4V0NA

Crystal structure of bbs1n in complex with arl6dn, soaked with mercury
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
166
structure length
166
Chain Sequence
b'SKKVNVLVVGLDNSGKTTIIERLKPRPRQAAEVAPTVGFTVDEVEKGPLTFTVFDMSGAGRYRTLWEQYYREADAVVFVVDSADKLRMVVARDEMEHMLKHSNMRKVPILYFANKKDLPVAMPPVEIAQALGLDDIKDRPWQIVPSNGLTGEGVDKGIDWLAERLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARF-LIKE SMALL GTPASE
publication title Structural Basis for Membrane Targeting of the Bbsome by Arl6
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Hydrolase/structural protein
total genus 51
structure length 166
sequence length 166
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2014-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4v0nA00
1ZRHA 1DTSA 2FFBA 2IEYA 3C14C 1J90A 1F2TA 5A0FA 3TK1A 1K5DA 3KJHA 4K8OA 4X8MA 1PVOA 1P7CA 2QQ0A 4EPTA 3D6TB 4ZDKA 1N6KA 4ZCMA 1GFIA 5AJXA 3B82A 4PAOA 4DZZA 1P60A 2QRNA 2I1VB 2OFWA 3E70C 2FFQA 3VU9B 4FCVA 4JLVA 2F3RA 1YJ5A 3BBPA 1N6IA 2HLDA 1YR6A 5A5GA 2GJ9A 4JLAA 4Z1MA 3AP3A 3CUEF 2HT1A 4AURA 1VCMA 4G0NA 2ORWA 1JECA 5FTKA 1EFCA 4LDJA 3U4QA 2JASA 4DXAA 1HH4A 1DADA 2HEIA 1KO1A 2WWFA 3KDSE 3OIWA 4PPQA 1AKYA 5J47A 2BJWA 2IBMA 1AK2A 2XSZD 4D2IA 4BEJA 1WMSA 4LSGA 3IBGA 4Q9IA 1DAGA 1DAMA 2NG1A 5BN3A 4BLOA 1FTNA 3GFOA 4B3FX 5B58C 2J0QA 2AWOA 2FG5A 1SQ5A 4PQRA 5CLLA 3QKRA 5JBQA 1GIAA 2IUSA 3QIAA 5TY0A 1G5TA 1OH5A 4G5RA 1YRBA 5JS7A 1H8HA 1QG2A 4KVAA 1FOEB 3ZD7A 2QTFA 1N5KA 1N6NA 2NO1A 5UKDA 3U5ZB 4MKIA 3WNDA 3NKVA 4WOPA 1X1RA 2DCUA 2QA5A 3L8YA 4OQXA 2VF7A 1UADA 1UBFA 4C30A 3M6AA 4F93B 4F91B 3M1IA 4B48A 2ZRMA 1WBBA 2ZROA 3IIJA 2RMKA 1VCIA 4BLTA 2A30A 2QGNA 1P2SA 3K70C 2ZRCA 4JZKA 5FBQB 4JVLA 1ZAKA 1XTQA 1QHHA 4URVR 4Q7MB 2OCYC 4PQFA 4NTZA 5B57C 1DBSA 3BB3A 1II8A 1E9EA 1CBUA 1UEIA 1TPZA 2WSSA 4W5HA 2J46A 1KSHA 4LK2A 2QT1A 1JALA 3MSXA 3P4YA 1ZIOA 4AK9A 3AP1A 2BHRA 4EIWA 1FP6A 2ORIA 2JJ8A 3RS5A 1QBKC 4DDTA 1E94E 2IK8A 2R62A 4TL8A 1Z3IX 2F55A 2XITA 3ZVMA 3OIYA 2IWRA 1O87A 1HQCA 1YZNA 4RCYA 1QF9A 2C96A 5BYJA 4OI2A 2JJ2D 3WYAA 1OH8A 4F92B 4R98A 1VIYA 4KITB 1TF2A 3BFKA 2W6JD 5AJVB 2WWHA 1E4VA 4Q47A 3WP1B 1SKYE 2RGNC 4UNSA 4KLZA 3EZ6A 5KSZA 1E2JA 2REOA 4LI0A 4GZMA 4DCUA 5F9HA 3GLGE 4MUBA 2F9MA 4JMPA 3VTKA 1VG9B 1B23P 2QMEA 1ZUIA 1DEKA 3O8RA 3VU9A 4QOSA 2WAYA 3WNCA 4MGIR 1Z0IA 1KTVA 2FA9A 3DKPA 4B3XA 2G3YA 3D7MA 4HLUA 4MRNA 3M0EA 3BH6A 4D0NA 2DHRA 2W2TA 3OF5A 2G83A 5FBLB 2VL7A 4NP6A 2ZSDA 1XXHB 4LBVA 2BBWA 1HT1E 1XWIA 3GJ6A 4TWZA 3UATA 4DSNA 1X86B 5FOSA 5SZIA 4V02A 4A1FA 4C0SA 4BFYA 4A15A 4IDNA 1G291 1G19A 2FH5B 1CULC 4HB3A 5JRJA 1E0KA 1XD8A 1B0UA 4R9UC 4RZUA 4Q9JA 1NSTA 4M9ZA 4XVRA 1TTTA 4Y0VA 3ASZA 5CYPA 4EJSB 3AF2A 4NYIR 5AR1A 2ONJA 4B43A 4Q1FA 1JR3E 2WWGA 2D06A 2BEJA 2J59A 2QROA 3OAAA 5JRZA 3MFYA 3RC3A 5JFGA 1NLFA 1RIFA 4DLUA 1UBEA 4PHFA 4B6FA 3AF1A 1E98A 5TDHA 4JBXA 1N6OA 1K6MA 4OK6A 1KSJA 2GK7A 4O25A 4WZBE 3PEVA 2Z4RA 4A2WA 1E9SA 3W5JA 2YINC 4KFUA 1U8AA 1WRBA 4DDVA 1PZNA 1A2KC 2BKEA 1ZUHA 2BBTA 4GRAA 4DKXA 1JAIA 2RGBA 1E0JA 4GOXA 2NTYC 2DFTA 4PHHA 5CIWA 3GP8A 2YZ2A 4WAUA 3E2IA 4Q7LA 1Z2CA 2VHTA 3LDAA 5J40A 1KJWA 2BMJA 1PLLA 4D0LB 1W46A 4DLRA 3ZGXA 421PA 1ZYUA 4IOJA 5EE3A 3GQBA 2XAUA 4CT4B 3MJRA 5KUTA 4A8JC 2G9NA 2IS1A 3TH5A 3NIBA 4C0JA 3QG1A 2QP3A 4M0LA 2IXGA 4DCNA 4RKFA 3AVTA 4OI4A 2ZETA 2GCNA 4JLKA 1CXZA 1Q12A 4LJ4A 1EFRD 2QORA 1YZQA 2GTPA 3LX8A 1U2RA 2QENA 4MKFA 5FOUA 1XJCA 1EGAA 3CKLA 4P3YA 2CCKA 4CT5A 1W49A 2F1RA 4P4UA 2R9VA 4KYUA 1KZ7B 4KSCA 2YJTD 4DT1B 3QBVA 1UKEA 3VKHA 3VAAA 1P3JA 4KVGA 3W90A 3SI7A 2QAGB 1MKYA 1N6RA 3K1JA 3TVTA 2IYSA 5IK2A 1GRRA 2IA5A 4R2IA 1YQTA 2B21A 5E7JA 5EZ6B 1MT0A 1Z0JA 1TQDA 2VSXA 1XXHA 3UWOA 4RZ2A 1I2DA 2V9PA 4YXWA 3OEHA 1RVDA 1ZJ6A 3R7WB 4LY6A 3IDQA 5F98A 1SGWA 4A9AA 4TYPA 4AWXA 1OFUX 2BEKA 2QE7D 4X8OA 1N6HA 3A58B 3IKJA 3NC1C 1OF1A 4LHWA 5L3SB 1KDTA 1XTIA 2RKOA 2NPFA 1OH7A 4XD7D 2P2LA 3I5XA 4GMDA 1E9CA 1G41A 3KX2A 5FTLA 3PXGA 2GCPA 1AM4D 3O8DA 5EE5B 3TUJC 5KSOA 4LHZA 1NNEA 3AF0A 3U6KA 4Q00A 1UBCA 2F1JA 3I72A 2W0SA 1Z29A 1DS6A 5GJWC 2G77B 3J81k 2CCGA 3NTUA 4I99A 4LBYA 521PA 1W2GA 2IL1A 1T6NA 3WYFA 1NIJA 4D0GA 3FHTA 5DLQC 1H8ED 1GG2A 2FEMA 2QQEA 3AB3A 1N3BA 1GWNA 5FFMA 3FTQA 4JLNA 2ZJ8A 4N3NA 2IS6A 2ASEA 1IXRC 1JI0A 1G6HA 2XNDA 4RVCA 3OEED 3L0IB 3WY9A 4MYCA 2OCPA 1N2CE 3OIUA 4YONB 4KYIB 4DIDA 3KQHA 1KK2A 2NO7A 5TVKA 5JS8A 1LNZA 3P32A 5CM9C 1GTVA 5M04A 3GEHA 1N6LA 1NLYA 2DWPA 1L8QA 3EA5A 5FR1A 3TUIC 4A6PA 2QT0A 3X1XA 2OXRA 1IOZA 4FN5A 3RWMB 3V4FA 4AC9A 1CJUC 1E0AA 1E2LA 3FOZA 2G0NA 2LKDA 1SVMA 2RGGA 2VP5A 4XVQA 4BECA 1AGPA 4HUQB 1GVNB 3RRMA 2BMEA 2CLDX 2Q3HA 5B64A 4I4LA 4OQFA 1VCOA 2ZVPX 3GLHA 4ESVA 2GHIA 1Z83A 4Q01A 1OFIA 5HR5A 3EZ9A 1P9NA 2XJ9A 3AH8A 2YWEA 3MMPA 2E9SA 4M9SA 4FIDA 4OK5A 4BZPA 4DT1A 2Z6VA 2N1BA 4MUAA 5P21A 3GLFE 2ZS8A 2ZUCA 1A2BA 2W6IA 5J4KA 2CMKA 1G6OA 2DPXA 1SKYB 4QGGA 2V55B 1S1MA 2ZJAA 3WBJA 1IY0A 2ZANA 2ZI7A 4KHZA 3T12A 1FTSA 1OW3B 1KO4A 1W1WA 4M53A 5FL7D 2VPPA 4B33A 3HPQA 2QY9A 3AF4A 2B7CA 1HYQA 4PQYA 3QBTA 1QHYA 1Z0DA 4Z8XA 3LBNA 3R8FA 4QC2A 2AN9A 3BFVA 2EQBA 3FVQA 1SXJD 1XU4A 3B6EA 3DM9B 4QM6A 1ZC3A 1VYTA 3AV0B 3L8ZA 2CBZA 4B44A 1W4CA 4LGMA 5L3SA 3ZLJA 1IBRA 4GBMA 1W0KD 1F60A 4P4SB 4KLNA 1FUKA 3P20A 4JL5A 4FMBB 2EU8A 4XSGA 1N6PA 5G41A 3D3QA 2E87A 2H17A 1KO5A 4TZ6A 2NO6A 2JLVA 2GAOA 4TSFA 3L2OB 2GJAA 5FBVB 5JLJA 5KSYA 4B6EA 4U7DA 1KNXA 1M74A 5FUYA 4AYWA 2AKAB 1WQ1R 3DEFA 4MRVA 4AD8A 4AKHA 4C2UA 2OO7A 3CPJB 2HXSA 2PZFA 1RKBA 5FBWB 5KOYA 4GP7A 3IHWA 3VR1A 3THWB 4B47A 2WTUA 1G3IA 1Q1EA 1OFHA 3CB4A 2JLZA 2V7QA 3CBQA 4HEJA 1S8FA 2CK3A 1XB2A 5CK5A 1KI7A 2ATXA 4UXHA 3PEUA 1XZQA 3KUDA 1WA5A 2IYQA 1AS0A 2ZUBA 3GFPA 3QEOA 1CP2A 5FOTA 2IT1A 2Q3FA 3NG1A 4M4SA 2VSFA 2BM0A 1GZSA 3GEIA 1M7GA 2JLSA 2ZJYA 5CYOA 4C0BA 5DYIA 3PUXA 3W6OA 3RVBA 2JLXA 5JJLA 4HUQA 3WMEA 4O2RA 4Q18A 2BMDA 2UZIR 2B7BA 2P67A 2XNSA 3GJ8A 5C4MA 4L15A 2PCLA 1E9AA 3TIFA 1Y63A 1PUJA 3CWQA 4AKGA 1NLZA 4LHVA 4QBGB 1ZW6A 5C1BA 3PFIA 4TQ9A 3RAPR 4D6PA 3LH5A 1EG7A 2J7PD 4OHVA 3DHWC 3H0KA 4IOKA 2JA1A 1Q3HA 2QM7A 2VBCA 2J0SA 1CLUA 2VHUA 5K8LA 1CRPA 3AKEA 2EW1A 1U90A 3A1SA 1OYWA 1G7RA 4RD0A 5HCIA 1KSGA 2PLFA 3CX7A 6Q21A 1JR6A 1G64A 4IEEA 3ZQJA 2YYZA 2GNOA 4NPHA 5LD2C 2Y8EA 2V6JA 5G3YA 1WBDA 4TN1A 1VTKA 1NF3A 3MCAA 5FOXA 3KJIA 5BN4A 2ZU0C 3QF7A 1CR1A 4MKGA 1PV4A 2F3TA 4OYHA 2R6FA 1JPNA 1NKTA 5IF9A 3V00A 2OLJA 4YDSA 1T3HA 2OFOA 3A1WA 1TF5A 3Q5EA 2H1LA 5DO9A 4EQ6B 2O8BB 1MR3F 3NEYA 2JIZA 3O8BA 3DPUA 4P4SA 5FR2A 2WJJA 3RSLA 4C0AC 4K81B 1E32A 4RFVA 2GZHA 1E2NA 3VX3A 4BLQA 2PMDA 4JLDA 5CDFE 2O8CA 2GXSA 1LF5A 3P26A 4UXIA 1A82A 1W5SA 3H2YA 2MSEB 1AA9A 2CDNA 1NN1A 3EWAA 3T35A 5LB2A 4XVUA 3VFDA 3WMFA 2ZJZA 1ZIPA 2Q9BA 4P33A 4LJ5A 1OFTA 3KTAB 2ZPTX 4DEYA 4TL7A 4TYQA 1OXUA 1GSIA 3EW9A 1NY6A 4LUCA 1AQUA 1TNDA 4LRWA 3THWA 3QJYA 4HZUB 2O0KA 4FCTA 4HAWA 1LB1B 1KDPA 3TLXA 5DH9A 4A0HA 4PC7A 2R2AA 2LKCA 3X2SA 5K8IA 3CRW1 1ZC4A 2AKYA 2JLUA 4QGAA 4DSOA 2F1IA 4M1WA 2YC2C 4WXRA 821PA 5DNYB 4Q9LA 5FTJA 3N2EA 3VQTA 3KJEA 4BASA 5IHPA 4BPBA 3SS8A 1I4TD 3A1TA 5DHFA 2FX3A 2R65A 3ICEA 1JQJC 1SXJE 3R20A 1DAIA 3SBEA 5CK4A 5J4VA 1SVOA 4V0KA 4KODA 4YMTA 1ZD8A 3P4XA 2HUPA 1XEWX 3U7EB 1XPOA 2WKRA 4PSAA 5CM8B 2WHXA 3U44A 4NCIA 2XSZA 1S3GA 1EFHA 1R0ZA 1W4AA 2AFHE 1TQ6A 3BH0A 4WA7A 3PG5A 3JZMA 4LBZA 3U3JA 4F7WA 4HDCA 2JLRA 2GZAA 1X8JA 2GBLC 1T3LA 1M7BA 4JL6A 1VG0B 3N70A 1JXMA 3WXMA 4UNQA 3PUZA 4TQAA 4NHOA 3GLFB 1XCMA 2DY1A 1K8RA 2GWHA 2ZU6A 4H9GA 1UDWA 1E69A 1XMSA 1AGRA 3K0CC 1TEXA 1XTKA 2QG6A 5HE9A 3NBZC 4E5UA 3TAUA 3PV0A 1HY3A 4EQ6A 4ZI2A 4LYHA 3VR3A 3PQCA 1YVDA 2Q6TA 4HLDA 5B2ZA 2IHBA 3KB1A 2WKPA 4KJZA 4MGYR 3KUCA 3KKPA 3X1WA 1T8UA 1TAGA 1Q1BA 4DDUA 4PX9A 1D8TA 5FPKA 2EFGA 3IIMA 4JSYA 1BYUA 3I62A 2C2HA 4DIEA 3EZ2A 1OXTA 2PT5A 2Q9AA 2KI5A 3AUXA 2ZRFA 2IYUA 3SC3A 1NG9A 1SVKA 1XCGB 3B1VA 5C46F 5KSPA 3UIEA 1MOZA 1DAFA 3BWDD 2Q3MA 3NH6A 3KTAA 3B9PA 1GNQA 2IYYA 4MRPA 1GKYA 4KSBA 3UMSA 4Q7KA 4QGHA 4FMDB 3CWZA 2HJVA 4DUGD 4R71A 4HZUA 1DE0A 1ZUNB 1FFHA 2OHFA 4A4DA 5JI2E 4AI6A 2ZAOA 4HYYA 2ZSAA 2YOGA 3QQ5A 1HURA 4DEXA 2JJ2A 3MUFA 3PVSA 2IF0A 1GL7A 4TL6A 3ZS9A 3FWYA 4PAQA 1G7SA 2W6JA 3K09C 4MRSA 5CB6A 4IDPA 3SJAA 3ZZUA 4ZKDA 1J7KA 3LBHA 4C4PA 3MLEA 1FMJA 1XX6A 2PJZA 4V0NA 1RJ9B 5IDVA 2J7KA 5JZVA 2G88A 3B2EA 3SJBA 4Q5IA 1II9A 1E2HA 4IOLA 4I1UA 3R8CA 3VHLB 5J4HA 5KDOA 3W3AA 3RWOA 5KDDA 1YKSA 4XWKA 1J8YF 3C7KA 4WW0A 3E1SA 1FP7A 1G8YA 1ZNWA 4DJTA 4BFVA 4HI0E 2WAXA 4FMCB 5CIQA 4ZV4A 2ZRKA 2IS4A 1GKUB 2PMKA 2QMUA 2JGNA 2P0EA 4MKHA 4F4CA 5TARA 4QNRA 3K70D 2JDID 3VR6A 2ZITA 5SZJA 4HATA 4B3GA 1E2FA 1JBKA 4PANA 4DHEA 1G3UA 2YKGA 5AUNB 1DARA 4EAQA 1L2TA 3NEJA 5JHHB 2FV8A 2ZYUX 2C5LA 2ECKA 3CH4B 4LWZA 4FW9A 4CW7A 4QBHA 5EXXA 2EFDB 3MWKA 2TMKA 3D31A 3IPXA 5JEEA 2J3EA 1JNYA 3JVVA 2D7CA 4C0LA 3SYLA 3GLFA 1UEJA 2XB4A 4CEJB 2FFAA 2ZR7A 4R2HA 1XFAA 2IYZA 2YWGA 4QJ5A 3UG7A 2UZ3A 2A3RA 2WM9B 1SHZA 4DLWA 3FMIA 3K9HA 1P2TA 1AZTA 3NXSA 4IDQA 3T5GA 2A5DA 2ZJ5A 3UMFA 4B34A 2O52A 4Q03A 2XXAA 4TLCA 3W9YA 3ASYA 2AHOA 3CF2A 4BEBA 4JT4A 4DBLC 4B32A 2LCFA 1G16A 1Z47A 3ZD6A 2VP4A 4ASUD 3WHLA 1G4UR 1ZU5A 3A36A 2KJQA 2AL7A 2L0XA 2KBFA 4JLBA 1XTRA 4A0GA 5FPSA 5L8VA 1OJLA 4DCVA 1MO6A 4XWOA 2XZOA 4LJYA 2H7VA 3SFZA 1Z5ZA 3TBKA 3K9LA 3S1AB 3KJGA 4Q1EA 1BO6A 4BLRA 1VIAA 1IM2A 2G1JA 3C41J 2QAJA 4CDGA 3DMDA 3VX4A 2A2ZA 1RRGA 2CVHA 3EWSA 3TR0A 2W83A 3JZAA 3QUSA 2EFHB 4NYMQ 2WJIA 1AJEA 3CONA 1OHHD 1EFRA 3SR0A 3X1YA 5KU1A 2H18A 2J41A 4JT2A 1G3QA 4A36A 1D2EA 1IJEA 2ANBA 1X8KA 2DFKB 1QHXA 2QPOA 4FD2A 5EE1A 4BFUA 3SHFA 4V0ME 2O8EB 4M1OA 4MA4A 5EP1A 3CLVA 2H16A 3IO5A 3AVVA 4URYR 5CLQA 2GEVA 3TW4A 1QHNA 2ZSBA 2JLQA 3OZXA 3NH9A 4IEIA 3KXKA 1HTWA 3EARA 2Z4SA 4F38A 2CL7X 1G17A 2ZEJA 4M1MA 5JWOA 1AS2A 2ODBA 3TVDA 2BVNA 2ZRIA 1H65A 1P9WA 2WIBA 1HT2E 4NMMA 3QXJA 1G4AE 2HYIC 2ZAMA 1SXJB 1MH1A 2ZI6A 4IVRA 2ZRLA 2XB2A 2QE7A 4RD4A 4BGDA 4BWYA 4KV9A 1M6NA 4NU0A 2B6HA 3CNOA 2FSGA 1FMLA 3LVRE 4IOMA 4XD7A 1AKEA 3Q85A 3RS2A 3RYTC 2IUUA 3I8XA 2HF9A 1UDXA 4ZPXA 2OE2A 3TKLA 1LFDB 4IFEA 3A37A 1F5NA 3K0SA 1NMZA 3W3ZB 4HDQB 4HSEA 3BJIC 4OJQA 1BMFD 1M34E 1W0JD 1N0UA 2C99A 5EUQB 2DFLA 2FGKA 2OILA 3G5UA 2EWWA 1KMHB 5C18A 4TYWA 3HP1A 3U3MA 3MWJA 3CRRA 5FUWA 1H8EA 1NL3A 2OXCA 5FPTA 4EUNA 1R6BX 1E79D 4L8GA 1SVIA 3A4LA 1Q22A 1GOTA 3IHLA 5TMPA 3OEEA 3EXAA 4BQSA 3BOSA 3KQKA 1CJMA 4B75A 2ZI4A 1JJ7A 4YC7A 4UJ3A 4GNKA 2ZXUA 2CE2X 4K46A 2HCJB 4Q9KA 2IC5A 3IBYA 2G1KA 1TF7A 3K9NA 1X6VA 3DVLA 3SZRA 3KQUA 3S1AA 3W8NA 2OESA 3A4NA 5ANRB 2MSCB 4TMXA 3QKSB 5GADl 4JSTA 5CDFA 3RNLA 4MH0R 2PJRA 1E9FA 2FZ4A 1NN0A 2CL0X 1S4QA 1TMKA 3GPLA 1MO5A 2HV8A 3CR7A 1GNRA 1SHKA 1TUEA 2PT7A 3LO5A 1WCV1 2WMOB 3FKSD 3KQNA 1TADA 3KXLA 3KQLA 4W7SA 3TQFA 4QFMA 1NVWQ 2FU5C 3AVOA 3EG5A 3W8RA 1U8ZA 3I92A 3WBKA 2LWIA 1OV4A 1NRJB 2WWWA 2O8EA 2KSQA 2XTZA 1CEEA 1T0JB 5JSZB 1KK0A 4NE2A 4LC1A 4NKRA 3IQXA 1XPRA 3B13B 1MRNA 3C8UA 4BZXA 4RFSB 5CJ2A 3T1TA 3HJNA 1IN6A 1OXSC 2XOKD 3IQWA 2HF8A 4RJLA 1WP9A 3DKVA 1ZCBA 1YR7A 4YMWA 4XH9B 5FL7A 2ZQ5A 1XD2B 3BAFA 2H5EA 1YZGA 4QL3A 1BIFA 5HZHA 3FMOB 1N25A 2X8AA 1SXJA 1YR9A 3QSYA 2F6RA 3TMKA 4ACBA 3RSOA 2GXUA 3P1JA 4YMSA 5KNDA 3B78A 4Q1BA 4Q1AA 1EXMA 1NI3A 1W0KA 1H8HD 5HZKA 2HJGA 3ND9A 4DB4A 1Q3TA 3UG6A 3LA6A 2AK2A 5K8TA 1HE1C 1I2MA 3F8TA 3V4RA 1K5GA 4B2LA 4H1VA 1FZQA 2IYVA 4TL9A 2ZI5A 1G9XA 2OBLA 2UVQA 5FBRB 4JVMA 1KMHA 1W36C 1A7JA 4FWIB 3ZIAA 1NY5A 3SJZA 1FW6A 2DB3A 2ZRDA 4I1OA 3IGFA 2B92A 1KI2A 4B2PA 4G5QA 4L5BA 1LS1A 4XJXA 1RE0A 1KO7A 5AJWA 3MJHA 2N42A 1ZNYA 1ZNXA 2JJ1D 1OIXA 3U7FB 4TMWA 4L9SA 2CVFA 4MYTA 2NMVA 5LDDC 1Y3AA 1T0HB 3EAQA 2JLWA 1XPUA 4IVPA 4EJSA 2X1VA 3I3SR 1BH2A 3Q3JB 3Q8XB 3QKSA 4D26A 1QG4A 1SZPA 4M1SA 1XMIA 4ZIRB 2R8RA 4YLGA 5CITA 4TQUS 3AQ4A 4IRUB 3H1TA 3NHBA 2AR7A 1E9RA 4OHWA 1XDBA 3LW8A 4PC2A 4EPWA 5H8WA 2GXAA 4O3MA 3VNUA 1D6JA 2IYRA 3SBDA 5C4GB 4DLSA 1GM5A 1OXXK 1SVWA 5KYKA 2CJWB 4CIDA 2J7PA 4KAXA 4TLAA 2J0VA 4Z8YA 4DC9A 1E3MA 1IAQA 1LVGA 1E6CA 1NP6A 4DLXA 3BFXA 4TLEA 5JSZA 1KI3A 2W2VA 4CEJA 3VR2A 4RFSA 1F6BA 3K0FB 4UNRA 2P5SA 5J4LA 4HLCA 2O8FB 2MMGA 3WRYC 1VYUA 5BWMA 3CZQA 3V9PA 4EDHA 4LYFA 1YRAA 2FE4A 2OCBA 5F9FA 1N0WA 2GEDA 1S1CA 1BOFA 1ZM4A 2VP9A 3LQRA 2EYQA 2AXNA 4Q48A 4BFWA 2WVJA 2IYXA 3GD7A 4E22A 2WWYA 3M4YA 3WMGA 4IFBA 1V43A 1QHSA 4LJAA 1Z0FA 1S9HA 3TSWA 1HA3A 1DO0A 1CR4A 4RZXA 3SNHA 4KBFA 1BYIA 1CR0A 5BXQC 3VKGA 3MWYW 1EK0A 2Q9CA 2GESA 2QAGA 2D62A 4HAXA 4DLYA 3QPUA 2IUTA 2PL3A 5BW8A 3JVUA 3L0OA 2A5GA 1U9IA 3T5DA 4QNMA 5EQTA 4H1UA 1E9BA 3REGA 4PZZA 1TL7C 1G1MA 3R7WA 3RABA 4RCZA 1XTSA 1ANKA 2PX0A 3BGWA 2OBMA 1FX0B 1W4BA 4YMUA 5E4FA 3EX7C 4TT3D 2IX3A 1TUIA 2A78A 1DAEA 4BE7B 2EYUA 1V5WA 3BD9A 4CZ2A 2W58A 4HAZA 1KY2A 2SHKA 2FNAA 2ODNA 1FNNA 4TLBA 3LD9A 3CPHA 5AWFC 1AIPA 2FSIA 2IF2A 1EFUA 5FTMA 4BFZA 4OI1A 4ZIRA 1G20E 1UJ2A 3CR8A 4D25A 1RC8A 4HLUC 1R5OA 1KNQA 4B71A 5KO2A 2A7QA 1E1RD 2X2FA 3BK7A 4JYCA 1VDZA 2WPDD 2D74A 2YWHA 2ZE7A 1UAAA 4KXFB 2P65A 1P62B 1XMVA 2CJWA 2GXQA 2D7DA 3TSZA 3K70B 4US1R 1IY1A 4CEIB 4ACAA 4GT1A 2OSBA 1CJTC 5G53C 2GRJA 1VHLA 3K0FA 2O8FA 3KKNA 4US2R 1NKSA 1TU3A 3CO5A 2YOHA 1AS3A 4B76A 4V0MA 2GCOB 2GETA 4C0HA 3I5YA 3RS7A 4D4LA 2ZIAA 3C5HA 4C0QC 3FYHA 3EPLA 1E2PA 1CJVC 5FUVA 5BQ5A 2R6AA 4C7OB 2VHQA 2QP9X 4B3BA 3NBFA 4KFRA 3UPUA 1ZD9A 2RHMA 4FI3C 4LOAA 4M22A 3U3KA 4D4MA 4AYTA 2BKUA 4Q02A 2HCBA 2P5TB 2ZRAA 1AN0A 1S96A 1OSNA 3MD0A 3QXXA 4ARZB 2ERYA 4OQMA 2KE5A 1Z8FA 1G3RA 2WJHA 4DLZA 2C98A 4D82A 2CLCX 4FXPA 4CGZA 3QF4B 2AFIE 2UKDA 2XTNA 2C03A 4OBEA 4PC3A 5DI9A 2V3CC 3LBIA 1OLOA 2ZE6A 4LPSA 2WBLC 3U7GA 1Z6TA 1NVUQ 4UXJA 4C3ZA 4D4KA 3OIVA 3VHXA 2XNDD 4MYUA 4NONA 2H57A 2YC4C 3ZZTA 1YZTA 1G18A 3MGCA 3GFTA 2A5FA 1KDRA 4A92A 1KKLA 2F9LA 2VHJA 3FPAA 4EFLA 2AK3A 5DGXA 3RRNA 2G0TA 1P73A 4DUGA 1FX0A 3NHAA 2KWIA 2F7SA 4ZKEA 4JLJA 1R8QA 4HAVA 1ZCAA 2C04A 1CRQA 1R0WA 5LPNA 1F48A 1UKYA 3GJ4A 4Q4AB 2RGAA 2H92A 1R5BA 1XJQA 3B5JA 5E7MA 3MRSA 3KB2A 4E09A 3TJZA 3IEVA 1J99A 5KNCA 2REBA 3LRPA 3B85A 4C2TA 3K9GA 3PR1A 2BJVA 4PPFA 1TEVA 2ZI3A 1HEIA 1KSFX 1DG3A 3SFVA 3DMNA 3THYB 1RPZA 4JKYA 1E1QD 4QBFA 5G40A 2BV3A 4GZLA 1IN7A 1E2DA 2I1QA 3FB4A 2F43B 5F2EA 3T1OA 4KBGA 3SJCA 4O2LA 3AUYA 1O3YA 1GAJA 3LXXA 1G5RA 1VMAA 2W2XA 4CF7A 2GKSA 3AKCA 2BWJA 5FTNA 2JDIA 1KY3A 2CEAA 3ZVNA 3CF0A 1LS6A 5DN6D 3RLFA 3DOEA 4IHQA 1S0UA 4D4JA 1XCPA 4CEIA 2WJGA 4HDOB 4DSUA 4TTPA 3FDIA 2RGEA 3HU1A 1KKMA 4GOJA 4OKSA 5FPYA 1E99A 4JLPA 4QHYA 1COWD 1TU4A 3TW8B 4A0FA 3GEEA 3X1DA 1JQLB 1KOFA 4A8JB 2GCOA 1IN8A 2EFCB 2NGRA 5EP3A 2CNWD 3GJXC 3SYKA 4MGZR 2EFEB 4PC1A 4C7OA 3EIHA 4PPGA 3BE4A 1NVVQ 2FGJA 4LX0A 2PBRA 2RGNA 4HLQB 5K8UA 4RD6A 1FQJA 3EZ7A 4ARZA 4CVNA 3HR7A 1OB2A 1ODFA 2IHYA 1FPMA 4BUJA 4ASUA 2W0MA 2GVDC 3B1XA 4NYMR 1YE8A 4PZYA 5JMTA 4WZ6A 4EPVA 2QRZA 5EXPA 4IKEA 1IY2A 2ZS7A 3ZH9B 2RGDA 1WE2A 1UFQA 1GILA 1ONBA 1XZPA 2FPMA 3IPYA 4JJZA 4EFMA 4JBWA 3OFND 1L7VC 1Q20A 4L4UA 3QG5A 4NZYA 4QBIA 1ZMXA 2AX4A 3UKDA 3QXHA 5SZKB 4M2LA 3H84A 1Z28A 2R6GA 3I73A 2FSHA 4B2IA 2O8BA 2WIAA 2Q21A 4Q4AA 2QNRA 5JCPA 4S35A 1OHHA 2VP6A 4JLOA 3CM0A 5HCNA 3QNUA 4Z51A 5FH9A 2J5XA 2NPIA 4NCHA 4QM7A 1LV7A 1EESA 2VH5R 1E2IA 1P61B 3FHOA 4YMVA 2RB4A 3LNCA 3AVWA 4HB2A 4O0MA 4PFSA 3T15A 3A1UA 2QAGC 2NZ8A 4LJ7A 1OB5A 2WV9A 1RRFA 1PLJA 1T4GA 1T8TA 3C16C 1Q21A 5JEDA 3QEJA 2R6DA 3THYA 2QPTA 2QI9C 1N0VC 2D4HA 4LHXA 1WB9A 3U2QA 2F43A 1BKDR 4WZAE 3U4QB 3AGPA 2WZQA 2DYKA 4II7A 2ZRNA 1N5IA 3TRFA 4HAUA 2BC9A 1R0XA 3O47A 4X8HA 3WHKA 4BZQA 1KGDA 2D2EA 1U0JA 3L0SA 2CCJA 1UF9A 3HPRA 4GOKA 2RAPA 4GI7A 4L9WA 1R0YA 1U99A 2VO1A 3AGQA 2AWNA 3LVQE 4IVQA 3H86A 3QKRB 3VMFA 4ZI3A 1P75A 3FKQA 2WKQA 5GJCA 2C9YA 5BYKA 2FEOA 2RH5A 4UJ5A 1IJFA 1ELOA 4A82A 3C4JA 3L82B 4US0R 4A8JA 3EIEA 4PSVA 3GLIB 1G5PA 4AG5A 1N5LA 1BMFA 3DDCA 1IONA 1W0JA 2PLRA 2DWQA 1E2QA 3D8BA 3GJ7A 1OYYA 1GDDA 4LZZA 2NO0A 3CX8A 5JJKA 4ON9A 2ZSEA 3IUYA 1RW4A 4LYJA 3RC8A 3DL0A 4XOIA 3FMFA 2ZRJA 4LV8B 5D3QA 1QHHB 5KPJA 4HZIA 3KKMA 4F4JA 2V54A 1II0A 1XJ0A 1G21E 2ZSFA 2QSZA 5H68A 3PUYA 5DE3A 5AUPB 1Q44A 3IEUA 1NN5A 2BMFA 2BOVA 5GVSA 2FJUA 1LW7A 1JR3D 4JYBA 2O0JA 3RRZA 2QP4A 1ESNA 2ZREA 1D2NA 3E5HA 5FL3A 2Q0HA 2V8OA 2ZVQX 2IEZA 5AUQA 3Q5DA 4B73A 5FI0B 2GF9A 4ERNA 5KHOC 3HR8A 2ZRGA 4JVNA 1OPXA 3BB1A 5EJEA 4Y0AA 3TGPA 3EPJA 2J9RA 2J45A 2QTVB 3FKSA 1NMYA 4E03A 2OM2A 4PPNA 4QRHA 1A5TA 2B8WA 3U3RA 1ESMA 5H1YA 2HDNB 1LTQA 2CHQA 3FFAA 3U61B 3KFVA 3X1ZA 2YVUA 4OJKA 4ZDJA 2MSDB 5DISB 3GJ5A 5DSZA 4W9MC 1Z63A 1A4RA 3CX6A 2QL6A 3HYTA 2VRWA 4X8LA 1ZM7A 2ODEA 1KDOA 3AF3A 3IO3A 4E07A 2XOKA 2AD1A 1Z2AA 5KNBA 4DCTA 4PTLA 3G0HA 1OT3A 3T1QA 1C9KA 1QVAA 2IWHA 2X2EA 3H4MA 4URXR 8OHMA 4WVFA 5JHGB 3A1VA 1OKKD 3RS4A 4OI0A 2WJYA 4GSYA 2KB0A 1T3SA 2J0UB 2GDJA 4P32A 4QHSA 3KXIA 1S9DA 3F5FA 4Q4LA 1RJ9A 3KKOA 5EXTA 1ZNZA 2ZM5A 4V03A 5BN5A 3AP2A 2PEYA 5GJVC 2ZJBA 3CRVA 3GLIA 4LV5B 1GITA 4JJKA 2H8KA 3BC1A 3U7HB 5GJBA 1IHUA 1XBTA 621PA 1KO8A 1X1SA 3TQCA 4P4TA 2YV5A 3QPVA 4JIMA 5TB5A 2PZGA 1QRAA 4EPRA 5EZ5A 3I8SA 1Z6YA 3THXB 3K0EA 4QGFA 2VP0A 4KU4A 5JI3E 2BCGY 3NDPA 2JJ1A 5HKKD 1NBMD 4PO9A 5DYGA 2ERXA 5C2JB 4RY2A 2QMHA 2QN6A 2REXB 3BS4A 3LWNA 1J8MF 3W6PA 5LD2B 4MDEA 1JJVA 4OL0A 2NOAA 4D80A 3LW7A 4GL2A 5H70A 3A6PC 3DO6A 2ZYVX 1GKIA 4IXNA 4XTRA 1E2KA 1Z0KA 4UQOA 2FOLA 5AUOB 4DWJA 1G7TA 4PXAA 1SVSA 2CLSA 4AYXA 1SULA 4ZCIA 4G1UC 3SQWA 1CF4A 1EFTA 1WXQA 3ECCA 3NBXX 3W5IA 3AVXA 4V0LA 4PSKA 4Q21A 2PCJA 3AVQA 3QKTA 2RHDA 5LBIA 1I4DD 1N5JA 1Q0UA 4XSHA 3ZS8A 2C9OA 1W36D 2ZE5A 3L0PA 3QENA 3EA0A 3SHWA 2G6BA 2QEQA 2OT3B 4P0TA 2BBSA 3CF6R 5LB4A 1ZM3A 4TMVA 2YNMA 2FPKA 1X3SA 2WOJA 4TMZA 2WMNB 4QHTA 1NMXA 3OE7D 3RS0A 1ZVQA 3UANA 1OIWA 1JAHA 3QY0A 1YZUA 3LLMA 2VHCA 1HUQA 1W47A 3U6BA 4BRUA 1VCNA 2AXPA 2I3BA 4AIIA 1P2VA 1W2HA 5EP2A 1D9ZA 2YWFA 4LC0A 4G5GA 4Q9HA 4TZ0A 3AVYA 1YR8A 3BB4A 4ABYA 1EWRA 2J0UA 1W4RA 4POAA 2BDTA 1BS1A 1NIPA 2YOFA 3R9WA 1ETUA 1OXVA 2HXYA 2HLDD 4NYJQ 1UBGA 4G5OA 3PIRA 4G3XA 4Z1MD 1X8LA 1QDEA 3GJ0A 3VNVA 1ZBDA 4GP6A 4N1AA 1RRPA 2GF0A 2O0HA 4TMKA 2P6UA 1Z22A 4CEHB 2HYDA 4N0EA 4LCBA 4Q4HB 4A0RA 1SKQA 5FPHA 1UPTA 5J4YA 4DCSA 4GDFA 1XEXB 2ZR9A 4TYNA 5G3ZA 2FN4A 3BH7A 4PR0A 5TXGA 4M9QA 1F2UB 1GP2A 2ZTSA 4IXMA 4W5WA 2RGXA 1OIVA 4I1VA 4FINA 1KJYA 1QZXA 3THXA 3FFBA 1MO3A 1DAHA 1XEFA 4TT3A 4YQFA 2HT6A 3AM1A 2ZJ2A 1U94A 4LJ8A 5JWHA 4QJ3A 4OQLA 3CZPA 2Z0MA 2OAP1 2YHSA 2QMOA 4IDOA 4V0OA 4OHXA 4RZ3A 3FHCB 1EWQA 3GCGA 4PHGA 2JATA 2OBNA 5CJPA 1KYIA 2IYLD 3ADKA 3EC1A 3L43A 1VKJA 4RD1A 3ETLA 3G82C 4RD3A 1E1RA 3GLHB 4MDFA 4RSGA 3Q7PA 5SZHB 3T61A 3MAAC 1GRQA 1MABB 3SDZA 1G8GA 1ZD1A 3Q9LA 2WPDA 1FL9A 3PUWA 5JCZA 2IXFA 5JWRA 2V6IA 2ZI9A 4OHZA 2DFNA 2QZ4A 1W44A 5E7IA 1RZ3A 2IW3A 3EASA 2WSSD 721PA 1Z07A 2BBOA 3LFUA 2JAQA 3PEWA 3QE0A 2D3WA 2VIIA 3QOFA 1M1YE 4IW3B 4NBSA 2ZJOA 3SOPA 5HE8A 1IN4A 3ZQ6A 4NCNA 3CH5A 4AY2A 3ZZ0A 1VYVA 2QTHA 2FPLA 1S2MA 4URZR 3N5CA 5KPDA 3BXZA 1ZP6A 2RGCA 1D5CA 4I1SA 2MMCA 5FI1B 4M1KA 4P31A 2DR3A 4TLDA 1XTJA 3TR5A 2CHVA 2BCJQ 1TQ2A 1YU9A 2IYWA 2V1XA 5CB8A 3B8HA 3QPWA 1KK3A 4IDHA 1WDTA 1T5IA 4MGKR 5GVRA 4LPKA 4WIAA 1NBME 2VA8A 5AK0A 3LAWA 5TV2A 1T91A 2D2FA 1JEDA 5L3QB 1Z08A 3F3YA 3REFA 3ADBA 3DZDA 3B1YA 3PCRB 3QXSA 5FOVA 2FSFA 3SEAA 3MWLA 3B60A 3PITA 4NCKA 2WSMA 3FMPB 4CEHA 2BM1A 3CPEA 4Q4HA 4W5JA 2XEXA 1P9RA 4BLSA 1XEXA 3ADDA 1XD2A 4CRWB 2AD5A 1F2UA 1R10A 1Q1ZA 1UKZA 2FDCA 5JECA 3HDTA 3U3OA 1CIPA 2OAQ1 3I32A 4PZLA 3SQXA 2WWIA 1E2GA 4U5XA 1U98A 1WF3A 1W5TA 1AQYA 1E96A 1L4UA 3HU3A 4BFTA 2J87A 1NJGA 1R7RA 3OAAD 1IN5A 1G8HA 3UWKA 2GBLA 4NH0A 2QSYA 2O5VA 1KAGA 4M1YA 1XD9A 4A2QA 5B30A 3B1WA 3VKWA 3OESA 3AKDA 5EE9A 2EVWX 2PZEA 3K0CA 1US8B 4N0DA 4JLMA 1UM8A 4GPTA 3NBYC 3LX5A 4Q4JB 3WYGA 1E1QA 2CXXA 4ILEA 1MABA 1VECA 3WRXC 3I61A 4NYIQ 3THOA 4RD2A 4IJMA 1G3MA 2V1UA 1PLKA 5DI3B 1Q1QA 2NO9A 5JJIA 2O8DB 3RHFA 5ELXA 2V4ZA 4WXPA 3B1ZA 4OQNA 1CTQA 4Q19A 5DN6A 3U60B 4DLVA 4FMDF 1NVVR 2GEUA 1LY1A 4ZO4A 3TNFA 3RDPA 4KCGA 2NZJA 3B9QA 3UXMA 3QKUA 3GLGB 1E9DA 3DOFA 2FF7A 1RFLA 1COWA 2QBYB 1DELA 1KZGB 1J2JA 1OE0A 2QM8A 5IRCD 1P6XA 3LV8A 3DZ8A 3ZVRA 3BRWD 2IXEA 4JS0A 4PAMA 1ZM2A 2CNWA 1U8YA 4A6XA 4PO8A 2ONKA 1T9HA 1NSFA 1Z6GA 4NL4H 221PA 1VG1A 3K09A 5DIFA 4QJ4A 4B74A 5KTYA 2WICA 1D2MA 4HB0A 4U02A 4UNPA 4WBSA 5L3QA 2FFHA 3GMTA 121PA 1J70A 1CKEA 2O8CB 4MYHA 3IIKA 4BLPA 1P2UA 3QI2A 5IK2D 2XX3A 3GLIE 4FMCF 2WWXA 3QVUA 4AG6A 1R2QA 4BRWA 3BIFA 2VYFA 3FE2A 2B8TA 4Q1DA 3WNBA 3ZIAD 2GA8A 3R9XA 4LV6A 4QG7A 3LY5A 1G7CA 2GJSA 3KKQA 1I4LD 3BORA 4FCWA 1D9XA 4YXWD 5AJZA 3I4LA 1KMQA 3OEHD 3UK6A 2X19A 2GK6A 3OFNA 5E95A 1XEWY 1MRSA 2C78A 1R4AA 4GMXA 1NVXQ 5L3VA 3RANA 1KI8A 4M8NE 1KK1A 3LXRA 5HTKA 3TUZC 2CL6X 4URWR 2ORVA 1C4OA 3SU8A 1CJKC 4MRRA 1GL6A 2P6NA 5IT5A 3QVVA 1VPLA 4EFNA 4B3DA 2XZLA 1T5LA 3ICQB 1TQ4A 2A5YB 3Q72A 4XTCS 3A8TA 2IYTA 2WOOA 3ND8A 2NIPA 1P4SA 2ZRBA 4M21A 4LHYA 1US8A 4LJ9A 2FZLA 1GRNA 4BFXA 3CRQA 3TE6A 2VEDA 4Q4JA 3P27A 1KAOA 1QHGA 2OLKA 1RRCA 2ZUDA 4TTRA 3BERA 4AKIA 1KI6B 1IXZA 1G8PA 3SN6A 3W34A 1KIMA 3U44B 2ZE8A 5DI3A 4LJ6A 1SXJC 2O8DA 1P72A 2GVZC 2GJ8A 2IS2A 1GL9B 4PC6A 2K5UA 3HWSA 4HUTA 2FWRA 1TX4B 4I81A 3CIOA 1LF0A 4DDWA 3AVUA 3KFXA 1E4YA 2GAAA 3GLGA 3EZFA 4D81A 1KI1A 2ATVA 2C8VA 2PEZA 2W00A 4CYMA 2QBYA 2XTMA 3ZJYA 4URUR 3WP0A 4F4IA 2Z5FA 4OHYA 4KFSA 3K53A 2ODWA 1DVRA 1Z06A 1FNMA 1A1VA 1E0SA 4LBWA 3KL4A 2C95A 3AKYA 2E1RA 2GZDA 3NC0C 1SVLA 4UKDA 2PX3A 2J1LA 2QPAA 4TTQA 3TSOA 1Z6XA 5EXSA 1FUUA 1DOAA 3SE0A 1CU1A 2A5JA 1CR2A 2ZRPA 3HYRA 3EPHA 2W6ID 3B7GA 5E3HA 1DAKA 5EE0A 5J5CA 3K0AB 1HE8B 2JLYA 1L4YA 2JEOA 3AVPA 1EX7A 4EJSC 2C77A 4XWAA 1PJRA 1E2EA 4M9XA 1HQYE 4C9BA 3F0TA 4LYAA 4UNNA 1JR3A 1P5ZB 4DB2A 5KDLA 4Z54A 3KZ1E 2I4IA 2OEPA 1IXSB 2X77A 2XJ4A 3EIQA 2PH1A 4XIGS 3ZDQA 5HPYB 1MO4A 4QXAA 2VF8A 2VQSA 4DSTA 5L3RA 2NQ2C 3AEZA 4U00A 1PUIA 1VHTA 4R7ZA 3DM5A 1OH6A 1GUAA 2R6CA 3CW2A 4ZDWA 2Z83A 3ZYCA 4TSFD 4BFSA 5EUMA 1NN3A 4NDZA 3VR5A 2VP2A 1XF9A 3T1VA 5D3MB 1KI4A 1U81A 5FUXA 2CHGA 3PUVA 3QF4A 4FWTA 4ZCLA 4S2EA 2VLIA 3NVAA 2ZYTX 1W36B 2JCSA 1Z0AA 2ZYWX 2EWVA 2QU8A 1KI9A 4Q7JB 3N2IA 1YHNA 3FGNA 1F3OA 3CRMA 1G8FA 1KI6A 1VG8A 2V7QD 3LQQA 2A9KA 4MQBA 1Q57A 1U0LA 2CK3D 3OHMA 4J0QA 1UKVY 1C1YA 1DO2A 1F2TB 3CNNA 4KI0A 4B3CA 2VTKA 1XNJA 1OKKA 2OFXA 4L16A 3ONWA 3ADCA 1JEEA 1U0HC 1RYFA 1YZKA 4JVSB 1XXHE 2ZS9A 1E2MA 5A4JA 3TAHA 2N46A 3I1FA 4JBYA 3R9IA 3IILA 2QUZA 4OK3A 2DWOA 4Q66C 4PO1A 4DVGA 4Q1CA 2KBEA 1M7HA 3ZVLA 1U9IC 1QHIA 4JKIA 2OG2A 3SYNA 3QXCA 1QVRA 2WJVA 4EKDA 2XXAB 2OZEA 1NJFA 3Q7QA 2XZPA 2CE7A 3NDBB 1ZINA 1ZM9A 2BIFA 2GJKA 1YZLA 1AZSC 4RKEA 3C15C 2DBYA 2VSOA 1M2OB 3A4MA 4MITA 3K8YA 2OUKA 2P6RA 2ANCA 3C5CA 1JXOA 1XP8A 3K0AA 5FOWA 4DLTA 2XGJA 2FMXA 5EP4A 3VR4A 3O8CA 1DG1G 1M8PA 4ITRC 2GILA 1NBMA 3UMRA 5HKKA 1DPFA 1XRJA 5AJYA 4EPXA 4EPYA 1W7AA 4NCJA 2C9CA 3T06B 4B35A 1XMJA 4JL8A 1MV5A 1KJZA 3T34A 4KO8A 4M1TA 2JIZD 5F3WB 4G5SA 1ZU4A 3LLUA 2R44A 5DHAA 4HAYA 3EPKA 2ZRHA 3MG9A 1FQKA 4DRZA 1RYHA 3CNLA 2ZR0A 4YDHB 2P3SA 3PJRA 1EX6A 3HU2A 3GJ3A 3PENA 4C0KA 1E79A 3RRYA 3NWJA 2QGZA 1R5NA 1JB1A 1KHTA 4HB4A 4ESHA 3W6NA 4A2PA 2F1HA 1R8SA 5D3MA 1GNPA 4GFDA 2OV2A 4ZDIA 1II8B 4PHTA 1IQPA 4TYYA 4KFTA 3GLHE 1CS4C 1S3SA 3EC2A 1W48A 4TMTA 3PEYA 1Z6AA 1JPJA 4G01B 1HV8A 2RCNA 4AKEA 4QKQA 3OE7A 4NYJR 3RS3A 1NG1A 2Z43A 2OCAA
chains in the Genus database with same CATH superfamily
2ZUSA 1KJ9A 2CZQA 4FX5A 1O54A 1DTSA 1Y3DE 2FFBA 2IEYA 3C14C 2RKWA 2IJGX 3KD3A 3FWKA 4KE9A 4U7FA 4YMHA 1Y8QA 1QO0A 4K8OA 2CW5A 1P7CA 4MCJA 1GV0A 4ZCMA 1I4OA 1C3XA 5JY6A 4DZZA 3RVSA 4B31A 5KS2A 1H93A 4WADA 2I1VB 4E5MA 2O2SA 4JD5A 1P31A 2HD4A 2HK9A 2P91A 4GLOA 4ZC8A 3W3AH 4X1YA 5ESDA 5CAEA 4LHSA 4Z1MA 1YFLA 1EUQA 3RK0A 3FTFA 2C2GA 2W4IA 3PRYA 2JPDA 4I5DA 3AP3A 2HT1A 2XMCA 3CGWA 1VCMA 3DUWA 1IHOA 3OQIA 2ORWA 3UWDA 4AURA 1JVBA 4BVKA 4FFSA 1ZONA 3OC0A 2VDKB 1COZA 3LUFA 3QUTA 1I36A 3U4QA 5J58A 4UMDA 3OIWA 1DADA 3QW2A 3AFHA 3U31A 3DE6X 1E61A 3BXXA 2OOSA 3NDIA 2I29A 1AKVA 2GI4A 4Q9IA 2JKYA 2HSZA 3CSUA 4QULA 4X00A 5HG0A 1O1YA 1QORA 3UHOA 1FTNA 3WX0A 4ZYYA 2AYXA 2VXCA 1E1LA 2J0QA 4V1CB 2AWOA 1CZLA 3L8DA 1W4ZA 4TYMA 2O3RA 3CB2A 4H17A 5CLLA 1JMKC 4PQRA 5D86A 4EG6A 3WGKA 5JBQA 4IGKA 5TY0A 5K09A 4G5RA 1YRBA 2C0CA 5JS7A 3GT4A 1OZGA 2I67A 1ZLXA 1Z5WA 2B30A 1C0LA 5CT5A 1N5KA 3WRYA 1ZGZA 2VJMB 3U9LA 5UKDA 3PUIA 1KZ4A 2B2NA 2OGTA 3KYJB 3U5ZB 4MHTA 2YIVX 4RPGA 2ACKA 4R2WA 1PT6A 5K05A 3HYLA 1TB4A 1UT8A 1X1RA 4NCXA 5D2CA 3L8YA 1B41A 2HBRA 5CJJA 4F3TA 4O2AB 4D99A 1ZA2A 4ESEA 1V8BA 2Z8ZA 1WBBA 1LNQA 1RYNA 1EFVB 2CBGA 2RMKA 5F51A 3VV2A 5CVUA 1VCIA 3ZWXA 2A30A 4EHDA 1HYEA 1CFZA 3EZYA 3QMPA 1P2SA 2AQHA 1U9CA 2MTBA 3FRIA 1EPUA 1QXSA 3ICOA 5AW5A 4D8UA 2PV0A 4JVLA 1SPBS 2FMIA 1E3IA 4WDRA 2OCYC 4N0PA 3N05A 5B57C 1UKCA 1KQOA 1M73E 2Z30A 5HKAA 5IT4A 1II8A 1E9EA 2NAPA 4FYKA 1KSHA 4TV9A 1GPMA 4LK2A 4UE6A 3EXHB 4ZEXA 2R00C 1C9MA 3MGKA 1XZDA 1SC6A 1ZIOA 3AP1A 3P4YA 3GH3A 4QELA 2ORIA 1J42A 3RS5A 3BG5A 4LVCA 5FYDA 4CKCA 2F55A 1QIJA 1N2OA 1QE3A 4JJ6A 2WZDA 3OX1A 1EEXB 2R8EA 4AJOA 4DBLE 4EZIA 3J7AC 1HQCA 1TMYA 3D0OA 1KF0A 4AULA 1QF9A 1RNLA 4CG2A 2PA3A 1SUWA 1JQ3A 1VIYA 3NDJA 1FRVA 5CVJA 3L1VA 1M8KA 2WWHA 3HACA 2R47A 1CY4A 4UNSA 4IUBS 1WNFA 2ENUA 2WIGA 4JI0B 1NOIA 5FPQA 1CS0A 2WVAA 4RTSA 2QTCA 4JMPA 4JZYA 3RH0A 3EVAA 1B23P 1U0GA 2QMEA 3RODA 4MQ4A 1DLJA 1OROA 5JD4A 1NYRA 2NQTA 3OZEA 4B46A 3GDGA 3UENA 2WAYA 1E6LA 4TKUA 3WNCA 1Z0IA 3IL2A 2H0AA 2BM9A 2ZR8A 4MRNA 1SBIA 4HXFB 1U04A 2XADA 4D0NA 1XTTA 2EQ5A 1ISGA 4JKOA 1OFVA 2W2TA 3MGAA 2G83A 5FBLB 3PC2A 1P0MA 4WEQA 3F74A 3EXFB 2BBWA 1HT1E 3A25A 2X0FA 3VC1A 5IKXA 3D7SA 4MWBA 3GJ6A 4RK5A 3N07A 1XRSB 1FU8A 2ZYGA 4XJTA 3AR9A 5THKA 3KUKA 3WNZA 1VJ0A 1XN4A 4BFYA 2GPNA 3NTQA 1OTXA 1G291 4IDNA 1G19A 2VATA 3A3NA 2FLWA 1T24A 2F8MA 3INGA 5JRJA 5JYEA 5KCMA 3TLAA 1W8IA 3O91A 1XD8A 3AM5A 4Q9JA 3JQ6A 2HRBA 4ALJA 3VMMA 5B4VA 2X9QA 3IA2A 1KC1A 4PGGA 2XT9A 2GZRA 1YDGA 4EJSB 3DD5A 4JB3A 5AR1A 2VHWA 2FEAA 2ONJA 4B8ZA 5CU7A 4F5EA 1O4WA 4BB6A 2EGUA 4KOAA 4NAHA 1IWPB 1DIOB 2ZWVA 4OMDA 4PFQA 5CB0A 3MFYA 5ICMA 3HJGA 3RC3A 5JFGA 1NLFA 4QJIA 3ABQB 2LRHA 3BWXA 3PJEA 2OBXA 4M6WA 4B6FA 4M87A 1E98A 1KJNA 2PQ6A 4JBXA 1QONA 3NXKA 1YB5A 3V6MA 4DXHA 1N6OA 1SM4A 4CTKA 4JQSA 2WZBA 2IV2X 4C4AA 3ADOA 5FTWA 2Q5HA 1QVWA 3EN0A 1U1CA 4A2WA 2TMDA 3QH4A 1KAEA 4OGWA 4LW8A 1U8AA 1RPTA 4X1KB 4R8RA 4XYEA 4DSOA 3T0GA 1J0AA 4U9UA 1TUBA 4ZHQB 3GEPA 1GCGA 4M99A 1BQEA 1MGPA 2JI8A 2YZ2A 1EJ2A 4L2IA 4X45A 3W6UA 4WAUA 4HNTA 1BZYA 4Y0NA 4NLLA 4Q7LA 5DV9A 1NA5A 2VHTA 1YQQA 2P9CA 3OKAA 4FFOA 1RR6A 2W6QA 5KOHB 4OP3A 1UAGA 3K5IA 1W46A 3T9FA 5B2FA 1NC3A 1N2ZA 3UK1A 4IOJA 4YJ2B 1J49A 1PWYE 2HN9A 3NYIA 2QUHA 4NATA 3U7IA 3E8XA 4N0MA 1N2HA 2IHTA 2QP3A 1N2JA 1Z7WA 4RKFA 2Q5FA 2MYTA 2YVKA 3ANYB 2EBFX 4Z7NB 1CXZA 2KHZA 4LJ4A 3B2NA 2XVXA 3OLZA 2NPOA 4JH0A 3SSMA 5A5EA 3W04A 5BORA 1ID8A 3LX8A 4V0RA 2I4TA 4CL3A 5LMUB 2NYUA 2CCKA 4AT1A 1JILA 1T1GA 1YUMA 4MR8A 3VU8A 3HR4A 5EIAA 1IUOA 4KSCA 4TZKA 1I3MA 1U8FO 1X9IA 1UKEA 1UFVA 2JGLA 2PY6A 3E05A 4K9OA 4QTTB 4RHEA 1ZN9A 1U0OC 1YJCA 4AN0A 2P1ZA 4NK5A 1YA8A 1W5AA 4JCOA 5HK8A 1XMQB 2IYSA 2PKRA 1H2XA 1GRRA 2E4XA 2HX1A 2IA5A 3C39A 1YQTA 2XDQA 2B21A 3FNHA 4FUQA 3WO0A 4HNGA 4FR5A 4IF4A 4Q39A 3AB7A 5EZ6B 3WGLA 1L5WA 2DLCX 1XXHA 1LX6A 4ARIA 5K5EA 3GNQA 4BNLA 1TC2A 3Q3VA 4IGFA 3JY6A 1JMVA 3NVKI 1TGYA 3OEHA 4L3WA 4PWYA 4N5NA 5TPWA 1BXRA 3TIIA 3ZZNA 4B3IA 4A9AA 3UHJA 4U7JA 1URPA 1XTIA 2GCIA 3M4JA 2ZSKA 1XDZA 4U7TB 1C9EA 2IU4A 2ZVJA 4JLWA 3RUDA 2P2LA 2YBEA 4GMDA 3T3MB 4OOFA 3KX2A 5FTLA 2C7QA 2AUTA 4LFAB 1AM4D 1VBNA 4U63A 1FFDA 2B2CA 3OTQA 4OFBA 1ZD4A 5LYYA 3RKUA 1PS0A 1RWQA 2FETA 2R84A 1RAFA 4BU1A 2CCGA 3EIUA 4EHFA 4BVFA 1CWUA 2P2SA 1G8AA 1W2GA 2Q4DA 2IL1A 3H7AA 1BVUA 1RWBA 1Y8RA 2QQEA 5F2OA 4YT8A 1HR0B 1FF9A 2Z58A 2E4UA 1PGQA 2YHAA 4BYMA 4DPKA 3D3KA 4AZWA 2ZJ8A 6ADHA 5CA1B 3LCJA 2ASEA 5BSUA 2XNDA 4H6PA 5T4HA 1KH1A 4EGFA 3OQMA 3WY9A 2H9IA 2OCPA 2D6FA 1JPVA 1KE2A 5ADWA 3OIUA 2NTVA 3V4PB 3HXLA 3LCVB 5H7XA 5KINB 3NHYA 2HK6A 2BFEB 3KQHA 1E6MA 4AQYB 4YR9A 1Y6FA 5LP1A 4BVAA 1GTVA 3W5DA 1G8JA 4CLHA 1U2EA 1WHSB 2O3UA 3BRSA 1NLYA 1FFYA 1L8QA 1MLDA 2X5OA 1ICEA 2J9ZB 5A2GA 2ZULA 1IOZA 4JLUA 1Q0TA 4QUDA 2QM0A 3V4FA 5K0NA 2ZJFA 1E2LA 2NU9B 2EXXA 1QPGA 2G0NA 2TS1A 2UYGA 1A8SA 3M1YA 4GZ6A 4URFA 4YUAA 1SVMA 2R751 4TZTA 2B99A 2RGGA 1TIBA 4XVQA 2OGZA 3W4JA 3QV1A 4P7JA 2IYAA 4I4LA 3U16A 3SXPA 1L7BA 3H75A 1SQSA 1VCOA 2EFJA 3GLHA 4ESVA 3A4IA 2CWDA 4I8XA 5AQ1A 1LDYA 3A4TA 3VJLA 3ZCXA 5JC8A 5HZMA 4FCCA 4DC1A 3KUUA 3KWJA 4CTJA 2OORC 1V11A 5JH7F 4ZOLA 2XJ9A 3AH8A 1ZCJA 3HJUA 2YJ3A 4OK5A 4WLFA 2VF5X 3FPGA 1KS9A 1F0KA 3RJZA 4J8PA 4GF5A 3RT1A 5AKEA 3OJXA 1E1YA 1SHUX 1ND6A 3R3HA 2W6IA 3DAOA 5JV5A 3EGEA 3NTRA 4P4LA 2OM6A 1G6OA 3PNVA 4M0EA 3IQIX 4PG5A 2P2NA 1KETA 4QEKA 4QGGA 2ZJAA 3WBJA 3EUWA 1C30B 4DBZA 4KHZA 2R4UA 3FKJA 1FTSA 1H1LA 1O94A 1W1WA 1X87A 2CNBA 2YN4A 2VPPA 2HU8A 4M53A 5FL7D 4B33A 5FIUA 3H5TA 1CIVA 2QY9A 2DHQA 1HYQA 1H6BA 1L6RA 4KN5A 1HDIA 1SU4A 4AP6A 4GWKA 1DBVO 3H0CA 1C1XA 1MH9A 3R8FA 3FVQA 3OMLA 3TSYA 5JSUA 3AV0B 3L8ZA 4KWHA 5TT1A 3TBFA 3LLSA 4FSHA 4CDRA 4XRGA 4UOQA 3NMUF 2H59A 4ZXFA 4GBMA 1IBSA 4YAJA 4P4SB 1X7ZB 4KLNA 4IMPA 4MWOA 2BZGA 3P20A 4GIBA 2V7VA 5DXFA 5EJ9A 1N6PA 1BNCA 1R8JA 2NNLD 4UDXX 1SKBA 5G41A 3SZOA 4CCYB 4TZ6A 2FPXA 5K2MA 4HOYA 3TRIA 1N34B 1UC9A 4J6EA 3C45A 4BU0A 2GAOA 2JLVA 1YOVA 3UPDA 3ZKWB 3L2OB 3PWTA 4BMYA 3LYHA 1K0UA 2GJAA 2QZ9A 4R9VA 4CR6A 4H1WA 5KSYA 3FR7A 3NUGA 2R11A 3NPMA 4AYWA 1NNSA 4BJ5A 3K7EA 1WQ1R 3DEFA 4FZ3A 3TCNA 4GPBA 2OCXA 4G8DA 4C2UA 4Q3BA 5IC5A 1RKUA 1RKBA 1U2GC 5DBHX 1REQB 3AERA 4HEA6 3EBPA 4HWRA 3THWB 2PKEA 2WTUA 1M8GA 1G3IA 3KOZA 1OI3A 4D9JA 1OFHA 1TZMA 2JLZA 1NM5C 3VJKA 4HEJA 4N7JA 1Y48E 2QR5A 1S8FA 5HVNA 1NXTA 2CK3A 1I2BA 4NEHB 3UKJA 3DR5A 1UC5B 3KUDA 1AQNA 1WA5A 5FWYA 2VDWA 2SECE 3BWBA 2RH4A 1CP2A 4PXYA 2Q3FA 4QE3A 3PFNA 3W5BA 2CVOA 2BM0A 3D3NA 3EXIA 1UMCB 3MAJA 4GM0A 4LWPA 1A9SA 3IV6A 3PZBA 7REQB 3QSGA 3MD9A 4FILA 4YMIA 1T36A 2JZCA 2HHHB 1UBHS 4QRDA 3OJ0A 2BMDA 2UZIR 3GJ8A 2I2CA 2I7TA 4FD3A 5GPBA 4FDVA 3TIFA 1E9AA 3CWQA 1PUJA 1NLZA 4QBGB 2FPSA 2AEFA 2Q1SA 4H0CA 3ETNA 4UOEA 3KD2A 2FZKA 3HVHA 2JCVA 3O8QB 3R3XA 4MULA 4OGKA 4V3CA 3KU4A 5MHTA 2FG6C 1R6AA 2QM7A 2J0SA 2W4QA 4NE9A 2VHUA 4EMTA 2RHCA 1TYBE 4ZVSA 4N65A 1EE9A 2EJVA 2G63A 2HPAA 5I48A 1OYWA 1RHMA 2BRUA 4RELA 1NVEA 4PYQA 4XDGA 1XYVA 3MPUA 4GC5A 2PLFA 1JR6A 3CVOA 1QCCA 4FU0A 2DPLA 4PFJA 3V8MA 1X80A 2DT5A 2FWBA 2GNOA 2CXSA 2IYFA 3L3BA 3NWEA 1S02A 2WHPB 3ROPA 4E0BA 5G3YA 4JI5B 5FOXA 1VTKA 4G25A 4BTEA 1WBDA 1QYXA 3KJIA 2BR4A 4XM0A 2IYOA 2F3TA 2VTEA 3V00A 1BHO1 2TYSB 3UOWA 4QXMA 4AG5A 5B3KA 5BXYA 4GKVA 1U6JA 4Q9NA 5DO9A 3SZ3A 3QPBA 4I55A 3AV3A 1L4EA 4C4XA 3NEYA 1VP3A 4RMJA 2WJJA 4E88A 4PG7A 1Y1LA 3OCVA 1ESDA 3X0DA 3W5CA 3TM5A 4P83A 1E6KA 4K81B 5I01A 3MEQA 1NF8A 1E2NA 2XCOA 5K6TA 1BCRB 2GXSA 2TMYA 2RBKA 5JXJA 2A6PA 2YFYA 1UT6A 3TOZA 4XVUA 4BMZA 2GZSA 2EJWA 1F17A 4IBOA 2Q9BA 1CE8B 4LJ5A 1D3AA 1RQGA 5JAUA 4JHLA 2G76A 2ZPTX 2HCFA 1OXUA 1E7YA 1ZWKA 2C0QA 3FTPA 4RKWA 4CODB 3SVZA 3VH4A 1TNDA 6GPBA 4S0ZA 3V2HA 5I8PA 5TSDA 2QSUA 3NHPA 5ALSA 1KDPA 1B43A 2P9JA 4PC7A 1H2YA 1L5YA 3MJ4A 1T43A 4IXWA 4NENB 4WZBA 5TS3A 2FEXA 3Q5GA 5K8IA 4X62B 4BNVA 1BGWA 2WWRA 4RLHA 4CN9A 5JHGB 2AKYA 1KYVA 3FVVA 4MTCA 2XBUA 2H5JA 1KYYA 2F1IA 4JEHA 3RQSA 3DKRA 3KC2A 2GN2A 2XNKA 821PA 1X92A 4XB2A 4HDAA 4YCDA 2OA0A 3NKFA 3B9BA 4BPBA 2PD3A 2VT6A 2C9MA 4OUKX 1QX4A 2PQ0A 2ZZMA 2NW6A 2R65A 3ICEA 3A9WA 3LI2A 4IS3A 3BD8A 1JQJC 4LQ4A 1I3LA 4FLFA 4PCLA 4E5VA 3WYDA 1KH2A 4TTAA 4IV0A 4P0QB 1XPOA 1A8IA 2OXIA 2QG9A 5K03A 4F9EA 1ZHHA 2RG1A 1EH5A 5BSFA 1H2AS 1R0ZA 2IPLA 1V45E 1N75A 3FW1A 2R3SA 5HRUA 2P1RA 2I22A 3LCMA 2O2DA 3RG8A 1WW8A 3BREA 4LF6B 3AK4A 2Q2NA 4K05A 2GZAA 1QC5B 1XO1A 2GBLC 3OQVA 1X8XA 4ZTBA 5AVYA 3N70A 5HZGA 1JXMA 6REQB 3O83A 4URHA 4KYVA 5C8ZA 5DCWA 3K6SA 4NR0A 5F64A 3TLGA 3GLFB 3DEAA 1K8RA 2GWHA 4AJPA 2HK8A 1B76A 4WKBA 4XARA 4YR7A 3HXOA 1XTKA 2QG6A 2ZG6A 4XDZA 3BKXA 4JN6B 5FPPA 1AE1A 1MEJA 2E55A 3GAZA 2GM3A 4LYHA 3GRRA 4DA7A 4HLDA 5JQGA 3AESB 1GPYA 2C54A 4KV7A 2IYPA 5KHLB 2A1TS 2AQ8A 1W2WB 1Q1BA 1R4MA 3QE4A 1Q7BA 4M46A 4E46A 5A4FS 1D8TA 2P9BA 2EFGA 4CV2A 5AYVA 3IIMA 4IH9A 4JSYA 4NZPA 5F52A 2FB9A 2EBHX 4RQAA 4EA8A 5EAIA 4DIEA 3I62A 5C81A 2C4WA 3H4TA 5AXAA 2Q9AA 1HEUA 3A14A 1QIHA 4ZQBA 4OH1A 1RADA 5IDXA 2A84A 4BMVA 4IIFA 1T9DA 2UXDB 5A2QA 4YQZA 2GH1A 3B1VA 1Y42X 1O94C 2G4LA 1AQ6A 2Q3MA 2V58A 3WWEA 3L0ZA 2IYYA 3PR3A 4JBIA 1GKYA 3B38A 3HEMA 2BE7A 1D6MA 1DCMA 2BLNA 3UMSA 1EVIA 3LX6A 4Q7KA 2C5GA 5GM2A 3QTLA 1L5SA 2ZBUA 1ISMA 1N5OX 2RC6A 2ZBPA 3OPQA 1G20B 1GLNA 1ZUNB 4GZ5A 3L7LA 5AKIA 4KX3A 4A4DA 5JI2E 3GRVA 3DV0B 5AVKA 1VL5A 1JIXA 2R7MA 2YOGA 3WB0A 3PHGA 3DULA 4BJ1A 4EARA 3MUFA 4EO4A 2H2HA 2JIPA 1GL7A 1HMPA 1SC1A 4OKIA 1QYRA 1RCFA 3K09C 3R77A 1U0RA 1AD2A 4MRSA 4MO2A 3KLOA 4IO0A 5KC9A 3B1JA 2IZ5A 3JX9A 2BZSA 3JQGA 3PNMA 2OMKA 3LBHA 4QUIA 4KQKA 3MUOA 2GPYA 2VWHA 4HFNA 1KZHA 1FMJA 2PJZA 1RLTA 2AQIA 3I9V1 4BVLA 4ZT5A 5IDVA 3ZTWA 1MDFA 5LMCA 1QAMA 4M60A 2G88A 1GEEA 4BRZA 5M7EA 4Q5IA 4RNDB 3VHLB 4IOLA 4I1UA 4AX8A 5KDOA 2NAFA 3IUBA 3RKRA 3UT5A 4QPJC 4TXJA 4YI3A 1FP7A 1G8YA 1ZNWA 3H6HA 4J94A 4O4LA 3N9IA 5CIQA 2BM8A 4TUYF 1UFKA 2WJ6A 1GTG1 1GKUB 2QMUA 4R3NA 2P0EA 3SYTA 1W93A 2JLYA 4QNRA 4LFCB 2JDID 3PHIA 2FN8A 2ZITA 3STUA 4HATA 3RC2A 1P8JA 1RHUA 1CZKA 4PANA 4B6JA 4DHEA 1IK6A 1CUEA 4IGAA 1LBQA 4J0JA 4JJ8A 5ALTA 1TCBA 3DWFA 5AK6A 3G2KA 3NEJA 2V65A 1RM4A 2WYUA 2B5WA 5JHHB 4MR7A 4RDCA 1EVYA 3CUSA 2ECKA 3CH4B 4QPPA 4AROA 4QBHA 1K3TA 4UUNA 3D31A 3MERA 1UOQA 2M1ZA 4Q05A 1ZRNA 2J3EA 5JEEA 1RPZA 5BMOA 1JNYA 3H6GA 3JVVA 4KDCA 4D9BA 1GAWA 3SYLA 3VU1A 2FSPA 3RJTA 1CYDA 4KMOA 4QEDA 3TBHA 3TOXA 1UEJA 2C1EA 4TWIA 4L0QA 4EY6A 4QUKA 2HMTA 2IYZA 4G86A 4LYEA 4OLJA 4UUAA 4E1BA 2UZ3A 3LY9A 4QGSA 4H7JA 4E32A 1QJ4A 1SHZA 2IP1A 1YO6A 3DDOA 4QATA 4RH1A 1W1UA 4AF8A 2AMLA 3K9HA 4OU4A 2FDRA 2OP1A 3KYCB 1SVNA 2A5DA 2ILVA 3R7AA 3T99A 3ZDXB 5JZMA 1G2QA 3DE3X 2FPGB 5AK4A 1YJBA 3VO8A 4ZAZA 2QV0A 3CF2A 1IIBA 3TTVA 4AO8A 2W2OA 4U6QA 1TZBA 1G16A 3UJAA 2G70A 3EHEA 1U7DA 4NQZA 5LA6A 1KP2A 1R6TA 4IUYA 3S6JA 2KJQA 3IB6A 2AL7A 3ZW7A 3UC9A 1M0EA 1R88A 1J1UA 2EJTA 1JDTA 1N2IA 3VKVA 3ROGA 2J6HA 4A0GA 1AMNA 3LLVA 4L51A 3UUEA 3LC7O 4OQDA 2E5WA 4KAFA 2O7SA 1TK2A 1A04A 3SFZA 4BGVA 3K9LA 3OI7A 3S1AB 3ZJUA 4RHXA 2JD2A 3O7MA 2PKQP 2QTNA 1VIAA 5KBYA 2VBIA 5A7GA 3BGOS 4OB8A 2HCTA 2G1JA 2HAEA 1CQXA 3C41J 3EVDA 4CDGA 2DERA 4OQQA 2A2ZA 2WMDA 4Y1GA 3DLIA 3O82A 1N9GB 3DPSA 2CLKB 3FZYA 2WJIA 1SQGA 3PKIA 4NYMQ 1XQYA 2MSKA 2H18A 3F6RA 3DPIA 1C14A 1G3QA 1FRNA 5ICFA 3S2GA 1CZNA 4OLBA 1ZOIA 2CHFA 3BBLA 1V7ZA 4A36A 1D2EA 1IJEA 4NESA 1WD5A 3S2SA 3FOBA 1R1DA 3GI1A 3QITA 4L5CA 3V1KA 3EWIA 2QPOA 1SHTX 4J1TC 3K9FC 2HLHA 1LTHR 4E5KA 5AMXA 4QG3A 3C4QA 3O8OB 1SU8A 3DCYA 5EP1A 1QQ5A 1WPQA 4WHMA 3IO5A 3AVVA 4MVYA 5ALYA 5THQA 1BEUB 1QIIA 4URYR 2Z5LA 1NHGA 1QHNA 3NHMA 4JNKA 4ARBA 2IEIA 4F38A 2ZEJA 3GFBA 3QEMA 2WQ6A 3C43A 2P9QA 1MC8A 2E85A 2ZRIA 4BQPA 4C08A 1F1BA 3UUFA 4KMSA 2DAPA 2H4WA 1GQ2A 4POOA 4D9NA 5IW8A 1QH0A 3ZLVA 4KH0A 3A6KA 4WKCA 4KV9A 4PIVA 2GUGA 2FSGA 1FMLA 3O4VA 1EUCB 1AKEA 1GGKA 2DTEA 3PL1A 1DDOA 3TKLA 3VBCA 1LFDB 4IFEA 1F5NA 1GCAA 3R5SA 1HX7A 1DT5A 4HDQB 3HKEB 2UZ1B 3KR2A 4OJQA 1YONA 3ORQA 1BMFD 3TLJA 3U62A 2ODTX 1Y7IA 4AY3A 3GU3A 2MSNA 4E4RA 1XRMA 2QNIA 5A0VA 2FGKA 2WHEA 2AR0A 5C18A 4KQEA 2UYCA 3BQNB 1I6LA 3EB9A 3ICPA 3GCZA 4Q15A 3HU5A 4GLLA 3U3MA 2OYRA 4AZ0B 5FO0A 1DXHA 2EDCA 2X40A 3WK8A 4AICA 1R6BX 3RRFA 9GPBA 4EG5A 1UK9A 3A4LA 3GJRA 1Q22A 1VSTA 1Z8DA 3A1NA 3IHLA 4GBGA 1NW6A 3QFTA 2V7XA 3DAPA 4I8IA 4BGEA 1R18A 2FZWA 2QRQA 5HIKA 3KQKA 2ZI4A 4ZRNA 4EZBA 2PX8A 7AT1A 1JJ7A 2AN1A 3GIDA 4YC7A 4U2FA 4DQDA 2HCJB 4Q9KA 5TMEA 2XMGA 3D54D 5EMMA 1M2GA 3HO6A 3IBYA 5DM1A 4AW9A 4CGYA 4EI2A 4Z53A 3I6IA 3DBVO 5J2TB 2JFUA 3DVLA 3SF8B 3SZRA 1V8FA 5LPNA 3KQUA 1NP7A 3R1IA 1T5DX 3A4NA 5ANRB 1DQYA 1RWPA 1YASA 2WNSA 2I99A 3N75A 3QQPA 4GQAA 3DE4X 4HJRA 2YN0A 4WZZA 3VC2A 1MB2A 1E9FA 2DULA 4HWPA 1D0IA 2FZ4A 4R01A 5T6MA 2CWWA 2E21A 4CIBA 3CH6A 1TMKA 2P62A 1MO5A 5CDUA 1WXDA 4NU6A 1U31A 1TUEA 2D5BA 2PT7A 2X1LA 1CY2A 3LO5A 5E9AA 1WCV1 3JWHA 2WMOB 1MT3A 2JFGA 3KQNA 4RO0A 4CHTA 3MJTA 1UKAA 1QWOA 4CL8A 2QDKA 1JAZA 1NUHA 5BMVF 2LBPA 2YYYA 4GZ3A 4YNBA 3FI0A 1SA0A 4DFDA 4JI7B 3KQOA 3EG5A 1H42A 5C9ZA 1QTIA 2ZWMA 3O3NB 4INPA 1W59A 1J09A 1RKVA 3I2FA 3P5BA 2XTZA 3LHIA 3OQHA 3CUWA 1APBA 4KR2A 3R3UA 4L3OA 4CQMB 5LN1A 4EX6A 1UK8A 2QZPA 4K9KA 2YQZA 3ZE8A 4R9SA 4BO5A 1J23A 2BKXA 3IP6A 1XPRA 2VNIA 4WOBA 4PX3A 1UP6A 5IABA 1JW9B 3TZKA 3T1TA 5B3LA 2E6UX 2WDZA 4W8OA 1X1CA 2FP4A 3FOFC 2WJAA 3HI4A 4HO1X 5TR9A 5LP6F 2VOEA 3HN2A 5FL7A 1QIDA 1WQ4A 3BAFA 2H5EA 4JBLA 4MWTA 1YZGA 3C2QA 1U5AA 1BIFA 2KM1A 2QYTA 1HE2A 4O4IB 1KXJA 4QL3A 5B53A 2X8AA 5FA5A 1CX9B 1RYYA 2RAVA 3D8UA 4YJHA 4UBOA 3MTJA 3W9UA 1E8NA 1QO7A 4CV0A 4Q1AA 5CB4A 3K9QO 1H8HD 2IDJA 3MWFA 1VL6A 3Q9NA 3I5UA 2ZAGA 4OLHA 1GGEA 3O75A 3DLCA 5C51B 4IDCA 3PXUA 1XZIA 3VHRA 3IBSA 3UG6A 3LA6A 4HNUA 4WA8A 2CXOA 1HE1C 2L42A 3I9LA 1E6EA 2HRQA 3ID6C 4Y2QA 5AM5A 2ECPA 3HA5A 2OK8A 2OFFA 4EKIA 2H3HA 2ZBQA 5L7TA 1LPBB 3CVVA 2AFHA 1G9XA 4KQ9A 3GEGA 2OBLA 3P9IA 4P93A 3RBXA 4LJSA 2DX7A 4NDNE 3VH3A 1KMHA 3DWGA 4I08A 1NYQA 1XRPA 4PYKA 2WIDA 3KJNA 4FWIB 1W36C 2PUVA 3ZIAA 4DMKA 4ZGGA 2GN0A 1C2TA 3AYZB 1I7NA 3M9WA 4CI0B 1FW6A 3GVPA 1G2IA 3IGFA 2B92A 3NU1A 3R5KA 4I1OA 5LUAA 1PYDA 1PGNA 4G5QA 2WIFA 2A7XA 3MILA 1VE1A 1E5LA 2C4NA 1Y7HA 4F8EA 4L5BA 1NZJA 4FTWA 5C1DA 4ZVNA 4OHPA 3PWSA 3OWXA 2HIAA 1WSAA 2P2CA 3MJHA 5ALJA 1ZNYA 2DSTA 4Q3LA 1EFKA 3WQRA 2P30A 2YY7A 4KLAA 3WRVA 1ZG3A 2HWWA 3T7JA 4L9SA 2CVFA 3KK0A 4E30A 5AW3A 1GGMA 2ZSJA 3FYTA 4DYVA 2IZ0A 4FNAA 4FKBA 3EAQA 4KK4A 4O5OA 3AM3A 4IVPA 4O2BA 3A04A 1DQZA 2X0NA 4ZCPA 3WGHA 3Q6NA 1YRLA 3QKSA 5CFZA 1QG4A 3EAFA 1W29A 5CPBA 1U0EA 4X66B 3WBFA 2CJYA 3BM5A 4TQUS 5IVDA 2QG4A 4DSAA 4IRUB 3MC1A 2VPWA 4TXLA 2A0KA 2AR7A 1E9RA 5FWDA 4EEKA 3HVKA 1E89A 1NOJA 5H8WA 4FYMA 4EA7A 4BY9E 4O3MA 3VNUA 2BFWA 5CD1A 5BQFA 4L1KA 4XDHA 2IYRA 4INJA 5C0OE 3WWZA 5DNEA 1OXXK 1M0TA 1SVWA 2HJWA 1IM5A 1HOTA 5EWJA 4MWEA 1FFXA 1RU3A 1B73A 4X6YA 4B4OA 5C8YF 5B4TA 5HTOA 3K1TA 1L1EA 1VHQA 1YVEI 1LBSA 2HBYA 3C6BA 2Q5QA 1NP6A 1E6CA 3RFUA 2WRZA 1HMYA 3R3ZA 3JTEA 1H2FA 2XQGA 2VLBA 3UHAA 3D1VA 2YNMD 1F6BA 1ZBQA 1RTTA 1GDTA 1NQ5A 2P5SA 3KWLA 5B12A 3VZQA 2FMFA 4CDMA 1JTEA 3UM9A 1UPCA 3K72B 3OZRA 1AN9A 4MVJG 4EDHA 3R09A 3WYNA 2FY8A 3ZU5A 4OFZA 3X2EA 5C53B 3NRBA 5TPZD 3AEYA 1RQRA 2GEDA 2VP9A 1ZM4A 2FMHA 5JS1A 4J3NA 2EYQA 2AXNA 1ZVMA 4Q48A 4W6ZA 3E22A 4V38A 3GD7A 4BQFA 4BV2A 3AL3A 3M4YA 3MT7A 4ZV7A 1Z0ZA 3A7DA 1P2GA 2FZ5A 4TXHA 4DCJA 4LJAA 1Z0FA 3JR3A 3ZU3A 1S9HA 1WUHS 3TSWA 4HK4A 5CNIA 5DHUA 1DO0A 5IFLA 3PI6A 5BYBA 4RZXA 3P5SA 3SNHA 4DPLA 5JJBA 1QP7A 3SCZA 1GQFA 4ZVMA 1JKJB 2VJDA 2WA1A 1CR0A 1TE2A 2B9EA 2VZLA 4HAIA 4IIJA 1BD3A 4MZDA 5A9RA 5BUQA 2Q9CA 1L4NA 2QAGA 2Z9BA 3W7BA 2H1IA 3HCBA 3QPUA 2PL3A 3VPGA 2W2PA 4ENRA 1U9IA 4PLGA 4CQNA 4H1UA 4C22A 2HPZA 4O4HA 3TIGA 2VKTA 2XRMA 5LQJA 3A0UA 1QM5A 4KGDA 2Q8PA 3ETGA 4UCFA 6YASA 1C7FA 1U2QA 4J7CA 1QVVA 3SQNA 2GAJA 1I80A 4UQPA 1M34B 1XTSA 2PWBA 2PX0A 5FI5A 1W4BA 1YZYA 3N0RA 2JCGA 5K6AA 5IF3A 1DAEA 3G7SA 4MVJD 4CZ2A 1L7RA 1VI2A 5JG7A 3CCCA 2SHKA 2H29A 3DHVA 2FNAA 1I2ZA 4Y2XA 2YIJA 1S2IA 4TLBA 1JDVA 1Z8HA 3HCWA 3KYDA 3GGPA 1UDCA 4PZEA 5ALHA 4JP8A 3RSHA 3TRJA 2ZUEA 4U8HA 2IOQA 4MNTA 3MQFA 3WWOA 1MJFA 1AO3A 4ZIRA 4LNAA 1G20E 5EN4A 3AG6A 1XRNA 1ZY2A 1RC8A 1USUA 3AB8A 4U39A 3FETA 4HLUC 2XI4A 2O8VA 2OCGA 3L8HA 4FPXA 3EDMA 2K2QB 2X2FA 3G2NA 4P22A 3FPBA 4ZOQI 5L9AA 2ADFA 2ECFA 4QSMA 5AH0A 3WIDA 4RNCA 3T3DA 4PAWA 5E7QA 4AJEA 4BO9A 3TPCA 1R37A 2CVPA 3SKXA 3F9IA 1E5VA 2D5IA 4WD3A 1V5EA 4KXFB 1VB5A 3Q12A 1J2TA 3T4PA 2CJWA 3ODPA 5TE9A 3NEAA 3K70B 8LDHA 3K73O 2FPOA 2Q7XA 2H1VA 4F71A 3ZDBA 3ER8A 4KRFA 2OGUA 3DMFA 4M7OA 1JIIA 1IY1A 1WCWA 3CY6A 1TYAE 1SK9A 1YMQA 3EWNA 2YJ5A 2OSBA 1HORA 2A1IA 1RE1A 1USGA 2Q8NA 4RAQA 2I8AA 1E3LA 5BR8B 3IRVA 2AMVA 2O8FA 1QSGA 4GX0A 2Q1WA 1NI5A 3MMSA 3ZBPA 2Q6KA 3QHPA 1DUVG 3QTBA 4V0MA 5JJLA 2RJOA 1QGDA 3USES 3I5YA 1H0KA 3C5HA 2N47A 4FYPA 3WDLA 3GWZA 1EDDA 1JDNA 2R6AA 2QP9X 3RT7A 2ZUWA 2VQ6A 3F97A 4B3BA 4MDHA 4NOMA 1ZD9A 4OBXA 1EEHA 2J6BA 3PC6A 2CGEA 4BGUA 3TPZA 4AYTA 5A4KA 2P5TB 3JD1A 5DTRA 3ELBA 1P6UA 1AN0A 3OTIA 3GBSA 2X4IA 3AUKA 3QVWA 3STVA 3IV9A 3PNOA 3NALA 5AM3A 2VXOA 3CZRA 5B6IA 1Z8FA 3JZFA 5CEEA 4RK0A 4QXPA 5JCJD 5T3UA 3NYRA 1ODIA 2HREA 3UQZA 2UKDA 2C03A 4PZ0A 4LN1A 1JFTA 2MINB 4WGFA 4JV5B 1OLOA 3VVCA 4PLTA 2ZE6A 2ZYRA 2O05A 2WUEA 4DF3A 4KR0A 2CLFB 2I6TA 2W2KA 5JVDF 1A0OA 4N9WA 1YS6A 4NONA 2H57A 1M6EX 2YC4C 1YZTA 1IRXA 1NQVA 1G18A 1T6XA 2GARA 2VA9A 2YHIA 3MGCA 1I33A 4GR4A 2F9LA 4X1OA 1FC0A 5HS6A 1D1PA 2F7SA 4YPFA 3T7AA 3CUKA 4E15A 2E1PA 3CLRC 3TXAA 2HW8A 1IG3A 3UK2A 1L1QA 1RBQA 1CQJB 1T10A 4Q4AB 1I4WA 2G72A 1P17A 1CUZA 2PX5A 3A06A 2XQFA 5E7MA 5IG2A 2IQ5A 2CJPA 4E09A 4YS6A 2GFHA 3IKMB 5CGQB 1DBRA 1NQOA 4GECA 2JEZA 3EGDA 4ENSA 1JIVA 1DFGA 4ND3A 5E1OA 1YCGA 2C1ZA 2OKCA 1H2ZA 4ZT2A 4R2JA 5H3HA 5B3JA 4DXDA 1DQSA 2BJVA 4KXNA 4L72A 4Z4HA 2ZI3A 4QD3A 1ZNQO 4LZPA 3UAGA 4YPOA 2AS0A 2O14A 3A31A 1ZOSA 3Q7TA 4KRXA 3VTFA 2A14A 1N32B 5G40A 2WJZB 1ZIDA 1BE6A 1RPJA 4GZLA 1IN7A 1K5PA 2VFAA 1I5RA 4HNSA