3LTNC

Inhibitor-stabilized topoisomerase iv-dna cleavage complex (s. pneumoniae)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
226
structure length
222
Chain Sequence
KLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTAKAKMADILKNEEINTMIYTIGAGVDFSIEANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIALPPLYKMSKKGKKEEVAYAWTDGELEELRKQFGKGATLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDNVKFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Isomerase/dna
molecule keywords DNA topoisomerase 4 subunit A
publication title Structural Basis of Gate-DNA Breakage and Resealing by Type II Topoisomerases
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 54
structure length 222
sequence length 226
chains with identical sequence D
ec nomenclature ec 5.99.1.-:
pdb deposition date 2010-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus
C PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.670 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ltnC00
1BGWA 2XCTB 2XCSB 3KSBC 2XCOA 3LTNC 3RAEC 2XKJE 4Z3OA 4KPFC 3FOFC 4J3NA 4KPEC 4G0VA 4KOEC 3RAFC 2RGRA 4FM9A 4Z4QA 3FOEC 4G0UA 3K9FC 3QX3A 2XKKA 4Z53A 1BJTA 2XCQA 2XCRB 5EIXA 4I3HA 3KSAC 3L4JA 3RADC 4G0WA 3L4KA
chains in the Genus database with same CATH superfamily
3AV3A 4WH0A 1GXSB 4MR9B 3TBHA 5LWHA 1UK9A 2VH2A 5GOTA 5JU6A 5IEJA 4AQ7A 1WXFA 3OPMA 1AC5A 4OAQA 2WLTA 3NFRA 5FR1A 4A8PA 1KFKB 3AEZA 3KVVA 4UTPA 1E1RA 3OAAD 2DHQA 3QM1A 1SXHA 5LMNB 5DT9A 4ZU3A 1YMVA 5DH9A 1G19A 3E23A 4LOIA 3WIEA 3UAGA 3U17A 4BASA 4BFCA 4HV4A 4IRUB 4RIEA 1ZXXA 2QM8A 4QOHA 4JHLA 2C9OA 4TWZA 3TIIA 4DCVA 4QEDA 2I8AA 5U9CA 2P1DA 2I33A 3PXEA 4EPWA 2D59A 1H0KA 1WF3A 2H0AA 4O29A 4ZAGA 2P6UA 4YP6A 1NXXA 1T9DA 4ZU6X 2CCGA 3CSSA 3CZ5A 5GIOE 1J8FA 1HDOA 1HL7A 3I28A 2AMYA 3ZLVA 5LWQA 3RUAA 2W2LD 2B8NA 3PIDA 3IO3A 1FSFA 1L7OA 2O8FB 3RRNA 4LBWA 1E3IA 2NPFA 1I51A 4PFKA 4LYFA 1TTPB 2PWPA 1M1YB 4KN5A 3UHPA 3IVAA 4KPEC 1D0VA 4BV8A 3F1KA 1V1MB 5C1OA 3EZ2A 4DDUA 3S44A 4X8HA 1P9NA 2DUUA 2IHZA 2YDXA 3GUVA 4AUEA 4QG7A 2AMJA 3GGPA 2CNDA 4MR7B 4HC4A 1B1CA 1E9BA 1NT4A 3N2LA 4IIYA 3EQ8A 3CTPA 2P7HA 1M2GA 1ZCJA 1BJTA 1EX1A 1M10A 1P72A 1E2IA 1G2QA 2HGZA 2XGSA 3H8JA 1MJGA 5DHPA 3GEEA 4L0DA 4B74A 4CVNA 1ITZA 1EJ0A 1RFGE 2OHIA 4DCUA 3DFFA 3E4CA 3JQAA 4XB6B 3C3BA 1O96A 3EBOA 3K0FA 4LYJA 2IA5A 1VHLA 5B58C 1CUJA 1DDIA 4P7JA 3QLVC 2C4HA 1GPYA 1BH2A 2ZCUA 5EHZA 1R9JA 1RDFA 4HLUC 1Z7EA 1P7VA 2RHTA 3KSMA 8GPBA 2P9HA 3C45A 1SUCA 1U11A 2OK7A 2WINI 4YMIA 2WSMA 1AV7A 3VFDA 2IXFA 2AGVA 4TWIA 2VTBB 1N1EA 3QVVA 3VDRA 4GX2A 4C7VA 3UT5B 1JSXA 1RWBA 2ZB3A 3E5HA 4K1LA 4O2AB 2ZI6A 3H1EA 3VSEA 2WIKA 4QHSA 1O0CA 1P0IA 2X0KA 4EARA 2HJRA 1CF9A 2XZLA 1Z5WA 1O94D 4PO1A 2RHGB 3NBUA 4PTYA 5CFMA 2DR2A 3BSYA 4DMKA 4LXYA 2JLVA 4ZCQA 1DXYA 1GHTA 4LJRA 1XU4A 1XI2A 2CLCX 5A5FA 3DAPA 2X4DA 3AC0A 2NU8B 1T2CA 3MHPA 3CNOA 4MARA 5CR9A 3V2UA 4EG7A 1FTQA 2J85A 1UXIA 3PYMA 4H17A 1D8TA 3BJIC 1XQYA 4LX0A 4DNXA 4UREA 1PIWA 3DB2A 5BOSB 4ARUA 1GTZA 4Y6GB 3L7IA 1BKDR 1JMYA 1H0HA 1B41A 1JQDA 1LNQA 2V54A 3OX3A 4LJ9A 1J8DA 1IONA 2BH2A 3ZK7A 3CUSA 3PC6A 3PQFA 3B6MA 2CFTA 4AJLA 1XZQA 5A4KA 2QRMA 1W1WA 2HM7A 3WRYA 5JCPA 3ANXA 5FTKA 5IDQA 4ABYA 3P9NA 5J43A 1GDTA 1P2BA 3ISTA 3I6BA 3MRSA 4A6PA 3PFKA 3DBIA 4IZIA 5IAAA 5CEJA 4J94A 5FT9A 4RF4A 1TM3E 4BU0A 2ZSFA 3PGA1 1MBZA 3FDZA 3AM1A 1LQ2A 1GA6A 1QGUB 2J3MA 4DR1B 3MPOA 2AVNA 4DMMA 5LP6A 5ELMA 1TA0A 2F1RA 1AXEA 3H2ZA 1GFIA 4CKYA 2BFEA 5I01A 4HNAA 3K2QA 1JQ3A 4BV9A 1HRKA 3JZMA 1WXWA 2OORC 4WUVA 1OB5A 3RVPA 1K8YB 1XXHB 1HT3A 1ZYUA 5DDIP 4I55F 5TDHA 2GBLA 2P35A 2QZSA 4A0RA 5JNWA 2OESA 4BQRA 4HX9A 1O2DA 3NC0C 2B82A 1JPJA 3LBAA 2VOEA 2GZDA 5CH8A 2ZJZA 4YJHA 3U31A 2GFQA 3VGPA 4BZQA 1A96A 2R8EA 5HM6A 4JX8A 4JBXA 2IYLD 2XHZA 2AN4A 2GWRA 4HS4A 2F1OA 2G9NA 3RSQA 2J9YB 2IUEA 3C3EA 4KLAA 3S0JA 1M72A 5E9JA 3OHSX 4IJQA 4OGFA 5B3AA 3ILXA 2YJGA 4HXEB 2DAPA 3EQ9A 4RKEA 2VH1A 4C30A 1DC3A 4Y2XA 2VHVA 2ZRFA 3V7UA 4V0RA 1AB5A 3NETA 4DLTA 2RI1A 5GONB 3TL2A 4OJYA 3RIMA 2I6SA 8ADHA 1R64A 3ESBA 1EDZA 4CMIB 1IY8A 3DMNA 1XAJA 5DGCA 1AZLA 3VUEA 1UJ2A 2B4AA 3HZZA 4M9CA 3ZLBA 4BQFA 1RHRA 5AOBA 4PC3A 3VZSA 2RHCA 5E38A 2I7VA 5TMEA 3TRFA 1TM1E 1MIOA 4D57A 5BSVA 1E2QA 2HSDA 2PRYA 3CGWA 3WL3A 1Q15A 5K20A 2CEAA 5EP4A 3LC0A 2QTAA 2DBRA 3KHSA 4A0SA 4XKJA 4UQLA 4BVLA 1X1QA 1KY2A 3D1LA 3V33A 3D3JA 3L43A 4O8ZA 5AM4A 3SR3A 3DLCA 1EM8B 1LWNA 1KJ9A 1P33A 2NACA 4K9NA 4AQYB 4EI8A 4E6EA 1NT2A 5HUJA 1DBWA 4F86A 2Z2XA 4FDVA 1TJ5A 4XQ9A 3X1JA 4WBXC 1PUXA 4FGZA 1XALA 1CD5A 2D0IA 3T3MB 1UEJA 3CLKA 5JHGB 5LQMA 1AHNA 1KHHA 4QDOA 4WY2A 3LLCA 2PXAA 1P0MA 1KI1A 4IG9A 1M0TA 1Z8NA 4C0AC 1F1BA 2V8BA 2XUJA 3O8QA 1TJ4A 3KR0A 4QO7A 3F1LA 4X60A 1VCOA 5GMOA 2P78A 4WRRA 5IT9A 1UZMA 4QXPA 1A77A 1IIBA 5T4EA 2QVYX 1T2UA 2YQZA 4FR0A 4HTFB 4PSCA 3ROPA 3CV3A 4F46A 1XUOA 1IDN1 2QR3A 1QHHA 2HV8A 4FGSA 3VZQA 2GZ1A 2YN2A 3H5AA 2GARA 4FOTA 3R6DA 1N4AA 2FAXA 3FVVA 2W37A 3OAAA 4XUCA 3X43A 2P91A 2Q50A 3BRCA 5KKAA 3GRUA 2BM0A 4HQLA 2NU6B 5ECYA 1QANA 3SYNA 4DC0A 1SVOA 1SZCA 5IMSA 1YQTA 2RGAA 3UTCA 5A7HA 4M8KA 2JGJA 4KKXB 3PA8A 3UCFA 4OFZA 4ZYTA 4L2IA 3FOWA 4FFSA 4KXQA 1WULS 1X7XB 1XJCA 1YMQA 3FI0A 3MWEB 5AJUA 3WA6A 1PYDA 4RV4A 4OEHA 5BNZA 2YVKA 5TMPA 5DW0A 1HZZC 1EVYA 2W2LA 2HQOA 3A6EA 1CQIA 1KJIA 1P60A 2O1EA 2QLFA 4R7ZA 5AW2A 1T2EA 3LXMA 3EVCA 3V34A 2RBGA 4KMOA 1ETUA 2ZYGA 1F06A 1HEYA 2N3ZA 3DOCA 3KE8A 3LLUA 4OK5A 3HDTA 1V6SA 3F2IA 5AI6A 2Q7DA 1BE0A 3TNJA 2J07A 1I32A 3EMKA 5LQSA 5B57C 2IDKA 2JCYA 1RXVA 2R6FA 3BFXA 2OGZA 1G2PA 1ULZA 4AZWA 4PCLA 5A71A 2QTNA 4ED9A 4F4FA 3EUEA 1MAWA 3IQGX 4RPKA 5BWLA 3ZBQA 4B32A 2HL6A 3OO1A 1H2EA 3LYLA 4GMHA 4AVYA 4EG3A 1N8KA 1VHTA 2IZZA 2A9QA 3QEAZ 3EARA 2QN8A 2AT1A 3M1IA 4IEIA 5EHGA 1JDPA 2RGBA 4Q4CA 2VDVE 2HJ9A 3A32A 4IUBS 4AK9A 2GBCA 2V8OA 3W0LB 1BD3A 4BNYA 4X61A 2R00C 2GZSA 2YWJA 2F2TA 1K08A 3KOXA 4Q4JB 1I5RA 1GNQA 3TQIA 1KZ9A 4KQJA 2E4XA 2QN2A 2WA2A 1S4QA 5KQSA 1I6MA 1PK7A 4CR8A 4PLCA 3EOBI 4Z0NA 2A0KA 4AYTA 2ZUBA 5EJGA 1I9CA 1SBCA 2CJFA 2JHAA 2WMNB 1P0PA 1GRCA 2V97A 3E3AA 4JC4A 3L8YA 4KWTA 1RHQA 1UDRA 2V1XA 5FFNA 4JXXA 3LL4A 4QUAA 4DEYA 4Z7QB 2J1LA 2B21A 3ZGLA 3MS4A 3OPYI 2N75A 4HGQA 5ICGA 4AYXA 3ETGA 4BRUA 1B3RA 1O94A 3HP7A 3ICOA 4YPFA 3QSYA 1NW3A 3K0CA 1QGAA 2P7IA 4HWRA 4TTRA 4QJ3A 2UUCB 3K6KA 4LF6B 2IPAB 2OV3A 3AHCA 3B2QA 4G26A 2GN1A 3K9FC 4X3CA 1IQRA 3QVUA 3NV9A 4LC1A 4RXMA 1H4TA 3RRMA 5LYYA 1SU8A 3REOA 2BISA 2YXPX 4MS3B 2X9VA 2YXNA 2X41A 1S2LA 1GOTA 2WSYB 4ZIRB 5C34B 3TW4A 1HT1E 1H2HA 1XRMA 4NAVA 4FHCA 3RF7A 2VWGA 5AW3A 1RI5A 1NR7A 1OXSC 5H82A 4DNQA 2Z2KA 2FEPA 2QHXA 3ZCPA 1NVAA 3IBYA 1T10A 2UYOA 1UC9A 4EGFA 2FNAA 3I04A 1YZGA 1MB3A 3DAFA 4W1PA 3L4BC 5H7XA 3H5TA 4CETA 1ZK3A 3W5BA 5EJ9A 4D9KA 2FWPA 1GL3A 3KV1A 5HCNA 2NVUB 1A82A 5J2UB 2AA3A 4QELA 3TEFA 3GFGA 4KXFB 4ND8B 4EPXA 4ZJPA 2PVCA 3OSUA 1V4BA 2X5OA 3L01A 2VXBA 4TKVA 5AVTA 1I2CA 1PNVA 1Z74A 2FSFA 4XQ0A 3ILSA 1KEPA 3X1ZA 2JFNA 4XAQA 2CSUA 3NP7A 2VNSA 2WE7A 3HKEA 5IM5A 5LP6C 4FE7A 3PHHA 2C83A 3SWWA 5EL0A 5F3DA 1AG9A 2IV3A 1UFVA 2FSSA 2J6CA 5TARA 1WMFA 3L05A 5E2IA 3NM4A 4CEHA 3GN2A 4FCTA 4E51A 4XFDA 2ZATA 1ZVJA 5JO9A 1EUCA 2OCXA 3D4LA 3EF3A 2X6QA 1I4WA 3P1JA 1B42A 1QIMA 2R6CA 3DAYA 5B3KA 4M0CA 3OIDA 1L5YA 2ZK7A 4OXIA 3TSAA 4C3ZA 1ZX1A 2OGSA 3V48A 4EJFA 5I7RA 3R4CA 1MV5A 2CXQA 3IEPA 1ZNQO 3QWIA 2YH2A 1P7ZA 1ENPA 1S8AA 3OMXA 4IIBA 1C7EA 3UJNA 1JR3E 4X00A 5A6SB 1L3CA 2Q5IA 3BL5A 4HT3B 1UPCA 2C0CA 1N8TA 3DKIA 1SZJG 3B6IA 4IH1A 3M6UA 4L75A 4EUEA 2AOWA 2FETA 4JLDA 3WAJA 4WEOA 4DV4B 5A9RA 8OHMA 1FFWA 2H2WA 2VDWB 4ML3A 4DM4A 2XWBF 3GH3A 1OPRA 3MCUA 4KR6A 1JXMA 1D03A 5HILA 4Q1AA 1ZMOA 4A8TA 3CH4B 2QV0A 5HRAA 2P1ZA 4GM1A 2IDJA 3DMRA 4L0MA 4NE9A 3EGDA 3V80A 5MFZA 5H68A 5E4TA 1AJEA 3KJNA 3LQKA 2HRRA 3DKKA 2G70A 4HDSA 4XVUA 3IAM1 2IU6A 4CIBA 4GWKA 4PNEA 4XQCA 4IMPA 3UOAB 2JJQA 4AO6A 4LHEA 2ZWIA 2OO7A 3B6ZA 5EP1A 2VYND 1E3WB 3B1WA 5HBRA 1XTQA 2PMEA 2GF9A 1C4XA 3PICA 6NULA 4J2TA 1R9MA 4ID3A 4YP9A 5C46F 2FPPA 4OGWA 1YUBA 3L6CA 2ZRJA 4Z2AA 1JG2A 4NBWA 5JJBA 1LVHA 1WKBA 4KPUB 4E94A 4PYKA 3RYFB 1TA9A 1ZITA 5CJPA 1NM5A 1RP7A 2HDNB 2QRHA 4JN6B 3BM5A 4KU4A 2QD5A 3V2HA 1W4CA 1B14A 1H2FA 2A5GA 2W2QA 4TLCA 5CHYA 3TFQA 1BYUA 1ONNA 2DTDA 1KORA 3PL5A 4G0QA 4M76B 4Q1VA 2H29A 4Q3CA 3N2KB 5LZ5A 4D1YA 4O4JA 1VKOA 5K3CA 4E5SA 2BWJA 1ZBDA 1ZD1A 3QA3E 5BRNA 2BZ1A 2HBQA 3OE7D 4X7RA 3SG0A 2ATCA 1A9ZA 3U3ZA 3OEYA 4F12A 3UK2A 1TQ4A 3CLSC 2P2LA 4XSVA 4B6PA 3FKSD 5LB4A 5E0KB 1X8KA 1UZUA 3Q5DA 1IXKA 1I0ZA 5CPBA 3TDMA 4DLPA 4MPPA 4YRAA 1NA5A 4G01B 1E9EA 4CQNA 1AGRA 2WJWA 3EUFA 1VPDA 4TSKA 3ETCA 1GZDA 2HEGA 1GGEA 1P4RA 2BJHA 1LV7A 4WXPA 2DX7A 1DWOA 4MGEA 3NYRA 2OHHA 4DANA 1AKTA 1Z38A 3JYOA 3NYQA 1BVYF 4MV1A 4X1YA 5KDDA 3KOYA 2IJGX 1G55A 2G9ZA 2DECA 1N2OA 4QHYA 5GV7A 1CHNA 1Y9JA 2R6R1 3Q9UA 4G07A 4TWRA 1BZYA 1NP3A 3LC2O 2VXYA 2Y0EA 4N8EA 4TV8F 5EC8A 5H3LA 3H42B 4A2WA 1PJRA 3D02A 2X42A 3KXPA 3KZOA 4IDAA 5DK6A 2WJVA 3H8SA 3OTHA 4NCAA 1EFCA 3KZXA 4NEHB 2JLUA 3KTDA 2CMHA 1QTQA 1F8XA 2RKBA 3QRWA 3BT7A 4RH1A 4E21A 4EFMA 2ZBUA 2IYWA 4KN9S 4N0EA 1IE3A 3AESA 1G5HA 1KK1A 4KOAA 1Z7WA 2GCGA 1NJ5A 2GPSA 4G0ZA 4EA8A 1CQJA 2EJTA 1TK9A 4Z9FA 2C7OA 4WV3A 1SJ9A 3PQ4A 5CNMA 3ER8A 1XD2B 3OJWA 3TH5A 4YJFB 1NZJA 1VYTA 3FRIA 5FO0A 1GPAA 4LHZA 5BOVA 3N0VA 3P9PA 3MJSA 1UFQA 1NMQA 3EMDA 4BKRA 3S2IA 4ZO7A 4JJAA 4C0KA 4DBLE 1NI4A 3D64A 4Q3EA 2CJWB 4NNJA 4AS2A 3GOQA 2C77A 1X8JA 1PR6A 1UPTA 1TMOA 2AC2A 3JVEA 4US0R 1JBQA 4KXVA 3QG1A 4BO0A 3S81A 3OX1A 1OIWA 3H18A 4CL8A 4H7KA 1LX7A 2INGX 3FNHA 3IP3A 3WLRA 3NAZA 4AY3A 2VH5R 3OZIA 2BZ0A 5TB5A 2GJAA 2I6QA 1M2HA 2OVFA 4LXTA 2X0NA 3MWKA 4MQ5A 4F3RA 1XJQA 3H84A 5SY4A 3P20A 1C9NA 3T7KA 4G25A 3R74A 4NI5A 5U1PA 1XTVA 2ZBQA 1OLSA 4MIOA 4S3MA 2UVPA 3UHFA 3N7AA 3NC4A 4D8XA 5EKDA 3CUWA 3QUCA 2ENUA 4K9DA 5LBIA 3IDOA 3BMNB 2MSEB 2R2GA 4FYIA 3LTEA 1PCXA 3QG5A 3ELYA 4J0HA 4IHJF 2Z6QA 3M1AA 3P2IA 2GVDC 4TT3D 1L8AA 5DXAA 4CM5A 3FRJA 1NMEA 1N34B 5AR1A 4CI0B 3LUCA 3R8CA 4LSGA 1QYVA 3WOVA 1HUQA 3R3ZA 4W1SA 5IWAB 4R83A 3ZW8A 1R3UA 2FUEA 4QQNA 5KYVA 4BKUA 3L1JA 2GAFA 1XZGA 1BIFA 1ZOSA 1QTNA 2JA1A 1ULHA 1A5BB 1OAKA 4MB0A 1UXOA 5HW0A 2QP9X 4HFNA 5I8ZA 3UMFA 3K6RA 4NABA 4YGYA 1E9FA 3ZE0B 2BEJA 4PPGA 1I2MA 3GJQA 3H5OA 3JRNA 2FR1A 3C15C 2CVOA 1HKUA 3KJQA 2OGUA 2QZZA 2WW8A 4IIJF 5DKFA 4BYGA 1SIUA 2YXBA 3SM9A 4IAOA 1WU7A 5DT2A 4G0NA 4DCCA 3PPVA 4J1TA 4LTNA 4Q03A 5KYGA 4J1SA 2DUMA 1UPUA 2FG6C 2ODQA 1G6OA 3LBIA 4YMVA 2HMSA 4CQLB 3TMYA 3MZ0A 4RY0A 1DIGA 2QENA 1H42A 4YQEA 5JAQA 3F8WA 3K9GA 4C7OB 2QTGA 5EE3A 4MH0R 5FLYA 2BONA 4AF8A 3QXHA 3RYIB 4QD3A 1Y6GA 1H2YA 2WQ6A 1M7HA 5IT0A 4L8YA 3PXDA 1XNJA 2PX4A 2VDNB 3CR3C 3TQHA 9ABPA 4W4TA 3SBEA 5AICA 3UAYA 1W75A 2B1GA 3QPDA 3RK1A 2J3KA 4E5NA 3VR4H 4CN9A 5A3JA 4MAMA 4P54A 4M4SA 3ZWNA 2HU8A 1U3FA 4JAVC 3QJGA 3WZLA 3TDNA 4D9BA 4OXYA 5K6AC 2DWUA 1ZMRA 2FOLA 2FSHA 3SE0A 1OAOC 2IRWA 3OQJA 4BVFA 2CHGA 5JEDA 3TFWA 1Y82A 2DBZA 4C5AA 4NCBA 1O08A 2RHLA 3FHJA 3U6KA 4RAQA 2ZKIA 4IJWA 4N48A 1NQ5A 3C6MA 3E27A 4WDRA 3VPXA 1KOGA 1Q3KA 1JJVA 2IIQA 3F4LA 1JDBC 4MRVA 3R76A 4JBLA 3P52A 2ZI7A 3ET4A 3UMRA 3WB9A 4CTMA 4GRAA 1E64A 1YDFA 3A1FA 5AHXA 5B4UA 2EJVA 1FDTA 1MCZA 2GEVA 2GXUA 2C2XA 3EIQA 4W5WA 3EZ9A 3JR3A 1COWD 1ETHA 1C80A 1V7ZA 1L4EA 2OLJA 4FX5A 2XNHA 2ZJAA 4O4LF 4W63A 3OOYA 5E3HA 5C5EA 2AOXA 4NNPA 3ZIAD 4O4IA 4F3YA 2XE4A 3ONWA 3QX9A 1Z68A 1Z07A 3H2KA 3QK7A 5AXAA 3U37A 3VA7A 1UBGA 5JC1A 2ETXA 4IQFA 3GFVA 3ND5A 2VYNA 1E3TA 1ZOOA 2W93A 1X70A 4WOJA 2I6GA 1D9XA 2FVYA 2VPXA 3D9QX 3G2JA 3PS9A 4OJMX 3N2GB 4F92B 4OLBA 2QR5A 2ZJ7A 1DOZA 5K05A 1H6AA 3WYGA 4C04A 4ZDJA 1D1QA 4MS1A 4JR1A 3LOUA 3ZWAA 421PA 1U9YA 2JVKA 4U2KA 5K8CA 1XPJA 2NSJA 3F5FA 3ZZUA 1OIXA 2GZHA 1ZIOA 3IPYA 1Q7CA 5T3UA 1S7CA 4BB5A 5IF3A 3BZUA 4CGZA 2JJMA 1U2GC 4C2AA 2KE5A 4DCTA 1M2WA 1U5BA 5EZSA 4FEAA 1D6MA 3I4FA 4DSNA 1KC3A 1T24A 1UKYA 2AMVA 2QN7A 1P5ZB 2ZQ5A 3FFWA 3FRHA 3OE7A 2AF3C 4RORA 2R66A 2JLXA 4CGYA 1U6JA 2FPGB 2M6RA 1U99A 4CUKA 3EW7A 3QFCA 1WLSA 1MA3A 2WVHA 3KOZA 3GXBA 3I0NA 3K5IA 3OM9A 4KNVA 3LC7O 4LHVA 2O2JA 3ICWA 2B4KA 1L5HA 4EG8A 4EUHA 3EAGA 1XXLA 4S1PA 3SY8A 5L3SB 2ACWA 3FKSA 3SKYA 2VUIB 1EVIA 3GV0A 3NH9A 4IJ6A 3DS8A 5B12A 2ECQA 2NO0A 1UT8A 3QWBA 4NIMA 4XX1A 3H16A 5A9TA 3PUIA 3KTFA 1DAKA 2FSUA 2HF9A 3O0DA 2FCRA 4HFMA 1L4UA 4F38A 2RG1A 1RCTE 1STOA 4L3VA 3OICA 3CVWA 1E2BA 1GXSA 1W49A 3F9RA 4MR9A 2DG2A 4FOPA 3ZWCA 1KQOA 1Q6YA 2ZB2A 2OBLA 4QTXA 1YI1A 1M6EX 5ICSA 1QFYA 2HYIC 2OUIA 4LF4B 4C3UA 1EE2A 4ZCMA 1P80A 2BELA 1FRVA 2VUSA 1PK9A 4ME6A 5FPPA 1YDMA 4UU0A 4CG2A 1YZKA 1CU1A 4QPZA 1OGYA 4RNCA 1AUXA 1H2BA 1X94A 3P9RA 4TL9A 5JASA 1EXMA 1IL0A 1OH7A 3I9OA 2ZRQA 3KYJB 1VJGA 3O83A 4PWYA 4W5NA 1XLTA 3PT9A 4JJIA 1Z6PA 5LQDA 3L49A 3Q0IA 1SVWA 3ZZTA 1E5LA 2PUDA 4C4SA 3ORQA 3JWPA 3VR6H 3WKAA 2B4YA 3OMLA 5HQ3B 4B71A 2O8FA 1N2GA 2WJHA 1QRSA 2XKAA 3PX2A 4K9KA 4X20B 1XZKA 4FMBB 3RARA 1M1YA 3SF8B 1YE5A 3IUMA 3PZRA 4QRIA 5IAKA 2FRDA 1V1MA 1J5EB 1RE0A 1R5JA 2G88A 1KU6A 1WXQA 4ZARA 3FYCA 4RA9B 2JGEA 2XOKA 4UD6A 1ECFA 4KO8A 5KDOA 4QGGA 5C5IA 1D4OA 3H1GA 5IBPA 4ERNA 1RZ3A 5DHQA 1PFYA 1PL8A 1RXSA 1UK8A 5AHWA 3TEJA 2EARA 5LMCA 4DUGA 2ZXEA 3IVXA 2V1UA 3U1VA 3PC4A 3V8BA 5LP6B 3AFIA 3B82A 2FZ4A 3QFFA 5KOIA 1KAHA 1S4MA 2V7TA 4OX9B 4QNNA 4XYBA 4E7PA 1YGPA 2M6KA 1TT5B 4KX5A 1FRNA 2R6HA 3JATB 2DWPA 2NSDA 2RAFA 2XITA 3P27A 5DNCA 2OA0A 1DRUA 3WISA 2AEEA 1EFHA 2AX4A 3GEHA 3IQIX 1SOMA 3LHKA 3EPLA 1KZ7B 1K5PA 1DI0A 3IYLW 1XU9A 3NWOA 4OSPA 5FR2A 3E9DA 1IC6A 4TT3A 1I7NA 1NBMD 2XIQA 5E9AA 1S2OA 5D5QA 3U7IA 1E3QA 3UT5A 2KSQA 2YC4C 3MBIA 5ECDA 5LLSA 4O2AA 3AVUA 4PGMA 5L3QA 3KELA 5AK0A 1IFXA 2DKOA 4FI3C 2HXYA 3SVZA 5CT8A 3BWEA 2OV4A 1T1RA 3KK0A 2YFKA 1ODLA 1BEEA 4RESA 3I5MA 1CUBA 1N5IA 4H16A 1FXUA 2CV1A 4FYPA 4BP1A 1L7MA 3L93A 1E0AA 1LRKA 3OQVA 2RK4A 1I4OA 1JH8A 2NU8A 4GSLA 1FJXA 1R50A 4U00A 1PL6A 1E3LA 1T8WA 3JW8A 1AUQA 1S9HA 4EPVA 5K3SA 1I5OA 1QTIA 5EHQA 2NNLD 4XVHA 3RKRA 3VAAA 3LT5A 4Z4CA 4G65A 1AHPA 1FP4B 2P90A 3WS7A 2I2XB 1GQQA 3O3CA 1JMVA 2FX5A 4V02A 2B8WA 2PS1A 1Y1PA 3MMPA 3SPXA 3L7OA 5FAKA 5F1KA 3AVQA 1U65A 2ID9A 5ILOA 1DKMA 1NFFA 1J7KA 2Q4TA 1LK7A 2QY6A 3B13B 3TZLA 1F7VA 3DUWA 3DTVB 4IRMA 3ZV4A 1CEQA 1NGSA 4QU0A 1VBKA 2WG0A 4NKRA 2L82A 1PP4A 2RHJA 3K9LA 1PJAA 2YIMA 3ADOA 3IQFA 4TKZA 5JSKA 5BW8A 1CNFA 1WUTA 1QCYA 3COWA 1OFVA 3K6SB 1FU4A 2YOFA 3DEFA 4NCNA 5ALOA 4MLZA 1RJFA 3UEOA 3ZU6A 1Y7IA 2C3MA 1H94A 3OETA 3W4JA 3HR4A 1QGUA 2I2WA 3DA8A 2Q3DA 3KQWA 4L6AA 2UVDA 1KVQA 1G5TA 1RM3A 2CHEA 4M8SA 2SKCA 4R2MA 1SVMA 4PLZA 1PD1A 5A4MS 1OZHA 2UXDB 4BKMA 4M1QA 4EGAA 1XXHA 3WIOA 1E98A 2HHCA 1H0SA 1YRHA 2JHGA 3GY0A 4D0RA 4R8RA 2DHRA 2O2GA 2OBFA 5B55A 3S2FA 4YT2A 2QR2A 3MQ4A 1U8XX 1DIOB 2A0YA 3FMIA 1IN4A 2GBIA 3Q9SA 5AXDA 4MVJH 2HJVA 2X7HA 3QIVA 1ZUIA 3L8DA 1OAAA 3DQPA 5KBYA 2J5BA 1COWA 3FBTA 1P81A 4HDRB 3CIFA 4NL4H 5TC4A 4XPIB 4JJKA 4XVQA 3VR2D 3H2HA 2VC2B 2OWEA 3ZIAA 3SR0A 2POQX 2XNJA 3O9VA 4KP7A 4R1PA 1QRTA 1G5PA 3DDUA 1TZMA 3N75A 3QKSB 2FMXA 4I9FA 3DCYA 5TR9A 4MVYA 5I7OA 3TUZC 1N9GB 1DZIA 3ZE7A 5CXUA 1CCWA 2IYUA 2O8CB 1L1QA 2EXXA 2I2BA 3L5OA 1DAPA 5GONA 3T4UA 4BO5A 1U0RA 4FNOA 3A6ZA 2PTHA 3ZDQA 4CMIA 2GAOA 3ZCSA 3PV0A 2Y1EA 4RTNA 1DHRA 4LMPA 4RE6A 5T6MA 5I7WA 5KNLA 1ZN9A 5JXIA 4OP2A 3ZCVA 2C03A 3L04A 2PKQO 2PGDA 5DBOA 1GITA 5KQRA 2AKEA 2WWIA 3TG8A 2OCAA 1SVKA 3N59A 1OROA 2Z5VA 2A7QA 3L7BA 1II9A 4F06A 1X13A 2VQFB 1T0HB 2AMLA 4EKGA 3A9VA 1CG6A 1EM8A 1GFWA 3H0CA 4Y6LA 4OU4A 3P0HA 4P32A 1X1EA 2OHGA 5G0TA 3UMBA 3UWDA 2BC9A 4MKIA 2A0UA 2PD6A 1JZSA 3ZCRA 4P83A 4TV8B 3B1YA 3EODA 3QPUA 4FEGA 3GCDA 5F3WB 2WJ4A 3QQ5A 3E9YA 1JPVA 2X0RA 1R0WA 4ONEA 4Q3KA 3P2JA 3PGXA 3DDOA 2EFEB 3WWOA 1W2HA 4F5YA 2JFYA 5KYKA 2H7CA 2C00A 2IY7A 1UOPA 2CL7X 3C7KA 2PRIA 2QRQA 3G79A 2HWYA 2QTCA 3HWSA 3U3XA 3LHIA 1QKJA 2C88A 3QUSA 4KUEA 4HTFA 2HV9A 4DBLC 1HNWB 1NXOA 2OAP1 2CKMA 3G1WA 3HCOA 4NP6A 4OQYA 4EJ6A 1AF4A 1QFMA 3A27A 3RU7A 3UGTA 5GP1A 1LKZA 4DIOA 5CT9A 5JZMA 1Z13A 3VTZA 4RPHA 5JZOA 2ZRLA 1CJVC 1OCEA 2FUG1 3QBDA 1G59A 2IZ1A 1DKPA 3K8YA 4BXOA 2NU6A 4MULA 1QC5B 2CL0X 3W5IA 2GK3A 3ZHUA 2NMVA 3D31A 1BYIA 3D4BA 4UEWA 3T4PA 4ZCIA 4UZEA 1PE0A 4Y2GA 1A97A 3IQXA 4B8WA 9ATCA 1X87A 3UHAA 1RYNA 1X7XA 2JKVA 2QI9C 3L8GA 1UBUS 3HB4X 3GRCA 2NT3A 3MWEA 4O33A 3RT1A 3X1XA 4ZT5A 4MROA 3A8TA 2Y1XA 4ZDKA 4H7HA 5JSUA 1NYLA 3R77A 1G1MA 3MXOA 3LY7A 4MW0A 3FFBA 3EB9A 3TKAA 4JKIA 4QFBA 1Z17A 4JCOA 2RH8A 1LDEA 1M2VB 2IELA 2XDWA 3PR3A 3REFA 1QU3A 2ADFA 2PPLA 3E81A 1SBIA 1U8FO 4F4CA 1OWMA 3FFXA 3EULA 2GQ0A 1KEVA 4D0SA 5KTMA 1GUAA 5I47A 4I36A 3FCXA 4FPXA 4DEVA 5KC9A 5G53C 2WJJA 3TRIA 2YWBA 2FKAA 4PLFA 2PEYA 1IOWA 5BN3B 3PX3A 1NI5A 2W11A 5AP9A 5ER9A 1ECPA 1TADA 3PSAA 4FZJA 2FG7C 1GR1A 3SJCA 2YV3A 4AIRA 2I65A 3T41A 2IIPA 3OCVA 2X2FA 4Q7QA 2PFSA 3LPDA 4Q24A 5KYNA 5I7FA 4BFYA 1JT2A 2BHRA 4GMXA 4JLUA 2EIXA 3I6IA 3IUEA 1E7QA 2I29A 3B12A 5BORA 4TYWA 1RCFA 2W6MA 4NJMB 4N40A 3ZCUA 2AXPA 4DJJA 3N0XA 2YY6A 4XPZA 1YI0A 1TKAA 1DTSA 2ZZKA 3M1LA 1ORVA 1T4CB 5DVZA 9LDTA 4I14A 3E15A 1DUVG 3JD4A 4IIJB 1YU6A 1NBMA 1QRDA 5BN4B 2QMQA 4OQNA 3VPGA 2HJGA 3QF7A 1QYXA 4UW9A 2F62A 3OZ7A 2E82A 2C5GA 3OT4A 1KJ8A 2GEDA 3EDQA 4CM1A 5KWEA 5DNUA 2B8EA 2Q27A 1PLLA 1HDRA 4C5CA 1AQIA 1BU8A 1ESDA 3L0CA 1JDBB 5AH0A 5E6RB 1YAJA 2FPLA 4TMZA 2XQIA 3RE1A 3U39A 1IBKB 2WR8A 3ADKA 4FFPA 3KLMX 4Q02A 2FQQA 5AKHA 3T52A 3RVSA 1V4NA 4JLAA 5JI3E 4RPCA 3UT6A 4JC0A 2Q28A 1BEUB 2WMOB 4XIJA 1GILA 4M1ZA 2VXCA 2XD4A 4I5IA 3C4VA 1JHPA 4MS3A 5KVCA 3HJAA 4ZIRA 1YCFA 4JENA 2Z95A 3EZFA 2OQ2A 3KXDA 1MZPA 3L0PA 4TS4A 1FZTA 4RH0A 4GGPA 4BV3A 1CQWA 2JEOA 2X1MA 1OZFA 3ECAA 1N6IA 2GO7A 4P22A 3ZGYA 4WQMA 4GOOD 4PYRA 2CV2A 2Q4RA 2ZVJA 2Q1TA 1NHWA 4L8WB 5KPJA 1Z18A 2ISCA 1QDUA 2ZCVA 2F1KA 2A9FA 2FWJA 4XGQA 4ENPA 1NWCA 2NVUA 1FDSA 4I2NA 1SD2A 1RT9A 3WL5A 4A1OA 5J2UA 2ADOA 2HA7A 1P18A 2QRPA 2W48A 4RDHA 4YALA 3BRWD 4ND8A 3WKBA 6LDHA 4X54A 1LNSA 3Q8WA 3BHJA 4G8JA 1PRYA 3KFVA 4CIWA 3TXAA 1YRYE 3EYWA 2VZ8A 1I7LA 4KQ1A 3CLTC 2JI4A 2HA6A 1SD5A 2HH9A 2ZRHA 5TF4A 2JFBA 2H2IA 4YJKA 1RAHA 1XTSA 2FG5A 1PEDA 3GRKA 3P0EA 1YFKA 3PQ7A 3KS9A 5G40A 4RJTA 4QZVA 1F6DA 3LKZA 4IL5A 3VO1A 4AUMA 3JPWA 4YRQA 5TJHA 4LVUA 5CVVA 5DNYB 3RLFA 2P3QA 4REQB 4URWR 5IXJA 4JJ6A 2UUOA 2JH8A 4DDTA 3ZHQA 4UCXA 4N0DA 4OL0A 1BFKA 3ZBPA 2QJFA 3WBFA 3FYUC 3GP8A 1ZM2A 4FYVA 4LG1A 4URVR 3FNBA 3PFFA 4X3OA 1LK5A 3D6FA 3ZZ1A 1SG0A 3F2VA 4C3OB 1R4MB 2C5HA 2E89A 2IZ0A 1UZLA 3CSUA 3EDOA 2QJTA 5H59A 5JH7F 3VR2A 2CE7A 4J76A 3QITA 1PW7A 3JR7A 2ID8A 5A6SA 4B5LA 3FYHA 5EJ4A 4JYPA 3CU5A 2DPGA 2DC1A 1GNLA 1X7GA 4UFOA 5JCOC 2E37A 2VDWA 1SBQA 4U2BA 1E5VA 1QIKA 3LIPA 3H9BA 2FK7A 2WLSA 3WQRA 4Y1GA 2OV8A 3HM2A 4JSTA 1BA3A 2WHQA 1XLVA 4O4HF 5K01A 4GG1A 4TMFA 4Z99A 1K6EA 4R9RA 1U1EA 1P4JA 5HPYB 1UJMA 3NEYA 1PNQA 2ZIWB 4F9FA 1YTUA 2BUAA 3OH8A 2DCMA 3LPCA 4ZU1X 3JRWA 1BDJA 3JQRA 4OAPA 1Q7GA 1QZXA 4AO8A 5EE5B 2Z4RA 3QUAA 1DX9A 3JQBA 1P39A 3AJAA 2G67A 3SZOA 1WBJB 3G6KA 1E3WA 1GZ5A 2P68A 5JSZB 3CH6A 4BLPA 1AKNA 4QUHA 1W30A 4R1OA 1YHZA 1XCOA 2GILA 3H1BA 2NU9B 1D6NA 5FUVA 1EDBA 2B98A 2B34A 4KPUA 3RYFA 3CUKA 1PR0A 2PN1A 1H6DA 3AI1A 4U2DA 3QUTA 3P5BA 3CRMA 1XHEA 3GGGA 1J2UA 5FQOA 1WZ2A 2J41A 3AHJA 1M54A 2W6ID 3G1UA 3MJDA 2IZOA 4A6DA 2G5CA 3N2KA 5A3VA 3O8OB 5KDLA 4BMDA 3O21A 1DIAA 1J2JA 1ZGJA 3A3OA 4OOEA 2B6HA 3EXIB 1ODIA 5DCYA 1UQUA 5IKOA 4C0HA 3BEOA 3R3UA 2BDTA 1GCGA 1KEUA 4BZPA 4DSOA 5K8UA 2ZZMA 4YO8A 2HY7A 2YRFA 4O3MA 4EB3A 4JY7A 1MJ5A 3GAZA 3PXCX 2XBUA 5H83A 1QUFA 3EVBA 4UEOA 1NL3A 4ZI5A 2FW6A 3T1YB 1E58A 5JD5A 2WMDA 3DDCA 3LRTA 3GEIA 1QVVA 2MT9A 4Q00A 2QXYA 4KUGA 3WL4A 3JWIA 4C4OA 3QTBA 3I0ZA 5E8JA 5F33A 1CRLA 1J2EA 3IUYA 5FWXB 2JDID 1LBIA 1Z6TA 3HGTA 4YAOA 4UUOA 4E5DA 1PEAA 1DJLA 3AONB 1ZCBA 5AO9A 2KBEA 2C8LA 3NHBA 3OQIB 4EKYA 4C4RA 1JHRA 1FTYA 4ZJYA 4D3SA 1H9BA 2BFOA 4OHBA 4XXHA 3CKLA 1USUA 4D3DA 1SPXA 4DR7B 5TEVA 3AIKA 3ZXXA 2O8EB 5DM0A 1XAIA 3F6EX 2J33A 4D8VA 1Y5LA 3WLMA 2I54A 2AK3A 2IEYA 3BBLA 4HADA 4P35A 5KTOA 5TY0A 2X8BA 3X1KA 2TS1A 4BNFA 4F4IA 4DLSA 3LSTA 1KJZA 3TLGB 5E4YA 4MUHA 3SYKA 1OXUA 5KU7A 5FBKA 4NCKA 1NXTA 2D62A 2RHOA 1OVMA 1J22A 4GEGA 2DLNA 2NW6A 3WJ2A 1OKKD 3AZPA 2H2DA 1CY7A 1DEHA 1CDEA 5K0ZA 5F2OA 4CL2A 3FMVA 4E6PA 1N6OA 1JLMA 5K3EA 621PA 1XD2A 2Q2VA 4GLOA 4YJFA 1U1IA 5DZSA 3ROGA 3PNPA 2AC4A 1KKUA 1YIDA 5E7JA 1MKYA 2QGZA 3HKBB 1WW2A 1YASA 2CJWA 3UJBA 1UBTS 4WGFA 4J03A 3O74A 4WLEA 3VU1A 1ZOLA 4B48A 1BJRE 5CA1B 2OT3B 1I36A 3PRKE 4LECA 5IRCD 1BVUA 1QPZA 3D7SA 1W5FA 3KYDA 3A1DA 4RZ3A 1DWUA 3L8MA 1DIHA 1NVBA 2X8LA 4RNDB 3PDWA 1E1DA 1G9XA 4AS3A 2OG1A 4JLWA 1YQXA 3U3DA 1JX6A 1PR1A 3H2IA 4MQEB 4XJVA 1CIJA 1JH9A 5L95A 2XUQA 3TQQA 4YRLA 5HJ2A 1XV5A 2NYRA 3GFRA 4WFIA 3I37X 3THWB 1RQRA 3GFTA 1VZ3A 4ZZ3A 3WDSA 4IKPA 1A7JA 1N2ZA 1YBVA 3E9CA 1Z6GA 4PZCA 4EGCB 2Q3EA 2EU8A 3BMNA 3RASA 1B6GA 3ZYCA 4L7QA 4IKOA 3JQEA 4CT4B 4DIUA 3ITEA 1HFWA 5JYDA 2WC1A 4RL4A 3ACDA 4R68A 5H0IA 2YUTA 2WUWE 3NJ8A 2GN9A 4ID9A 4M1SA 4NTZA 3TLZA 4C0LA 4E3ZA 4NDNE 1ISPA 721PA 1RYBA 3L82B 4HGYA 3MILA 1DDOA 1C50A 2BBTA 3CH5A 4L1KA 5DV9A 3V7WA 1XVVA 4B7XA 2WHYA 3RM3A 2F9LA 2ST1A 5CBPB 2OE2A 1JTEA 1ZUD1 4Q15A 4XIGS 2RJOA 2K2QB 10MHA 2G7MC 2AFHE 3DF7A 4H3HB 4CM8B 3HJRA 1KI7A 1B6TA 4I55A 3UMGA 1ISMA 1K1EA 4M1WA 4ZV4A 4K46A 3NBAA 5B1HA 4JITA 4P3PA 1RPJA 4BY9E 1DRWA 1UPAA 1FX1A 2PGJA 3N9IA 2N1BA 2WUGA 1G1AA 3BRWA 3E2MA 2GRUA 2ZAIA 3Q9NA 1O8CA 1D4ZA 3KOWA 3S1LA 5JNRA 1DRJA 1XGKA 1UBMS 4HQKA 4ZQHA 1JKXA 1TVEA 4WE3A 1SBTA 1KVSA 5FLEX 1SG6A 2FKNA 5BMVF 4C7OA 1N6LA 3DTVD 3SC2B 1QLHA 3EFOB 4RZQA 3GRPA 3RYIA 5JY1A 3HYRA 4Q37A 3KSBC 4GBED 2HWUA 1XRNA 1GPKA 1OOEA 1PJQA 2WICA 2H11A 1KS9A 2WVAA 3NBKA 4GX5A 5BSEA 3A1WA 1EM6A 2O59A 2VPTA 4E46A 1KP3A 1E1QD 3GDOA 1BX0A 2PX5A 3RT9A 3JQFC 3FCSB 5BSWA 2QORA 2IXAA 4OHOA 3OCCA 4OHCA 2NP6A 3UJAA 1PQ4A 4TKLA 1KOJA 4I5DA 4FIDA 1L8QA 2JKZA 3KPVA 1R4ZA 2WRZA 3D8UA 4EDFA 4AS1A 4LRQA 2FGJA 5C8YF 4GL4A 1Z08A 4RM2A 4AF6A 3CM0A 4MKXA 2XBLA 2A30A 2OENG 5JSQA 2GM9A 3I53A 6PFKA 2FN8A 5ILGA 1XMQB 4A2QA 4TTAA 1LDMA 1WCV1 2Q45A 4AY2A 3W9YA 2WP8J 2EL9A 5E1MA 1X7YB 1RBQA 5CA0F 2BJVA 2MHCA 3QVKA 4G1BA 4IRXA 1T0IA 1VM6A 1HM5A 1QMPA 1CVIA 1RLJA 5C4GB 3LO8A 3W05A 2O2HA 3DMYA 5JJ5A 4HN9A 3ZXUB 1RAAA 4N18A 4LC9A 1BSVA 4P9NA 2VAPA 1MX9A 2ZUVA 1GO2A 4A26A 4KWIA 4FQ8A 4OSOA 4P5DA 2PUFA 1N77A 4AJOA 3D6VA 3F8SA 2CUZA 4D5EA 1N2IA 1XQ9A 2HSGA 4KRFA 4V2IA 3DZKA 4QBKA 4PBRA 1Z4LA 2H2GA 4LFAB 3ASUA 1NV8A 2ZTLA 3HB5X 2O07A 3N2GA 4UUPA 4ZAVA 4DVGA 5IF9A 1T43A 4C4ZA 4EHLA 5AOCA 1WVIA 2C61A 2W2KB 2FI1A 4KFTA 3SNHA 1UKVY 1MRSA 3KKMA 2OV1A 2XJ4A 4BP3A 3PKJA 5B64A 1XCJA 2CFSA 2R1ZA 1Z56C 2XMCA 5EN4A 5EXTA 2EJBA 3VPBA 2OPHA 5YASA 4OGKA 3UKOA 3G49A 2NO6A 1QRRA 2FFQA 4MYSA 3P0IA 5ANRB 5K8JB 4FR5A 3EVFA 3ZDYB 4EWLA 1QR6A 3EGIA 2R85A 2AFIE 3H2GA 3OU6A 4HH3C 1BFUA 3TCXB 5IJWA 2FPGA 4TPKA 3ZLJA 3QVSA 1J8MF 3LUAA 4IZ6A 4I3GA 3HJNA 2F4NA 4JMLA 3LNTA 5F2NA 3GGCA 3CSDA 5JCZA 1L2TA 1S2MA 5DSXA 2FN7A 3I8SA 4N6GA 5L3SA 3UPUA 3OTQA 4G6ZA 2CL6X 2ZJYA 4BNUA 3BE4A 1B6SA 3ZI0A 4K3VA 4LJKA 3WLHA 1E5TA 1FF9A 1DX6A 1EP2B 4HGZA 1B8UA 1JMKC 3MSXA 2JDIA 3HUEA 3FVTA 1LY1A 2O7QA 3IAXA 5AVQA 1GYPA 4R81A 1QZZA 1QO0D 1KO7A 1VXOA 4G5FA 4K6GA 3DO5A 4WZAE 3AUYA 2XKKA 4N6OA 1EVKA 1G63A 1F6WA 4JUAA 5C3MA 1PR9A 2B7LA 3A2MA 5EWMB 1CUZA 3U3JA 2YKGA 3EEBA 5FUQA 2Q4DA 1EE1A 1CTQA 4R1LA 1SU6A 4EMTA 4UOZA 1C30B 3FETA 4XLTA 3G85A 1XEFA 3WJ7A 1KR2A 2A94A 3NJ4A 2IHBA 3BCSA 3MGGA 1NNUA 1U98A 3CBGA 3RRXA 3ZN2A 1B15A 4NK4A 4MGYR 2FSVA 4KVGA 2XAAA 4MKGA 1Y9DA 1JG6A 3U0BA 3U7HB 2GBFA 3A3YA 2X6TA 3STUA 4Y9TA 1EUZA 3AETB 4ZVUA 4M8LA 4G81A 1XZ8A 2JJ2A 1OHHA 2OC9A 2R4UA 4M37A 3SP1A 1UUFA 1XLWA 4DDKA 3GMDA 5HQ3A 4OQEA 3LQ4A 4NHOA 4EI2A 3NB0A 4KGDA 2VHCA 3PUVA 2QBYB 1FFBA 4X20A 3SF8A 4EPTA 1EK0A 1WB6A 2O57A 3VKUA 1J99A 4M7OA 4COKA 2XCQA 4IJMA 2J4CA 2XB4A 3LK6A 2WM9B 1ZWKA 4CG3A 4DNOA 1EUDB 3H17A 3JWEA 1XU7A 3HRHA 4RA9A 3WP1B 5LUAA 3R5TA 5FOQA 4R16A 4W9NC 4EENA 3L18A 5DW3A 3EXHC 5HE9A 3E5RA 4WW0A 4PLGA 3FUVA 1ZVQA 4A92A 3ZDCA 2CNLA 1X86B 3D0RA 2UXBB 1MRZA 2XA1A 4WOBA 4TKUB 3SYMA 1DG9A 1N5JA 2QM7A 3C8HA 3E8SA 3NJRA 4GYKA 3WGZA 2FEWB 1F14A 1SUIA 2XQJA 3OHMA 4Q3LA 2B37A 3T3HA 3WGYA 1NVXQ 1LW7A 3RSZA 4ETIA 1HE5A 2I6TA 3NYWA 5B7PA 3JQCA 3VTFA 3MCWA 2OMEA 3R09A 3JVIA 3LOQA 2YW2A 2XGOA 1GVHA 2C5SA 5I7AA 4L74A 3JATA 2VP4A 4TQ9A 2EZ8A 4L78A 3N6XA 3SICE 1TQHA 4K0KB 4NYMR 2PR7A 1RZRD 1MNAA 2F1JA 2GVZC 3S2YA 4EB6A 1TIPA 1QG6A 3AM4A 1FUIA 1KERA 2BAGA 2D1QA 4BJ1A 1JEEA 1VP3A 2O7VA 3L7NA 2P67A 2UUPA 3F46A 3PNOA 3U09A 2ZU6A 1HPLA 1WVMA 2DHEA 2NXJA 4Z9YA 1MG0A 1TYBE 3D81A 3R7SA 1WDTA 2PGNA 4WUTA 3UA3A 5TPWB 4I1OA 1G18A 5IXYA 1ZJZA 2NSHA 3A7DA 3OLQA 3OX4A 4FDLA 3UAVA 3H4VA 4J6FA 2OP0A 1NPTO 4ER7A 5BYAA 5I4BA 2PUGA 4Q12A 4EX6A 1Z2PX 1CUHA 3KQHA 5KYYB 3MUFA 4J43A 1H5NA 1EAMA 3DR5A 1KDOA 1L5VA 5T8KA 2F59A 4JQYA 5A2QA 3BFPA 3UXHA 1JFVA 3P9QA 2ZSHA 3SDBA 1FP4A 4PY2A 2A92A 3OZTA 4JK3A 2D1TA 4MITA 4QPJC 4O59O 5ALVA 1RR6A 3HU1A 2BZSA 1SRRA 1H23A 1M75A 1W8IA 2WUEA 5DHFA 3TZQA 4JUCA 2C07A 4UVIA 2H5LA 1NF3A 1T0BA 1XF1A 1DOAA 1LD3A 5FIUA 3DTVA 3I9NA 4PIVA 5T57A 3BJZA 3S6JA 3ADBA 3IAAA 1EK1A 2Q2NA 4WY8A 5KOHA 2ZT8A 3LP5A 1GPDG 1X2BA 1EQUA 5F9FA 4INOA 4WKGA 1RAIA 4LK2A 4DR5B 1QGDA 3C14C 3HSYA 3TRJA 3H1PA 4O4HB 5HFAA 1SZPA 4IXTA 5JO0A 5KWIA 1UK7A 2H4HA 4N8SA 4EDHA 1T0JB 1WLYA 5T64A 4Z5XA 1QQTA 5EINA 2RAUA 3UKJA 4WZBE 3ZS8A 5ETJA 1ESMA 1S6YA 4QLBA 1X1CA 2X5KO 4TTSA 1UWLA 3QBTA 4F1JA 4GOLD 2J0UB 2PBLA 3P71T 1KSHA 1TTHA 3QWHA 5F76A 1GKLA 5BPHA 1JTVA 2XUZA 3QYJA 1E7SA 3I39X 2YV5A 5DGTA 3U7GA 2JCGA 5DI3B 4HDOB 4YRPA 6YASA 4R2XA 3PQ2A 4CI9A 2ZYTX 2P2SA 2H08A 2VYFA 4UBIA 1OE0A 5GINE 4FUTA 4UAUA 1XVAA 4YLEA 4HDRA 4YRNA 5IAOA 5EHIA 4XPIA 5JBNA 5C52B 1SUSA 2VXOA 1JDJA 3MFYA 3R44A 2GYYA 5B6IA 2N42A 4HVLA 4QDJA 1XRLA 1IULA 3KJGA 3HLTA 1KO5A 2NYVA 1N7HA 1SWVA 1N9GA 1SBYA 2A57A 4QHTA 1RQ2A 2O8CA 3EBPA 4BHTA 4LJ5A 1SOAA 2UUBB 1XRSB 3DE6X 2ATIA 3VO2A 3AO0B 4HVCA 1GEGA 1A4RA 3A1SA 4UBOA 3EMVA 1QV7A 3IEIA 4GWGA 4N03A 3DNPA 5AJWA 4IKEA 3LCVB 1JQ5A 1V96A 2FHSA 3FGNA 3FN4A 3AWIA 3O4RA 4C7MA 1L5GB 4DA6A 1AXRA 1KJJA 2RH9B 2VT3A 1SK9A 4MCHA 2I1QA 3GYGA 3RIYA 5LZ2A 3PEEA 5IN4A 4ETMA 3DXFA 2ZUUA 4YLGA 4PX3A 5JMTA 5LBUA 4S1NA 4LZOA 1HE2A 2BGIA 2QJOA 1KK0A 3O1JC 2VP0A 3BTVA 3KEOA 4P80A 4B82A 1U0NA 3GPIA 4DDMA 1VKZA 2PRZA 3K1ZA 4OK6A 4RF5A 1RKVA 3BH7A 3UANA 2VBFA 2P27A 4TV8A 3CLHA 3B5EA 3GGJA 3K96A 2Q3BA 2QT9A 3SDZA 4P4UA 4K2HA 4O6VA 4WXMA 1F12A 1Z73A 2FW8A 2G17A 4Q9HA 4DIBA 4ZVSA 2OKGA 2X0JA 1ZI6A 2PGOA 2CK3D 4INJA 5I51A 3F74A 1O6FA 2O3QA 2PYIA 2Z0MA 4W8GA 1XKTA 4IMIB 1L6RA 5CVDA 3SR4A 1EEXB 3TM4A 2KM1A 1QO0A 1LI7A 2QLBA 3NHYA 4H0CA 4IDCA 3THXB 5F51A 4DJAA 3KL4A 1VKRA 3FJOA 2PRJA 4EATA 4KQCA 5EXXA 2PUVA 1ESEA 3ZY6A 2GKSA 3IMCA 3M82A 1BFDA 2MSCB 3T7SA 2ZM5A 1VHQA 3QHPA 1WU8A 3BWBA 1QC5A 3ZGNA 2C5LA 1VP9A 4PONA 4DMGA 3A58B 3O7WA 5AFSA 4Y2VA 1QYRA 1ADGA 2VG8A 3RNOA 1PDOA 3WKCA 2RKOA 2VYCA 1OF1A 1BD4A 1F51E 3PGLA 1YBAA 2OFWA 4YJGB 4CHGA 1G0NA 3MN1A 2ZWAA 1DGQA 1EB8A 1C14A 2G80A 3WK4A 1MOSA 2HJWA 2XMSA 3CPEA 2PMFA 4OYLA 1M2VA 1C4WA 1HE1C 5EE1A 4DCGA 1DLJA 4QODA 4TKMA 4RSHA 4D9GA 3ITNA 1JNYA 1LXCA 4GP7A 4RLFA 4BCCA 5A06A 4I4TF 1Z4JA 3K1TA 1W2GA 2LR0A 1L5OA 3D0OA 3KXIA 4JL8A 4YGXB 2C2BA 3AKEA 5J63A 1EINA 4HQFA 2C59A 4RF3A 5BN3A 2P9FA 2EG5A 1TU4A 1Z16A 1IIRA 3LU1A 2QROA 4IEEA 1U80A 4IHJA 1QX4A 3ELBA 4HMOA 4DTIA 1TAQA 2V0CA 2X2EA 1YONA 3K9CA 4M7RA 2FWMX 5DIFA 1J97A 5HKKD 3C7CB 4BZXA 1WY5A 2MDTA 4IYJA 3UB3A 1PJZA 3HG7A 4MOWA 3H5LA 4NG5A 4B6JA 4UMVA 2VEDA 4RABA 5EIBC 3TJZA 3UJDA 4L3OA 4I3HA 2A1IA 3CX6A 3GJYA 1SKQA 3R0ZA 3AL3A 4RUKA 1DQPA 4NJMA 3M4YA 1PO7A 2CT8A 1GEEA 4E5VA 1MB2A 4XRRA 2PLAA 2HCTA 2IF2A 1ZQ1A 3EJ6A 4ZOCA 1UAYA 1KXJA 2OP1A 3QLEA 1MR3F 1RZRA 5K6AA 4QYXA 3K09A 1A9SA 4IIJA 4ZCRA 5BN4A 3OJXA 3EG9B 4OQZA 4WPGA 5IARA 1JJBA 5CT5A 4BLTA 3OA2A 1O6ZA 2D5AA 2YZ7A 1II0A 4MKFA 4P7GA 4HY3A 1D2EA 1JECA 5WRFA 3AM3A 2X40A 3WLOA 4K87A 5E6RA 1XMPA 5BMVB 1RNLA 4OM7A 2XGJA 2CNOA 3AUSA 4GSKA 5FUWA 3UOGA 4J7UA 1TC2A 3Q8KA 3B7PA 4YCBA 4IWYA 3DE3X 4U3JB 5G02A 3UWMA 4ZJZA 1T0PA 5EKXA 2ZG6A 3T3PB 1L4MA 3JCZA 3PUKA 3TMAA 1GRQA 3E82A 5C53B 4B9EA 2C94A 1G8FA 4XUGB 3T5TA 1Z39A 4ZZ1A 4ZZIA 1R10A 2GYWA 2ZUCA 1TZ2A 2W2PA 4G9EA 1H5QA 1I30A 1VDZA 4L3WA 1C7JA 3RFFA 2QLTA 1XTZA 2AS0A 2O2XA 1B73A 3PFHA 4FYMA 5BP7A 1CUVA 4MUGA 1EFKA 1G3RA 1WPGA 4IICA 2R96A 1M1ZA 5IJ0A 3H6GA 2JASA 3OIYA 4RD0A 2DFVA 5E1OA 1Y7PA 4UCQA 4LYHA 1KBOA 4G4IA 4YWJA 1MFPA 4V0ME 1GZ7A 3CF6R 4YQFA 1N6NA 4ENUA 3RSGA 1EE9A 1FFDA 3CZPA 5JRZA 2IDZA 3IPXA 4MW6A 5H3CA 1XNRB 3BVPA 2V6GA 3G9UA 3Q3IA 2Y6UA 4LXGA 1M6WA 4ZRMA 1SUDA 4IQGA 4ENSA 3A1EA 4KR0A 3KVRA 2WF5A 1EVZA 1HDEA 3AUFA 1KIFA 3SOPA 3K72B 1VYHA 2C57A 4LHXA 5CVJA 2JGRA 2GMWA 5G1OA 5AVXA 5HSGA 1SCDA 1UM9B 5K0SA 4REQA 1B26A 1J8QA 5GVSA 1DARA 4XZ3A 1P17A 1SH7A 2LWIA 1N2BA 2OOKA 1X0VA 4QXAA 2OYCA 5I8PA 5DHAA 3SVLA 2JZNA 3A9TA 2BW0A 2V59A 1U8UA 3ADPA 3R7AA 1IBMB 2H07A 2H92A 4NDAA 1FDUA 4WFQA 4XD2A 1N5MA 1X80B 2VPPA 4P3YA 3H7AA 1R4MA 2VI5A 4PC1A 4E03A 5CDSA 4Q3BA 3TJMA 4F56A 1L4HA 4S1TA 4C4PA 1UQTA 4JC5A 2VT6A 4P3OA 4ESVA 4MEBA 4P81A 3ZTYA 2B61A 4NWIA 2NZUG 3QVTA 4KBYA 5GM2A 2V5VA 4A8HA 4UU8A 3TX2A 4ZOEA 3M6FA 1P75A 2R6GA 3AEUB 5LD2B 2HQRA 4G1EB 5TT1A 3TB6A 1D5WA 3NKFA 2YV4A 4X6UA 3QKWA 3AL2A 1OXXK 2F17A 1OI3A 2CLEB 1V0JA 2WI8A 4G63A 3DEZA 1Z22A 4B6RA 2BBOA 2IGTA 1HNXB 4CLDA 3V8VA 3CT4A 1OJ7A 4W5JA 4G3XA 1ZRHA 1DCFA 4PX2A 5G3YA 5JSZA 4JQSA 2Q49A 2HMYB 2EKZA 4NU6A 1W47A 2FWIA 2UZ3A 5AHOA 2D74A 2AW3A 3WDKA 4U6SA 2NU9A 2ZUWA 5AT1A 4G0VA 2CCJA 1MAHA 2Y0BA 5DTIA 1E8DA 2HX1A 4MQMA 1DJOA 3HUUA 4I6JA 4M0PA 5EXSA 4ALJA 4GXTA 4R5MA 1KO8A 1YDGA 4OMDA 4P34A 1JPUA 3N07A 3DCJA 3PPWA 3TTYA 4CIAA 3U61B 2WBLC 2C7VA 3U2QA 4CKCB 1HQKA 5LVAA 1UXHA 4TTVA 3T61A 2JHPA 3O8OA 3IEVA 1GZ3A 1L4FA 2PXHA 2CK3A 4PXAA 2VA8A 1KK3A 3EEQA 3EXIA 4PYOA 3CPHA 4R2JA 4B33A 3L5KA 2O2IA 3FNGA 5IMBA 3E58A 3UN1A 5HKAA 3LOPA 1FC0A 5FWYB 3GPBA 1JHYA 1RPZA 4YECA 2XYHA 3A04A 4LAFA 4KC0A 3FVQA 5DTEA 4J1QA 5HCIA 3UJPA 5FPSA 3W79A 4BFUA 1H1LB 3T1QA 3CVUA 3P9ZA 3NHPA 5JXJA 2Z83A 2H2AA 2UDPA 1HDGO 2BM9A 4KJXA 3WGUA 4EVQA 3IURA 3CF4A 4HDQB 1BCSB 2V3CC 1YIAA 4IX1A 5H70A 2X0IA 4XYGA 5FWXA 2H9AA 4BV2A 3O4HA 1KSFX 2V9PA 2BFWA 4RVSA 5CVCA 1UBHS 1JB9A 1T5OA 4ZV7A 2ZDHA 4R3WA 2XD9A 3MRVA 4S1WA 4FKMA 5E9QA 1UEIA 3TLKA 3OQIA 4RV9A 1EXDA 1GQSA 1J1UA 1WZIA 1IG3A 2FPWA 3BGSA 1OQAA 3N2YA 4KW7A 1BMTA 2O8EA 1BDBA 2IUSA 1UJCA 1XD8A 2HA0A 4W5RA 1PFKA 1ZJ6A 2BBWA 3KQTA 3D7MA 3FWHA 3VH1A 1XE3A 1C3OB 3OLZA 4GT1A 4G84A 1RABA 4U9IS 1CF2O 1DCMA 2JFOA 1BG6A 3TOXA 4HAOA 3EEOA 3RPEA 3S2SA 4QUKA 2VF5X 2CLSA 3AG6A 4QPDA 1L5SA 5ITZB 4HL6A 1V6AA 3GT7A 3PJGA 5TS3A 1T9GR 2DUJA 2WZQA 4H3KB 4DAEA 2GERA 3MCTA 4PRZA 5CVUA 3AKCA 2ZB8A 4R7TA 5HKKA 3L4EA 3GPDG 2O1SA 2KJQA 5EHXA 4HX5A 4KLNA 4N01A 4MWEA 2BM1A 1DO0A 2C2MA 2WIDA 3G2IA 3HKBA 4A3SA 3Q3JB 3ORFA 5KX5B 1Q1ZA 4LYDA 5CA1A 1G8HA 1YBHA 2E0IA 5KMGB 1VXRA 1PG2A 4LQLA 3HBLA 4YRFA 1BMQA 1RMQA 3KKQA 5E0OA 2OKCA 2IWRA 2OCKA 4G89A 4EUFA 1E0JA 2BGRA 4MV4A 4MQEA 3A2NA 2OZKA 3UMSA 5FI3A 1KR5A 4DWOA 4PICA 2ISQA 3RWMB 4PHTA 4MQLA 5ESRA 3UFXA 4X41A 4AUKA 3H6KA 3I3OA 3K30A 3MJCA 4FD2A 3THWA 2ZITA 1WUYA 3KCQA 2O8DB 1HURA 2Q8PA 2GAIA 3FY4A 3N39C 2DU8A 1JG3A 3ZDFA 4QXOA 3ZDXB 2HSJA 1OWOA 5AW5A 1XIVA 2F48A 2Z2JA 1JVNA 3SXUB 3DGFC 3B53X 1HBJA 4D74A 4AMUA 1KI9A 1SXJE 1UDCA 3L3BA 2Q2WA 4IVQA 1RCUA 4RZUA 1EUQA 2HMVA 1R9GA 1Y3AA 4K88A 1UT6A 3KD2A 4X9XA 1ECJA 1OH8A 1VYVA 3WDMA 4BPBA 2E49A 2Q4OA 3O6VA 1QCDA 3INGA 4RA6B 5CB4F 1PI3A 4C3VA 4QDUA 5CBPA 2OHFA 3ASZA 1N25A 3A11A 1Q1QA 1NQVA 2J7PD 5A4AA 3DXYA 4LXUA 5ALXA 2ZBPA 2B6NA 4CM8A 5L3RA 4ZYYA 1WOYA 3K05A 5JFGA 1Z8FA 4HNVA 5J23A 1Z3IX 2D0PB 3DSRA 2J8ZA 1RXIA 4Z3OA 3BA6A 5H4HA 4YWHA 1IY2A 4EFNA 3TZ6A 5FV4A 2V7GA 3RF6A 5CCXA 1N75A 3KSRA 4B2YA 5IWCA 3MB8A 2H4XA 1IRIA 3KQLA 2G08A 2ECKA 3H9GA 4YNBA 4YRBA 3OJEA 4YCSA 4MPRA 3OQBA 1A69A 2BKAA 3C3PA 3KE9A 4HNHA 1AUOA 1QOZA 1MEJA 3IPLA 1DNPA 1T3LA 4PEVA 4X97A 1MHPA 3DBVO 3EFOA 5E4FA 3SC2A 4KIWA 1T1GA 5GPBA 1Z0DA 3LNCA 1NBEA 5AXBA 1HYBA 3RD5A 5B1DA 4G8CA 1DWQA 4TMWA 2CLFB 4Z9BA 1JILA 5TMBA 3KFLA 2HIAA 1A9YA 4UAGA 3VO9A 3OQPA 2V58A 1NJ8A 3LQYA 1S96A 2OFPA 1Y3BE 2Q1WA 4MHSA 3TTUA 4U7PB 1Y8AA 4AXXA 3TEMA 1M6YA 4PVDA 4L5IA 1QORA 2A14A 3CR8A 3UAWA 1KYVA 1NJ6A 1SOUA 4KO3S 1ABEA 1XPRA 4UBMA 3R7BA 4EO7A 5TPZA 3WGHA 1U9IC 2C7QA 3CX8A 3MBOA 1C1XA 2BFCB 3EQ6A 3RU9A 4HNQA 2YYZA 4J0KA 1MENA 2OV2A 3KVYA 1A5AB 1GPNA 2AG1A 1UINA 2EW1A 2QYHA 2AEMA 5JXHA 3V4LA 4Z54A 5K0JA 3NDRA 3PC3A 2JZCA 4RFVA 3LZCA 3EVGA 2E4AA 2VJNA 1BN7A 3RS5A 3AR3A 1T2FA 1X7YA 4MB2A 4F60A 2OILA 3V6LA 3OUTA 3VI4B 2BOVA 1A88A 2V7XA 2VWQA 3ACBA 2QOEA 3H5NA 2PUBA 4DV7B 3DVLA 5AOVA 1MPXA 3GG2A 3WO0A 2PV0A 1DFHA 1ONOA 1Z37A 1W52X 3P4XA 1DV1A 4TRNA 2C29D 3OFVA 3RVLA 1RI2A 2WILA 3W2FA 5LN1A 3WVNA 4G0MA 1Z6ZA 2OLKA 2ZT7A 3UC9A 5AW6A 4M46A 3WBKA 3RREA 2XYGA 1V2HE 1SVUA 4I7EA 3ETLA 1YQ9A 3KT3A 3OCXA 4JDPA 2W2KA 5FNVB 2R8OA 1A9RA 1D3AA 1AQ6A 3R0VA 4ZKEA 1P7CA 1IN6A 4V0OA 1C3VA 2B5VA 2PT5A 4TLMB 4RWEA 2UZ4A 1WL8A 1MMFB 4XGNA 1C4OA 1X7DA 2ZBVA 3FYDA 5I3ZA 1DBPA 3QBVA 3V4OA 3ZWVA 1W36C 3HXOA 5KJFA 1QZ3A 5A3QA 1TKRA 3D1VA 1YZYA 3O8BA 4L95C 5I5EA 5K9ZA 4FS8A 4Z4QA 5JJIA 2XVAA 2F3TA 5CGZA 4LQ4A 4LX8A 2F90A 4GPAA 1X9HA 2XNSA 4N5DA 4E4YA 1AMUA 3ADDA 5D86A 1M6HA 2I66A 2I5PO 3EDRA 1B00A 3KB6A 4AN1A 4G97A 4WX2B 4FYKA 4K0RA 2WT8A 4FE3A 3CUYA 4TWJA 2BFBB 3E9QA 4OA5A 4WCVA 3T38A 4I4TB 5LFAA 1AOXA 4BO7A 1NY5A 1C8VB 1M2JA 4FYJA 1GRVA 4WNIA 4XCQA 3SSNA 4DE5A 4FB4A 1N36B 1EK2A 3VVBA 1NPYA 4UXJA 4QASA 3NHJA 1XDWA 2ICAA 1SCNE 2L2QA 1OWPA 2Q5JA 1RRVA 1QG0A 2XGGA 2YXLA 7ABPA 3HJCA 3JAWB 4BJHB 1LUAA 2CXOA 2X2OA 3I1IA 1ESCA 1Z6YA 5ULLA 3GBVA 2BGGA 1CQXA 1L4LA 3MD9A 2A9JA 1C30A 3PA6A 4JS0A 1QXSA 4Q9LA 3OIWA 4BLSA 4ZEMA 3K1YA 2VP9A 2WAYA 3JAMA 4II2A 2I3GA 1DBRA 3CRNA 4ETNA 5JBQA 3GNLA 2E5WA 4NSNA 4A27A 4J7AA 2JLZA 3KPJA 2KBFA 2ASEA 2Q2QA 3I6QA 1QHNA 1GAXA 2PJDA 1D04A 3VZDA 1A3CA 4BLOA 1Z9BA 1TFUA 1KS2A 1E3EA 1K0UA 3AETA 3IUPA 1ND6A 3IVRA 2XKJE 2WWGA 1C41A 1DCKA 1ZAKA 3AR7A 2EGGA 3I30X 3KB2A 1PT6A 2PQ6A 3N76A 5FTWA 3ZHBA 4HYYA 3DZCA 4AJHA 3WOHA 4OYHA 2G1KA 1RAEA 2HDWA 1U0LA 3H2JA 4RHEA 4HMQA 3GB9A 2JEZA 3ETDA 3RUHA 2FPKA 2ZYDA 1G3MA 1P3Y1 4EG6A 3FOEC 2QBYA 1HK7A 2QEQA 1U2DC 4LA4A 1HNNA 5FUYA 2BMDA 4RVCA 5CLIA 3U4QB 3O95A 4HEA6 3S3TA 4N5NA 1EUDA 4QM6A 1NJSA 3EIFA 1IHUA 1V45E 3DP9A 4JYMA 1Y4AE 3GJ4A 4Q3NA 1VL2A 2XWPA 2YMMA 1JIJA 4YH1A 1F2UB 1F9AA 1Y8RB 4O25A 5BV8A 5LIPA 1QP4A 4TKUA 5DGXA 1VPTA 1G3QA 3UH1A 4E88A 2IXGA 3WICA 3R0QA 3SQWA 3ZI4A 4JL5A 3GH1A 8AT1A 1GZHB 1K97A 1U5CA 1K6JA 2EQBA 1N57A 3RSSA 4Y1EA 3OF2A 3K9WA 1JEJA 3CZCA 4JA0A 4RQTA 3LDAA 4U63A 1O4WA 1R3DA 1M74A 2XLCA 4HB2A 4M53A 4AM8A 2HQSA 2QQEA 2SICE 3EX7C 2FMKA 2ZR7A 3K53A 3A6PC 2C5AA 2M1XA 1YZFA 2IYXA 2VDOB 2ZI3A 1EYZA 4YAFA 2ZJ8A 5BVHB 1SOWA 4JJFA 3TSZA 3WDLA 5KSZA 2LIPA 1RKBA 2QRGA 4I19A 1FDRA 1QIIA 4IF6A 1FPMA 3NP9A 4UJ3A 2Q6KA 3V97A 5B4VA 5HX7A 1XTIA 5BVGB 1WAMA 1YKSA 3CX4A 3UAOA 5AOAA 4A16A 5EZ5A 3PTAA 5F64A 3QKUA 5KB3A 1NIPA 5FI5A 1H4SA 3L4SO 1U4OA 3H4MA 4A8JC 1ZN7A 3L7YA 2J59A 1YE8A 2Q41A 1QQBA 3CHYA 1JFFB 2ZETA 4NU5A 4P82A 3RWOA 1QQAA 2J7PA 5TPWA 3TLYA 4D4JA 1ELOA 2XNDD 3WL6A 1AGYA 1FNMA 3TR0A 3A6GA 2IUFA 3FPEA 2FMTA 2JIDA 2PZLA 4WCFC 2QZJA 3OZUA 5KYYA 1YJ5A 4QC2A 3OQMA 4EZIA 1E8NA 4MMXB 2P9JA 4C4YA 5MFPA 1RYEA 4WCDA 2H1CA 1ZGGA 1VPVA 1YR2A 2LKDA 2R48A 3A3KA 3WKEA 5C4IA 3FWPA 4AMVA 3UUWA 4YRDA 5HZMA 1W4BA 1LQUA 1OTYA 2RD2A 2QQGA 4UMDA 1T9CA 5JH7A 1E2DA 5D01A 4KMRA 2XCLA 1DKLA 3EHEA 3EDMA 2R79A 3RS4A 4ZMBA 1AN9A 2Z1MA 5TQ0B 5K0GA 5J2TB 1VL1A 2IYQA 1AN0A 4B3RB 2C42A 4BX2A 3FDXA 3STTA 1JE1A 5BQ3A 4PAGA 1ISFA 3QEJA 4JWKA 1SBHA 3ZD7A 1IWPB 3ZDEA 1YR1A 1ZW1A 3DTYA 3GZNB 1TVKB 4FCCA 4TOIA 4FGKA 4JP8A 1AA9A 4R05A 4O4HA 3T7RA 2WQZA 4AFNA 1U7HA 3QBEA 3A1TA 3I23A 3VPSA 1M1NB 4DPMA 2Y8EA 3MELA 1OH5A 1NUSA 2HWWA 2OBYA 2ZS8A 1MT0A 1CP2A 1TZJA 4DCMA 3O0TA 4BGVA 1XMSA 2FYTA 4PQRA 3MTJA 1DBVO 1XYGA 3D2CA 2J0UA 1K63A 3EC1A 4RCYA 5F35A 2C82A 3EUAA 5BWNA 1Y98A 5KJ1A 1TM7E 3ZBTA 3IA7A 5K6RA 3NFYA 2I78A 1OB2A 4NE2A 4GP9A 1JHVA 1BHSA 1QG4A 2HDHA 4K9PA 5DI3A 2IXDA 4JODA 3MEQA 5JYEA 1DXOA 1FNNA 4Q0MA 3GFQA 1E2EA 1I1OA 1WKVA 3DXZA 1E2HA 4XQGA 2MYTA 2P0AA 3LX6A 2CBZA 3COYA 1AXGA 3T15A 3QE9Y 4IIFA 2AN3A 2I2FA 1OX6A 13PKA 3BGOS 3GLHE 3V55A 3R9XA 3EH2A 4BWFB 2CJXA 4BNZA 5FPQA 5LQJA 2IX9A 1E6WA 1Q0LA 3U7FB 2WOJA 4GZ3A 2CDBA 3ROQA 9GPBA 4R41A 3LT0A 1B3BA 5HIMA 1OWLA 3WGMA 5FXMA 4TRJA 4PZ9A 1TW3A 2P4EA 2IOFK 3NHUA 4KG7A 5JWOA 1MH1A 2FU5C 2CUTA 1NXWA 3H7IA 4MP3A 3VVLA 4C0BA 1KZ4A 1GG5A 1TF7A 3MG9A 1TLTA 1YD7A 2VFAA 2NO9A 3MT0A 2OXIA 2H9YA 3PEFA 2C7GA 4LJ6A 4OJKA 3ABQB 4RTKA 1BE1A 1N0UA 1N2EA 1WDKA 5A1TA 4JV5B 1CJUC 1SB9A 1NE2A 1I2DA 3ZBUA 2WYVA 4WESB 5BSKA 2DFKB 2RB5A 1HXHA 4R1NA 3S8MA 4ZYLA 2XT6A 5EJMA 4U5XA 1BHJA 3A9UA 3IUSA 1RW4A 3L46A 1UOQA 1L5QA 1YKGA 1TQDA 2G0AA 3TIXB 1H3FA 1B1AA 2Q7XA 4W82A 5FHQA 1ZVMA 4D46A 3RAEC 1YCDA 1JDTA 1MT3A 3G5AA 5DULA 1GTSA 4FFLA 4RF2A 5EQDA 2AYXA 1VI2A 3QLUA 3UK6A 3WWCA 3WI7A 1JVBA 3E4DA 1MNQA 4RK4A 3WRYC 3V1TC 3ASYA 4I4NA 3T34A 3PGVA 3QJYA 1ATIA 2GN6A 4TN5A 3TR6A 1T9AA 1KSGA 1FXWF 1WQ3A 2PH1A 4HZIA 3W8EA 1R0LA 4WSOA 3THXA 4OKSA 4HG2A 2LCQA 4DWJA 3IELA 1QIJA 3L0YA 2XJ9A 2X14A 2CVZA 5FA6A 1I9GA 2G6TA 1NFRA 1JU3A 4GPIB 2JFUA 5TGTA 2PKQP 1D8AA 1PD0A 3EZ6A 3SLRA 1FTWA 4NF2A 3S28A 2LXNA 4GL2A 2Z2YA 3F71A 2JIOA 5K8LA 4I4CA 3WTCA 3QE2A 2J6HA 2GBLC 3IPCA 3TI7A 3DYIA 1AKQA 2PXXA 2I67A 3AEXA 1Z0AA 2Z56A 4YJGA 5L8VA 4GS5A 1Q1NA 4HVAA 5JZBA 2ORYA 1PR3A 4P4NA 1OUMA 2FFAA 4RIGA 4MUYA 4EMBA 1REQB 3ZDDA 1YCGA 5CW1A 4CE6A 2XWQA 5C7OO 1XEWY 4DQXA 4KQGA 4Q1DA 4GVLA 1F8UA 1JEQB 3AYZB 4RPLA 4X84A 4YACA 4QA9A 5COAA 5JAIA 4TQUS 2JIQA 4D97A 4NLLA 3RVOA 1UDAA 4IVPA 2GLUA 3A4TA 3DLPX 4WVLA 2HK9A 2P6MA 1GNTA 4R51A 4BQPA 5K0BA 1RLOA 1T1SA 4ZT2A 3OPVA 3WA7A 1MC1A 3QLTA 4BEVA 3W4KA 3BJEA 5CLGA 4IHAA 4BNHA 1KDZA 4WINA 3NU1A 3I5UA 3INNA 4IV0A 4JQCA 3L6RA 3Q7RA 3LBHA 4GBMA 1B2LA 3BICA 4FBLA 2WD7B 3KLPX 1B93A 3QFSA 4RGYA 5DEIA 1RZUA 3IPRA 4AG5A 4CQJA 5CB4B 1XTJA 5I45A 1UADA 4A0FA 5C3UA 1G17A 2I2DA 2UZ0A 2C2GA 2A3NA 3ZQ4A 3N6VA 2B0CA 4RAOA 4TLLB 1UBOS 4PU0A 2XUIA 3PFIA 3IXLA 4RQUA 3WP0A 3RV4A 2B1QA 1DXQA 4INZA 4LDPA 3KWFA 1G7CA 1H8ED 2DETA 1E2JA 3CNEA 4E12A 1GARA 4FVTA 4QECA 5DOZA 4YCLA 5LNK6 3EG9A 5CITA 4MWOA 5LC1A 2PO5A 3P97A 3QOYA 5FWDA 4OATA 5J1TB 5I7UA 3ZK9A 1E1CB 4ZOLF 1UFKA 3CUTA 4OLHA 4OHZA 3SJ7A 3KUXA 3FTDA 4IDEA 2CMDA 2IKQA 4RXTA 2AG5A 1WMSA 1PV1A 3KB1A 5EEHA 1NLZA 5BMVA 1VRVA 4NENB 4E11A 5BURA 1CY6A 1R6XA 3HHEA 1I4DD 3NNDA 4OV6B 2XNDA 3Q0TA 1R8XA 2WF8A 3I64A 4JBNA 2QNRA 1QGED 4P36A 2Y9MB 3T9CA 4M1EA 4U3JA 5JJCA 2X4LA 5BR1A 5HF5A 1FS5A 1Q0SA 5ISMA 2N0SA 2NVWA 4EG0A 3H83A 3OFJA 2VUTA 4NDZA 4BLVA 3PQ8A 5D6NA 2WV9A 1O0BA 3GBPA 3T1NA 6GPBA 4AZVA 3FWNA 3RCBA 5DFAA 4HN2A 3VHRA 4BFVA 4ZI7F 4P86A 5K2OA 4PX9A 2VDQB 4DZTA 4BXOB 3N3AC 1HC7A 2V6MA 3VC2A 2JJ8A 3UFBA 1D0IA 3BH6A 3V2GA 4OIFA 1T3TA 1I7QB 4MUIA 3WWYA 2NZVG 4DKXA 7MDHA 1OA0A 1YVPA 3AFGA 1WJGA 3HCRA 4QXRA 5AHKA 5AKGA 3WXMA 2IVFA 1ZDMA 4OHFA 1GAQA 1L5MA 3ICPA 4H1WA 1UPBA 3WGKA 2WSLA 2Q9UA 3BDIA 4URXR 1ADFA 1OW3B 1YB4A 2IP2A 3EBLA 3H9JA 3OZBA 4KDRA 4ITUA 3WLNA 4CDMA 1UR5A 4Z4GA 2XTAA 2Q0SA 4GMGA 2J30A 5CA0A 3EVTA 4XQEA 3SIXA 4OP1A 3NT5A 1BOOA 4PO9A 5EXEA 1VQ1A 4EFLA 1DPFA 1NULA 3H6HA 4ZALA 2DQZA 1YI8A 2ERXA 1CNMA 1NBIA 2PG3A 1B0ZA 4HYEA 3OA0A 4UUNA 4F5WA 2E7ZA 1WMBA 2AXQA 2HT6A 1CZLA 3MJTA 4TL8A 2PKWA 2Y1FA 3TKYA 2AN5A 3DMGA 3O1HB 1UM9A 2J4FA 3BE6A 4ZI3A 2NQ2C 2VJDA 4Q7LA 1C2TA 4HBZA 4YV7A 4S2UA 4YJ3F 3GJXC 3ZLUA 3AF0A 1I3OA 2R84A 3AUTA 4N4AA 5D7BA 3TUJC 2OBXA 4O5AA 4EA9A 4FFWA 3ZWPA 3GLGA 4XSHA 1KP2A 3CQ9A 4TSFD 3ZHYA 3I2HA 4HQ0A 2H2HA 2JBWA 2NADA 1E9VA 1VGRA 4N6NA 4O2BF 4WBSA 5EQFA 2P6PA 4L4ZA 1X80A 4KHPB 1K7SN 1EQAA 3ZHVA 3FNRA 1TA4A 3D7LA 3EAQA 3HJTA 5GTDA 1TMGE 2ZLBA 1V7PC 2GZ2A 4Q66C 3UK0A 3WJAA 1B43A 1FFEA 2NX2A 5F23A 1P6XA 2QRKA 1PZXA 2IPMA 3AEUA 4LZLA 4LPKA 2CLKB 1G21B 2F1HA 5H5JA 4RDCA 1F9EA 4LBYA 4ECAA 1N3YA 2VJPA 5F4ZA 5JQGB 1N8SA 5ESXA 1VIYA 1PQPA 1S3FA 4H7JA 4O1HA 3QKTA 3LVRE 1DPGA 4WKCA 1CUYA 4X95A 3UIEA 5BXQC 3DAGA 1PJ8A 4QAQA 4ZT7A 4K7JA 2R1TB 1NOIA 1O94C 1ONPA 3DFIA 3DKRA 3EEIA 3E3NA 3GD5A 4NMWA 1NKTA 3K0CC 2LTAA 4MCAA 5JNSA 4X5OA 4TMVA 5HMMA 1M1YE 3FX2A 5ALWA 5FWNA 4M9UA 5IFKA 2XCTB 3F6CA 2V7QD 3R3XA 3N8HA 4N9QA 4GVXA 4DC1A 4UVGA 4GX1A 1FP6A 2AI2A 1P2DA 3F0TA 3LW7A 4Q7KA 2ZBFA 1T8SA 2YS6A 4R69A 5BWMA 2QU8A 1ZAYA 2XVMA 4K9OA 2B2CA 3UGQA 2IVZA 3MLEA 4BN4A 6CHYA 3W5CA 3KQNA 4DSTA 1OYVA 2JATA 4ENVA 2IK8A 3LWBA 1QPGA 2ZT6A 4CMAA 1XVUA 2LGJA 5H81A 1VBFA 4MINA 1HOXA 3SCZA 4QOJA 4EHIA 3BWCA 1YZLA 2BEWB 3CO5A 3RJTA 4EKEA 4QARA 1QO9A 1RQXA 2ZQYA 4JVOA 2PUEA 2DB3A 3P9CA 5FWYA 3KQUA 1E94E 3G17A 3RADC 4B17A 4MUNA 4Y9RA 1R27A 1Y3DE 3H1TA 1ZLXA 4DGSA 3GVIA 1H1LA 1R8QA 2AC7A 5HTOA 1T35A 2ZS7A 3NXSA 1KMQA 2QTRA 1U7WA 2QD1A 4UJ5A 2QAIA 1BCSA 2NU7B 3AJ9A 3IMEA 3M8KA 3HCFA 4JB8A 3H0KA 4LRXA 4UDXX 3GFPA 1PBNA 3TQOA 3QVWA 3TIGA 4C05A 3S8EA 2GN4A 4R7GA 3FI9A 4PBSA 3S55A 1ZM4A 2J9RA 2QMZA 4NPCA 4YAWA 1WZEA 4QYIB 2BMAA 5BQPA 3PR1A 1PF7E 4G1UC 2O0MA 1NYQA 3MAJA 2A7XA 2X8WA 1IOVA 1OMOA 3QU9A 4PM4A 1T36B 1BAPA 3HWWA 3PFWO 1LLQA 1KDYA 3WWPA 1ZK1A 2EL7A 2OHXA 2OL4A 3KKPA 1L4YA 2OQVA 3FTEA 1TCCA 3BMCB 4JP1A 3Q6MA 1C3OA 2ADMA 4Q18A 3N53A 4RW0A 1B0UA 1K8XB 2DLDA 3ZWMA 1OFIA 1ZINA 3FLMA 2E6UX 4LDRA 4YMWA 5C80A 2QUZA 3KKKA 3FSGD 1HT0A