3DQZA

Structure of the hydroxynitrile lyase from arabidopsis thaliana
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
256
structure length
256
Chain Sequence
b'RKHHFVLVHNAYHGAWIWYKLKPLLESAGHRVTAVELAASGIDPRPIQAVETVDEYSKPLIETLKSLPENEEVILVGFSFGGINIALAADIFPAKIKVLVFLNAFLPDTTHVPSHVLDKYMEMPGGLGDCEFSSHETRNGTMSLLKMGPKFMKARLYQNCPIEDYELAKMLHRQGSFFTEDLSKKEKFSEEGYGSVQRVYVMSSEDKAIPCDFIRWMIDNFNVSKVYEIDGGDHMVMLSKPQKLFDSLSAIATDYM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-hydroxynitrile lyase-like protein
molecule tags Lyase
source organism Arabidopsis thaliana
publication title Hydroxynitrile lyases with alpha / beta-hydrolase fold: two enzymes with almost identical 3D structures but opposite enantioselectivities and different reaction mechanisms
pubmed doi rcsb
total genus 90
structure length 256
sequence length 256
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.10: (R)-mandelonitrile lyase.
pdb deposition date 2008-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3dqzA00
1LPSA 1JT2A 3SWWA 4JYMA 4MEAA 1CUIA 5CRIA 4UFOA 4X7BA 1RP1A 2VQ6A 1Y7HA 3O4GA 5AKYA 3OC0A 2O2IA 1ACLA 3HLKA 5D3ZA 5AM3A 4HRYA 2Z8XA 2PBLA 4XX1A 4Q3OA 5ALSA 1OILA 4BDSA 4H18A 3D59A 2WU3A 5F4ZA 5AP9A 3F67A 4LXHA 5K3DA 5ALYA 3KD2A 5A2GA 4CIAA 4RPCA 1XKTA 1YA4A 4BVKA 5AI5A 4OU4A 2QJWA 3R3WA 2B4KA 4B9EA 3W2TA 4AO6A 1VZ3A 4H7DA 5AKXA 1DTEA 5AHXA 3DKKA 1FSSA 2C7BA 4CCWA 1QIGA 3SK0A 3W04A 4B85A 1QIFA 5ALLA 5C81A 4YPVA 5KBYA 4KE6A 1PV1A 1UK8A 2WFMA 3LLCA 4FLMA 4PQEA 1MX5A 3QBJA 5JZBA 3BE8A 5EIAA 4Y2TA 3FYUC 5KREA 3PF9A 3LS2A 4I19A 5AI8A 1FFBA 1W1IA 4XIIA 5HQ3B 4OYYA 5JZSA 2WSLA 1QE3A 2XE4A 2WLSA 2HL6A 3ESAA 1AURA 2ACKA 2RHTA 1THGA 5A62A 2AJLI 4Y2YA 4ROTA 1WHTA 1YS2X 2VTVA 1ZJ5A 2HHAA 2ZJ7A 3WK5A 3WKDA 1CFJA 1EDDA 5AJHA 2WHPB 4NS4A 1XZAA 3WWDA 5AM0A 1XZKA 3BDVA 5ALJA 4DSZA 1E89A 3QPCA 4ZXFA 4N5HX 3OPMA 1XQVA 5DYYA 4KAAA 3R40A 1S8OA 3G0CA 2J3DA 3CN9A 1UXOA 3JWEA 3ED1A 2OCIA 3V1NA 4MQLA 1VA4A 3VJLA 1H22A 4S0XA 1SCIA 2O7RA 2G4LA 3ANSA 1CUFA 5JAHA 2Y6VA 3F98A 3T4UA 4CI9A 4Q1VA 5LZ9A 1N1MA 3CCCA 4LKOA 3LCRA 4EY4A 4UHFA 3RLIA 5LP1A 5K3AA 5EHZA 1ZJ4A 4J0IA 2I3ZA 3I2JA 1YS1X 4N5IX 4DNOA 2J3QA 4HXEB 3EQ9A 3VJMA 1QIIA 5EHQA 2I78A 1EB8A 5CT8A 4JUIA 1IZ8A 2O2HA 3C8DA 4QZVA 1UK9A 4Q3LA 1JJFA 3O4HA 5DWDA 3HABA 1BCRA 1BROA 2PUJA 4G9EA 2FX5A 3STTA 4QDXA 5FP0A 4B83A 1UFOA 2QZPA 3AIOA 4FLEA 2JGLA 3AJAA 4BCDA 3EIOA 3M3DA 5HF9A 4H7JA 1NU8A 1QIHA 5FPQA 2XMZA 1CR6A 4UBKA 3AFIA 4X95A 1X2BA 1N5MA 2PL5A 2XMDA 3FWHA 3DQZA 2Y2UA 3I6YA 4BATA 4HXFB 1JMYA 4WFKA 1SC9A 1MNAA 3G0DA 2XUPA 3WYDA 4FKBA 3I6ZA 5K3FA 1C7JA 1QTRA 4B7ZA 2GBCA 1UT6A 1IUNA 4BRSA 4ZREA 5AIAA 3FLAA 1W75A 4BTLA 3V1KA 1UKBA 4LYEA 2WJ3A 1SCKA 2HRQA 3FNBA 4X85A 4ZRDA 3W05A 2CZQA 4DMCA 4BP8A 4A5SA 2PUHA 1OXMA 5I7UA 4IH1A 2P8SA 4KRXA 2PSDA 3IUJA 1ODTC 4UFPA 4LXGA 4DLNA 2HA6A 2DCMA 4FBMA 1TCAA 3DLTA 1HDEA 2JGFA 4J3JA 4BBZA 3WK7A 4FBLA 4EB0A 4FFWA 5AKJA 1O6FA 1JKMA 6YASA 1B6GA 3ICVA 3LIPA 2HU5A 5BWBA 3X3HA 3FLEA 5JIBA 5AI0A 1JFRA 2ZSIA 1BU8A 4BP9A 2CKMA 4DSAA 3AZQA 1UOPA 3UMJA 4C01A 1VZ2A 1JJIA 3IURA 1QIEA 2WM2A 2VJDA 3SX4A 1H2WA 4AB1A 2QM0A 1FFCA 4ZV7A 3WKBA 5AK5A 5AKIA 5EIHA 1LPNA 5JASA 4TPKA 4W1PA 3GUUA 3H1AA 3BIWA 3I2FA 3IDAA 4ETWA 1XFDA 3OURA 4UBIA 3V1MA 1FFAA 1F0NA 2DHCA 2HA0A 1ETHA 4U2EA 5A71A 3I28A 2ZJFA 4RNCA 4BE9A 4J0CA 3DL4A 5CH3A 4WFJA 1NU6A 3QMWA 2V98A 4AZ3A 3D7RA 2HA5A 3WK6A 2OGTA 4EA6A 1HQDA 4QDUA 3WJ2A 1W76A 1VA5A 1LBSA 2JF0A 2QOEA 4C88A 4N8DA 4P9NA 4BVLA 5JALA 1W4LA 2QUBA 5CT5A 2ONCA 3QYJA 5BOVA 1HL7A 3WKAA 2DFPA 3F97A 1LPPA 1DX6A 1QZ3A 1GQSA 1XZMA 3JW8A 3DS8A 4UHCA 5CBKA 1CRLA 1O6GA 3ANTA 2JEZA 1XLUA 5JAPA 3WL7A 3LP5A 1FFEA 1GPKA 1QO9A 4G4GA 3M83A 1CUSA 4H0CA 4MYSA 4DYHA 3WL8A 4AMZA 3GFFA 5ALWA 2RGUA 2AJ8A 4X6XA 5H3HA 5AICA 1Q0RA 5JADA 1ZI9A 3A2NA 3R3VA 5ALTA 3KDAA 2HDWA 2I3DA 4B84A 3DEAA 4X6YA 3WI7A 1XQXA 4JH0A 3PFCA 4H35A 3B3QA 5ALVA 1LZLA 4CIBA 1GKKA 3L1HA 1EVQA 3H18A 2IIVA 4KACA 1UKAA 1MNQA 4WDRA 2D0DA 3E1GA 4G4IA 2QR5A 1G4HA 4HRXA 2D5LA 4UFNA 4UHBA 5HZGA 5ALXA 4ITVA 1P0PA 3DOHA 1WPRA 4G8CA 3C87A 1KU0A 5AKGA 3H2JA 2WJ6A 1UK7A 2H7YA 4HAIA 3BWXA 4RE5A 1C4XA 1QO7A 7YASA 4J0DA 3C70A 1GXSA 1QTIA 2C5GA 1JJBA 3WK8A 3KWJA 4X91A 4J7AA 3FCYA 1E8MA 3WWCA 2OAEA 4DTCA 1XRPA 4E46A 2WHRA 4BAZA 1AMNA 1CPYA 3QPDA 3ZPXA 3DL7A 2WUGA 1CUVA 2WG0A 1EI9A 2OPHA 3R3YA 4K5QA 4L3WA 4WY5A 3NOXA 2Y2VA 4HZGA 4LYDA 4B0OA 1CUXA 3D2BA 3C5VA 2IX9A 4LXIA 1SOMA 4PSUA 2CJPA 4FFVA 2AJDA 1CUCA 4BCCA 2WIDA 3HYSA 2VAXA 3UUEA 2RHWA 5ALOA 1BN6A 5CTAA 1J2EA 4BYMA 2ES4A 1XZGA 3RKSA 1ZD2P 5LYYA 2JBWA 5CH8A 1OCEA 2WFZA 4J0GA 3BL8A 2Z3ZA 1BEEA 3E3AA 4NVRA 1QFSA 2WILA 1H2YA 2AJBA 1IUPA 1G5FA 3G02A 2H9YA 3H2HA 3KSRA 3W06A 1VLQA 2WFLA 1TRHA 2BFNA 4X00A 3ZV7A 2X8BA 3EQ7A 5AKLA 4B80A 3CN7A 2YH2A 3WJ1A 2QKYA 1UKCA 1EHYA 1ORWA 2AJCA 4OB8A 3R41A 1DT3A 4E11A 1MN6A 4QDZA 4C87A 2BUCA 4UBOA 1WB6A 4INZA 4G4JA 2BCEA 4Y2SA 2OCGA 1XKLA 2XQJA 4X71A 1QFMA 4EZIA 4BC0A 1IUOA 2XUOA 5C8ZA 4P93A 4P92A 4G5XA 2V9ZA 2WQZA 2Y6UA 5YASA 4DGQA 1CUHA 5T4HA 3GROA 2YYSA 1BEZA 5HF6A 4EHBA 1MTZA 2XUHA 3DYIA 4U2BA 5DYWA 1EDBA 3C6ZA 5AOBA 3UUFA 3V1LA 5ALEA 1CIJA 1MX1A 5T4FA 3VXKA 2IITA 2JEYA 3N0TA 3KWFA 2DSNA 4H7KA 4DNFA 2ZVDA 4A16A 1XZFA 5K5EA 4U2CA 1ODSA 2OCKA 3FYUA 4D9JA 1XZHA 2ROQA 3VVLA 2GYUA 3GELA 1ZIXA 3G9ZA 4X3CA 5K3FB 3DKRA 1WPXA 4J0KA 1CQZA 3MGAA 2YASA 2XLCA 1CUEA 4LHEA 5IVHA 2XQFA 3I2KA 1Z68A 3HEAA 3O4JA 3STWA 4ZWNA 3NWOA 5KWJA 5K3BA 3ICWA 2HA3A 1W6RA 2HU7A 4IHAA 4Q05A 5LKRA 3FVTA 1XLVA 5LZ2A 1CLEA 3KOOA 3VDXA 1TAHA 5ALQA 3EBLA 4Y2XA 5JYCA 3AZOA 4QDTA 2WJ4A 1A8SA 1W52X 5CXUA 2VATA 4Y7DA 1ORVA 4Y2RA 3BJRA 2OAGA 1E66A 4X93A 2FJPA 3I2HA 4UHDA 2XUAA 3I1IA 5FOQA 2V96A 5IVKA 4B0PA 4LIPD 1RYYA 2HFJA 2OQIA 3A6ZA 1A7UA 3T52A 1AC5A 4M0FA 5D7BA 3W9UA 4AQDA 2J4CA 5ESRA 3ILSA 3IULA 1H23A 3QH4A 5JD4A 3C5WP 5CT4A 3I2GA 2C58A 2ZYSA 3G8YA 1QIMA 1TK3A 5T4EA 2R8BA 1GPNA 4FDMA 4C4YA 1DWQA 4QNNA 5DJ5A 3L1JA 3D2CA 1EB9A 3H2KA 3Q8WA 2DQZA 1YAHA 5E4TA 4KE9A 5FV4A 3PF8A 5AOCA 1CUGA 1EK1A 5ALUA 4J0JA 1R3DA 2WG2A 3TEJA 4C6HA 5CW2A 2EDAA 5ALIA 2OXEA 5FLKA 2QMQA 4UBMA 4P08A 1SCQA 2K2QB 1TKRA 1PFQA 4N8EA 1A8QA 1VXRA 4KAFA 1U2EA 3G9TA 4DM7A 4FMPA 1IMJA 3V9AA 4BDTA 4TGLA 5AO9A 5C8XA 4OPMA 2UZ0A 3KXPA 3AZPA 2QJRA 1AZWA 1IZ7A 3HSSA 4U2FA 1DQYA 3I6MA 3YASA 1EINA 2O7VA 5FXMA 2XMBA 3A2LA 1BS9A 1QIDA 5AI6A 4O08A 5CMLA 3OOSA 2DQYA 1R9NA 4EY7A 1HPLA 5HFAA 1K63A 4UPDA 1XRQA 3IA2A 4BC1A 1U4NA 2W22A 2PPLA 4DMKA 4MWSA 4EY8A 4XVCA 5LZ4A 4OD0A 1MPXA 1SFRA 2QRUA 3BDIA 4AO7A 4FLFA 4ARAA 5DTJA 1CUZA 4JYPA 2WTMA 4IO0A 5HF8A 1EK2A 1LPBB 1LZKA 2XUGA 1JU3A 2PSJA 3IUQA 3EF3A 3AIMA 3STUA 5DNVA 2HIHA 4XWGA 1XRRA 3FSGA 5JD5A 3ESDA 4GI1A 3WYNA 1LGYA 3STXA 2OG1A 4GHWA 3MVEA 4CCYB 4C89A 3F8SA 1U65A 1DWOA 3A70A 2PVSA 4W63A 5E4JA 2HRRA 4GDMA 4BTVA 3R3XA 3JYHA 1VJ5A 4K6GA 4X97A 1ODCA 1QJ4A 4H77A 5AKZA 3QPAA 2Z8ZA 1L7RA 5HF5A 2WUEA 3O95A 2C5FA 4MQMA 5CT6A 1Y37A 5AKHA 4IQ4A 4PNZA 2WIGA 3C43A 5K3EA 2PX6A 5EI5A 3H0CA 3WL5A 4K6HA 5A7FA 4KAJA 1E5TA 1VOTA 3IIIA 5AKKA 1BN7A 1IVYA 3C8HA 4EBBA 1XQWA 4Y2VA 3WZLA 2H7XA 3FAKA 2BUBA 2PSHA 3DOIA 4GWLA 4AZ0A 4BAGA 4QLAA 4G8DA 4QWWA 1YB6A 2VJAA 4E15A 3O9MA 3G7NA 3K6KA 4OCZA 2DHDA 1WCYA 2WG1A 2OGSA 4YASA 4CG1A 1WM1A 2ZJ6A 2C0PA 2XI4A 2LIPA 5EHXA 4OU5A 4X6UA 5ISMA 2HA7A 4BRZA 3V48A 4UUQA 4F21A 3BXPA 3H04A 2CB9A 4BE4A 1EA5A 4I4CA 4DNPA 5FKJA 2QUAA 4WCVA 1R9MA 5FUMA 1GZ7A 2WFLB 3QZUA 3HC7A 3O0DA 1BRTA 3MUNA 4KE8A 3VISA 1A8UA 3B12A 1R88A 2QXUA 3G9UA 2O2GA 1CQWA 3PDCA 1XQYA 3SC2A 3Q0TA 2OLEA 1CUBA 1CV2A 4H7IA 1N5RA 3M82A 3D2AA 4H7EA 4FWBA 4FNMA 1WB4A 3PICA 4QE3A 3DNMA 3WKEA 1F6WA 1ZICA 4JNCA 4W1QA 2XMSA 2RAUA 1XZIA 2WHQA 3STYA 4HXGA 2VJBA 5JARA 5ALFA 1P0QA 1TCCA 5EIEA 3HI4A 3C6BA 3S2ZA 1EH5A 4L72A 2PSEA 3CXUA 3FOBA 4K6KA 4EY6A 1XZBA 1DWPA 5HK9A 3WWEA 1U8EA 3STVA 2G5PA 2Z5GA 2RI6A 2JGMA 2OCLA 1LPAB 1QIJA 2CBGA 1DT5A 5SYNA 1DQZA 4L0CA 4FNGA 3QMMA 1K8QA 2ORYA 5I9IA 5HKBA 2GZSA 2PU5A 1H2ZA 4IH4A 4QWMA 2GYWA 2QVBA 3O4IA 3TRDA 4Y2JA 4GECA 5AH0A 4BZWA 4Q34A 4JEIA 4UBNA 5K3CA 3IB3A 3QVMA 2VA9A 3H19A 3VJKA 1YB7A 3WA6A 4UHEA 4GXNA 2WIJA 3F96A 1DINA 3PE6A 1J07A 1CUWA 3WWPA 4WJLA 2ACEA 2HA4A 3C6XA 3IVMA 5D3KA 5ALKA 3BF8A 4FTWA 4B9AA 4AN0A 1TCBA 2WIKA 2DHEA 1CUDA 2C4HA 3WQHA 2YXPX 4Z49A 4ARBA 2FJ0A 1B41A 3H2GA 4CG3A 3M81A 3VVMA 5ALDA 5LIPA 4ZV9A 2VF2A 3WA7A 1BE0A 5LZ5A 3TGLA 4C4XA 3DD5A 1E3QA 4GBGA 2WHPA 3GA7A 3VKFA 3RARA 2XMQA 2XLBA 3U1TA 4B6GA 3P2MA 5JAUA 1JI3A 1EDEA 1G66A 1MJ5A 2H7CA 4C4ZA 2BJHA 5EFZA 1UOQA 2XUJA 2QS9A 4DNQA 4L9AA 1AKNA 2WKWA 2I03A 4CG2A 5DTIA 4N8SA 4WDQA 5HCUA 4RE6A 4I3FA 2HM7A 3R3ZA 5HQ3A 5CH5A 2HA2A 4NMWA 1Q83A 5FDFA 4HS9A 3WKCA 4DMFA 5AI9A 3K9BA 5HKAA 2XDWA 3PUHA 3DJYA 1AUOA 4G9GA 5EGNA 1K6EA 4DIUA 5AI4A 5BWCA 3I2IA 1CEXA 1XRLA 1A88A 4J0HA 1GKLA 5LLSA 2PSFA 4HVTA 1CVLA 2VEOA 2R11A 5JAOA 3G9XA 5IVDA 5LKAA 2JGKA 1XZCA 2X5XA 2X76A 2XUQA 1XZEA 1ZGCA 4UBLA 1WOMA 3E4DA 4OSEA 4Y9SA 4NZZA 3W9BA 2PKYX 5AM4A 2VJCA 4PW0A 2GZRA 3D4LA 2EEPA 3AIKA 3NGMA 2QXTA 4MJ3A 5DLPA 1ZI6A 2XB6A 4UBJA 2HU8A 5AK6A 4PSCA 2WU4A 1EVEA 1WB5A 3F9CA 4QEKA 2XMRA 2JGEA 3FLBA 2GBIA 4ZI5A 3IBTA 1XROA 4OUKX 5HK8A 1X2EA 4DMHA 5LZ8A 3D3NA 1MU0A 2WUDA 4AO8A 2XUKA 2GBGA 2XMCA 4QLOA 2WUFA 4MXDA 3K2IA 5CURA 2JGJA 3FYTA 2RONA 1YAJA 2PM8A 1LLFA 3HJUA 2VAVA 1QONA 2ZSHA 3DYVA 1AGYA 4A23A 1THTA 5CXXA 1Q84A 1X70A 4PSDA 3WMRA 5IH7A 1RWQA 1ZI8A 3AUKA 3MUOA 4F60A 3R3UA 3DDUA 1ZGBA 3DCNA 2VSQA 4OB7A 1FFDA 1Y7IA 3B5EA 4QDOA 5AM5A 3GBSA 3OG9A 2JGIA 4QA9A 1MAHA 5ALPA 2V97A 5E4YA 1DU4A 5DNWA 1QGED 1ZOIA 2BGNA 5FPPA 2HFKA 1HBJA 5IVIA 2JIDA 3H1BA 1LPOA 5A7HA 2G5TA 4KR0A 3FVRA 4BZZA 4GEGA 2PU7A 2XUDA 1AQLA 4EY5A 4RGYA 4X92A 5ALNA 5SYMA 4BB0A 1WHSA 4M0MA 4AXBA 4E14A 3FBWA 3R0VA 1VE6A 5AM1A 1TQHA 5BV7A 2ZYRA 5E2IA 5T4BA 1MT3A 3ZLUA 1MX9A 1ZIYA 1XZDA 4U2DA 5ALMA 3WK9A 3WK4A 1F0PA 2AXEA 2RIPA 1VXOA 1GT6A 3ZWQA 2OQVA 1NX9A 2NW6A 3WLAA 2CUTA 3S8YA 4WFIA 3G0IA 1CUAA 2GYVA 1LBTA 5EHNA 3BJMA 4BAUA 1R1DA 3RK4A 5ALRA 4CCYA 5C7YA 2ECFA 2C0QA 2B20A 2BGRA 4MEBA 1ZD5A 1USWA 1QLWA 1EX9A 3ZLTA 2DR0A 3I1YA 1XZLA 1KU6A 2QT9A 4ZGBA 4YX9A 1CUYA 5DYTA 1XRNA 3PI6A 3GZJA 5ALZA 2W6CX 1VE7A 4PV7A 2WTNA 2B9VA 4AMYA 1N8SA 4YK7A 3OTQA 4W9RA 1AX9A 4KE7A 3AILA 4UHHA 3ESCA 2HADA 4CFSA 1LPMA 1YASA 4KJXA 3G0GA 3H2IA 4KRYA 5AOAA 4FHZA 4XJVA 4BVJA 3G0BA 3D0KA 1H2XA 4BCBA 3C45A 3H17A 1VKHA 5HFNA 1JU4A 4KYVA 4HTAA 4FOLA 2QTBA 1XLWA 2Q0XA 2XQGA 3ZI7A 2CEKA 1EXWA 4G1FA 5I8PA 4Y2PA 4TVKA 4Y2QA 1T2NA 3PUIA 1F8UA 5A6VA 1ACJA 1M33A 4PO3X 4GLBA 2B61A 2BKLA 2ZYIA 2OGZA 5J3JA 1TIBA 1ISPA 3D5EA 1L7AA 3OM8A 1LNSA 3BIXA 4X94A 1E8NA 5AK4A 1CUUA 3E0XA 4H7HA 1UK6A 5ALHA 1D07A 5CT9A 2Y1KA 2BUAA 4OB6A 1YA8A 1E8DA 4AX4A 4F5ZA 1UZAA 1UOOA 3A2MA 3IUNA 2XUFA 1G42A 3WIOA 1C7IA 1JMKC 1XZJA 1J06A 3HACA 4PF1A 3IUMA 4OYLA 2WIFA 1YCDA 2VT6A 1J1IA 5JD6A 2H1IA 3C6YA 1GPLA 4IH9A 1MO2A 3FCXA 3L1IA 1P0MA 1UWCA 1FJ2A 3WIBA 2ZYHA 2GBFA 3PFBA 2XQKA 3FYUB 4AN1A 3CCBA 2G63A 2BAGA 1QOZA 1KEZA 5JZ9A 4MYDA 4F0JA 5C8VA 3EQ8A 3QMVA 3N2ZB 2XT0A 4H7FA 3LIIA 1YR2A 1HKHA 4W1SA 4V2IA 3HRHA 5FRDA 5ALGA 5LZ7A 3QITA 2J4FA 3BF7A 1XRMA 1CUJA 4B82A 2XQIA 2VT7A 1BCSA 4J03A 3ESBA 5JANA 1GGVA 5JATA 5AM2A 4Q3KA 2FUKA 2XMGA 1DX4A 2Z3WA 3AINA 1GQRA 3WWOA 1R4ZA 5AKEA 4K2AA 4M0EA 5IKXA 4MWTA 3NUZA 2CMFA 2E3JA 3WZMA 3HXKA 5DNUA 4Y2UA 3RM3A 1ZD4A 4KEAA 1T4MA 4EUSA 1Q0ZA 3O9VA 2EDCA 1P0IA 1K5PA 1HLGA 4G8BA 5A7GA 1YSCA 3U0VA 1K4YA 5AK3A 5AIBA 4X90A 3FSGD 1QIKA 3HZOA 4GW3A 4U2GA 1PJAA 3QM1A 5D6OA 4W1RA 3WL6A 3TJMA 1I6WA 1R50A 4B81A 5KWIA 3ZLVA 1MAAA 1L7QA 1ZD3A 4WY8A 2XUIA 4Q82A
chains in the Genus database with same CATH superfamily
1CQPA 2ZSBA 3R7AA 3EASA 2OT3B 4NCBA 1PNRA 1Z0UA 1TU0A 1BEUB 5CRIA 3ZVLA 2SNIE 2NO7A 4R8LA 4TM7A 4Z8XA 1JYSA 3O7WA 4LSWA 4WBSA 4X7BA 3IPLA 1HEUA 4WUTA 3WS7A 1ZK1A 3BXZA 5E3JA 1W94A 1K6JA 1ZL2A 2BV3A 3TZBA 4DL9A 3C97A 3TK1A 2C2GA 5EIBC 2O2IA 4IGFA 3P45A 1KYZA 3THYB 4LMPA 4WXMA 4TMVA 2RSLA 3M49A 2CW5A 1I1NA 1YIOA 1HEIA 4WE3A 3H9BA 1TC2A 4XX1A 2Y8EA 4FUQA 4C3ZA 1CDEA 1B1AA 1X15A 5DI3B 4GL4A 3NEAA 3E7XA 4MUIA 4NCAA 4R8VA 3ZWVA 3DV0A 4W7HA 4DCSA 1DGQA 2QX9A 5F4ZA 1YI8A 2VWPA 3E9ZA 3KDPA 4C30A 2WSMA 5KNCD 4TN1A 4PLCA 5B58C 1SCJA 4EPWA 2LGJA 5BMVF 1MXHA 1VRWA 1XKTA 4WHMA 2WTAA 1QP7A 1RI4A 1K8XB 1E2UA 1O3YA 2F4NA 2QRVB 4C2TA 4MICA 2QJWA 1FW6A 1MDBA 2I6GA 1IOZA 2IT1A 5FTLA 3VSDA 3DPUA 3BORA 4H3KB 4H7DA 4ZVUA 4EF4A 3FMVA 3EJ6A 2N9UA 3IJRA 3GBPA 1MAVA 4M0PA 3FPHA 1DUSA 1FSSA 5KU7A 2GCNA 2H2AA 1NPDA 3L8FA 2C7BA 2NXWA 3DQPA 5DHTA 4LOIA 5KHLB 3EZLA 3H4TA 1E99A 3W04A 4KLRA 1EAYA 1U9IA 5HIKA 5JI3E 5C81A 2ATEA 2QRLA 3CIOA 3IILA 1CY2A 5WRFA 3L93A 3UEOA 3VHQA 4GI2A 3QEMA 4JCCA 3EIUA 1QDEA 4UE3S 3LBYA 4YI3A 1KJWA 4RK7A 3LPDA 4KE6A 1PV1A 4I55B 2WFMA 3ESQA 4QECA 3LLCA 5JVDF 1P3Y1 4JC5A 2PEYA 1OOEA 2B98A 2B6HA 3TI9A 2ZQZA 4EKDA 3GPLA 3GJSA 5K6TA 3K5PA 3EWIA 3KQWA 5KNLA 2HSDA 3UMSA 2DY0A 5KWEA 4QJ3A 5KAMA 1DCMA 1SA0A 2C98A 4CR7A 5K0GA 1SM4A 3BE8A 3EIQA 4IJ5A 4OHFA 3F5FA 1QNFA 5TY0A 4GX5A 2IHKA 2BGLA 3LPAA 3PHLA 1GAXA 3KAQA 4OAPA 1VPVA 5AI8A 4BMYA 1FJGB 4CM6A 1VHJA 4CM9D 5JZSA 3NVKI 1Z28A 5TEVA 5PNTA 4AYWA 3F3MA 4D0GA 5K9ZA 3GGCA 1QE3A 3DHVA 2WLSA 3IBCA 4GLLA 4FCTA 2GJ8A 4UD6A 1J8VA 5J5VA 3BFVA 3RVDA 3RYCB 2PMCA 4X9XA 4KKVA 1E92A 2GAJA 4LY9A 1BXKA 1KAHA 1N7JA 1N75A 2EATA 1HYGA 4RLQA 2NZ2A 1PCXA 4C4TA 5IKMA 4MYCA 3H5TA 2OP1A 3WL4A 4OMFG 5CJPA 4OO3A 2J7KA 2C1XA 3TLJA 5C7OO 2J7PD 1PX2A 3K32A 3UMFA 3I37X 1Q0TA 4WLVA 4LNAA 1IOWA 2XIQA 2YOGA 1I14A 1RBMA 5LQJA 1PSWA 2CXHA 2ZJ7A 3D4PA 1R0KA 3HKCA 1RJ9B 3PQ3A 4CODB 3DWGA 1UBOS 3WKDA 4YPOA 4JLPA 2DWCA 1E79D 2FRVA 5DEOA 4ZDIA 2DT5A 1DLIA 4JLWA 4OFWA 4N12A 4BN4A 1HFWA 1JHAA 2ZB8A 2WHPB 5KTKA 4MV9A 4RFSB 2WWFA 3HK2A 1V1RA 2EKZA 1GA1A 4B31A 2NZJA 2ZR7A 3OEED 3QPBA 1FLDA 5EINA 4WKNA 2CSXA 2I91A 1U8AA 1AT1A 2BI4A 2VDRB 2DLNA 2C07A 3QPCA 3A2KA 4KODA 5GY7A 1HO3A 2I54A 1LK0A 2PUVA 4JL8A 1P72A 4MI3A 5JT1A 3FROA 2AFIE 5DYYA 4E09A 1X9HA 4YIKA 4KAAA 1J2JA 2N47A 4ZYTA 1KJNA 2R6JA 4QELA 4R1PA 4Z9AA 4HGZA 4K28A 1T24A 1HTTA 1M5RA 1VKRA 3GI1A 3LK6A 3AVTA 1S02A 1L7NA 2WTBA 4UU8A 5TF0A 1K4MA 5GOZA 4HGNA 3SE0A 4OL0A 4MCHA 2V58A 1ZRHA 4AY5A 3HHPA 4NPHA 5TV2A 1GPUA 3ED1A 4TN5A 3V1NA 3ZZMA 1B00A 1Y3IA 2C8KA 3K72B 4Q12A 2Z0MA 1OX4A 3KQTA 3FKQA 4MH0R 4OFXA 1SCIA 2CMKA 1IHYA 4C1NA 4FFNA 1J24A 1O1YA 4CKZA 4WLOA 3VZQA 4ZODA 4LK3A 2Y6VA 1KEKA 4BLRA 3RKUA 4PN7A 3ABSB 2XH8A 3TQTA 4AIRA 4R41A 2HRZA 2UDPA 4PGGA 5LSAA 3QW4B 3QLUC 3UTCA 4Z3KA 4P6VF 3S7TA 2DE0X 4WZ6A 3DE6X 3LY5A 2OC4A 4ZYWA 1EG7A 4A8TA 3IRVA 2HHJA 3LCRA 2ZI5A 2WWIA 3F6PA 1E9AA 4MO9A 2IFTA 4PC7A 4UHFA 3TZQA 1P7ZA 2FY8A 2P30A 4PYJA 2CVZA 2XXBA 3EXFA 4P35A 1BXGA 2HGZA 2H2FA 4KBFA 3LMKA 3O3OB 5EMNA 4GZ3A 2CVFA 1XCPA 4DS3A 4OI0A 3DT8A 3JTMA 1D4OA 1T1EA 2GEVA 2QTWB 2R0QC 4J94A 5A9SB 1DARA 2N1MA 4HXEB 4R3UC 3VJMA 1QIIA 4Y98A 3NC0C 3SDBA 4R2WA 4EPTA 5EL0A 1YGYA 1PK9A 1MJGA 3V2HA 1AHHA 1C0LA 1GG8A 1KSHA 1Y3CE 2W6ZA 4JJEA 5CT8A 5DTEA 1HLFA 3MT0A 1IZ8A 2H65A 4JUIA 4MA4A 1JEDA 4BO2A 1D7OA 1DCTA 2I4LA 3PEWA 4Q3LA 1GCIA 1TF5A 3QBTA 3AR3A 3O4HA 4UVGA 5DNEA 3WV5A 4YY3B 3LG2A 3HJCA 3M5DA 3ER8A 4QBKA 3A0UA 5KTRA 1O58A 1U1IA 1DJMA 3IEKA 1Z6TA 4RWEA 4ZOQI 2D2IA 3OHPA 4TLAA 3HM2A 5FUVA 5BYKA 4RDXA 1N8KA 5CGZA 1QYXA 1SVOA 4MVJH 4G9EA 4O4IB 2CNKA 4OP2A 5C4GB 3STTA 3WHLA 3WNCA 5K4GA 5GINE 4DR5B 4F3CA 3WISA 2CNWA 2QTRA 2VHJA 4TV9B 5ILQA 4A6EA 5FPSA 1UFOA 2VHZA 1TF2A 2QZPA 2XKAA 4M76B 1I7DA 5EMLA 4IXDA 2JGLA 4E51A 2P3QA 3QX7A 1QE5A 1NKSA 2YV4A 5HIMA 5KDDA 1YA6A 2DLCX 2ZSUA 3F6YA 4G0XA 1LNZA 1TZKA 3FPJA 3LUAA 1LJUA 2FPRA 4OJQA 2I2WA 3FJOA 1GUZA 5B1DA 3OPQA 2A30A 4NKRA 1OAKA 4AG5A 1XD2A 1I7LA 2XYPA 1IM2A 5K8IA 1Z6PA 4GF5A 4M1EA 1JKJA 1SJ9A 3INYA 1DOAA 1XHFA 2P0AA 2HCTA 4D3ZA 1QF7A 3IOCA 4UBKA 2C2XA 3IBSA 3G79A 1KQ3A 2O54A 5I7VA 1TM7E 2WVHA 2PL5A 1AE1A 3GCDA 4BLUA 1SPXA 1EMDA 5HE8A 3IEUA 2CNBA 3ESXA 1VJTA 3K7EA 3LPCA 3R5TA 4EYOA 1SHUX 2NZ8A 1TM1E 2VHCA 3KVRA 4BATA 1T6XA 4LRYA 2J08A 1FSZA 1IPHA 1ODFA 2XCIA 3F7MA 4J6FA 4UZSA 4X1OA 5EIFA 5FUXA 4LQ4A 2W42A 1ONBA 2IIPA 1TTTA 4RULA 4E2XA 4Z1MD 3KR2A 2NADA 3LZDA 4EH1A 3A4MA 1M6WA 2B8WA 4G84A 2J59A 4LNUA 3WYDA 1T1JA 1UBCA 5K3FA 3S1AA 2WE7A 1YQQA 3OIYA 1F5NA 1I1QB 3B6JA 2GBCA 4B7ZA 4J1TA 2WLTA 3LWBA 4BO8A 1GY8A 4UKDA 1RKXA 3BFJA 4BRSA 1HDCA 4ZREA 1GUDA 4NYIQ 3N8DA 5AIAA 3FLAA 5IT4A 3DE4X 2FPOA 3GB9A 4IQ0A 4CM1A 3UJNA 1UKBA 4LYEA 4HHEA 3ZHRA 4V0RA 1JFFB 1SCKA 3AEKB 3FNBA 5BYBA 2CZQA 3OMWA 4HLQB 3ND7A 1C1XA 2AR7A 1U8UA 4BP8A 1FNMA 4E1AA 2EXXA 3U61B 4DPLA 3SZMA 1VDZA 4QM6A 1U04A 5CCXA 3IEPA 1GGHA 4NFYA 1ZUNA 1NDHA 2QNRA 2XBLA 2FK8A 3HVIA 4WXEA 1N2ZA 2QN2A 3GV0A 1PDWA 4Z1MA 2MR5A 4V02A 5COAA 1P7PA 5A3VA 3K1AB 3A1FA 4UHJA 3FZNA 5SICE 1ODTC 2E6UX 4QTZA 1AGNA 3G2MA 1R0RE 4GR4A 3GMDA 5DYIA 2DCMA 1PL0A 3COWA 4KDCA 2PGJA 1U8TA 1EWTA 1TVKA 2VPQA 2PUCA 4RTKA 1T8UA 1O0SA 1RQRA 1X92A 2B94A 2XOXA 4KO2S 5T6BA 4J3JA 4U9IS 4JI2B 2JRCA 4RACA 2HNBA 3SVTA 3GD7A 3PHHA 4FBLA 4M0CA 4EB0A 4FMCB 1XRJA 1SQSA 5DFAA 1IN6A 3INGA 5B4TA 2CMHA 4KQCA 1KQGA 1T2FA 2WB4A 3ABOB 3G2PA 4DLKA 1L5KA 1EESA 4FFWA 2BFEB 1Z4MA 1O6FA 2E87A 3GUZA 1Q91A 2V6GA 4NYIR 3WAJA 3GPCA 4HAWA 1YE5A 1RPJA 3EUAA 1A95A 3C48A 3M1IA 1SKBA 3OTHA 4MRMA 5EZYB 3TB6A 5DNYB 4OM7A 4AY6A 1Q7GA 2J5QA 3GJXC 3ITEA 2C77A 3X3HA 2GZMA 3FLEA 2IV7A 2RH9B 1Z0AA 2FRDA 4ECAA 2ZSIA 1P2FA 4BP9A 1POXA 1L5VA 2CKMA 3O8OB 4RK0A 4TTIA 3AZQA 1UOPA 4DCJA 5DGTA 3FHLA 4EG4A 3F0TA 3VO8A 2PRIA 5EQDA 2RC5A 2QR2A 3E5NA 1W4AA 4JOCA 1FMJA 3B3JA 1LF5A 3T1VA 4BQSA 4EI9A 3SX2A 1VZ2A 3ZDBA 3PT9A 3P9YA 4XAQA 2HLDD 4O2AF 3L1UA 3H1GA 1PBNA 3V4OA 3WJ7A 3SX4A 5IANA 2OK7A 2GD0A 4HN2A 3RFUA 4QHYA 3W6OA 5ICSA 4UHKA 1RWPA 2LCIA 3OCUA 1XG5A 1Q2UA 1FFCA 1N5DA 4KPFC 1YJ5A 5BVGB 1LS1A 5FHQA 2FRDC 3O03A 1Z3IX 3V8BA 3MZ0A 4ZEVA 4TPKA 3TZLA 2FP4A 3MCZA 3FPLA 2FZLA 4OTZA 1IHDA 5C8YA 2C5AA 3WDSA 2FZKA 5B4VA 4W1PA 4AICA 2VYCA 3ZWKA 4O5AA 2JRLA 3KTOA 2J9FB 4IVPA 3I2FA 1SXJB 3IDAA 3SC6A 4EUKA 3G5LA 4U02A 1R0CA 1XVTA 2D1SA 4GSKA 1P6QA 3N39C 5ETJA 1KEEB 1NVTA 3P9RA 4DCVA 4YBZA 5DMHA 1L5YA 2ZRQA 3BYZA 1F0NA 4E6EA 1R4NA 1FXUA 2HA0A 1COZA 1XVAA 1N0WA 1EJ2A 3D1LA 2PY6A 3HBAA 2BHNA 2NXEA 3SKYA 3QEBZ 2PZEA 5AHOA 2JATA 2P0YA 5T41A 1V43A 2CVHA 2W43A 3RWMB 1IBCA 2I76A 1KYVA 1Q0LA 2OXIA 5L3QB 2JFZA 3MFQA 1WHTB 1D1TA 3M5WA 5CH3A 5DXJA 2V98A 4HDSA 4R84A 4NCNA 3JQRA 3CZ9A 1ZEMA 1VE5A 1A4RA 5LL6P 3GVIA 3V33A 4AF6A 3FXAA 4NE9A 2QYOA 4QYIA 2NT4A 4Q9JA 3JR3A 5E7MA 4WBNA 2JFUA 2AI2A 3KOXA 3GFRA 1Q6ZA 4N8DA 4PNPA 3ZQ6A 4BVLA 4UOQA 4JC4A 3PWTA 1TRKA 4D8YA 1QQAA 3HA7A 1OXTA 1S8FA 3O8QA 3QP9A 2H4HA 1RJGA 5CT5A 3KBBA 2GN9A 3QI7A 3VPXA 1Z08A 5EPOA 1F3LA 4C14A 1Z7GA 2O8CB 2QVGA 3U4QA 2WZBA 3RU2A 3PYLA 4YRIA 2GJ4A 2IEYA 4N3BA 3WKAA 4F96A 6REQA 4CQLA 3F97A 4PRZA 3EDCA 2C7VA 3FR8A 3F1LA 3NM6B 1UBRS 1YVEI 2YNMC 3PGVA 4OJYA 1DX6A 3UV7A 3PE4A 5DRYA 1LLCA 2CF6A 3OQJA 3VNQA 1AMOA 5A4IS 2BD0A 3VTKA 3H84A 2FPKA 3VNUA 1NQAO 2ZVQX 2NIPA 2DC1A 2QK4A 3AI2A 2UVPB 3I9MA 5D2CA 5B7NA 3QKRA 9ABPA 5F9HA 1SUDA 4PRKA 2R84A 4NX2A 3B60A 3VPBA 2D4AA 5AUNB 1O6GA 3DMHA 4F2HA 1U4SA 5CDYA 1VL1A 1E9FA 1R6DA 3ORQA 4MS1B 4AM8A 3GUHA 4K9RA 3HKBB 3LP5A 3HCPA 2GLXA 4J8PA 1G6KA 4CLHA 4U7DA 1HT1E 1BNCA 3HPRA 3KVYA 3PTAA 1NP7A 4RJJA 3CPEA 4HPJB 1IL0A 2H06A 3ZWDA 3HCCA 1SHLA 2YV2A 4RJKA 3K5WA 4M1WA 1X1AA 4E5PA 1R10A 4MWGA 1BDBA 4B6SA 4ID3A 4DG8A 2W4MA 1QJCA 4GBMA 4NV0A 4Q37A 4URZR 1HWYA 4ERNA 2RB4A 1NF3A 1QH1B 3GPIA 4WEQA 4OI1A 3MTEA 5I48A 4PZUA 1P80A 2OHOA 4YUZA 5CBPB 1OH6A 2NPFA 4KIGA 2AJ8A 2EF0A 5FBWB 3I6IA 4YCNA 4Q9IA 2B3DA 5C80A 2PK3A 1K89A 3EEOA 3C0KA 1MV8A 3AJRA 1ECGA 1QRRA 1ZI9A 2UAGA 2VSOA 3ND8A 4JJAA 3BZWA 3TOSA 5ALTA 3JQGB 3KDAA 3RQSA 3VR6A 1GVHA 3ROMA 1Q1ZA 3IQEA 3N2KB 1QOQB 3RWOA 2ILVA 2NNWB 1CQJB 4JH0A 5LP6B 3O1HB 3PFCA 1WBJB 2K87A 2RI1A 5A0FA 1A4UA 2Y4NA 3LQRA 2AWOA 2I8AA 3B3QA 2NGRA 3NM5A 5CFMA 3PHBE 1I8TA 3R9KA 3MCUA 4CIBA 4HATA 2EW1A 1GU0A 2X1HA 2QTHA 3ACCA 3IKVA 3U49A 4PAWA 3H18A 4UEJA 4WD3A 2IIVA 2NZYA 3S2EA 4LAFA 4MVXA 4P98A 1CB0A 2D5IA 3IXMA 4WAUA 2GQ0A 4M3NA 1UKAA 2OA0A 3T5AA 4P58A 1MNQA 2Y9MB 4WDRA 3NMUF 3E1GA 3W6NA 1NE2A 1MGPA 4Y6GB 3DMTC 2AQKA 4LHSA 1QHNA 4LZZA 4PAOA 4ZO9A 3VHXA 4OOEA 1D2AA 5BN5A 1PSZA 3FTFA 2D5LA 1I36A 3PBKA 2FR1A 2OL4A 3KU1A 3OPYA 4II2A 3ABIA 4BVGA 2IL1A 5E1OA 1MZPA 1JR3E 4RCYA 1T2EA 1ESMA 3CUVA 3ZHYA 4PY2A 5K0CA 1I7QB 1N3BA 3R6DA 2PPVA 4MV3A 3B9RA 3MW8A 3OWHA 4H3SA 3DOHA 4ZQHA 1WPRA 4L7QA 4P83A 1Y9AA 4G8CA 3C87A 1QH8A 5H02A 1KU0A 4HX9A 1G8GA 1NOKA 5AKGA 1JQBA 3BG5A 2GILA 4BS9A 2X2OA 4GSLA 3LDAA 4S12A 3U13A 5BMOA 1UK7A 4PPFA 5FO1A 4MV8A 1OD6A 1DRVA 2A1TR 2EP8A 2SICE 2FMTA 1D7AA 1OFVA 1QO7A 1VYUA 4AJ9A 1L3BA 2CDRA 4O4HF 2EBFX 5T3UA 5AUPB 4J0DA 4Z4QA 1RU3A 3FUTA 1OWOA 4MCJA 4EB6A 2JD0A 1WXHA 2WV9A 3K9LA 2P6RA 2ZUUA 3TXAA 5D1HA 1KJQA 2HN9A 1HSZA 1L4FA 4K05A 4OYRA 1V71A 4QUAA 3AM3A 3PGMA 3WK8A 1MB4A 3SQLA 2FLKA 3OECA 4KXQA 4J7AA 4LJYA 3E6AA 4ZOLB 3L0CA 1NZFA 1E8MA 2PZGA 4MQ4A 5DN6D 1M6HA 2AFRA 1I2AA 1KJYA 4QOSA 3ZE1B 5ADWA 1XRPA 2FP4B 4EGSA 1PG2A 1FSGA 3AWDA 3GC6A 1XMIA 2QX6A 4DCCA 1Q7CA 2VDUE 2QTLA 1WV0A 3ZPXA 3DL7A 2WUGA 1G19A 2GTHA 3D2LA 5A3SA 4ENTA 2Z2KA 1EUYA 1Z56C 1BGVA 5U9CA 1Z5ZA 2Z8YM 2AN9A 2QAIA 2OPHA 4BUZA 2QN9A 1XAIA 1IN7A 1I7NA 1OLXB 4JXKA 4WY5A 3PQ6A 3NOXA 1MAWA 2FQWA 4HZGA 4LYDA 4XB6B 1K2VN 1ZA1A 1OFTA 1CUXA 2X9NA 1E3LA 3D2BA 2WWVD 1T2UA 2W2LA 2OORA 3C5VA 5G4KB 3HWRA 3HFJA 4XFKA 3VR1A 3VBEA 1LJLA 4BQRA 1O95A 5GMOA 5AVYA 1O03A 1HORA 2ZRAA 3THXB 2G4CA 2QX7A 2YVUA 4LXIA 1SOMA 2XWJI 2WYIA 5BO5A 1G21E 3OIDA 3UMMA 4RJLA 4M21A 1YT5A 3GUCA 4INOA 1P8AA 1HL3A 4MV7A 3SOPA 1OXSC 4Q1AA 4A1FA 4MZDA 3O31A 3E3LA 2X0FA 1JA1A 3IPRA 3OBBA 1OWNA 1USUA 1IHXA 2G9UA 4UPEA 2QAGB 2PD6A 2A0WA 3KQPA 4LBYA 4N7RA 5KVQA 1FRFS 3USCS 1XZGA 1UXJA 3RU9A 4HDOB 2PRZA 3RKSA 3UCEA 4CKBA 1XF9A 2IHNA 1RXUA 2JHAA 5A4KA 1IHUA 3AEXA 1NBME 1L4MA 4BMNA 5CH8A 2WM8A 3EDYA 1QZTA 1PJ8A 2P9BA 4EX6A 4ZQEA 4J6EA 1F2TB 2ZROA 2A0FA 2PD4A 5CM2Z 2WWHA 1OZFA 3DGFC 1WKVA 2D6FA 1DV1A 2HNAA 2UVQA 4G65A 4PG6A 3DCIA 4GM1A 1QFSA 1TO6A 2BEWA 1L1RA 1Q95A 2YIVX 3A27A 3DAPA 4JSYA 2BPOA 3VMFA 5GONF 3HB7A 2AX3A 2IF2A 3M1LA 1HOTA 3F71A 1G5FA 1UJ4A 2H9YA 3UK0A 1JIKA 3I0MA 3W06A 1FMLA 2IEAA 3LWZA 3RV4A 4X00A 3ZV7A 4NBRA 4HLUC 4G81A 4MCAA 5AKLA 2PWAA 4Z7QB 4UMVA 5TMPA 3FOAA 1U7TA 3PPYA 3WLOA 2GAIA 4B40A 5TVKA 4KXMA 2QKYA 1UKCA 1NPTO 1C7QA 5B4UA 1DBIA 3GXOA 3PS9A 2R97A 4LC0A 5F76A 5JFOA 3MERA 2AJCA 4P36A 2HKIA 3L8HA 4E2WA 2Y1XA 5K8LA 2XCRB 4MDEA 3MWLA 1NQ5A 1E7RA 4LA4A 3COSA 4J3NA 5CDSA 1OTYA 3KCNA 4EQ6B 3D7NA 3AUJB 1BFKA 3AC0A 1RXSA 1D6JA 2RGWA 4Y6QA 3ZS8A 4E11A 1OX6A 2ZJ1A 3W5IA 4DIDA 1YU6A 2GKOA 4R7TA 4A4DA 2VTKA 4XR9A 4KLCA 2CDAA 2XKKA 1G21A 4P0QB 2AFVA 4Y2SA 4F3YA 1XKLA 1IEVA 1LC3A 1O4VA 2XQJA 3KYCA 4EI2A 3O5AA 1FE8A 4BC0A 1AGPA 3G17A 4R6XA 3ELBA 3UA3A 2VUSA 1IUOA 2H3HA 3NFRA 3OCJA 1C9YA 1RHUA 1XDSA 3KOYA 5C8ZA 5IDXA 3OE5A 5JCJD 4BLQA 5K2MA 4RZUA 3TMYA 4EBFA 1QG4A 3SJCA 3ELWA 4C0XA 5YASA 2WPDD 3KQYA 4MINA 5K51A 1A8HA 1TAUA 2P79A 1CUHA 1IN1A 1DRJA 2PLRA 2XF2A 1XNRB 2YYSA 4D56A 3E53A 3IHWA 5FUYA 5IT5A 1WEKA 4DQDA 4XLZA 2VWGA 1MTZA 5BUQA 2XUHA 4I2NA 3U4GA 4EMBA 2DAPA 1EDBA 1G20A 2HXGA 2N0SA 3CWZA 3L79A 2CVQA 4D0NA 3AEQB 5IEJA 2BYTA 2C3YA 2VHTA 4IRUB 3I9OA 3D6JA 5ALEA 5M29A 1A7JA 3PVZA 3U26A 4BWYA 1R12A 1SK9A 3BH0A 2IHTA 1JDVA 2YWCA 3H9UA 1Z4NA 1LX7A 4O0LA 3N0TA 3NOOA 4B3IA 2HQSA 5DT9A 2X4IA 3EGDA 5TQ2A 4DNFA 3UAXA 3BIJA 1OIWA 2GZ3A 3LNTA 4ZI2A 2B7BA 1XZFA 4PZEA 4ZKEA 1GZVA 2WPDA 1O94C 2FE4A 4LVUA 4EATA 1E4YA 4NFSA 1I3OA 1JSCA 3N8IA 1NQUA 1ODSA 4YQZA 5FI0B 3WYEA 2HHHB 4ZAGA 3GJQA 2FVXA 2YWBA 3WLIA 5FA6A 3SN6A 1U3WA 4FD3A 3TZEA 1L2TA 1XZHA 2ROQA 3CF0A 4Q9HA 2KWIA 2ZDGA 3CZ4A 4FDTA 5J43A 3MJCA 3PGLA 3G9ZA 4Q7MB 4H9GA 4HGQA 4MW2A 4X3CA 3V1YA 4BEJA 4PINA 3W5UA 1WPXA 1X8KA 1WHSB 3ZS9A 1CQZA 4QRIA 4HDCA 4QPNA 4P7KA 2YOHA 3GJ3A 4XD2A 5FI5A 3L8CA 4MV5A 5EVCA 4AZ3B 3TVDA 2EZTA 4EGCB 1DDGA 2W00A 3NBUA 4G2TA 4J9UE 4M0KA 1PQPA 4N47A 3DFKA 3B1ZA 2FEXA 3I2KA 2O5VA 5I01A 2Q29A 1NVGA 1XKQA 4YUXA 3OOJA 4WOPA 3TQRA 2PMWB 2KE5A 3OKCA 3IC5A 3ONVA 2UYOA 3ZQ4A 4H7PA 3VGPA 4RNDB 1STOA 2O1WA 2GZAA 5DBIA 2ZBEA 5A2QA 4CFYA 2HA3A 2C5LA 2BEUA 2PBFA 3CTPA 1IZ9A 3FOCA 3W3AA 1P18A 2GASA 4RMIA 4TTAA 1JH8A 4HDNA 1Z26A 3SY8A 2PGLA 4Q03A 5CIYA 3ZHOA 3GWZA 1E5VA 4GOND 3K6SB 5LJIA 1AQIA 4J4BA 1NFFA 4C5BA 3EJWA 4HQ0A 4ZAZA 1E1CA 5TQ0B 2OWEA 1Q20A 3TLAA 4EZBA 1XLVA 4GYYA 4N03A 4BV3A 2VYND 1G21B 2D3WA 3G2NA 3Q9LA 2FDCA 3KOOA 3VDXA 4B7CA 3A05A 4HN9A 1SXIA 4LVNA 2VJQA 5HX7A 4IDNA 4RTQA 5JFGA 1LW6E 4Q9DA 3K5IA 1DJLA 1JQAA 2DTDA 3DDZX 1EIWA 2QZ9A 1QRTA 1IOVA 3M4XA 4LHVA 3AZOA 1ZXLA 2XW6A 3N3AC 1L7OA 2V74B 1W52X 2YHBA 4TTJA 3W9SA 1XV5A 1QH0A 1ZDMA 1EKXA 2XD9A 4JC8A 1SBTA 4RVSA 2WY2D 1G3RA 4W7SA 1KK0A 3RRZA 3UMBA 3NCTA 1E66A 3D3QA 3B7PA 5HKLA 5J4HA 4R8KA 2Z6UA 4M87A 2JEOA 1U11A 1H6DA 4Y1RB 7REQA 1WDMA 2RGNA 3KJNA 5A6SB 1VPLA 3D8BA 3I1IA 4KVGA 1U4OA 4EVSA 5FOQA 1N9KA 2DCUA 2V96A 4PGHA 5EP2A 4CHGA 2Q6VA 2G4VA 3OKPA 4C2BA 5IVKA 3GGGA 4QQFA 5CM8B 3B7WA 1NQTA 1RYYA 2A14A 4HDMA 3DM5A 2OQIA 5CTJA 4XSVA 1RW4A 3HE3A 4N0DA 4DLUA 3RC2A 5AVTA 2D4HA 4CTMA 3OQVA 5C4IA 1TYCA 2QJFA 1U3FA 1VL2A 1N3YA 2Z9BA 3NBAA 4EJMA 4M0FA 1DIAA 1XNQB 1FFHA 5HM8A 5IUKC 2IYFA 2SHKA 3N6VA 1UPAA 2HREA 5DM1A 1KI6B 1X1CA 2AK2A 5ESRA 3IALA 1NI4A 4L5YA 2OQRA 1K08A 4C7KA 1KK3A 2QUHA 1K6XA 1GCGA 3GEEA 4HWPA 5BSGA 3ZDQA 4R83A 2A5YB 1GTG1 2O8BB 1IEXA 4AUNA 4I1SA 5JSKA 3SZRA 4GMGA 4RHTA 1OXXK 1FVHA 2PRYA 1J42A 3P20A 1QZXA 1W44A 3VDNB 1H23A 4LV8B 5IM4F 4I6JA 3QH4A 1PZHA 2JCGA 1X1EA 5HIIA 4DG9A 2CV1A 1E2MA 5FUBA 3OAAA 3ICEA 2VHXA 3OT1A 1ZRMA 1G4AE 1GG2A 5H70A 1QIMA 2OC9A 4BNDA 2IH4A 1JQ5A 2F3QA 3F8TA 1WNFA 2QL6A 2P75A 1DWQA 4JN6B 1GO2A 5JLJA 1FL9A 2C3MA 3KPJA 1SU6A 3A31A 5G4KA 1PD1A 5DJ5A 3V32A 3D2CA 1EB9A 1J1UA 2QVXX 5EG5A 1JIIA 1G0NA 4RS4A 4C7MA 1EK5A 3HBMA 3PF8A 5EP1A 4XFDA 3BXXA 4ABTA 2R4TA 2PZLA 5IDYA 1EK1A 1ISIA 1FP4B 5CA0A 3WO1A 3DAFA 4OVKA 1NATA 5FNVB 3LYAA 3TIFA 3DKVA 1BXRA 3VZBA 3JATA 1E4VA 3JX9A 1E5XA 3HSYA 3A6EA 2V7XA 4RXMA 2G09A 4E07A 4EPYA 1Y5IA 4XRGA 3F4LA 3ND6A 4P32A 4IOLA 2OXEA 5ALIA 2ONYA 2G9ZA 1GAQA 5FLKA 3EB9A 4LJ7A 1PR9A 4B2YA 4Q4CA 2E5WA 4UBMA 1O2DA 1U0RA 5J2TB 4YO7A 4XTRA 5F5LA 1Z16A 2AKAB 2JH8A 3UW3A 2YFKA 1G20E 3TZHA 4XX0A 5E7IA 2PFSA 2DBQA 5DIZA 5EOVA 4UTPA 4CQNA 2EFDB 1N6OA 3SDZA 4TS1A 4QPJC 1D6MA 3DWEX 2KS6A 1W5BA 5J63A 4EF6A 2I7TA 3NEPX 5FTWA 2ZIWB 4MV6A 1GSOA 2B2NA 4FXPA 3EXHB 5AJYA 3EIWA 4XDHA 5JAQA 2ECKA 4EWLA 1KIAA 4K9PA 4F3KA 3SYLA 4HEA6 2QRHA 5JBIA 2OZLA 3DE2X 4YMTA 3RAJA 4BDTA 1Y5RA 2R4UA 1UM8A 3MFYA 4KK4A 5AO9A 1T34A 1NQOA 5C8XA 3DHNA 1FUYB 3OFKA 2FG5A 4OPMA 1ZUD1 2IDMA 3JYNA 2Q3HA 3IV7A 1PR3A 4H3VA 3AYXB 3Q0EA 4TSFA 5IPFA 1Z4KA 2JZNA 5K8CA 2QJRA 1IZ7A 3UWKA 3ZJUA 2AKEA 4Q16A 2EX4A 2YV3A 2GK4A 2RHHA 3ANXA 1XTJA 3RFXA 3HYRA 2G7MC 5HJ7A 5L6MB 1CY6A 1WDLA 2VZEA 3QWFA 4FGSA 2CV2A 2NYVA 1QC5A 1WD7A 3MG9A 4NBSA 3V8MA 4JEUA 1NGSA 4BFXA 3NTVA 4EB6B 3PL1A 2J9RA 3L8YA 1CZLA 2JJ2D 2IPXA 4YRZA 2DTXA 1SXPA 1J0DA 4RQUA 4E4TA 1KDVA 4JLBA 2DPXA 1EFVB 4HBZA 4RTJA 2BLNA 2QRKA 1RAAA 3MB5A 1DBSA 3B6MA 4FK8A 4JA0A 4ZHQA 1T1SA 3ON5A 3W5BA 4Y18A 4L5JA 2O50A 2QQ0A 5CYOA 4KXLA 4ZI7A 4WQMA 4I1YA 4RJTA 4CIYA 1KVSA 2C7GA 1SC1A 3I9V6 4AP5A 1J0EA 2KPOA 1KC3A 3AL0C 2JCXA 3DB1A 1PT9A 3VKHA 2BEJA 3IDSA 3KQSA 3FWPA 4DEVA 4RV4A 3PXGA 4TT3D 3ZJTA 2KX7A 5TB5A 4C0SA 2YTZA 4YMHA 3U62A 2JB9A 1AKQA 1U4NA 2GZDA 3KEQA 4HG2A 4PR3A 5CR9A 3B7GA 3GJRA 3TDNA 1NF8A 3HO1A 3EIEA 3P27A 4QPDA 1OT5A 4H60A 2V3VA 2V7PA 2AW5A 1AY0A 3CE9A 3JD3A 3QU2A 2XZPA 1O54A 2YJTD 4MKHA 2O3TA 3RNOA 4OA8A 4H16A 3N7UA 1H42A 4Q3CA 1AXEA 2WZCA 3TUIC 4XA8A 4EY8A 4XVCA 4LBWA 3T7IA 5LZ4A 1PP4A 3VZSA 2BHLA 2QB5A 3T61A 3UK7A 1JH9A 1MPXA 1SFRA 1GG9A 1VSQA 3KKZA 3T9FA 1VRCA 1JEYB 4BECA 4RV5A 1VE3A 3VQTA 2FMUA 5KNBA 2O20A 1M6EX 3N86A 5M04A 4QO8A 2JI4A 2VHYA 1K3FA 4B1FA 3MUEA 4FEGA 1P9NA 1LVGA 4DLTA 1AKUA 2R79A 3A3KA 4W7IA 5BPHA 1DRWA 3QTLA 1CUZA 1DI0A 1UBNA 5B7GA 4X62B 2GTPA 2WTMA 4IO0A 1CJVC 4I9GA 4MS3B 1E1RD 5AQEA 4N5NA 1LZKA 1QFYA 5BSRA 5E2BA 2XUGA 3UK2A 2JCVA 1C9DB 2YZ7A 3QVUA 4IHKA 2I7DA 3HRIA 4M2LA 2C8JA 3UV6A 2AD1A 1NW3A 5JRDS 1WY7A 5HTOA 1HGXA 4RF2A 3IO5A 1E5QA 3LP6A 3UKDA 1MAUA 2DBZA 3FYCA 4XWGA 2XWSA 1XRRA 3AB3A 1GZ6A 3IAM1 3CEJA 3H9CA 5BV2P 5JD5A 3ESYA 3ESDA 4AZ0B 4DA0A 3WYNA 1PGPA 1T5HX 3N76A 4REMA 4B3FX 1G5TA 4FILA 1T9CA 2WK1A 4ZZ2A 4MIYA 5DO9A 2RK3A 3AVVA 5F33A 4ZV4A 1U65A 1Q1GA 4UNIA 5CVUA 2OV4A 2PVSA 3AV0B 1U9CA 3ROEA 4TKMA 1E1RA 4M8NE 1WTAA 1ZIPA 2FPUA 3A4NA 4XTCS 2IH5A 1ZAKA 3JYHA 2I0FA 1VJ5A 4KTVE 3V00A 4X97A 1ZONA 4AT1A 4GC5A 3RUDA 1WUKS 4F45A 2D59A 2EGGA 2Q0HA 4IUDS 4YCMA 4HNRA 1K8RA 2OZLB 3BGWA 1XELA 1ZY2A 3DC2A 5AKZA 1V3VA 5EJ2A 3HWWA 4YQYA 5CCDA 4Z7NB 4ZI7B 3PRYA 4D9KA 3T9EA 3Q85A 3GZTB 2D54A 3KELA 4IQ4A 5FLEX 2HPZA 3QJGA 1R18A 4FE4A 3ZHBA 1XN1A 5H81A 5B2ZA 3DF7A 3H0CA 4DUGD 1HT3A 3HEBA 4K6HA 4N3CA 1X86B 1R0BA 1BHQ1 3DGEC 3L6BA 1MA0A 3VR6D 4II7A 2O8CA 3H1EA 2BZ0A 2WQ7A 4ZVKA 4B4DA 4KOAA 3UVEA 2GCPA 3EZFA 3CMMA 3RSOA 4FZJA 4B4WA 1T0BA 2JFGA 3WZLA 1NXVA 1FYEA 1BXRB 4LV5B 5DNDA 5J4VA 1WULS 5DBEX 4M1OA 2IJGX 4HMOA 3ZCVA 1UT8A 2C8LA 5HJ5A 3AHIA 2PSHA 2VNSA 3DOIA 1DMRA 3TSOA 3AEYA 3MTGA 4UZFA 1EM8A 1RYFA 3VV3A 4TZTA 4BMXA 4AZ0A 4Z5XA 2QLTA 1CIVA 4IDGA 3AFNA 3Q12A 4BAGA 4QLAA 2FW8A 4E5YA 3SNHA 2XVAA 1XALA 3KKEA 4PLHA 3N28A 4FFBA 4XASA 4DRYA 4PANA 3AR2A 3UBMA 7ADHA 5KSPA 1TVCA 2H85A 3GLFE 5HMMA 3W6PA 3HR4A 1SPBS 3QF7A 1E7SA 5DF1A 3U7JA 1GN9A 1WCIB 3GDGA 4BQOA 1S4MA 4HVLA 2F3SA 5J4KA 4OHZA 1WCYA 4YASA 1JHRA 3LQYA 5LU9A 4AY4A 1QOPB 3AVPA 4P3NA 2A6PA 4DCUA 2XZOA 4MW4A 1CNMA 1UJ6A 4HGRA 2VCHA 1OXVA 1Q17A 1UDBA 4F1JA 4FP9A 2ZJ0A 2PLFA 5EHXA 4B75A 5E1DA 4OU5A 1KQOA 4YJHB 3EFHA 3I9FA 2HA7A 2FPGA 6GPBA 4HUQA 3V48A 5LUAA 1O9GA 2R48A 2HK7A 4MHTA 1GZ3A 1RE0A 2XNDA 3FIJA 3QE0A 1UJ5A 5B2EA 4MDYA 4CL8A 4QYWA 3V8VA 2CB9A 2W2PA 2WKQA 5IYZB 1QO0A 3HB0A 4J9VA 2BTQB 4I4CA 1Z73A 3KX2A 3UTDA 1DFGA 2QUAA 3EBPA 4FMBB 3RUEA 3UN1A 2ZBFA 4LJ5A 1OWPA 3V7UA 3EIFA 5FUMA 1GZ7A 4R1NA 2Q1WA 3HC7A 1IOLA 4XGIA 4ZQCB 1M2NA 2P2LA 3O0DA 2P9EA 4ZQBA 5LWHA 1ZPDA 2NVUA 1WZNA 3O8DA 4JLSA 3T3OA 3KQVA 1MFZA 2ZANA 4D3DA 4BB9A 4RKRA 1PQYA 3UG7A 3AHGA 3QXXA 4EFMA 1BW9A 2VP2A 1OJ7A 1Z4IA 3AF1A 3HKEA 5DOVA 1QPZA 3AVYA 4NU8X 1ADYA 2G9VA 2PX3A 3DZFA 3FUXA 3MA0A 1DL5A 4LWQA 1DQSA 5CVEA 4F5YA 1C80A 3NTXA 3OQIB 3ZGZA 5I7RA 4C29A 5CB4F 4REQB 1XQYA 1V25A 3VV2A 2JFBA 5F7XA 1CUBA 2QD2A 2WOJA 3U09A 4NF2A 1RPTA 3MBKA 4WZBE 1MFPA 5ESWA 3W2IA 4EW6A 2YW2A 2QU8A 3EE6A 5D5HA 4JX9A 3NYWA 1EFPB 1QFXA 1W88B 3BWYA 2ZETA 3CJQA 2JFNA 1P6UA 4LVCA 1ULTA 3GT3A 4RMHA 3H3JA 4FWBA 4BNZA 2RGEA 2CNNA 4L08A 3URKA 1V47A 2EL9A 2H4JA 3IX7A 2Q62A 4PLFA 1V8OA 3LNCA 4PSVA 1J90A 3WKEA 1GRCA 3DO5A 1F6WA 4BX9A 4W1QA 1E6WA 2VDKB 4LNUB 2MSDB 1XWFA 3H7AA 2YVAA 4EABA 3STYA 3B3GA 2P6MA 3LWNA 1J9GA 2JKYA 2ZZNA 1C1XB 1WMAA 2DZDA 1L8AA 1U0TA 1WOYA 2FX2A 3BOSA 3HWSA 4FDAA 1SMKA 3L82B 4WCFC 3BREA 3KJGA 5H16A 3T12A 3OFND 3U3DA 3VC3A 2QNIA 4H1HA 4TRRA 5ALFA 1XLTC 2W6JD 4WIAA 5L45A 4P4GA 1AH2A 3Q7TA 3O3NB 3HI4A 1Z5NA 1CJBA 1E2KA 2HIMA 2C0CA 3DLPX 1MQAA 1U9IC 4HDQB 1AIPA 1NLUA 4ND7A 4EHHA 5KIAA 3I9JA 4ZT4A 5FWYA 2R1ZA 4GOKA 2PUAA 4R31A 4L72A 1HG0A 4LF6B 1FMCA 3WAGA 2HJHA 1JR4A 4K6KA 4TZKA 3F5DA 2PUEA 4G41A 3I3SR 3L0IB 4J7CA 4HVCA 3UGKA 1SN7A 3D6VA 2C2KA 3LHSA 4KXNA 4OF4A 1GITA 3D3KA 4V0SA 3PQFA 3OESA 5HK9A 3VJRA 3LLSA 4JK3A 4XYMA 5AW1A 1X7YA 3C4VA 3V3KA 1V6SA 2OMKA 3MQFA 3ADKA 2VWQA 3K9GA 1YBAA 1OH5A 2WD8A 1V5IA 4CM8A 1TPZA 2JD1A 4P1ZA 3NWEA 2G5PA 3B85A 3EDQA 4JODA 3EDOA 2GX6A 3DZ8A 1YHZA 2BGTA 2QN8A 2OCLA 1LPAB 4N5LA 4R4JA 3MMZA 4ISCA 4ZPJA 3U37A 4CEHB 3GA0A 5B37A 1Y80A 4L0CA 1K8ZB 1CC1S 4GNRA 4YCJA 4DJFC 4RMGA 3UPUA 4D26A 1YC5A 4CLEA 4K0RA 3NZEA 5JJBA 1D9XA 1XD2B 3PQ8A 3GRYA 3BL6A 3QMMA 1EDZA 3KQHA 4JR0A 2APJA 2IEGA 3LX6A 3OX3A 5JS8A 2ESRA 3H05A 1RM0A 1H2ZA 3EMVA 1F0YA 4I1OA 1WLYA 3HR8A 2QVBA 1BX0A 3K96A 3O4IA 3NVMB 4G5OA 5F2KA 1PWYE 4UPVA 5F1PA 2C96A 1U0OC 4Y2JA 2C84A 1KDYA 3KZ1E 2PKCA 2GJ9A 2OCXA 1KEVA 4DDMA 3UJPA 3HLTA 4JEIA 1SD1A 2EG5A 3V5NA 4K46A 1NVEA 4UBNA 1YZ3A 4L75A 5AOVA 4JJ7A 4DR2B 2JIBA 1ZL0A 1E0DA 3BTSA 4N1AA 1CLUA 1YB7A 4P34A 4D96A 1WKCA 3QENA 4UHEA 4HN4B 4BL5A 3ROTA 4L51A 2XITA 4NIMA 2DP4E 3K53A 3OZIA 1XTUA 1YXMA 3BBLA 3CUEF 4X92A 3GFBA 4F6CA 3QSYA 1OPXA 1UH5A 2ASVA 2FZCA 4RDIA 1HUQA 1Y1LA 4G97A 4KR2A 4L3OA 5AXBA 5KTNA 1G5PA 3A28A 4JL6A 1JTVA 2H59A 4FCVA 5EXDA 1YIDA 1P4RA 3VR3A 5KWSA 1ECCA 1V48A 1ZK4A 3TRKA 2A2ZA 2PX8A 1J0AA 1YS6A 1K5GA 3ACBA 3C6XA 4LX8A 3NETA 2CBXA 4QJIA 4TTTS 1DFIA 1RS0A 3S81A 3ABRB 1JIVA 1UR5A 4KVAA 1XMSA 5TDHA 1A9XA 3VR5D 3FI9A 3LHIA 2AL7A 4FTWA 3L4JA 1YQEA 3T4EA 2GEDA 3AEQA 3TQSA 4D3SA 2IKQA 3ZWBA 3V8RA 5BUSA 1QQ7A 2WIKA 4F91B 5IFKA 2ZTUA 4YCAA 3H5WA 3OCZA 1HRKA 5FNVF 4MR8A 5HPYB 1JUDA 1EEHA 3VDMA 2IXFA 4Z49A 4CIWA 1ZISA 2XXAA 3G2QA 1JHMA 4QUBA 1T8PA 2DJIA 1HR0B 4YWJA 2JK0A 5C9ZA 3PIRA 1PR6A 4JXZA 1PEDA 4BP1A 5ICGA 1AMUA 4UNQA 1H2HA 5LIPA 5H4GA 1P77A 1L8QA 4JVLA 5KI6A 3Q5EA 4TLCA 1NJGA 4ZV9A 4E5VA 3A6KA 1PT8A 3CCFA 4FDUA 4RQAA 1JPJA 2C2ZA 3TTWA 1ZGHA 5LZ5A 1E6EA 1RDFA 4BLOA 1SIBE 2FEOA 1E2IA 4L50A 1E3QA 2HMAA 1RPNA 3LLUA 3AWIA 4KFRA 2PBZA 3N07A 3O21A 5ENVA 2WHPA 3GA7A 3WVNA 3A9TA 1N33B 1T9GR 4IUYA 3VKFA 1U2SA 3QVWA 1W59A 1T10A 4EKEA 2QSZA 1MVOA 1TGVA 3V4FA 5A03A 5ED4A 3D0QA 1M2KA 2E55A 3KAJA 4I0WB 4A1OA 1EFPA 3MAGA 2HF9A 4O4LB 4AURA 4CEIB 1NQXA 1G66A 1GRQA 1ADFA 2H7CA 2VH5R 5HGXA 3JR7A 3PFGA 5E38A 5ESDA 2GZHA 4D6XA 1NC1A 2SKCA 5HXAA 2FR8A 5EFZA 1UOQA 3UQYS 5HILA 5GOTA 2BF4A 1DJQA 3L6UA 1MG0A 1YVRA 1ZG3A 2FWNA 3PEEA 4IMJB 1XMPA 4RO0A 2WKWA 1QMPA 4E3ZA 5DTIA 2GRAA 1G2IA 4IMRA 3L8EA 4Q3EA 4WDQA 1H1TA 3EPJA 3OPNA 1BD3A 4NOKA 5D1NA 4IWNA 1WU7A 5DASA 2LCFA 2YOFA 2JPDA 3OTOB 1DX9A 1U3GA 5CH5A 1U7HA 3KEGA 4LJLA 4PZZA 2QN1A 1TT5B 1EXNA 1Q21A 1VKJA 1VP9A 4HS9A 1VHWA 2KLBA 4ZEOA 3DW3X 4UEWA 1MRSA 1G5HA 1SA0B 3QY9A 4YRQA 3RSGA 3VZDA 3ZDZB 2JLAA 1F8XA 2Q3MA 2CHGA 1KI2A 2FMFA 3PUHA 3BMXA 4G9GA 5KC9A 5EGNA 2C9CA 2PRSA 4FGZA 5FQNA 5BP7A 1K6EA 2UXDB 3GFPA 1V45E 4ZGGA 5ELLA 4NNPA 3GLHE 3R0QA 2G40A 3MWGA 3ZGYA 5AI4A 4DR3B 1I5OA 1RCTE 3I8OA 3I2IA 1KMCA 5ECYA 3OEHD 1CEXA 2C7PA 5JS2A 2P5UA 3NRJA 4WLUA 2ZUBA 5D3QA 4O1MA 4NEHB 5TPWB 4CM8B 3JAMA 2P90A 4GPBA 4S1PA 2DH6A 1KHHA 4EARA 2PSFA 1AXGA 1XTTA 2O3SA 3V8QA 5KOJB 1NBIA 1P9LA 2GBPA 2H54A 1FF9A 4UC0A 2JDID 3BXOA 5LA6A 4EYQA 1JXQA 5IJAA 5JAOA 1FA9A 1G8MA 1WE2A 1RWBA 2HUPA 3G9XA 3ZV5A 1RPZA 1OBFO 4D6PA 4U0KA 2JGKA 5DE3A 2Q2QA 5FBRB 1D2NA 4AZTA 2QTVB 3CUWA 3TOXA 4XQCA 1XZEA 1F0KA 1TW3A 1WOMA 2O05A 2IH2A 4S1WA 4JI3B 4ZJYA 3U80A 4JWKA 5AM4A 1NNEA 1SVIA 2VJCA 2RE8A 5I8ZA 1OA0A 1XCMA 4JHXA 4AZWA 1I4WA 1KY3A 5DLPA 1NOIA 1EM8B 3QVVA 4URWR 4UBJA 2CLFB 5IJZA 3E61A 3PXBA 4IDOA 1KH2A 5LC1A 1H9CA 2Q3FA 2X4LA 1PJLA 2XRMA 3DT6A 3ZCRA 3DVLA 4LF5B 2C92A 3DBIA 1TK9A 1A9PA 1GUYA 4GPTA 5LNK6 3EMDA 1VLLA 2IZ1A 4KMSA 2IPLA 4NENB 4DG5A 1Q1AA 1N2CB 2AG8A 3GDWA 5LZ8A 3M2PA 1L7VC 4EECA 5KYXB 2A1IA 3H8VA 4INJA 3CUUA 2REXB 4PCAA 5JJIA 1N5OX 1P9WA 2BR5A 4L4UA 5TPZA 3RVBA 2UZIR 4JVMA 1U0SY 5K0LA 4AS2A 3UJ9A 1JA9A 1E58A 4WOKA 4ZT7A 2KBFA 2XMCA 4MHOA 1XVVA 4BHTA 4NY1A 2W6ID 1YWGO 2JJ2A 2NUTA 4QTUB 4D9EA 1SEPA 3UT0A 5CLFA 4UEQA 1O96B 4RHUA 3OPXA 5A3RA 1P2GA 2ZBPA 4OHWA 1XZPA 2EWMA 1BJTA 1NMSA 2PMKA 2R6GA 4NFLA 2RONA 1WQ3A 1D2HA 1ORHA 3PXDA 4R1SA 4AFNA 2YW9A 2NXNA 4OEHA 1LLFA 1AS0A 1QZZA 3G7SA 1QONA 3KXKA 1Z4PX 1AS2A 1DBPA 1KR5A 1ONSA 3FVQA 3GHHA 4JJIA 5DSTA 1CG6A 1WDWB 3LUHA 4FOPA 4U5XA 1SHZA 3OO1A 2W6QA 3RFFA 4BO3A 3QOFA 4RHCA 4GUAA 1Q84A 2I5PO 2QAGC 1A5AB 1NSTA 1M2HA 1UXIA 2WI8A 3G2LA 3REQB 1G41A 3V8EA 4Z9FA 1YZTA 1KY4A 4X7RA 5H80A 2G0TA 1M5TA 1NN5A 1W48A 2X5OA 4HQRA 3AUKA 3MUOA 4F60A 1USGA 1DIRA 2YQZA 4LJSA 1KKUA 3VKGA 1OW3B 3DCNA 5G1PA 4YRPA 4ZJPA 1DDOA 3DJFA 4W9NA 3G1TA 4RD3A 1JT9A 1QTNA 2QGFA 2AZDA 1TVMA 4G24A 5K0EA 4BVEA 2AOUA 1UC9A 5CA0F 1XEWX 2O0JA 2PUGA 2Z9DA 3EPPA 1G8KA 3UV3A 2NSYA 2PA3A 1P0FA 2XKJE 1UMCB 3G8CA 4J29A 4WJKB 2I6SA 4KQWA 1IY8A 1SUEA 5ALPA 3VUFA 2V97A 2W0SA 5E4YA 4BMVA 4B2PA 1G64A 1JI0A 2D5AA 3AUAA 4NE2A 1N5JA 2RARA 4ENRA 1L5NA 4XD7D 2ZDQA 4TVOA 1YZNA 4FHFA 4DLVA 1QGED 3LXXA 4N4AA 1T1RA 2BGNA 2XDQA 5FPPA 3VSCA 4C2UA 3NC1C 2HFKA 3H2YA 1PG0A 2GB4A 2QVCA 4JELA 5F2EA 3DV9A 4JBGA 5DM60 1J22A 4DUYB 3P2IA 2VRNA 2H1OA 2E0IA 1M34E 3AERB 1PR1A 1Y8QB 2LRHA 1RC0A 4YP5A 3FJ1A 2G5TA 1G5QA 3ETHA 3LUJA 5A7HA 4KR0A 2V6FA 3FVRA 1C3LA 3W5HA 1C9MA 1NA5A 1OHHD 1NRJB 2J0UB 2WT8A 4X20A 2X19A 3ZU6A 2O0KA 4YDHB 2XUDA 3TQCA 1AQLA 1DTWB 2XE8A 3NNDA 4EY5A 3G85A 5ALNA 3RSFA 4RA6B 5SYMA 3GFVA 4BB0A 4HR7A 1NP3A 1NL3A 4K9QA 2NYRA 5L3ZA 5BQ5A 2IYQA 1KQPA 2P0EA 3U19A 4AXBA 2XUZA 4MWEA 3AVXA 3CZ5A 4P3YA 4S1VA 2KLHA 4FI3F 4EI8A 2OLJA 3ITDA 1Z63A 3IP7A 1DBRA 4Q4JB 4NZ9A 3FPKA 4XM2A 1U2GA 5JHHB 1DQRA 5AM1A 3VAAA 1P8JA 3Q1KA 4FJ1A 4HNQA 3UFBA 1EFVA 4AP9A 3T1TA 3W7VA 1AM4D 2EIHA 1SHKA 1G3IA 2IDZA 3QHAA 4U7GA 3QKRB 1MX9A 5I7AA 2NMVA 3H5OA 2FSSA 1UZLA 3CMCO 2G04A 3N74A 4JOSA 1I13A 3LP8A 1ZJYA 5E8JA 1NJSA 3HJGA 1WR8A 2B4YA 5KX5A 1GT6A 2GPBA 5CB6A 1XU4A 1E7YA 4OMUA 2K6GA 3OQOA 3Q1LA 3LBFA 3V7NA 4NU0A 4QC2A 1YS9A 4DQUA 1UZMA 4REOA 2P1DA 3B89A 5BN5B 5F3DA 1Z34A 2SCUA 2WUWE 3FWKA 3G0IA 3RCBA 2Q4OA 2IWHA 3QKWA 2E5LB 4BAUA 3DMGA 5I9TA 1E77A 5C7YA 2X5NA 2ECFA 4NQRA 4EW2A 3FPFA 3QFRA 3MYRA 2ZI4A 5BWLA 2C0QA 4S24A 4XOIA 1KO1A 1R64A 4I14A 2VYVD 2DQSA 4QT4A 4XIYA 3LYLA 2C7RA 3HDJA 3WQQA 3TG8A 1E7QA 1EX9A 2C83A 3GNQA 3V97A 5F3WB 1LBEA 4N6GA 1K0FA 1Q16A 3QXCA 3ZLTA 1XZLA 1D2CA 1YQDA 2O2EA 2JGDB 4MULA 4ZP1A 1GTMA 4YFVA 3EA5A 3OQNA 1DXYA 2QSYA 2I3GA 3MRTA 3T35A 2I80A 4B17A 1CUYA 4S1NA 3NWJA 3DKPA 1T3HA 1XRNA 2OVBA 5BWOA 4AJ4A 3EC1A 1Y9JA 4RZ3A 3VNAA 4LPKA 3O75A 4WN3A 4B6EA 4R0VA 3GZJA 1KP3A 2RGCA 4ALIA 3RVMA 1C41A 5EJ6A 2GN4A 2WU0A 5EMKA 4MEJA 5FAXA 2W6CX 1M67A 5AW9A 3O73A 1BYIA 2WTNA 1ZXXA 1EX6A 2I2XB 3H8JA 3IMFA 5EWJA 1UWLA 2QLBA 4YK7A 4ZCPA 3ZBUA 1P44A 3N1UA 3R0JA 3ZWMA 4LZJA 4G89A 4V3CA 1RI5A 4E2YA 1AX9A 1SU4A 4KE7A 2CL7X 3DTNA 1FNBA 2VDJA 1PVDA 3ESCA 2OHGA 2EKBA 1RABA 3KOUA 2JNWA 1TO2E 1ND6A 2NSHA 4MUBA 3MWFA 3HN2A 2NVOA 4CFSA 1ZMOA 4KW7A 1Y4DE 1LPMA 1OF1A 3M2TA 1AB6A 5GONB 3KVOA 2H57A 3TPCA 4DM4A 3GZNB 1ISGA 4DIBA 1RBZA 3ICOA 1MEEA 2HH9A 3LXRA 5TIIA 5CVVA 2G1JA 3BK1A 2D62A 1DJNA 3PXXA 4KRYA 3Q7PA 2H08A 3F4BA 3HYTA 3QLUA 4YRSA 1XD8A 4FHZA 5IMSA 1G2PA 5CNIA 5E7JA 3MWKA 1SBZA 3R8XA 4P54A 5F5NA 3SZUA 1H2XA 2WJGA 4C2AA 1EFKA 5EMMA 5KSYA 1Q0QA 1VLVA 5JHGB 1T8RA 2YWJA 3FPGA 1MEOA 1RLOA 5HFNA 4YXFA 4IZIA 1FS5A 1QX3A 1ZSVA 3KT0A 5KTTA 4EA7A 3C3MA 4IV5A 1IHPA 5IAEA 4C0BA 1YZKA 2FWAA 3TR0A 5KYTA 3A6LA 5LMNB 1YZYA 2Q5QA 1KPGA 1YL5A 4KQ1A 4WZBB 4ZJZA 2AQHA 1ZJ6A 1D0IA 3O8QB 3WMWA 2Z08A 3OI7A 4G1FA 3GW8A 1R66A 2MDTA 3K9CA 1O97D 3K2EA 3ZWPA 2D5CA 3U7HB 4D98A 3CGGA 1C1YA 1DZIA 1JKIA 2G7ZA 1UODA 1Z2OX 5HRAA 3TD9A 5IAAA 3PJDA 4LTDA 1MD9A 4Y2QA 4ZHQB 5BW8A 3PUIA 2CV0A 1GILA 1EG2A 3ES9A 4NXMB 3HBFA 2GM4A 1KE2A 3HV2A 2X1MA 4N7JA 4YWHA 3VSEA 1D8TA 1W96A 4OP1A 2B61A 2BKLA 4IV8A 4B76A 1U6JA 4PCUA 5KNBH 2OGZA 1ECLA 2D1QA 1KOGA 2CJWA 4LZPA 3O8LA 4KXUA 4ZVSA 3PLNA 4D9IA 3VPHA 2H4YA 2HHLA 3FHOA 1CY8A 3OM8A 1QK4A 1I9CA 1LNSA 1ZAYA 1I6KA 2GXQA 4RD2A 3BIXA 1E8NA 4DLBA 1CUUA 4FKZA 4L27A 4O2RA 2B8TA 3KB1A 2D7DA 5LA6B 2XB8A 2FW6A 2F1KA 5BNWA 4W8HA 3RANA 3TLEA 3SC3A 3OT5A 3T3HA 1UKZA 1G1MA 4MW6A 3SYKA 3PWSA 1MHPA 5JNVA 2QX8A 3T5MA 3FUCA 3KC2A 1DAFA 5TQ0A 3W78A 1XCJA 4R3NA 1KAEA 4WFQA 3TZCA 4ASUD 4U2KA 4WL0A 3DFIA 3FNGA 2X5KO 2OKGA 3W8DA 4AWBA 5CT9A 3KJFA 3RS3A 3ZQKA 2Q5JA 2DOKA 2DRIA 3M6IA 2OV2A 4F5ZA 1UPBA 3GGJA 3KALA 1UZAA 4I9FA 4B2IA 4DC0A 2EZ9A 4UVEA 3ZDEA 1FDSA 4IQGA 1LF0A 2GN2A 1C7IA 1JMKC 3LO8A 3MJSA 2AG1A 1O6CA 4XQ9A 4YAEA 4PF1A 3IUMA 3VOBA 1S96A 2AH5A 2A67A 2I7VA 3RG8A 5FEUA 3WYGA 1YCDA 1GGFA 2ZSJA 3R7DA 4PS1A 5JD6A 2JGNA 3N75A 1NLZA 1OT3A 2O6LA 2FMIA 1FTQA 2H1IA 3OO0A 4H4CA 2QA5A 4IH9A 1MO2A 2OD9A 4JJFA 5CPFA 5IEBA 3ZBPA 2J3LA 4W8OA 3ZCSA 1F2UB 1PDVA 4JLUA 2VRCA 5B3JC 1UWCA 4ER5A 4O6VA 3PWKA 4QUHA 3ZXSA 3A6GA 3FPSA 3VPSA 4HK4A 3O1JC 4JJKA 4R9UC 1RWMA 2Z5LA 2ZYHA 4NS1A 2B7CA 4W9NC 2ZUEA 4JT2A 1RYDA 2ZTLA 1IBSA 1QFJA 3ORYA 2ZREA 3U31A 3ZDRA 1QPBA 4N0MA 1TT7A 2G63A 4QPCA 2Y1CA 3HU3A 2E4ZA 1SZCA 4O4IA 1TE2A 4F0JA 4LFCB 1WUIS 2EGHA 1WJGA 3A10A 3QBEA 4X84A 2QD4A 3TLMA 3CB2A 2TMGA 4WCFA 2H48A 4YAJA 1WCV1 1EE1A 8GPBA 1ZKMA 2CLCX 1N5LA 1ESNA 1XDUA 2W5UA 3OEYA 4G36A 4GO1A 4Q4AA 3ASZA 3OEEA 4GU5A 5DSXA 4JJGA 3SR3A 2NTJA 4V2IA 1PV4A 1J5PA 4ZYUA 1I2ZA 4W5RA 3ENVA 3GG9A 3QITA 1WBDA 1QRAA 3SICE 1N4DA 3EGOA 4X6LA 2X3UA 5KU1A 1VPDA 2Q46A 3L04A 3NP9A 2R6R1 4FOOA 4GZ6A 3RTDA 1RXWA 1YJ8A 1Z7YA 3HCBA 1H94A 2H3EA 3MWJA 4I5IA 4ZEXA 3F3SA 1CUJA 2EYQA 5DHUA 3EGVA 3TTTA 2VT7A 4DBZA 4JI0B 4IIUA 2JH9A 4WXYB 5JTTA 4KKXB 3FB1A 2K7FA 4R9VA 3J7TA 1Y0BA 3IGFA 3OFSA 1GGVA 2B99A 2Z5VA 4PLGA 4FONA 4GQAA 3UWDA 1U0BB 1LLQA 2MSCB 2DEUA 5AM2A 4O59O 3CISA 5CJ2A 4CMCA 2RGBA 4RCZA 3AINA 1UMBB 1NFRA 1YZUA 1E59A 3O26A 4AS3A 4WV3A 1XDGA 1YIAA 1WKBA 2HJWA 2HQOA 2ZGVA 3CZRA 4LYJA 2I66A 4PZLA 4H31A 3SHWA 1HE8B 3BRSA 3LU1A 3ZWYA 1JXAA 5A06A 1PNQA 1ETUA 1ZUWA 4WEOA 2Q7OE 5LYJB 4QGBA 2JAXA 3FHJA 4WY2A 1Z6YA 3Q7SA 3O9VA 1P0CA 4NICA 5H83A 3TZKA 3WGKA 3CW8X 3GIWA 4IWXA 2YWRA 3S4YA 3LW8A 4AJEA 3TFOA 1LTQA 2ZAIA 1P1KA 1LLUA 4R0NA 1JIJA 5JZVA 4CLDA 5EZYF 2QIPA 4HNSA 4BX8A