUB 1WHTA 2JNWA 2XYHA 4HYQA 1NM5C 2D7JA 5IYZA 1N5JA 4D0LB 1FP1D 2J6IA 2Y93A 3ETCA 5JECA 2HV9A 1GLGA 4IIJF 1XPUA 4M0UA 3I28A 4E08A 1B14A 2UUOA 5HM6A 4WERA 4IIUA 3W2FA 1RJGA 3I83A 3K0HA 1DDGA 3BWXA 3CLVA 3EG9A 3TQOA 5LU8A 1L7OA 1Z25A 2HO5A 2A9RA 3KAQA 3PYXA 3R5XA 1A69A 5K1ZA 3V7NA 4AO6A 5BW5A 1K6XA 2Y1XA 4EF4A 1VG9B 5AKLA 1LTKA 4URWR 4YP9A 2IXAA 4QAQA 4A91A 1A4IA 4DNOA 5D87A 4PCUA 4YCCA 3L4EA 5LQCA 4DV3B 1E3DA 1SXJE 1JI3A 4AJ4A 3VI3B 3GOQA 4XQCA 1C3JA 3NHMA 4F9TA 2WC1A 3VR4A 4UOQA 4I3HA 5JI3E 3KNZA 4MQEB 4YMVA 1BWRA 3LQFA 4RIIA 4R9UC 1EKXA 1KJWA 2XVAA 4ZEWA 1HL7A 4X6YA 4ZCSA 2AXEA 2D2XA 4BGDA 1EGVB 4PS1A 1CNFA 4F46A 4MRAA 1BJKA 1JIJA 3E9ZA 3LFHA 1C9NA 1QP0A 2NO9A 3HJAA 3TD9A 4JLSA 1LC3A 4HLCA 2XNSA 3DAFA 3GFQA 5EWLB 2C84A 2FZGA 2QTTA 4FLFA 4MVYA 4RD0A 1TF2A 3WS7A 4A4DA 4MUJA 5AVSA 4KR2A 3IEMA 1NVUQ 2W2LA 4WDRA 2JFWA 1HE3A 1YMVA 3GUUA 5BWOA 2O1SA 3F5FA 3Q72A 3QOFA 3LPNA 1U1DA 2QYHA 2B30A 2OBYA 4R2MA 1XNRB 1JTEA 1DG3A 1XRRA 5BPHA 1P2VA 4XYLA 3MNFA 5BSEA 5C18A 3O4RA 3Q87B 4Q1BA 3EEOA 4GI2A 5DCUA 1K06A 5GM1A 2IBSA 4GH5A 5LKAA 5GZ6A 1ZAYA 5JD6A 4RCVA 2IDJA 1HRDA 2JKYA 2EC5A 4NCIA 1FW6A 1BNCA 4KLCA 1BD4A 4YQZA 1TMYA 2C5SA 4RAOA 1XAGA 4PVDA 2WM3A 4DG9A 3NRCA 3GJQA 2I4TA 3T3OA 1GFZA 1M2OA 1T1GA 3OOEA 1RD4A 3CEMA 3M81A 4B4VA 5HIAA 5CPFA 2OSBA 5D1HA 2WIBA 5NLLA 2JGDA 2OCAA 1DJQA 1SUIA 4ZQEA 1P74A 3OT1B 1LLFA 3X2FA 2X41A 4RAQA 3X1KA 2NU9A 2EKLA 1LK7A 1H4VB 5TMDA 2WSSD 3E1GA 1FOEB 4N0EA 4EYEA 1FA9A 2B4QA 3UUEA 2LDXA 3ROXA 3K3PA 1Q57A 3FI9A 3PE6A 2VVTA 4XYEA 3HWWA 2IYOA 2R8RA 4LZNA 1SKMA 1E3EA 2P2CA 1MJ5A 3DDHA 2K6GA 1ZW6A 2AW3A 3NH9A 4LWOA 4PN3A 2XWBF 1GTMA 4XAQA 1J2RA 3FSJX 5F21A 3K1TA 4WQMA 3BDVA 4I5FA 1T0IA 3ZHBA 4F2DA 3O5AA 1HR0B 4E46A 4PFQA 4EKYA 4HFRA 2G28A 4HNVA 3K9HA 4GM4A 4YRIA 1CQIA 2I34A 2GGSA 3R6GA 3IUSA 3QUAA 4HX9A 4AKGA 1Y7TA 3GNQA 3IRVA 5P8WA 2O0HA 3VPHA 4JL8A 4X3CA 2DUJA 1COWD 4GNRA 3GLFB 1KK3A 2XKJE 4DA6A 4M38A 2ICAA 1A76A 1G0OA 1P0QA 2HMAA 4J0CA 4AUEA 1U28C 1YDEA 5AI8A 5AW4A 1DXHA 2LIPA 5EHXA 2JAOA 3KB6A 1RAGA 2XX3A 1DX4A 4UNPA 1NIPA 4GYKA 5EQTA 3MWDA 1I14A 4NJOA 4OQLA 5T6BA 2B1GA 3GLHE 2UKDA 1CSEE 4A92A 3U60B 3HCDA 4KUGA 2XRZA 2R9VA 1Y8RA 3LC2O 3UAOA 2BEVB 4QDZA 4LF5B 1WLSA 1Y80A 3C6BA 1G21A 4YBRA 3O3OB 1OBVA 3OEEA 2FZCA 3NGXA 1FFHA 1D4OA 3IJRA 1PTJA 5DBOA 5LP6C 4YFVA 4N39A 1KJIA 1U0BB 2BGJA 3PQ5A 5IBPA 3PC3A 4D74A 3PC4A 1RI5A 2PMKA 5D3QA 1GKLA 1CEQA 3FCYA 3CURA 3NBFA 3BTUA 4EEKA 1I1OA 2H54A 3SF8A 5B3LA 1ZVVA 1RYNA 1TAUA 1FP7A 1XCOA 3KLOA 4DUPA 1SCDA 3L5OA 4JJIA 4ZVSA 5AT1A 4HEA6 4LXYA 4XIYA 1UF9A 2G7ZA 4PYNA 4EFMA 5TLSA 3TUZC 3SM3A 4L6AA 3BSFA 1QZUA 1NRJB 3W8RA 4ESVA 3C8MA 3ND8A 4H6VA 3W7VA 5J23A 5T4FA 1EX9A 3DA8A 5BV2P 2JB9A 3KCNA 4IGFA 1UKZA 3TOSA 2Y6VA 2P9TA 3MLAA 1PYGA 4RA6B 3N7UA 5E8JA 3V97A 3VPFA 5BMVB 3DHEA 2GAIA 2H9YA 1C9JA 4IH4A 4XUCA 1YFZA 3WP0A 1E4EB 2ZRBA 3KWJA 4M0KA 3T0IA 5HRAA 3QEMB 5JS8A 3LP6A 3OLVA 4LHVA 3GRVA 1GRRA 4CEJB 4Q3NA 4WCDA 1IVNA 1D4FA 3FHLA 3R9IA 2CXUA 4PIMA 4YVFA 4IVQA 1XLWA 3OD1A 1ML3A 3Q7IA 1XZNA 1R6AA 5LVAA 5EXSA 2FB9A 1QYVA 1A5ZA 3DCIA 3M0EA 3PBKA 4Q4JA 1U6IA 3ZV3A 2KX7A 3QEAZ 5CTJA 3QVSA 2ZT5A 5EJ9A 2HNAA 4WKCA 1JT9A 3BE6A 3NNDA 5CP8A 4BO3A 4Q9NA 2N46A 1YKFA 4PW0A 4C05A 3R3WA 4MVJH 1XZFA 3RNOA 4RIHA 3BHIA 1EFLA 1BRMA 4PRYA 2XUOA 1IM5A 3D2AA 4DDHA 4ZTUB 1CK4A 1QH8A 3T1HB 2IFTA 3PUVA 1T8SA 5JJBA 3I01M 1WNTA 5EL0A 2LPMA 1RQNA 1PJRA 1ZKDA 4DE5A 4CFYA 1NR1A 3GJ5A 3EC7A 2GK7A 1QRAA 2D1RA 5FOQA 1HF3A 3D6TB 3BXFA 3HJBA 1NE2A 3NIBA 4DM4A 1N6LA 1ANKA 4J4BA 5B64A 1U6KA 2ZT6A 3G2PA 1N9KA 4IILA 1NVEA 5FL3A 1I4EB 3LHIA 5C8ZA 3WA7A 2Y1DA 3QLJA 3ZQKA 2FA9A 3DF9A 2I91A 3M3DA 5LNK1 3D3WA 3AZQA 3JD2A 1FFSA 1CBUA 1PGQA 2HBZA 2W11A 2ES4A 3GFTA 3INNA 3RG8A 2QI9C 1CZKA 4PG6A 2DWPA 1GZVA 1MGPA 3FW1A 3FY4A 2CE7A 2QPTA 1KI9A 1Y3DE 2P7IA 3MT8A 3P0RA 4BNLA 2AX3A 4D9BA 1Z2OX 2EG5A 3WRWA 4F4UA 1R6XA 5IYZB 4PRZA 4MUHA 1G98A 3G6KA 2X58A 1L5VA 3DEAA 1XJCA 2ZPAA 2ZSFA 3HBJA 4ILEA 4D8TA 1B16A 2WJHA 4GOJA 3H3FA 3VSBA 1J9ZA 2Z9CA 3P5BA 1XBTA 4LX0A 1FFBA 5BMVF 1SIBE 1XA0A 4P32A 1NG9A 1TD9A 2PMDA 4L85A 3RVDA 1KQFA 3K2EA 1NMZA 4EX7A 1ZGHA 3OM9A 5ES3A 2OHGA 2ZIUB 3IGFA 1V5GA 4LY3A 4G63A 1IXRC 2WT4A 1YAHA 3OZ7A 2NV2B 4IS3A 4P81A 3P97A 1JHMA 1P73A 4K88A 1C8VB 4Q4AA 4UZEA 4URXR 5G2OA 4AUNA 3Q88A 3ML1A 4CIXA 1PZGA 3BRWA 2HTEA 3JAWA 3M6IA 2IWHA 1KXZA 1ULUA 1OASA 2Z43A 4ARZA 1DEXA 5F1OA 3SZOA 4JXJA 4G8DA 1CEXA 3M4ZA 4GKKB 4V0SA 3VDNB 3WDSA 1MV8A 2QM7A 5AVJA 5JBNA 1RWNA 2O0KA 1FYDA 4MQBA 1XLTA 5HSGA 1DCMA 2PBRA 5ARBA 3JWJA 3VKUA 1DX9A 1AS3A 2VAMA 4DM3A 1G41A 1XDDA 1ZL0A 2CYAA 4QGSA 4TKUA 4CM4B 2WEKA 2OD9A 4P0TA 1PT6A 4DHEA 4GUAA 3NBXX 1WPRA 4HQKA 3RK1A 4QATA 4DMRA 1U4NA 3MIZA 2XE4A 1BW9B 7ADHA 3A9VA 4LZOA 3E4DA 2PQ0A 3L1KA 2QRUA 2HYDA 4ILKA 4LQDA 5CT5A 3HEAA 4IH9A 4P58A 3WLEA 5JO0A 2Z1NA 2X23A 1V8BA 5IUKC 9MHTA 4AKSA 2TMDA 1ZGCA 1KSFX 3ZOKA 3B6EA 2QMEA 2SECE 4PYRA 4RGBA 1EZ1A 4FDLA 1EVEA 4WGGA 4C0JA 1KHTA 4CM5A 1WPGA 2SICE 1KQOA 2F43A 5FPHA 4HAXA 1C50A 5LUBA 3TCNA 3TNDA 4RW0A 3ZWMA 5KX5F 3ZDQA 1FF9A 1L5MA 2XXAB 1ZNXA 5DISB 3T5CA 1IZ7A 1UPTA 1DKOA 4C6TB 2WE7A 1WF6A 1R6TA 1Q0HA 2IYAA 4XB1A 3CR7A 1Z2NX 2ZS7A 3PUXA 3URMA 1X7WB 1I3LA 4BNYA 4RENA 3U4QA 1T9ZA 1KZGB 4NICA 3QBDA 1XTQA 4Y1GA 4QFDA 4B2IA 2VRNA 2QTWB 3PX7A 4DA4A 4Z4IA 2FOIA 3IP5A 1G7SA 1Y9AA 2VCYA 1NW9B 2ZT7A 2XUKA 3P94A 4CIBA 3TSOA 1PR3A 3K8ZA 2UYQA 3V2GA 5L53A 1OT5A 4P3OA 4XZ3A 2I8LA 4INPA 1VJ1A 3HWX1 4MEAA 3GRUA 1Z6XA 4B0OA 2C94A 3SEFA 4K40A 2AUMA 2FEKA 1F6BA 3NKLA 5J4VA 3MFQA 3IUYA 1PGJA 3CJQA 2KI5A 4ZD6A 1S2LA 2H2DA 2AEJA 3FXAA 5BUSA 4Z9XA 4RJ2A 2D62A 3L6CA 4CEJA 1DKLA 2B4YA 1Y1KE 2OVBA 1QGZA 3O7WA 3LPAA 3WBJA 1PL0A 4KBGA 1Q50A 4MW1A 2XUHA 1E7RA 1NN5A 1WF3A 1X94A 2CVOA 2ZU6A 3KZNA 2G6TA 2JLCA 5FJJA 3BIOA 4C4SA 2AQKA 1PI3A 1AOXA 3KKNA 4KXVA 2VHWA 3EASA 3W90A 1JLHA 1J8FA 4JEUA 4R5HA 2EJVA 1ZNWA 1G38A 4BO5A 1ZJJA 1QGUB 2OB2A 2VDUE 4KMRA 4V03A 3GVCA 4HDNA 3DL4A 3GQVA 2VF2A 3MINA 3T06B 1TKRA 3GJYA 1G9TA 4YONB 5TMBA 1LH0A 3CSUA 3L9XA 3IP3A 3AHGA 1ZM7A 5C5CA 5HHTA 5E9QA 2OV4A 5JCOA 1D1QA 4TRNA 4HH3C 5KYUB 1F4VA 1GEGA 3JD3A 3FCEA 1MD9A 1YMUA 2YFKA 3IT1A 3LW8A 4I1YA 5BN3B 4HDSB 4OMDA 1DZIA 4EA8A 1XD9A 3KEGA 3FR7A 3ZCRA 3HSYA 1BIFA 5JD4A 4MULA 3GD5A 1IHUA 2D0DA 2Q3LA 3AW8A 4Y9UA 5AXDA 3ROGA 3JQGB 1B26A 4ERNA 2ZJ4A 7REQB 2D5BA 4I4NA 4QYMA 4QYSA 4QT4A 3TGWA 1GPH1 3GRCA 3HXMA 1B8VA 1MNQA 3L07A 4RWEA 3KZMA 4RXMA 2ZR9A 4CM8A 4CV1A 2MR5A 3D9QX 4GECA 1F06A 3VV3A 1N1EA 2VHQA 3AV0B 3C1TA 1KYVA 2O2JA 3PNMA 1UBFA 4GI3A 1Z3IX 1L4UA 3FVTA 3RSOA 1XCPA 2X8LA 4Q4LA 1XTBA 2GR9A 2UZ3A 3MGBA 3CX8A 2GN2A 2BFEB 4FJ1A 3DTVD 3PEYA 3TO5A 4WN9A 1YE8A 1K8YB 3L3BA 4FYIA 2G8LA 2DFNA 4MCJA 4PC2A 3HCCA 3K0CC 3GRAA 1H2ZA 5CDFA 4JK3A 3UXMA 3VHXB 1OB2A 2FW9A 1X1BA 2IUFA 2P3LA 3NJ4A 1L5YA 1ZCBA 3WLFA 3GLFA 4EX6A 1SBYA 1EBUA 4PAMA 1EWKA 4JZKA 4AJ9A 3HJFA 2AMLA 1OBHA 3F5SA 2O59A 5AW6A 1S8AA 3CLHA 3VR4D 4R8RA 1PV4A 1RYZA 2PT7A 3VDMA 4A0GA 3K0BA 4CLDA 1YRQA 3AESB 4X7PA 3KG2A 4D4MA 5J2TB 3PUYA 4HDOB 4R05A 4I3GA 5D8DA 1QQ6A 5A5EA 4J0QA 4BLUA 3GZNB 3P71T 1VE6A 5FKJA 1D6SA 1FFAA 4OAOA 3R75A 3AF3A 2WJIA 3MAGA 4IO1A 4B8ZA 4C08A 3IAAA 1VGRA 4RD6A 4JBLA 2HJ9A 3L8MA 2ZYUX 4CT5A 1T5BA 2Q9UA 3G85A 4KHPB 3W3AA 1KVTA 1D2AA 1TJPB 1GG5A 3U81A 3FZEA 3S27A 3BQ9A 5E1MA 2WHPB 2X0JA 3P27A 4NMXB 3TLMA 1UKEA 4AKEA 2GXAA 2Q6LA 4QT0A 5LQRA 2VG8A 5JVDB 3FNRA 4L8LA 2ZIAA 1Z4MA 1XRPA 5HJ2A 2GDJA 2HJHA 2ZUCA 4IDEA 3RK4A 2O8EB 3MW8A 3LNTA 4D81A 5AVYA 3R5TA 4RDIA 1V39A 1ZOIA 2J4CA 2B7CA 1XUOA 2NSHA 1C0LA 3BVPA 3R3ZA 5EMKA 1FMFA 1JE0A 4CL8A 4YXWD 4C4ZA 2QORA 1LBTA 1Y3BE 2I6FA 1FLAA 4X00A 2OHFA 3AUJB 2MSWA 1JTVA 4UNIA 3DC7A 2XI4A 3EW7A 2WJ6A 3PA6A 1G55A 1V4VA 3SHFA 3TDKA 5D3KA 4DMGA 4KO1S 5C8VA 5ICCA 2WHXA 1GN9A 5MFZA 1GNQA 4ZAXA 4EUNA 1SJ9A 2Q28A 1DC7A 5HTOA 4F12A 2VZ9A 5AOCA 5EJGA 3K05A 3OLYA 2A9FA 4FYJA 2Q4DA 4RSRA 1A4UA 4Q7LA 3BQMB 1N2SA 1US8A 1D4ZA 5L3SB 2Q41A 4V2UA 3C24A 1P0IA 5E7QA 1O6GA 2PZBA 3OFNA 3BSYA 3QJGA 4LBYA 5LZ8A 4K3UA 2I99A 3T95A 1KVSA 2ZAYA 1N8KA 2HDWA 2WPNA 5AKIA 1BN6A 1MENA 4HRAA 4FHCA 5AD1A 3QLUC 3OH8A 4KWEA 4QDUA 3QMPA 3DNPA 2YQZA 3A28A 2GPWA 3TLZA 1U2TA 3L7CA 2FPPA 4L4UA 4FX2A 4OXYA 3A58B 1RRKA 3NBAA 5EZ6B 4ETNA 1MAAA 1XL0A 4DQLA 4FD2A 3R4CA 5ESWA 4MV6A 3CB4A 1I7PA 2QX9A 3QVGB 4N5MA 4QU8A 2YRXA 1TIKA 4RIGA 5J4YA 4DAEA 4AI6A 1M7BA 3AUXA 3GA0A 3TOXA 1NUPA 2ZB3A 2PKWA 2D2FA 2H85A 3C8ZA 4ZO7A 4ZIRB 4TLCA 1QFZA 2VNSA 3DZBA 4WINA 4BLSA 4BLPA 3D8NA 2CJYA 3TTSA 3TK1A 2HF9A 2WAAA 1UBHS 3ABZA 1UFKA 1XLTC 1TEZA 3I8SA 4HOYA 3S2EA 3RRBA 5CM2Z 2JAUA 1L5QA 1L4GA 1RKUA 4LTDA 4TMKA 4R1NA 4NBSA 4ZXFA 1PYOA 3UK1A 3KJGA 2E85A 4XGNA 2XGJA 1MGOA 3PQ8A 1U2ZA 4L73A 3WFIA 3U7FB 2PMEA 2HCBA 2R68A 5IT4A 4IWYA 1APBA 3ACBA 2PJUA 4M0CA 5EQDA 2V8OA 4KR7A 2RHMA 2BC9A 4R5MA 4JOBA 1C1XB 4HGQA 4G0WA 2BL4A 2P1ZA 4AYTA 2O6HA 3FYUC 4FKZA 1PX2A 4AULA 2NG1A 2AJLI 1R2QA 3DXYA 3H1GA 1Y1LA 2EL7A 3HQ4O 1QIJA 5CBKA 5L95A 4GS5A 1HGXA 5DK6A 1E79D 2XTMA 4OK6A 5JR3A 4F4HA 3MD9A 5IWAB 3ICCA 5CT6A 2NZ8A 4BQFA 3CINA 4E15A 2BGKA 2G1KA 2NU6B 3GVXA 5KVCA 5HG0A 2NO7A 4RYLA 1UKAA 1UZAA 3DV2A 4M7RA 4J9VA 3L01A 4IGIA 2BLLA 3MAAC 4EB8A 4YX9A 1GSAA 1U7WA 2D7DA 3KOMA 4FYWA 5IDXA 5FOXA 2QMQA 3GLVA 3QHAA 1JUDA 3MJTA 5JNWA 1Z73A 4B09A 1AKRA 2HQBA 3ESQA 3HL0A 3UANA 2O05A 4FC7A 1WR8A 5K9ZA 4X62B 1GZ6A 1QKJA 4FKBA 3VX3A 4CMGA 1WQ4A 4WGFA 2WYVA 2HLNA 2V0CA 3PXBA 1LV7A 3GGJA 5IKPA 3H16A 3PJRA 3QVXA 3ZVKA 2JCYA 4HDKA 4IHJF 3ECSA 1JB1A 1JR3E 4IDAA 3ZY2A 3RARA 2QEQA 1QAMA 3WC4A 1UPXA 1FSFA 2IZ5A 1O0BA 2W4QA 1XN4A 1SQ0A 4KAJA 4S1VA 2GD2A 2RIRA 2F3RA 2OECA 3TL3A 1XRJA 3W4KA 1JWAB 3VBEA 5T7BA 1IMOA 4Y1RA 1T1EA 4AAYA 4RE6A 2B61A 3IULA 4MVJG 2C2HA 1CS4C 2Y1GA 2E2WA 3A6DA 4KIGA 4WH0A 2HEGA 2IYXA 1RDFA 4E4TA 2M6LA 3D4BA 3WMRA 2O54A 1ESEA 4XKJA 5KYUA 2I71A 3JALB 5B3AA 4U7GA 3LS2A 2IF2A 1JA9A 2QUIA 3HVJA 3R0ZA 4DS3A 2EQ5A 3L82B 4O3MA 1C9EA 3H5OA 5HZHA 1T2NA 3TRJA 1XRNA 3OCWA 3QNMA 1PJ3A 2GJKA 5IVHA 3DZGA 1IJFA 3T4EA 1EWYA 1QIHA 2O3TA 2Q6OA 2Z83A 3AETA 4DDUA 2HREA 4R3NA 1GAQA 4YEDA 1VCIA 1C4WA 3A05A 4KO2S 4EJSA 3JARB 4NZNA 3GT3A 5F12A 1IBCA 5FB3A 3BWDD 4CPDA 3GP3A 1IBMB 3ZKWB 4UHCA 5J2UF 1H1LA 4LZJA 5K0LA 4F45A 1EFHA 4S04A 2KE5A 2O2EA 4ENWA 3WZLA 2F55A 5IX8A 5I4KA 2RGBA 1MDBA 4LK2A 3AG5A 4ENUA 2RK3A 2NSDA 2O8EA 2PJDA 3AIIA 4P3YA 2Q8QA 1RHQA 1UFQA 3EE6A 5F3WB 3SQXA 2GM3A 5FADA 5H16A 2QRZA 2WG2A 2I5PO 3AVOA 3ENZA 3ZR4B 2PUCA 1FB5A 4I9HA 4WKPA 3A6FA 1UOQA 2V1XA 3QELA 3I1YA 2ONZA 2QTFA 2WHPA 4IDGA 4HP8A 4KH0A 2OFXA 3TM4A 3CV3A 1T35A 2PKQP 1H8HD 2ZRCA 2ZB2A 3N87A 5DX1A 5SZHB 3UWKA 3ZCUA 3SVLA 1MW8X 5I8ZA 3JRXA 5B3JC 4C4RA 5ESXA 2QVCA 2PRKA 3ZIAD 3RYCB 5I7AA 1HTWA 4Y7CA 4JSRA 1GCGA 2PKQO 3UW3A 3LTNC 2RI1A 2FGJA 5TPZD 1K7CA 4DA7A 1G1AA 3SYMA 3RFXA 1ZFNA 4IO0A 1Z0ZA 4NV1A 1R0YA 3BHMA 1SBCA 2FUG6 2H17A 2IYUA 1P5HA 3JD0A 3P2MA 1R0KA 2QVXX 3TTXA 3WHLA 4AICA 5LP6B 3G5AA 1KDPA 3AVTA 1ZIOA 3LC0A 5CNKA 4REMA 4OQEA 2WF9A 1TVKA 3C6QA 1WUIS 2JFYA 3S5UA 3OU7A 3TLGA 1QFMA 5CRIA 5FDFA 3K4QA 2P1RA 3DWEX 3L0DA 4JDUA 2II6A 4HVCA 1UBMS 1U8TA 3OO0A 2V4MA 3N7AA 4UVEA 3RGGA 5BN3A 2RK6A 2ERYA 2RI6A 4HG2A 4BLWA 1TUIA 2R7NA 4OHKA 1R74A 3UMSA 7MHTA 1WBJB 4EPXA 3I9NA 1RZRA 1G5HA 1N2HA 4KQCA 4DQVA 3ZLBA 3W0LB 2CFTA 4P4NA 1SWVA 4BKRA 1E6EA 2P62A 3ER6A 4UPVA 4BNIA 4QJBA 3L8FA 4YMWA 1XT6A 3SDSA 2A58A 3OFVA 3PEWA 4QQFA 2P65A 3EXFB 2JGFA 3BB4A 4N0MA 3M1IA 3QA3E 3PWSA 4FNOA 2B4RO 1IAVA 1PFVA 2VHVA 4M2LA 1R4AA 4G5RA 1AF4A 1DFHA 2CB9A 4KIWA 1ZM3A 3JQGA 2ADFA 3LKVA 2OOSA 5KYNA 4B6RA 1PEAA 2HX1A 1V3VA 3LHSA 2Z1DA 1EAYA 1ESZA 2CUZA 2OORC 3KKMA 3PD1A 3PENA 4KDFA 2QXTA 4HMQA 4DDWA 1GCAA 1JS1X 2BHTA 5F2KA 3LAWA 5I4BA 1BU5A 2VAXA 5DYYA 2FN9A 4HQOA 2GPNA 3N53A 4ZVTA 2XGSA 3OPVA 3L4JA 2VDKB 3T54A 1KKLA 3OT5A 3BA1A 1MXHA 3E8SA 3DFKA 2O07A 1OTHA 1XWWA 3CLTC 4MVJM 2CW5A 5B30A 2X0DA 4ND7A 2L42A 1MUUA 1SOVA 1WMAA 1XGKA 3MOSA 3TL2A 1FLNA 1NDHA 5AQ1A 2PGIA 3HNOA 3EX7C 4NI5A 2JBAA 2B1IA 1QYXA 1I80A 3JYPA 3LBFA 2BEKA 5EZYB 2FZWA 1AQYA 3PKIA 3O8OB 1DO0A 4RY9A 3AVUA 3KSZO 3ZXYA 5FPTA 2OLEA 1A5TA 1PJQA 2NO4A 3LT5A 3ICEA 1RSZA 4YUAA 3PL5A 5KDLA 4BJHB 4DCTA 3JQBC 3TB4A 1JEEA 3KBBA 3ZHZA 3LKZA 5IABA 1E6CA 3DDZX 5L3SA 1A8SA 1ETHA 2GJ8A 4I9NA 5EP3A 1Z39A 2VNKA 4AJ2A 2G80A 3WNCA 2C29D 3ZJUA 2V96A 1YUBA 1H8EA 3ABSB 1M2VB 1BN7A 5FT9A 4C30A 4B3JA 3LK7A 4EG8A 3PQFA 4PG8A 1AF7A 4EJ0A 2NXJA 3S5JA 1I2MA 3LF2A 4EQ6B 2J0UB 2XCRB 4HZIA 4MWDA 2ID4A 3AZPA 3ANLA 3DLAA 3GLKA 4J16A 3R74A 4MVJA 3ZDBA 4O25A 1QIGA 3TQQA 1TCUA 3F97A 3IBGA 4X8LA 2C03A 1TT5B 2KS6A 3A1VA 1NN3A 1X38A 4EHFA 3LP5A 5AUPB 5C8YF 1Y8QA 5E8RA 1A77A 3LL7A 3FMFA 2QQGA 1N25A 3IR5A 1HFKA 3GJ4A 4JGIA 3JQPA 1BEUB 1T1IA 2X22A 1VG8A 1Z62A 2VP4A 3EHDA 2ZXFA 4KI0A 1XAHA 4Q16A 1G8SA 3VH2A 1B41A 5DNWA 3TIVA 5IH3A 2JFFA 4NBNA 3NTOA 4RMGA 1MG0A 3IB6A 4V0ME 3CVXA 1NM5A 1C8BA 3BM5A 4D46A 3BJMA 4E30A 3V4ZA 3V7WA 5EWJB 1PK7A 4RV9A 5IW8A 2AD1A 5BP7A 3SN6A 4ZAZA 1JAYA 4EKGA 3TLXA 2JATA 4FFSA 4LV5B 2FG6C 2PRJA 1NVKA 1WV0A 1FUIA 3IR7A 3R7NA 1Z3CA 1K1EA 1QM5A 3E23A 1N78A 3K30A 2PU7A 3HO6A 4DLLA 2ENUA 1VHTA 2GXSA 3DMRA 5FCDA 5DTJA 3U62A 5DULA 4RZIA 1U2PA 3T7TA 1L1EA 4FLMA 2VBCA 4F6RB 5AESA 4KGDA 1M67A 3WLRA 3AESA 3GH3A 4GZ5A 4OEHA 2R96A 3KSBC 4URZR 3ICWA 1GXSB 3VZQA 1U7TA 2YZGA 4G1BA 2EX4A 4EP1A 1Z68A 1LVUA 4S05A 2BTQB 2ZUDA 1M5UA 2QLFA 3GN1A 4BTEA 1JV2B 2MDTA 3ESDA 1OYYA 3DLBA 2DWQA 4W5NA 3H0CA 2V9CA 3DHYA 1YRLA 4NU5A 1JJIA 1KVUA 1T13A 2HK8A 2GESA 3UATA 1THGA 4EIWA 4KKVA 1PGPA 4YDQA 4A23A 1MMFB 1NATA 5K0FA 5HRUA 3ZZMA 4EI8A 3M6AA 3SQNA 1RHRA 4FP9A 1BCRB 2SBTA 3S3TA 1WEKA 3A70A 2B0JA 1YR3A 1DUSA 3G5MA 4B3FX 3GUVA 4V1CB 1U9IA 3TBHA 2JGKA 4ALLA 4DLYA 2R7KA 5C2JB 4EY7A 1R8YA 2HIAA 3DLCA 2IE0A 1B42A 2OEPA 2GQ0A 1XTKA 2B5VA 2FW7A 3ETGA 3NHKA 4HI0E 4QUIA 3NYIA 4XWOA 5AI9A 1DGQA 3UMCA 1FPQA 4KTVE 4ISBA 4FW8A 3I39X 4BZQA 1OZFA 2ET6A 1XWIA 1W47A 2XTJA 5L3ZA 1UP7A 1AUPA 2ZQZA 3EAFA 1P2FA 2CBXA 3G2OA 3WBBA 4UDNA 4FCCA 2I03A 1M73E 3G8BA 5HZMA 2QS9A 5AICA 4FZ3A 3RW9A 2O2GA 3RWOA 3JWHA 4G67A 3X2SA 3MQFA 4U2GA 4Y8VA 4KPEC 1WKBA 2QGFA 4J76A 2W2OA 5JXIA 2QUJA 1R9MA 1N77A 1NRXA 3EIWA 2JCSA 1F1BA 3CR8A 5BT8A 2GKGA 1P5JA 2X2PA 3PRYA 1WDWB 3H6HA 1ZM4A 1WY7A 5HXAA 4C0BA 2GO7A 1YZ3A 4EYSA 1Q15A 2OWEA 1TU3A 5CD9A 1M34E 3AG6A 2VPTA 3UK7A 2CSXA 4BAZA 1VE3A 2XB2A 2HOQA 4LF8B 3W5UA 3UPTA 2C31A 3A6HA 5A9SB 1W2GA 4RWZA 2O8DB 4QL3A 5A6SA 2NU7B 3C3XA 3CVJA 3SZLA 1L5ZA 4H3HB 5K09A 1DB3A 4PSDA 4CKXA 4GR4A 1AXEA 2ZUUA 5AW7A 3HN7A 4K28A 1X7DA 1T9DA 4CMEC 1DBVO 4V39A 3WGIA 1ORTA 5DBGA 2NQTA 5LUAA 4WFJA 3DWGA 5B3KA 5SY6A 4NULA 4GLFA 2VKTA 2O2SA 3P0IA 2EFHB 3TB6A 1GGNA 1VKZA 2AZXA 2ZI5A 2FFHA 2H1CA 3QF7A 4G65A 3VO9A 3B3GA 2ZAMA 1QVWA 3FLEA 3QEKA 4IPTA 5FHQA 3V4PB 1DINA 1JU4A 2HV8A 1J9GA 2JGDB 5BOSA 3HKEA 4U2EA 4WKNA 3TPFA 2JFHA 1P1JA 2H1WA 4HWTA 1TI7A 4JXKA 2G9VA 1P62B 1JSLA 5DNAA 3KVOA 5IULC 4FCVA 3TZQA 2VWPA 2XMCA 2OO7A 4KO3S 4KXQA 2IEDA 2ZCUA 5HZKA 4F1JA 1EVKA 3OZCA 3QEMA 5JSUA 4XWWA 3G2MA 1TQ8A 2V65A 3ZI7A 1K9SA 4X45A 3A4VA 1NUQA 2PLFA 3S8MA 1JXOA 1XOIA 1O1YA 2XADA 3BCSA 2ZI3A 4J7XA 4NAUA 1BXZA 2NZ2A 4TS4A 1OMOA 3H9BA 2W2TA 1I9GA 3GNTA 1PIWA 1DZ3A 8OHMA 3SJUA 3LC1O 1A9XB 3PK0A 1Q44A 3OQNA 1DXOA 2HMVA 1J8VA 1ZQ1A 1E3LA 5LOVB 2RH4A 1V1RB 5HQ3A 1SUDA 2FH5B 4U7HA 1N6RA 2HEIA 2R7AA 4X6LA 2H2IA 1PTJC 2WTEA 2WG0A 5DI9A 5KYKA 1U98A 4ZTBA 1BD3A 5IJWA 2C2WA 3LM8A 1AZSC 4JFRA 3FTCA 3UHFA 1A7KA 3PTLA 2VO1A 1Z5ZA 2XXAA 3HCRA 4MS3A 1QYRA 2ZDHA 2VJNA 1EXVA 4FGLA 4DQ0A 4MWGA 5H80A 1RLOA 1XVTA 5G0UA 2DVMA 1R10A 4BC1A 1DWQA 1G8JA 1R5OA 2UDPA 3ORHA 1P5RA 1DE0A 4PO8A 5LNK6 4Z9BA 4BNDB 1L4HA 5I9MA 5T8KA 4JKIA 4KQMA 2FQYA 4IOMA 2WOOA 3T9EA 5BWLA 5KX5B 2AJDA 2J46A 3VOAA 1N7JA 4C7BA 1FQWA 5CNIA 4EENA 1YZYA 1MB2A 1XVAA 4YMGA 3FGOA 1YB6A 5E4TA 4TXLA 1K9VF 4YR9A 3AB3A 4R2XA 3ZTTA 4XSVA 1L5NA 3T7SA 3OT1A 5GY7A 5JLJA 3VTKA 5FL7D 5LIRA 2HLHA 4UKDA 5I9NA 1GQYA 3N2IA 2Q3MA 1A2OA 5K8IA 4YHHB 3LZCA 4ETIA 3A7EA 4QPZA 1DL5A 4UVGA 5LBTA 4QAJA 1JIQA 1CVRA 1NFRA 3E3NA 4IJWA 4F6RA 1L5OA 2E4AA 1PRYA 1VXRA 1WEHA 1ZX1A 1YDWA 2P11A 2P2ZA 2J33A 1THZA 2YXBA 1LW6E 2E37A 3R41A 3RBXA 1RJWA 3QVOA 2P9ZA 3HNRA 3OZXA 3CEJA 4QFCA 4ID3A 4X1IB 4PINA 5KCZA 3EQ9A 4WRRA 1VLZA 3LIIA 4MS4A 3DJYA 1JEOA 2IGTA 1NKSA 1XMJA 2YHSA 3FF4A 3GJ3A 4OH7A 3REQA 3UMGA 1W59A 3VR5D 4COKA 4D3FA 4AWAA 5THQA 1BH6A 5KOJB 3KDSE 5F73A 5KTMA 4TT3D 2N1MA 2I7DA 3IPYA 3V2IA 3IEKA 3LK6A 3AI7A 3NALA 1WTAA 5LXTB 2W6IA 2FKAA 3HP7A 3PIDA 4M53A 1DIHA 5IP5A 1LUAA 3V7FA 3B51X 2X8BA 5ERYA 4ARVA 1U8ZA 4AC9A 1M10A 1HLGA 3WG9A 4R2KA 2HIGA 3GP8A 3MWEA 4UZSA 5IM5A 1JYEA 4WXRA 4DIDA 4D9NA 2R1VB 2WSYB 4R1UA 1GR0A 5TF0A 2FNAA 3UG6A 3ZVNA 4RH0A 2D1SA 3IQXA 1X7YB 2FEAA 2XQGA 1GZUA 4WCVA 1QQBA 4JUFA 1SIUA 4KXXA 5EERA 5CX1B 5CHEA 1XVVA 4QUKA 2JLQA 5AW1A 2HU2A 1R00A 3UB2A 5HM8A 1FLDA 1SOWA 3JPWA 3O4GA 4KQ6A 5LB2A 2G9UA 2PS9A 1T4MA 2XA1A 3N2LA 4X5OA 1VSBA 1TM5E 2HXGA 3E5MA 4H3VA 4PTYA 4BB9A 5LP1A 5TS3A 3K6RA 1BXGB 1QS0B 2NGRA 4FEGA 3NTRA 4JI6B 3ROKA 2ZS8A 4D9FA 1T3SA 1ZD3A 2WKPA 2WKWA 3AK4A 4Q4JB 2VN8A 3ZGLA 1NXSA 1YE5A 2FQWA 1NGSA 2O0JA 2P0AA 2XNHA 2GVNA 3BWCA 4RORA 1SUBA 4UXJA 4MCHA 2Z5GA 4P5DA 4X1KB 4QE3A 4OHCA 5A0VA 4RK7A 4R69A 1CQIB 4JYCA 3VYRB 3COZA 1VP9A 2FN4A 2ATEA 3MRTA 4C3OB 1HDRA 3SI7A 1Q84A 1XAJA 2H29A 2YVUA 1WO8A 4R0NA 2IUEA 4XI9A 4C7OB 3T9BA 2I1WA 4JYMA 4RNDB 3LPLA 3FGPA 3ITEA 4O2BB 3MB8A 4IQ0A 1HDZA 2B82A 1TCCA 2JLBA 2PA3A 4CF3A 4PLYA 2VDMB 3HKDB 4I8IA 4QHYA 2G63A 2COUA 1JLLB 4X92A 5KBYA 1RXWA 4CG1A 3O4JA 1A97A 1W8DA 2DOKA 2O3SA 1YB2A 3IS3A 4OOFA 1OHHA 2YNMD 3CZQA 3NLLA 4AZ0B 5E6UB 4O4JF 1VGVA 3OX2A 1XKTA 4L95C 1W2WB 4D97A 2Y1KA 3TIGA 1XZKA 1V0JA 3NUZA 3R0JA 2ONYA 4M37A 4PPQA 2IZ0A 1HOXA 4PBSA 5J2TF 2BGIA 5BR7A 1OX4B 3MVEA 3PFBA 5DHQA 2AZDA 1U04A 3FUVA 2OV6A 2PMCA 3HRIA 3OQOA 1RXVA 1R4MA 1A9OA 2WFLB 1ZUHA 2QQEA 3OM0A 1UEIA 1KH2A 4Y6QA 3QVKA 3H5LA 5CT9A 2WV9A 5J3JA 1GZ4A 2V9ZA 4DUYB 4BP1A 4QGHA 1BC5A 4NCNA 1KE2A 2HRCA 2HCRA 1U2SA 4TT3A 1KYZA 1IK6A 3UJAA 3TTTA 3A6JA 3RFUA 3DDWA 1AV7A 3M5PA 2YX1A 4M1QA 2NIPA 4BQQA 4C0LA 5FUQA 1TUBA 5JJLA 1CYDA 3CLSD 4GPD1 4IHAA 2PZLA 2GVZC 2J4DA 3MMNA 2G9RA 3R9KA 1BX0A 4CLRB 1XQ9A 2Q1YA 4AMZA 4MH0R 4YRKA 1E2KA 3DZHA 5EEGA 4JROA 4URHA 3FLBA 5J5VA 3OZEA 1L4KA 3TRFA 1EVJA 3QXCA 2CLHB 4RABA 1UXGA 3QLUA 1YDFA 2G5GX 4DF3A 4Q9LA 3G8CA 5SZIA 1WZUA 2QYTA 4MA4A 4RNCA 2FLWA 3L8DA 5I7FA 1AGPA 1ZD4A 4HYYA 1ZJYA 5F7XA 4ZVMA 5LLSA 1ACJA 3HFJA 4MS3B 3IJ5A 4KXWA 3I6ZA 5H4GA 3VVBA 1YL6A 2J48A 3N39C 3IAFA 1FVXA 3TG8A 3SBOA 1FZQA 2ECFA 2QQ0A 1UC4B 4X60A 5IAKA 1IH8A 3KJEA 3HCFA 1UJBA 4YRLA 3OE7D 3U2QA 2F1KA 1BX3A 1MO5A 1P4RA 1I32A 1ZUIA 2FN8A 3BWVA 2GASA 3ET5A 3PXCX 5DLEA 3ZD7A 1KBZA 2XUDA 3AMVA 1LNZA 5JUWA 3U19A 1CB0A 3U3JA 2AJTA 2W70A 1M8FA 1S89A 5JEDA 2Z30A 5B37A 4DCMA 3VOTA 3OJEA 5DW3A 5KWJA 1N2XA 2HNKA 1SC6A 2WINI 3TDMA 1HDIA 5G41A 3DVRX 4BATA 1KJ8A 1W88B 4XDZA 4IIFA 4L15A 2F64A 1A95A 5JS7A 5IZCA 1FYFA 5A9TA 1GL6A 3E48A 3H4TA 1WXXA 3R6WA 2R8YA 5ER9A 4BJ5A 3C45A 4ER3A 4MP6A 5AJUA 1Y3CE 4IJVA 2C4WA 2GEBA 1VYUA 1IZ9A 3RRJA 1P81A 1WXFA 1TM1E 5IEBA 4RF2A 3K70B 4ROSA 2V7XA 4L78A 3HKCA 4UUOA 3UK2A 1EG2A 4G36A 5HUJA 2F1RA 2VSQA 3IKLA 4KGZA 2IHJA 4ZYUA 5AW8A 2IEYA 4LYAA 4I08A 5G0WA 5BN4B 3TIXB 1WDKA 3HKDA 1V8FA 3OZUA 4Q4HB 1N6NA 3EVNA 4MR7B 4Q1EA 2DLNA 1B8NA 1K27A 3BMNB 2BFCB 1VYVA 1ACLA 1QH1B 1ZVJA 1MCZA 4V0LA 1XO1A 1GQQA 5IMBA 4C89A 1NHGA 5CB4A 1J0CA 3E27A 3CH7A 4Q3BA 3W6NA 3V8VA 1V37A 2PQ6A 3NBMA 3UVEA 3K9GA 4ZZ3A 4KITB 2QUZA 1QVAA 3I23A 4TVBA 4UEWA 2FMKA 4Y2JA 1PDVA 3E5RA 1TYZA 3TXYA 1D1PA 2UAGA 3JSXA 3A06A 3Q9NA 4G4JA 5JTUA 2IJGX 3SSMA 2X5OA 2FPGB 3NETA 1JHDA 1OKKD 2G17A 5BN5A 1SVKA 3DEIA 4O1HA 3E8XA 5JSZA 2QMUA 4P4SA 3SR0A 4A10A 1YA4A 3UGJA 4FQ5A 3R3JA 2Z5VA 5F23A 4HO1X 1U28A 4MKZA 4C6SA 2GNPA 4P80A 5IJ0B 1PJ8A 2FHSA 3F2VA 5FNVF 5EXEA 1QK4A 1HYGA 2FSHA 4BIIA 4C07A 4MI3A 3H11A 121PA 2PV7A 1DKMA 4RK1A 3GY0A 1YIOA 3ZK9A 4B46A 4DXAA 3PT5A 2FMUA 1EP9A 2JD2A 2WSBA 3K0FA 1X7YA 3BWMA 4XGIA 1IG3A 3WLJA 4C29A 5C5IA 4G8BA 1XNHA 5K3AA 5JAIA 1GRQA 5ALTA 2KJQA 2WD7A 4RS3A 5DGDA 4QXRA 4J03A 4YCBA 4NEHB 4D9IA 1KZYC 4CDMA 3L79A 1UQUA 5TJ9A 1XQWA 2CZGA 5FR1A 3A6ZA 2DBZA 1QGAA 4BRUA 1EA5A 1K3TA 4LI3X 4Q0MA 3DT8A 4HDRB 4US2R 1CUXA 3CT6A 2A7XA 4R6XA 1Y1TA 3AERA 3D8RA 4MGZR 1JIKA 3NORA 1YCDA 4ITRC 5FBLB 4DMMA 3OECA 4ZQIA 3IVGA 3HGMA 3I5YA 1Z35A 2X6TA 1OU4A 3UMJA 1KEUA 4PLCA 3H83A 2C0QA 3U3XA 2YN2A 1K8QA 3CF4G 2ATXA 3HKBA 3RADC 1ULZA 5LQUA 4ZGWA 3OY7A 1C29B 4IKPA 3PUZA 1PNVA 1TJNA 1TO6A 3F7OA 5KC9A 3QBTA 5CBPA 2H2AA 2QJTA 4QPNA 4MZXA 1P4HA 1TC2A 4GRDA 5CTAA 1FMLA 3GW8A 3KLMX 3AHIA 2HPHA 3F0TA 3LIPA 4O3FA 4P2GA 3ZZTA 4QEZA 3K92A 3TFWA 3NRBA 4QUEA 1DP4A 2EJUA 3ELBA 3PDIB 4FCWA 5L4NA 1YWGO 1BMTA 2QJRA 4FHEA 2GHTA 2H2GA 2ZG6A 2CLIB 3O82A 3T5TA 3UYKA 1TOAA 1WY5A 4UPDA 1DV1A 1YKGA 2Q6IA 2IEGA 2YS7A 4JI4B 3QEOA 1E1NA 1C4KA 3R6DA 2ZANA 3GUYA 4B3IA 3H13A 3LXRA 5JISA 3EF1A 3G9ZA 3OKCA 2KBEA 4W5WA 4R1TA 4DDMA 5FBWB 3KTFA 5K5EA 5BW4A 2A0FA 2PLRA 4NESA 5K0ZA 4QM6A 1EFPA 1NBWB 4NSNA 1QG0A 2RKBA 1X9HA 3ZS9A 4W6QA 1CTQA 4B6OA 4EHKA 1ELOA 4CM9A 4ZK2A 3K0SA 2HR1A 1JHAA 1FL9A 1I6WA 2IOQA 3EQ2A 1RWVA 4OSOA 5TPWB 3UT0A 2CUKA 4BWFB 2UU9B 1NQ5A 5EE3A 4F84A 2A4KA 3PNQA 2F8SA 1KMNA 4H18A 5CH5A 4F1KA 1PG0A 3F4LA 3MLEA 3U7QA 3HVRA 1XZPA 4PZ9A 2K2QB 2VP2A 2UV8A 5AW9A 1KIMA 2QP9X 2JLSA 5C4MA 2OO3A 3QWAA 3L40A 621PA 1X15A 3C6KA 4V3CA 3OPYI 1KL7A 2HMUA 4EGSA 5BNFA 5SY9A 5FLEX 3WHPA 4FYMA 5EJ6A 5MN4A 4CEHB 3KOUA 1PWZA 5H3CA 1X3SA 2DQSA 2SCUA 3DVAB 4IVRA 2YYZA 1NV9A 1UUFA 2O7RA 3DXFA 4EFLA 1HL3A 1XJWA 4ABYA 5B12A 3GZ4A 3MMZA 2WIKA 4C4TA 2WWIA 4BUZA 4CDRA 3V9PA 1GUZA 2DTEA 2Z1MA 4R3WA 4PSVA 3TQHA 3H05A 2A9JA 3TOCA 2XZLA 3ETNA 3SEZA 4A82A 2AUNA 3BXHA 1KJJA 2PL1A 3FPSA 1AD2A 1NVXQ 1M2HA 3CIOA 1NJSA 3L0OA 4M88A 4FFVA 1WD5A 2IE8A 4G84A 5HIJA 2WJAA 3TE7A 4FB5A 4J6EA 1U0NA 2E87A 4DIUA 5AWFC 1WSWA 1N4DA 5AOAA 1P0CA 4ZT7A 3WWCA 1QF7A 4M55A 1PE0A 1YVUA 5L45A 5DTEA 4IMJB 1NOKA 3IUBA 4S0XA 2OT3B 2FSIA 2WJGA 5ALOA 4QDKA 3TR6A 4MIOA 2CUNA 3DQPA 3PUJA 2LR0A 3IE0A 1NUHA 4CIYA 3WJ7A 1VKNA 1K7EB 5JPDA 2CLOB 3MAJA 2IHNA 3VBCA 2HIMA 1GJRA 4XGKA 1QFSA 5C7YA 3W77A 3UOGA 4ALIA 1E2BA 1ZLYA 3IUMA 3SQWA 3I6YA 2X3UA 4UW9A 3WLMA 2C0CA 3L18A 4C9BA </