5IEJA

Solution structure of the bef3-activated conformation of sdrg from pseudomonas melonis fr1
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
MSALTQILIVEDEPLIAMMLEDFLEVLDKTPVGTVDTVAGALARVEDGGIDAAILDVNLRGGEKSTPVAEALAARDIPFVFATGGSDDSVDSRFRDRPVLQKPFTMDGVAKALAALLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of the PFXFATG[G/Y] Motif in the Activation of SdrG, a Response Regulator Involved in the Alphaproteobacterial General Stress Response.
pubmed doi rcsb
source organism Sphingomonas melonis fr1
molecule tags Protein
molecule keywords SdrG
total genus 30
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2016-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5iejA00
2YHBA 1IIBA 2PAFA 4W5RA 3OQNA 3GBVA 1F4VA 2NT3A 4IRXA 4QICA 2VK2A 1JFVA 3I5AA 4MGEA 2ID7A 2P9HA 5EWMA 3SG0A 4ETNA 1SXGA 3ROFA 2B4AA 1A0OA 4O5AA 4FE4A 3O1JC 3CHYA 1L5YA 4Z9BA 1C0EA 1ZY2A 4RY0A 3A0RB 3O74A 4KV7A 4YLEA 3K4HA 2L18A 4MLCA 1A04A 4Z4GA 4RK5A 3ROTA 3HK2A 1DBPA 4ZMRA 4Z4CA 2GBPA 4KQCA 3BRSA 3LUGA 3HO1A 1U04A 1DRKA 5TPWA 2HQOA 6CHYA 1FSPA 4YCSA 3JPYA 4IF4A 3GYBA 2WJAA 3I45A 3LOPA 3A10A 2ZAYA 4MS1B 5FWXA 3EULA 3N0RA 1DZ3A 4EVQA 1K66A 2R47A 4L4UA 3RVPA 1CEYA 2IOYA 2LIVA 1E6LA 2GI4A 2NZUG 3JVIA 5FWXB 2IPNA 4NQRA 3UK0A 2V0NA 3C3MA 2QVCA 3BILA 3HJFA 3NHZA 4KMRA 4E7PA 4MS4A 3O21A 3EDCA 4D6XA 5JNSA 4Q7EA 3RQIA 2QZJA 5FWYA 2O20A 3Q15C 3E61A 3Q7RA 5IULC 5D2CA 2P4UA 2VUHB 1U8TA 1Z26A 3NNDA 3OLVA 2R48A 1ZITA 4MR8A 2WY2D 2M1ZA 2IYNA 4G0ZA 5IX8A 1QP0A 4RKRA 3CKMA 2I6FA 3H5OA 3HSYA 5IEJA 3HCWA 3QX8A 5PNTA 1WETA 2HQBA 4F12A 1BDHA 2FLWA 1Z15A 1DC7A 3ILYA 3LUAA 5E3JA 4EYGA 5BQ3A 5BRAA 2PE5A 1PEYA 3HDVA 1USGA 2PLNA 3BRQA 2FLKA 4EVRA 5TQ0A 1PEAA 5IUNC 3N8IA 5GOTA 4NICA 3LUKA 4DN6A 3FGZA 2L19A 2QR3A 3SQNA 4H3HB 2Q5CA 4MR9A 5FBKA 3MM4A 2IPAB 2H0AA 1NXTA 3KLOA 4MPTA 4YV7A 4M88A 2PUDA 2E4XA 4H3KB 4D6YA 1YS7A 3CRNA 4GNRA 2GKGA 1JH9A 1ZGZA 3SY8A 2PUCA 4LE1A 1ZDMA 4Z4IA 8ABPA 3I42A 3C97A 2JVIA 4MQFA 1ZAYA 2MSKA 1QO0D 2E4YA 1MAVA 4N76A 4WXEA 1D1PA 3QEKA 4WZZA 3H6GA 4XARA 1VLZA 1JDNA 5FBHA 2AYXA 4RK1A 4YGXB 3GWGA 2CWDA 1GUBA 4WUTA 1YMVA 3KYIB 2MYTA 4MR9B 4N47A 4Z4FA 2R25B 4ZMSA 2L17A 2LPMA 3EJWA 3TX6A 1E6MA 2KYRA 4YS6A 4G97A 2FEPA 4KK3A 3H75A 4WWHA 4W5NA 3T6KA 1NXPA 2A9PA 4N0PA 4GPAA 5DLEA 3CG4A 5ED4A 2AYZA 3HV2A 3IPCA 5B3JC 1AB6A 2PL9A 3O1IC 4YP9A 1EWVA 2FW0A 1DBQA 4EGSA 4NCBA 3B2NA 1Z13A 4JP1A 4MR8B 5C5EA 4IILA 1PNRA 2FQWA 4RY9A 4PEVA 3T95A 3CG0A 4PE5B 3JPWA 1Z25A 1BAPA 1P6UA 3FDFA 1APBA 5DCLA 4RS3A 1TMYA 2A9RA 2WB4A 4MS4B 4RXMA 4Y9TA 3N6VA 3UKJA 1LJUA 5KQPA 3BREA 1FFGA 4Z99A 4MRMB 4F06A 3H5WA 4HNRA 5DKFA 3JS5A 1W9HA 2E4WA 2OENG 3H5TA 4MRMA 4XASA 1M5TA 1GUDA 3N75A 5KQGA 1R8JA 5IEBA 4Z4EA 3BBLA 4G0OA 3QLTA 3EGCA 1A2OA 3DGFC 4RXTA 4RDCA 2PUEA 2NT4A 4MLDA 4ZJPA 1QQAA 1XHFA 3N0WA 4TLMB 1ISSA 2IDMA 3EAFA 3MIZA 4XAQA 4EVSA 1RPJA 4RK6A 3RVRA 3OQOA 2FTKE 2N9UA 2X7XA 5EWMB 1YK0A 3P9YA 1OXBB 3CTPA 4RU1A 4F3TA 3A3KA 5JS2A 2JBAA 3W9SA 3KLNA 1VRVA 3VNAA 5CHYA 5KWSA 4MS3A 3F73A 2JB9A 2PUGA 3IP9A 4MS3B 4EYQA 3OMWA 1VPWA 1LBHA 1P2FA 2FQYA 1JYFA 2PMCA 5HM6A 4PZ0A 5KQLA 1GCGA 1KRXA 4Z9AA 3HM9A 3LUFA 3QK7A 3RVOA 1I3CA 1ZH4A 2A9OA 3LUDA 3MYYA 2VUIB 5EWLA 1USKA 2H3HA 2M98A 2FVYA 3RVNA 1RZRA 5JNVA 1L5ZA 1GCAA 4RK0A 5TE9A 1TJYA 4OTZA 1U0SY 3LUHA 1ZH2A 3GV0A 1RNLA 4LZLA 1Z18A 4RY8A 1MVOA 1QP7A 2VYCA 2RJNA 4RKQA 4MQEA 3D02A 1D5WA 1JDPA 4TMYA 1DP4A 2RGYA 1J56A 4YR7A 2JVKA 1RZRD 2PUAA 1KGSA 1ZGGA 2MYUA 2FKAA 3H1FA 1JFTA 3T38A 1Z17A 5TPZA 1JF8A 5CNKA 1XHEA 3QX9A 3RVQA 1M2FA 5TPWB 1GLGA 5JNWA 3EODA 5KI6A 4KK4A 1NXWA 2TMYA 2JRLA 3LMKA 4ZPJA 3GA5A 4KVFA 3OQMA 4MS1A 4WXMA 1DCFA 4MR7A 3URMA 4EY3A 5JS1A 4DADA 2GX6A 1SXIA 4Z0NA 1USIA 2HPHA 1DBWA 3M9XA 3KG2A 1Y1LA 3IP6A 3GBPA 4XFKA 3OLZA 1PHRA 4LRQA 4G0XA 3MMNA 3D8UA 3RVLA 3KJXA 3EQZA 1JWLA 3LKVA 3C6QA 2B1JA 3MA0A 3NNNA 3OLYA 3HVRA 5ABPA 4ZYLA 5JNRA 4G86A 2NZVG 3IP5A 1FFWA 2PL1A 4RV5A 1SXHA 1Z2DA 3G85A 4MAAA 4OBBA 2PUBA 4OLAA 4JAVC 1XWWA 2BGGA 4XLTA 3HUTA 2DRIA 3L49A 3VNBA 4LDAA 1EFAA 1MB3A 4OATA 2FN9A 5TQ2A 1LJLA 1PUXA 3CNBA 3TO5A 1BVHA 1D4ZA 3CS3A 5HSGA 3GL9A 1D2AA 4RZSA 2FQXA 1B00A 2F8SA 2IKSA 3DBIA 4CBVA 4YRZA 5IUJC 4N41A 3I09A 4LDZA 2FSPA 4L85A 5T3YA 2E4ZA 2JVJA 3T8YA 3NBMA 2FMKA 3NHMA 5HQJA 1U2PA 3E3MA 1BDIA 3QLVC 4O1HA 4JB2A 3QEMA 3DZDA 4EYOA 1LK0A 3F7NA 3HZHA 5CNJA 5EWJA 3H5VA 3O1HB 1EWKA 2FMFA 2QU7A 3DLBA 4D74A 1Z16A 3EQ2A 3LUJA 1F51E 3KCNA 4IGAA 4Q6WA 5F64A 4B09A 4Z4HA 4HYEA 3RVKA 1MIHA 2XDYA 3CFYA 4P1ZA 1RXIA 4W5QA 1HEYA 2MSLA 2QXYA 1EWTA 3IDOA 4KZKA 5IBQA 7ABPA 4KRFA 5GQSA 4FB4A 1DRJA 3SM9A 1YMUA 3GT7A 4IMIB 1ZESA 4G0PA 3CLKA 4Q6BA 3RVSA 5BR1A 3FFTA 4LE0A 3IPAA 3RH0A 4O1IA 4N03A 3Q41A 4HNQA 4RK4A 4WT7A 4OLBA 1NXOA 4XXHA 1RXEA 3HEBA 3O2SB 2ID9A 2FEKA 4ML3A 4P98A 1TVMA 2MYPA 3KSMA 1ZVVA 5JNTA 9ABPA 2FMIA 1JFSA 3SAJA 4PICA 4F11A 1OXKB 1YVUA 3DGEC 4LE2A 4DQDA 2FMHA 5BRJA 1YTUA 1Z12A 3LTEA 6ABPA 2A9QA 4S04A 4TN5A 5C5CA 2QVGA 5TQ2B 2FEWB 2PKXA 4RSMA 3H6HA 1ABFA 1QKKA 4E7OA 3O2JA 4KFCA 1H9CA 3HUUA 1FFSA 2NUBA 4EUKA 2JCGA 3CU5A 3KKEA 4RK7A 3Q9SA 2R4QA 1S8NA 5EWLB 1JYEA 4F8JA 1BA2A 1TM2A 1E2BA 4S05A 1NXXA 5I4CA 1K68A 1ABEA 2CD7A 4OG2A 1JHZA 5TPZD 4IMJB 2JK1A 1NTRA 4YWHA 2HQRA 3O75A 3DLHA 3TD9A 3OM1A 3JVDA 4HNSA 1CHNA 1UDRA 2LBPA 5TQ0B 5HKOA 3FFXA 1URPA 1JL3A 4TLLB 3M6MD 2FXIA 5EWJB 4JOQA 1BDJA 3Q7TA 3C3WA 1NY5A 4QYMA 4W5OA 3MF4A 1SRRA 3FMVA 1YS6A 3OLWA 5IC5A 1P8AA 1T34A 2PUFA 2WRZA 1QPZA 3LKBA 4JA2A 2CHFA 3QELA 3N0XA 5TQJA 3G1WA 1PNTA 4LX8A 2GWRA 4MQEB 3KS9A 3O2QB 4G0MA 3UUGA 1NATA 1NXVA 1KMIY 1YIOA 2F8TA 3K9CA 1TLFA 4JASB 2IPLA 4QPJC 5DGCA 3OM0A 1LBIA 4RWEA 2QW1A 1EHCA 1ZN2A 4JB0A 4RXUA 1DC8A 2L2QA 4KPYA 1P6QA 1M5UA 3NNSA 2LP4Y 4PYRA 3GRCA 2RDMA 3H5IA 4KQ9A 4FE7A 3CZCA 2LUOA 1C4WA 3R0JA 1QQBA 1D1QA 2WMYA 4ETIA 3QLUC 3QEMB 3C3KA 3H5LA 2HJ9A 1ISRA 4MQFB 1DCMA 3JY6A 5T7BA 3FFWA 2JBAB 2WJWA 4KREA 4KNYA 3Q7SA 3TMYA 3KHTA 3S99A 3KYJB 3QLUA 4G0QA 3LFTA 2W42A 3MQ4A 5IUKC 2E4UA 1KRWA 3JTEA 2E4VA 1CYEA 2IPMA 2CHEA 3QELB 1VKRA 3OO0A 4G0YA 3H1EA 1JLKA 3OLXA 2WWVD 5KQMA 3SNKA 1FQWA 5KC8A 1DG9A 2ZWMA 2MSWA 4NCAA 1JBEA 3IP7A 3H1GA 1SD5A 1YK1A 1NXSA 3CZ5A 2HSGA 3N53A 1DCKA 5B3JA 2RJOA 1M2EA 1QO0A 3L6UA 3LUCA 5JNUA 3F6PA 1DJMA 5DTEA 3QLVA 5CNMA 4MYRA 2J48A 4QYWA 3F6CA 3ILHA 2OQRA 4YO7A 2FN8A 2MYNA 3M9WA 1QNLA 3RVMA 2QV0A 3OMXA 1U2QA 1EAYA 1MB0A 4NV3A 3HXMA 2PJUA 1Z2EA 5FWYB 5KC9A 1JX6A 1W25A 3HS3A 3OO1A 4ETMA 3A0UA 4N0QA 2QSJA 3KTOA 1ZHHA 4UHKA 4EYKA 4MR7B 2YHAA 5CNIA 4W5TA 4UHJA 1AB5A 1E6KA 3TB6A 1QP4A 3RVJA 1QMPA 3HDGA 4H60A
chains in the Genus database with same CATH superfamily
2FGKA 5HOQA 4OMDA 4PAGA 3EGDA 4WLUA 3LBYA 2C84A 5G0VA 2NYAA 4G8BA 3WA6A 2WKRA 1AZTA 4B7AA 3LYLA 2R2GA 1XZJA 2JFVA 3HYNA 4EFLA 5HIAA 3IIJA 5FWAA 1WOYA 3KQUA 3LT1A 5G02A 2ID7A 4DRXB 1IZ9A 1LRLA 2W58A 1H5QA 2R5WA 3PV0A 1YACA 1MB2A 2WZDA 3HA3A 3EF3A 4WGGA 1K63A 4DANA 3DZJA 1P19A 1CS4C 1V6CA 2NXNA 3R40A 1ZY2A 3ZR4B 3V4FA 3NM4A 1DOZA 3T9EA 3ZHCA 1XTSA 4M9CA 3OVMA 3WDSA 1XDSA 3BL6A 3I5YA 1Z5OA 1THZA 5LA6F 3WRXC 4D02A 1QCCA 2ES4A 3I6ZA 1KSHA 1CRQA 1GP2A 3IDFA 5H1YA 3TRFA 2HDHA 4OXIA 3ANXA 2JD2A 1HSZA 4IZ6A 1JJBA 1JNYA 1YU6A 4EJ6A 2DSNA 3I4CA 4MQUA 1PZHA 4M87A 5CFNA 2QLLA 2WYWA 4MS1B 3D6UA 3QY0A 2RCYA 2W2XA 4GPD1 2VSQA 3JWHA 4LC1A 4BO0A 1QP7A 1N3BA 2X3UA 4V03A 2G5PA 1CYDA 3B51X 1F60A 3L0ZA 3NH9A 3JR3A 3SPXA 5BV1A 1I94B 3THWB 3TL6A 1A71A 2ZUDA 3BE4A 5IKMA 3P5BA 5JAPA 2R86A 2RGXA 2WF7A 3LCVB 3SMVA 2RH8A 1G3MA 5DXAA 1MUUA 2PXCA 3QOYA 1SFRA 3H04A 2FZVA 4YJKA 1Z26A 5LNK6 3PYMA 1AKEA 1RXCA 1NE2A 1E60A 1XLVA 3HUFA 3TVTA 4B33A 1QP0A 4JXXA 4BWYA 3HCWA 2EWWA 1KZ1A 3I01M 3DE3X 5L3SB 4OI0A 1DC7A 3G49A 4GPBA 1E2NA 4K9DA 4MHSA 3QJ5A 1C2TA 4BX2A 2JFHA 4KACA 3WICA 3OKPA 3BD6A 1W5BA 4UCQA 1EFDN 2BFEA 4R01A 4TROA 1KMCA 4Q4AA 3TE7A 2FWAA 2XUZA 1H4QA 3BFJA 1G38A 1TKCA 4RTMA 4EMSA 3UXHA 4ISCA 5K0EA 4PC7A 4UXHA 1G4UR 4FGWA 5FBKA 1G5IA 1K6IA 4L4ZA 2JFXA 4MQ6A 2B3DA 2H0AA 4S24A 2IUEA 2OBXA 4ZDKA 1OX4B 2A57A 3NJ8A 4FZVA 1RZ3A 2AV6A 1V37A 4GNRA 1Z4KA 2R8PA 5A05A 2VNIA 3HZRA 3PDUA 4V24A 2E5WA 5F1YA 3HLYA 5DI3A 4G2TA 2VQSA 4MQFA 3RBVA 4LBYA 2C7GA 4HRYA 2H1HA 1FFDA 3LXXA 2QYSA 3PFCA 1RXSA 2NV0A 2PZMA 4U2FA 4ASUA 5I48A 3NUGA 2AFHA 1S1MA 1SB8A 3ABZA 4OHRA 4B43A 4OOFA 4ZIRB 4DMCA 1L1QA 4C4AA 1NYLA 3GG2A 4DWOA 4DLUA 5BXYA 3AVUA 4HPJB 2W43A 2QRVA 4UHCA 1DG3A 4AM8A 4IHKA 5JE8A 1W93A 2Q6VA 2YXNA 2G4VA 4YS6A 1MABB 2J5XA 2H1VA 2REOA 2AJLI 3D64A 3P9SA 4X6XA 2H65A 2V7PA 4DJFC 1U0JA 5CB4B 2ETVA 3Q88A 5A06A 5E6UB 4JEIA 1S2IA 2WWRA 3IEKA 1DUIA 1WUKS 3VZCA 4ZI5A 1DBQA 4GOOD 4KIFA 4NYIQ 3UMSA 4MR8B 2NP7A 2PL5A 2V7QD 3ZYZA 4ZN6A 5K2OA 3WK4A 1PNRA 3MERA 5EUMA 4CIAA 2QT9A 1RS0A 1XWIA 2GK6A 1LLFA 1PAUA 5K8VA 5IDWA 1KPHA 1P6UA 4J3FA 1NBEA 3U60B 2PQ2A 1I30A 2AXQA 1XNHA 2IDJA 2VNSA 2Y4NA 3FBTA 5CJ2A 3RV3A 4DJAA 4MS4B 3TH5A 5JADA 4M8LA 1LJUA 2YJZA 4EHBA 1RRGA 3WHKA 4TWAA 1F5SA 1GADO 5FORA 2SICE 2GILA 5DEOA 3TJMA 4LRXA 2Q2QA 3OT1A 4B8WA 3AJAA 1VP3A 4EKEA 1I2CA 1LWOA 3Q85A 1T6YA 2JLYA 4HQLA 4JUBA 5GOZA 1WOMA 4JVOA 3O5AA 5LYJA 4CKEA 5JOQA 2DBYA 1KZ9A 1VFPA 1JXOA 1TUEA 1N2CE 3H5NA 5JSKA 4QM6A 4XUGB 2UYGA 3A4YA 5DN9A 5DYGA 1IHUA 3TDNA 3U1BA 1JA9A 3CW9A 3MC1A 2NO1A 4I2VA 1E92A 2Q62A 4DWVA 5JMWA 1V41E 4MOWA 4P3PA 2CJWB 4EVSA 1RWPA 4CM7A 4QBKA 1N6KA 5I8ZA 5INTA 4QFDA 2R6FA 3PFHA 2X7XA 1MC8A 1Z22A 5JALA 1W6RA 4NYIR 3VMMA 4G23A 1THMA 2REQB 5J2UF 4OGWA 3O0TA 4RU1A 1FQKA 3VX4A 3ZV4A 1N75A 3FJOA 4Q93A 2GOYA 4S2UA 4XCQA 4EG8A 2H1CA 3W6OA 4AMGA 5BVHB 3V5NA 4B35A 2H5IA 1SOAA 3VFDA 1CV2A 2H1WA 1RPAA 3AYZB 4PSAA 1N5RA 4GYJA 1L7BA 3L8EA 1OX5A 3NEPX 1CUEA 3PJRA 2E89A 4BY9E 3RAGA 4YX9A 5ICMA 4GOKA 3RS5A 2E85A 3NHRA 1O5TA 5A5VA 1BNCA 1IAVA 1X1EA 2ZPTX 2CCJA 3OE7A 3BPSA 4XW2A 3V2GA 1NDQA 1PR9A 1QH1A 2ONCA 1D1SA 3KZOA 2M98A 4EY4A 1QC5A 4U7DA 1FNDA 4IWNA 4MCAA 4XLLA 1TA9A 3SYMA 2ZTMA 3QTBA 3T0GA 1M2JA 2C57A 2P65A 2Y1OA 5HNKA 1ZL0A 1TNDA 3R41A 4HWKA 1WEHA 4YR7A 3F6EX 4OSOA 1I8TA 4RNDB 4I1RA 1WNFA 1Y8RA 2XJ9A 3LQ2A 3PP8A 3FVQA 4A1OA 3DYVA 5A7GA 1HA3A 5CFQA 1RZUA 1U2DA 3QX9A 2C4VA 1GUZA 1UBCA 1MJ5A 2VLBA 2CHUA 1UDBA 3EZXA 3U1VA 4Q66C 4Y7CA 3E8SA 4PNZA 1J5PA 1EHIA 4UFPA 2P90A 2F2TA 3L5OA 1SXIA 2H1SA 3LLMA 4D8UA 1WZNA 4HS4A 1CFJA 2Y6UA 3IP6A 4ZD6A 2VAPA 1EP3B 2JFQA 2YVUA 4R2MA 4F2WA 3ZIDA 4ZVVA 5K0JA 5KNDA 1KC3A 4R69A 2QN1A 9ATCA 4I9NA 4TWRA 5CXXA 5IK2A 1ISPA 4IICA 1PFGA 1VL8A 3LKVA 3B20A 4Q4HA 3MA0A 2BR3A 1N2BA 4PO1A 5CEEA 4GF5A 4CI9A 2I80A 4QDJA 3KTAB 4RV5A 1UR5A 3CJRA 2BKLA 1PZMA 4RCYA 5CT6A 5TS3A 1VJCA 4TUYF 3CB4A 3UT6A 2BGGA 3CKYA 1J7JA 3V80A 1QLHA 5AOCA 4BFSA 1MB3A 3IOEA 3WS7A 2OG2A 1QQ5A 1K8QA 2EJUA 5C9ZA 2W2QA 1MAUA 4ZZ2A 3MJCA 4BFVA 4IV5A 1L5MA 4HLCA 2I65A 1P4GA 5I3CA 1N2EA 1AU9A 2ZJ1A 1GPBA 1T0UA 2WD7B 3D3WB 3RTGA 3NASA 3I5XA 2IFTA 4FFPA 1RQLA 3T9BA 1C81A 4N41A 1FDTA 4U5XA 3JQAA 4YRMA 2NXWA 1IN6A 3UOGA 5T3YA 1JQAA 3VKUA 3BCRA 4YUVA 4PXSA 3K73O 4UKDA 2WA1A 1DXYA 3FB4A 1T4BA 3IBFA 4WOPA 5FO1A 3QLVC 5L4LA 1CW2B 5E95A 1VE5A 4RD6A 2VJCA 3D6MA 4TMZA 3A3NA 2DMRA 2J41A 3TFWA 3ZWQA 1R0KA 3THWA 3ROKA 1T6BY 4DREA 1RIFA 1QWSA 4IH1A 4IDQA 2EEPA 2QRKA 3IBGA 4XEHA 5DGXA 4B6FA 3P7MA 2YOFA 3KR9A 4Q6WA 4TT8A 3CRZA 1ZD1A 2PX8A 1Y7LA 1RXIA 1P5HA 2P41A 4FT4A 1DS6A 1NASA 3RRNA 3LKZA 5FCDA 4CFZA 2ZR0A 2EYQA 2JI6A 4IGFA 3QEJA 4LQCA 4RVNA 4C6HA 2OCGA 4W5NA 3STXA 2VXCA 4QU9A 4NC9A 1DRJA 3PEWA 2A84A 3FOEC 4GI5A 5C4GB 4LWPA 2AX4A 4KDCA 1DV2A 3CLUC 3C74A 4HAIA 4Q6BA 4CUJA 1RRKA 1KK1A 2EQ5A 4O63O 1JLLA 4WEQA 1R0SA 1SC3A 2ORYA 1ZJWA 2BR5A 2FPPA 1KKMA 2Q4BA 5L7YA 1FXWF 5I9TA 1ZS9A 4P98A 1JEEA 4OJYA 4LQ4A 3D7MA 2K2QB 5JSZB 1L1FA 1FIUA 1ZVVA 4RV9A 4OQNA 1FP2A 5EKSA 1UMKA 1MV8A 3TLMA 5B57C 2JBWA 1YJ5A 1SBQA 2BYTA 4YP5A 3E7FA 3CURA 2V97A 4YK7A 1G8AA 1IEQA 2JIBA 2Q8PA 2VTVA 4IX1A 2ZWVA 3AIMA 3RAFC 3A32A 4UULA 2HOQA 2NUBA 5FV7A 1YGPA 4ECAA 1G7TA 3VR0A 5KWJA 3A9RA 3FE2A 5ESDA 2A5YB 4E07A 4R9RA 3C5WP 3G23A 1R9GA 4PLPA 3B6ZA 1GGMA 2ISCA 1I6MA 4LZJA 1Z0SA 4JH0A 5KPJA 1CZOA 4C7OA 1YZUA 3BG5A 3B5JA 2OB1A 1X42A 4LTNA 4X6UA 4FYMA 3HR7A 2A30A 3WO1A 3MEQA 1NUPA 4FZ5A 3PEVA 1GHTA 1NVDA 3MTBA 2JAPA 1BXGA 3MT9A 3DMYA 5KVSA 4BQOA 2ERCA 2HA4A 4MJXA 1KOGA 3GRAA 1MG0A 2Y1XA 1U0BB 1UP4A 3E1GA 2ROQA 1LLCA 1WTAA 2EFGA 5K5EA 2BGLA 3BSYA 2IF2A 4PM4A 5KWIA 5HF8A 1KVSA 1JJ7A 3NEJA 1QRTA 2FPUA 3C16C 3N1UA 1GTL1 2J5RA 4ROSA 5DMHA 2DWQA 5EERA 3JQ8A 4CM8A 2C83A 2X5NA 3JQGA 3VVLA 1ZNWA 3KQVA 2GHIA 1HKHA 2GARA 3PXAA 1GA6A 5J4KA 2ZB4A 1KNXA 4G37A 1J00A 1CUVA 1X3LA 2VAMA 4TZ6A 2ACEA 2AE2A 4UBKA 1O95A 1Q0ZA 1VIYA 4MW5A 3ZS8A 3IERA 1FFBA 4MUYA 4BO2A 3BA6A 5DHTA 4JB0A 1MN6A 2O1SA 4TYYA 1E1KA 3HCNA 1ZH0A 4MA5A 2OYSA 4FI3C 1QANA 1JTFA 3VR2D 4FKBA 1A4UA 5LQNA 1BW9B 5M7EA 4K9OA 1WJGA 4A6PA 4BYGA 1X9HA 4ZU1X 5EA2A 1RHQA 5DYYA 5DLQC 1C1HA 5AW9A 1FXWA 3KXPA 1OHHA 5TSDA 2DLNA 2P0AA 3WYGA 4EA8A 2G9ZA 1M1YA 3SR3A 4YXWD 3ZNQA 1UBFA 2AVDA 2C07A 4CE6A 2B82A 2V6IA 1ACJA 3AEZA 1EVLA 2YDXA 1OA0A 4EPYA 2A88A 1DCMA 2VQDA 4AUEA 1Y33E 4UTVA 2OK7A 2WABA 1E3LA 2C4KA 4C7BA 4JVNA 3HJUA 2X41A 5IT0A 3A1SA 5EMMA 4A0HA 5HJ2A 1A9PA 1UBNA 2ZYTX 2O2SA 2Q0SA 2O2ZA 1J99A 2AJCA 2WJJA 3VDXA 3VKFA 1EYZA 3G6WA 3I37X 4OYHA 4KTVE 2IS1A 3T1QA 1QF7A 4LIPD 2FDCA 4LJ5A 1UZMA 5JZSA 5A4JA 4G85A 1CJVC 1VXOA 3DAFA 2P2CA 3F6BX 3H1GA 4MI3A 4YXFA 5FJIA 2EWMA 2R8YA 5AMXA 2ZUUA 1UOPA 2C2ZA 2CHVA 5AJUA 3T5PA 2GXQA 5CYFA 4X20A 3Q40A 3ZHUA 2ZR7A 4BTLA 5KWEA 1W5FA 2OY0A 2CVFA 3RDPA 2WIBA 1W2WB 1W5TA 3BWXA 4ZV9A 2HHHB 1CG6A 1XZBA 3UB2A 2BFFA 3E9NA 2A92A 3ONFA 4MW9A 5MFPA 5J1TB 2FJPA 2IU4A 1G17A 3AP1A 2VT6A 4Z0TA 1VMDA 2XHZA 3DHYA 2O2YA 1NSTA 3PQ8A 5I9BA 3UJ3X 3ZUGA 1WHTB 3PG5A 1C7RA 2XD4A 3FKQA 3FVTA 4JLWA 4NPCA 4WBSA 5D3ZA 4EB6B 5M34A 2BMFA 5FBLB 3MOIA 1M1ZA 4GMXA 3A9CA 3CA8A 3GEPA 4I8XA 3TQHA 2PGJA 2Z2YA 1UKAA 3QE2A 3EA5A 1AB5A 1TU3A 1RWQA 4R9SA 4AICA 3PJGA 1QP4A 3PGMA 5IYZF 4RJ2A 1E1QD 2ZSUA 3KYCA 3ZQKA 4DLVA 5BOSA 4DIKA 4F92B 1FUYB 4M38A 4CT4B 4ZO8A 1P9NA 2YWBA 1UINA 3Q9LA 4HO1X 1OH5A 3GFRA 3UHAA 1EUQA 4OHZA 1J2TA 4F21A 3TEFA 2AE1A 4C05A 4CMCA 1YZYA 2VDLB 1A95A 1NMXA 4YEDA 2EF1A 4XIFA 5LQJA 3PXDA 3HWRA 5CGZA 4EF6A 5DCYA 1KO5A 2VP9A 2CNOA 5DX8A 2XVXA 3TNLA 1K2WA 1W5EA 4IINA 3EPRA 3MXTA 1W88B 3QITA 4JUIA 2UVDA 1TA4A 4MRRA 1VXRA 4KN6A 4B3DA 1C0EA 3HB9A 4L07A 4NR0A 1LXCA 3IHTA 3DOEA 4R8RA 2O0JA 2PZKA 5K4HA 3ZK7A 1SBHA 1AF4A 1K2VN 1NW3A 4QWMA 4Z4GA 1ID8A 3OUZA 3TPZA 1JZSA 1U04A 4M6WA 1R4MA 1OBOA 2QBYB 1FSPA 2XB9A 3DOUA 3JQRA 2R66A 2WJAA 3DZBA 4KO8A 4PSKA 5DGIA 2ZVQX 3A6LA 1PYDA 2R7KA 4OXYA 5FWXA 5JR3A 2DUWA 1JG2A 1GITA 1A82A 1I3LA 1CEYA 1B15A 4QFCA 1E6LA 1TKBA 2KLBA 2HPAA 3A9VA 2D2XA 1FFYA 1I13A 1YQDA 4QHTA 1QLJA 2GK3A 3EXG1 4O4HF 3D5TA 3KSDO 1I2MA 4R1UA 1V3UA 4MS4A 1NUAA 4CG2A 5BURA 2OG1A 5JNSA 4EB8A 1M1UA 2O20A 2JAXA 3LC0A 4KWEA 4G81A 1XZDA 4KIWA 4RLQA 5JRJA 3HP1A 2HT1A 3ZTTA 1L0BA 1TVKB 1L7RA 1XTZA 2X8BA 4KGDA 1P2SA 2C5LA 3IBTA 3NGLA 5FWNA 2H57A 5K8UA 1G9TA 3QNWA 4V1CI 4N3GA 1YWGO 4M1EA 1VOTA 1WCXA 5DT2A 3CE6A 4YIKA 2C4TA 4CG1A 2O05A 2R6JA 2HQBA 3K20A 4A3SA 5C4MA 2YMPA 3CR3C 3UIEA 1ENPA 2O5RA 3ILYA 5JDIC 2C8VA 4G1MB 1QS0B 2DBRA 2Q2VA 2RHOA 3R0IA 5BMVB 2ERYA 4EFNA 1SEPA 3K71B 4QELA 4XUDA 4EVRA 4BGEA 5TQ0A 1LKZA 3D8HA 5IYZA 1Z6GA 2O54A 2NU7A 1K8XB 3OCXA 4TTTS 1VIAA 4WZBB 3RADC 3DT9A 4J2TA 4D80A 2ODQA 2QDXA 3WYEA 4PN3A 1EIWA 2EKQA 3NAQA 4PFJA 3N07A 2AHOA 5JWRA 3EIFA 5G4LA 1FX0B 1KQPA 3KNZA 1QFMA 4H1UA 4M88A 3TLKA 1Z5UA 4RQBA 3PR2B 1USWA 3ZN2A 2FOXA 2O1EA 4BLUA 4RPIA 5HRAA 1H3NA 3CLUD 4MAFA 5G1NA 2Z04A 5JXWA 2Q1UA 5D5QA 3PFGA 2UZ1B 2EX4A 3OQIB 1FP1D 5EXXA 2MSKA 2C3PA 2Q8QA 1QO0D 3HDYA 2QLBA 4GMFA 4JODA 2V4UA 3NUQA 4YGXB 5CA0B 1IULA 3C8ZA 4ZEOA 4CMGA 3VKVA 5ETJA 2R751 4INZA 2YWEA 2GD0A 4GSKA 2VDUE 2B5OA 1C4KA 2H48A 3BDIA 4NX2A 3OD5A 1FUUA 3HCEA 4RY2A 4CM9D 5IFLA 3H75A 1UBJS 1DOHA 3H87A 3KXLA 3QOWA 4C87A 2FPLA 1LV7A 3DVSX 1FF9A 3ETEA 3PGVA 3Q8WA 4UNNA 4PBRA 5LC1A 3JYLA 3WLNA 1I1HA 4DW8A 1RD4A 3OQJA 2ZWIA 3IHKA 4HDSA 3WGMA 5CUQA 1T9GR 2QAGC 4R68A 3X1DA 5KYXB 1QXSA 1TF5A 2DUMA 2E48A 2I4RA 4FINA 4O2RA 4W5WA 3S1AB 4E11A 3QVUA 4QTTB 4MV8A 1R0BA 2PHZA 2PUWA 1AKQA 1T2FA 4AB1A 1ELOA 2OCDA 3MT8A 1KTVA 4Y98A 4RS3A 1A9ZA 2HJVA 2WB4A 4IJWA 4UMDA 4V0KA 4CL8A 1R8YA 3KD3A 3QVGA 2PBRA 5HFNA 2PRKA 1JBQA 2C29D 3BREA 1R10A 4ARVA 5JY1A 2ASEA 4MDHA 1RJDA 2PTGA 5CP8A 5DKFA 2KBEA 5E4JA 3BH6A 1W9HA 1MIOB 2EX0A 1CEQA 2HCBA 3LCMA 3R5TA 4MRMA 1VHDA 1WZIA 3UV6A 4BCCA 3TQIA 4BVBA 2CLMB 1NY6A 3GNLA 1Z75A 2DKNA 3BK7A 4KPUB 4G0OA 4U7JA 4YHBA 1XD8A 3ZPXA 1Z6ZA 4A92A 4URYR 4JLUA 2IGTA 5DOVA 5LQCA 2JHCA 1U3CA 3DGFC 2I9KA 2NWQA 3SIRA 1DT3A 4WNAA 2PUEA 2NZ2A 1TOAA 1KVQA 2LE0A 2ZATA 1JJAA 4BMCA 2AEJA 5EJEA 4O29A 2JCSA 1O9HA 4GLLA 4WLFA 3WK8A 4KVAA 5BR8B 4N0DA 4C0XA 3Q7IA 5FPTA 2ZUTA 4NS1A 1A7AA 2ZJ7A 2PL3A 2OUKA 1RYNA 5EJIA 2QJWA 5KJFA 3CZPA 1NIJA 1T3GA 2PNJA 2WFLA 3ESDA 1KWKA 3PQ7A 4KP7A 5HQ3A 1V1MB 1VRVA 3LHDA 4ZP1A 1UJCA 5KWSA 1UAAA 1IDN1 4G25A 2PVCA 1NOIA 4KAAA 4OFXA 1S5PA 4KZPA 4X24A 5EZYA 4NLLA 5BW6B 1AKVA 2OT3B 1MZPA 2B36A 4NY1A 3R3SA 3SSAA 1X1QA 1TYEB 2Q5QA 3EVAA 4X91A 3RSSA 2JJ1A 1P2FA 2NVOA 2XGSA 4Y8VA 3NW9A 2PMCA 3RC8A 4PZ0A 1RI1A 2BI7A 4FDLA 3ZBPA 4Q3DA 3HN6A 3N3BC 4UHDA 4JI2B 2GJ8A 4OGGA 3RVOA 4DJTA 2XRYA 2VUIB 1QIHA 4NQZA 3SEZA 2I71A 3THRA 5C8ZA 1CUZA 1TJYA 3OKAA 4CF5A 1ZH2A 1C0LA 1QHHB 2V7EA 5L3RA 2D2EA 1T2EA 2JEYA 3ENZA 4XGNA 4MVCA 3LS2A 2RHDA 1US8A 4I5IA 2GBIA 1GPMA 4LV6A 3LSTA 4B4OA 5I7RA 1RZRD 1OXMA 3C1TA 1PZFA 3LQKA 3WWZA 4AIIA 5F2NA 3PA8A 1Z17A 1O4WA 3SX2A 1U1CA 1KZHA 3T38A 1U7TA 5CFMA 5TPWB 1GLGA 2P9YA 2VRCD 1NXWA 1DC6A 2BWJA 3QF4A 5DHPA 4B84A 3ZCUA 4HVLA 4X44A 3W3AD 3F9CA 3GJ7A 3M9LA 5JS1A 4FHZA 1T0PA 1GNRA 3KG2A 4Q9LA 3WP0A 3FUTA 4L8VA 3I61A 1Q7CA 3PHBE 4HWSA 5CVUA 5AHKA 3IMFA 1ICIA 3QW2A 5ER9A 3L8YA 1JE0A 1ETUA 4IIYA 3AINA 4K3UA 1HE3A 4KBYA 1QNFA 2ZRCA 1QGYA 1P2GA 2O8FA 2DECA 2B1JA 4MMYB 1LY1A 1AQNA 4QLOA 1GAJA 4YCJA 3RC3A 2W8BA 2HJHA 2BGMA 3DFMA 3R24A 3HVRA 4ZYLA 4WZBA 3SE0A 1XVLA 4XJVA 1VG8A 2CJXA 2VP5A 4B2PA 5A1JA 3GOQA 2GSDA 1A8UA 1B2LA 3BZWA 5EHQA 4UD6A 1M8PA 2Y1LA 5BSMA 5IZ4A 5DULA 3OZBA 4GX0A 2JJ8A 3PVZA 4ZGBA 2QVZX 1U4SA 2G3YA 4B82A 1JAZA 9GPBA 2J33A 4U2GA 3QLEA 2NZWA 4Y9DA 3UKDA 1VA4A 2J07A 3LNCA 2GM9A 1JHRA 1U7DA 4KGVA 2ZDQA 1YS1X 3HFJA 2VTEA 4AJKA 3TO5A 3WBBA 3Q9NA 4AUNA 4P3KA 3BTVA 1WD7A 3KT6A 2A58A 3HPQA 1O57A 2QUAA 1Q2UA 1QR6A 2CLSA 1B00A 3FPEA 3L0IB 4FGKA 4I36A 5KYTA 3UJNA 2Q3DA 1B23P 1G3RA 1AH2A 1NVVQ 3HJAA 2FPPB 3C3DA 5GONB 5DHSA 4C3VA 1G63A 4QDXA 3S3TA 3ZW8A 1ZOOA 4ZAYA 4EW3A 5B55A 1MABA 2PSEA 1VYHA 2CDBA 2OL4A 3ACCA 4QQRA 4WZBE 3VSAA 1HLPA 5A2GA 3EB9A 3VRHA 1A8PA 4BQFA 2IZ6A 1CNEA 2R6ZA 3PEEA 2J32A 3TFOA 3HNPA 4QJ4A 3CLSC 4ZVMA 4AG3A 1E9DA 1QUEA 1EK6A 1B6GA 1S2LA 1LA2A 3DLTA 3PFNA 4A0RA 1MFZA 3V4RA 1L9XA 4D3ZA 1OH6A 1IB6A 3PNBA 5AUPB 4UPDA 4LQDA 1CY1A 5B5SA 1JG4A 1XMXA 3AVXA 1TK3A 3SBDA 1YDFA 1ZESA 3WFZA 1GPWB 4UC0A 3AEQA 3FGPA 1WPXA 3H4MA 3EFEA 3TLEA 2EDCA 1R7RA 3DNMA 5LUBA 2GEDA 1KYYA 4X1YA 1KMMA 4G1UC 3UTCA 3TECE 4YCNA 1LSOA 4OQQA 4GT1A 1OIVA 2P6RA 3M3DA 1SWVA 4GZ3A 4IVNA 1KEVA 1QGUB 3DA8A 3KSMA 4EPRA 5IKEA 2FMIA 1D8AA 1PQPA 4FYHA 1OXKB 1D6NA 1ORVA 3FR8A 3NBFA 4ZT7A 3R8XA 4ARZB 3CH7A 4R8SA 1G4AE 1Z63A 4YMTA 5C5CA 4R84A 1JILA 4YUAA 1P4SA 4MVWA 1FNCA 4RH3A 3EE6A 2V8BA 4EPXA 2W4IA 3HGMA 1A9TA 1L7XA 3LW8A 2QX9A 3PD0A 1J0CA 4WY2A 5CLHA 5F35A 4X1YB 2YR0A 3NKVA 2C2GA 4KYUA 5LA6A 1OT3A 2CLHB 4XX1A 4QRIA 5FYDA 2QTBA 1EDEA 2FXVA 2X4GA 2RGAA 1JYEA 3AUAA 3NCTA 4N8SA 4QQKA 4RPCA 4Y1RA 5TGTA 2QQFA 2RK4A 3UBTA 3J81k 4ZOQI 3AY7A 3HC7A 3IQEA 3RWOA 1AY0A 3BWDD 5HG0A 1D2NA 4UBJA 3OZVA 3MN1A 2ZJ3A 3HJBA 1T6XA 2J3EA 5CK5A 5ALIA 2C7OA 1GT6A 2B7LA 2L69A 4TT3D 2GN6A 2PO7A 1CHNA 2ZROA 1ZMTA 1Q20A 1CY8A 3AV0B 3JTMA 3AG5A 4YGYA 4GZ6A 5DGDA 3VX3A 4TLLB 4OHCA 3R76A 3GJXC 3KHUA 1K5DA 4Q03A 4W4TA 3VNVA 4PS0A 4C3ZA 4CFYA 1QQ6A 2FRVA 3MF4A 4EBBA 5HW0A 3L04A 4MV1A 5IH3A 5LVAA 3RJMA 5AUNB 4JA2A 5KYWA 4Y6GB 1FY2A 1ZGAA 1BVYF 3WL4A 5FLKA 3WDLA 3MCVA 3NDJA 3OH8A 4HK4A 4FFBB 4MWEA 1NXVA 3SLRA 2W2KA 4MWCA 2PMKA 4D57A 1YIOA 3IMKA 2CLCX 3OIDA 4CHGA 4D8WA 3D1LA 2X8LA 3OM0A 1KNQA 2RH5A 3EZFA 2VIIA 3M33A 4KXMA 2H4JA 4YN3A 3WQSB 1MT0A 3INNA 5B64A 4URXR 3BM5A 2IS4A 3S2IA 6YASA 4NBSA 3DBRB 1IY9A 2C7VA 3NNSA 2BMVA 2LP4Y 1N78A 2F3TA 4BNZA 3DAHA 1DCTA 2HCJB 1O8CA 2E87A 1S0UA 1Z8FA 4ZQGA 3OY7A 2DPXA 1QU2A 5EC8A 3GUYA 3SQMA 3GZJA 2P9EA 2BMWA 1OC2A 1YBFA 1SIBE 3AUXA 4JI5B 4E3ZA 1AMNA 3L6OO 2DT8A 2Z9BA 1E2EA 2QAJA 2HHLA 3QLUC 3QXHA 3KZCA 1Z6YA 2V4ZA 4F96A 2BCGY 2G88A 4LOKA 3WGIA 4FYVA 4JJ4A 2XXJA 1ILEA 4JKYA 1K8ZB 1VQ1A 1SQSA 2LKDA 4IIVA 3O4IA 3UAOA 5JNLA 3K6RA 1NBWB 1OH7A 4N3AA 3S99A 3LFTA 2I6UA 1AGPA 1AQ6A 2W93A 4PG8A 4OXKA 3AC0A 4Q1BA 5ADVA 3KIPA 4AAYA 5K9ZA 3IRVA 1N3LA 3H1EA 1UT5A 3L6CA 3H9UA 1Z68A 3SNKA 4NNOA 1CUSA 1OTHA 2G7MC 3REOA 4CTKA 4OYRA 2LCQA 5EIFA 4EPVA 2FW8A 5REQA 1U8EA 1E7RA 1F0PA 2CHQA 2WUVA 3AHIA 3KDAA 1RXVA 1E7YA 1G8SA 3UGTA 1ITZA 3N53A 3TEJA 4MDEA 3F5FA 4F1WA 4C5BA 2GN8A 1L8LA 1V26A 4E4RA 3L93A 3F6PA 1X8KA 4LMAA 3PIIA 2J48A 4A8JC 1DUSA 1L4LA 1LWNA 3PPYA 1YL6A 1GL3A 1G7RA 4IG4A 5C32A 1HC7A 4JSTA 5LCXA 4JI6B 5E9QA 4M6WB 3H65A 2EJBA 5C18A 3VYTB 1JX6A 4FR2A 1X2BA 5A62A 2PYZA 4W82A 1K7YA 3N2EA 1KC1A 3BMNA 4TL9A 4PO3X 6Q21A 3PC3A 4YFYA 2H6EA 4AS3A 4EYKA 1D6MA 2WJPA 1LW6E 1YBHA 2WWYA 3D54D 4JI8B 3BZUA 5LBIA 2YV3A 5ALNA 3A1TA 1JNXX 3IAUA 4XTRA 1XGKA 3CUYA 4OFZA 1WU8A 3I5UA 5FI5A 1F2VA 2A1UB 1ZWLA 2PAFA 2R85A 4J4TA 1PJSA 4HSGA 3QIAA 2BKXA 3C3AA 5AK5A 2D13A 2XUPA 3U3DA 2QA5A 3DTYA 3FFBA 3KU4A 3TS1A 3ILXA 4C20A 1V47A 5DYNA 5I45A 2XKKA 3VKGA 1AKWA 1JFVA 3Q7EA 3TVDA 2RAFA 3LW7A 4A0QA 4U0KA 1U7UA 4EG6A 3FTPA 5A5DA 3PRYA 4RZXA 3KQTA 3ZHZA 4CT0A 4EDHA 2P6PA 4FE4A 3KT8A 4DMFA 4DJJA 5A7FA 3P0FA 2YFQA 1KDRA 5HA5A 3S2SA 2ADFA 1ZU5A 1TJNA 2WAXA 1Z6AA 2CUKA 3INYA 3ANTA 4I81A 2PJRA 3HO1A 4W8GA 1KYWA 3IO3A 4ER0A 2W2KB 4WKPA 2B9VA 1VIMA 2H4WA 3E7DA 3GFSA 1XJ5A 1V43A 3GD5A 4E5SA 3BRSA 2CUNA 3IV6A 4IQGA 4L8GA 4KI7A 4KJXA 4QU8A 3LC2O 1CJUC 4JROA 5TPWA 3TM4A 5F73A 2CXUA 5A9TA 4C5CA 3MTAA 5MHTA 4A2PA 5J63A 5MDHA 2OHVA 2QM3A 4L08A 4L4UA 3DL4A 2BGNA 3EFBA 2XWSA 1NBHA 1ADYA 1K08A 4FGSA 1IHXA 4PR0A 4F4FA 3C3MA 4B4UA 4I99A 1E62A 1HDRA 2J3HA 1K89A 4ROTA 1PNOA 3F3YA 3RRYA 1YJXA 2QU8A 2BIFA 5IAKA 3GMSA 5BSHA 1EKXA 4ZDJA 4M76B 3R7LA 1UAGA 1RIIA 3E61A 5EIAA 2WR8A 3KQMA 4KKXB 1EINA 2VP3A 1L7AA 3QPWA 3WNDA 3WG9A 2KS6A 4L4RA 3F1LA 1GZ4A 4DCVA 5GZ1A 5G0TA 1AKNA 2M1ZA 3TVYA 1IJEA 1OPXA 2I6FA 3RT9A 4QGBA 2QL7A 5KTTA 1P72A 2AT1A 1JT2A 2YYSA 2PE5A 3I9NA 1R15A 2WTMA 4DSUA 5CCXA 1VSUA 1A96A 5E6SB 4EW6A 1TQHA 5DNWA 3FGZA 4KO3S 4N82A 4POAA 1BYIA 1S89A 1OY1A 4H3HB 4CLHA 3PZRA 4TLAA 1QKJA 1VTKA 2VPWA 3DDZX 3GA0A 2EQBA 1NLFA 2JFFA 1EFPB 3AI7A 5CT5A 4CVNA 4OMFG 1CP2A 3VYUB 3QNUA 4UASA 2NX2A 4BE9A 4JEMA 2JLUA 2GTPA 2JCXA 1D2HA 1FVOA 1U7ZA 1ZDMA 2QTVB 3K0BA 2V58A 3I42A 3U9LA 2PS1A 1ECJA 1DKNA 4DM4A 1DZIA 2DHDA 1Y3CE 3CNHA 5F7OA 4WXEA 1D1PA 2ABWA 4TUYA 3H8SA 2UUOA 4BEBA 4AJPA 3I9MA 4XARA 1Q3HA 2K6GA 2XECA 4UHFA 4OB8A 4GL4A 4O0LA 3W8NA 1IBCA 1OXSC 3FPKA 5AICA 2FR8A 4Y2JA 2G8LA 2JDIA 2H06A 4YAKA 3CF4A 4EW2A 3O82A 4RTOA 1R88A 1E32A 1QBKC 2WWXA 5DBEX 4HAOA 2IIBA 4LYFA 3ELYA 1IRIA 1L4GA 1Q7RA 3EJWA 3F46A 3GRRA 4BBJA 4F2HA 4QGAA 2AW3A 3N87A 4KK3A 3Q8MA 1SA0B 1II8B 4OA5A 1FJ2A 2KSQA 2G36A 3ZTYA 4DMMA 5LB2A 4IDNA 2XJ4A 5IVDA 2WTUA 5KVCA 3ANNA 3TZQA 1UP7A 2H5EA 1SG0A 2PMFA 2PL9A 3PXBA 5D3KA 1K1EA 1G20A 2ZSDA 3A04A 3OFNA 4U7GA 2J9GA 5KAPA 2ZUVA 1RI5A 4HDCA 2BGRA 1E3EA 1FMCA 5CYGA 5C5EA 2CVHA 3VR3A 1UAYA 5C7YA 4CL2A 4NMHA 1G19A 1R0WA 1V4VA 3QMWA 4BNGA 1Y4DE 2BM8A 3A4VA 4QREA 5DCLA 1JB9A 1VI2A 3GFOA 4Y2SA 2ZCJA 1ACMA 5DTIA 2A9RA 3MD9A 3DPIA 3ER8A 4DR2B 2QPOA 3IKLA 2HBZA 1O54A 2PUTA 1NURA 2ZITA 3B8HA 3LY8A 1A4XA 5AJZA 5DLPA 3TAHA 4B6GA 1SVKA 4BLRA 4Z1OA 5CD9A 4L0DA 4HEHA 4DMLA 1ZN8A 2R97A 3FD8A 4LPKA 4IS2A 3G88A 3Q0EA 1OFGA 4HEA1 1UFQA 4YRQA 4ZV7A 3TNYA 1OZFA 1NNUA 3E22A 2VI5A 1QHEA 2CXRA 3DEFA 3RW9A 3LSYA 1R8JA 4AWXA 5IEBA 5GJBA 1SXJB 1ZICA 4BVJA 4OI1A 2ZDGA 2BBOA 3PR1A 4M1TA 2NZYA 3VVCA 2PWAA 1GG2A 1O6ZA 3QQ5A 2YZ2A 3R09A 3E48A 4ZVSA 3JWIA 4ESOA 3T7EA 4PPFA 4K28A 2JIZD 2JNWA 4WECA 1DBSA 4XOIA 1J5XA 2O9JA 4I1UA 3D7KA 2II6A 3DJYA 4WNAB 3AI1A 2QTTA 2QTVA 5A5FA 1GT91 2CB0A 3SZMA 5ITWA 2IK8A 1Z82A 1V2GA 3PUHA 2FTKE 4GAEA 4I9GA 4BMSA 1FW8A 2NUTA 4EUEA 5I7UA 1F0YA 1NFQA 2N1BA 2XEXA 4MA0A 4X62B 2FWNA 2JEOA 2ATEA 4P81A 1F38A 3A3KA 1G59A 4F3TA 5LMUB 5FDFA 1H8ED 3KQWA 1J2UA 3WGNA 3HVJA 2VQ6A 1QHNA 4U3JA 4DA6A 1Y1SA 2Q5OA 3WVNA 1AXEA 3BTSA 1ADFA 3RJ5A 4G41A 3IIIA 1US8B 4BNFA 4DM3A 3O90A 4QJIA 5B4UA 3O3CA 4HAVA 2H2GA 4JY7A 4S35A 4GKJB 3E0QA 4EHNA 3JQFA 2IPOA 3FWZA 1IYZA 2Y0CA 5EMNA 4Z3DA 2R84A 3FZEA 4EJSC 2XEDA 2D1FA 4Q9AA 4US0R 4WA7A 4ESVA 5EMLA 1ZH4A 4H4CA 1ZVMA 3H2YA 3ORRA 3VXKA 2ZBPA 2CL5A 5JNVA 2JAOA 3ZE6A 3PRJA 2GS9A 5JWOA 2PWZA 1AQLA 4X41A 4FEEA 1RNLA 3RIGA 2VYCA 1F4LA 1HBJA 1OKKD 2G06A 2CMKA 2WJGA 1JDPA 3UC5A 1P7PA 1ES9A 5CJJA 1TEVA 3D7RA 3G2JA 8ADHA 1U7XA 2PUAA 3KO8A 1WPGA 1QK5A 1P0PA 3G2LA 3ZXSA 3HP4A 1JFTA 1MF7A 3T99A 3W6ZA 4DUGA 5CFOA 3CT4A 1FX1A 2JGAA 4X45A 2AG5A 5FPYA 4NF2A 1P62B 3D8BA 4TT3A 5ITSA 1H2BA 3LMKA 1RXWA 2D5BA 2HMAA 2Y05A 3BKWA 3CEJA 3SBEA 3O8NA 2QLJA 4J0HA 5B2ZA 2C1XA 3DKRA 2E7ZA 3GLVA 4FN4A 4IG9A 4RTLA 4FQ7A 3HB7A 5BUQA 5JI3E 1ZHOA 4LDJA 1USIA 2A59A 1M33A 3CB2A 2YW9A 3RTCA 2AMVA 4DLWA 1T36B 3GDHA 1RCUA 2Z56A 3ZJVA 1Y5LA 1G0OA 3LPAA 5MN5A 3AZOA 1E4EB 2IYSA 4Q9HA 1UC8A 2G9VA 2VPZA 4IHJA 3C6QA 4PX2A 4BFWA 1IAQA 2BMJA 2FWJA 2Q28A 2WFZA 4GE0A 4J03A 2X0IA 3DWFA 2XZPA 4MGKR 5TGZA 5BYBA 1Y8ZA 2P9GA 1RLJA 1FC0A 3M8KA 3EC2A 3WGZA 4C43A 4F3KA 3WDMA 3G1UA 2G5CA 1FYXA 2A33A 3CH4B 3QIVA 1XWWA 3H97A 3K1JA 2WYIA 4M1ZA 4OHFA 2C9BA 1XLWA 4XLTA 3HUTA 1E64A 3OKFA 1ENZA 2F1JA 1LJLA 4H7PA 4ENQA 1MGPA 3PFKA 1UFRA 3LFHA 1RHKA 2O0MA 4L0QA 4A2CA 1H1DA 3A4TA 5H4GA 1D4ZA 2W6ID 4P92A 2QZSA 4UVEA 3CUKA 3JQBC 3LX8A 3UB4A 1XMQB 2FQXA 3DEJA 1HE2A 4FIDA 4M8SA 4KR9A 5UKDA 3TZKA 3U3OA 3WQQA 3ZLBA 3M89A 3U62A 3CRMA 1BU8A 4CBVA 4BAUA 1JQDA 4M0KA 1VKOA 3KT3A 3D3WA 5ERGB 4ZOBA 2AK2A 4I55F 4MQLA 3S27A 3HDJA 3DEZA 1C7ZA 1IE3A 3A4IA 3ZZNA 4H6VA 3RS2A 3CH6A 1SK8A 4IDHA 5F78A 1LK0A 2CVZA 4MPRA 4MDFA 2BHLA 2Q29A 3GEIA 1D6SA 2QMHA 1V0JA 2QORA 2XB8A 3F4KA 3H5VA 4DCMA 2QU7A 2JGEA 4YLYA 1BYUA 3PPWA 3BDVA 2ZUWA 4WJZA 1ADJA 1BXKA 1X2EA 3OZSA 1G2IA 4IDAA 4MO2A 5ECWA 1BEUB 2D7JA 2QI9C 5H8WA 4CETA 2O5VA 1UM9A 2PEZA 3ESBA 3R0VA 4YBRA 4B71A 1G6KA 2UUBB 1NVVR 1EWTA 1M2VA 2X19A 3IAHA 2HJSA 1NFRA 5FNVB 4LHXA 3EPJA 1HMYA 2FPXA 3GEGA 3AJ9A 1YS4A 2CZCA 3KAKA 1CIPA 2B6NA 2AA3A 1C3EA 5CHEA 3PZBA 3CRVA 3X3HA 4H7FA 3GCZA 3V1UA 5KX5B 2AZTA 2Q21A 5BVGA 5DO9A 3U09A 4DUYB 2ZWAA 2GYYA 1BROA 1ISJA 4RK4A 2JIPA 2R9VA 4FFOA 3PIRA 7YASA 2O8EA 3PK0A 3INTA 4R54A 1BXRB 1UL1X 1TVMA 4E88A 1KYXA 3L41A 5K03A 5FUYA 2Y71A 4MXDA 4NU0A 4IHJF 3ASZA 2IELA 2H1RA 4K9KA 4P08A 4Z1MA 4MYTA 1CUFA 1JMYA 4KYVA 1YTUA 3BB4A 5F9FA 2ZI4A 3ZCTA 3F1KA 4KQ2A 3SM3A 5A1TA 3TR0A 2PA3A 3F3SA 2C5FA 2XMZA 3EXEB 3QHQA 4L7QA 4A1FA 4RORA 1Y3AA 1NI4A 2WOOA 4P3OA 4PHGA 5FTNA 3TLCA 1N8NA 1VPTA 4GH5A 4LV5B 4E7OA 3SBOA 4Z6KA 2ZIXB 2IY9A 2H9AA 4FHCA 4KFCA 4AY2A 4BQRA 4TSFA 5CFPA 3O4VA 1KI2A 5IG2A 2AL7A 4EUKA 4RPLA 1PP4A 4RK7A 2O8EB 4C4TA 3I2FA 3D9QX 2V59A 3DOHA 4ZI7A 1XD2A 5ALTA 1R0CA 5TGDA 3DAPA 1TMKA 4RHFA 3LP5A 2XNDA 1KKUA 4R8MA 5IH7A 3EZGA 3DZCA 3AW8A 4TSFD 1JEAA 1LLUA 1Q1NA 1JHZA 3ND9A 5AKHA 4NENB 1BS9A 1YIDA 4B75A 4CQNA 3PUJA 4DAEA 3GPCA 1SZDA 1UDRA 3VTFA 3ZEIA 3EXFB 1I6LA 3BIXA 3M6AA 3RKSA 1E3JA 4JBXA 1BXGB 1L4KA 3GVXA 5D5PA 3CF0A 1UM8A 3M2TA 4NSNA 1Z73A 3B2EA 4RMHA 4AY3A 1T34A 3THYB 3QU9A 4YDHB 3PE6A 3OF5A 1YR6A 2HL6A 2APJA 3L7MA 3LQ4A 3QU2A 3HB1A 5H81A 4BLOA 1K7EB 2OXCA 4ZANA 5SZIA 1V8FA 3D0KA 3TW8B 2VCEA 4LCBA 2IDZA 2XCUA 4OXNA 3K9CA 5FOSA 4H6WA 1IL0A 5DCWA 1RQPA 4HRXA 5FL3A 4E09A 4EO9A 5K20A 4TKUA 3WYNA 3S1LA 4XSHA 3OPVA 2B7BA 3SC2B 1Z7EA 4DDHA 4I5EA 1FDWA 3CRRA 4NBUA 4LRSB 4KPYA 1M0SA 3FTEA 5SZJA 3EXIB 4R16A 4XJSA 4L78A 4YMVA 3KKPA 1P0FA 3EVEA 4NCNA 2JGDB 1ZMBA 2ADOA 4U2EA 3K31A 2WWTA 5FBZA 3HCOA 3H2GA 4H2DA 1KI4A 1D1QA 2EAUA 2J30A 3H1PA 2EKZA 4NL4H 1QZXA 3IESA 1U0OC 3OU2A 1KSGA 4REMA 1WSBA 2O6HA 3WMWA 4JELA 4HGNA 4LS3A 2OKCA 5BN1A 1MAAA 1Y3FE 1ZJYA 4EG3A 4ZZ1A 1GZ3A 5AK3A 1WV1A 3IELA 4Z51A 1JU9A 3I12A 2WSSD 4DXDA 3GVHA 3GRZA 3P2EA 4ZI7B 3I1YA 4XYMA 3MS7A 2P5YA 2FHSA 4HH0A 4RADA 4KQEA 2BEUB 4D56A 5L4NA 5F2OA 1I24A 3FCYA 2CHEA 1G8MA 2VNHA 1VKRA 3G02A 3A2KA 2G09A 4D79A 3VSEA 2VKTA 5K3AA 2VTDA 4ZI7F 1NNLA 4LOIA 1Q15A 2PZEA 1UC4B 4OQXA 3RTBA 4NCAA 2PNFA 4FYPA 4RZ2A 5A3VA 3ZWXA 4CTJA 4WCFA 2QIPA 1YK1A 4G4IA 1HFKA 1KEWA 2H8GA 4A36A 3SLGA 1EM8A 2OCAA 2IWHA 1P1CA 3BE6A 4LXTA 4IDOA 4JJIA 2G9UA 1OBVA 4TLDA 3FDIA 3U44A 4Q15A 4WKNA 5IT5A 3BCSA 4I1SA 1P5FA 2GZDA 1IQPA 1GTMA 3SXUB 4A2WA 3AF4A 2RC6A 3PX2A 1F14A 1VL6A 4JUAA 4XDYA 2O06A 1Z9BA 5EP4A 3ZDCA 4I4IA 1FRZA 5D87A 2ACWA 5EJ6A 1U9JA 3V8PA 2GERA 3STHA 1XTKA 3L1VA 1W25A 1NG9A 3OO1A 4P4UA 5ESXA 3GCWA 5LZ7A 1I9CA 4PC6A 4GPEA 1KL7A 4RF2A 3R4VA 1Z28A 1FQJA 2VHVA 4H4DA 2Q4TA 2BTQB 2C5BA 1H2EA 3BMOA 3HKDA 2XRZA 1T1SA 2GB4A 2D4AA 3D3QA 1C14A 4GS5A 1WUYA 1H5UA 1E0KA 2QDKA 3MUOA 3PNPA 4ERNA 2EBFX 3MGGA 1XZKA 4NKRA 1MC1A 3FSGD 3ZHSA 1YR3A 2Y27A 1TPZA 4QICA 1U1GA 3WL3A 4XJTA 1TB4A 2XCRB 3C8DA 1BZYA 3S1AA 2ZIUB 3ZVLA 1NX6A 1KVRA 4YRSA 4ZEVA 4XM2A 1FUEA 2FSVA 3ITNA 2B4AA 3ROFA 3QBJA 3OTHA 3UCFA 4ABYA 1IJFA 3ENKA 5DBFA 3NOVA 3GEEA 1L5YA 5IVIA 2XDAA 3DLPX 1XJWA 3NDPA 4I19A 5JDCA 1ZR2A 1FBNA 2F48A 4CR7A 4F8YA 2AJTA 2NUPA 3SSOA 1PVOA 3MINB 4AKGA 1CR4A 2Z4SA 2CBZA 1A3CA 1TJ5A 1KORA 4Z4CA 2PKCA 5CFRA 2PXAA 2YZNA 4IMRA 3HKEA 3I9KA 1CUCA 1QRSA 4JI4B 3OU6A 1NX9A 1D5CA 3F97A 4GMKA 4J07A 4M0LA 4U2DA 4IKOA 2Y0PA 3GLTA 2D2VA 2AI1A 4UMEA 3R3UA 3TJZA 4HAWA 4IIXA 4KRXA 4BIMA 3THYA 1UWCA 3MUEA 4EHDA 1HETA 1CRZA 1OWLA 1QTNA 1T3HA 3B5IA 3H5RA 4Q4LA 3DVRX 4NQRA 4QSMA 1J8QA 3T5MA 5C7IO 1YJQA 5LSAA 2Z2ZA 4J4BA 4KXWA 5TF0A 4M9RA 1RJ9A 4DV2B 3NHSA 4DXHA 1L4EA 3ROEA 3QQPA 3EDCA 1FJGB 4BNTA 2E21A 1M7BA 4H16A 1Q22A 2IXFA 3LA6A 4ENTA 4TYPA 4JWTA 2IIVA 2VUHB 1XA4A 3UH0A 3LLCA 5TMBA 2XQIA 5CVTA 1ZITA 4HAUA 5I47A 2ZUFA 1P0CA 2GO1A 5FTKA 4KH1A 5IAGA 1YCFA 1CRLA 2OVBA 2FLWA 5HZHA 1QTQA 1C4OA 1XN1A 1BS2A 1II8A 2VT2A 1USGA 2PLNA 3HDVA 3JAWB 3IPRA 5LYJF 1NMSA 1Y42X 5EJ4A 4D25A 1L5SA 1VPVA 1G2QA 3ADPA 2FUKA 5DN6D 3HSSA 3IAAA 1JHYA 3VPAA 5TJHA 2C9ZA 3A9UA 1K5HA 1OVMA 2A3RA 4NARA 4J1NA 3MJVA 1EVYA 2ZXUA 3OQVA 4IVRA 3C43A 3E84A 3BERA 2DQ4A 1O6CA 5K6AC 4QSHA 4ZVTA 4WSOA 4MVXA 3ZK9A 5KVVA 2X2EA 4ZCLA 3L7CA 4CKBB 4PIVA 2HZ7A 2LVBA 1OB5A 1FNBA 1WZUA 1ZLYA 3HCBA 4B3RB 3LWNA 5AD1A 1J70A 1WNTA 2ZUSA 2E4YA 1UZAA 4FR5A 1E5VA 1Z4JA 2JCYA 3FYCA 4GLFA 1ULBA 4WK2B 3OECA 4CR8A 4JBGA 2BSQA 5T6BA 3NXKA 2V9PA 1CE8B 1XAGA 2GEVA 1EVJA 4Q1EA 4S0XA 2B78A 3KWJA 3HI4A 3UAZA 4N47A 1GVHA 2P5UA 4FB5A 1FDUA 4B45A 1F2UA 4KG7A 5EOVA 2ZIGA 1KH1A 1XVVA 3MS4A 4CFSA 4PFSA 1YI1A 1LI5A 1ZXBA 1C4XA 3U17A 1L8OA 3QYPA 1FW6A 4V02A 3A6EA 3K6SA 1G1AA 3GNQA 1NLUA 1NOKA 4F60A 3DBVO 3FRJA 1T8UA 3WV4A 3RJTA 4F4UA 2AQKA 2P5SA 5JZOA 3DKVA 1YMQA 1NFFA 1C9EA 3DE6X 2YRFA 4C4RA 1C9MA 2NLOA 2ZJFA 3J7TA 2VA8A 2QENA 4DC1A 2F4NA 1VPDA 3FETA 3HB5X 3L8HA 5EE3A 5JEDA 1G8GA 4OU4A 2NO5A 2FQWA 1UMDA 4EI7A 5KYXA 3EXEA 2G82A 3H3FA 4GSYA 4PZCA 4IL5A 3KRTA 3RHZA 7REQB 1G55A 5I6DA 1R0RE 4JC5A 4Q4DA 3KZVA 2W11A 3U5TA 1VLMA 2GETA 1EEXB 2X2FA 3N6VA 5FUBA 3WLEA 4OFWA 3ESZA 1REQB 2GVDC 2QLMA 1X9GA 3F7TA 4PQEA 1CJKC 3TW4A 5JYBA 3PI7A 1A5AB 3HMKA 3DEKA 3JS5A 2OENG 2QSUA 2BUCA 3CUUA 4R8KA 4XASA 5LB4A 4B2IA 2P68A 2WP0A 3AM4A 3PRHA 4HWPA 1J8MF 2Y6VA 2FPOA 3HV0A 2K87A 4ND7A 1FNSA 1UDAA 2ZJZA 3C3XA 4H3VA 2V6JA 1E2PA 1ONNA 3ICOA 2HMVA 3TZCA 5TVKA 2C9DA 2QTAA 1RU3A 2J7PA 4AMVA 5JXJA 1OX4A 3NWEA 4U0JA 1PG2A 2OHGA 4QXPA 2H1FA 3KB1A 3ZW7A 4ZJPA 3B8EA 3WLAA 4Q7LA 4A4DA 5I4BA 1X1SA 4HRAA 2WJIA 5HOEA 3O8OA 3G0BA 1E59A 3C7TA 4DNOA 1WDKA 2Q4EA 2Y3IA 1S3IA 3PNVA 4P3XA 4X20B 3ZE9A 3HEMA 3JQBA 4H7JA 2QMOA 2PPVA 3CTPA 5LBUA 2HU5A 5JS2A 2D0PB 3DE7X 3WL8A 5CT8A 3FJYA 5EHNA 3A9WA 1BMQA 1CJMA 3GUCA 3T3IA 3VNAA 1Q91A 1I6WA 5AXCA 2ILVA 1DPGA 3HHEA 2HWYA 1BCRA 2QT1A 2VJDA 2YNMA 3QVGB 1X14A 3ZDBA 1AKUA 1MA3A 1PR2A 5C81A 2X5JO 3DDOA 1E7QA 1SCAA 3MHTA 2QB5A 3U37A 1P44A 1WKBA 2XOKA 3DDUA 4W9NA 5FH9A 1PT5A 1R5BA 3U3JA 5ALLA 4RA9B 2PDAA 4B5LA 1MEEA 2O8CB 4Z54A 4WY8A 1U2ZA 5JBNA 2X9VA 1UBRS 1P33A 3TI9A 1OX6A 3NT4A 1GQ2A 1E0SA 3BUSA 3NM5A 3QEOA 4FCWA 1N0UA 4XPIA 1NQAO 2PZFA 3C39A 5U1PA 4BE4A 1MCZA 3SKXA 4F9EA 2PPLA 3AH8A 3UJ6A 1X7ZB 1DARA 3KJIA 5F7JA 2BZ1A 1E3WA 1ZCBA 3EWSA 1NUSA 4QAQA 1DJPA 1ZGGA 4AYTA 2FKAA 2UZIR 5EN4A 1VFNA 4LZWA 1DUVG 1XKQA 5CNKA 4ENPA 2XBMA 1YO6A 3OE4A 5CVVA 3ZIAD 5ELXA 1U7PA 1Z7WA 4KK4A 1I36A 3DCYA 2JFNA 3GA5A 1JHVA 3OZRA 4HMQA 4X00A 3DF7A 2WIKA 1YAJA 1RPZA 5JD4A 1T36A 1J33A 4MR7A 1EFVB 1DSSG 1Q7BA 1G5QA 2BHRA 3I58A 1DBWA 5GZ6A 1DU4A 3K0AB 1GFIA 421PA 5JV5A 1E2JA 2I66A 4QD3A 4LWQA 2NW6A 1TW3A 1XWFA 1MPTA 1Y3IA 3IFSA 4GRAA 4J4HA 1QYRA 3VISA 4YJ2F 4YO8A 4KHPB 3BWBA 1PGQA 4AI6A 2IT1A 2VAVA 2C78A 4XWWA 1Y1RA 4IIHA 5HDQA 1WXXA 2H85A 3NYIA 3TRHA 2GNOA 2SNIE 3AHGA 2D7DA 2X4DA 4JJKA 2MU1A 1KI3A 5HK9A 3GRPA 1N2GA 2H2WA 3FSEA 3NHFA 2VK8A 3D6NB 4MAAA 5EUCA 1E5DA 3RPEA 3VKWA 4AMYA 5AVUA 2HCTA 1W88A 5EXTA 8AT1A 1AGXA 1WW2A 3KEOA 3D2LA 5ALZA 1S8OA 1XFDA 2EP8A 4BB0A 1GNSA 4X1KB 3O3NB 1OWMA 3AEUA 2J3MA 4RZ3A 5TQ2A 3TRJA 2DETA 3UANA 3CVUA 2D5AA 4F3RA 1PBNA 3VOSA 5FWDA 3IJPA 1RWKA 3A26A 4GLJA 3DBRA 4B3CA 4XA8A 2F8SA 3QFFA 4Q12A 1PWEA 4G2NA 4JKOA 3P0IA 4ZO7A 5B3KA 1F7UA 4HQNA 1XHLA 3HB0A 2O8CA 2ZYSA 2FSPA 2Q27A 3IMCA 4L85A 1THGA 2GFQA 1PYGA 2KBFA 1GKYA 3B1JA 2WQ6A 4N6GA 4UQLA 3KYDB 4FD2A 2DFTA 4QXMA 1UDCA 2VG8A 2WTNA 3GGSA 4JB2A 4M0PA 2XMSA 4DCOA 2JEZA 5AI8A 2ORWA 4RE5A 2P2SA 4H7HA 2XUAA 4RVDA 4YONB 3DLBA 4HN4B 3AF5A 3K0EA 3RYIB 4MQ5A 2FF5A 3P4UA 3W5IA 2CD9A 1O87A 5LP1A 3SQXA 4HUTA 1W52X 2WU4A 4C4SA 2HFKA 4ZDIA 1M1XB 1W49A 5AJXA 4LJ6A 3W6UA 3NVAA 3ZWWA 2JJMA 4DDTA 5CDUA 4V3CA 2AUTA 3PC8A 1DT5A 2W4MA 3FNEA 3QI2A 3SOZA 4ZYZA 1DAIA 3KYBA 2YWFA 1G41A 1PSZA 3L7DA 3KQSA 4MO9A 5DM2A 5TLSA 2I7CA 4DA8A 2ZXEA 4NULA 5E0OA 2IEDA 4A8JA 5HHTA 2D5CA 1OCEA 4AKSA 2HN9A 3P9XA 2CLEB 2ZSAA 4HMPA 5E2IA 5EKTA 3FTFA 1A7KA 2JLSA 3G1TA 5B53A 2O6LA 3KVOA 1QU3A 4EKGA 3ZQJA 3L0DA 4DZZA 2Z57A 3KE9A 3O4JA 5J47A 2PZ8A 3EPKA 2BZ0A 2MYPA 2OCKA 4YJ2A 2WJ3A 4TQGA 2AFIB 1XJCA 4FKMA 4RKFA 3LV8A 4IMPA 1C8LA 1GZUA 1RM4A 2JGFA 3PNOA 1E1MA 4HTAA 1JWAB 2A9QA 2VSYA 4DRZA 4TN5A 4YH1A 3TN7A 3UMCA 1R18A 3F6SA 4QOHA 4YPFA 5C8DA 1I2BA 4H08A 5TQVA 3TFQA 2ZETA 1M1YB 1IY8A 1P75A 1N9ZA 2R8RA 3DMHA 1T3ZA 4EFDA 4UOEA 1X7GA 1H9CA 1XCJA 1XCPA 1JUDA 1FFSA 2DWOA 4IQ4A 3RIEA 2QX6A 4LFAB 1TT5B 2P8SA 1JH8A 3F9RA 3KR2A 2FZCA 1QGZA 2IDKA 3DVLA 3FHCB 4JBWA 4ZQHA 1DEXA 2JZNA 5HEKA 3T4UA 3T3DA 3ZJ5A 3PXUA 4ED9A 5BMVF 3OOSA 3LGXA 1PWHA 3FNFA 4NCJA 2W6OA 3P9ZA 1IVSA 5DRYA 2OHOA 3C1OA 4U1RA 3C5CA 3G59A 5JROA 2EBWA 1ESZA 3D81A 4YRFA 1KJWA 5ALQA 3IUEA 3SIXA 4FJ2A 3WIBA 3M2PA 5E7JA 4CNQA 2NUAB 4E5MA 2XZOA 4AW9A 2C61A 1YQTA 1FTYA 3UWMA 1KSJA 4GO1A 1NM5A 2O3UA 1QK3A 4RANA 3OEYA 3N58A 1B1AA 2B8JA 1OW3B 2UYQA 4GGMX 4V38A 5FOVA 2V45A 3IVRA 4F8EA 1N1DA 1C41A 3LT0A 3RG2A 1KJNA 1YS6A 1ZD2P 3VA7A 2GAFA 1RQXA 1YZTA 2XYHA 2B8TA 4O5OA 5B7GA 1YQ9A 2CHFA 4Q3LA 4ZRDA 2H1IA 1T5TA 4UNQA 3IEIA 3G1WA 2GHRA 1K4MA 4L57A 1I51A 1QGAA 4MQEB 5ERYA 4JJGA 1XALA 2XTMA 3MMSA 5FQNA 4PRYA 3UUGA 4BNNA 5F3WB 2MJLA 1D9XA 4K9PA 2W90A 2PU7A 2BZGA 2PZLA 5F3DA 5AESA 4QPDA 4I14A 4ZC1A 2IH2A 1POWA 2DFPA 3NC4A 1W19A 4RXUA 2EKBA 2ZZKA 3AU8A 4LY9A 4M9ZA 1DO0A 2MR6A 5AH0A 4MQMA 1AMUA 2VHWA 4PYRA 1V11A 1F5NA 3PEUA 2DJ5A 3H2KA 3KHKA 1N1GA 4MKGA 4MGHA 2ZGVA 5G40A 4B8YA 1MO3A 2BL4A 2CDCA 4EUFA 3JQEA 2G8NA 1C3VA 3IJEB 3UH1A 2OAQ1 2IA5A 3O4RA 1NULA 1GGJA 1XDDA 1UBUS 4ETIA 3CMMA 1D4FA 2AOUA 4K9RA 1D7AA 5CMLA 1I7DA 1ZINA 1YVEI 1NONA 3KXIA 3ZE7A 4Z4QA 2IU3A 2OVFA 1RC0A 3FLAA 3RK1A 3X1MA 3D4PA 1XDBA 4C21A 5I7FA 4JVMA 1D09A 1AOXA 3Q6IA 3QBDA 5IAJA 5J59A 5BR7A 3I1FA 4RJJA 4XR9A 5JPIA 2YX1A 5J40A 1EU1A 2CVQA 3QLUA 3OCYA 4L50A 4RCZA 1OZAA 2Q2NA 5LA6B 3V4ZA 3EF0A 4ND3A 4A91A 4ZI3A 2ONYA 3WBFA 1AQYA 4HLDA 1YC2A 3M3HA 4II3A 1JLLB 4RVSA 1E3QA 1JLKA 5KQMA 4F3NA 4WXRA 4NAVA 3B1WA 2MSWA 3EWIA 3CNOA 2I8CA 3FYUB 2C2WA 3CCCA 3T5DA 4HWRA 2IYXA 5EGSA 4BX8A 4CGZA 1NLYA 2Z98A 4UNIA 4BASA 1RWBA 2UZ3A 4YQZA 2AH5A 5BR4A 1W36D 2RJOA 4HBZA 1I0IA 4LMPA 1ZQ1A 2JFBA 2A5FA 1R3DA 1U2TA 2BSXA 2PRYA 2YUTA 3LK6A 2VZ8A 3PHGA 3QLVA 3DV0B 3U4QB 1I0ZA 1SXJC 1OTYA 2P6MA 3DFZA 2R60A 2Q41A 1YS9A 4M1QA 4QARA 1CR6A 3TAXA 1DRWA 2XIQA 1UZUA 4TUYB 4WAUA 3SIPA 1P1BA 2EJCA 2WYVA 3TRKA 3PICA 4MCHA 1QHHA 1QO9A 1M75A 4TXMA 2O0LA 1OI4A 1S1CA 1Z2EA 1ZEJA 2D1QA 3LWDA 1F17A 3S7ZA 3L0YA 4DMHA 4HHEA 2BLLA 4PFKA 4FFLA 4KC0A 5IAOA 3M1LA 1V7QA 5K8IA 4JUCA 1GDHA 1NPYA 4C6TA 1Y5IA 621PA 3B1YA 2W22A 3ZXXA 4IV0A 2Z95A 3H3XA 3HLKA 4JLDA 1H2HA 3CMCO 1GQQA 2X15A 3IC5A 3O47A 1NA5A 4K9NA 4H17A 4DSTA 1JZQA 4H60A 1L4NA 5D3MB 3I0MA 1G20E 2Y92A 3RWMB 4EATA 5HR5A 3G13A 1RMTA 4LWOA 2HSJA 3BGVA 3GMDA 1N4AA 1H94A 2FWMX 3UJPA 5FULA 2OCYC 2H92A 3RIXA 1ISFA 3I28A 4XD2A 1AO0A 3JV7A 5K7SA 1J21A 4E2YA 2ZJAA 1JDTA 2PKEA 2Q3HA 1IATA 1CR2A 4QUHA 1VKJA 4XPIB 1QP8A 1K4KA 4INOA 5EHIA 4TMVA 4A9AA 3RBAA 4EECA 3OE1A 4KCGA 1ZBDA 4X7MA 3QXGA 1SC6A 3ICVA 5CG1A 4YLEA 2DM6A 4LSZA 4EELA 1COZA 4QFMA 1DBPA 4U7PB 2OECA 2GFIA 4YDQA 3BMCA 4PYOA 2XY4A 2EV9A 3AGQA 4JIMA 4URWR 2HQOA 1VI6A 1Z4NA 2FMXA 2PVPA 4Q9NA 4RH1A 4YCSA 5IF9A 2PMWB 2JLQA 5K6AA 4YUZA 3LOPA 2JKYA 3O9ZA 4K86A 1J1ZA 4BLWA 4X85A 3PDHA 4N65A 3K1TA 5IMSA 5IXSA 1ZD5A 2J1LA 1DVRA 2OBFA 3BZBA 3USCS 4CZ2A 4DLYA 1J42A 1BE1A 5IT4A 1YHZA 4J6EA 4A10A 2V7VA 3HCAA 3TL2A 2QVCA 3AL3A 4JLNA 5A4DA 4HDRA 1XX6A 5FLEX 2VAXA 4OQYA 3AR3A 3JZMA 4MZDA 1SU6A 4DLZA 4BUCA 1YZNA 3NB0A 5FBQB 1W4LA 3FIJA 1G0NA 3T3NA 3GGJA 4S0ZA 3KYDA 1NT2A 2J6HA 1O96B 3B7PA 3L4BA 1Y5RA 1B0PA 3LCJA 4ENUA 3R6LA 4K9MA 4WE3A 4GM4A 1SQ6A 2DSTA 3F90A 5A0FA 2FW6A 4R2XA 1TM1E 2CLOB 3DBLB 4AKHA 3FPAA 2QN3A 3K9BA 4FDVA 4G0UA 2YIVX 1NYTA 5KNBH 5G41A 3FPSA 1TUIA 3K8ZA 2ATIA 3LUAA 4N7RA 1SVMA 3GWZA 3W3ZB 5IXJA 2I6QA 2OZLA 1KQFA 3EQ8A 3L0BA 1NGSA 1HDGO 4MP8A 4ZCTA 1YZHA 2GRJA 4KFSA 4MW4A 3OOHA 5DK6A 4EWLA 1FU8A 2A1UA 2C5SA 1WRBA 5IUNC 4JR2A 5L51A 1C1XB 1NAHA 3NHUA 1Y5NA 2CNDA 3RUEA 1PJLA 4NESA 3VR5H 2G80A 3TBFA 3LIIA 5JTTA 3ETJA 3FUWA 4DL9A 5EXPA 3AX6A 4QXQA 2PUDA 4KWIA 5FPKA 3AEXA 3HKBB 1JH9A 3O0DA 3GLFE 3SY8A 3V8QA 2QRJA 2XTZA 2PU5A 4LSGA 1N6PA 5C1DA 1CZLA 1EUCB 3B3QA 4FVTA 4YNBA 4EARA 3LL7A 4F9GA 1H8HD 3BJRA 1NPTO 2YIMA 3CO5A 1QVZA 3GLHE 4PINA 3EGXB 3LT5A 4C0HA 1H4SA 1UWLA 5EZYF 1QFJA 4J0JA 4ND8A 2AZDA 2QL6A 3KXDA 5FPHA 5LQDA 1HQCA 1KBOA 2DQYA 3RJ9A 3TG2A 1Q3KA 4WY5A 5BXQC 4HY3A 1I9GA 3WNVA 3UCEA 4XX0B 1U8CB 1J8VA 4PTYA 1JKFA 5H7XA 5LN1A 1OFVA 5GINE 1MZVA 2ZG6A 5FI0B 3M70A 2A9PA 3IP1A 3MTDA 2AIRA 3N76A 3ODGA 1WW8A 3T3GA 4OSPA 3QG5A 4JT8A 1Y6QA 1JEQA 3IPCA 2C2OA 3AF1A 3T9CA 1EWVA 3PUYA 4UMVA 3UGKA 1I33A 4JP1A 4BNYA 3M4ZA 2IYWA 4DRXA 4N18A 4IILA 1PJRA 2X7JA 1AUXA 1RHUA 1Z6XA 3AETA 3GN1A 1ZQ9A 4IIDA 1M6YA 1SBYA 2YH2A 1DG1G 1IK4A 4WESA 4WJKB 1APBA 3DOOA 5E38A 3OEWA 1TQ4A 4O4IB 1UJ2A 1P9WA 3PIDA 4ANFA 1VJGA 4DAOA 5KQPA 1E9RA 3PTLA 2BH2A 3A1EA 1JZTA 1C0KA 3K9WA 5KJ1A 3E7XA 3MGCA 2EU8A 1EDBA 1S8AA 3HVUA 4M1KA 2A0KA 4W7HA 3UICA 3AM1A 3LDAA 3EPPA 5JEEA 2W6QA 1I5OA 1UPAA 1KI8A 1VLQA 2X8WA 4I4LA 1W30A 4K9LA 4QYIB 3D6HA 3QLTA 1E5XA 2Y76A 3IUNA 2WV7A 1IZZA 2ZZMA 1LZLA 4RDCA 3S28A 4CKWB 3CKKA 1D0SA 4MLDA 1YL7A 1XTTA 4A73A 4ZOCA 1TCCA 4GR4A 1JQ3A 1H8EA 1T5BA 4KOAA 2DFDA 2DQKA 3P27A 3JASB 4HPWA 3FWHA 5GMOA 3PD7A 3G17A 2BFCA 4L2IA 2CYAA 4GBJA 4YBZA 1A5BB 2A9VA 3LK7A 1EE9A 2Z5VA 2ZYVX 2BRUA 3EUFA 1TEHA 1PV4A 1KYIA 1NI5A 2RFLA 3FROA 3N59A 5L45A 5LL6P 3JXEA 4G56A 1BJKA 3JQQA 3R3JA 4L72A 3CEHA 1E6CA 3D4BA 3ZNNA 4N3NA 5AKYA 2GLUA 4LXUA 2RH4A 4RKEA 1EFLA 1FSZA 1Z37A 3H9EO 4NCXA 1TYDE 4I6JA 1A50B 3E03A 5K0GA 4QTUB 2BI8A 1OJ7A 3DCNA 2X0DA 4KXVA 1SKBA 4C7MA 2Q0XA 2UDPA 2FE1A 3LO8A 5GGYA 2BEVA 2ZJ4A 4BE7B 1BU5A 4CLDA 2Y1FA 2ZEJA 1PEDA 4B6PA 1MEOA 5DE3A 4R40A 4Z9AA 4AWAA 4AD8A 3FTCA 4PC3A 4KLNA 4DR3B 2IQIA 2JJ2A 1ZK1A 5DTJA 3RCBA 2OM2A 3R9IA 4Q05A 1TE2A 2ZS9A 2VNJA 4LSMA 2P7HA 1MVOA 3ZCXA 3GLGB 1ZO8A 5IM5A 4EGQA 2V6MA 3PE3A 4HVCA 1P5RA 3FNRA 4B7XA 4OIFA 3ODPA 2AN9A 5IDVA 1PJZA 4Z53A 1W36C 1XR3A 3DMRA 2C03A 4ZCMA 5TPZA 1L5WA 1JF8A 1A72A 1MJFA 1R64A 1R8QA 1XHEA 2ZJ5A 5D5HA 3WJAA 4DDKA 5JNWA 2GYUA 2FR1A 1AK2A 3EVBA 3K9QO 3P5SA 2ZRIA 4GXRA 5CG2A 3KPYA 5DU2A 5FLYA 4MS1A 1XOIA 3DHEA 4UE3S 5F2KA 3U1TA 2OV8A 2OV6A 1SIWA 1FVHA 3Q3CA 4DVJA 4X94A 2VEDA 1PGPA 1WXFA 3QUQA 3EG9B 1MT3A 4XFKA 4M7RA 5TEVA 3VSCA 4B6OA 5E0KB 3W4JA 3PKZA 4JB3A 1Y6ZA 1N7GA 2QYTA 4H31A 2FOLA 3G2NA 3LGSA 4J0QA 4L6CA 5EESA 3W7VA 2RBEA 2W6JD 4CCSA 4YP1A 3O83A 2AQHA 3A6ZA 4F3YA 2BFFB 4CTOA 4R81A 4BKPA 2RHJA 2OO5A 1CRWG 3G9UA 4DQUA 1QWOA 5A7HA 3ROQA 1CVLA 1YZVA 3ZLVA 5K3EA 2YWCA 1IH8A 4TRNA 4IFEA 1VC2A 1Z3IX 2JIQA 2X6QA 3OX1A 4LDAA 4UAGA 1PLJA 3RAJA 1EXDA 4DR7B 2QVXX 1Z4PX 3G8CA 4M3NA 4L4YA 3RRMA 3Q2IA 4U7TB 5GWXA 1COWD 1S2OA 1YBVA 2C2KA 2GNPA