3IRVA

Crystal structure of cysteine hydrolase pspph_2384 from pseudomonas syringae pv. phaseolicola 1448a
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
213
structure length
213
Chain Sequence
MSKPLVRWPINPLRTAVIVVDMQKVFCEPTGALYVKSTADIVQPIQKLLQAARAAQVMVIYLRHIVRGDGSDTGRMRDLYPNVDQILARHDPDVEVIEALAPQSDDVIVDKLFYSGFHNTDLDTVLRARDVDTIIVCGTVTNVCCETTIRDGVHREYKVIALSDANAAMDYPDVGFGAVSAADVQRISLTTIAYEFGEVTTTAEVIRRIESAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF CYSTEINE HYDROLASE PSPPH_2384 FROM Pseudomonas syringae
rcsb
source organism Pseudomonas syringae pv. phaseolicola 1448a
molecule tags Hydrolase
molecule keywords CYSTEINE HYDROLASE
total genus 81
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2009-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 3irvA01
1X9GA 1ILWA 3OQPA 3R2JA 3V8EA 1NBAA 2B34A 1YZVA 1IM5A 3TG2A 3MCWA 3R77A 3O92A 3IRVA 3O93A 4L07A 3O91A 3S2SA 3EEFA 3O94A 3PL1A 3TB4A 3OT4A 1YACA 4L08A 1NF8A 3KL2A 1J2RA 1XN4A 3UAOA 3HU5A 2WT9A 3TXYA 2FQ1A 2A67A 2WTAA 4H17A 4WGFA 3O90A 3LQYA 1NF9A 2H0RA 4WH0A 3HB7A
chains in the Genus database with same CATH superfamily
1KAHA 1GNSA 3L2OB 1NMSA 1EK0A 2GHQA 4RF2A 5GOTA 1N9GA 3GJQA 5ALXA 3ZDEA 1JECA 1ESNA 2CL0X 3AR6A 1H4QA 5JE8A 5JJIA 1QO7A 4CLHA 1WS6A 3UOGA 3GLFA 4REQB 5JYBA 3WI7A 4DCPA 1FRZA 3EAQA 4B75A 4MVJD 2FPGB 2Z2XA 2DTXA 4PZCA 5ILGA 4D0RA 2J45A 1LK7A 4D46A 2PUCA 2WPDA 2X9QA 1S8AA 3KU1A 2XVAA 3RARA 2JLZA 2R3SA 4MUYA 4CM3A 1Z22A 3ETDA 1G4UR 1FLVA 3NLLA 3PR2B 4C6TB 3PZRA 3K1TA 2P2YA 3QLTA 1MAHA 4QJ5A 4TTRA 2V98A 1LH0A 4MWBA 1WUJS 2AFHB 3PNKA 3VU0A 2H31A 1VIYA 3JVUA 1SKAA 4DV6B 4XLLA 4EGCB 3O91A 4DDWA 4ZZ1A 4HRXA 1KZHA 4ZPXA 1JWLA 3H2KA 2JKVA 5EJ7A 4DA7A 1H93A 2ZT7A 3HRKA 3DMTC 5ED0A 5CW1A 4UTOA 4BP3A 1JEJA 2ATXA 3IJPA 5HQJA 3JY6A 1SG6A 1IQUA 4XLTA 4S1TA 3UQZA 5KYXB 2JLSA 4JQZA 3W9YA 4H6VA 4N8EA 3HS3A 1BOOA 3BTUA 3EC1A 3GNTA 3PEVA 1SULA 2WKPA 5BQ3A 2Z9CA 4A2CA 4DGSA 1SVUA 3P9IA 1FX0A 4X7BA 2ID8A 2FMUA 1K6MA 1UDWA 2FPUA 3MTGA 2KX7A 1DT3A 1OWOA 1TVMA 5BUZA 3ZZMA 2IHVA 4B3JA 4CN8A 1ABBA 2OXCA 3LWBA 2UYHA 4M2LA 4MYTA 1PYOA 1TF2A 2ZUTA 4RDCA 5GPBA 1II0A 2ZETA 3C3MA 4P2BA 3G0IA 1UIMA 4Q9JA 1XDDA 4AYXA 1Z56C 1KDZA 1NF8A 2QRUA 4YPFA 3WLAA 1GTMA 1NUPA 2C95A 2AOXA 3WSWA 3D6UA 3GP5A 2C1EA 1HYHA 2PKQP 3HVUA 3VPHA 4HNAA 1JF8A 3QFHA 5AXDA 2CJWB 3AY3A 2VNIA 2EFYA 1L2TA 1EE9A 5T4BA 1DX4A 1NVDA 1X80A 4H7DA 1AQIA 2BW0A 3SNHA 5KMGB 2PUGA 1SVIA 2OV2A 1ZNZA 1TF5A 2XA2A 3L05A 3UGTA 3VGJA 3FA2A 4A27A 1EGVB 4IO1A 3UOAB 3QE9Y 4X1IA 5HIKA 2DLDA 3N8KA 5FUQA 1KETA 4KRFA 4CGZA 1U1GA 1F3LA 3A9TA 4IEFB 4D92A 2GK3A 3F47A 2O05A 5FL3A 1J24A 1PEYA 3HR4A 4D96A 5C9ZA 2V1UA 3H3FA 4OJYA 1SUCA 2BHSA 2V7VA 4AKTA 2G0NA 5E7JA 2E2WA 3Q72A 1P0IA 1PFQA 3CGWA 4JVNA 3H9GA 4NWIA 1TT7A 3L0YA 3CLRC 2MYUA 3CH6A 4BMPB 1WBDA 1V45E 1KVRA 4LBZA 3CR3C 4V02A 4W4TA 4CRWB 4KXLA 5AI4A 2BSXA 2IV3A 4JQOA 4AKHA 2QXTA 3EFOB 3A1DA 2IEIA 3NJ4A 1TF7A 1ORDA 1LS1A 2EKLA 4OQXA 1TVKB 3RHFA 4D41A 2WSBA 1DDIA 4ZCSA 2F3QA 4RA6B 2E4ZA 2I66A 4I4NA 2H17A 1N9GB 2H4ZA 4IP0A 5I8ZA 4LECA 3C4VA 2R44A 1TT5A 4PG5A 5IYZB 4O4HF 3CG4A 3M83A 4GUDA 1M5TA 3KG2A 3SLRA 1CEYA 4HRYA 3PNPA 4OSPA 2FZKA 4F91B 3OJWA 2Q28A 1NUSA 4OA5A 4NYMR 3PXCX 4UATA 5DI3A 2XUFA 3MWEB 3VX4A 4E2ZA 4LOKA 2OGZA 4DR3B 3O0TA 1DOAA 1EFKA 3PPVA 3K0HA 5D84A 4TWZA 1LS6A 2DJ5A 4ENWA 4S0ZA 1FFDA 2WOJA 2AMVA 2MSNA 3C98A 4G1BA 1HZJA 4J2HA 5H5JA 1W4RA 2C5FA 5JV5A 2YFQA 4M0DA 1G7TA 3DOOA 1IXKA 1RT9A 521PA 3NNDA 1XNRB 2J87A 1G7SA 1GCUA 4RSGA 4IZ6A 1QUEA 4KK4A 3MT0A 4HK4A 2WHYA 5DYTA 3V42A 3J81A 1LRLA 3GLTA 1X1RA 3LLVA 4D3XA 2PGNA 4CV3A 3H5WA 2RD2A 3SM9A 2BKEA 4DNFA 4PO3X 2YHIB 1QU3A 2QYSA 2FVXA 3HFSA 1T5SA 1K88A 2V03A 3TDNA 1H4SA 4LXHA 3AH8A 1W88B 7MDHA 3G6WA 1LPNA 4I50F 1J25A 2LTAA 3TLCA 2J31A 1V39A 3SKVA 4KFRA 1K3TA 2HM7A 2YN2A 3IMCA 2HU5A 3VI3B 5C4IA 3FTFA 1IE3A 2E5WA 1GRCA 2ZUCA 4H3KB 2OGTA 9LDTA 2QLFA 3CT6A 1FZTA 1JKJA 2O8CB 1HDCA 4LYYA 4F84A 1ZL0A 4OGLA 2FSFA 2X9VA 3D8NA 4LW8A 5DVZA 5JZOA 1E79D 2EU8A 2WJ3A 3P9ZA 1G38A 3HEBA 3KLPX 4DCSA 3CW2A 1GGVA 2H1VA 4CL0A 5JCPA 1N2JA 4TYPA 4G01B 1D5CA 1RHRA 1YL6A 4DQVA 2P35A 2Z3WA 1E2JA 1X9HA 1MV5A 2XBLA 1XJWA 2FH5B 4AQDA 4FSXA 4CM9D 3OM8A 4YQZA 1G8GA 3U3XA 1RIIA 3FNGA 4C04A 3L0OA 1L5FA 5G40A 3NWBA 3ROGA 5JR3A 5IWAB 4XPIB 1EDZA 1EFVB 1AF4A 1JV2B 2Z9DA 2AF4C 2YIDA 2IHKA 3MINA 3CZAA 3OJFA 4GAEA 4RS4A 5AVVA 5KWJA 2PSFA 3H2ZA 3CX6A 1J2TA 2Q4RA 3SQNA 4F2GA 3D3WA 4ZI5A 3HB1A 4NMHA 4GT1A 4UUBA 3T3MB 4TL9A 5C46F 2OPBA 2CMKA 2EL9A 4TKZA 2JANA 5DULA 1W44A 4ZTUB 2PUDA 1C29B 1E5XA 1AU9A 2CLSA 3TFWA 4BLOA 1P6XA 1FQOA 2CXRA 2UKDA 5TQ2A 5D51S 3CCFA 3EH1A 2PLFA 2CFSA 2Q3CA 3EXAA 1HFJA 3L4BC 4L8FA 3AHHA 4OQ4A 1EA7A 4RGBA 4X90A 2CHQA 3AWIA 4C1NA 2HSJA 3LCCA 3PTZA 1J9EA 5CDTA 5L3VA 1DIBA 3E2MA 1H3NA 1US8A 1Q14A 1K4MA 1SC3A 4M0KA 4LF7B 3HJCA 1J8QA 2BN4A 3KTAA 1HE8B 1CCWA 4NDAA 5KTPA 3O1JC 2A1UA 1NF3A 2ZI7A 4EG6A 2DP4E 1SWWA 2YN0A 3AHFA 5IH3A 2A5YB 4BEJA 1O5TA 3G7NA 2XDQB 4W1RA 3Q7QA 4M54A 3NJ8A 3TEFA 2GK6A 1ZJ4A 1WSAA 2XA1A 7REQB 2HBZA 1T34A 3D7KA 3DL2A 1D2AA 1NA5A 3AEQA 4B3BA 2X4LA 1WKBA 1MC4A 4B3GA 1QYWA 4DNPA 5IT0A 2Q49A 3EXEB 2O2EA 2P2GA 4N76A 2XTZA 1N2ZA 3K1AA 3S8EA 1N9ZA 4GEKA 2AC7A 3DH0A 3E3LA 3TMYA 3LE8A 4NECA 1DP4A 3T1OA 4WESB 2QN6A 4OB8A 5E0KB 3OECA 3AVVA 4MWTA 3I23A 3MMPA 3IOBA 5ALYA 3IQDB 1RXWA 3ZHUA 5KPJA 2RAVA 4RL4A 3BAFA 4DQ0A 2PZKA 4RABA 2Z8XA 3D5EA 4GECA 1R0WA 4N6NA 1TYBE 2HBRA 3B8HA 1CY6A 2WU3A 1CRQA 1EX7A 3CZQA 3RU3A 1LNQA 1SHZA 2DH5A 2GQ0A 2YZNA 1QYRA 4K6KA 3FWZA 1QAMA 3LD9A 3KVOA 4F2HA 3TQOA 1U2SA 6AT1A 3RF6A 4DC9A 2OUKA 4IEIA 1E6EA 1JPVA 2ZIVB 3OZFA 1UQRA 4F06A 3VHXA 3JRXA 4RHYA 4FXOA 5K0LA 1EBUA 4EGAA 1EWQA 1GL3A 4H1TA 2CVHA 5A7GA 1EUCB 5KOJA 5E1DA 2FMTA 5A0TA 4UOZA 5HZKA 2O0MA 4NKRA 4DPMA 1GQOA 1G55A 2QM7A 3E8XA 5FYDA 3WOVA 2XGOA 3RG2A 4RL6A 5IMSA 2D1RA 4B46A 4BLQA 3IBFA 3U60B 4MJLA 4G5HA 3RVBA 4YRDA 2X76A 2JLRA 2WU8A 1MG5A 4BXOB 1SKMA 5GONB 3G2QA 5IDVA 4UHJA 4W5HA 3TINA 1LW6E 1JEAA 1I2DA 1W29A 2PMDA 1CJSA 3CVJA 3T61A 3UATA 3PXGA 3ZHYA 1QHNA 3W78A 4BVAA 2B3DA 1XWFA 2EFGA 3I0ZA 4CR6A 2Z5GA 3STWA 4JB0A 4MQEB 4GZMA 4CKBA 4TKVB 3PKIA 1GV0A 2H4XA 2R2AA 2P4HX 4QEZA 1AK2A 2EGUA 2NVWA 1BC5A 2QT9A 3LDGA 3OCCA 3OT5A 4NTZA 1CVLA 4R1OA 5AJZA 1R8YA 2PRJA 4QU0A 3DSRA 3UJAA 3WK9A 4CMIB 4LY6A 1F2TB 5A4IS 3SZOA 4DY6A 3FCYA 3NYIA 3SEAA 1MN6A 1EJBA 2I6GA 4R2XA 5FPYA 5FJIA 2IT1A 5DBOA 3EVTA 2J6HA 1Z0KA 3CR7A 2W37A 4YUZA 1Q7EA 2FWBA 4EEKA 4NATA 4KPUA 3LX4A 4CT0A 1ZXXA 3BH6A 4BYMA 4RJJA 1IG0A 1NLZA 1P5JA 4O1HA 2J32A 1X80B 3C3AA 4YP9A 5KVAA 3T1TA 4ABYA 2RI6A 5C32A 3IUPA 5EP1A 5BV7A 3D4BA 3R9KA 4PBSA 4A8JB 4JBHA 1U28C 1G41A 4G84A 4F72A 1T8SA 4C76A 1JDTA 1H5UA 1ODSA 5JARA 2FLVA 2G88A 1NZJA 4AXXA 4TSKA 4KQCA 2R68A 4AJPA 2EVWX 4BVFA 2Q6IA 3KLBA 2E55A 4GM0A 3RR2A 2B5OA 2J9FB 3FZQA 3EDYA 4N5LA 4NY1A 1YU9A 4QOSA 3M1IA 2ES4A 3NC0C 2DHRA 4GYWA 5DEIA 2BFEB 5K05A 5MDHA 2JLUA 4ZVVA 5IT4A 4C7MA 3I62A 5CCBA 1U8TA 3S4YA 4WFQA 3SQLA 4NHOA 2WM3A 2ZM5A 2H5IA 1EU1A 3OIVA 4HC4A 2OWEA 4TQGA 5FNVF 4ZIRA 4ZHQA 1YBMA 4N9QA 3I45A 4TVBA 1KI6B 3DDWA 4UQOA 3RYHB 2H52A 5L3QB 3W5CA 1FFCA 2IBTA 3F6PA 2A59A 2DG2A 5DBEX 3JQPA 1TCUA 4Q0MA 4OKNA 2WB2A 2JDIA 3KTFA 4QPZA 4LE2A 5TDHA 3JAKB 1Z6AA 4TV8F 2VK4A 4ZD6A 1E2DA 3IMEA 5C7LO 4Y1EA 3U49A 2R00A 3LF2A 4G0MA 2F1KA 2GCEA 4Q9DA 2H2AA 3EF3A 3S44A 3EW7A 3EW9A 2DR0A 3FYHA 3KX2A 1IXSB 4BVGA 1OYWA 1RQ2A 2Q5FA 1PIWA 2ZEJA 3AWDA 5K0NA 3TN7A 2AE2A 3H18A 4ER7A 3LC0A 1PQPA 1SXGA 2DFPA 3GRRA 3K8QA 1CHDA 4K9NA 4WX2B 2CFIA 2CFCA 2Y1WA 5E9WA 4CQMD 1H9CA 1P1IA 1VZ3A 4EA8A 1UBRS 4H3SA 1U8FO 3FMPB 4XE5A 3KSBC 3R76A 3FLEA 5EJIA 2DB3A 2VQEB 1I5EA 1PJSA 1E9EA 4KMRA 1POXA 3MGCA 4UPVA 3WGIA 1QQBA 4I55F 4CMJA 2E9SA 2C58A 2VHQA 2WR8A 1QUFA 1RCTE 2GAFA 3I6QA 2QJRA 5JCOA 2YOHA 4CKBB 4ER6A 2J3KA 3GPDG 2IP2A 2BJHA 2OESA 2VT2A 3GRCA 5KTRA 3EDQA 5DHFA 1XF1A 1ONOA 1JG6A 5PGMA 1G4AE 1TZ2A 4O33A 1E3QA 1XZGA 4RZUA 5AXCA 2G76A 3W5SA 5F5XA 1S6YA 3JQ8A 4FR2A 4WXMA 1UK9A 4CETA 3SQDA 3ZKWA 4BFUA 3VNAA 1O9GA 4DHEA 1NXVA 1CQWA 1Z62A 2PZFA 3FYCA 4PICA 3RU9A 2M32A 3HBMA 3TXYA 1VLHA 1H9AA 3IQZA 5KKCA 4ZVRA 5DBHX 2Q6LA 3Q0TA 1E6LA 1VG1A 3HLKA 5FJJA 5E8JA 1SU6A 3KT6A 4JJKA 3DTNA 3QSGA 1P3Y1 1XVVA 4KTVE 4XYEA 2FMKA 4YIHA 3IP9A 1U3UA 3OJ0A 3E84A 4YFVA 5BXYA 2WIGA 4HWPA 1Z2OX 4O59O 4DLZA 4H0CA 3UJ9A 2J0UA 3I4FA 2HD4A 4Q47A 2FPLA 3A9VA 4FNGA 1ADYA 4L8YA 4X6YA 3COPA 5BQPA 5DNYB 4NBRA 4W5WA 3TB4A 5F76A 1IXZA 2Y1DA 3GFBA 3R3ZA 1RMTA 4P1ZA 1I2CA 4QGAA 2Q5HA 4FFVA 4NS1A 5DCWA 1SVNA 3VJRA 1BHO1 2FWMX 3HY3A 2F59A 1TTPB 3RWBA 2Q2QA 4LFAB 1ZH4A 1M8JA 2FXIA 2HSDA 3T41A 2RK4A 4OSOA 3P5SA 2GKSA 3PHBE 1H2FA 2O3QA 4V1CA 1HL3A 2AJTA 3BVPA 2ZUSA 4FT4A 1AQ6A 4FSHA 4ZVQA 3TDMA 1JLKA 4DCTA 3KZCA 3DVQX 4IBOA 3FCAA 1TX4B 4EG7A 3IUNA 3P96A 2A58A 4QBHA 1CZLA 4H31A 2G5CA 3NOOA 1EDBA 1L7QA 3G68A 3Q4GA 2FDCA 3BRWD 5A4FS 2X0RA 3B6ZA 3U0VA 4JVOA 2VVTA 1HG0A 2QQ0A 1NP7A 2C3YA 4MQ6A 3BQMB 1WSDA 3DMGA 3PWKA 5A05A 4AWAA 2OBNA 2FG6C 2XGGA 2AFHA 4QBGB 1F4VA 4NL4H 1GSIA 3F96A 1EP1B 4KE9A 5CAEA 4X45A 1G5FA 2P9ZA 2F90A 1CUHA 1S2LA 2YVKA 3O31A 4GOMD 4EHFA 1GFIA 4PLCA 4LJ9A 4J1TC 3I1FA 4WSOA 3GX1A 3JZMA 2FPIA 4ZRNA 2FY8A 2FCAA 2ZJ2A 5E4JA 2AUMA 2CLLB 1CFZA 4B3XA 4L6CA 4XYMA 3ZCPA 1WDTA 1Z4MA 2R8YA 1ZUNB 3QGMA 3R7FA 4P4UA 3FOBA 5DWQA 4KAFA 2EZ9A 5FPHA 3LH5A 5G1PA 1XF9A 1QVZA 3AIMA 3TSAA 3W9UA 3BFKA 4Z2YA 2QUAA 3W9SA 2BMEA 4WBNF 1Y6JA 1LZKA 1VL5A 2HQBA 4R9RA 5JS2A 3ZBTA 1IWBB 4XJSA 5K3CA 4X66B 2OBFA 4FIZA 1XHFA 1ZLXA 2FZ5A 3SSNA 3IP3A 4PONA 3UMCA 1AN0A 1THMA 4JXJA 3EQZA 1JB1A 2O1XA 4R1UA 1FP6A 2B92A 2PLAA 5A3VA 3LQ1A 2AB0A 1VPDA 2YWDA 1GN9A 4FYIA 2Q7OE 4IDBA 1OR8A 1RQPA 2ZWVA 1SRRA 1VHTA 3B60A 3CNBA 3CPJB 4I1SA 4ZV9A 4YAIA 4MR7A 3OQ1A 1Z0SA 3G02A 4ZYVA 3GCWA 1P9RA 1IJFA 2CL7X 1E2GA 2A3NA 2WFAA 3PFFA 3WWZA 2ZQYA 1YHYA 3ILSA 2EDAA 3LUFA 2MYTA 4TOIA 2G25A 3LCMA 5FBVB 1LSJA 2X86A 4D8YA 5F98A 1JDNA 4ZOEA 1XCGB 4RD2A 4BWVA 2CYBA 1N2CA 3CPEA 3F6YA 2XB4A 3EB9A 3I9OA 4IDEA 5H82A 1QBKC 3GRAA 1NSYA 3VHRA 2KYRA 4CKWA 3MWDA 3DEAA 2ZYVX 4RS3A 1S9HA 1FMJA 4BMSA 4M76B 5DU2A 5SZHB 3UBTA 1AMNA 4PAWA 1QANA 2FMIA 1GOTA 2QGZA 3UC9A 1E3LA 3ST7A 2CKDA 4ZT7A 1ZU4A 4KR7A 1WMAA 2JGFA 2DRIA 3E58A 2FNAA 1TFUA 5C34B 3MG9A 1P81A 3O47A 5BN1A 4JX9A 4M1TA 2QAJA 4WBSA 1T6YA 4M0FA 2FFHA 1IN4A 1PL8A 3MRTA 4BZPA 1CDDA 3QXJA 1XVAA 4S1PA 1T6NA 2G36A 4RMNA 3LVQE 4L5YA 3CVYA 4CTNA 1BD3A 1DVRA 3PQ6A 4G4SO 1SO8A 5HA5A 3JWGA 3FMFA 1E9AA 1OCEA 2IYSA 4LRQA 4OKIA 3RS3A 1NV8A 3FMIA 4DZZA 1IVSA 4Q1VA 4X3OA 5EZ6B 3O2JA 3HP1A 1YL7A 3NT2A 1V5EA 1U7OA 3PNVA 1E1NA 4KKXB 4LY0A 3TLBA 1DAKA 4R0MA 4DV7B 2C7RA 4YJGB 1QVRA 2CXXA 4UNNA 5P8WA 4BTEA 2UZ0A 3VR5A 4TKVA 3CNLA 1M75A 5JAZA 1W19A 2ZIXA 2GM4A 4R16A 5J2UA 2QUJA 4O5AA 2Y27A 2YHUA 3QKTA 4MS3B 4AG3A 3FHOA 2WWGA 4QTXA 3MWEA 1QIIA 3EXG1 1CVRA 1PX0A 1WBJB 4EFLA 4ASUD 1PKXA 3GLFB 3G6KA 5FL7D 1HE5A 1T2FA 5TARA 3GT0A 3AHJA 2OBXA 3DBLB 3ND5A 5EUCA 1O96B 4ZVPA 1XLTC 2UVPA 3AMVA 3RIEA 4YXFA 4GWLA 5AYVA 5IX8A 3HWRA 2ZITA 1JXQA 4QASA 3CINA 5T8KC 2W2KB 4FBMA 4B8YA 4UD6A 5KVVA 4CIDA 1VHDA 1TM3E 3LFTA 1XNJA 2NSJA 3T0FA 4BRZA 5KJCA 1XMOB 2AHOA 4GQBA 1Z8DA 3DV9A 3SVTA 3TZCA 1KPGA 3PQ2A 4L9WA 2WAXA 3UYKA 3CE6A 3L7IA 2VUIB 1W34A 2DT8A 3I01A 1IOVA 3ILYA 1KH2A 4XWAA 3K6KA 1UXIA 2E37A 3LY9A 3NH6A 4Z0TA 1T1RA 1JLMA 1N2OA 2WP8J 2FQWA 3PQ8A 2ZQZA 1DSSG 1P60A 2XA9A 3G0OA 1JE1A 1LSUA 3U7EB 3W34A 3CRMA 3EN0A 5J58A 2HA2A 2J46A 3TJMA 5H8WA 1T13A 2IU0A 2P0YA 3CS3A 1T1IA 2B7LA 2IIQA 1XYGA 4RVSA 1KTIA 3NBMA 5KOIA 2GAIA 1W4AA 2EW8A 3DWFA 4JQSA 1B8PA 2CVZA 3DE1X 3QPDA 1X9GA 5K09A 2MR6A 5F77A 1WAMA 2YWFA 4NE2A 1C30A 1MD9A 3RVRA 4KGDA 5GZ1A 1KZYC 3PFIA 3BF7A 4RWEA 3JPWA 2DR2A 4JYZA 4EFNA 4F4IA 1FL9A 1P9WA 3WWEA 4P6VF 5EHZA 3W7AA 2Z5FA 1WW3A 3OF2A 2ZB4A 1FEZA 1V7ZA 1E3IA 1I0ZA 4PZEA 1JAIA 2N1BA 3LCUA 3E9YA 6YASA 1H8ED 3URMA 4J2OA 4LVCA 2YXNA 1BRMA 2C9OA 2FP4B 3H8JA 1QHEA 2A57A 4CDMA 4MI1A 4QFMA 2D2XA 5IW8A 5KYXA 2XDQA 2YWRA 3DO8A 4GOND 3LDAA 2CYCA 3GVXA 2IPAB 3CE9A 4IRXA 4YIKA 5D3MA 5F12A 2C7BA 1WY5A 1O2DA 5L3RA 1PX2A 4O4HB 3AIKA 3G49A 1P7YA 5JATA 3FPLA 1HOTA 3I2FA 4RGQA 1IRXA 4V38A 5BSRA 5FUXA 1S5PA 1ZU5A 2CFTA 2R8PA 3HRHA 5EWMB 1ZJWA 2QM0A 3IESA 1IY9A 3JALA 4NIMA 4OLBA 3ZQKA 3FY4A 3IPCA 1SC1A 4N39A 4QYTA 5EIAA 3TKLA 2V3VA 2Z43A 4B87A 2B4RO 1L5HA 4EY3A 2VHVA 1F0YA 3HACA 5AJXA 5BWLA 4YRRA 5JWRA 1F2UB 3FAKA 4KXYA 1WXHA 3PFWO 4BZZA 3TF5A 4LTMA 4X1OA 5GGXA 3M49A 3R7WA 3TMAA 1HNNA 2OV4A 4QT4A 2JIZD 1VIDA 5ALUA 3A1SA 4D02A 2Q3EA 4N18A 1R9NA 1YIOA 3EPJA 4JT9A 3CWZA 1C7JA 4LQLA 1W4BA 5AXBA 4OQDA 5TS3A 5JNUA 1YZVA 4NR0A 5C5IA 3AUSA 1JDSA 4IRUB 4NULA 4F5ZA 2ILTA 2GYYA 3M6MD 4RKFA 3HCPA 3LUCA 2JDID 1EJ0A 3AEKB 4MQ5A 1U3TA 3QVWA 4RKQA 5A0FA 2PLNA 2YYYA 3VSEA 2C4UA 1LD3A 3CKYA 1X7XB 3PSAA 2ILVA 1PJAA 2QORA 1XZ8A 3N2IA 3QU5A 2LGJA 4JYPA 3U2QA 2AD5A 3K0AB 3OUUA 1XROA 1PGOA 1YC5A 4NZZA 2JLWA 2VDPB 2I2AA 1Z0ZA 1T5LA 3P9SA 2CXOA 5DK4A 2FUEA 4CHGA 5LLDA 1ZWKA 4PXAA 1C4WA 2WVHA 1N1GA 3AC0A 2A14A 2BGLA 3QSYA 4DLLA 4X1KB 1UBLS 3L01A 3MC1A 1OLSA 1V3VA 2OQIA 2JHFA 3Q7SA 4IIYA 2X2EA 5EHGA 3K15A 2XNDA 3OIGA 1AD2A 2R6R1 5TJ9A 3FYSA 4D74A 4QIHA 4X1KA 3EVDA 1S01A 2H11A 3JXEA 4J91A 2F8LA 5KTTA 1RJFA 4WECA 3CRRA 5U1PA 3OEHA 5K20A 4JHXA 2F3SA 3OUTA 4A6EA 4DG9A 3AF0A 3H7IA 3H65A 5IT5A 4M7PA 1D5WA 5B5SA 3JTMA 4HZUB 3OZIA 4M8NE 2X8BA 2BZSA 4IDCA 3PC2A 1YA8A 1ZD4A 1KZ1A 3KWLA 5IKXA 3C74A 5YASA 4OPMA 2BH9A 1CUDA 4BJHB 1REQA 1P1FA 3LHKA 1Y4ZA 2F62A 4NJEB 5AK0A 2V6BA 3QUTA 3ZU5A 3OICA 1L4LA 1RXUA 2HNBA 4D0LB 3A9UA 3LY5A 4LZZA 3SZUA 4CDRA 3H05A 4DIMA 4Z4CA 3OHPA 1UWCA 4F92B 4D9KA 2ZSEA 4R3NA 5K8VA 2Q3FA 1L4YA 3RC1A 5FOSA 2NO5A 3LHDA 4TLLB 1V3UA 5ITWA 2NIPA 1MFZA 3JATB 4RK1A 4YAJA 4O4HA 2HXYA 3DQPA 1OI3A 5BNTA 3NZEA 2IEGA 2VUHB 2NTNA 2OOSA 4NS4A 1X1DA 5HCNA 1QH9A 3DZHA 4FP9A 4QECA 4XIGS 1QHGA 5IZCC 1HR0B 3UMGA 1Z5ZA 4DEYA 4CU2A 2QIOA 1QGUA 4JC4A 4DJFC 4QYIA 1NAHA 3NPAA 3QELA 1UOPA 3OIUA 1IXRC 1CUCA 2P62A 1S3SA 1XRMA 2ORVA 4BNTA 2QD3A 3NANA 2ZRQA 3DZGA 3MYRA 4EPYA 1XXLA 3UWDA 3WHKA 3HJUA 4XEHA 1UDCA 2D8MA 1PQWA 1QQTA 4JR0A 5F7ZA 3TAHA 3NHSA 4LGMA 1YFLA 3K70D 4EDFA 1GITA 1WB9A 4FFMA 5K99A 4QLAA 1GPLA 3PVCA 1BTOA 1DMSA 3WBBA 3LXRA 2WAOA 4JN6B 2PXXA 2MSCB 1HSZA 3AKDA 2XXJA 4LPSA 5D6NA 4S12A 4UCXA 3QW4B 1LDNA 1OBCA 1RPTA 2CHVA 3G13A 2V0CA 1DUIA 1MABB 4JDUA 2EHDA 5CIQA 1EM8B 1F8GA 3IRUA 3RCBA 1PEDA 1HEUA 3N8DA 3VR2A 1O9HA 5CFPA 5TT0A 1XK7A 2IOQA 4CYMA 2YMMA 3EH2A 4ZKDA 4E33A 3EHDA 5BY2A 3ZGXA 1UK7A 3SR4A 5AW2A 4A15A 3PYMA 3FVQA 4GOJA 4TUYB 1SUPA 1O8BA 2Z6QA 1A7UA 3ENVA 1MB4A 1VB5A 2CJFA 1P1BA 1BFDA 3WHIA 2FWAA 3A3OA 1KPHA 1NZFA 2FEPA 4P2GA 1HGXA 3RC3A 4AD8A 2IYXA 2Z3ZA 5IJ9B 2PKCA 1XQ6A 1L4HA 4BMDA 5CX1A 3N87A 1BN6A 3MJHA 3ONFA 3FOZA 4G5SA 4DCGA 3I3SR 3FPAA 4C5AA 3BE6A 4PG4A 3DTVA 4LXTA 1D4AA 5IM5A 1OJLA 1PI3A 4K6FA 2YBDA 3UXEA 4Z49A 3RU7A 4RHXA 2O52A 5K8IA 4L76A 4DLAA 3AVYA 1LK0A 2RHLA 1PK9A 4A82A 3H1BA 2I78A 3NWOA 3AI1A 1MQ9A 3BIFA 3PPIA 3PUZA 5G4KA 2B1QA 3PKJA 1E2NA 3DEJA 1SK8A 2YV5A 2JA2A 5LLTA 3DMTA 4FKBA 5THQA 2V55B 2I33A 1IFXA 3OPXA 1ZH2A 2IY7A 2X4IA 2IY9A 3GFFA 3W6PA 3ZKWB 4IQGA 3OZAA 1RJ9B 2RARA 2Z2JA 4FDMA 1W96A 1Y6QA 2QYHA 5JD6A 1ZXLA 1L4NA 1Q1QA 5I6DA 3GEHA 4BB6A 5CXSA 4OV6B 4R3WA 5H16A 3GROA 1NXPA 5TVGA 4IH1A 3ZK9A 2C77A 5F9FA 1NE7A 4NJOA 2YJTD 1KGDA 1INLA 1WG8A 5HW0A 4CLDA 4GPAA 4I5IA 4R7ZA 1N6HA 3EBOA 3LDHA 4OKSA 4QWWA 2XTMA 2R48A 2PV7A 1WZCA 1PR0A 4EK9A 3M3PA 5HKAA 3U1VA 4TMTA 5DWDA 3KOZA 1E8MA 1DRVA 4HUQA 1YQTA 1G5QA 1Y4UA 1YHZA 1B8OA 4DNXA 3NDJA 4CM4A 4MK4A 1VI6A 3ID6C 4RZQA 2RH5A 4ND4A 5JVDF 4MO2A 4IHJB 4TMFA 4Y1RA 1M7GA 1LI4A 4MUBA 1SCUA 1E1RD 3PC6A 5IWCA 4RCZA 5IUKC 5L9AA 1RKXA 5FLXA 3ZNPA 1VYHA 5FAKA 4WJZA 4Q05A 4CG0A 1A9RA 1U8XX 4YAWA 4N8DA 4N47A 1PP4A 2G28A 4FFPA 4TV8B 3B12A 4UUNA 4Z7QB 3V48A 3FCSB 3MIIA 1WMSA 3PQDA 1UFRA 1DC5A 1W46A 5G4LA 2QA5A 2YWHA 3JYOA 4WWHA 1O95A 2Z8YM 4X60A 4CM1A 3FI0A 4G41A 1A4UA 1E20A 2DKOA 1N57A 1LDBA 1Y1KE 2LPMA 2FSUA 3GF4A 1A5BB 2O4CA 2WAMA 1P1HA 1VBKA 2ZPUA 3CKKA 3O1LA 4UFNA 2BP7A 5L95A 1OV6A 2VSFA 2FMFA 2PKYX 4ZI7A 1H3FA 3LGAA 4QU8A 2VZ8A 3K6SB 3TNLA 5JC8A 5TQ0B 1I4WA 5H9WA 1GPAA 1YZFA 1QVAA 3AY6A 1E4EB 4E2XA 5F9HA 4KXQA 4F7DA 1LV8A 1JQ3A 1PFGA 3WMXA 4QEDA 2Q4DA 1U3FA 4X6LA 1JHQA 3IUQA 4QQKA 4GLFA 3R74A 2BEKA 4WN3A 3L93A 1SQSA 4YCAA 1NXTA 5L4LA 2O7VA 2W4IA 4JC5A 4KO2S 4LMRA 3V2GA 5HE8A 1S7GA 3ZV3A 1PJLA 3OOSA 1KYZA 3AK4A 1T4GA 1SPBS 2O8NA 3CRW1 4O1MA 4Z3KA 3SHOA 3HJRA 1A50B 2FQ1A 3MCVA 3ORQA 3NAMA 3ZLBA 1BA3A 4EHIA 4OK5A 4QXMA 4UDYX 4ZOBA 2TECE 2J3HA 2WSMA 1MEOA 1ENPA 4HT3B 1RAAA 4FD2A 3FVWA 5AKXA 4RA9A 3F2VA 1QKKA 4P7BA 3H11B 1XYYA 4QYSA 4WCVA 1C1HA 2B6NA 2CXQA 5AHRA 4BMCA 2QT1A 3D8SA 4B79A 3LGXA 3ZVLA 1M74A 1YTUA 3T7AA 1E63A 3EEIA 1TIKA 1NWCA 4PGFA 1O4VA 2J8ZA 4BASA 2A94A 2PLRA 3U7QA 4QQ8A 3O4RA 1V7CA 1NVTA 5E4TA 2NUTA 4LWQA 4OXRA 2RAUA 1AURA 2PE5A 5F3WB 4UAVA 1OGYA 4AMBA 3AFMA 1KF0A 3BXFA 2GZ2A 3F5MA 2WD9A 3DJYA 4C4XA 1U0SY 2VZ9A 4DJAA 4OX9B 4CIWA 4DPKA 3QWHA 5CGQB 4A2QA 4K5QA 1Q2XA 1ZI8A 4C3OB 1XRSB 1C9KA 1Y5LA 2RH8A 1WP9A 3K16A 2MMGA 1WCYA 2YHIA 2WVAA 1JWAB 1G63A 1XJCA 2ZRDA 4D6YA 4NMXB 4AKSA 4C4OA 1UAAA 4E5DA 4RAOA 5J43A 3STTA 1ZQ1A 1MP0A 3LX8A 3UPDA 5JAHA 5KX5A 1QHFA 4AVYA 1UXHA 3CYFA 4FXPA 1MAUA 2IFTA 2E4AA 3V8EA 3ZEAA 4XUCA 3MCWA 1DXOA 1YZNA 4G97A 2X58A 4BPRA 1YS4A 2CK3D 2WT4A 2ATCA 1NOJA 4ZGGA 4DCMA 3HA5A 3QVKA 1H4TA 4TT3A 1ZAKA 5JDCC 3PA8A 2W2MA 1EG7A 4XDYA 5TPZA 4KOEC 3V2IA 4B09A 3I4CA 5LZ4A 2CSXA 5C52B 4DWWA 3WNBA 3WWOA 4FMCF 4D57A 1G8FA 1KK1A 3ZCSA 4AYWA 5EIEA 3KYBA 4OAOA 4DV2B 2PJRA 3JAWA 4HWRA 1E2LA 1OZAA 2XUDA 3H2HA 1Z6PA 2XF2A 2QX7A 4MPRA 4QT0A 4BVKA 1ZXBA 1PJ3A 4KHPB 4PHFA 2WMYA 4MEJA 4WOBA 4A8PA 3EZ9A 3JAWB 1M54A 3DZDA 1M2EA 3RBVA 3AERA 3SX4A 4ZK6A 1G2OA 2CLDX 2IKQA 2QLLA 3TXAA 4DT1A 3ZBQA 2HIAA 4TMVA 2WD8A 3VVBA 5AM4A 4G0YA 5BURA 3TLXA 1SCIA 1A5ZA 2IUTA 4YJ2B 4A5SA 4CBVA 2XCRB 1FQJA 2JVIA 4K8RB 3HO1A 3FTPA 1ORIA 2XZLA 4QODA 2VSXA 3P26A 5I51A 4DV4B 3F9CA 2PUFA 4J7UA 3U5TA 1DJQA 3ETGA 1LGYA 3AR3A 2Q4TA 3GLRA 2BMVA 4YRNA 4E09A 5KYWB 4YCNA 1PEAA 4RK4A 4CF3A 1DRWA 1VRWA 4RK6A 1K7XB 2W11A 2CWDA 4Z9BA 2D5AA 1ODIA 3VR6D 2ZVJA 2NACA 4G6ZA 4ZZIA 5C5DA 3ANYB 3U4GA 3S81A 1PSDA 2XE4A 2YZKA 3EMVA 1O6FA 4JITA 3L92A 1HDRA 3TDKA 4AJJA 4C4RA 1K98A 2VXBA 2QMZA 4S04A 4QYWA 4PZ9A 5HQ3B 4YRLA 1NN5A 4JZKA 1OWLA 2PKWA 1C3OA 5ALOA 1C7FA 1EDEA 1CERA 3ELWA 4HFJA 1P45A 4HQKA 4XYGA 3VZRA 1TO1E 2JAQA 1ZOPA 3A9CA 3C4QA 3PYXA 4WQMA 5M3BA 3VZCA 2O14A 3S40A 4UE6A 3ZE8A 1SC6A 1W75A 1F0NA 1ZI6A 2CN1A 4DCUA 5IH7A 2RK3A 2ZAMA 4AZWA 1A8SA 1C8VB 1W48A 3ES9A 2RHDA 3QVOA 1RBQA 5L53A 1VCHA 3V9PA 1O5IA 1ZI9A 2UXCB 1A5AB 3TTSA 3TJRA 5JWOA 4PFSA 1Q44A 3MOGA 4BGVA 4C2TA 1EXMA 4HLUC 1ZIXA 2VOEA 5DNCA 1OBVA 3FUWA 2P4EA 1TLLA 3LBIA 5JEEA 1M73E 3DONA 3R1IA 2WJ6A 2BFCB 4G0NA 2DHCA 3S28A 3GYGA 4M9RA 3RQSA 3TVTA 5KYGA 3PNLA 4OJNA 1ULTA 1SBIA 2VZ0A 4JB8A 1YJ8A 4UVDA 2B8NA 4EAQA 4JJEA 5E8RA 3F8TA 4P36A 3ZY3A 3D3NA 3JYQA 4Q1CA 1HNWB 5K3SA 4K9PA 5CP8A 3BSYA 2XSZD 2P78A 3TS1A 3B2NA 4BV8A 3RK0A 2QYTA 1K7FB 3IQXA 1QFMA 1OU0A 3BIJA 3COZA 4ZI7F 2CVOA 3LW7A 3HXQA 5FKJA 2HK8A 1KTVA 1XSEA 1NVEA 3CY6A 3ESBA 4OO3A 1XAJA 5GTDA 1U3WA 1B23P 2ZCUA 2WUDA 3OT4A 1D2GA 3PE4A 4NRDA 3BAZA 3N6RA 1T3SA 4CTKA 4AI6A 2WD7B 2Y2VA 1BX3A 2JIOA 1VFNA 1R0CA 2PT9A 2QMQA 2DWUA 3D0OA 2VJMB 1JLSA 4I8IA 2P90A 1G8YA 2XY4A 3B5EA 3FVRA 1H8HA 2JBWA 2B7CA 1Z45A 4TROA 1SHKA 3B70A 1G2IA 2K6GA 3K3PA 4R0NA 4B6SA 3L4SO 4MPPA 1EKXA 3RNOA 4CQMB 5KTYA 1NQTA 1XTIA 4IGIA 4JLVA 4KQXA 5LYJA 1O97D 2JJMA 3V4SA 4ER0A 2WWYA 2QTWB 1QHXA 3MWGA 5JS8A 1EK2A 1JFFA 1PYGA 3H2GA 3PD7A 2GEBA 1QTNA 5CXXA 5FO0A 4BMOB 1ZVJA 2JRCA 2QM8A 4MRMA 1YTLA 2R65A 4U4AA 1XXHB 2JCBA 1QB8A 1WXXA 3C3JA 2ZT8A 4TTTS 2V7PA 5JI3E 5FPKA 1ABEA 3HXTA 2D0OB 4GDMA 4KWTA 5FBRB 3ZGLA 1B0UA 5IHPA 3OFSA 2WTNA 5B7NA 1Q6ZA 3MD9A 2FU5C 1I24A 2XECA 4AY6A 2OG1A 4PE5B 1RI3A 1DHTA 3K9HA 5EUQB 4QRHA 5EHNA 1SU7A 1G9SA 1C3EA 2AR7A 1YR7A 1KK0A 1TM4E 3BIXA 1RMQA 1SCUB 2DKFA 4JCCA 2PYZA 2FX3A 4YCDA 4TM8A 1GUFA 2AMLA 4JI1B 3T06B 1JHOA 3T5DA 2O1SA 4RM3A 4EVSA 4ML3A 3K5WA 1CIPA 2J7PD 5AVTA 4JJAA 1ZOOA 5HK9A 2PSSA 3EXEA 2HY7A 2NSYA 4U6SA 1BVRA 3HQ4O 5HSGA 3QQ5A 2LKCA 3EXHB 3TIXB 4RAQA 5L8VA 1W85A 4L27A 3FMGA 2BISA 1IUPA 5DYIA 3TJZA 3LWNA 4MLPA 3ABIA 2HLDD 3QYJA 4JK3A 1D1PA 5F21A 3QUQA 4LTNA 4UM7A 1Y98A 5CJPA 5D7NA 3X1YA 4ENTA 1NP6A 3EZGA 3DTVD 1UBGA 3OU6A 1G6HA 4EATA 4JZYA 2I22A 5DV9A 1VLVA 3Q9UA 5JXJA 1A77A 1NUTA 1QQ7A 2V7XA 1OT3A 3EXFB 3SN6A 2B4QA 3NIDB 4B85A 2CD9A 3H1PA 2IWRA 3EFBA 5JHHB 4LGCA 3FHTA 5AD1A 4RZXA 4WACA 3KXDA 2Q45A 2XRFA 3L6EA 5EIFA 4ZCIA 2HCJB 3CW8X 5KPDA 4OBEA 1J6UA 1JIVA 1ISMA 1I33A 2O2ZA 2VFAA 3HWX1 4BAGA 5MGNA 1EK5A 3L1JA 3RSQA 4NYIQ 1P33A 2JI7A 3LLCA 4DCVA 5BN4A 1E69A 4HR7A 4RIGA 2P9TA 3VNSA 5JRDS 5JT1A 4RUKA 2BTEA 2C4NA 2P1DA 2XQFA 3MQ2A 4D44A 3SWWA 3A1TA 5BNFA 3RVNA 3IT2A 1Z0IA 5SICE 4U7PB 2WA1A 3ASUA 3K9GA 1MB2A 1DAHA 1TDJA 3OOHA 5EP3A 4RXMA 1A9XA 3ZGYA 1IHPA 4MULA 1M8PA 1E94E 1TEVA 1L8QA 1NT2A 2IP4A 2OO7A 1UODA 3TLKA 1U4SA 1NUQA 3LP6A 3F46A 3OEYA 3OFND 2HRDA 1VJRA 2FE1A 2XVXA 2GN1A 3JZIA 4IJKA 4BO9A 1E4OA 1QX4A 4N5DA 5C8ZA 3OQNA 2IQ5A 3R5FA 1HTBA 1IJBA 2JFYA 5GOZA 1AZSC 1IZ8A 5FRDA 2OM2A 3IJEB 5EKTA 1NQUA 1QF7A 2SCUB 1U9IC 2I8LA 3NTQA 4RJLA 3SKXA 3UB4A 4BNWA 2CCGA 1SCNE 1OSNA 4AF6A 2O2XA 2B21A 5AOAA 4YDRA 3ODPA 3NHPA 5KUTA 3IP7A 4WAUA 4LVUA 5AK3A 3O9MA 2C2XA 4MV0A 3P0IA 4LS3A 3NONA 4I66A 3RSOA 4HS4A 3S1SA 2P7IA 1KI8A 1W1IA 3ANTA 1KO8A 4LBYA 2CHFA 1JR3D 3F97A 4MRMB 1AZTA 3HY4A 2G5GX 3IRVA 4ZEOA 3VH2A 1AMUA 1KDRA 1U4NA 1JILA 1GVNB 2GPAA 3L7AA 3DLIA 4JMPA 2XGMA 2GAAA 4NX2A 4Q7LA 3ZVKA 5FFNA 1CB7A 1JQEA 2LWIA 3H9UA 3QF4B 4W9RA 4KUGA 5IKEA 3E18A 1DAIA 3RGGA 3C48A 4F45A 1P9NA 2GN9A 4WGGA 2P0EA 2IIPA 3B1FA 3KUCA 4IKPA 1C9EA 2GYWA 4J16C 4L22A 4EG5A 2AN9A 3NB0A 3UO8B 4Q4JA 4RW0A 2G17A 3LT1A 1FW8A 4GXQA 3RKRA 4TXNA 4JJFA 3S27A 1R5BA 3N2KA 2PX6A 1SA0B 2EP5A 1WB6A 3RSSA 1AHPA 1D9XA 1YQGA 3CNHA 3QVJA 3SC6A 1NHGA 2ZSIA 3HCAA 4OP3A 1VKRA 2YQZA 4HXYA 4C0LA 4F60A 4MUGA 1YS2X 4BU1A 1ULZA 3GUUA 4XQ0A 4BN0A 3UQYS 3QFCA 3EFEA 4QKQA 2F4VB 2BUAA 4AJIA 4DLBA 3IO3A 2AXEA 1K0UA 2P4SA 4RKYA 5AVOA 3UCEA 3HZRA 4X8HA 4PR3A 2VAMA 3GOHA 4B5KA 2O5CA 4PPFA 4D3FA 3BHMA 3EZNA 4FONA 4EFKA 2WYVA 1YVUA 4QJBA 4PBTA 3NHZA 2VNHA 3MTAA 4AP5A 2PX4A 1V8BA 3FDZA 1U90A 4LMAA 1SC9A 3Q3CA 2WTMA 4YC7A 1I6MA 1XKTA 1E9VA 1VXRA 2J48A 2QVZX 2FWPA 2VP9A 3H3JA 4KXNA 1FUKA 4EHLA 4ZCRA 2QUHA 1D4OA 3W8NA 4ZZ3A 4Y2UA 4F3TA 3T3NA 4RNCA 2HWXA 2WLTA 4QGHA 1F9EA 3R6GA 4KQEA 5EXPA 3P2MA 1SU4A 4K05A 2IVFA 4LYAA 121PA 4IVRA 1SCJA 2FFBA 3G5TA 4IGEA 2LZ0A 3RS5A 3EZ7A 2IEYA 1T1SA 3I53A 3JZDA 4I99A 1U5BA 2PR2A 4W63A 1NBEA 4J1TA 1AUQA 2VK1A 2ZYAA 2JAHA 3OMLA 1Z7BA 2KM1A 1Q0QA 3CW9A 3H04A 3I72A 5DGIA 3Q7EA 4YP7A 2AUNA 5A9RA 5HPYB 3KKKA 5LQAA 1G6OA 2ASVA 3IA7A 4FJ0A 2QL5A 2RHJA 3MILA 3N9IA 4ENUA 3EVZA 2ZZNA 2RHHA 2B8TA 2FPXA 1J22A 2EDCA 2GN0A 3V8QA 2ZK7A 3TEJA 3GGOA 8LDHA 1RWKA 2IZ7A 2F3PA 5BR1A 1PDWA 4OVKA 2PWBA 2ZYDA 4U9HS 1LX7A 1KY5A 4A1OA 1AN9A 2J9ZB 2OQ2A 5E38A 1KI2A 4FYKA 4EJSA 2ISQA 5KJFA 2JFGA 4CXMA 5AR1A 1QAOA 2HMAA 2ZJZA 2J9FA 2XAUA 1PVDA 1SKYB 2HU7A 2ECKA 2JGKA 3ELDA 3HGMA 3R0QA 5E6SA 4AULA 5CG2A 3S1AB 5IN4A 2C3PA 3ZX5A 2V7EA 2O8BA 4N40A 1BDIA 3MD0A 3TUIC 2QTNA 1NN0A 1HYEA 3W9BA 2YZ2A 3MS4A 4I08A 3RT7A 1SC4A 1H0HA 3H83A 3R3UA 3PUVA 3VAAA 4R31A 1NJ1A 3DFZA 3C3XA 1T0BA 1Z6XA 3N05A 3NVMB 1FSPA 5BSFA 1L1QA 2QJFA 1I0IA 4ND2A 5F1YA 2JH9A 4M46A 4R1QA 1OAOC 2BFAA 3UUFA 1U0HC 2RB5A 4H7EA 1QIGA 2EX0A 4UW9A 5GONA 1Y8ZA 1KZ6A 4XUEA 4L15A 5FWDA 1A71A 4EA9A 3Q98A 2GLXA 1E1QD 2R5FA 2E49A 4YAKA 4IJ5A 5T6MA 1Z7WA 4BVJA 4YRBA 5LXTB 1TPYA 1R7RA 4MMYB 5BMVA 1VE6A 1QCCA 1BWSA 2H8KA 1EIWA 3F4KA 4I4CA 3WZ2A 1ONBA 3DUFB 3ICOA 4ZYWA 1KOFA 3KS9A 4N7JA 2C00A 5DNUA 4QNRA 4YDHB 2RGYA 2Q4OA 1NBOA 5IHXA 4CEHA 3Q8KA 3OA2A 3EQ7A 2GZSA 2PWAA 2AFVA 2BRUC 3F8WA 3FLAA 3U4IA 3P0HA 4X44A 4CCSA 1BVUA 3CEJA 3O9VA 3QUSA 4RFLA 3CB4A 4C06A 5TS2A 3HC7A 4IVQA 2XEDA 3G0DA 1OLXA 3WKBA 4B9AA 3IVRA 2XXBA 4BFSA 1P4SA 2PGIA 3IOEA 4PX3A 5E1BA 3C3YA 2JD1A 2PX3A 1E9CA 3RE1A 3A36A 2NTYC 1IJEA 5FX2A 1F06A 3WYNA 1KAQA 4FGWA 3T9CA 3COSA 3AY7A 2VWHA 1P2GA 1AKVA 5EWJA 1KP9A 2IYWA 5DRTA 4BMNA 2YBEA 2GF9A 3FNEA 1BU8A 5CB0A 2OA0A 3I12A 3HVKA 5JYDA 2Z8ZA 2P4QA 4NU6A 1DCTA 3VQTA 1C1DA 2I6TA 5LLSA 1W0JD 2JJQA 2PG3A 1Y89A 3OJOA 4V0QA 5G0VA 4HVCA 4GHWA 1QYCA 4FFNA 2IODA 4O1IA 4L3WA 4PX9A 5I9MA 3LZCA 1GPNA 1H6AA 3D4PA 4X91A 3F6CA 4HNVA 2G06A 2PGXA 2I4RA 3E03A 2PRIA 4FR5A 5FOTA 3R09A 3NAQA 4ECEA 4J90A 3RK4A 3Q9SA 4US0R 4M36A 4X71A 2B5WA 2G4LA 2HJSA 2IXFA 2R11A 2GO7A 1RWQA 2Y0EA 2JI8A 2W6NA 4N8SA 1PG2A 1O0CA 2X0KA 1QHIA 2G0TA 5D7BA 3CLSC 1H6BA 4CQMA 4YJHB 2RGCA 4AKIA 3NOVA 4Q4HA 4ZEWA 5KOHB 2FX2A 3QM1A 4L7VA 5J2UF 2Y1LA 4DBVO 4TWJA 4D98A 1OZHA 2NUTB 3BKWA 2GCOB 2QR2A 3R3WA 4K7JA 4M8SA 2FZLA 2HEGA 3PNSA 1NPTO 5BN5B 4RU1A 5JAIA 2NQTA 3DZBA 5ELLA 2GD2A 2DFTA 4IWXA 3ZXXA 1E66A 3C8ZA 2YUIA 4MVJF 3C7DB 1Z34A 4UTNA 4OHZA 3UAYA 2WA2A 3NJRA 4MCHA 4WASA 4WCFC 1B41A 1GNLA 5I4IA 3SSOA 3TBHA 1SQ0A 2O3JA 2GPBA 2A67A 3P7MA 4DHWA 1D7AA 5ILQA 3RRZA 8AT1A 3FFAA 1NMXA 4CMEA 2II6A 1TVKA 1XL1A 3EVAA 1ZUNA 3AUJB 1VA4A 3WISA 4KQKA 1ZR4A 5TGZA 2WDPA 1JX6A 2HPHA 1JHDA 4PYMA 1DBIA 3NHAA 1KAMA 5ALJA 2CVQA 3B3JA 3F67A 3PDHA 1QFYA 1UPUA 2R8BA 2GWHA 5B57C 2FSVA 4FE4A 1A2OA 1Q3TA 1AC5A 1ST3A 3BDAA 4KIWA 5T41A 2V5AA 5TF4A 4LOJA 2O8CA 2W6PA 1TI7A 1CUXA 1MQSA 1R6DA 3T7RA 2OO3A 4M49A 2HDNB 4NNOA 2O2GA 4IV5A 5AI6A 4Q12A 5BW6B 1K5GA 3SX0A 3VVLA 1BH6A 2QY6A 2FWJA 1UAGA 1T8PA 1N0WA 1U6KA 2ENUA 1CW2B 2YV3A 3LWZA 4FYMA 4OMUA 2NP6A 4L4ZA 1RRFA 3WGNA 1O9BA 2WOOA 3RIHA 3W3AH 5DSZA 3G23A 2VPWA 1J4AA 5H81A 3K0BA 2Z4TA 4KQ9A 2P30A 1DTWA 1PS9A 2ZOSA 3A58B 4MWGA 1UWVA 1VPTA 1TA4A 2XYHA 4LJYA 1MOQA 4A8JC 4ZDWA 4E30A 5C5CA 4AT1A 4ZC8A 1L7NA 3HDGA 1QZTA 3KDSE 4MIYA 3ZK8A 3LNTA 3R3YA 3DOIA 1SBHA 3PVZA 4WCFB 5I9BA 3T9EA 4HAXA 5JNVA 3HYLA 3O8QB 2Q6OA 1ZM9A 4NK4A 5K8UA 2IXAA 3C6YA 3QVGA 3HYCA 3QA9A 3ER8A 5DTQA 3TD6A 4C5BA 3K9NA 3PPWA 1XJ0A 4CFSA 3U44B 2GBCA 1DXHA 2OXRA 5REQB 4UE2A 1P61B 4I1IA 2NWQA 2IA5A 4EJ6A 1JQAA 1USWA 1K8QA 1MAVA 3X43A 3Q1LA 2YVLA 3PQ5A 2CMFA 4XW2A 4IMPA 4Y18A 1TUEA 2FN9A 5TE9A 4IYRA 3RSHA 1PE0A 1DXYA 1G3RA 1W94A 5FIUA 4XLZA 2WM8A 3SQMA 2JVJA 3FLMA 2X77A 4K9KA 5H3LA 3T5BA 3KQMA 4NV3A 1C3OB 5LKRA 1CRLA 1EUDA 3WK8A 2PMKA 5DX8A 4UMEA 1I9CA 4N03A 3W2IA 1SG0A 2RKWA 4KWHA 2GUGA 1P2TA 1WEKA 2PFKA 4V3CA 4EUHA 5HHTA 5HWSA 1YBFA 1W4LA 2DPYA 2VDWA 5CVDA 1U2QA 3WTBA 4CQJA 2CNKA 3N74A 4AW9A 1E2EA 2H65A 2XOXA 3R4CA 3GRFA 2AKYA 4ZGWA 4RTNA 3TSYA 4D6XA 4Z3OA 4EG3A 2COKA 5FV4A 1U0TA 1I3KA 2NVUA 2R2GA 3NTRA 4Q93A 5B7PA 1JQ5A 2AOTB 3DT6A 3C1OA 5JJ5A 4MVYA 1DZ3A 5SYMA 1OLUB 4I9GA 3FPGA 3ZIUA 4QC2A 1LRKA 3CJRA 4WPGA 3D6AA 4RV5A 4ITUA 1HWYA 3TAUA 1Q15A 1TZKA 3LTEA 1CWUA 4E7OA 3NW9A 4CM7A 2P6UA 4B35A 1XCLA 4XTRA 3Q8XB 1N3YA 1GN8A 2WY2D 1DAFA 3V4ZA 3OE1A 5A4JA 1UC9A 5L45A 7AT1A 1R0XA 3SSAA 1MB0A 1C3XA 4M9SA 3IHKA 3P9PA 2R84A 2A5JA 1Z0FA 4ZYZA 4UM9B 4TMKA 1KJ8A 2PAAA 3W3AA 4FMDB 4NNPA 1BJRE 2CNNA 2FQYA 4IR7A 3RRBA 2D54A 2GBLC 4QUKA 2YFHA 1U11A 4I5FA 5DCUA 2GVDC 2I6FA 4KYUA 2VZLA 3VZPA 4X97A 1BHSA 3CF4G 4DUGA 1WSBA 2WFZA 1WHTA 4XWGA 2IXEA 5DMHA 1DKPA 3ZWXA 3EBPA 1SXJC 4H6PA 3HFJA 3L79A 1XAGA 1HE1C 2HNKA 1TYCA 1V7PC 1L8OA 4AG5A 2Q07A 5KYKA 1GADO 1ZMBA 5LQSA 1YK0A 1RPAA 1X1TA 2ZB7A 3FPJA 1UQTA 4ZYLA 1QH1A 2YXDA 1J2RA 3VKHA 5HKKD 1N2GA 4HDMB 5CM9C 2IHJA 2OV1A 3UJ7A 4F5WA 4E7PA 5FO1A 1KFJB 3IAAA 4KAXA 4HYQA 2IZOA 4HX5A 4DC1A 5IKMA 5DM0A 3OZBA 1FS5A 1U0OC 3A3YA 3E1SA 1NVBA 3HV0A 4M0CA 5G02A 1HK7A 4BNFA 4GSLA 1K7CA 4EB8A 2P6OA 4LYGA 1JTEA 2WLSA 3ONNA 4RTKA 3ADCA 1YJQA 1QVWA 1W8IA 5JXWA 4B71A 2GBPA 3JSXA 1UZUA 2VQ3A 4PS1A 3EOZA 5CMLA 4ZVTA 3EOAI 1KHHA 2IZZA 4D9JA 4NDZA 3I37X 4BVLA 1VSUA 2FSGA 3TFQA 1DC6A 1R12A 1TD9A 2QPAA 1XC7A 1DJPA 2WIKA 5HZMA 4KTTE 4R2MA 1B0AA 1ID8A 1RBMA 4LK2A 3SQWA 4ZOAA 3CSSA 5B3KA 4P3PA 4FS8A 3RSFA 3F1KA 3RS7A 2PH3A 3VOBA 2AI1A 4YAGA 1SXJA 1Y3BE 1SBQA 1USUA 2BMDA 4MVJI 4R7TA 5K01A 4ENSA 1YMUA 1NUHA 4Q82A 1U1EA 3OFVA 1VSVA 4XQ9A 5JZBA 1SXJB 4ZVLA 4RVFA 1I7QB 5KSYA 4W82A 4K40A 3GQBB 3AGPA 4YRZA 2ONCA 4G1MB 1KWGA 3NTOA 4HAZA 2A35A 4UNQA 5E6RB 1KDYA 1Z5WA 5CH8A 1P2SA 4TUYA 3T7DA 2Z2IA 3N07A 4UDOA 4WKCA 3VFDA 1G0OA 2Z09A 3D6NB 1ATZA 2H85A 5E6SB 4LHWA 3C6MA 2DAPA 1EQUA 4XQCA 3GIWA 1XMVA 1M8KA 1U04A 4GVLA 2CZCA 1GQFA 3T3IA 4I1UA 4GZ6A 3T8YA 1V5WA 3ZHVA 4BMXA 3DS8A 3F49S 4RIFA 3WZMA 2Z6UA 2VDNB 3D6JA 3HXLA 4XARA 1KKLA 1AO0A 1FE8A 1T8TA 3B9QA 5EGSA 4RETA 3TZLA 1BO6A 3O3MB 1KKUA 1UMKA 5JS6A 3VYRB 1FPMA 4NV1A 5A0VA 3FMVA 1NKTA 4R1PA 4EI9A 3CUUA 3PDCA 1Q84A 2OAP1 1DKMA 2VYCA 3NBQA 4EY5A 2GN4A 2QP3A 4UVHA 3V97A 1OBFO 4E5NA 5LWHA 2MMCA 3O5AA 3AXTA 2OYRA 1T2DA 1VTKA 1JI0A 2VDRB 1JKJB 2C7QA 3LUHA 4OJTA 5A2QA 2CHEA 3OTOB 1Y4SA 3GLUA 4PYRA 2XUOA 3ZHRA 2H3HA 3K20A 3P45A 2P67A 3VNRA 1IEVA 5CW2A 5DM60 4IHJA 4KH0A 5KQSA 2PL1A 4P38A 1CF9A 1ZBQA 1C2TA 2C4VA 3H4MA 1WABA 4RPKA 4A2WA 3K71B 3QHPA 1YRHA 4NCBA 4JWTA 4F2WA 2C9DA 1NM5A 2H2IA 2QLBA 2Q1YA 6ADHA 3TQSA 4LDRA 2HRBA 3ZS8A 1L9KA 4GI2A 1ZRSA 2O2HA 4L5JA 2NZ2A 1U7DA 1K27A 2WE7A 2G07A 3BWXA 1TADA 4TS1A 3CCBA 1ISSA 4YWJA 4O2BB 1P73A 3E15A 4FVTA 5T8KA 5JXGA 4BLSA 2BL4A 3LX5A 1M1UA 3OZGA 4XJTA 4UUAA 3ND7A 1PEKE 2REBA 3GGCA 3JYPA 4Y6QA 4FJ1A 2E85A 2X8AA 4GI3A 1WNTA 2JAXA 1AX9A 2EX1A 3H1AA 4WDRA 5L7TA 1IPHA 3KETA 3THYB 5IP5A 5GZ3A 2R8XA 2HQSA 4DBLE 4D80A 1D03A 2D2VA 2Q5EA 3BSFA 2A1UB 1M1XB 1TZBA 2NV2B 1N2BA 2HJWA 1UBMS 1OQAA 1G8PA 3L8DA 4U8HA 3B3GA 2DC1A 4K9QA 4K0KB 3RLIA 1O5OA 2C03A 4L5AA 2C8LA 3EFHA 3P2EA 4Q3KA 4RZSA 2J3DA 3GWZA 2GEUA 1F4LA 1ACMA 5AJWA 2JD0A 3IIMA 3QMPA 5C7YA 1B2LA 2DLNA 3JD4A 3INGA 3N8HA 1JDZA 2XCOA 4QICA 1M5RA 2I65A 2WTBA 2Y6UA 3OQVA 2J0SA 2VRCA 2P77A 3BX1A 2IHUA 2WEKA 3HXMA 4WA8A 2NZYA 3WGUA 1LTHR 2XD9A 1DJMA 5FYQA 3E9RA 4EY8A 1RQXA 1P31A 2B4AA 2A33A 1DOZA 1MOPA 1TYZA 2Z08A 5L7WA 1ZUD1 1Q7TA 4GL2A 4OJMX 2RCYA 5FUMA 1K97A 3O8OA 4NYMQ 4EJ0A 2PZAA 3L1VA 5J4VA 3DHWC 3KR2A 2QK4A 5B7GA 1GAXA 2AC2A 3G9TA 3VVCA 3VSDA 1XEFA 3HH8A 5DM70 1JJIA 1FFHA 4E4RA 3SC4A 1Y5RA 2CY0A 2P9EA 5K6RA 1JLRA 5EZYB 4BB0A 4D7AA 4ZT4A 5JH7B 2IOFK 1BCSB 1E7YA 1X42A 2VA8A 4K81B 3GW8A 4ZREA 5I7FA 4TTVA 4MHSA 3GGGA 3SEFA 1X8XA 3ELUA 4AUEA 5KB3A 2EG5A 3ZWQA 4WCFA 3QXGA 3OEHD 4E5VA 1G5HA 4DS3A 2V6MA 3ZIAA 4L5BA 4MA0A 2AIRA 2PJUA 1JAYA 1N5JA 3ITKA 2PDAA 2L2QA 4HGPA 2PX0A 1CY8A 2VXCA 1RQLA 1EJ2A 5CEEA 1WCIA 2PUEA 2B4YA 2BGTA 1T6BY 1XKXA 3BJRA 5FUWA 1IY8A 1Z63A 2OHGA 3WRXC 1Q12A 3PRJA 4BO4A 1VIAA 3P8ZA 3AZOA 2VH2A 2PZMA 3KT0A 4HB4A 4GLLA 1THGA 5FTNA 1E98A 5TC4A 3B7PA 4YLEA 1WMBA 4KXVA 2BR4A 4B76A 1S3FA 4KFUA 4KNWA 4ZT3A 4JUIA 5HUHA 4MS4A 1VRCA 4BNGA 4R0VA 4L0DA 3D8TA 2D00A 3EARA 3IDSA 3QOYA 1T3ZA 3I2GA 1J56A 3C8HA 4NH0A 1Z3IX 2I8CA 4MKGA 3WAKA 1KRHA 1GG5A 2FZ4A 4TMWA 4ZC1A 1LUAA 1FNMA 1TQ4A 1X92A 1XFDA 4FNAA 1BDBA 1Q95A 5FFMA 2D06A 1OI7A 3U7HB 1E1KA 2PGAA 3TXXA 2HF9A 4LMPA 3ZYZA 2YYAA 5F33A 3ESDA 2JGLA 1EFDN 1B6TA 3HI6A 4FYHA 1DIOB 1Q0TA 3GJSA 4B6RA 3DE3X 2OKGA 4D0NA 3GG2A 2DQSA 3GCZA 1T9ZA 4DLPA 3OURA 1UXJA 2GR9A 4YLYA 5J3JA 3UPTA 1NQXA 3ZV6A 5HRAA 4B0PA 1QRUA 4BO7A 1Z08A 4O2BF 2P2LA 3GQVA 3NRCA 4HBZA 3RLFA 4Q3NA 2R8RA 3ETNA 1WXWA 1SPXA 2XMGA 3TIIA 2YW2A 3LKVA 1VL8A 3A05A 3BGIA 1GT6A 4HSEA 5EAIA 4HDOB 1IATA 2HN9A 3E5RA 3NGMA 4W6ZA 1Y3HA 3VR6A 3IODA 1ETHA 1G21B 2B0CA 1WE2A 4OHOA 4R8SA 1Z13A 1EVIA 1IG3A 3ABZA 3BB4A 1Q7RA 2G83A 3HPQA 1FXWF 3VTZA 3OQMA 5CCXA 1DIRA 3G8YA 3FKSA 2BGRA 5CIYA 1RRKA 4YBRA 1EE1A 1P7WA 4HRVA 1JG3A 4UEWA 1NYRA 4JJGA 4MYHA 4OQFA 4DQDA 4GG1A 3F7OA 2HB6A 2E18A 2D7CA 2VSOA 4FKMA 4GVPA 3VH4A 3HTXA 1COWA 2CUTA 5C1DA 1FMFA 2FR8C 3PXAA 1R37A 4ZOCA 1LPPA 1N6RA 3V34A 5ELXA 3DDCA 4OMCA 3LQYA 4MV4A 1T36A 3K6RA 3RC8A 3T3EA 1SOVA 4KYVA 3H5NA 3AR4A 4AJEA 1TLTA 3IUSA 1BEUB 1DB3A 4M53A 4DBZA 1YC2A 5TV2A 1UMDA 3IBSA 3LRPA 3GJYA 4FMDF 1W0KA 4H3HB 4Q16A 5BSMA 3U3RA 1KI1A 5CLJA 1RZRD 1CR1A 1EFRD 1SCDA 1T3TA 3K0KA 3WLOA 2REOA 1OBHA 4EI7A 1R8JA 3MCZA 3OZSA 1QGED 3DM5A 4LDAA 3QX9A 1AGRA 4JLKA 1OD6A 3DZCA 3OZXA 1H2BA 4QO7A 2CBXA 4ZXFA 4DLSA 2P9GA 2VNSA 3KPUA 3R5HA 1P8AA 1JA0A 4AS3A 2INGX 5F1KA 1FDIA 3I73A 5BV0A 4K1LA 1V7QA 4DSNA 2BDUA 4YRTA 3NBFA 1AOXA 3IEUA 3ZI4A 2C07A 2FN3A 3RREA 3FF1A 1S9DA 4HBGA 4AQYB 1BXGB 3O4VA 1SBNE 4GLJA 4CM5A 3NG1A 5E9AA 4E5SA 2PU7A 1JG2A 3MERA 3KKEA 3K8ZA 4ZI7B 3WGGA 2VHXA 2FKNA 4HEA6 3IVXA 1BXGA 1ZJZA 2UDPA 1DIAA 3VKUA 1SOMA 4MIKA 1PNRA 2QW8A 2PGLA 3SIXA 4J1NA 2NVOA 2P75A 4KNYA 1I4LD 2W2XA 4RTRA 4M7OA 5CB4B 4RZ3A 1A4XA 2ECPA 3GJ6A 4RVOA 5HF8A 2GYVA 3JQFC 4RVUA 4F97A 3LHFA 1XDSA 4QBFA 3PLNA 2RHMA 4WEQA 5A5DA 2P9HA 1ZKMA 4HNAB 4BX3A 4URZR 1GPYA 1QH8A 5HMMA 2JGRA 1AKUA 2JAPA 2JGNA 5ALHA 1VKNA 2OB2A 3ZQ4A 1O6GA 2IDJA 4K9DA 1NWHA 4G4SP 1DC4A 1F4PA 5DPMA 3GMDA 3IPYA 3UJBA 1NHWA 4I3HA 1KR2A 2WKSA 3VJMA 5LUBA 1ZCAA 3TO5A 4DQUA 3C5CA 4Q00A 5JNLA 3C87A 3I01M 1G4HA 4ACBA 2W42A 3A1FA 1CR2A 3CUSA 1VL6A 3K8YA 3ZE2B 2JFWA 2VLBA 5KO2A 1PL0A 3KP1A 3OQJA 4OX9Y 2G0AA 5GY7A 1NL3A 1YR9A 1QV7A 2BV3A 1BN7A 3P2YA 4IDPA 1IPFA 3E81A 1XKQA 1PZFA 2MSDB 5IDYA 5HS4A 5IDQA 3QWIA 1TO2E 1D2CA 1R0ZA 4Y2PA 3FD8A 1CZNA 5HOEA 1ZICA 2EP8A 3RUPA 3M4ZA 3VX3A 3H8WA 1SXPA 1OZFA 2QI9C 1VCIA 2WSSD 5C31A 2QI9F 3RFXA 2Y4NA 1OMOA 3FROA 1N4AA 5FBWB 5JADA 2YMLA 4BGDA 2JAWA 4LJSA 4XX0B 3VHQA 5T67A 2WUEA 2QW0X 2UVPB 4NJMB 2PQ0A 1ZR2A 1QHSA 3NMUF 1UDXA 5JS1A 2BM1A 2HO4A 2HF8A 3SS8A 3SQOA 4MI6A 1RLIA 1LTQA 3PC8A 4K1XA 4KN5A 3THYA 1X7YA 3EA4A 3H75A 5CBPA 1J5EB 3EGXA 3I64A 4GVXA 4OHYA 1NN3A 1L3CA 3IAM6 2PXCA 4RHUA 4M22A 4XA8A 3GVPA 3FDFA 3SAJA 1L7OA 3PGKA 3NVDA 4WNAA 2C8VA 5ER9A 3SYNA 2ACVA 3NHJA 1CNMA 2JFVA 3WA6A 3K0CA 1U63A 5AI9A 4K6GA 3NORA 4YJ3A 4IH9A 3NHKA 4KVZA 3AVTA 4D42A 1C80A 2VP5A 3I61A 3HCDA 1DU4A 1UK8A 2RGDA 2OAQ1 4LDJA 4OHUA 4NAVA 4F6LA 4DLXA 4Y6PA 5CX1B 4YUAA 3BICA 3FPFA 4FFLA 1P5HA 1U0RA 2HRCA 2XNSA 4M1KA 5EZQA 1BDMA 2OFXA 4HWGA 2IHZA 4R81A 1YZKA 3QY0A 4Q3CA 3GUVA 3I04M 4JBYA 3THWB 3HDHA 3C14C 3PHLA 2RG7A 1KO4A 2HF2A 4OAQA 4P0TA 1ULAA 4QHYA 3B6MA 1GEEA 4AK9A 1OFTA 1OA0A 2RGNC 3ANNA 1QNFA 5JISA 3I6BA 4QVKA 1A76A 1ONSA 1NW6A 3MLEA 3DT8A 1FUYB 5T4FA 1WUIS 5KIAA 3DOCA 4BKQA 5A5GA 1BMQA 4GX5A 4PZDA 2RGBA 1NJSA 5GV8A 1IXYA 3RW9A 1UDBA 1EQ2A 1GDDA 3O4IA 1UOQA 2ZJ4A 5BT9A 5HGXA 4Y2XA 7MHTA 4QPJC 4BE9A 4DB4A 1IAVA 1S7CA 2OECA 2GMWA 1SZPA 2YOFA 3DPUA 3QOFA 4BKUA 3IAS6 1UADA 2PD6A 1ZMTA 2ON6A 1N32B 3PQ7A 2G04A 1V6AA 3QVSA 2PCLA 3BIOA 1JEDA 4R05A 4TVSA 4WADA 4KN9S 2RGUA 4RCYA 5IARA 5WRFA 3VDRA 1FUIA 3CUEF 1PHRA 3NHMA 2VJPA 1VLMA 4J0GA 5JBNA 1NATA 3UM9A 5HXAA 1XPOA 1CIJA 1V71A 1IOZA 3EXIB 2BGNA 1UC4B 3EZ2A 1BRTA 4JL8A 3RAPR 4LAFA 2HMUA 4A5OA 4RTJA 4M7WA 2Z4RA 3IDAA 5AVSA 5I9LA 1ZCJA 2UXDB 4C7OB 3NIGB 3KBBA 5HCIA 5HF5A 2HJHA 4A16A 4EUSA 2W58A 1US8B 5BWCA 3EJ6A 4AN1A 2GZ3A 4ARVA 1II9A 4XVRA 1CZUA 5A03A 1HKHA 1QZZA 1TVCA 1F60A 1UWKA 1YT5A 3NV7A 4ID3A 5IMBA 3R5SA 2GH1A 3PEEA 2BI8A 4OP1A 2BFFB 3RC7A 2F55A 1TKRA 4TZ6A 3LXXA 2IS4A 1YHNA 2BM0A 2DCUA 3VHLB 1LZLA 1Z39A 1TUIA 1O94C 4DEVA 3I09A 5A2GA 2R4QA 4RY0A 4BO1A 3KO8A 2CV0A 3IP6A 2O8VA 4GZ3A 2Y9MB 3KT8A 2AFIE 4WOJA 3LPDA 5IJ0A 5IBRA 5L40A 1I4OA 4MGEA 2AL7A 5CNJA 2RGWA 3KQTA 3MINB 5EC8A 1CD5A 2MU1A 2QAIA 4AS2A 5ALDA 3K30A 3FAZA 1E4EA 3V6LA 1G19A 2YVQA 1M67A 4BVEA 4HL6A 4BCBA 1YUNA 3AM1A 3WLKX 2P6MA 1EWRA 3O38A 3BZWA 5ES4B 1LW7A 5JH7F 1HDEA 1SH7A 3C4JA 3OTGA 2ZS9A 3PRKE 1ENZA 4G0OA 1YH3A 3EQ9A 4XFDA 4A1FA 1GL6A 1TRHA 2X40A 4OQEA 3NYQA 1C7ZA 1P0CA 1Y9JA 2MDTA 4MWDA 1FP4A 5C3MA 4LTDA 1YK1A 2AE1A 1H22A 2AQHA 3ABQB 4U00A 5CA1A 2FOXA 5KYYA 3S55A 2MCFA 3ZXSA 5K8CA 5FTJA 1GLNA 3VPSA 2RFLA 3L8YA 1S8OA 3ELBA 2Z1MA 2EV9A 2Y1FA 2FRDA 3F9RA 3PPXA 4ND3A 3ZI7A 2AN1A 3NPMA 4CIYA 1KS9A 4M8KA 3BFJA 1OROA 1Q83A 1Z6QA 4QUAA 5IF3A 4QXPA 3GLQA 3L8ZA 1KMQA 1XMXA 1PR1A 2Q3MA 2XB9A 1N0UA 5M7EA 2YR0A 4O29A 1R0RE 3CUYA 4TMXA 1XMSA 3MRVA 2JLVA 3CLVA 2XQVA 1J8YF 3TZ6A 3VOSA 2O8FA 1D1SA 3H5RA 5B58C 2JKYA 2RE8A 3ZCUA 3W7VA 2CW5A 2H51A 5FUBA 2CCJA 2WC1A 2XUHA 1IONA 1CUVA 3PC7A 4RHCA 1LLFA 1R0KA 1S2OA 1PR2A 1SD2A 2R25B 3GCGA 4XGKA 5AUNB 4NBNA 5FPPA 4NAHA 2FW8A 2ZUDA 3G85A 3JQ6A 5DN9A 2YXBA 4MMXB 2IKSA 1TAQA 3OE4A 5HGJA 2QTHA 3QXXA 1PVOA 1P1KA 4EB6A 4AROA 1OAKA 1U5CA 3HCFA 2BJWA 4JLOA 3ACDA 5JD4A 1NX9A 2ATEA 1TM2A 3N58A 4GX2A 3FHJA 4DYDA 4IIJF 4KQFA 1I4EB 4INAA 3B52X 2G9UA 1QQ5A 3HDQA 1W35A 1PQ4A 2EWVA 2QRVB 1JR4A 3OQHA 2IUUA 5LQNA 4QAJA 5PNTA 2E4VA 1KIFA 2DLCX 4N3AA 3TFOA 2ZVDA 3AHIA 2POQX 2OFPA 4HPJB 3FGOA 3E23A 4J03A 5BVHB 1LI5A 2VDVE 1ZZEA 1EVKA 4KX3A 5ECYA 2BFNA 1UINA 4EG1A 1XVIA 2WUWE 3M6FA 2QSUA 3FZNA 2JEZA 2TSYB 2X42A 3C24A 1Q0ZA 3HUDA 1KZ7B 1GGJA 5BNIA 2QVXX 4D9GA 1KEKA 2F3RA 2VP2A 4IEEA 4ZO8A 4FX2A 1FFBA 1DAPA 1KNQA 1T2NA 4IQ4A 4MINA 3WL4A 3L7MA 4ZAZA 1PZNA 3EHEA 5LP6B 4GBGA 8ATCA 5AVXA 4G5RA 2FHSA 3L02A 4RF5A 2XRZA 1IBKB 1JE0A 4HQFA 2WF5A 2XXAA 4KBGA 1RBZA 4YP5A 2C9ZA 3T4UA 3IEIA 4FDLA 1QRRA 1UBUS 5KU7A 3CSUA 1R74A 1C2YA 4MIOA 1FUEA 3I28A 1L7AA 2BE9A 1ZCZA 3KZNA 1A8PA 4RD3A 1ANKA 4M8IA 2BE7A 4XYBA 1NI4A 2I9KA 4EW6A 1BD4A 1NASA 4G2NA 2Z0MA 1M6HA 1JEQA 2NSLA 1M7BA 2R7NA 2ZB8A 3BULA 4GIBA 4CR8A 3ECSA 3R9XA 2AOUA 4NARA 2IX9A 1IZ9A 2VPQA 3CZMA 4PGGA 4RJKA 1P8JA 4CM4B 3KZ1E 4RPGA 4JI0B 2VP4A 2XMCA 5HYVA 1U99A 4HWTA 4RY8A 3I1IA 3MTBA 5FBQB 1PCXA 2VDUE 3EY4A 3HGTA 3K0EA 1ML4A 1DPFA 5L4NA 1LSOA 3A6DA 2F3TA 3L7YA 3ICVA 4M1EA 1TZCA 3KAKA 5NLLA 2VG8A 5JC1A 1OI4A 3WZLA 4CL3A 3BMXA 2CVPA 1BYUA 4GBMA 2OOKA 4RFSB 3WBFA 2L82A 2YXLA 2RAFA 3EDMA 3S7ZA 5KTSA 3W7BA 2HJRA 4MW4A 1YZGA 4D3SA 3H5LA 4KLNA 1X1EA 1IEXA 4I81A 1KPIA 1TVEA 5GIPE 3B9RA 3PDIA 3O8CA 3FZEA 3Q7PA 1SGWA 3QKUA 3U0BA 1XNQB 4WZBB 3CUVA 4UARA 2NUPA 2OCXA 4HB2A 1P2BA 1UFKA 3AUAA 5H4HA 1R88A 2WYHA 3HCOA 1XVTA 4L4XA 1DAOA 4R8KA 2GCOA 2JATA 3F78A 4YT8A 4IRMA 3SBEA 3FYDA 5KKAA 1KA9H 1XP5A 3ACBA 2QRVA 4M88A 4X41A 4X7RA 2JFBA 4Z3DA 2ECQA 2OHIA 4HAIA 4QL3A 4Q4JB 3DBIA 2GKGA 3V00A 1ZK3A 3UENA 5EIBC 4ZTZB 3H9JA 4CKCB 3W05A 5A7FA 1H0SA 5H7XA 5ADHA 2AWNA 1OF1A 2JZOA 4FOOA 1G3MA 4KAAA 5EJ6A 2G1UA 4RD4A 2ORWA 2VXYA 3MJVA 5JLAA 2PUJA 1QP7A 3S29A 3ELYA 2QD4A 2QP9X 3FDXA 1G5RA 2R00C 4DWJA 2QOEA 3UV7A 4Q1AA 5DHUA 1DL5A 4EY7A 1NNSA 2PYDA 1V16A 1TEXA 4YR9A 1NI5A 2L17A 1MC8A 4KZPA 5IC5A 1QRTA 2WM2A 1BHQ1 5EZSA 1X9IA 1VFPA 5JDCA 3SGLA 4BEBA 1RU3A 1ULHA 2D5CA 5HQTA 1T0UA 3KB8A 1NXXA 5DHSA 1NONA 2M98A 3GEMA 1K7YA 1AF7A 3DNPA 2QRKA 2HSZA 3OAAA 1X3SA 1XTTA 2ZXFA 3EMDA 5HKKA 4RIIA 1J0BA 1PZXA 3N59A 3RANA 3RYFA 1QMPA 4BBJA 4DPLA 4DSTA 4ROTA 1CY0A 1MJNA 3HA7A 3ITDA 3R75A 5JCOC 3RPEA 3WRWA 1DRKA 5SYAA 4BMZA 2KWIA 2QWXA 2FEKA 3PI7A 4D9MA 3ZJ5A 1YJCA 1QKIA 3P97A 5A71A 3ZZUA 3A4VA 1ZNYA 1UBFA 1BS2A 2HC9A 3D9QX 3EZLA 3PC4A 2ZRBA 4WNIA 2GS9A 2YWXA 4JB2A 2X14A 4HPWA 2Q2NA 4M9UA 2WHXA 1R9MA 4KEAA 2V74B 3ZNNA 2A1TR 2WYUA 2BF4A 1FVFA 3HEAA 4HGYA 2PUWA 5B2FA 4X62B 10MHA 3MQFA 2NU7B 4KVGA 2E6UX 4PC2A 2HIGA 3IAXA 3W79A 2RH9B 5KI6A 4IUBS 2PIDA 3PQFA 1NDUA 1OTYA 4WLFA 3QPWA 1JBEA 1UBOS 1QHHA 2R47A 3G0CA 4HQRA 1HXHA 4JLWA 4K28A 5BYBA 4PZZA 4G1FA 3WYCA 4HX9A 2I7CA 4RPHA 4DUZB 1L0BA 1K9VF 1XEXA 2C0PA 3FTCA 4G8BA 1RHMA 1WO8A 1A97A 1ZK2A 4YPVA 3M34A 4M0PA 4E2YA 4C0WA 4BO2A 4DDMA 4FCVA 4C78A 1FDWA 3BJZA 2EF1A 5IBCA 2ZJ1A 1RWBA 3P9XA 3WLRA 2ZUWA 1HFEL 4KU4A 5IJ0B 1EDOA 5EKUA 2ANCA 1W4CA 3D7RA 4B34A 4CL8A 5B7QA 2XKAA 2EWMA 1FVOA 1XL0A 2K87A 4ZOLA 2YQ4A 4RJ2A 4L08A 1T5OA 3Q6MA 3MELA 1M34E 2RMKA 3HKEB 2HPZA 1YJ5A 5J59A 2O0JA 4D4HA 2ODTX 1GTZA 3BFPA 4J29A 4MHOA 1XE3A 4WRRA 1FZQA 1LEHA 1NLFA 1R0LA 1RADA 4C4TA 3GPLA 3S8YA 4P5EA 3HCNA 4IH4A 2I3DA 5AK5A 1MGPA 4YJFB 2CJYA 1MBZA 4INJA 3TTUA 4LJ8A 3KC2A 3DAGA 2EHJA 4BB5A 2D0PB 2FOIA 2PJDA 3CVUA 4O3MA 3K1ZA 3NDPA 3EA0A 3Q3GE 4LC1A 4O2AF 5JCJA 2N46A 1XKLA 3EGIA 1N7JA 3RG8A 3WGQA 3TOSA 1KQ3A 3N76A 1T9CA 2QVYX 4UHEA 1W2GA 4BQFA 1H0KA 1JQLB 1VJ1A 5KJEA 1GVHA 2KJQA 1FDVA 1XCOA 3MLBA 3SC2B 1BVHA 3VSBA 3PIDA 1KZGB 2BGJA 2YJZA 4F1KA 1J8FA 1DDOA 1P4JA 1X0VA 1Q20A 2HHJA 4L9AA 1HMYA 3T7TA 4UNRA 4U2GA 1FJXA 3AESA 2IUYA 2J0VA 3DLAA 1KQNA 3QKIA 3ZY5A 3ZXYA 1U3GA 4UHCA 3OOYA 1LSSA 1I2AA 1KYWA 3HCCA 1YIAA 5CB4A 2VDLB 4UTZA 2L69A 2IW3A 1BGWA 1WL8A 1YNOA 4M99A 1P1RA 1QF6A 2AZXA 4J8PA 2Q7XA 4JLBA 3QY9A 2I3BA 4IVPA 4MGHA 4A23A 4OY3A 1G1MA 1E18A 3MMZA 4QO8A 5IC4A 4E31A 2V97A 3VJKA 4R54A 1F12A 4ALJA 4EMSA 3SXUB 1JGTA 3HKCA 4WK2B 1OC2A 1M6YA 4G0ZA 4OATA 1AS2A 3WO1A 2JASA 2V5UA 3AI7A 2QG4A 2V3WA 2ZJ5A 2K4MA 2BGUA 1GRVA 4CNBA 1C3VA 2Y1KA 2JI4A 4P86A 1AM4D 1AVTA 1EVQA 5EPUA 3WDKA 2V6IA 1KYQA 1IHYA 2DWOA 4EX6A 2BVNA 2J7KA 4RLSA 1QTQA 1EE2A 2XUAA 1ZN8A 1ESCA 4P3KA 4K26A 1XAHA 4I9FA 1OFUX 4C2BA 4CLEA 1N77A 2DWPA 4MP8A 1NR1A 3D6MA 3ETHA 4MUEA 3X44A 3KLMX 1BFUA 1YRYE 3G89A 4H2DA 4NI5A 1K5PA 1KO7A 4NBKA 4YRFA 3ZV4A 1AV6A 2GARA 4XWWA 4HAWA 4G9EA 4PYKA 4E12A 2ESRA 5KNBA 1BDHA 1NJ6A 4YI3A 3S6JA 3UHAA 3S1LA 4CF7A 3ICPA 3S68A 1XPRA 1UJ2A 4OJQA 4YTEA 3ADOA 2JW5A 1SCKA 1WEHA 2F67A 4YMTA 2A4KA 1UEXC 2H5LA 5GVRA 3L0ZA 4EVQA 1FNCA 1MIOA 3NBKA 4L0QA 2PNFA 3NIFB 4EJSC 2XKBA 3HWSA 1OWNA 2B7BA 3HI4A 4CJXA 2NUAA 2YFKA 3C7AA 4KXXA 1WWKA 1X8KA 1C1XA 4HS9A 4RPJA 2V3CC 4LF5B 3M9XA 4G56A 3HCEA 2R8OA 2OZEA 5GP1A 2X1HA 4HEHA 3DO5A