4V0NA

Crystal structure of bbs1n in complex with arl6dn, soaked with mercury
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
166
structure length
166
Chain Sequence
SKKVNVLVVGLDNSGKTTIIERLKPRPRQAAEVAPTVGFTVDEVEKGPLTFTVFDMSGAGRYRTLWEQYYREADAVVFVVDSADKLRMVVARDEMEHMLKHSNMRKVPILYFANKKDLPVAMPPVEIAQALGLDDIKDRPWQIVPSNGLTGEGVDKGIDWLAERLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/structural protein
molecule keywords ARF-LIKE SMALL GTPASE
publication title Structural Basis for Membrane Targeting of the Bbsome by Arl6
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
total genus 51
structure length 166
sequence length 166
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2014-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4v0nA00
4EPRA 1XXHB 3NC1C 4HB2A 5D3MB 5CDFA 2ZRLA 5GJWC 3OE7D 2QUZA 2J46A 1OH8A 4KVAA 4C0LA 2X2FA 1UJ2A 2V55B 1KMHB 5EE1A 1GG2A 2VPPA 3A36A 3BS4A 1EG7A 4BLSA 1GSIA 4BZXA 2REXB 3V4RA 5CIQA 3QXXA 2PCLA 1WP9A 3EWAA 4P33A 3A1TA 2XJ4A 3QG5A 4QBIA 3THYB 2JIZD 3U3KA 1R0XA 4WZAE 1KI3A 4Q4LA 1GL6A 1G64A 4FMBB 2CVFA 2JGNA 5K8IA 4W5JA 3P27A 4BRUA 3GLFA 3H2YA 2IYXA 5C4GB 2NG1A 4CGZA 1OH6A 1KI1A 5DHFA 4P4UA 1JXOA 1YR6A 1M2OB 4ZPXA 2JJ1D 1W46A 5FL7D 4EUNA 2A7QA 1J7KA 3MSXA 2W83A 1G20E 2ORVA 5AUOB 1Z0FA 3B78A 3W5JA 5JRJA 2PX0A 4I1SA 2XJ9A 3U44B 4YMVA 6Q21A 3C16C 5JMTA 3FGNA 4Q4AA 4DCVA 4RZUA 1E2QA 1XRJA 2FFHA 3KQNA 2O8DA 1LF5A 2ZJ5A 3BJIC 2JLYA 3NKVA 4HSEA 1FUUA 1KOFA 4GNKA 4XWAA 1U94A 3IIMA 3PG5A 2J5XA 4CT4B 4V0MA 5CDFE 5EZ5A 3KQUA 1YR8A 1VCNA 3VHLB 3K0AB 1PLKA 3VR1A 4QM6A 1Q44A 4Q19A 3GPLA 2CL0X 4HLCA 2N1BA 4KFUA 1N5IA 5F9FA 5J4HA 1SVKA 5DI3B 2YC4C 4R2IA 3CBQA 3D8BA 2QROA 1AS3A 1DO2A 5DGXA 3EAQA 4XWKA 2QPOA 1NLFA 2BBWA 4PPGA 4Q4HA 3WP0A 4RZ3A 4NE2A 4IFBA 5L3SA 3FHTA 1NLZA 2DHRA 3GLFE 4ZDKA 3M6AA 1Z6AA 3FMOB 2ZSFA 2PJRA 2RGCA 2BKUA 2ODNA 3WMFA 3WNDA 2VIIA 1N0UA 4PPQA 5EE0A 5DISB 1P9NA 4RFSB 2Q3FA 2XXAA 3CONA 4X8MA 1I2DA 2YKGA 1KDPA 1JEEA 4GP6A 1TUEA 1TPZA 4L15A 3UMSA 1E9BA 2RGEA 3PIRA 3Q3JB 4C30A 3GP8A 4FCWA 4LBWA 2FG5A 2RGAA 2QRZA 3SBEA 2A30A 2Z4RA 5ANRB 2HYIC 1P72A 2JLXA 1S0UA 2ZYVX 4TMVA 4C0BA 1XXHA 1Y3AA 1MRSA 1PLJA 3IHLA 1RPZA 5D3MA 4V0ME 1ZBDA 2ZRNA 3W8NA 1H8HD 3CX7A 3NBFA 1KMHA 3VNVA 3A4MA 3QEOA 4C2UA 2ZRGA 3RS2A 3DOEA 4LYFA 1NBMA 1P2TA 2GCNA 2H57A 3CPEA 4MA4A 4JS0A 3R9IA 1GAJA 1N3BA 5KU1A 3THYA 1EFRD 3SYLA 4HB0A 2BWJA 4OHVA 1OB2A 4LSGA 4RD1A 3T15A 2V6IA 2D2FA 4LC1A 2PBRA 1FQJA 1W7AA 5SZJA 4DRZA 4MQBA 4W5WA 2J7KA 5BYJA 2IYSA 4HAUA 4RCYA 1T5IA 1NIJA 5JCZA 1EWRA 1XPOA 2QRNA 3B6EA 4AD8A 3DMNA 2VH5R 1JALA 4LYJA 5BYKA 1II0A 2YOGA 2ZSAA 5KSZA 1OHHD 1CKEA 2H5EA 2QE7A 5DHAA 3L0OA 3U44A 1MO5A 3BH7A 3L8YA 2PMKA 1D9ZA 3N2EA 1LY1A 2G6BA 4TN1A 3MD0A 4Q02A 4LJ5A 1NSFA 2V6JA 2ZPTX 1XF9A 1XXHE 1H8EA 5FOVA 3RLFA 1U8AA 4LV5B 4HDQB 4PC7A 4R9UC 1OT3A 2PLRA 1G9XA 2ZAMA 2OXRA 4GMXA 2YHSA 2GCPA 4AY2A 4ZO4A 4ABYA 3K0EA 1P3JA 2RGDA 4S35A 2ZJOA 2GF0A 1KO8A 1NBME 3PUZA 1VYVA 3AVYA 3KTAB 1E2LA 2QZ4A 2ODWA 3EPHA 4NYJR 3KX2A 3VU9B 4FCTA 2P6RA 3LO5A 4NPHA 3QXSA 3ZVLA 1N6LA 4ZCLA 4OHZA 1T8TA 3OAAD 4C0JA 4QJ4A 4CVNA 2HXSA 4DLZA 3UPUA 3QXHA 1JAIA 1W49A 2XZLA 4DXAA 2GBLC 1E69A 2W6JA 4K8OA 4O0MA 4AURA 1HQCA 1WA5A 4DIDA 4PZLA 1DELA 3LNCA 3BBPA 2OG2A 4GBMA 4WXRA 2ZYWX 5DN6D 4O2LA 1G3RA 4LDJA 4RFSA 5B64A 3A1UA 4DSNA 2C95A 2PJZA 2O8CA 4C7OB 2ZUBA 2B92A 1EX7A 3R9XA 1DAMA 2IT1A 3TLXA 3OIUA 1TNDA 4D4MA 3NVAA 4OYHA 5LD2B 2EW1A 3A8TA 4QRHA 3GLIB 1VYTA 1E0JA 3U4QA 2HV8A 2PL3A 3QF4B 2VHQA 2Q9BA 3W6OA 2Q3HA 1KO4A 1A5TA 3IEVA 3F0TA 3BAFA 3I1FA 2C78A 4NTZA 3AGPA 3UXMA 2KBFA 1IM2A 2IHYA 3FHOA 2XOKA 2QSYA 1Q3HA 4P4TA 5FBLB 2ZYTX 2W6ID 4TMTA 2KSQA 4BFYA 5AJXA 4PAQA 2VEDA 3RRMA 2ZI7A 2B8WA 1FP7A 1Z3IX 2FA9A 1TL7C 2GBLA 2HXYA 3DDCA 2BBSA 4M1TA 1XJ0A 2XTZA 1KI2A 3OIVA 1IY1A 1FNNA 4Q48A 3MG9A 4PC6A 4US1R 2ZSEA 2J9RA 4ITRC 1GL9B 1CXZA 1W4RA 2GA8A 2IYTA 3LDAA 4A2WA 3NXSA 3THOA 1U0JA 1UKVY 2BMJA 3EWSA 3KUCA 4HLDA 3DPUA 4KV9A 4LPSA 4DDVA 1KO7A 3RSLA 4BLOA 4W9MC 4TWZA 2WVJA 3AKCA 4EFLA 4V02A 2AXNA 4FN5A 3UANA 1YZGA 4NCHA 5JFGA 2NMVA 5FOWA 2RHDA 1P73A 2XNSA 4JKYA 1KK1A 1QDEA 3K1JA 4DLSA 4EFMA 2HEIA 2JJ2D 1M7GA 1QBKC 3CKLA 4DDTA 3TR0A 3CPHA 2QAGB 3W8RA 2RGNC 4RD6A 4JKIA 4F7WA 2PZFA 4LJ7A 1E1RA 1XTJA 4QG7A 4D82A 1YKSA 3UMRA 5L3RA 4YMTA 2VP5A 3GD7A 1E9RA 1JB1A 2FU5C 2G88A 5LD2C 3TJZA 4CW7A 5JSZB 5CIWA 3EIHA 1D2EA 2MMGA 1XPRA 2AX4A 1KZGB 1FUKA 4A36A 1TTTA 4QGHA 5AJVB 1R0ZA 1XP8A 3LXXA 3KQLA 3NWJA 2OFOA 2YINC 3CF2A 3SYNA 3ZVNA 1NVUQ 1JECA 3DM5A 1DPFA 1NMYA 1W44A 1W5SA 2GCOB 2ZETA 3CIOA 4KYIB 3PITA 3T1VA 4EIWA 4BGDA 2WSSD 3K70B 3IIKA 4LV8B 5BXQC 3OEED 2AFIE 1E4YA 4I1UA 4IOKA 2ZRCA 2GK7A 1FTSA 4QHYA 1E3MA 3NEJA 4B34A 3TUZC 2X77A 3AVPA 3GJ5A 4Q9LA 1KTVA 2VP2A 1HY3A 2UZIR 3TRFA 4DLYA 2H18A 2CCJA 2OCPA 3CX6A 5GVSA 1UDWA 3AVTA 1IONA 5FL3A 2G3YA 3NH9A 3WRYC 3IQXA 4L4UA 4LGMA 4DWJA 2WJYA 3QVUA 3BOSA 3QF4A 4LOAA 4HDCA 4DSUA 3QJYA 2XX3A 3B13B 1QHHB 1ZNWA 1PLLA 3T1TA 2OCYC 1M8PA 4Z8YA 5EXTA 1ESNA 2AFHE 3BB1A 2QAGC 4M1OA 3VFDA 2QNRA 4LC0A 3Q9LA 5FPTA 3I61A 2CLDX 3AVOA 5JRZA 1KO5A 1S96A 2OM2A 3P1JA 3PEWA 3PFIA 3CM0A 2YWHA 2FFAA 3FKSD 1NN3A 3Q7QA 4NU0A 3HYTA 1DS6A 4JLOA 3DO6A 5J47A 1JAHA 3CRQA 1E9EA 4NH0A 4HB3A 3P26A 5CK5A 1E4VA 2FZLA 2EYUA 2QTFA 3B2EA 2R9VA 4MKGA 3U6KA 5AUQA 4LK2A 1N6RA 2WMOB 3S1AB 3FFAA 1R0WA 2GEDA 4RD3A 1PUIA 4HAXA 3K70C 1KIMA 3IQWA 4X8OA 2VRWA 1MV5A 2KE5A 2A9KA 4F93B 2XTNA 1JNYA 2ZR0A 2ZUDA 2CHQA 2QP9X 3SFVA 3QBTA 4Q5IA 4TLEA 2XGJA 2WWIA 3BB3A 2OAP1 1UPTA 2OILA 4JL6A 5AUNB 5HR5A 4URUR 4G5SA 4NL4H 4C3ZA 2J41A 2AK3A 2OO7A 1YVDA 1E79D 1HEIA 5HZKA 1A2KC 5JI2E 2BJWA 5JSZA 2VP0A 1M1YE 3AGQA 5KSOA 1ZAKA 3NH6A 1LFDB 4OQMA 2BMFA 1YZLA 1I2MA 4AKEA 1MO4A 1M7BA 1FOEB 4M1YA 5CB6A 3J81k 1OXVA 2F43B 1IHUA 1KMQA 3IO5A 3PUYA 1NL3A 4K81B 4M0LA 3PXGA 4LZZA 5IK2A 3SOPA 3VTKA 3LFUA 1KI6A 3BC1A 5EXSA 4A1FA 4ESHA 5EXXA 3WMEA 5JS7A 3SS8A 4JLBA 2IXFA 1US8B 2W58A 2VA8A 3AP1A 4JVNA 1PVOA 2ZS8A 2WBLC 2ZJBA 3HWSA 1W5TA 4IOJA 1TU3A 3HPRA 5G41A 2NZ8A 2EU8A 3THWA 1D2NA 2GZHA 4IXNA 5EXPA 4WIAA 4UNNA 1NVVQ 1UBCA 5TV2A 1LF0A 4AKIA 1ETUA 2BVNA 4EPYA 3TUJC 5EUMA 4XJXA 3KFVA 3CPJB 1O3YA 2HF9A 3X1WA 4KI0A 5J5CA 1IOZA 1CRPA 2QM8A 3DOFA 1OH5A 4GSYA 1N6KA 5KHOC 3EIEA 3UMFA 5HZHA 3D7MA 3ZD7A 1GL7A 3C5HA 1E2GA 1QHHA 4MYHA 1BMFD 3GFOA 4DB2A 2ZRJA 1BYIA 4G01B 1J8YF 4YDSA 1Y63A 2ZI3A 4KJZA 1HV8A 1GFIA 1NRJB 3FMPB 2GJSA 4LYAA 1EESA 2VP9A 1ZM2A 1GIAA 1AGRA 2DYKA 1OFUX 5H1YA 3WYGA 5CLQA 3NBZC 2HUPA 5FPKA 2GJ8A 2DFLA 2J1LA 1W48A 4G3XA 2ORIA 2H8KA 2GNOA 1SKYB 1E1QA 2IXGA 2JASA 3FTQA 4BEBA 3DZDA 4AG6A 1N6NA 4WW0A 1KYIA 3GEIA 1UKYA 3Q72A 1J8MF 2REBA 1U0LA 2HT6A 2W2TA 1CJUC 2ZRIA 4CDGA 3AKEA 1KI4A 1ZNZA 2EWWA 4OQLA 2R2AA 4C0KA 2FPKA 1S9DA 3RDPA 4URXR 1OW3B 5GJBA 4TSFA 3W34A 3T34A 3MAAC 1GITA 2NTYC 4ON9A 1T91A 4YONB 4NCKA 1SVSA 3LW7A 4C2TA 4P32A 1VIYA 1G4UR 1N25A 2J0VA 3RRZA 2C04A 1E2JA 2Q6TA 4O25A 1XD8A 2H16A 1XFAA 3GMTA 3JZMA 2F9MA 2XTMA 3IUYA 2O8BB 4RY2A 1OJLA 2C77A 4V0KA 3CRMA 2ZJ8A 1ELOA 1VCIA 3CB4A 1BYUA 1U9IC 2ZYUX 2FMXA 3LQQA 3ASZA 4KFTA 4V0OA 1QVAA 1TF7A 3HU1A 2CK3A 4GPTA 2F43A 2RB4A 3CF0A 1HE1C 2KBEA 3B1ZA 1ZD1A 3QKRB 1TUIA 1P2VA 1G17A 3UG7A 2G0NA 1DAKA 1US8A 2DCUA 3ZYCA 4B2LA 4TMKA 2OFXA 3QE0A 3U7HB 1LW7A 4HDOB 5ELXA 3K8YA 3GLHA 1JXMA 1K5GA 4R7ZA 4V0LA 5C18A 1GTVA 2C96A 1Q12A 4BASA 5C2JB 3EIQA 2GK6A 3NIBA 4B2PA 4A15A 5FFMA 2OHFA 4Q7MB 1IY0A 3AUXA 1XDBA 3PUVA 3L0SA 2CNWA 3KUDA 4JT4A 4IW3B 4OQNA 4LCBA 3KJEA 4OQXA 3THXA 2WAYA 2WKRA 1UBGA 1U9IA 2Q9AA 2VSFA 3ETLA 4M9XA 5CJ2A 1AS2A 2QT0A 1DAFA 4DB4A 1VECA 2NZJA 2ONKA 1IJFA 4MKFA 1P61B 3NEYA 2HCJB 3RNLA 4IRUB 2P3SA 3CW2A 1NNEA 3I92A 4ESVA 3VKGA 2HYDA 1XJCA 2VHTA 4CT5A 2QA5A 1T3HA 3MLEA 4I81A 1N5KA 2ZE5A 5E4FA 1QVRA 1KDTA 4QJ5A 1RE0A 4NYIQ 1GKYA 2W0MA 4A8JB 4TLAA 2XITA 3KDSE 3NTUA 1BKDR 3ICEA 4DLUA 2YV5A 1J2JA 4WZBE 3SC3A 3QKTA 5EZ6B 2XAUA 3U3JA 3C41J 5JZVA 5IDVA 2RH5A 3GLHE 4ACBA 4TT3D 4FWTA 3KB1A 1OIWA 2X2EA 1LVGA 4Q1EA 5B2ZA 2R62A 2P6UA 1IN6A 2XNDD 1U98A 4L5BA 2BM1A 2D62A 421PA 2WMNB 4NYMR 4E07A 2ZVPX 5HKKA 4QNRA 2AXPA 1E0KA 4LBZA 2DFTA 3VR2A 3LD9A 2C2HA 4RZ2A 1G8FA 2GZDA 1ZMXA 4Y0VA 1YRBA 4OHWA 1T8UA 4BLQA 4Q4JA 3ZLJA 5P21A 4BFXA 2YOFA 5EP2A 4P4SB 1JI0A 2YC2C 5FI1B 4L9SA 1BOFA 4MRRA 1KDRA 1AJEA 2C9YA 5J4KA 1RRFA 1W2HA 4FW9A 1NJGA 2VP4A 3QKRA 4EPXA 2OZEA 3VKHA 1IBRA 3QXCA 3AF3A 2AN9A 3IPYA 3CZQA 3HR8A 1OKKA 3H4MA 4XD7A 3QF7A 2VL7A 4AG5A 4LJ9A 4PTLA 621PA 3SU8A 4UXHA 1YJ5A 3TQFA 1WB9A 4A8JC 1Z08A 1EK0A 4DLXA 4BLPA 1P2SA 2BC9A 2FH5B 2QI9C 1DARA 3ADKA 2C9OA 3EZ2A 3OZXA 4Z1MA 5DNYB 3TBKA 5EE5B 4E03A 3QPUA 3M0EA 3UK6A 4BUJA 3AVQA 4TL8A 1J70A 2IYQA 3BWDD 4L8GA 3DZ8A 3T5DA 1X8KA 1X8JA 2BM0A 4DLVA 2CCKA 4MYUA 4BLTA 4LJ6A 4G5GA 4BRWA 2OBMA 4KLNA 3BERA 3SI7A 1GKIA 1KI8A 2IUUA 1NMZA 3JVUA 4BWYA 1E9SA 1OIXA 4MUBA 3NC0C 4PQFA 2GILA 1ZUIA 3VR4A 2A5JA 3BB4A 4IXMA 1TAGA 2DFKB 221PA 2IYUA 1R7RA 2WHXA 3SEAA 3RC8A 2R65A 4ACAA 2I1VB 2N42A 3BH0A 4A8JA 3ZIAA 2X8AA 3RAPR 2QBYA 1E2KA 2IUSA 4C0QC 5KYKA 1U0HC 1SXJB 3EC2A 2AWOA 2IYZA 5DH9A 5FPYA 1XMIA 4JL5A 2Q0HA 3WBJA 4A0HA 4CEIB 2QT1A 2O5VA 1A4RA 1SHKA 1W36D 5FUXA 1WCV1 5IHPA 2H17A 5FOTA 4IVPA 2ZEJA 4RZXA 3CLVA 2ZITA 4KCGA 5EUQB 2P0EA 3ZZUA 1FW6A 1JR3A 3IIJA 1DO0A 3AVWA 3IKJA 3CRRA 3ZGXA 4D0LB 4TL9A 2C8VA 1KJYA 2NPFA 2C9CA 2ZUCA 4HEJA 4N0DA 5JWRA 3LBIA 4FMDB 2P65A 3MFYA 4U00A 2D74A 2VF8A 1HE8B 2ANCA 1OLOA 2ZRDA 4KBFA 1ZINA 1W0JA 4JLPA 1XB2A 4P4SA 3A6PC 3B5JA 4ZIRB 1XCGB 3OFND 3RS3A 2JLVA 2XSZA 2ORWA 1CF4A 4MKHA 2JLRA 1Z6TA 3RSOA 2WWXA 1XU4A 2IXEA 4LY6A 3V9PA 1II9A 1E2NA 2FSGA 3TNFA 2BBTA 1NBMD 3HJNA 3C5CA 3U3RA 1X1SA 1E2HA 1V43A 4V03A 1R10A 1L2TA 1UM8A 2CLCX 3AVUA 5E7MA 5CLLA 1K8RA 1KKMA 3AF4A 4LUCA 1TEVA 4BFWA 3LLMA 4F92B 4LBVA 3U6BA 1MRNA 1NKSA 1G6HA 1I4DD 2FSFA 2V8OA 5G3ZA 1E0SA 1SXJC 2P6NA 1T0HB 3OESA 5FUVA 5JBQA 1Z0AA 3DEFA 1L7VC 4ZCMA 1JR3E 3SDZA 1N0VC 1UBFA 4BFTA 5GADl 1E32A 4RVCA 4B74A 2DY1A 4D6PA 5DYIA 2DPXA 1L4UA 2G0TA 2JEOA 1MT0A 4W7SA 1EFRA 5FTNA 3EX7C 2QE7D 4MDEA 1XEXB 2PT5A 4HAVA 4BE7B 4GDFA 3T5GA 4L16A 4GRAA 5CJPA 3KL4A 1AZTA 1F48A 1NLYA 1ZM7A 4DEXA 2QMHA 3SFZA 3ADCA 4KITB 5E95A 3GJXC 4LHZA 4IDPA 3CR8A 4HYYA 4M2LA 4B43A 4YQFA 1H8ED 3N70A 5TMPA 5FPHA 3K0AA 5D3QA 4EJSB 4O2RA 1G8PA 4MRPA 5IT5A 3ADDA 5DE3A 3QVVA 1C9KA 2AKYA 5G3YA 1GVNB 4JLVA 5DI3A 4S2EA 1TU4A 1SXJA 3WY9A 3AF1A 2VHCA 4NHOA 1SKQA 3I72A 4CEIA 2VHJA 4Q01A 1XZPA 4KVGA 4WZ6A 4TQAA 3LX5A 2WWFA 1E94E 2CDNA 1WXQA 3N2IA 4OI1A 1F5NA 2FF7A 5AJZA 1VPLA 3KJIA 3N5CA 2NO7A 4EFNA 2FSHA 4NCIA 1T0JB 1FZQA 1KO1A 3SBDA 1R5OA 2ZRPA 3VX3A 2A5DA 4GI7A 2ECKA 1EFHA 4JBWA 4OHXA 1FNMA 3CNNA 4RCZA 1QHXA 1XEWY 1HT1E 1Z83A 3IEUA 3GJ4A 1M34E 5G40A 1SVMA 1COWA 4BECA 3TSZA 1GZSA 1G3IA 2IEZA 1AN0A 3V00A 2ATVA 1U99A 3K9HA 4QM7A 2O52A 1J99A 2R44A 2V7QA 2OEPA 4RSGA 1S3GA 3G5UA 1WBBA 4ZIRA 1IQPA 2ZSDA 3OEHD 3ONWA 5DN6A 1G8GA 4F91B 4QXAA 1QRAA 1W1WA 1G41A 3AKYA 3WYAA 2IX3A 1ZNYA 1XD2B 3SE0A 4P31A 4A9AA 2RMKA 4CYMA 1R4AA 1U90A 4E22A 4B3FX 5JEEA 2OT3B 3Q5DA 4A2PA 2XOKD 1SXJE 2BCGY 3SHWA 3VQTA 1Z0KA 1LS6A 3O8RA 2AHOA 3LW8A 4ZKEA 3SJBA 1Z0JA 1KHTA 2VQSA 3JVVA 2GVZC 2BCJQ 4RD0A 1R6BX 1W4AA 3ZZTA 5SZIA 4F4JA 1F2UB 1XWIA 2WPDA 2GDJA 1C4OA 2DBYA 2FWRA 1XTIA 2HF8A 4ERNA 1RC8A 1Q3TA 1VHTA 1CU1A 1RIFA 1NY6A 3EARA 2W6IA 2EQBA 3AVXA 3AKDA 4XOIA 3EXAA 3LX8A 1QF9A 1Z07A 2CL7X 1XNJA 2IYYA 3MWLA 1KSHA 4TMWA 5TB5A 1XEXA 4LI0A 2MMCA 1JEDA 1M7HA 3RHFA 2ZU6A 5JWHA 1GP2A 3U61B 2L0XA 1YR7A 4AKGA 1GRNA 5K8LA 1OXSC 4TLBA 3W5IA 3FMFA 3T06B 1ZW6A 1FTNA 2VO1A 3VMFA 5BWMA 1R8SA 1E1RD 1MH1A 3E1SA 2F9LA 4B3GA 3C8UA 4CEHB 4QBFA 3TR5A 2HDNB 4U02A 4AI6A 5JEDA 1GUAA 2IWHA 1KZ7B 2GRJA 1GRQA 2YYZA 3D6TB 5J40A 2LKCA 2GZAA 4RKFA 5BN4A 2AL7A 2ZE7A 1DAIA 3KTAA 3T1OA 4MITA 5FTLA 2ZJYA 2QP4A 5KPJA 3VU9A 2VYFA 4TQ9A 2C03A 1G7SA 2QGZA 2ZAOA 4D2IA 4ZDIA 3IDQA 2WKQA 2JLSA 1ZVQA 2OV2A 5F9HA 1FL9A 2GKSA 2H1LA 1CR4A 2WOJA 3RC3A 2ZU0C 2C98A 2WWHA 4Y0AA 2VSOA 3P4YA 5JWOA 1CR1A 2RGNA 3MGCA 4EDHA 3IHWA 3QKUA 1S1MA 3WRXC 5JLJA 3EPJA 4C7OA 1Q21A 1FQKA 4PHHA 1N6OA 3GFPA 3HU2A 5FTJA 2CBZA 5H70A 4B76A 2ZM5A 5HPYB 1NG1A 4JYBA 1WE2A 2V3CC 5FPSA 2Z5FA 1A82A 4G5RA 5HE9A 3GLIA 2EVWX 1KJZA 2DWQA 1WDTA 2IYWA 2FSIA 3FPAA 3EA0A 3CZPA 2ZRAA 2CL6X 3CNLA 3ZVRA 2F3RA 2D7DA 4YMWA 4YXWA 5KUTA 3Q5EA 4TYWA 3KXLA 2F3TA 1RRGA 2P5SA 2D06A 1SVOA 4DHEA 3TGPA 2ODBA 1ZM9A 3AF2A 5GJCA 2J0QA 2FX3A 1E2MA 3W6PA 3MWYW 4IEEA 4IDHA 2R6AA 2IK8A 4LHWA 5TARA 3AM1A 1EFUA 3W3AA 1Z6XA 1ZC4A 3UATA 4C4PA 2UVQA 2EFEB 1ZYUA 2G1JA 5EE9A 1X1RA 1AQYA 1F2UA 4AIIA 1RZ3A 4LRWA 3KQKA 2NO9A 1Z6GA 2GJKA 3TUIC 1VHLA 2CHVA 4DDUA 5B58C 3TMKA 5TVKA 2YWEA 1GM5A 1CTQA 3BD9A 4HATA 1GNPA 1ZU4A 4UNSA 1O87A 1VYUA 2FV8A 3UG6A 2A78A 1EWQA 3L2OB 4OK5A 3I73A 3QOFA 3GJ7A 1G18A 2FEMA 1II8B 2Z0MA 3GLIE 4D4LA 2QAGA 4TLDA 2Y8EA 1G8YA 3SYKA 3BFVA 3BXZA 1JJ7A 2IS2A 2WM9B 4M22A 4JLDA 2QP3A 4URYR 4CEHA 2QSZA 1TADA 2ASEA 4PANA 3HPQA 4LHXA 8OHMA 4CF7A 3HU3A 2VTKA 4PZYA 2ZR9A 3LAWA 4FMCB 2Z4SA 1UF9A 3VR5A 3GLGB 3TKLA 1Z8FA 2XB4A 2ZJZA 4DZZA 5C46F 3IO3A 2HLDA 3ZDQA 1UDXA 4POAA 4Q7JB 3FYHA 4I1VA 4JSTA 1GKUB 1DAGA 4E09A 2FOLA 1CRQA 1XEFA 1ZIOA 3U7EB 1G19A 4IEIA 1U81A 2GCOA 1ZNXA 5IK2D 3AVVA 4A82A 3LXRA 3TAHA 4B3BA 5KNDA 4OK3A 3SHFA 3PEUA 4ZDJA 2G9NA 1TMKA 1KK0A 3R20A 1DVRA 3CRVA 4PX9A 2JLWA 4JLKA 1OE0A 2JDIA 4MGZR 4PHGA 2F1HA 3QKSB 3PUXA 1WF3A 4OBEA 1XD9A 4PC1A 2GF9A 4HUTA 3RWOA 4LPKA 3RS7A 4KLZA 1DG1G 3K0FB 3T35A 1L4YA 2JA1A 1T4GA 4GFDA 3EC1A 2LWIA 1IJEA 4GZLA 4MRVA 1P6XA 1FPMA 4K46A 4YLGA 2GTPA 3UWOA 3P32A 1N5JA 4NDZA 2FFQA 1H65A 3I5YA 1OH7A 5FBWB 2ZE6A 2K5UA 1G7TA 1EXMA 2HCBA 3UKDA 4XWOA 1N6HA 3GJ6A 3HDTA 3WHKA 3QEJA 1OPXA 3OHMA 2B8TA 4MGIR 2PH1A 4E5UA 3AP3A 3D31A 2QMEA 1E9CA 1EFTA 1DAHA 1FMLA 3OIWA 4KBGA 2HJVA 2BBOA 3CUEF 4B44A 4CIDA 1PJRA 1W0KD 1ODFA 4PPNA 1MO6A 2ZI4A 2CXXA 2IF2A 4R2HA 4ASUA 4PSAA 5AR1A 2JLQA 3RVBA 3O47A 1J90A 4TTQA 1OFTA 2CEAA 3Q85A 1AK2A 1UBEA 1NI3A 1S4QA 4C0AC 1S9HA 4DCUA 3TW8B 3S1AA 1S3SA 1F6BA 3U3MA 4KFSA 4ARZB 4BEJA 5EE3A 5BN5A 1B23P 1II8A 3B8HA 1E2IA 2EFCB 1IXZA 3EZ6A 4KSCA 3FFBA 4TSFD 1Q1EA 1SVIA 1RYHA 4FMDF 1R5NA 4BFZA 4LWZA 3RS5A 1PUJA 5A5GA 3GQBA 4FI3C 2WKPA 1C1YA 4HAYA 1MKYA 2QY9A 5HE8A 1G7CA 2IWRA 1YU9A 2GEVA 4IDNA 5CM9C 2DWOA 2GXSA 4DJTA 2BV3A 4MH0R 1Q22A 3TW4A 3VAAA 5LB2A 1JQJC 2EWVA 3RWMB 3GLGA 3QUSA 1T9HA 4EPTA 4HAZA 4UNQA 2IS6A 3A1SA 4PZZA 4Z51A 2QMOA 5TDHA 2QPAA 1NP6A 4PO1A 4BQSA 3HR7A 2QQ0A 4NONA 4A92A 2ZRFA 4JL8A 521PA 3V4FA 1UFQA 4UJ5A 5GJVC 1WBDA 1TF5A 2NIPA 2QEQA 4P3YA 4MDFA 4JBXA 4NCJA 1ZJ6A 2OCBA 5G53C 2O8EB 3DKVA 2CMKA 4L9WA 1FMJA 4M1SA 5SZKB 4LJ8A 1G3UA 1Z2AA 3QKSA 3ZH9B 5EJEA 4HI0E 1E9FA 2R8RA 3P20A 2DWPA 5DYGA 1FX0B 3EG5A 4JLNA 2O0JA 3KKQA 1NN1A 3K0FA 4FD2A 1LB1B 5DIFA 2CNWD 1LV7A 2Z6VA 1KNQA 5SZHB 2BDTA 3AH8A 1YZQA 3GCGA 3QY0A 4DUGA 1R8QA 1HYQA 3KKMA 4HZIA 1GWNA 2IS1A 2Q3MA 2MSEB 3NBYC 2NOAA 4D0GA 4DCNA 3GLFB 1QG4A 1G21E 1OIVA 3EW9A 4IVRA 5B30A 3GLGE 3ZVMA 4PHFA 3U3OA 1CR2A 1QHGA 3A4NA 2VLIA 3KXIA 2QPTA 4PPFA 4MYTA 2WSMA 3ND9A 5IF9A 1CJTC 2BKEA 4URVR 2UZ3A 5L3QB 1XEWX 4EPWA 2ZS9A 3PEYA 3ZZ0A 1PV4A 3F3YA 4GL2A 2X19A 3CWZA 4OJKA 2J7PD 4RD4A 1UKZA 1BS1A 1XTQA 4JVSB 2IUTA 4B47A 4BFSA 3JZAA 3D3QA 2B6HA 2JAQA 5L8VA 4JLAA 1ONBA 1RRPA 1DADA 4ARZA 2BEKA 3BGWA 2GXUA 1N6IA 2YOHA 5KSPA 2BMDA 2VBCA 4A0FA 3U7FB 4AYXA 5M04A 1ZCBA 2SHKA 4Z8XA 3TK1A 3W6NA 1XTKA 5KOYA 121PA 2GETA 4U5XA 4IVQA 4A0RA 3L0PA 2ZXUA 2Q21A 5HKKD 1KY2A 3Q7PA 4O3MA 1XTSA 5CITA 3W3ZB 3L82B 1A7JA 1GOTA 1KAGA 4TT3A 3P4XA 1OFIA 2WWGA 1A2BA 1W36B 4QJ3A 3R9WA 1PZNA 3I3SR 2ZR7A 5L3SB 2UKDA 4LX0A 2RHMA 3REFA 2O8BA 4B6FA 5FUYA 2XNDA 5F2EA 4NYJQ 2IC5A 1W4BA 2WV9A 5EP1A 3G0HA 1ZUNB 1Q57A 5H68A 4JLJA 5HTKA 4GOJA 2FDCA 2IA5A 3K9GA 2ZRHA 2XXAB 5AJWA 4GP7A 5FR2A 2OLJA 721PA 1U2RA 1W47A 1KSGA 3DKPA 1YQTA 3EZ9A 1G5TA 3DVLA 3ZS9A 5JECA 1Z06A 1AS0A 1OKKD 1SKYE 3PEVA 2RGXA 4JJKA 4XD7D 4BZPA 1GRRA 2TMKA 5AWFC 2XB2A 4M9SA 1ZUHA 2ERYA 1NF3A 5FOUA 1IY2A 2ZANA 5E7IA 4XTCS 3OE7A 1D8TA 2GAOA 4HB4A 3C15C 3VX4A 1CR0A 4Z1MD 1M74A 2YZ2A 1G4AE 4B73A 1FX0A 3ND8A 5J4VA 3PVSA 2AWNA 4M1KA 4FIDA 3L43A 3LBNA 4OI0A 4G0NA 4H1UA 1ZRHA 3A37A 1P4SA 1QG2A 2D4HA 3BORA 4FCVA 2JIZA 4IDOA 1SQ5A 3K9NA 3IGFA 2LCFA 3PR1A 3IILA 3TE6A 1AZSC 3RS4A 1HTWA 1UEJA 4RFVA 4XH9B 3BH6A 1E2FA 1XMSA 1F60A 2JJ1A 5FL7A 1YR9A 1S1CA 2AD1A 2BIFA 5KDLA 4PXAA 5LPNA 5EP3A 1W36C 4ZCIA 3FE2A 4JSYA 1WMSA 2RAPA 2J0UB 2GHIA 3ZIAD 5L3QA 3FVQA 2LKDA 4M4SA 1LS1A 4MUAA 4XSHA 5FTKA 3BK7A 4IDQA 3L0IB 4WA7A 4Q9IA 1CP2A 4DLWA 2J59A 2CHGA 2P67A 3BIFA 4Q9KA 4G5OA 2WWWA 4UJ3A 5DI9A 5E3HA 3KQHA 1UKEA 2JCSA 4KXFB 1MOZA 4TQUS 4YMSA 1JR3D 1XMVA 2A5FA 5BQ5A 3LWNA 3CH5A 1XCMA 5FH9A 3OIYA 1AA9A 3I8XA 4AYWA 4Q18A 3I5XA 4B3CA 2QAJA 3IBGA 4KU4A 3W90A 3QSYA 2ERXA 1ZC3A 3IPXA 2IS4A 1CBUA 3CR7A 4TYQA 3LH5A 2KJQA 2WIAA 2A5YB 4TMZA 2CCGA 4PC2A 2A2ZA 3KXKA 2XZOA 3K0SA 5TXGA 1G5RA 1W0JD 4QNMA 3PJRA 4C9BA 4AKHA 3FWYA 3VR6A 1A1VA 2QQEA 2I1QA 1R0YA 2WJVA 2QL6A 2EFGA 2XSZD 3O8BA 5KTYA 1OFHA 4PO9A 1XCPA 4PSVA 4C0HA 2OBNA 4G5QA 2O8CB 3ICQB 2GEUA 2XEXA 3BE4A 1VG9B 2BJVA 1YZNA 4M1WA 2OESA 2J87A 3AEZA 3B9PA 4H1VA 4YC7A 3U4QB 3OFNA 1IAQA 1IN5A 1H8HA 3VHXA 1Z2CA 5LBIA 1G8HA 2FEOA 5KNCA 1CJMA 3MRSA 3F5FA 5FI0B 1VIAA 2WICA 3CO5A 2B7CA 3M4YA 3KZ1E 4LBYA 4IOMA 5L3VA 4I4LA 3SQXA 4TYYA 1KJWA 1JQLB 1OF1A 1YZKA 3AF0A 5B57C 1KY3A 4LJAA 3AUYA 3E5HA 3TH5A 1JBKA 2VP6A 2FNAA 4I99A 1R5BA 1S2MA 1SZPA 1VMAA 4C0SA 5A4JA 3NHBA 4Q1FA 1HA3A 2YWGA 2F6RA 3LBHA 3HP1A 2ZRMA 4NYIR 3H84A 3H0KA 3K09C 1R2QA 4N3NA 4RJLA 1OHHA 3I4LA 4QBHA 2GESA 1KNXA 1FFHA 4UXIA 4FMCF 2E87A 2V1XA 4HZUB 1BO6A 4PAOA 1ZU5A 3VKWA 2J0UA 2V54A 4WBSA 3WBKA 1S8FA 3B7GA 4XVQA 3EPKA 2ZVQX 3AQ4A 1D6JA 2EFHB 3G82C 1RJ9B 2A3RA 1SXJD 2WIBA 3RRYA 4UNPA 2P2LA 2WZQA 2HJGA 1Q1BA 2NGRA 2RKOA 3GJ3A 2ZI9A 3K9LA 5FUWA 1CJKC 2J3EA 4NZYA 3QNUA 1KI7A 4GT1A 4B33A 3K53A 2VHUA 5GVRA 3AV0B 3R8CA 1D2MA 3WHLA 2ZJ2A 4B3XA 3X1YA 1IN4A 4TYPA 4KODA 4DT1B 4QHTA 1D5CA 2W6JD 4MRSA 1P9WA 4OKSA 4D26A 1Z5ZA 1X8LA 5KDOA 2H7VA 1JPJA 2MSDB 1T3LA 3BFXA 5FBRB 4U7DA 4B3DA 5FBVB 2NO0A 4EQ6B 3K09A 1P2UA 1E99A 2O0HA 1COWD 2QMUA 2HT1A 5BW8A 4OL0A 1OYYA 2ZI6A 2QTVB 3OAAA 2V4ZA 3LLUA 3NDPA 2ZSBA 4HLUC 4P0TA 2FN4A 4TTRA 2V7QD 5JJLA 3KJHA 2JJ8A 4QC2A 4XSGA 3EZFA 3FHCB 1DAEA 3NBXX 2OFWA 1AQUA 2OLKA 4JLMA 3REGA 2RGGA 1XZQA 2J0SA 5JI3E 1HURA 1CJVC 2QORA 5FTMA 4R71A 3EASA 3MMPA 4QHSA 4RKEA 3I32A 1OB5A 2B7BA 4EJSC 1G1MA 4Q03A 2ZQ5A 4DCSA 3OEHA 2E9SA 3O8DA 4DLTA 5KO2A 1E9DA 1MO3A 1TF2A 3QQ5A 2RGBA 2KB0A 4LYHA 1AGPA 2IYLD 4LJ4A 1K6MA 2KI5A 3DL0A 2WPDD 3NHAA 4OQFA 2PT7A 1I4TD 1JPNA 3X2SA 4TZ6A 4HLUA 2D2EA 1VG1A 4OI2A 1KSFX 1TQ4A 3KKPA 1GNQA 4TMXA 1Q1QA 3WNCA 3LV8A 4Q47A 3R7WB 3TQCA 3U60B 3B60A 1E0AA 1Z28A 4MGKR 4Q9JA 2GAAA 3LVRE 2YVUA 4MYCA 4PAMA 1VKJA 1QHSA 4D0NA 4KYUA 4QGGA 2AD5A 3AP2A 3A4LA 4XTRA 2NPIA 5CYPA 1E6CA 4TTPA 2F7SA 4Q1AA 3KJGA 3QG1A 3WYFA 5HCIA 3ZJYA 4EJSA 4F4CA 1N5LA 1UAAA 3IBYA 2G77B 3QBVA 3QPWA 4HZUA 1QHNA 4FINA 4UKDA 3W9YA 2R6FA 2IYVA 1RJ9A 1GDDA 2JJ2A 3PENA 2R6CA 4PFSA 3X1DA 1YRAA 2WJIA 3RS0A 3CX8A 4TYNA 1RYFA 4CRWB 3RYTC 3DHWC 1NY5A 3GFTA 1RRCA 4JBYA 3T61A 1ZIPA 4XIGS 4EAQA 3LY5A 2QN6A 3KB2A 3TSWA 4DT1A 3LVQE 2CJWB 2PEYA 3I62A 2XZPA 2PZGA 4X8LA 5CK4A 5JHHB 2WJGA 2WTUA 2Q9CA 4DSTA 1G5PA 2MSCB 3B1YA 4GOXA 2IHBA 4EQ6A 2OCAA 2B21A 4LHYA 4QOSA 4AYTA 1XPUA 3T12A 4FXPA 3B85A 4EKDA 5KDDA 2H92A 2BEJA 2ZRBA 5F98A 4URWR 1OSNA 5TY0A 4BZQA 4TLCA 4US0R 2WSSA 1KI6B 3WP1B 5H8WA 3KKOA 3OEEA 4BFUA 3VR3A 2WJHA 1IN7A 1V5WA 4WXPA 1Z47A 3SZRA 4YMUA 3MJRA 2CVHA 4RD2A 2PX3A 3KKNA 1N2CE 1U8YA 5KPDA 1XD2A 4QL3A 2ZE8A 4URZR 4DSOA 1YZTA 2PCJA 4YXWD 5JHGB 3THWB 5J4LA 1NVXQ 4KSBA 1T6NA 3GJ0A 4MGYR 2GXAA 1OXUA 1NN0A 3TVTA 2GWHA 3A1VA 3VNUA 4Q7KA 3EPLA 2DR3A 1K5DA 3SQWA 1P9RA 1G6OA 4B32A 4OHYA 1D9XA 5EQTA 3L8ZA 3Q8XB 1P62B 1TQDA 2IF0A 1MABB 1MR3F 1ZD9A 1SVWA 3ASYA 4UXJA 4Q9HA 2KWIA 1T5LA 4Q1DA 4N0EA 2IW3A 4EPVA 2IL1A 4F38A 5FBQB 4Z54A 3A1WA 4N1AA 1IXRC 2ZI5A 3TSOA 2OE2A 1I4LD 4PR0A 3R7WA 2GJAA 1YZUA 1OXXK 3FKSA 3B1WA 1KK3A 4LHVA 2QTHA 1AM4D 4PQRA 5HCNA 5KSYA 4HLQB 3X1ZA 1CLUA 2PEZA 2JLUA 1KI9A 3FDIA 3ZD6A 1KK2A 1HH4A 2VSXA 2FJUA 2YJTD 2I4IA 1XJQA 4KFRA 2ODEA 1B0UA 2PMDA 3B82A 1DBSA 2FPLA 2ZS7A 5LDDC 2C5LA 3BFKA 2O8FB 4Q1CA 4B2IA 1KAOA 3A58B 1WQ1R 4DIEA 1VCMA 1DOAA 1VG0B 4HUQB 2AR7A 1AIPA 3O8CA 1Q20A 4M9QA 4Q21A 4DEYA 1P75A 5FR1A 2F55A 2HLDD 4F4IA 3R8FA 1WRBA 1X3SA 1EGAA 2REOA 2W0SA 1E2PA 2YNMA 2ZRKA 3CF6R 1E79A 2G1KA 4NYMQ 3K70D 4NKRA 3LQRA 1EX6A 1QZXA 4XVUA 4KAXA 4OI4A 2CJWA 2D7CA 3ECCA 1CULC 3WXMA 4PC3A 3U2QA 3BRWD 3LRPA 1E96A 4JVLA 1RW4A 1XBTA 2R6GA 2BHRA 3ADBA 3UIEA 1E98A 2JDID 4KHZA 3DM9B 1N6PA 2PLFA 4LV6A 4BLRA 3MUFA 1BIFA 2O0KA 3U5ZB 1CIPA 1NJFA 3QXJA 4B6EA 1YE8A 4B35A 1NKTA 1KSJA 1M6NA 2FFBA 2P5TB 4LJYA 3SNHA 1F2TB 1DG3A 2GXQA 2ZJAA 1DTSA 1QHIA 3PV0A 3FOZA 4A4DA 1ZM4A 1TX4B 1NG9A 1E9AA 4AWXA 5LB4A 3RABA 5CM8B 3GLHB 2FPMA 4QBGB 2QM7A 4ZI2A 5K8TA 5DLQC 2W2VA 4TZ0A 2EFDB 3ZQ6A 3U7GA 1ESMA 4JT2A 4D25A 3TIFA 3SR0A 3CWQA 2R6DA 2IYRA 4DCTA 2OUKA 2YWFA 2J45A 3NG1A 3QENA 1Q1ZA 5UKDA 4NCNA 1U8ZA 3THXB 4D81A 2ZIAA 4R98A 4CEJB 1MABA 4D4JA 1BMFA 1P60A 2ANBA 1AKYA 2WJJA 1NN5A 4A6PA 4US2R 4ASUD 1LTQA 1E1QD 2W00A 3SJZA 3UWKA 1TQ6A 2AKAB 4QGFA 4M8NE 2JATA 3ZS8A 821PA 4Q7LA 2X1VA 1DEKA 2EYQA 1W0KA 3I8SA 4JZKA 4M21A 2DB3A 3QIAA 3H86A 4ZDWA 3GEEA 1OXTA 2W2XA 4JYCA 2FE4A 1W2GA 5FOSA 2IBMA 3E70C 2V1UA 1SGWA 2QU8A 3GEHA 1G16A 1VG8A 4PQYA 4H9GA 1W4CA 4B75A 1G7RA 4D4KA 4IFEA 4IHQA 1RKBA 4AC9A 5JJIA 4ZV4A 2O8FA 3MCAA 2FGJA 3OF5A 5AK0A 3C14C 4HUQA 1Z6YA 2CE7A 4OJQA 5DSZA 1XMJA 1G3MA 3CNOA 4NMMA 3EA5A 4M1MA 2CK3D 1SVLA 4NBSA 4UNRA 1IN8A 1UEIA 1LNZA 4I1OA 1TQ2A 5JS8A 1UADA 1XX6A 3KFXA 4B71A 4CZ2A 1GNRA 5JJKA 3B1VA 3MWKA 1F3OA 1G291 2F1IA 4PSKA 2ZREA 5C4MA 3FB4A 4GZMA 4Q4JB 2NO1A 5DO9A 1KGDA 1SULA 3E2IA 3TAUA 4A6XA 4DKXA 2G83A 4PHTA 2JLZA 5F3WB 4ILEA 1Z0IA 4QKQA 5C1BA 3RRNA 4BPBA 4ZKDA 4WAUA 2ONJA 3NDBB 2V9PA 4IKEA 5CYOA 1RFLA 4UQOA 2OBLA 4V0NA 1Z22A 3T1QA 3K0CC 1YHNA 3C4JA 2WAXA 2WOOA 3FMIA 4JMPA 1IXSB 1F2TA 1N0WA 2D3WA 2NO6A 4Q66C 2C99A 1Q0UA 4FWIB 4MRNA 3TVDA 1E2EA 5IRCD 4G1UC 4DUGD 1L8QA 2OSBA 3CH4B 2WWYA 4JIMA 5AJYA 5EP4A 4DBLC 3SN6A 4II7A 1JJVA 1NSTA 3X1XA 5A0FA 2F1RA 1P7CA 3WMGA 4Q00A 5K8UA 3F8TA 1ZM3A 5J4YA 1HUQA 1Z29A 2FZ4A 2RCNA 3EZ7A 3PUWA 4KO8A 1P5ZB 4D80A 1CEEA 4CEJA 3DMDA 5FOXA 1E2DA 2F1JA 4DVGA 2CLSA 2Z43A 1ANKA 4QGAA 2OAQ1 4A0GA 1T3SA 4Q4AB 3ZQJA 1ZCAA 1ZD8A 4GMDA 4Q1BA 2O8DB 2A5GA 2AK2A 3K0CA 1JR6A 1VDZA 5KNBA 1Z63A 1EFCA 4XVRA 3SJAA 1VTKA 3MWJA 4HAWA 4PO8A 5AUPB 2E1RA 1X86B 4W5HA 4M53A 1AKEA 1HT2E 2QGNA 2Z83A 1ZP6A 1FP6A 4B48A 2FGKA 1XTRA 2ATXA 4A2QA 2ZTSA 2QENA 4BFVA 2QBYB 4WVFA 2BMEA 1CS4C 4YDHB 3PQCA 1NIPA 4OK6A 1QHYA 1SHZA 1OYWA 1BH2A 4NP6A 3B9QA 2J7PA 4M9ZA 4DC9A 3SJCA 5BN3A 2PZEA 4WOPA 4JVMA 4Q4HB 1NMXA 1KKLA 1KDOA 3WNBA 1TEXA 2ZROA 3LA6A 2GVDC 2OXCA 2CE2X 1DE0A 1RVDA 2VF7A 1NVWQ 2I3BA 2QG6A 4MKIA 1X6VA 2IEYA 4X8HA 3C7KA 2NQ2C 4ZI3A 2N46A 5JCPA 3M1IA 4QFMA 1GILA 3HYRA 1VCOA 3FKQA 3B1XA 4IJMA 4TL6A 3RANA 4DLRA 3PCRB 3GJ8A 2BOVA 4J0QA 1HQYE 5CB8A 1Z0DA 3AB3A 3QI2A 4GOKA 2O8EA 2GJ9A 2DFNA 4DDWA 3CRW1 1OV4A 4JJZA 3H1TA 4TL7A 4IOLA 1NVVR 3QPVA 5E7JA 1G3QA 3MJHA 4AK9A
chains in the Genus database with same CATH superfamily
4EPRA 3I9V6 1ND5A 3W04A 2JZOA 5D3MB 3TW0A 1C3EA 1ONNA 3ONVA 3A9CA 1LLUA 3CLSD 5EE1A 4AJHA 1EG7A 1MAVA 1I30A 1SA0B 4DBLE 1P80A 1QFXA 1XO1A 4UBNA 1OZHA 1QV9A 5K6AA 2REXB 3V4RA 1TB4A 2X0KA 1UFRA 3K72B 4P4GA 5CIQA 2YQ4A 4IV8A 5CVDA 1MX9A 5BT8A 5IMSA 3A1TA 1YK0A 2NU9A 3G2JA 2XJ4A 3QG5A 4QBIA 4R05A 4S24A 1RYDA 3U3KA 3O84A 3ZWPA 5DM60 3GH1A 1KI3A 1MX1A 1G64A 2YY7A 2P4QA 4G8BA 2JGNA 3AUAA 4HNAB 4YRRA 3RS9A 5K8IA 3PGKA 4NU5A 3H2YA 2IYXA 4DR1B 4CGZA 1XZCA 1OH6A 1KI1A 2VPZA 4N3CA 4ECAA 3HA5A 3P0EA 4P4UA 4RVGA 1JXOA 3LA8A 5KCZA 2JGAA 4Y2HA 1QH8A 2JJ1D 4YASA 1JTFA 5DHRA 1PN3A 1C7ZA 1IEVA 2A7QA 3AW9A 3HG7A 3OZFA 4W1QA 2YASA 4PLYA 4AMGA 5FRDA 4HLNA 5K3FB 4WADA 3ILXA 3B78A 5AUOB 3HJCA 5EQJB 5CLFA 2X0JA 4MR8B 5JMTA 2QU7A 3Q10A 3ZLTA 4DCVA 1JL3A 3C8ZA 1P77A 3SLGA 1XRJA 1TFUA 4NENA 1LF5A 1Z4LA 2PO7A 1Z5GA 3G23A 4ND7A 2JLYA 2EP5A 3KYJB 4HSEA 1EZ4A 1KOFA 1RJDA 3OM8A 1UBLS 1RE1A 4C7VA 4CT4B 3RCBA 5CDFE 1QP7A 3B7PA 3R3JA 3TD9A 2X5KO 1VCNA 1W9HA 5AK4A 3VHLB 3AC0A 1Q44A 4KWIA 4CKZA 1ZCFA 3NJ8A 4HLCA 1UIRA 1UJ6A 3YASA 4KFUA 4O4HB 1BKSB 3DXXA 3IMGA 1N5IA 5F9FA 5KYVA 4N76A 1SVKA 2OQVA 4LGCA 5JH7F 4CFSA 4YRGA 1AQ6A 5B58T 3CBQA 1RXCA 1G6KA 3U31A 1DO2A 4QYWA 1WZNA 3DTVA 4F11A 1Z39A 3CVVA 1E5LA 2VR1A 1ZVVA 3AT1A 2DHDA 3Q41A 2Q50A 4Q4HA 4NE2A 4IFBA 4WACA 1X7WA 1Z5PA 4KPUB 4P92A 5UKDA 4B87A 2DHRA 3IVXA 3FHTA 4ZDKA 4TV9F 3M6AA 1C1XB 1Z6AA 3FMOB 4A23A 1H1LB 3QELA 2P9JA 3QUQA 3CEHA 3RUPA 3BMQB 1ECJA 2CFIA 2F48A 2ZSFA 4BMNA 1BDHA 2BKUA 4N47A 3UWSA 2O48X 4GL4A 5EHIA 5T41A 3BXHA 2VIIA 1P31A 2HWWA 2X0EA 3SR4A 3WNDA 3R5KA 1NF2A 4OQPA 2IY7A 2Q3FA 3CONA 5HG0A 1I2DA 1KDPA 1JEEA 5HGXA 4OLBA 3NBKA 4KPFC 1TPZA 1MGOA 2UDPA 1E9BA 4L0QA 3SQOA 4MW5A 1WP4A 3P9PA 5EINA 4BO8A 4UEWA 4C30A 5ES4B 5LJLA 2RJNA 4LBWA 2PX6A 1T3GA 4MRMA 3SBEA 2Z1MA 2ZYIA 2C4UA 3Q1KA 3SC4A 2A30A 2ZK7A 3T3PB 1A9YA 1P72A 2DBVO 2ZYVX 4TMVA 4C0BA 5CDUA 5IKPA 4DV2B 4IIDA 4B3TB 2VJYA 1ADJA 3IHLA 4V0ME 4DW8A 3ZDYB 5TVGA 2JG3A 3VR5H 3E22B 3F8WA 3I34X 3PKJA 4RF4A 1KMHA 1SPBS 4QWMA 4BP3A 1HDCA 3K6JA 4KRXA 2FSVC 1ZSNA 1SOAA 4RV9A 4LF9B 1DJPA 2Y1EA 5HTOA 2DF8A 2H57A 4GBJA 3U9LA 1JDTA 3H05A 4IS2A 4JS0A 1N1EA 1GAJA 1N3BA 1T9CA 4V2IA 2V0GA 3S2UA 4EATA 6ABPA 4TX1A 3ZEIA 4NG5A 4OHVA 1FC0A 3LP8A 4CM4B 5IN4A 3LHFA 2XUAA 2PBRA 4X85A 1FQJA 4D9MA 3PHJA 3KT0A 2VDKB 1NHWA 4DRZA 4MQBA 4W5WA 2J7KA 4RCYA 2VNJA 3G0IA 1EWRA 2NV0A 1D2RA 2WIJA 1K9VF 3B6EA 4Q3KA 3SIXA 5CA0B 4U2CA 1JMVA 1FU4A 1LRJA 1RYZA 1QOQB 2WZBA 4LYJA 2GPNA 5BYKA 1KC1A 1NGSA 3AU8A 3VPSA 5KSZA 1OHHD 3DS8A 3PTAA 2H5EA 2INGX 2AX3A 5CTAA 3UPDA 3L0OA 3WK9A 5K0FA 1MO5A 5KWEA 1ZD5A 2YICA 1UH5A 1AO0A 1NUSA 1C4WA 1HKUA 1RAIA 2X6TA 4MDHA 1Y1PA 2G6BA 1V8PA 2PD3A 4HNRA 3MD0A 3DXZA 4Q34A 1QP8A 5HP4A 1TXGA 2PIAA 3RR2A 1HFJA 4ZQIA 1PQWA 4PGMA 5FOVA 2EAUA 2JGMA 3RLFA 3KPVA 3ZBUA 3IVCA 5B3LA 2O2EA 4R1NA 1G9XA 2ZAMA 4IRXA 4Q0MA 1OFUA 4RVDA 4MYRA 4EYEA 4ZVKA 1E6UA 3TOCA 4AY2A 3IP7A 3DBHA 3TOVA 4JV5B 1ECPA 2V96A 5IBRA 4AROA 1JMKC 2RGDA 1X1BA 1NYLA 3GLRA 4MQFA 4JUCA 4R3UC 1KO8A 5ALFA 3M2PA 5AVZA 2COKA 4M9RA 2BGIA 3I39X 3KTAB 4RVFA 4D3ZA 1E2LA 5BVHB 3AVYA 4B7CA 2ODWA 1G5FA 4BO4A 3EPHA 2ZAYA 3LHKA 3KX2A 5C1PA 4FCTA 3D7NA 1O8BA 3LO5A 4NPHA 3PXDA 3UT5A 3ZVLA 1N6LA 2UZ1B 2HSZA 2FLKA 5DM0A 4DMMA 3HYLA 3OAAD 3SSMA 3N3AC 4DLZA 4KQXA 4OUDB 1V8OA 3ETHA 3R7BA 4W5NA 4ITVA 4DXAA 1E69A 1WA5A 2X4DA 3DL4A 2I4OA 5DN6D 3BBPA 2OG2A 4WXRA 1V2GA 2Q7DA 4O1MA 3HUEA 1UDBA 3PKIA 4O2LA 2CUTA 2XQGA 2I2FA 2IRWA 3E7WA 5M7EA 4Z1OA 4UE3S 4C7OB 2PNFA 2B92A 4BFLA 3H8WA 2EZTA 3EUFA 5CB4A 1DAMA 1NR1A 5ICCA 2IP2A 1F2DA 1K08A 3NVAA 1LK7A 3NHSA 1NASA 1ZLYA 2FEPA 3A8TA 4U7GA 5HFJA 1U7DA 1YI1A 4QRHA 3VJLA 1L7QA 1X19A 2PYIA 1GA6A 2O2CA 3QFRA 4RU1A 2H31A 1EMDA 3CURA 2HV8A 1DKNA 2IUYA 1M10A 1W88B 2VHQA 1U1IA 4HBGA 4MW1A 5DSXA 4A5SA 2P0AA 3HSKA 4NTZA 2IV3A 3AGPA 1F1BA 4J1SA 2IHYA 2PUTA 2Z3WA 3E3OA 4Z9YA 4IQGA 3W7VA 5FBLB 5C0OE 3GJSA 1XYYA 1QK3A 3PXCX 1QIGA 3DAPA 1RWBA 4M83A 5AJXA 3I9KA 5EJ5A 1BGVA 2ZI7A 4GW3A 3CCCA 3D8UA 3RRMA 5HSGA 3WAKA 4BV2A 5KYUB 3MQFA 2BBSA 1KI2A 3G7SA 1IY1A 3OIVA 4Q48A 1NVDA 4AY3A 2BDUA 4L57A 2YXEA 2IE8A 5KJCA 2IPXA 3LDAA 3K30A 3L7BA 3U5TA 4HGNA 2AOUA 4RTQA 5KQGA 1TRKA 1I51A 1U0JA 4E3WA 2BMJA 1KDVA 1VBKA 1LRLA 3FCCA 4HLDA 5J58A 1XTZA 2PKRA 3K71B 4BMOB 4XSVA 4W9MC 4RAQA 1K3TA 2XKKA 1KZ4A 1NRWA 3AKCA 3IUQA 4WXMA 1C8LA 4V02A 1GLGA 4MARA 4RQUA 4X63A 1THTA 1UK9A 2ETVA 5ALPA 4BUZA 3DE4X 1OY1A 4PY2A 4DKJA 3KEFA 1L1FA 3I9FA 5TS3A 1BD3A 3IHKA 5FOWA 1JG4A 2NPOA 3EA4A 3BQNB 3PNPA 1QDEA 2R8ZA 3K1JA 4IXTA 4GM0A 1Z2PX 2XKBA 3OD5A 4MS3A 1PJLA 1P4GA 4TZTA 1NVTA 1M2GA 1KH3A 2QAGB 4RD6A 1N9ZA 4IM7A 3SSNA 2UUAB 4CQLB 3RYCB 2F64A 1NW3A 5FA5A 4YMTA 3UMRA 1UJBA 1THGA 1GRVA 1IIBA 1K1EA 2HQBA 3PNQA 3C87A 4RZSA 3N0TA 1E9RA 2G88A 3EYAA 2X9LA 3GZ4A 4GSKA 4IKPA 1DC5A 4OSEA 5JSZB 1AKTA 3FNGA 4N3BA 4RH1A 5CIWA 4F0JA 1Y7LA 3ZHRA 1FF9A 3Q9UA 1FFWA 1XP8A 2EQAA 1CS0B 2H1WA 3LXXA 1L7MA 4ND8A 2ISCA 4BB9A 5JJCA 2V7GA 3DKIA 4JB3A 3ZHXA 3GWGA 1LWOA 2WKSA 3ICOA 3CF2A 3M9LA 1NVUQ 4AF7A 4K2HA 4OH1A 1QV6A 3C1AA 3DM5A 1MO2A 4GOND 2LD4A 1UP6A 3ORFA 1CUYA 3PITA 5F78A 1P2GA 2WSSD 5AW5A 3WICA 4W5TA 1ZPDA 3O9VA 1PFKA 4BNXA 4INOA 5JSHA 2RI6A 2RHTA 1L4FA 3AWDA 1F51E 4K6GA 1WO8A 4Y9UA 4J0GA 2C2OA 2OG1A 4QHYA 1AGYA 3OQVA 1QMGA 3ENNA 2RARA 1I2AA 2BEUB 5A2QA 2YBDA 2Z04A 3TUZC 1PZFA 3I53A 2DQKA 4H7FA 5ALYA 3PRYA 4WESB 1KTVA 1Z56C 4MVJM 1HY3A 2QM0A 2UZIR 3FNIA 2WT9A 4U7PB 1BXKA 1ZD3A 1Q14A 2OCPA 1TUBA 2HLHA 3TXXA 2JI7A 3B38A 1LVUA 2C9MA 1ND6A 1S6YA 2G3YA 3DHYA 3E27A 3IQXA 2DQZA 3QVUA 1GZVA 4L4UA 1R0RE 2BL4A 3I1JA 5FL7A 2A84A 3RUDA 5HVNA 1GQSA 3L6BA 3PNSA 4YH1A 3QJYA 2VHEA 5JCJD 3IDOA 1GTZA 5HM8A 1EGVB 4BO1A 1M1YA 4OHUA 1X42A 4MXDA 5EXTA 1ESNA 4NH4A 4F86A 2QNRA 1KO5A 1HBJA 2GSDA 3UAOA 1A9PA 3P1JA 4FNMA 2GMWA 1UT8A 4R1UA 4HN4B 4UZSA 3ZYZA 5JAMA 2C5AA 5FV7A 3TRJA 1MG0A 3CCFA 4KMRA 4POOA 1A8PA 1JPUA 3OSZA 3DO6A 1SUAA 1XHEA 3HI4A 3O0DA 2W37A 3EBLA 4HB3A 4WLFA 4MCIA 5KHLB 2FZLA 3VO2A 5E1DA 2EYUA 5ABPA 1I3MA 5LYJB 3IUPA 2J6CA 4P3XA 1CQXA 1V39A 3GP3A 4G0UA 4FGJA 2EV9A 3IAM1 2Y2VA 2JIOA 2EC5A 3QE2A 1RI3A 1PUIA 3K70C 4UDYX 1E7WA 1TGYA 1B0PA 4FDTA 1MV5A 4H35A 2XE8A 2H4WA 1YASA 4F93B 1P29A 3JWEA 2H8GA 1JNYA 1NBAA 1GPUA 4HGOA 3NBMA 7REQB 2K6GA 5LXTF 2TYSB 4DLPA 1PP4A 2OILA 4HFMA 3A9SA 5SY9A 3AIOA 1EJ2A 4OFXA 1QBGA 1YONA 2HDWA 1VJ5A 3GQBB 3IE0A 4FHCA 4NL4H 2WIFA 4PYQA 2K7FA 3VJRA 3SNKA 4X7MA 1U3FA 2NVUA 2WUGA 2C5BA 3JPWA 4PYNA 2BJWA 3E84A 1GXSA 3GEPA 3NH6A 2I55A 1LFDB 4C5AA 2EBHX 3BXEA 3DAGA 2JI9A 3QEMA 1FOEB 4M1YA 2BLNA 5KQSA 1YI8A 5JH7A 1ORTA 3K9CA 4L0CA 4W8HA 3PWKA 4JYMA 2QTAA 4IY1A 2F43B 1IHUA 1KMQA 3DBIA 3INYA 1NL3A 3RIXA 3DT9A 3IB6A 3C24A 4LZZA 3SOPA 1BXGB 4TS4A 1UPUA 4PBTA 4ESHA 5JS7A 1GQRA 3DHEA 1M6VB 4OXQA 3VSDA 3O8LA 1K7SN 2W58A 2H0AA 4I50B 4TV9A 1PVOA 2NP7A 1SRQA 2PKQP 3GUVA 3ITKA 4I19A 4J6FA 4ZV7A 3W2GA 2AYZA 2DGDA 3HKEA 3L77A 3R5SA 1EP1B 2PZMA 3HPRA 2B0CA 2EU8A 3Q9SA 4YRAA 2GZHA 2QRGA 4WIAA 1NVVQ 3OJOA 1QF7A 1LF0A 3BK1A 3FVWA 4INJA 2F17A 2XVXA 2ZW9A 1WSDA 1KBOA 3AHGA 3I58A 3ONNA 1K92A 2IIQA 3BWEA 3EVEA 1NUTA 3IDZA 3P0IA 1ADBA 4X91A 5E9AA 3M9WA 4A7PA 3NYQA 4HEHA 2IELA 3HWRA 2VDPB 4M7PA 1GDHA 1OOEA 1V8FA 3KR2A 2GDZA 3L93A 5ALHA 2GKGA 1Q7TA 3A3PA 3CSUA 1FFCA 1OVMA 1W1IA 4K26A 1OH5A 1UPBA 4GSYA 3EIEA 3Q8LA 2WT4A 1BWPA 3FCYA 4RJ2A 4ZYWA 2XDYA 1GL7A 5L51A 4GVPA 2FK8A 3CKMA 4MS4A 4MYHA 4E15A 2ZUEA 1SC4A 1WW2A 2EJVA 1RHKA 2JHAA 2OUIA 2OORC 3FWZA 3MFQA 4UEOA 4XLTA 1J8YF 4UU1A 3AY7A 3S2YA 2J3KA 3W8FA 3JWPA 1GFIA 5HM6A 3EULA 3QXGA 3H3JA 5E6SA 5AVSA 4JUBA 2VP9A 4AZTA 2VPTA 3SHQA 2DYKA 4ZYLA 2JC3A 5H1YA 3WYGA 1R15A 2A14A 4QOHA 5LP6F 2I4TA 2PKXA 1TTHA 1P7ZA 1YC2A 2CGEA 1B73A 2HUPA 1TE2A 3SQDA 1C30B 4JI6B 3NETA 2H59A 4GZ3A 5ALXA 1WDLA 2J1LA 2XB9A 4GWKA 2CXNA 1B3RA 1JDVA 4G3XA 5AXDA 4DOMA 3UENA 3AZPA 4HFRA 5E1BA 4ZZ2A 4AG6A 1SBNE 4WW0A 1KYIA 2PRIA 1MUUA 1UKYA 4MHSA 4D92A 2DG2A 2H1OA 5BSHA 3FDZA 3V4ZA 2PGLA 1I4OA 1CJBA 3ET5A 4MVCA 3K31A 1CJUC 3H2SA 5D3ZA 2AVDA 4K3UA 5IVDA 4CDGA 1KI4A 3EF3A 2C7GA 2R2AA 2JJYA 4X1IA 4FP9A 4ZGWA 5J1SB 3WYEA 1E89A 2CFCA 1F0YA 1NRIA 2OORA 1PWYE 2Z4TA 3SKXA 3MAAC 3OG9A 4G89A 4IV0A 4ON9A 1T91A 3W90A 4NCKA 1SVSA 1TZCA 2FUG6 5HZGA 1Z8DA 1L7AA 2QJOA 5KOIA 1EVJA 2CY0A 1HORA 3EGWA 4IO0A 3ON5A 5CFOA 3VZRA 4B31A 2J0VA 2GGSA 2I6QA 3DQPA 4B0PA 1OBFO 2DFVA 2H16A 3PU6A 3D0KA 3E5NA 3IUYA 3I01M 1HLGA 3MJFA 4WPGA 4AY5A 3V1MA 2O8BB 2ZYRA 4V0KA 3CRMA 2OQRA 1GARA 2IPOA 1U9IC 1T29A 2ZYUX 3FYUB 4YDRA 1IZ8A 4GD3Q 4KFTA 2WR8A 4Z9XA 1TF7A 2GT1A 3S8EA 3G88A 3T95A 3BL8A 2CK3A 1RI2A 4GPTA 2O2ZA 4LOJA 1OAKA 4N7MA 1RC1A 4AU1A 1ZD1A 1FRNA 1LVHA 1T2AA 3UG7A 3IAS1 3OTGA 3TB6A 5BRJA 4B83A 5BR1A 3OQNA 1DAKA 4PTYA 4JBIA 4G84A 1F8GA 1US8A 2IYFA 2MYPA 3QLTA 4WZBA 3ZYCA 2OFXA 4BGIA 2ECFA 2VRCA 3GO4A 3LYAA 3U7HB 5KEIA 1LW7A 4PR3A 2GYUA 3K8YA 1Y9DA 5LUBA 2JNWA 5CBPB 2CFTA 5CA0F 1RAEA 1YDFA 1ZONA 4V0LA 1T0IA 5GWXA 5C2JB 4I9GA 1RWKA 3QMWA 3EIQA 4K9MA 1EJBA 1EFDN 3IKVA 4B2PA 2VP3A 1ZMTA 4J16C 3GMSA 4A15A 1IY0A 2NNWB 2OVFA 2GZSA 2HLNA 1WOYA 3AUXA 3E0XA 3I6BA 3PUVA 1GV1A 1KQ3A 2ISSD 2CNWA 1FSZA 4JT4A 5F64A 2VYNA 5TF4A 4BU1A 4OMFG 4FNAA 4A1OA 1U9IA 1BCRB 1VIDA 4M9XA 4GKBA 2BSXA 1AS2A 4RCVA 1UM9A 4C22A 2Z8ZA 1DAFA 1VECA 1FFSA 1IJFA 2XCSB 4LDNA 4MKFA 3L9WA 1ESEA 3PRKE 4S0XA 5HQ3B 4P0QB 3D6HA 2JJQA 3OC6A 5AXCA 4CR8A 1J8DA 4D99A 1NRXA 4OB8A 1N2SA 4FNOA 4I81A 3MLEA 4J7CA 4UW9A 2XT9A 4ZYTA 1N5KA 1QIKA 4RIHA 1QVRA 1G4HA 3F4KA 2Q3BA 3UJPA 5A5EA 2ON6A 5BR8B 5H7XA 4A8JB 1YUMA 4IIYA 3QHQA 1BEZA 3GD5A 4TLLB 1C3VA 3KDSE 3NWBA 4NULA 2WKWA 3QYAA 4DLUA 1A4XA 4J16A 3RSFA 1QTNA 2EWMA 4FHFA 1PQ4A 4N0PA 5EZ6B 2OQIA 1WF6A 4P93A 2OXIA 4XWGA 1J42A 2RH5A 3F9CA 3GLHE 4HUJA 4ACBA 5LFAA 4XGRA 1YDEA 4UTZA 1I6WA 3M6LA 3BXOA 1U98A 2FZGA 3I5AA 4RAOA 4TOIA 5AVOA 2PV7A 2AI1A 4L4YA 5AJTA 2GNPA 5FLXA 421PA 5DGCA 2WMNB 4AKTA 3JASA 5A3JA 1YVUA 5C81A 4UDXX 4C2BA 3RNOA 1AKUA 3OUTA 5HZMA 2DFTA 3CA8A 4MR9B 1EP9A 4RZ2A 5KVCA 1BJKA 3CLSC 5REQB 1HLDA 2PYZA 1W35A 4ONEA 3L8CA 1F6DA 5C3UA 4BNZA 4Y0VA 5H5JA 2LIVA 4HXGA 3BE5A 2FN8A 2EGUA 4F2PA 4Q4CA 3FCOA 4BFXA 2I4NA 1NXOA 2AJCA 4L9SA 3LT4A 5DMXA 5EZSA 2ZP1A 3SCZA 3FCSB 1QUFA 3ABZA 3SC3A 4U4AA 3K92A 5FP0A 1AJEA 3OMLA 1NAIA 5J4KA 4BZWA 4GMFA 1NJGA 2VP4A 3QKRA 3VKHA 1DJMA 4X24A 1V0JA 3KBBA 2DUNA 4FSXA 5JIBA 3AF3A 1VJ0A 4D7AA 2GPAA 3H4MA 3TFOA 3I3OA 3QF7A 3QX8A 4PTLA 2HA0A 1CZLA 1CY6A 1HRDA 1N5RA 3TS1A 4EHFA 3MNFA 2C61A 2P5YA 1YJ5A 2PMBA 3TQFA 4E4RA 5B7NA 1O6ZA 4RYLA 1KU0A 2BC9A 3DT8A 2QI9C 4MKXA 2C9OA 2EZ4A 3JQ7B 3AEQB 3TBKA 2HL6A 3M2TA 1QR6A 4NCBA 1IU9A 4U6SA 5EE5B 3QPUA 3BIJA 5M2QA 1EE2A 4WX2B 2OD9A 4BCCA 3WGQA 1XZEA 2CHEA 2IYQA 2IITA 1CEQA 1FDIA 1ZEMA 3BWDD 3GBPA 3DZ8A 5FEMA 3ZX5A 1TTPB 4NCAA 3V7FA 1X8KA 1QH1B 1X87A 4DA0A 4U2BA 4G5GA 3BUSA 2JD2A 5CIYA 3ZDXB 4PEVA 3IDAA 1M0WA 1GKIA 3SI7A 4O8ZA 4MV3A 4HNSA 4QT0A 4D9JA 1NMZA 1JVBA 3FIUA 4MULA 4CMCA 2R8XA 5CCEA 3NC0C 1A5SB 5ALWA 1N8KA 5HX7A 1GQFA 1HDYA 1DZ3A 1R18A 2R7KA 1TAGA 3JQAD 4IXMA 2V4UA 2C3MA 3UH1A 5B6IA 3WLEA 3EXG2 2I2BA 1K7CA 5A4AA 3AI3A 5BWLA 2R65A 3FR8A 5GOTA 1Z6PA 2X8AA 4B80A 2V3VA 3OZ7A 5BR7A 1S2OA 2UZ0A 3LZDA 5EVCA 1W5FA 4BNKA 3HZRA 4MCHA 4C3OB 4DM3A 4IBOA 3HDQA 2D1SA 3IS3A 2AWOA 3KS9A 5CW1A 2ZJFA 1MIHA 3MMZA 3ZU5A 5IAAA 5KTNA 4XXHA 5BR4A 1XMIA 2IZZA 5EEGA 1ID8A 2DKFA 4CM8A 2OR3A 2EKDA 4C7MA 4JB2A 1SHKA 4O29A 4JI2B 3PRHA 1WCV1 3L46A 4R2XA 2KPOA 5T67A 3UGJA 3MJ4A 4GBGA 2YYSA 1WY5A 1Y6QA 2Q4BA 1FW6A 1SQFA 3ZZUA 4OG2A 1RZUA 1FEZA 1H4TA 2WTAA 3U0BA 3GOHA 3GL9A 1W6RA 1FTYA 3OTWA 1RWVA 3OFKA 4JSRA 2F1KA 4N0DA 5K8JB 5LXTA 1ZNQO 4IIGA 3A0UA 4AMUA 4BDSA 1N4AA 4ZQCB 1KIFA 5JQGF 4KO1S 3L0DA 3IESA 3MFYA 4WE3A 4JBGA 4U00A 5B7QA 1B6GA 1P1IA 3FF4A 1OLOA 4KBFA 1L7NA 1ZINA 3HHPA 1IBSA 4JLPA 1XB2A 16PKA 1UR5A 2IZ7A 4RF2A 3B5JA 5AK3A 4IZHA 1XCGB 1XAIA 5DBHX 4H0FA 3IAM6 3SYTA 4ZIRB 4DPKA 3H9UA 3N8KA 2G08A 2QD4A 4JC5A 3B1KA 4ENSA 4B3MB 1AV7A 1QORA 2QRPA 4DNOA 1USIA 2C9ZA 1CJSA 1QLHA 4QUKA 5E8JA 5L40A 4KUHA 3I05A 5KHAA 4D02A 1KZ6A 2FSGA 3WO0A 1FPQA 1U2SA 3BYZA 1TAQA 3ORRA 3U3RA 2Y92A 4J07A 1LBTA 1EVQA 2CLCX 1X14A 1B3BA 1H9BA 5E7MA 2C3OA 3ORSA 4FR5A 5G0VA 4Z0HO 1NKSA 4HNAA 4UQPA 5ARDA 1I4DD 2FSFA 3N3BC 2JL1A 4TTJA 5G3ZA 1E0SA 5LYJF 1LPMA 1EFPB 4MQLA 5K0LA 1SXJC 3V9AA 1GEGA 2DUUA 5C8XA 1T0HB 1YDGA 2FW9A 2C7RA 5LP6C 3TLEA 3ZKAA 1A0OA 2RBGA 1JR3E 1N0VC 1VP9A 1UBFA 1WVIA 2HQRA 1PL7A 1E32A 2LV8A 2DY1A 1HTTA 1PIWA 2WILA 5DYIA 1N9GB 1FU7A 2G07A 1PEYA 2DPXA 3GU3A 3KCQA 2G0TA 2X0IA 4NAHA 2OBYA 4W7SA 1JGTA 1TO1E 2QVXX 4MR8A 3SIWA 4GKKB 4HAVA 4ALLA 1SD1A 3D7LA 3O74A 1BDBA 1FUIA 4GRAA 4H3KB 4WDRA 5IKMA 2A9QA 2AOVA 1HDXA 1CB7A 3CY6A 5KJ1A 3NHLA 1ISFA 5CJPA 1AZTA 4MCAA 4UASA 4YJDA 4CCYA 2QMHA 5BORA 1VFNA 1GAQA 3MCZA 5AOVA 1SXPA 1JHRA 4IDPA 1OZGA 4B3RB 2F4NA 4MLPA 4B43A 2FQYA 1S7CA 2PAAA 3TCNA 4U5QA 1EB8A 1PJTA 3A70A 1XR3A 1K7FB 2DPMA 1U9JA 4XQCA 2BGNA 1FXWF 2AKYA 5T8KC 8ABPA 1H3EA 1ZI6A 3ICWA 4BGUA 4CTOA 3HCFA 3K05A 5C31A 1H9CA 2FG7C 3FNEA 3BGSA 1XZFA 4JJIA 1CZKA 1RQRA 2V74B 4UDOA 3UMJA 1SXJA 5BSVA 2OK7A 3TZKA 1VHDA 1U02A 5LP6A 4G37A 1EPUA 2QVBA 3LIPA 4S12A 4YIHA 3U13A 3HCAA 1E0DA 4RJTA 1J25A 2RKWA 3ZE6A 4TQAA 3LX5A 1E94E 2G7MC 4I50F 3N2IA 4CLRB 3DB1A 1FDVA 1TYAE 3TM5A 4F9TA 5EWMB 5I9SA 3OQ1A 3ULKA 4DNXA 1PEAA 3BMQA 3FBTA 5IPFA 2DPHA 3N5CA 3IMCA 4F8YA 4HNVA 3A6ZA 3WXBA 1KO1A 1R5OA 1P17A 2PT6A 4MROA 2Z8YA 1AKRA 4S1VA 3O4HA 4RCZA 1FNMA 1QHXA 1CW2B 1XEWY 2B5OA 1Z83A 2XDQB 3RREA 3FLMA 1N0IA 1ZMOA 4MUNA 3L7OA 3HJHA 3TWOA 2YXDA 4TM7A 5A62A 1ZSYA 5AJHA 5T8KA 1ODCA 1XVIA 1PHPA 5DNUA 4DWWA 1AN0A 5IWCA 1RI4A 1XLVA 3V5NA 3K9HA 1MQAA 5A02A 2O52A 4GIBA 3KD3A 3QV2A 2Y71A 4NXMB 4WKPA 1WBBA 1OROA 1DRVA 1WXWA 3ONWA 1G2QA 2QG4A 1G8GA 5DN6A 1SU6A 3FCEA 2TMDA 2GN9A 4Q3EA 3FA2A 4P5PA 4EG0A 4PLWA 2F62A 2RMKA 4F84A 8LDHA 1U90A 1Y5IA 2P9FA 3M1LA 1YB7A 2Z57A 5IEJA 3CR3C 2BCGY 3IJPA 2QVYX 2MTBA 3SIRA 2RGUA 3LRXA 2XGGA 3JVVA 3O2NA 2GVZC 2AH5A 2D5BA 3I0MA 5DXAA 1YVPA 4XGIA 2BTEA 1T25A 5SZIA 4NBUA 4DTCA 1F2UB 1WZCA 1VLVA 4X3PA 1EQUA 2DBYA 3C74A 3UUGA 4ERNA 1QCYA 1O1YA 1Y80A 4E51A 1XRRA 1CU1A 1RIFA 4CLOB 3AVXA 1XTTA 2ID8A 4KWHA 4P84A 4XOIA 3R0ZA 3PB3A 3AONB 4O1HA 5JSYA 5P8WA 3ZGLA 1PAUA 3KVVA 4OTZA 1N33B 1JEDA 1M7HA 3D6MA 3GZJA 3TMYA 5JWHA 2C2YA 1GP2A 3U61B 1YQGA 2COEA 2FAXA 2O8VA 3WOHA 4UTVA 1GRNA 3TOXA 3WOVA 1ICEA 3LYLA 5AVJA 3VPCA 4AKGA 1UOPA 4TLBA 5IAGA 1VHWA 4XDYA 4RA9B 2XY4A 1WSBA 3QM1A 2Y0PA 1EDOA 2I87A 3PYXA 2FJ0A 3G68A 3R7SA 2Y6VA 3KQPA 4ND2A 4YRMA 4U02A 4AI6A 1NE2A 1TZJA 1GUAA 3AR2A 1EJ6A 1KZ7B 3U7IA 2HBYA 2M6SA 3WLRA 2LKCA 2GZAA 2F3SA 4CM9A 4E7OA 4XWWA 3FHLA 2ZE7A 3QU7A 3KTAA 3GRYA 1NXQA 4MITA 3PUIA 5FTLA 2ZJYA 3QVWA 2APJA 2ZUTA 1QFJA 3B7WA 2VYFA 3G1TA 4H27A 2C03A 3J7TA 5KNBH 2FXVA 2I71A 3IDQA 4X3OA 4IDCA 2UZ1A 4IICA 4KNYA 2XPCA 4ND1A 2ZUUA 4ARCA 4OUDA 1FJ2A 1CUBA 1R88A 4LXHA 2O57A 2GERA 2H1LA 4DJJA 1MIOA 2WOJA 3RC3A 3WAGA 4Y8VA 3SKYA 3R24A 1KOGA 3DVQX 2QJTA 3F90A 2RGNA 3MGCA 3VC7A 1L5FA 3D3JA 1HEYA 4G4JA 1MQSA 1OA1A 1RHMA 3DMHA 1Q21A 3EIOA 5D2CA 4MI9A 5AHRA 3KD2A 1N6OA 2Q5JA 4B76A 2CBZA 3TZLA 4C7OA 3NRJA 3HU5A 4P4NA 5BQ3A 4KREA 5LZ5A 3FR7A 1A82A 2I2XB 3NAGA 2HF7A 3NW9A 4O4LB 5HE9A 3V8EA 1LWNA 1WDTA 2WHYA 1NMQA 4BNTA 4QLOA 1N32B 5EIBD 2IP4A 3EQ2A 4F5EA 3JAMA 4F5ZA 3CZPA 2GZ3A 3CNLA 3Q3VA 1L4KA 1S01A 4QX6A 2F3RA 2D7DA 2WHQA 2QS9A 4B9EA 4V1CI 3AHFA 2GEJA 1JDPA 2V58A 1KORA 3PT5A 3Q5EA 2P4SA 3EVGA 1GCOA 2PU5A 3KXLA 2EHDA 4KQFA 3UJHA 4DHEA 1Y37A 4DYVA 2H2HA 1ZK0A 2F2TA 3G5AA 3AF2A 5GJCA 4FZ5A 3ZN2A 3W6PA 3K4QA 1PFYA 2R6AA 3HXTA 1BS2A 3LC0A 3SGLA 3ZD8A 2JAOA 3QOXA 4H4DA 1YQWA 5TARA 3AM1A 4QOIA 5IAEA 4OMCA 2Z30A 4C4PA 2EFEB 1TMYA 4RESA 3D2CA 5JCJA 4NFYA 3A3KA 2GNAA 3NXKA 1RZ3A 2DUMA 5C34B 2FSPA 3LI2A 3STYA 3CEAA 2NO9A 3ZE1B 1HR0B 2BFDA 4IH1A 3TUIC 1VHLA 5B58C 4FFPA 4U0KA 1FX1A 2IYPA 4BYGA 5JROA 1ZW1A 3BD9A 4YO7A 3IP9A 2Z2XA 1ZU4A 3EEIA 3MJDA 4UARA 3ND6A 3H5IA 3MMNA 3PVCA 3NALA 2FV8A 3UG6A 2Q1XA 4L08A 3DZHA 5I4IA 2OV8A 3L2OB 1UDRA 2B37A 4OXKA 4YPVA 1K66A 1NW7A 3QOFA 2FEMA 2BR4A 3QFHA 1D4ZA 2Z0MA 1WPRA 3WK8A 2XXJA 3GLIE 4YQYA 1VIMA 4X64B 5IVPA 2QAGA 4L4XA 1GZDA 2Y8EA 4ABTA 3JD3A 3MT0A 4LI3X 2VXBA 3BFVA 3BXZA 1JJ7A 3IXLA 3RUEA 1D0IA 3RSHA 1VFPA 4DIBA 2IS2A 4ZCTA 1Z36A 3PQ7A 4TQGA 4WFIA 3MF4A 1U0NA 2QSZA 3B9BA 1TADA 1EDBA 2X9NA 3CJQA 2FG6C 4N82A 3S40A 4BBAA 1WG8A 1R50A 3HPQA 4JBNA 3KTOA 1V71A 3HU3A 4XGQA 2EX4A 5FAXA 2ZR9A 3WGMA 5BV7A 3LAWA 4DMKA 2Z8YM 4AZWA 3GT3A 2A1UB 3WS7A 1CS0A 3GLGB 5DTIA 3KTFA 2EGGA 1H5UA 1XT6A 4H7JA 3D2LA 4ARBA 3ZDQA 3G0DA 4POAA 1UC9A 4I1VA 4HR7A 2XUGA 1CRQA 1NVAA 1JEQA 1JQKA 1YHZA 2P2ZA 1ZXXA 1ZNXA 2Q1WA 3L1KA 3MB5A 4K9QA 5K1ZA 1PKEA 1Z73A 3FNFA 5FWXB 2VDWB 4XPIB 3RBAA 3HA2A 3Q2KA 3PEUA 5BNTA 3DMTC 3BG5A 5JYCA 3GX1A 2Z2JA 5GQSA 5KNLA 4LVOA 3WBFA 4JLKA 1OE0A 2BEUA 5TQJA 3FUVA 2EW8A 4WESA 3KAQA 1XD9A 2VHYA 1O9HA 4LRTB 4RMIA 5EMLA 3RYCA 5FCDA 4HUTA 3RWOA 1OU4A 5KTSA 5ESWA 4JX8A 2VAPA 1GY8A 3EC1A 2X4IA 1D4OA 5IM5A 1ESCA 3C6BA 4FFLA 1DQRA 4MRVA 4F5YA 5JQGA 4BIIA 3B6KA 4YLGA 3IMKA 4CHGA 5AESA 1KU6A 3H3FA 4RSHA 2H4JA 1QTQA 1KJJA 1NBWB 2H7CA 4PWYA 4CTJA 1N5JA 3QHPA 5A3RA 4JFAA 5JD4A 4ZZ0A 3QHAA 3CRZA 3H9BA 3UAGA 1U5AA 3UKDA 1UT6A 4BMPB 2O20A 1I3OA 3WHKA 1RWXA 1OPXA 2FETA 2B8TA 3NUGA 5TJHA 1TJYA 1LLFA 1AUPA 2QMEA 3DMTA 1DJQA 5G0WA 2BBOA 4JGBA 4L72A 2AOTA 1YB5A 1UMKA 1MTZA 3R4VA 3GRRA 2K4MA 4WBXC 4YJGB 1GPLA 3K1TA 2G28A 2Q3JA 3D0RA 3WJ1A 2DC1A 4R2HA 1YDWA 5CFQA 2AOXA 4PSAA 3AHJA 2JLQA 3RVBA 2CKDA 4AQ7A 1J90A 5LYJA 1BC5A 1OFTA 2Q3LA 3G2KA 4WZBE 1NI3A 2A0WA 4DCUA 3EG9A 3I52A 1Z2EA 2PXAA 3F3MA 4PHCA 3BZWA 3T4UA 4PGFA 5K0BA 1VJRA 1EVIA 2GF2A 5C8VA 1JQ3A 1EA5A 5C5CA 3UA3A 4HAIA 4DUPA 1RHQA 3WMRA 4ARZB 5EE3A 2D59A 3PCTA 1EVEA 2BGLA 3LPMA 5AM0A 4M8SA 5CLGA 4EZBA 3D7KA 4NMLA 1OU0A 3FFBA 4ZJPA 1U0FA 2XTAA 4I8XA 4BVAA 1R5NA 3H1PA 4BFZA 1YULA 4S1OA 1PUJA 3K5WA 3P9NA 5A5GA 3GQBA 2Q5EA 3SZUA 2EF0A 1VP3A 3PA6A 1C1YA 2CZGA