3IRVA

Crystal structure of cysteine hydrolase pspph_2384 from pseudomonas syringae pv. phaseolicola 1448a
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
213
structure length
213
Chain Sequence
MSKPLVRWPINPLRTAVIVVDMQKVFCEPTGALYVKSTADIVQPIQKLLQAARAAQVMVIYLRHIVRGDGSDTGRMRDLYPNVDQILARHDPDVEVIEALAPQSDDVIVDKLFYSGFHNTDLDTVLRARDVDTIIVCGTVTNVCCETTIRDGVHREYKVIALSDANAAMDYPDVGFGAVSAADVQRISLTTIAYEFGEVTTTAEVIRRIESAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYSTEINE HYDROLASE
publication title CRYSTAL STRUCTURE OF CYSTEINE HYDROLASE PSPPH_2384 FROM Pseudomonas syringae
rcsb
source organism Pseudomonas syringae pv. phaseolicola 1448a
molecule tags Hydrolase
total genus 81
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2009-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 3irvA01
3TXYA 2B34A 1NBAA 3IRVA 1ILWA 3PL1A 3TB4A 1XN4A 3TG2A 1IM5A 3OT4A 2A67A 3O94A 2WTAA 3O90A 4WGFA 4WH0A 3LQYA 1NF9A 3O91A 3R2JA 3MCWA 3UAOA 3O92A 3O93A 3EEFA 1J2RA 1YACA 2WT9A 3V8EA 4L08A 3HU5A 1X9GA 3HB7A 3OQPA 3S2SA 4L07A 1NF8A 2H0RA 4H17A 2FQ1A 3R77A 3KL2A 1YZVA
chains in the Genus database with same CATH superfamily
1QHFA 1TD9A 1PQPA 4BJHB 2BBSA 3AP1A 4RK7A 3Q40A 3JRWA 2IXGA 2V54A 2HBRA 4EJ0A 2OCIA 3IULA 5AOAA 1Y4ZA 3HMKA 2CVZA 2Q21A 1UMBA 2Z2IA 3IJ5A 3WAKA 3TQFA 4B80A 4D43A 1XUOA 1O97D 3NWOA 1OBCA 1HG0A 1YMUA 3CJQA 3QOWA 4TL6A 5SZHB 3QKWA 1TE2A 1ZDMA 1X7HA 5KYKA 2HXSA 4XB1A 3RYCA 4PAWA 4WNIA 4A6EA 4B3SB 1Q92A 5JCOC 3LPCA 3IQHX 4CR7A 5K3EA 3HJTA 2IW1A 3MMPA 3OAAD 3SXJA 3LCMA 5EMHA 1HNNA 3ELBA 3JAKB 1GAJA 3IAHA 2FSUA 4H77A 4P7JA 2IYTA 1IQUA 1PJZA 2ZJ2A 3UCFA 1JDUA 4KNWA 2B4KA 1ZD1A 3D4NA 1JSZA 4NNJA 3IX7A 2QXUA 3KAPA 3WWZA 1XPJA 3CSSA 3MQ4A 1XU7A 2YWDA 3LLUA 1PAUA 5F1PA 5T5QA 3WMWA 2IDMA 4RSMA 3BL6A 3HB0A 3QM1A 3ILHA 4TMYA 1I2CA 1VJCA 3RK1A 2CBGA 2QTVA 2VYFA 2Z2YA 2JLVA 1EGHA 5JD3A 3TUIC 1G98A 3K9HA 1ORRA 1JQEA 2LIPA 2OMKA 4FYYA 4X63A 4GMFA 2WPDA 1KJIA 1ZJYA 1BFDA 1RAGA 1S9DA 3ENKA 3NMUF 4J1TA 1HEUA 2FGKA 1HSZA 1FK8A 1MT3A 5FOXA 4CTKA 3GR6A 4EG1A 4B3TB 1ZZGA 1XELA 5EQJB 4IMRA 2H9AA 3M2TA 3ORRA 2R2AA 2YDXA 3IRVA 1PR4A 3AETA 3MB8A 2JLZA 2IV3A 1PJSA 1PRYA 1FVOA 1NLYA 2QTFA 2UVQA 5DEOA 1U94A 5HGJA 2D3TA 2JK0A 3O94A 2AFRA 3A10A 4J76A 1T1RA 4YXFA 4ZJPA 2GD2A 3KZOA 2F62A 4ZZ3A 2PRZA 4L5YA 1QRSA 2YN2A 1HDRA 1KMNA 3WL3A 1CFJA 4A8JC 4AZ0A 3DSRA 1U28C 2IVZA 2Y1XA 2PSDA 3CPHA 2GA8A 4RYLA 4Q9LA 5DW0A 3GFTA 4IGFA 2EKBA 4K6GA 2P90A 3J81A 4GQBA 1KJYA 4G5YA 4B46A 2LVBA 4EHFA 1NTRA 4DZRA 4UNRA 3IV6A 1D2EA 2AC7A 3W2IA 3K0CC 4Y1RA 5F12A 5BN3A 1T9KA 2XZDA 3G59A 1MC5A 4NENA 4QQNA 4YJHA 1FS4A 3DOOA 4HEJA 1S2LA 4IAOA 3CO0S 4BGIA 2O7NA 3TQHA 2Y05A 2P62A 2LPMA 5COAA 3UKDA 2YUTA 2BFPA 2VA9A 3DDCA 2JPDA 3OURA 3BIJA 4QBIA 1TIKA 2DLNA 1R3UA 3AY7A 3C6XA 3IXMA 4QFDA 3G2QA 3OOWA 1GFWA 3OJLA 1NQ5A 1BYUA 4M46A 4D4LA 1XTVA 5DT9A 1MHTA 4ARVA 2VG8A 3DMDA 3NKFA 3FUTA 4FD2A 4R68A 5EZ5A 4V0RA 2NM0A 1UM9A 3IB3A 5AM5A 5KTOA 5LOVB 4US1R 2IA5A 3P2JA 4N12A 4BO6A 5LQCA 4WJKB 5DBEX 5ALDA 4MPJA 5FL7D 4WJLA 5LR6A 5JEEA 2XGJA 3HHPA 4Z8XA 3RT7A 1JAXA 4KITB 5HQ3A 4FSXA 2C59A 1KKUA 4ZI7A 1L4UA 3IC5A 3N2GA 5IS2A 2D1SA 2Z3VA 3HB9A 1T8SA 4YA6A 3BSSA 2NZYA 2QQEA 3QA3E 5FWDA 4DRXA 1TIPA 2IITA 2E0IA 3A6FA 4GMKA 4QJ3A 1TPZA 1FVHA 3LCJA 5GM2A 3X1DA 4R0MA 1H69A 3NBMA 4OJKA 3U56A 2R4UA 2ZRBA 3H3FA 1C41A 2V97A 1UJCA 5ALYA 5TMDA 3FSRA 5LYYA 3MMSA 5AI4A 1T9DA 1WXDA 1UFVA 4ZZ0A 3DGFC 3BGIA 4UAVA 2QT0A 2XYQA 1H5NA 4B4WA 1M2GA 1NY5A 3KDPA 3VO8A 2CL7X 4EGFA 1OX5A 1O96B 3TTVA 4HNUA 5AXCA 9ABPA 4QTTB 3AWIA 6LDHA 4AJ9A 1TZ2A 4XD7D 4GWLA 4ENRA 3KX2A 4Q4LA 1MC1A 2SKCA 1CJMA 2YFQA 2YIJA 3FAKA 3IVCA 4NOMA 3VNSA 2AE1A 3BB3A 3IKTA 3RYHB 1A7KA 3JQFA 3WRVA 4ZVSA 2ECKA 2Y1LA 5I4BA 4BNJA 5GONB 1P2VA 2JAWA 4Q05A 1FFXA 2RK3A 4XUGB 4AQYB 2BHLA 4K0KB 3WXMA 3ED1A 1GZ7A 4NTZA 3CLSC 1N2CB 3EXG2 4XASA 5B3KA 3RG8A 3ONDA 2O8BA 3KYDA 3W90A 2D2EA 3WS7A 1YVUA 1XJQA 5BVGB 4C4PA 4ZI5A 3PX7A 5FNVF 3EGEA 3CW8X 1DLJA 1OAKA 1GT91 2BISA 3RVLA 5DWDA 1KIMA 3AF2A 1VYTA 4GOLD 4BP9A 1PEYA 4OU5A 4WVFA 3VKWA 3IEUA 5J4KA 3IEVA 3MWLA 4FT2A 4NU6A 2QP9X 5LLTA 3RFCA 5HFAA 1ZMXA 3MS2A 5CD1A 4NZ9A 4IV0A 1HA3A 2QVXX 3F3MA 3OM8A 2UZ4A 2GBFA 2GUWA 3CVUA 5LDGA 4ZEMA 4LF9B 1KZGB 2WTUA 2Z83A 4ZO9A 1B1AA 3G9QA 3IDZA 3KHSA 3ODGA 5FYDA 1EP9A 3DUWA 4GPBA 3UJHA 1OX4A 4P7FA 4MR8B 3PQ4A 4ZTBA 1BD3A 2GGSA 3BMCB 3C5HA 3DCNA 1KP2A 3Q12A 4Q4HB 5KMGA 1JFLA 4ARSA 3LPMA 1J07A 1BWRA 1MOPA 3LUJA 5FHQA 1AMUA 4BE7B 1L4GA 1MX9A 4FJ1A 4YUAA 3T7JA 3P9KA 2ZYTX 5KTKA 5AK3A 4B3CA 1TJ4A 3THWA 4Q9DA 4S1NA 1H0KA 2M9MA 1A9QA 2Z4RA 1U9IC 1UXJA 3DMNA 4PZ9A 3R3ZA 1HY3A 4GF5A 2L18A 4Z4FA 2J0VA 3OICA 4JEUA 2GF9A 2RMKA 2WMDA 4XVHA 2GETA 3R3JA 1WUKS 1ZK4A 3GJ0A 3GOQA 1YJXA 3OCZA 1RPTA 4N7RA 4UD2A 2J1LA 1E64A 2WKQA 3CEPB 4JAVC 4NQRA 2QA5A 5BW6B 3TMKA 2MSNA 4ECEA 5JDIA 5HIJA 1N5JA 3UV3A 3OLXA 2RHHA 1R4ZA 2AK3A 4X1KA 4NU8X 3DBHA 3OLCX 4R2MA 5JLJA 4R2KA 2PT5A 2V3VA 1O87A 4L6AA 1QV9A 4AC9A 3I39X 3O8OA 2CV2A 1LW6E 3ELDA 2AH5A 2C07A 2WJ3A 5EOVA 3E9DA 3FOWA 5J4LA 4MJLA 2Z5VA 3ACCA 1AQJA 3COJA 3WA7A 2JGJA 3T61A 4YV2A 3JAMA 2ZJAA 1LNQA 1USGA 2GZSA 4XZ3A 4Z4HA 5CEJA 3T7TA 1KZ6A 1MN6A 1C9MA 4MJ7A 1YV9A 1XZJA 3KQYA 4Z2YA 3E7XA 1YZLA 4ZDKA 1BC5A 1SC4A 3HL4A 2IPLA 1KSFX 3PTAA 3LNTA 1GZ5A 1RAHA 3HKBA 4XCVA 5HCIA 2R1ZA 3EEIA 5THKA 3SHVA 4EI9A 3ADCA 4OH1A 4QKQA 1RW4A 4EARA 1CF4A 1QXSA 5ES4B 1Z5UA 4NONA 2IZ5A 1P2FA 1BJKA 2QMEA 2QRNA 4G4IA 1QHNA 1XNHA 1HDYA 1CUDA 1ABEA 4FHDA 4HAWA 4JK3A 4YXWA 1CNFA 3SFVA 3U7IA 5E8RA 2QT1A 4OI1A 4BNFA 2GM3A 4A5OA 3MQ2A 4WERA 5FOWA 1QP4A 2G63A 3O4FA 2GRJA 1BEEA 5JNSA 4DAEA 3ZOKA 3HG7A 2FMFA 4K86A 1A5BB 3N86A 4QBTA 3OFNA 5HOQA 4QBKA 2P8JA 1QHHA 1I3OA 2Q41A 3LGAA 4JOCA 3DLTA 4HNVA 4MVJP 2J3MA 3ESAA 3FOCA 4OXNA 4IG4A 4TZKA 4I9NA 3TI7A 5BSVA 4LCEA 5LYJB 3GAMA 3GBPA 3MPOA 2IOHA 4QYIB 4R8SA 3OQJA 5BVHA 5I6DA 3VZRA 3KWFA 2A67A 3DV0A 3RVDA 4XPZA 4PU0A 2FZVA 3M4YA 5FB3A 1MCZA 2H92A 3GL9A 1YFLA 2XJ4A 1UEJA 4LSMA 3R5HA 5IM4F 1QR2A 1KDRA 1N2EA 2I3BA 2OCAA 2G9QA 2ZK7A 4LXXA 4MZDA 4ZHQF 5L3VA 2G77B 3C3WA 1TAHA 2B30A 3VV2A 3U3MA 3L6BA 3HZZA 4FKBA 1ECGA 1WL8A 3WLSA 3AILA 2HQBA 2IYWA 2IGTA 2OK7A 4NS4A 1E7WA 3TXAA 4BKPA 4KN8A 3MTJA 2ZRPA 1VLZA 3DULA 4MGKR 2GFHA 5EP3A 2AEEA 3EIFA 4EMBA 2AXQA 1ESEA 4L9AA 3GUZA 4DSZA 2XDQB 1UZMA 1T0JB 3PS9A 3WKAA 2N75A 3V1LA 3BPSA 2CLHB 1USIA 2BONA 2D4AA 5K3FA 4Z4CA 4CYMA 1JWBB 1YS6A 1KMQA 1WB6A 1PCXA 2FN9A 1ISHA 1DRKA 4IO0A 5AI9A 3GMDA 3GRZA 3MFQA 5CEEA 2KQUA 3TX2A 1T10A 2E4YA 3MUEA 4QGHA 1YR3A 3GVCA 4RPGA 1Z15A 4WMLA 4ZT6A 1L4KA 2JCBA 4JBXA 1TU3A 2GEFA 3CUKA 2A14A 3NRBA 1PZHA 4Z3DA 3SF8B 1A96A 3WKCA 2JGEA 5DRTA 5A3JA 1CHNA 2Q1TA 4CCAA 5AVXA 1XDUA 4EA7A 2QTMA 1D1QA 1YA6A 3BXZA 3NHFA 1ES9A 1PWHA 3OZVA 3UC9A 4PBSA 4ZCIA 3ZY5A 4EF4A 1JHQA 2IUYA 1GU7A 5FH9A 1CZLA 3PXXA 4PZCA 1EQ2A 3JYLA 1U4NA 4GLFA 1P1JA 3G8CA 1CY8A 4NOJA 1S3IA 3LW8A 2V65A 4RE5A 4QOGA 3ICVA 3JQGA 5BNWA 3SGLA 4MPRA 1TDJA 5SY4A 2FSVA 1EP3B 1GQQA 3HCOA 4HWTA 4RDIA 1ZUNA 4ZGBA 4AXXA 3DF9A 2R1VA 3IEXA 3A1NA 3KL4A 5C5IA 3TR5A 1EUYA 3IXQA 2R9VA 5JUWA 3ZGNA 3WB9A 2IQIA 4F0JA 2XT6A 2WT9A 3OWOA 2G76A 4FMDF 1O8BA 4GW3A 3SQDA 1ZLXA 1K5DA 3E9CA 2P4UA 3IALA 3WGOA 3R9WA 4HH4A 2WTBA 2DQ4A 3RYFB 2PNJA 1EINA 4J0GA 3K9LA 4CT0A 4FOLA 4OA5A 5KNBH 1KAEA 2OQ2A 3I92A 5A7GA 3LY8A 4LHXA 1II0A 4MAMA 2Y4OA 4TLMB 2F3PA 3E5RA 3IELA 4H3KB 3VHLB 2ZB2A 1ULAA 4QG3A 2ZWIA 3OPMA 2XITA 1V16A 3BMQA 4JSTA 3W5DA 4HH3C 1TYZA 3AM5A 3ZWPA 3BAZA 3LQYA 4KLAA 1PR0A 1RBMA 3QLVC 4O4IF 5LIRA 1A9XA 5JD4A 1F60A 2AF3C 2JEZA 1W8IA 1VQ1A 2H1IA 5H1YA 1LPAB 3W4IA 2RE8A 1SUSA 2J7PA 5F73A 4J7CA 3O38A 1KOGA 1HRKA 2QZJA 3KKEA 5L4NA 1NOJA 3G2OA 3ZS9A 1V5WA 1PR9A 4Q12A 1C0IA 2E5FA 4HYEA 2ENWA 2QRGA 4ZCSA 3PC4A 3NH9A 4KYVA 3PQ5A 2VF4X 5L7WA 3GIDA 3HXPA 3ZNNA 4LV6A 4TYPA 3B9RA 4AF8A 3DOCA 4Y2RA 3MAAC 1M2KA 1X80B 1KPHA 3PDIA 3UQYS 4U7PB 2O5CA 4HMQA 1C0PA 2EYQA 4F2WA 3AR6A 3OFND 2C78A 1B43A 3E58A 5BSMA 2HWKA 2PSJA 1NMQA 2DYKA 3LOQA 3H4VA 1ZH6A 3H11B 1WULS 3SJUA 2IPOA 3VKFA 4F5EA 5BV7A 2CNBA 3Q8XB 3NM6B 4G25A 1KTVA 1RRGA 4PFJA 3OOYA 4J0DA 5DFAA 2AJTA 3ZQ4A 4E7OA 4EQ6B 5KQGA 2CHFA 3MS4A 2X0DA 4NPHA 1QIDA 3BE4A 5C18A 1AKWA 3URMA 2AFIA 4H3VA 5DKFA 2G06A 4C1BA 5JS6A 5HK9A 3HCBA 3INGA 4G1CA 4MUIA 4TKVA 1Q3TA 3KXDA 5FNVA 4ALIA 2JBAB 2YS6A 4FM9A 2UUBB 4FYWA 4KCGA 1P1KA 1FX1A 2C2KA 2O2DA 1IIBA 3QFRA 5GV7A 2H29A 2YZGA 3UHFA 2KSQA 1AH2A 1GCOA 5CVUA 1JEQB 3F9IA 4WXRA 1R1DA 1KQ3A 1AO3A 4DA8A 4FNGA 4MPDA 4R16A 2ZIXA 4RELA 4H35A 2EV9A 2V6BA 4ZOQI 1ZGGA 1VLLA 1XIVA 1NJSA 4WKCA 4OX9B 2MIIA 1RLJA 4K6MA 4B32A 1EHIA 4N3CA 4EHAA 4UATA 3UXHA 2QDXA 3QKRB 3WYFA 4R8KA 4OGWA 6ABPA 1W9MA 3AO0B 2VHYA 3IBFA 4GXTA 4I5DA 1PK7A 2FPIB 2M1XA 4KIGA 1BQ4A 3S2EA 2AEMA 2B4QA 2HF2A 2PGXA 1VPLA 1M6VA 3IT3A 3MC1A 2YXEA 2AFHE 4IWYA 2FHSA 4EGQA 1Q0SA 2FWNA 2JJ1A 3VR6D 1L5WA 2R5WA 1EZ1A 2OV8A 4HP8A 4IV5A 3BJIC 4B40A 4JLVA 1MEEA 2RAUA 2CDAA 2C2WA 4H7JA 4S2UA 5GZ1A 1E0JA 3KLOA 1COZA 5BQ3A 3A4YA 4IP0A 1OWNA 3NAGA 2QD5A 3DG9A 1TI7A 3SHTA 3FIJA 3JZMA 1AZTA 1Z2PX 3VPXA 1II8B 4AWXA 2V0NA 1MJGA 4OHOA 5T6MA 3VZSA 2AQIA 2VSNA 4CQMA 4TV9B 3O3OB 3OZIA 2A0KA 1CZRA 3ZHVA 1J8YF 1SMKA 3D2AA 3OQOA 1F06A 3U7JA 1VKJA 4PLYA 5ALJA 3Q6MA 1Q20A 2XMZA 4IHJB 3EIEA 1AKVA 4AS3A 4TLLB 4D5GA 1FX0B 1E7QA 4BYMA 3RLFA 2BR4A 1NVWQ 2BCJQ 3V42A 3FF1A 5CA0B 1PSDA 2JH3A 4HGNA 4HF7A 1AMNA 1RQNA 4BQRA 3GGSA 3KQWA 4B82A 2G5PA 3GLHB 1E2BA 1SO8A 1J7JA 3TTSA 3A26A 4RHTA 4DLVA 1IN7A 3BIOA 2NUPA 4KLRA 2XQJA 3W1VA 2Q1YA 3R5TA 5JAQA 5T4FA 2D4HA 4HN4B 1CYEA 4TT3D 3SC4A 4KXQA 4IQ8A 3VVCA 2JGKA 5LU8A 3MWJA 2HPAA 2CL6X 2ZCVA 3BD6A 5IM4A 2WJGA 2BC9A 3FZYA 3ZHOA 1JA9A 2EP5A 2QSUA 3IKJA 4GZ6A 4QBFA 4TRJA 2GPTA 4D0LB 2XZLA 4L8WB 1QAOA 2O2YA 5HKBA 3AVPA 2DP4E 4RY8A 3DBRA 3RJMA 5LQJA 4MDFA 4MITA 1DEXA 4RABA 1YRWA 2CFSA 2V5VA 3C8HA 3EXHC 5B30A 5JG7A 5A9RA 2D2XA 4N6GA 3OCWA 2ERXA 2X1LA 1T9ZA 3ASYA 3TLJA 1NBEA 5F3DA 4C2BA 3S3TA 2II6A 2JIMA 4DR7B 2UYOA 1XWFA 3OKFA 2I66A 1H85A 2GZRA 4F5WA 3X44A 4TXNA 2NO0A 3RUEA 3IOCA 3TOCA 2ZUFA 4EGAA 1CUJA 1BS1A 2R7MA 4EITA 1RM4A 3CYFA 2BE7A 1MO6A 3A4LA 3E9NA 4FW8A 1NRXA 2W93A 2D59A 4NZZA 4R69A 4CQLA 1H4VB 2QGFA 1MD9A 3KZXA 3N8IA 4MQ5A 2BFDB 4LY9A 2R8RA 1F9EA 3L7IA 1JSCA 4X8MA 3LVBA 1H2WA 1PF7E 1P5FA 4BMDA 4HNGA 1CJTC 4I8XA 3T54A 5KCMA 4Y67A 3CGGA 1RKVA 3D6NB 4X91A 5CBPB 1E3SA 1RACA 4Y1EA 4LTDA 4PAQA 2PMBA 1W47A 4WBSA 2IYFA 2ZRKA 3LNCA 3PXUA 4LWZA 3HKEB 4LC9A 5B7NA 2DG2A 2AZDA 1IYZA 2EZ9A 2PZKA 3JZDA 3WQBA 1XO1A 2YCLA 3SOZA 1VJRA 5AM4A 3SY8A 3AW9A 4CM8B 1WY7A 3UY4A 1KE2A 1L5MA 1UFRA 4IOLA 2IW3A 1TEVA 5KNDD 3U09A 3D43A 3JQ9C 1P3JA 2OHIA 1O54A 2O6LA 4U02A 4OKNA 3ZK8A 5HXAA 1ZOSA 4UE3S 3U61B 3U62A 3M6LA 3A28A 1U9JA 1KTIA 2OV4A 1M8JA 2DTXA 1Q95A 1KJ9A 1WS6A 1Y8RB 2FPMA 3OFVA 4P31A 4Q3NA 4F5YA 3EHDA 2OXRA 2RC5A 3ZDFA 2M98A 3CX7A 1A8PA 1DIBA 1EK1A 1IEXA 2ZTMA 2ADMA 2Q7OE 3E9MA 5KSWB 1B41A 3H86A 1IQ0A 3FDZB 3VZBA 3IAM1 1PVDA 3KJGA 3R3UA 3CLUD 4QXOA 1OLXB 5CEFA 1SZDA 5CH8A 3TGPA 3WLIA 2YWJA 1TQ6A 2FWIA 3H1GA 3VR0A 3D3EA 3ABOB 3A37A 1CEEA 2W70A 5CXSA 4DBVO 3FJ1A 4FHFA 3AUAA 5BQPA 4AJPA 4YR9A 1IN1A 4Q82A 5BYKA 5DXAA 5DYGA 5CITA 1UBMS 1D7AA 1Z62A 3N3AC 4LI0A 3EMBA 4MUHA 3CUUA 3Q5GA 3T7KA 3DTTA 4MWGA 2ANCA 2BJHA 4CQMD 2B2NA 1BG6A 2ZJBA 4YT8A 3B7GA 3UA3A 1KZ4A 3F67A 3L4BC 1PVVA 1H42A 4G4SP 3GAFA 2BJWA 4NYJR 4R8LA 2X3YA 2X8JB 4F56A 5JZBA 3OOEA 2VSFA 2VQEB 1PL7A 3FW1A 3M82A 3Q2OA 1UKCA 1U63A 5B1DA 5DX1A 4KBYA 4XTRA 4X44A 3UKJA 1NMSA 2RHWA 2JBHA 2PDAA 3FKSD 5F33A 9LDBA 3JQ8A 3PNSA 2M32A 1OU4A 3EEFA 4YAJA 3RU3A 2AQHA 1JG4A 3QXSA 1AZWA 2QPAA 3K0FB 5CT4A 2WUEA 1E6KA 2W83A 1CF9A 2XWPA 4LJ9A 5CAEB 4RZIA 1EFUA 1G64A 2PUVA 9MHTA 2QR3A 4ZCPA 3FOFC 3LM8A 3G82C 4CMBA 3LHDA 4I9UA 4DHEA 2FP4B 1EX7A 1IONA 4O2AB 4UUAA 4D3FA 4DMCA 2FN4A 4RH1A 1HE8B 1X1EA 4FXOA 4BZPA 1CQPA 1JA1A 2CF6A 5B7GA 2P2ZA 3OECA 1NV9A 3GRYA 2AOUB 3UM9A 1NVBA 2J59A 2WFZA 3U44A 2R8PA 3NALA 2WYIA 1NR5A 4JL8A 4D9GA 2P0EA 1UXOA 2IZ6A 1JEOA 1M10A 1VCIA 2OT3B 2WSSA 5AJVB 4DYHA 2CYCA 2AR0A 1Y8AA 5K0BA 1K88A 1S6YA 4R40A 1TJNA 2JNWA 1LB1B 4UU1A 3DV2A 2PT7A 4HEQA 3OO0A 1YZHA 2Q45A 5JZMA 3T7SA 3I01A 5FTLA 3O3CA 1A4IA 2HPHA 1L7EA 2FLWA 2IPXA 3I1JA 4OB8A 3RU7A 1GQRA 1SBZA 2CUNA 3NJ4A 1J39A 1NVXQ 5LJIA 1KWKA 4YAIA 2PUDA 3Q4GA 1XPOA 4Z51A 3CNLA 3WDSA 1R18A 3KM0A 16PKA 5E6RA 5FA8A 4LJ4A 5FQNA 3EVZA 1P5HA 5BSGA 3HJBA 4YPVA 1N5KA 2JGRA 2NO1A 3JWHA 3KZMA 1WXQA 4ZODA 4RAOA 1F8UA 2IKSA 4G5OA 1Z17A 3EXIA 4O5AA 2WQ6A 2VAPA 3GQBA 3PU6A 5LJLA 1FRZA 5ISMA 1X7GA 2XRYA 1JH8A 1V8PA 2RH8A 4N8EA 1EWQA 3OTWA 4NZPA 5ITZA 3DB2A 1K8RA 4PNZA 3UENA 5H9WA 1X7ZA 2PMWB 1N2HA 1OIWA 1J21A 1KQOA 2QW8A 3TK1A 5CLFA 4CKCB 4UUQA 3EA4A 5KTTA 1ILEA 2X19A 4GKVA 1Z5VA 2GK3A 1Z7WA 1E20A 3JD0A 2XCOA 4HZGA 2IHZA 4DA6A 4C0JA 3V4OA 3D3WB 4IJ6A 1JEAA 5ENDA 4AKTA 3RNLA 1QB8A 3ADKA 3JD1A 1JDZA 2JLRA 4RU1A 5C81A 1C7EA 4AURA 4BOYA 4FQ7A 1N5DA 1NJ8A 2QY9A 4AJNA 1G3MA 2QMHA 3FGNA 4LJYA 3EHEA 4CKXA 1P19A 1SVSA 2KE5A 1TM1E 5KTYA 3UHAA 3GGOA 5TB5A 1OIVA 1G4HA 3PSHA 3RTAA 3WSVA 1IH8A 2VP6A 4XRGA 1U1IA 4LV8B 3R5XA 4YQZA 1EVLA 4HY3A 4L22A 1J8DA 1VFNA 4AY5A 3OTGA 1SB9A 3KB6A 4D0GA 3AY0A 2IH2A 2IOQA 1P4AA 3VTFA 2WU8A 3PENA 5PGMA 3PFFA 1EPUA 1E9DA 3HDJA 3MVEA 4QM7A 4D0SA 1YSCA 2KLHA 3FZQA 3HY4A 2X5XA 1HV8A 4NBSA 4TLDA 1YHZA 4QGSA 2H1VA 2VAWA 1SC9A 2J0UB 4HAUA 4KOAA 4RIIA 3DMTA 3VTZA 3CKYA 1NMZA 3W6OA 3QLUA 2IZ7A 4FU0A 3G0OA 4GPZA 3UG7A 3KR1A 4RD4A 5I7UA 3MQFA 3PEEA 3N7AA 4IDGA 1PSWA 2JI4A 5I8WA 2FFJA 3EE6A 1W0KA 1LNSA 3DWIA 1XZHA 2G80A 4PG5A 3L0SA 5BURA 5JH7B 2VJBA 3A6PC 4HWOA 5CCBA 4IV8A 3A6EA 2X9LA 4GZLA 1J1UA 1EJBA 4HUJA 4BQOA 3A1FA 2PBFA 3RVRA 1TK3A 3ZD8A 2OB1A 1RJWA 5H3HA 3AUTA 3IEMA 3DLAA 2NO7A 2VSOA 2BGWA 4JJFA 2HA6A 4XGRA 3SQXA 5K0LA 2D8MA 3F5DA 1Z4KA 4B1FA 1VYHA 2IYXA 5KQMA 2NUAA 2C82A 3OEWA 2Q4EA 1ESNA 1DTWB 1DT5A 2R1TA 3L6RA 1EDBA 2WV9A 2BEWB 4AKEA 2G07A 2V6FA 3CF0A 1ZU4A 3DDNA 3OC6A 1IPFA 1T36B 1YA4A 3HGTA 4MCAA 3IAEA 5EPUA 5HNKA 4QREA 2WSSD 4NCKA 1E9RA 2PYZA 4J16A 4RE6A 3HDVA 3RV3A 3ONEA 2GCIA 3KXLA 3Q98A 3P19A 4G23A 4HK4A 2J33A 1I24A 1S2NA 2Y1DA 4RD2A 4AAYA 2CV1A 1GSOA 3CT4A 3B3QA 4MS4B 2VQFB 1Y3HA 1ULTA 2ZBPA 3BCHA 4AY3A 2W00A 4QDTA 4Z8YA 1TMGE 4MS3A 5GY7A 5CDFA 4D4JA 3GARA 2FDCA 1PNOA 1F12A 4C5CA 1ZM2A 4GRIA 1FRNA 3OIVA 3WQHA 4DIBA 2AC4A 2P75A 1NZDA 2EKLA 2NXJA 3SYTA 5C4IA 1VP9A 3SVTA 5JBQA 4B84A 2XTNA 2VBCA 4KI0A 3UK6A 3LUKA 1FRFS 4AX4A 2C4HA 3V5NA 3KETA 1EUDA 3ZVLA 3VI3B 1UXHA 3HZHA 4MS1B 1SCJA 1H2EA 3MRVA 2PKRA 3A1VA 4FVTA 1F38A 3EFEA 2QRMA 4OGKA 4WNCA 1EGQA 1VG8A 4HB3A 3AKZA 1QK3A 5JNWA 3TLGB 2PO5A 4CL8A 2EZUA 5JCJA 3QFSA 2V9ZA 1T3HA 1GPMA 4D44A 4I1PA 1KHTA 4M6WA 1PX2A 2NUTA 1WCIA 3SZOA 2GAFA 3LDFA 3WYDA 1Z2OX 1ECBA 3D0RA 3R23A 4KH0A 5DPMA 1WG8A 1K0FA 1WUHS 2PTGA 4AX8A 1SIUA 3EZXA 1DDIA 4HAOA 2VL7A 3PQEA 3NVKI 4KX3A 5B7PA 3I2FA 4PGGA 2OFPA 4DJJA 5C2JB 5JANA 4DJDC 5F4ZA 4WWHA 1YFJA 3CNHA 3C4QA 4BO9A 5BQXA 2EJBA 5K8VA 2WKWA 4HXGA 3KSRA 4MH0R 5BPHA 3H5NA 3TRJA 1SHZA 3EDOA 4F2GA 3ZD7A 1K8XB 4YP0A 3QQPA 3ZU4A 1M83A 1IN4A 1OREA 2SCUA 3F7NA 3LYAA 4MYCA 1V48A 3WGYA 1DAPA 4AMUA 2VWQA 2H1OA 3EUAA 1LLDA 2VH1A 3F7MA 2GI4A 1FL9A 1YUMA 3ZS8A 1N78A 1IHOA 3NDJA 4AKSA 4ZOLB 4GEKA 5EFOA 3ZDXB 2FMIA 3SZUA 3D6JA 3BORA 5DTEA 2ERCA 5TQJA 5IRCD 2Z4TA 4BHTA 3IBCA 3M33A 3VU3A 1BJTA 1D3AA 1I6WA 1KK3A 3ZY2A 3RS2A 3H65A 1P0PA 3UAYA 2JD1A 3KWLA 1C7IA 2C42A 4IOJA 2XZOA 1WDTA 5LQAA 1JPJA 2XCSB 2C9OA 2CLMB 1IXRC 1VE1A 4HDSA 1XWIA 3MJVA 3IMEA 1NLFA 4L08A 3ZOZA 3FY4A 2PZJA 1UL1X 3LMKA 3HCAA 4LRQA 4AP5A 5G4KB 3SLRA 2V7PA 2ODWA 4XM0A 3HL0A 1NJ1A 3K5PA 3NUGA 4Y9SA 2AZXA 3F4BA 2Q1WA 3PGKA 5H5JA 3RK0A 4U7DA 4CU5A 3U60B 1VIMA 1I2DA 3OLVA 1AXGA 5MFZA 4V39A 3HBNA 1SZJG 2ZJ4A 3DAPA 4M8KA 5FWNA 2QRLA 1GPWB 1FYVA 3B3GA 4IIGA 3ID6C 4ETMA 1WB9A 1JJFA 2IXDA 2QRUA 3SHOA 1CYDA 3ESYA 5A0VA 1B3RA 5TT0A 4R7GA 5SV2A 4ZI2A 4ED9A 4HSEA 5IHXA 4JLKA 1S96A 4E70A 1CQXA 2JASA 2Q5EA 1C1XB 1YBMA 3T9EA 4V0OA 4FFOA 4JMPA 4C0SA 4D57A 1G8HA 2DBVO 3L7YA 4K8RB 3B85A 2MCFA 4P2BA 1MNQA 3K0EA 4G8JA 3PHHA 3JS5A 1EGAA 2O50A 2PVPA 5ITWA 1QTRA 3P9NA 4EFLA 3IS3A 3K71B 2WJZB 1Q44A 3R0QA 4BUZA 1KY2A 3K6SA 1ZD9A 1ZH2A 3SXPA 2EP8A 3CLRC 1K2WA 3KZKA 1R8SA 3AJDA 4U2CA 3WZLA 5HJ7A 4BRSA 1AVTA 4IF4A 5HZKA 1XK7A 1GP2A 2XCLA 3RHFA 3VMFA 4ER5A 4UFPA 1VMAA 4Z7QB 2F64A 2JFQA 2UYCA 5DRYA 1PJ2A 4FOTA 5CB0A 1V6CA 1UJ2A 2O0KA 3FOAA 4PCVA 1W0JA 3ES9A 2Q8PA 4JIGA 1OH5A 3UICA 4NRDA 3E2MA 3RM3A 1GL7A 1KGDA 1QONA 4WL0A 3JQQA 4CM9A 1HZZC 2DTDA 4ITVA 4RDXA 1A8HA 5GONF 1LLUA 2VSYA 2HJVA 4PFKA 4ZGWA 2W22A 3GDOA 1FW6A 2IOYA 3NHLA 4KH1A 4Y7DA 2BE9A 4N3AA 4ZRDA 5A0FA 4LXTA 1L5NA 4F6RA 3H6KA 3UYKA 3FMPB 2EEPA 4JELA 5EXPA 3MGBA 3U1TA 4BV8A 3LT5A 1PR2A 4GX1A 1R50A 3B2QA 1Z6TA 1GILA 2YJ3A 3PL1A 3O31A 2FG6C 3FPBA 4YUXA 2XUAA 3HR4A 2HJ9A 4QYTA 4A7PA 3TGWA 4CDGA 4ZO6A 2EYUA 3FF4A 1U6KA 2ZAIA 4Y2YA 4MV9A 3SC3A 2HQ1A 1VKOA 1T0IA 5JCJD 1FQOA 1QHXA 4BZZA 3HKCB 3ZV4A 4QPJC 4YQYA 3LF2A 2ZWAA 1PR6A 1EFVB 1QPBA 2ZE6A 1AM4D 3CX3A 3EVNA 3NASA 5DI9A 1G17A 3DZFA 4P32A 2DULA 3B9PA 3LU1A 3FYCA 4D97A 2XRFA 4EO7A 4OPMA 4F5DA 2W8BB 1NKSA 2CMDA 4F2DA 2NVUB 1YJAA 4UM7A 3NBZC 1RAIA 1W46A 4IEIA 4PYNA 4E5DA 2OLJA 4U3JB 2GWHA 3AV0B 4JGGA 2O8EB 2HF8A 4JJZA 1U5CA 2VAXA 1X7WA 5CXQA 4RXUA 1OKKA 1DPFA 2CUZA 1E61A 4E13A 3TW8A 2EZTA 4AROA 1P7CA 3FUVA 3NNNA 1AQNA 4YQEA 4CKYA 2RJNA 1ZUWA 3BSFA 4PPNA 2C96A 1SOWA 2DF8A 2GEUA 2BFMA 221PA 2J5QA 3GUUA 4AJOA 4C87A 3VPFA 4KAFA 1DC8A 4GU5A 3FKJA 3OI7A 3PHGA 3W6ZA 4BMSA 3VKHA 1TTQB 3B6KA 4YMGA 2WWVD 2XTAA 3F5MA 4MRPA 1ONOA 2NV6A 2NVBA 1S8NA 1MOZA 2QG9A 3D2BA 2CXQA 3JAKA 1IHUA 1K6EA 4YWJA 3LIPA 1LBQA 1W1IA 4QUAA 3TOXA 2XUJA 4PYKA 2FMTA 4UTVA 3TSYA 2DQKA 3FIUA 2BR3A 4EW1A 1P29A 1C30B 1R8YA 4MYTA 3FM9A 3WG9A 1Z28A 4YRTA 3BTSA 4I99A 5T8KA 4BUCA 2QP3A 5BSEA 5FV7A 3QSYA 3P26A 3JYQA 1W73A 2RKOA 4UBKA 3UWDA 2R8EA 3SZGA 3CVXA 4PHGA 2ADFA 3IP3A 1Y5NA 2WG2A 3EQ6A 3QWFA 3I9NA 5IDVA 4A2PA 1CUWA 3IE1A 2I2BA 1B7GO 5LZ8A 4PHFA 4ZREA 1CT9A 1MA3A 1JUDA 1QX4A 4JP2A 4RMNA 3O2JA 3FZNA 2IYOA 4LW8A 4FDVA 4OA8A 5AXDA 3T41A 1GKLA 2OFWA 3HJAA 1W2HA 3ZK7A 4NZYA 2ZR8A 3PEVA 3R3XA 5MFPA 3BK2A 1S4MA 2P91A 4QVKA 2Y99A 4TX1A 2ZUSA 2GSWA 3RIGA 1Z2CA 1SU8A 2R3SA 3BDIA 4J2HA 2V8OA 4ZPXA 4C4RA 4DGQA 1UANA 1A0OA 2A9RA 4OMDA 1KFJB 1E60A 3M6XA 1F0KA 2FVYA 1F8GA 1YDFA 1E2JA 3LC0A 1T0BA 4G85A 4QTZA 3L7NA 5B12A 1T8UA 3KSAC 1KAHA 4PPGA 4F7WA 3GLGB 3I61A 4LF7B 3OCUA 1J0DA 1KJQA 3DPUA 3UB2A 5IUJC 1G5FA 1W0JD 5K5EA 4H17A 1KVSA 1EQAA 5D8DA 1SRRA 1FNMA 1T2NA 3CZ9A 2ZP1A 3NKLA 2IK8A 4IIVA 4CM9D 4AECA 1EFHA 1Z2EA 1HE1C 3EW9A 5F7XA 5L45A 1SHTX 1ZRNA 3RNOA 1CZOA 1OILA 5LYJF 2GQ0A 1NMXA 1OLUB 5FCDA 4YRLA 4QDJA 5FUBA 4CN8A 2QTTA 5U4XA 4D1YA 3E03A 3Q7RA 3QXXA 3WL8A 5CVTA 1P6QA 3P96A 1AXEA 1ZL0A 4J6EA 3TW6A 4HDKB 3U13A 2WP0A 1HQYE 3CZCA 1NYLA 3H5TA 4UNPA 1W59A 2GAAA 2UVPB 1PFKA 2ZIZA 2VPYA 5BN1A 4XR4A 4H4EA 4ZA2A 5LOVA 3SHWA 2WHEA 3RADC 2BSAA 1GA4A 2ZWVA 3WGUA 3IUMA 1OH6A 5AM2A 3E9YA 1TW2A 3I34X 4AULA 1W5AA 1SHLA 5DNYB 2HUNA 3DYIA 3X1WA 5IF3A 1IBRA 4ACAA 5AKEA 1QMGA 2ZQ5A 4HTAA 3D9QX 1WW2A 4DG5A 4ZI3A 5C8YB 2AG0A 3CRMA 3TSAA 4A1FA 1BOOA 5FWAA 3U7RA 4EY7A 2PE5A 2A58A 1P4GA 3AL2A 3QVXA 3O73A 4KPYA 1OBOA 4EMTA 3FPCA 2FXIA 3QFCA 1GTZA 2DHCA 1CS4C 2H59A 2KW5A 2C9ZA 1DKPA 4HVTA 4RLSA 3U4AA 4CCWA 3EODA 5IVKA 3QY9A 1YE5A 3PQCA 4W6ZA 1ORWA 2YWXA 3GZJA 1PT6A 3A3OA 2VYND 3KT3A 2QD2A 3OCXA 3RE1A 3ZIUA 1V5IA 2FXVA 1O96A 3NEYA 2ONCA 4FB4A 1L7XA 4DQUA 4M83A 1EAMA 1XA0A 3B70A 5A62A 4QPCA 4BVFA 4DDWA 4UCQA 1M76A 3TAUA 4JVNA 2FZKA 1VCMA 4L0DA 3SVZA 3LA6A 1WZEA 4RGVA 3W5CA 1E6LA 1RBYA 2NZJA 2PQ6A 1SVWA 3C3EA 3GDWA 1P0CA 2FPXA 1EFTA 2AUMA 3LJKA 1AV7A 3Q7QA 1WTCA 3QPAA 4V2IA 5H7XA 3RYHA 2JLQA 2VDUE 2ZLBA 4LV5B 3GJQA 4IVNA 2WYOA 5GONA 5SY6A 4DEVA 2BGGA 4TZ0A 4EELA 4U5XA 3HGQA 1ODTC 2VK2A 3VZQA 4R4JA 5LBTA 3R6WA 4YLGA 5JYCA 1N2CA 3VX4A 5H3LA 1R4MB 1UEIA 1DFHA 1Y80A 4QJ4A 4UEJA 3D7MA 3E81A 4IS3A 3NCHA 5BVGA 2F67A 2Z5GA 4FFVA 2LZ0A 3DOFA 3NG1A 3GNSA 2VJMB 3RVNA 4JIMA 3ZCUA 3P9IA 3OZRA 2B99A 4M9CA 4DMLA 3PVZA 3EQ8A 3VAZA 3E6AA 4NOKA 1XVVA 2PL5A 1N2JA 4F4UA 5AKIA 2WU1A 5J4HA 1CR2A 1P18A 3MYRA 1JKJB 2NTVA 4ABTA 3I6ZA 1ULZA 3KYBA 5EXTA 4W1RA 2A35A 2PX2A 1U2DA 4CIWA 2J3HA 2N1BA 4MA4A 2HA0A 1FJHA 5K0FA 3KYJB 1AMOA 3VR5A 3NTLA 4FC7A 1VL0A 1G7TA 4MW6A 5P21A 4R0NA 3PF9A 2C3UA 3ZNQA 3AT1A 3QBDA 3HXOA 1PS8A 1WB4A 2PH3A 1LSUA 2WD7B 3GLTA 3VM6A 1D1PA 1VLJA 1Z33A 5J1TB 4BBAA 3IDQA 4EUEA 2HO5A 2VJAA 4MR8A 3BMCA 1TQHA 1VIVA 4NJMB 4Q4HA 1IJFA 4EBBA 4K7JA 2XAAA 2W6OA 2ZTUA 2GJAA 1PUJA 3H5AA 2CJYA 3JCZA 3DHYA 3M1AA 5CFRA 3O90A 3C3YA 4FS3A 1US8B 4RY9A 4JJEA 3TVDA 1VMDA 1GDTA 2BEUB 3V8NA 2QROA 3LT1A 2HNBA 1I32A 1KDVA 1H0HA 3CVWA 3BEOA 4IDFA 4PSKA 4BBJA 5AW0A 1JFSA 3CLKA 4BWFB 1QX3A 1F1JA 2X86A 1M6HA 3EZFA 3RBVA 1Z63A 5IMSA 1T1IA 1I3KA 2R65A 2HBZA 4JC8A 4WLEA 1HORA 3GRKA 4RNCA 2FPUA 5LB4A 4DV2B 1OWMA 2CEKA 4NECA 1VMIA 2FJ0A 2YWBA 4G97A 1Y1TA 3GRRA 4WNYA 4EB6B 3RAJA 4F72A 5DNUA 3NHPA 3AIOA 4WN9B 4W9RA 4MHSA 3C3JA 3UK2A 4B3GA 4BRZA 1JI3A 3GEPA 1WA5A 5K8IA 1BCRA 1NKTA 3ETHA 5BWNA 1R4NB 3M5DA 4PWYA 1GQYA 5IW8A 4K9PA 5K3SA 2JB9A 2EFHB 3PQ8A 4NATA 1SG6A 4TWIA 4QU0A 5C3MA 5FDFA 1V7PC 2QPLA 1CWUA 1ZI6A 5FBZA 3IHKA 2XE6A 3UJ6A 3B3JA 5KKNB 4D92A 1JECA 2B2CA 3LS2A 3ZGOA 2Q5IA 3CG4A 4ZWNA 1SVMA 3IT0A 3K7EA 3ND9A 4FLEA 5KNCA 3I0MA 3SR3A 4IKOA 3BK7A 5HRUA 3PR1A 4QDKA 5CH3A 4F4IA 2IEAA 4RSGA 3RJZA 4IFIA 1Z47A 4URZR 4JCCA 3TNLA 2V0GA 3LTNC 4NK4A 1U8AA 2LR0A 4DV5B 3PEYA 3B1XA 3KTFA 4LXYA 2ZQZA 4UCFA 1UDCA 3CF4G 4FHEA 4ILKA 4PAOA 3HEBA 2YOFA 3I52A 4RD6A 2CT8A 2WZBA 3HS3A 1JNYA 4PZYA 2OC4A 4OHRA 2VCYA 1VXRA 3EBPA 4XX0B 3VNQA 1NPYA 2A1TS 2XKBA 3MAJA 4KYTA 5JC1A 3UJNA 3EC7A 4R9NA 3AV3A 2ZXFA 1ULBA 3DOJA 4JODA 4TV9F 3TRKA 5F23A 4DR4B 1YONA 4JS0A 4QOSA 1LI7A 2Q3DA 1DI0A 3DHEA 3IOEA 2ZYIA 2W43A 4LOKA 3TSOA 4IHJF 4FTWA 2YWFA 3TW4A 2R8ZA 3DL0A 4Y30A 4ADSG 2ZTVA 3EUWA 5CA0F 4G0NA 4HAXA 2I3AA 2NIPA 5LYJA 3ZZNA 5B3LA 2A33A 3NBAA 4QYIA 3KT8A 3WNQA 4B4OA 2P6PA 1G5TA 3KOWA 3NPAA 5FR2A 3E27A 2ZIAA 2PTHA 2RH9B 1GG8A 1ZUHA 3JVEA 1BWPA 2GTIA 3HACA 4UAJA 2XVXA 3D6TB 2NO9A 2R4TA 3UTDA 3ZIAD 4HQ0A 5DLEA 3WSTA 3DW3X 1A9ZA 4NULA 4ZICA 3E7PA 3ZD9A 2OLEA 2PZBA 4QOFA 2GJKA 1XMJA 2GEKA 1EVKA 2VSQA 2Z2XA 2YZ2A 4PZEA 4PN3A 4BO1A 2O7VA 1W49A 4N40A 5EIOA 2DY1A 2YJ6A 3PG5A 4K40A 1NP6A 2ZSKA 2IFTA 3LCVB 1WTAA 4I1OA 2E4UA 1NX6A 2C61A 3COYA 3GPDG 4D6XA 5TMPA 4HDMB 5FX2A 4H6PA 3O8QB 1NUSA 3N1UA 3QENA 2XDQA 4C4XA 3O1HB 2EU8A 3L43A 4YLYA 5JASA 2Q9CA 5CDGA 1H5QA 1UF9A 2R6AA 3F9CA 1FP2A 1FDWA 4E1VA 2HW8A 3EW7A 4K1LA 5LQUA 2XMCA 1LBSA 2WAAA 4GC5A 1XLWA 4I6JA 4GG1A 4MVWA 5SYMA 4W4TA 3SEAA 1B8VA 4YFVA 3ROXA 3TOVA 3ON5A 4C03A 4E2WA 4QUJA 2BKVA 3D8UA 1UZNA 1W4AA 1JG6A 3PHBE 4TL8A 4GICA 3UMVA 4FI3C 3E7DA 2B78A 1JL3A 1TO1E 2Q4BA 3DR3A 3F3SA 3PQ3A 4Q1DA 5JLAA 4AMYA 3BWCA 1Q50A 5K0EA 2I6UA 1T4GA 3T4PA 5EA2A 1X9IA 5FLXA 3ZY6A 5HYVA 1DAMA 2G7MC 4BMXA 1WSAA 4LJKA 4XGQA 2DR2A 1KFEB 2RGCA 4ZVUA 1ZVQA 1F6DA 2VWHA 4JI0B 3HP4A 4WRRA 4CT5A 2IF2A 3IP6A 1WAMA 1NMEA 2DCUA 3HWX1 1LPBB 4B74A 1JMVA 5I4CA 4IQ0A 4A5SA 4MXDA 4YRCA 5JBIA 5TE9A 4CRWB 2COKA 1HMPA 2A9FA 3O2QB 4EHNA 1RP7A 4G36A 4O0MA 4X8HA 5JD5A 1RXUA 2ZB8A 4MYDA 5AVVA 1ZW6A 5LQKA 1G7RA 2XCIA 2BF4A 3T3PB 3X1KA 1AQLA 1V8OA 5G4LA 2CK3D 1MBZA 3EWNA 1SUIA 3EFOB 3RYFA 4GKAA 4CUJA 4QT4A 3NWEA 2AOXA 1HM5A 2Z0MA 1XNQB 4L4RA 3V3KA 5KNCD 4ZTZB 1JHVA 2W11A 4EYKA 2Q3BA 1HK7A 3K2IA 1Z38A 2WDZA 3PCXA 3T5BA 3RUIA 3BEDA 5KOJB 2I34A 3SIPA 1OZ0A 1Q0QA 5ADVA 3KKKA 3LCCA 3NP7A 1DBIA 2AMJA 1KRWA 2ZUCA 3GLHE 4ENWA 4W9MC 1Z06A 1GZ6A 4BKMA 3EF3A 4K9DA 1HDXA 3C74A 3IQWA 4CLHA 1CP3A 1DMSA 3QX3A 2GO1A 2H48A 2Y8EA 3OM1A 4BPBA 3TQOA 3AKCA 4YREA 4AO8A 4LWQA 1QJCA 4K8OA 1O6FA 1TJ3A 4XB2A 1GZ3A 3GT0A 3GP3A 3IUSA 1EMDA 3ABRB 1ZOLA 1X80A 1PUIA 4PC3A 4ER7A 5HM8A 3AEXA 1QRUA 1XA3A 1P39A 2B35A 3NVAA 1WQ3A 3A58B 3A3NA 4QXRA 4DYVA 2BKEA 5CTAA 5EE5B 1U2PA 1XDSA 5C4MA 3H11A 5IKXA 1JPVA 3I04A 3CKLA 2JAPA 4LY3A 3S5UA 1JGTA 5IG2A 1VP3A 3RB8A 1CRZA 1CDDA 3OEEA 1N1MA 1MP0A 3GI1A 2V74B 4RW0A 2J3LA 4XH9B 1ZIPA 3TNDA 3UGTA 1TK2A 2W2QA 3AUFA 4C6TB 5FI3A 5ICEA 5LBUA 2YMPA 3B20A 3W4KA 4B3XA 1YL7A 4KHZA 4DM4A 1JDJA 1ZSYA 2BMWA 2DWOA 2OCGA 2RHRA 1G5RA 2RK4A 3GG2A 3KSDO 1BHSA 3O7MA 4TWAA 3WL5A 3AF5A 2XUQA 3IDOA 2JBAA 1NXPA 2BBOA 3AUUA 4GBGA 4JH0A 3D3QA 1WQ1R 4KR2A 5TARA 3GROA 3OJXA 2J30A 3R20A 1R0BA 2JCVA 3G0IA 2D2IA 1JEQA 1FMJA 2HZBA 1GUFA 3IE2A 2B9EA 1UUFA 2IYQA 2W2KB 1IJBA 3GVXA 3OPYB 5ALMA 5HTKA 4PAGA 3N2IA 4ZVQA 4ZEWA 1TYAE 4RKFA 5G0WA 4QYMA 3RARA 1U1GA 5HKLA 3MRSA 1RJDA 3QKRA 3LF1A 2VDRB 2PUJA 2QM7A 3HUEA 3LLVA 5EHQA 4CNBA 4YCMA 1V3QE 2FLVA 3ORFA 1LY1A 2FPIA 3C3KA 4LI3X 4RD0A 2W71A 5FUVA 1G9SA 1ORHA 3Q7TA 5PNTA 3CEJA 1IUKA 1OHHA 2F1OA 2GKGA 2QTHA 1PWXA 3QEJA 4QOJA 4BNGA 4MYHA 4JFAA 2R44A 4U6SA 1PL6A 1IY0A 1PJ8A 4RTMA 4K9QA 4BJ5A 1HOTA 4BFSA 1CY0A 3ND5A 5HBGA 3WYNA 3UAVA 5MDHA 4KN5A 1CY1A 3H4IA 4IWXA 1QVRA 4YRMA 1II8A 1QH1B 4B4UA 3U4MA 4J4TA 1PJRA 1Q6ZA 1KEVA 2VUIB 4TV9A 4E5NA 2MYTA 4IRUB 2BM0A 3I72A 4IILA 5JWHA 3GLFE 4EI7A 5G1PA 5KC8A 3I64A 3WY9A 2RIPA 1S8FA 3IOBA 3D81A 3EGWA 3PJDA 2HN9A 4TOIA 1CPYA 1HO3A 1SVUA 3FUXA 1NA5A 2JS7A 2NNWB 2O0HA 4IHJA 1G2OA 1MJGM 4KZPA 1FX0A 4YMWA 1RXEA 2OZPA 3LL7A 3ONNA 1I14A 3TQCA 3WL4A 4MQFB 1TOAA 4MP6A 3O1JC 5CA0A 2VHTA 5JRZA 3NW9A 2QTZA 1P1FA 2VP9A 3TN7A 1J0CA 1YULA 3GLHA 1KVUA 5KJ1A 1YE8A 4M0LA 3LHIA 5CJ2A 1IM2A 2NU8B 1XTSA 2C3PA 2KS6A 3L1JA 2FE1A 1N57A 4HWGA 3U3XA 2WWFA 5B3JA 3GPIA 3N7UA 3MJ4A 1Z0JA 4U1RA 4INOA 3T5PA 2GZMA 1XZCA 3CRZA 2WTXA 3DMGA 3E5NA 3ZQUA 3E53A 4ER3A 1M6NA 5FT9A 1MG0A 1LRJA 4ZP1A 3N0VA 3AM1A 4PRYA 1D0SA 2CNOA 2WFMA 1N3IA 2IIQA 1HT2E 1XZIA 3CZAA 4M7OA 2JIZA 1A95A 3GRCA 1PZXA 3GRPA 1Q3KA 5ICMA 1A8QA 5LLDA 1TTHA 1TRHA 4ZVVA 1NFFA 4GQAA 4LY0A 4N5IX 4Q15A 1NBAA 2BVNA 3ECAA 5KTMA 3AFIA 4MCHA 3FGPA 3HFGA 1GNLA 3RREA 4GI5A 3T7AA 3H5IA 2C8VA 1Y5LA 1E62A 4MZXA 5DX8A 5TQVA 1K7SN 2OSVA 2PKQP 2NYUA 4ER6A 5AIBA 4QPPA 2IYLD 2VS1A 2GK4A 4YB8A 2ZI4A 1U7HA 4QRIA 1HC7A 3AIMA 2X7HA 1TZCA 4UEOA 4U2KA 4X65B 2H51A 2BFDA 4BX8A 4EHKA 1QFMA 2E89A 3I8SA 1XCJA 2JLSA 2XD4A 1QRAA 3DV9A 2EBFX 3CEAA 4JD5A 3FPKA 4MINA 5BSUA 3S2SA 3UXMA 1VRWA 2RAPA 3D5TA 4RANA 1XQXA 1ZGAA 3BFPA 5CBPA 3VH3A 1LTQA 5B1HA 2XTMA 3O9MA 4ENVA 1ULHA 1C7FA 2E85A 4IHQA 1NNSA 2UYQA 2QKYA 1U0EA 3LFHA 5ANRB 2WJWA 5JH7F 3BC1A 3DKRA 3HKEA 1KFBB 2JI9A 4NV0A 1VGQA 1Y98A 3M81A 5ADWA 4P98A 3EPKA 2R87A 3QPDA 1GTSA 4BMCA 4ND1A 5FBLB 3WRYC 1BVRA 4S1OA 5EIFA 4J07A 4CM8A 4PO9A 1OZHA 1L5FA 5F7ZA 2H7VA 5GIOE 5H9VA 3O4RA 3KKZA 3TAHA 2IEYA 3QXGA 1VRVA 4O4HF 4K88A 3WLJA 3GGDA 2V4UA 4KO2S 2WVGA 4MQEB 1AD2A 3AHGA 4PCUA 5EIAA 1Y8RA 2ZSIA 3LC7O 3E5MA 2QDKA 3HR7A 4RH3A 3L06A 4RDCA 2XT9A 2BH2A 2ZJYA 4YMIA 2X2EA 5KYNA 5DT2A 2FYTA 3BREA 1QU3A 4MIEA 2FWMX 5BWBA 3QU7A 2C5FA 3FJYA 1XQ1A 3FDZA 1N6PA 3N0RA 3QPUA 3KOZA 2J4FA 3O6VA 2RD2A 4U3JA 4CEHB 1JU3A 1OLXA 3PPVA 2NW6A 2QRQA 4RTPA 2V7VA 3A6DA 1S0UA 3IIKA 4RQAA 4XIFA 4BFLA 2P2YA 2PGIA 4MLPA 1Z4PX 2PWPA 4EH1A 2Z09A 2PBZA 1E3LA 4EA8A 2BUCA 1ZFNA 2RGAA 3WLQA 1MAWA 4C2AA 5IDXA 4IVQA 4FR5A 4DCOA 4CF5A 4UVEA 2XRMA 3WO0A 4C3VA 3B7PA 1QCDA 1J70A 2BEVB 1ODLA 1BW9B 1KMCA 1QDEA 3AEQB 3F8TA 3LGXA 2X8JA 3QI2A 5JADA 5L95A 2I1LA 2VJOA 2G09A 3V8BA 2QAGB 3Q1LA 3IPXA 1NUQA 5E7IA 3TOSA 3U3DA 4EX7A 4WKOA 3AI3A 2VBIA 5EEGA 1RMYA 4YJGB 1V5FA 4A0RA 1Z0FA 2ACEA 1XKXA 2O23A 1IN8A 1P4JA 1ZVKA 3EXEB 4R05A 4L3WA 4P5PA 5CGQB 4ZDWA 3JYHA 3CCBA 1SBNE 3K0FA 3RC7A 1JLLB 4KQIA 3ANMA 3OMWA 4RF4A 5CAEA 3O8NA 4I5IA 2DXIA 1SVNA 5E0KB 4DA4A 3DXXA 4PO3X 1AS2A 2WM3A 5JAHA 1W5FA 1SA0A 5JZ9A 2FF5A 3BERA 4IRMA 3EC2A 3HC7A 4BCBA 1JLMA 1H66A 3KVOA 2SECE 4V1CB 1VPDA 2PJRA 4W9NC 5EKUA 4FE7A 4O2AA 4R84A 1KYZA 3M7IA 1L8OA 2HOQA 5FL3A 4BUJA 1WR8A 1V45E 1XSEA 2HK8A 4ZOLF 4RO0A 2AOUA 3H16A 3OCJA 1JSLA 1JNXX 1U31A 4YRPA 4D79A 1RJEA 1X8KA 3TSCA 5G3ZA 4TROA 2R25B 1C4XA 5E95A 1J2RA 2V7EA 4FR0A 4BC1A 1QHEA 4JLSA 5EVJA 2AV6A 4LRXA 4CEJA 3EXAA 4CQNA 2IXAA 1JWLA 2J07A 2Z4SA 2CJWB 2ZWMA 4R1LA 2Z43A 4N6NA 2H06A 3GQVA 3C6ZA 4UTOA 3BGSA 1O95A 5B1SA 3W8EA 3FAZA 4HQKA 4G1VA 2WLTA 1I2AA 3ZZUA 1A97A 3TYXA 3FTPA 2VTVA 1XROA 3ME5A 3BOSA 4DXDA 2VP2A 4X0EA 3QXCA 1KJWA 1NJGA 4Y1FA 2F2TA 1G3QA 4PQFA 5G1OA 3T52A 2JGDA 1T5DX 3AIKA 1XN1A 3F7OA 2AG5A 3RTDA 2IVFA 4HLUA 2HMAA 2P4QA 1HKHA 3LDGA 3NEAA 1EWVA 4JOBA 4L76A 1W48A 1RNLA 5CNKA 2DUNA 2VP4A 1I30A 4CMEA 2BMVA 2AQKA 2J9GA 4WD3A 5BSFA 1A7AA 1M6YA 4FUTA 1SPXA 1MQ9A 1WDWB 1V11B 1HT3A 1OUMA 4M49A 1CUCA 3UWOA 3W2HA 1P60A 5G3YA 3IAXA 4C01A 1XTTA 3BFKA 3FYUB 2HD4A 4CKCA 1D9XA 2BKLA 3H6HA 1NW6A 5JI2E 1Y7HA 2IBMA 4DYDA 2LIVA 1REQB 1K2VN 3NATA 3RSQA 4BZQA 2GJ4A 5AW5A 2F43B 3OPNA 5FLEX 2ZJ5A 4U7FA 3D3WA 3RSFA 3CN7A 1X1BA 3QKTA 1KO8A 1MA0A 4CI0B 2PQ0A 4OM7A 1GL3A 3QYFA 1FSGA 4N7BA 4WASA 1E2DA 4TYMA 1QGOA 3ANYB 2JFHA 1EK5A 3C4JA 4MA0A 1E2PA 2VF7A 4N8SA 3QOYA 3DKVA 2F17A 3OZWA 3OP4A 3PRYA 4EVRA 2YWCA 5KSYA 1T13A 3AINA 3D59A 1TVMA 4ZVOA 3CLVA 1NVVR 3AR5A 1PJBA 1G55A 4XLLA 2ZSEA 4RYDA 4JITA 3WYAA 1CHDA 1TW3A 5C8VA 2ZQYA 1FPQA 2HNKA 4RVCA 4DLKA 1RXSA 2VDMB 4M98A 2O8CB 4EY6A 5ICCA 2WVHA 4YDSA 4PQYA 5KZMB 5LFAA 1IWPB 3QW4B 4WHMA 4W5OA 1HQDA 5ECYA 1PT5A 2ZKLA 1ISSA 3HNPA 2I2DA 4J90A 3VXKA 2Q1UA 4BLOA 5LN1A 2JG3A 1XDBA 1IC6A 3UAZA 3UJBA 1BTOA 2HRRA 2JHFA 4Q18A 5F21A 3T6KA 4BNKA 4POOA 1IVSA 4O59O 3PQDA 2QZPA 4I8IA 5AKHA 1SVIA 4U8GA 2OENG 4GS5A 3FR7A 3MJSA 1EFDN 2J0UA 4NI5A 4NAVA 4TXLA 3I2KA 1UT5A 3OPQA 4M22A 3TTYA 3A14A 1MMFB 1CUYA 2XUDA 5BR4A 5BNZA 1EUZA 2NZVG 4LY6A 2PNFA 3ZWAA 4OYYA 3DAOA 3QKSB 3JQAB 3CTPA 5K09A 2AN1A 3NAZA 4G4JA 3L7OA 3PWKA 4GNRA 3VDXA 1YJQA 4PLCA 1A9YA 1XDDA 4DM3A 2RH4A 4OSOA 4X84A 5EHXA 4G9EA 1GNVA 4GIBA 1BAPA 1KERA 3LT4A 2K4MA 3VJRA 1NMYA 2BFEB 3BE8A 5AI5A 5E9QA 1RWBA 3TTTA 1PZNA 3W3ZB 3H8JA 3CF2A 3PUWA 4AMVA 3TMAA 2PR2A 2C3OA 2D3WA 4MR7B 2XCRB 1SXGA 5H83A 5AQEA 4WV3A 2F6RA 3PGVA 2CWDA 4RLQA 2I4NA 2Q5CA 3EIQA 3RFXA 4Q01A 4DLWA 1A3CA 4R2HA 3MHTA 2H5IA 1U0SY 1DTWA 2BWJA 3BGWA 3I6YA 3QUBA 4TUYB 2OBYA 2BEWA 3LBAA 3I37X 5DDIP 5CDUA 2C9DA 3L7KA 2V8BA 1BEUB 1T36A 2CHUA 2FPLA 1B00A 5K0JA 4RETA 4YRFA 2FW1A 1YQ9A 5EMLA 1Q22A 1QHSA 3CNEA 2IXTA 3EK2A 3TDKA 2A9PA 1R9JA 1DJQA 1VCHA 4LZZA 3VH1A 2W37A 4MS4A 5BN4B 2GEVA 3AESB 2MMCA 3L40A 1O95D 2HHCA 4RTKA 1RYFA 3GG9A 4CZ2A 2W4MA 4NFHA 1OR8A 2GFQA 4NMHA 1SU7A 1Y1KE 3RKSA 1XRPA 1WZ2A 1THTA 1X3LA 3FROA 4J91A 5KWJA 3IILA 3VA7A 1CZUA 3U1VA 1Z5NA 3NQ41 3OU2A 2PIDA 4P7BA 4OIMA 1Y4AE 1MB9A 1K08A 2YMQA 3JD3A 1A82A 3NGMA 3OHPA 4MX8A 1GFIA 1FMTA 4MW0A 3WLHA 3ZQKA 2POQX 5F9MA 3TQRA 3QNUA 1K6IA 2GD0A 2FSGA 1IJKA 3OESA 4GQIA 4Q34A 4W1QA 5ALGA 4F04A 2JIRA 4ZFNA 3DGEC 4MS1A 1CX9B 2H31A 4K28A 4FHCA 1PJ4A 4IFTA 2OORC 2XCUA 2VH2A 4X20B 3TLGA 1P74A 3TG8A 4C0XA 4FYXA 1OLSB 3PD0A 1P75A 2VN8A 4OUDB 3T94A 4AJ4A 4BKQA 1T1JA 1I33A 2LE0A 1E3IA 2HMSA 4N0DA 1ACLA 2BM8A 3O74A 3M5PA 3JTMA 4V0LA 3FVQA 4F12A 1TEHA 2JIOA 1KDTA 1XV5A 3UO8B 4AYXA 5L3RA 3I2GA 3I2JA 3WZ2A 4LRYA 4PO8A 4JBGA 5B53A 2AYXA 3A9CA 1YS9A 3HSSA 3DKIA 3DE1X 5CGZA 3LK7A 2X5KO 3OEHA 1BA2A 1B4DA 4URWR 1Z0IA 2AWNA 1U0NA 4KQ2A 4ZHSA 3OTQA 3E70C 5F1KA 2QN7A 1OC2A 2X5JO 3N6XA 5IEBA 2YY5A 4Z1MA 1N34B 1MGPA 1QIHA 1QH0A 4PIMA 4RJJA 4I19A 3WLRA 3FFAA 4ZOLA 1B74A 3BTVA 3RRNA 2D1QA 9GPBA 1XEFA 3ZLTA 1T3TA 2REOA 2XX3A 4ERXA 5IJ0B 2C97A 1U9YA 2OD9A 2PRJA 2KLBA 5IYZF 4R1UA 1CQWA 3W5AA 3A05A 4E08A 4AYTA 1RP1A 3TUJC 2DX7A 2VHEA 4QHTA 3J81k 1YH3A 4IGEA 1UZLA 2H7XA 1QQAA 3K4PA 5DBHX 3WZMA 5T3YA 1V4BA 2PQ2A 4NMWA 1RAEA 5AW9A 1B6RA 5G4KA 4QUDA 1P33A 2JLAA 2YWHA 1YS4A 4LXHA 5BNFA 1QG4A 2Z2JA 2XYHA 3WJ7A 2PUTA 4COOA 3HV0A 1UBKS 1WSBA 3FPHA 3G2PA 3IVMA 4IINA 1ZVVA 5GJCA 1Q0PA 2EJUA 3HSKA 2H54A 1P6UA 3WGZA 2O1SA 2ZCJA 5EXXA 1RU3A 1Z4NA 1UODA 4J8PA 5AUQA 3H1TA 4L28A 2FH5B 3W1EA 2XUPA 1WDKA 2GK7A 5C8YF 4D9BA 4MUYA 4P0PB 4LYDA 1DV2A 2WWWA 2RHDA 4XSGA 2XSZA 3AI7A 4CG0A 1JS1X 1C1XA 1ZKDA 3GRAA 4G0MA 3G8YA 3HB7A 5E2AA 2NPFA 3KQKA 3K09C 2CBZA 3EIHA 3G0CA 4MW1A 3RIEA 1KXZA 3BBPA 3ND7A 2R60A 3P5SA 1A5ZA 5D7BA 3WDLA 2RGDA 2QSYA 2BELA 2PG3A 5T4EA 1YCDA 5EKXA 5E3IA 3HVJA 1N7JA 4N1AA 4BV2A 4NBTA 2VWPA 3K8ZA 4JBNA 4K46A 2FAXA 5FV4A 4FDUA 2ZVQX 3TFQA 4OIFA 1HDEA 1RYBA 2FFBA 4O4JB 5DSZA 1T2FA 3MPUA 4IVPA 3BH0A 3CONA 3GY0A 1I2BA 5ALNA 2FQYA 4P86A 4GYWA 4BV9A 2EQ5A 5JPIA 1PBTA 3BRSA 2P7IA 3EN0A 3UQZA 4ALMA 5KU7A 4D82A 1AF4A 1L7VC 3PPIA 1E9EA 5DCYA 1VHJA 2P2DA 4L74A 2H4FA 4Q7QA 5LD2C 3G0DA 1SQSA 4G9BA 1W76A 5ESWA 3REGA 3M4NA 1TLLA 4R51A 3NHAA 3TR6A 1VL8A 2GJ8A 1T0HB 2DR3A 4DABA 4EOGA 3N2EA 3GMIA 1SM4A 4NX2A 4ZYYA 4QXMA 4A8PA 4S1PA 3SFZA 3N5CA 4QPDA 1KK2A 3PRKE 4UKDA 4IR7A 3RTGA 3AOEC 3S99A 2OP0A 3EWAA 3RCBA 4PLPA 4RF3A 2C5BA 2GKSA 1JVNA 3NKVA 1B1CA 4MR9B 1NRWA 1TLFA 2NO4A 2RI1A 2ZUVA 2JGAA 2QT9A 3HKCA 3G2KA 4FJ0A 3THYB 3E0QA 1O3YA 3KAJA 4J0JA 4K9LA 1EFVA 4KQMA 2HRDA 2Q46A 4MVJF 4YCJA 4AXBA 5ALFA 2Y76A 3C43A 3KB1A 2HQSA 1M2NA 3A1SA 4PYOA 4PNEA 3L8YA 2V58A 3OUTA 5ALZA 3ITDA 5IBQA 1A9RA 1XLTA 1K0UA 2W8BA 1KYWA 4Q3EA 1ZH4A 4AUNA 4BATA 4CNQA 5A4MS 2NVUA 2Q5HA 1B16A 1ARZA 4RENA 4RJTA 5K6RA 2ID8A 4MGIR 1BXGB 1YASA 1NE7A 3BJEA 2CSUA 3LQ4A 3NX4A 3GJ6A 3OEHD 2EAUA 1YR1A 2WIBA 1NGSA 1DC7A 3P94A 1OWOA 4IDQA 1J5EB 2O8EA 2G6BA 1CF2O 2I6TA 3AG5A 3MAGA 1WJGA 1PR5A 2E7ZA 2Q3CA 2BV3A 3BWEA 1EX6A 4XUCA 2QI9C 4Z1MD 4OP3A 3BILA 4A8TA 4LFCB 4MWDA 4RK5A 3WIEA 1NTOA 1RJFA 2WYWA 5AW4A 4KLZA 2PMFA 2VLBA 2CD7A 3DEYX 3KQVA 1ONSA 4KKXB 2F4VB 1E1LA 1JRLA 2YICA 3EVEA 3HVUA 4HPJB 2DJ5A 3R74A 3GEMA 2AUTA 1ZWKA 1RJ9B 1L9XA 1PW7A 4OG2A 4MP3A 4KXLA 1T5HX 2JLYA 1T9HA 2CFIA 5DLPA 2V5UA 3ZYCA 3O21A 1RWWA 2J67A 4TYNA 1HYQA 3WNCA 2XYPA 3VC2A 4BNZA 4PYMA 3D54D 3EDRA 5ESDA 4E4YA 3SNHA 2PLRA 3SLKA 1TF7A 2EIXA 1C30A 1LFDB 1XHLA 3BKXA 3OUUA 2B37A 2ZTLA 2XQFA 3IUEA 5JJCA 1BVUA 1GKKA 4DB2A 4B45A 2YKGA 3M6FA 4UFOA 5IJZA 2BPOA 1ODCA 1APBA 1QO0A 3R0XA 4HAYA 5ALHA 3SM3A 3ZDYB 1VJGA 2DY0A 2PSSA 3C98A 1EA7A 1GLGA 1SNYA 3D3JA 4Q7JB 5DNWA 3FRHA 4O1HA 4BNLA 3QIVA 1TAUA 3E9QA 1IBLB 1JAIA 3MTEA 3NDIA 1RQGA 4Z9BA 3TQTA 4KMOA 2OECA 2DERA 2CFCA 2XSZD 3DFKA 3S2GA 4D3XA 1UZAA 1WHSA 1X1CA 2HQRA 1X94A 2V7BA 2YFKA 5TF0A 3D6HA 3EMKA 2FUCA 4DW8A 2QXTA 4ND8B 4B7CA 2UUCB 1V96A 2X9GA 1E66A 3L6DA 4X7RA 3RC2A 3UFXB 3EH1A 2G1PA 2XMDA 3VR6H 4YCBA 2XOKA 3EAQA 1ICIA 1UK7A 1X1QA 4FZ3A 5LA6F 3ZI4A 1DWUA 6ADHA 1GG9A 2EWMA 4UXIA 4Q3KA 1JZTA 3A1UA 1MIHA 1OZAA 3K4HA 4GOJA 4ISCA 2JRCA 4BO0A 5L6MB 3UT5B 4WPGA 3C7KA 1NULA 4GGMX 1FXWA 4O2BF 2VZLA 1V6SA 3GLGA 1MAHA 1M66A 1E8DA 1ZIXA 2IP1A 2B0CA 2D62A 3KO8A 2VPZA 2YWRA 2MSDB 4KFUA 2JARA 5CW2A 2YVQA 1BDJA 3LLSA 4WY2A 1Q1EA 4WK6A 1GV0A 5IC6A 1E9AA 1PKEA 1HYGA 4KFRA 3VSAA 1XCOA 2BBWA 3RU2A 1OLUA 2BUBA 3H1EA 4OLFA 5EERA 2DLCX 3L4KA 4TLAA 4CTOA 5BSHA 4MV6A 4KR7A 4S3MA 5BYJA 1N2ZA 1QTIA 1UBNA 3EAGA 4TMKA 1K8ZB 4HYTA 1BS9A 8AT1A 5B1EA 4RK0A 4TM8A 2JDIA 4HDKA 1MPXA 4MW7A 1O6ZA 3FCYA 4IIFA 4M37A 3M3DA 2EGUA 5JNLA 2O3QA 2UVPA 3MWEB 4V0SA 3KKOA 3RAEC 4RS3A 2QQ0A 4X90A 3IR7A 1W29A 3JSAA 5FUYA 3IUNA 4Y6GB 3H2YA 1NASA 3R09A 3NRJA 1ZEJA 1GITA 2R8BA 4GLBA 4LECA 5L6LB 4ZAWA 1EUCB 1R00A 1XHEA 1VJTA 2IHKA 4KVGA 5K2OA 2HA2A 2G71A 5B7QA 3IEKA 2JFXA 5C8YA 3G9TA 1Y6QA 1H6BA 4W8GA 3ZEAA 3TQQA 4LHWA 3LBFA 1A76A 1H4QA 2KWIA 3GBVA 1TCCA 1C3LA 1QPGA 1YZYA 5LWHA 4LYYA 5HDQA 3RFUA 3CW9A 3YASA 5I7HA 2AMYA 4B31A 3ZZTA 3FMGA 2J6IA 3OOJA 4LNUB 4KQEA 5IVPA 4MVJG 3IQZA 4PLVA 1QFZA 1LFAA 2VTEA 4XYGA 1ZNYA 1H2AS 1OPXA 1T5IA 3Q0IA 4JGIA 5ALSA 4CI9A 4BCDA 1G8MA 1U98A 2BR5A 3IAUA 1TZMA 4RXMA 2H4ZA 4ZOAA 1F8YA 3IP5A 5JXGA 3OY2A 1QS0B 4DCPA 4UVIA 4H16A 3OCVA 4HGPA 3EF1A 4RACA 4DMMA 1H1TA 3DBOB 1C8BA 1WM1A 2WHYA 1HFJA 1WXEA 2XXAB 2VRCD 2WJIA 1I4DD 4LRWA 4V03A 4S24A 2F1JA 3PGA1 2PL1A 1PS0A 5ARCA 2R2GA 1A2QA 4JWTA 4B09A 5BR1A 4RTJA 1ODKA 4W5RA 4KGDA 2DPLA 4DPLA 3HP7A 5ES3A 3WL6A 4KNVA 3R7BA 3T5TA 5KNDH 1R4MA 2WSBA 5DHPA 3CWCA 2H2DA 2WABA 3U80A 4NS1A 2ZUBA 3V6LA 2VJMA 5KOHB 1UMCB 2WUDA 3IUYA 3WGHA 4MYUA 2NYVA 3NB0A 4HS4A 3KSMA 2QN2A 2YS7A 3E61A 3Q5EA 1DWPA 1JKJA 3MYYA 5C37A 2Q2NA 1SD2A 2YTZA 2PZLA 3VYSB 3HZRA 1VPEA 4YMVA 2B94A 4YX9A 3RVSA 3H05A 4UPEA 4JP1A 4XQ0A 3AKDA 3LECA 4I4IA 5CXXA 1K8QA 2DFNA 2PLWA 2G9ZA 3ZXYA 3U4GA 3RUHA 2QP4A 3G7NA 4BNIA 1I4TD 3W77A 4CM1A 3C2QA 1H94A 5FRDA 1PD0A 3SE7A 3CG0A 4FBMA 4UREA 2WD7A 1BH6A 3C6YA 4E7PA 2OHJA 4FIZA 1A9XB 3KR0A 3WBBA 3AR4A 1AGPA 4C06A 2FJPA 3NRCA 5ILQA 1QM5A 4NJMA 4U2BA 2HK9A 4N65A 1T2DA 4X6YA 2WM2A 5BT8A 2Q0SA 1HRDA 1WDLA 3FTNA 5J5CA 5KYYB 1SWVA 2CJXA 2YJTD 1IY1A 1PGQA 1QVWA 3GD5A 3NWBA 2JFWA 3EZ2A 4LMBA 3DMPA 4LVUA 1US8A 4ZGGA 5AW8A 1SKMA 4L8LA 2PPLA 3ESQA 2BEUA 3MJEA 1KZ9A 2I3DA 3G49A 4RH0A 3JXEA 5EYPB 3D2CA 2J5KA 2IUEA 1ZJWA 1UPBA 3OM9A 2C1XA 1L4YA 3W8DA 4HX9A 3SE0A 3PWSA 4Z5XA 1W4CA 5K8TA 2HRZA 2EL7A 3ZCXA 1F6WA 1LV7A 2X58A 4KTTE 3DEJA 3QYPA 3IVAA 3AL3A 3QTBA 3IQEA 2GO7A 3HN7A 1RM0A 1WP9A 4M55A 3WLPA 1POXA 4EB6A 4Z49A 3OCCA 5HFNA 2WJHA 3NPMA 4WN9A 5D3MB 4NEGA 3H9UA 3AKYA 4YY3B 1GZHB 3DL4A 3FGOA 4IJ5A 1R4NA 1F4VA 2FZ4A 2GCNA 1H2RS 4QJBA 2P5YA 4FDMA 4JP3A 2XYVA 2WSMA 2Z1DA 3VHXB 4M1KA 4P4TA 4UU8A 1ZRSA 1PQWA 1R9MA 4RVHA 1FSSA 3RS4A 1TYCA 2WJJA 3ZXSA 4BLUA 5HWSA 4D81A 3AQIA 5J1SB 1AKRA 3R6LA 4JN6B 1W36B 1DRWA 3GUVA 3ODPA 4AF6A 3NC4A 3QTTA 2A1TR 1KI9A 4UBJA 4X97A 5HIAA 1QLWA 4IG9A 1RYYA 3LDAA 1B42A 4KQKA 4D4MA 2UYGA 2VF8A 1YL6A 8MHTA 3U7EB 3TLBA 4DMRA 1NT4A 3R24A 5HQTA 2V03A 1H2YA 3RKRA 1DQZA 3IAAA 4YYZA 2EJVA 2IU4A 3KZVA 1XQYA 1NLUA 3OIDA 1OVGA 3ZDAA 3B6IA 1DG1G 1P2BA 3MD9A 4RZQA 5AWFC 2GM5A 5TXGA 1BDBA 1SHUX 4ZVTA 4XX0A 1L4FA 3U3OA 3F2VA 1LF0A 2GNPA 2AR9A 1MO2A 5JR3A 3AVWA 4H7EA 5EMKA 1NHWA 1P2UA 5T67A 1J5XA 1TKRA 4N39A 2QTWB 5LU9A 3FJOA 3RJ5A 1R0RE 4Z1OA 1I7NA 4KQHA 3SLGA 2W8ZA 3EC1A 3IEPA 2CV0A 2IUUA 3I73A 2NUBA 2Q9BA 1ZCFA 1R0LA 3RS3A 1J8MF 3EX7C 1CUBA 2VXYA 4R41A 1Y3CE 1QG2A 2FUNB 3FBGA 3EY9A 1NJ6A 2OBLA 2B1RA 1F0PA 4BKUA 4DNXA 3N87A 1WZUA 3NZEA 2DKNA 3PUKA 4XE5A 3ILYA 4BQQA 2O2GA 1GIAA 1KORA 3LUBA 1TU4A 2BGKA 2XWJI 5DWQA 4ZCMA 1S3GA 1ZGCA 3HA5A 4L3VA 4HB0A 3JQBC 3K94A 3ROPA 4B0PA 3H9EO 4EF6A 3OQ1A 4JEHA 3M9LA 3UWMA 2FEOA 2HV9A 4FE4A 2H63A 3KKLA 4HADA 3CNQS 4Q4CA 1YGPA 5CLHA 1TUBB 3ZWDA 4G1BA 4LMPA 3OPYI 4DSNA 5LDDC 2QNRA 3IT2A 3ZN2A 4KR6A 5DM1A 1OY1A 4QQKA 3O3MB 1BO6A 4RWZA 1C2YA 4HYQA 4MVJD 1KDPA 4DCSA 4HJXA 5JISA 3OQBA 4HDMA 4UDNA 4OQLA 3O8QA 1HTTA 3ZHUA 4KWTA 1I7QB 2HYDA 1U8FO 2JEOA 2BTQB 3ISJA 3T06B 5JS8A 4LYEA 2R7LA 2ORVA 2MSWA 5JWRA 5EIBC 3QWAA 3T5AA 1LKZA 1T4BA 2GAIA 1AHHA 1G6OA 1QP8A 1GQOA 2SNIE 4WY8A 2GT1A 1KY3A 4KQXA 3NYIA 4MCIA 2F1KA 5J40A 5IANA 3PNOA 4RVGA 3E15A 4PVCA 4EG5A 2P4EA 4BLQA 5EP1A 3MUNA 2IWRA 2MSEB 1C50A 1G8GA 3TJRA 3A36A 4OOEA 3DWEX 4LYGA 4NZNA 1ZGHA 2YV3A 3H2ZA 2JFZA 3HQ4O 1CUSA 1Z0UA 1QRDA 3C1TA 4FW9A 7MHTA 1T2CA 2IYNA 2IYUA 2H57A 2PMDA 3K0BA 4TN5A 3IO3A 1XZGA 2X8LA 4BQSA 4EHBA 4HBZA 4Q1AA 1PNRA 3TD2A 1TA9A 3PSAA 4FJ2A 3RTCA 5DOVA 1Z22A 4PINA 4EIWA 3EEYA 4DLUA 4J1NA 1DC3A 3ITNA 4JASB 2B25A 1N6RA 1NRIA 1DQSA 3HA3A 3NBKA 1ELOA 2VPXA 1UDRA 2ZUWA 3QU5A 3R0VA 4HNRA 2PX4A 2PYIA 1P1IA 2VRWA 3JQPA 1T2AA 2CKDA 2A3RA 3ESXA 4HFMA 3GFGA 3GUYA 3LPDA 1UBJS 1TQ2A 3EFOA 4WTOA 3ZWQA 1C3OB 5HHTA 3MMZA 1D2CA 2J9XB 3R0ZA 5KWSA 1OFHA 3OG9A 1P7WA 1H0RA 1TM4E 1G8KA 2RBEA 2PWAA 3E9EA 4ER0A 3C6KA 3DW1X 5CJJA 5AM3A 5I45A 1BVHA 1CQJB 1PLJA 1EP1B 2CCJA 1Z4OA 1E6CA 1WVGA 1OJ7A 3GH1A 1NM5A 5KOJA 1V25A 3GFFA 4GZ5A 1X74A 4UHJA 3LKVA 4EPWA 1KMMA 3PE3A 3IQIX 4FE3A 5I9MA 1M54A 1RWOA 4L7VA 1T9CA 5A6VA 1WCV1 2QOEA 1IQRA 3JY6A 4JUDX 4B17A 4DMFA 4G0XA 4RJIA 5IH7A 2Q07A 3OLWA 4Q7EA 3AI1A 2O0MA 1U11A 2OCXA 2ZWPA 5A05A 5IAAA 3DVLA 1NR7A 2A57A 3WL7A 3WLKX 4LFBB 1SKQA 2Y0DA 1PFVA 1L5YA 2ET6A 2W4QA 1QH9A 3EASA 5AJZA 5EN4A 4DQXA 3LKDA 2JIQA 2AS0A 4F86A 3QEBZ 3RSGA 1MORA 2DMRA 1ZHFA 3D1LA 4W7IA 4IVRA 4YRJA 3A6JA 2Y1FA 4EM6A 4H3HB 2HADA 5HTOA 3EVTA 3E35A 3FVTA 4PZUA 4M53A 4GX5A 2ZTHA 4D9NA 1Z6XA 2BEJA 2NTYC 2ODPA 4EKYA 3FDFA 4OXIA 5CVVA 4UM9B 3KQMA 4RQUA 5LZ2A 3OZCA 3PT9A 1A7JA 1Z2NX 3KHKA 2I4RA 3R75A 3TCNA 1SCDA 1J2TA 3MTQA 3U17A 4C6TA 4BQEA 1WZNA 3QVGB 2NTEA 1L5LA 2W2VA 2FRVA 2K7ZA 4M1WA 1Z5WA 3Q8LA 1KFKB 1MEJA 4MUEA 4IDAA 3LHSA 2GN8A 2I7VA 3BSWA 3KU4A 3QRWA 4G01B 2WF6A 1FFBA 1P9WA 3DAYA 1P2SA 4O4LB 1X70A 4M1YA 2IS1A 2Q99A 4A0HA 5M34A 3OPYA 1TO6A 4A0FA 2W2KA 2ID7A 3A2LA 4HATA 3SBEA 4CDRA 3OZ7A 4UOZA 2XA2A 4B83A 5AVQA 1O0CA 2IODA 1J2EA 4H59A 4JC0A 4I08A 5BNTA 3AL0C 3A2NA 3ERCA 2C83A 3IOYA 2Q3LA 4JDUA 2IYPA 3P9ZA 4GM0A 2WHPB 4WUVA 4Y7CA 3I05A 2AF4C 3W5IA 4NXNB 3D7NA 3UMGA 3C48A 3GB9A 2ALJA 1TIBA 4BFXA 3ZNOA 1SEPA 1V7CA 2WKPA 4L07A 2GPJA 3D64A 1IG3A 4YCCA 1N0IA 1Y89A 2ZSBA 2FEAA 4XIGS 2DOKA 4J0HA 2VH5R 4Y3UA 3F73A 2WJPA 3EY4A 2VDNB 3ZZMA 4KPFC 4QC2A 1J4AA 3FMVA 1FEZA 5LNK1 1HKUA 2YCBA 3KLPX 4MRVA 4X7BA 5GP1A 2BZ0A 3RHSA 3DOUA 3JALB 3UMMA 1DUIA 4UTXA 3FB1A 3C3BA 2OO5C 4CR8A 2QQGA 1QH1A 2YFYA 3AHIA 4NNOA 4C4ZA 2HEIA 1B8UA 1Q77A 4ONEA 5A5VA 6AT1A 4RF2A 1ISRA 2BMAA 2RFLA 4XJTA 3S2YA 3TTXA 2QU7A 2H4YA 3EAFA 5AI8A 4YTEA 5L4LA 3CIOA 1W85B 1V26A 3BRQA 2LGJA 2MSLA 1RXIA 2AE2A 3LP8A 5J59A 2PV0A 5A4AA 5JMOA 2V1UA 4NV3A 1EXVA 4MQFA 3U0VA 4CLDA 1Z8DA 3ZKAA 3OE7A 3OH8A 2JHCA 1JMYA 1N0UA 1IOVA 5J2TF 4PNHA 2NU8A 5LP6F 2HK7A 3HXQA 4LK3A 1T8RA 3NWJA 4HRAA 2O1XA 2H2WA 4YS6A 4BO5A 4BP3A 1PIWA 4PN7A 1I3NA 3LWZA 2P11A 4OO3A 4UUNA