3LTNC

Inhibitor-stabilized topoisomerase iv-dna cleavage complex (s. pneumoniae)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
226
structure length
222
Chain Sequence
KLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTAKAKMADILKNEEINTMIYTIGAGVDFSIEANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIALPPLYKMSKKGKKEEVAYAWTDGELEELRKQFGKGATLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDNVKFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA topoisomerase 4 subunit A
publication title Structural Basis of Gate-DNA Breakage and Resealing by Type II Topoisomerases
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Isomerase/dna
total genus 54
structure length 222
sequence length 226
chains with identical sequence D
ec nomenclature ec 5.99.1.-:
pdb deposition date 2010-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus
C PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.670 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ltnC00
4Z4QA 4G0VA 3K9FC 5EIXA 4I3HA 3FOFC 2RGRA 3RAEC 4KOEC 3KSBC 1BJTA 4J3NA 2XKKA 2XCQA 3QX3A 1BGWA 4KPFC 4KPEC 2XKJE 3LTNC 4G0WA 2XCOA 2XCTB 3RAFC 4FM9A 3RADC 3L4KA 4Z3OA 2XCSB 3L4JA 4Z53A 4G0UA 3KSAC 3FOEC 2XCRB
chains in the Genus database with same CATH superfamily
2C9OA 4U7PB 5IDQA 3FCOA 1JF8A 1ECPA 2Y1FA 3HO6A 2V7TA 4CTOA 1SCNE 2VUTA 4B4UA 2B4KA 1IPFA 4OYYA 2CHQA 4RGQA 4EZEA 1GFIA 1PFUA 1AQ6A 1A9SA 3FCAA 2UVQA 6REQA 3W8RA 1OZFA 1C9YA 2G5CA 2HJVA 1BMQA 3QA3E 1CZNA 1K7FB 4JLWA 3S1AA 5HK8A 3LQ1A 5AQ1A 3OO0A 3QU9A 4JXJA 2BLNA 4PSVA 4Y0VA 1L4EA 2D5AA 2I4IA 2WV9A 1E1CA 3TLKA 4TKUB 3JCZA 2FMKA 1G55A 4FCCA 4X41A 4UMEA 1KWKA 3GNTA 2YXNA 1QDEA 2CB9A 3HBFA 2X5OA 5DYGA 4B80A 2QP3A 4AN4A 3IE0A 3ED1A 3TW0A 4AJIA 5CEFA 5A06A 1GTSA 1R6XA 1KOGA 2I1QA 2IBMA 2Z30A 4UZEA 2IGTA 1MRZA 1Q92A 2AQIA 1EUDA 1OH7A 3UB4A 1JMVA 4PQYA 1OKKD 1VKZA 2W71A 3PI6A 4PG4A 3W2HA 4C76A 4E5MA 2HH9A 2QAGA 3N2IA 2Z2XA 3WC4A 3QXCA 2NO7A 4RZIA 1WXHA 1N75A 4P5PA 4DM4A 1L5FA 3D43A 4YRAA 3L0SA 4TT3D 3WMEA 4ZQGA 1FUEA 1FB5A 5FUWA 3CF4G 3M5PA 4WCFA 2P2NA 2CJWA 4GPZA 4XB6B 3ZGOA 3COZA 5IC4A 4KG7A 2QGZA 4E03A 1CZUA 3C98A 3M1LA 4YJFB 5C35A 2HJGA 3F6PA 2YZMA 3RG8A 3THWB 4Q00A 4WBSA 2SHKA 3PC2A 5BQ5A 4XIYA 3PQ7A 2XYPA 7MDHA 3T5PA 5TVGA 3DOIA 1LDBA 3QG5A 1W30A 4N3NA 1R00A 1BDIA 4RF4A 1Y9DA 1T9ZA 1E79A 4X1YA 2XTNA 3Q7RA 2ZRQA 2QX6A 5HF9A 2VQFB 1T3HA 1CS0B 1YOVB 2MWMA 2EEPA 1M34B 2MJLA 3EH1A 3KQYA 4QWMA 4CM8B 4EPXA 5AW0A 4GM4A 1F7VA 4RVHA 1TCBA 3WNQA 2AZXA 3BMOB 4ERNA 3AB7A 5DHTA 3DVAB 5DV9A 1IAVA 2WUFA 5JZBA 1ZN7A 3Q85A 4A8JA 1M75A 1QVVA 1FMLA 1YQUA 4MW4A 1ENZA 1Q0TA 3B12A 1DVRA 4E1AA 1T35A 3S2ZA 5I7OA 5G40A 3MT7A 3GJYA 3KK0A 1JBQA 4LW8A 3ZZMA 2F9MA 4R51A 3OM0A 4R81A 4EY4A 3O21A 4L0QA 1C0PA 2QQ0A 3EXFA 3RU9A 3D6NB 4WT7A 2RSLA 2IYRA 3W5IA 2ZT5A 1BA2A 1O77A 2P9ZA 2PQ6A 5H80A 3SXUB 1WVIA 3FWNA 4QNMA 3W5DA 3LUJA 3SSMA 5AVUA 3A7DA 4I36A 4ECEA 5JNUA 1MG0A 1GKYA 2B78A 2J59A 3ZY2A 4LC1A 5LQRA 1DAOA 5EESA 1EVYA 3JAWB 4B9AA 5KNBH 3SZGA 3C5VA 4RDXA 4JXXA 3NBAA 3ZDRA 4N5MA 3H0CA 3TZHA 2XQJA 5KMGB 5KNDA 4Y18A 4GKKB 3HB4X 4JBYA 1DGQA 2QRQA 1YE5A 5JYBA 3ZCTA 4EL5A 4WFKA 1X70A 2XUZA 2YFYA 4EUKA 1JALA 1BYUA 1W76A 2ZSEA 1P5HA 3MTJA 5EJMA 1OHHD 2XYGA 3R0JA 4E2WA 3NIFB 2Q1WA 1QYVA 1SWWA 2QMQA 4UDNA 7AT1A 5AK0A 4WLUA 4KITB 5KYWB 1I1NA 5EXTA 3MOIA 1H6DA 3E7XA 1A2OA 1PGJA 2E49A 2VDUE 3E3OA 2AHRA 3RAEC 4UHFA 2HOQA 1XEFA 5ALDA 5F21A 3QYPA 4REOA 1PR4A 4MWTA 3IOEA 4XSHA 2P4SA 3OT1A 4M0EA 2OQVA 1Y3IA 1JG1A 1F2TB 3I2YX 4AULA 2OGTA 3LQFA 2BGUA 4KMSA 3VJLA 1DC6A 1Q7BA 3CWCA 1WO8A 1KY3A 1C7RA 2V4MA 3OKAA 5K05A 3UO8B 2PAFA 4PY2A 4G09A 1OWLA 3C8DA 4XA8A 4US2R 3TQCA 2WNIA 3ECAA 1YR6A 3CHYA 1RHQA 2EQ5A 3ETEA 4L5IA 1D9ZA 1EVLA 4RVFA 4H9GA 3R4CA 4XTRA 4IIDA 2VJAA 5KJ1A 3VC3A 4A8HA 2B4QA 2CY0A 3FA2A 1W48A 4EBBA 4HDQB 4A8TA 2WVJA 4MDEA 3W1WA 2R9VA 2VEOA 4OG2A 4ZDKA 4Y6OA 4B4DA 4ALLA 4D0RA 3IEKA 4D26A 3CEHA 4XJVA 2EJCA 3GPLA 3NRJA 1MH9A 1E5DA 3VKWA 3O75A 4EGJA 1OWMA 2VIIA 2FW0A 4IIVA 5IP5A 4PCUA 2Z2IA 2QJWA 4LG1A 1OFTA 1YAHA 5DHQA 2BKAA 2GF9A 2EW2A 1B23P 2CHVA 5EZYF 4RNDB 2FN4A 1UJCA 2WAMA 3BH0A 4OHWA 4JP2A 4BX8A 5B7GA 1WW8A 2HU8A 2P27A 4QDXA 1CC1S 3CWZA 3PKZA 4HTAA 4JS0A 4U2DA 3T9FA 4OQDA 3PHBE 3G2HA 2JFUA 5DTRA 4XOIA 3HU5A 3HG7A 4DQ0A 2XLBA 5C0OE 4KTTE 3SFZA 1QYWA 4DA9A 1Y8QA 4J9UE 4MGEA 4DV4B 4Q4JA 3LF2A 1JJFA 5E4YA 1Q14A 3D8NA 5KWJA 4IJ5A 4NENA 2JBAB 1T4CA 1X38A 1E32A 5E7MA 1A7AA 4C3ZA 4UMVA 1YHYA 2ZBQA 3PDCA 2HN9A 4RDIA 2PWBA 2V5VA 4UZFA 4XWAA 4L73A 2O3JA 1KI7A 2RH8A 4E5SA 1P1CA 4E6EA 2IW1A 3ICPA 5KSWB 2RD2A 4LZPA 4Z9BA 5HGJA 3K30A 5KSOA 1R4MB 3KB2A 2OLEA 5CVVA 5FEMA 4LYYA 3WI7A 4CKXA 1DX9A 3PXAA 2Q2QA 1ONBA 3D1JA 1JZQA 4FOSA 5BN4A 4IH4A 3RUDA 3A4IA 2FN7A 1P2TA 5HUQA 1GTG1 2HGSA 2WU3A 3L0CA 1T1IA 4IX9A 3LOQA 3BMCB 4MKFA 2UUBB 3VX4A 3G3EA 2C58A 3QXGA 1GZVA 1N9ZA 2BEKA 4WLEA 5E2AA 2PUBA 2ZFUA 5AOBA 2FZCA 3AM1A 3JY6A 3U7QA 2QTLA 4DUYB 1ZOSA 4J1SA 3WLSA 4DC1A 2H4ZA 3C85A 4BB5A 4BLVA 1U0BB 2XA1A 3C70A 3NTUA 3OZCA 3I9KA 5CJ2A 1R5NA 1X3LA 3INRA 1FDVA 4ZYTA 5A3JA 3T99A 4XYEA 2Q45A 1ODIA 3CFYA 2ORYA 4YIHA 4PSKA 5JNSA 4Z7NB 1SD5A 4R98A 2FF5A 2OC9A 1AV6A 2FQ1A 3DTNA 3QK7A 4RJIA 3Q6MA 4PAOA 1UDCA 2ZAIA 4DGQA 4ZODA 4X9XA 2GN1A 1Z0FA 1Y7HA 3ZLBA 4TMWA 3FVVA 1YZQA 1QLHA 1G63A 2KX7A 3IPRA 2VPIA 2VPQA 4KZPA 4YRLA 3SIXA 4EHNA 4Z6KA 1X80A 2RHOA 4K6HA 4CV2A 5HYVA 2F8TA 3CNEA 4YJHA 5TT1A 3Q3HA 2NZYA 4FSDA 1GZHB 1G5TA 5JAZA 1C9EA 2VBFA 3RVLA 1JXMA 1AGYA 4OHBA 1AE1A 1BCSA 1JHRA 1GG2A 1GRQA 1L4LA 3K2EA 4B47A 1HK7A 2B9EA 2WJIA 3DZCA 5DGIA 1X6VA 4Y6SA 5TQVA 3RIHA 4P7BA 4S04A 1Q3TA 4R2IA 3DV9A 4YP6A 3H04A 1GZ3A 1G3RA 4MWDA 1PS8A 1L5LA 2XKKA 1EX9A 3HUTA 4FD3A 2YS7A 1UOPA 2Y1LA 1BXKA 2JKYA 2AWOA 1YQDA 2Y27A 2O8FB 2H59A 3O95A 3ZUGA 4B0PA 3V1YA 1XLTC 1RDFA 4PZAA 3E5MA 4QDZA 3KCQA 4G81A 5NULA 1ENOA 4J6EA 3EWSA 2RHMA 4QUDA 1JQ5A 3QI7A 1LDMA 2EC5A 4S1VA 3FCSB 5EHGA 4AVYA 1NVEA 1ZLYA 4L0DA 1D4FA 3ESZA 4BS9A 2DPLA 2J0SA 1UFRA 2EKZA 3WB2A 1FRZA 2ANCA 4AMVA 4LX0A 3V5NA 2I2BA 2CN1A 5FX2A 4UKDA 2D4HA 2CD9A 2C1ZA 3KKPA 1GNVA 4C4AA 1ESEA 3OLZA 2AFRA 2ORVA 2ZTLA 2JJ2D 3GDHA 3V1UA 3K70B 1EKXA 4A2WA 5J58A 3VYWA 2RGNA 1KZYC 2NZ8A 5IYZF 4US0R 1R88A 3R4VA 1C1YA 2QVZX 1JDBC 2WM9B 2VN8A 3IVGA 1J33A 3OZEA 3FY4A 3P4YA 1WZCA 4AUNA 2AQKA 1RC8A 4CEJB 1P60A 5FI1B 1MZPA 2P65A 3V42A 1G64A 1SD1A 3ZWYA 2HIGA 3BH6A 1TKAA 2PRYA 2FK7A 3B9PA 4HB3A 1DV2A 4RL4A 1ZZGA 3L1VA 5HBRA 1VL5A 5FH9A 2OVFA 3LX8A 3HV0A 5AJZA 2O1WA 5F33A 4CLOB 3DEFA 1Y1TA 3IQEA 2X0EA 1VJDA 2V54A 1HDEA 3A9UA 3QPUA 4NSNA 3ZYCA 3N75A 3WSWA 3UK6A 2Q9BA 2IODA 3EGXA 5TR9A 4B0OA 3GLGE 4MVJA 3KVOA 4LF8B 1L4NA 1K4YA 4EG4A 1CIPA 2EFHB 2OO5C 3ESCA 3TLEA 3BE6A 5I7RA 2ZULA 4F4JA 2JGAA 3COVA 3N0WA 4PFSA 2W42A 3DOFA 1EMDA 3UEOA 3DW3X 1PIWA 1K4KA 3IR6A 3BG5A 2EIXA 2K2QB 2XSZA 4L8VA 2V03A 3DKKA 2G7MC 3QE3A 4EELA 1QO9A 1SVOA 1BJTA 3RU7A 3GOHA 2GX6A 3K8QA 3QBJA 4B2LA 4B4KA 1RKXA 3P9PA 4I1IA 3KJGA 1PL7A 2J07A 4NULA 5J5CA 1VQ1A 1YRYE 2XWPA 1EVIA 4QWWA 3EZ6A 2QX8A 4A2QA 5EGNA 3VSBA 4BIIA 1XZQA 2QRZA 2X0NA 4U7WA 4F6LA 3NJRA 1BOFA 4ISCA 4DN6A 4IXDA 2QYHA 2ZUSA 4H3KB 4ZI5A 1MOZA 3ROFA 1CDOA 2ALJA 4HDKB 5JEEA 4XWGA 2A7XA 4MKZA 4HMQA 3IX7A 4RCYA 5JS7A 2JLAA 5BPFA 4GXTA 5CT6A 4PONA 3BRSA 1E6EA 4OFXA 5AKXA 4KGDA 1YDMA 1GNSA 2B37A 3VBCA 4GXQA 1K9SA 4D41A 5BVHA 5LP6A 3CUSA 4J7XA 4G1EB 4I08A 3SQWA 1VPWA 5CA1A 3DEIA 4X7PA 4DQDA 5KU1A 1WQ4A 1H2BA 3TQRA 2OXRA 2OCBA 1OT3A 1XZPA 3SHWA 2B34A 5A9SB 1OBVA 2EZUA 4KZKA 4WDQA 4C04A 221PA 2A0XA 4OX9Y 1U8TA 2BP7B 1W5EA 1M2FA 3C1AA 2ZWAA 1UIRA 3GJ4A 5IUNC 1I10A 2R8ZA 1XQ1A 1PEKE 2XPCA 4E09A 4AROA 4NATA 1ABBA 4FC7A 3JYPA 5AIBA 2FCRA 2IZOA 4B4OA 3TLGB 1QU2A 5GJBA 3MJSA 1S2MA 3OTQA 1J90A 4YHBA 5CJJA 4HN2A 2CL6X 2HA0A 2HA4A 1ECFA 1K6EA 1YMQA 2Y8EA 3CBGA 1XD2A 4M7PA 4ZO7A 3ANTA 4JI6B 4E33A 4HRVA 3LM8A 2ZP1A 5B64A 5CX4A 2DHCA 1AKRA 3TB6A 1KIMA 3GDOA 4TWZA 4KLNA 4JX8A 3T7DA 4MEAA 3FMFA 4KPEC 2R1TB 1IN7A 2QM8A 1FP2A 3EZNA 4HWKA 5JZSA 3FTFA 4KRFA 4EI2A 3RS3A 4PFKA 2QDKA 2QRLA 1G21A 2NSLA 3WLTA 1L5VA 1HDRA 5JPDA 2A5LA 4LYHA 2WHPB 5BSWA 3K96A 1NC1A 4WLFA 1ATIA 3QUSA 5A3RA 5ALXA 1RIIA 2DUWA 4OHMA 2X0RA 1QXSA 2JI7A 1MA0A 2YNMD 3NT2A 4FT4A 4CDGA 1SK9A 3HEMA 2P8JA 4LJLA 4PU0A 3SAJA 1FJXA 4DPLA 1YC2A 3EPRA 2PT5A 4YECA 3PPWA 4GGMX 4O1IA 4B31A 5B1EA 5JZMA 4JCCA 3LZCA 3LVFO 5JXHA 4DEVA 2EZ9A 3CH4B 4MR9A 8ATCA 1DQSA 2PMBA 2RGEA 4ZJYA 3CLTD 5BV1A 2BISA 3UWSA 1SY7A 1A8HA 1W96A 2XBMA 2GN8A 5A6VA 1K8ZB 1DJNA 1JXQA 2JFQA 3G88A 5A4MS 1IXRC 2NQTA 5HDQA 5DRTA 2BEVB 3ML1A 3QKRA 4JX9A 5MF6A 5D01A 3UXMA 1M6NA 1E94E 2X4DA 4EEKA 3NP9A 1XJ0A 2EFDB 4LRTB 3VAZA 2IHUA 1QIEA 2IS2A 4KLZA 4C4XA 3E5NA 3IMKA 2H1LA 1L4UA 4Z54A 3DFFA 5EWJB 3JQBC 3GWZA 3QVTA 3M6XA 3OT4A 2XXAA 5J1SB 3QX9A 3K0BA 2GSDA 4OMFG 2OQ2A 3A1NA 3EN0A 2PZAA 3G2NA 3P2OA 1GVHA 4ZT4A 3GB9A 5L4SA 1E5XA 2W8ZA 1Q5PA 4UAGA 4PX2A 1I14A 1I9CA 3FNGA 5F73A 4F71A 4F3KA 1X1SA 4G0XA 1T1SA 2HT6A 1J21A 3OZIA 4R1UA 5CVEA 3KUXA 2IH4A 4F5EA 1O2DA 3F74A 1KEKA 3DDUA 1PI3A 3LBNA 2ZIUB 2R4TA 3AC0A 1Y1RA 5FTKA 2V1UA 1T34A 5TPZA 3C5HA 1IVYA 1J5XA 1KFBB 4FYMA 1PBNA 3MWEB 4Y6LA 3W5AA 2OCLA 2UVPA 2I33A 4FGLA 1GPBA 3DBLA 1SZJG 4M49A 3ZU4A 3EPHA 4BXOB 1RBMA 4X6UA 1AU9A 1IN8A 1N2OA 1NVUQ 1T5DX 2YHBA 2YNMC 2EP8A 3DE4X 1DINA 3RLFA 3DBHB 4UE3S 4BX2A 2NUAA 3T5TA 4CQMA 1KL7A 1FDIA 3OPYB 5GOTA 5DEIA 1TIBA 4AD8A 3SFTA 4X7RA 1N1GA 1FZQA 5J1TB 5JH7F 2BGGA 2IIQA 2D1SA 3DBRB 4X24A 1P81A 1GTJ1 4IIEA 3VNVA 1K8XB 1VE5A 2CMHA 3I9OA 3CLTC 3FYUA 4ZGGA 2WWYA 4G2NA 1EP9A 2XNCA 4WK4B 3SOZA 2R6ZA 3QKUA 2P9GA 5BYKA 1J8YF 4CIAA 1MO2A 3EC7A 4PQGA 4DSNA 5F3DA 3DAYA 1W6RA 1UAAA 1T6NA 3E4CA 1FRFS 1TA4A 1W4AA 4DB4A 3Q3EA 4YRMA 1ZI8A 5HUHA 2M98A 1NATA 1JMKC 3RVKA 4V0MA 3U62A 3D6MA 3ZV3A 1DJMA 3CNLA 2A5JA 4INAA 5T57A 2PRJA 4TLDA 5EJFA 3L8GA 1K7XB 5CRIA 3VR4D 2ZYRA 4POOA 3L9WA 1Z5NA 5F98A 1KC3A 2PX4A 3NC1C 1FW8A 3KLBA 4DIMA 3VV3A 3JYHA 2GBLA 5K0FA 1KQNA 2Q29A 3S0JA 5FJIA 3TNYA 4D9IA 2XGMA 4HS9A 1GLNA 6PFKA 4GS5A 2VK2A 2C54A 2JANA 5LZ8A 1RHJA 1XU4A 1SXJA 3HN7A 3D31A 3H4IA 4MCHA 3N1UA 1A3CA 1PWHA 1S96A 1YIAA 1ZGZA 2IWRA 4KP7A 2V9PA 1ULUA 4MLCA 1OLSA 5F2KA 1KEEA 2FFRA 3TMYA 1OQAA 1P0MA 1IH8A 3N2KB 4JBHA 1LDGA 3MJDA 3JARA 1XK6A 3V7YA 2JS7A 3OY7A 4M87A 4AIRA 3HB7A 3PCRB 3VSDA 8OHMA 5HVNA 1UXOA 2ZUFA 4K81B 4NK4A 4F6CA 2QLTA 3SJUA 3RJTA 1K2WA 1WCIA 3FKQA 4QGAA 2B98A 2N75A 5IWCA 4AJPA 2W6NA 3QUTA 2E3JA 3PRKE 1P4SA 4W9NA 2WK1A 1CB0A 1KORA 3EB9A 2GM3A 3H17A 2HK7A 1ZSNA 5AP9A 1YS4A 3R3ZA 4TZ0A 3QBEA 2GZHA 3EASA 1DKLA 2PLFA 3GU3A 2HPAA 5EOVA 4NU0A 3K2IA 4PLHA 4CM9A 1SA0A 5LBUA 3I1IA 2DC1A 2YVLA 4IINA 4Q4DA 1Q91A 2GNPA 2V6FA 3DZJA 3QV1A 4RH3A 5ED4A 2G4LA 5KJFA 1RT9A 3RYCB 2DBVO 4HDMB 3ABQB 4L51A 1OCEA 1XP8A 3ND8A 5DX0A 4MCAA 6Q21A 3KELA 3G79A 3A4YA 1RBQA 2I4MA 4XAQA 3KJQA 3FWYA 2NYVA 2YXEA 4A27A 1OU4A 4IW3B 3ETHA 2O8DB 4ZMBA 1VMKA 3CN9A 1TF2A 4WGFA 2V97A 3NHJA 5AXBA 3I37X 3MIIA 1P61B 4BGUA 2CVPA 2A0UA 1L5YA 3CUEF 1DL5A 5IAKA 5TQ2B 1PJ4A 4NV0A 4PGAA 1YFKA 1RHUA 1NZJA 2J3LA 2LD4A 3JZFA 4UAVA 1RRVA 3CLHA 1KSHA 3VHXA 3B1JA 1N9GB 3ZVRA 4IEFB 4B84A 3K5HA 2VR1A 3TB4A 3QLEA 1N2IA 4YALA 2ZJZA 5D6OA 4E30A 2AKAB 2B6HA 4CT0A 2WDPA 4W5RA 3K0CA 1ML4A 1ZQ1A 1A9OA 1XMIA 1RXSA 2HU7A 2QI9C 3FVQA 2PRKA 3BWXA 1QH1A 3G0BA 3MCZA 5AJUA 5JY6A 5KTMA 2PCLA 2WMDA 2WKSA 2YVUA 5GY7A 421PA 1K2VN 2HYIC 2QRGA 4G5SA 4LBZA 4G4JA 3WKEA 1MABA 3E84A 2OCXA 2OTCA 2Q50A 1M6HA 3V34A 2CNWD 5D3ZA 3TSAA 3PCXA 3DCJA 2BFEB 4I3GA 2BTEA 3EAFA 3HADA 3WIEA 1UKZA 2BZ1A 4OLBA 4X94A 1SCUB 2FUNB 2L82A 2NXNA 3JW8A 4MGZR 3T7RA 3TNLA 4I4TB 4EHJA 5CDFE 4R40A 1P8JA 5AO9A 4YRIA 3UMYA 3ONDA 4LK2A 1WM1A 5L6MB 2Q41A 4RTKA 5LR6A 1W2HA 3KXKA 3EBPA 3IVXA 4BU0A 2LCIA 4F1JA 2C0PA 4FQ8A 2CNNA 1IJFA 3AIKA 2WWWA 4TMXA 2YUTA 2J5RA 3AI3A 2ID4A 4OAQA 4TUYF 1NQTA 3GGPA 1SCDA 1T1RA 2YXBA 5ILOA 1C5KA 5K7SA 2B83A 3QX3A 4DLTA 1B0PA 2WYOA 2VJOA 4MVCA 1WB6A 1KKLA 2IHZA 3ENKA 1YB4A 2PQ0A 4JHXA 2OVBA 2NU6A 4YMUA 4K0KB 5DYIA 4TTVA 1BHQ1 1NUUA 2B1JA 2DQ4A 2ZCUA 3H7IA 4CDMA 4D0LB 2DSTA 3I04M 1QM5A 1TAHA 3F8WA 4L6IA 3QI2A 2WC1A 1X9GA 3BCSA 4KXQA 2V7PA 3O8QA 2XCRB 5F1KA 1I7LA 2VSOA 3KXIA 2XDWA 2VHCA 3B6ZA 4OA8A 4EI7A 3NAZA 3PE4A 1B8UA 1HUQA 4LHWA 3S5UA 4JFRA 3UMSA 4RANA 5AI6A 5HOQA 2ASEA 4IRXA 1O6ZA 5CTAA 2H29A 2VYVA 1C1HA 4K9LA 5CW1A 2A86A 1O58A 1F8FA 1TC2A 2JH8A 2H5IA 4DQXA 1O9GA 2OZKA 1JQAA 3IHTA 4CTMA 1NURA 4JGGA 3RIXA 1EFPA 4A3SA 3SYMA 2H9AA 3DP9A 1JQ3A 5E2IA 1IXYA 2L0XA 1GLVA 2GK7A 3ORSA 1CY0A 4GLBA 4KHZA 5KTKA 3I3OA 3UOAB 2EYUA 4FR0A 2GJSA 1FZTA 3C5CA 3G1TA 2F9FA 4US1R 4INZA 1WUJS 2AFHA 4QAJA 1GKIA 3WK6A 1I80A 1AMUA 3GHHA 4JP1A 1E2GA 4J0GA 3M3PA 3GNLA 4KGVA 1NGSA 1RWVA 1E66A 2B94A 4D7AA 3PS9A 2AUNA 3REQB 4NXMB 4NEGA 3UKDA 3H5NA 1QBKC 2R6GA 2VK1A 4JXZA 3GQBB 1KRWA 3INTA 1BN7A 5A5EA 5ITSA 4IHJF 3OQNA 4C89A 5J4LA 1EFCA 3OEHA 1CRZA 2AN3A 2QW8A 3ZOKA 5IANA 2CF6A 2HBYA 4U0JA 5DM60 2IYUA 5GZ3A 1BFDA 3I5MA 1N1MA 2Q0HA 4B7XA 1UEXC 1VCIA 4X84A 4GX5A 3AY6A 4MJ3A 3ZDCA 4X54A 1BTOA 4B5LA 3HA7A 3IV7A 4P81A 4L9SA 1M1ZA 3WDSA 2DCUA 3C6MA 4JVOA 3UWPA 3KYCB 1M1XB 1H3NA 1RC0A 4TYMA 1RQ7A 4EFDA 1XMVA 2ZATA 1CUHA 3U7HB 3HYCA 4JYZA 2BFPA 5DMHA 3FVRA 1Y48E 5DGCA 4BBAA 1JW9B 1WDKA 3QLUA 4RXUA 3VC1A 3OIUA 3IPCA 3RRBA 3T3PB 1WOYA 4WNAA 1OFUX 3R7WA 2F3SA 2WQ6A 1FTNA 1JKJA 3RW9A 1ABEA 5GPBA 5CAEB 3MMZA 4EO4A 4HVCA 1T3TA 4HAYA 3FFBA 1HETA 4FYJA 4WUTA 3GG9A 1Q1QA 1T6XA 3GD7A 5LJIA 2YJ5A 3EEBA 1GR0A 4BLTA 3PYLA 3OQOA 3Q8KA 2M1XA 2GB4A 3H05A 1CUUA 3QELA 2YINC 3I05A 4UOZA 3S8YA 2GCPA 1NYTA 2E21A 2QT9A 5EUQB 2A9PA 3KD3A 4N5HX 4O63O 4OM7A 1OXXK 2F7SA 4ZD6A 5FFNA 1Q7RA 1UWVA 1PQYA 2G9VA 4M9RA 1P4RA 2YJNA 4QBHA 1JEQA 4HWGA 3W6PA 1UDWA 2J46A 3MXOA 5DYNA 2WM3A 2R1ZA 3WNBA 1S6YA 4IJVA 4BMXA 4FZRA 3LCUA 2NO0A 1UKCA 1DBWA 3Q12A 2QP9X 4DMRA 4Y2HA 4B6OA 1I5RA 5BT9A 5GWXA 4N41A 2JFGA 1VSVA 3ZDFA 3FPHA 3RUCA 1AGNA 4CLHA 1KOJA 1XJ5A 4Q1VA 4V2IA 2C2MA 2X2PA 1YZUA 3FOEC 3DKIA 4BV2A 1P7WA 2WMOB 3IVAA 2G72A 3MCUA 2BHNA 4IOKA 4CUKA 1EK0A 3AUKA 2QE7A 3T12A 4A6PA 5EP3A 5JW6A 4JBGA 4BVLA 1UQTA 3BULA 4DLZA 5DOZA 3V7WA 4JUAA 2VP4A 3H65A 4IF4A 3GRYA 4TRJA 3SZ3A 1WLSA 4CWAA 4K9MA 1U8YA 2NZUG 4QUJA 1J9ZA 2IKQA 5FWXB 1DXOA 4NCIA 1HT0A 1EWKA 2F1IA 1VP3A 4D3DA 4UD2A 3JRNA 3ZVKA 5EZSA 2XZDA 3ZE9A 1B6GA 1TVKB 2H5LA 2YWBA 3GD5A 4G0OA 5T8KA 4ER5A 3VH4A 1R0XA 2PYZA 2YOGA 3DDWA 1L1FA 4IDHA 2KE5A 2ZBVA 4PAWA 1AQJA 2F9LA 4HB2A 3VZSA 5LYJB 1T0IA 1KZ4A 1MGPA 1MEJA 1JFSA 2WD7B 1B00A 5JCXA 3H18A 2GJAA 4ZJZA 3TUZC 4PNZA 2W6JA 2GUWA 2C4VA 3HCFA 1DJLA 2J6HA 2RKBA 3ESBA 4LY6A 4U3JB 2P6OA 3EEOA 3JQAD 3K0AB 8MHTA 2I80A 3BF7A 2IU4A 4C7OA 2WVGA 2F4VB 3AF0A 3LQQA 3RANA 4DANA 1V11B 2V58A 5B1YA 1YMUA 2RHTA 3WDMA 1L7XA 2UUOA 1UCFA 2A92A 1MJGM 3C87A 3PIIA 1TDJA 1TUBA 1YDGA 1RAEA 3U3JA 4DDTA 5BSKA 1DEKA 2ZWPA 2Y05A 3ZH2A 2J3DA 2FYTA 2BSQA 2Z95A 1OU0A 2ODAA 3H2GA 1SUWA 2QLNA 5EC8A 4LPKA 4YDQA 5IHPA 4MMZB 4PCAA 4U39A 1OYOA 3RT1A 5JC8A 1W36D 1O9HA 4OJKA 2H51A 1OI2A 1T2EA 2H57A 3CX6A 4D4LA 2BEWA 1N8SA 4X95A 5AM3A 1K98A 3EC2A 3UG7A 4KFTA 1Z4KA 2BM8A 4D1YA 1DRKA 4NESA 2DLCX 1PD0A 2AC2A 4E5NA 5CFOA 3MERA 1OX6A 3D64A 5CX1B 1NBEA 1X1BA 3HBLA 4KWTA 5BOSA 5KOYA 3IB6A 3PQFA 4FEEA 2QT0A 2O0LA 4MW5A 1NF2A 2X5NA 5BR4A 4DNOA 2YOHA 5FA8A 4OQLA 5JXJA 2B5OA 5J2UA 1OV6A 2D1YA 3A6JA 5LBIA 1P2SA 1JTEA 4WRRA 1KDPA 5KO2A 3I0NA 1DS6A 1KFCB 1TL7C 4OUDB 2WIKA 5K3OA 1OY1A 1EJ0A 2NPOA 3ANMA 5ALRA 4FWTA 1G7TA 2ADOA 2C88A 1E3TA 2C5EA 4KPYA 2ZSUA 3BE8A 4WCVA 2GLXA 1ZS9A 2JHAA 2ZJYA 2Q3BA 4YV7A 2E4XA 3KAJA 5U9CA 3QY0A 4B3TB 3P20A 1MJNA 1UBMS 4JYMA 3ZCSA 1BH2A 2AMJA 4PLZA 5BSEA 2NU7B 4XCXA 4DIOA 2GA9A 1RI2A 1XAHA 1L5GB 1U5CA 1PF7E 5EHNA 3D9QX 1JPVA 1T36B 1U0JA 5DHSA 3M6IA 1JSCA 4WK2B 4J0IA 3VU9B 1U2GC 3FBTA 3PJFA 1SUFA 3R40A 4RWZA 4X63A 2H0QA 5U4QA 3RRNA 4Z2AA 3ZGZA 1Q95A 4GOLD 3W90A 3WGKA 1DWUA 3MIZA 4F4HA 5GZ6A 3SLKA 4BDSA 1RAIA 1MVOA 4N0DA 4PLPA 1GAEO 2OENG 5MN5A 2XA2A 3NV7A 1Z5PA 2I4TA 4PC2A 4EGCB 3U4IA 4UMFA 5C31A 1S3GA 3KOMA 1PW7A 2IKSA 5KTNA 3LQRA 1W36C 1P1JA 4IMRA 4X1KB 4CCAA 2C3UA 3AMVA 4DG9A 5AW6A 2EZ8A 1LJLA 2OAP1 2QMEA 5KNCA 4YQZA 3MBOA 4GT1A 2QL6A 4HFJA 4P4UA 4JOQA 1VRVA 2VS1A 3AJEA 2HO4A 1E0KA 2DUJA 3ZIAA 3R7AA 1VFNA 3S2UA 1L7QA 1QYXA 2GN6A 5IUKC 3X1DA 4DA0A 2ZAMA 1SQ5A 4H16A 3RSHA 1IU9A 1Y0BA 1X1AA 2L18A 2XF8A 3I6ZA 3VZRA 4TYWA 4QDTA 3QV2A 4OP1A 5C1OA 1TTQB 2BI7A 4N12A 4OK6A 5DNUA 3PPXA 1XNRB 2LWIA 3B89A 4CKCA 2IYVA 4DCMA 2DR3A 2YWXA 2P6RA 1UAYA 1WPRA 1CJBA 5GMOA 3S7ZA 2IV2X 2IW3A 4X20A 3LW8A 4W9RA 1PJBA 3WLQA 3L9XA 1NBMA 2HWWA 3MD9A 4JENA 4KYTA 2AJTA 5GONA 3EIHA 1XNGA 2DWUA 4KAAA 3WAJA 2GBCA 1N5DA 5LA6B 1N7JA 1WMDA 1CZKA 4L74A 1P33A 2YHAA 5A3QA 7REQA 3OHSX 3ELBA 2X77A 3T7JA 2PXXA 1VCMA 4Y2QA 3ZU2A 5A6SB 2BRUA 2FG6C 2J09A 2AYYA 3CM0A 1EZ4A 1CE8A 2B0JA 4RPKA 4F9GA 3D3EA 4NH4A 2DULA 4ZANA 3J80A 5LSAA 1EHIA 2WQ7A 4DA4A 3PF8A 4Q9IA 1GT91 5FIUA 3UHFA 2ZIGA 5IJ0B 4DM7A 4X92A 2GYUA 1C3OA 4GMHA 2NUTA 3PNMA 4EB6B 2X4LA 5D6NA 4RK7A 4YNBA 1AKTA 2PZEA 2IZ5A 3B6EA 3V8BA 3D6TB 4JVNA 3VUEA 4EA9A 3ZE8A 2ZQ5A 2QTCA 4IZIA 4DSOA 3DYBA 3G0GA 4E7PA 3U39A 4N5DA 1P2FA 2GUGA 4JCOA 3ADCA 2AF4C 2IXAA 4C4TA 4CI9A 1ECCA 2DYKA 4F8EA 2R8XA 4LXGA 4CL8A 2GEBA 5JVDB 3WDLA 2J9FB 2Y0CA 2AR0A 3LOPA 5DNYB 1SEVA 2V6MA 5JMOA 1BD3A 1Z56C 3C43A 4J0CA 5I7VA 3RSZA 1SOWA 2AL7A 3PQ3A 1GNRA 1WY5A 2G1PA 1GILA 2Z2ZA 4QGSA 3PDIA 4MYSA 2PWPA 3CNBA 3G1WA 1SHLA 4HDSB 1S2OA 4YRCA 2GK4A 3STHA 4HJXA 4EMBA 3GLFE 1F0PA 3D2CA 3DLAA 4X90A 5FL7D 3PYXA 821PA 4U6NA 3L6DA 4QYXA 4W5JA 4XGKA 3KRTA 5IVIA 3AEYA 2VNHA 3DO6A 2XNDA 4Y0NA 5HX7A 1LBTA 4JP3A 1YZVA 1Y9EA 3UUFA 2YZ7A 4LV8B 3TD2A 3TCXB 4HGPA 2QD2A 2F2TA 4OQNA 3IT3A 3UPDA 4S0ZA 1TYCA 3L06A 4K1LA 1DE0A 2BKVA 4ZMSA 2IJGX 5FUVA 5AWFC 5KNBA 1R4AA 4PNEA 3PE3A 4Q93A 3TBKA 4QGFA 2FKNA 3IMCA 2DETA 2PIDA 2AWNA 3TWOA 3T7AA 1Q22A 1MC8A 1UC8A 2PBRA 2CCKA 1HT1E 1YR1A 3DT8A 4JBXA 4QT0A 2Q7DA 1AHHA 4C7MA 1QR6A 2VTBA 4E07A 2C0CA 3H5RA 4KQFA 4JHLA 5EIHA 5B1SA 5LMCA 3CH7A 1M8PA 4MPDA 4B3HA 4ZT2A 3JU3A 4MVJP 4WKNA 3R7FA 1X2BA 5ED0A 1ISGA 1GKLA 4RSMA 3UMRA 3ETLA 3GJ7A 4YA6A 3G5UA 3I58A 4RHTA 4H0FA 3TVTA 4EB8A 4JL8A 4G9GA 1M1UA 1VECA 4YRSA 4ZVPA 2BFOA 2OP1A 3JWHA 4OREX 5E7QA 4WN3A 1G291 3ME5A 1I7DA 2ZYGA 3TSZA 3OX2A 1D5CA 1UK6A 4EPRA 2NP7A 1U2TA 3N7UA 2G82A 2R8BA 2FLWA 5FYDA 3JVDA 2BDEA 2P9FA 1K7CA 2C7OA 4HYEA 3OWHA 4JSTA 3A06A 4FFBB 4WBNF 3DEAA 2POQX 1LLUA 1IHDA 1XDZA 2YY7A 1CWUA 3CXUA 3ZR4B 1SWVA 2ZDHA 1FW6A 3NGLA 3PD0A 1HFWA 1I2BA 3GFTA 1JA1A 3DE3X 4OAPA 4UUAA 4Q9NA 3CZ5A 1SXIA 2M6LA 5CCXA 1FFAA 3DM5A 3JZMA 3LSTA 1Z0KA 3LE8A 5BNIA 4O4IA 1QAMA 3ND6A 1JX6A 2F17A 3DMNA 3FFAA 1L5QA 4HUJA 3TZ6A 5J4HA 4WXPA 4DR1B 4C0KA 3IBTA 1SVMA 4ZDIA 1S1MA 2PA0A 2H2AA 2PYIA 4WCDA 1X92A 5CM8B 4AT1A 2VDLB 4YMIA 1U04A 3O8LA 5EEHA 4WFJA 4A6XA 1UZLA 1RD4A 5HXAA 3AL3A 1Y5MA 1GXSA 3I9FA 3RS9A 4MUFA 1JDUA 2O6LA 4TXJA 4XIFA 1A5BB 2KBEA 1M6VB 2ZXFA 4IIHA 3V4PB 2WUVA 1GTZA 2OUKA 4HAZA 5C34B 1QQ6A 1JWLA 1KVQA 3EXG2 4J90A 4MYRA 2PU5A 2XIJA 2FPPA 2IYEA 4Y7DA 4Y6QA 1YR3A 3N3BC 1NR1A 3PKIA 1UMBA 1C0KA 3FYTA 5JCZA 5KEIA 2O8NA 5IVHA 1U3WA 5H9WA 1H0KA 1YQ9A 1RI1A 5BRAA 5BWCA 1PDWA 2HTEA 2ODBA 2IYPA 2AN9A 1P31A 1M8FA 2FK8A 4RVCA 4KB5A 2Q4EA 5I7AA 4QRHA 5CDSA 2WG1A 3I8XA 4K6FA 4HB0A 2B2CA 2I67A 3NHRA 4MYTA 1N4AA 3VYTB 1MAAA 4WFIA 5A5DA 3LK7A 4I3FA 5JHGB 4H1HA 1AJEA 3PD7A 2AD1A 1SC4A 4K9SA 2ISCA 5EJGA 2J9YB 4QM6A 3UPUA 1RJDA 2WG0A 4H0NA 4PO9A 5D3MB 5HQJA 1C8KA 3IOMA 4RORA 1XCOA 4RYDA 2JLZA 1PW5A 4IWXA 1WVGA 2HBQA 3BILA 4ZJPA 1NSFA 4IDAA 4NP6A 2Z5VA 1X7ZB 1OIWA 4RZ2A 4XPIA 2Z6QA 1GZUA 3NT5A 1N5OX 3NYRA 5CD1A 2JIZD 4KO1S 1AUXA 1J0AA 4OEHA 1JKXA 1ZUNA 1J09A 3K7EA 2UV8A 2D8AA 1XFAA 5AJTA 4XD7D 4AI6A 3RUIA 3BJZA 3EFBA 4MR8A 1ZCJA 3NGXA 4UM9D 1K9VF 4NEHB 1L5HA 5ISMA 3BT7A 1XA4A 3PC6A 4X1IB 3H83A 4UCFA 2BLLA 3KSAC 3CVVA 1AGPA 2NYUA 1PR2A 2F55A 4PZDA 2OFOA 3SQDA 4JP5A 3DT9A 4XM0A 3UFXA 1KAMA 5AJYA 2FP4B 3N07A 3CUYA 1DB3A 2ZVDA 3OJXA 3PNYA 3G13A 3NS7A 4PZPA 3TLXA 3TRDA 4EW2A 1VZ2A 2PD3A 2O1XA 4Y2YA 1FFWA 3D7LA 4AWXA 2R48A 2J7KA 1N8TA 5AM1A 3CYFA 3FXAA 2H1HA 3L0DA 1VJGA 2E7ZA 2WYWA 4BGVA 1ZGJA 2FSVA 2PN1A 3EUEA 4QATA 1GQFA 5DNEA 1JDNA 1A96A 4JOBA 1VLVA 3QUBA 3SIRA 1UJ5A 3KQKA 4ZCMA 2O19A 3G8AA 4OQYA 1JLLA 3QTBA 4C9BA 4HCJA 1K1EA 1X7HA 1QVZA 3DBIA 3OQPA 1IRXA 5IAJA 4AQDA 2H54A 2D4AA 4Y8VA 4LSMA 2C8KA 3A04A 1EA7A 2IIBA 3HCCA 5GM2A 1RQPA 2OWDA 4P7KA 3DWGA 4R1OA 2CXTA 4P83A 5BN1A 4MYUA 2WJ3A 3K94A 5H16A 1HE5A 1HLPA 1LK0A 1UJBA 2Y76A 3NNNA 5F4BA 2WU0A 5BORA 1ZRNA 2HK6A 4F5WA 5JXWA 1HR0B 3ZGXA 4CEIB 4P36A 2AFIE 2IUUA 3VU8A 2H06A 3NEPX 4JI2B 5JAMA 4L72A 1E0DA 1OJ7A 1KJ9A 3LO8A 5FD8A 5IKXA 3OKCA 2EHDA 4IX1A 4X8HA 1EUCB 5AICA 3ZQKA 5LB4A 1JR2A 2ZYWX 3FTPA 2W4QA 2HA5A 2A88A 4NPAA 4OJNA 5K6AC 2IS4A 2C2ZA 1EX7A 3SYLA 1EHYA 5DWDA 1VG8A 3N8KA 1PWYE 3GDFA 1CIJA 1NQAO 1N5IA 1UPUA 1YZHA 3KZCA 2HQSA 4P33A 4BKMA 3HVHA 2FSSA 1N2CB 3CRVA 1X2EA 5CK5A 3IIJA 2M9MA 3OD1A 4P4NA 3T9DA 3LLVA 1JVBA 5H82A 1K8QA 1U7UA 1OD6A 4X7BA 3FOAA 3B51X 1QFXA 3ABOB 2VZ8A 3CNNA 5KOHA 1QANA 4BGIA 4G8DA 1ORRA 1YB1A 3E2IA 3PC8C 4RXMA 3GEDA 3GJ3A 1Y6ZA 1N77A 1J2EA 3CV3A 3PGJA 2HWYA 4MRNA 2G04A 1F2VA 2WIBA 4GFDA 3C74A 3VO9A 4YUWA 5HQTA 2P4EA 5IABA 2EV9A 3O9MA 3QQPA 4QOIA 5AVKA 2QMUA 4K9RA 1JEDA 3EQZA 1H1DA 3ZWOA 1TTHA 3FOCA 4FGUA 1YCDA 3HZZA 4TLLB 3BCHA 1DKNA 3NNDA 2I03A 4CM4B 3SC2B 2E0IA 4OXNA 1D2HA 3WFIA 2GK6A 3AQIA 3EGOA 4IO1A 4W1QA 4Y9DA 3WJ7A 2VHYA 4F72A 2FRDC 1K97A 4P2GA 2BHLA 1C0EA 3HCEA 3N53A 1WDTA 4WOPA 5IH3A 4DJ5X 1C29B 3ZW8A 4N6OA 3HYLA 1YZYA 3P4UA 4PYKA 5CMLA 3IQGX 4M7WA 4PXSA 2C2BA 3FGOA 5LA6F 1D4OA 4N0MA 3MAAC 5TPWB 3THOA 1GZDA 5MN6A 3W9BA 3MMPA 1HQDA 1U3DA 4FI3F 3E35A 1M2VA 5EIFA 2EHJA 4DLUA 4BMVA 2IYZA 2OL4A 3FSJX 3DMDA 3KTFA 5LPNA 1EWRA 5FLEX 2ERXA 4LF6B 3EYWA 3U3XA 1P2UA 3L4KA 1SVWA 1F2UB 3CKKA 3OPMA 2QZ4A 1XQ9A 2VHJA 3JQGB 3IVMA 1Q77A 3IUMA 3W8EA 2WAYA 4R0VA 3G9UA 2PS0A 3EVGA 2PX5A 3EZ2A 4Z8XA 1M34A 3N0VA 5TE9A 4Q37A 4F7WA 4CM8A 1OB5A 1DLJA 3LDHA 4EY8A 1TAQA 3I1FA 1PL6A 2R86A 1F6DA 3A3NA 4HRYA 3ROGA 1NR5A 2ZR9A 1HLGA 3TQFA 5HTKA 3MCTA 1VJ5A 3R3SA 5KNLA 3AI7A 3OIDA 3WK8A 1YCFA 1PNVA 4KXMA 5ADVA 1THZA 2R62A 2P6UA 3WBFA 2P79A 3D4BA 4OYLA 2Y1EA 2IY8A 2DUNA 3L0BA 4M46A 4AO8A 2YCLA 4KJZA 4BYMA 2IPOA 1W1WA 1VHTA 3LIIA 1THTA 3SNHA 1CNFA 1R8JA 2J7PD 3E7DA 2X1MA 5EJ7A 3C3BA 4PYMA 1YCGA 3MT8A 3GROA 2HJWA 3EGCA 3GH3A 4P9NA 3V6MA 4JR1A 4DEXA 2PXAA 4E5YA 5BQFA 4R8LA 1Y81A 5JXGA 2QN8A 5KREA 3F3MA 4ALNA 4M9XA 1XZMA 3UHJA 2D6FA 4QBFA 1M1NA 3OP4A 2WJPA 2X58A 3R3XA 3LUGA 3LZ6A 3K32A 4G8JA 3AM5A 5DI9A 3OCWA 3R76A 3JAWA 3WJ2A 3EXIB 2HV8A 2B1RA 1DNPA 5C8YA 4LI3X 4DNXA 2CLOB 4HL6A 5ABPA 1P0IA 5CG1A 3HO1A 4K6CA 2WM8A 2AXEA 1U28A 1I9GA 1IRIA 1DXHA 2F1RA 4TT8A 3ZXSA 5CGQB 2JIDA 2H2DA 5AUQA 4A0SA 4OFBA 3HDYA 1YQGA 4Y30A 3I6BA 2ATEA 1YSCA 3GW8A 3ZHYA 4BVHA 4DT1A 2I7TA 4XVCA 4WZBA 3CMCO 2W5UA 1GCOA 3HCBA 4KH1A 5JZVA 3MRTA 4DARA 1U8ZA 2N1BA 2JI8A 4M9UA 1B16A 1XVIA 2AX4A 4FMPA 2G8NA 2OHFA 1V1MB 5I9MA 5JS2A 1TPYA 1C9MA 2YKGA 2YL2A 3EDMA 5A9TA 4BVFA 1QPGA 4RJTA 2I87A 1J00A 2BUCA 3DDHA 4LYGA 2FPGB 4COOA 3IUJA 1V4BA 4YUVA 2ZXUA 1L4FA 3KB8A 1HE2A 3D7KA 1FLVA 5F5XA 5I5GA 1NUQA 2D1TA 4LXHA 4PXAA 3L6CA 1Y6JA 1Y4ZA 4RH0A 3I0MA 3KYDA 1KP2A 3MS4A 3OBBA 4LKOA 4AUEA 4OYHA 5TF0A 4DR3B 1LY1A 4JB8A 4BNUA 1L9XA 3PXDA 1Z12A 1U7OA 5DIZA 3OQ6A 3PXUA 4D3XA 1EVEA 2RHCA 4V0NA 1T1GA 3G5MA 1SUCA 1TUEA 1E6KA 1P7PA 4FYXA 4O1MA 3V9PA 2YUIA 5DNDA 2I3BA 3RF6A 4ARVA 1JECA 1AQIA 3LDAA 3IDZA 2CLMB 3ZHSA 1QK3A 3UA4A 3ECSA 3T7SA 5J63A 1Z37A 2Q9UA 4URHA 1MCZA 5HZMA 2H5EA 4RYLA 3RFCA 1VC2A 1COWA 4EO9A 4RK1A 4JKIA 4YH1A 1EAMA 1TK3A 2LDXA 1ID8A 5D2CA 5ALYA 3VR5H 2VYQA 4ME6A 1CJTC 3K9WA 3OZ7A 3SBEA 4DWJA 2XCTB 2QI9F 3EXHB 4RXTA 3QVJA 1ZL2A 1ZM7A 3ZGNA 5INTA 1OFIA 3M4ZA 4UUNA 1I6LA 1KI9A 4XE5A 2WF8A 2V5AA 1ADGA 2JAQA 2XQVA 3IXQA 3KOUA 1D6SA 2C4UA 3O7MA 1N2BA 2AXQA 4JBLA 2JEYA 3VSCA 4ZOQI 5KUTA 1XELA 4J2OA 1HXHA 1Y8ZA 2RCYA 5D86A 4MCIA 4F4FA 2AK2A 2Q8QA 2OZLB 4ALIA 1JHAA 1EVQA 3QKSB 1G6OA 3WJAA 3EWAA 1G42A 3EZ7A 5BSHA 1K8RA 3MB8A 1TW3A 2REQA 5FWYA 3B38A 1UBLS 4KPUB 5TSDA 1Z18A 3WE7A 2I1WA 3QOFA 4PRKA 4RY0A 3CZQA 2H16A 1QWSA 3QA9A 2XIQA 4PC1A 4PQFA 1OLXB 1C41A 1XTUA 1Z2AA 3ESQA 2C00A 4XQ9A 2EERA 1AX9A 3P1JA 1DAMA 3OCVA 1P2VA 2HADA 4BUJA 1B8OA 1BS1A 2B3DA 1PR5A 3HY4A 1DXQA 3LO5A 5CDYA 4XJTA 3X1ZA 5IXJA 5CIQA 5IM4A 2QX7A 4P84A 4TWAA 2FWPA 2C20A 5ERGB 5JAOA 1H2FA 1VFPA 1CDZA 2BCJQ 1JU4A 3L1HA 3ZXIA 3DLCA 2QM7A 3B78A 2GN9A 3SR3A 4M1WA 3AR9A 5BT8A 1QIIA 3DV0A 3RSLA 3OC0A 4RTMA 2XUPA 4H3VA 2R6R1 4DBZA 3BMCA 3VZBA 5JIBA 4GAEA 4GYWA 4MWEA 1P29A 4NECA 3OIGA 1CJMA 3T0FA 5KVSA 1LRLA 2I3AA 1GA6A 1FFHA 2Q3HA 3LECA 3ENVA 4HK4A 3C14C 4NBKA 3MBIA 4RACA 4Z0TA 2HCRA 4EJSB 1EFAA 4R6WA 1DAEA 3I01A 1TF5A 4ZZ1A 4UARA 2P77A 2VJDA 3TTWA 3LMKA 4D3SA 2HREA 3OECA 3DQZA 1XVAA 4M1EA 1J23A 2H3EA 4Q6BA 4EG5A 1BWPA 3TPZA 2HSJA 3AOEC 3ROKA 4WESB 3KKZA 3DTVD 3IOCA 1ISPA 2GESA 3GAZA 3KXPA 3LOUA 2I8AA 1NVFA 2X8AA 3QY9A 1O4WA 3ZLUA 1VJTA 4L4XA 2AZ4A 4NJMA 5A62A 3ANNA 5AXDA 1YL7A 2FNAA 3ZDZB 2YWDA 4QSHA 3ZBPA 2JBWA 1T6ZA 1YA6A 1R0BA 1KOFA 2IITA 4Z4EA 1AKVA 1C9KA 2P7HA 1L3BA 2B8JA 4DQVA 1P7ZA 1UC4B 2WEKA 4C05A 1SUSA 2I8LA 3IPLA 5JJBA 2GEUA 2WHEA 3K0HA 2H85A 4UVDA 4WKCA 2DCMA 1Z8FA 4QBIA 4WNCA 4I4LA 3T3HA 4AP6A 2IZ6A 3F5MA 4GMFA 5A1JA 5BR8B 1HDCA 2QAGC 1EX1A 2P0EA 3KPUA 1UP7A 4BLSA 4AKGA 2HLDA 2FFJA 5ALGA 4ZAZA 3O4JA 3CR3C 5JSFA 4Z1MA 4KDRA 2R44A 4M9CA 5E1OA 1MG5A 2I62A 1MHTA 1W7AA 4S0XA 2VPWA 3F98A 4PHGA 2NVOA 1WP4A 2B2NA 1A8SA 4RTOA 5ECDA 3BM5A 2WJVA 1VIDA 3DM9B 4I46A 3WP0A 4DMHA 1YDHA 1V5WA 4BFWA 5IJWA 1AQYA 4KIWA 1ZICA 4J0JA 1A9ZA 4BQSA 5JZ9A 1SC3A 3QF4B 4D6PA 1NXVA 2JBHA 1RXIA 2Z08A 1V1JA 1JHVA 1ISHA 2CNKA 1PT5A 2ZRGA 3OEED 4XWYA 5JQWA 5L51A 5HNKA 3U44A 5FLKA 2NUBA 1SH7A 2QK4A 4LZZA 4DV3B 3ROPA 4I8IA 1LGYA 1M76A 3A0UA 3KB6A 2HM7A 3G2JA 3U31A 2UYYA 4UTXA 3A25A 1ZM9A 1HWYA 1Y6QA 4EI8A 4GEKA 3REGA 3BL6A 5AI5A 3ZNQA 1I6WA 2ACVA 3VJRA 1XEWX 2VEDA 4TS1A 1BGVA 2BBSA 1V6AA 2V96A 2WIJA 3W78A 4CTJA 4FZ3A 5DBIA 5T6MA 3OIVA 5HHTA 4WADA 3IHLA 3GAMA 3HDVA 1F8UA 1Z4IA 2F3PA 2CBZA 2QUAA 2NQ2C 4GOND 3PFIA 3DDSA 1XKTA 3PHCA 2E37A 1J2RA 1W88B 5A4IS 4BL5A 4G0QA 2VUUA 4M0CA 2I0FA 4OHVA 4PSAA 2EDCA 1XG5A 2B82A 4AW9A 1Q11A 1VGQA 1VXRA 2EL7A 3RYTC 5IH7A 1IY2A 4C0QC 1WB9A 4LZAA 3BHNA 1OR8A 3DMFA 3KSRA 2P1ZA 4JL6A 3KKNA 5IFLA 4Q19A 3ZHUA 1ULTA 1Z8DA 2B8TA 3AY3A 3LP5A 4QTXA 2QMZA 1EBFA 1KH2A 4KODA 4ND3A 1E64A 1Z7BA 5F1OA 5BQPA 3RUFA 1M9NA 1TU0A 3B1KA 1K7SN 2VJMB 1Y8RA 2VYNA 2AKYA 3DBVO 3NDPA 2RGGA 1ZD4A 3W3AA 5BNWA 4E51A 4Z0HO 4DA8A 5K8TA 4CMIA 2UUAB 1ZD8A 1IBSA 4B40A 2I6UA 2A1UA 2JH3A 4X65B 3HP1A 5CT9A 4HFNA 3LBFA 1MNQA 1SBYA 1STOA 5IPFA 4NAVA 1U65A 1KBZA 3BIWA 3EBOA 3MWFA 1MGOA 4F4UA 3NX4A 1JI3A 1NLUA 4XX0B 2AMFA 2R6HA 3T1OA 4LQLA 5K3BA 3U9LA 1IHYA 4JJ7A 5KB3A 5E6UA 3KAPA 2R8OA 3E48A 2ZE5A 3PXGA 4H7DA 4D45A 3K9QO 4BWVA 3V8QA 1BVRA 1JVNA 1ZK2A 4R9VA 2JIQA 4TMZA 2ORED 1SURA 1XEXA 3P9IA 5KINB 3L0OA 3HACA 1Z5VA 3Q9SA 4H77A 5ENZA 1TEHA 5TEVA 4GDFA 3PEYA 1GRRA 2D0PB 2XGSA 2YC4C 4QPNA 1UBGA 4ZK6A 3IAFA 1M2EA 3OEWA 3U13A 2R00C 1NPDA 2DEUA 3AKDA 3M7IA 1SU6A 3ILHA 1VHQA 4ARSA 4B32A 5CEEA 4G1FA 1SKYE 4H6VA 1ZCBA 5JAPA 5DGXA 2WUEA 3EFOA 3GLRA 3HP4A 4H7IA 2BSAA 4IBOA 3R20A 4S1WA 5EINA 3GJ5A 3WWZA 2B61A 5TVKA 4AJJA 3BKWA 2EX1A 1M54A 4RIGA 1YB2A 2GLTA 3GRFA 2J67A 2FOXA 2JFFA 5A9SA 2I6FA 4MDYA 3DZBA 2ZS9A 1K7EB 2Z57A 5KC8A 1JT9A 1O3YA 2JRLA 3BIFA 3C6KA 1KYYA 1TYEB 1U0OC 3G5LA 3HVUA 5F1YA 3T7KA 1P5RA 1BS9A 1C4OA 3KT6A 3A4MA 2R84A 3WXMA 2PUVA 3P7MA 3BSYA 4EMUA 1YQTA 4X00A 1CULC 1KQPA 3TW8A 3OLCX 4DREA 2J3EA 2OZVA 4LYJA 3QLVC 2QL5A 2PO5A 3NHFA 2OGUA 4MTLA 2EP7A 1GQ2A 3TL2A 4E5KA 3JQFA 1GYPA 1NX6A 3DXFA 1ZDMA 3JWIA 3KOWA 3GF4A 3RS5A 4MUIA 3OP1A 4MVYA 1PKXA 1US8B 3EVNA 2RJNA 2F43A 4JQOA 4WNYA 1GGVA 1HDGO 2R1TA 3S4YA 3OIFA 1TTTA 3SFVA 2FPUA 3HGQA 5HS6A 3RSCA 3PNSA 3UG6A 2WHPA 4WINA 4CUZA 5I9SA 3O3CA 4ZO8A 3F0TA 3S8EA 2LBPA 5EFOA 3H75A 2R65A 5ER9A 4B3GA 4RTJA 2OSBA 1A9YA 2YXDA 1T2AA 1LRJA 4W7SA 3ULKA 1JSLA 2ZR7A 2QTVB 4I6GA 4EHFA 3F6BX 4BLPA 1P4GA 3DZKA 3L4BA 3RGGA 7YASA 2BYTA 3MN1A 2GR9A 2P3LA 2Q8PA 4BCBA 4AY5A 3SYTA 2Z6UA 2JD1A 2ZRMA 3PEWA 1N3YA 4C7XA 1E96A 4RETA 1CEQA 2QOEA 4X3CA 4ZHQF 5DFAA 1XKQA 2D3WA 2NQ8A 3BJRA 2ZJ6A 2PJRA 3FF4A 1WPQA 2QD4A 3L7AA 2RBEA 4AK9A 3HA3A 1Z39A 4DR5B 1P80A 1YB6A 4L6CA 5CA0A 2IC5A 5U4XA 2DHDA 2AJCA 4TTAA 1EWYA 5F3RA 4LFBB 1FU4A 3D3JA 3N6VA 2H4JA 4U2BA 4DGSA 1TD1A 4BNVA 1DARA 1FS5A 1EFHA 3AB3A 2GS9A 4RC9A 1XZCA 2FFQA 4MROA 1QCYA 5HF8A 1L7AA 4I55A 3WLMA 5L3SA 3GEHA 1N57A 1XPOA 4W1RA 5EWJA 4Y67A 1PNTA 1U6JA 1VI6A 5KOJB 4KVGA 3O8DA 5LQKA 3I5UA 4DUZB 2N0SA 3ZZTA 3TR0A 4OB6A 2FWIA 3EJWA 3PQDA 4JV5B 2GZRA 4HGZA 1N2CE 2V7BA 4GI2A 5E9JA 4I6JA 4U6QA 3EVEA 3UV7A 5LUAA 5CLIA 4RULA 1NFRA 1UOOA 3FMVA 2ICAA 5EJ5A 4ZI7B 5DKFA 4X8LA 4K87A 4X6XA 4Q9KA 1DPGA 2HA6A 3HKBA 4JL5A 5EP1A 2RGRA 3ISJA 2QAJA 1A7KA 4ENQA 2HSEA 2X8BA 4KWHA 1DBIA 1L1RA 1MAHA 3A9SA 3WAGA 3EZYA 1KKMA 3ER6A 2EFJA 4WZAA 2IYAA 5DTQA 1V5IA 2RONA 5BSUA 3ZTWA 3DHVA 2NO4A 2VLBA 5JO9A 1A97A 2AV6A 5EP2A 2RAVA 2GZ2A 5AK5A 4KWIA 1TCAA 1J0EA 3RWBA 1Z8NA 1P7CA 1YB7A 3G0CA 1E2QA 2WT9A 3RFFA 3FDZA 4HQKA 5IASA 2EDAA 2FFBA 4QYWA 3DHYA 3P97A 1R0WA 4K46A 2TS1A 3A14A 5HKBA 3ZPXA 4NNOA 3TXYA 3W4IA 1Q17A 2E1PA 3AINA 3RUHA 2FWMX 3ZDXB 3KQVA 4A8PA 2FR8A 2XSZD 3OE1A 4NZMA 4ZGBA 4GZLA 1D4AA 4ROTA 3GFFA 1E59A 4RFSA 5D1HA 3VXKA 4UD6A 3CB4A 4YT5A 5I48A 2OHGA 1GPDG 3GGGA 2Z8XA 5KYUA 2OHVA 4C5AA 2Y2VA 5HCIA 1DUSA 3HSYA 3ZWQA 3T7IA 1UK8A 1QE5A 1XK7A 1B6RA 3Q1KA 3U26A 1JQJC 5FFFA 3V7FA 2ZE8A 3LS2A 3MWJA 4WVLA 1QZXA 4MS1A 1QR2A 1TM2A 1XXHB 2DR0A 2R6DA 3A6KA 1PYOA 4L85A 3ELYA 1FSGA 1U3GA 2UKDA 1T8SA 1WTAA 2P9YA 4QECA 4MTCA 3NRCA 4YQYA 3U6BA 5F7XA 3ZDAA 1O5OA 3H9GA 4PNHA 1G1MA 1HRKA 3T1VA 5DM70 1QAQA 1S8AA 1CFJA 5DW3A 2JCVA 4K8RB 3H1EA 2DFTA 4QU9A 2RARA 3QMPA 5DW0A 2XB2A 3ESXA 3P4XA 1YZGA 4LRWA 3JASA 5DSTA 3TL6A 3PLNA 3CVUA 5F9FA 2B4TO 3ZBTA 2CNLA 3GQVA 5GV8A 1CSEE 3FTDA 5E38A 4E2ZA 4RZHA 5B1HA 2YX1A 1EGMB 4PEVA 5CXSA 3A1SA 4GOOD 3CLKA 4HLDA 1Z33A 4OKNA 2WJAA 2AC7A 2RHLA 1H42A 3NRBA 4FN5A 3AUSA 4ZKDA 4R69A 3DE6X 3VGPA 4LY0A 4IIYA 2VZ9A 5CVJA 3HJRA 3L6UA 5FPTA 2RAFA 4R5MA 3ICEA 4PAQA 1U0RA 4UNNA 4G41A 4D3FA 3BXXA 5L3QA 1OX5A 2CV1A 1CUBA 4F86A 2GPJA 1E6UA 1IN4A 1DAIA 3LC7O 4CXMA 1JV2B 4KV9A 4D74A 2R11A 5F4ZA 1G8GA 2ATVA 1T9HA 4NS4A 4QNRA 4TRMA 4LGYA 4WACA 1EAYA 1F38A 4A91A 2BUBA 1MIOA 4YXFA 4KXWA 4YLYA 4BVKA 5K8IA 3AVYA 1QIFA 1XD8A 1ZNQO 4W7IA 1MX1A 4UE6A 4DDVA 4CQNA 2X8LA 1UBRS 4FYWA 5J4YA 3HK2A 1PJSA 3FYCA 4YCDA 1LPAB 2CLSA 3HN6A 1A8QA 1CLUA 2DHQA 2VPTA 4KSCA 4ETNA 1VGRA 2ZJAA 4ND8B 2HU2A 4GMKA 1Z0IA 2IWHA 4ALKA 3HU3A 4BC1A 3RYCA 4TKVB 2QA5A 4LXXA 2VKQA 2JGDA 3ID6C 4M2LA 2MSNA 4G0UA 4Q4AB 1O7JA 4RVGA 4MJ7A 1EQAA 1ZQ9A 3WZMA 3BCUA 4U2KA 4XRGA 4N0EA 4EVSA 5JFOA 2YWHA 1L5WA 1JI0A 3DFKA 3LBAA 2XMSA 3K1ZA 4P08A 2O8DA 1P0FA 1CQIB 5AHOA 3C3KA 3CH5A 4II7A 2HEGA 4WJKB 5FYQA 1XRLA 2VF5X 1Y8CA 4RHFA 2A1TR 3P8ZA 2ZZMA 1O87A 1X42A 5TQ2A 4HLNA 1ZZEA 1ZPDA 3GYGA 3IO3A 4TL7A 5HKAA 3MCWA 5LP6C 4OK5A 4JLJA 3H7AA 1OX4B 1B93A 4HI0E 4M36A 4QASA 3QP9A 4L75A 2W0MA 3K6RA 4MWSA 3UJPA 4PNPA 3R8FA 1JR3A 2RGCA 4Q47A 3L1JA 5HBGA 1UP6A 3K9CA 2JAHA 4LDAA 4IWYA 4PZUA 1GPWB 3VYUB 2HMYB 1KNQA 1QMPA 5IG2A 1U3CA 2O9JA 3P9KA 5YASA 3C0KA 1HLDA 2ZB3A 3JS5A 2CNBA 1NQVA 4N5LA 5JHHB 3GPBA 1MB0A 4R1NA 4BBPA 1REQB 1YKFA 1WEKA 3ZGYA 4F12A 1TMOA 4Q4HB 2JG3A 2LZ0A 2P68A 1QKKA 4FKBA 4C6TB 2GO1A 3KOZA 3JQ8B 2V3CC 1OXSC 5H83A 2VRCD 1V41E 4JNCA 1GGMA 1MJHA 1NKVA 4QUBA 3A6PC 4ZTUB 4GX0A 5B3KA 5JU6A 4CRWB 1QHHA 3SC3A 1Z22A 3A3YA 2ZKLA 1MBZA 1VYTA 3FR7A 4NY1A 2ATXA 2NAPA 3LT4A 1KU6A 4FLEA 4U5QA 3TTVA 3CLUD 2XBLA 1RR6A 3SHVA 1NUAA 1I7QB 4HH3C 3FSRA 3TKYA 4LY3A 4ZQEA 2PWAA 2WTBA 3ABIA 3W1EA 1JHUA 4ZRMA 5H1YA 4CIBA 5JARA 1VPDA 1AH2A 5GIPE 2OFWA 3ZGLA 3ZHCA 1PL0A 3EA0A 1NOKA 3GEIA 4MWZA 4MPTA 5AKIA 5FBHA 1YDEA 2NPFA 3SZLA 3ZQUA 1XMQB 2Q5QA 2VDVE 5P8WA 4XRRA 4C7KA 4ZRNA 3KUDA 5K8CA 4CQMD 4ES6A 4AWBA 5COBA 2ZI7A 5JNTA 1UDXA 3HKDA 3KZ1E 3BWBA 1Q1EA 4IGKA 4GZ3A 2C2YA 4LRYA 1ODSA 5A05A 3VGJA 3KVYA 5BVGB 4AQ7A 4INJA 2QBYB 1NLZA 2CMKA 3SHQA 6CHYA 2W90A 4XARA 4JLAA 3RVQA 3RADC 4I1PA 1ZM2A 4P2BA 1VI5A 1GZSA 2E5LB 4KQIA 5E6RB 4QU8A 5HDBB 4JELA 4Y0AA 1FFCA 4M8KA 5EMKA 4DMLA 1PT6A 1EFRA 3BD7A 4Y98A 3X0DA 3UMMA 3SX0A 4MZXA 1E8NA 2ZI6A 1LI7A 4FPXA 5AW3A 3CQ9A 1PNQA 2HUPA 2OV3A 4KR7A 2R4UA 1PQWA 4LXQA 3RS4A 2WSYB 4ZT6A 1QHIA 5LZ5A 4Q9JA 3T6KA 1R3UA 3SG0A 1ONSA 4HZGA 2HRZA 4N7MA 1B76A 4UNQA 5KYKA 4W5OA 4H1WA 1GDHA 2ZE7A 4DCJA 1GCAA 5IJZA 2ZTMA 2GAJA 3RH0A 1TECE 6REQB 5LIRA 3SSNA 3TAHA 3LTEA 1Z6GA 1FFSA 3SC6A 2E6UX 5GJVC 1DAKA 1DIOB 3CZAA 3AR7A 4GP9A 1E1CB 4NJEB 1AC5A 3CLUC 3VHRA 3MTQA 4EA8A 5LZ9A 1ZK3A 2O8EA 4D9CA 3GT7A 5EE3A 2IA5A 4TTSA 4JI8B 4Q3KA 5CU7A 2B25A 5IDWA 1R64A 1M8JA 3AHEA 4CN9A 3TXAA 1NG1A 3N5KA 4B75A 3EQ6A 2W2LD 1JGTA 1E7SA 3PGXA 1EUDB 2CYCA 2X1HA 3KQSA 2Z8YA 2BHSA 1KEZA 3UXYA 5B3AA 3GUYA 3HWRA 3HXTA 3EF0A 2YVAA 2QAGB 4QXRA 1GPLA 1V6SA 4UHBA 5EUBA 1ULZA 3DF7A 4JAVC 3SZUA 2H0AA 3K9HA 5CIYA 2YC2C 3RVBA 1E6MA 2FPLA 1N6PA 1SBCA 1KI1A 3ADOA 3EOBI 3K1AA 2A6PA 3Q0EA 4GF5A 5CP8A 3RC1A 4NCJA 1T8UA 4WCFB 5I4BA 2CJWB 5LXTA 4L5AA 2JJ1A 3FYUC 5SICE 3F96A 1M0SA 2D00A 3PNQA 1ONOA 2R6JA 1NBIA 4RLSA 3B1YA 5K20A 1IJBA 1L7NA 1Z29A 1J42A 1XUOA 5KVAA 1CR6A 1C1XA 1EFVA 2R60A 4AKTA 3FNIA 1O97C 2OXEA 2UZAA 5CURA 2DERA 1CTQA 1KAGA 4JUDX 4TLBA 4ZMRA 1KWGA 3EXEA 2A3RA 1JT2A 1ONPA 1P9RA 4TMVA 3CW9A 4X1YB 2PJUA 1GRVA 3KOXA 1GWNA 4YJ3A 4Q34A 1V47A 3RAFC 2WYHA 3AFOA 1HNZB 1HFEL 1LK7A 2FP3A 4J7AA 4YR7A 2Q1SA 3PJDA 1YFJA 1ZOLA 3OQ1A 3SKYA 3ZEIA 1LVHA 3DLPX 4A8JB 2P78A 3MMNA 4Z4IA 3AEUA 5A3VA 4ARAA 2X9LA 4URWR 5TLSA 1G4AE 4LSZA 2PSJA 1G41A 2GBLC 2O2SA 2WRZA 5HOEA 1ZWKA 4LFCB 3S44A 5BV2P 4TYNA 4XFDA 4GR9A 2JAXA 3SX2A 1Z73A 4N0PA 1SXJC 4KFCA 1VLLA 1W4BA 3UT6A 3D8RA 3EFHA 4L4UA 1BU8A 3PQCA 3O4RA 4C06A 1P2BA 2PXHA 4LHXA 3BAFA 1OMOA 2EGGA 2OHJA 4BMSA 2GERA 3ZNPA 4BO7A 5K4GA 3J81k 3AGPA 2QN6A 1NPTO 2A33A 3G49A 3OUTA 4W99A 1MHPA 2XQIA 3HCNA 4EG7A 1E99A 1H0RA 3AHIA 5DK6A 4XASA 1R9MA 4XW2A 2PX6A 3ON5A 4LNHA 5DU2A 1M2OA 1GKUB 4Y6RA 1RE1A 4W9NC 1JFFB 3T1TA 2V9ZA 3I73A 3CUTA 1IZ0A 3DEKA 2HGZA 3CO0S 4PYRA 4U7TB 1XLWA 4AMZA 3N74A 4QEDA 4YY3B 4KVAA 3ITDA 4URXR 1AHNA 1HOXA 5CLJA 1VHWA 2OZPA 4N01A 4UNSA 4WERA 1S8FA 4L8GA 2WWVD 3LKZA 1ZBDA 3FPEA 4LEIA 3AG5A 5A9RA 5B3JA 2XCLA 4X93A 1G2OA 1WCXA 2FAXA 1TZMA 4P35A 4S3MA 5ANRB 2OAGA 3VPAA 1POXA 4ZXPA 1BDJA 4YRNA 2AD5A 3K4PA 1Y82A 3IV9A 1W0CA 1DWQA 3PFBA 5FUYA 5SZHB 3ORFA 2FKAA 2VJQA 1FA9A 2F6RA 3OT1B 2PMKA 4ZU6X 2PBLA 3IJPA 5LYJA 2PA3A 1PV4A 3DDCA 3VR3D 2ZPTX 1ZINA 3GY0A 3FSGA 4U5XA 2XOEA 3QU4A 2JLVA 3UCXA 1LVUA 4Q12A 1HORA 2PZKA 2D13A 3UH0A 4GSLA 5BSRA 1I2MA 3BHIA 2CJPA 2FW8A 2FDCA 2PVPA 1YIDA 1JLRA 2Z9CA 1RYDA 3FTCA 4GZMA 1SU4A 3KFVA 2VYVD 1HFJA 3ANYB 4TSFA 2FMTA 2YWRA 1TD9A 1YH3A 1U0FA 4I2NA 1Y37A 3Q10A 3JV7A 4NOMA 1SOUA 4LVUA 4MMYB 4P92A 4G0MA 5LMZA 4E2YA 4JVLA 4UU0A 3IESA 2FLKA 3K1YA 3TNDA 3WL7A 4L6AA 1OF1A 1VSQA 3O84A 2VPXA 4CMAA 1QGYA 1I4EB 4TLAA 5EQDA 1LTQA 4Q02A 5F76A 4M1MA 2D2XA 1QFYA 4OSPA 1DEXA 3RBZA 1GU0A 3TRKA 3QWIA 5ITZA 2Q49A 2C2GA 3COJA 3OZXA 4KRGA 4J4BA 1XCMA 3CPJB 4HNQA 5LMNB 1APBA 4ARIA 1R9NA 2RG1A 3V48A 4IO0A 5K0NA 3TZBA 4BNDB 5ARBA 3S6JA 5I01A 1A95A 2F3TA 5JWOA 3S8MA 1OREA 3VZPA 4MV7A 3DMYA 3U80A 1GVNB 3N7TA 3D4PA 5DLQC 3U7EB 3WDKA 2GVDC 2YVQA 1UZNA 3QUAA 2A5FA 3M2TA 4AKSA 2J30A 1Y8QB 2ZPAA 1Z2CA 1E3EA 1AZLA 5DULA 4Q4JB 4BEBA 4EMSA 4WV3A 2DKNA 1DTEA 3L5OA 1JP7A 4ENUA 2DBZA 4N3AA 2ZJ2A 3EY9A 4YP9A 1PT9A 3FCEA 4MINA 5LLTA 4MW7A 3DOHA 5EXPA 3T34A 4NENB 1SZCA 1Z08A 1RCFA 1YZ3A 4X44A 3N87A 3TJMA 1B14A 2PUAA 3FPFA 3QXJA 1PX0A 3IV6A 5NLLA 4BNWA 3INYA 3JAMA 3WOVA 1LNZA 2RHBA 3H8JA 2JGRA 1T4MA 1S7CA 2C96A 5H4HA 2O05A 3QHPA 4O8ZA 3RFXA 3EXAA 3HBAA 3IQFA 3VOSA 3E8SA 1O08A 2C8VA 3I39X 3ZHVA 1BQEA 2OCYC 3ISVA 3K8YA 4UBMA 3D8HA 3CSDA 4R1MA 3UHOA 5FFMA 4QRDA 4EPTA 3EQ7A 5BN4B 3U5ZB 4QVIA 1XZBA 3ND9A 1DKUA 1TGVA 4ARZA 3BTSA 3FZQA 4CBVA 4F93B 4DV6B 4LNUA 3L40A 4DIFA 3OJ0A 3RIGA 3GRZA 1V3TA 4EYQA 1C80A 5LB2A 4BQNA 4N03A 2GA8A 3U7QB 2XMPA 3W5JA 1K5PA 4LK3A 1H6CA 2C9CA 4OQFA 4ZV9A 4CG1A 4CIVA 5FRDA 4V1CA 1EUYA 2QUZA 1LX6A 2ES4A 3W3ZB 4IGIA 1DI0A 5IAOA 1M73E 3PUYA 3KZOA 3P2IA 3E3AA 2JI4A 5HP4A 1KI8A 4FUQA 1EG7A 1CY2A 1N1DA 1E4EA 1KMNA 1VHDA 5E3HA 1Y5NA 2OQIA 4LF5B 1YK1A 3TMAA 3WGMA 1P4AA 2O3UA 4JEMA 2CXUA 2FPIB 4NRDA 4MJLA 1XAGA 2PZMA 5F9MA 5BRNA 5A71A 5K01A 4ZQHA 5CDGA 3HFJA 1QFMA 3F73A 4HATA 5JQGF 3HZOA 4JJFA 4TV8A 4DF3A 1R16A 4B34A 4KVFA 4F6RB 3W4JA 5IARA 3B5IA 3ZK8A 4B5KA 1JHDA 4F11A 2EJTA 1X80B 4LTNA 3TNFA 4KACA 3I42A 4YJHB 2Q1UA 2CVHA 5KAPA 1L7EA 3JQCA 4IDEA 1U2PA 3R24A 3QG1A 3SLRA 4NNJA 1TYDE 1XCGB 1BCSB 1H1LA 3E5RA 3RS8A 1JQKA 2QE7D 4RSHA 3VPFA 2EATA 3AHFA 3EMDA 3T3DA 3UAGA 2FQQA 5L3VA 3T3OA 1CY7A 3IT1A 1KGDA 1NM5A 5K99A 5BWNA 5B7NA 1PSDA 3OKFA 3PJEA 1PFVA 3UBTA 4PPQA 4FOTA 3EVFA 3UJHA 5A6SA 3QLUC 2CFSA 2NADA 1S8OA 3GFRA 4QYIA 4WMLA 5CYFA 5AVXA 4A15A 4DCTA 2KMLA 4RESA 5F5NA 4YK7A 5K51A 2K87A 3FKJA 5CFMA 3WB1A 5AW4A 1ZIYA 2OMKA 2X15A 3ACCA 4KQJA 1K0FA 3B8HA 1UKBA 5DI3A 1FQKA 2Y9MB 4KYVA 4HNRA 1U7HA 4MKRA 4R2MA 4I4IA 4Y2RA 2FEKA 3J7TA 3KALA 2CMFA 3FUCA 4KN8A 4WL0A 3S2YA 2GXAA 5F3WB 3UT0A 2BFCA 2AG5A 1GCUA 1A5SB 1WNFA 2Z09A 4HFMA 4LDJA 4OHCA 1U8XX 2FPWA 4MXDA 3E7FA 5G4LA 2QL9A 5JCJD 3SEZA 4Q3DA 2Z83A 5I45A 1P6UA 1MZVA 2CVZA 2WABA 4ZGWA 2FJUA 5LL6P 3UQYS 2FN8A 3QU7A 3TZQA 3U0VA 2XMRA 2OPBA 4ITVA 1PG2A 5G3YA 3ZE7A 1IMJA 1RZUA 2NNWB 2ZUDA 1X8JA 4AKEA 1XXHE 3R0QA 5IU6A 1JFRA 3RPEA 1EJBA 5JVDA 1OIVA 1NW8A 4YRRA 5H0IA 3ZCXA 2XB9A 1TQ4A 1G60A 4BB9A 4R2WA 4YX9A 5H3CA 3H8VA 4KOAA 4UBKA 5AI9A 2JGLA 1P3Y1 3BXFA 4G1UC 5TGDA 3W1VA 3B5EA 4ID3A 3MJTA 3KZVA 2OV6A 3OPQA 4H1VA 3THSA 3ZWMA 4QT4A 4PGHA 2P4UA 4MYHA 1RJ9A 3DCIA 3PPVA 4G23A 2SICE 4MQLA 2BPOA 1T9GS 5EY5B 4F4IA 4DDWA 1VJ1A 5CXQA 1N1EA 4D0SA 5I9IA 1BJRE 2W2NA 3JQ6A 3LUHA 1V48A 5EKSA 4W5WA 5C18A 2Q6OA 4HQNA 1JBKA 2G17A 4AZWA 4C20A 1P91A 1VSTA 5ALUA 4OFZA 3SZRA 3RTBA 3ZDQA 1HEUA 4O5AA 3BJIC 4DRZA 1AXGA 1OLUA 3MTDA 2H2FA 4HGNA 4HZUA 3ORHA 4OVKA 4XGIA 2W93A 5HCUA 4EY6A 3EGXB 1B15A 4NYJQ 2OYSA 4ALMA 2ZB7A 3TPCA 1QV9A 1R6VA 3LY9A 2X9NA 4ARBA 1NOIA 5J2TA 2JGEA 1FDTA 1Z0JA 2BMWA 2C9DA 1ORTA 2OK8A 1D2EA 3OZVA 3PA6A 4JFAA 2PH7A 3Q87B 2D1FA 3TKLA 2O5CA 3HGTA 4QYMA 4CMCA 1YJ8A 3FF1A 3R6LA 4DQUA 1NJ6A 3NAQA 3PENA 2YJTD 1XZEA 5BSTA 1XQXA 1P1BA 4M0LA 1QKIA 1R3DA 1YQWA 3SSAA 4M1TA 3UH1A 3Q5DA 5LNK1 3VMFA 3NI2A 4OLAA 4QOFA 5AM0A 5GP1A 3PFCA 4F56A 4WHMA 1RXVA 4UJ3A 1MQ9A 2G0AA 2P8SA 4ASUA 1KF0A 1RKUA 2HFJA 4PZEA 4BYGA 5JYDA 3BICA 3HJTA 2XD4A 2VNKA 4E22A 5BV8A 1CUAA 1CLEA 3DZIA 3N9IA 4Z9YA 4QLAA 3QVWA 4U2GA 2HZBA 1W34A 3RC8A 4F8YA 5IJ9A 4BDTA 5JV5A 2FOIA 2JAOA 5EA2A 3N2GB 4OO3A 2G9UA 3ELDA 3S2GA 5BVHB 5LP6B 4PC3A 5KWVA 5CA1B 1LS1A 5FO0A 4V0KA 1WABA 3ADKA 1J70A 2BGWA 3F90A 4CF3A 3TOCA 2P2ZA 3M1AA 3NUQA 3OHMA 2PLAA 3HDTA 5B53A 2SBTA 2F8LA 1DQPA 3JQPA 3ILSA 1NW6A 4P34A 2WAXA 5EZYA 1V3VA 2GD6A 3HXLA 3WLNA 4EHAA 4EH1A 4IQGA 1O8CA 1MQSA 2XEDA 4JJZA 1KO4A 1E1KA 2X3FA 3AF2A 1CG6A 5FB3A 4KXYA 5PGMA 4OV6B 1KZ1A 1PHRA 1G2QA 2M2IA 1Y42X 4CF4A 3EEIA 5IK2A 1NBMD 1M6VA 1XD2B 1RZRA 4LRXA 3HUUA 2GJ9A 2XUQA 2K7FA 3ZWAA 4BPBA 2JFOA 5MGBA 2ONYA 4UBIA 2F62A 1H2AS 1XHEA 1YZLA 4IFEA 4LHZA 4ZEWA 5UKDA 1VBFA 2HRBA 4G5GA 1QG0A 5ARCA 5JATA 1E2EA 1Q1BA 1ZW6A 1RRGA 4LQCA 2VQDA 2ON6A 2C2OA 5FWDA 1G21B 1G8SA 1SG9A 3QFRA 1E58A 4GVLA 4U6SA 2BGRA 2V59A 4GI7A 1B0UA 5EHXA 5JAQA 3WK7A 1KYZA 5BSVA 1A88A 1XPRA 4WAUA 5L7WA 1QO0D 3G0OA 3R23A 6NULA 2QVYX 2CXSA 4RFLA 5AKHA 3B1ZA 3EZFA 2VK4A 5IEJA 2V6IA 8AT1A 2EJBA 2FW6A 2J9ZB 3ND7A 2L69A 4UREA 3H5AA 2VF7A 1GG5A 3VDXA 4EUHA 2A35A 3O3OB 4PX3A 4XJXA 5D3MA 4B2IA 3B2EA 3FVWA 1EFUA 1ZLXA 1T3SA 4H7HA 2VWGA 3PDUA 5DASA 2WFMA 3SC2A 5K03A 2B6NA 4MGKR 1UFOA 4OH7A 3M6MD 5LFAA 2K7ZA 5AHWA 4OXKA 4OXXA 3WRXA 4MGIR 3QKRB 3MMSA 1YUNA 2YJ4A 5IC5A 3LFUA 1SB9A 5HZGA 3UC9A 1ORHA 4M98A 3OOEA 2ZIWB 2PEYA 3BRCA 1M2HA 2ODWA 4PQEA 2ZRCA 1AD2A 2OEPA 2OBLA 3L7CA 1D1SA 4P7JA 3OD5A 1H4QA 1RJEA 3R0VA 3TQQA 4M76B 2XXAB 5DZSA 3IT2A 1H6BA 1NMYA 3D7MA 3JSAA 3N76A 1XZNA 2QVCA 3PB3A 4KV7A 4Z2YA 4HOYA 5JI3E 3VOBA 3VO1A 1KS2A 1DO2A 1QFZA 1U1IA 3EC1A 1JJVA 3UJBA 7ADHA 4RGYA 1CUIA 4AZ0A 2BW0A 2QSJA 2FE1A 3FYHA 1CUYA 1G3UA 3G23A 1ZUD1 4O4JF 4LXUA 5TS2A 3ST7A 4EX6A 1E4OA 3K6KA 3WKDA 1WSBA 1JSXA 2PCJA 3QVXA 3RU2A 1JIUA 2GJ4A 3ZV4A 4ADSG 1PWXA 1ID1A 1ADFA 2YBEA 5K4HA 4RZQA 4TWIA 2UVPB 1PQUA 3DBLB 2EU8A 3E9RA 3N8IA 4ABYA 5JS1A 4FSXA 1SG0A 1RJGA 4YRPA 5LNK6 2W6QA 1KHHA 3HHEA 3LBHA 3QFTA 4FHDA 4HH4A 4C0XA 4DMGA 4I2VA 1OXUA 2O0HA 3I9NA 4FNAA 2ILTA 3RVMA 1PWEA 3CEPB 1D4ZA 1MRSA 4QBGB 3JAKA 3RI3A 1NMXA 5AJWA 4BFYA 3BJEA 1LU9A 1T2VA 1Q20A 2I2DA 2PMFA 4QFCA 2HR1A 4YLEA 2QT1A 4LDRA 3G9QA 2P2DA 1QUFA 2X1VA 3D2AA 1N0VC 1L8OA 1XZDA 4U63A 3V8NA 3EQ2A 2NU8A 3DZFA 3KR0A 3E7WA 3KOYA 4ZOLA 4M1ZA 3K15A 5K0SA 3Q2OA 1Q2XA 1JG7A 1EUCA 3BREA 2VOEA 1LSSA 3LXXA 1OWPA 5TQJA 1DWPA 2VVTA 2X8WA 4FYIA 4LKRA 5JZOA 2XGGA 3AM3A 3NVKI 1DUVG 1Q7TA 2GTPA 1ZC3A 5B4VA 4MVJG 4BKPA 2J0UA 2AA3A 1W0JA 3JD1A 2OYCA 4I5IA 4G97A 1G5IA 1GV0A 1PEAA 3T06B 1TMYA 3MTIA 4Q7JB 3HM9A 2VPYA 1JU3A 3AI2A 3ADDA 1CUDA 4YUZA 1NXQA 2NG1A 3AQ4A 1IQRA 1P62B 3L82B 1ZHFA 4TL6A 1GN8A 1JJIA 1QQTA 5IYZA 2NTYC 2JFWA 4C7BA 1O95A 3VR5D 4ESVA 1Z4PX 1XCLA 1SXJB 1WAMA 1YVEI 2NO5A