4V0NA

Crystal structure of bbs1n in complex with arl6dn, soaked with mercury
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
166
structure length
166
Chain Sequence
SKKVNVLVVGLDNSGKTTIIERLKPRPRQAAEVAPTVGFTVDEVEKGPLTFTVFDMSGAGRYRTLWEQYYREADAVVFVVDSADKLRMVVARDEMEHMLKHSNMRKVPILYFANKKDLPVAMPPVEIAQALGLDDIKDRPWQIVPSNGLTGEGVDKGIDWLAERLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARF-LIKE SMALL GTPASE
publication title Structural Basis for Membrane Targeting of the Bbsome by Arl6
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Hydrolase/structural protein
total genus 51
structure length 166
sequence length 166
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2014-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4v0nA00
1E9AA 5FPTA 3LRPA 1KYIA 3T5GA 3N2IA 3I8XA 2ZE6A 3BB4A 5JCZA 1UJ2A 2RGXA 2AHOA 2QGNA 2R6AA 1Z0FA 1NMZA 3LFUA 2G1KA 1V43A 4MA4A 3AKEA 4PQFA 4QM7A 2ZRCA 3A6PC 2WSSA 1OB2A 3U60B 2WKRA 1ZBDA 1VDZA 2ZUBA 1MH1A 4KFRA 1GWNA 3QIAA 3R20A 2IYZA 4B2PA 5KOYA 4L9WA 1R7RA 2O8EA 3K09C 1UBCA 3QQ5A 4HLUC 3UWOA 3W90A 1VECA 3CKLA 3IHWA 4UNNA 2X2EA 4DLZA 1QHHA 1ESMA 3TH5A 2ASEA 1KJZA 2VA8A 3SFZA 2JIZD 3FFBA 3BD9A 3SJCA 5J47A 3R9IA 3WRXC 1AA9A 2Z0MA 4TTQA 3KUCA 4TMTA 1G8HA 3UMRA 4Q66C 2AFHE 4TLAA 5TARA 3P32A 1R10A 3KXIA 4ASUA 3DPUA 4A0FA 2REBA 3CUEF 2J1LA 3K0CA 2O8FB 1M74A 2P2LA 5J4KA 5FTMA 3ZVMA 5JHGB 2IF2A 5DYIA 1Q57A 4M9SA 1Z6YA 2PX3A 4XSGA 3CH4B 4OHWA 1YR7A 1Q1QA 2RAPA 5SZKB 2HLDA 3N2EA 1KSFX 1IONA 2IUSA 1H8EA 2QMHA 3IIJA 4HDOB 1GDDA 4URZR 1D9XA 3BORA 3SU8A 3FHCB 1YE8A 3W6NA 4PHGA 3I5YA 4TTRA 1E2MA 3P4YA 2RB4A 1L2TA 3NBXX 4UXIA 3W3AA 2PBRA 2WBLC 5CB6A 3H1TA 4NYIQ 5TDHA 1LW7A 3B78A 1WBBA 3GJ0A 3TUZC 1XP8A 4H1UA 5D3MB 1N6OA 2OCAA 4HATA 3AV0B 1SXJD 5TY0A 4XTCS 3OIYA 4NONA 3T34A 1N5KA 4BLTA 4DSOA 2OZEA 2FDCA 1UAAA 4NP6A 4WXPA 4QNRA 1S1CA 4NHOA 1OH8A 4OI1A 1G7TA 4MQBA 2W6IA 1SZPA 2WWIA 1HT2E 2PCLA 2PLRA 3EG5A 2GJAA 4AKIA 1U0JA 1HEIA 2J0UB 3CF2A 2A5JA 1QG2A 3DOFA 4TZ6A 4C0BA 4I99A 4BZXA 5CLQA 4B3DA 3NH6A 3EPJA 1OE0A 3HYTA 4WW0A 3OIWA 1KMQA 4HUQB 2ONKA 4KXFB 1FPMA 3QKRA 1JECA 4F92B 5FTKA 3PG5A 1JXOA 1FQJA 1W5SA 2RGAA 1PUIA 4IW3B 3SBDA 3CZQA 4IDPA 4PR0A 4ZIRB 2D7DA 1XEFA 4ZKEA 2X77A 2J45A 5J4VA 1D9ZA 1JNYA 1Y3AA 4OK6A 4OQFA 5AR1A 4WIAA 1S3SA 3TBKA 2B8TA 3RLFA 3VR2A 5LDDC 3E2IA 3QG1A 1KSHA 1E94E 4CYMA 3R7WB 4PC6A 4TQAA 5FI0B 5J4LA 1XPUA 1G291 2NQ2C 1GNPA 3CRW1 4CT4B 1E2DA 1CLUA 5DN6D 3R8CA 2WMNB 1KDPA 2WWXA 2XSZD 1D2NA 2EW1A 3RAPR 3EZ7A 3VR1A 3AVVA 5L8VA 1FUUA 2NZJA 1G3RA 5DHFA 1SKYE 2IYRA 3QBTA 2GJ9A 4IRUB 4B34A 4HYYA 3ZQ6A 4NH0A 2JCSA 3THWB 3X1WA 3K0AA 2PJZA 1GFIA 3IUYA 4KBGA 1IY0A 3FKQA 4IDQA 3GLHA 1OH7A 4QHTA 1U94A 3KDSE 1NIPA 3KXLA 2CL0X 3SFVA 1G8YA 2OESA 2XNDD 4UKDA 3NBFA 4P4TA 2Q6TA 3C16C 4V02A 1KKLA 2VP6A 2ZROA 1J2JA 2AK3A 4Q5IA 4NMMA 2WV9A 1G8GA 2YKGA 3AF1A 3LQQA 4N0EA 3AVYA 4UXJA 1Q1ZA 3SJZA 1G18A 4RSGA 2HEIA 3T12A 1E9EA 1SVKA 4A2QA 1ZYUA 1C4OA 5H1YA 4LBZA 4HI0E 5CDFE 5JEEA 4I1OA 2EFEB 3AP2A 4UJ3A 1NJGA 4C0AC 2XJ4A 4JLBA 4FD2A 2WTUA 1J8YF 1GOTA 2JLUA 4L15A 3FKSA 2CK3D 4KAXA 5KNBA 4XWOA 2VLIA 4RCYA 4QFMA 4AY2A 2VP2A 3LAWA 4G1UC 4ON9A 3VAAA 2YZ2A 2FEMA 4JSYA 1AN0A 4TYNA 1E2NA 4IOLA 2QL6A 1DTSA 1NVWQ 4C7OA 4FXPA 3VHXA 4DDUA 3MSXA 3KFVA 4PO9A 5FI1B 2JIZA 3U44B 2PEZA 3O8DA 2FN4A 3T1QA 4FIDA 2WSMA 3N70A 4UNPA 2KWIA 2NOAA 3EC2A 4Z54A 4Q4HB 2OFWA 3T1TA 2FFBA 2AXNA 2OAQ1 3AVPA 4Q47A 4RZ3A 2OG2A 4EAQA 4EQ6A 1TAGA 3SHWA 2CCGA 2OEPA 2QTVB 4XD7D 5AUOB 1HV8A 2DR3A 2CNWD 4QRHA 3D31A 4B3XA 2GBLA 2OBMA 1Q3HA 4XTRA 4CT5A 2F1HA 2ZSDA 5FPSA 1PZNA 1F3OA 1DS6A 3V00A 3B5JA 1OFUX 3VR6A 1OPXA 3CR7A 3QEOA 3MGCA 4DDTA 2GRJA 3IQXA 1TEVA 2FGKA 4DLSA 2XB2A 4KJZA 1E3MA 3PUWA 2E1RA 3GFOA 4EJSB 2RHMA 4LYAA 2C9CA 2W6JD 1RRPA 1MO3A 3EIHA 2WIAA 5FBWB 4BLOA 5BWMA 1E69A 3ZVRA 1P9WA 4KFSA 4RFSA 4HAUA 3CONA 4PC3A 1ELOA 3DEFA 4KI0A 3UANA 1Z6GA 1IJFA 5FOTA 1JB1A 2BJVA 1VIAA 4NYJR 3TMKA 2IW3A 2QG6A 4G5QA 2BMJA 4JBWA 1QHGA 3KJIA 4TL7A 2JLVA 5LPNA 3FE2A 5E3HA 1BYUA 2B92A 2X19A 2ATVA 2BC9A 4RKFA 2WJGA 4KV9A 4O25A 1ZUIA 3EASA 2GCNA 2OCYC 2RGBA 4QM6A 1X3SA 5HE9A 4M9ZA 2QBYB 5TXGA 1GVNB 2GEDA 2WJHA 1XXHB 5EUQB 3GLGA 4AIIA 3BH6A 4DCNA 1IN4A 3FOZA 2PJRA 1OHHD 3EWAA 1MABB 2FPKA 4ZDKA 1W4AA 1SXJE 3NVAA 3KJEA 3VFDA 2HDNB 1M2OB 2VSXA 3QPVA 4RVCA 3A8TA 2R44A 5SZIA 4Z1MD 3PEWA 3DM9B 1CJKC 4FMCF 2R8RA 3ZDQA 3DOEA 2DY1A 1R5OA 1Q20A 4Q1EA 3GJ8A 3AF4A 621PA 1E9DA 4A0HA 2WJJA 1JR3D 3GLIE 1MRNA 1R8QA 4JLOA 1L4YA 1NKSA 4DIDA 4DLRA 3D6TB 5BN4A 2XGJA 1KOFA 4MGKR 1E32A 1TX4B 2QT0A 4IXNA 1E0KA 4HB4A 5CM8B 3PXGA 5DLQC 1XWIA 3ZLJA 1YHNA 2FSGA 2OBNA 4LSGA 2GXSA 3VR3A 5FTLA 2C8VA 5AJWA 5G40A 1KK1A 2CMKA 3BH7A 4GP6A 1G6OA 1XTIA 1OLOA 2L0XA 4MITA 3GP8A 3FB4A 4BLPA 3BJIC 5JMTA 1KZGB 4DC9A 1XCGB 2MSEB 2ZPTX 3DZDA 3U6KA 2J5XA 1KI4A 4DCUA 2XNDA 3PQCA 2G77B 3VX4A 4Q4JB 2BBSA 3LA6A 4F4IA 3UIEA 4E22A 3H86A 4HAVA 1HYQA 4F93B 3C5CA 2ZRNA 5JECA 1Z22A 2V6JA 2W2TA 5DGXA 3HR8A 1ZU5A 4ITRC 3IQWA 2FV8A 2CHQA 1XD2A 3E5HA 4LHVA 2O8EB 4BFYA 4B6FA 2GAAA 2EU8A 2C04A 2BIFA 1GG2A 3Q5EA 2CLSA 3OHMA 3OE7A 1NBMD 4KODA 4RD1A 4C4PA 2IWHA 1LVGA 1P2TA 4F4CA 3WMGA 4QC2A 1YZLA 4A6PA 1Z63A 1G6HA 4D0LB 2ZU0C 1AGRA 3DMNA 2CCJA 4YXWD 1WBDA 2J0QA 3PITA 2CK3A 1EWRA 1U8ZA 2QORA 3MG9A 5EZ6B 3H0KA 4V0NA 4B3FX 4F7WA 2J7PD 3IGFA 3KB2A 2BBTA 5P21A 3MWLA 2ZRFA 4WBSA 1O3YA 1RRCA 4QXAA 1SQ5A 1ZUNB 2O8DB 1KK2A 3ZIAD 4DWJA 2W83A 1OFIA 1CRPA 1TTTA 3SJAA 3M6AA 1ETUA 1AGPA 4MRNA 3A1WA 1ZW6A 2A5DA 3T61A 5CIQA 4U00A 2V54A 4LGMA 3MUFA 1ZMXA 4DJTA 1U2RA 2ZJOA 4FCTA 4NCJA 2IS2A 4V0LA 3FWYA 2AKAB 4Q1DA 2QMEA 4Q7LA 1E4YA 2QPOA 3I1FA 1EFUA 2QT1A 2H7VA 3OAAD 2D4HA 4GZMA 2ZM5A 4XD7A 3CPJB 2PLFA 4XVRA 1II0A 1KI1A 5LB2A 3LLMA 4B76A 2CNWA 4OYHA 2WM9B 4NCKA 2XX3A 2R6DA 4TMKA 4CIDA 5JZVA 2FGJA 2P3SA 1MO5A 5K8IA 3RHFA 2FZLA 2JLQA 1RFLA 2JLSA 4DCTA 2A30A 3CNNA 3T15A 2NO6A 3QXXA 1RC8A 2AX4A 4X8LA 5JI3E 4PAMA 3SS8A 4A0RA 1R5BA 3RWOA 1HA3A 2IUTA 4EPXA 2W6JA 3BE4A 3AH8A 4O2LA 2EFHB 1LF0A 2PT5A 4OI0A 4H1VA 2LKDA 3EWSA 2IEZA 2ERYA 2QA5A 3TQFA 1W36B 2VHJA 1JAHA 3U7FB 1VG9B 4Q21A 3QPUA 2H1LA 2O0HA 5C2JB 2K5UA 4JLNA 2V1UA 4X8HA 1HQYE 3THXA 1QHYA 3KZ1E 2QP4A 1XD9A 3QKRB 4M2LA 5DI3A 5BYJA 2R9VA 1XPRA 4NCNA 5AUNB 2CJWA 3IPYA 3MCAA 2CE7A 5EP1A 2JGNA 3D7MA 5KSOA 3WYFA 121PA 1KK3A 2RMKA 2CDNA 4NDZA 4TYWA 2WJYA 4AYWA 3K0EA 2VL7A 2HCBA 3UG7A 3P26A 1JQJC 5CK5A 1C9KA 4Z8XA 1IQPA 2NTYC 4JBXA 1KDRA 5EXPA 4HSEA 5F2EA 2YJTD 1YZNA 2QAGC 5KDLA 1OB5A 1A1VA 4ZPXA 1IN5A 2E87A 1OXSC 4G5OA 4PSAA 2OILA 4IEIA 4F4JA 1ZCAA 3HU1A 4DBLC 1Z5ZA 3K0AB 1FNMA 4JJKA 1JR3A 4B73A 2VF8A 1UBGA 2WIBA 3MD0A 3LX8A 3W34A 3QF4A 4Y0VA 4DUGA 4TMVA 4JLJA 3W6PA 2F7SA 5F3WB 1MRSA 1DBSA 2GK7A 5CIWA 3Q7PA 721PA 5DH9A 4JIMA 2PZEA 4FMDF 4V0MA 3K0SA 2ODWA 2WJVA 3GJXC 2OLJA 1KSGA 2ZRIA 4R9UC 5B2ZA 3BB3A 2QZ4A 3CNOA 3X1XA 3NKVA 1U9IC 4N0DA 1RPZA 1DAEA 3ONWA 1SVOA 4LJ7A 3LBHA 2XXAA 2AD1A 2Z4SA 4MUBA 2BKEA 4MUAA 2BCGY 4MRVA 5EE3A 2LWIA 3WBJA 5FPHA 1IXRC 1KK0A 1ZUHA 1WRBA 3QY0A 4Q48A 1JALA 1XMIA 3UXMA 1S2MA 1DE0A 1ZU4A 1TU3A 1ZNXA 3CPEA 4DHEA 3OESA 3OFNA 5AJYA 3PR1A 4QGGA 1BKDR 2QE7D 2BMEA 3A1VA 3IKJA 3EIQA 5HZKA 2QU8A 4AKGA 5HCNA 4D4JA 5DIFA 1R6BX 1XZPA 2GCOB 3EZ6A 2P6RA 4GBMA 2OFOA 4HZUA 1TMKA 4BFVA 1I2MA 2OO7A 1Q22A 1JR6A 1QHXA 1AKYA 4DEXA 3VMFA 5JSZA 3KX2A 4G01B 5EQTA 1LY1A 2GJKA 2IYQA 1T91A 2D3WA 3N5CA 1X1RA 4YXWA 5DSZA 2RGGA 1XCPA 4B35A 1FQKA 2VEDA 2J7PA 4EQ6B 3LW7A 1UKVY 2RCNA 4BE7B 1E1RA 2A78A 1U8YA 1E2LA 2UZIR 5JBQA 1XJ0A 2FFQA 1NBME 3QSYA 3NH9A 1US8A 4ESHA 1A2BA 1BYIA 4B71A 4KYUA 4I1VA 4P4SA 4PZLA 1AS0A 2QI9C 1NVXQ 1ZINA 4K81B 1D5CA 3K70D 3RC8A 1GRNA 1Z8FA 3ZS9A 4YMVA 2C96A 3L43A 4LYHA 5EZ5A 4C9BA 3KQNA 1OH6A 2OSBA 4AG6A 2DHRA 4JVMA 1J70A 3KXKA 2GF9A 4M1TA 2C9YA 1SVIA 1XDBA 3WHKA 2PZGA 5JI2E 4RJLA 4JVSB 2AL7A 3CF6R 4TLCA 4II7A 3K8YA 2DWQA 4GI7A 4JT4A 5CJPA 2V7QD 3B82A 4RFSB 3U61B 4KVGA 4OJKA 1XEWY 1W0JD 2BCJQ 1NG9A 4LJ5A 2XTNA 2ZYUX 3CPHA 5G3YA 2GA8A 4JYCA 3P4XA 2AFIE 2PL3A 3VR5A 1R4AA 4CF7A 2QM8A 2P6NA 3MWJA 1E2QA 5F9HA 3C7KA 2GF0A 4R98A 3KFXA 4G0NA 3FHTA 5EE9A 3TSOA 2HF9A 1W5TA 1E4VA 5AJZA 5K8TA 3C14C 1VMAA 3C5HA 4CRWB 3Q72A 4A8JC 4Q00A 1XXHE 4DEYA 1RIFA 4ZO4A 1VYVA 1ZD9A 3PIRA 3W5JA 3F5FA 5JWOA 1M34E 4OI4A 4DKXA 2MMCA 5C4GB 3VX3A 3AKYA 5HKKA 2CBZA 4Q9LA 1P4SA 1JEDA 2FSIA 3GJ5A 1XBTA 4LOAA 4D4KA 2ZJ5A 4LDJA 4TTPA 4NKRA 4M1MA 2YHSA 1AS3A 1QG4A 2IS4A 4MKHA 5FPYA 4GP7A 1TF7A 3VNVA 4YDSA 1KMHB 1F6BA 1M1YE 1ONBA 5K8UA 1DPFA 5CYOA 2FOLA 4K8OA 2QGZA 2WJIA 4KLZA 3CX7A 4PXAA 2LCFA 3WBKA 4GNKA 5F98A 1U99A 1ZM2A 2VP4A 1E9CA 1K6MA 3IBYA 3WRYC 1N5JA 1EK0A 5JHHB 5AUPB 2R62A 3GEIA 2ECKA 2H57A 1R5NA 3CWQA 4JLPA 5GJCA 1AQYA 3PV0A 1N6KA 3SN6A 1GM5A 2ZRGA 4KU4A 2AKYA 4M53A 4MRSA 5TB5A 4G5GA 1FNNA 1ODFA 5E7JA 5M04A 2HXYA 4C3ZA 2J9RA 2GTPA 3KKPA 2VSOA 1SKQA 1VHLA 4LWZA 1SULA 4TLDA 3RS2A 5CITA 3M1IA 2ZYWX 1AIPA 3GJ4A 3VTKA 3TAUA 3DKVA 3G0HA 4DRZA 5FOSA 4NYMR 4IDNA 1GKIA 4G3XA 4TMXA 4LHYA 3GEHA 1ZNWA 2Q21A 1XD2B 5KO2A 1F2UA 3DMDA 5LD2C 1X86B 2HV8A 3IIMA 4G5SA 4LJ4A 1E2HA 1II8A 4IDHA 4LYJA 3PJRA 3UMSA 4TWZA 4CEHA 2D74A 4AK9A 4L4UA 1YZKA 2CLCX 4B74A 5IK2D 2IYTA 1LTQA 3KB1A 4TZ0A 1HE8B 2QE7A 1YRAA 2FPMA 1RW4A 3T35A 5FBRB 1G9XA 1E79D 2H5EA 1GIAA 4PANA 4TQUS 1G41A 2D2FA 2D06A 2X8AA 4IDOA 4URWR 3FMFA 4YQFA 3SNHA 3W3ZB 3GD7A 2FU5C 4JLVA 3RRMA 1PUJA 1NLZA 5IRCD 1L8QA 3IIKA 3TE6A 1BO6A 2OXRA 4KSBA 2RGNA 5KNDA 4BZQA 1QVAA 2IEYA 2ZSBA 4TN1A 3UMFA 1KNQA 4B6EA 2O8BB 1UEIA 1AK2A 2GXAA 1COWA 3JZMA 1TF5A 5GJVC 5EUMA 1R0YA 2QNRA 4P3YA 1I4TD 3SQXA 1PLLA 2QAGB 4FCWA 4RD0A 3K0CC 1LFDB 2AD5A 3SBEA 3SE0A 5AJXA 1VYUA 3QKUA 5AUQA 2WAXA 4I1SA 4A2WA 1XTJA 1DG3A 3NC1C 2WPDA 3NIBA 5KSZA 3R9XA 4KBFA 2QAJA 3BBPA 3TR0A 3B1ZA 4JT2A 4BFZA 5J40A 2CHGA 1SHKA 4UXHA 3CW2A 4BPBA 2IBMA 2IYWA 3L0IB 3A4NA 4V0KA 2VO1A 3LX5A 4A82A 4C0KA 1TQ4A 2LKCA 2V7QA 3NTUA 1T5LA 1Z83A 2P0EA 2WKQA 1YR8A 3GLFE 1YRBA 1QDEA 2C2HA 2FSHA 1N0VC 4TSFD 3TUIC 5LBIA 3B1XA 1CTQA 1WP9A 3LXRA 1KI3A 3B8HA 1MO4A 4DSUA 3THXB 4GL2A 2NIPA 4Q1AA 2I4IA 5CDFA 1NN3A 4QGAA 2OCPA 1KO1A 4B43A 4JKYA 1W4BA 2ZS8A 3V9PA 4AI6A 2KE5A 2OXCA 3CX6A 4QG7A 5FR2A 1M6NA 4AWXA 4AYTA 3ADDA 3CNLA 5B30A 4PAQA 1AKEA 1W36C 4M1YA 3TAHA 2Z4RA 2XAUA 2ZE7A 1AQUA 1G21E 3LBIA 4OHXA 4RFVA 4A92A 2F9LA 1F48A 4ESVA 4Q9IA 1AJEA 2AK2A 2ONJA 2GJ8A 3B7GA 3REFA 2WWHA 4BASA 2UZ3A 3EPKA 3CO5A 1GNQA 1U81A 2BBOA 2ZANA 4AC9A 1D6JA 1S96A 4MKIA 2AXPA 3AVXA 4RZUA 2O0KA 3FYHA 3U6BA 4KYIB 3QJYA 4TYQA 2D62A 2AR7A 3DHWC 5FUYA 1FX0A 1PJRA 3K9LA 4LI0A 4QBGB 4ARZA 1T5IA 4Q03A 4TL8A 1NVVQ 3I72A 2UKDA 2R6FA 1UKEA 2F1RA 4B3BA 3IEVA 1EWQA 1OFHA 1VG1A 4YMWA 4US1R 3KJHA 5B64A 2FF7A 1UKZA 4E07A 3A1UA 1G19A 3RS7A 2FFAA 2QRNA 2F43A 3RS3A 3TVTA 3IHLA 1T3SA 4W5JA 3THOA 3FMPB 3JVVA 3CB4A 1UBEA 1KY2A 2HUPA 4OKSA 4M4SA 5FTNA 5BN3A 1CS4C 3EX7C 3W5IA 3W8NA 1Z2AA 2XXAB 2IXGA 2DB3A 4FI3C 1V5WA 1NG1A 3HU2A 1S9HA 4PC1A 1TQDA 3QKSA 2QROA 1W46A 4DDWA 4W9MC 2WWFA 2ZRKA 1CR2A 1XEWX 3BFKA 3QI2A 1ZJ6A 1FTNA 1KY3A 2QTFA 1KO7A 1E2EA 2ERXA 4DZZA 1F2TA 1VCOA 1EFCA 1OXVA 1XPOA 4NE2A 1XX6A 1MO6A 4OBEA 3UG6A 3SYKA 1R0ZA 2R2AA 4AG5A 1L4UA 3AF2A 5KPJA 3CLVA 1IN8A 1E2PA 1UKYA 3HPRA 5AJVB 5TMPA 3ADKA 1NI3A 3B6EA 1RVDA 1II9A 2Q9CA 3AVOA 3CRMA 4BLSA 2HT6A 1N3BA 3NHAA 3TUJC 2VP5A 4HZUB 1KI6A 4QHSA 4LX0A 3C15C 1TNDA 3QVVA 1CU1A 1OYWA 5FOUA 1IY1A 3ZD6A 2H17A 4GOXA 4L5BA 1JQLB 1MOZA 3LW8A 4UQOA 5JSZB 1WF3A 1TL7C 2J7KA 2D7CA 2JJ2D 4UNQA 2VIIA 1R2QA 1G16A 5IK2A 3GJ7A 2FJUA 3Q9LA 2F3TA 3OZXA 2G0NA 1XD8A 4A8JB 4HEJA 4HLQB 1SXJA 3ETLA 3UPUA 5JJKA 4KO8A 3CX8A 2JJ1D 1R0WA 3AUXA 1Z29A 1ZVQA 5ANRB 4BQSA 5L3QB 3GPLA 3VNUA 3I61A 4P4SB 4JVNA 3VKWA 1ZM7A 1XMJA 2BEKA 2ZQ5A 3C41J 2ZVPX 2OCBA 4DXAA 3GLIA 4LC0A 1SVLA 1CKEA 3TSWA 1JPJA 1Z06A 3X2SA 1E2IA 1OW3B 2N42A 2GBLC 1DAIA 1NRJB 1XB2A 2CVHA 2HF8A 1ZD1A 3K1JA 3NG1A 4HB2A 4RD6A 3WNDA 4C0QC 3LO5A 1VPLA 2VHUA 3EPHA 2GXUA 1N6RA 4A9AA 2WWYA 4RD2A 2W0SA 4ZI3A 3UK6A 3U4QA 2V3CC 821PA 2FE4A 3O8RA 2DFLA 5FL3A 2XB4A 1KAOA 4Q9KA 4URYR 2RHDA 3EA5A 1LF5A 1P5ZB 1NY5A 4HLDA 1NF3A 3ND8A 2Q3MA 4EUNA 1FMLA 1N6LA 3BGWA 2ZR9A 5DN6A 2XSZA 5FOVA 5JJLA 2XOKD 3HR7A 1XEXA 4LHWA 3UKDA 2ZU6A 5BN5A 4D81A 2HT1A 5JRZA 4A1FA 5J4YA 4TSFA 1EFHA 1FP6A 3Q8XB 4WAUA 1Q21A 1NN1A 3FMIA 4D0NA 4YDHB 3MLEA 4ERNA 2CLDX 2QEQA 2A3RA 3G5UA 3PEYA 3Q85A 4N1AA 1MR3F 3EA0A 1H8HD 5LB4A 5LD2B 3PUZA 4BECA 1HURA 2ZRPA 5DO9A 4Q1CA 4OK5A 4R7ZA 2UVQA 2DFTA 1Q1EA 4IVPA 1P9RA 3TW8B 2VTKA 4B44A 1X6VA 4AKEA 2D2EA 3GFPA 4QGHA 2WICA 3RANA 2ZSEA 4GMDA 1G4AE 4PQRA 2ZYVX 2OFXA 2V55B 1G3QA 3G82C 3ZYCA 4EIWA 3QXJA 4E09A 1YZQA 1QHSA 1MKYA 3CIOA 2Q3HA 1QHHB 1CJTC 4Q7MB 5FFMA 4KSCA 4H9GA 6Q21A 3F8TA 4Q4LA 1GP2A 3NBYC 4LPKA 1A4RA 2NO9A 2KI5A 1N6HA 2PMDA 3OF5A 4IFBA 1GRQA 1R0XA 1ZNZA 1T9HA 3HU3A 4BWYA 4TYYA 1E0JA 4JMPA 2VHCA 3RSLA 3TW4A 1CR1A 1DO2A 3MFYA 2BEJA 2GAOA 2GETA 2YOFA 3A1SA 4ZCIA 1NSFA 1W0KD 2ORWA 5L3RA 1YR6A 2JDID 3SI7A 4MYHA 3W8RA 8OHMA 4XVUA 1CJVC 4Q01A 2NGRA 1ZNYA 1G8PA 2EFCB 2YWEA 1XTQA 4C30A 4M9QA 1Z28A 3NDPA 3U5ZB 3L8YA 1P73A 3ND9A 4W5WA 4BFWA 2WOOA 3WY9A 1ZAKA 3SYLA 2ZR0A 2QQ0A 4LYFA 5C1BA 4LUCA 1IJEA 2YWGA 3PVSA 1F2UB 5D3MA 4XWKA 1QRAA 2HXSA 2GESA 2KJQA 1P9NA 2A9KA 2N1BA 4IJMA 3O8CA 3ICEA 1T4GA 2IXEA 1RE0A 4PO1A 2VYFA 1X8KA 4HZIA 1YKSA 4RZ2A 3SJBA 3ZS8A 1G7RA 3AUYA 4MH0R 3I5XA 3QXCA 2H18A 1N2CE 2J0UA 4QKQA 1RRGA 4QNMA 5GVSA 5EE5B 1RJ9A 4DLWA 1GL9B 2ZSAA 2GVDC 1FMJA 3GMTA 4KITB 2R6GA 1UPTA 4WOPA 3TSZA 5E7MA 2W0MA 4Q1FA 5G53C 3OEED 4Q18A 1CR0A 2R65A 4HAZA 2GZAA 4LBYA 2CEAA 4A36A 3HWSA 3KTAA 1GL6A 5HPYB 3L0PA 1Z0DA 5K8LA 3U3KA 1N6PA 4TT3D 4B2LA 5KTYA 1DEKA 1ZCBA 3K9HA 4NPHA 1XJCA 2JJ1A 1XTKA 3R7WA 2IT1A 1OXTA 3ZH9B 5BXQC 2NO7A 1E0SA 1FP7A 3HJNA 4PTLA 3T1VA 3F0TA 3VU9A 4C0SA 4LJAA 4W7SA 3B13B 3HYRA 2FX3A 3BFXA 4BGDA 1PVOA 4A6XA 2QP3A 2OAP1 4GSYA 4IXMA 1DG1G 4JSTA 2XJ9A 2BMFA 2DPXA 4NZYA 4TMZA 5HCIA 1OHHA 1KIMA 4E5UA 2IHYA 3IILA 3ZVNA 1P2UA 4LJYA 4CW7A 4P4UA 1E99A 5JJIA 5AK0A 3B9PA 2W00A 2V8OA 4Z1MA 4HAWA 1KDOA 3NXSA 2WSSD 2PEYA 2R6CA 2GEVA 2FNAA 3PUXA 3ZZUA 1OXUA 1QHIA 1CXZA 1XFAA 3QE0A 2XZPA 1F60A 1PLKA 2P67A 1MT0A 5L3SA 3A4LA 1W44A 2PMKA 1YU9A 3EZFA 3GLHB 4Q1BA 5CYPA 1GKUB 1G3IA 3TNFA 4EFMA 1NP6A 2PCJA 2BOVA 3QUSA 4LHXA 1FL9A 1DO0A 4Q7JB 1ZM3A 3KQLA 4M1WA 2XOKA 3BAFA 4MDFA 1P61B 1JJVA 2EYUA 1FTSA 3K53A 4J0QA 3A37A 3LBNA 4JLAA 3AVWA 5EP4A 2QMUA 4NBSA 4LV6A 3KKNA 5AWFC 1XU4A 1LNZA 3KL4A 4RD4A 4XJXA 2JASA 4IKEA 2ZJZA 2EWVA 5FUWA 4PZZA 4LC1A 1Z0KA 1H8HA 1W49A 3FDIA 4Z51A 1HY3A 2V4ZA 4B32A 3QVUA 1KGDA 2ZJ2A 4ASUD 3RRZA 1WB9A 4BEBA 2OE2A 2ZJBA 3WNBA 4NYJQ 3RS4A 5GADl 4Q9JA 3U44A 2QQEA 3B1YA 5GJBA 1SVMA 1Z3IX 3WHLA 1A82A 3EXAA 1DAGA 4X8OA 2ZUDA 3V4FA 1VTKA 2RH5A 4KCGA 4Q4HA 3ZGXA 5DISB 1TUEA 2G0TA 1H8ED 1YVDA 4D4MA 4C7OB 2O0JA 3H4MA 3QG5A 1NBMA 1TUIA 4GT1A 1QVRA 4EPTA 4BEJA 3FTQA 1DARA 3CH5A 4XOIA 1EXMA 2F43B 5KPDA 3RNLA 2IHBA 1RKBA 3ASYA 3C4JA 3I8SA 3ZZ0A 1G3UA 2B21A 2CL7X 1E2FA 2IS6A 1YZUA 2C95A 1G1MA 3A1TA 5KUTA 1GILA 4BZPA 1G7SA 1D2MA 3WYGA 1OIWA 1W0KA 4TMWA 4D80A 1ZIPA 2C9OA 3FVQA 3QKSB 4G5RA 4TLBA 3ZIAA 5KU1A 2F55A 4TL6A 3RS0A 4A15A 2REXB 3ZVLA 2GDJA 2ZJAA 2O52A 2PX0A 2W6ID 2VH5R 2ZI5A 3NBZC 3C8UA 4YLGA 5E7IA 1F2TB 2IYVA 2NZ8A 1OT3A 4Q7KA 5HTKA 2YC4C 3QXHA 4OQNA 1W36D 4FWIB 2GVZC 3LLUA 4MKGA 3OAAA 1A2KC 1KAGA 4GOJA 3L8ZA 1BMFD 3KKMA 2W2XA 4LV8B 4URXR 1LV7A 5EE1A 3BOSA 1W7AA 1NY6A 1I4LD 3ASZA 1YZTA 3ICQB 3X1YA 2ZAMA 4EPWA 1U0LA 4F91B 1B23P 3KQUA 3D3QA 3MMPA 3AF0A 4QJ5A 1NN5A 5FUVA 2QBYA 1Z07A 1XXHA 4Q9HA 1M7GA 2F6RA 3B1WA 1SXJB 3BH0A 4DVGA 3RWMB 1KI9A 1MABA 1ZM4A 2ZI9A 5CB8A 4EFNA 3AVUA 1SHZA 3K09A 4HLUA 1E6CA 1VCIA 4A0GA 4LRWA 2JLZA 2OT3B 3BB1A 1G5PA 2ORIA 3A58B 2G6BA 2QM7A 4ZDWA 3AP3A 1S4QA 2G88A 4MGZR 3AEZA 5F9FA 1S9DA 3GLGB 2QRZA 2ZTSA 1GKYA 4PO8A 2NPFA 4TT3A 1E1QD 4MYTA 5KHOC 2ZE5A 5FR1A 1XF9A 4QL3A 4R71A 4V03A 4AYXA 1FFHA 3EAQA 1NVUQ 3BXZA 3LDAA 3U7GA 3S1AA 1TQ6A 5JS8A 4MKFA 1W4RA 3B1VA 4PHFA 1GAJA 1X1SA 4IFEA 4IVQA 4DSTA 1FUKA 4DB4A 3U4QB 1RYHA 5L3VA 1YR9A 3QBVA 4DT1A 1OV4A 2J3EA 5A0FA 3AVQA 3TQCA 3RSOA 4BRWA 3TR5A 3OIVA 4PC7A 1GRRA 2J0VA 1VKJA 3JVUA 1IM2A 4K46A 2FZ4A 4BLRA 1UF9A 1X8JA 5IDVA 3Q3JB 4OQXA 1OXXK 1EG7A 1N0UA 2TMKA 3LVQE 3RABA 4BUJA 4FW9A 5KNCA 5FTJA 1P6XA 1XEXB 3H84A 1DELA 4BLQA 4Q4JA 4O2RA 1FOEB 2Z83A 4A2PA 2Q0HA 2BBWA 2O8CA 2IUUA 1WE2A 1N5IA 3FKSD 3T06B 2C78A 4D0GA 4YMUA 3O47A 3J81k 3PUVA 2B6HA 2A5YB 2IYYA 2JEOA 2JJ8A 3FPAA 3GEEA 2RGDA 4MRRA 4P33A 5E95A 2G9NA 5SZJA 2E9SA 1CULC 2IXFA 2DYKA 4PHHA 1SVSA 2DBYA 3LH5A 4U7DA 4LJ8A 4GMXA 2ZRDA 4DLVA 3F3YA 2PZFA 1KNXA 5BW8A 1UM8A 4ZI2A 3B9QA 1BIFA 4X8MA 2YYZA 1DADA 2ZRBA 4JL8A 5B57C 1EGAA 4LY6A 4F38A 1Q0UA 5J5CA 1XTSA 2QY9A 5G41A 1M7BA 1Q3TA 2WZQA 221PA 2J59A 2O5VA 4Z8YA 4JS0A 4BFTA 3QNUA 4KFTA 2O8DA 1NMYA 2AN9A 5UKDA 4UNRA 4QJ3A 3I3SR 4C2UA 3RRYA 1T3LA 1TADA 3TGPA 2BM1A 2YINC 3L0OA 2IL1A 1LS1A 5E4FA 4OHVA 1QBKC 2J41A 4U5XA 3VKGA 4GFDA 4DB2A 3BC1A 2IYUA 1WDTA 1UDWA 1HTWA 3AKCA 3SYNA 3IDQA 2G3YA 3UWKA 1T8TA 1OIVA 4UNSA 3R9WA 5EXTA 2JLRA 2A5FA 3L82B 1JXMA 3MWKA 3OIUA 4QBHA 1OFTA 3UATA 4ZDJA 1H65A 2ZRHA 3LVRE 1RZ3A 2ZI4A 2CXXA 3VHLB 2BM0A 5FUXA 3EPLA 1Z0JA 2ANBA 3P20A 4MRPA 3WNCA 1N25A 3L0SA 2X1VA 1DOAA 2OLKA 4CDGA 3MJRA 1Z6AA 3V4RA 1ESNA 5FBQB 4AKHA 4OQMA 5G3ZA 1G5TA 3ZD7A 1EX6A 3I4LA 4B47A 3GLFA 3RYTC 4RD3A 1E96A 1Q44A 3E70C 1UFQA 1OSNA 2C77A 4QHYA 1RJ9B 1NLFA 1UBFA 3W9YA 2DWPA 2IWRA 2ZJYA 1BMFA 2XNSA 1OIXA 1J99A 2VHTA 4ILEA 1P2SA 2P5TB 4O3MA 3QXSA 4CZ2A 4JLDA 1D8TA 1W2HA 4PAOA 5EJEA 2XZOA 3KTAB 1E98A 3U3MA 4RY2A 4CGZA 5JFGA 3PCRB 1M8PA 1W0JA 2DCUA 5CM9C 3OEHD 4LHZA 3K0FA 3WMEA 4I4LA 1W47A 3RVBA 3CZPA 5DI3B 3SZRA 1UADA 1Y63A 2GZHA 4UJ5A 1YZGA 3RRNA 3ECCA 2CJWB 2EVWX 1T8UA 2F3RA 1S8FA 2ODBA 4LJ9A 3VU9B 2MMGA 2KB0A 1ZM9A 1HT1E 1ZC4A 2RGNC 4HLCA 1J90A 2GK6A 1VHTA 1KO5A 3MJHA 4FN5A 4JLKA 1P7CA 4I81A 3GFTA 1E1QA 1XCMA 1E9RA 1P72A 1N6NA 1G20E 2BDTA 2QN6A 3EZ9A 2QTHA 3GCGA 4JVLA 4PZYA 2X2FA 2IF0A 2V6IA 1Z47A 2VPPA 4HDCA 3U3JA 3THYA 4PSKA 1P60A 4C0HA 4CEIA 2FA9A 1IHUA 2CE2X 2HJGA 3SQWA 1IY2A 1LS6A 4B2IA 3K70C 4YC7A 3TJZA 3BERA 3HP1A 4LCBA 4PPFA 3U7EB 5C4MA 5L3SB 1VYTA 5JRJA 1P62B 2NO1A 5IF9A 3AQ4A 3O8BA 3QF4B 3ZJYA 3AVTA 2JA1A 1KO8A 3GLHE 1KHTA 2ZXUA 1XMSA 4IOMA 1IOZA 1Z6XA 3OE7D 5DNYB 2EWWA 4ZCMA 1D2EA 2PH1A 3M4YA 4Y0AA 4BRUA 4IOJA 1XJQA 5TVKA 5HR5A 2WWGA 2GEUA 2BKUA 1BS1A 3IO5A 4OQLA 1G17A 4Q19A 4URVR 2OBLA 2ZRAA 4IEEA 4B3CA 2ZE8A 1IBRA 1GNRA 3P1JA 1Z0IA 2RGCA 4PX9A 3TIFA 3T5DA 4ZDIA 4NTZA 1VCMA 2GCOA 1K5DA 1B0UA 3AKDA 3U3RA 1EFTA 2JLXA 2ZITA 2ODEA 2JAQA 4D2IA 5FBVB 4DDVA 2ZS9A 5JLJA 3SEAA 1E2JA 1TQ2A 2HYDA 2QMOA 1Z6TA 1FZQA 2H8KA 2N46A 2G83A 4KLNA 5GJWC 1BH2A 1X8LA 2Z6VA 2IYXA 3QEJA 521PA 1RYFA 2C5LA 1GZSA 1W2GA 2KBEA 3SC3A 3BK7A 4PSVA 5H70A 2FWRA 3M0EA 4XIGS 2ZUCA 3I92A 1KDTA 1IN6A 1CJMA 2P6UA 1OYYA 4JL5A 3T1OA 4M8NE 4P32A 4XWAA 4IVRA 4QJ4A 1XZQA 2EFGA 1NL3A 3H2YA 4PHTA 5J4HA 1CJUC 1HQCA 3MWYW 5JEDA 4B48A 4B33A 2IYSA 4PQYA 3IPXA 4YMSA 2Z43A 2SHKA 4HUTA 4M9XA 5HZHA 4V0OA 5IHPA 3KKOA 4WZAE 1F5NA 4OHYA 1E79A 1KKMA 3SOPA 4R2HA 4LBVA 1JI0A 1W48A 2OM2A 3FMOB 3QKTA 3LV8A 1E9SA 4Q4AA 1M7HA 4ACBA 1WMSA 2ZREA 5FL7D 1US8B 3FGNA 1ZC3A 4CEJA 1DAHA 2GZDA 3EIEA 3KKQA 2I1QA 3TK1A 4GZLA 2PT7A 3BS4A 4QOSA 4QBFA 3HDTA 1TU4A 4TQ9A 5FBLB 4LJ6A 3AF3A 1WQ1R 1I4DD 1S3GA 2H16A 5BQ5A 1CEEA 1ANKA 1I2DA 2FG5A 4CVNA 4FMCB 4DLXA 3MRSA 2IX3A 5A4JA 1OH5A 3VR4A 4C0LA 2WHXA 4EDHA 4YONB 1FW6A 5H68A 3CRQA 3PENA 2BV3A 1QHNA 4DSNA 1G8FA 2V1XA 3P27A 4KVAA 2BWJA 3B60A 1E2GA 3NEJA 2GWHA 4WXRA 3RDPA 1IXSB 2YVUA 3U7HB 1G5RA 2VP9A 1S1MA 2ZEJA 3CRRA 5FOXA 1VG8A 1E9BA 3X1DA 2ZRMA 2WMOB 4U02A 2IA5A 1ZD8A 4LZZA 1O87A 4NYMQ 2VP0A 1NKTA 1EESA 4C2TA 4B3GA 1DAFA 1ZRHA 2VSFA 5EP2A 3AM1A 4A4DA 2ANCA 3PEVA 4ABYA 1E9FA 3DO6A 2EYQA 4M1OA 1IAQA 3OEHA 2FEOA 2YWFA 4R2IA 1SXJC 1E2KA 1JBKA 3GLGE 1JPNA 1KMHA 3ADBA 2F1JA 3K9GA 1OF1A 4DUGD 1KJYA 2QSZA 3S1AB 1SVWA 3U2QA 1G4UR 1JAIA 1PV4A 4AURA 1G3MA 4LV5B 4OK3A 3TKLA 4DT1B 4DCVA 2A7QA 4OL0A 3WXMA 4PPGA 1Q1BA 4US0R 1KJWA 3CM0A 4L9SA 1CP2A 1KTVA 2HJVA 4EPVA 1NLYA 2DFNA 1U0HC 4BFXA 2WVJA 3K9NA 4YMTA 4FWTA 4EPYA 2B7BA 3EARA 4BFSA 4NL4H 1CR4A 4ZKDA 5JCPA 4M22A 3VQTA 1LB1B 1GUAA 1U98A 4JZKA 2Q9AA 2C98A 2AWNA 2O8FA 2O8CB 2ZR7A 2DWOA 3OFND 1KI7A 4GPTA 4D4LA 3MAAC 1T0JB 2WAYA 1VCNA 1U8AA 2V9PA 3QF7A 4S2EA 4I1UA 3SDZA 1J8MF 2YC2C 2YNMA 1N6IA 2EQBA 4MDEA 2AWOA 2VF7A 1Z2CA 2ZI6A 4XSHA 2Y8EA 3X1ZA 3A4MA 1NSTA 1L7VC 4DLTA 2JLWA 4PFSA 4W5HA 5KSPA 1T0HB 2JLYA 1A7JA 1GSIA 1KZ7B 2FH5B 2QPTA 4D26A 4TLEA 3DVLA 5KYKA 1GITA 2REOA 1P3JA 2GKSA 1TPZA 2ZIAA 2GHIA 1XMVA 3RS5A 1E1RD 1QZXA 2P5SA 3A36A 3CBQA 2HCJB 2IK8A 4MGYR 5KDDA 1II8B 4CEHB 1EX7A 3WYAA 3SR0A 3L2OB 4JL6A 3WP0A 1A5TA 1RRFA 4D6PA 2ZJ8A 4JLMA 2KSQA 3U3OA 3GQBA 4HAYA 5CJ2A 1C1YA 1WXQA 2B7CA 2FPLA 1DAMA 2VBCA 3ZZTA 5IT5A 2W2VA 2QP9X 2XEXA 4HAXA 2J87A 1KSJA 2B8WA 2A2ZA 4HUQA 2O8BA 3BIFA 3SHFA 1N5LA 5FOWA 2QSYA 1OKKD 4URUR 3AGQA 2QAGA 4WZBE 4ZIRA 4EPRA 4P0TA 2RGEA 3W6OA 1PLJA 1NMXA 2F1IA 1SGWA 2JJ2A 3E1SA 4EKDA 2XTMA 2OV2A 2YOHA 1TEXA 1U90A 4LBWA 4FMBB 1EFRD 4S35A 3PFIA 3JZAA 2YWHA 2NO0A 4JJZA 3ADCA 4PPNA 3KJGA 1R8SA 4QBIA 1HUQA 1OJLA 3CF0A 3LXXA 1MV5A 1JEEA 5FL7A 2EFDB 2ZETA 3RC3A 5B58C 2GCPA 2J46A 1SKYB 1WCV1 2ZAOA 3LNCA 2JATA 3GLFB 1ZIOA 3K70B 3LQRA 1P2VA 3TLXA 4O0MA 1XRJA 2QUZA 4OI2A 2NPIA 3THWA 2Z5FA 5A5GA 2W58A 1U9IA 3PUYA 3ZQJA 4NYIR 2XTZA 3NDBB 4Q02A 1W1WA 2VRWA 1NJFA 4ACAA 2QENA 4PPQA 5HKKD 3I32A 4ZV4A 1UEJA 1CIPA 4RZXA 1Q12A 2YV5A 4L8GA 2VQSA 4US2R 3K0FB 4IOKA 2IC5A 4OJQA 3WMFA 2WKPA 4FMDB 4B75A 1AM4D 4QGFA 2ORVA 2OHFA 5DI9A 1N0WA 5FPKA 3EC1A 3AP1A 1J7KA 2C03A 5FH9A 2GNOA 2GJSA 2ZRJA 1T6NA 1HH4A 2CL6X 4AD8A 4C0JA 3DZ8A 3KQKA 3WP1B 2ZI7A 2IS1A 1K5GA 3NWJA 3GJ3A 1IN7A 2C99A 2F9MA 2ZYTX 1G64A 5CLLA 2ZS7A 1NNEA 3Q7QA 4MGIR 2FFHA 4GDFA 3LWNA 5BYKA 3DL0A 1CRQA 3EW9A 5JS7A 5EXXA 3THYB 1WA5A 2ATXA 4DLYA 4CEIB 4BFUA 3BFVA 3HPQA 1K8RA 3B2EA 3TRFA 3NHBA 4ZCLA 5DHAA 1T3HA 4D25A 4POAA 5D3QA 1FX0B 2I3BA 1AZTA 1KI2A 4ARZB 4M1SA 2HLDD 2ODNA 1JR3E 4M1KA 1E0AA 2QPAA 2ZI3A 3GJ6A 3KUDA 2CCKA 3IEUA 4NU0A 5SZHB 4DLUA 3TVDA 5H8WA 1Z08A 4HDQB 4JKIA 4XVQA 2GILA 2XITA 3LD9A 4JYBA 1JJ7A 5C46F 2ZRLA 2BMDA 4V0ME 5HE8A 5GVRA 1NN0A 4WA7A 3EZ2A 3VKHA 3DDCA 5KDOA 3PEUA 4P31A 2WOJA 1ZP6A 2JDIA 5C18A 2H92A 4EJSA 2XZLA 4L16A 421PA 4DCSA 2Q3FA 3IBGA 2Q9BA 3R8FA 4GRAA 4FINA 1YJ5A 2NMVA 4IHQA 2WWWA 1CBUA 4LPSA 4NCHA 4NCIA 1BOFA 2FSFA 3BWDD 5CK4A 3IO3A 1P75A 4RKEA 2GXQA 2ZSFA 5DE3A 5EP3A 2DFKB 3LY5A 4MYCA 4FCVA 1W4CA 1UDXA 3AB3A 3CR8A 3REGA 4A8JA 4HB3A 1COWD 1HE1C 1KI6B 3QENA 2MSDB 1CF4A 1AS2A 1KI8A 4EFLA 1NVVR 3BRWD 4M21A 4E03A 5L3QA 2BVNA 2J0SA 1G7CA 5JWRA 3NC0C 1Z0AA 5ELXA 3FFAA 2WPDD 4KHZA 4XH9B 3DKPA 1XTRA 2A5GA 4DIEA 1AZSC 2I1VB 3FHOA 4RCZA 1VIYA 1XNJA 3I73A 4Q4AB 2IYLD 1DAKA 5KSYA 1VG0B 5DYGA 1OKKA 4PC2A 3OEEA 4WVFA 1IXZA 2VHQA 4N3NA 4CEJB 4MYUA 5TV2A 4JBYA 3B85A 2HYIC 3CRVA 3NEYA 4GOKA 3I62A 5EXSA 5JWHA 4HB0A 4WZ6A 3GLIB 4LK2A 3KQHA 3CWZA 4OHZA 2NG1A 1EFRA 1QF9A 3AGPA 2MSCB 2FMXA 3D8BA 1S0UA 5EE0A 4EJSC 3QOFA 1TF2A 2BJWA 1NIJA 2YOGA 2CVFA 4D82A 2KBFA 1GL7A 4M0LA 2BHRA 4TYPA 2OUKA 1GTVA 4TL9A 2G1JA 1YQTA 3QPWA 1KO4A 1DVRA 2P65A 3DM5A 2CHVA 4KFUA 2ZVQX 3Q5DA 2RKOA
chains in the Genus database with same CATH superfamily
4JD5A 5FPTA 3K0BA 2W6CX 1PF7E 3LRPA 2CMHA 5KKCA 3E4DA 1X7WB 2A7XA 4CTOA 1OXMA 4IYRA 4FB4A 4LF7B 4D4IA 2AHOA 2WU1A 5C35A 2H1CA 2X76A 2YMPA 4J3JA 1E62A 1DIOB 1NMZA 2G1KA 5ALXA 1N2BA 1L7PA 2O48X 2DG2A 2Q6VA 1XKTA 3AKEA 3Q3VA 4MA4A 3DKKA 5MN6A 2YFKA 2PRJA 4Z3KA 3AONB 1VDZA 5AHWA 4YT4A 4IX9A 4I1RA 1GGHA 3MCTA 3TLJA 4F8JA 5GZ3A 1Z6QA 2IYFA 1YA4A 2X40A 3A0UA 1LBEA 1M72A 3BSWA 3K94A 3QIAA 4JGIA 4KFRA 3RTAA 1GYRA 4B2PA 2IYZA 2ZTHA 4L9WA 4J0DA 5D01A 4HLUC 1NZDA 1R0SA 2UYYA 4JLUA 5H7XA 1LJUA 2P9HA 3IHWA 4DLZA 4R8RA 1VP3A 2ESRA 2OOKA 1QHHA 3KJFA 3KL2A 4J1NA 1NW8A 3MSCA 4IZOA 4NICA 3TH5A 4DQKA 2BR5A 3LHDA 1KJZA 1UPCA 2VA8A 4YWJA 4EEZA 4F12A 3AF6A 4J0KA 3BD9A 3MUOA 2FQYA 4AS2A 4JJ7A 3A9VA 1J25A 2VZEA 3SJCA 3VZBA 4A27A 2WYOA 3GMDA 4QGBA 4ENPA 1V7PC 2NU6B 2M1ZA 5F2NA 2H51A 3IS3A 4TTQA 2GZSA 3KUCA 3UMRA 2AFHE 2AVNA 3H5OA 4FS3A 1UFRA 1FP4A 4FHZA 5FD8A 2UXDB 3P32A 4ID9A 1V8ZA 1DKMA 1PJ4A 4HOYA 4FGZA 4OSPA 1BWPA 4TV9B 3WK9A 3DHYA 3L7DA 4UASA 2H3HA 1W88A 2HRZA 3H2IA 5HUJA 2O8FB 1DKQA 1I2CA 4O4LF 5FTMA 3KB8A 4KV7A 3AR2A 3ZVMA 2DQKA 2IF2A 4GKKB 1CRZA 2EKQA 1H3EA 2EQAA 1YXMA 4XSGA 5COAA 5DSTA 4OHWA 4UEQA 3DAOA 1G1AA 3M9WA 1BDHA 2IZ7A 1SXPA 5SZKB 4QLOA 1C3OA 3IIJA 3NGMA 5AK4A 1XZNA 3V46A 4I50B 3DCNA 4MKXA 3RJZA 1J00A 3KHUA 3LWDA 3SIWA 4DLPA 4LMAA 5C5DA 1Z2NX 1G2IA 3DB1A 4MJLA 4YRLA 2C9DA 4C06A 2RB4A 2YN2A 2E6UX 1MJGM 2DPLA 2BR4A 1DCFA 1L2TA 1Y4ZA 3EXIA 3KR0A 4J4HA 2WBLC 2O8VA 1OMOA 5CB6A 3L0DA 5JCOC 5LMCA 4NYIQ 4TRMA 4EECA 1WBBA 2FJ0A 3DVAA 2NX2A 4BFLA 3TUZC 1XP8A 3LFHA 4QBTA 1N6OA 2JPDA 4CNBA 4RTJA 4X66B 1J6UA 3MTEA 2FVXA 3SLRA 4XTCS 2DH6A 1CS0B 2XUKA 1V45E 3H6HA 2OZEA 4NONA 3ZHCA 3IB3A 1O54A 2GNPA 1H42A 2XY4A 1S1CA 3HADA 3NHMA 4NHOA 4PWZA 1OH8A 1G7TA 4MQBA 3PLNA 1NFRA 1W96A 5DYTA 2W6IA 4ZEOA 1SZPA 5A9SA 5FHQA 2X22A 3EG5A 5GINE 1KOGA 3Q3HA 4AKIA 1U0JA 2E3JA 3CF2A 5LQAA 3HVRA 3VH3A 2YJ6A 4TZ6A 1UMDA 4JI6B 3I76A 1SQSA 5C31A 3MTQA 1YD7A 2O3TA 4WY5A 1JQ3A 5CLQA 5HIIA 1XK7A 4KIWA 4AY5A 1OV6A 4QYMA 3G2IA 5JYDA 3OIWA 3TPCA 3K5WA 3VC7A 1A5AB 2XUOA 1KC3A 3DOHA 4IXTA 1JECA 2IQ5A 3CUKA 1Q0TA 4QQNA 3PG5A 1NATA 1JXOA 2G8LA 3GGSA 4PYOA 3GFGA 2H00A 5HZMA 1W5SA 2OZLB 1GADO 4CE6A 1PUIA 4IW3B 3TMYA 1CG6A 3T5TA 4ZIRB 3NBAA 2JFGA 4YJ3A 1YB5A 3WISA 4ZP1A 2GH1A 3QE2A 1D9ZA 1U7PA 2D5BA 3ER6A 1YZYA 1Y5NA 2ZXFA 3ADPA 1OAOC 3KZCA 4AJEA 1PNQA 1HK7A 1G20A 1KSHA 2HQSA 2GHRA 4CYMA 1E3WA 1RS0A 3MILA 5EC8A 3P94A 1O1YA 1D1PA 4HADA 2JVIA 3V1KA 2CXSA 4XB2A 2P9CA 3IMEA 3QA3E 3UUGA 1EGQA 2A84A 1E2DA 2J8ZA 3OPMA 3FHJA 4PW0A 4ZEWA 3V8EA 3W9UA 5DN6D 4TM7A 2M9MA 1J8DA 4IVNA 4MV5A 2NU7B 1PQUA 3BMNB 5FAXA 4OEHA 4I5FA 1AURA 4MYRA 1TTHA 4NCXA 2WF5A 4IRUB 4EMUA 1VLVA 3ZKAA 2OG1A 2JCSA 1KYTA 4GVLA 4BNFA 4YJ2B 4LJSA 3K0AA 1XDWA 1JW9B 3N28A 1H1TA 1SQFA 3FKQA 4FFMA 3GLHA 1ZS9A 4I46A 4QSMA 4QHTA 1L5HA 4MB2A 3S70A 1U94A 3TOZA 2WJZB 4NDAA 1QE3A 5DM0A 2CL0X 2Y3IA 3P45A 2R4UA 2RK3A 4B5KA 1LX6A 4QOEA 1HE5A 1QS0B 2BF7A 1VLLA 2FUEA 3F7TA 1KKLA 3FOBA 4NS1A 4N9WA 1GA4A 3S1LA 2WV9A 4ML3A 3PNMA 4DMKA 3HB0A 3O9ZA 2P6PA 3ZKWA 4AWBA 5TEVA 2YKGA 2CBXA 3RRJA 3SJZA 4YCMA 1GTRA 1X0VA 3E7PA 4MR9B 1K27A 4RSGA 5IT4A 1GSHA 1OI3A 3LOQA 4IHAA 3ILYA 3S28A 3A6HA 3NTOA 5M5BA 3V00A 5CDFE 2W9XA 5FLKA 5JEEA 3SVLA 2C1ZA 4DGSA 3UH0A 1HX7A 4UJ3A 2VTBA 3O1IC 3AESA 1NJGA 3M83A 3ZYZA 1P0PA 3VSEA 2XJ4A 4C0AC 2YJZA 1DQYA 1NQUA 1QKKA 4W9NA 2ARKA 2QU7A 1ABFA 1E3EA 2XYQA 2XYVA 3EH2A 3FBTA 3DAFA 4L15A 4N12A 4O4JF 3OLVA 1GGNA 1GTZA 1G5QA 5B1DA 4V1CA 3DMYA 2I29A 1H94A 2VP2A 1V5GA 3MWEB 3QWFA 4EHIA 1IAVA 2RHTA 5E8JA 2OBYA 1P2DA 5A1JA 1RLOA 4FYKA 1BHSA 1BKYA 3HA7A 1DQNA 4N03A 1YCDA 2CZCA 5LA6B 2QT9A 1EUQA 3OA0A 1FB5A 4YROA 1Q5PA 3HG7A 3SOZA 4DR1B 2JIZA 3O8DA 4JBNA 1QLHA 3WQSB 1Y98A 4FIDA 3N70A 2DPMA 3PFFA 4KJXA 4OXRA 4HXEB 3HKCB 4Z54A 4WZAA 1BVUA 2ZUVA 3V1YA 5KVAA 1A95A 2LR0A 4Q47A 1UZNA 3AVPA 4GWLA 1WNFA 1YUBA 1DDIA 3A06A 4FGUA 4B7XA 2BN4A 1CQPA 1KFCB 4JHXA 4UCWA 1JZTA 5TPZD 1GQRA 5IZ4A 2E48A 4RYLA 4FB5A 1YA6A 2CNWD 4OUDB 4B3XA 2GBLA 4BNKA 5K0LA 4KR2A 3W4JA 2F1HA 3AUUA 1F3OA 3GCXA 3G2OA 1FTYA 4I55F 3DE1X 3HJGA 3H9EO 2RHRA 5A4FS 3UC9A 2QR2A 1SXIA 4KKXB 2HR1A 3ESZA 4LSZA 2XHEA 1CHNA 2R6JA 2B1QA 4BMCA 3FNHA 3TQHA 2FGKA 4B0OA 4DLSA 3I2HA 3PUWA 1EZZA 3TEJA 3ZWPA 4EJSB 4L5AA 1GTMA 3N7AA 4ER7A 4EKEA 5C8YF 3SVTA 1XDGA 4JCOA 2FAXA 4C14A 5BWMA 2UZ4A 2RBEA 1KZ6A 2FXVA 1YSCA 1ZAYA 4EH1A 4D9CA 3QM1A 4PC3A 1ELOA 2CUNA 5I7WA 2P9FA 3EEQA 1Z6GA 4YO7A 5I9LA 2G1AA 4FJ2A 3J80A 2P41A 4M87A 3ENVA 3G8YA 4B7UA 3TMKA 3QZUA 4G5QA 4HPXB 3VDRA 2AFIB 3KJIA 3KLNA 2CFOA 3Q7IA 3DAHA 5LPNA 5BMOA 4YACA 2JZOA 4DMLA 5MGNA 2Q4DA 1CUGA 2YRFA 5H3CA 4BMVA 1IEXA 4NXNB 3FVTA 4JJ4A 4ES6A 1VHWA 4O25A 4KLRA 2F00A 4HMOA 4MUXA 5A6SA 3OZFA 1E8DA 2RGBA 3F5QA 2G1UA 3B3FA 3L4SO 5AHOA 1X3SA 4XVHA 5KYWA 2CD9A 3EUAA 4P3KA 1GVNB 1NWHA 3D81A 1XXHB 5HDQA 2I7TA 4JT9A 2X15A 3BH6A 5HFAA 2PJRA 3CSUA 3V42A 1M34B 3DDNA 1DRVA 2FPKA 2CEKA 2IYOA 1ZJYA 3IDZA 4XIJA 1CE8A 4Z7OB 3VFDA 3T54A 4CDNA 4XB1A 5CCEA 1EHCA 2Q2WA 1YU6A 3QPVA 4FEEA 2X3FA 3EXEA 4MS1B 4ZAFA 4CM3A 3SSAA 3KBOA 1G59A 3A32A 4UAGA 2R8RA 3LKDA 2CB9A 3ZDQA 4BO0A 1MC5A 1Q20A 3QTBA 4PCAA 5IJAA 5EHGA 4ZT3A 3V1UA 3N2ZB 3ADOA 5JH7A 3GLIE 4ZOLB 2QRQA 4BTEA 1K7CA 1QYXA 1G8SA 4AJNA 4EYQA 2BEWA 3E61A 4P98A 1PQPA 4LXUA 3W0LB 4EGSA 1K3TA 4HNRA 1JIUA 1KOFA 4XFDA 2FEPA 4PXYA 5EGNA 2GT1A 3OJCA 2QT0A 3EB9A 5J2TA 4X62B 4HB4A 3TLCA 2FKNA 1IEQA 4W8HA 2OCGA 4MPPA 4A03A 1RM3A 3ZLJA 2FSGA 4GSKA 1NW4A 2C8VA 1BWSA 1ECJA 5IJ0A 2EGUA 3PC7A 2DZDA 4B6JA 5JOQA 3PFKA 3ZIDA 4FT2A 4LVNA 2HSDA 1OU0A 4BLPA 3PGXA 5LQRA 3MQFA 3ZIAD 5BPFA 3GY0A 1KI4A 4LMRA 2XNDA 3F4KA 1Z25A 5AVOA 3IBFA 3ICWA 5J59A 3QVJA 1XOIA 4RVOA 4DR3B 1BDIA 3LGXA 1NRWA 2C2KA 4JI2B 1CFZA 2NSJA 4U39A 1A1SA 2IPOA 2K87A 4E22A 3ZLVA 3KPJA 1HYQA 3C5CA 4JI5B 4XPZA 2TYSB 3I9MA 2V6JA 3WIUA 2MR6A 5IWCA 1SXHA 3FCCA 1DEXA 1ZU5A 2FZVA 5T64A 4HYEA 3K5IA 1E6WA 4IXDA 3E5HA 2RHJA 4S2UA 3VPHA 2BEUB 4B6FA 2XMRA 3HBMA 2X23A 1JDZA 1ZJ4A 4KE7A 2BGNA 3HCNA 1C41A 4FLEA 4BMZA 2VBIA 3FZGA 4GZ5A 4BLWA 4Y1RA 3TG8A 4F4CA 3TZCA 5K0NA 1SD1A 1Z63A 5AJHA 2JRCA 1G6HA 1KAMA 3SNKA 2QIOA 3A31A 2ZB2A 3C3JA 3U7QB 5JIBA 2XGSA 4JB2A 1EWRA 4OAPA 5EZ6B 3H0KA 1EWVA 4EI9A 1O96B 4F7WA 1ZR2A 4ZQFA 3R5KA 3QX8A 2EP7A 3R7FA 2DQ4A 2QLLA 1RRCA 1SQ5A 1U7DA 3V34A 2W83A 2XUAA 1PTJA 4DWJA 3VPFA 1TTTA 1ETUA 4JOCA 3P2EA 4IV8A 4NAVA 4RGYA 3EVDA 4ESEA 1ZW6A 4IQ4A 2G9RA 3SKVA 4U00A 3AR3A 4I2VA 5AIAA 3TAXA 5JANA 2OTCA 2QLBA 2VT2A 5JG7A 3LZDA 4MARA 5T41A 3SR4A 4UZEA 2AKAB 4OFWA 5JZBA 1NOIA 3ETHA 4FBGA 4QYWA 5DMHA 2CUKA 2FWNA 1EFUA 4TQGA 4KMMA 5EIOA 5GQSA 2FUKA 2ZFUA 1ZMBA 1I14A 3JXEA 3GGGA 3TLBA 4XD7A 3CPJB 4XVRA 5DCUA 1II0A 2WU0A 1PZGA 4CHTA 1LPMA 1WNTA 3HFGA 3LLMA 4UFPA 2NVUA 5C8VA 3JATA 4B46A 5EHZA 2NUTB 3ZDRA 3MEQA 1R9MA 1LRLA 2JFPA 2J3HA 2I22A 3OOJA 4BAZA 4CIDA 5KCZA 2P3SA 1MO5A 3ZXSA 5K8IA 3QYAA 2BFCB 3H0EA 4QIHA 2ICAA 2FMIA 3P52A 3D54D 4G0PA 3CNNA 1IG0A 3KLBA 4A10A 2AX4A 4ZOQI 4QO8A 4V2IA 1XZDA 2A1TS 4A0RA 4I19A 1K2VN 2COKA 5K3CA 3CUUA 2FMKA 4GLLA 2W6PA 3TZKA 1S01A 2IUTA 3HI6A 3OT4A 4RYDA 2Q1WA 4ND4A 3PJDA 3VUFA 5FWXB 2PQ0A 1GNVA 2EFHB 1LF0A 3EWSA 3OC6A 3C6ZA 4I9UA 2I3DA 2IEZA 2P1RA 3W6UA 1PT5A 1K8XB 1TLFA 3RSFA 3PRYA 1W36B 3LRTA 1Z4OA 3ZDFA 3F47A 3R6GA 2YXPX 5C2JB 2V1UA 4KDRA 4BMNA 721PA 2AOUB 3VZDA 1N1EA 3KZ1E 1XD9A 4U2CA 4JEIA 1SUAA 3S8YA 2O1EA 5BYJA 4I3HA 2R9VA 4NI5A 4GXQA 5LZ2A 1YCGA 3KP1A 4NCNA 4QD3A 1ML3A 4YJGA 4PN7A 1JEJA 1O08A 2XD9A 1KEKA 1N0IA 4WFIA 3IPYA 3A70A 3WGUA 3DFUA 3ICPA 1X7ZB 3IQEA 1C0KA 3ZX4A 3KTOA 2WI8A 3RFUA 2NPOA 5DNUA 3NBUA 4WACA 1YGYA 5K6AC 3H16A 2WJYA 2PKYX 3GLKA 1JDBB 1J56A 1ST2A 1VP9A 2HCBA 2RARA 3E18A 1ZGCA 3F1KA 4I6EA 4PYMA 1I33A 4QUHA 1JQJC 1XAHA 4MUFA 1C9KA 1JFSA 3DULA 1AQJA 5E9WA 4JBXA 4P3OA 1KDRA 5DZSA 2QUKA 2O0LA 2FW9A 1SQ0A 1MAHA 1W87A 1PJTA 4OYLA 1ZJ5A 3CMCO 4TKZA 1SKBA 3SQOA 4UVIA 3UMCA 3IPLA 3X3HA 4CMIB 4CUJA 9ABPA 1I5EA 4FFLA 4NJEA 1PV1A 3ESDA 4HS9A 4ARVA 3TRHA 1OXSC 3ZBUA 3LKBA 3AW8A 4GE3A 3WAKA 4DLKA 3K6SA 2ALJA 3OJLA 4PSAA 4TRJA 3H87A 4IEIA 5AM5A 3EXHB 4E1BA 1ZCAA 1AN9A 3HU1A 2OAGA 4WINA 2OWDA 4B73A 10MHA 4ZJZA 1T2FA 5KIAA 3OX1A 1GSAA 1PBNA 1XHLA 4MUNA 4Q0MA 1QYWA 4QLAA 3W1VA 3W34A 5AVVA 3W6PA 2F7SA 3CJTA 2FFJA 1MRSA 2ORED 5ILOA 2GK7A 5ENDA 1PJ8A 2QX6A 2V9CA 3Q7PA 4Y7CA 5C1OA 4NEGA 4CQJA 3GVHA 1Z88A 4RVSA 4JIMA 2PZEA 3SZUA 4CL3A 2ODWA 4JAVC 1UPAA 4I14A 1Z35A 1KQNA 2VUSA 2ZW9A 1Y48E 4OJTA 3FDZA 3JWJA 4JVOA 4R9UC 5B2ZA 5BSGA 5BXYA 3SIXA 3Q1KA 4WN9A 3VMMA 1TLLA 4XJVA 1QIJA 4PQGA 4XQ0A 3U0VA 2OWEA 1DAEA 3A04A 3ONWA 4C87A 4EG3A 3RFXA 3LBHA 3WGKA 3FPEA 3ELWA 4COOA 2GBIA 1Z4QA 4MUBA 5FDFA 1N3LA 3QBDA 5IDWA 2BI7A 2XXAA 2GD2A 3WK6A 4E2XA 1IOVA 4QEKA 4MRVA 1DUIA 1RKUA 3RASA 3VOBA 1Z7YA 3GRYA 3K1TA 4L0QA 3VH4A 3PL5A 3WBJA 2DTEA 1M2HA 4M7RA 4Q48A 4O4HA 5EMLA 1O6ZA 2NP7A 5AM0A 1DE0A 1TU3A 1ZNXA 2FVYA 3BGIA 3OESA 5BW4A 4LDQA 5I7FA 5AJYA 3PR1A 1KH1A 2EFJA 3OF2A 4PLHA 2HLPA 3T3GA 4B6PA 4EELA 5JXJA 3AR4A 3A1VA 4K3VA 1EHYA 1ZRNA 5JT1A 5DIFA 1R6BX 1XZPA 4R4JA 1FXSA 2B0JA 1EVYA 3JQPA 4YJFA 3CEJA 2C84A 3C6XA 4HZUA 4BFVA 2OO7A 1HLFA 2GERA 3WLNA 5DNCA 5JSZA 3T3EA 3KX2A 3FNBA 1R6VA 6CHYA 4YXWA 2CDBA 1NPDA 2VP3A 3FI0A 2RGGA 4RVGA 5DSZA 2BFDA 4F9GA 4ZGGA 1KA9H 5C51B 1FQKA 1PDOA 2O1WA 4L5IA 2J7PA 4O2AF 4EQ6B 3E5RA 3LW7A 2IYAA 4BE7B 1WUKS 4PLWA 3KYDB 3MMSA 5SV2A 2UZIR 2XQGA 3HXQA 3OCUA 5HS6A 1A5ZA 1NBME 2C20A 2L18A 3QGMA 2BFBA 3N5KA 4PYIA 1Y5RA 4HS4A 1U0TA 4B71A 5I8ZA 1QMPA 5IKMA 2QI9C 1NVXQ 4BE9A 4RJ2A 1N2JA 1D5CA 2J3JA 4RESA 4L28A 4AG5A 4WLOA 3ZS9A 4HNHA 3FPJA 3IERA 3L43A 3WG9A 5IJZA 4LYHA 1SCKA 2G80A 4LC9A 5BUSA 1PWEA 1VC2A 3FNFA 2BW0A 4ZI7A 3G8BA 4JVMA 4OBBA 3OQMA 1UBOS 4V24A 3GHHA 3CU5A 5JS6A 1WVMA 1SVIA 2FG6C 2I4RA 4RJLA 1GCGA 4JVSB 4R1LA 3ZNNA 3KK0A 4K05A 1TCUA 2C5EA 2QYOA 4TLCA 4II7A 4E15A 4JT4A 5TT0A 1QLJA 2V7QD 3VV3A 4OMCA 4DC1A 3IUPA 1GAQA 1X7DA 3P2KA 3K8ZA 4C4SA 1UZUA 3JQ7B 2H5JA 4WKOA 3ZW8A 3U7JA 1NG9A 4E5YA 5KVSA 5GAJA 4EAAA 5CXSA 5KNLA 3Q41A 5DHPA 4IX1A 1R12A 1M9NA 5DVZA 4JYCA 4RMNA 3VR5A 4CF7A 2QM8A 2P6NA 3MWJA 2MJLA 3X1MA 1G8JA 5F9HA 4XX0A 1W5AA 3C6QA 3LHSA 4J9UE 2VJPA 3U0BA 1JFFA 1UJ4A 2RI6A 3EGVA 3GUUA 1W5TA 1E4VA 3V80A 3WDMA 3L4JA 3ANXA 2W4MA 3C14C 3OPYB 4KTVE 3JV7A 3H8WA 4PWYA 3VOAA 1ZITA 3WR5A 5KTOA 4A8JC 3WKEA 1Y3DE 2P35A 3MCUA 3N7TA 2O2GA 3F5FA 5JWOA 2Q7XA 1KU6A 2MMCA 5C4GB 1AV6A 2D1TA 2PK3A 3A9UA 4HWTA 2CBZA 2FSIA 2X5JO 2WYIA 1XBTA 3U4GA 4LDJA 1XZCA 2NNLD 3O4HA 3G7UA 4PG4A 4G0ZA 4G9BA 1YBFA 2D8AA 4FEYA 5A3RA 3HLTA 5IM4F 3ROKA 2WC1A 1M1YE 5E1BA 2JHGA 3SF8B 3PC4A 1Y7TA 1GGVA 5HK8A 4ZT4A 1KE2A 1KZYC 3TJMA 4ALNA 3E84A 4H35A 4QG3A 4W1QA 1TRHA 1QRUA 5JALA 1E9CA 2SICE 1Q77A 4KIJA 4RHEA 3A2MA 1PK8A 3IP1A 2HSJA 3L1UA 1K6MA 3DT9A 3IBYA 4G36A 4MYSA 4P84A 3WRYC 3DLHA 1RI1A 3IQFA 4TZKA 5CT5A 1H85A 2D0PB 3LC0A 5GJCA 1I3NA 4JLPA 5DTIA 3O4GA 3PV0A 1INLA 1IWBB 2TRSB 3H5WA 3FPBA 4MRSA 1J5XA 4NR0A 3I04A 5K2OA 1XAGA 1Y9EA 3HU5A 5E7JA 3V8VA 3G0BA 4JB0A 3ZNOA 5EN4A 4GYJA 1F5SA 3IJPA 3HO6A 4UMEA 5LC1A 2JH9A 3A26A 3E7XA 4WCFB 3SZGA 3VV2A 2J9RA 1CY1A 3KKPA 1ZY2A 1P5JA 1RHQA 2BMAA 3M1IA 5ERGB 2G07A 3O95A 4CTJA 2ATIA 3DBHB 3ZU6A 2E1PA 2FUG6 2LRHA 4OXKA 1RI3A 5F51A 1ZJZA 1FS6A 3L0BA 3ET4A 5ESRA 5J43A 4XM0A 2I7DA 4TYYA 3L1VA 4MWSA 2A67A 3OU2A 4MQ6A 5DFAA 5I4KA 1WZNA 2ZT8A 4PPYA 3SBOA 4G3XA 3L79A 3PD7A 4TMXA 1V16B 1Q3KA 2FK7A 2W8BA 3NLLA 2CJYA 1U4NA 2H2HA 3KT3A 3QLTA 3PGJA 3NJ8A 4MQEA 5CLGA 4BB0A 5EJ6A 1F2UA 3DMDA 3VR0A 1PFYA 1BX1A 3QJ5A 3UJBA 2M32A 2O9JA 1CZRA 1SRQA 2LVBA 4IDHA 4CEHA 2QRVB 4CKBB 1N2CB 2D74A 3Q7TA 4Y8VA 2JI9A 2Q41A 4WNAA 2VRCD 1U8EA 1ZD4A 2JFOA 4B74A 2HMWA 5IK2D 1DAPA 3M9LA 4L3WA 1FJ2A 1VSQA 4ZXPA 2WVAA 2PJUA 4F9FA 3TEFA 5CA0F 2QE7A 1Q0HA 2HJSA 3PNPA 1AQNA 1YHYA 1I94B 1CHDA 3VC3A 3M49A 1OUMA 2ADOA 4J91A 4BVJA 2DQYA 4Y6PA 4PZAA 5F2EA 1NUTA 1G41A 2VHWA 2WD9A 2MSLA 1B7GO 3AW9A 4TQUS 4URWR 5AVSA 3FMFA 4U5QA 5DNAA 3WS7A 1FVOA 1VKHA 1JI3A 1YBMA 4FR5A 3SNHA 4XWWA 4AL4A 3GQBB 5AYVA 3RVPA 2BKAA 1TI7A 4OTZA 3L8HA 3TE6A 5L9AA 1RQNA 2EHDA 1BO6A 3OX4A 4R3WA 3ISVA 3H8SA 4UHCA 3ZHYA 5KNDA 5K09A 1Z75A 5IM5A 5HCUA 3ZCTA 3IOMA 3UMFA 3TTSA 1L6RA 1TF5A 1CV2A 2IUFA 1IUOA 5EUMA 3RAFC 3ITKA 1F1BA 5FAKA 1S8OA 3K0CC 3ESCA 4NU6A 2HLHA 3N2YA 4LZOA 5DCLA 1LFDB 4WV3A 5CHEA 4BNNA 3ESXA 3ZE8A 4WZZA 3R7AA 3QKUA 2C5AA 4I1SA 5BYBA 1MPTA 4OGKA 2JARA 4A2WA 5KOHB 1DG3A 5JY1A 1ADCA 1WU8A 2PRIA 2EX4A 3R9XA 1KZ1A 1PD1A 4K7JA 4KBFA 3PFNA 2QTMA 2IU4A 2J67A 3GYBA 3VBEA 2VK1A 3ZHVA 3AXSA 4RLHA 3CR3C 2AR9A 3B1ZA 4JT2A 3I01M 3RWBA 3CYFA 1JFVA 3OOYA 3I05A 4NFYA 5CFPA 1A69A 1VB5A 2IBMA 3AJRA 4H3KB 4A82A 1Z7BA 2JI4A 2IZOA 4AROA 3G2PA 2Q9UA 1JT9A 3VSCA 2P0EA 4TVSA 4TSFD 2BYTA 3KR2A 4X1YA 1N0VC 5I7UA 1KI3A 3B8HA 4LCJA 1BROA 3JQBA 4GL2A 3L6DA 4Q1AA 1XRQA 1RI2A 1EM6A 4QU5A 3GBVA 4QFBA 3FZQA 4NFHA 1PL7A 3IT2A 4Z9XA 4KUHA 2JB9A 4B43A 2ZS8A 3E3MA 4E5NA 4KPEC 2ZKIA 2YY7A 2KE5A 3OQNA 4TTJA 2FMHA 3EAGA 5KQPA 1ZUD1 2FP4A 3CNLA 1BXRA 3GJYA 3W06A 2CB0A 4L8YA 5EL0A 1XEAA 1U2DC 2XAUA 1HDRA 3C7CB 4RWEA 4A92A 5HFJA 3H83A 4R1QA 4WOCA 3UHAA 1B8VA 1VBMA 2ONJA 1JSCA 3B7GA 4NSNA 4QYIB 1WHSA 1DJPA 1K9SA 2GZMA 5AVTA 4DPKA 1U04A 4LTNA 3N3AC 2R47A 2JGKA 3LY9A 3CO5A 4CF3A 2ZANA 1E61A 4J2TA 3UMVA 4RTOA 1UC4B 2X7HA 2A94A 4X5OA 3VOSA 3U6BA 1XQYA 1U8XX 2FHPA 4X1IA 3U13A 3V7FA 2BSAA 1O89A 4MV7A 3T6KA 2Z1MA 4TWIA 3HL0A 2RG1A 1WS6A 3K9LA 2J85A 5FUYA 5CD9A 1ORTA 3MINB 4ARZA 4Q03A 1KQFA 4AG3A 4Z9AA 3B5IA 1T8SA 2UKDA 3ON5A 3WLPA 4QUKA 5I9TA 4I2NA 3W2HA 1A98A 3HACA 2A4MA 5L4SA 1JQDA 4L8WB 1IVNA 1Z5WA 2VJNA 3A28A 1UIRA 3U4IA 3TVTA 1QRSA 1SB9A 4F3RA 4ZJPA 3CB4A 4J7AA 2C00A 4R5HA 2HUPA 2VYVD 4U4AA 4OKSA 4QEZA 5H81A 2C7RA 5AM1A 1NNLA 5BNIA 4OXXA 1O97D 4LIPD 4D46A 4XLTA 1EYZA 2ZPUA 1V5WA 1NG1A 1CUZA 3M5CA 4DLBA 3AEUA 1TQDA 3G9XA 5D51S 1EA7A 2R8YA 1Q19A 3NGLA 4DDWA 5CA1F 1VPDA 3QI2A 1D07A 4HBGA 1FTNA 3S5JA 3STTA 1Z2OX 1X9IA 1F2TA 1VCOA 4O3FA 4CM4A 5LP6B 1JDTA 1M2VA 3AHCA 3KKKA 2VFAA 1ISMA 3ZWXA 2JFZA 4LAFA 1SZDA 2FPWA 3OLCX 2JLAA 1IN8A 3A11A 3OIDA 4M86A 5KAMA 1QIHA 5LQKA 2Q9CA 5JATA 2Q8NA 2KW5A 3TUJC 4WMLA 1X2EA 3NWBA 3Q8WA 3QVVA 3OKFA 3ZD6A 2G0AA 5K8JB 2H17A 2F48A 4GOXA 4BX2A 4IQFA 3IUEA 4UQOA 3P71T 3I1JA 1WF3A 3EDRA 1TL7C 2E6KA 4H16A 3TFOA 3GJZA 2JJ2D 3TOCA 3BFJA 2PXCA 2BD0A 3PD0A 4NMWA 3GJ7A 5D00A 5JD5A 3P2OA 1QP4A 2Z09A 3KETA 5GY7A 2FJUA 4JP8A 3Q9LA 1XD8A 2FPPB 3JARB 4HEJA 1JR4A 1AUPA 3EF1A 2H6EA 3INRA 3OUUA 4HLQB 5LYYA 2Q5HA 2NYVA 1ZLXA 2WIFA 3G1UA 4OSEA 1VJGA 4LF6B 5FWYA 3VTZA 2L2QA 5ANRB 4X24A 4GEKA 4BQSA 5JISA 3ME5A 1LWNA 1R3UA 3O7MA 1RQGA 3ZW7A 4NZZA 4P4SB 4P6VF 2C9MA 5KYGA 3OFVA 4F60A 3G8DA 4FYVA 4IUCS 2G28A 3NVKI 1FU7A 4DXAA 3UM9A 2ODAA 4LC0A 2CL5A 1JPJA 1Z06A 5CFOA 4TKMA 1P19A 1E2IA 2P91A 4C21A 2N42A 2Z1DA 2GPAA 4OOFA 3HUFA 3W5UA 5IKXA 5F1OA 1DAIA 1NRJB 3DD1A 3YASA 3WNDA 1ZD1A 3L6EA 3OFJA 2CUZA 3FUWA 4DABA 2GXUA 5ADVA 4ZYXA 1QJ4A 4GI2A 1N6RA 4L76A 2COEA 3JWPA 3R9KA 3O8RA 4GI3A 1MV8A 4D99A 4FYYA 2Q1XA 3FYUA 4YEDA 1AQ6A 4LQCA 2ZSHA 3OWOA 2AJCA 2B4KA 2BONA 3EA5A 1YJXA 3F2IA 1PR6A 4HLDA 3WRVA 4N76A 4EUNA 3MJCA 2O2ZA 1JILA 1PSZA 3VXKA 3BN3A 3UBTA 2R1TB 2RBGA 2WKSA 4NK4A 1XTUA 5DN6A 4QDUA 3HS3A 1RDFA 2DEUA 2XOKD 1H3FA 2WA2A 3HEAA 3HDQA 2WUVA 1ZSNA 2VBFA 3LQYA 2GEBA 1RLTA 5DEIA 1DC4A 3Q0IA 4C07A 2CWWA 5EJ8A 2PH5A 1EFHA 1XVVA 6YASA 2DPHA 3HCWA 5FA8A 3WBBA 4N82A 5K2MA 1S8AA 4IIJA 1BQ3A 4ERNA 2C59A 3DWIA 3L0YA 3STHA 4FP9A 4WBNB 5KEIA 1K75A 3E58A 3PUZA 4B45A 1D2GA 5LQJA 4M46A 2YBDA 4G1BA 4P81A 3K4PA 2ZRPA 3SZMA 3MIZA 2AX3A 4Q1CA 2PUCA 3DKIA 1P9RA 4FYMA 3TW8B 3JYQA 4N3BA 4Y9DA 2ZBFA 4G0MA 2K2WA 2I3ZA 1J1IA 3PIIA 2LIPA 3RQSA 1B6SA 3TQIA 1GN8A 4AJ4A 5E1OA 4DMMA 2R5NA 1ODKA 2V55B 1QP0A 5GTDA 4MV6A 2XVYA 3G82C 3R3SA 4R0VA 2HW8A 3BZWA 4OIFA 5CT6A 1QHSA 1MKYA 4BNUA 3WGLA 2I7XA 3PX7A 3FUVA 1B2RA 6Q21A 1Q95A 4Q4LA 1TYEB 4JITA 1A4RA 2PMDA 1UT5A 3EFOA 2WYWA 4ZT7A 3W77A 4BWYA 1E0JA 1M2GA 3LMKA 3OX2A 3TXXA 3G6WA 4C4OA 1KBZA 1CR1A 5F35A 5DM70 2GAOA 2DU8A 3MHTA 3VOTA 1ISFA 2YOFA 1SD2A 1AXRA 3HN6A 3IAAA 4ZVRA 1W0KD 2ORWA 5HMMA 5JNSA 2C8KA 4AQYB 2OAEA 8OHMA 4I50A 3EPPA 4PYQA 1CJVC 5A7FA 4Q01A 3EIXA 3GFBA 4HRXA 4U8HA 1G8PA 1ONPA 1NUSA 2EKZA 1XTQA 1ZN7A 1TZCA 4K9MA 3RUPA 4U2DA 2PPVA 3GA0A 2WSIA 1P73A 1GGKA 1BZYA 3ND9A 4YIKA 1Z68A 1C9JA 4PSCA 2VVTA 4NEHB 1N9ZA 3DL4A 1E6KA 4X61A 4RTMA 2JBHA 2YWGA 2AG1A 4OM7A 5TPZA 1QRAA 2HXSA 2GESA 2X9GA 1VBNA 4AT1A 5PNTA 2A9KA 2N1BA 4CF4A 4CDGA 4F04A 5BNTA 2NUAB 1CS0A 4EG5A 5K0TA 1KMCA 1RE0A 2LE0A 3MF4A 1RSZA 2QL7A 3Q6MA 2PE5A 2VJYA 1X8KA 5TQ2A 1R16A 2AN4A 4B3BA 3G0DA 1YKSA 3ZS8A 3DMTC 3ITEA 1MW9X 3ITNA 1G7RA 2DJ5A 3OTGA 3QUBA 5G1NA 3I5XA 5HBRA 3AFOA 1PNVA 4JKOA 1VSBA 3JALB 2QTTA 2GOYA 1JG3A 4QNMA 1RJ9A 1AB5A 2FWPA 1BG6A 3PQFA 4MIKA 1K3UB 4MX8A 2ZWAA 2A1UB 4ZT2A 3NP7A 1MZPA 4RV4A 2NXEA 3WB1A 4DM3A 2MCFA 2W0MA 3QVWA 3C1UA 1P2FA 3DFKA 2BGIA 4OQ4A 4HAZA 4IYJA 1Q83A 2CEAA 2OVBA 4B84A 3U4DA 3HWSA 4W1RA 1RYDA 1O0BA 1F14A 1WZ2A 5EKUA 4S1OA 4UTXA 5DU2A 3UKOA 5B53A 1N8NA 4YHBA 3CZ4A 1DEKA 3KYIB 1V3VA 2PRYA 4LF9B 4NPHA 1Q0RA 3NHKA 2IT1A 5C5EA 1GXSA 3ZH9B 5BXQC 2DUJA 1P39A 2PUVA 3IUMA 4XGIA 4RF5A 4DYVA 4LVUA 5JO9A 3S7ZA 3WWOA 4UHFA 2P62A 4W7SA 5KNCH 5DLYA 1IOWA 2BFEA 4M6WA 3IE1A 5D8DA 2FX3A 4CG0A 1FS4A 4IJWA 2QP3A 5DTQA 3MMZA 1BAPA 4IXMA 1QFJA 3DBIA 4I0WB 5KI6A 5AVKA 4ZAWA 5D3KA 1SURA 4YJ2A 4E5UA 2YY6A 1XTVA 1YCFA 1P2UA 1HT3A 4DBLE 2KS6A 4F6LA 3C70A 4O4JA 3WLQA 3FSJX 4LXQA 3TKYA 2WY2D 4OCZA 3UICA 1O94A 5JJIA 1A88A 2JIRA 4G4SO 3IJRA 2H2GA 2OBXA 3L9XA 2I2BA 4HQKA 1BQ4A 5HF5A 5I45A 2W2KB 1GPYA 3NXSA 4EG4A 4TXJA 2PEYA 3ZZUA 5K20A 1MT3A 1ZH0A 4K26A 1QHIA 1VPEA 4GHWA 3BTOA 1XFAA 4CCSA 4F1KA 1K5HA 4JBGA 1F60A 4MO2A 3AL2A 5J9FA 3SG0A 1OLUB 3AUJB 4RTLA 2PMKA 3ORFA 5CYPA 3S2EA 1J07A 3U9TA 4KN9S 1GKUB 3CVJA 4KL8S 5B1HA 4OHRA 2PCJA 5A7HA 1T36B 1U0BB 1SG9A 2NSYA 3A14A 4HQNA 2OGZA 1SAYA 4C7VA 7GPBA 4Q7JB 4UZFA 1DBRA 3EY9A 3HKDB 2I6GA 1RXUA 1P61B 2QD1A 1XVAA 3GH3A