4V0NA

Crystal structure of bbs1n in complex with arl6dn, soaked with mercury
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
166
structure length
166
Chain Sequence
SKKVNVLVVGLDNSGKTTIIERLKPRPRQAAEVAPTVGFTVDEVEKGPLTFTVFDMSGAGRYRTLWEQYYREADAVVFVVDSADKLRMVVARDEMEHMLKHSNMRKVPILYFANKKDLPVAMPPVEIAQALGLDDIKDRPWQIVPSNGLTGEGVDKGIDWLAERLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Membrane Targeting of the Bbsome by Arl6
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Hydrolase/structural protein
molecule keywords ARF-LIKE SMALL GTPASE
total genus 51
structure length 166
sequence length 166
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2014-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4v0nA00
1E1QD 1OPXA 3R8FA 3SFZA 721PA 1P61B 1CP2A 3FMPB 4LJ6A 1H8EA 2R6GA 2J7KA 2D74A 4PC7A 2Y8EA 3I8SA 3BH0A 4UKDA 1D9ZA 2BVNA 3LXXA 1VG8A 3LDAA 2ORWA 5GVSA 1R5OA 1KI3A 3VR5A 1Z6TA 5BN3A 3D7MA 1W48A 1ZUIA 3HU3A 3FFBA 5L8VA 1TTTA 4OBEA 4LV8B 3TMKA 5HCNA 1AA9A 2X1VA 1R0WA 3WP0A 4AURA 3ZH9B 2XOKD 4HDOB 5CM8B 3U3RA 2ORVA 5FI1B 5FOTA 4MRVA 3SYNA 2ZREA 5TV2A 4A8JB 3BOSA 3P4YA 2E9SA 1FZQA 1GKUB 1U98A 2ANCA 1GAJA 4GT1A 4Z1MA 5BYKA 2OHFA 4NYJR 3TQCA 3LLUA 4D4LA 3VKGA 1IM2A 4HSEA 2GA8A 5JECA 1ZBDA 3K0FB 4URVR 4QOSA 3I73A 4B73A 1XPUA 1EFTA 4ARZB 4ZKDA 3C7KA 3GLIA 4V0LA 4NU0A 2XZPA 2CCJA 1MH1A 3P32A 2ZQ5A 5JCPA 1CRPA 1XF9A 5EXTA 1Q44A 1EFHA 3F3YA 4U5XA 5TVKA 1ZNXA 5JHGB 4FI3C 1W44A 2XXAA 5JFGA 2G6BA 2MMGA 3IQWA 1FPMA 2JLZA 3UPUA 1TEVA 2BHRA 3T5DA 3EW9A 4M1TA 2YNMA 1U0JA 3DPUA 2FV8A 3T35A 1SZPA 2DY1A 5FOWA 4A36A 1E94E 1GFIA 1HE1C 4KYUA 3ZD7A 3MLEA 1DOAA 1BIFA 2QE7A 4ZIRA 3REFA 4GMXA 4HYYA 1R8QA 2XGJA 1RVDA 2YC2C 2ZTSA 1KZ7B 3M6AA 1W4RA 2BEJA 4TTQA 3T1TA 1HTWA 4GP6A 3GJ5A 1T91A 4A6XA 4XVUA 3ZZ0A 3ZJYA 2IW3A 3NH9A 2YZ2A 1F2TA 4BLOA 4FMCB 4UJ3A 1R0ZA 4M8NE 4NYIR 3CWZA 5FPHA 2CJWB 1XX6A 4P33A 1Z0KA 3L43A 3PJRA 1S1CA 1SXJA 4ABYA 3ZVLA 1ZINA 2BBWA 2BCJQ 1XEXA 2GJAA 1F3OA 1NY5A 4PSAA 1NIJA 3B60A 4JSYA 1OSNA 5CYPA 3EX7C 4NHOA 4OK6A 4PAOA 4DSOA 1P6XA 1OXSC 2OE2A 3KX2A 1PUIA 4JVMA 3B1ZA 2YWFA 4N0EA 3UG7A 3MWKA 5CDFE 3EIEA 2OM2A 1EG7A 2YWGA 3V4RA 1Q22A 4ZPXA 1J99A 3BGWA 1T8UA 2DBYA 2GDJA 3N70A 1KHTA 4UXJA 3J81k 4D81A 4TQUS 3ZZUA 1WBBA 2A2ZA 2QPAA 2W6IA 3QSYA 5LB2A 3KJHA 4C30A 1FMLA 4BFSA 2BDTA 1G6OA 4P3YA 1XMJA 2YWHA 2JDIA 2BMEA 4JLAA 3SFVA 1P9WA 3BORA 4Q7KA 3ADDA 5JBQA 1HH4A 1QF9A 4LBWA 2F1HA 3LFUA 3IIMA 4GOKA 1WDTA 2DFLA 1QHXA 3FE2A 1X8JA 2JIZD 2FX3A 3QKUA 2HJVA 5UKDA 1JALA 2ZAMA 4US1R 3GJ8A 4DLZA 4MYHA 4TYWA 1HURA 5AUPB 4CYMA 4Q4HB 1M7GA 2ZU0C 2ZSDA 3GJ0A 4C0AC 2PZEA 4RD1A 3DVLA 1Q1QA 1HA3A 4DRZA 5KSYA 1HYQA 3FYHA 4QBHA 4B3DA 4MGYR 4BFVA 2VEDA 2BWJA 1US8A 2AR7A 2ZU6A 5J40A 2OXRA 2JLQA 2XNSA 3LVRE 4HZUB 4YXWD 1OXUA 3H84A 4Z51A 1NN5A 3RANA 3SI7A 3QIAA 1PJRA 2WJHA 1YZUA 1EK0A 1P3JA 1ZD1A 8OHMA 1L8QA 3K70C 4ZI3A 2GEUA 4QHSA 3JVUA 3T34A 2GHIA 2YOFA 1GL6A 1Z6GA 4HI0E 1JEEA 1BS1A 2VQSA 1E9AA 3QXCA 4OQLA 4W5WA 2QENA 4TLBA 1LV7A 4HZUA 4QHYA 2X2EA 3THOA 4XIGS 1ZMXA 2FGKA 2IYQA 3WHKA 3OIVA 1E9DA 2JJ2A 2Z0MA 4JZKA 5DH9A 4ZDIA 2J0UB 5FUYA 2Q6TA 1UEJA 3V4FA 4ILEA 4W7SA 5KDDA 4DLUA 2QUZA 5EJEA 2BBTA 2G1JA 2XNDA 3G82C 3I3SR 3VR2A 5G40A 4M9QA 4XH9B 4HUTA 1JPJA 3B5JA 4MITA 3T1QA 4FMDF 2CCGA 3B1YA 4Q1CA 1ETUA 1XCMA 2XSZD 2G83A 1E2DA 4MH0R 1CR0A 1RFLA 5EP4A 4V0NA 3SJAA 4FW9A 3B8HA 4AY2A 1E2NA 1MABA 1S3GA 1G291 1HV8A 4N3NA 3B9PA 4DLRA 3KQNA 1EWQA 1F2UA 1DVRA 3IIJA 1XD2B 1XJCA 4P0TA 3LD9A 1E4VA 3AP2A 3TKLA 1T3SA 1CJKC 1E9CA 1U0HC 1G17A 4D0NA 1NN1A 4EPXA 4PPGA 1YHNA 2WTUA 5J4LA 2Z83A 5DHAA 1RYHA 1P60A 3D6TB 2AK3A 3GFOA 5FPYA 4DLWA 3CPEA 1JAIA 1KI9A 2VPPA 4NDZA 3PVSA 5FOUA 3U7FB 1GRNA 4AYWA 1W5SA 1NIPA 3DEFA 1DO2A 4QG7A 2PJRA 4M1KA 1FX0A 3BJIC 3CRMA 4N1AA 1Q12A 3CX8A 4I1UA 1SXJC 2H57A 3V00A 4DLXA 1ZIOA 2QMOA 4LV6A 1KY3A 4I4LA 3L8ZA 2XB4A 1UF9A 1G8FA 5KSZA 1XDBA 5FBLB 1S9HA 4UXHA 1O87A 1O3YA 3EC2A 5CJPA 2AL7A 4Q9KA 4Z1MD 2FSGA 1NBMD 2VP0A 3GJ7A 5G41A 4BFTA 4R71A 1ZD8A 2V55B 4BQSA 1BYIA 2PL3A 2OCYC 5KSPA 1FOEB 1XU4A 2QQ0A 3RDPA 2J0QA 2IYYA 4CVNA 1N0WA 3KDSE 3FOZA 3EPHA 4A2QA 3I62A 1W0KD 3DM9B 2W2VA 4RD4A 3H4MA 4RCZA 3O8DA 3IILA 1LS6A 5EP3A 4PPFA 1DARA 2FOLA 5EE3A 1AGPA 5FL3A 5FBQB 1GOTA 3U3MA 3UWKA 4B76A 2IWHA 4KFUA 2QG6A 2EYUA 4YC7A 4A15A 3QKSA 5KUTA 1PVOA 2ZRMA 1D2NA 4O25A 2ZI5A 4MRSA 4URYR 3SS8A 3BFKA 1AS0A 1T3LA 2OAP1 3IHWA 4KCGA 5AJYA 5FUXA 2ZR9A 1DAMA 1P5ZB 1MRNA 4TT3D 3ADBA 3BERA 2IF0A 4GFDA 4OJQA 2VF7A 5AR1A 1VCIA 2F6RA 3CRVA 5DYGA 3RS2A 3WXMA 3G0HA 1AJEA 1Z3IX 2I1QA 1W2HA 1CIPA 2HLDD 2ZROA 3I92A 5FOSA 1XTJA 4A0RA 1RC8A 2OEPA 5KSOA 1WRBA 2XTNA 3CB4A 4D82A 4M1SA 5JRJA 1Z08A 2QMEA 1WA5A 1WF3A 4TTRA 1OXVA 3DMNA 1AZTA 2V8OA 1Z83A 2MSCB 3BB4A 3GJ6A 4L8GA 4LYHA 4DCTA 1KO8A 1ZM2A 4JVNA 2NPIA 3OF5A 4KYIB 2CHGA 4AG6A 1ZAKA 3KTAB 2FG5A 2WJJA 4WAUA 4IFEA 2CE2X 1QHGA 4PZYA 1P72A 4BFYA 1NSTA 2HCBA 4D4MA 3LX8A 4HB0A 4B35A 5KNCA 2E87A 3SC3A 2WWWA 4NYJQ 1W2GA 3ASYA 1T8TA 3RS5A 5JS8A 3OEEA 3MWJA 2F55A 1XWIA 3EZ9A 1IN8A 4BRWA 2JLXA 1F60A 1X6VA 1YZKA 1SVIA 2Q3FA 1TQDA 4IVPA 3B13B 1G3QA 5FTMA 4Q00A 3R7WB 2PCJA 2DCUA 4YQFA 5GJWC 4HB4A 1VG0B 3AEZA 3PG5A 1S0UA 3L0IB 1IONA 4LWZA 2QU8A 2WWYA 3F0TA 2FE4A 2YJTD 2QT1A 1LFDB 2SHKA 3MD0A 4X8MA 1DEKA 3AVXA 2OUKA 4E09A 4X8OA 2V7QA 5FOXA 1GSIA 5KO2A 3HU2A 1NNEA 1YQTA 5EZ6B 1RJ9B 1SVOA 1UBFA 5EP2A 5AUOB 3ZVNA 5E95A 1FX0B 2GZDA 1VPLA 2FZLA 2ZJYA 4ACAA 2P67A 3LNCA 1KAOA 2J1LA 4W5HA 1SULA 3QENA 2ZUBA 1OFUX 3LBHA 4O0MA 4RD3A 3U3OA 4ZI2A 5DLQC 1GL7A 3GEEA 1ZM4A 4Q48A 4A92A 3THYA 2QMHA 2EVWX 1G5PA 1AS2A 2F43A 3WYFA 1E99A 2YOGA 2V1XA 2P5SA 1Z0JA 2CK3D 4PPNA 2YOHA 2WZQA 3AVYA 1UDXA 4WZAE 1J70A 5FPKA 1XPRA 2RCNA 3OEED 1DAHA 1KI6B 1OJLA 2VIIA 3WBJA 3RC8A 1CXZA 1CU1A 4XVRA 1NMZA 1PV4A 2XZOA 2FFQA 2OFOA 4M0LA 2ODBA 1Z5ZA 2H17A 1E32A 3L0PA 1DAEA 1U81A 1H8HD 2NG1A 4LUCA 1R8SA 4BFWA 2P6UA 5HKKA 3KQLA 3UWOA 3U7EB 4M1OA 4HLDA 4LJ9A 1W49A 1ZC3A 3ECCA 4IVQA 2VP5A 3CKLA 2IA5A 3DHWC 5GJVC 3LQRA 5JEEA 3T06B 3QXHA 1UFQA 2QROA 1TADA 4II7A 5AJZA 4A8JA 3QPUA 3T5GA 2N46A 4AKIA 1Z0IA 4A1FA 2RGDA 4URXR 2VP6A 3CBQA 1GVNB 2AWOA 5DN6D 4RVCA 3H1TA 4PX9A 2QP4A 4D80A 5L3VA 2GEDA 1IY2A 1XJQA 4PFSA 3QQ5A 4GDFA 4HB2A 3ETLA 4DBLC 1OH7A 4MUBA 1U8AA 1AZSC 3JVVA 1Z06A 2DWOA 3CO5A 3WYGA 1G7TA 1YZTA 1HT1E 3LAWA 1G3MA 2JLYA 1W36B 1KDRA 2FF7A 4Q47A 4M21A 2XOKA 4IEEA 2V6JA 2VHJA 3M0EA 4B2PA 1G41A 4NMMA 4BWYA 2WSSA 1M7HA 1UBCA 4V0MA 1NF3A 3HYTA 2ZAOA 4CEJA 3FGNA 2EWWA 2ZI7A 1ZUNB 1P62B 1DADA 5KDLA 4D0LB 1N6NA 4DEYA 4EQ6B 2AWNA 4Q7JB 1XNJA 1XTSA 2IYZA 5C18A 2J45A 3TSOA 2BMJA 2FZ4A 3E5HA 3IBYA 4RKFA 2R6AA 4Z8XA 4ZKEA 4BLRA 4DJTA 4M4SA 4WXPA 5IK2D 4JSTA 1LTQA 2ZPTX 3K9LA 3AF1A 2V54A 2QTFA 2R6DA 1V5WA 4NL4H 5JWHA 4LYAA 3HPQA 2CL0X 1E1RA 1SVKA 2ZE5A 3KFXA 1U9IC 3FKQA 3MFYA 3MG9A 3BK7A 3SHWA 5JCZA 5FL7D 1RKBA 3VAAA 1Z6YA 2MSDB 5IHPA 1HE8B 4RD0A 4PAQA 4D25A 3ZDQA 4M2LA 2ZI3A 5HE8A 2KJQA 2OO7A 3GJ3A 4YMTA 5TB5A 1ZVQA 5CIQA 3CM0A 4IJMA 2GAOA 1HEIA 4PQFA 3CX6A 4LHWA 4B47A 3BH6A 5A4JA 4ASUA 4V0KA 2QP3A 3CPHA 4GPTA 2NO0A 4DEXA 1OIXA 1PLKA 2GEVA 2KWIA 2N42A 1T9HA 1FP7A 4NCHA 3LV8A 4PPQA 3DM5A 1YR9A 1ZU4A 2ZE7A 5CB6A 1N0VC 4C3ZA 1NLYA 1E2EA 2YINC 3WRXC 4PHTA 4TSFA 3PITA 4EPYA 4ZCIA 2N1BA 4A0HA 1Q0UA 1LF5A 4AKGA 4FWTA 1IY0A 1I2MA 1NP6A 1AKEA 3QBTA 5FR2A 1G18A 2PX3A 4BFXA 4Q4JB 2JATA 4FN5A 4L16A 3RABA 4P4SA 1N6RA 3MJHA 4LBZA 1S4QA 1IXZA 3AVOA 4US2R 2J87A 2IWRA 1NKSA 3HJNA 3VHXA 3X1WA 2WKPA 3I32A 3ND8A 1E2LA 5EQTA 3MWLA 5K8UA 3D3QA 1ZU5A 2ZJ5A 4B2IA 1KO1A 3VNVA 2FPLA 3OZXA 4Q1DA 3UG6A 4TLAA 3KKNA 3GLFA 1G5RA 1GWNA 3NVAA 4KLZA 1L4YA 4K81B 3TW4A 5H1YA 4TMVA 2FFAA 4JL5A 1XD2A 2ONKA 1R4AA 2QAGB 4BPBA 3E2IA 1EFUA 2BBSA 3CIOA 4QL3A 3DDCA 4DB4A 3RNLA 1GNPA 2A30A 1RW4A 4F92B 4BASA 1KO4A 5EE0A 3LBNA 4QGAA 3H0KA 2OBMA 5A5GA 2ZI6A 3GEIA 3OEHD 2GJKA 2GJ8A 3PEVA 1OYYA 1W4CA 2HYIC 3TR5A 1TEXA 4BUJA 3TNFA 3WP1B 4GI7A 1SKYE 4Q9HA 2F3RA 4LBYA 1C1YA 1FTNA 4Q4AB 3R9IA 3A4MA 4NZYA 2A5FA 2ZUDA 3CR8A 1JQJC 1RRGA 1ZC4A 3CH5A 3IO5A 1MABB 2R6FA 1NG1A 2ZJAA 2BKEA 1Q1EA 2GZHA 1E9SA 1Y63A 3NXSA 2PZFA 3P1JA 4HAUA 3DMDA 1ESNA 1K5GA 1XEWX 1CJMA 2ZM5A 2REOA 2J0SA 3A1UA 1XMVA 3FMFA 4ACBA 4DDUA 2ZJOA 3TGPA 1Z63A 3EWSA 1YR6A 3RHFA 2FPKA 5SZHB 2VTKA 4Z54A 2ZYTX 3ZIAD 5KYKA 4DDWA 4YDSA 1MRSA 4Q1BA 1T0JB 2IUUA 1OW3B 4HAVA 5BWMA 3SDZA 3SJBA 3QI2A 1P2TA 3AUXA 1QDEA 4AK9A 1CULC 4JLMA 4AIIA 3FKSA 3ZVRA 1KOFA 2QNRA 4NPHA 4LRWA 4DSTA 3CF0A 1KTVA 3RSLA 3X1YA 2GK6A 2NZ8A 2WICA 1KSJA 3BBPA 3TR0A 4PAMA 1RIFA 2FPMA 3OFND 2ZRLA 1FQJA 1P9RA 1G4UR 2V3CC 4OQXA 4GZMA 1YZLA 2QI9C 1IAQA 1B0UA 2B7BA 3KTAA 4C0LA 3N2IA 2Z5FA 3PFIA 1QHIA 2XEXA 4IXMA 4NONA 1OFTA 4WVFA 5L3RA 4KFSA 4QC2A 5F9HA 1OHHA 4Q03A 2WAYA 1TQ6A 2C5LA 1N6OA 2ZRNA 4JKIA 2KBFA 2YKGA 1GTVA 1PUJA 1RE0A 1DS6A 4F91B 3CH4B 2Q3HA 4JBXA 1UADA 1I2DA 3TH5A 1H8ED 3Q5EA 5JSZA 2NO7A 3U60B 4AKEA 1UDWA 4O2RA 3RWOA 4LBVA 1XZPA 3B1XA 3FMIA 1D2MA 3KZ1E 2XNDD 2ZVQX 2EFDB 3F8TA 2ECKA 4A9AA 3U7GA 4D26A 4B3CA 4JYCA 4RZUA 1XXHA 2WPDD 4LJAA 5EE1A 1BYUA 2O8EA 3LVQE 1EWRA 1W0KA 3NHAA 4MKIA 4WZBE 3E70C 4MRPA 2C9CA 5G3YA 2ZJZA 5JZVA 1NN0A 4FMCF 1TL7C 2IYVA 3DL0A 2DWQA 1TU4A 5EP1A 3C8UA 4XTCS 1D8TA 3MUFA 2JLWA 1V43A 4OK3A 1D2EA 4KVAA 3X1ZA 3CNOA 2OG2A 3EAQA 5JJKA 3R7WA 1QG4A 1II0A 3QXSA 4QJ5A 1AS3A 3NWJA 4TL8A 2GVDC 2GESA 4TSFD 5FOVA 3KKMA 2VSOA 1XTIA 2VLIA 2WOJA 4L9SA 5D3MB 5CJ2A 3NDBB 1MT0A 1R2QA 2QEQA 1FP6A 1GDDA 2ODWA 5EXPA 1RPZA 1DE0A 2LKCA 4DCUA 3AKEA 2YHSA 3GLGA 2JASA 3W90A 2E1RA 4PTLA 3EC1A 5E3HA 3C5CA 3U6KA 3SJCA 3R20A 4RD6A 4AI6A 1VIAA 4KV9A 3KKOA 4HDQB 3ZGXA 4BZXA 3O47A 3X1DA 2NO6A 2ZVPX 3UMFA 1NBME 4A6PA 2V6IA 1ZCAA 4TWZA 3K0AB 3ND9A 2LKDA 4FINA 4XD7D 4N0DA 1KMHB 3C41J 2IC5A 1P2VA 1YKSA 4I1VA 1XTRA 1D9XA 5LD2C 3K09C 1KY2A 1T0HB 1X8LA 2DYKA 3W8RA 3C5HA 4NCKA 2AD5A 3DZDA 4Q21A 4LSGA 3OE7D 1KI4A 1NL3A 1E2QA 2WWIA 4TMKA 2REXB 4B33A 3GQBA 2YYZA 2VYFA 2DFNA 2RHMA 1IN7A 3I61A 3T1VA 3GLGE 5DHFA 3KKQA 3W3AA 1PLLA 2ZETA 1RYFA 3QUSA 4P4UA 3B1VA 1KDPA 1QHHA 3Q85A 3QPWA 3WNCA 4YMVA 1W46A 4M1WA 4IXNA 2JJ2D 4ERNA 1A1VA 2V1UA 2X8AA 2NGRA 1SXJD 4DVGA 4YLGA 4AWXA 2J0UA 2J5XA 4ZCMA 1YZGA 4EPRA 4HAYA 2QA5A 4CIDA 4EPTA 2TMKA 1E1QA 4OI4A 3AGQA 1N6HA 3U3KA 4KFTA 2L0XA 4O2LA 3H2YA 3BH7A 3BS4A 4W9MC 3U6BA 1M34E 2AKAB 1Z29A 2WBLC 3SE0A 3T15A 1CEEA 4V0ME 4NCNA 5CDFA 4XD7A 3ZQ6A 2CLDX 1N25A 1A4RA 4R7ZA 2AXNA 2IL1A 2R2AA 2BKUA 4UNSA 2B92A 2EFHB 4HAWA 5FBRB 2OCAA 2G88A 3VHLB 1Q3TA 2QPOA 5BYJA 1TQ4A 1CR2A 1G16A 1Z6XA 4CT5A 3QY0A 3TQFA 4DT1A 1GRRA 4PC1A 4XVQA 4UNNA 1ZUHA 3TE6A 5KU1A 4GOJA 4ESHA 4NYMR 2Q9AA 1CJTC 1JR6A 1GNRA 1G64A 2D2EA 2IT1A 4UXIA 5J4VA 1M2OB 1KDOA 1TAGA 4LYJA 2GCPA 3KB1A 1OB5A 2ZSAA 1NMYA 4DLYA 1G9XA 1E3MA 3SOPA 3SNHA 4BZQA 4M22A 1EFRA 1WXQA 4XWKA 1AKYA 1NJFA 1OFIA 2HDNB 4Q9LA 1UKVY 2QQEA 5FH9A 4C2UA 1OB2A 5E4FA 1RZ3A 1YZQA 2CE7A 1VECA 3THXB 1KI7A 2HXYA 1WE2A 4L5BA 2I1VB 4A8JC 5KOYA 3KJEA 3CONA 3P4XA 1JECA 4ZDKA 1COWA 4F4CA 3QBVA 4LOAA 2JCSA 3W5IA 2RB4A 2VP4A 4NYIQ 3PENA 3SJZA 3U4QB 4Q5IA 3LH5A 1NVVR 4JVLA 1G7RA 2BOVA 4EPVA 1JB1A 2C9OA 2XTZA 3QKRB 4QRHA 4DXAA 1EFCA 1TF2A 5F98A 1GP2A 2R65A 4JLNA 4CEHA 1IOZA 2BEKA 4KJZA 3LLMA 1J90A 3GFTA 1G3IA 4XSHA 2R44A 1H65A 1VHLA 1N5JA 1Z22A 2QORA 3A58B 3MRSA 3K0EA 1LW7A 2O8FB 3SQWA 1G4AE 3I1FA 1ZIPA 4CEJB 1CR1A 2PMKA 1G3RA 2HXSA 4Q19A 2GRJA 4PHGA 2VL7A 3NC1C 3RWMB 4FCVA 1SKQA 3HR8A 3HR7A 1KGDA 2WVJA 4KODA 3SYLA 4DZZA 1YR7A 4P32A 4CW7A 4ZO4A 2JLSA 1ZP6A 1XEXB 2PMDA 3QJYA 3EZ2A 4QM6A 4NCJA 1VYTA 2C95A 2IYRA 2IYWA 4TZ0A 4XJXA 5TDHA 4R2IA 3QF7A 1KDTA 1KKMA 1FNNA 4LK2A 4PANA 5LPNA 1DAFA 1F2TB 2YV5A 2A5JA 5FI0B 3AKDA 2ZRDA 2FFBA 1E1RD 3TK1A 4IHQA 1VTKA 2O0HA 1KK1A 2H8KA 2UZIR 3AKCA 2GBLC 1C9KA 2V9PA 2J7PA 5IDVA 3A6PC 5SZKB 4HEJA 2JLVA 5E7JA 3BXZA 2ZJ2A 1QHSA 3UMSA 5JI3E 3BAFA 1KNXA 1CJVC 1UPTA 4POAA 1QRAA 3EWAA 2ZITA 4ESVA 1YRAA 1KI6A 1KSFX 1S2MA 1W0JA 1P9NA 2H16A 5FBVB 2EWVA 5EE9A 2QGNA 1GKYA 1Y3AA 2NPFA 3TVDA 4PZZA 2P2LA 2IHYA 3EPKA 2CL6X 2LCFA 3WMGA 4S35A 1CF4A 2A9KA 3LWNA 2O8EB 2NIPA 4DWJA 5FR1A 5TXGA 2C2HA 1KSHA 1IN4A 1KO7A 1W4BA 3THYB 4RJLA 4LV5B 2FA9A 4WW0A 2RGAA 1AQUA 3B7GA 1DAKA 3A4NA 1C4OA 1JR3E 5CB8A 2HCJB 3W5JA 3K1JA 4E07A 4B3XA 4FCTA 5DNYB 2B8WA 2OXCA 1L7VC 5K8TA 2HJGA 2PH1A 2HUPA 3IHLA 3AUYA 4PQRA 4B2LA 1G20E 2VO1A 3PXGA 2ZYVX 1OF1A 2OBLA 4DC9A 2NO1A 4JL8A 5KDOA 1UJ2A 1MKYA 4ZCLA 4UNQA 1P73A 2HT6A 2CEAA 3FDIA 1FFHA 1AQYA 1W1WA 1MO4A 2F9LA 3B82A 5BQ5A 5L3QB 4OHVA 1LVGA 1GNQA 1OLOA 3IUYA 4P31A 2FSIA 2IXGA 3NDPA 4CT4B 4G0NA 4MKFA 2W2TA 2FEMA 2QY9A 2VSFA 3K70D 3GLHA 1DG1G 2QN6A 1E0SA 4KU4A 3KUCA 1EXMA 2W2XA 2WMOB 1UKEA 4NE2A 3FB4A 2PJZA 2DR3A 1WMSA 4I1OA 2ZS7A 3E1SA 4EUNA 2VBCA 2HT1A 1OKKA 1VG1A 3QKRA 1E9RA 1KJWA 1XJ0A 3NBXX 4E5UA 2XSZA 5EXSA 3LBIA 3NBFA 5HCIA 4M53A 3G5UA 4PSKA 4NKRA 2HEIA 4KHZA 2A7QA 3HDTA 5B57C 1II8B 3A4LA 5H8WA 3TAHA 2AHOA 4IDQA 3O8CA 3AV0B 2CMKA 1N0UA 3BC1A 3IIKA 1CTQA 4JS0A 2XITA 4R9UC 4JIMA 3DKVA 3QF4B 2H5EA 3SQXA 1M8PA 2FN4A 4KSCA 2H18A 4Q4AA 2VH5R 3QNUA 4QHTA 2ZRGA 3A36A 3BWDD 4DDTA 2NZJA 2QRNA 2BCGY 2W0MA 2YC4C 2AFIE 1A2KC 4XTRA 1G6HA 3GCGA 3CNLA 1U94A 2J46A 1KI1A 2V7QD 2GBLA 2I4IA 4C0JA 2QM8A 4OQFA 2O0KA 1NG9A 3EZ7A 1OXXK 4DUGD 1LS1A 3U5ZB 3TJZA 4GP7A 3OIYA 1IJFA 4MDFA 3IQXA 4XWAA 2XJ9A 2FJUA 4DDVA 5LBIA 1QHYA 1E0KA 1RRFA 1QVRA 2QMUA 4ITRC 4D4JA 2QAGC 3CPJB 3C4JA 4MGZR 4BLQA 2G0NA 2CJWA 4Q1EA 2IX3A 3GLHB 4OQNA 1LF0A 2WWHA 3HYRA 4C0KA 5GJCA 4GZLA 3AP1A 5J4YA 2ASEA 4G5RA 2REBA 3W8NA 5AUNB 2CLSA 2IUTA 1W47A 4AG5A 4B6FA 2DB3A 3EZFA 4B43A 1JJVA 5JJIA 2DPXA 1ESMA 4LDJA 5FTKA 4XWOA 1TU3A 4JMPA 2WHXA 4LHZA 3ASZA 4JLVA 3TSZA 4F38A 1BH2A 1KMQA 1FTSA 2OCBA 4IVRA 1NJGA 4NTZA 4Q02A 4EAQA 3NTUA 4PC3A 2B7CA 2EYQA 1L4UA 2ZI9A 3U44B 3PEUA 4OKSA 3RRZA 3GPLA 4MRNA 4JBYA 3EZ6A 3EXAA 1QG2A 2RGEA 3R9XA 1Z2CA 3ICEA 1AGRA 4MQBA 2D7DA 2ZE8A 2DWPA 3FHOA 4CZ2A 4BLSA 3KQKA 4RKEA 3VFDA 3BRWD 5KNBA 1OH6A 3CW2A 5E7IA 3CF6R 1IN6A 3RYTC 4C0HA 1K8RA 2WWGA 3K9GA 4L9WA 1J7KA 3FPAA 2BBOA 4QBGB 4PO1A 1X3SA 2GXSA 4GSYA 3T1OA 4D0GA 1N6PA 2QM7A 3NEJA 5K8LA 3AB3A 1R6BX 2B21A 3VKHA 1E2KA 4GMDA 1R0YA 2IYUA 2BMFA 1R10A 4GOXA 4PR0A 3MCAA 4UJ5A 2QSZA 3GJ4A 3OE7A 1UAAA 2ZR0A 1G7CA 4G3XA 2GVZC 2C8VA 2O8BB 3K0AA 1FQKA 2FNAA 3IPYA 1G8YA 4JLJA 4RZ2A 2FU5C 1NVUQ 2GTPA 2Z6VA 3FVQA 1E2JA 3KFVA 2PT5A 1LY1A 4LC0A 3B9QA 3K70B 2VRWA 4F93B 2OAQ1 2A5GA 3NG1A 1S3SA 4M1YA 2GXAA 1E0JA 4A2WA 2ANBA 2VHCA 2OSBA 4UNPA 5JMTA 1JPNA 1VYUA 3PUYA 1R5NA 421PA 1XBTA 4FIDA 4HLQB 4YMSA 5JRZA 1II8A 5BW8A 3B2EA 3Q9LA 4JLPA 4KAXA 4M9ZA 2JIZA 4IDOA 4EFMA 1DO0A 4BFZA 4KITB 4QM7A 1G1MA 3IPXA 3VR1A 1TF5A 4M9SA 4U02A 1TPZA 1RJ9A 1IN5A 4R98A 1GITA 5J4KA 3REGA 2PBRA 2KB0A 2JDID 1P75A 5CLLA 3B1WA 1ZM7A 2NMVA 2RGGA 5JHHB 2XAUA 1IXRC 5BN4A 4JLBA 3T12A 5HPYB 2BJWA 2ATVA 2GCOB 1ZD9A 3C16C 4LZZA 2HYDA 3QE0A 4XSGA 5GADl 1JJ7A 1ZW6A 2DHRA 3NBYC 1Z0FA 1XMIA 2V4ZA 3VQTA 4DHEA 1XB2A 3CRQA 5FPSA 4F4IA 2Z4RA 1U2RA 1W4AA 3RS0A 3ZYCA 4RFVA 2RAPA 4QBFA 3ZQJA 4OHYA 1CJUC 4RZ3A 2D3WA 2XZLA 1P7CA 1FUKA 3AVWA 1JXMA 4LHYA 2HF9A 1ZNYA 1EESA 2CHVA 5ELXA 2F1IA 5AJWA 3VNUA 2VP9A 3C14C 4LYFA 4UQOA 4EFLA 4EFNA 1N5LA 3BB3A 4BZPA 4ZDWA 4I81A 4WIAA 4TYYA 2O8DB 3KXKA 2O0JA 2GAAA 3H86A 1CBUA 3AGPA 3MJRA 2AD1A 4FCWA 1FW6A 1UBGA 1GL9B 4EJSC 3THWA 2WJVA 3CX7A 2DFTA 2ZSFA 1SQ5A 2QBYB 2OESA 4LJ4A 1X1RA 3SHFA 1T3HA 2ZANA 3W6NA 3K09A 2D06A 4TN1A 5LB4A 1NRJB 2R8RA 5EUMA 3A37A 1MO3A 2F43B 5KPJA 5G53C 1I4DD 4WZ6A 2QZ4A 4YDHB 4B48A 1HQYE 3SEAA 1GRQA 1OHHD 3TUIC 621PA 2B6HA 1TX4B 4B74A 3AVUA 5HTKA 3A1SA 1XPOA 3BB1A 3ICQB 1OYWA 1ZM3A 4NYMQ 5DIFA 1Q1BA 3KUDA 1QVAA 1KK2A 4IDHA 2Q0HA 2ZS9A 1X1SA 2JJ1D 1E2GA 2QRZA 1GUAA 4IDPA 1TUEA 3PUWA 5D3QA 4A0GA 4GBMA 2RGXA 3AM1A 3M1IA 3CR7A 2WJIA 1D6JA 1E2PA 2GXQA 5DO9A 3PUZA 4G5GA 4Y0AA 2J3EA 1OFHA 4PHHA 4OJKA 2I3BA 1KJZA 2OT3B 3K53A 5IRCD 5AUQA 3GFPA 3PQCA 1OKKD 3NEYA 2EU8A 1XD9A 2J9RA 5B2ZA 1QHNA 4CGZA 2FSHA 2IYLD 5TY0A 1IBRA 1AK2A 3R9WA 3JZMA 3AVTA 3I5YA 3VKWA 4MUAA 4DSNA 4RY2A 1OT3A 4E22A 4URWR 2VP2A 2VF8A 2ZRJA 4HLUA 3N2EA 1PLJA 2P6RA 4IKEA 2F7SA 2P3SA 3CF2A 3RAPR 1D5CA 2Q9BA 2Q9CA 3A8TA 3L0SA 3TRFA 4BLTA 3GLIB 2PEYA 4ZDJA 2G0TA 2GZAA 2BJVA 4JT2A 5J5CA 4B44A 4B71A 2K5UA 1DAIA 2ORIA 2LWIA 4R2HA 1XFAA 1P4SA 4U7DA 2JEOA 3NH6A 5HE9A 3GLHE 2D2FA 4A4DA 5KTYA 5FTLA 4IDNA 3VTKA 3LY5A 1SVSA 4LI0A 3THWB 2QBYA 4Q1AA 1MO5A 1M74A 2XTMA 1E96A 3QXXA 4H1VA 3U3JA 2VA8A 2W83A 3RS3A 4Q01A 1DAGA 3WNBA 1XZQA 3QEOA 3IO3A 2AK2A 2H1LA 1U8ZA 3MGCA 4G1UC 5DI9A 3HWSA 1I4TD 1KYIA 2O5VA 4LGMA 5K8IA 1QBKC 4JLKA 1PZNA 1W36D 3DOEA 4V03A 4AC9A 4LHVA 1EX7A 3Q5DA 4PQYA 3UATA 3U7HB 2DFKB 1XP8A 2IXFA 3CRRA 3L8YA 4QJ3A 4QXAA 4WOPA 2IYXA 2VHTA 5IT5A 1SVLA 1IXSB 4CEIB 4W5JA 1N2CE 2IHBA 3K0SA 5EZ5A 2PEZA 4BGDA 1IY1A 4QGHA 1NI3A 3UK6A 5LD2B 1E2HA 3GP8A 1E79D 1E2IA 3KJGA 4DKXA 4CEIA 1S8FA 3U4QA 1NBMA 3U2QA 3PEYA 1NLFA 1F48A 3TW8B 3CZPA 1YR8A 1HT2E 3A1WA 2C98A 2WIAA 3KB2A 1XRJA 5A0FA 3T61A 4NCIA 5FFMA 2GILA 4CEHB 4HATA 3D8BA 1ZRHA 1XXHE 1XEWY 1Z8FA 4OI2A 3DZ8A 2JLUA 4A82A 4YXWA 5FPTA 2MMCA 5JS7A 1JBKA 4ASUD 3BIFA 2IBMA 2ZSBA 4AYTA 4RD2A 3IDQA 2YWEA 4FMDB 4US0R 2JA1A 3UANA 4AYXA 1JEDA 5J47A 3P27A 5EXXA 5C1BA 2VHQA 2RGBA 4H9GA 2IUSA 2R62A 4OHWA 1WQ1R 3THXA 1VCOA 3QF4A 4RFSA 4TL7A 1BOFA 2G77B 4Y0VA 2B8TA 2RKOA 3QKTA 4DT1B 1U8YA 1J8YF 4LJ7A 5P21A 4JKYA 3HU1A 1OV4A 3NBZC 4TQ9A 1Z2AA 1YU9A 2W6JA 4HAZA 4G5QA 2R6CA 3AF4A 1QHHB 2JJ1A 121PA 2XX3A 2MSEB 3A1VA 3VU9A 3K8YA 1E6CA 2P5TB 2EFGA 1KMHA 5HZKA 4TYQA 1T6NA 1U0LA 2X2FA 4J0QA 1XD8A 3TVTA 2GKSA 4D2IA 1S1MA 1XTKA 3FHCB 2WM9B 3ZIAA 1K5DA 3NC0C 4QFMA 4LY6A 1Z28A 1SXJB 4YONB 1IQPA 5B30A 1SGWA 3BD9A 3ZS9A 4PSVA 1VIYA 2QT0A 4QNRA 3K0CC 3GEHA 2BV3A 1SVMA 1AN0A 4X8LA 1XMSA 3N5CA 5E7MA 3UIEA 5F3WB 1GM5A 4PO9A 3A1TA 4G5SA 2IEZA 3GD7A 1A82A 2AXPA 3WMEA 2R9VA 5SZIA 2IS6A 4MRRA 5C46F 1WCV1 2JAQA 3I4LA 5M04A 1VHTA 4EIWA 1BO6A 1FUUA 4BE7B 2AKYA 3CNNA 4PXAA 1KAGA 2CHQA 1Z0AA 5DGXA 5GVRA 3FKSD 5C4MA 1N5KA 1OIVA 3Q72A 4PC2A 1N3BA 2PZGA 1JR3A 3WNDA 3IGFA 1JAHA 2A5YB 2OFXA 1YE8A 2ODEA 4Q18A 2BC9A 3ZVMA 2Q3MA 1J8MF 1L2TA 4CDGA 221PA 1EFRD 1DBSA 2UKDA 5JLJA 2GK7A 2RGCA 1OH5A 4BRUA 2ZE6A 1XCPA 2Z43A 1NVWQ 3TUZC 1ZNWA 4F7WA 4IRUB 4JJZA 2ZRCA 2GXUA 3RSOA 3PR1A 1E98A 2A5DA 4FWIB 4L15A 2G9NA 3CWQA 4TZ6A 2ZEJA 2ERYA 2QAGA 5LDDC 2RMKA 4MYUA 3K0CA 1VKJA 4OHZA 4B6EA 3B6EA 2CNWA 3SBEA 3TIFA 1G7SA 4MA4A 4Q1FA 4MKGA 2WKQA 4TLCA 1CS4C 4G01B 5B58C 1GZSA 2PX0A 2PLFA 5CK5A 3ZZTA 3KL4A 3RC3A 2OCPA 4WXRA 2WMNB 3NIBA 4LHXA 4TL6A 5CLQA 4LCBA 3WY9A 1M6NA 3C15C 1KNQA 4DB2A 1G5TA 3VMFA 1Q3HA 2CLCX 3IBGA 2QE7D 4TT3A 2HF8A 3LO5A 2JLRA 4HB3A 4LC1A 3WMFA 3EPJA 2QTVB 1EGAA 4M9XA 3P20A 3I72A 2CVHA 1G8HA 5EUQB 4C0BA 4RCYA 2F3TA 2CK3A 4EKDA 1TUIA 3L0OA 1OIWA 1II9A 4TMTA 4EJSA 2C77A 1IJEA 1KI8A 2CBZA 4HAXA 3AF0A 3QG1A 3X2SA 4TTPA 1DTSA 4KXFB 1JI0A 4I1SA 3RVBA 3M4YA 3MWYW 4MGIR 5G3ZA 2CDNA 2WJGA 2W00A 2GCOA 1EX6A 2C78A 2KBEA 4Q4HA 3U61B 4DCVA 1MO6A 2FFHA 3CUEF 4KI0A 2PLRA 3SBDA 2IF2A 5FUWA 4B75A 2ZYWX 4KLNA 3WRYC 4BLPA 1F5NA 1SKYB 2GF0A 5SZJA 3WYAA 3DKPA 1U9IA 2AX4A 2X19A 3AVQA 4TLEA 4D4KA 4GL2A 2F9MA 4QGGA 3OIWA 4MYCA 2GJSA 4NP6A 3CLVA 4OQMA 1R7RA 1TNDA 1BMFD 4EPWA 2QP9X 3KKPA 4B34A 2GETA 1MR3F 1JQLB 2AN9A 1R0XA 1G8GA 1MOZA 2F1RA 5AK0A 1LB1B 2C04A 2ZRFA 1GIAA 2QAJA 4FMBB 5EE5B 2IEYA 3O8RA 4JLOA 4C9BA 2IS2A 4LJ8A 1G21E 3MAAC 2O8CB 1M7BA 4TYPA 1XEFA 2EFCB 2IXEA 2UZ3A 1T5IA 1UKZA 4IW3B 3AF2A 2ZI4A 4EQ6A 2KSQA 4PZLA 1F2UB 2JGNA 3B85A 2C9YA 3PV0A 3EPLA 1FMJA 4B3BA 2WJYA 4C0QC 1MV5A 4DSUA 1ONBA 1Z6AA 2VHUA 1AM4D 1UEIA 3CRW1 4HUQA 2BM0A 4DUGA 2KI5A 2C03A 5HKKD 2P6NA 3CZQA 1KI2A 1YJ5A 2OZEA 3AQ4A 1X8KA 1SHZA 3OEHA 3OAAD 5F2EA 3AH8A 3EIQA 3K9NA 3WHLA 2CVFA 4TMXA 4MDEA 3P26A 1ANKA 3PIRA 4ON9A 3NHBA 1KSGA 3WBKA 1KK3A 3HP1A 4Q66C 2ZJBA 1NSFA 2GF9A 1NMXA 5HR5A 2HV8A 2J0VA 1G8PA 2CNWD 1VMAA 1YZNA 4K8OA 1N6IA 4YMUA 5L3QA 2OLKA 3MMPA 3EG5A 1N6KA 2CXXA 4Z8YA 2ERXA 5B64A 4GNKA 3W6PA 1S96A 1ODFA 5L3SA 2AFHE 4XOIA 1GILA 3DO6A 4QGFA 5AJVB 2FMXA 1SHKA 2J41A 3EASA 4IEIA 1G3UA 5FTJA 3GLGB 4AD8A 2P0EA 4Q4JA 3L2OB 5F9FA 1Q21A 4BECA 1AIPA 1H8HA 1E79A 2QSYA 2VSXA 2ZSEA 2ZIAA 3Q8XB 3UMRA 4M1MA 3I5XA 4HZIA 2BIFA 3TLXA 2RH5A 1W36C 4KO8A 2ZR7A 1US8B 5CITA 2PCLA 2OBNA 4IOJA 1COWD 5CIWA 1GG2A 1NLZA 4RFSB 2H7VA 2FWRA 3GLIE 1VYVA 1A2BA 5DI3A 1KO5A 1UM8A 3TBKA 3D31A 1TQ2A 4TLDA 3W34A 2W0SA 3QOFA 3TSWA 1E0AA 1TMKA 1QZXA 4MGKR 4OYHA 3SZRA 2YVUA 3UXMA 3QVUA 1CRQA 4Q4LA 4Q7MB 4LX0A 3QXJA 2IK8A 2ODNA 5GJBA 2CL7X 2WOOA 3GLFB 3Q7QA 1UKYA 4YMWA 3W3ZB 4MYTA 1NVXQ 2O8DA 3LRPA 2J7PD 4NH0A 4PC6A 5KHOC 1E69A 1ZYUA 3LW8A 3RRYA 2UVQA 3RS4A 3TUJC 2Q21A 1E2FA 4P4SB 1YRBA 4C7OA 3VR6A 3AVPA 3HPRA 5FUVA 4DLVA 3AF3A 4KBGA 1SVWA 5DISB 3ZS8A 5DI3B 2Z4SA 2ZXUA 1S9DA 1JNYA 2GNOA 3LX5A 1N6LA 3JZAA 4HLUC 1NVVQ 3FHTA 2ZYUX 1E9EA 1R5BA 3FFAA 1ZNZA 1W7AA 1FNMA 1HY3A 1I4LD 2P65A 4URZR 5IK2A 1WP9A 4PO8A 3SYKA 5H68A 2HLDA 2WSMA 4JLDA 1TF7A 5KPDA 4RZXA 2FSFA 1F6BA 1E4YA 4AKHA 2ZRPA 2G3YA 1K6MA 1CR4A 3IKJA 5AWFC 4F4JA 5JI2E 3KXIA 4TYNA 4S2EA 1KZGB 4OI0A 1T5LA 2ZUCA 1IHUA 4DIEA 2J59A 2EFEB 2O52A 2ZJ8A 3FTQA 1Z07A 3GJXC 4JL6A 2BMDA 4QBIA 5C4GB 4B3GA 1JR3D 4UNRA 1XXHB 1M1YE 3I8XA 4JYBA 5JWOA 3AVVA 3GMTA 2EQBA 1BMFA 4LPSA 4C7OB 4B3FX 2CCKA 3B78A 1N5IA 4PHFA 2ONJA 1KIMA 1OXTA 3ONWA 3S1AB 4DCSA 1ZM9A 4WBSA 2A78A 2IYTA 2XXAB 4Q9IA 6Q21A 3SU8A 3AKYA 4C4PA 5BN5A 1CLUA 3QEJA 4IFBA 3RLFA 821PA 2OILA 4DLSA 3BFVA 4D6PA 2W6ID 1VCNA 1B23P 4HUQB 1U90A 3QG5A 3PCRB 5CYOA 5DE3A 3KQUA 4U00A 4G5OA 3VX3A 4ARZA 3ZD6A 3QKSB 4GRAA 1G19A 4TMZA 3V9PA 4P4TA 4IOKA 1NKTA 4C2TA 1XTQA 2KE5A 4B32A 1J2JA 5TMPA 1GKIA 1NY6A 2IYSA 1ZJ6A 4OL0A 5CK4A 4QNMA 3IEVA 2IS1A 3VX4A 1KK0A 3X1XA 3LQQA 2O8BA 1HUQA 2ZRAA 4KBFA 4EDHA 2RGNC 5CM9C 4URUR 1E9FA 3EA0A 4C0SA 4QKQA 3OESA 5IF9A 2W6JD 4RSGA 2NO9A 4DLTA 3Q3JB 4BEJA 1T4GA 4FD2A 3O8BA 5L3SB 2C96A 4IOLA 2JJ8A 4JVSB 4QJ4A 5AJXA 2QGZA 3IEUA 3S1AA 1VG9B 1HQCA 1OE0A 3FMOB 2WV9A 3AP3A 4ZIRB 2WWFA 2PT7A 5BXQC 3QVVA 1YVDA 4OHXA 3U44A 4LPKA 1W0JD 2D7CA 3NKVA 3MSXA 3LXRA 3L82B 5FTNA 5KNDA 5JEDA 1P2SA 3OIUA 4X8HA 2OLJA 2FH5B 3BE4A 4CRWB 2ZS8A 3EIHA 1A5TA 2GWHA 4FXPA 1VCMA 4KSBA 1RRCA 3ADKA 1OH8A 2G1KA 2XJ4A 3SR0A 2FGJA 3RRMA 4CF7A 2ZRIA 4TQAA 2QL6A 1A7JA 2WPDA 4V02A 5TARA 3VU9B 1DELA 1P2UA 5DSZA 2OV2A 2ZRHA 1E2MA 3OHMA 3W6OA 1ELOA 1W5TA 2GJ9A 5JWRA 3QPVA 1ZCBA 3R8CA 4JJKA 4NBSA 5C2JB 2RGNA 1CKEA 3PUXA 1X86B 4Q9JA 5JJLA 2O8CA 2D62A 2F1JA 1RRPA 4JT4A 5H70A 2EW1A 3TAUA 1NN3A 4O3MA 5FBWB 3EARA 1Q20A 3PUVA 4ZV4A 2WSSD 4MKHA 2W58A 5ANRB 1U99A 2FDCA 2FEOA 3RS7A 1Q57A 1Z0DA 2O8FA 3K9HA 2WKRA 3VR4A 4OI1A 1KJYA 3VR3A 3LW7A 1XCGB 1E9BA 4LJYA 3K0FA 2NQ2C 4E03A 2XB2A 1WB9A 4KVGA 3F5FA 4TL9A 4WA7A 4I99A 2IS4A 3RRNA 3UKDA 4LJ5A 4K46A 4A0FA 3KQHA 4OK5A 1LNZA 3DOFA 2ZRKA 1JXOA 2WIBA 3LA6A 4V0OA 5DN6A 3KXLA 4BFUA 1Q1ZA 1DPFA 3EA5A 4IOMA 4KFRA 3SN6A 2NOAA 4DIDA 3KJIA 2WWXA 2D4HA 4BEBA 4JBWA 5JSZB 1Z47A 3BFXA 1WBDA 1VDZA 2X77A 4A2PA 5J4HA 2OFWA 1BKDR 3Q7PA 4H1UA 521PA 2RHDA 1DG3A 2C99A 2A3RA 2QTHA 4TMWA 3OFNA 3FWYA 1FL9A 2ZRBA 2ATXA 4HLCA 5HZHA 2NTYC 4DCNA 4L4UA 2H92A 5D3MA 2BM1A 3OAAA 5DYIA 1UBEA 4EJSB 2WAXA 1KKLA 4HDCA 2QPTA 2GCNA 3GLFE 3ADCA 4Q7LA 3ZLJA 3PEWA 3W9YA 1SXJE 5FL7A
chains in the Genus database with same CATH superfamily
1IZZA 4LYYA 1Z74A 5AVRA 1OPXA 3N0RA 1C4XA 4ZQGA 4FK8A 3WFZA 2G04A 4LZLA 5KOJB 2VHXA 3FMPB 5IHPA 2ADFA 1H8EA 5F98A 5MN6A 3TGLA 3PDJA 3GHHA 1DXYA 1L5VA 4HNHA 1R1DA 3DBRA 1H2XA 3DE7X 2BVNA 3LXXA 3N53A 1VG8A 1J00A 3LDAA 5LBUA 3MCZA 4PS1A 3KYDB 3PGKA 2D5LA 1O54A 2PHZA 3DDZX 4ZK2A 1M5RA 3E8MA 3K73O 5BN3A 3M4JA 3D7MA 3O2SB 1PZHA 1FSPA 4Z0NA 1TTTA 1Y1SA 2YWCA 3DJYA 1FTQA 3GFVA 4HHEA 4MZXA 4B9EA 5KKCA 4DCGA 1H05A 5DF1A 4GUDA 1ADGA 4BFCA 2YCLA 3WP0A 5FPQA 3C98A 5JYBA 1HNXB 4TXLA 1KFEB 4OLBA 1AHHA 3LT0A 5KWSA 4URHA 1PVVA 4Q19A 5H82A 3U3RA 2ORVA 2VZ9A 1J21A 2I55A 4Z0PA 4C88A 3SZUA 3L7DA 3P4YA 4H6VA 2PH5A 4ZODA 5EPOA 1CUVA 4RY8A 2IZ0A 2JIQA 3STUA 1SUFA 1ZMOA 5KU7A 1TAQA 2P9BA 4K05A 1G2OA 4R8LA 1ZIXA 3VKGA 3COSA 3S44A 3KR2A 1IIBA 1TM5E 2GA8A 3P9NA 3GGSA 2PUTA 5JECA 3FYDA 2YRWA 1I4EB 1N8SA 5CT5A 2FK8A 4UAJA 2J67A 1ZOIA 2XF8A 3L7YA 3Q9UA 4LHEA 4UBJA 4B73A 1LGYA 3PS9A 4ZKDA 3C7KA 4PVDA 1ULHA 4NU0A 3I2IA 2Y4OA 2D1RA 5EIHA 2XZPA 4GBED 1MH1A 4LZAA 1FE8A 2ZQ5A 5JCPA 5T7BA 1CRPA 2H0RA 1XF9A 5EXTA 4B81A 4BO7A 1EFHA 1ID8A 1L4MA 4U5XA 4ZHQA 4RENA 4OYRA 1ZNXA 4FI3C 4HBGA 2ZAYA 4NBVA 3VO9A 4ZEXA 5JFGA 3AI7A 5ETJA 2MMGA 3SIPA 1FPMA 1ZVKA 1CQXA 1GPLA 5ALNA 2GN8A 4M1TA 2YNMA 1U0JA 4IV0A 2V65A 3HVJA 4Y9SA 3W2FA 1NBWB 1PR2A 3T35A 3STVA 3EODA 5HFJA 4BNFA 1HE1C 4KYUA 4JJ6A 3UUWA 3VR3D 2EJUA 1WETA 1DOAA 3UHOA 2QE7A 5JS6A 3R6GA 3TM4A 4ATNA 2YC2C 1XVUA 3M6AA 1I1OA 3MPOA 2C0PA 2QRVB 4LOJA 2FJ0A 3DDOA 4N4AA 1VC2A 1T3GA 1SU4A 1ZJJA 2Q5CA 3JX9A 4GP6A 5J59A 2A33A 4J16C 3HK2A 4ZOLA 3SQOA 1CY1A 1T91A 4A6XA 5BWOA 5C5IA 2IW3A 3FJOA 3R3WA 1A9XA 4RORA 2FMHA 5K6AA 1XAIA 3D8TA 4UJ3A 4M8NE 2J5BA 3PHGA 4MR9B 3D6MA 1KDZA 4B6QA 2PUFA 4BNTA 3OD5A 3DLBA 1S1CA 4TT8A 4ABYA 1JN0A 3KYCB 4YO7A 1O6GA 1NYLA 3PUHA 5EJFA 2GJAA 4XEUA 1F3OA 1NY5A 4PSAA 5CYPA 3B60A 1GCIA 2VH2A 1BS9A 4FYHA 4Q15A 1FX1A 2FEPA 3U40A 4B1FA 2SKEA 4AXBA 3UJ7A 1CETA 3WVNA 3SDSA 1RLOA 2MYNA 4REOA 3UG7A 1L8XA 4GC9A 4RK1A 4QG3A 3COVA 1ZH0A 2OM2A 1EG7A 2WDPA 1IMJA 3V4RA 1Q22A 1BFUA 4UVGA 1KHTA 3BFJA 3ZZUA 3FW1A 1WBBA 1UPCA 3GJSA 4H2DA 1JHXA 5ADWA 2W6IA 5EN4A 2VJAA 4EECA 3TOCA 4DDMA 1ZICA 2CXOA 9LDTA 1CFJA 4CE6A 1U8UA 4EGAA 5K0TA 2ADOA 2HQOA 3GRCA 1KGSA 4MSUA 3LUCA 1ESCA 1XMJA 1U2GC 3E3NA 1J0EA 4DW8A 4JLAA 1ABBA 3P0JA 2QJOA 3PP8A 1L1FA 4ZQBA 3TD9A 5JATA 5CJJA 3AV3A 3EVDA 3LDGA 3P0RA 4LBWA 3MJSA 1HDIA 3YASA 2DFLA 1OREA 1QHXA 1Y3DE 2FW0A 2I67A 2O2DA 3EQ7A 4US1R 5JASA 1G42A 1I6LA 3I2JA 4DG8A 4DLZA 1T4CA 2HEGA 4JBLA 1HLGA 2FQXA 1NQAO 4MYHA 4TN5A 3ZWNA 2BGLA 4CYMA 2DUUA 4KGXA 5AUPB 4TYWA 2IELA 1JSXA 2UV8A 1HDYA 4FGLA 4J76A 2NU8B 2FUKA 3UAYA 2NX2A 1CQZA 1HA3A 1GQRA 1NLUA 2TS1A 4J1TA 4N18A 5ALIA 3FYHA 1V5GA 1SCUA 2HRCA 2VDJA 2D2IA 2MDTA 1US8A 3BREA 4FW8A 5EGSA 2ZU6A 5LXTF 3WLEA 3OE1A 1IVSA 2MR6A 2I5PO 3U4DA 1FRZA 2I6XA 3LVRE 3WYEA 1C80A 1OXUA 4Z51A 5EKSA 4HJXA 3WG9A 3SI7A 1A69A 1PJRA 5AVWA 3DOUA 1YZUA 4Q34A 3HS3A 4PN3A 8OHMA 5EWMB 3K70C 2V5AA 1KQGA 3G1UA 3SC2B 1V48A 4HI0E 1I5RA 2NYUA 1JEEA 5H16A 3KEGA 5EQDA 2BJHA 5AK3A 4DILA 2YN2A 4LOIA 4H31A 4OQLA 2QENA 4W5WA 4AY4A 1EVKA 1L6IA 5M29A 2QRGA 3W9BA 2ZJ1A 4QHYA 1ODIA 3DVQX 2X2EA 3HDGA 4XIGS 1KZYC 5AVKA 2EJTA 3AOEA 1JDTA 2C5GA 2FW6A 4ENQA 2IYQA 2GVNA 2QZJA 1DEXA 2ON6A 1U8CB 1W5AA 2WTEA 1IHPA 4JZKA 2PZKA 1C81A 2PYDA 4ZDIA 3A0UA 1HNZB 5TQ2B 4X41A 2BBTA 1ULUA 2G1JA 2VTEA 3CLUD 3OPVA 5HIIA 3RF6A 4XH9B 4AMZA 3H9BA 3T1QA 1EVLA 2FWPA 3GI1A 4L6IA 4OX9Y 4I50F 1QPBA 2G83A 3AEKA 1C9NA 2ZTMA 1RFLA 5E4TA 1EM8A 5LFAA 1VBKA 5JPDA 1BWQA 1EWYA 5ENZA 3QYJA 1RE1A 1MBZA 2OB2A 4O4IA 4N3NA 3VMMA 2ADMA 1PNQA 5GM1A 1F2UA 1KEEA 4XM1A 1QV6A 3CH6A 3C8HA 1XD2B 1SBZA 2F9FA 1K6JA 5A2GA 4OXIA 3NJ8A 4LXUA 3T3MB 3TKLA 5DOZA 1E9CA 4N47A 1OGIA 4E1AA 4LXTA 1FSGA 5CU7A 5AVOA 1YHNA 2ACKA 2YDYA 1DKOA 1PYOA 3F5QA 2YUIA 3G8CA 3K2EA 3LPMA 4CCYA 2V6BA 4F5YA 1UMDA 1WMDA 1RYHA 3HSYA 5D85A 3D6TB 4MWTA 1UIRA 3CPEA 5FOUA 2VPPA 1HC7A 3JQDA 2CLLB 3PVSA 4QVGA 2GNAA 2FVYA 2WZCA 5GPBA 1UJ5A 2N9UA 4DNPA 3M82A 4M1KA 1EGQA 4R51A 3HH8A 2GM9A 4I1UA 3IIIA 5LQJA 2HH9A 1RBQA 1KETA 2H57A 2WU8A 5L3ZA 4NK4A 4DEVA 2NVOA 4LV6A 3AF5A 2X0KA 4I4LA 1NWHA 4KOAA 4MRAA 2EX0A 2EP5A 4PRZA 1O3YA 1PT6A 3WADA 5LKRA 4PHCA 2NVUB 4Z1MD 3J7AC 2IPMA 3GJ7A 3SHOA 3K1AB 1BYIA 3JASA 1BDBA 1MN6A 3MTAA 4QO7A 1RP7A 4FOSA 5KSPA 4Q9AA 2IYYA 3RDPA 5JJ5A 1UEXC 2JCYA 3KDSE 3QM1A 4CVNA 3IL2A 1ZG3A 2A94A 1W0KD 3EPHA 5TPZA 2VP3A 3HDVA 2CZCA 4QTUB 1IZ9A 1LS6A 4XGQA 5MGNA 5EP3A 2DUNA 3WLQA 1D7AA 4GHWA 2FOLA 4F6LA 4QEKA 3H0EA 1K66A 4HPWA 4IIJB 4ONEA 1GOTA 2C59A 4KFUA 1FFXA 2EYUA 2H2DA 5BP7A 1CQPA 3VPCA 1IY8A 2E4XA 2F3SA 3EUEA 3HP7A 5AH0A 4JI4B 2W2MA 1XLTA 1BVHA 4REQB 2G06A 1JA9A 3SEZA 5HZMA 5H83A 2FCAA 2Y77A 2OAP1 1T3LA 3E7PA 1MC8A 4KCGA 1UH5A 5AJYA 4EF6A 3OJ0A 1N2HA 4TT3D 1LRLA 5AXBA 3T7KA 1WB4A 4GFDA 1KXJA 1U1DA 1ZEJA 1PP4A 2VF7A 1VCIA 3EUAA 2IYFA 3GV0A 4IILA 5E0KB 3AL2A 1Z3IX 4KR7A 6AT1A 1CIPA 4QYMA 4ZRDA 4XPIB 2K4MA 3THXA 1WD5A 4MULA 1RC8A 1JL3A 3GRAA 2NV0A 4D82A 3I2HA 3HJAA 3RUEA 1X9HA 2Q4TA 4PCAA 3R7BA 1WF3A 3WZ2A 1PN3A 4PYJA 2SNIE 2HM7A 1OXVA 3NAQA 3FPFA 3DMNA 4NZNA 2V8OA 3KVOA 5C8XA 3NTVA 1P0IA 3TAXA 4MW1A 1WNTA 3BB4A 3GJ6A 4AO6A 1IMOA 4KYIB 1KFCB 3O8QA 4RAQA 2FG5A 2M6RA 3AJRA 2WLTA 1YFKA 1E1CB 1YUNA 2CE2X 3M1AA 4FIZA 4IFEA 4JFAA 4XGRA 4PZYA 5FNVB 1DAPA 5CH5A 5I9IA 4BFYA 4DA4A 1TKRA 2BGGA 3TL2A 2GHRA 3GNLA 3WX0A 2XCIA 3DW1X 3SYMA 3LX8A 3KWFA 2Z9BA 4HB0A 4B35A 4BJHB 2E87A 4CUJA 1QFSA 3PNSA 1AXGA 1B76A 1J42A 1EJ2A 3FDJA 2WWWA 3JTEA 4QAJA 2O19A 1RTKA 3BEDA 4U63A 3RS5A 3OEEA 4YJDA 2NZWA 2O2SA 1XWIA 1TTHA 1IN8A 1AVTA 4TUYF 1MMFB 3RW9A 2WY2D 2P35A 1YZKA 4G1MB 2X9QA 3ZWPA 5EIBC 2Z6QA 2B3DA 5ALDA 2DCUA 4EX7A 3WGIA 3IPRA 3FMGA 1DPGA 1S0UA 3IQEA 3VZSA 4Q39A 4MUIA 5DYYA 1IONA 1WXEA 3H9UA 4LWZA 1M5TA 4A26A 5JBNA 2WWYA 2GLXA 1LFDB 2PPVA 2SHKA 4P38A 4YPVA 2BFWA 2JGRA 4WRRA 1HE3A 2GT1A 5DHSA 5JTUA 4QX6A 1AE1A 4E09A 1RQNA 5EZQA 2ZATA 1FSSA 2QX6A 3UJ8A 2V7QA 5KQSA 2H2FA 5DEOA 3HU2A 3O84A 1YQTA 4YRJA 4L8FA 1X7XB 1RJ9B 1SVOA 2J48A 2WYUA 3S29A 3P4UA 2C2XA 1UXOA 2F67A 3KDAA 3LECA 1X1QA 5E95A 1NXOA 1SAYA 3NVKI 3QJGA 3A9UA 4DRYA 4ACAA 3S2IA 2ETVA 2FR1A 3WTBA 4EW3A 1OFUX 1GZ3A 2WJWA 5G0SA 2BFNA 4IZ6A 4GO1A 3GEEA 2OTCA 2KMLA 1MDFA 2OPHA 5IH7A 4L74A 4OAQA 4ZOAA 4A92A 2G5CA 2QMHA 2XF2A 4RPJA 1OASA 1G5PA 3T3DA 1R9NA 1TXGA 4NMHA 3UHJA 5L7YA 4E33A 2IE8A 1RMQA 5IF3A 4RCVA 4WFQA 4L9AA 1RAEA 3A2LA 2ID7A 3LUJA 1MC1A 4L2IB 4PPNA 2QYTA 4NZOA 3F6EX 3V8QA 1R50A 3G1WA 4WZAE 3AVYA 3PEEA 3TSCA 3OT4A 2RCNA 3WLKX 1HKHA 5BWBA 3KL2A 1CNEA 1MFPA 1XZHA 2B4YA 1OJLA 4GBJA 3WBJA 2JBAA 3WJAA 4ARAA 2R751 4FI3F 4DWOA 1M34B 1PK8A 2V0NA 3PDHA 1OU4A 5FB3A 1UXJA 3BL8A 5DNUA 5EC8A 3G2LA 2VZ8A 2X1HA 3T0GA 3EXHC 2QYHA 5KNLA 2ODBA 2FG6C 2V45A 4GR9A 2DEUA 4ZGBA 4WDQA 1B2LA 3TLJA 5AOCA 4N03A 1E32A 1XZKA 4LXXA 4H16A 4NHEA 3L0PA 3V4LA 4E3WA 5JBIA 1RQGA 1RBZA 1TM3E 1GV0A 1AHIA 2R4TA 2NG1A 4OAOA 4FJ1A 5HKAA 3LBYA 1R8SA 3EVTA 1ZLYA 3DOIA 1J2UA 3UWOA 4DJEC 3N0VA 4JOSA 1E1MA 4RF4A 1LK7A 1W49A 3ECCA 4IVQA 4O4IB 1V11B 2VP5A 4IIUA 4YO8A 1AMOA 2EJVA 2VDLB 1YBMA 1RXVA 3IIEA 5DRYA 1GUDA 5GJVC 3ZDXB 5JEEA 4BGVA 3QXHA 2QROA 2W71A 5AJZA 3AW8A 1OBOA 3G5TA 4GX2A 3UZUA 4AKIA 3OZAA 1VJ0A 1L7MA 2Z58A 3TZ6A 1RWMA 3PXDA 4A10A 5LUBA 4PR3A 4Z7QB 5DN6D 4JR1A 4OG2A 4RVCA 2WIGA 3ZCQA 4RA6B 2G80A 1XQ6A 3H1TA 3K4QA 5DHUA 4NZZA 2QP4A 3DZKA 5B3KA 1T2UA 3PQDA 3Q7RA 1NJSA 2G7ZA 3QQ5A 5HIJA 3DMGA 4V0QA 3U3ZA 1BQ4A 1THTA 2BDUA 2XUZA 2Y0DA 4XB1A 1Z06A 1EDDA 1T2EA 4V38A 2DWOA 4LDRA 4E32A 1G7TA 1AGYA 1SCIA 2C07A 1YZTA 2XB8A 3EIUA 4B40A 2WNSA 4HWPA 4BMZA 5EHZA 2ZJ0A 5BUSA 1Y5NA 1QCYA 1W2WB 3CZ4A 4Q3AA 4EENA 1G41A 2B37A 4BB0A 2WSSA 4ZT2A 3ZHRA 3HYTA 1G5QA 3JS5A 1EUQA 2FRDA 2ZAOA 5EXDA 2EWWA 3R41A 4GD3Q 3TWOA 2C4VA 2Y92A 3LK7A 4R0VA 4D0LB 3R77A 2YS6A 1N6NA 1L7RA 3C3JA 4KUGA 1PW5A 4Q7JB 3TB6A 4DEYA 1XTSA 2E85A 3I04M 2VDWB 3QBDA 5H7XA 5JSYA 3E5HA 4BLRA 3IBYA 1YMVA 1TZ2A 4WOBA 2OY0A 4TXNA 2ZPTX 5C80A 4UCWA 4GSLA 2VF5X 4NL4H 4DPKA 2PSHA 3NS7A 4LYAA 5FO0A 4HXFB 3HUUA 2E7ZA 1E1RA 3OOSA 3UVEA 4ZRMA 5AK6A 4D9BA 3KFXA 2FKAA 4QYTA 1T8SA 3MG9A 5ARBA 1LBTA 1JKJB 1EFVA 1SBQA 1DBQA 2XNJA 2HF2A 3W3AH 5FL7D 4H0FA 3ZKAA 2W6NA 2MSDB 5EJ6A 2LUOA 4LCJA 2HJHA 4GX5A 4ZARA 4EVSA 4RKRA 3ZDQA 2WYWA 3HO6A 4Q7QA 2JI6A 2EGUA 2VQ3A 5DCWA 3SLGA 2OO7A 2QTLA 3CJRA 5CR9A 5C5DA 5SY9A 3EWNA 1J8FA 3A4YA 4YYEA 3EIXA 1IPHA 1LQUA 1ISHA 5DYWA 3B5IA 2O6LA 1CUDA 3CX6A 5A4JA 3BH6A 3S68A 3TMYA 1NHGA 3WLLA 5JYDA 3TW8A 3R0XA 4LOLA 4V0KA 1Z39A 4D4IA 4FE7A 4DCPA 3OHSX 3LPLA 4QGBA 1OIXA 4Z4EA 2J85A 1YOBA 2KWIA 1U2QA 2N42A 2OZKA 3TPFA 3PJEA 1FP7A 1Q74A 5DWQA 4EF5A 4PPQA 3HEBA 4IHJB 1N2IA 5CB6A 2WAOA 3N3BC 5L9AA 3ILXA 2YINC 3CLRD 4PHTA 4PLWA 4DUZB 3SXPA 4EPYA 1Z82A 2X22A 1C9DB 2VJQA 4YMIA 1E62A 2X8JB 3RJTA 1E64A 4IZIA 5ALVA 4FWTA 1IY0A 1MB3A 3ZKWA 3F73A 3S2SA 4K3UA 2RBEA 5FR2A 4Z6KA 5J1SB 1SKMA 4H6WA 5LJLA 3PHLA 3TG2A 1DWPA 4EHNA 5K8JB 4J3NA 4L16A 1KVSA 4PAGA 4PEVA 5IW8A 1N6RA 4UM9B 5FLEX 2PGJA 4F3YA 5CLHA 3SC6A 2E4VA 1NONA 4MWEA 1KVTA 4L8WB 1DO8A 1CUJA 1NUTA 2QRVA 3X1WA 4Q3EA 4DDKA 2WE7A 1P5HA 2JKZA 4IH4A 2B4AA 1F17A 3D3QA 2VCHA 4I66A 1N5MA 2ZJ5A 4X54A 3ZHXA 4HQOA 5C37A 3II6X 4J2TA 3T7TA 2I8AA 3JQ7A 4Q1DA 3TLGA 4TLAA 3KKNA 3LP5A 2R8XA 1P5RA 3M49A 1GWNA 3BF7A 3UXHA 10MHA 1L4YA 1JFLA 3K5WA 2WKWA 4W5NA 5H1YA 4TMVA 4UOQA 4OXXA 4B2YA 4CKBB 4QSHA 1IK6A 3KC2A 2A92A 1XD2A 3A4VA 5AVQA 1R4AA 3MRVA 5CNKA 2Q8PA 2ESRA 3WGHA 2R2GA 1PT5A 2FUG1 3CIOA 5HRCA 1M9NA 3FJYA 4OB6A 3UFBA 5JJBA 2RJ3A 4KQ1A 1KO4A 1TIPA 1V3QE 1CEXA 4MV4A 3LBNA 3IKLA 2VF2A 4R1OA 1PWHA 4MVJE 2JW5A 2FN9A 2Q4BA 3KSRA 3MBOA 5A5GA 1XDGA 3HCCA 4I1PA 4NNJA 1JS1X 3G59A 3OOHA 5A5DA 4DTCA 1W4CA 2G07A 4JYAB 2HMSA 1PFWA 2OYSA 2W48A 1GYRA 3AJ9A 2PX8A 1J23A 1J20A 1Y34E 1SKYE 3GELA 3INNA 4GI7A 4RVFA 3TNFA 3WP1B 4CLRB 4KZPA 1CDOA 2A5FA 2ZUDA 4PLGA 1RRGA 4TV8B 1T9BA 1SB8A 5B2EA 1FF9A 3H99A 2ZJAA 3NT2A 2X5XA 1VSTA 1XTUA 1P29A 1IG0A 2O2XA 1H1TA 1RXIA 2YZGA 4N7BA 4RESA 3VR6D 3IBTA 1PUXA 3SIRA 1MJNA 2PZFA 4LXGA 4LZPA 4EJMA 4EHAA 3RHSA 5FWYA 1XEWX 1NNSA 1CJMA 3WFIA 2JK0A 2REOA 3OBBA 1EDBA 3N9IA 1OFGA 3A1UA 2IHJA 1XMVA 3TINA 2Y1KA 3WJ2A 1YFLA 2FZCA 5ILQA 2HIAA 2HKIA 4U2KA 4BO3A 4F2DA 4DDUA 1M6VB 4K5QA 1Z63A 4MAMA 3LPCA 1FFBA 2CJXA 2C42A 4G26A 3TL3A 1CDDA 1H42A 1RYDA 3WQQA 2ZYTX 4Z54A 4RY9A 2EX4A 2IUUA 2EATA 5A3QA 4HAVA 5BWMA 3SDZA 3A6EA 3SBOA 3QI2A 1UXGA 1DB3A 3TTTA 1BAPA 3WSWA 5CDYA 2ZBGA 3ZVRA 4B7AA 3D3EA 1L3IA 1SC6A 4LRWA 5DWVA 2IU0A 2ZGVA 1KTVA 1V9LA 2JLCA 4N9QA 4L9RA 3RSLA 3VU3A 4EGSA 2XNKA 1RIFA 2GN2A 3FSEA 2ZRLA 1TA4A 3HI6A 3NRJA 4JGIA 4MP8A 3GGOA 4M0MA 1ZKDA 1V6CA 3SEFA 4CV2A 4ZYXA 1D4ZA 1JG2A 2V3CC 1R18A 3KTAA 4JXZA 1WD7A 2VNJA 3N2IA 3PFIA 4FZJA 3PRHA 5KC8A 1YRYE 4X97A 4WUVA 1WTCA 5J3JA 2XIJA 3BQ9A 3V8EA 1P4GA 3D0KA 5F9HA 1IEQA 4Q03A 1HOXA 2A8YA 3GAFA 1KMMA 2C5LA 1WX1A 1N6OA 4FCCA 1TVKA 4D92A 1YGPA 3DDUA 3ITKA 4Q6BA 1RE0A 3U17A 2Q3HA 1I94B 3EQ9A 4DRXA 2UXDB 1N3IA 4IQ0A 3HLKA 3A1FA 4DZRA 1N7GA 4G0OA 3VKUA 4AKEA 1RC0A 4O2RA 2DUJA 3F6YA 4Y7CA 2BP7A 3G0GA 4LBVA 2D3TA 2PZBA 3FMIA 3KZ1E 4HMPA 1LSUA 3DTYA 4PG6A 4DQXA 1F2DA 4ENTA 4ME6A 3AOGA 1FXSA 4RIEA 2FPIA 2D5AA 4Q3KA 4KXUA 5B12A 4B3CA 1M73E 2F8LA 2ODTX 3HB1A 3FTNA 1NXSA 1XXHA 2IY8A 2YICA 4O8ZA 4W63A 5EE1A 5FQOA 1H2WA 1EWRA 1W0KA 2HMAA 1OBVA 2D2VA 4FDAA 3HC7A 2C9CA 1HDCA 1XMXA 2ZJZA 3EG9B 4FMCF 4GM0A 1PG2A 1TL7C 4MW5A 4LS3A 4PCVA 1YZYA 4Y6SA 5JXHA 3DCYA 2FUG6 5EP1A 4NENB 1JAYA 1SIWA 2R3SA 2OD9A 3ZV5A 2YFKA 1D8TA 1QKIA 3MUFA 4BO5A 3ZXSA 1D6MA 2JLWA 1GYPA 4OK3A 1D2EA 3JTMA 4J29A 3X1ZA 1PI3A 4KX3A 3DBHB 2XOXA 1QLHA 5EVJA 1GD1O 3UENA 5E2IA 2PVPA 4RSRA 2XB6A 3HGMA 4WK6A 1Z2NX 4FQ5A 3WB1A 7MHTA 4D9EA 1F4PA 2VLIA 3NHSA 2JGFA 2OK8A 3L4BA 5CJ2A 3O4GA 1MT0A 1R3UA 5ECYA 4ZXPA 1FP6A 2QEQA 1UBLS 3O92A 3ABOB 2ZIEA 1GHTA 1OWNA 7ADHA 3AKEA 4YAFA 4Z9YA 3I6QA 5K7SA 1YC2A 8ABPA 1JI3A 4BYGA 3UUGA 4JFRA 4F11A 1FJXA 4K0RA 1Z13A 4I8XA 5DOVA 4MS1A 3PHCA 3CEHA 4HDQB 5EMNA 3RHZA 4UTXA 4KUHA 4AP5A 4AROA 3O47A 1XRQA 1LTKA 1V96A 1W1IA 2V6IA 2ZBEA 4WEQA 3T38A 3VPGA 1DKNA 3ND9A 2LKDA 4CF4A 1TEZA 4KDFA 1RXYA 3DXFA 4N0DA 1KMHB 4XD7D 2IC5A 4EG6A 4OATA 3HBAA 4PF1A 4XX0A 4I1VA 3SD7A 1XTRA 2DPHA 1D9XA 1C3VA 2P4HX 2BF7A 1QIGA 1KY2A 1T0HB 3TSAA 1YI8A 4KAJA 3S28A 1SZJG 3V34A 1UOPA 4NCKA 2MCFA 2XRZA 1ZJZA 4Q21A 3DWIA 1NL3A 1AHPA 4HNRA 4QD3A 4TMKA 3LKDA 3CSSA 5BW5A 1XI2A 2I4OA 3ETJA 1N34B 4LE1A 3VPBA 2GPNA 3KAQA 4JH0A 4NEQA 2DFNA 2H1FA 2J5KA 2RHMA 3K35A 3LYHA 4GIBA 4UD6A 3I61A 3UKOA 3KKQA 3DWFA 3QQPA 3OCZA 1PLLA 4LDZA 2ZETA 1RYFA 1OMOA 3QUSA 1KDPA 1U2TA 3Q85A 5AO9A 3A0RB 3ML1A 3IRUA 3O21A 3E2PA 3HA7A 2I1LA 2AEJA 2VWHA 2WI8A 1FLNA 4UUQA 1RRKA 3JQEA 2G7MC 1L3BA 2NGRA 1EVQA 2FETA 5JPIA 4YLGA 2VAMA 1MVLA 3EXG2 4AWXA 4JITA 2J31A 3NHWA 5IABA 1A5BB 3R5HA 4KPEC 2GEBA 2J5XA 4IUBS 4C7BA 5IJWA 4ZCMA 1SU8A 1I6MA 1P9OA 1U2GA 3PXAA 4WN3A 2P77A 4DR4B 5I7SA 1Q6YA 2PLNA 3BXGA 3VPHA 2QA5A 4L0DA 1EHYA 2TMKA 2X1MA 1D2RA 2HA4A 3GFRA 1IRIA 2CLEB 4RK4A 3LVBA 2CXTA 1M2VA 2L0XA 2OHOA 1L5NA 1M2WA 4O4LB 5BWCA 2HWKA 5HS6A 3GH3A 1CCWA 4PZUA 2WPNA 1ZCJA 1JJIA 2WBLC 2DFPA 3HYCA 1IEVA 4J7XA 5CP8A 3SE0A 2P6PA 4AZWA 4BMNA 4WK2B 1WLSA 3JYOA 4K87A 5HVNA 4CFZA 4DYHA 2WLSA 1A4RA 2CLFB 2GPBA 2JZOA 2ONCA 1YMUA 2OCAA 1XZLA 4PBSA 2QPOA 1Z6XA 1U02A 1NW7A 4MQ4A 4WESB 5ERXA 3ZGYA 1FA9A 1MB2A 4JOCA 4YAIA 5KU1A 5L6MB 5I9NA 3KWLA 3M34A 4Y0NA 4MCIA 1GNRA 2O48X 4UXIA 4LIPD 4L0QA 2W5UA 5A7GA 3AB8A 4DREA 4ZREA 5BNZA 4QXPA 2WIJA 1G4HA 1NMYA 2O1SA 3KVYA 3RKUA 1G9XA 3ND7A 4G0WA 5K4AA 2BGWA 1Y3CE 1MRZA 4K3VA 4M22A 1EFRA 5H0IA 3SF0A 4N76A 3EDRA 1P44A 3G9ZA 1NJFA 1OFIA 2JHPA 3G0IA 2KQUA 4E5NA 4HGQA 2QQEA 5FH9A 1OB2A 3EVAA 1RZ3A 4K9DA 4MPJA 1VECA 1W8IA 1KI7A 4YRIA 1CUUA 3FCOA 2I1VB 5KOYA 3EMBA 1JAZA 1YS9A 3FDZB 1RKXA 1JECA 2ID9A 5HUHA 2VJBA 1WCIB 2XQJA 1U3VA 3G02A 3SXJA 5DM1A 4TZKA 5AW7A 1U2PA 1ENZA 1I6WA 2JEYA 3O91A 4NYIQ 5AKEA 4J94A 3LUPA 3MOSA 4QULA 3SJ7A 1VKRA 3U4QB 3LH5A 2GZMA 2DAPA 1FLVA 3NV7A 3A3PA 4KQ6A 1UP6A 3NNSA 2O2ZA 4P6VF 5FHRA 1BHO1 3ZWDA 5A62A 3GOHA 4OMDA 4GNRA 2PRJA 3PJGA 5BMOA 1R9JA 2H5LA 3INRA 4QOGA 1VGVA 3TXXA 3BRCA 3LLMA 3GFTA 5K0JA 4XSHA 5G1PA 1ZL0A 1SUIA 1N5JA 1Z22A 2B1IA 3A58B 4KYTA 2I7TA 3I52A 2OD7A 3RYIB 3U7QA 3ZHVA 1UMKA 1G4AE 4U5QA 3WLSA 1EFLA 1ZIPA 4EG0A 4XLLA 2ECOA 2GRJA 3BXXA 3WRVA 1YBFA 2JBWA 4C4AA 5FWNA 3JWIA 1SKQA 2UUPA 1J24A 2VSYA 4QDKA 3GWGA 2WVJA 2CUZA 3Q3HA 5EUCA 1IOVA 4MIKA 1MW9X 1V8ZA 1V1RA 4ZO4A 3RO7A 4QM6A 1QF6A 1XDDA 4PWZA 5G0UA 3Q0TA 3DVAB 2E4UA 3DB1A 4DIOA 1VYTA 4PGAA 5H4HA 4IIHA 4AS3A 5KMGB 2C1XA 2DJIA 3KD2A 1KDTA 1KBOA 4K9OA 1FNNA 4NV3A 2DBRA 4LK2A 1XU9A 4KRFA 1DAFA 1PYDA 2REQA 4EKGA 4WOKA 5KMGA 4KRXA 1FMCA 2TMYA 5EY5B 3DO5A 4Y1FA 1XVLA 2C2GA 1C9JA 5B3LA 3OX1A 3TK1A 4IHQA 1WZEA 3DDHA 1V1RB 1C30B 2H11A 5IS2A 2EG9A 3D1JA 4OLFA 4MVJD 4PLTA 3A6PC 5KYTA 4HEJA 5E2BA 1KP9A 1VI6A 1HFKA 1RJGA 1WO8A 2IU3A 2XYRA 1Q0QA 3IOYA 3BXZA 1CUHA 2ZJ2A 5IN5A 5FUQA 1M83A 4O4LF 3BAFA 1RRMA 3FJ1A 1UPTA 3K4PA 3EWAA 5DM4A 2OZPA 3V7WA 1YE5A 2VTVA 8AT1A 1Z25A 2PR2A 3ESXA 4I36A 1YRAA 3ANLA 3SYRA 3U7QB 4E6EA 5IT0A 1KI6A 1KSFX 2AR9A 2FQ1A 3BZUA 3RVDA 4M88A 3S2GA 4AWBA 5FBVB 5EE9A 2QGNA 1GKYA 4P84A 3PE4A 1QTQA 2R7LA 2NPFA 2A9JA 1Z4IA 2QVXX 1FP4A 2H2AA 2PU7A 2P2LA 2VG8A 2X5OA 3RVLA 2A9KA 2HRRA 1QRRA 3LWNA 3K6KA 1FFCA 3DLAA 4DWJA 5GIOE 4GI1A 5IN4A 2B6NA 1WY5A 1KO7A 1RAHA 4FNGA 5GV8A 1WHSB 1HQKA 1W4BA 4IV5A 2Q62A 3D2AA 3RVNA 2GASA 2FA9A 4WW0A 1S2NA 4RAOA 1AQUA 2EC5A 3AQIA 1H94A 3A4NA 2B82A 1MB0A 3OY7A 1JR3E 4J7AA 2HCJB 2XYGA 2NW6A 3ZIUA 1L8AA 2PWYA 5CB8A 2PRZA 4ECEA 1A7AA 5IASA 1C9YA 1HSZA 2PL5A 1ICEA 4I19A 2HJGA 1G20E 2G9QA 1WSWA 4M46A 1ZDMA 1N7HA 2ZYVX 2D13A 3E82A 4C0WA 4W7IA 1OA1A 1XTZA 5HQTA 2FPOA 1S8NA 1P80A 2NO1A 1PR1A 2X8JA 4JL8A 4JOBA 4V24A 5B4TA 1VMKA 1KEVA 3TEMA 4EYEA 1NFRA 2QE6A 1AMUA 1P73A 1OILA 3MM4A 1EDEA 4ZO7A 1Z5OA 1ZVJA 1AQYA 2HMYB 3NEPX 1PJAA 1MO4A 2C88A 4UEOA 5CA1A 3VHRA 4CCSA 1FDTA 5BQ5A 5D5QA 4OHVA 3QGMA 4OMFG 3D4NA 4A6DA 1B00A 2ACWA 2IXGA 3HJHA 2WTNA 3V5NA 3DLCA 3E84A 2GFQA 4NFSA 3QV2A 1G98A 4MKFA 1HKUA 4MYRA 1HGXA 1E66A 1NASA 5EWLB 3BJRA 5ADUS 2FX5A 4JJEA 1EUYA 1V4VA 2P9EA 4KU4A 4KE8A 1JZSA 2YV1A 1RWXA 3HACA 5LBTA 3P0HA 5JAPA 2DR3A 4LF5B 5B7GA 4EUNA 4UBLA 2ZS7A 4ZHQB 1YJCA 4XR4A 1PZMA 4LA4A 4W6QA 5MFZA 3WJ1A 2WSYB 4MIOA 1A9QA 3VPDA 4I2VA 1X15A 1U3TA 5IJZA 1TD9A 1LRKA 1NMSA 2GO7A 4M53A 2YV4A 1EIZA 4PSKA 4IG4A 2AEMA 4TKZA 1K2VN 4NKRA 5JD3A 3H2BA 4ODIA 3T3EA 3G13A 4B6PA 3BMXA 9ABPA 4KWTA 2BFFA 3TAHA 2ZAIA 3TQTA 4ALJA 3TQQA 4B4OA 3BX1A 3ZOKA 3O8CA 1GA4A 4JS0A 1ZEMA 2XITA 4YRTA 1H2HA 1ULSA 1MXHA 1WVIA 3SQXA 2FN4A 1BA3A 3DOHA 3ESCA 3SE7A 1FNDA 2I6GA 2I71A 1ZESA 2NT4A 2NZJA 1TC2A 2QRNA 4LC9A 3EQZA 1G20A 1OWLA 1RXSA 5E7QA 5ER9A 1LX7A 1A2KC 5DGCA 5F7ZA 3BWCA 3L92A 3MUOA 1G6HA 1QIIA 4ZZ0A 2QKYA 3ZW8A 3UJ3X 2J46A 4U6QA 2RHOA 1NR7A 1KI1A 2HU2A 3EQ8A 4TTTS 3RU2A 5BR7A 4L50A 2FQYA 4C0JA 4U39A 2HA6A 2G70A 3R23A 5FI5A 5DSXA 3QVWA 5BVHB 4ZZIA 1SG6A 5C1PA 4X84A 4AG5A 4F8JA 4EMBA 3WV5A 4FN4A 2XV1A 3CUVA 1CZNA 1YUBA 2XJ9A 4B3HA 3EYWA 1E0KA 2Z09A 1QVRA 5C1IA 5E3JA 3G2NA 4MGZR 4BLQA 1BMTA 2LD4A 2C3OA 1WXXA 3HYRA 4G56A 5J4YA 1Y42X 2EBFX 2IUTA 1F38A 1W47A 4MJ7A 4B6FA 4U4AA 1V3VA 1VCHA 3LOUA 3HY4A 4DIBA 1U5BA 4AG3A 1B7GO 3AFOA 3S8YA 4WKCA 4RADA 2UXCB 3CJQA 5FTKA 1TKAA 2JI7A 3K2QA 2R1ZA 4G1FA 2VDNB 3FBWA 1J9GA 3HCDA 1QP4A 3TSZA 1BH2A 4AZ0A 3E23A 5LP1A 4IVRA 3UOWA 4KQGA 4KQEA 2VUSA 4MB2A 3NTUA 1NJ2A 2B7CA 4J90A 4MUNA 5CA0A 3VTFA 3ZUGA 4GGMX 5E38A 3U44B 3PEUA 3RRZA 1A8QA 3RSQA 1E3DA 4MRNA 2X0EA 3ESBA 4BBAA 4OSOA 3EZ6A 2JFNA 1QG2A 1IBMB 1OUMA 1Z2CA 1P74A 3DR3A 3PYMA 4KGDA 3ICEA 1XYYA 2D7DA 3SZGA 4TWJA 1RZRD 4P80A 2XDQA 1PNRA 4RTSA 4LNUB 4DTIA 4BLSA 3KQKA 4RKEA 2HMVA 3BRWD 4HF7A 5KNBA 1OH6A 2BPOA 1L4NA 1Y5RA 3JRNA 4N5IX 4P1ZA 4JT8A 5E7IA 3FYUC 5EHNA 3LC7O 4MMXB 1IN6A 3Q3GE 1JH9A 4HEQA 1RMYA 3K9GA 3EF3A 3FPAA 3CC8A 2C2OA 3A9WA 1VJRA 4PO1A 4EHLA 3F4LA 2GXSA