3LTNC

Inhibitor-stabilized topoisomerase iv-dna cleavage complex (s. pneumoniae)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
226
structure length
222
Chain Sequence
b'KLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTAKAKMADILKNEEINTMIYTIGAGVDFSIEANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIALPPLYKMSKKGKKEEVAYAWTDGELEELRKQFGKGATLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDNVKFT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA topoisomerase 4 subunit A
molecule tags Isomerase/dna
source organism Streptococcus pneumoniae
publication title Structural Basis of Gate-DNA Breakage and Resealing by Type II Topoisomerases
pubmed doi rcsb
total genus 54
structure length 222
sequence length 226
chains with identical sequence D
ec nomenclature ec 5.99.1.-:
pdb deposition date 2010-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus
C PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.670 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ltnC00
3L4KA 4Z4QA 5EIXA 4G0UA 4J3NA 4Z3OA 3KSAC 3FOEC 3K9FC 3RAEC 2XKKA 4KPFC 4KOEC 4FM9A 2XCTB 1BGWA 2XKJE 2XCSB 3FOFC 4G0VA 4G0WA 4Z53A 3L4JA 3RAFC 2XCQA 2XCRB 1BJTA 4I3HA 3KSBC 2XCOA 4KPEC 3RADC 3LTNC 3QX3A 2RGRA
chains in the Genus database with same CATH superfamily
3PFHA 2C99A 1KR2A 4I9FA 16PKA 3G7SA 4QOHA 3T9BA 4E5PA 2EOAA 2YMPA 3LCCA 4HEHA 4XSGA 2JFOA 2WTUA 3N2YA 2VS1A 2QM7A 1N1DA 1JAHA 3LQ2A 1KNXA 5I9MA 3A4YA 4CKEB 4MB6A 3THXA 3UK6A 5GOTA 4DR7B 3H3JA 2H2WA 2PQ2A 3VR0A 1XTRA 2J0SA 5HXAA 3EEYA 3JZMA 3KX2A 3KZOA 3ZE7A 1JEEA 4N40A 2BEJA 3T9DA 4B31A 4BZZA 4EL0A 2OBXA 1Q7BA 2YJGA 4LX8A 4QECA 4R6WA 2ET6A 3HB7A 3PDHA 4GKVA 5DEOA 4ZQHA 4NRDA 2BDEA 1JJVA 4C4AA 4E5MA 4KUEA 4INAA 2GCOA 3WL6A 3WLSA 3IHWA 1BFDA 3BHNA 3C74A 3KU4A 3KJZA 3CSDA 3HZHA 2V5UA 4EHJA 4DKJA 1N6NA 2C97A 3M9LA 2O7QA 2WU3A 5HZMA 1P3Y1 5DNUA 3QI2A 3W2FA 5TMPA 5AJYA 1P5JA 1E9DA 2FEAA 2IOHA 2YICA 3NIFB 5GMOA 3NIGB 2W4MA 3GFRA 4NIMA 1RPAA 4JQYA 4MJ7A 4UCFA 4QPPA 4NVRA 4X1YA 4I9NA 2Q6TA 2EFYA 1A5BB 2IYSA 2JZNA 3ED1A 4Z0PA 3REFA 5DV9A 4KGXA 5J4YA 2ZIUB 3ZJTA 4BKQA 2IVFA 2Q6VA 1P2GA 4KEAA 2R6FA 5KQGA 1I6WA 1ZWLA 3FKJA 2WY2D 3CUUA 2WZQA 3AKYA 5HKLA 1WLSA 2ZS9A 1RTKA 3EIHA 4CQMB 1L5GB 1Z4MA 2Z9BA 3O4FA 1BXZA 1HH4A 5E2BA 4D8XA 5JMTA 1ISGA 1KZ6A 3AG5A 2XQJA 3HYTA 4Y2RA 3MSCA 1Z0DA 2F1OA 3DFUA 4G23A 5EKXA 5CYGA 4A6EA 5KYVA 4F2HA 3DP7A 3OPVA 1MZVA 1Q0LA 1ZU4A 2BL4A 4QTXA 2B82A 3H65A 2WKQA 4J1NA 4C3OB 1HM5A 5BNFA 4UD6A 1FYVA 3BMXA 1MFZA 1CVLA 1G21B 4BAUA 1NNUA 5DM0A 4EVQA 4Q4LA 1UM9A 2Y77A 3UWKA 4MKZA 3FMOB 3JQ8B 2C4UA 1FOEB 2ZZKA 1JR3A 3JASB 4D26A 3OZXA 2DPMA 4KVFA 4MLCA 4MWZA 5D3ZA 5TGTA 4MGHA 3RBXA 3CEHA 3IA2A 3WLRA 4C06A 1MAAA 2R9VA 2EBFX 2YXLA 2YHIA 1FVXA 3G82C 4MVJG 2FF7A 5JLAA 3RUHA 1EM8A 5K2MA 1CY2A 5LBTA 3AKCA 2FUNB 1JE1A 4IHQA 3IMKA 4J7CA 5T3UA 1GZHB 4Z1MA 3H2HA 3MEQA 4QUDA 5F33A 4P5PA 1QP0A 5CB6A 3RSGA 2QAGB 3U3XA 1I36A 2ECPA 2ZSBA 1JFLA 2INGX 3O0TA 3ZY6A 1FXWF 1XCBA 3G0BA 1V71A 1WMEA 3L8FA 5F77A 3O8RA 1JW9B 3AK4A 4ITUA 2Q5QA 2ZSHA 3KHUA 5E6RB 2GO1A 4DJ5X 4N41A 3HSKA 2WUWE 4LF4B 4RF5A 2YWRA 1HMYA 1ZD5A 1RXSA 1N8KA 4HEJA 1ZBDA 4RZXA 5JXWA 1X1EA 5EZYF 4IHJF 3PRYA 1BVRA 3EIUA 1H5UA 2GH1A 4S2EA 3ROFA 3SHFA 2H51A 2MSDB 4JQZA 3ABOB 5IXJA 3CLRC 5FT9A 1P7VA 1QG6A 2ZETA 4WHMA 4I0WB 3V4FA 1E4OA 3Q1KA 1Y4ZA 3G6KA 1S4QA 4F12A 4LVUA 5KKCA 3D0QA 2VJKA 1BU5A 2JIPA 2QN2A 3PC8A 5CJ2A 3W1VA 4PEVA 8AT1A 3HB1A 2ZAGA 3I04A 3QVTA 4CMEC 2RGBA 1KJJA 2P5UA 3GA7A 3HO1A 2GKSA 1OLUB 1QO7A 1SUEA 2P79A 4EHLA 1J56A 1PX2A 5AVQA 3CLUD 4CQMD 5SYAA 4XGKA 2VUUA 3KHKA 5AI4A 2IYZA 2HMUA 4DPLA 3ADBA 1KYQA 1NNLA 1TCCA 2F3PA 8ADHA 4ERNA 3OF3A 1KJNA 1MAHA 1P7YA 2VPXA 3NR2A 2X9VA 4O33A 2YS6A 2ZI6A 4YAIA 1JBEA 1WVIA 3GZJA 3NUZA 2OWEA 5TSDA 2ZYSA 3LBYA 3G5UA 4ZC1A 4JJKA 4Q47A 2C88A 1O96B 1AK9A 2A5LA 4AJ4A 3ZKAA 5IKXA 4OU4A 2JJ1D 5CX1A 2PUVA 3K8ZA 3ZWCA 4YPFA 1QZUA 3LDFA 1E61A 2XZDA 3BX1A 2DKFA 2XCOA 1JDNA 3I5AA 4CU5A 1X39A 5F2EA 1WDMA 4YNBA 5DB4A 1ZJYA 3C4VA 3PNOA 1XCMA 3P9SA 4RIGA 3W2TA 4XWKA 1WMSA 3UKOA 2ZU6A 2C2MA 1LV8A 4JR2A 4UJ5A 4C08A 1TJPB 2JANA 2HK7A 2RHRA 1M10A 3UA3A 1P0MA 4JS0A 3CB4A 2VCHA 3GK3A 2VPYA 2GTPA 2XQIA 2RD2A 4MV6A 3TD6A 1REQA 1W9HA 5JARA 3CVOA 3QW2A 2ORVA 4H08A 5JPIA 2QTRA 1OASA 5LQCA 3E8SA 1BH2A 1U0JA 3Q8WA 4C3ZA 3KOWA 3BSWA 4C9BA 2BGTA 1U0EA 2IPNA 3LHKA 4LJAA 4BATA 1ISHA 2BKVA 4NJOA 4RKQA 4FLMA 1MXHA 3VR2A 4X66B 1WHSB 4RTPA 3RUDA 4DCMA 2XNDD 5C4MA 5LVAA 1I3MA 1RAHA 1QOQB 3HUEA 1TYBE 3T06B 4MPRA 1HZZC 1W85B 2GBFA 3DKVA 5KTNA 4PVCA 4QAQA 3RDPA 3ANNA 3P0JA 4BMZA 1DHTA 1KEEB 3TLMA 2ZXEA 3IPLA 2AL7A 4DSUA 3DE4X 3CH4B 1W4BA 3DMTA 3I28A 5F1KA 5K0TA 5E9JA 2H1SA 4MVJD 4ZT6A 1DCFA 5JO9A 3CE9A 1M72A 1VIDA 3BIXA 3WJAA 2BM8A 1CEQA 2HWUA 3EVGA 4F04A 2DQZA 3GY0A 5EXXA 1E2UA 5HQTA 4GLFA 3IIMA 5IVDA 4AKIA 2O0KA 3K6JA 3R0XA 1HDEA 1VIAA 2NACA 2OHGA 2ZDHA 4C7MA 5ICGA 4KYTA 3MWDB 2V0CA 1YR8A 3VOTA 2F17A 3GRYA 1XNQB 4KIJA 4EKNB 1O08A 2D54A 5TDHA 1Y1KE 2WR8A 1ZUHA 4DUYB 1MW8X 5B1HA 4JWKA 2H9YA 5DGIA 3TM5A 1AQLA 4JI0B 4YLGA 3S8MA 4Y1EA 2VPTA 4PSAA 4TKZA 2FY8A 2O0LA 3ELUA 3X1MA 3ZHVA 3W3ZB 4KC0A 1BGWA 4MR9B 4URZR 3RUPA 3HVKA 5BWCA 5CD9A 1SHKA 3KR0A 4YP5A 3CNLA 4ZC8A 4J29A 1K6JA 2XT9A 1ZOIA 1QR2A 2B98A 3ND7A 2VNIA 2P1DA 1U11A 4A23A 2ZRMA 1KBZA 2W4QA 5C34B 5K8CA 2QNIA 3Q6MA 1RFGE 1V6CA 2PLRA 1UM9B 2MCFA 1TQHA 3SX2A 3AHEA 1FMFA 1D09A 5AI8A 1CUUA 3HBMA 5AVOA 1LLUA 3GCZA 3PEYA 3THSA 4P4LA 1QK5A 4FMDF 1ZAKA 4N39A 2X77A 4R01A 5EHXA 3K1AB 5CB0A 2QBYA 2YYYA 1CPYA 3H9QA 1KZYC 3OD1A 4ALIA 3VO1A 1CUBA 1BDIA 4GAEA 3CKKA 1UMCA 2J4DA 4WSOA 2J9FB 2OYCA 1WA5A 3DR5A 5KTRA 4IIXA 5G0UA 1YJAA 2QYOA 3U0BA 5AIAA 5ALOA 3IAM1 4HT3B 4BBAA 4Y98A 1D2EA 2AXQA 1K06A 2GK4A 3REOA 2VYCA 3WRXA 3RRBA 4M38A 2OCKA 2R8RA 1N33B 1DI0A 3WLIA 1OLOA 2ZJ2A 1LSOA 1CXZA 4NNPA 1H2HA 2AW5A 1DBVO 1Y6QA 3D7MA 4BWGA 1OB5A 4CQNA 3NHYA 4EUHA 1LW6E 3N8GA 2DT5A 3E9EA 2O8FB 4CV3A 1M1XB 4G9BA 4A5SA 2QL7A 1M8FA 2P0YA 3G1UA 4YMTA 1CEYA 5BVHA 2HSGA 2ENWA 3B7GA 2MSWA 3LX8A 2QL5A 3RS9A 3V4SA 2C96A 2QOEA 1JQKA 1M66A 3RK1A 5JWHA 3C3YA 2JW5A 3GLFB 1IY2A 1N78A 4O4HB 4P7JA 1CDDA 2GAOA 4ZV4A 5B55A 3C8DA 3P9QA 2ZJ0A 5DXJA 1YJXA 3RRJA 2AVNA 3TRFA 3RVBA 4MP8A 4KAFA 1TZKA 5GV8A 1MAVA 1P4GA 3DUWA 4R69A 4CR7A 4ZYXA 2TYSB 4JL6A 2JCSA 2FKAA 4DV6B 3GP3A 5M7EA 1KMHA 5EVCA 4DV0B 4LWOA 5AKZA 4MB2A 1U7XA 3EISA 1LF5A 2XRFA 4LSWA 4LI3X 3E70C 3K0CA 2GN6A 3L18A 4TXNA 3W1WA 2LV8A 1LI7A 1W25A 5EZ5A 4RPGA 3JAKA 4UATA 3GRUA 1QJ4A 2O9JA 3D6TB 2DWCA 1GTRA 3I62A 1O6CA 3GHHA 1Z6TA 5CDHA 3DWFA 3AR3A 5J63A 2QTGA 1H0RA 1DBQA 1MIHA 2QG4A 4PINA 4UXHA 3WK5A 1Y1TA 2P2LA 1RZRA 2CVFA 2P40A 2VYVD 3HUFA 4UBIA 3GPIA 4WNIA 1MJGM 1TTPB 4G1MB 2Q7OE 1UXIA 2G25A 3LYHA 1YL6A 5TMDA 2PH3A 3FMPB 3ZLBA 1PWZA 3BFJA 3V1UA 4MICA 3JWEA 1TT5A 1A7AA 4NV3A 4OQFA 3S3TA 4CMCA 2B6HA 2AKYA 2QUAA 3D0RA 4H0CA 3TINA 1G7TA 1CNEA 2Q1UA 4TS9A 5DK4A 3B5IA 1PF7E 5ERYA 1E1CB 1QWOA 3BG5A 3RREA 4ZOEA 3BFKA 3I05A 5A0TA 1PFVA 4BGVA 5FUBA 4MYHA 4K9PA 5F51A 4E94A 3ZCXA 2WD9A 2PX4A 3PWTA 1MOSA 3TF5A 1U7DA 2J6CA 3I0MA 4M1EA 8ATCA 4CKBA 2NSJA 5NLLA 3VAYA 3ECCA 3WYCA 2OILA 1H5NA 1MGPA 3ED5A 4B6RA 3ZDXB 1UPFA 2RG1A 3KLPX 1U28A 2Q4EA 3WBKA 4A2PA 5I8WA 1QHGA 1Z7WA 4ESVA 1EXWA 2EKBA 1YR7A 2G76A 2HF9A 5F7JA 4G0UA 1RBQA 1WDLA 4G07A 2ZUVA 3J81k 4BGIA 1OXBB 1OZHA 1ZJWA 4F11A 3KM0A 1GSHA 1BHQ1 1LGYA 4NV0A 4EGCB 2BGJA 3H17A 3LQRA 4OXNA 4DSAA 4ESOA 4CKBB 3IEPA 1XVTA 4W5TA 1GHTA 2HSWA 4O2AA 3I61A 4PQGA 2PGLA 2JATA 1GOTA 3CNBA 1M6EX 2X0IA 4H6XA 8ABPA 2C20A 3NDJA 1T26A 1UKYA 2BEVA 2FFRA 4FX2A 3KT0A 4MO9A 1UP6A 4MJLA 3B1YA 1EFRD 2EQBA 1VMAA 1UBFA 3A1SA 1A72A 2Z8XA 3JARA 1IQRA 2RGNA 4HFRA 2GS9A 4S1NA 4YQZA 4E51A 4ZCMA 3A6KA 3RADC 4IDHA 3CNEA 3QE2A 4IIUA 3AONB 3HM9A 3S1SA 2I8AA 1UBEA 3X1KA 4CKCA 2GARA 2WYVA 4IR7A 3A1NA 3PGVA 1GZ3A 1VRVA 5DASA 3C6XA 4ER7A 3FVRA 3VZCA 5EJEA 2Z6QA 4IL5A 3IPXA 3UAOA 1U2GA 2ODTX 3ZWPA 1R6XA 1G1AA 3IAXA 3LKVA 1F60A 1WXGA 4NMHA 1K7YA 3BWCA 2AOWA 2PTGA 4CLOB 3FLAA 4KO4S 3KSZO 2NU8B 4BNNA 3HYSA 4DMKA 5DM2A 5BR7A 2VYFA 1YIAA 3W4JA 1NVXQ 1P1IA 4DJEC 4DA4A 3I9V6 2G71A 2IYOA 4PNZA 3PQ2A 3F6PA 5H3CA 3SJAA 3ZHXA 4GM0A 3IMEA 4C0HA 3NBFA 4HQKA 1FNBA 1MQSA 2VPWA 1ZO8A 2RK4A 5DSTA 2I67A 1JAXA 1P39A 4CT0A 2QP9X 1EINA 3RYHA 1F4PA 4DPKA 5DCYA 3WMFA 3VNUA 3AZOA 5FTNA 3ZVRA 5ITVA 3I5XA 3NAGA 3HDYA 3EXHB 3OZWA 4JVOA 1V9SA 5ALHA 2WKWA 1PJZA 4H1HA 4D81A 4X95A 1AO0A 3LKBA 3SF8B 3JZDA 5B5SA 2DPHA 5DMXA 2NW6A 4Y2VA 2GXSA 1JRLA 1MX1A 3M2TA 3OJOA 4GWLA 3SBXA 4W7IA 3GQVA 1DBIA 3BMNB 1CRPA 5K1ZA 2AA3A 1JU9A 1KYTA 1U94A 2AWNA 3ABIA 4MUBA 2HPZA 3E3AA 3FBWA 4CI9A 1YTLA 3FNQA 3SHWA 3G2LA 4XYLA 1VFNA 3GRAA 2R48A 2QG6A 2ZWMA 3GZNB 4TS4A 4ZYUA 5A1TA 5C1BA 2R3SA 3HDGA 4H7DA 3DOJA 3P2YA 4B09A 2VWHA 4MUKA 2RGCA 5CLFA 2C4NA 2VP9A 3QTTA 6ADHA 3NQ41 4ZGWA 2XQGA 1P9LA 3HY6A 3LUKA 4LXIA 3HB5X 1QRRA 4N12A 4NABA 1NXVA 5CVEA 4A3SA 4JT9A 2CFOA 4QVKA 4Z8XA 3WNBA 3PKZA 1E1MA 3FZYA 1ILWA 2ZXUA 2A9OA 5I5GA 4LMPA 5JQWA 3HM2A 2XNSA 4ZANA 4NH4A 1NNI1 2B5WA 2PKQP 4HC4A 3EDYA 4ZYVA 3ZCVA 1T3HA 2W00A 5B58T 2WJ3A 4I50A 4EKEA 5FV4A 3L4KA 2BEWA 3OH8A 4Q48A 4KDRA 4G0ZA 4RE6A 1K1EA 3K09C 2WIBA 5AW7A 2K2WA 4MW5A 1BMQA 3FTPA 1MRNA 1SXJE 3BRQA 5K8JB 3COWA 2DYKA 1X2EA 5LQDA 2ADOA 3O75A 1JLLA 4CYMA 2ZROA 2EJTA 3NGMA 4EG1A 2ZBUA 1S4MA 3CUKA 4QGGA 3CX6A 1US8B 3IMFA 2MIIA 2Z56A 1ENYA 3C16C 2HDWA 1ECFA 2HXGA 2Y1XA 3HO6A 2CLKB 2W8BA 2VSFA 1POWA 3M9XA 3M5CA 3R09A 1CDZA 2V1XA 1T6ZA 5H68A 1HQCA 3QKWA 4MWCA 4C43A 1UMDA 3O92A 3VPGA 4QYMA 3V8NA 4RY9A 4Y2GA 1CS4C 3IAS1 4OB8A 1UKAA 2D74A 1NBOA 4M1SA 3O8OA 5E1OA 1EEHA 1K4MA 1OXXK 2HZBA 3LUBA 2I65A 3COPA 2QNBA 1NWHA 3TRIA 2WVAA 1M1YA 2JBAB 1XHEA 3G0CA 3MBOA 5K4AA 4D1YA 3OPXA 3P5SA 3G2MA 1T9CA 1VA5A 3DVLA 5IN4A 1YZHA 4RJIA 5TPZA 1OZFA 1RR6A 4LSMA 3WHKA 3GZNA 3AF6A 3JAWA 4MRMA 4RCVA 5K8VA 1IN8A 2JFHA 3BFPA 4OQ4A 4OJQA 4JXXA 4QPCA 1R00A 5BSRA 3EZLA 1E9EA 1XDSA 4MVJF 2COEA 2P8JA 1N9KA 3KT8A 3R3ZA 5CDFE 3UXYA 1JQ3A 1H2XA 4DDVA 3NATA 3DV9A 2JPDA 3SXPA 3GLFA 2NYUA 3TPCA 5JDCC 3ZLUA 1VL1A 3F78A 3M0EA 5BMVB 1E3LA 1AKRA 2HJVA 2QUBA 2P2DA 1KXJA 3D6FA 5HSGA 4MRPA 4RHFA 3VU8A 2X0FA 2HLHA 3RHTA 1V3TA 1ISPA 1K97A 1FFGA 1IY9A 3B13B 2F1IA 4JVSB 4B76A 5AM5A 3RGWS 4D79A 2QUZA 3W79A 4KQ1A 3NX4A 5K3SA 2C29D 2GNAA 4OXXA 1MC4A 2I62A 3IP3A 5BSUA 5TV2A 1DAPA 2BC9A 1PWHA 4YUVA 3F73A 4UU8A 1T0IA 1VG8A 4Q1CA 4CGZA 2H48A 3STHA 4IWNA 2AFVA 1P77A 3CISA 2D13A 1AT1A 1N2OA 1BHSA 1WVGA 1ZINA 1T9DA 3BDVA 3SZMA 4DNXA 4DRZA 1RI1A 3R5XA 2FSHA 5EQJB 1G6OA 3COZA 3OBBA 2Z2KA 4B9AA 2VK1A 1I0LA 2WSYB 5ER9A 2PA0A 4ARSA 5BR8B 4EVIA 4DM4A 3RKRA 4OYLA 3U13A 3WGKA 2UYGA 2ZLBA 2P9JA 1N2ZA 3ZCRA 2NIPA 3RS8A 4DA7A 2WSSD 4P93A 3B1VA 3DZKA 4KH0A 3WWDA 1OVGA 1ZMBA 3F7OA 3K32A 4GOKA 3H1GA 1KOLA 3ZYZA 3ILVA 3PR1A 1RW4A 3G7UA 4J49A 5ALKA 5AXCA 1PR3A 2CCKA 2O3RA 2TMYA 3PUHA 1QOZA 5JWRA 4BFUA 1IE3A 2CL7X 1UFQA 3MTQA 5AW9A 1KE2A 3PEFA 3KUCA 5AD1A 621PA 4CG0A 2X7XA 2V6JA 1Y42X 1ZGAA 1K9SA 1UAGA 1UPBA 2PCJA 4OM7A 4U8HA 3GC6A 3FTNA 5DX1A 3RNOA 3SXUA 4ZI3A 5B2EA 1AVTA 4YQEA 3W3AD 4IHKA 1W8IA 3I39X 3A1VA 3LCUA 4MMYB 3CRVA 4P4GA 1H65A 3L79A 4YI5A 5FUVA 1VB5A 3DF7A 2Y68A 3MA0A 1M1UA 1U2TA 2HJGA 1VRCA 3C3DA 1VLLA 2HBRA 2WMDA 4IOMA 4YJGB 4EPRA 4GOJA 4E08A 5IAJA 3HVRA 1XMOB 5AKHA 3L6EA 2QR5A 4W1PA 4EYEA 2JIZA 1BXKA 1OYWA 4KV9A 5H16A 4RPJA 4EYSA 2VAMA 3H5NA 3F6SA 2P4HX 1NY5A 3OI7A 2HV8A 3OM0A 4LMAA 4U7WA 1CTQA 5LYYA 4A7PA 5IHPA 1GADO 3RT1A 4NAUA 5AOCA 3TAHA 2X0RA 1NC3A 1E8NA 4KE9A 4ENQA 1LDNA 2X2OA 2A33A 2VCEA 5AVVA 1XRPA 3MQFA 1WMAA 2VHZA 3SBDA 3H16A 4B74A 1VP9A 3QHPA 4HDQB 1B6TA 4W8HA 2FYTA 1HDCA 1JEDA 4RL4A 2LGJA 2X23A 4ZOBA 5DOZA 3AY0A 4MVJE 3VHXB 1XTTA 1DE0A 4UNSA 1U9IC 3K16A 4K9OA 1AUVA 4O0MA 3UHAA 1X8LA 2DC1A 3LQYA 5FO0A 3HCDA 1W5BA 3QEKA 4Q05A 1G63A 3E8XA 3AFNA 1J0EA 4S35A 1Q95A 3KD3A 3HLKA 4GRDA 2VQSA 2WSMA 1CY0A 4PCLA 2FZ5A 3RVJA 2CVQA 3VPHA 4KPEC 5DWDA 5FB3A 5J1SB 1XTZA 2ZQZA 2XDWA 1GKIA 3GLHE 4L95C 2ERYA 3WAKA 2PLNA 4OHBA 2OGSA 4YMHA 2RGAA 2F3UA 2J6BA 3C6ZA 1Q50A 4FW9A 4W5WA 5TF4A 3S68A 4QU9A 3L07A 4H1VA 5TX7A 1KNQA 1FTQA 1LEHA 3RT9A 1JLMA 2YHSA 4MA4A 1QGOA 4Q39A 5DBGA 3VDNB 2DFVA 2OV4A 3Q7EA 3ODGA 4R51A 4YCLA 5SZJA 3ONWA 4ZCRA 1TFUA 1QP7A 5I7FA 2KBFA 4AFNA 3F9CA 3U7FB 1P1BA 2WJPA 3OQJA 4KNVA 1LDYA 2O1WA 3PBKA 1FSGA 4QASA 1GG9A 3DMFA 2ALJA 4NCIA 5A1JA 1CJSA 3ZD9A 2OHOA 4LQCA 3RAPR 1D04A 3BULA 3R20A 4I46A 1MZPA 1R27A 1DC6A 3AEUA 1KI7A 3NG1A 4XLTA 2N1BA 1MO3A 3G2OA 4YRLA 1BU8A 2P5TB 1GL3A 3EFBA 4NE2A 4UBNA 3RV4A 3WIVA 4AG6A 3QX3A 1GZSA 2AE2A 2QL9A 3HY4A 3WISA 1GA6A 1YR6A 2LW7A 1B3RA 2BTOA 4PTLA 1E79D 2WHRA 3HDJA 2J3JA 3FWNA 1ZK4A 1V1RA 5EXDA 3SS8A 2RGNC 4OK6A 4DTCA 3G9TA 2D4AA 3NTVA 4OXIA 3EAGA 4QJ5A 1T0PA 5U4XA 2JF0A 4PHCA 1II8A 1P1HA 3LD9A 1CRLA 1L7OA 3LPLA 2WVJA 2WMNB 3UMBA 3PGMA 3T4UA 1WQ1R 3HLTA 2D1RA 3GA5A 2EZUA 4R9UC 1VCMA 3TE6A 1Z29A 221PA 4J2HA 3ZW8A 4CLRA 4AI6A 2DZDA 4OL9A 1V1RB 3PUIA 1OFHA 4MWDA 4KXNA 5D01A 4EMUA 1L5HA 4MARA 1YTUA 1W2GA 4G0XA 3CQ9A 3IIEA 2FPXA 1WU7A 1XD2A 2WUGA 3TFWA 1NW7A 4F1WA 2GN9A 1ARZA 3PQEA 5HRAA 1EUCB 3A8TA 2H59A 1U28C 3O1LA 3TLYA 2ECQA 3DQPA 1H6CA 4LRXA 4NMWA 1ID8A 2WKSA 2RH9B 4LY6A 4YGYA 4M83A 5M2QA 1PV2A 1SBZA 2ILTA 1GCIA 4FYVA 4G4GA 1RC0A 3K2BA 3NWEA 1FDSA 4QWMA 3VSDA 3ITEA 3K73O 3WXMA 3ZUGA 3R8FA 1ZIPA 2HREA 5A7FA 1NVBA 2ZI5A 4Z3DA 5DYNA 3I4CA 1Q1ZA 1Y1QA 5BOSB 3ZV3A 3H2GA 1BJTA 1IEVA 2FN4A 4FOSA 2R4UA 4R2MA 5AMXA 3KQKA 3T5DA 2JJMA 3HN7A 1T3LA 1SRRA 3G2KA 5ALPA 3C85A 3A06A 3NASA 3N2KB 4Q4AA 4TYQA 2GILA 2BHRA 4DA9A 1D5WA 4FZJA 4M9RA 1HDIA 4NZMA 2DH5A 1AA9A 2ETVA 1GEGA 1ZEJA 2EW2A 5CURA 4OJNA 1T34A 1W0JA 1U0HC 1XQ6A 4RSMA 1T29A 4B7AA 2QD2A 1ZD9A 4YMIA 1CUEA 1XD9A 5KQSA 3VYSB 2RK3A 1YFZA 4LOHA 4PZ0A 4O2BB 4EY3A 821PA 2E4ZA 4W8GA 5ENVA 1A88A 1GPYA 4EGSA 1C5KA 5AICA 5HDQA 4RXMA 4KO2S 3K1JA 2BRUC 2X86A 2ZRKA 3EXHC 3N75A 3WGOA 3WB9A 1EGHA 3ITNA 4L5CA 3AETB 1ML4A 4XX0A 1VLVA 2VPZA 3PIIA 4MKRA 4CIBA 1ZY2A 4XGRA 2B4AA 4K03A 3DONA 3SXUB 3VVCA 4TYYA 1V2HE 1RAEA 2Q3FA 1YQWA 4EHHA 4ZRNA 1EMDA 4FYYA 2OOKA 1SR8A 3X1XA 3DLCA 2BONA 3WYDA 3UAYA 1RSZA 2PUDA 4GX2A 1S01A 1RDFA 1YJQA 1VLJA 2QRZA 4FEGA 3WRWA 1PK7A 5FADA 5A5FA 5DE3A 2C5EA 4NK5A 1NYQA 4IXWA 1NYLA 4UBOA 4J1TC 2X76A 1WO8A 2A14A 2HK6A 5IAKA 4GECA 3QEMA 3M8KA 2VHTA 3O2NA 4HX5A 1TGVA 3SYKA 4I55B 3UY4A 3DPSA 4EG7A 5ADHA 4D96A 3SIWA 1FFCA 3AEKB 3RLIA 3OOEA 2QTFA 4NG5A 3SYTA 3V8EA 2ZTSA 4DCGA 1R18A 1O94D 3GAAA 1BRMA 1LK0A 3B12A 1HPLA 3GFTA 3VU9A 3W2EA 4FC7A 4PZDA 4E3ZA 5I3ZA 2IHUA 3GNQA 5E2AA 2IHNA 3U4MA 2I1VB 5K9ZA 2ZR0A 3BZUA 1VYTA 2QROA 4V0ME 1VL2A 2NAPA 4II7A 4D99A 2QJRA 4LBVA 5KSOA 1LRLA 3AESA 1WCV1 4URUR 2ETXA 3CC8A 3PJFA 1YC5A 1I3LA 3A6GA 5CH5A 3T5PA 4N4AA 3V9PA 3K0FB 3LCJA 4JEHA 4AF6A 5LPNA 3WADA 3QVWA 5KTKA 1KA9H 3BORA 3AERB 2ZCVA 1X1BA 2QRLA 2AQ8A 4BFYA 5ICCA 1M9NA 4QYWA 3S40A 1U8FO 4OQQA 2BGNA 1ENPA 3S1AB 4XX1A 8LDHA 3AYXB 4AQYB 2QJFA 3V97A 1IEWA 1MA0A 1G0OA 3O9ZA 4CWAA 1OILA 4JLOA 4JJIA 3UW3A 3LUPA 5IT5A 4LFAB 1E1QD 5HF6A 1YGYA 1SKYE 1JBQA 2B20A 2DKNA 2X2EA 1L7BA 4TT3A 4DC9A 1ZXLA 3HN2A 3HJNA 1Z28A 3ORFA 5HTOA 1VPLA 1X1QA 3H1BA 5KX5F 3C3PA 1OAOC 1ZUWA 4I1IA 4AYWA 4HWSA 1H9BA 4RC9A 1XTUA 1Z47A 3IT2A 2WIDA 5BOVA 1IULA 1BCSB 4Q7KA 1D1QA 4IIVA 2A9RA 1ZXBA 2VXBA 1NNSA 1VE5A 2G80A 1ORTA 3WYEA 1ZONA 4AT1A 3EGIA 2D7DA 4RUKA 3CZCA 3P9NA 3V4ZA 4Q4DA 3HFRA 1T24A 3DMNA 4B3FX 2G9UA 3B2QA 4IDPA 3D1LA 2HF2A 3L77A 3NDIA 4KWTA 4JOQA 4BNLA 5HHTA 2F8SA 4CV0A 4OHWA 3CZPA 1ESMA 1IQPA 1E7MA 4MRMB 1RFLA 4R3NA 1E1NA 1ISSA 2ZIEA 5F4ZA 1DFGA 2IHKA 4M9UA 3A28A 4LA4A 1QHFA 2QQ0A 5JJCA 1QDUA 4OAQA 3WHPA 1VCHA 4PYRA 5TVKA 3NBMA 3FR7A 4CMGA 2K6GA 2RJ3A 1B4DA 3EWSA 3LA6A 4US2R 3CU5A 5IXYA 2NQTA 3VU3A 2AI2A 1HKUA 4QXMA 4DLSA 4BFWA 1T9KA 3RFXA 4R1LA 4HMPA 3K0SA 1XXHB 2VYVA 3RQSA 2Q5OA 1IUPA 1JEJA 3JYOA 2W98A 4Y6RA 3ZDFA 3KB1A 2H3EA 2NP6A 1U3UA 4MPJA 4LSZA 4M37A 1NTRA 4CIXA 1J9EA 2PSSA 2XB6A 4PHHA 3SJBA 5GAJA 1NL3A 4HDRB 4YRAA 2WI8A 4FGKA 1DQPA 3DOIA 3FYUB 5HKKA 4LX0A 5DGHA 1FYWA 4YDSA 3HRKA 3D3QA 3OIYA 2OO5A 4HS9A 3PPXA 3NHZA 5JS8A 5JSZB 4GMFA 1U0SY 4QFCA 4QGBA 2LXNA 2D3TA 1DIHA 1U3GA 3HJTA 4AMUA 5LKAA 1C8BA 4BX0A 1I6KA 5E9AA 4TS1A 4RKYA 3AI2A 3DKKA 4EGFA 5CBKA 1C50A 2BELA 1YR2A 1TYZA 3EGDA 5YASA 1GU7A 5IT0A 1SBCA 2O2DA 1WULS 1JB9A 3BXXA 3VQTA 4WX2B 2V8OA 3QU9A 2A92A 5JS6A 3DDNA 4AC9A 4IKPA 4BPRA 1C3VA 3E4CA 1ZVMA 3DPIA 3BM5A 3LZCA 2IXFA 2PMWB 4PPGA 1DOZA 5G0VA 5CT8A 1NKSA 2GAIA 3EVDA 1UC4B 4XD7A 1SUPA 3KXLA 3T1NA 2HX1A 1G5RA 2X0KA 1XZ8A 1WDKA 1ZVQA 4FGWA 2HLDD 1BX1A 4V0NA 4E5VA 3K5PA 1CQJA 1MBZA 1VCNA 2IYTA 2WWTA 3CKLA 3QPVA 4A8PA 2QG9A 5C0OE 3THWA 4WNAA 4K8RB 3ESAA 4ARIA 2V3VA 2EQAA 4JYMA 3DA8A 3O84A 3UC9A 4GE0A 3RAJA 2IELA 4CCAA 1VI5A 3A6DA 3FLEA 4UZEA 3PJEA 1G8HA 2DPXA 2XNJA 3WRXC 1NR5A 4ZTUB 3GRKA 2FWPA 1FFDA 3W3AH 1YL5A 2O2ZA 3BERA 3T41A 3VNVA 3JWIA 4PO3X 1IM5A 1TZCA 1AK1A 1NX6A 2A88A 3LCRA 1J00A 1MQ8B 1Z0ZA 1HTBA 2ODBA 2R5WA 3BHJA 2LE0A 2F3RA 2VEOA 1YRLA 3R3XA 5TY0A 1BXRA 3TGWA 3UWSA 3PX3A 3V1MA 1K08A 2P6NA 1KEVA 1X0VA 3KFLA 3AVYA 4FC6A 1VIYA 4JCCA 1LRKA 2WJWA 3ZY5A 4DSNA 2QE7D 1WB9A 4AO6A 1TU4A 1SY7A 2F7SA 5LLSA 4DEVA 1ONOA 3DV0A 3QQ5A 3HXKA 4UXIA 2RGRA 2CNDA 2QORA 2H08A 1JTFA 2GBPA 1BS2A 1UPCA 3RSHA 2RHMA 4NY1A 1L4EA 2EKQA 5DYTA 2JFXA 4WXEA 5FCDA 2JJYA 4ZMRA 1V6AA 2D1SA 2X8LA 2WWYA 1NW6A 4UW9A 4C4OA 4M53A 1PCXA 4Q16A 2W2KB 1A7KA 1OVMA 1E2QA 2AYYA 3TTVA 1UT8A 4NU6A 4XJTA 4KFCA 2JLQA 4AZ0B 5AO9A 3MCTA 3I5MA 3LCMA 4Y2XA 3ZU6A 5DNCA 1H2ZA 4RPIA 1HFKA 1S96A 5CCDA 1RXCA 1II8B 1RU3A 4RZUA 3WO0A 3HR7A 4NQRA 4IGIA 1L7RA 2XCLA 3AOEC 4NBVA 5E1MA 1A76A 2P27A 3ECAA 3JVUA 5JNRA 1LTHR 3I1YA 5CLGA 4CKCB 3HRIA 4H17A 5JD5A 1RQPA 3SR0A 4KLZA 1RNLA 1GA4A 4WBNF 1QIDA 1PT6A 1BS1A 1OJLA 1TQ8A 1BKSB 4NFYA 2VF2A 3JASA 4B4UA 1XPJA 5JU6A 4CDNA 3ZVKA 1A2OA 2AX4A 1XA0A 1T3TA 4M6WB 4R8VA 2BMVA 4FDTA 1K4KA 2VP4A 2ZRFA 3KSRA 3TL6A 4DB2A 2PVSA 1TD1A 4XWWA 3H99A 1YZQA 3V4OA 1HR0B 2W42A 2QTCA 1XQ9A 4N0QA 1JZTA 1JLKA 5DX0A 1JQLB 1P31A 3L1KA 1QQ5A 2E55A 2KW5A 1X1AA 1N5DA 2I3BA 3FUCA 3F2VA 3LKZA 4BCDA 4EB8A 3UXHA 4KACA 5F64A 1NTOA 1T15A 1YR9A 3VBEA 4B6QA 3SQXA 3FPEA 4DJAA 1PT9A 3IO3A 4Y6LA 5IYZF 3QI7A 1R15A 1KZGB 3D2LA 1CF2O 3K9QO 5HR5A 4DR6B 1VKNA 2CVZA 2E49A 3CT6A 4FONA 1IHDA 2BP7A 2W83A 4FGUA 2D00A 5ICEA 2E7ZA 3Q7TA 3DBRA 1HDRA 2G82A 4HNTA 1L5YA 1N5RA 2VHXA 3RPEA 2HHCA 3GPLA 1B0UA 3L49A 1SXPA 3WNZA 5C5CA 1NVTA 1DS6A 3UEOA 3DTNA 3DLBA 4RPLA 4DR5B 1ONBA 1IBSA 4E15A 5KEIA 2R5FA 4KL8S 3AUYA 1OR8A 2QT9A 3E61A 1JKJB 2R7NA 3DAOA 1LQ2A 5DGCA 1YZLA 1G8JA 1EX7A 1SOWA 1UT5A 2QTMA 2XIJA 2PZBA 2WU1A 3Q3JB 4OLBA 2HF8A 2POQX 4FFOA 3N9IA 4HK4A 4L15A 4QUKA 3G49A 5EIEA 1F7UA 5D3MB 3VO8A 4FYHA 1D1PA 1ONNA 3ZXIA 2RJOA 1LJLA 1BTOA 4G4SO 4IMJB 4PG6A 5K4HA 1Y3FE 3QXSA 5DISB 1E63A 2HD4A 1HUQA 4FB4A 3A37A 1C1YA 3DBOB 4ZVQA 2ST1A 3IJ5A 2IY9A 4FWTA 4LEIA 3DHYA 2QD4A 1ZIDA 2VDNB 1NLUA 2JGJA 3FWKA 1LW7A 3N0WA 5CIWA 3HSYA 1Z16A 3Q88A 2DCMA 3HYRA 2EZ9A 4CF7A 1A96A 3WDMA 4A1FA 2ZT6A 1V5IA 2PBFA 3AOEA 5LXTF 2JJ8A 3T3OA 2VTBA 1F0NA 2H1CA 2ZUTA 4TZTA 3P2OA 2DB3A 3DVQX 1RJWA 2AJTA 2OD9A 1ZH2A 4Y18A 4MWSA 5BP7A 4CMEA 3WGNA 3FNBA 3I9JA 2CLIB 1BSVA 5EEGA 3TDMA 2J09A 3EWAA 3Q7IA 2VQDA 2PXCA 2OP1A 1N3BA 4B6FA 2AG8A 3F49S 4LJSA 1PVVA 5CFPA 1WZNA 4P3YA 2O14A 4WVLA 4HYEA 3O94A 3SYNA 3V7WA 1P5HA 3NT2A 1RXWA 1EWKA 5DYGA 3HDHA 4TMVA 1KZ4A 4XA8A 2ZI7A 3PWZA 3SM3A 4JI8B 4GIBA 2ZCJA 1RZRD 4MVJM 3R23A 4Q7LA 5J5VA 4FD2A 1E0DA 4DDMA 3ILSA 1YB2A 4CF3A 3WNQA 2B30A 1MW9X 3HXPA 2XITA 3JQCA 1ULTA 4WECA 2CJYA 4X54A 3JAMA 4BVKA 1HKHA 3HVHA 3M6LA 4Q7EA 4B34A 2WYIA 2P9FA 2RK6A 4HNRA 4UAUA 3LDHA 2IW1A 2YFKA 3WYBA 2BDUA 2BTQA 2EP7A 4H0FA 3Q3CA 5BVGA 3P27A 4KAJA 2SKEA 1E4VA 4P33A 1Q0TA 3T1VA 3FDFA 1BGXT 2GD2A 3VDQA 4BZXA 1UDCA 4HX9A 1THZA 3R8XA 5EJFA 1RKUA 1S8FA 3TGLA 1H5QA 3O74A 4MQ5A 3R6GA 1NRJB 1QFXA 3BFVA 5T6BA 4J90A 1M75A 2F8LA 2IP2A 4IDGA 1SUAA 4NAHA 3W2HA 5BT8A 2J9YB 4AQ7A 2P6MA 2QVLA 2ZREA 4OFZA 5CM2Z 3RO7A 4A2CA 3QIVA 5TQJA 3DV0B 4UBMA 1S2MA 1YK1A 3MWJA 1T9AA 3GXOA 4DNOA 2BLNA 3NHJA 4LAFA 2MR5A 5MN6A 2Z3ZA 3TG2A 4TTQA 2IHZA 1TFRA 3D8UA 3ZTTA 4AQDA 4MA5A 4G81A 4Q9IA 1XVLA 2KB0A 3DL2A 3MWDA 2M6LA 1XF9A 2ILVA 2BMFA 1HFWA 1DNPA 2X1HA 1HBJA 2Q3BA 2PFSA 4NBNA 5A9SA 4MNTA 2BM1A 1O9GA 5C8YB 3FTCA 4OAOA 2QTVA 2XECA 4GPZA 4F9FA 2XADA 1E5DA 4NSNA 3D0OA 4MJXA 4EJSA 3ON5A 3PNBA 3UCFA 1LWNA 1QV6A 3W6OA 4MAAA 2CMDA 1V8DA 5BO5A 4V39A 3V4RA 5HM6A 1EFLA 2OO5C 4F3TA 5AKIA 3TKLA 1TA4A 5A7HA 1Z0JA 4YR9A 3OIUA 1XL1A 2CN1A 4MZDA 1CQJB 4EG4A 4NEQA 4U2KA 1C3JA 4WMLA 1XMPA 3GEHA 5F35A 3WDLA 1A0OA 3M81A 3WBBA 4HV4A 2E21A 2OSBA 3BCRA 3EDOA 5BQOA 2B6NA 5FA6A 3PXGA 1T2VA 5EESA 2IV7A 1XCLA 4GR4A 3AZQA 1YA4A 2BP7B 2HJRA 2W8BB 3PXBA 1WS6A 4O4JF 1O87A 3LFHA 5CTJA 1ZCFA 1OBCA 4GL4A 1LWOA 1Y4DE 1HGXA 4Y9RA 2XYVA 1IZ9A 1RLIA 1T3SA 4QQKA 4ZOLB 4EBFA 5FOQA 4G5YA 1GKYA 1Q74A 3I73A 2X0EA 2W48A 5ALEA 1GKUB 1K9VF 3B3QA 5EJ6A 3IQGX 3EGXA 5DDIP 3HL0A 2P4UA 4RGVA 1V26A 1FDWA 1XQYA 2I6XA 1BDBA 3NEPX 1GQOA 2YOFA 4FMBB 4LJKA 1G4HA 4L4SA 3EOAI 4KZKA 1ZQ1A 5D86A 4TMKA 3LK7A 1TL7C 3IQFA 1JG1A 1N2CA 4OJMX 2B7CA 3OMLA 2ZTMA 1YDFA 4ZOLA 4LNUA 3S6JA 2OC9A 2AXPA 4FE7A 4IIEA 4MIKA 3PUYA 1Q6ZA 3RIEA 3ZXUB 1NQOA 4MKFA 1VCIA 2QPAA 1CZNA 2RGGA 4IDBA 4CM4B 4RSHA 3WQBA 1Z4QA 1IOWA 1DEKA 2P9ZA 3LW7A 4Q0MA 1QANA 3JZIA 5AHRA 4DIDA 4X6XA 3TMYA 5GVSA 3JQBA 1TVMA 4GWGA 3HEMA 4FUTA 4WXYB 5BN1A 2CJWA 3GLIA 1T8YA 1R3DA 5GJVC 3L7CA 2ATCA 2VNJA 1CY7A 3ODPA 1TYEB 1N3YA 3PE4A 2CLCX 5THQA 1FTYA 1QTIA 3O4VA 1UMBB 1WUHS 3RBVA 2A4MA 3K9BA 1CSEE 1J09A 1SPBS 4FMCB 4FJ2A 4PC1A 4EELA 3BL5A 2VDWB 4R2XA 1GFIA 4I1VA 3VR2D 1PL0A 3L8ZA 4YRTA 4C4PA 2O8VA 3GLIB 2QU7A 1PJ3A 1N0IA 3KELA 1CZLA 6ABPA 5AHKA 4XE5A 4RW0A 3FYSA 1IZ0A 1W2WB 5KTOA 3SEFA 2QR3A 4GUAA 4M54A 3GUUA 3R5SA 3SS9X 3CZ5A 1QGED 2V5VA 2E4VA 5ARBA 4B5KA 3BT7A 4G01B 3GOHA 1JKXA 2QM8A 3RS7A 4LV8B 1QCZA 1QS0B 2QU8A 4QXAA 2SNIE 4P31A 5LMNB 1YCFA 4GF5A 1Y7LA 3B8HA 4A91A 1HG1A 2OCAA 2OGTA 2ZFUA 3FPCA 3UYKA 1TTTA 1CVIA 1KK3A 1AS3A 5C8XA 5KJFA 4FR5A 1YVPA 1JR3E 4HXEB 3EASA 1JHRA 5AQEA 3VV3A 1Y5IA 3FGPA 4RL6A 3ZCTA 4YGXB 1DINA 2AQKA 4J0IA 4YPOA 3I2JA 3DAFA 3D81A 2RI1A 4AY4A 2Z98A 3EULA 4TL7A 3O4IA 2V03A 4QU5A 3ZYCA 1E5VA 3EZ7A 3K7EA 1JEYB 2RB5A 1GTVA 3R6DA 2Q1WA 5FHQA 3ZZ1A 1TO2E 4HTFB 2TRSB 2P9GA 1RYFA 2VF4X 2VJBA 1FLNA 2XTZA 3BN3A 3TW8A 1T9GR 3QBEA 2PUCA 2IXTA 2Q0SA 1E94E 2VSQA 1P44A 3K96A 3EZXA 1MMFB 1MR3F 3KQNA 1BW9A 3QBTA 4WLNA 1UUFA 1V8BA 1JZSA 1S3GA 2HPHA 4UNQA 1KPHA 4M0PA 1UCFA 1YDGA 1N75A 3HHEA 4IDNA 3DCJA 2FK8A 4MS1A 2XJ4A 3OQNA 3RFCA 2HNAA 5LUAA 2W6NA 2J07A 4PYIA 3VR6H 4L22A 4RABA 1B43A 2BI4A 3OZDA 1Y34E 2QTTA 3MJEA 4UUNA 5F73A 5B1SA 5CFMA 3ENKA 4O2AB 4A0SA 5DMHA 3EXFA 2H0QA 1AHNA 2AFHE 2JI7A 4ZV9A 3EYAA 9LDBA 4ND3A 2PAFA 3OIGA 2GK3A 2OGZA 2WWRA 4R4JA 4DBLE 3HA7A 4LJYA 5IPFA 4RH3A 3DXXA 2IDMA 2HW8A 2C5GA 1I8TA 3PL1A 2GQ0A 5TJHA 1V9CA 4IJKA 2BLLA 4OGKA 4YP1A 1ZCZA 1MU0A 3F3MA 1O3YA 1ANKA 2XEXA 2YRFA 2CVOA 1Q57A 1TEXA 5FWDA 1E1LA 1GYPA 3ZBPA 1P5RA 5HILA 3MK31 1QYIA 1KFJB 3F3KA 1Z4LA 3NBYC 5LA6A 2GD0A 4UQPA 2VK4A 3ANYB 2SECE 1FEZA 3L1UA 1E7WA 3ZHOA 2PEZA 1EB9A 3L4SO 4PTZA 4X1KB 2PKCA 2WTNA 3O6VA 4E2FA 1Z8FA 3LWBA 2WJHA 3QPCA 3ZWYA 1YFJA 3N07A 1DQNA 2G1AA 2BAGA 1NC1A 4Z7OB 2PBRA 3H9JA 1GN9A 2HTFA 4EG3A 1YI1A 1L5QA 3NUQA 4QGAA 2C7OA 1GNVA 4PZAA 1PFYA 1SU6A 4BO6A 2ASVA 1NDHA 2GPTA 1RRKA 1RQGA 5J5AA 1O03A 4MYUA 7REQB 3HN6A 3NXKA 3HBLA 2IUUA 3WKAA 1JAYA 1U4SA 1OCEA 4L16A 2FPWA 1U8YA 3DEKA 3FWPA 4XYGA 3WXBA 4LF8B 5BV0A 2YXNA 1HYEA 3LP8A 3R3SA 3K1ZA 4ND2A 4AS3A 2JARA 3VDXA 5J9FA 1MG5A 2WAMA 1SZCA 5FEUA 2P6OA 4H6VA 2L18A 1A97A 1XZHA 4P4TA 1M2NA 1DDGA 1JLHA 2P6UA 3F7TA 2W6CX 5CX4A 4H6WA 3EVBA 4OM8A 4AZ3A 1KOGA 4KE7A 4X7RA 3S5UA 4PTYA 2WG2A 1TA0A 1EK5A 1VECA 2GAJA 3JSAA 2CJFA 3JVDA 1UF9A 5BUZA 5AW5A 2ZAIA 1AGNA 4I8DA 4OL0A 3NEAA 3UT6A 1BXGA 3O93A 2XOEA 1PJQA 5LWHA 3I6QA 2P2ZA 4BUZA 3KVYA 1L4GA 3RHSA 2EARA 5FPHA 4D4MA 4N3AA 4BBJA 1XFDA 3VOSA 1XU9A 4CR6A 2AEJA 2KX7A 3IP7A 4NPCA 1QB7A 2AOUA 4XFDA 5K3BA 5BQFA 5LZ5A 3AYZB 4A6DA 4O5OA 2OHIA 4UXJA 1YC2A 2ZSUA 5AJUA 4AZVA 2WIGA 5CGQB 4HPWA 2Z2XA 2BF7A 3RKUA 4CLRB 1T1RA 1VI2A 1W4CA 1KK2A 2ON6A 1I3OA 1NKVA 2JFQA 5ER6A 5BSEA 3LQFA 2XWQA 4LHEA 1SKUA 4H1UA 3OT5A 1MHTA 1GZUA 3PD1A 2ANBA 2GZ2A 5C35A 2B83A 1Y9AA 1M2VB 2DBQA 2Q07A 4PGFA 1F06A 4I8IA 4F4FA 4HN9A 3ZEIA 4NOLA 4RM3A 4TRMA 1F4VA 2OK8A 4QBIA 2OR3A 1L1QA 5LQMA 2C2WA 4D80A 2YBDA 1I01A 3M82A 3NV7A 4M3NA 1B0PA 5C7LO 4TYNA 1MJFA 3I3SR 1R0LA 1B42A 3DUFA 4IOJA 4PRZA 4R9NA 4UEKA 2AD5A 5NULA 3URKA 1XLUA 4DV4B 2CE2X 3EIOA 4PW0A 2FJUA 4NKRA 1DZIA 5KSYA 1XGKA 1MORA 4KQJA 4IKEA 2RFLA 1UWCA 2I3DA 3Q5EA 1N9ZA 4U7PB 4UM9B 1GRRA 3K0AA 4K0RA 3D2AA 5AR1A 4MYTA 2Q5EA 1UZNA 1KZ1A 2BFDB 3IMGA 3N2EA 4TL6A 1P1FA 4WN3A 3MWLA 1L8OA 3NYIA 4BQIA 4D92A 5JJ5A 4RTKA 1ZH4A 3D7KA 3GMSA 1ENOA 2V3WA 5IVIA 3LYLA 4TQUS 6YASA 3FNFA 1T9GS 1Z6YA 1T13A 1XUOA 2WZBA 5AKGA 2XSZA 3N8DA 1UM8A 4FXOA 4KAAA 1Q0SA 2FETA 3EBOA 5F78A 2Z08A 4EB3A 4K40A 4XVCA 2R11A 3AIOA 2V6BA 4EZIA 2REQB 3IKLA 4AKSA 4YUAA 3MGKA 2IUFA 4D4KA 2FZVA 2J7PD 1FVOA 2JVKA 1Q2UA 3EUAA 1EUDA 4O2BA 3JY6A 1FSPA 3UPDA 1GRQA 2UZ1A 5DBOA 3DAYA 2A35A 2CKMA 1FQOA 1S3SA 1LNQA 4HX2A 4L9RA 3V80A 2H57A 2AX3A 3KQVA 4X1OA 4N47A 3P8ZA 4ZYZA 3OBIA 3SBEA 3IX7A 5A4AA 5ALSA 5C8DA 5D3KA 2B2NA 4LC1A 1K6MA 4JCOA 4QU0A 3SYLA 4MQ4A 3N6VA 4KCGA 4BNFA 3ZN2A 3N2KA 4G97A 5U9CA 2NXCA 4CKYA 3JU3A 1MAUA 2J1LA 3U44A 4MHOA 3D4PA 3L0BA 1TC2A 5IHXA 2WOOA 2W6ID 3KDSE 3M4ZA 5FHRA 2KBEA 2WE8A 1W5SA 2A78A 1U8ZA 2PWYA 2ZDGA 4HWKA 3H9CA 5E6SB 4H1WA 1NJ5A 3M6MD 4CT5A 3OEYA 1AQYA 4PYNA 4B6GA 2WHEA 4CMIB 3A3YA 4PNHA 4E4YA 5KNBD 3R3JA 2R44A 4QUAA 1NSYA 3UICA 1ZQ9A 4K28A 2E4YA 5AHXA 5L53A 1IVSA 3BD7A 3CX8A 3PS9A 5AUNB 2GMWA 1UBNA 1ZM4A 1SCIA 3L6UA 3OUTA 3PZRA 3WL4A 3BHIA 4QC2A 2OFXA 3EZ6A 3ER8A 4Q9LA 2GEDA 1E1DA 2JFFA 3NOOA 3PRHA 4B35A 1VL6A 1OC2A 1SBNE 3LC2O 1DCKA 3VKUA 2PZLA 2QX4A 3GMIA 5HGJA 4EPWA 5AK5A 1JEOA 2XNDA 3JATB 2XE4A 2VA9A 4RZ3A 3VR4A 4QGFA 2J48A 4P32A 1N5LA 3H9EO 3KTAB 1MABA 1CETA 4Y1GA 4EM6A 3JALA 1A9XA 5AJHA 4D2IA 2E1PA 2NSHA 3H6HA 1K3TA 2CHVA 2WJJA 2WT8A 3KVOA 3QVKA 3RVKA 3GJRA 5BQ3A 4RIHA 3GMTA 5JC1A 2JG3A 4OLAA 4YBRA 3TOCA 5FPYA 3LG2A 4FNMA 4LHVA 4DABA 4RGYA 4HH1A 1ZVKA 1FNNA 4DYDA 1CP3A 2BH9A 1W0JD 4RZHA 4FHCA 5IBPA 4A2QA 4WY8A 2XCSB 1ODTC 3PFCA 1G0NA 1KWKA 3M9WA 4Q6WA 1XZAA 4ID9A 1UK9A 5CX1B 1N6HA 1GGEA 1U7ZA 1HV8A 4YECA 2DHEA 1W30A 5CDYA 3H2YA 2MSLA 1ENZA 2R1VB 1I1QB 3CNHA 1YUMA 3IPCA 5EIBC 1E2PA 4RIFA 4RJTA 3DQZA 3ASYA 2LIPA 5KVSA 4FZRA 2X2PA 5EZ6B 1NBAA 2V6GA 1CUYA 1S5PA 5CNMA 1M34E 2DULA 2PG3A 3C43A 3CLUC 2QAGC 3KOYA 3R3HA 4A0QA 1F9AA 4QQFA 5IWAB 4ZZ3A 2FX2A 3T4XA 2HA7A 2VJDA 1FRFS 1HYBA 1AKEA 1LBHA 4OFWA 3HCWA 1ZI8A 1IOLA 1D6NA 4HADA 2O6HA 3Q2IA 4ZEVA 3FPSA 2NUAB 1FMJA 5DCUA 1QF7A 4PPFA 1DC5A 1KIFA 5CB4B 2DE0X 1RRFA 1F8YA 1ZZEA 4FXPA 1MQAA 1BAPA 2O2GA 1V11A 1Z34A 5LOVA 3UV6A 1ULSA 2VA8A 3IUBA 1KY4A 4Z4GA 5FI5A 4GLLA 4DUPA 6AT1A 3W0LB 2UUOA 4Q1AA 1HRKA 3PEEA 2XVZA 1R8JA 1OUMA 3L7YA 3OTOB 1JHAA 2OO7A 4LRYA 3JQGA 4V02A 1F8GA 3CUYA 5EWLB 3AL2A 4WEQA 5HDBB 5CXSA 2ZOSA 3JYQA 2ZRBA 5JXIA 3WY9A 4RQTA 2PKXA 2Z5LA 3GJQA 1GNLA 3VH2A 3K09A 1E79A 4AU1A 4DW8A 3BUSA 3CLHA 1V7CA 1N4AA 4D0RA 3Q7QA 2V9CA 1M5TA 3RROA 4ZDIA 2NTYC 3KCQA 2LP4Y 2ZKIA 3ECSA 4XJVA 4GL2A 3CJTA 1M1NA 3IAAA 5AJZA 4AK9A 4WPGA 3T5AA 1SPXA 5AW6A 3FPAA 4U4AA 1KYXA 5HUQA 2D1FA 2NYAA 1ONSA 4HDRA 5FIUA 1Y8CA 1UEIA 3GH3A 3RU2A 4FEYA 2BM0A 4BLPA 2VUHB 5ALTA 1NJ2A 2YFYA 5HKAA 1V8OA 5L7WA 1XRLA 2PMDA 4G0YA 2KYRA 1C29B 3AP1A 3F46A 4J4BA 4QU8A 4YRGA 2QXUA 3SJUA 3GEBA 3RTBA 3FHCB 1RAIA 3GGPA 1G41A 3AVQA 4B2IA 1N2IA 5AI6A 5ALRA 3CLSD 2F3SA 2ZUCA 1HT0A 5IP5A 2DU8A 4DLTA 1J21A 1YIDA 5JH7B 4HAYA 4NE9A 1KZ7B 1QYXA 1EM6A 1SZPA 2H07A 2QLFA 5D1NA 4CL0A 4PICA 1XPOA 2C57A 1DFHA 1JPUA 2QRVB 2A1UA 3A9WA 3UJDA 3N2GA 3SHTA 4BE9A 3Q41A 5TGDA 1GZ5A 5H7XA 2X4DA 2H1HA 4NENA 3LPCA 4W5HA 3OA0A 4JI3B 4A0HA 4Z49A 3M2PA 4RD0A 2NO1A 3QPUA 1K27A 4JC5A 4Y8VA 4RA6B 1J49A 4DQ0A 2EL9A 2O2YA 3P32A 4KLAA 1RWWA 1WX1A 4BJ5A 4TQGA 3JX9A 1R8SA 3IAFA 4RD3A 4UKDA 3L6OO 1N4DA 4DE5A 4EYGA 3EIWA 1GPUA 2GYYA 3IQIX 3O83A 1IBLB 1E1QA 3GROA 1ZN2A 3G0HA 4I4NA 3KPYA 1AUOA 2OBYA 2WINI 2AFHA 4ITVA 3NHRA 3P9ZA 3V2GA 3EMBA 1S1MA 5DTQA 2F8TA 3OX4A 3PF8A 1B8PA 1CY1A 2VHUA 3FSRA 3R5TA 2Y9MB 1I13A 4N3CA 1V3VA 2RHGB 5BY2A 2JIZD 4TWJA 3B3GA 3ZNQA 1ZMRA 3CS3A 3MRVA 3KWMA 3SQMA 4NCHA 3WOHA 2P4QA 3A1FA 3HSSA 4WFQA 3B36A 3FWZA 4RZSA 1Q1BA 4BVLA 5ICFA 3UGTA 5DO9A 3ID6C 4YAGA 4X00A 3PVSA 1RKQA 3QLJA 1JF8A 1DUVG 4XYMA 3TPFA 4B40A 2XGMA 4C5BA 5CEEA 4I1PA 1Z33A 2AS0A 3IOMA 4X44A 4D74A 5JCOA 2GHIA 3FKSD 1T6YA 2I99A 4LJLA 4EO9A 5KYUB 2G40A 2VDRB 1R4AA 2PMBA 3BWEA 4TV8B 3R5JA 4Z3OA 3AGPA 4CMBA 1UAAA 1IEQA 2E2WA 2AOTA 3A4VA 2OECA 5JVDA 2Q1YA 5AKYA 2O2HA 4LZLA 3HKDB 4FCCA 4Z7NB 2AN5A 3PQDA 1IMOA 2HUNA 2X8JA 4TKUB 1JSLA 4E6PA 2ZDQA 3AKEA 3K3PA 1P9RA 2GKGA 2WUEA 1VGQA 5EZYA 4JP8A 4QUIA 1C0EA 1A2BA 2RAFA 2D59A 2CF6A 3AHGA 4M1OA 4XYEA 5JAQA 3WL5A 3EFHA 5REQA 4CZ2A 1DDOA 2EAUA 2XUPA 1ZOPA 4G5HA 4MW9A 5L45A 4W9RA 5DEIA 1GPDG 3FE2A 3KPVA 5CYOA 3WS7A 4C1NA 5JCZA 4C7XA 3TD2A 1FTSA 2QENA 3ND8A 3TUIC 1JHDA 5JISA 2BGKA 1GLGA 1PD1A 1JEQB 2N1MA 1W6UA 1Z4IA 4M22A 2YVKA 4JLDA 3SZRA 1SWVA 5C1OA 5EIXA 1Q7RA 1SA0A 4ZMBA 1P7WA 2BF4A 5DGDA 1KFKB 1MOZA 4O4LB 4A9AA 2ODNA 3CRRA 2OD7A 3E9NA 4UUPA 4PYMA 4F3RA 1EUYA 5EOVA 2NN3C 4L9SA 2FMTA 1WL8A 1E2DA 3V7NA 3ROZA 2HT1A 5DULA 1FFXA 4J3FA 5IWCA 3HXOA 1YKFA 1X1TA 4QXQA 4Z9AA 2JVIA 5HM8A 4IHJA 3E48A 2A30A 2VN8A 2O0HA 4KJZA 3BJZA 3KSBC 4TN1A 2GN8A 3RV3A 5LQJA 4PLZA 1I33A 2QSZA 3A6HA 2QE6A 2IXEA 2O4CA 1NXTA 3P2EA 4FNGA 3TBFA 2JLSA 4ZXFA 3MG9A 3B48A 1U8EA 4RD2A 3D6HA 3O7WA 3MWGA 3SR4A 4FMCF 3P0EA 3R75A 3GJ3A 1MEEA 1ZBQA 3D8RA 3DFIA 3F6CA 1UDXA 4PZUA 5KHOC 2EZTA 3A3OA 5IH3A 1Y4UA 2JAQA 3CB2A 3ZZ0A 1ZESA 4J75A 4RWZA 2R6GA 3GH1A 1ISMA 3GLGB 4FUQA 1XQXA 3P94A 2YHAA 3F8WA 4R2IA 1C2TA 3CINA 3K92A 3RVRA 2NO7A 3WBJA 1Z35A 3OPMA 4FQ5A 1B41A 3CKMA 1A8SA 4D41A 3OCZA 1PN3A 4RFLA 3NTXA 4R31A 1P75A 3QH4A 3HB9A 1RAFA 3H5VA 1TW3A 3Q5DA 3V8PA 4PGMA 4BU1A 1JPJA 3WV4A 4P0PB 3UZUA 4O4IA 5JI3E 1VSBA 4L78A 2NXJA 1EA7A 1URPA 1V11B 4OHMA 3WLOA 1OI7A 2Q62A 3VZQA 1LI5A 1GUZA 1TKBA 2IODA 4DTIA 4KITB 4C6RA 4BYMA 3IILA 4IUBS 2X7JA 2WZCA 4QPZA 5TLSA 3KZMA 3GUZA 3KTFA 3N2LA 4LOLA 1K2WA 1WCIB 3QTBA 5FLXA 2UDPA 4KQEA 3KB2A 1O95A 2VG8A 5HK9A 1GLVA 5EKSA 1KKMA 3IP6A 2QE7A 1TZBA 1W47A 1KTIA 2CXOA 4QHSA 1O7JA 4DUZB 2I91A 1IM2A 3HPQA 4BO3A 1W4AA 4YP9A 2GM9A 4UARA 1P62B 3MOIA 5IT9A 3VUEA 3KQMA 4F21A 1CLEA 2J6IA 1WAMA 4N49A 3TTUA 4DA6A 4NYJR 4R2JA 5B6IA 4CVNA 4UOEA 3PIDA 2DFPA 3GU3A 1WXEA 3H84A 4FBMA 4QDUA 4R0VA 3DZ8A 3FXAA 5BSHA 4MP6A 2GTIA 5KDOA 3P26A 4G26A 1DC7A 4UU0A 4JMPA 3A9VA 1LD3A 2NV0A 4MRVA 4NARA 1WXDA 4PR0A 2D3WA 4P4SA 3GWZA 4WA8A 3WYNA 3H2IA 3G5TA 1BN6A 2FJPA 1Z4KA 2YNMC 2CLMB 2KSQA 2QVZX 3AKDA 4EGQA 1E4EB 3OZ7A 1QORA 4EG6A 1YRWA 3AF5A 2Q4BA 4XWOA 1M7HA 2JH9A 2PUEA 3FMGA 1EFPA 3PGJA 1I4EB 1QHHA 3FW1A 1J20A 1TUBB 3MT9A 3BHMA 4MV5A 3TVYA 4GRAA 4TVSA 4ZYWA 1RQ7A 2QLJA 3HQ4O 1FBTA 4YJKA 3SHVA 2IYAA 4M1TA 4YMWA 3HBNA 1A5ZA 1QYVA 3AJ8A 2W6IA 1S2IA 1XLWA 2WD8A 4CBVA 1N2CE 2GN2A 1VCOA 2J45A 1QZ3A 2D1QA 4XM0A 2VP5A 3LPNA 3RRXA 1SZJG 4PSDA 1LS1A 3FHOA 3CO0S 3FCUB 2X1MA 3JD2A 4EJMA 1L5HB 4D4IA 4OUDB 2PUHA 2HU2A 1W88B 4MGIR 3WLKX 4TXHA 4NJMB 2ZT7A 2Z0MA 4REQA 4WL0A 3A32A 2AOVA 2XCIA 3UVEA 1IFXA 1VYHA 4JU9A 3KSMA 4ZAGA 4LZNA 3HVIA 2PKYX 3C3KA 3DZIA 2PDAA 3QX9A 1A9YA 2BPOA 5ELXA 4NQZA 1PG2A 2GUGA 3H1AA 1EDOA 3EMDA 4RXUA 4L8VA 3WYAA 4K9DA 1TM4E 1WV1A 2FMKA 4KMRA 4AKTA 3BOSA 4AL4A 5JAPA 5K20A 2BTEA 2IVZA 2NG1A 1ZISA 3UV7A 2R1TA 3QUTA 3NKVA 3LSYA 4JVNA 1CIJA 3TZ6A 4YDRA 3VR3D 2GA9A 3IOYA 4HWRA 3RBZA 3RC7A 5IFLA 1XJ5A 2CXXA 1DUIA 3HYLA 4EUEA 4XLZA 4LNHA 5KYNA 1OH7A 2HUPA 1UXKA 1NLZA 1CUVA 3EFOB 3GXBA 1XZFA 3GAMA 3L7NA 5REQB 1EPUA 1Y9ZA 5KTMA 5CYFA 2E0IA 1PK9A 2QDKA 4FKBA 2Y8EA 2XRMA 3H05A 3P96A 4PO8A 1NDUA 3EGDB 3GDFA 3UB4A 3U80A 4BFSA 4RHYA 4ROTA 1XWWA 4B4OA 5IS2A 1E7YA 3RJ9A 2HRDA 3RSQA 2F2TA 2DFKB 3TQRA 1XFAA 3R9IA 2BD0A 1V0JA 3GDWA 3P9PA 3K8QA 2BKAA 2IUTA 4KE6A 2EKDA 1DAFA 4W6QA 1T5LA 4LZWA 5FOWA 3TVDA 1N0WA 4NFLA 4UVEA 1ZGGA 3KKNA 4XJSA 3KVNA 1Y9EA 2W11A 4FOTA 1L6IA 5ESDA 2MSEB 5FKJA 3S5JA 3AUUA 3JW8A 1VJGA 2FLWA 5JBQA 1S3IA 1T8TA 1SU4A 3FMIA 4LKRA 2IZ1A 5ANRB 2D62A 3HP7A 1ADGA 2GKOA 4FLEA 3EUFA 4FHDA 4D9KA 4EF6A 2P2SA 3ZK9A 2WJGA 3QJYA 4EW1A 4UTVA 2YV2A 2ANCA 1F9EA 1Z38A 3FCOA 3FOAA 1QAQA 1LX6A 3A58B 1WZEA 3AVVA 3CSUA 4XCVA 1YRBA 3KU1A 4XDZA 1CT9A 1N3IA 3QKUA 3BRSA 1QVWA 1YBAA 1Z5ZA 3BE5A 1G5HA 2J5QA 3PGKA 5I7HA 1VXRA 5DI3B 1YMUA 1C1XB 2JFYA 3QK7A 1WSDA 1NT4A 4JELA 3WL3A 3CWCA 4I5FA 3CX4A 4TV8A 2B34A 3K4HA 4LYAA 4O3FA 1CW2B 1FFHA 1NONA 1AXEA 2OLKA 5CNIA 5TS2A 2Y4OA 3V42A 1J0XO 1M5UA 3C7AA 3OLXA 1X7DA 1GUFA 2B69A 1DP4A 2GT1A 2Q99A 3HGMA 3MZ0A 1H1LB 2FFAA 4G4JA 3AV3A 4N5NA 1WHSA 4P3KA 3ROQA 3UAZA 1E2FA 3A1WA 3G2QA 3T5MA 3WHIA 2J8ZA 2WZDA 1NVDA 1YHZA 1D4ZA 4XIFA 2FPGB 1DQSA 3HJHA 1ZRHA 2G88A 4W82A 4J0FA 4LTMA 1WEKA 2FH5B 1X77A 2WP8J 3MT8A 3F9IA 3FZGA 4UPVA 1TPYA 4CCWA 4R05A 4RCZA 1NN3A 5FOTA 3R0VA 5JJKA 2ZJ3A 4X91A 2Q5CA 4Z99A 3F4KA 3X43A 1CUCA 2CLHB 2Z1NA 3VZRA 2VKQA 2XNKA 2RHHA 2QM3A 4NBTA 1EFUA 4ZOAA 1RQXA 1YCGA 2R8BA 1M54A 2ERXA 2GAAA 4YP7A 4ZCSA 3BA1A 2RHTA 1QK3A 2H1RA 4FSDA 1IL0A 1IDOA 5FXMA 5JD6A 1FJHA 5BSVA 3AM4A 3KYCB 2VIIA 4HTFA 4E33A 2PH7A 3OQMA 2ZVPX 3FOCA 3B5EA 3QLVA 3FGZA 3H8SA 4FNOA 5D84A 1M6NA 3X0DA 1F5NA 4EZEA 4FFSA 3SQWA 5JXJA 2R5NA 4UNNA 3TZEA 4XARA 5ABPA 2DHQA 3DWIA 1I0IA 3OZRA 1IRXA 1OC4A 2C0CA 3GJ0A 5F7ZA 2AVDA 5FBVB 1TF2A 4BIIA 1X1RA 1UJCA 5IM5A 3T7KA 1Y0BA 4YACA 3TTWA 4OU5A 1K8QA 4FK8A 4KQXA 5EKUA 3EGWA 3ADOA 4GDFA 2JAUA 4OAPA 1UDRA 1JN0A 1N5OX 2DR2A 1TJ5A 3GPCA 3CPSA 3ZU3A 4DMHA 4ARZA 1JH9A 4CHGA 3R76A 4LW8A 3MS4A 1GPWB 1JQ5A 5JCXA 3E0QA 1TUGA 3UG7A 1PUJA 4ALKA 2W90A 4NZYA 3TLJA 5F76A 4CG2A 4DUGA 1U2ZA 2IHJA 2E4WA 3TUJC 2UZIR 3OESA 4AJ9A 4DCVA 1VE3A 2Q0XA 1JJIA 2XKBA 3OZEA 4AY2A 2WFAA 3LF1A 3KDAA 2Q3CA 1IATA 2P1RA 1X86B 1UQUA 1ZRNA 3H8WA 2DBYA 3DTVB 4DWOA 3BXZA 4XGIA 4ABYA 2GZ3A 5JWOA 4BGEA 4TLLB 5M3BA 1KDRA 1N77A 3PHJA 4HXFB 2FN7A 2P9EA 3S1LA 1DQRA 2Q3DA 1OGJA 5I45A 2RCNA 2NTEA 1FDUA 2QUKA 4N8SA 2HIHA 1QP8A 2O50A 2JLZA 4X20B 2YCLA 1W35A 5ALLA 3VR1A 1T36B 4QULA 2CSUA 2EYUA 3FFXA 3IHLA 4IRXA 4BKOA 3JWGA 4H15A 3EB9A 1Y1PA 3OEWA 4HY3A 5BWNA 1AMNA 5JMWA 2C4VA 4X93A 5K6RA 1C41A 3SCZA 4YT4A 4JI5B 4B8YA 3DMDA 1XMJA 2M98A 4OI4A 5FNZA 1U6JA 3UK1A 2HRCA 2FA9A 1T4GA 1C7ZA 1Y9JA 1H0KA 1T1SA 1N2SA 2OA0A 2IPXA 2VXCA 1YDHA 4HSGA 4EA7A 1GTZA 1Z6QA 3A6LA 5KHLB 5KYKA 1EFVB 1VIVA 4RTOA 1AE1A 4G2TA 4ZV7A 2FN3A 1JDPA 4RVSA 5A4MS 7ABPA 4JH0A 1PJ8A 4NULA 4YALA 5AKKA 4XSVA 1U7TA 3H4MA 4HDSA 4WJKB 4ZO8A 1SMKA 4J2TA 5EZQA 2HHHB 1G2QA 2RIPA 3EJWA 1XJ0A 5FTJA 2PXXA 2YCBA 5G53C 5GPBA 3JQ9A 1E6UA 4YV7A 4KR7A 2PZAA 4ZQEA 2D7JA 3H5TA 1XVUA 4X90A 2LPMA 3H3FA 3STUA 3V4PB 2Z58A 3IUJA 4WUTA 3EW9A 1WXXA 1C1DA 2DG2A 3QWBA 1Z0UA 1G64A 2Q9BA 4OB6A 3M6AA 4QVIA 1W76A 1PFGA 2FDCA 4MWOA 2WF5A 2PZFA 1TEVA 3RRNA 2GRAA 2IIPA 2K5UA 2Y1GA 3LLSA 1UJ5A 1BKYA 2FPRA 3FVWA 3DBIA 4UUQA 3NTLA 5TXGA 3U62A 2RAVA 3SNHA 4F0JA 2NP7A 1KQ3A 5CMLA 3TFQA 2C84A 4LF5B 1U0OC 1CUZA 2VH1A 1V1MA 2VP3A 4ZVLA 5KNCH 5JQGA 5KOIA 1VHQA 3ZGYA 3E18A 1G3IA 3JQGB 3QEJA 1UC8A 1IUOA 2PU5A 5FFMA 1JG7A 1ZUIA 3W9SA 1P2TA 3FVVA 2I54A 3CEPB 4EY5A 2EBHX 1KMMA 4JITA 1Y3HA 1RBMA 1LJ8A 4RHEA 4X8OA 5BWBA 1ZVVA 4HZUA 1T4MA 4IV8A 4KYUA 3TNDA 2WD7A 2ACEA 2XEDA 2ZUDA 4LF7B 3JQQA 1WBJB 2QTWB 4QT0A 1IN4A 1QXSA 3IIJA 4UU7A 4XR4A 2Z4SA 1R8QA 4FN5A 4J7XA 1H8EA 1XP5A 3IALA 4U02A 3SSAA 1O58A 1PG5A 4CKZA 1KO4A 5G41A 4PX5A 4R9SA 4YUZA 3TOZA 2WM3A 1IN7A 3GGDA 1T1EA 3G88A 4ILKA 2J5XA 1RYDA 3BK7A 5G3ZA 1F1BA 4TUYF 3SLGA 3P71T 2J9FA 2XMCA 2ADFA 2C3PA 2PEYA 1GQYA 1OI2A 2ZRNA 3CIOA 3QKIA 4K9LA 2Y92A 4LMBA 3HYCA 4GE3A 4ITRC 4L4YA 3U6BA 4BV2A 2JB9A 5HFJA 5HE9A 5J2UB 3ZE2B 4ENRA 3F4LA 3L6RA 1N92A 1TKAA 4NICA 4YCBA 3DWEX 3QBJA 3E05A 4AMVA 2B2CA 2B2XA 3RRMA 4UFNA 2I7VA 3JQDA 3OZSA 4QJ4A 3NHSA 1ZIYA 2JJ2A 4K9SA 1C0IA 3UMJA 2H8KA 2GM5A 1VZ2A 2W2MA 1XU7A 2DGDA 4YAOA 4WADA 3I5UA 2OHXA 4IEEA 1NVWQ 4BJ6A 3ZH2A 2H85A 4ZQIA 3KQUA 1VBNA 3K70D 4BL5A 3VPSA 1XALA 4BV8A 4LJRA 3C5WP 3HMKA 4NFHA 3CVVA 3INGA 1WUYA 1FRZA 5T4FA 1LZKA 4EJSC 4JGIA 3RR2A 4GPIB 2WYWA 3RS0A 3UT0A 5AUOB 2B4YA 2Y2UA 5J47A 5DFAA 1R0CA 5FR1A 5DHQA 3W77A 4O2LA 4XQ9A 1ZR4A 3Q87B 2B1IA 2M1XA 1N25A 4PWYA 5DH9A 5EQTA 2HI0A 3NXSA 3IDSA 2WNHA 3F6RA 3S55A 3ZWBA 1UBMS 2G1JA 2I71A 3QFSA 4GQIA 1LA2A 4OSEA 1P0FA 2D5AA 3ET5A 2PKRA 1KVTA 1HNXB 2JGAA 2ZVJA 4OLHA 3WC4A 1KQNA 5CBPB 1Q77A 1W34A 3P9XA 1ZGBA 5IK2D 3QUBA 5LZ4A 5E3HA 3H1EA 1Q5PA 3GP8A 2P91A 1NDQA 3HADA 1TA9A 1R8YA 1XSEA 3CWQA 5DHAA 4BQFA 1FZTA 2EWWA 5C51B 1Z5GA 3HA5A 2HTEA 3G8DA 4RM2A 2P3OA 1UWVA 1JHXA 2J7PA 1NURA 3V8QA 4LQDA 3W8FA 1KGDA 1ZH8A 2ES4A 4FS3A 1D6MA 3VKHA 2VTKA 4IS3A 3CMCO 2AG6A 4MA0A 2PX5A 4X7PA 5CU7A 2G08A 1FTGA 2IQIA 2Y6UA 3M70A 3PXDA 4R1OA 3JAWB 3RWOA 4EVSA 5JDCA 3WSVA 3W04A 3OURA 4B43A 4ZK6A 2ZUBA 5E38A 2YXEA 1PZEA 1KJWA 3C5CA 1Z6ZA 4X1IA 2OQVA 2QP3A 2P2CA 1UT6A 2WTXA 2OGUA 1PE0A 1E2LA 1XA3A 2FLVA 4Z3KA 1KI8A 4YXWD 3T9FA 4HZGA 1YA6A 4DR4B 2C1XA 2GVDC 4CF4A 2WWGA 4ZVSA 5K3FA 5LCXA 5BORA 5AW0A 1EJBA 1F2VA 1K98A 4AJ1A 5IABA 5E3IA 2WSLA 3PQ3A 4BO5A 4LCJA 3GAZA 3SC2B 3LECA 4JLNA 1CYDA 2WJVA 2X2FA 3ADDA 3IR6A 3BDAA 3DKIA 4FD3A 2VP2A 3I4FA 3IJRA 3PITA 4US1R 3LXRA 3RAFC 1OMOA 4LNAA 2P75A 4LWQA 2AYZA 3P2KA 3L8GA 5CDTA 3IE2A 3FJYA 5B4VA 4OUKX 3PVCA 4HRXA 3RS5A 3WR5A 5LDHA 3D3JA 2GSDA 2EP5A 3EAQA 3H86A 5IVKA 1P0QA 3OZAA 2GDZA 3SEZA 1HE1C 3WIOA 2Y0BA 4QDXA 3OPNA 4EB6A 5CFRA 2BW0A 4GVXA 2PT9A 3KYIB 3A2NA 1Z2EA 4PGHA 2OCIA 2HR1A 2PRKA 1DRVA 1ORHA 2JGEA 5GONA 2Z5GA 3QXCA 1NVKA 2J46A 4JUFA 4O4LA 2FCRA 3AFOA 3SS7X 1QQ6A 4EY7A 4IJWA 4H6PA 1C14A 3MTDA 4ESHA 1X19A 3OCYA 3QOWA 3FPFA 4BVBA 4TZKA 4JP1A 4D9GA 5CK5A 3MAJA 5MGNA 5K2OA 2V0NA 3GN1A 2I66A 3QA9A 1F14A 4TQ9A 1X14A 2M32A 3BAZA 4LHYA 4RY8A 3UH0A 3N8HA 3HB0A 1V16A 2NZJA 4PM4A 5CIYA 5I9LA 4K9MA 1LFDB 2BIFA 4I81A 2VQEB 4EL5A 3ABSB 2I33A 4PZCA 1EX9A 1NIJA 3CCFA 4R5HA 2OAP1 2F48A 4NS1A 4PQRA 1JHQA 5JANA 5AKXA 1D4OA 1IZ7A 2E48A 3CW9A 3FB1A 3HKEB 3FFBA 3JRWA 3FCXA 3LHSA 4WK4B 5L51A 4HKTA 5DZSA 4LQLA 5IG2A 1P6QA 5JQGB 1VJTA 3BDIA 4W5QA 2XUOA 3FDZB 1OIXA 5KQRA 1B93A 4KJXA 1AJEA 3CVXA 5KWJA 4FGZA 1KTVA 1X7ZA 3PHBE 1KEZA 3QVGB 4HAUA 5ARDA 2PUGA 4ZVUA 1UINA 2YN0A 1C9MA 3K9NA 4V0MA 1C7IA 3B82A 6GPBA 2MMGA 2W6MA 3FPHA 4BPBA 3MIIA 2XTJA 2DX7A 1EIZA 5AVZA 1TJ4A 4G8DA 3T7IA 3S29A 1D4FA 1N0UA 1BMTA 4X65B 3OY2A 4ZQCB 3OE7D 3DKRA 1EYZA 2OBMA 5HQ3A 3THYA 1NN0A 4INOA 2X6QA 3TM4A 1JDSA 1JVBA 1KYWA 1L5WA 4GOND 3OEED 4M0UA 3QLEA 4YROA 1JTVA 2AFRA 2V6FA 5IANA 3Q5GA 1KP9A 3O1IC 3MTAA 3OCWA 5AK4A 4CMAA 4XB2A 2I6FA 3L0OA 3FOZA 1XDWA 3EGXB 5C52B 3I6YA 2ORWA 4G5QA 2BOVA 2GEVA 4KN5A 2H6EA 4ZALA 3EH1A 1R9NA 4DILA 4MVXA 4HMOA 4NZZA 1P60A 1ZRSA 2HMVA 2PSDA 4MW0A 3WGHA 5KC8A 3DBHA 1E3MA 3FWHA 3NHMA 2BCGY 1IPEA 2Q8PA 3PZBA 3ZZNA 2CUKA 3NBZC 2PNJA 2O57A 3W4IA 4DHEA 4W5RA 1MB9A 2QLNA 4RA6A 2IV2X 3HKCB 4AMGA 3GR6A 4HOYA 4J4TA 3MSXA 3Q8MA 1W49A 3B7PA 2I5PO 3C3BA 4FFMA 5JAZA 3R7BA 2OK7A 1R88A 1J5EB 1FJ2A 3JYNA 3N8NA 1NM5C 3IV9A 4R0NA 4YRFA 4ZVVA 4U7DA 1D3AA 4MYCA 3FY4A 4YI3A 4FM9A 2WPNA 4NK4A 1T10A 4CQMA 1ESZA 1LXCA 4D4GA 3FDZA 3WWEA 1Q1EA 2IIQA 4FHZA 4KNWA 1RJDA 1EB8A 5FUYA 1HG0A 2PE5A 4G0OA 3CLTD 1NIPA 2BMAA 4MI3A 2V7QD 3MJFA 5KNDH 4IIJA 4DUGD 3TOSA 3KTDA 4PGAA 4BQOA 1SM4A 2Z95A 4BNIA 3AINA 1HEUA 1QFZA 3N76A 3E2PA 1EVYA 2I1LA 3R6TA 1JFRA 2NZ2A 1UKZA 2XMZA 3AUTA 1RI2A 3AVOA 5LQAA 4TPKA 1XK6A 3KQYA 4RJKA 4AN0A 5GIPE 1TMGE 3ETCA 3G59A 1HNNA 1CDEA 3MTIA 2RG7A 5EJ2A 4B3GA 1ZOLA 3GLHA 2SCUA 3FMFA 1NF3A 3WJ1A 3WGGA 4OHFA 1OOEA 3DDZX 1JKIA 4FKZA 1WE2A 1P2FA 2WPDA 2BGGA 2XB2A 2V7PA 1Q7TA 1KF0A 1AKWA 3W8EA 3WZLA 1KHHA 4IV5A 3QYJA 1J8MF 4QIHA 1RXYA 3KFXA 2XYQA 4NE7A 3CT4A 3LCVB 3Q3VA 4KO3S 4LBZA 1V8PA 2VDWA 5BSWA 4GOLD 4I6GA 1IRIA 4RJ2A 5A03A 1GTJ1 4NBWA 3HKCA 4MVJA 2QI9C 4NESA 4F1KA 4M49A 1O0CA 2O8EB 3SVZA 2PUBA 2VT2A 2XVAA 3C4JA 4K8OA 5JNSA 1P73A 3UHPA 5BV2P 5C7YA 2OMKA 2ONZA 4LXTA 2WM9B 4CETA 4CLHA 1TF7A 2QI9F 1ZNWA 2P4SA 4A82A 2X3FA 5E95A 4BVFA 4AW9A 4LV5B 1H2WA 4UFOA 3CA8A 5D7NA 1ULZA 4IICA 5G0TA 3V6MA 4AIIA 3MXOA 2FLKA 3U49A 1NBMD 5FUQA 2YIMA 4EKYA 2L2QA 4YXWA 5EFOA 3NIDB 4YQFA 1OWMA 3SLRA 4H7IA 1N6OA 5GZ3A 4N8DA 3NAQA 4LNUB 2FK7A 4MVCA 1JDTA 1B8NA 2O07A 1R50A 4NMMA 2PQMA 3CLKA 4GMXA 2GCNA 4HAWA 2OCPA 2R8PA 3AILA 4M46A 4XUEA 1AB6A 1Z17A 2CLSA 2EZ8A 2CV0A 1B23P 2IS1A 1NLYA 3B3AA 3ST7A 4BJHB 4GSKA 2VWGA 1K7EB 4DKXA 5M29A 1TYDE 3ROGA 5EJGA 3S1AA 2HSDA 4TMZA 2WHYA 4F6RA 3HEBA 2H7VA 3IXLA 4FINA 1CFJA 1GQFA 2DQKA 2YC4C 4UDYX 3VZSA 2DLCX 2B8WA 4YY3B 3DZCA 2B5VA 1SUWA 4KH1A 3EQZA 3OPYI 1F8UA 5J1TB 4G8BA 1WZCA 3D9QX 1NOJA 5FTKA 2PJRA 1T25A 4H7HA 4IDQA 4QYIB 5EJAA 3ZHCA 5CFOA 2G04A 5FYQA 1T5OA 3ZGNA 1NE7A 2HV9A 3IUNA 3NO4A 3OQIA 2PJZA 4RLHA 3VAZA 4OHPA 5M5BA 1U0LA 3ADPA 4F2WA 5CG1A 4LBWA 3MCWA 3PKJA 1A82A 1H2RS 5ITZB 1B0ZA 4D25A 4YJ2F 1TADA 1R9GA 2ZPTX 5L3VA 4EAQA 1HLFA 1RI4A 2OFPA 3ND9A 4TQAA 2BFOA 4MV3A 4TSRA 4O4HF 3CYFA 4ZT4A 3UBMA 3Q3IA 4LBYA 4AS1A 1THTA 2QAGA 1ZIXA 4C29A 1UXGA 4FS8A 2F6RA 3DQQA 4RZIA 3Q40A 2O2JA 2W71A 2IC5A 3O8BA 4RELA 1CV2A 3P0HA 3IUQA 4MAMA 1PVOA 4C07A 1XVIA 3D3EA 1ZK1A 4BO2A 3RJMA 2OE2A 4RK6A 2DBRA 2I55A 5D1HA 5AM2A