5IEJA

Solution structure of the bef3-activated conformation of sdrg from pseudomonas melonis fr1
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
MSALTQILIVEDEPLIAMMLEDFLEVLDKTPVGTVDTVAGALARVEDGGIDAAILDVNLRGGEKSTPVAEALAARDIPFVFATGGSDDSVDSRFRDRPVLQKPFTMDGVAKALAALLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of the PFXFATG[G/Y] Motif in the Activation of SdrG, a Response Regulator Involved in the Alphaproteobacterial General Stress Response.
pubmed doi rcsb
source organism Sphingomonas melonis fr1
molecule tags Protein
molecule keywords SdrG
total genus 30
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2016-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5iejA00
1JX6A 3N0WA 2GX6A 1MAVA 2QV0A 3FMVA 3O2SB 3KG2A 2WY2D 5TPWB 1BDHA 5FWYA 1NXXA 2WJAA 4E7PA 5GOTA 3QLUC 2FQYA 3P9YA 3ROTA 5JNWA 4MGEA 2B4AA 1JYFA 2RJOA 5DGCA 4W5RA 3H5LA 5DKFA 4F12A 1GCGA 3H5VA 4W5OA 1NXVA 1U04A 3ILYA 4MRMA 5ED4A 3JPYA 3I45A 2FQXA 3O2JA 4G0ZA 5HM6A 1QNLA 2E4VA 1TVMA 3I5AA 3KLNA 4RXUA 5PNTA 5EWMB 3NHMA 4YWHA 3FDFA 1JWLA 3LOPA 3O1JC 1Z12A 1YVUA 1EFAA 4G97A 3LUKA 1ZY2A 1VPWA 4FE4A 2VUHB 2H3HA 1JHZA 1ZGGA 1W25A 3OMWA 1E6LA 1P6QA 2LIVA 5KQLA 4S04A 4WUTA 3DLHA 4EVRA 4JB2A 1MVOA 3M6MD 1WETA 1JDPA 5TQ0B 4NV3A 4MLCA 3GRCA 1U0SY 1SXIA 4G0MA 2L17A 4IF4A 2ID7A 3F6PA 2JBAA 4M88A 2FXIA 4MPTA 2FLWA 2GKGA 3F73A 2PUEA 2FW0A 3A10A 3SAJA 1QQBA 4ZJPA 4WWHA 1EHCA 4ML3A 2QVCA 3HDVA 1LBIA 4QICA 3RVQA 1JFSA 4EVSA 4RSMA 1ISSA 1FFSA 1DBWA 1SXGA 3CHYA 1PUXA 1JL3A 3N6VA 4XFKA 5ABPA 3KJXA 4TLLB 1Z2EA 4RK4A 5GQSA 1QQAA 3D8UA 3OLYA 1USKA 3LKBA 2E4XA 4UHKA 4EYOA 3Q7TA 1SRRA 4OTZA 3C3WA 2HQRA 4D6XA 3LUAA 3E61A 2R4QA 4PZ0A 4RKRA 4PE5B 2VK2A 3Q9SA 4YS6A 3OM1A 3W9SA 3BREA 2HJ9A 3QLUA 4O5AA 3RVLA 3MA0A 3QLVA 4S05A 4Q7EA 4KZKA 1DCFA 3HSYA 5D2CA 3M9XA 3L6UA 2IPNA 4JP1A 1QP4A 4H3KB 5TQ0A 4XAQA 1DBPA 1KRWA 5BRJA 4WXEA 1BVHA 1KGSA 4MYRA 1TMYA 4HNSA 1YK0A 2NZUG 3T38A 5KI6A 1BA2A 5IULC 4MR7B 2VYCA 1M5UA 3Q7RA 5TE9A 4DN6A 1BDIA 7ABPA 3T8YA 2FVYA 3IP9A 2GBPA 3H1GA 4YO7A 4TN5A 2QU7A 2MSWA 4N03A 2I6FA 4OLAA 4WXMA 4P98A 2PAFA 3GA5A 1OXKB 2NZVG 3N53A 1E6KA 3HJFA 4Q6WA 1DZ3A 3KYIB 1JYEA 3EULA 2LP4Y 2GI4A 3RVOA 3MM4A 3HVRA 2BGGA 2CHFA 2HQBA 1D2AA 2QVGA 3C97A 3CG0A 1A0OA 4PEVA 3OQMA 1RZRA 5IUJC 2F8TA 4G86A 1PNRA 1EWKA 4RWEA 3UUGA 4Z4FA 3BBLA 4YCSA 3QEMA 2LUOA 4RY9A 2P9HA 1JBEA 1PHRA 2WWVD 5DCLA 4ZPJA 4P1ZA 4Z4CA 5JS1A 4NICA 4RK5A 4Z4IA 5CHYA 1QP7A 2HPHA 2JB9A 4YLEA 2O20A 3EODA 4N0QA 3Q15C 3N0RA 3HV2A 4FB4A 4Z9AA 1ZH4A 5E3JA 5JNTA 3HM9A 3EGCA 4MAAA 4RDCA 3FFTA 1VLZA 1RZRD 2ZAYA 2WB4A 3FFWA 4Z4EA 3S99A 4LX8A 1EAYA 3GL9A 8ABPA 1F51E 4KV7A 2E4ZA 4F8JA 3KHTA 2N9UA 1GCAA 3TX6A 4EVQA 4QYMA 2R47A 4KK4A 3C3KA 3H6GA 2FMHA 4WZZA 2FSPA 5IX8A 5FBKA 5JS2A 3FFXA 4EGSA 3A0RB 3H6HA 3CKMA 4EYGA 3LUHA 2NT4A 1A2OA 1CYEA 2RGYA 5FWXB 5IUNC 1DG9A 2JVKA 4JAVC 2JVIA 3H1EA 3RVNA 3LUFA 3MQ4A 3OO1A 4PYRA 2YHAA 4E7OA 4LE1A 3RVSA 3TD9A 3RVMA 2VUIB 1P6UA 2AYZA 4KMRA 3SNKA 4JASB 4B09A 3IP5A 3H5OA 3HK2A 3IPAA 3DBIA 3H5IA 3EDCA 5HQJA 2LPMA 4PICA 1Z13A 2Q5CA 1USGA 2PL9A 3OMXA 2NUBA 4MS1B 9ABPA 2PKXA 2FQWA 4MR9A 2X7XA 1JFTA 1RNLA 4N41A 3CNBA 1NXSA 4IGAA 2IOYA 2IPAB 2IYNA 3GBPA 3GYBA 5F64A 2JCGA 2IPLA 1Z17A 4IILA 5EWJB 5C5CA 3GBVA 3VNAA 3C6QA 3KYJB 4MS3B 1XHEA 4KNYA 1B00A 3QX9A 1PEYA 1Z16A 3CG4A 4RZSA 4XASA 5KQGA 4YV7A 2MYUA 5KWSA 1ZAYA 1PNTA 2PUAA 1Z25A 3GWGA 1K68A 4H3HB 3GV0A 1T34A 4G0YA 1EWVA 3IP6A 3EQ2A 4F11A 4LDAA 4JA2A 1R8JA 3DGFC 2PUFA 2PJUA 2PUBA 2CHEA 4MR8A 3G85A 3OQNA 4G0PA 3BRQA 3HUTA 5JNSA 3OM0A 1QP0A 2FTKE 3MYYA 5CNKA 1CHNA 2OENG 3K4HA 4KQCA 4XARA 1YS7A 2PUDA 1DCKA 3UK0A 4HNQA 1AB5A 5KC8A 4XLTA 2PE5A 4KQ9A 4RY8A 1LK0A 4TLMB 5TPWA 3NNSA 3A0UA 3JS5A 2E4WA 4ZYLA 1MIHA 1DJMA 4O1IA 3JVDA 3Q41A 1RXIA 3CLKA 2ID9A 2FN9A 2R48A 1DBQA 1LBHA 1QKKA 1APBA 3I42A 1JF8A 4W5TA 4KVFA 3CTPA 3QEMB 3O74A 1Y1LA 2FMKA 1TLFA 4D6YA 4ETIA 2PUCA 2J48A 2QZJA 1ABFA 1E6MA 4OLBA 1IIBA 2JVJA 3RQIA 2LBPA 2JBAB 1ZITA 4NCBA 2PMCA 1Z18A 2QXYA 3HEBA 4YRZA 4RY0A 1JH9A 3CRNA 2HSGA 3DGEC 1SD5A 4OG2A 1JLKA 1YS6A 3QELB 2ZWMA 5EWLB 3LKVA 5IEBA 2FLKA 1D4ZA 4TMYA 5KQPA 2AYXA 3EJWA 1PEAA 1ABEA 4LE0A 4ETMA 3LUDA 4OATA 3H1FA 5JNVA 3LUCA 4DADA 3BILA 2FMFA 2HQOA 4CBVA 1L5YA 1GUDA 4EYKA 2GWRA 3KTOA 3N8IA 3NBMA 2E4YA 2XDYA 4LE2A 3NNNA 3OLWA 4MR8B 4MQFB 5FBHA 3TO5A 3VNBA 2MSLA 4LRQA 3CS3A 1NXTA 3KS9A 4RK6A 5TQ2B 3H5TA 2V0NA 1EWTA 1TM2A 4MQEB 3HZHA 5C5EA 3UKJA 1Z2DA 3MF4A 1OXBB 4Q6BA 3LFTA 5FWXA 1C0EA 5CNJA 1LJLA 4Z4HA 1M2EA 3T6KA 2WJWA 3DZDA 1HEYA 2MYTA 4JOQA 1MB0A 6ABPA 2A9RA 2KYRA 2DRIA 1JFVA 2A9PA 4KFCA 5TPZA 1ZVVA 2L2QA 1RPJA 5IC5A 2A9QA 2PUGA 3Q7SA 2FN8A 4WT7A 1FFWA 4KK3A 1TJYA 1XWWA 3O1HB 4Z99A 4QPJC 4MS1A 1DP4A 4G0XA 3F7NA 3RVRA 2A9OA 1ZHHA 2WRZA 4F06A 3RH0A 1ZGZA 3BRSA 5EWMA 3D02A 4MR7A 1KMIY 3LUGA 5JNUA 4N76A 3HXMA 1ZESA 5HKOA 4EYQA 1W9HA 3CFYA 3JY6A 4MQFA 3SY8A 3TB6A 4RS3A 3G1WA 4MRMB 5KQMA 3HUUA 4QYWA 2L19A 4G0OA 3CZCA 4RKQA 3O2QB 5TPZD 1UDRA 4EUKA 1DC7A 2YHBA 5IUKC 2FEWB 1NXWA 3HCWA 4KREA 3R0JA 2WMYA 4FE7A 4LZLA 4XXHA 4W5QA 4G0QA 4RK1A 5CNMA 3SQNA 4L4UA 1K66A 3OO0A 4D74A 3C3MA 2FEKA 5BR1A 1P8AA 4W5NA 4MS3A 3LMKA 5TQ2A 2QR3A 2MSKA 3N75A 1URPA 4MQEA 4UHJA 5HSGA 2RDMA 3JVIA 4KPYA 3JTEA 4NCAA 2B1JA 4MS4B 2M98A 4RU1A 3RVJA 3KCNA 4RV5A 1ISRA 3IPCA 3QLTA 4RXTA 1SXHA 3KKEA 4OBBA 3RVKA 4DQDA 1YMUA 2IKSA 4N47A 3N0XA 3SM9A 2RJNA 1U2QA 1D1QA 4ZMSA 2FEPA 2FKAA 3B2NA 2R25B 4LDZA 4NQRA 4EY3A 2PLNA 6CHYA 2P4UA 5T3YA 1U2PA 1S8NA 1H9CA 1YIOA 3KLOA 2QSJA 1YK1A 1Z26A 2CWDA 3SG0A 1YMVA 1ZN2A 2NT3A 3FGZA 1NXOA 4HYEA 4RK0A 5DLEA 1ZDMA 1U8TA 3EAFA 3NNDA 2MYPA 5BRAA 3H75A 1AB6A 1NXPA 3RVPA 3K9CA 3QX8A 1USIA 4N0PA 4RK7A 4YR7A 3QLVC 3ROFA 1NATA 1QO0D 2JK1A 3LTEA 4YGXB 1L5ZA 1M5TA 2OQRA 1KRXA 1DRKA 2PL1A 5I4CA 3IDOA 2MYNA 1D1PA 3GT7A 5KC9A 3DLBA 1DRJA 5B3JA 1GUBA 4H60A 3F6CA 1FSPA 5JNRA 1BAPA 1I3CA 4RXMA 4JB0A 1RXEA 1YTUA 4F3TA 4ZMRA 1NTRA 1CEYA 3OLVA 1GLGA 1A04A 4MLDA 4Z4GA 4Z0NA 5B3JC 2M1ZA 5DTEA 3O21A 1ZH2A 3IP7A 3HO1A 4MR9B 4O1HA 1FFGA 5IEJA 3M9WA 4IMIB 3O1IC 3QK7A 4Y9TA 1BDJA 3A3KA 2QW1A 1LJUA 2CD7A 1DC8A 4L85A 5TQJA 2F8SA 1VKRA 1FQWA 5FWYB 1JDNA 1Z15A 2FMIA 2E4UA 2IDMA 4YP9A 3QELA 5EWLA 1MB3A 4MS4A 1VRVA 3MIZA 1C4WA 3L49A 4GPAA 4HNRA 1QMPA 3CU5A 1F4VA 2L18A 3ILHA 3O75A 3OLZA 4GNRA 3HS3A 3URMA 4KRFA 1QPZA 2JRLA 2H0AA 3MMNA 3OQOA 3KSMA 1XHFA 1E2BA 3OLXA 3QEKA 4ETNA 3T95A 1J56A 4IRXA 5CNIA 1M2FA 1D5WA 3E3MA 3LUJA 5IBQA 5T7BA 3JPWA 1P2FA 1NY5A 4Z9BA 5BQ3A 5EWJA 3TMYA 2TMYA 2IPMA 1DCMA 3HDGA 3NHZA 1QO0A 3EQZA 2W42A 3I09A 3CZ5A 4IMJB 3H5WA
chains in the Genus database with same CATH superfamily
3DKVA 1UP7A 3GZNB 3MTAA 3FX2A 2C3OA 4QPZA 3L43A 1EUQA 1SGWA 4QXQA 1C1HA 2ZYWX 4C4SA 1QHIA 2XB9A 2ETXA 2WJAA 5E3HA 1YHYA 3BRCA 3PXBA 3P9YA 4V03A 3RLFA 4KSYA 1G9TA 1CIJA 4KOAA 3CQ9A 2G63A 1W75A 3K35A 4KQXA 1TT7A 4AQYB 4FIDA 5JSKA 1YZVA 2IYTA 2ZYVX 3H5VA 3ZVKA 1PR6A 4JR1A 2JGJA 5CT9A 2NNWB 3OEED 1PT5A 1W4CA 2CNNA 1IHDA 1E1LA 4K81B 1QGUB 1LV8A 3EC2A 4TMTA 4XPIB 3KQOA 2A5FA 5CXXA 1YB2A 1VYUA 5PNTA 1MTZA 1WW8A 1D7AA 1X7XB 2H7CA 3STVA 3UAVA 3AKZA 2Q2NA 4J91A 4E2ZA 3J7TA 2HYIC 3SC4A 1E9BA 3GPBA 4GBED 3E53A 1I14A 3EIFA 4G85A 4IHAA 2NSLA 4IWYA 2Z08A 4HVTA 1FTGA 2ZYHA 4L8WB 3PX3A 4G97A 1PLJA 3HBJA 3W2GA 4ZCTA 2ECOA 2WIKA 4LVOA 3U7GA 2X0JA 1Y4UA 4D9MA 2O8CB 1CY1A 2CF5A 1YCGA 4Z3KA 5BV0A 3H83A 4NCJA 3FPSA 5DP1A 4UPEA 3MGKA 5EPEA 4BC0A 1LF0A 1G2PA 3RC9A 1XCGB 1KZYC 1FX0A 4JOSA 2MMCA 1Q0PA 1KAQA 1J9GA 3ZCVA 2PKQP 4DVGA 1PZXA 4LSWA 3UAOA 4E08A 1OC2A 1FFEA 2XB6A 4N54A 1WUIS 1SRQA 4GXRA 4LAFA 4UBJA 4G8BA 1ZSYA 5ILGA 1JFSA 4RSRA 2P9FA 2WJJA 1K63A 3CJTA 1N3BA 1E2QA 1MVNA 1XNRB 1PDWA 1SXGA 3CHYA 1JIQA 2ANBA 4JH0A 4TYPA 2D0OB 1CQIB 4RA9A 1USKA 3M49A 4D9GA 1SC4A 1V8DA 3K30A 3PRKE 3Q3JB 2H6EA 4JI6B 1RRPA 1L0BA 1Z5VA 2EATA 3GEMA 3PCRB 3EVTA 2ZJ1A 1A9XB 1T36A 4GOXA 4OD0A 1TJ3A 3E61A 4AF8A 4LRSB 4BVEA 2UUAB 1W1IA 2Z0MA 4PZ0A 2GVNA 4IV0A 3ZPXA 1HMYA 3IRUA 2D7DA 1TPZA 1UXIA 1QVZA 1XRNA 2O6HA 2OGZA 3UHPA 3MA0A 3HDHA 4ZHSA 5JPDA 1RYYA 1QP8A 3CLRD 2G25A 4MV0A 3F6EX 4PC3A 4UUAA 5D2CA 3ZH2A 3S2FA 3SHOA 5H59A 1FZQA 3PGLA 2BFCB 4POAA 3WLRA 2PXHA 2YDYA 5MDHA 2BM1A 2ZUEA 1KRWA 3W34A 3V1YA 1QC5A 3HYNA 1L8AA 5JYBA 4K9DA 3SN6A 5KI6A 3UT5A 1I7SB 5AW6A 2Q0SA 5DISB 3DFKA 3NAZA 2IK8A 4BQPA 3HCEA 3FUUA 2V7PA 4J0EA 1CUUA 3HCFA 3A1FA 4YUVA 4UOZA 3B12A 1TAUA 1SBTA 2BV3A 4RD6A 3PZRA 3U4IA 1OX4A 1Z6YA 4PVDA 4RJJA 4W6ZA 3QEBZ 4AZ0B 2NZVG 1NC1A 3PNMA 4TRRA 1US8A 3CJQA 4XUGB 1EFPA 1QFJA 4ND2A 1T5DX 1UFQA 4M37A 3FOZA 3PLAE 1GZDA 1KOJA 4HQ6A 1EKXA 4FOSA 4LSZA 3NEPX 4RPJA 4RW0A 1OD6A 2H11A 2O0JA 1U2GC 3FAKA 3TRIA 5I3CA 4NHEA 1EUDB 2XBLA 4M9UA 4LRYA 5TF4A 5A62A 4YJ3B 3VR2A 4ZHQB 1O57A 4L0MA 3GU3A 3IFSA 1CQXA 2WYOA 2SICE 5IAGA 4KO1S 1PG2A 4RY9A 1XU7A 5F3WB 5KOIA 3R5FA 1JXQA 2JAHA 5HVNA 2WHRA 1YONA 5CJJA 4Y67A 3KPUA 4MQ5A 2B36A 3D4BA 1ADJA 1NFRA 4FYXA 1MOZA 1S2LA 4NBUA 2CLDX 5LNK1 3CUUA 1U8UA 3IIIA 1TU0A 1UJCA 2XUOA 3EUWA 2O23A 5EZSA 4P4UA 3K9LA 1SXJB 3H2HA 3LGXA 1R7RA 1RXYA 1L8OA 2X8JB 1X80B 2FPMA 1JALA 4G36A 1VC2A 2COEA 5IBPA 4F4DA 3LX4A 2ZAIA 5C37A 2Q0XA 4AC9A 5TLSA 5DRTA 3E3LA 2WTAA 1I10A 3EGVA 4F8JA 4UVEA 5DNDA 3GLQA 5BT9A 3RSLA 3B85A 3H8SA 3P0IA 2AFRA 3EVDA 4X84A 3VKFA 1LDEA 1BS2A 2CFIA 4C76A 3DBOB 1GXSA 3VZRA 3IR6A 4YAOA 4HNTA 3TVDA 1IOZA 4DT1A 1Z56C 5KYUB 3OC0A 3MWKA 3LJKA 2R8ZA 3E3NA 3TJRA 5IT0A 4BGDA 3BD9A 2OY0A 2NT4A 1UBNA 2Q3JA 1N1GA 1PR1A 4HG2A 4TQ9A 5DGIA 2PGJA 2NZWA 5BVGA 1DFIA 3N87A 3U9SA 1A8PA 2GQ0A 4I4TA 3NAQA 1KWGA 5ANRB 2QRQA 3BGSA 5I7OA 3TEMA 1JR3D 3ENVA 1WOYA 3U7QB 2R62A 3DKKA 3D2LA 3IXQA 1AQIA 2YJGA 2YHAA 2IS6A 4YPFA 3VKWA 2EQ5A 1BMDA 3RYFB 3RVMA 1AMOA 1U63A 1OOEA 2R44A 3L8HA 4KMRA 1A4RA 3CINA 5JWHA 1RCTE 2O4CA 2X8LA 4QPPA 2AOTA 2L0XA 3H5OA 1LTQA 2VHQA 2QV7A 3OE5A 2NUTA 5C5IA 1IG0A 2G09A 2PVSA 1Z13A 2D5LA 1GA1A 2PL9A 5K8TA 1M6WA 3L8CA 2JA2A 4KPUA 2H85A 5CT5A 1A9TA 3HRIA 2FK8A 1GZ4A 1B6SA 1RNLA 4BXOA 4HCJA 2NO0A 4DCSA 1Z5NA 2X0IA 3AIMA 5AVTA 4RH3A 5HG0A 1TQDA 2E4AA 2P41A 3EW9A 5F64A 2QTZA 2QN9A 3KUXA 4DDVA 2H4JA 4K9NA 2RE8A 1R4AA 2W58A 2HRBA 2XMQA 3C6QA 4MQBA 5DNYB 3OPYI 3G13A 3UF0A 4MZDA 5IZ4A 1FPQA 4P32A 2WDPA 5DCYA 4XASA 2CLMB 2RKOA 2JLVA 3U6KA 3INRA 4KIFA 3FCOA 3QE3A 1GU0A 4KLAA 1K9SA 3RUAA 1OKKD 3T41A 1OLUB 1SC1A 3URKA 3ZY3A 1ENPA 2OTCA 4Q1CA 1WUJS 4TUYA 1HDZA 1KI2A 1RIFA 4LDQA 4UQOA 2C2HA 1WXDA 1GUAA 5T67A 3ZLBA 5DB4A 1LZKA 1WMBA 3H9UA 4JK3A 4MR8A 1QYWA 5EE5B 4N3GA 2NU6B 3MOIA 5HS6A 4BYMA 1K8QA 2Y76A 3UCEA 3QPAA 5DHUA 1ZU5A 2P6NA 2P79A 4WN9A 5FUQA 3FSJX 2LR0A 2PT7A 1N9ZA 3PXDA 1VHDA 3PQ6A 3OOJA 5GWXA 5CCXA 4AMVA 3COZA 3UK0A 4DGSA 2PX8A 4LGYA 1TF7A 3TCNA 1WSAA 1YZNA 2FXVA 2WU8A 4MHSA 4KPFC 4CODB 3EFEA 3NNSA 1ZL0A 4AF7A 2VEOA 2B30A 1Z7YA 2ZYDA 3BTVA 5A71A 1L5HA 2GN8A 4OKNA 4B4UA 2JGEA 2JH3A 1Z36A 3FLBA 2I4MA 4UC0A 2B35A 4AUEA 2ES4A 3LWZA 1DBQA 3I9MA 2XUFA 5IXYA 3LX6A 1RVV1 2CE7A 5ESXA 2FPPA 3IH5A 2QG6A 2ZYIA 1BEEA 1SQ0A 1CUCA 5C4IA 1V3UA 1XQ1A 4RTSA 4MUIA 4W5TA 2ZU0C 4MVJD 1IFXA 1U3DA 2K87A 4PYKA 1VIYA 2DKOA 1DKQA 3GDOA 3ENWA 2EDCA 1E6MA 2XNDA 3L8FA 1RXWA 5DW3A 4G37A 1SKYB 5CUQA 3EA5A 4V0SA 1PTKA 4LV5B 4N5LA 1SD5A 3UV7A 1JLKA 3GT4A 2BLNA 2ZIUB 5KJFA 5AKXA 4IS2A 5EHXA 3A1DA 1RWWA 1YDGA 3NBFA 1C7EA 3IMEA 2GM5A 4RQBA 4YRMA 2HPAA 3WL8A 4ZN6A 1X42A 5JNVA 4TV9B 4DADA 2ZM5A 1PX2A 1B8OA 1W5TA 2P3LA 4W7HA 1EX7A 1FP1D 2GJSA 2J32A 2WF9A 1KTIA 4BP1A 3IHTA 1XLWA 1Z39A 3BJIC 4FZ5A 4RWZA 2GHTA 5C80A 1NW6A 2A5GA 2G9RA 4PSCA 1WY7A 2IRWA 1EJ0A 1E5TA 1JZSA 3CS3A 4P4TA 4RK6A 1ABBA 1BE0A 3LIIA 1NLZA 2YNMC 4J07A 5AM2A 3ROKA 2P9BA 1T8UA 3DKRA 3EAGA 2OCIA 4F45A 2WINI 4TS1A 5K05A 2BKLA 1TQ6A 2QENA 2R8YA 1R0RE 1G3RA 1ZHFA 2FW7A 3LDUA 3T6KA 3VVCA 1JIIA 4AY2A 1IPHA 3OE1A 4C04A 3U4QB 1ZL2A 3KKQA 1O6CA 2Q5OA 2OHHA 4Q48A 1KQGA 2A9PA 1JR6A 2V6BA 2FETA 1IHYA 3ELDA 1W19A 2ZI7A 2EERA 2QMQA 4LDRA 9LDBA 3WHPA 5AQ1A 2AIRA 2JAQA 3BRWD 5IN5A 1JILA 4CV2A 4C2BA 1Q7EA 4I50F 1TYCA 4RFSB 2CUKA 5A3JA 3JRXA 4AJKA 1USWA 2WJHA 1B3RA 3HU5A 2D3WA 3A1WA 2JFVA 1C9NA 1WBDA 1VCMA 3NVMB 2QI9C 1GTVA 1Z4QA 3H2ZA 3QYFA 4F5ZA 3KQKA 4RHYA 4FKMA 1B1AA 3L8ZA 3LUGA 4YXWA 3UMRA 3WAJA 3HNOA 5B36A 3TB4A 3RRMA 2CXHA 3SY8A 2AFHE 4W82A 1I6LA 4F6RA 4O5OA 4HMPA 5HR5A 1H6AA 1U0JA 2H2IA 2H1HA 1AQLA 4JP5A 4OFXA 5E6SB 5C8YF 2W43A 4DM4A 1JEYA 1J5XA 1X8JA 2FUCA 1YJCA 2DF8A 3DV9A 4N8DA 1O96A 4AUMA 2DQKA 5ALSA 3QMWA 1IZ9A 4H15A 5IJ9B 3GLHE 3GFRA 4FCCA 4O63O 2CUTA 3NETA 5CNMA 4L4UA 4Z3DA 5B2ZA 4PHTA 2W22A 3GK3A 4JYBA 5DWVA 3KALA 4KQHA 2BFFB 3HFJA 4I3HA 3ZXXA 1J2UA 3UOGA 2MSKA 4IX1A 4DA7A 1P29A 4GBJA 2AZDA 3EWAA 1Z29A 2AJ8A 3MGBA 1J1ZA 5AICA 4BBJA 4MPPA 4ENQA 4NCAA 4DC0A 1ZJZA 3LF1A 2FSSA 5KIAA 1CFZA 4DQDA 2BEKA 5JMOA 2UZ0A 1Z0IA 4TRJA 4WDQA 3IOCA 2FPLA 3E4DA 4DDWA 1XN4A 4B3FX 1GTZA 2ZRCA 2C5EA 2MR6A 1PKEA 4GT1A 4QOGA 2W2KB 2ZBQA 3ZTWA 2HRCA 2FPGB 1SUPA 1S8NA 3AYXB 4CQLA 4AN4A 3B70A 3BXPA 3KLOA 3Q8XB 1XXHA 2G5CA 2WWGA 3L4EA 4RACA 5KYWA 3BGWA 1BW9B 1ZN2A 2NZXA 2BKEA 3PWZA 4RK0A 5KYUA 3M8KA 1KDTA 3DMNA 2QORA 1T5LA 3EAFA 3QOXA 1RFLA 3UWKA 1AB6A 4FXPA 4HDRB 1YA8A 2Z43A 1QFZA 1DX4A 4LJ5A 3GT3A 2DR0A 3TE7A 2EFYA 1ZOIA 4YMWA 5HILA 2ZBUA 4JL6A 2F43B 5ADWA 1MG0A 2OAEA 3QVJA 1CHDA 3LTEA 1ZEJA 4ZQBA 2V7QA 3RB8A 4M0CA 4ASUA 5BN3A 1ZO8A 4TL7A 1ENOA 1Q44A 2CW5A 2ZWPA 2CNWD 2MYNA 4R1LA 1K27A 4JBLA 3T52A 3FKSA 4EHJA 4L6AA 4YJ3F 1VE5A 1FTYA 2AG5A 3RSSA 5J2UF 3O90A 4KN6A 2IHNA 4CF5A 1GUBA 1REQA 1LBEA 2VRCA 2XWBF 1P1RA 1FSPA 3VZQA 4O25A 5IM5A 2P7IA 4RXMA 2G06A 4KMOA 1IEWA 1OTHA 5KYNA 2H9AA 4GKAA 2XMBA 1YQEA 1FCJA 4Z5XA 4Q9DA 5E95A 1TYBE 3HBNA 3KSDO 2NO9A 4M9QA 5JO9A 2FPIB 1FXWA 1L6IA 4KG7A 1OXUA 5LD2C 1KORA 3MWDA 3QK7A 1QIJA 4D0NA 2P2DA 2GAFA 3CGGA 3AR5A 5DLPA 5FWYB 3RLIA 1QGED 3CLUD 4IEFB 4EMSA 2I99A 3M2TA 3HABA 3GFQA 1GCOA 1CQPA 2J9ZB 2VQEB 2FWBA 3SSMA 4ER6A 1OXMA 1I1QB 1P1HA 1RC0A 3GRKA 5F1OA 4OQQA 1QMPA 3QVGA 3P5SA 1X2BA 3CVOA 3K9BA 3L7AA 2QTGA 3URMA 1SQSA 1HQYE 1QPZA 4YASA 2EYUA 3G9ZA 1XHFA 4JZKA 3RRZA 3SLGA 4NCBA 1WCXA 1OZGA 4CU2A 1G6OA 2SCUA 2VNSA 3PFKA 4Q01A 2E48A 5AK3A 4JI1B 3WNDA 1EYZA 1S4MA 1SKQA 2O7SA 3SU8A 1AD2A 2PGXA 4PLGA 2OOSA 4XGIA 1PJTA 2P8JA 3Q87B 4IHKA 3UHOA 1JB9A 1GDHA 1QH8A 1DCMA 1OIWA 2BHRA 3U3RA 4OMUA 2ZRJA 3QZUA 2ECFA 1A96A 5BMVF 2CYCA 3P2YA 4RHUA 5JNWA 4JL5A 3JX9A 2BMAA 2KQUA 2PBLA 4DHEA 1JIUA 1KMHA 4JFRA 4DBLE 3O2SB 2OPBA 4H7KA 2DWPA 4NG5A 1VE6A 4ZWNA 3G9QA 3IEUA 2YWEA 1KZ9A 2XZOA 5D3QA 2Z5LA 1QAMA 5ISMA 5ALFA 5DX1A 4BEBA 4GDFA 1EB9A 1P1CA 1NBIA 4HTAA 1F0YA 3DL0A 1QGDA 1X9IA 2I2DA 2Y93A 5E7IA 3VOSA 2J6BA 3LM8A 5FULA 5FAKA 2P9YA 2BBTA 3AF1A 1LLUA 1EM8A 2EL7A 2LKCA 4L7VA 4BYGA 2ZUWA 4GM1A 3D3NA 5J5CA 3ILVA 3W05A 1U11A 2I6TA 5CURA 1G0OA 1SG9A 4NNPA 2Q4EA 2VHWA 4E51A 1QS0A 4FPXA 1ATIA 3EGDA 2FUG1 1DKMA 3Q3IA 1RACA 5TDHA 4ZTUB 4MVJP 2CJFA 1WS6A 4WNYA 2V7GA 3A6EA 3AJRA 4WLVA 1AO3A 1L5KA 3BGIA 3THSA 2V74B 4P34A 4I8XA 1M73E 3UFXA 1NUPA 3LYHA 2WUGA 4UKDA 3SE0A 4Z53A 3KYDB 5AJTA 1H4VB 1JDPA 5TQ0B 5K99A 5TARA 3SLRA 5L3QB 4K03A 5M3BA 2CDRA 2WJIA 2WWTA 4ERXA 2EOAA 1R0XA 1JZQA 1EPUA 3SAJA 1GNLA 5JJIA 5BY2A 1KI6A 1VI5A 1Z6TA 2VEDA 1NZDA 2QPOA 5L7WA 3TSAA 3GFTA 3ZYZA 2GEKA 2X1VA 1PI3A 4DSTA 1F4LA 3M7IA 3MQFA 5LQMA 4IO0A 2ZE6A 1SD1A 4RH1A 5AHXA 5L3ZA 4BQIA 3S81A 1CE8B 2XF2A 1HYEA 1Q3HA 4P0PB 4TM7A 2FW9A 2YWCA 3WR5A 1SRRA 2IS2A 3C7DB 2BEVA 2X22A 3NYIA 3THYA 3ABSB 4HLUC 1KZ7B 4LISA 1LH0A 2QLFA 1YE5A 4HYQA 5THQA 3ZNQA 2P6PA 1B0ZA 3D54D 4DNFA 5E8JA 3BREA 4UTXA 6YASA 2C2XA 2BFEA 2ZSJA 1SPXA 3NYWA 1JJIA 2QTVB 3PUKA 1DKNA 3EEQA 3S28A 4YRAA 1EVZA 1RYHA 2WM8A 2PCJA 2IPNA 1QK4A 4I1YA 3FROA 1ZXLA 4XAQA 4CR7A 4EG8A 1K6MA 1JT9A 2C2YA 4NCIA 3F5DA 4HWPA 3GY0A 5AVWA 2YOHA 4DSUA 1R5OA 4EGJA 4BY9E 4G89A 1V5WA 1ZUNB 5J59A 1AGRA 4KRXA 2QL7A 5BOVA 2YMPA 1Z8HA 2I4LA 2WU3A 1QK5A 5D3MA 5FUWA 4DPLA 4WI1A 4QQKA 4DDTA 5LLTA 3AI2A 3KKKA 1EFVB 3ZHQA 1GTG1 1ITZA 4MVJF 3JW8A 2BGNA 3RS9A 1C3OA 3CRMA 4LGVA 2CXXA 5DFAA 1A8IA 3KQLA 2PPLA 2COKA 1JYEA 4EP1A 3QBVA 2PZBA 5LQNA 1EHYA 1E8DA 1BOOA 3G5AA 1FFBA 4LY9A 1Z4NA 3WTCA 4B3JA 2BWJA 3BA1A 3SZLA 5D01A 2BGTA 3EMDA 4JOCA 5FA8A 5IT5A 5KTMA 1YFLA 1IJKA 3UHAA 3KHKA 1YJ8A 5B7NA 5CGQB 1VGQA 4NQZA 3U61B 4Z49A 4RWEA 3IX7A 3KAKA 3M6WA 3JYOA 4KO3S 4ND4A 4PSDA 3JYQA 4INOA 4MKFA 1F6DA 1UOPA 2SNIE 2OPHA 5FIUA 1IN5A 1IXKA 3PFNA 2QY9A 1V7PC 5ALGA 4LFBB 5TNXA 1K6IA 2ZUCA 2R5FA 1KF0A 4MP8A 4HLNA 5CHYA 1FYFA 1W88A 1A1VA 3DDUA 2ACEA 3AOEC 1ID1A 2VHVA 2IYXA 2RKBA 3ED1A 5HQ3A 1HTBA 3NPMA 1NU6A 1R37A 3I8XA 4S1TA 2ZRNA 2QW8A 4DCOA 3NKVA 1ACJA 3EGIA 4KWEA 3M9LA 1Z33A 5JVDB 1XTVA 4B46A 3QWBA 1KNXA 5HRUA 1RRCA 1IMOA 4JSTA 1H2YA 3Q9LA 4RDCA 1QZTA 1ISHA 1JLRA 2ZR8A 2ZT6A 3RS0A 1Q3TA 2I3BA 2UVDA 4L5YA 2ALJA 2GK4A 1TGYA 3DW3X 4FYHA 4OREX 2XDAA 3DZJA 1WMAA 4FMDF 3DLPX 2NADA 3ZYCA 2A88A 2ZYGA 3LBAA 1KETA 1ADBA 2O8BA 4KHZA 3P71T 5MN5A 5DNCA 2E6UX 5NLLA 3HB0A 1SBZA 3N39C 2GASA 2HRZA 3WLTA 5JDIA 1NNSA 1PGPA 3E22B 3H11A 3DMTC 4X60A 2TMGA 2X23A 1D6JA 3WLEA 3HPRA 2FUG6 2IHBA 3FB1A 2ZRQA 4L5BA 1JVBA 3T1QA 2GN9A 4DG5A 4DF3A 2DY0A 4CMEC 1MH9A 1TDJA 3G7UA 1TLTA 3X1MA 4B33A 1R4MA 3ESQA 3NHAA 3PTLA 1WDMA 3HL0A 1PP4A 1GA4A 3A1EA 3F8TA 4HI0E 1M6HA 1AQNA 2EWMA 2NACA 3VR2D 2IYEA 4HDMA 4B34A 4QPCA 3RVNA 3WL4A 3OO1A 1T2DA 1YB6A 2IL1A 4XWGA 1FMFA 2WKPA 3H3XA 2XA1A 5DASA 4DSAA 3OD5A 1P6UA 3E3OA 3SFVA 2G6TA 2IJGX 3GAFA 5KB3A 4E2WA 4BO4A 2Y0DA 3DQQA 2VK1A 1RHJA 2CLEB 1ML4A 5FI0B 3G49A 1QTNA 3W8EA 3PE4A 3H5IA 1SNYA 3ZVRA 4O2BA 1SBNE 4DLAA 5AVVA 4TYWA 4XWKA 1I7LA 2VBFA 1JHXA 4DWVA 2PKXA 5AW7A 1CDDA 3U0VA 4K9RA 5L4SA 4BASA 1UBMS 3DE5X 4IKPA 5C8YA 1K2VN 2CB9A 3FDXA 2B1QA 4HDKB 3BVPA 1ELOA 3F71A 4KQFA 4EFNA 2EJWA 1OGIA 3LWBA 3ZVLA 1RQLA 1Z17A 2R6FA 3H3JA 3PRYA 3AVOA 4FS8A 3MN1A 3KYJB 4D2IA 4M1ZA 1KI3A 1QYCA 1YC5A 2AJCA 3CW8X 2CDBA 3ONFA 5LP6A 4A3SA 4C9BA 3FFAA 4EVIA 4YUAA 3CT6A 5KQGA 5KWSA 3OTOB 1K8ZB 1PNTA 2PUAA 1AQ6A 1C9KA 1PEDA 2LTAA 3DCIA 3PVZA 4KDFA 1I7DA 4U4AA 4U39A 1E3LA 2Q49A 2JFXA 3JASA 1BVYF 3JRNA 1LPPA 4LC1A 1XDSA 3EQ2A 4MQUA 5DYWA 2IYVA 4LDAA 5FFMA 4ARUA 2F48A 4F11A 3ANSA 4LFAB 5B3LA 2ZGVA 4JA0A 1EFCA 1U2TA 3CZPA 4RTMA 1T3GA 4ZODA 2PUBA 421PA 1GGJA 1S89A 2CNKA 5GZ3A 3GP8A 1SCJA 3B9RA 4EW1A 3OQNA 3BCSA 3L0BA 1IY1A 3T9AA 3ZHSA 3LGAA 3Q5GA 3WIUA 5E2IA 3KKZA 1BEUB 3WXMA 2YHIA 4O2RA 1BD4A 2D0DA 3NBAA 4UTZA 1AA9A 1ZJ6A 3Q8KA 2VS1A 1DCKA 1XMXA 2W6PA 3KVNA 5CB6A 2AF4C 2AX3A 4D8TA 4XLTA 3V42A 1E3TA 4DV6B 2I7DA 4OHMA 1XDDA 3DV2A 5K0GA 2CYAA 4BVFA 1E3MA 2I6GA 2QAJA 4IH1A 1P45A 2P4SA 5EIHA 3L9XA 4Z9XA 2GAAA 2WFMA 3P4YA 1XXHB 1EA5A 2PFSA 4FQ8A 3DF7A 1E1RD 1B8PA 2FSUA 2GF9A 3HO8A 4IJMA 4GKKB 3PPXA 1ECJA 1IPEA 2CKMA 4JLMA 4WXHA 1KSGA 2GPBA 3MILA 3S29A 3K1YA 4FD3A 3DVAB 2ZRIA 3PGXA 4KNVA 5F5XA 3QEMB 3K1AB 1PBNA 3G5TA 2N47A 3NBXX 4ZIRB 3DEZA 3PU6A 3L05A 4I1RA 5B58T 3A04A 5IVIA 4MV1A 1NFFA 3EZ6A 4YAEA 3PIRA 1D7OA 1QIEA 1M1NA 1Z5UA 1DDOA 1VFNA 1OYVA 1A9YA 1Y80A 2VWHA 3O26A 3O8LA 4FE3A 4QEZA 2ZBEA 4PYLA 4OB8A 2EKBA 5DE3A 1C30B 3BFJA 2M2IA 3VR3A 2JLXA 3JQ7B 4PRLA 2OCKA 1K4MA 4PIPA 4RVSA 1XNQB 1C3LA 1P6XA 1HDIA 4R9UC 1GY8A 1PRYA 1DDIA 2XNSA 2IIBA 1Y7HA 3HVUA 3ZI0A 5IM4A 2NVUB 1E3EA 5DGTA 1CRLA 4RORA 5JYDA 3NDBB 3RK0A 4LTMA 3LQKA 2OG2A 4XDYA 2GS9A 3TKYA 3HJHA 1TGVA 2FW8A 5AJVB 3S2GA 1K0FA 3F67A 5JH7F 1PQPA 2QSYA 2ZBVA 4FHZA 1B3BA 3ZZNA 4DCTA 2IH4A 1M2GA 3NHBA 1EWTA 2ZXEA 3NM4A 3EXFB 4G56A 3ZHVA 4M2LA 1GWNA 1U2GA 3WB2A 3JATB 5EE3A 1EINA 3QFTA 3HGTA 3I2KA 3EPRA 1H2HA 4RVHA 5FHQA 2FSVA 5JSQA 3EUEA 1ESNA 4IAOA 3RR2A 3CNLA 3UC9A 2ZSEA 3RV3A 3SFTA 4G4IA 5GONB 4KFSA 3TEFA 3TQIA 4CTOA 5A02A 3AFOA 4HNVA 1NQ5A 5JAMA 1KDYA 4XIIA 5A04A 1RPJA 2WFAA 3O2NA 3VOTA 2GZSA 3V8VA 5FV4A 4CIVA 4QHSA 5G4KA 4QVGA 2ZPAA 1WXFA 4U6SA 1TJYA 2GPAA 3KVVA 1XWWA 1K4KA 1L1RA 3KDPA 1AVTA 3NWEA 3M33A 3O1LA 2P7HA 1EFRD 3B3AA 4RMHA 2M1XA 1LNSA 4MINA 2A8YA 4RTPA 2WRZA 3KLPX 1Z9BA 1U7TA 4HQNA 3IUYA 4G24A 4U7HA 1CERA 4CKCA 2HCRA 2QVBA 1BRTA 1VLVA 3Q3EA 5DGDA 1Q92A 1FU4A 1X8LA 2VPWA 4JR2A 1IB0A 2HNKA 1L4HA 5CK4A 4A2CA 1K5DA 3CMCO 2P2GA 1MB2A 3I4LA 4GG1A 5DNVA 4AY3A 2D1QA 1PT8A 1WVIA 2DUNA 6NULA 2I33A 4QAQA 1CR2A 3VJKA 1XEXB 5J40A 1A5SB 1TM4E 2H1VA 1HDGO 3E2IA 1G5HA 2MT9A 5H5JA 2W8ZA 1GPLA 5IUKC 1OLSA 3QFRA 1VGRA 4QT0A 3GBSA 1WWKA 5B5SA 2WMYA 3FUWA 1RYDA 1XRSB 3MMZA 5I45A 4RK1A 3A58B 1YKFA 2YOGA 4JR0A 2ZYRA 1RAFA 4ZHQA 4UCFA 4YV2A 3P0EA 4PLCA 4RVDA 5JPCA 3VO9A 5LQCA 4KR9A 3VAZA 3IVXA 5CA0A 2B6HA 1NUHA 3Q8WA 4S0ZA 4A2WA 5EP2A 1F2TA 4RDHA 2IITA 4DQVA 4N18A 3Q0EA 1ORWA 2Q4OA 4NYIR 4B76A 2FOXA 4K9MA 3NT2A 2V65A 3KBOA 3PC4A 4GI1A 1ISRA 2ODWA 1PUIA 2QPAA 1NVAA 4QTTB 1A4UA 4KAJA 2IKSA 1EFHA 1RQXA 2C31A 1GV1A 2RHMA 3R7DA 1Q2XA 3HCDA 2HO5A 3SM9A 5G41A 4E3ZA 1SWWA 2PH1A 2ZXFA 2CFCA 3DAPA 4J0DA 4K6OA 3Q4GA 3VAYA 5IKPA 3H87A 5T3YA 4DLWA 3ZJVA 2FG7C 4QTZA 5A6VA 5CFMA 2R85A 2VOEA 5I3ZA 4N48A 3JQGA 2IPXA 3L7NA 3QFFA 1U8TA 4MVJE 2DQYA 4MYDA 3SBOA 1JDBC 3KQPA 4OHWA 4ZICA 5K5EA 2GCOB 5LNK6 3KB1A 4FT2A 4BQEA 3B7WA 4NTZA 2OORA 1UPCA 1IY0A 4TKMA 4ND8A 1Y7IA 4AQ7A 3PEFA 4FYKA 2ZULA 4XRGA 1LC3A 1Z5PA 3JQAB 3VQTA 3QA3E 1X1AA 1GHTA 3BE6A 2ZIFA 5JC8A 2POQX 1CW2B 2GZRA 4EQ6A 4UTPA 5JAIA 4D9BA 2ATEA 3O21A 5FUXA 1U2DA 4C87A 1ZMBA 3BD7A 3OFJA 4C20A 1CZRA 2QRHA 3LCJA 3M9WA 4LQLA 2FZ5A 5B1DA 5CVCA 3ZQ4A 2W4MA 4YJKA 2O6LA 5CPFA 5KTPA 1UKYA 1H65A 1SBQA 3DM5A 4QODA 1K8RA 2BSAA 1VKRA 1IUKA 1G9XA 3K2EA 4NCHA 5LXTF 4YRGA 4EAQA 3I6IA 1Y3AA 3IC5A 4Z7QB 3W5DA 2O52A 3VDNB 5A0FA 2QAGB 2X5NA 4K3UA 3HCNA 1MHPA 2GARA 3R4VA 1X7ZB 1YQ9A 4K6HA 3MWEA 2FUKA 5D8DA 2A5LA 1YBMA 1UKBA 2NU9A 1NX6A 3U9TA 4UNRA 1F4VA 2L18A 2VA9A 3OLZA 1XG5A 1WKBA 4IV5A 5FADA 2V4ZA 3EY9A 3TUZC 1BXKA 3KJNA 3LHDA 3NOQA 2MCFA 2O14A 1Y7PA 2QN2A 4IGFA 4WE3A 1VJDA 1B6RA 5CNIA 4QO8A 3E3MA 3GGSA 3NU1A 1WD7A 1PVDA 5B1IA 1QPBA 1OFIA 1U0GA 2ZJYA 2JFFA 2HXGA 3OPXA 3HJAA 4UHDA 3HCPA 2IYSA 4BZZA 1JHYA 2CZGA 1N2CE 3NVAA 1YDEA 4J7UA 1UMBB 4NR0A 5DRYA 3TDMA 4B6EA 4OI0A 3DJFA 1PNQA 3O4RA 4EMUA 3GQBA 3K92A 4KUGA 5FOTA 4U7GA 3JR7A 4KXVA 1UADA 4ZA2A 1C4OA 3QVSA 5F1PA 3RRXA 3IMKA 1XVVA 3ZDZB 4F4IA 2Z2ZA 2E55A 1Z6ZA 2YXDA 5ALRA 4HBZA 3ANYB 4X8HA 4Y6QA 2PXXA 3C8HA 2VP9A 5EPUA 1NXXA 5GOTA 1GUFA 4RCYA 4B2YA 3AB7A 5C31A 2B8JA 3ZV5A 4BPBA 3DT9A 2VDQB 3P19A 4FC7A 3TX2A 3CNEA 4FDMA 3UGQA 4QFMA 2VXCA 2FWMX 4O4LA 4F12A 5L4NA 1YCHA 1NXVA 4TKZA 3K09A 4FMDB 4HMQA 3AY7A 1G3QA 2WA2A 4MRMA 4NC9A 5KOYA 1FW8A 1XIVA 2XPCA 5HMLA 2W2OA 2BGJA 1V4BA 5HMMA 4RXUA 2PUJA 1VB3A 1VJ5A 3PQEA 3FYDA 2QE6A 3VR0A 2XUAA 5FTWA 4M1SA 3VSAA 4DJAA 5JHHB 2QXUA 3BWCA 3QF4B 4KAXA 1C1XA 3R3UA 5BSMA 3V5NA 1YQTA 2ZTUA 3LQFA 3B36A 2CXSA 3JTMA 4JKOA 4P6VF 5FO1A 3YASA 5IYZB 2NO7A 1GGMA 1G8YA 1HZJA 2NZYA 2ZE5A 4EKIA 1WNTA 2HFJA 2ZZNA 2W6CX 3ETCA 1WXGA 3M3PA 1ZGGA 1MR3F 2CHQA 5BURA 3JQ7A 1HO3A 4IDQA 4LJRA 1Q74A 3EVCA 1PZNA 3C45A 1XWIA 3NHJA 4RM3A 3MLAA 1PL0A 4TVSA 1TO2E 5LQUA 4IF4A 4U0KA 2Z95A 4KPUB 1BFUA 1ZFNA 2Y77A 4ZEVA 4NBNA 4UM9D 5KYXA 3BORA 4A0GA 5CFPA 3B3QA 4Z7JA 3WL3A 4Y9SA 1XTPA 1VSQA 1CJBA 1LPBB 1T10A 5FL7D 3SXUA 2VDWB 2QGZA 3AEKA 3INTA 3KZXA 1EHCA 1MPTA 2PANA 4G5RA 3O0TA 5D3MB 5EZYF 5IDQA 1OJ7A 1XELA 4RGVA 4RSMA 1ISSA 2V7XA 5IHPA 1TUIA 4Y2XA 3CVWA 4GPBA 4R1UA 3TIXB 3UTCA 5K8UA 1U8FO 3ZZMA 3W5BA 1YS1X 1UBRS 4TLLB 4EZIA 2VTBB 4N6OA 2C7BA 4ZI7A 5I8ZA 3F97A 3I83A 2X0EA 3HFSA 3Q7TA 4P3NA 4CDRA 3CXRA 3N8NA 2LW7A 1EGQA 3Q6NA 3VNQA 2ZTHA 2A5YB 3LY9A 4YJDA 2IXFA 3WOHA 3MOSA 1XUOA 4WVFA 1X1BA 2VK2A 4HQ0A 2BL4A 3W9SA 4MULA 4OK3A 3X0DA 3QLUA 4IQ0A 2Q1WA 3L7CA 3A25A 4GOLD 2PV0A 5CM8B 2FFJA 3KM0A 1L9KA 1WBBA 5IC6A 3BMQB 4GKVA 4H3KB 1DCTA 1H9BA 1K5GA 2CV0A 4HJXA 4CUZA 2BFOA 2WA1A 3HCAA 2PBFA 4ADSG 1KH3A 4CDMA 3BIOA 2EZ8A 1U5CA 2F3RA 4HZIA 4M8NE 2PD3A 2Q3EA 2RGBA 4YCJA 3VO8A 3W90A 4CMKA 7ABPA 1M2VB 1WBJB 1NONA 3JD3A 2JPDA 3ENKA 4XZ3A 5FPSA 5HCUA 3WWYA 2ORWA 4YO7A 4HVCA 1N2HA 2MSWA 4OJNA 4C4TA 1IXSB 5FPKA 3QX3A 1KY5A 1R8YA 4H59A 4N03A 3L18A 4PPQA 3FHJA 4P98A 4WXMA 5C32A 6AT1A 1QONA 2GM4A 4YAFA 5BSEA 4AMUA 3LP6A 1MENA 4JHLA 5DBHX 3C5VA 2V98A 1GQ2A 1O9BA 1TCAA 2BGGA 4DQKA 1EXWA 3C97A 2C07A 4FOLA 1GGVA 2GDJA 3JAKA 4DRXA 1FRNA 4MJLA 4HO1X 2IW3A 3KVOA 3FKJA 5JC1A 2I3ZA 5LA6F 1J2TA 1Q1AA 1XI2A 3S7TA 2WR8A 1Z6PA 3KOWA 1DUVG 3T3DA 5HKBA 1ISJA 1D2NA 4BMPB 2QX8A 5K9ZA 1JBEA 3NHKA 5DBGA 5JI2E 3KK0A 5CG2A 5DCLA 1EEXB 3C1OA 5JS1A 1OY1A 3NTUA 1L7RA 4NICA 1WZNA 2AD1A 3SZOA 1PJZA 2BM9A 1ZHOA 1H2WA 1OAAA 4B3HA 1Z06A 2UVPA 2WSSA 4HDMB 4UBNA 4IDDA 3GC6A 3UV3A 3DOIA 3TW4A 1G59A 4R6XA 2GK7A 2GCEA 4DXHA 1Y4SA 3IDAA 4ECAA 4G9GA 1PGJA 2EWVA 3QHPA 1ICIA 3P45A 4NMHA 3UHFA 5EIFA 4AJ9A 3RDPA 4B9EA 4CKBA 1CDEA 3GDHA 4YAGA 2FFQA 4NOJA 5DLYA 1LVHA 1SIOA 3DE2X 3S99A 3TLAA 4XB2A 4BNDA 1L4YA 1PFYA 3AK4A 2QM8A 3FNEA 4IFEA 4XRRA 1NAIA 2NIPA 2H7VA 1GGHA 4DR4B 4WA8A 5DN6D 4R4JA 1CQJB 4BVHA 4AZSA 1UM9B 5DV9A 2NU8B 3FNBA 4DLKA 1UJBA 3TMKA 3T7KA 5J3JA 2XUDA 5KVQA 3ZE0B 1ODFA 4EF5A 2DPXA 3H6HA 2Q3BA 4KFUA 5CXSA 3ZR4B 4CKWB 3UJNA 3ZDBA 1NBWB 4QU9A 1G5PA 3AVTA 1AK2A 1Z0FA 1VBMA 4BKOA 4DIBA 2VP5A 3NC0C 4KXNA 4KXMA 3B9PA 4RIEA 3BYZA 4B7CA 4MW0A 1IAVA 1AKWA 3AKYA 1L5GB 5IH7A 1F7UA 1O94C 4ZAYA 4B3IA 4DPKA 4CT0A 3OP4A 1IY9A 3H1EA 3GUVA 1IONA 3H9BA 3O93A 4KP7A 4ZVUA 3CX8A 4PYRA 4RJKA 5IYZF 4BFVA 1SCAA 1TTPB 3ZDYB 4UAVA 3AKCA 3L40A 3PDUA 4DLSA 4E22A 3BEDA 2R87A 2EQAA 4HATA 4G5YA 4K6KA 3U39A 4ZVVA 4DANA 3FVQA 4HXYA 3V97A 2C95A 2HLHA 2J3JA 2VJOA 3BDAA 2OZPA 4JBHA 5LUAA 4E1VA 4B79A 4GHWA 4IJVA 4ER7A 3EDCA 5AVJA 3FAZA 2NN3C 3IO5A 1YBVA 4HYTA 4K26A 1BX3A 4U8HA 4CG0A 4E6PA 2HSWA 1NXSA 1AF4A 2AJTA 2GZ3A 2J9XB 2OL4A 3G2PA 4HWGA 3BF7A 3V4LA 1PJCA 1UBUS 3HXLA 3WGUA 3VDXA 1VJGA 3GYBA 3DEFA 2XVZA 3AETB 4XLZA 1IUPA 3IUBA 1L4NA 3IEMA 5EWJB 5FRDA 2QLBA 4UUBA 1YOVB 4I8DA 1WIWA 2QQ0A 1Y9JA 5AW0A 3N9IA 3HU1A 2WTBA 4G81A 4X3CA 1ZAYA 4AJJA 1Q21A 4K0KB 1XQ6A 4DMMA 1CLUA 3GWGA 2QRPA 1I5EA 3VYTB 1KEKA 2O2SA 4MEBA 2OQVA 3C7AA 3PC6A 4NY1A 1RADA 1Z3IX 3IP6A 5CK5A 4C14A 2NU8A 2NYAA 4MUMA 5IPFA 1FZTA 1UC5B 4J43A 5BORA 4QUJA 1GLVA 1T6YA 3RS8A 3HUEA 1IEVA 4PR3A 4BATA 3ZDRA 2CXNA 2YKGA 1QFXA 4PWZA 3MYYA 4CL0A 3QPVA 4MO9A 4NZOA 4ZRMA 3F46A 2X3YA 1HFEL 2J08A 2DUJA 1Y1TA 1Y6JA 2ACKA 4HNQA 1EJ6A 1AB5A 2P1RA 4PANA 4B32A 4AS2A 1J2RA 1E63A 2IHYA 2ZKIA 3K3PA 2CL6X 3N5CA 3GP3A 3TG8A 4JJKA 2JLCA 1N9GB 4XPZA 3USES 3LYUA 2G80A 3MD0A 1N2ZA 2XAAA 3GRZA 3QVWA 3UWSA 2QBYB 1PNOA 1QKKA 3QVMA 1HDCA 4NLLA 1HOXA 3L01A 5AW9A 4MYUA 3ELWA 4IQGA 1U1IA 4ZYVA 4OLJA 3X2SA 2WHEA 4TYQA 2CL5A 2Y1CA 3HXOA 3FSGD 1LLQA 3WK4A 1HDYA 4HY3A 2BGMA 1CY0A 2IXAA 5TVKA 4TM8A 3W5CA 3RAEC 3HSSA 2NYUA 5D84A 1DAFA 2CWWA 2UYHA 2AFHB 2JGKA 1A9RA 2R4UA 4WZBE 5FLKA 3VR6H 1QOZA 1KEEA 1GYQA 4TTJA 3K0AA 3DOFA 4LQDA 1O4VA 3O38A 2NUPB 4UW9A 4B75A 3RROA 4YRZA 2VT6A 5HHTA 1QTQA 1Y9AA 1L4GA 1C7ZA 3AERB 4OHKA 4QPNA 5JTUA 2UXCB 3PDHA 1KJJA 3LH5A 3LLUA 3O4HA 1NI3A 1MORA 1O8BA 1AV6A 3BKXA 2DLCX 2X7HA 4JT8A 3ACCA 5ECDA 2G0NA 1E5XA 1P3Y1 3G17A 4LF7B 1DEHA 4NU5A 4E4RA 5FQOA 3M6FA 3AIOA 4JS0A 1S7GA 3OF2A 4JX8A 4MW1A 3OLWA 5EE1A 1DIRA 1XJWA 4R2IA 2B92A 1KIFA 1TQ4A 2FCAA 1VXRA 4QUIA 4B2IA 4C0AC 1Z0JA 2OCDA 3HKEB 2EX4A 4LOHA 5LJIA 1G8SA 3UM9A 1QQ7A 2BHTA 2F4NA 2BHLA 2YUTA 3B38A 1K9VF 1ACLA 1JEDA 2BI7A 4RPHA 3HZHA 1NW9B 5C5EA 2OLKA 2C5SA 2YS6A 1IDOA 1BHQ1 2HWKA 2W2LA 1W76A 1R0BA 1PAUA 3ADDA 5GGXA 2P6UA 4OIMA 1NUTA 1E1RA 1MB0A 1RXCA 1S2DA 2AVNA 4RPLA 5LKAA 1ZUHA 4TXJA 4GPZA 4ND3A 5AFSA 2DQ4A 5J4KA 1K3UB 2YTZA 3EHDA 3B7GA 3K0CA 3QVOA 1IM8A 4RD2A 4EY4A 1E98A 1MX5A 2D2VA 1H42A 2QRGA 4KLNA 4EATA 3L3BA 3VM6A 1NUAA 4IVNA 4E15A 1N34B 4WKPA 4KR7A 1QCDA 2YXBA 1KAGA 2OD2A 3F9IA 4IIEA 1H4SA 2V7WA 2X2FA 4QYXA 1O0SA 2PWAA 1XC7A 3D02A 2BR5A 3W4JA 5AW4A 5JNUA 2ZJ3A 5JAZA 4PZ9A 4B5LA 5T64A 1GGFA 1UJNA 3H4MA 3TB6A 1KO5A 1YJQA 2WJYA 4P31A 4ZCQA 4D4HA 4A92A 4WPGA 1JPVA 3DUFA 1PW7A 3BCRA 3KZCA 3U48A 2J5RA 2XZPA 5I4KA 3D5TA 4H77A 4MA4A 4ZT6A 1P75A 1GTMA 2X7JA 3D6VA 2O48X 1TMGE 1U1EA 4MNTA 3S44A 5C8XA 3U4MA 5DYNA 1UFRA 2OG1A 1U6KA 2NXEA 1EK1A 4PC1A 3QXGA 2CFRA 2PX6A 4Q4HA 5IKOA 1ORRA 4JB3A 4FLMA 3LT5A 3MWDB 3ZX4A 1XPJA 3DPIA 3WNCA 4Z1MD 2C9OA 5EYPA 3U81A 3SQWA 1ONOA 4MEAA 5G4KB 2RB5A 2OP0A 1E92A 2YH2A 5JZOA 1O5TA 4RSGA 1L7EA 2BZSA 2GVDC 5CB0A 4WINA 4JBYA 1V48A 1JEQB 5HJ2A 3SEQA 1CJKC 4Q4LA 4GC9A 4RDIA 2HJSA 1NBMA 2J0EA 4UBLA 5F1KA 5EZYA 3RVKA 1QIHA 2JIQA 2ZRGA 1TJPB 1YMUA 3CH4B 3H5RA 3MT0A 4YAJA 3UTDA 2CNLA 4S1WA 1JKFA 3PEVA 5TEWA 2P4QA 3N0XA 3TOZA 4N3AA 2NXJA 4IUBS 3VZBA 1RWBA 3H1TA 3QSYA 1WD5A 4HXGA 4L9RA 2Q3LA 4OI4A 1DO2A 3V7UA 3M4XA 4EO4A 3PQ2A 2PK3A 3JQDA 1L5MA 4CFZA 1TM3E 2V5AA 2B3DA 1T1JA 2F67A 2JAWA 3LKDA 4BAZA 4PAOA 1BCSA 5DLEA 2QN8A 1HKHA 4HYEA 4X6XA 3SG0A 3UV6A 4IJ5A 3L7IA 3T99A 4BIIA 4RK7A 4F4CA 1NWHA 5BO5A 3QLVC 4UNQA 2I2AA 3ILSA 4R2WA 4X41A 4AU1A 3UKOA 4DCUA 3R3WA 1GZUA 4X1KA 3OOHA 1XALA 1XJCA 2JK1A 3OZXA 3STTA 3BCHA 1DRKA 2V3VA 3PL1A 2HK9A 3K8OE 1SA0B 1U6IA 4P5DA 1II8A 1SURA 4LOKA 4K6FA 2NX2A 4XX1A 5JSYA 1K3TA 3VA7A 3CXUA 4ALKA 5E4FA 3FTEA 1MGPA 1M1XB 1U98A 1YTUA 1NHGA 4TWBA 4KL8S 1RJ9B 4O4IB 2PS3A 3VSEA 1TZBA 3WWCA 4W8HA 1A8QA 5AHOA 4A91A 4C4AA 5K4HA 5DTEA 3AVYA 1W2GA 3FUVA 2KM1A 1A50B 1F0PA 3IEKA 4MUHA 1VP3A 1AS2A 1Y48E 4XM1A 3T94A 1BDJA 3A3KA 4WXYB 2CD7A 5IDXA 3KELA 4MI3A 3SF8A 1RM0A 2UZ1A 4WLUA 2IOQA 4KWHA 4F71A 2MSEB 3U17A 3FRHA 1G5RA 4RKWA 1ZIOA 1E9DA 2QL6A 2VJAA 4A0RA 1MC4A 4UUOA 3EBPA 1XB2A 2ZT7A 4ICIA 3SC2A 3E5RA 4EY6A 4B35A 1UCFA 1ATZA 1RXVA 1QHNA 1FF9A 1ZBDA 4G9EA 2H2AA 1AKMA 1WHSB 1WMDA 3TGWA 3RIEA 2QE7D 4S1VA 5F77A 4BEWA 5HBGA 4TS4A 2H51A 1RI5A 2A0FA 3UO8B 3LQ4A 4KO4S 4BMDA 4ZJYA 2QAGC 2ZJ8A 4DOMA 3U1BA 1AKYA 4OA5A 3UMMA 2ZSKA 4PHGA 1K6EA 4YECA 3A14A 3UATA 1D5WA 4B85A 3Q8MA 3BZBA 1W49A 3ZUGA 1QF7A 1W4LA 5CYGA 4MWGA 2BMDA 4H1VA 3CKYA 5FL3A 3QKIA 4FR5A 4KSCA 5F9FA 1QE3A 5GONF 3MTIA 4RZIA 1RZUA 1C41A 3T54A 1M7GA 3CEHA 4G25A 5I4IA 1OSNA 2HB6A 4YQYA 4TUYB 1C9DB 3P9ZA 5B1EA 4EBFA 5B4TA 4WH0A 3ISTA 1VA5A 3B52X 4KKXB 3BMNA 5AJWA 3GEEA 1TUEA 4YUYA 4JQOA 2C3YA 4J29A 4JGIA 3I92A 3DO5A 3PQ3A 2C88A 3M4ZA 4Y7CA 4YJHA 4JI3B 1B1CA 1OH6A 3ES9A 2HHCA 5KOJA 2QWXA 2WUVA 2APJA 1BKSB 1E7MA 4MGEA 3VR4A 1ZVQA 2XWPA 4LXQA 1QG2A 1SUBA 2WJGA 4TWJA 2O54A 1VIVA 4MKXA 3A9CA 1LFAA 4Q1VA 2I4IA 1NF8A 4XQ9A 5CGZA 4CF6A 3DCJA 3GJ4A 1O95A 1Q0SA 3ILYA 1N75A 3EXAA 3VUEA 2VBCA 4ZVQA 3PSHA 1DXYA 2JD1A 1EUYA 1G8MA 2O7QA 3BPSA 3WBFA 2ADMA 4TKVB 2GPYA 4JLNA 4IDHA 4JDUA 3ZGZA 1DDGA 5KSPA 2RC6A 3VVBA 3T1HB 3G82C 3OAAA 2JF0A 4OF4A 5JD3A 1HZZC 2NAPA 4C29A 1ZD2P 1I24A 2XDWA 4AD8A 1BQEA 3MRXA 5JAUA 1BJRE 4D56A 3M89A 5FR2A 1U0OC 3R5TA 4EB6B 2OHJA 2RI0A 4UBOA 4WUTA 4EVRA 3TNJA 4HLCA 2AQIA 3ZG6A 4RVGA 4DIUA 3OX4A 4N0DA 3I2IA 4BWFB 3RHSA 3OAAD 1U0SY 4PYNA 3QF7A 5BR7A 4FDTA 1MQ8B 1NJ8A 1CD5A 1OWLA 2VYNA 3HYCA 1OXXK 4GSKA 3EVGA 1Z5WA 3SC3A 4QVKA 1JHDA 1NVWQ 1TU3A 4NYMR 1N5OX 2VF5X 2H52A 4TKLA 3BK2A 5AQEA 5AR1A 5JLAA 4O0LA 2JCXA 1TE2A 1ZKDA 2WTMA 3TTYA 5IJ0A 4XFKA 2BTOA 1NVMB 1QORA 2PNFA 3BXHA 2G4CA 4NARA 3RSHA 5E6UA 5LM3A 4HVAA 1GQSA 4HEA1 3OFNA 1FL9A 3TYXA 4BJHB 3DE4X 2R4QA 5BQFA 2AZXA 3PFIA 4YCAA 1P4RA 2BKVA 2GF2A 2W6JD 4HN4B 3W7BA 3EGXB 1N5KA 2L42A 1NW5A 1ORTA 3KNZA 3NBUA 4FHCA 2GKOA 4WVLA 1QYIA 2F3SA 4AJHA 1TKBA 2WE8A 2G67A 2WK1A 1DEXA 3I1YA 3IOEA 3C8DA 4AIIA 3V8RA 3O9ZA 4HUQB 4XUDA 2R00C 5EERA 4MROA 1JA1A 2QDKA 3MCZA 2C3PA 3JARB 1IHXA 1FB5A 4R41A 4WXEA 4WV3A 1ZNYA 1BH2A 2VHEA 1LK7A 4MYRA 3M4NA 2BCGY 4WNIA 2Q9CA 2CMFA 1F4PA 1Q19A 2X3FA 3NBYC 1UH5A 2Q0HA 4INZA 2YRFA 4JP2A 4WZAA 3WRWA 2PZLA 2FZEA 4FYYA 1Z2CA 5HFNA 3SS9X 5LOVB 4NXNB 3MS4A 2AR7A 3HN7A 5FLXA 3RS3A 4F4HA 1Y1RA 4Y6LA 1BQ4A 2PAFA 1EDEA 1NPYA 2Y1XA 4P93A 1U7OA 4Q6WA 3AI3A 4HR7A 2VG8A 4ISBA 5H3HA 1OTYA 4LSMA 5MN4A 3BSSA 1LUAA 4F2WA 2A9FA 4AZWA 5G4LA 2HQBA 4JROA 5E1BA 2JHCA 4KUHA 4P3KA 4Q3LA 2V5VA 2PH5A 4DHWA 1NG9A 5DCUA 3L0CA 1NZJA 3VNSA 3AL0C 3GW8A 2VP6A 3P94A 3CEPB 1U5BB 2IP4A 1A2BA 1VLLA 2GYUA 3QLEA 4HGYA 1E77A 3QEMA 3UAXA 5DTQA 2O8EB 1L7BA 2BEWA 2Q5FA 3E8SA 1EZ4A 1DMRA 3EIWA 4NYMQ 4NMXB 3PQDA 5LMCA 4HDSA 4UE3S 3U5ZB 4MVJG 1TZCA 4QA9A 3GNQA 4ZGBA 5E1MA 4GOJA 3NHLA 2O8DA 4JITA 4K87A 5EAIA 2FY8A 1DQRA 1ZUNA 2HF8A 1JYSA 2Z58A 2HPHA 3CSUA 3TCKA 4YR9A 3V4RA 1QP7A 3OIVA 2O20A 2EC5A 3UJ9A 1QV7A 4F96A 121PA 1MC8A 3U7QA 4FFSA 5JD5A 4LBZA 4OMFG 5LLDA 1IC6A 1RWPA 3A9WA 1FFDA 2F3PA 4BJ3A 5AW5A 3HM9A 1XYVA 5AKHA 1M2OA 2BSQA 3KD2A 521PA 4EOGA 4G1MB 1OLXB 4KV7A 3O8RA 1EGVB 2IELA 2ZQYA 2WQ7A 1N32B 4TWIA 2IGBA 3ROMA 1YRLA 2RBKA 4YDSA 5HK8A 4CNBA 3E82A 3RUPA 1M0EA 1PU2A 1YBAA 3DZKA 3IS3A 3D2AA 4RTRA 2K2WA 3RRNA 3ZQ6A 1HPLA 1E9SA 4E1BA 1FUEA 2LDBA 3ZCRA 4RKEA 3I2YX 1H1LB 4DB4A 1YS9A 2JGMA 2QZ9A 2WMNB 2XH8A 3AKDA 3N2EA 1M9NA 3RIMA 1OAOC 2BTQB 1XROA 2XWJI 1DEKA 3RTEA 1U1GA 4KRGA 2ZPTX 2Q5HA 5BVHA 5IVKA 4A10A 5I7UA 2B8TA 3F98A 4G0WA 3K0EA 4UARA 3VX4A 3T3PB 2K6GA 2ZRLA 4M36A 4Z54A 2WFLB 3NP9A 1G1MA 2SKDA 5BMVA 4I19A 2BRUC 2HLPA 4AAYA 2DKFA 1G6Q1 2QYHA 1V1RB 2RCNA 3NBQA 3OX2A 3QMVA 3CPSA 4J76A 4JASB 5TXGA 3WX0A 3BTSA 4B09A 4CLOB 5EQJB 4EHHA 4F3CA 3JQBA 6REQB 5CDYA 1OZFA 3NC1C 2OCAA 1CF4A 1E5VA 2BW0A 2WHYA 4PICA 2WTUA 4PYMA 4US1R 3IDZA 4U9IS 3U37A 2OE2A 1T9HA 1BX0A 2JK0A 1TEXA 4NYJQ 5ETJA 2A5DA 3KUCA 3WK5A 1RLUA 2O2YA 2JFYA 2VZ0A 3I5UA 3PDWA 1TM5E 4U3JA 4E5PA 2AMYA 3TTSA 2POCA 3VSBA 4AM8A 1J09A 4DWJA 2O50A 3EWIA 4Q7QA 2R11A 1UQTA 4IILA 2C2OA 3MUNA 4GM0A 4R68A 3RFUA 3HY3A 4MS3B 1I0LA 4PGFA 3GNLA 4Z6KA 4J0IA 1IQUA 1T6XA 3AV0B 5CG1A 1P2GA 2XVMA 2EX1A 3EWSA 3U7EB 1PTJA 1X14A 3LP5A 4MCIA 4TZ6A 4I55B 5EE0A 4NXMB 2BBOA 1K68A 4X61A 3C16C 3QWAA 1S5PA 1JVSA 4K6MA 4DKXA 3VV2A 3GZNA 2I66A 3F74A 3MSXA 4TMKA 1LTKA 1J8DA 1E99A 1FP4B 1Z2OX 2PJUA 5C7LO 3EPHA 3TFQA 2IEAA 1U8EA 1YO6A 4YFVA 5CX1B 5DHSA 4F3YA 1BHSA 9LDTA 2C2KA 2DPYA 1QQ6A 2YHUA 1HA3A 2X1LA 3LLCA 1CT9A 5KBYA 3GZJA 2VP4A 4MWBA 2D1FA 2FZKA 4PNEA 1U4OA 2P77A 1F3LA 4JVSB 1WEKA 5D7NA 4AXXA 4UMEA 3C74A 5TPWA 5LYJF 4F9FA 1UKZA 2IX9A 2JC3A 4BQQA 4HEQA 1I0ZA 2ZI5A 4XYMA 4B8YA 1M2WA 3ZIUA 4B6RA 5BV2P 3BL5A 3VVLA 4XQCA 1TF2A 3HI4A 4OCZA 2XUGA 4WCFB 1DWUA 2PEZA 3SJZA 2AWNA 3HZRA 3FHTA 1DG1G 5DHRA 3EHEA 4M55A 3WGZA 3MS7A 4QXRA 2IYZA 3V32A 2A1UA 1FOEB 5TGDA 2V4MA 1YB7A 2Q6LA 2QZZA 1V71A 5KJEA 2EW1A 4GL4A 3ZIAA 1XOIA 2QAIA 3W6NA 2CMGA 2LV8A 3DG9A 4B4KA 4BQOA 3IT2A 1RKXA 2PX5A 4JBWA 5IWCA 2YJZA 1W73A 4P4NA 1TQ2A 1N6NA 4PHCA 4DJDC 4RY0A 1JH9A 4KBFA 4GMGA 3DBRA 4YX9A 2I2WA 1Q7CA 2V96A 2G4LA 1PR9A 5ILQA 4I4NA 3S8EA 4RELA 3AF4A 1UAAA 3CR7A 2X5KO 1AN0A 1D0SA 1U0NA 2WSLA 4TTVA 2GN2A 2BUBA 4QASA 2GA9A 1T91A 4EPTA 3PXXA 1YA4A 1VMIA 2FMFA 4IF6A 2HQOA 4F7WA 1Y0BA 1U2RA 4FYMA 1K06A 2J45A 5D1NA 1JI3A 1Q7TA 2FZLA 3H11B 3N1UA 3O3NB 4FFMA 2F8MA 4ME6A 3OEWA 4Z9YA 4C01A 1BWPA 4YJGB 1VE7A 1A72A 1RXUA 1U0FA 3CCFA 4HLQB 1S01A 4JXZA 3HEMA 1TM2A 1N2IA 4MQEB 3S27A 3EPPA 4TL6A 2WNIA 2OT3B 1NASA 4XIGS 3RSCA 3GT0A 1GZ6A 3MF4A 2RGCA 4FBMA 4FQ5A 4IIXA 4J75A 4JVOA 4OGGA 4A9AA 2DHRA 4HT3B 4URVR 3TECE 4Q1AA 2O05A 3CH6A 3OFKA 4ZYTA 5K3EA 2D5CA 5SV2A 1GKIA 4RTJA 1AU9A 2MYTA 1W0CA 4YRFA 4ZT4A 5HJ7A 2XVAA 3GLHA 4A6EA 5IAAA 3GVPA 1JHUA 1S8FA 3ZBTA 2WMOB 1T1SA 1XZCA 2D2FA 2B8EA 2OCYC 3AFMA 3HGMA 3MFYA 4MP6A 1XNHA 3FSGA 1DLIA 1FY2A 3WSTA 2CN1A 4D9FA 5CAEB 5LXTB 2IYQA 3HB1A 1PWZA 5DK6A 4KQEA 4M6WB 4O59O 4ZI5A 621PA 4D1YA 4CKEB 2G28A 3CSDA 3N0TA 3BMOA 5EGSA 5FKJA 2XXAB 2ZRBA 5J9FA 5L51A 4RGQA 3FH0A 4FP9A 4YAKA 3U19A 1D6MA 1W85B 4I6JA 2P6OA 4HN9A 1KMIY 3CV3A 1YZKA 2DFLA 3DZIA 3BAFA 3MWFA 2P11A 4DFDA 1ID8A 5E0KB 3CO0S 1BMQA 2X0FA 1BGWA 3A6ZA 1R4ZA 4RKQA 3KC2A 4ZYXA 1NHWA 2W2TA 2YW9A 1T2VA 3B1KA 1GYPA 3OA2A 1MB4A 4URUR 4BAGA 4JMLA 1EIZA 1AKVA 1UBLS 3AI1A 3EDRA 1G6KA 1JHPA 1XCOA 2FR1A 2WJZB 4U5XA 3RSQA 4BMXA 1XZFA 3AZPA 4BCBA 3EIEA 3HCWA 1TAGA 2Q27A 3O8QA 4YT2A 2J30A 1E1DA 1VMAA 2CK3A 2JFZA 3BS4A 3DDSA 1EFTA 5FBLB 4CIDA 4ZU3A 2XJ4A 4GOND 1SCQA 4ER0A 1WU8A 4PS0A 3D6NB 3LMKA 1DRVA 2VP2A 4WRRA 4HRAA 4MWZA 2W2LD 1URPA 2JGDB 4BMYA 3JVIA 3P4XA 4E09A 1P4SA 4OJYA 3S55A 2C77A 1WDTA 1CZNA 4PQYA 2G88A 4UE6A 5I8WA 4RXTA 1T6ZA 3ZZTA 3QG5A 1AGNA 4HEHA 4NCNA 4N47A 4DQLA 4PC6A 3OTGA 5BNWA 3ZEAA 4NQRA 2Q29A 4RZ2A 3FWPA 3C3DA 4INJA 2P4UA 3C4VA 4I66A 4U6NA 4BHTA 1RZVA 4XJXA 4BC1A 5LXTA 1YK1A 4I5IA 3VNUA 5IDYA 1V95A 2OILA 3ANXA 1VJ0A 2FWPA 4A0SA 4Y6OA 4DUPA 4NFHA 4PG4A 3AHFA 3P1JA 4EYSA 4ZFNA 3M6VA 5JYCA 2F4VB 3GYGA 1X7WB 3EFBA 1WAMA 1MOQA 4YWJA 1MJGA 2YMLA 1VZ3A 3ISJA 2Q4TA 4PYOA 4RY2A 3VDMA 4BEVA 4H3VA 1IZZA 1L5ZA 4G1BA 3JSXA 4OXYA 4C6HA 1Q0TA 1SD2A 3FUXA 2OV8A 3A4NA 2SCUB 4HDQB 4D9CA 1G5TA 1HKUA 5KREA 3ZEIA 1EDBA 4CLOA 3DO8A 3KEQA 3VJRA 1XD8A 4GXQA 3PGVA 3FPFA 1JQ5A 4IMPA 3UT6A 4Z1MA 4BMCA 3TLYA 4Z4GA 4MOWA 4EQZA 2ZKLA 2EJTA 1P5JA 2OB1A 3R6DA 2QJTA 3CEMA 1NVVQ 4MR9B 1XN1A 1C9JA 5BSKA 5FJJA 1MTOA 5UKDA 3FVRA 4RZUA 2C9BA 3TZ6A 3M83A 4II2A 3P9IA 3L41A 1GPMA 3NB0A 1M2NA 1TCVA 2AW3A 2O3TA 3MW8A 4RF2A 2X77A 1STOA 3FTQA 1M34E 3FXAA 5LZ9A 3PNLA 2I80A 5L7YA 2JKVA 1GG2A 4UEKA 1E5DA 3HCBA 1IJEA 2R9VA 3OKPA 3SQDA 4HNRA 2RG1A 4DRYA 2WJ3A 4KRFA 3DB1A 1R0YA 4S1OA 1SELA 4XJTA 4BVJA 1K7YA 4AJ2A 5A2QA 1N6OA 1SHZA 1G55A 2A84A 2GSWA 3PICA 3FCAA 5LN1A 1RQNA 1BGVA 1NMYA 4ETNA 2CZQA 2BFMA 1W5EA 1XNGA 3IDQA 2P9TA 5ALKA 1A5TA 2QXTA 3BL6A 3W5AA 1Y7LA 5JS8A 1FTSA 5H81A 3AGQA 2FHPA 2Z5VA 4HDRA 5EMMA 2QRUA 4D92A 5JANA 3FZQA 3H5WA 5B1HA 1NYTA 1OQAA 4KW7A 1OLXA 1BOFA 1PWYE 3COPA 4I8IA 2ZS8A 4HV4A 4XGNA 3KAPA 4RJLA 1Z4KA 1DU4A 4L78A 2AVDA 1R3DA 2QYSA 3EXG2 2PWZA 4MTLA 1EZ1A 4M0EA 4IJ6A 2FQYA 2E5LB 5B6PA 3UJCA 1ZZGA 2MDTA 4PRKA 5EEGA 2UZ1B 1R0KA 1ZD9A 4QL3A 3VKHA 2X2PA 2XRFA 2QHXA 4O2AA 1KU0A 3FNGA 3AILA 1UANA 3IBFA 1VHWA 1CR1A 2GFHA 1U04A 3I04A 3QP9A 1JLLB 3R9IA 1TA9A 3S68A 2XWSA 1FMLA 2GBGA 2I6UA 5DCWA 5MHTA 1VRCA 4GEKA 3RBAA 4GX1A 3V7FA 2XGGA 3I5AA 2GEJA 3T12A 2XSZA 4C4YA 2K5UA 2N1MA 1TQHA 1Y4AE 2G72A 3DD1A 3IDFA 3MAJA 4FILA 2OD9A 1G2OA 1G20B 4ZCPA 2FU5C 3V7NA 3OJFA 4QECA 1FJ2A 3ZDFA 4BL5A 1EFAA 1YQXA 3E81A 1UAYA 2I62A 3CCBA 5I5GA 1LTHR 5LOVA 2DAPA 3LZDA 5LZ4A 3ERCA 1XA0A 3T3HA 2JASA 1PW5A 2OLJA 4FFDA 5FHRA 2EDAA 3EIHA 2WIBA 5CDFA 3Q3GE 1KY4A 4Q18A 4GFDA 2QTHA 4RNDB 3V8EA 4BFLA 4M86A 4Z7NB 1JG2A 5EOVA 3GRCA 4KQJA 3VJMA 4WKOA 3NS7A 3A9TA 2G77B 1RWOA 2Q41A 3HDJA 4LYJA 3N2IA 4C05A 4C08A 2I2BA 3SYTA 4EY8A 3KB8A 1S2GA 3ZWPA 1SKAA 3V1UA 3RKRA 1SZDA 5DX0A 1XMIA 3WWEA 1DBWA 1FFHA 2G83A 2XBUA 4RD0A 1K98A 1JL3A 3P9XA 4LOJA 2G1KA 1FYXA 2YZ7A 5FYDA 4DV0B 1UKCA 1K3FA 3IKJA 4R6WA 4DLTA 4PINA 4CI9A 4CQMB 1CETA 4UHKA 4FKBA 1XCBA 1WHTA 2BFBB 2FZGA 1NNI1 2XIQA 2PRKA 4DV4B 2HQRA 2QZ4A 3WB9A 4G63A 1XCMA 3AHGA 4CNQA 2CVFA 5G3YA 1XBTA 2CJPA 2CCJA 4IIBA 4JUDX 2C4NA 4BWVA 2D1TA 3UB4A 1LFDB 3KETA 3I64A 3KQVA 1FDRA 1QBKC 4JVNA 4MGZR 3SP1A 3SS7X 2WHXA 1X80A 4V1CI 1EBBA 3GRRA 3DFZA 3I2GA 3IUNA 1E2PA 3PR3A 4QOSA 2MJLA 3QU4A 3IKVA 2Y68A 3MTDA 3G2MA 4ZI2A 1X15A 3OZDA 1FMTA 4NP6A 4Q37A 5EXEA 4JLWA 5DTMA 3IV6A 4ARZA 4P7JA 1YZYA 1ZICA 3NDRA 1JXOA 5BSFA 2Z4RA 2F6RA 2IGTA 2ETVA 3Q7RA 1M8GA 2ERXA 2H4XA 4JLOA 1YS4A 3E9MA 4LTDA 3FNFA 2GYYA 3HA7A 4WCDA 4LHWA 1CR0A 1ODKA 2H5IA 1Q1BA 3AINA 4CETA 2XRZA 1J6UA 3PXAA 2AW5A 1B74A 4IHJB 4O4HA 4IDPA 4LXUA 4TLBA 5IXJA 3O8DA 4IIHA 2HSJA 2GZMA 2DERA 3EDMA 1OLSB 3IMCA 4M1TA 3KYIB 4B4OA 3K4PA 3FDJA 2GI4A 4MUGA 2FW1A 1NIPA 4ZU6X 1UC9A 4I4IA 4ZC8A 4W8OA 5ED0A 5EJ9A 2CHFA 2QVGA 5KWJA 2BE9A 2QMZA 4QNRA 1NT2A 3N2ZB 3EK2A 3KZMA 3UQZA 1XTKA 2RIPA 3B2EA 4L95C 2RJ3A 3FLAA 3LS2A 4R69A 3AUXA 3LI2A 4MVJI 1KEZA 3AHCA 4POOA 1ZD5A 2JEZA 1VJTA 2OHGA 1R6XA 3K0FB 3TQFA 1VSBA 5I6DA 3IE1A 4M1KA 3CRRA 5BSGA 3GLFE 5KYYB 5M29A 4EKEA 4X7PA 4GSYA 1R16A 1CCWA 3DOJA 2ONCA 2WT9A 1Q95A 3ZS8A 3PVCA 2PY6A 2G3YA 4OQDA 2J4DA 4CFSA 4D8WA 1J25A 4X54A 2MMGA 1V2HE 2HMSA 1RJWA 2J09A 5K20A 4HDOB 1R6BX 1L5WA 2IYWA 2VTVA 3GVCA 4XCXA 1Y5MA 2VYVD 1GR0A 3ZHOA 1A77A 5E4TA 4IHQA 1ONBA 1FDSA 2ZYTX 3HLYA 3HV2A 4FB4A 5I7SA 1PV4A 1IBLB 4Z9AA 1CS0A 1RZRD 5AW1A 2C29D 3RU7A 1X3LA 3H16A 5I5EA 1QF6A 2QP9X 3WIVA 3FNIA 4DR5B 1RWQA 4QO7A 3DVQX 4R3WA 1ZH0A 4S3MA 1T0UA 1E3SA 2ZG6A 1OREA 3BCUA 3DR5A 3PNKA 1EGAA 1Z75A 1M8JA 1JKJB 2AEEA 3DTNA 4YUWA 1E9VA 4R0MA 1MO4A 1I7PA 3A6HA 3T5GA 1VL8A 4ZT7A 2O8FA 1HXHA 4BUJA 3HJTA 2XKKA 3JQQA 4X1YA 2P27A 4TXHA 3KZKA 2IYOA 3VKUA 5K0CA 1V5IA 3LUHA 3OZRA 1Z0DA 3GUUA 5AJZA 3ZWVA 1XEFA 3SIRA 3JQAD 4RMJA 3BB1A 5LVAA 4LYFA 4JJEA 1FUIA 2DTDA 2QUKA 5AKJA 4BQNA 1I51A 3NP7A 1L7OA 3P7MA 5A5GA 5BWBA 5JZMA 5I48A 2YICA 2JVKA 3KR0A 3UK6A 1WPXA 3GRYA 3TLXA 2Z5GA 4E30A 1D0VA 3DV0A 1RVDA 1QLWA 2PUWA 3ETEA 3IULA 1YA6A 2HK6A 1PZMA 4LXGA 4UU8A 1FX0B 1DZIA 4E7OA 2VQSA 5D3ZA 1YR3A 4OP1A 4PN7A 1NJFA 3RC7A 3L1KA 2B5OA 1P0CA 1RRKA 3UG7A 2VKQA 2IZ6A 1RPNA 3S8YA 2EJCA 3F6YA 3RD5A 1NQUA 1BZYA 3DSRA 1N0HA 1QYDA 3SM3A 1Z4OA 2ZCJA 2VJBA 1FFXB 1VDMA 2LPMA 3CR8A 9ABPA 2N42A 2HLDA 1BNCA 2BDTA 3QVXA 4M8KA 3UCFA 1CUGA 3OU2A 4P0TA 2OXFA 3H0EA 1M6NA 5B1YA 4NKRA 3GJRA 5FTJA 3G5LA 5JCXA 1D04A 1NVEA 3OZUA 2R7MA 1CNMA 2QRKA 4DMHA 3WGLA 1VKNA 2XHEA 2IBSA 3I3OA 3TRFA 3P20A 1DHTA 3IEVA 1B00A 1ORDA 1R9MA 2KJQA 3KYCB 1OYYA 3AWDA 1DVRA 3MHPA 3QX9A 3EFHA 2AI1A 3IOMA 2VFAA 1L5RA 1H6BA 4DTCA 4RD1A 4FIZA 4TYNA 2RHHA 2E18A 4HNAB 5CD1A 2XT0A 4H3HB 1ZK1A 3BQNB 2KMLA 2QZSA 3V3KA 1T4DA 3X1DA 5IHXA 1ESEA 1JKJA 3OESA 4MYTA 4ARZB 3THOA 4OU5A 3DFIA 3T3IA 5TSDA 1AMUA 2G07A 1C29B 1KJIA 1PIWA 1ADYA 5HOQA 4WFQA 5AH0A 3VSDA 4R2KA