3LTNC

Inhibitor-stabilized topoisomerase iv-dna cleavage complex (s. pneumoniae)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
226
structure length
222
Chain Sequence
KLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTAKAKMADILKNEEINTMIYTIGAGVDFSIEANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIALPPLYKMSKKGKKEEVAYAWTDGELEELRKQFGKGATLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDNVKFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA topoisomerase 4 subunit A
publication title Structural Basis of Gate-DNA Breakage and Resealing by Type II Topoisomerases
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Isomerase/dna
total genus 54
structure length 222
sequence length 226
chains with identical sequence D
ec nomenclature ec 5.99.1.-:
pdb deposition date 2010-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus
C PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.670 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ltnC00
3QX3A 2XKKA 4Z3OA 3L4JA 3K9FC 2XCTB 3KSBC 3FOEC 4KPEC 4Z4QA 4G0VA 3FOFC 3KSAC 2XCOA 3RAEC 5EIXA 4I3HA 4G0WA 2XCQA 2XCRB 1BJTA 3L4KA 2XCSB 4FM9A 2XKJE 3LTNC 4Z53A 2RGRA 4G0UA 4J3NA 4KPFC 1BGWA 4KOEC 3RADC 3RAFC
chains in the Genus database with same CATH superfamily
2ONZA 3FPCA 2DUUA 2I78A 3LNCA 4C7MA 1X42A 3KOXA 3BGOS 5C8DA 2WYWA 3GWGA 4ERXA 4NXNB 5LBTA 1RXVA 2AZMA 2OD7A 3EDCA 1TZMA 1OJ7A 3CRW1 4D45A 5IVPA 3AEKB 4WY8A 4DRXA 3R4VA 3T5CA 2WRZA 3ZHTA 2FPPA 4CIBA 3G0OA 4JX8A 1USIA 5K4HA 3N8HA 3ROXA 1OAAA 4JD5A 4RLFA 1SZPA 1ZNXA 4K9RA 2R44A 2G63A 2QT1A 2R96A 4DCNA 2R1ZA 1XDBA 3EFBA 5JCXA 1XQYA 5LZ9A 3KJIA 3OPYB 4G4GA 1U80A 3M5DA 3U37A 4D9NA 5AK6A 4AG5A 1Z4JA 3LUPA 1CRQA 2Z8YM 1SQFA 3LDHA 4C0WA 5IF9A 3B2EA 1MC5A 3FWZA 3DDCA 1ULSA 2F48A 1G66A 5JAOA 1QK4A 1ZN8A 2FF5A 3B52X 5F2KA 3NIWA 5K6AA 5JD5A 1ND6A 2HB6A 3H2SA 4Q05A 4ZZ0A 1UP7A 1VHDA 4Z7NB 1G5PA 2HMAA 5ESDA 4UHJA 2GN8A 2Q29A 2WKPA 4BZXA 4I4LA 3OCUA 2KBEA 4ESOA 4K40A 5BPFA 3LDAA 2HJGA 1IQPA 3NBKA 1ADBA 2AJCA 4NCAA 5K8CA 3U44B 1O96A 1DMSA 1Z62A 4URYR 1W36C 5BOSA 1FMFA 1RYBA 1EB9A 1Z75A 2B69A 5CXQA 1ZVVA 1EFPB 4Q66C 4RPCA 3KHKA 1E1YA 1NKTA 2ECQA 2P6PA 4XWGA 1XNGA 1UAYA 3MJFA 3D3WA 4PHHA 5D5PA 1LSSA 4XCXA 1GZUA 1R0YA 3DBVO 3X2FA 3ZWAA 2C2WA 1UIMA 4M1YA 3X1WA 3ZDAA 2PLFA 3I9JA 3WOVA 2RBKA 3HY3A 4Y2QA 4QSHA 5EKXA 4KYUA 4EGSA 5CA0F 4GBJA 1YQXA 5LP6A 1T9AA 1IEVA 1MKYA 4RLSA 2B4AA 4PLGA 3WOHA 2LGJA 1BU5A 4IIEA 1C4KA 1SCUA 3EF0A 1DJPA 1ZUIA 2HNAA 1YZLA 1E1KA 4M1MA 3AF3A 3HLYA 4CKYA 4QVIA 1FB5A 2XF8A 3LHKA 4LGVA 1L4UA 5SZKB 4F8JA 1AKVA 1M2OA 3QUSA 2G9ZA 5DRYA 2W2KA 5KWEA 4HUTA 2A88A 2HWKA 4WLFA 5BYJA 1R0LA 5FBZA 1L4YA 2VJMB 1ZCAA 2PWBA 3NFRA 3PXDA 3KX2A 1C9KA 2UZ0A 3BRWD 1NQTA 4V2IA 5TS3A 4E14A 1PFWA 3AEXA 1UZLA 3ISJA 3Q3GE 3KJGA 4ZXPA 2ADFA 2GBPA 4IDFA 1Y5NA 3GP5A 3F78A 1T3LA 4HFJA 1GLVA 3LYLA 2H18A 5BVGA 2C2XA 3ZQKA 2HCJB 2DTDA 4LWZA 3G0CA 1ESNA 1BD4A 3A7DA 2F4VB 2W43A 1QUFA 3KE8A 1NBWB 4HAOA 1DWUA 1NY5A 2PRJA 3TTTA 4YRCA 3VMMA 4N7JA 1ONBA 3FMGA 4OMUA 1SC3A 3TQRA 4YR7A 1CZOA 1I2MA 3OQIA 4FMDB 4RD0A 3F1KA 2E1RA 1NQVA 3BRWA 3N2LA 5C32A 4F1JA 1JFFA 2XUZA 5I3CA 4YRNA 2IUEA 1NFQA 2G09A 4FFPA 3QLVC 1R5JA 4LWQA 5AUNB 3R41A 5DWVA 2H1OA 3GNQA 4B71A 1R88A 3D64A 3HDHA 1NG9A 4EY3A 2CFIA 2JBWA 3OUTA 1HT2E 1QNLA 3PFFA 2VAXA 1JI0A 2NTEA 3GP3A 3LV8A 3EX7C 1JNYA 3W05A 5JXJA 1EFUA 2Z4SA 2HK6A 2FCRA 4DJAA 4PFSA 3MQ4A 2EWVA 3MSCA 4HYYA 3SQWA 3KT0A 1UZMA 2CBGA 1K2VN 1XR3A 4GX2A 1L7QA 4GVPA 3COPA 4OKNA 3S55A 1J9ZA 1NVVQ 1UXGA 2QRPA 2BKEA 3JZIA 4EB0A 4CL0A 3VR4D 3VC7A 3P9ZA 3HA5A 1A5BB 1RC1A 2H4FA 4HG2A 5I7UA 1OX5A 5KVCA 4JXKA 4E5SA 1P3JA 2UV8A 1I7DA 4OFBA 2HTEA 3GD5A 4HJRA 4P84A 2IKSA 4EUEA 2ID7A 5TS2A 3NGXA 2W0SA 3VPFA 2HBRA 3K5IA 1U7TA 5B55A 1T5TA 1XNJA 3JR3A 4ZC8A 3ZX5A 3TFOA 2WP0A 2LWIA 3R6DA 3SYMA 2HYIC 5JAZA 2H2HA 1I94B 4NH4A 3FNIA 5ENZA 3W90A 2CHVA 2EFEB 2VNSA 3W8RA 3K0SA 3QMVA 3VR4A 1NQOA 1MW9X 3LBFA 1BGWA 4UTRA 4BRSA 5JHGB 3P4YA 4O5AA 4Q39A 4IHJF 4C0QC 2BTQB 2R66A 3VZBA 5I9NA 3UEOA 1AKUA 1JQLB 1QRAA 3KUCA 1SQGA 3TQOA 4PHGA 3D5TA 1RYYA 1JQAA 5T4FA 1YDHA 3LCUA 1CR6A 5MGBA 2P6UA 4ED9A 2WMNB 3P0JA 2VP6A 2ZBEA 3Q6IA 4K9NA 1M6NA 1WCIA 3MQFA 2R8ZA 3GRKA 3W5HA 1MC1A 1XQXA 1JIXA 4AJHA 3AFOA 3SJZA 3JPWA 4O4LB 1YS9A 1QORA 3TOCA 5JNVA 1KYWA 3DOHA 3O95A 4QICA 1R5BA 1GO2A 1RYEA 3SE7A 4N01A 3ABQB 3ILHA 1EK1A 1IY9A 1HT1E 1NV9A 2NU9A 4B81A 2BBSA 1CR2A 2RK4A 3QXCA 1E9AA 3TJRA 3WB2A 5DI3A 5F12A 4YVFA 1RD4A 2QXTA 3T4PA 3TX2A 2BIFA 1Y8AA 3FCXA 4KRGA 5FI0B 3EVAA 5AVSA 1Z38A 1I4TD 2V9PA 2QVGA 1GRNA 2IHZA 1PJ4A 4OSPA 2ONKA 4ZDIA 2YWCA 2FEAA 3F6CA 4B2IA 2JZNA 1BDHA 5GV8A 4HZUB 4K46A 5B3KA 4XWYA 2PL9A 3O4GA 4NBVA 3NPMA 3PGJA 1K6JA 3I92A 1N3YA 3OSZA 1JTVA 4AWAA 4DSTA 2J32A 3R3SA 4QDZA 4L8VA 2CLCX 3J7TA 4R69A 3O26A 4DLNA 2DQ4A 4HSGA 1S02A 1C29B 3GYGA 5CM8B 4UHCA 1QRSA 3MNFA 4BPRA 1Z29A 1VPEA 4EGAA 5IYZA 3GJ4A 3NRCA 2WKQA 1LSUA 1XZJA 4HDSB 4K8OA 1U8ZA 2QB5A 3FCOA 5AQEA 3RB8A 2BE7A 2C4VA 1L3BA 2XUFA 2WYUA 3ZDEA 3A9CA 2FQXA 1Q2XA 2NZUG 3TQIA 4E08A 3OQ1A 1F9EA 4G0WA 3STHA 2XEXA 3MWKA 4J7CA 4RTOA 4CLXA 1CVLA 1ENYA 1RBQA 2ZB2A 1B00A 1RYHA 2H57A 1IZ0A 2PZKA 2VPXA 3L84A 3LAWA 4AX8A 1NSTA 4YLGA 1KSJA 4IICA 3BMXA 3UF0A 3EFEA 4JKYA 1HFWA 1EUCA 1Z8NA 16PKA 1ZKDA 3NALA 3PNOA 3WLIA 3BB3A 1Y81A 2BFEA 4M49A 4P38A 4HDKA 2AZ4A 2EGUA 4LE2A 4YS6A 5AJUA 4ZI5A 3L0BA 1OJLA 4LECA 1FP6A 3CH6A 4JK3A 4AO8A 3MUFA 5KVVA 1H65A 4W7IA 3PUWA 4RWZA 1RRGA 1HNNA 3ZLBA 4FYXA 4MQEB 3L2OB 2QU7A 2AFHE 3TLBA 4QT4A 3TECE 4X9XA 4XGRA 4IMJB 2GEFA 4CEIA 3OVMA 4ZVPA 5DX1A 4GX1A 1PW5A 3ANNA 1QE0A 1E6UA 2DWQA 4Y0AA 2C78A 3DMTA 1YU6A 4KYIB 3VMFA 3EUAA 2XMBA 2CMKA 3CWQA 1AHNA 1VFNA 1NW5A 1J2RA 1XQWA 2NZJA 3O2JA 5JFTA 4EJ6A 2PJDA 2XITA 5ARBA 2SECE 3X43A 4CMCA 5HUQA 4GGPA 1IB0A 2ZREA 1TL7C 2Q5EA 2YOHA 3EGWA 3GOQA 3LQFA 1DJOA 2GQ0A 2FJ0A 2P3OA 3OJOA 4AFNA 5AKHA 1KI6A 1APBA 3BIFA 4EZIA 5HP4A 4BGDA 1DUSA 3T54A 2VDWB 1Z2OX 3TIFA 3A4YA 5CX1B 3MMSA 3NM6B 1QHFA 1UPTA 1UWKA 3HN6A 4MR7A 4M1TA 1NF9A 2FEMA 4XPIB 3NHZA 3IA7A 4FGKA 2D7JA 3UFXA 3L5OA 2WUFA 2JAOA 1M73E 3W34A 3ZWMA 1FP7A 3OJXA 1QP0A 3LQ2A 4FNAA 4HRYA 5G4KA 3K7EA 3C2QA 4XA8A 3NTLA 1TM5E 3ESAA 4ZRDA 1UP4A 2MYUA 4D44A 3UMGA 4HNTA 2C1ZA 3N7AA 4D8YA 4HNVA 1NVVR 1ZUD1 2I7TA 2HNBA 4UEQA 5CCEA 4S0ZA 4MUYA 5ITZA 1K0UA 4RHUA 3W3ZB 2VHUA 2CD9A 4RXMA 3ELYA 5ALSA 4NRDA 4V1CA 1MX5A 3FETA 5C9ZA 1D3AA 3IT2A 3NJ4A 1N0IA 4JBLA 4K9PA 2O0JA 3DMNA 4MMXB 5ILGA 5LZ5A 1PZEA 3AZOA 2QVYX 2MDTA 3U3RA 4AAYA 3H4VA 5BN4A 1FMLA 2IYTA 5CB8A 5ALWA 2IWRA 2DFVA 2V65A 3K0CC 4MQ6A 5G0TA 4CMEC 2X4GA 1F60A 4LQ4A 4DGSA 4WZAE 5GVSA 3AR4A 2GCEA 5E7JA 3OE1A 3ZWYA 2GN1A 5B1SA 5KYYA 1Z28A 4QRIA 3R44A 2VHVA 3HBMA 4OYHA 1ZD2P 3DULA 5DTMA 1EWRA 1TUBA 2VC2B 3U9SA 4CMBA 5K20A 1E92A 1MG5A 3ANYB 2ICAA 1KZYC 1M10A 3HO1A 3JTEA 2OOSA 3PCTA 1JEQA 2J67A 2ZWPA 4K26A 1DXYA 3SQNA 3ZU5A 3S1SA 4HH4A 5F3DA 5BNFA 3SJBA 2LXNA 3OIGA 5J4KA 4CUZA 5EG5A 3TIXB 4K2AA 2NZ8A 2BE9A 2D8AA 1G21B 4H3SA 4OBWA 4D9CA 5JJ5A 3CNNA 5CB4A 1GGHA 2D1TA 3M8KA 4G2TA 5DBOA 4RACA 3W4IA 3IRUA 4JXZA 2IV2X 2VPTA 2IZZA 2E2WA 2F1IA 1XE3A 4FBGA 1EUYA 2QT0A 4RK5A 4Z53A 4CNBA 1E3LA 3PF8A 1S7CA 2UYQA 2ZSKA 1YDWA 2WYVA 4JELA 5CAEB 3ZE0B 1D7OA 2ZS7A 4E2XA 1GXSB 4FJ1A 1B1AA 2W90A 3NT2A 5D86A 2PUAA 3QEAZ 4W8GA 2YBDA 1OT3A 3X3HA 3AKCA 2F3RA 3MCAA 4WUVA 1QH9A 1EDBA 3HBNA 3NAQA 2UKDA 4EJSA 1M7GA 4MI1A 5KQGA 1JJIA 2B37A 4HLNA 1XAJA 5FTWA 3R4CA 2CE2X 1ISHA 3UA4A 5KNLA 3W5IA 1VHJA 2GEDA 3PGXA 4HVTA 3BD8A 4IL5A 5AUQA 5IKMA 1EX7A 1PR9A 1J56A 2WU0A 3UANA 4AD8A 3SZ3A 5K09A 3GPDG 3SJUA 3PLNA 4L4XA 3WL7A 1GU7A 4CMKA 3HB9A 1DEKA 4WXEA 2RGAA 2B61A 1KH2A 1RLJA 4KXVA 4J2OA 3D8TA 1O97C 1I0IA 3EHDA 1GG5A 2QRHA 1PGPA 2XUGA 3R40A 2W58A 9ABPA 4RPLA 4YAFA 4M22A 4UTXA 2QRQA 1B8PA 1KFKB 4XIYA 3AFIA 3VPAA 4FDUA 4WKNA 1ZDMA 5JRJA 3T5TA 3AR3A 2ZUEA 1MVOA 3JW8A 4COKA 4Q3DA 1EVKA 4OHCA 1S2LA 3MBKA 2Q4EA 4LCBA 5K05A 3KEFA 5BRJA 3PQ7A 4KQXA 4QYWA 3VDRA 2FMKA 1RRKA 4MUKA 2ODBA 3IGFA 4G65A 4NMLA 3D02A 1C9DB 2RARA 1E6WA 2FFAA 1XAHA 5CK5A 3DEAA 5FQOA 1JIIA 3S2EA 1U4SA 2JAQA 5FO0A 4B3MB 1NRXA 1B4DA 3ZD7A 4YRAA 4KLRA 5AO9A 1US8A 2NZXA 4WZZA 3A14A 4W1SA 2PL1A 4Q9HA 4AZ3B 2UZ1A 3RT9A 4IPTA 3HWRA 3W1VA 3R7DA 3K9NA 4UD6A 4D82A 5LQCA 1E59A 3SCZA 4R2JA 1PR2A 3UWMA 2Q50A 3KQWA 3WTBA 4DZTA 3OT4A 5K0EA 2ZTMA 5T4HA 4AT1A 1NF8A 4F1WA 3NEPX 2NV2B 2B83A 1V6SA 4EG1A 1Y5RA 4YT2A 4URXR 1FMTA 2Y0BA 2A7QA 1FFHA 2VDOB 2FEWB 1XGKA 2QQ0A 1N6HA 3PFHA 3G2QA 1JTEA 1HZZA 2ZP1A 3E2PA 3FZYA 2X0FA 1A9SA 1J22A 2GZ3A 2H3EA 2YOGA 3IP6A 3SIRA 5KQMA 5K2OA 1UH5A 3BIXA 3ZX4A 2WK1A 2PVSA 2VO1A 3S1LA 1GL9B 1SCNE 2ACWA 1NX6A 1TVCA 1HR0B 3JASB 4C76A 4ETMA 1QHHA 3K1YA 1T4GA 3WLFA 2CVQA 1ISRA 4S24A 4WFIA 1JPNA 5B6PA 3G2HA 2JGMA 1T43A 4AURA 4CEHA 4DG8A 2ERCA 4AP6A 2C20A 3TOXA 3JSAA 4MINA 5KWIA 1UWCA 1E64A 1YAJA 1TIBA 2JLQA 2QN2A 2TS1A 1R66A 1XXHB 3IAAA 4MO2A 4PAGA 4US0R 4ALKA 4DV5B 2O19A 1GQFA 4PSUA 3RT1A 1MTZA 2PKWA 2ZROA 3CLTC 3LSTA 2BBTA 4JSTA 1Q17A 3WLOA 4Q4AA 4U0JA 1TUGA 2F3UA 4G0UA 1O4VA 1WSDA 3UW3A 1N9GB 5AKEA 3DV2A 1J9GA 3T9FA 1FRFS 4D9EA 1NN0A 1X1DA 3E35A 1JKJA 1U3FA 5GP1A 2GAIA 2XXAA 2O8DA 3MTDA 4Y1GA 5EYPB 3E9MA 3UG6A 3WQQA 4A91A 3AEZA 3L0CA 1J5XA 4LFBB 4RKFA 3OU2A 1ZH0A 3K5WA 3O7MA 2JFZA 5EMJA 3U4MA 1BN7A 2X5KO 2XNKA 4TN1A 2PX2A 3UJCA 1IBKB 3HBFA 4GR9A 4IGFA 3MT9A 3UMFA 2MOKA 1V2GA 1UBHS 1UMCA 4RK4A 3BIWA 3C3KA 5GJCA 3ROGA 2IHVA 5IUKC 5A1TA 3EIUA 3O74A 2LKCA 3ORYA 1Q0HA 3C6MA 1D5WA 1TT5B 1X7WB 1CJVC 3L8GA 4KVGA 1KOFA 2WWXA 4Z7JA 3KZNA 1K66A 4LISA 5AVXA 1UMBA 3H2BA 3O1LA 1VPWA 1KJWA 5J2UF 4PYIA 2C31A 3W5AA 3U4IA 4YRPA 1XN1A 4PO8A 2Y1CA 3TJMA 3UQYS 4MI6A 2A9QA 4I5DA 3AY3A 3K1JA 2WFMA 3HKDA 2H65A 3B1YA 4FR5A 2JFOA 4ZVKA 4PS0A 4YAOA 2GRJA 2W2TA 3G2LA 3MD9A 1B41A 3GHHA 2WVHA 3O8OA 2ZRFA 1OFUA 2IDZA 2QMZA 3GAAA 3E7FA 4RJ2A 2L18A 3ZY6A 4A4DA 3AIIA 4HY3A 4UTPA 2VP5A 4GYJA 4JS0A 4CKBB 4R68A 1FVXA 1VLVA 4B0PA 2B0CA 1TPZA 2CV2A 3TZHA 4Y9SA 1I6WA 4GXTA 1U2PA 4AZSA 2LV8A 2O8BB 5H0IA 2ZT5A 3C15C 4DB2A 2DSTA 2X0IA 2PPLA 3KYJB 1FYDA 4KN8A 3H4MA 4F9FA 3PQ6A 4HTAA 2EX0A 1IATA 4HJXA 1AKRA 1Z5OA 1L5SA 1NX9A 2G3YA 3BTVA 4HMOA 4G4JA 5AI8A 1WOMA 2I6TA 2V55B 2X4DA 4KXQA 4P54A 3NJ8A 4S0XA 1YZHA 3HACA 3PUZA 2W83A 5LWHA 3NRBA 1SEPA 1XDUA 4LZAA 4EL5A 2PU5A 2DBQA 4K28A 3MRXA 3CVYA 1PS8A 1AN0A 3GGCA 4JJ6A 5CH5A 3TQQA 3N2KB 1JVSA 3PFWO 3SM9A 2PMDA 2ZJBA 3D7KA 4ZAXA 2QTFA 3UHPA 4HQKA 2WSSD 3A1NA 3A6GA 3RJZA 5LU8A 4WAUA 2V3WA 3S99A 4BVEA 5GWXA 4D9FA 3CT6A 3QPAA 3H1GA 1KXJA 4L02A 1LDBA 4RF3A 5FO1A 4I4TA 1DIHA 1I01A 5B3JA 4B9AA 4MB0A 2FP4B 3BB1A 4MLCA 3IDOA 4QGFA 2WIKA 1RKXA 2JCSA 5JMWA 1KA9H 2I65A 5CVVA 3Q85A 8OHMA 4DR5B 4X7RA 1WTCA 3TLAA 2RJ3A 1ZC3A 1Z0IA 2H2DA 1MN6A 4YJ3F 2FFHA 2F1JA 1AX9A 2E37A 5MFZA 5A6SB 3GAFA 2IUUA 2G4VA 1Y4ZA 4GICA 2HA2A 2WSSA 4AM8A 3ADBA 2ODWA 4A73A 2P5SA 3F8WA 1IY2A 2C1EA 3R7WB 4CW7A 4GZLA 2PUCA 1SR8A 4MJ3A 3Q1KA 1U0LA 1V8FA 4F5YA 3L93A 3FDXA 1QHXA 1SVMA 2O2SA 2XKKA 3X1JA 1L7BA 2J48A 2I29A 3IUJA 4Q4LA 4YIKA 3U3XA 1QCZA 1RADA 2VAMA 1CZUA 3OKAA 3EVEA 4HYEA 5DU2A 1P0QA 3CRNA 3T7RA 2PZGA 5L3QA 3KJXA 5TNXA 5T3YA 4HQ6A 1Y1LA 4ALJA 5JD4A 5KOHA 1RAFA 3GIWA 3LMKA 3PQEA 3S27A 3LXRA 1EXVA 4IX1A 2C0PA 1RHQA 2O52A 2QSJA 3IKJA 4F9EA 2WUEA 4DC0A 2XIQA 5D6NA 1B15A 1GTZA 1N8SA 5CT5A 1KJZA 2YZKA 3AEUB 3SQOA 3OJLA 1QU2A 1YDEA 2NSLA 2XLCA 1SBIA 2F3TA 1OFHA 3KB2A 4OA5A 3ZJ4A 4E3WA 1HLGA 4R6WA 2Q28A 3TJZA 3ZZ0A 3HH8A 3LT4A 4MJ7A 4MI9A 5KX5B 1WMAA 1RJ9B 4WZAA 4O2RA 3T38A 1Q84A 1E79D 1EX6A 4WBNA 2FMTA 2WF8A 3M1LA 3MHPA 2YKGA 3R75A 4MJXA 4WT7A 2VP3A 5EP4A 3P9QA 3SZMA 1AQUA 1DEXA 3SHFA 5HPYB 1RBMA 1SGWA 2P68A 3QVGB 4GMFA 3HNPA 4WGFA 3TW8A 3ZJ5A 3DMHA 1C0PA 1T35A 1XMQB 2I76A 1JFTA 3OFSA 3L7MA 3OEEA 4FE4A 1D6NA 5CG1A 1UOPA 2O8FA 2Z5VA 2Z8YA 1QBKC 2XNHA 4QJIA 4H3VA 2Q5HA 4L5CA 5AI9A 5EQTA 3QM1A 3TYXA 1YA6A 5D6OA 3E9DA 5LCXA 4KSYA 1CUYA 2QJTA 1KBZA 2JAWA 3VRHA 1EFLA 3PQCA 4OUKX 5DMHA 1J21A 1E79A 5IAJA 1R0ZA 4ZV9A 1NNI1 5JROA 4RS4A 4DMKA 4KO3S 4RGVA 1CSEE 1YBMA 2QGZA 2I2CA 5D3MB 5C8VA 3GMDA 5B36A 1HLFA 3INNA 1E3WA 1UAAA 4KR7A 3N6RA 2VEOA 4J0IA 1VLQA 3C3JA 4CTKA 2DQSA 2E6KA 6GPBA 2HKIA 3PQ4A 2GJKA 4TVKA 4BQSA 2YCLA 4PRYA 5K0SA 1XTVA 4PYOA 4NOMA 5LZ8A 5C7LO 4IRUB 1NYLA 1CEQA 2P65A 1V6CA 1DC7A 2VK8A 4PXSA 4ZAWA 3SIWA 4F3YA 4JUBA 4U2DA 5DM60 3BMNB 3LO5A 4LK3A 3N2GA 1KO8A 2ZEJA 4N18A 1ZWKA 3IDSA 4LNAA 1PX0A 4GI1A 4E1VA 3E5HA 1BCRA 3SLRA 4Q4HA 4X1KA 3QUQA 4S12A 3UG7A 1QV9A 4K9QA 1JV2B 3UJDA 3G3EA 4FR2A 4TS9A 2I9PA 5IWAB 3M4XA 2J0VA 2Q5JA 1D1QA 2E4UA 4PX5A 1LJ8A 1XTJA 4TOIA 2RC6A 3INGA 1YJBA 2FPIB 5KWJA 2XB2A 1EEHA 3VFDA 1RJDA 4D2IA 1U0RA 5BVHA 3LCJA 2PKQP 4N1AA 4PAQA 3EWSA 2RMKA 2IYVA 3LU1A 3ZIAA 3F2IA 3CH7A 4JCOA 2WJPA 4INPA 4OIFA 1OXMA 2XZOA 1DE0A 1PG5A 1G7RA 1L7MA 1SA0B 2PUFA 2R97A 1JI3A 2OENG 1H5NA 2B9VA 3KUKA 3NBMA 4YTEA 2PZJA 5TV2A 3DO6A 5B64A 4ZEOA 4KC0A 3DNPA 3H8WA 1R8YA 3W5DA 4DV3B 3K9FC 4XRGA 1YIDA 4MLDA 3AL2A 2JCYA 4PTZA 5BSTA 4TS4A 3SE0A 1B0AA 4C4SA 3IEMA 2QN6A 2F17A 2PH3A 2KPOA 5EKUA 3VHXB 3SI7A 2BCGY 4XB2A 3WYBA 3R5KA 5C5IA 2UVQA 2JF0A 2DVMA 1I7PA 2XEDA 1U5AA 1A4XA 1X7ZB 2ZIWB 3S8YA 2OORA 1KJYA 1XSEA 2W6NA 3L8EA 4BV9A 3UT5A 1NW4A 3V4FA 1H2AS 1XF1A 3H11A 4LDPA 2H31A 2XUHA 1YS6A 3ZUPA 1NXXA 4B3XA 4F7WA 1SZDA 4GSKA 4AECA 1JHUA 5T4BA 1LUAA 2M32A 1A9ZA 2ZB4A 4IH9A 2V6JA 1QGUA 3RSFA 4UZFA 3T5MA 1K8RA 2A8YA 3QPBA 4N0QA 2Z8ZA 2J31A 2GN0A 5G0SA 4QPCA 3RV3A 4JWTA 2N3ZA 3AONB 5A6VA 1GGFA 2GZHA 3A6JA 2JG3A 1DGQA 5F52A 2B30A 3LM8A 4GNRA 1TEZA 4L2IB 2A9KA 3BJMA 3IP8A 1EIZA 2OD9A 4UE3S 2FYTA 1B74A 4EKYA 3QV2A 2CZQA 2PH5A 4JLMA 1AURA 4Q1EA 4R05A 1TCAA 2O57A 2EEPA 2PSEA 2C4UA 2EP5A 3WAKA 2GX6A 2IYFA 1RXUA 1E7YA 3L7BA 5KI6A 4HAIA 4O4IF 3L8FA 3U3OA 5CBKA 1YVPA 1ZSNA 5HJEA 1GGMA 1KI7A 4RA6B 1G8PA 1Z0JA 1JTFA 4XFDA 4XFKA 4PE5B 3H5IA 3IPAA 4EPRA 1VJRA 1OAOC 4H1VA 1WLYA 2KQUA 2SKDA 1SIUA 1T0PA 3DMRA 1XRPA 2JI4A 3T9DA 1T26A 3AUAA 5H3LA 1CX9B 4OJMX 2JLBA 1DWOA 4Q3BA 4BMNA 4GMGA 1QQ6A 4JP2A 1G4HA 1PWXA 3VR3D 1I33A 5HW0A 2NSHA 2EXXA 1ID8A 4ARBA 2PFKA 2VAVA 3C3XA 4LXHA 5DNWA 1T9CA 1N3LA 1EVYA 1SH7A 3WL4A 3SS9X 3O9VA 5COBA 3GCDA 4R1TA 3SBDA 1ZK4A 3CWCA 3NRJA 1C3VA 3NYIA 2Z3ZA 1T1RA 1IHOA 4HWPA 1D2EA 1JDZA 3T3GA 5I7FA 2PFGA 3EMVA 1K8QA 3JD2A 3ANLA 1FA9A 1KQFA 2I7CA 4QL3A 2WD7A 1BEEA 3GJSA 2PMEA 3ZY4A 4YUWA 3EVCA 4BASA 1B0ZA 5KHOC 2J9ZB 3GEGA 2UYHA 1Q7EA 3F46A 1CJBA 3W2FA 3I5XA 1U9YA 4BDTA 4XVHA 1I10A 3I23A 1B1CA 1W88B 4HDRA 2OAQ1 3PRJA 4US1R 5DDIP 4ZDKA 4ZHQF 4Q3EA 4E1BA 1KI8A 1QLWA 4RPJA 1RHUA 1VBKA 4MW7A 2BFFA 3GFVA 3PTAA 3RGGA 2J6IA 1Z4PX 3K0AB 4NK4A 1JEAA 3GQBA 5CVUA 3OURA 1MOSA 3JSXA 1NBHA 4W7HA 5KOJA 2BFCA 5A3SA 3RODA 3AB3A 1TD9A 2W2OA 3MWEA 4I46A 3G79A 1R5OA 3LDGA 4LNUB 4KWTA 2VWPA 5IWCA 2VDVE 4PIMA 2WAOA 3QLVA 3U62A 4KN9S 2GCGA 5DYWA 3FJ1A 3KSDO 3V9PA 3EIHA 1QAMA 4DGQA 4LF8B 3HKEB 1E2IA 2Q41A 1G8HA 2XUAA 3A0UA 5F1YA 4JT8A 5C35A 2HJRA 3BHMA 1JG4A 3FVTA 1E5XA 4Z51A 3V8RA 4NOJA 5DH9A 2ZJ7A 1YA4A 1EFDN 2VJYA 1RXYA 2VYFA 2ZANA 4RM2A 5HJ2A 3CLRC 1TGVA 4MULA 4JLNA 2OPHA 3R77A 4BJ3A 4AJ1A 3SHWA 1NUAA 3ZLTA 3H8VA 5I7AA 2IDJA 2F67A 1CEEA 3L8HA 4KR0A 5F5LA 1IEXA 3ZVMA 1X13A 3KSZO 1P6QA 3IT0A 5J3JA 1FRVA 2BFMA 3U1VA 4JWKA 3D6JA 4DA6A 4L4ZA 4AJOA 4OK5A 2JHPA 1UBMS 1O9BA 4R6XA 2BKVA 5CVCA 2C0CA 1KHTA 4JX9A 2IELA 1FDIA 3OQJA 2UXBB 4WH0A 1SO8A 2W0MA 5DTQA 4M1WA 3GPCA 1IEWA 1TE2A 3NO4A 2Y0DA 3PQDA 4NZYA 2WKSA 3BXPA 1SOUA 3PSAA 2G1KA 1DDIA 3RVQA 3SLGA 4I99A 2VUIB 3H1TA 3U48A 4HQFA 3B78A 2IX3A 3U4HA 5CX4A 4W9RA 3QW4B 3RK4A 2R3SA 4MEJA 4RMJA 4HEA6 5FKJA 1P0PA 3ESZA 3FPHA 3AU8A 2QZ9A 1QP7A 1V3VA 1OSNA 1Z7WA 5JZ9A 3NDBB 2WJAA 1A7KA 4WASA 1G38A 4NBLA 1RYNA 5I4IA 4Y2JA 4MKRA 3CSSA 4BLTA 2PYIA 1MB3A 2AHRA 4FDMA 4G26A 2DH5A 1O5IA 3RKSA 3B38A 2DE0X 4TLDA 3UWKA 3TSAA 4Y2SA 2CCKA 4IZ6A 3AQIA 5BMOA 2NU6A 4V0QA 8ADHA 4MYHA 4KGDA 1JU9A 4L7VA 1ODFA 1RQ7A 4LHXA 3UCXA 1KKLA 5K8LA 1TU4A 3HSYA 3ES9A 3I0MA 4R2LA 1P91A 3P96A 1NF3A 1R8XA 3PEFA 3TOVA 2B2NA 5D3ZA 1QTQA 1WJGA 5FUWA 3G23A 4JJFA 1O95C 3VPGA 4PR0A 4IIDA 1M5RA 5JJIA 4A16A 1SKUA 1YR7A 3EK2A 3DXXA 3ZQ4A 3AV0B 1HDYA 3BJEA 3OETA 4YRDA 2EFGA 3KSRA 3PE3A 1HNZB 2DAPA 2NXWA 4D8WA 1A7UA 2NUAB 2QUHA 2DZDA 2OGUA 3FVQA 4HDMA 3GVPA 4S1VA 4WOPA 3G1UA 2B1GA 3SEAA 3BPSA 1D1TA 4G23A 2H63A 4IDGA 3SAJA 1JYEA 1CQWA 4XOUA 2Y92A 1EUQA 2XR1A 3R3UA 1FQKA 3SG0A 4DMCA 1W9HA 3RGWS 1MX1A 2JJ1D 4OHBA 2AOTA 1VBFA 1UBKS 3C4JA 3D2CA 2FU5C 3THWA 3IIKA 2GPBA 3JVVA 4ND8B 1C2YA 3IOCA 5J2TA 3NIFB 3QFCA 5CTJA 5SV2A 1Q15A 4DV7B 3FHTA 4ITVA 4UOEA 1DHRA 4TMYA 3OEYA 4FSHA 4MWEA 4EW3A 1RYFA 2P9FA 3O1JC 2AFIE 5ALIA 4U6QA 3VHQA 4INJA 4GRDA 1H66A 1XTRA 3KJHA 3NI2A 4FYYA 5AKXA 5U9CA 3B7GA 2ZB7A 4WEQA 1QDEA 3ICCA 4ZI3A 2JJ1A 4P6VF 3H3XA 1DG1G 2FV8A 2NT3A 4DQVA 2BMJA 5EGNA 3BZUA 4CN8A 5H1YA 8ATCA 2P40A 2VSQA 5CFNA 5F35A 2O54A 1KDPA 1HQCA 2DLDA 4MUIA 4HV4A 3ZD9A 3K2BA 4JA0A 2QP3A 1H23A 2R84A 4DBZA 4YC7A 1QIKA 2YBEA 3KQYA 3LT1A 2JHFA 2VA9A 2WTEA 5LQKA 5DHTA 5DYTA 2C7VA 2ASVA 4TTJA 3EQ6A 1MRNA 3AI1A 1KL7A 4Z2YA 4IWXA 1O9HA 5EMMA 3ML1A 3A6KA 4EFDA 1P81A 5KYWA 3NWPA 3ZE9A 1WB4A 4CUJA 1NY6A 3C6YA 4K2HA 4N0PA 4Y1RB 6AT1A 5KNCD 1FJHA 3AVWA 1G5RA 5EKSA 2YFQA 1EJ0A 4K1LA 4EO7A 1PI3A 4MRRA 4HPWA 1X8LA 2C29D 4EG6A 2E82A 1XDZA 1AKEA 1RZ3A 1Y1SA 2J33A 2NAFA 3EIFA 4DM4A 2AFVA 3M7IA 1QK3A 4LBYA 1GA6A 1TJNA 1S2MA 3RSHA 4BCCA 1VCIA 4UMVA 4TSRA 1CT9A 4G4IA 3V7WA 4OOFA 4YJGA 1F4LA 4RTNA 4TUYF 3F9RA 2FSHA 1NBEA 1FLNA 4BJ5A 1G3UA 2QD5A 1H93A 4AMYA 2QM8A 4D3YA 5IT9A 3FGOA 4YJFA 5KNCA 5FFFA 3R0JA 1OZ0A 4MRMA 1LXCA 3EN0A 4XYBA 3TKAA 1P62B 1P1KA 2FJUA 2J0SA 3O93A 4TWIA 3RROA 3SFVA 4GO1A 4R0MA 4LJ4A 2EL7A 2Q3LA 1ISPA 1WUKS 3HN7A 2O7QA 1HEIA 2Z2ZA 3MUNA 4Q19A 3VQTA 4BGUA 3IAS6 4P2BA 1Z7BA 1F8XA 1WZEA 2OMKA 3LQKA 1ZKMA 3WGVA 2VYVA 2PD4A 4TZ0A 3Q7QA 3BHIA 2ZE5A 3LBYA 3FTDA 3SZGA 4H0CA 3VVMA 1ZUWA 2Q4DA 3P32A 3I8OA 4B8YA 3R7FA 2JK0A 2X86A 1Q7RA 5JLAA 3OBIA 1IHUA 1M2GA 1E2UA 3GFQA 2G9UA 3TRIA 3ETEA 5I5EA 1L7EA 5E8RA 4PY2A 3WWPA 2OL4A 1D04A 1ZGZA 1E4OA 1KEZA 3G49A 4S1OA 3CLHA 4LRTB 1LLUA 3BJZA 3P2EA 4ZQIA 1WIWA 1IUNA 3N59A 3TR6A 4LXGA 4EY5A 1KVTA 4PLYA 1L4FA 1LDEA 3KWJA 2A1TS 4OH1A 3C1TA 3NJRA 3BZBA 4D0SA 1VC2A 1W5FA 1MAAA 2BVNA 3GN1A 3SBEA 3EEQA 1EYZA 2FPGB 3K0CA 5DNVA 3TR0A 1JHAA 1KNQA 4CMEA 2H0AA 1ML4A 3K70B 1M34E 3IVGA 2HTFA 3NIBA 4QULA 1V8OA 5GGXA 1IFXA 3IDQA 2H1LA 2OFXA 3PXEA 1YWGO 4CDGA 3ASUA 4UEWA 1BMFD 2G9RA 1LVUA 1NLMA 3HFGA 4YMTA 4V3BA 2BFDA 5C4IA 5K0ZA 4FKZA 1L9KA 1M1ZA 3ESQA 4PIPA 4L73A 5BP7A 4CPDA 3DL7A 1EFRD 1Z0FA 3D5EA 3PD1A 2R2GA 3I8XA 3EODA 3MMXA 3NEYA 4BNIA 4F4DA 5ECYA 1Z37A 3OPYI 8GPBA 3EXFA 4AF6A 4QXMA 3TRHA 5AW9A 1RPZA 1PQ4A 1QBGA 2G5GX 1RZUA 3E05A 3JQ8B 1GZVA 1XRLA 1YQUA 2QE7A 3FUVA 3KBBA 3QKRA 4FJ2A 5DEIA 4Q9KA 4FGWA 3NC1C 4OQYA 5EP3A 1XEXB 4KPYA 2HYDA 2AYXA 1M7BA 2Z3WA 5I47A 1SXHA 2WJJA 3ESCA 1LTKA 3N0VA 4INZA 5TF0A 4XRRA 1O97D 2XBLA 2AB0A 2J6HA 3G0GA 3KAQA 4K9DA 1EFRA 4RV5A 4V0SA 4KCGA 5DFAA 5BRAA 1N2HA 3GFFA 2ZRAA 5FA8A 4DYVA 4DR7B 2V6FA 4FKMA 2ZUUA 1L8XA 1U2EA 4C78A 3CG4A 9LDBA 4J9UE 5DT9A 1EJ2A 3A6DA 3GZJA 3LJKA 1SEVA 4PHTA 4XR4A 4ALIA 3V1YA 3IHKA 2WZQA 1J00A 2AEJA 3QG5A 1LDGA 2YYYA 5AR1A 3HY6A 2BELA 2BGNA 3C14C 5DVZA 4EKNB 1XNQB 1PX2A 1YR9A 1UKVY 3GJ3A 4BQQA 3QX9A 1CRPA 3OM0A 2GAFA 1G7CA 4RVHA 4DCCA 4O25A 1XKTA 3BWXA 2CLEB 3UFBA 5HIMA 1Z2EA 3CNBA 1UC4B 5CLGA 1JG7A 2V54A 1DO2A 3HCPA 2OWDA 3E8SA 1UQRA 4QAQA 1A7JA 3KLMX 2JFUA 2PAFA 2W2MA 2XA2A 3RYIA 1U9CA 4FEEA 3ZH9B 1UIRA 4TV9F 4O1IA 5AM0A 3A31A 3THYB 2N75A 1UMDB 4MW6A 4GPAA 4DR1B 5HM8A 5T64A 1KDOA 5U4XA 1NXTA 2PG3A 5JDIC 1KTIA 3FPGA 3U39A 2ZAOA 4GBED 1G6Q1 1H2WA 3EMKA 3CYFA 4IHQA 4FWTA 3NHMA 4QOHA 5CFMA 3SGLA 1EFTA 1YJAA 2JARA 4ZT4A 4TMKA 2EP7A 3KRTA 3W4KA 4BVJA 2QQFA 3RU7A 2X9QA 3MD0A 1K3FA 4MA0A 5BW4A 1BFKA 4L3WA 2EVWX 3ISVA 4ZVUA 5A4JA 1KK0A 5ESRA 1FTWA 5C8ZA 1C3JA 4R01A 3SSAA 1P4AA 2QUBA 1F2UA 3FIUA 3HR4A 2IU4A 1Q0SA 4G0ZA 1J07A 1PRYA 4LRSB 3IMGA 1L6IA 1UZAA 1NIPA 2H5LA 2KLBA 1AZLA 1CC1S 1OLXA 2HF7A 3CUWA 3KQNA 2WQZA 1JJFA 1I4EB 3KQLA 3QUAA 2AMVA 2GNAA 3GLHB 3IBTA 3QBTA 4NJEA 3B85A 3BTUA 1CY4A 1IG3A 1EFCA 3A27A 4HAXA 4IOKA 1R0XA 1T5OA 1SNYA 1TCBA 1E2PA 1V43A 1Y4UA 2JRCA 4G6ZA 4H1UA 4K6GA 4YRTA 4E3ZA 3PYXA 1E9EA 2XDQB 2BEKA 3K8ZA 1GGVA 4MA4A 3U1BA 4Z4FA 2DB3A 2V6MA 4KAXA 4M0CA 1P1FA 2I7DA 2X8AA 3FDFA 3HBAA 2NLOA 3OA0A 4UQPA 3V3KA 1XLWA 3ZOKA 1RHMA 1VLHA 3FLEA 1TJ3A 3IDAA 4YCBA 3LE8A 3ZIDA 3BGDA 2GYWA 2QKYA 1MC8A 1I7QB 3LNTA 1NC1A 3M4ZA 1PT7A 5K0FA 1PD0A 1TJYA 5CLIA 1JHYA 4OP2A 2AC4A 4KLAA 3OM1A 3PQ2A 2D1SA 1ORRA 3MK31 5JPCA 3UH1A 2Q3JA 1BEZA 1Q0LA 5IJ9A 5LKAA 1H0SA 2D5CA 1KVQA 4FFRA 1KS2A 1L1FA 2ONJA 1ZEJA 5TMBA 2RHTA 3HK2A 3BH6A 5L3RA 1JLHA 2B1QA 2R47A 5F4ZA 1UKBA 3EMBA 2QBYA 1C7RA 5K03A 1WUTA 4MI3A 1WZUA 3M70A 2RD2A 4M0LA 2ORED 1CP2A 2BDUA 4YH1A 4RD4A 3V7NA 2QZSA 2NO7A 1Z74A 5TQ0A 1K9VF 4UZEA 5FH9A 5HEKA 5K0NA 2UYOA 1EGVB 2ZUWA 3UWDA 2JJYA 2PMCA 1KHHA 4Q7JB 5FPPA 2FG5A 1XALA 2HHCA 3CVVA 5J5AA 1U0GA 2GSWA 2EEZA 2AWOA 5F9MA 1Z56C 1OC4A 5CIQA 5EXXA 3T12A 1Q1QA 1A88A 3KJQA 5C52B 2REOA 2Q27A 3UMCA 3W5JA 1OD6A 4IDCA 1E7WA 2FWPA 3FZNA 1P0IA 3A10A 3VV2A 4P92A 3JAKA 3M3DA 4GKKB 1BS1A 1R37A 4FB5A 5HJ5A 2UUCB 4DRXB 4ZQGA 4DV6B 5GM2A 4WMLA 5KYUA 1S89A 1Y33E 3HYRA 1DL5A 1IY8A 1EK2A 1RAAA 2FPPB 3I6BA 5E7MA 2ZDGA 2LIVA 3A6FA 4ASUD 3QHPA 4NMMA 1QHGA 5E6SA 5F4BA 1KMIY 1R15A 4O59O 1CUZA 1W85A 2HF9A 3P9CA 4X1YA 4WV3A 1T8YA 2G5PA 2R65A 4HYTA 1DUIA 4C3UA 3ZOZA 3BK7A 2CNKA 4LF9B 4DVJA 4ZODA 4DIBA 1Z0SA 1IAVA 2EF0A 2DU8A 2JJ2D 2HO5A 3PFIA 2VNJA 4OYLA 4CR7A 2AFIA 4H6VA 4JU9A 4YRFA 4W5RA 5GVRA 2YIVX 4YJ2F 3M4YA 4ARAA 1CDOA 1ECCA 1V7PC 1IHXA 3FH0A 1VMIA 3NKVA 4H4EA 4YP9A 3TTSA 3E9QA 2VPQA 3PPVA 2PX5A 4NECA 1NZFA 1PLJA 3RIGA 4DILA 3K8OE 2GEJA 4E03A 3HFSA 4ASUA 3LT2A 1WX1A 1DSSG 1FDWA 3T06B 4YPVA 1ZG3A 2YWFA 2HIMA 1JE1A 1FFDA 4GMHA 4JDPA 3I2KA 4MWTA 5H82A 2LDBA 2O3SA 4L51A 4MV1A 4XIFA 1YOVA 1N78A 2CZCA 5BQOA 2AH5A 3AM1A 1AC5A 1Q83A 1Q2UA 2JJ2A 4TQAA 4IDEA 3A3YA 1QB7A 3OLXA 1PYGA 3I1FA 3NGLA 3BT7A 4IG4A 4GG1A 4YXFA 1C2TA 1F7UA 3QVTA 3D3WB 2ZTLA 2PVPA 3O3MB 1T10A 3UK7A 2EKQA 4LV5B 4ZVTA 1CBUA 3DOIA 3TBFA 2FLWA 3V8NA 3T4XA 3EZ6A 1H6DA 4PCVA 3K1AA 5G4LA 1YNSA 3IO3A 3ZQUA 3ABRB 3MEQA 3KQMA 2V58A 4R2IA 3A4TA 4B6OA 4DCSA 3MM4A 1XYYA 4BC0A 2P0YA 1QZUA 3U26A 1JX6A 4OHWA 4U3JA 3WKBA 1T1GA 1NI4A 1I0ZA 4PAWA 2MWMA 4UBLA 3R23A 3FOWA 4ZN6A 3CLUD 1M2OB 3B6IA 3LYUA 3ISTA 4OFZA 4LJ7A 1P2TA 2JC3A 3NETA 1KZ7B 3GU3A 3H1AA 3W1EA 2R60A 4BWGA 2X8LA 3EQ9A 3GNSA 4FLMA 2WJHA 3EC2A 2QPOA 2VOEA 1JEDA 4ZT7A 3SEQA 5JMTA 2OGSA 3ZWCA 2ILVA 2BYTA 1PK8A 1UC8A 3PJEA 2FN3A 1KPGA 1XJ0A 1M0TA 2GUGA 1JDVA 4FZRA 2DPLA 4G1UC 5A3VA 5H8WA 3C45A 4MEAA 3KQKA 2RDMA 5BVGB 2XYQA 3HEBA 1C8VB 3DBRA 3MFYA 3O9MA 5ALZA 2QLNA 2D62A 5LSAA 3C7AA 1HYEA 2ADMA 4UU0A 1KOJA 5HX7A 3O6VA 3FX2A 4F3RA 1A8IA 3FSJX 4NE2A 2FWIA 3LPMA 2C8LA 2JD2A 1DQPA 1RWMA 1M2EA 4M1KA 4DJFC 3Q7RA 3WZLA 3OQIB 1HETA 1AXRA 1L2TA 2X9NA 2HFJA 2ZBQA 3E53A 1IWBB 4P7BA 5DYNA 4YDSA 5EMNA 3WMRA 1JFFB 3UJNA 4X6LA 2JLUA 4HRXA 4DUYB 1UDAA 1EP3B 1FFXA 1K6XA 3DE6X 9ATCA 3PTLA 3HN2A 3DUFB 1FXWA 3L7DA 5EZ6B 1L5RA 1ENOA 1QQTA 2HSDA 3BS4A 2JBHA 3ZXIA 4RETA 4OHXA 1O2DA 4D6XA 3H8JA 4I2NA 1YZNA 4OHVA 1AGRA 3ILVA 1WEHA 2CNNA 2IL1A 3PRKE 4KKXB 4LDRA 4NZZA 1PHPA 4M8LA 1M34A 1W8DA 3EAGA 4P8RA 5MN5A 1D1PA 1ONPA 2O2IA 1DB3A 2AI1A 2WHPA 3K31A 4RLHA 4TLBA 3ZHXA 4XDZA 4A1FA 3GLFE 4TWAA 4XI9A 5JR3A 2OR3A 4RIGA 4FMDF 2FUEA 1KTVA 3X44A 4IZOA 4BL5A 3L0SA 4C6RA 1ZUNB 4DQLA 1TQ4A 2D2XA 1W19A 2PJZA 3FYDA 4B6JA 3WDLA 5IARA 4K05A 4BEVA 4DEXA 1BGXT 3I2FA 4GPTA 3TGPA 4C2BA 2P9GA 4FFLA 4CKWA 521PA 5KYTA 3ERCA 2G07A 4BNNA 3NNSA 1JSRA 4NKRA 1YB2A 4X93A 5LUAA 4X63A 3ZJVA 3HP4A 2V59A 3EG9A 4PCUA 1LK5A 3H04A 1P1JA 2LIPA 2EV9A 4I1IA 1E9BA 1OW3B 5JVDF 3R2JA 1UEIA 4BO3A 2RG1A 2AJBA 3EGEA 4NL4H 4UBIA 4DSZA 4K0KB 1M8PA 3PXAA 1WU7A 3H9QA 3MRVA 2K7ZA 1CERA 1Z22A 1ULBA 2IY7A 4U7WA 5ITVA 4D25A 2X1VA 3ENWA 4MW4A 4PBTA 3QNWA 1NUSA 4FDVA 3LZCA 2CLSA 2V6GA 4ZA2A 1PS9A 1FFCA 4ZOEA 1CUVA 1MEOA 3SDZA 4ADSG 3BXEA 4DXHA 1P77A 2PX0A 1QFZA 1OLUA 2PS1A 4NZMA 4C4YA 1WCIB 3EXEA 4QBKA 3HKBA 4QXRA 1XCMA 3DZ8A 3HI6A 4TTAA 4HUQA 1SKYB 2OO7A 2QAJA 1JBQA 4Z4EA 4XUEA 1T0UA 5F5NA 4EK9A 3KQPA 1PFQA 1K6EA 1PQPA 1S3GA 2VT6A 1G6OA 2ZPAA 4IFBA 4U00A 4WCFA 2E7ZA 5D3QA 5IAOA 2HLDD 4AZWA 2ZM6B 3D3EA 1QE5A 4LVNA 1QGZA 2WE8A 4MWOA 1QKKA 1DWPA 2CVZA 4PG8A 3N05A 4TZKA 1YCFA 3L9XA 4DLZA 3NANA 1E6CA 2IYQA 2XOEA 1UBTS 5DI3B 1MJNA 1TRHA 3DT8A 1T29A 3FD8A 5JRZA 4Z9AA 5KPJA 2VSOA 3C5CA 1PGNA 3HA7A 1XHEA 1RWWA 3ETGA 4WLEA 4TWRA 1Z4QA 3HR7A 4AMUA 1SXQA 4F72A 1G42A 3KLBA 3NBQA 2ZVJA 2JRLA 4N39A 2X8BA 5AW4A 4Q82A 3QVUA 5K8JB 3O03A 4YRZA 4CTOA 1U7HA 3FWYA 3JALB 4CM3A 2C5BA 2CJWA 4PSCA 3SK0A 1WHSA 4R98A 2H17A 3LQRA 2QT9A 1EE1A 5EKTA 5GMOA 2HLDA 5AW8A 2I3AA 5EZ5A 1W0CA 2YJZA 3ZNPA 3R5TA 2YUIA 2HPAA 5ED4A 3P5BA 4PV7A 5F1PA 5LXTF 4AXXA 2MR6A 4EJMA 3AB7A 4FFMA 4RO0A 1PUJA 1USUA 3NLLA 2AXQA 4H17A 4KBYA 2WWVD 3SKVA 3N7UA 5HJ7A 2FPMA 2DPXA 4GT1A 3D6TB 4LK2A 1BD3A 3RS8A 3S2UA 2QVXX 3FRIA 5IYZB 1U0TA 2G88A 4Y2VA 1WNTA 1U94A 5EESA 4HB4A 4DWVA 3UT6A 2Z43A 1II8B 3EGVA 4K3UA 2FEOA 3DXYA 3VHLB 1J9EA 3WYEA 3SZRA 5CXXA 4RTKA 4H1HA 1VP3A 4MPTA 5CCDA 3JATA 4RNCA 1G5TA 2P6MA 2P3LA 5DCUA 2AYZA 3BA1A 1ZISA 2GXSA 4FYJA 4L08A 2A1UA 4Q4DA 1MX9A 4ATNA 1Y3CE 3ZK7A 3I9V1 2PZLA 1L9XA 4G5HA 5HRCA 4JC5A 4M46A 4OY3A 5AJTA 1V9CA 2IEDA 3OY2A 3Q2KA 1IULA 1NMEA 3F0TA 3NIGB 1MNQA 2X1MA 2XWBF 4RDCA 5AKLA 3NHPA 3W4JA 4RTMA 1ZWLA 5FBLB 2X5OA 4EHJA 3D2BA 4K8RB 1S1CA 4HDKB 2Z2IA 1TJ5A 1KNXA 4EEKA 4I1UA 1QX3A 3TRFA 3VOTA 1Z5UA 3O31A 1JLLA 1QHNA 4ZCPA 4FBLA 4P0QB 4QAJA 4I9HA 4QX6A 5BN3A 3T61A 3GEPA 1PEAA 4MW2A 4CEIB 4H7EA 4OXRA 1LK7A 5FPTA 1JQBA 3KJEA 3I6ZA 4R1NA 3OWOA 2H0QA 1W1IA 3CY6A 4JITA 5A0FA 1LX6A 2JW5A 1IQRA 2GDZA 2VHZA 1AB6A 1EDOA 2G6BA 4A82A 1FVOA 4UU8A 1E3JA 4QG7A 1H0HA 2I6GA 4NZ9A 4DC1A 2FN4A 5COAA 3HZOA 2EC5A 3ZDCA 1T4BA 2FPXA 5DGHA 4B6GA 4YUZA 3SFZA 3QBEA 1SU4A 4J7AA 1IY1A 4IIBA 1AUOA 1P5HA 3NHSA 3OD5A 3PA8A 4IIJF 4MS3A 1KI6B 2NPIA 3HC7A 4GSLA 2OXFA 4LA4A 4XQ0A 4EQ6A 1H4QA 2WHXA 1VPTA 1XZCA 3GUZA 4Q1VA 3OQNA 5DHPA 4O4HF 2HADA 1NM5C 1SHUX 2CUZA 4MR7B 4ZYZA 1N8NA 3PJFA 1GU1A 2G8NA 2A4MA 3QNMA 4G37A 2ZT7A 4UXIA 3SX2A 1OH7A 2IOFK 2RHOA 4WL0A 2UUPA 3UFXB 1A2KC 4D98A 1XB2A 1Z08A 4PVCA 5M7EA 4J0EA 4EARA 4I7EA 5CFPA 5CFZA 1BS2A 3BAFA 4X3PA 2B8WA 2XDAA 4XVRA 1E1CA 1OV6A 2A35A 3BB4A 3CO0S 3KCNA 4L4SA 4M8NE 2ZWVA 5SICE 4PN7A 2JIBA 1RMQA 3PEEA 4UUAA 4BHTA 1QRRA 5FBKA 3ZHQA 1JU4A 1ZJ6A 4QUKA 4Y18A 1ZNZA 5BQ5A 4MLZA 4EUKA 4K7JA 2XNDD 5ABPA 1QHEA 4OQZA 2ZR0A 1LVHA 2GNOA 3VDQA 1GFZA 3ZNNA 4V1CB 5L95A 2BJWA 4OHMA 4JL8A 3DFIA 4ZQCB 1N5IA 5BN4B 1QYDA 3NBFA 3LDFA 4MYTA 2ZM5A 5F2NA 1ZJWA 2E6UX 4E70A 2C9BA 1WXFA 1SUPA 2A4KA 1E9VA 5FD8A 2RGNA 1ZHFA 1RQXA 2ZUDA 2ZVPX 1XAIA 4GKVA 3V8EA 1D4AA 1GZ3A 4FSDA 3V80A 5KYYB 3KT8A 1XMJA 5FUQA 3F7OA 5IKPA 1O54A 4IILA 5IU6A 3MGBA 1TUBB 1NKVA 4AJEA 5HOEA 1H1TA 5KEIA 2ZULA 4NZOA 1P9WA 4ZOCA 1ODCA 2ZGVA 5ER6A 1XIVA 4EFNA 1E2LA 3WGKA 1E5TA 3KPWA 2CLHB 2DBYA 1JEQB 3AHJA 4NBTA 3AO0B 1PEYA 1PVDA 1NHGA 1JHVA 5KSOA 5AI6A 1L4LA 1KK3A 2OB1A 2PV0A 1AS0A 1Z6TA 2C8JA 2VRCA 2WG1A 4I2VA 1MIOA 2K4MA 4QE3A 2VCHA 5IDWA 1Y5LA 2WTAA 4KPGA 4A7PA 4QPNA 2OZVA 2A59A 2QW0X 1T13A 2WI8A 121PA 3FKQA 3PGVA 4RD1A 1ULZA 2BHSA 3DOUA 3B9PA 1XC7A 1YZYA 4ER5A 5HQJA 4QGHA 4JI5B 1T8RA 1JAZA 3LGSA 4JBHA 3PKJA 1P9RA 4U2EA 2PGLA 3RSQA 5FEMA 5HGJA 3CW2A 1GPLA 4P1ZA 2EARA 4LJ8A 4RC9A 1OXBB 5AM4A 2SKEA 1I4OA 2FZKA 4Y2TA 4C08A 2HX1A 4QO8A 3RSSA 2IHBA 2ZBDA 4C06A 4EJSB 4KR3A 5AUOB 3BC1A 1CQZA 4KFSA 3I37X 3AHGA 4QECA 3KLNA 4QJ4A 1P4SA 4WGGA 5BUCA 1ZM2A 1V3UA 4H9GA 4LBZA 4YRGA 1WCYA 5IKEA 2NWQA 1DBPA 1HE1C 4QYIA 2DM6A 3AOEA 1TCCA 4L1KA 4B7AA 1KDYA 5LDHA 2COKA 4IO0A 3WZMA 2XVAA 2WIJA 2NUTA 4Q1DA 1FTGA 1ILEA 4ACBA 1CEYA 4EMUA 1VHQA 2O2DA 5DM4A 1ELOA 2FHPA 4NIMA 4TVBA 4D56A 2HJ9A 3FTFA 4W8HA 3OLZA 4CQNA 1NJGA 3GDGA 3H7AA 3PQFA 1VHWA 4BMYA 4D5GA 4CM8A 4EDFA 3GRVA 4XH9B 2ZTSA 3R9XA 2FW1A 3IPYA 4KV7A 1QMGA 3I9MA 4F12A 3QF7A 4DBLE 2ZYHA 4PO1A 3CZRA 5CM2Z 3N0RA 1UQTA 4DLAA 2OCAA 1V96A 1QQ7A 3BE4A 1MJ5A 3G9QA 2XX3A 3FRHA 5DN9A 3W9YA 4L0QA 1IPEA 1CJUC 4XM0A 1WUJS 3N0XA 1YONA 5B3LA 5JAQA 2C04A 2YWJA 3DOJA 1RZVA 1N4AA 4TMVA 1R9NA 5LVAA 5KBYA 1ORIA 2ZI9A 1OCEA 4FYIA 3IIIA 3QELB 2YHIA 2RHMA 3S2IA 2C7PA 1G8MA 1GADO 2IEBA 3N07A 4NNOA 4PM4A 1GNLA 1P5RA 1K27A 1UKCA 1US8B 3DP9A 4JSYA 2HL6A 5E9QA 4L9WA 4YQEA 1K3TA 3LA6A 5EI5A 1SFRA 4NXMB 3TQTA 4BV2A 4HNQA 5C53B 3C4QA 1MF7A 1ESDA 3IUEA 3OMLA 4ZYXA 4RKYA 3GLFA 1SBHA 3E5MA 1YJCA 2VT2A 3VC3A 3OEHA 4MK4A 3KVVA 1FFBA 3L18A 4DQDA 2GRUA 3FN4A 4ZHSA 2Q3FA 2IGBA 2XF2A 2WG0A 7MDHA 2F00A 1EBFA 2Q4OA 1HUQA 5DRTA 4QREA 4A6EA 3IOBA 2GN9A 2E5LB 5CDYA 1WA5A 2PQ0A 4KHZA 4JL5A 4OJNA 2FZGA 3SNHA 3ASVA 4C5BA 1U0BB 1B93A 4XEUA 2X13A 5ALNA 5B4UA 1NAHA 1NXSA 3OQPA 1Y48E 2VJOA 4RESA 2JIZD 3DEKA 2EG9A 1YO6A 4ROSA 4KMMA 5KNBH 3VU0A 1NUUA 2VH2A 1RT9A 2XXJA 2ECOA 1QHHB 2ZSFA 1A8QA 3RASA 2E21A 4BLSA 3BXXA 1R0KA 4BVHA 3DM9B 3DBOB 4N8SA 4CI0B 4CEHB 1C7FA 1ESEA 3EPRA 3RUDA 1YULA 1A4RA 2DQKA 4QU5A 4AKIA 4CUKA 4YCSA 1WXEA 4WEOA 5J4LA 4O33A 3L7IA 3F4BA 5P8WA 1A2OA 2J0EA 1ONSA 1BVUA 3QYJA 2JIZA 3IILA 4GS5A 1XLVA 2QZZA 4IVPA 3Q5GA 1N36B 3NT5A 4Q4AB 2PSFA 1TW2A 2ZB8A 4PG6A 4YV2A 3IBSA 3VI4B 3MN1A 3NCTA 5J63A 4HDCA 4TLAA 1C8KA 2OHFA 2OBBA 3FVWA 4BKPA 5KJEA 7YASA 1S4QA 3JQQA 1GPWB 1SUIA 2HMTA 2NIPA 4QPDA 5CJ2A 3UWOA 2O8DB 1N3IA 4G5RA 3PE6A 4YASA 4FFBA 3FNRA 1FLVA 1XD2A 4P4GA 4AL4A 3IAM1 4TSKA 4LF4B 1DJMA 2GPSA 5GIPE 1ZOPA 4MB6A 1DCFA 1NATA 1YHZA 3EZ2A 1SOWA 4PLPA 2AJLI 1V5GA 1DNPA 2VDLB 1Z8DA 4O2AB 1E0AA 1JDNA 2KB0A 1UMCB 4GOMD 5DI9A 1XAGA 3OCYA 5K45A 3ZVNA 3V8QA 4GUAA 1SBNE 4F5DA 3ETNA 1TQDA 2V3VA 6REQB 4AQ7A 5B58C 2IH5A 2IYAA 4IFTA 1P72A 3DVLA 3IVMA 3KZVA 4UZSA 1VDMA 2BGUA 1V25A 2WT9A 5EP2A 4BFVA 2ENUA 2G25A 5IKOA 3T8YA 3R74A 4P53A 4G84A 4UEKA 2PZBA 4H7IA 3IHTA 4G0XA 1SVLA 1G19A 3ZDBA 3SR0A 1UMBB 3PS9A 3CMCO 4JB0A 4Z4HA 1UMKA 2ZETA 2ZI3A 2O0HA 1IRXA 2X0JA 3IV6A 3MJEA 3FPEA 2J5BA 3NOXA 3OZEA 1GG9A 1MFZA 3QLUA 4Y7DA 1X1QA 3PNKA 5IAAA 1IUPA 1RRFA 2YJGA 2FSUA 3P4UA 2YOFA 4KSCA 3TNYA 2XNCA 4HTFA 5A04A 1LPNA 3HKDB 4EA6A 1FBTA 2Z8XA 2NV6A 3A4VA 3FUTA 1VJTA 1T15A 4AF7A 2JJMA 2LR0A 4C2AA 3VSEA 2JANA 2Y67A 4IUCS 1KARA 1JFSA 4OHFA 1CNMA 3WFZA 4BFXA 4BMVA 1WB9A 4LDJA 5J5CA 4QG3A 4XUCA 1QRUA 3TLGA 2WWRA 4EFMA 5HK9A 5ELLA 2C9MA 5HQTA 2YXNA 3ZE1B 3QZUA 2B4QA 1M2WA 4TLEA 2GEBA 2YFYA 1QFSA 3RAEC 2WUWE 1CF9A 3TQCA 1QO7A 2CLMB 3S1AB 5HVNA 4LRQA 4UDOA 3RTEA 1TT7A 2J45A 5K9ZA 4M0KA 5GONB 1M66A 1IZ9A 3RUEA 5CT8A 2OP1A 1I2CA 2QRNA 2ZJ2A 5EPOA 3DXFA 2NX2A 3FAKA 3GVHA 4IW3B 3FHCB 3GT7A 3V42A 2V5VA 5JNRA 5L4SA 5GJBA 5C7YA 4LSMA 3J7AC 4A8HA 3FKJA 1QG4A 2IBTA 2AFHB 3O1IC 3VYVA 3QTLA 1J7KA 3HHEA 3T34A 3C7KA 2V4ZA 2YJ5A 3SC4A 3L0ZA 4UTNA 3FBTA 4WY5A 3IUPA 5FPQA 2H00A 5IAKA 1QCDA 2E48A 3K15A 1Z3CA 1XFAA 2H4WA 2AYYA 4KN5A 1DARA 1T0JB 2YQZA 2YVAA 4GZ3A 3LCVB 4OCZA 1RPTA 3LQ4A 3D1VA 2Q0XA 4I4TB 4OU4A 1W76A 4JOBA 1DKOA 2RGRA 4B9EA 3BHNA 1DAFA 3VKUA 2DQZA 2W71A 1VECA 1M74A 1PE0A 3F74A 4R3WA 4Z9YA 2NMVA 5EEGA 2YR0A 3PHIA 2Z9DA 3VZDA 5I7SA 4N41A 2OYSA 2HI0A 5FBHA 3RV4A 3NAMA 3WLSA 1S9DA 1ABFA 5JH7F 3HJCA 2ZUVA 4KQFA 4Q9NA 1G1AA 4RSRA 1NTRA 4GPEA 4RGYA 3ZS9A 4DCOA 1M33A 4FFSA 3TRDA 1O8BA 4P3OA 4GU5A 2RE8A 2VCEA 5ALQA 4PGAA 1V3TA 3FYUA 1YTLA 2CSXA 1D4FA 3EWIA 1AT1A 4CIDA 4PGFA 3JQFC 5J4YA 2XT0A 3TPCA 1BRTA 1KPHA 1N2GA 2FSIA 2HV9A 2PTHA 4HN9A 5FPHA 2ZQZA 2NU8A 3WGGA 2IEYA 4Q00A 5BR7A 3PGA1 4MROA 1USKA 5BNTA 3ZGYA 2HPVA 4NCNA 1CV2A 1GT6A 4J1TC 4B4UA 1A50B 3REQA 4BFUA 4CFZA 1AQJA 2AZXA 3D1JA 1AGYA 2X58A 3TAUA 1L1QA 1YKGA 3BXZA 2AXNA 4MUJA 4JIMA 5EFOA 4BS9A 4OIMA 5I9SA 1ZJZA 1CNFA 4Z6KA 5KOHB 1V8BA 1ZOSA 3EZFA 4MUGA 4C9BA 1S96A 3OFND 3IV7A 4UNRA 3IEVA 2B4KA 3NVDA 2ONYA 1Z6ZA 3BE6A 3V4ZA 3VYTB 3I42A 3COSA 1VL5A 3DEYX 3NQ41 3OPXA 3ZWVA 3EPHA 1ARZA 4IGIA 4G0QA 2C92A 2ZJ8A 3GROA 3BTOA 4CR6A 1ZZEA 4E5DA 3B5JA 1GDHA 3EDRA 1L5LA 1EAMA 4CCAA 2VAWA 5TGDA 3UKDA 3U7IA 4IS3A 2VZEA 5TE9A 1GNSA 4EX7A 1IOVA 2BEWB 3N6VA 4MNTA 4NLLA 2JCGA 1DJNA 4WZAB 4BAZA 2C3UA 2VAPA 4WBNB 1XRJA 4N48A 1N7IA 2FVXA 3OLWA 4LCEA 3OIVA 5D8DA 4HX2A 3UMVA 1AF7A 1JQ5A 4LYGA 4YFYA 5EJ6A 5CPFA 3VH3A 1L5OA 2QV0A 3R3ZA 5IVIA 3PX2A 3OFNA 4NPHA 3HCNA 4N5MA 1N2XA 2Z95A 4GP9A 1B8OA 5JMOA 4JLVA 2O8FB 5HMMA 2VDUE 1H4VB 4CI9A 1ES9A 1CUAA 2V7UA 4LZWA 1P2BA 3G7UA 4FT4A 1T1EA 4LJYA 1QG0A 3ROKA 4BVLA 1YKFA 3YASA 2P2YA 5CA0A 1TA4A 1HPLA 3EEIA 3D8UA 3JQ6A 3ZKAA 4DY6A 3AR9A 2X2EA 3HUFA 1JZTA 3HEAA 1Q1EA 3T7KA 4KG7A 2CEAA 2RH5A 1KS9A 2QK4A 3CC8A 4C22A 3SQMA 3IL2A 4FNGA 1E3WB 3R3HA 5JCZA 4A15A 3BJIC 2QSYA 3Q4GA 1YHYA 3NVAA 4PG5A 5K0LA 2X3YA 2O5VA 4WK2B 4B2PA 1VP9A 2OBLA 4DWOA 1OI4A 1HE8B 5FX2A 4ID9A 3AHEA 1W93A 2FOLA 2VF4X 3K6KA 3FTQA 1EAYA 3GX1A 4CV3A 1ZEMA 2OGWA 3FPKA 6ADHA 3B6MA 4MLPA 2P78A 4MW0A 1Y5MA 2RH9B 2ZJ6A 5CXSA 2I4RA 1R4NA 2COEA 1X1SA 1YGPA 4IAOA 5CYGA 4S2UA 2GF0A 4BTEA 3P20A 1XJ5A 2VDKB 1Y1QA 5TY0A 3MOGA 1EEXB 1AOXA 1BCRB 3TLKA 1HOTA 4X1KB 5DNUA 4E0BA 2H9AA 2ZG6A 4CIVA 1GQ2A 2YW2A 4GWGA 5FHRA 3RU2A 2WICA 4E2YA 1DIBA 3BICA 4JUDX 1Z6AA 3STYA 5LB2A 4F84A 1Y0BA 1K88A 2QLFA 3ON5A 1FSPA 3W2GA 1TVMA 3TN7A 1XVLA 2VH1A 3THRA 4XQ9A 1VJGA 1B14A 1Z6YA 1X87A 5BVHB 2NUPA 3HJRA 2JFHA 2XW6A 3K9HA 1WM1A 3N0TA 1NG1A 4TT3D 3H0CA 4CGZA 4RH3A 1JR3E 2DY1A 3EY9A 1QYVA 3LY7A 2UU9B 5DSTA 2CYAA 2G0NA 1RE1A 4D4HA 3GGSA 4LUCA 2YN0A 5DYGA 4B2LA 2Q5OA 5E4JA 1NAIA 3ZZUA 2IHTA 1DXHA 1NBIA 3OO0A 2OUIA 1YD7A 2OXEA 3CX3A 2HUNA 3L06A 4ZXFA 4EVRA 1MHTA 1JB9A 1V6AA 1W5TA 1A9RA 2BEUA 2WU4A 5P21A 2VHJA 4DIKA 3NDRA 4EB8A 4RE5A 1LLDA 1YJQA 5FPKA 2WWTA 5HHTA 1NMSA 4TT3A 4KQJA 2OPBA 3COJA 4L75A 3NHLA 3I52A 3HWX1 2XB8A 1O58A 4JQOA 1E6KA 3IO5A 4PLTA 4Y0VA 2R00C 1EK5A 3MZ0A 3UT5B 1IDN1 4PQRA 4AICA 3DTVD 1N5DA 4WVFA 2IPMA 3H11B 3RVRA 3C43A 3V5NA 3KR2A 1BHJA 1ZLYA 3B1ZA 3GUHA 4MCIA 1X7XB 4RW0A 5ER9A 4F04A 3SC2A 4RHCA 1QYWA 1QGUB 1G5HA 5A4FS 4F92B 1DQYA 3WLPA 1NYRA 4WNAA 3BZWA 4L3VA 2XCLA 1RKQA 2YJNA 3KZ1E 2IIVA 1ONNA 3PTZA 2OA0A 5HM6A 1W36B 3R7NA 4BE9A 1URPA 4LOIA 4IHJA 1AK1A 3AUXA 3GFRA 3BL8A 4ICIA 1ISFA 1RNLA 2WEKA 2XD9A 3DTVA 4MRAA 1YC5A 4OI2A 4GVXA 4LQLA 5HMLA 5SYMA 3RG2A 4FILA 4QKQA 5ICGA 1GCAA 2E4ZA 1QFXA 2Z08A 5EWMA 1K6MA 2VRBA 3WNCA 3URKA 1GNVA 1L1RA 4GE0A 3GB9A 4DIUA 3K92A 3FR7A 4PYJA 1Z36A 4D6YA 4DVGA 5KTKA 2N0SA 5EHQA 1P7PA 3LUKA 2HCRA 3A8TA 2YV3A 3WA6A 1HO3A 4B4KA 2EZ4A 3C7TA 1C8LA 1SCDA 2BF7A 2IVFA 1UJ6A 3L6CA 1Q91A 3OM9A 3P9XA 4JOQA 5K3FA 1TVKA 1TU0A 4C30A 4DIDA 2TYSB 1H69A 4CR8A 1JMVA 1G6HA 1FSZA 4TS3A 2WJGA 4YK7A 3PNYA 5IJAA 3AU9A 5FWYA 2G5CA 1X2EA 1W5BA 2VDRB 5GV7A 3WLRA 4KAAA 3A06A 5FUBA 4D9GA 3RYCB 2C9DA 1TX4B 1YMQA 5ICSA 1TAQA 3GBVA 2ZPUA 2XMSA 3N0WA 3IP5A 1CK4A 1NUTA 1R9GA 2PKYX 2WD7B 1P19A 2FSVC 3B8EA 3FB1A 4HN2A 4L9AA 3VZCA 5KJ1A 1AQ6A 3DF7A 2XCSB 3ZCVA 2QRGA 2NO4A 3LC7O 3LIIA 4OX9Y 1OWLA 2VUTA 2FI1A 2OQRA 3KOUA 4G56A 4HDRB 4LTNA 1K7EB 4P3PA 3RWMB 3WP1B 1JBEA 1Z2CA 1MJFA 3I3SR 1TK2A 2IXTA 1GNRA 3V1NA 5EJ8A 1Y6RA 2BFFB 2J3HA 2I66A 5ALHA 5DX0A 5FIUA 1XA4A 1H2FA 2A84A 2ZJZA 4C01A 4LSGA 1S3FA 2AC7A 3GQBB 2FP3A 2KW5A 5KOJB 2BFCB 5JUWA 1ZAKA 1BQEA 3MWEB 4ND1A 1AXEA 3EHEA 1L8QA 4V0RA 4B35A 3X1MA 4QTYA 4LE1A 2NXNA 1PNTA 4ENPA 4P31A 2VQDA 3T4EA 1UFQA 2HQRA 1KO7A 2FW6A 3UCEA 2NM0A 3ZHYA 4PC2A 3EZ9A 3ORFA 4QUIA 1I5RA 1WF6A 4LXIA 1ECBA 3COWA 4HNHA 2EOAA 3G17A 1H8ED 3DHWC 5K3CA 3W04A 4ALMA 5TGTA 2IYSA 2Z5GA 1QV7A 4IIUA 1VKRA 1BWSA 1ECPA 3A9TA 1OQAA 3HM2A 3MWJA 4MVCA 4CM1A 2NP7A 3FFWA 1TKCA 4KXXA 4NU8X 3VPCA 3WYDA 3ZQJA 3MGAA 5JS8A 4D9HA 5HYVA 3K4PA 4ZV4A 3VPXA 1JB1A 2RSLA 3KT3A 3QPCA 1XZNA 2QQ5A 2W5UA 3BH0A 1PR0A 4MWSA 1FMJA 4LNHA 2K2WA 3AHIA 1K4KA 3ED5A 4XX0A 1WL8A 1X9HA 2MINA 1XMSA 3UBTA 4EF4A 4YCAA 3DT9A 2P1RA 2C2HA 2QPAA 3OG9A 4FE7A 3KYIB 4EVQA 2DECA 1IDOA 5EEHA 1H8EA 3JYLA 4PYMA 1V4BA 1VCHA 3CN9A 4UFOA 1IRIA 3T94A 3E7WA 1R6BX 4CIYA 3WSWA 3I1YA 2C5HA 2HFKA 1ESCA 1PJBA 4X92A 3UGTA 2P2SA 1SG0A 3MPOA 1GZ5A 1XNHA 1FFEA 4UMFA 4BMSA 2E5WA 1T9KA 2X7HA 3V46A 3AW8A 3EA0A 3UPTA 3USES 4FZJA 5DE3A 4BNVA 4CNQA 2IZ6A 3NYRA 4FYMA 5AKYA 4OQXA 3KFVA 5IEBA 2FF7A 1NNSA 1T3TA 3OOHA 4Q3OA 2P1DA 4TTPA 4C6TA 3IIMA 5KCMA 4C7BA 1OE0A 4M3NA 4DPKA 1MRSA 4PZ0A 2NQ2C 1ODIA 3LUFA 1YZQA 3Q3CA 3RFVA 3ASYA 4KE6A 4DCUA 4YO7A 4CM4B 2BHRA 3F3YA 4DLWA 5LL6P 3PP8A 4H27A 1FE8A 3D1LA 1JH8A 2JAUA 1J6UA 3PI6A 4N40A 1B8NA 4LQDA 3VR0A 5JALA 1M1YA 3DYBA 3O8NA 5A3RA 1IVSA 4XGQA 3PYMA 1ESZA 4IRMA 2NU6B 3U9TA 4B6EA 3SHOA 2ZVDA 5HZHA 3DO8A 3JR7A 2V7BA 5GZ6A 3HVHA 2RAUA 4IKEA 3TRKA 3C7DB 4JXXA 2DR0A 1JIJA 3HL0A 3PNVA 2AA3A 2DT5A 3AI2A 4JOSA 5IN5A 3T7TA 3UJBA 4UM7A 3QEBZ 2L17A 1K86A 1N5OX 1IHPA 4MQ5A 1BE1A 1OGYA 2DHRA 1KO5A 1NVAA 4L0CA 3D3JA 2FX2A 1P4HA 3Q9LA 3OM8A 4G9BA 1CR4A 4R16A 1ZS9A 1ZSVA 1V8DA 1SBYA 4HDMB 1LFDB 1C41A 2DPYA 4MKHA 4DLYA 3LSYA 1RQGA 2ISCA 5ADWA 2AT1A 4Q3CA 2PT5A 1TYEB 4NCXA 4UVHA 2JS7A 4K6HA 1JA9A 1SUDA 2LW7A 3Q2OA 2CL6X 2H4JA 1SBTA 2AOTB 1GD1O 2Y99A 3G8CA 4QD3A 3PWZA 3PVZA 2YYAA 2HCBA 2Z5LA 1L5HA 1P4JA 2HK9A 3ZD8A 3MOSA 3RTBA 4GZMA 2DERA 3I83A 5FB3A 2VWHA 2VG8A 3ZVKA 2GHTA 3ZTYA 2R8RA 1XTBA 3L0YA 3OCCA 5CP8A 5JS2A 3IERA 3PBKA 1I51A 2RGXA 1E5LA 1Z6GA 4C4OA 4YAUA 4C1BA 4A6XA 4HLCA 4TV8F 1AM4D 1EFVA 3PJRA 1WMDA 1DRWA 1EWKA 3PNLA 5KQLA 1LV7A 2PS9A 1M0EA 2ZJFA 3TE7A 1KQ3A 1NT4A 2PUJA 2IP2A 2BC9A 2NO5A 2V8BA 2MSNA 1DBRA 4KWEA 1X9GA 1S1MA 2XAAA 3A0RB 4LDAA 4ZOAA 2OV2A 5DTIA 2DSNA 1XQ1A 5HNKA 1NV8A 2REQB 3X1YA 1SB8A 3E9NA 3M1YA 4Z9FA 1H4TA 1WXIA 2ZBUA 2PO7A 3U09A 3HWSA 4A03A 4RADA 3NHKA 1PV1A 5EQDA 2CCJA 2FMFA 3WQBA 1NXQA 5ERYA 3GP8A 5DXAA 3DR3A 4EG0A 3S3TA 3WRVA 4UQOA 5CNKA 5DOVA 1EK6A 2HU5A 7REQA 1VJ0A 5KYWB 3NYWA 5TRTA 4OVKA 1J8MF 4JT4A 4N3CA 3PXXA 3L79A 2HA5A 2C3YA 1XVVA 1O94D 2HQOA 1PT8A 4P5DA 4Y6SA 5TX7A 2X6QA 2AF3C 3R09A 1PZMA 1T8WA 2IU6A 5ADHA 3OZIA 4P34A 1J8DA 4QFMA 5ESWA 1WY7A 5EXSA 4Y0NA 2XI4A 1N7JA 1MJHA 2IX9A 3OF3A 3Q2IA 3VC2A 1V7CA 1PQUA 3LUDA 1RCFA 4CM5A 2IYZA 4J16C 1RW4A 2QZ4A 3QMWA 1E9SA 1TM7E 2AVDA 1YB4A 4PC1A 5KB3A 3OZWA 2OLJA 1GN9A 2A0UA 4LZNA 4YJGB 1ST3A 1XQ6A 4BV3A 3AI3A 3KAJA 3N5CA 1X7DA 1MPXA 1YUNA 3QXHA 4F4HA 2JLWA 1A9OA 1W29A 3OWHA 4FP9A 1BU8A 4YJFB 1UPUA 3Q7IA 3W5SA 4N6GA 3RHZA 3DXZA 3KZOA 2HA3A 1QGAA 1NM5A 2OZKA 3LVBA 3NHUA 4EO9A 3JQ9C 4IJVA 4GZ5A 6LDHA 1JR3A 2F2TA 2IJGX 3TZKA 3WMWA 4QHYA 1R9MA 1TO1E 3KQHA 5DN6A 2I22A 2P4QA 4XE5A 3OZBA 5ILQA 4D3ZA 4F91B 1TXGA 4HGYA 2XGOA 1XLTC 3KEGA 1E5VA 4RIIA 1A8PA 1BXGA 2FQWA 4D4KA 2WFLA 3DV0A 4YECA 4IJ6A 3PICA 5ES3A 4DY4A 3PITA 2CE7A 2R6AA 1GA4A 2RFLA 2UUAB 4GLBA 3AG6A 3T5GA 5LIPA 4XSGA 4P93A 1Q12A 1CDZA 4EHFA 3MTGA 1DFHA 4I14A 1TO2E 2FFQA 5E6UA 2WE7A 3MG9A 4CYMA 1BMTA 5EPUA 4ZICA 2XUOA 1OFVA 5EUBA 4QODA 1JUDA 2ZRQA 2V97A 4MARA 1L5FA 4OGWA 2GA8A 1UBOS 1QVRA 1CY7A 2VP9A 4BZPA 4IHAA 4UEOA 3G2OA 2ZIFA 3L1VA 3AVOA 5DGXA 1N9ZA 2C0QA 1XF9A 4KYTA 3LWZA 1ECJA 1P17A 2QG9A 5BWCA 1X7YA 4A6PA 4EI9A 3L92A 2DUMA 2NW6A 2Y1XA 3SSOA 1QG2A 3BEDA 5SY6A 1IN8A 3CF4G 4CTMA 2OCDA 4C0KA 4CV0A 5A4DA 5JSZA 1CY6A 3VR6A 2Q6VA 3DEZA 3ZDDA 5MN4A 2ZRIA 3TWOA 4CMJA 3IAHA 1P9NA 1T3SA 2ODQA 3PXGA 4B5KA 1D4ZA 5LMUB 2FPUA 4YJHB 2BFDB 3D7NA 3EW7A 1INLA 4NZNA 1ZD3A 2HA7A 1KU0A 3FFAA 5BOVA 2R6JA 4KX5A 1WHTB 2UDPA 1A71A 1HKHA 3U13A 5T57A 3TMKA 3WK4A 4MZXA 5JEEA 5ALLA 1JHRA 1VBNA 2GHIA 1KEUA 3L4BC 3Q0EA 3UYLA 1X7GA 3BDAA 3ZHUA 1BWPA 3H6KA 5LMCA 1UJ2A 2VJQA 1GFIA 3AUKA 1G0OA 3EXFB 3OBBA 5EERA 4HEA1 3GRZA 2PZAA 4GLOA 3RF6A 3ZJTA 4I1PA 1JEYA 4HFMA 4OBEA 1CFZA 2H2WA 4YMSA 1SUWA 3I4CA 4HSEA 2WJ4A 3ZU6A 3GBSA 1Y8RB 2FZ4A 1KAOA 3EFOA 3DOFA 1BOFA 2H5IA 2KBFA 2I7XA 4Y98A 4RZUA 2PIAA 1BNCA 1QIHA 4KPUB 3TCXB 3NMUF 4EFKA 1YR6A 1NIJA 2O2XA 3FIJA 1H94A 2ZR7A 1ZGAA 4UEJA 1OI3A 1EVQA 1HWYA 4Z8YA 1JVBA 1OBOA 3RJMA 3HCDA 3FB4A 3N87A 2NP6A 4LVOA 2RGCA 3OECA 5H4HA 3W0LB 3AKEA 3H5VA 4OM7A 1HV8A 2HU2A 3HCEA 5LR6A 1E98A 4MICA 1QOZA 2AEFA 5AVQA 4JLWA 2VYQA 4EY4A 3N2ZB 3VR5D 5F77A 4EI7A 1T9GR 1V2HE 3DZBA 5J23A 1UPAA 5J2UA 4G3XA 1UUFA 2IEIA 4ZGGA 2FPWA 2B8NA 1B3BA 3GZ4A 1J1IA 4HBZA 2QORA 1FSGA 2G70A 2J07A 3H5WA 5E7IA 2WM8A 1MOPA 2ZZNA 2QEQA 1Y9EA 4EHNA 3MCUA 3RYIB 3R8CA 2R79A 1FS6A 3FSEA 3G5LA 3IIEA 4KTTE 3ZBQA 1GQRA 2X5JO 3G59A 3OIFA 3AESA 5EJ9A 4ISCA 1T5SA 4RDHA 3RVJA 4L4RA 4HEJA 1EFHA 3A28A 3DV9A 1IL0A 5ENDA 2ZUFA 1EZZA 1U28C 3B1VA 3AFHA 3DDUA 2FUCA 1X74A 1CY0A 3VR5A 3NG1A 1NASA 3RBAA 2A5FA 1QDLB 2QTVA 3BFJA 1XA0A 1QUEA 1LA2A 1P2UA 1UKZA 2ODEA 3IUQA 1G8KA 3M6FA 4P4TA 3ESYA 1ESMA 3V8VA 4IOMA 3ZCSA 2VLIA 3G0HA 1TLLA 3WNVA 1YF3A 1FLAA 1MA3A 1YSCA 2J8ZA 3FGZA 1AGXA 2G1UA 2DF8A 2V1UA 2OXCA 1JDSA 1F2UB 2AL7A 2VXCA 1VPLA 2XCQA 1PWYE 3PUKA 5JAUA 1MO4A 1QPGA 2F43A 4WOJA 2ZSBA 1S9HA 5KNDH 3Q40A 4G5XA 1OLXB 3REOA 4P0TA 4TTVA 1SOVA 1J0DA 1XUOA 1L0BA 1UM9A 1R6TA 2DCUA 3LC1O 3NHAA 1FC0A 1Q1BA 5HE8A 4NJEB 1I2BA 5C8XA 3Q8KA 1WZ2A 1GFSA 1YS4A 2YXBA 1M67A 4PNZA 5EIFA 5KTMA 4P7GA 1UKYA 3E0XA 3GT4A 4BE4A 3AFGA 5DJ5A 5JS6A 2D3WA 1GJRA 2JFGA 1FXSA 3LGAA 3IEUA 3EC1A 2BFAA 3KTFA 3AUJB 4K03A 3PZBA 4AC9A 5KNBD 5K6AC 4IIFA 4A1OA 3VYUB 2EJWA 4FCCA 5HWSA 2CCGA 2O2HA 1DDOA 2OECA 3NBUA 4ARVA 3ZI7A 1IZZA 2WKWA 1Y63A 3K70D 3RLIA 1L5MA 1NVEA 3KAKA 3UAGA 1G6KA 2X1HA 3OJCA 1QPZA 5DSXA 5BT9A 2BTEA 4YJ3A 3FNHA 4B8ZA 4JYMA 3JQEA 5DULA 2EFDB 4JLBA 4HATA 2ZTUA 3D3NA 3O8QB 1DIOB 1SAYA 4KQEA 2HEIA 3P5SA 2XQFA 5AXAA 4OLAA 4GUDA 2C58A 2AMFA 3RM3A 1PYOA 2XGMA 5JD3A 3VKVA 3ZZMA 2W93A 3G2JA 5KNBA