5IEJA

Solution structure of the bef3-activated conformation of sdrg from pseudomonas melonis fr1
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
MSALTQILIVEDEPLIAMMLEDFLEVLDKTPVGTVDTVAGALARVEDGGIDAAILDVNLRGGEKSTPVAEALAARDIPFVFATGGSDDSVDSRFRDRPVLQKPFTMDGVAKALAALLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SdrG
publication title Role of the PFXFATG[G/Y] Motif in the Activation of SdrG, a Response Regulator Involved in the Alphaproteobacterial General Stress Response.
pubmed doi rcsb
source organism Sphingomonas melonis fr1
molecule tags Protein
total genus 30
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2016-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5iejA00
1P6UA 5JNRA 1JYEA 4NV3A 3Q9SA 4H3KB 3QX8A 3D02A 1YMVA 1DP4A 5DLEA 4W5OA 4IILA 1MAVA 3HEBA 4RK7A 4JB0A 4B09A 2GX6A 1SXHA 3G85A 4ZMRA 1JWLA 2JB9A 1Y1LA 2NT4A 1XHFA 3CZCA 4RK1A 4ZPJA 3RVKA 4HNSA 4HNQA 1FSPA 2RGYA 3LFTA 1EWKA 1JBEA 3VNBA 3Q15C 4Z4IA 2LUOA 2R48A 3CU5A 4OTZA 2PJUA 1PNRA 4MQEA 1E2BA 3DGEC 5EWMB 2CHFA 3QEMB 4UHJA 3HV2A 3LUAA 3EAFA 1T34A 4IF4A 1OXBB 5KQGA 4CBVA 3L49A 1YTUA 2PMCA 4UHKA 4Y9TA 2RDMA 3JS5A 4RK4A 2P9HA 1JYFA 1I3CA 2FMKA 4LDAA 1QQAA 5EWJB 3EGCA 4JB2A 1A2OA 4XXHA 3TX6A 1E6LA 1ZH4A 2I6FA 3K9CA 3RVJA 6ABPA 4OBBA 3BBLA 3GYBA 3QELA 1L5ZA 2AYZA 2WWVD 2IPNA 2QVCA 4PE5B 4TN5A 3N0RA 5IX8A 3QLVA 3CG0A 1CEYA 4G86A 4MS3B 1LJUA 3OO1A 4ZMSA 4XAQA 2FEPA 2PL9A 3JTEA 3H6HA 5EWLB 1J56A 1Z15A 4TMYA 3N8IA 4Z0NA 1JL3A 4KREA 5TQ2A 2FLWA 4Z4HA 1D4ZA 3IPAA 3CTPA 4RKQA 1ZESA 1ZVVA 5TQ0A 2R25B 3LUDA 4RV5A 3M9WA 4W5TA 4GPAA 2HQBA 3IP5A 1MVOA 4RK5A 2E4YA 4XLTA 3QEMA 2BGGA 3KG2A 1SXIA 4RU1A 1C0EA 3H1FA 3TD9A 3GV0A 3H75A 1P6QA 1K66A 4OG2A 3HCWA 1NXOA 2WJAA 1ZDMA 2LIVA 3F7NA 1NXVA 1F51E 1TJYA 4RY9A 4EY3A 5IBQA 2JCGA 3KJXA 3C3KA 4G97A 5GQSA 3KS9A 4LE1A 2FMFA 4W5QA 1TLFA 3OQMA 1QP0A 3I5AA 4PZ0A 1RNLA 2FQYA 4RK6A 2CHEA 3CS3A 4MS3A 4N41A 4EGSA 1KRWA 3KTOA 2FSPA 3RVMA 1BAPA 1QKKA 3TO5A 4KVFA 5IUNC 1M2FA 5EWLA 3JPWA 1DRKA 3Q7TA 2HQRA 1NXWA 4O1HA 1Z25A 3FMVA 4G0PA 4LDZA 4MQFA 1ZN2A 1Z18A 8ABPA 3CKMA 3RQIA 3JY6A 1Z12A 4W5NA 4YGXB 5IUKC 3GRCA 4O5AA 3O1IC 5TPWB 1URPA 3HXMA 1YIOA 4RY0A 5IEBA 1JF8A 4LRQA 4MQEB 2P4UA 1NXTA 4G0OA 5JS2A 4Z4CA 3RVRA 1PHRA 2HJ9A 5KQMA 1U8TA 5DGCA 2R47A 3EJWA 2M1ZA 2ZWMA 1DG9A 5DCLA 2E4XA 2JBAB 1OXKB 4YS6A 2QXYA 3O1JC 2IKSA 2F8TA 3GL9A 3E3MA 2IPMA 1Z13A 4RY8A 2DRIA 3ROTA 3MMNA 3L6UA 1EFAA 3GBPA 1BVHA 2B4AA 4HNRA 3MF4A 2CD7A 4D6XA 2YHBA 4RK0A 1D5WA 1M2EA 4WT7A 2JRLA 3C6QA 4MLDA 4FE7A 1ABFA 1K68A 3O1HB 3FFXA 3RVOA 1RZRA 1L5YA 2PKXA 3K4HA 4PEVA 5PNTA 2L18A 5TQ2B 1VPWA 5BRJA 3A10A 4MPTA 3OLWA 5DTEA 3SQNA 3MA0A 4RXTA 3H5VA 4N0QA 5TPWA 3HZHA 5TQ0B 4OLAA 1DCKA 2A9RA 2AYXA 2HPHA 3GBVA 1TMYA 1ZGZA 3QLVC 3N75A 3EQZA 4G0ZA 3MYYA 2WMYA 4FB4A 4YV7A 3LUKA 4IMJB 3HDGA 1H9CA 1LK0A 1NATA 4RXUA 2WY2D 4EUKA 2F8SA 4F8JA 1DZ3A 5KI6A 2ID9A 1TM2A 1NXSA 4YP9A 5HKOA 1RPJA 1ZH2A 2JBAA 1WETA 4WZZA 2L2QA 5BQ3A 2NT3A 2VUHB 2XDYA 3HVRA 1MIHA 3CG4A 3HUUA 4N0PA 1MB3A 4ML3A 2VK2A 3RVNA 4MS1B 1QQBA 4NCAA 2E4UA 2FKAA 1USGA 5CHYA 4XASA 4NCBA 4DADA 1E6MA 1DJMA 1EHCA 1XWWA 5FWYB 3JVIA 5E3JA 2VYCA 4KK4A 4F3TA 3IDOA 3OMXA 2MYPA 1AB5A 1AB6A 1RXIA 3NHZA 1EWTA 1LBHA 5BRAA 1FFSA 1VLZA 2CWDA 1QP7A 4MR8B 2ID7A 2FTKE 1CHNA 2IPLA 3EQ2A 5T3YA 2ZAYA 2JK1A 3KYIB 3NNSA 3QLUA 3SG0A 4MQFB 4MR9B 1D1QA 1DBQA 2B1JA 4HYEA 5TQJA 3BRSA 1SRRA 3F6PA 3DZDA 3FFWA 4E7PA 2LP4Y 4RSMA 3DLHA 1MB0A 3OM1A 3ILHA 2PUEA 4YR7A 4YLEA 4PYRA 2MSLA 1W9HA 2L19A 4YWHA 4L85A 5ED4A 5I4CA 2KYRA 3QK7A 2W42A 3H1EA 3MM4A 3NNNA 1APBA 3JVDA 3T6KA 1CYEA 1F4VA 2QV0A 3Q7RA 1ZITA 7ABPA 5IULC 3O2JA 2JVJA 1ZY2A 4KQ9A 4MS1A 4RDCA 3GWGA 3ROFA 5T7BA 2N9UA 4IRXA 3N0XA 4P98A 3LKVA 5FWYA 3LUGA 4Q6WA 4M88A 3IP9A 2PUGA 2FMIA 2YHAA 5F64A 2PUBA 2GWRA 3DBIA 2Q5CA 2V0NA 3SM9A 2MSKA 4MR8A 3HM9A 2FEKA 1USKA 4MYRA 3CFYA 2FN9A 3FFTA 2QVGA 1PUXA 4O1IA 4S04A 2FN8A 4MR9A 1DCFA 4Q7EA 2WB4A 3RVSA 1QP4A 1DCMA 4KNYA 3URMA 1NXPA 3R0JA 4Z99A 3H5IA 1GUBA 2GKGA 1R8JA 4EVSA 3T38A 1JDNA 4LE0A 4OLBA 3BRQA 5KC9A 4Z9BA 4QICA 3LUHA 3H5TA 2J48A 3G1WA 1YK1A 5IC5A 2PUFA 3FDFA 4QYWA 2FEWB 3KSMA 3H1GA 3GT7A 4N47A 4ETNA 3A3KA 3A0RB 4WXEA 3IPCA 4MR7A 3OLZA 4MGEA 3F73A 3BREA 3CLKA 3CNBA 3MQ4A 4Z4FA 5HSGA 1PEYA 5TPZD 4TLMB 2PUCA 1NY5A 4E7OA 3GA5A 1VKRA 1JFVA 3KCNA 4EYGA 1ISRA 2OQRA 3DGFC 3N6VA 2NUBA 1BDHA 3E61A 1A04A 1ZAYA 4JASB 1A0OA 4TLLB 1QO0D 1ZHHA 5JNTA 1SD5A 2IYNA 2A9QA 1JFTA 3W9SA 4W5RA 2NZUG 3RH0A 4G0QA 3C3WA 1DBWA 4JA2A 4LX8A 4WXMA 5FWXA 4EYQA 4KFCA 4EVRA 3KLNA 3OM0A 4D6YA 2JVIA 4YRZA 2MSWA 3C3MA 5BR1A 4KRFA 4WUTA 3RVLA 5B3JA 4IMIB 2WRZA 1VRVA 1TVMA 1Z16A 1JDPA 3TMYA 9ABPA 3VNAA 3OLXA 4DN6A 2IDMA 5KQPA 1BDIA 5JS1A 2GBPA 2PL1A 3KLOA 3LUCA 3OMWA 1EAYA 3LTEA 2O20A 2H3HA 3OQNA 1Z26A 4D74A 1C4WA 3CHYA 3I09A 5DKFA 3RVPA 2GI4A 4F11A 2PUAA 4QYMA 1JHZA 4FE4A 1Z2DA 4RS3A 3NNDA 4YO7A 1P8AA 3QLUC 1ABEA 3HK2A 2FLKA 4ZYLA 3P9YA 3MIZA 1LBIA 4KV7A 4EVQA 4F06A 3BILA 3ILYA 2PE5A 4ETMA 4MS4A 3O2SB 1LJLA 2L17A 1D1PA 1U2PA 3LUFA 1DC8A 3N53A 4OATA 1S8NA 1BA2A 4JOQA 3NBMA 3HDVA 4YCSA 5GOTA 1EWVA 3EDCA 5IEJA 1GUDA 3CRNA 1Z17A 2E4WA 5JNSA 3QX9A 3H5WA 1NTRA 1DC7A 1U04A 5KQLA 1KRXA 1QPZA 3EULA 2MYNA 3OLVA 3OO0A 4KMRA 1JFSA 1XHEA 1USIA 3QEKA 1YVUA 4ETIA 4PICA 5KC8A 5C5EA 4RXMA 3DLBA 4JP1A 3M6MD 3O75A 3O21A 4LZLA 1RZRD 4Z4EA 3HSYA 4N03A 1YS7A 1GCAA 5HQJA 2WJWA 2PAFA 4XARA 6CHYA 1FQWA 3I42A 4GNRA 4H60A 3O74A 5TE9A 4RKRA 3OQOA 2QSJA 1RXEA 2A9OA 5ABPA 4Q6BA 1NXXA 2FMHA 4RZSA 4F12A 4KPYA 3JPYA 2QZJA 2NZVG 1ISSA 3QLTA 2MYUA 1DBPA 4MR7B 3UKJA 3LMKA 1QMPA 4EYKA 5CNKA 2A9PA 3H5OA 1HEYA 3C97A 1U0SY 4G0MA 1SXGA 2FW0A 4RWEA 3SY8A 1GCGA 4LE2A 3T8YA 5D2CA 4IGAA 5EWMA 3B2NA 5FBKA 5TPZA 1IIBA 4WWHA 5JNVA 2FQWA 1W25A 4MRMB 5KWSA 3I45A 3HJFA 1Z2EA 1JX6A 2RJOA 3HO1A 2IPAB 1FFGA 1FFWA 3KHTA 1E6KA 5EWJA 4KQCA 5JNWA 2H0AA 1M5TA 2LBPA 1QO0A 4ZJPA 5FWXB 1PEAA 4S05A 2PLNA 1BDJA 3H6GA 1YMUA 2QU7A 4H3HB 1M5UA 4G0YA 1DRJA 2M98A 2MYTA 3LKBA 3O2QB 4Z4GA 1P2FA 3UUGA 4QPJC 3SNKA 1B00A 1ZGGA 1YK0A 3LUJA 3NHMA 3M9XA 3FGZA 2VUIB 3IP6A 3T95A 5HM6A 4Z9AA 3UK0A 5JNUA 3EODA 3KYJB 4NQRA 2FQXA 4MLCA 3A0UA 2QR3A 4KZKA 3RVQA 4N76A 3HS3A 2X7XA 5FBHA 3S99A 4DQDA 1KMIY 3SAJA 5CNIA 3N0WA 4MS4B 5B3JC 3LOPA 3F6CA 1PNTA 2TMYA 4MRMA 1YS6A 5C5CA 3OLYA 4L4UA 1UDRA 3Q7SA 1QNLA 3IP7A 1KGSA 2JVKA 2OENG 3HUTA 3Q41A 4MAAA 4KK3A 2RJNA 1D2AA 2FXIA 4P1ZA 2R4QA 2QW1A 1GLGA 2E4VA 2HQOA 5CNJA 1JH9A 4XFKA 2PUDA 2E4ZA 1U2QA 5IUJC 3D8UA 4G0XA 2HSGA 2IOYA 2FVYA 3CZ5A 3QELB 4NICA 4JAVC 3H5LA 5CNMA 4EYOA 1JLKA 2LPMA 3KKEA 3TB6A
chains in the Genus database with same CATH superfamily
1U3CA 4XVCA 3WGVA 4FNGA 4MP8A 3CEPB 5LQDA 5E38A 3D02A 3GLSA 3IUJA 3FOCA 4G1CA 1DP4A 5DYTA 1MZVA 4RADA 1BS1A 2O2HA 4MUBA 1DAGA 2WQZA 2H2IA 2QE6A 2DKNA 1TVCA 1XHFA 2FSIA 4FSXA 4OQYA 5GVRA 4RK1A 3W6OA 4EGFA 3NDBB 1KZ4A 2VWQA 3K96A 5EOVA 1NX9A 4CM7A 1BS2A 1PJSA 1YXMA 2PM8A 2YV3A 4HNSA 4I46A 1H2HA 1W29A 3H6KA 3IHKA 4RHXA 4LZZA 2LUOA 3R9XA 4H7JA 2QZ9A 5I48A 3RUDA 4BMZA 4PZEA 1E1RD 1G6OA 5I7OA 3DGEC 1YC2A 1RKBA 5E7IA 3A25A 1M34B 4BNKA 2Q9UA 1N5RA 3VYTB 4Y9TA 2ORWA 3CWCA 1L5SA 5HMMA 5I5EA 1VOTA 2IOFK 5F3RA 4NENB 1C1DA 4TXLA 2DEUA 1IY0A 2GZ3A 3DR5A 4HWOA 2CB9A 3HWRA 4OHKA 3ZBTA 1U5AA 1RHUA 2R68A 3QFRA 6ABPA 3OIFA 2VAVA 3GFQA 1GSOA 1P1JA 4RD2A 3K6SB 2IPNA 4DY4A 1E7MA 5K0SA 4GFDA 2CSUA 4OY3A 2XQIA 1W6UA 1OUMA 3DXXA 1FYVA 2FPXA 3FMPB 5BOVA 3RTGA 2BGJA 4KUHA 1I0ZA 5CCDA 4W1PA 3AHEA 1XTUA 4JNCA 1PJCA 4NU8X 3K05A 4R1MA 3OZ7A 1K1EA 4IS2A 2QUHA 4PN7A 1C7JA 3BCHA 1ICEA 2YOFA 1IONA 4UJ3A 3KU1A 1YUBA 3IMGA 1RYEA 1ZD8A 2VQEB 4F4CA 1PGPA 1GKUB 4ZKEA 1WOYA 4JT8A 4PYOA 1ZC3A 3LUDA 2IUSA 1JQJC 5IU6A 4LNAA 1E2FA 2O2YA 1XE3A 1VHDA 3EXIA 2XV1A 2I4RA 2HR1A 4IDDA 5HJ7A 1DC5A 1B41A 2VSXA 5DYGA 3M5PA 3TSCA 2Q1YA 3G9UA 3L79A 4HUQA 1OB2A 4ARUA 2B3DA 3WGMA 3KJEA 1N6LA 3U0BA 4XPZA 3U7IA 3ZVLA 4F5DA 1IWOA 1T0IA 5U9CA 2IYOA 2P6NA 2B34A 2W8ZA 1ZDMA 2C3PA 2LIVA 3F7NA 2H1RA 4I4IA 1WLSA 3CKKA 2I22A 1H1LA 2JCBA 4FLMA 1X6VA 3TZKA 4ALMA 3MWEA 3NKFA 4FFLA 3ET4A 2RFLA 4WW0A 3U4DA 1YIDA 1X94A 4KRGA 4P8RA 2XOXA 1E4OA 4OKNA 3EC2A 2IKQA 3CNNA 4L8VA 4PZ0A 5JD3A 1GGEA 3PHBE 3CS3A 1RM0A 4J0CA 1CQJA 2Q5EA 2DUMA 2FR8C 3TTTA 5H82A 5K8UA 1T0JB 1ISMA 4CI9A 3EEOA 3RS3A 9LDTA 1AO0A 3FETA 3GXOA 4G3XA 1UP6A 1AKTA 3FH0A 3IOEA 1E3JA 1PFGA 2BBSA 4GI2A 5EWLA 1T35A 3N2LA 3ESBA 4RVNA 1YUNA 1OZFA 2RG7A 5ARCA 4QELA 4QQNA 4AZ0B 5REQB 3E9EA 4YJHA 2AZDA 1UMCB 1PR1A 2FW1A 2NPIA 3UMFA 2QI9C 3U9LA 1EFVB 4G0PA 1SM4A 2OFFA 3TW8B 1U2TA 5JZBA 2JH8A 4WY8A 2JBHA 2EYQA 1I7SB 2PZMA 3GVHA 3LO5A 4MKXA 3DKRA 4S2UA 3SPXA 3LG2A 5A6SB 3SSNA 3Q2IA 3V8BA 1Y8RB 3UJHA 5C8ZA 3H18A 3R24A 2C92A 2FPGB 4J2OA 2QBYB 3WO0A 2HCRA 4DCGA 4ZK2A 1NVFA 2GS9A 2WVAA 1C3XA 3PNBA 5FWAA 3EHDA 4Q4LA 3CURA 1KFKB 1RBYA 5K0JA 4G85A 1B0UA 4LRQA 3JQCA 2AE1A 5DSTA 5KSZA 5A7GA 2J9GA 3AO0B 3OTGA 1EP1B 2Q9AA 4J76A 5JS2A 4DHWA 2ZR9A 1FSGA 1CIVA 1HMYA 5AI8A 1GLVA 3I8SA 5KQMA 2IT1A 3I6BA 1L8AA 1YVPA 3OMLA 2WM2A 4F2GA 3GDHA 3C8UA 1SK8A 3BG5A 5DCLA 2JBAB 2IYYA 5FHQA 1GHTA 3EGOA 3VR4H 4Y2RA 1N3LA 1KZ6A 3IA2A 3NOVA 4QOEA 4CM4B 1ULSA 2WJ4A 4CJXA 1O95C 2DXIA 1NUTA 1J23A 2B4AA 3MF4A 3ZV3A 1G8MA 1QG0A 3I9FA 1JLHA 2ZYDA 5FI0B 1FQJA 1IMOA 4WFQA 1U1EA 1ZQ9A 2OFOA 1E63A 4X62B 3GWZA 5KNDD 3QKSB 4DCUA 1IRXA 2XXAB 4EI2A 3K1TA 4DUGA 1CQZA 5T64A 3A37A 4KXNA 2CL5A 4YFVA 4G1EB 1DJQA 4F96A 2YBEA 1OF1A 2ZT8A 4XW2A 3WLKX 1QWSA 3M4XA 4PEVA 5TMBA 3HVUA 1JEJA 3NYQA 4MLPA 2IZZA 1M0TA 3MA0A 4IHJA 1E58A 1XB2A 3NTVA 4N0QA 5AW3A 1T5TA 1JG7A 3QBVA 2FPLA 3OQBA 1HOTA 1D6SA 1HQCA 4Q1CA 3U7EB 1U2GC 3E9DA 3H0CA 4G0ZA 3ZQKA 4OBWA 1MTOA 3UT5B 4BQSA 3AIOA 3WGHA 3D4OA 2VT3A 4KN8A 3BFVA 1QTNA 3Q3CA 1I3LA 5L7WA 4YP1A 5HOEA 4YIHA 1WEKA 4JLPA 5HKOA 4MI1A 5KDDA 3GMTA 4AQ7A 3QMVA 1G8FA 2LIPA 5ALXA 4D1YA 1GFSA 3UXYA 3EWNA 4ZCQA 5SYMA 1LLCA 2JI6A 3IUPA 2PRYA 4EHKA 1X1TA 4FI3F 3CZQA 4RD6A 4HAXA 2AGVA 1OFHA 1HE5A 1S2NA 2NO4A 4WLUA 3RSLA 1O1YA 1PP4A 4MINA 1JVBA 4BUZA 16PKA 2ZIVB 3IEPA 5FWYB 2VFAA 4IG4A 4INPA 1SXPA 2XVAA 4NR0A 3OMXA 4PM4A 4B8YA 1VPLA 3BJRA 4F2DA 1VP9A 3EC7A 1VLZA 4R6WA 3DE1X 4MVJI 3QX3A 3ACBA 3KTAA 5H02A 1XAHA 3PPWA 3TDNA 4C21A 4IDCA 4YDSA 3NNSA 3P0HA 4Z8XA 2QRVA 1DBSA 4S1NA 4YAOA 4WDRA 3GB9A 3QEJA 3OCUA 2ZUEA 2B1JA 2W6MA 4HYEA 5TQJA 2BVNA 2A1UB 3VAYA 2OZPA 5LWQA 2ACKA 4DR1B 4S12A 2LP4Y 4LXGA 4BVBA 4C87A 5A1TA 1NJ1A 2HPAA 3KYDB 5AT1A 2B30A 1FU8A 4DAEA 1WD5A 4OHCA 3TLEA 4KPFC 3D8NA 3BE6A 4H6WA 3ZHVA 3EIEA 3WB1A 4BNXA 1GDHA 2A30A 4MWCA 1Z4MA 5EZSA 2D2FA 4UCFA 5H83A 1TVKB 3QA3E 4KITB 1ECFA 3P2YA 1K06A 2POQX 1VBFA 5DHPA 3ZLJA 3FFAA 4FE3A 5H16A 4Z0TA 2WK1A 2YDYA 1VBMA 3DE2X 2GM3A 2ZATA 4P80A 4QRDA 1N2CA 4BRZA 4ZCMA 5ITZB 1RAFA 1RHQA 3IHWA 1EA5A 4O1MA 4HG2A 1N8NA 1A9XA 2AEEA 2NU8A 5F64A 3V32A 1AG9A 2H17A 3KTDA 3KR0A 3MOGA 2ZKLA 4FOLA 4IPTA 3QP9A 1FUIA 4LC0A 1O94C 1CUEA 3FVRA 3I9NA 3W5HA 1ULTA 4Q3CA 5G4LA 3FGOA 2ZM6B 1ZJYA 4RJJA 2WD7B 2WB4A 3K16A 3OPYB 3BTSA 1Z74A 1QO7A 1TAGA 4AW9A 5JISA 3HVKA 1LC3A 2ZR8A 5FA8A 4URXR 4L9RA 1GZ4A 1KU6A 3L1JA 1WB6A 4B3CA 4MMYB 4BQOA 3FAZA 3H17A 4YRFA 2AG1A 1XMIA 1V9CA 1G17A 2Q3HA 2JGNA 4K40A 3VU9B 4AY5A 4C2UA 4U7DA 3S55A 2H7XA 1XQVA 3AR2A 3DDUA 2FRXA 1H8EA 3IQFA 2XGOA 5TDHA 4FYJA 1LX6A 4OHMA 2PL5A 4GICA 1N2HA 4JEHA 1UDBA 1ZD9A 4NBKA 3TW4A 1KIAA 3R23A 3IAEA 4F4DA 5K3OA 4XB2A 1PZHA 2JIMA 3MQ4A 4B6GA 4M22A 4NP6A 2DPLA 1E9VA 2V98A 2V3VA 4MA5A 1R0YA 4HDSA 4IXDA 4E7OA 3QE2A 5IEJA 1SKMA 1GARA 4L2IA 3VUEA 1IBRA 1VKRA 4PZCA 9ATCA 1KFBB 4CIVA 5IJXA 2BH2A 2NYAA 1T2UA 4WADA 1Z63A 3A04A 2EKPA 3S8MA 2LZ0A 3DNFA 4MKZA 3B6JA 4OHPA 1ETUA 5TARA 2ZQ5A 4V02A 4UNQA 5AHOA 4DGQA 2HRZA 1ZD2P 4HTFA 2A7QA 4HS9A 1M1UA 2B2NA 2CNKA 2PU7A 2UVQA 3I2YX 3NP7A 4MJ7A 4QU0A 3OZGA 3N9IA 1E0AA 2DFTA 3MQ2A 7GPBA 3EAGA 3PFFA 5JTTA 1OC4A 3WR5A 9GPBA 1RS0A 2A7XA 3UWOA 2Q3JA 3B78A 4JEUA 5JSQA 3GP8A 2HWUA 1O8CA 4X90A 3KT0A 3TLBA 1HO3A 2PWYA 4MB2A 1AHNA 1UMDA 1TVMA 3FE2A 3T3HA 3NWJA 2QSZA 4U2GA 4MPRA 4U6QA 3GLIA 4C4TA 3MTQA 3WKBA 1CD5A 1Y5NA 5J2UB 1C9JA 3I30X 4R1LA 4MLZA 2UYHA 1UKBA 3RBZA 1RI1A 3KQTA 4F5ZA 1NKTA 2GI4A 3PSHA 3GCXA 4OQMA 5EHZA 1JHZA 5FPYA 4RS3A 2XT0A 1P8AA 2Z5FA 3OPNA 1E3TA 1U8AA 1MFPA 4G0NA 3K8QA 3QFTA 4LXQA 4PTYA 3TX2A 4AJNA 1LC0A 1QX3A 4ZVPA 4DMRA 5IJ9B 1F12A 1P0QA 1U7UA 1OV6A 4ZCSA 4KQIA 5J59A 1LX7A 3SHTA 4RVDA 4FS8A 1JAHA 1YR8A 3AP2A 3MOSA 1PKEA 3D8BA 1YQTA 4L8GA 4GYWA 4KGZA 1EWVA 4K6KA 3S44A 4U1RA 4K6HA 4IICA 3K9LA 5AJZA 3PFKA 2HWYA 3EVCA 1NSTA 4PONA 3HGMA 3KVNA 4TRNA 3E9YA 3WGLA 1JFSA 3F7MA 1KO4A 1VJTA 3LC2O 4NH4A 3ZNOA 4D82A 5JXHA 2G1JA 3HEMA 3RWOA 4CEIB 5B2FA 2HA7A 3NMUF 5SV2A 4FOPA 3FOFC 2BMVA 1SVWA 2ZTMA 1U63A 1FVFA 1Y5RA 3B9RA 5BMVA 1JZQA 1DC4A 4EI7A 4DV0B 1VFNA 5K3FA 2WJJA 4LNHA 1E3WA 1WVIA 4UTRA 5CB4B 2Y2UA 3TVDA 5TE9A 3EYAA 4D5EA 5HNKA 1GFIA 1XFDA 4AZVA 5ABPA 4MVXA 1KY2A 5IDYA 1YRYE 4INZA 1O95D 1D4AA 1OAAA 1VDZA 3ROPA 3BXGA 4Y1RA 2IZ0A 1W0JD 3DT8A 3OJ0A 2R66A 1RWXA 4AX4A 1H4VB 3O8OB 3PL5A 1AN9A 4MUMA 2V9ZA 3LYHA 2C61A 5ELLA 1XMOB 1L8QA 2FMTA 2R1TA 3QPUA 4BV2A 3VDXA 3HL0A 1GQSA 2CXPA 1E9RA 3A05A 3M34A 1S6YA 2IQ5A 4JQSA 2ZIEA 3NHFA 4H7KA 3VI3B 1W25A 4FNOA 1MQAA 1H94A 3I45A 4YASA 1C3EA 3FJ1A 4ZRDA 4QJ4A 3TRFA 3WIUA 2O8DB 5DTIA 3JR7A 1SUIA 4CMIA 1Q91A 4HPJB 3S8EA 1KMMA 4FQ5A 3PC8A 5ALVA 4ZPXA 5HF6A 1LB1B 2AOXA 3ZHQA 2FFRA 3BICA 3QTLA 4KYVA 1VYUA 1M10A 1XCOA 3D3WA 4PLPA 4B3JA 1DRJA 4DBLC 5CX4A 5IABA 1X2BA 2P1ZA 4KVZA 1BFDA 4WK4B 2VDRB 1ZD5A 2YVQA 3HCBA 1IU9A 4QPJC 2V0GA 2PMKA 2PH3A 1P4JA 3V42A 2WVGA 4LY9A 4R2LA 4AG3A 5ALPA 2NYRA 1J33A 1TK2A 2QOEA 4Q9JA 3A1TA 1U8YA 4JP3A 1RRPA 6Q21A 1FDOA 2OHXA 4X1YB 4K5QA 2RKOA 4XUCA 1EBFA 4UMEA 3CGWA 3TIVA 4LSMA 1PX2A 4IRUB 1W5EA 1Z2CA 4CKYA 2NM0A 4LHWA 4ZVMA 3VOSA 5F4ZA 2O3JA 3MUEA 4U5XA 3T1YB 5M3BA 2HU2A 4EHIA 4LF9B 2P3SA 1BH2A 4JYBA 1AGXA 2W2PA 1UDCA 1XTZA 4L4ZA 4LC1A 2CHGA 4MRMA 2WD8A 2HBQA 1ZNXA 3W05A 2XOEA 2GYVA 4F92B 2P2LA 4Q00A 2I65A 4XUEA 3ND5A 3Q8MA 5T67A 1CJCA 1GAEO 5K3SA 2ZIZA 1YACA 5ESXA 3HJUA 3T1HB 1P9LA 4YCDA 2PX5A 5CLLA 1U1IA 3KKLA 3MWDA 4XUGB 4BXOA 3I6MA 1VG8A 1EM8B 2AFHA 4MAMA 1U4NA 5EIXA 2XUPA 3QELB 2H9AA 3FHLA 4GX5A 3FPCA 1L2TA 1MJFA 2FFAA 2GVDC 4YUXA 3Q12A 4CIAA 3LGSA 2Y1KA 2A33A 5FD8A 1GUYA 3SJCA 1K7EB 5HZMA 4JVLA 1R6TA 5LMNB 4G0WA 3OLQA 1RPNA 5L95A 1TTQB 1TK9A 1H93A 1TRHA 4UCWA 4YT8A 5AUNB 4FIZA 5C3MA 5SZHB 2WMOB 2A5FA 1ZGBA 4KDEA 5D86A 4O4JA 1KVSA 4RD4A 1NWCA 1FDSA 1WO8A 3NASA 2HW8A 3B36A 4MUFA 1NI4B 5H0IA 2CL0X 3QFFA 2OM6A 4G81A 1UOPA 1YSCA 2WM3A 3L0PA 4AUEA 4IFEA 2VA8A 3VNBA 4MI6A 1Z36A 5ALLA 4HJRA 2ILVA 4LFBB 1YZKA 2J67A 1RE0A 1E2BA 3D6HA 3QG1A 4BX0A 1G2IA 4ACBA 1FNDA 1KC1A 2HJWA 3HV2A 2MR5A 3R3YA 5C5DA 1YTUA 2HMUA 3I4LA 1V11B 4WOKA 1MC1A 1NF2A 2RDMA 2QPOA 1P7CA 5JRJA 2P9HA 3V2HA 5DN6D 3KYBA 2GPJA 3UOGA 3TUZC 4RLHA 3QWIA 1UODA 3W90A 4D9IA 3NHKA 1E6LA 2YJTD 1FZTA 3ESAA 1M2OA 4LHSA 4I5EA 4AWAA 4KZPA 4QEDA 3GYBA 3HZOA 3UCFA 4Q9KA 4KP7A 2DPGA 3B12A 4QE3A 3N0RA 3Q6NA 3S7ZA 3DQZA 2RGXA 5TC4A 5EIFA 4ZZ3A 3CLSC 5H81A 4H4DA 5IT0A 1ZL2A 5JAMA 2QVLA 3QWFA 5G1NA 1JA0A 4PGHA 1V48A 2OORC 5EMLA 3SFZA 1VE3A 2VYQA 2AN1A 3GDGA 2QGNA 5EQJB 4KLCA 4ACAA 4Z4HA 6REQA 4HN2A 5IBCA 3E8SA 4C0HA 1JLSA 3DKKA 2EJTA 2VJYA 4PLTA 3HMQA 4BTLA 5CB6A 3U7JA 2P27A 3ENZA 4NDAA 4DCNA 4UM8B 5JI3E 4TKZA 4YDHB 2GM4A 1JHMA 3JXEA 2PX6A 3M9WA 1POXA 1UUFA 4MW6A 1X1CA 3B1ZA 2O2DA 3B1KA 3IP5A 3LD9A 1JNXX 4XLTA 2PVSA 1T2VA 2LCQA 2X9LA 4NK5A 3LK7A 2KI5A 4V1CI 3IQGX 4OSPA 3LDFA 3M5DA 2BSQA 3LQYA 4M86A 1WCWA 2VAXA 3H75A 4WBNF 1PR0A 1U4SA 2VPYA 2CCJA 2Z9DA 3LU1A 4P9NA 4TTQA 3V8RA 8GPBA 4DCSA 1NXVA 1E4VA 1GZVA 5HKBA 4EAQA 5DULA 1ZM7A 2O8BA 5LWHA 1PDOA 1CQIB 2IU4A 3DHYA 4J1TA 3BRWD 2XXBA 1G2QA 3KK0A 4KN6A 4WINA 3AY3A 1Z6QA 4QAQA 1T3GA 1WSWA 2EGUA 4FOTA 4NH0A 3QVMA 1KPGA 1E6CA 4RAQA 2UZ4A 1XZCA 1BWPA 1E1DA 3O84A 1TYCA 4R01A 3T7SA 3GJQA 4B35A 1W0CA 3A1SA 1OH5A 4W8OA 1GNSA 1J8FA 1GJRA 1U7OA 2COEA 3HY3A 2OO5C 5AD1A 1M2FA 4PS1A 2HJRA 2UV8A 3N5KA 3JPWA 4ZHQF 1KDVA 1QS0A 1T3HA 4J0DA 4LRUA 4NCNA 1RWOA 2C5EA 4D41A 2O7VA 3V1KA 4UZSA 3TJZA 4LDZA 1L6IA 2VSNA 3GEEA 4RMGA 2BDTA 1YQEA 3K8OE 4L08A 2QRHA 4I1PA 1CB7A 1VG9B 2QMOA 3PX3A 4RPHA 1E64A 4PPFA 4AJIA 5LSAA 4IIDA 2C42A 4KR3A 1DKLA 3QYFA 5EXDA 1YL7A 1EJ0A 4K87A 3RNLA 2R7NA 1W9MA 1YOVA 4EX7A 1Y98A 4C7XA 1T1IA 4R0MA 1XN4A 3LYUA 1Q20A 1X92A 2WD9A 5IMSA 1EPUA 2FF7A 4F3YA 2PWZA 5IAEA 1NUUA 4ENQA 1VJCA 1K9SA 2HBZA 4IOKA 2O48X 1KI6A 1LVGA 1BIFA 4BVFA 4HNAB 4JYZA 4TMXA 4ZI3A 2WSBA 3BMOA 5ALDA 3ZHOA 1HTTA 1L3CA 3GLHE 2JCVA 4CEHA 1Y1SA 4QOIA 3ZXUB 4Y7DA 4I50B 4R2HA 5LFAA 2A3RA 1O97D 3EIXA 1SKYE 1K27A 2KBFA 3FUCA 3I9KA 5D5PA 2JCSA 1T1SA 1YHNA 1JILA 2ZBEA 4G01B 1A9PA 2A1TR 3LKZA 4M1QA 5LOVF 1EVKA 2B2CA 4PCLA 2OCXA 2BFCB 4UTVA 1U3DA 2YHBA 4V3CA 1G8YA 2XUZA 3H5AA 3OFKA 4XWWA 1K2VN 2OWEA 2AJ8A 1FMCA 1DKRA 1SG0A 2AZTA 3MERA 4PC1A 4A91A 1KYIA 4JQZA 4WN9A 5F1PA 5LB2A 4ON9A 5AOVA 4ZD6A 3IEMA 3ICPA 2EATA 1WB9A 1J8VA 2IXBA 5DBGA 3COSA 1G3IA 2DLNA 4KE6A 1GSAA 3WBBA 4D9MA 5EUQB 4I5IA 3G2QA 4CODB 4OAOA 3IE2A 2AC7A 2GXSA 3SQNA 4RXTA 2HIAA 2I1WA 4ES6A 1WM1A 4OLAA 4EY7A 1DCKA 1DELA 2G83A 4LZPA 3RKRA 1WP9A 3GLUA 2W6IA 1J90A 1G21B 1S89A 2C5SA 3PDJA 4LFCB 3T12A 1ZJ5A 1WW3A 4E15A 1TYAE 4HYTA 2R1VA 3R5JA 5DNDA 1EFPB 2HA3A 4QATA 3A9SA 1Y1KE 3HA5A 3A1CA 5IFKA 3Q8LA 3WQSB 5FQOA 1NPTO 4LGVA 3WS7A 2ID9A 4IDHA 1IBKB 4MRAA 4J7AA 1W87A 4U2BA 3IR7A 4MW5A 1AS3A 4M1YA 1Z82A 2RGAA 1TYDE 2VUHB 3FD8A 4H0FA 2X2PA 4MIYA 4WIAA 1MIHA 3HUUA 4L22A 5I9LA 1L5LA 2QZPA 5CD1A 2P2YA 4HDRB 4K3UA 2ZBDA 3JAKA 4CMAA 1GAQA 2JCXA 4BIMA 4DADA 3TR6A 3GBSA 3T7JA 1T0PA 2Q7OE 4C9BA 1PTJC 5BWBA 1NP3A 2HKIA 2MYPA 1AB5A 3N3BC 1AB6A 1RXIA 5GV7A 3N2KB 3HB7A 5KYTA 1FL9A 1QGDA 2ZUWA 3KZXA 2IXFA 2ID7A 4MHOA 2ACEA 2FTKE 2X0IA 2IPLA 3VH3A 2JPDA 3ZWMA 2F3SA 4OQ4A 3NWPA 4NMXB 3LW8A 3MTJA 4HB3A 4LJYA 3NAQA 3RAGA 2JC3A 4RZ2A 2OXIA 1EDOA 3RIYA 1QYWA 4BP1A 1P73A 2QDXA 4P84A 1COWD 4TS1A 3LLSA 3DCIA 5F12A 4LRYA 4LJ9A 4DM4A 5DNVA 4EENA 3ESXA 2H1WA 4UHFA 1IFXA 4PIVA 1HQDA 4L85A 2ZUBA 4M76B 5FV7A 3AF3A 2GXUA 5E6UA 1KKUA 1L7AA 5A9TA 1WPQA 3UKDA 4D3YA 2O8FB 1NUAA 5K0CA 1CDZA 4JR2A 1K9VF 2R8BA 5AVJA 4LFAB 2OBLA 3EPJA 2FEXA 3V34A 4ZGWA 4MS1A 3O4VA 1KDOA 4D80A 1KAOA 2I99A 3VBCA 2NU6A 3VKVA 1CS4C 2C2WA 1M1NB 2CK3A 4R7ZA 4WLFA 3UTCA 3C16C 3P9RA 1O0SA 4GVPA 4BMDA 1U9IA 3EIHA 3L6BA 4PAWA 4DA8A 4K9NA 1X8LA 4YRRA 3UQZA 5IKXA 4RTJA 2I2FA 3Q6IA 5FPPA 3UWDA 2X0JA 3PZBA 2V0NA 4GMFA 4AY4A 5FOQA 1DL5A 1EK6A 1JTEA 3TWOA 1K8RA 1TVEA 2XHEA 3JVUA 4FI3C 4ZQFA 3A31A 2DOKA 3DG9A 3DAPA 2RK3A 4ZDKA 5IYZA 1RXYA 1JU3A 2EX1A 2HC9A 1XUOA 1UQRA 4AJ9A 4DSNA 2V7QA 3AB3A 4TTAA 5AKIA 4YRSA 2OXCA 2EU8A 2FA9A 3HCEA 1R88A 5ADVA 1J0EA 1ZOSA 1KY5A 2A4KA 3ANXA 1XKTA 3L7IA 1GUBA 4HOYA 1PFWA 3AK4A 5BY2A 3MB8A 5DNYB 5EKTA 3T06B 2Z8ZA 3DBLB 4GM1A 4NMWA 3H9GA 4EQ6A 2PVPA 3I9JA 3QXJA 4PC3A 4NBLA 3GFFA 4WCVA 3E9RA 3QVOA 2WAYA 1E0KA 1EK2A 4Z1OA 3AUKA 3BIOA 5CFPA 2IWRA 2F9FA 3WK4A 4A7PA 1UZAA 4MWZA 5IKEA 1XKQA 4XPIA 3M83A 4DLZA 2JAHA 1QNFA 1VMIA 1R8SA 1V39A 3WSWA 1RYDA 4IDGA 2XTZA 3AR6A 1HFKA 4MGEA 3WYCA 5AI0A 1EKXA 2EVWX 5IBRA 3IQIX 4WESA 2E0IA 2HX1A 4UNIA 4Z1MA 2FRDA 4TLMB 1NY5A 3H4TA 4IZIA 3ZNPA 5AW5A 4OKSA 4DIMA 5LKAA 3KCNA 4BU0A 1KAGA 1S2DA 1V1MA 2OLEA 4TN1A 2JI4A 1OILA 3BXFA 4N18A 1YRLA 2HXSA 2OG1A 1WKCA 3DGFC 3R4VA 4N0EA 4B4UA 5AM3A 2B83A 4OI4A 1ZHHA 1ZNQO 3JYPA 4LZAA 4WJKB 2J3DA 4ZT7A 5I9IA 2CFOA 4LY3A 3I01A 5KYYA 2O7QA 4W1SA 2QPTA 1NM5C 3DV0A 4BWVA 1ZHFA 2YASA 1KTVA 1Q0QA 1ZWLA 3CR7A 4XVQA 4DLXA 1OZAA 5C1BA 1IC6A 5KWVA 1FDRA 4C6HA 4KW7A 1I01A 1DLJA 1EGVB 2UUCB 3ZK9A 1CEQA 5AYVA 1QGUA 4RDXA 4Q1DA 4MKFA 4UNRA 2OP1A 4Y1GA 1KZHA 1LPMA 1FCJA 1W49A 2DUUA 1A4XA 2NTJA 1NOKA 3PUKA 3SSAA 4B5LA 2GMWA 1YDFA 2VDOB 3GT4A 5DYNA 3PUYA 5JS1A 3KLOA 4DR2B 3IPYA 3WGQA 1U6KA 1XD2A 5KOYA 2QTTA 1VSBA 1GDDA 1TC1A 2BMEA 1KSJA 4KVAA 3U3ZA 4QYMA 4ARZB 1DIAA 2EERA 2N42A 5IXSA 3LNCA 1IATA 3BJEA 1JG6A 1OXUA 3O94A 4ZYLA 3HK2A 2IITA 5HF5A 3RVDA 3OTHA 2IEYA 2WIGA 5D84A 3VR6D 1DKOA 1LJLA 2ECKA 2L17A 2QRQA 1GITA 1T6NA 9LDBA 4P2GA 5D5HA 1PJZA 3EY9A 5DW0A 2FLVA 3N53A 4CPDA 5JT1A 1F0NA 4EA6A 1OPRA 1ZD1A 3NBMA 3OY2A 1XZQA 1ZH0A 3QZUA 4I8XA 3UANA 4YCSA 4REOA 2AH5A 1U8FO 1YZFA 4B47A 3THXA 1EXWA 5JNSA 1RM3A 1Z6XA 1HYBA 1U3WA 2ZJYA 1OKKD 3ISVA 3LSTA 3D6JA 4OK3A 1VM6A 3SYRA 4EB6A 5JZOA 3OD1A 3F98A 3CSDA 1Z7BA 1KWGA 4TSFD 1N9GA 1Y0BA 1OQAA 2LE0A 3OTOB 2V55B 3FDXA 4C88A 2QP9X 5IJWA 2IS6A 1MN6A 3OECA 4HC4A 2IY9A 4BNHA 2ODQA 2HXGA 4JVOA 3WGJA 4PIMA 4JQOA 2DR3A 3BWXA 5I9SA 2X2EA 3ZU5A 3V1MA 2PMBA 3I42A 4H60A 1A8UA 4WOPA 5KKCA 4TWIA 1NG9A 2VDLB 2QE7D 3I83A 4IV5A 3AJEA 3HKBB 2JFBA 2VF5X 4GP9A 5AW7A 2DFVA 1MRZA 2I4NA 1XXHA 1POWA 3PPVA 2Z58A 1VKZA 3BE4A 2QS9A 3CXRA 4CKEA 2MOKA 1WDKA 3C97A 3ZDQA 1OH7A 4QTYA 1BYIA 4I4TB 5J43A 1ZP6A 4AFNA 1A8SA 1Q16A 2C88A 2ZFUA 3GRKA 3JWPA 4ZT4A 3GF4A 1P5FA 3I3OA 1QCYA 2OGUA 1R6VA 2G4LA 1TNDA 2HRBA 1U3UA 3AW9A 3H2JA 1H3NA 4CKCA 1WDMA 2WSLA 4DW8A 3IESA 4BWGA 3VYSB 1L7NA 3LT0A 4H77A 4XD7D 4HGYA 5FKJA 4F56A 5H9WA 2YS6A 4XYEA 2XKKA 1T36A 2Q6IA 2GAAA 4Q1EA 3UK7A 4A16A 2VN8A 4OJTA 2JJ2D 4GKAA 4U2EA 1EG2A 3BN3A 5MGBA 2WTXA 4LNUB 4S05A 1E2NA 3GFOA 4PG8A 1AHPA 5BV2P 4REQA 1NW5A 5K8LA 5KNCA 1ENOA 3EBLA 3ASVA 1SULA 3QM1A 1DPFA 2J6BA 3OFSA 2HTFA 1QC5A 3HVJA 2WZQA 3OZBA 5D6OA 4Q4CA 3H86A 3KLPX 1DKUA 1YK0A 2WT8A 4FMPA 4U7JA 1V5EA 3QJGA 4KLNA 1GQQA 2PJZA 3R7DA 2XNCA 3SXPA 2PLWA 1X8XA 3EODA 3PXEA 4DILA 3BSWA 4MLCA 2EKZA 3O90A 5BMVF 4IP0A 4JIMA 1QYRA 3DC2A 5DBOA 3URKA 3E2PA 4ESEA 4V0MA 2X7XA 1BE8A 5FBHA 3WJAA 3D31A 1Y3IA 5I7RA 3P7MA 2XGSA 3BDAA 3OPQA 1J2EA 3S5UA 4HWSA 1I2DA 2FWJA 4C2AA 5LP6F 1NUHA 3BBPA 5DTRA 3QEBZ 1ONOA 4BWFB 1N0UA 3DB2A 1JR3A 2HLNA 3WLHA 4MDFA 1UAAA 2W90A 5ISMA 1C14A 4HX9A 2FP4A 3FOZA 3E9ZA 1MMFB 1DAKA 2OZKA 4UHBA 2PSHA 1CEXA 4GZMA 4D0RA 3KVOA 4HLNA 4OF4A 5M2QA 2PUDA 1M6EX 3RUFA 4LGYA 1R5OA 1R66A 3UO8B 3UZUA 1FLAA 3T0FA 3RBVA 3TXXA 4Q4HA 4Z8YA 4COKA 4F21A 3HCFA 1QMGA 1TKAA 1RVDA 2OYCA 4LMRA 3BWBA 3DOOA 3JZDA 3L5OA 3PJDA 3A1DA 3QX8A 1IY9A 3IBSA 1L5HA 4LVNA 3ELBA 4HDQB 1Z3IX 1SXHA 1CLEA 3EUAA 1BS9A 4Z9XA 2ZB3A 4KJXA 1ILEA 4PXAA 4R9RA 2Q3LA 3LCUA 3NHUA 3S81A 1K4MA 3DW1X 4NCJA 4FC7A 1MIOA 2VBFA 2XMCA 3GJRA 5BVGA 1A5SB 2F8MA 2ZULA 3WLAA 2R48A 4PZ9A 2QJOA 2VF7A 5HTKA 1Y4AE 3VYWA 3SWWA 4JROA 2C9CA 3QEMB 1FE8A 1RM5A 1PL7A 4ENVA 5CPBA 1G7SA 4QUAA 4FDAA 4H6XA 2F1KA 1DGQA 2WA1A 1J8YF 2ZVQX 3CRQA 4KFTA 1EJ6A 4KXLA 3A4NA 1RAGA 1UOOA 2ZJ2A 3M6IA 3ZTTA 3IXLA 3DEFA 3I6QA 4DLVA 1JBQA 2OXRA 4PCVA 3V7UA 4F38A 2IHKA 4R81A 1IUKA 3QXGA 3RGWS 3R75A 1IDN1 2OBBA 3FZYA 5HRAA 3HY6A 1UEXC 3K5PA 1HG0A 4BUJA 2NGRA 2WABA 4IYRA 1WB5A 5IBPA 2AXEA 2GAJA 2P9FA 4FOOA 4R05A 3WMWA 5I7VA 2I66A 3TL6A 4ZYVA 5KYGA 2VJBA 3HPQA 3LM8A 4YCNA 1J56A 4NMMA 1JL3A 3LVFO 4JWTA 3C70A 5F5LA 4DA4A 5DPMA 4JZYA 4MHTA 1T0UA 3K92A 4GDFA 4ZEMA 3U4IA 4EO7A 3QU5A 3KE9A 1L0BA 1L7QA 5AXBA 2WYWA 1K8ZB 4LJ8A 1FMLA 1TPZA 3OZDA 3ECSA 4MKRA 3S68A 2FK8A 3B1WA 3G17A 2DSTA 3UN1A 3D1JA 4O4JF 1UJCA 4G9EA 4QECA 3RSOA 1DKNA 4Y0AA 2ZITA 4Q1VA 4R9NA 1E20A 5ICFA 1HDGO 4MUYA 2QMYA 3OKFA 3QY0A 4HATA 4B0PA 4BFXA 1AHHA 2YC4C 5THKA 3R9KA 4EOGA 4LY6A 3NOOA 4FSHA 3BDIA 1I2ZA 3M0EA 4RKFA 2ERCA 1LPAB 4O2BA 5J2TA 2ZRBA 3GRUA 2VDKB 3CRMA 1VI5A 2AR9A 1NI5A 3ES9A 421PA 2D0IA 1T6ZA 2BGWA 4N3NA 3L43A 3P45A 3LDGA 3SMQA 3KJZA 4LAFA 1Z5OA 4U39A 4CTJA 2FDXA 1USUA 4QJBA 4KI0A 5COQA 2P9GA 2DZDA 3KOZA 2X6QA 3G6KA 5EZYA 5EXTA 1LI4A 4IXMA 2I33A 5THQA 1OGYA 4UEOA 2FR1A 2M9MA 3H19A 2QLJA 3V9AA 4DOMA 4OH1A 2CBGA 4ZVUA 2C4MA 4PHCA 3EH2A 4MCAA 4IEIA 1KORA 2D1YA 1GPMA 1UAGA 1WSAA 4ZGBA 5DMHA 2V6BA 1QGZA 2C5FA 2FETA 1CZKA 4K9SA 5KO2A 2DFDA 2O23A 2V1UA 2W6QA 3N39C 1KE1A 2O8CA 3HXLA 3QUSA 3JD0A 3R0IA 5ALYA 4DZTA 4PYNA 2FY8A 4BL5A 3LP8A 4MEJA 4R2IA 1WZEA 5BO5A 3IOMA 3B89A 3V3TA 4OBEA 2EF0A 3BJMA 1YB1A 3S2GA 2HJ9A 3FTCA 2PX2A 1KR2A 2NO1A 2C4TA 3NU1A 2D0PB 3DOUA 2IU3A 1X86B 1UK6A 2PMWB 5CJPA 3WDKA 4YS6A 3UPTA 1WE2A 2OAGA 2PDAA 2UXDB 1E66A 3EFBA 2PPLA 2ST1A 1NNSA 3PNOA 2IHBA 1RKXA 1SUFA 1GGFA 4JC8A 2H6EA 4TXNA 3VV3A 4BAUA 3TLYA 3TNJA 4IEFB 5JAPA 5CGZA 3QPWA 3B5IA 3IKMB 4LIPD 2GN6A 4AB1A 3T3GA 3GJ3A 5JDCA 1A69A 1M6WA 3MJFA 2BR5A 4PO1A 4HBZA 3TBFA 2V6FA 4PX5A 3BMNB 1O6BA 3D81A 5E8JA 3MMPA 2V6IA 2QZ4A 1PFUA 5CLIA 4UZEA 4AQDA 2H92A 1QAQA 1CUVA 3O6VA 4CT4B 4GLFA 4OU4A 5IAGA 1U2DA 4UVIA 3G8CA 3RUPA 2L18A 2FPKA 2BW0A 3QF7A 4MQ6A 3KIPA 3PUVA 1ZCFA 1VPWA 5BWNA 4Q3LA 1F48A 5CXUA 4HUTA 3COJA 3ZX4A 4CVNA 1TZ2A 3TN7A 1LQTA 2Y27A 4XVRA 3GJSA 5A06A 1ZGZA 3AUXA 2ABWA 4IGIA 3EQZA 5JS8A 1G66A 5E1DA 3W5DA 4WX2B 2EHDA 2V3CC 5CTJA 2P40A 1MABB 4J4TA 4MX8A 4DJAA 1HZJA 1DDIA 1U6IA 4GVXA 1YL5A 2DH5A 3A36A 2GN9A 1YIAA 3OQIB 3QHQA 2OPHA 3A2NA 3GLFA 3GRPA 5T41A 5BXQC 1LSOA 4XYGA 1KQPA 1U0EA 1LLFA 1USGA 2YWGA 1RAHA 3LLCA 2XH8A 4UVGA 3TXAA 2WJZB 3U3DA 1IQ0A 4NARA 3UGKA 1NP7A 4KK4A 1Y6FA 1P4HA 2N0SA 1YUMA 1VECA 1EGAA 2CXXA 1SKUA 4Y6OA 3DM5A 2QQ5A 4CLOA 2F7SA 4IIHA 4YWJA 4DR6B 3K5HA 1RU3A 4LJKA 5EP4A 3EXHA 2WQ7A 1YU6A 1GZDA 2C3OA 3CEAA 3LWDA 4PLZA 1SXJC 2AJBA 2IBMA 3MT8A 1Z75A 5A3SA 1O9HA 1WVMA 3F6PA 4N9WA 1MZPA 3DZDA 4E7PA 2PFSA 1LRLA 2QAJA 1RM4A 2IUEA 3EDMA 3KJHA 4NE7A 4RSRA 2OA0A 4GWGA 5CD9A 3FSGD 2CVHA 2W6ZA 4D4LA 2GCNA 3D8RA 2N47A 3RYFA 4A2CA 2HFKA 4PXYA 1U8XX 1M9NA 3ORHA 1KEEB 3KZCA 3RSZA 4JBYA 2EJVA 4AO7A 4LV5B 3N76A 5CDSA 5I4CA 4JOBA 3RI3A 2WA2A 4IX9A 2IZ5A 3CIFA 4AULA 4HYQA 3Q40A 4PRYA 5BQ5A 2R84A 3T5MA 3LRTA 4AICA 5JQGF 2EP7A 3J80A 3JYHA 1GNVA 1OAOC 1P2BA 3JQ8A 1BTOA 3CX8A 1BCSB 1Z73A 2X8JA 3BD8A 1ZJ6A 3HYLA 3LUGA 4GLLA 4XSHA 2PA0A 4AP9A 1A1SA 1Y7IA 2ZYHA 4MDEA 3T41A 4AXBA 3ZLBA 3T5PA 2AFIA 2YHIB 4A5SA 4BNVA 1BXGA 1JIKA 1PNQA 1X80B 3DBIA 3GAMA 5LBIA 2IXDA 4KFSA 2ZCUA 1Z7YA 2HLDA 1V4NA 4GG1A 1GZSA 4MYRA 1ENZA 4N4AA 3GA0A 3SYMA 1X7HA 4J0GA 1QVWA 2QVGA 4ZVLA 1P60A 3IC5A 4J0QA 5AKHA 3LOUA 4C6RA 1W96A 3PRHA 3C6ZA 3VXKA 4D56A 4GS5A 3DH0A 5LXTB 2VRCA 3VSCA 4E6EA 4OLHA 3KR9A 2GZSA 1QJ4A 1JDUA 1SZCA 2IDJA 4CTKA 1S4MA 2WIDA 3BRQA 4DMCA 1EX9A 2PNFA 1ST3A 1U0HC 5DK6A 1H6AA 4HP8A 1DINA 3S2YA 4A8HA 4J7CA 1J5EB 1ORVA 4EBFA 2PUTA 3LW7A 3ZHCA 1ZA2A 3VBEA 3UAVA 3ZUGA 2QUZA 2PKQO 2WF7A 3A3KA 4WXEA 1NNLA 4MULA 2J9YB 4HAZA 3WSVA 1CUCA 1DIBA 1RI4A 3L1HA 2DERA 2CLSA 3CLKA 3HXPA 1PQUA 3I53A 4CMEA 1TUBA 5HSGA 2GM5A 5EIOA 1JT9A 2ECOA 3KKOA 3QLEA 2XUOA 3GUVA 1TZCA 3NH9A 4KQMA 3SE7A 4BV9A 4QUHA 1E98A 2OD9A 2OVBA 1JBKA 3ON5A 3QFHA 5EZ6B 3ZDAA 4NRDA 2OQRA 3KQOA 2X1VA 1JKFA 4N8DA 4FJ1A 5DI9A 4URWR 5DLYA 3RC1A 3L7NA 4JT2A 1A04A 1HZZA 4JASB 4PYJA 1LDYA 3IL2A 3HABA 3ZLVA 1SVMA 2WDZA 3LHDA 1SUWA 4L74A 1VL1A 5LD2C 1O8BA 4IGEA 1KQNA 3G8BA 1IEWA 2WG2A 1KYWA 2H65A 4QUKA 2MINB 3SLRA 5KSWB 4D6YA 2QTCA 1QYVA 1V45E 2C0CA 2GCOB 2J4FA 1Y9ZA 5IYZF 4FYHA 5FADA 3OPYI 4WUTA 1DARA 4IIYA 3RVLA 3LT1A 2G9RA 1ZICA 4IMIB 2JGFA 4D26A 1UDWA 1F2VA 3HUDA 4QREA 3T3DA 4ECEA 2YXPX 3PQ6A 4K1XA 3OLXA 4DN6A 4E33A 1L9XA 2PL1A 3LUCA 5JYBA 4EJFA 2QX7A 1OLXA 1ZD3A 4HZIA 4L9AA 1LFDB 4U0JA 2H3HA 4WN3A 1F0YA 4HKTA 4WZAA 3ZE7A 3VRHA 1W2WB 4OIFA 3RVPA 4Q5IA 5HIMA 3SR0A 2YZ2A 4FE4A 3TM5A 5FNVA 3VR6H 3FW1A 3OP1A 1T6BY 4YO7A 3HFRA 4M0LA 4OOEA 1MX3A 3BAZA 2Y2VA 3C15C 3IVGA 1L7RA 2H9YA 4BLTA 1MDBA 5HF9A 4R71A 1TTTA 1WS6A 4FHZA 1N1MA 4H7PA 5FLKA 4HLQB 3V7NA 1ZK3A 5K01A 4URVR 3P52A 3AEKB 4MI3A 4D3SA 4IUCS 1BA2A 4Q1AA 4IH9A 2BTQB 3D0KA 4XWAA 1H69A 4C1NA 5BN3A 2Q46A 1HKUA 2ZANA 2ZIAA 3ZDEA 2EAUA 4DIFA 4AC9A 2D2EA 2MSCB 3JZMA 4INJA 2C96A 1VSTA 3GQBA 5ILQA 2WWWA 2XSZD 2BEVB 1PI3A 1X42A 2Q3EA 4BIIA 4JSTA 2HSJA 5FBZA 3W34A 5M5BA 3CBQA 3QEKA 3W5JA 3T0GA 3PX7A 4N12A 3WIOA 4OFZA 1JU4A 2V7WA 3PPIA 4PICA 2JAPA 4FW8A 1S9DA 4BGVA 3BT7A 2P9BA 1C9YA 3EWAA 1YS7A 3CUKA 3IIIA 3ITDA 4JJFA 4N03A 5HQJA 4BMNA 1MO4A 5BURA 2ACVA 2PWAA 3FM9A 3T9FA 5K2OA 4E4YA 2WU1A 3TLKA 3KT8A 3IUYA 3OU7A 4M1WA 5TNXA 5KVAA 2ZR0A 2N1MA 3UB2A 3ESYA 3ZY2A 2FMHA 3DYVA 5EQTA 1QWOA 5FPSA 4XSGA 4CR8A 1EK5A 2YMQA 3EASA 4KNWA 1QRRA 2OV3A 3Q3JB 1OBCA 2I80A 3H5OA 4KIJA 2YJ3A 1U0SY 1C9MA 1UJ2A 1T3LA 1U02A 2ZREA 4AUKA 1RBQA 2RI1A 1WCXA 3IUNA 5EMMA 5EXSA 4GWLA 3ECCA 3GFBA 4NZZA 3KETA 2C57A 2G1UA 3P2MA 4ZYYA 1L7OA 1EE9A 1IIBA 2ZSIA 3P9IA 3WOVA 2ZIUB 3FAKA 3LT4A 4AROA 4CQLA 2GKSA 4RTSA 4MIOA 3VC3A 2W58A 1DIOB 1FX0A 3B70A 3DZCA 2BHLA 1NBIA 5K0NA 3D9QX 4YA6A 4B87A 2GA9A 2H0AA 4BPBA 1HNWB 4M55A 2GARA 2YXLA 2IK8A 4HGOA 4P53A 1Z2OX 2WAOA 3VC7A 2NU9B 2VT6A 3BF7A 5DX8A 1KA9H 4BHTA 2I6XA 4F6RB 1G64A 4FCCA 1NFFA 2X4GA 2XUAA 3Q98A 4NS1A 4DIOA 1VL2A 4H3HB 3CN7A 3WK8A 3H1PA 1TKRA 4YECA 1W1WA 1GPNA 2AI2A 3AEQB 5IWAB 3R3UA 2X9VA 3CE9A 2O7RA 5DX1A 4W63A 5A4MS 5C1DA 4AYWA 1RYZA 4OXYA 3AVWA 1T2EA 3ADKA 1M1YB 4EM6A 1T2AA 4X8LA 4CM8B 3AFNA 1QIMA 4NQRA 2RJ3A 3KC2A 2KLBA 3OWOA 3QHPA 4V2UA 2VP5A 5AOBA 3OOHA 1J99A 4M0KA 3IAFA 4HSEA 2B4TO 5ALMA 1Q44A 1IZ8A 1VLJA 1ZMXA 5D51S 5EXPA 1LU9A 3HB4X 5JCJA 3D7SA 3G0IA 1O5IA 4EMTA 1W8DA 3DTTA 3JSAA 2JFWA 3LOPA 3DL4A 4NJOA 3MW8A 3PTZA 4KSYA 1P1BA 4L4UA 1QNLA 1XTTA 3FUXA 3F96A 3OHMA 4YO8A 1S8AA 5K2MA 3WMGA 4BBJA 5IRCD 1D2AA 3ZIDA 3WYNA 3PDWA 3X0DA 4DSUA 4ZOQI 3N2ZB 1N5KA 4NIMA 3ZHSA 1G7TA 2AHRA 3L8FA 5IAAA 4IQFA 3U4QB 5AM2A 3N87A 1NX6A 2R8OA 3T4XA 1GLGA 1S9HA 2X1MA 2YWCA 1JV2B 3C2QA 2ECFA 2HU5A 1NA5A 3B3QA 4JOCA 4XFKA 4D9NA 5IM5A 3TOXA 5G3ZA 1EFCA 5LZ8A 3S4YA 3EFOA 4FUTA 3VVBA 4BLPA 4L5YA 1C9KA 3I5MA 4Q7JB 1PR4A 5CP8A 2JZOA 1JDJA 2Y1CA 3BRCA 1L5NA 4D4HA 5K0ZA 4GBGA 5SY6A 3WLMA 1EB9A 1OT3A 1QH8B 2FXVA 4H3KB 3AKYA 4NBNA 1K3FA 3JQ7B 1DAEA 1HKHA 2AWNA 4EJSA 4B09A 3FIUA 1Z5VA 3O8RA 4BCBA 1E1CA 3LBAA 3MJ4A 4HS4A 3C45A 3QXXA 5EHIA 1FUYB 2V7UA 1AA9A 1IE3A 2WJYA 3EGEA 4ID3A 1NMZA 2GPWA 1GT91 3HL4A 4RA9A 2QRMA 4JQCA 4QVIA 3FN4A 3IR6A 1T4BA 3ZI7A 5AIAA 1UBTS 2C2GA 4CKXA 1WHSB 2ATXA 3G8YA 3IVRA 3WLFA 4D4GA 4EELA 5B1YA 1XELA 3NKLA 1UFQA 3D8SA 1JDVA 4IY1A 4KWEA 3VOAA 3ZR4B 5F9HA 2VQ6A 3AIIA 3G5LA 4RK4A 4MW2A 2I2WA 5COAA 5AHWA 3WNCA 6AT1A 4BP9A 3EXG2 4BX3A 2DTXA 1A2OA 5EHGA 1ODJA 2YN0A 3G23A 5LP6C 3PEFA 5CFNA 2B2XA 4GL4A 1USVA 5FT9A 4LN1A 4GE0A 3SJBA 4NG4A 2FOXA 4TTVA 2X6RA 4KWHA 3G2LA 4J0KA 1I2MA 1QPGA 1MAWA 2DT5A 4F85A 4B48A 5C4MA 1IYZA 1G20A 1J9EA 3H2KA 3JV7A 2I1LA 4KXXA 1NLUA 4RVUA 4Q02A 5B7GA 2A9VA 4QSMA 4M9RA 4LBWA 1T3TA 4U2FA 3VJLA 1JSLA 3BHJA 4MTCA 1R6DA 5LJIA 5KTKA 4YJ2A 2WKWA 3GJ6A 1VA4A 4Q18A 5E4JA 5HRCA 3R6WA 3ROXA 4RTOA 1B0ZA 1RRKA 3MWFA 4P58A 3NPAA 4DRXB 5L4NA 3DTVA 4JI4B 2QSUA 3B7PA 2D5CA 4W5TA 5A5FA 1E3EA 4P6VF 3T52A 2OMEA 1MVOA 2X3YA 3RT1A 3TQQA 3D2BA 3CVOA 2BGGA 3DMHA 4L16A 1WTAA 3U2QA 1N6KA 5JWRA 3AVTA 4G8BA 4W9RA 3AKDA 3ZN2A 4KPYA 4YRPA 1CQWA 4J7UA 4IUDS 1Q0PA 2JZNA 2VI5A 4H3VA 1FFEA 1LWOA 5EJ4A 1Z7EA 3ONWA 4U6SA 1XJ0A 1QOQB 4JXZA 4RETA 1E2JA 3HRKA 4PZLA 2IPXA 5T4FA 1MC4A 2X0FA 2I62A 1XDBA 2AMVA 2F43A 4FDVA 1M0EA 1PWXA 2V59A 1YA4A 2BP7A 2FSVA 2VJCA 3RYHA 1GU0A 4ZAXA 2LDBA 1QE0A 3QVXA 1WV1A 2K6GA 4AYXA 4M1TA 4MS3A 5SZKB 3RRXA 1E8DA 1PCXA 2PUJA 5KDLA 3ENVA 4N0MA 4C0WA 3D3QA 3ZW9A 4KVFA 1YCHA 1YDEA 1E9CA 4YRBA 4D9CA 1OXSC 2K2QB 3V8NA 2X1LA 1XMVA 3LCJA 5B2ZA 4BCCA 4EECA 1QE5A 1KI4A 4TQAA 3BC1A 1DJPA 4U3JA 3LO8A 3H9UA 3EHEA 4OMUA 1HE8B 3HCNA 3COVA 2AWOA 5IF9A 4HH0A 1XAJA 3FLAA 4BOYA 3RQIA 3F5MA 3DF7A 1HNNA 1L7MA 2C29D 3FZGA 4TROA 4O5AA 1PGOA 1Q1GA 4QYIB 1BHQ1 4OLFA 2F00A 3KPWA 1VLLA 2XUQA 5D00A 3ZWNA 3VH4A 2OPBA 4CCWA 4CKZA 3R9XB 1II8A 3DNPA 4GXQA 1ULUA 4JC0A 5IDVA 3U13A 3IUQA 1P4RA 5K4GA 1OWLA 5IT4A 4LF6B 1Q0LA 1ZJWA 2WAXA 3FCUB 2IEIA 4L51A 4RC9A 1QHXA 2ZJOA 5KVSA 2A0WA 4F3CA 2QXYA 4QWMA 5EIWA 5TRTA 1TCBA 2K2WA 1XCMA 3QW4B 3B38A 3UW3A 4ZAGA 5DP1A 3NCHA 3U3MA 3LP5A 4S1OA 3R4CA 2PBRA 4BMCA 4PYKA 4GPIB 1J0CA 3EW7A 5C2JB 2XB4A 1BCRA 4ZYXA 3OZFA 2R0QC 5BSVA 3IAS6 1ACLA 2EWVA 3QEOA 4R8LA 4L1KA 2OCIA 3JALB 2V7PA 3EVZA 2ZJ8A 3C24A 1U7HA 3FI9A 1EFTA 4GH5A 3PS9A 4QQKA 4TYQA 1CJMA 2G36A 4D4MA 4EQZA 1O6GA 2IDZA 4DWOA 2VRNA 4B5KA 4DJDC 1TJ5A 4AF8A 3DE4X 3H3FA 1FS5A 1P9NA 4G5RA 4IS3A 4OXXA 1QIKA 1U7XA 3RREA 5C32A 1CETA 1LBQA 4B3RB 3R6LA 3GBVA 4URUR 3V7FA 2IZOA 4NFSA 1H8ED 3ZQ4A 2NADA 5EINA 3EXIB 1Q74A 4LXIA 4LVCA 1O87A 2ZM5A 1LW6E 2GFQA 4IUYA 5HVNA 4RXUA 4QARA 3I2JA 1DZ3A 4EKYA 1KSFX 2Z2IA 5AW6A 2BTOA 3A4VA 5D3KA 5F1YA 1JWBB 1TTPB 1ZH2A 4WFIA 4UEKA 5LQMA 1YA6A 4FCTA 4M9SA 2Q5IA 1H1LB 3H83A 1Q7CA 2YVUA 3MWEB 1JPUA 3W0LB 3HVRA 4HXFB 4HN9A 1QZZA 1ZUD1 2HHHB 4E0BA 1DJMA 1N6NA 4FFBB 1OT5A 2QT0A 1RT9A 4F9EA 4P4GA 1CQJB 3IXMA 4J0IA 2G76A 1MPXA 1ZBQA 3R3HA 1Q2UA 3E3LA 5I45A 4IUBS 1XEWY 1EUDB 1F7UA 4MUEA 5AI9A 4ZT5A 1DAPA 2GN0A 1YI1A 2G72A 1T8SA 5JEDA 2XD9A 4B7ZA 4YJHB 1CHNA 1IH8A 2VYNA 3SBDA 3GYGA 3H11A 2AMJA 2PMFA 2QU8A 3BD6A 3QLUA 5KTYA 1CRZA 1FX1A 3IOBA 4OU5A 5KOHB 5IXYA 5JNLA 3WFJA 4Q3OA 1X2EA 2JGLA 3MRTA 5K8IA 3DDWA 4HV4A 1KK3A 3W6UA 1P7WA 1JG1A 3CPEA 4CT0A 2EG9A 2NUTB 3PQ8A 4KUGA 2R5FA 2B8TA 4CFYA 3X43A 1N1GA 3U09A 4YR7A 3NEAA 4RH0A 2CY0A 1XGKA 1GXSA 4KXQA 3I6IA 1K6EA 3DDNA 1Z29A 1LTKA 1QGYA 2EZTA 5ED4A 1VYTA 2RKWA 3SC2A 1VI6A 1UPXA 2JGEA 3CSUA 2ZZNA 1PU2A 1SG6A 2CFSA 2IYVA 3ONFA 3SJAA 5HBGA 4IX1A 3WC4A 3Q7RA 4KSBA 1ZITA 3DEKA 2ZYRA 3BEOA 3L92A 3ADPA 4NNOA 4BN5A 2FG5A 2JGJA 4X93A 5JAHA 4DDKA 3M49A 4Q7LA 1ZRMA 3NTQA 2IELA 4X94A 3H7AA 4HYYA 4K6OA 1ULAA 3N0XA 4L3VA 3TEJA 2JHGA 1JDSA 5A9SA 2NAPA 4KHZA 2DY0A 2O54A 1QHSA 2ORYA 1XZHA 2GLXA 3QI7A 3F6BX 5CLQA 1TU3A 2R6R1 3EZ6A 3EW9A 5E9WA 3WJ1A 5JSHA 4M53A 1QQ7A 4PX9A 3T7CA 4MR8A 3ZH2A 5F2NA 1JHRA 3I2FA 4R68A 3WA6A 2ODEA 2CZGA 5JPCA 4GI3A 3FJOA 2DSNA 4TZKA 4MR9A 1H0SA 2ZRDA 2CXTA 2H52A 2QENA 1YBHA 3CLRD 1JZSA 4FJ0A 5LPNA 2Z08A 3EG5A 4QJ5A 3ONNA 5M04A 3IHTA 2EP5A 4HEHA 3S2IA 2IE0A 3L82B 1B8PA 4IHJB 3DDZX 3LQ2A 2PBFA 1QKIA 4CG2A 4R3WA 1G38A 1P44A 2VWHA 4EA9A 1P2TA 2J48A 3ID6C 1Y3CE 2V45A 1TW3A 3LX4A 1RKVA 2A57A 4GZ3A 5AK0A 3J7TA 5J1SB 2Y1OA 5KSPA 4BVHA 1LV8A 1SKQA 1YE5A 3VHRA 1H2AS 4IZHA 3VZQA 2WU4A 4QUIA 2FEOA 4MR7A 1P9RA 3C7KA 1X39A 3HXOA 2V8BA 5AVKA 2TS1A 1Y81A 2VYFA 2BFNA 3CNBA 4M6WA 3WE7A 1MT0A 4TS4A 1GYRA 3OZTA 3TINA 5KB3A 3O8BA 1H4SA 1OBOA 1B23P 1WTCA 4BNUA 1GTL1 3ZQJA 1VCIA 1N2GA 4B6EA 5K9ZA 1XRRA 1EU1A 5TR9A 4EHHA 2XJ4A 5AO9A 4URHA 1NNUA 4FHEA 2AB0A 2ZQYA 2VJQA 4HH3C 1KO5A 1B76A 2NAFA 1XA0A 2ZJBA 3QITA 1NG1A 4HQ6A 2X13A 1G9XA 1RYFA 1N5OX 3NIGB 3U37A 3ZU3A 1P4SA 4C3UA 4UAGA 5AW4A 2BY4A 1SEVA 1MOZA 4UAVA 5HDQA 4I1SA 2UYCA 2OV4A 4WXMA 2GPBA 5DEOA 3ZUPA 1RJDA 2AX4A 3FCEA 1RYYA 1MD9A 4N6OA 3UXMA 1X7GA 5IM4F 2VHQA 1XRMA 1GGJA 4A4DA 3BGSA 5MHTA 5FUMA 1JB9A 4E08A 3OOWA 2FEMA 2VJKA 1FTYA 3FSEA 9ABPA 5TS3A 3NATA 1TQ6A 1ESDA 2RGCA 3FJYA 3GO4A 1YNSA 4FFVA 1FP2A 1IBCA 1HUQA 1V26A 3IBCA 3H84A 1RHKA 3FB4A 3NBKA 4KKVA 4M8LA 4RL4A 2A0UA 4ATNA 2Q4TA 1M2VA 3PC7A 3USCS 1I4LD 4ABYA 2YWBA 2ZTUA 3H9EO 1HI9A 2J0SA 3STVA 1EX6A 4BDSA 1NASA 3OT1A 3CT4A 3ZWAA 2D1FA 2W6CX 3X1JA 3NYWA 3B6IA 3VSDA 3I9OA 4W7SA 5K0BA 1H66A 1WXHA 4CKWA 3WRYA 3HBJA 4UHDA 3PR3A 1F8UA 2NWQA 2O8VA 4BGDA 4O4LA 1L1RA 3TTVA 1EUYA 3L1IA 1RWWA 4QDTA 1A9XB 3PNVA 1NWHA 3BVPA 1VYHA 2NU8B 1FS6A 2D5AA 3JWEA 3GOQA 4TUYB 3U5ZB 5AHRA 3WWOA 1H2ZA 1ZNWA 4C20A 3FHCB 3DAOA 4TKVA 2VF2A 4LF5B 1DI0A 1G98A 3JQEA 3PDHA 3PJFA 4U9IS 4AJ4A 5B58C 2WI8A 4EUNA 2TSYB 1PJAA 1VKHA 2WTNA 5HK8A 5AVUA 2NTVA 3OZAA 3REQA 4C1BA 3GX1A 2Y77A 3EFEA 3K0CA 3O4IA 4CV2A 4EG0A 4ETIA 4FR5A 3G0HA 1P8JA 1UXJA 1QHFA 3UT0A 1UZLA 4MGHA 3WYGA 3VPBA 4PZAA 1ISGA 1U9IC 3IMKA 4EGJA 4TYYA 1SC9A 2OGWA 1QHYA 2XUJA 3MC1A 5TF4A 1FQWA 2QTAA 3VU1A 1EIWA 2A9OA 2QLBA 3OKAA 4RFLA 3RHZA 2EW8A 2O0JA 2Y05A 3I0MA 1Y8QA 4RGVA 3TOSA 2OMKA 4F12A 3EUEA 3VSBA 3FWNA 4UFPA 2BFEB 3M6AA 5FPHA 2GEFA 1DBPA 3D5TA 4EG7A 4OQPA 3LMKA 3QKRA 3MUFA 3ZQUA 1OYVA 2C07A 2F9LA 1W4CA 2IVFA 2FW0A 1GU1A 1R0KA 1DRVA 4R31A 4UXIA 3UG6A 5AOAA 4DB4A 2C2XA 2KE5A 4K9RA 3ENKA 4L2IB 1QG6A 2J07A 5BSHA 1J20A 5LCXA 1B6TA 2FQWA 1RR6A 4NBSA 2GZ1A 4O02B 4K6GA 5LUAA 2YZKA 4FP9A 4L76A 5AKEA 1E6KA 4MROA 5JNWA 2HSEA 4KFRA 4BVKA 1OZGA 2O14A 4TMVA 3A1FA 1Z0SA 1HDYA 4IDPA 2IHJA 1ZRHA 5U4XA 3OEEA 1E1NA 1IBSA 4QFCA 1ZVKA 2HK6A 1NVEA 2QMEA 4WKCA 4B3TB 2VHWA 4QNMA 4I9NA 2J9RA 3AETA 5LA6A 2FRDC 1O54A 5CDUA 3HRIA 4Q24A 3SSOA 4LECA 2GN8A 3VGPA 1AC5A 2FN3A 1TT5B 1DJLA 3L4BA 3SNKA 4TYNA 1MV5A 1YOBA 3GU3A 1UZUA 3MD0A 4NYIR 3LUJA 3ZHTA 5BWMA 3F3SA 2YC2C 3GLIB 2VCEA 2LGJA 3UJPA 3U81A 2NACA 1C29B 4LXTA 2ZJ5A 2FP3A 1G8HA 3A0UA 4QOJA 5AM5A 3W8NA 1T8PA 1NBOA 3R7SA 5LMUB 1DEXA 4EP1A 1PR5A 3NIBA 4C01A 5AW1A 4M87A 4Y2SA 1JKIA 4BV3A 2QYOA 4I5GA 1U8ZA 3T4EA 2PXHA 3KOWA 3I64A 4X7PA 3VHXA 4EY5A 2O7NA 3VAZA 1GUAA 2ID8A 1G8KA 1XDWA 2HYIC 3PUWA 1KGSA 2WWHA 3Q41A 4ZJUA 4R7GA 1XEAA 4BNFA 5ADWA 3E15A 3UKOA 4B0OA 4GGMX 5HZHA 1P29A 1FTGA 3AHJA 1QP4A 3A26A 4RPKA 4BC0A 1NVDA 1TXGA 4KO4S 4H1VA 1JH9A 4Y9RA 2F2TA 1E9SA 1GPUA 3LT5A 2BBWA 1G3QA 1U2QA 4RMHA 1I7NA 4YRKA 1N6PA 5DTQA 1ZXBA 2FVYA 2WJGA 4N8EA 3L7DA 1TDJA 4MARA 1UR5A 5DWQA 5C0OE 3MVEA 2IH5A 2VYVA 3KKEA 3VZDA 5JJ5A 3OC0A 1OHHA 1TUGA 3ND8A 1MR3F 3QI2A 3GAZA 5K3FB 3QNMA 2EBFX 1U80A 2YJ5A 4IZ6A 1E3WB 1OWNA 4WNIA 2YWEA 3ONVA 3RF7A 4E3ZA 3RYCB 1JAYA 3QMWA 4H31A 1YT5A 1I3MA 2E49A 3T9EA 4DSTA 1UBUS 4HVCA 2XBUA 3R7NA 5JE8A 1Z2NX 4LRWA 2Z8XA 1FY2A 4J90A 1ZA1A 4Y1RB 2HMTA 4RVOA 2VTEA 1MT3A 2BGKA 3LFTA 3VYUB 4F9FA 1KBQA 4AKEA 5DT9A 2NMVA 5CURA 4RPLA 4WJLA 2R1TB 3IEVA 2CEKA 5H70A 3T9BA 4K2AA 3R0VA 4YC7A 1QOPB 4OXRA 2GEUA 2GK3A 4IF4A 1NUPA 1SU4A 1ZMBA 3QYPA 1SBIA 1LDGA 2WBLC 4CQJA 3VZSA 1Z8NA 1ZH8A 2TMGA 5KVQA 1E7RA 5C8XA 3ZOKA 3AI3A 2NO7A 4CMIB 4PF1A 3ZEAA 4AZWA 1IEXA 5CVEA 1I1OA 1V3TA 2PZFA 5JADA 2GEVA 2I8LA 3OAAD 1C1HA 2DFKB 3WI7A 1C3JA 1V47A 1CU1A 1CUZA 2W93A 1FDWA 1ETHA 3PD7A 4CHTA 4DTCA 4C89A 1NKSA 2AYZA 3GUUA 2QVCA 3MJCA 1H8HA 2LKCA 3PE6A 2GJSA 4Q47A 5SICE 1BFUA 1KR5A 3DMYA 2AEJA 3EX7C 1QDLB 1P0PA 2O0HA 3GJYA 4CQNA 3HRHA 1XZEA 2X58A 3R3ZA 3UK6A 2UXCB 4TXHA 2HY7A 3CKYA 2Q0SA 3RU7A 2NXNA 3BK1A 4B40A 4X1IA 3G5MA 3QVLA 5I7SA 3BMQA 3AFMA 1L4EA 1YV9A 4TMYA 1A4UA 1EVLA 4GI1A 2WSSD 3O9VA 1TA0A 5CCBA 4B3MB 1B6SA 2IYSA 4I3GA 1NULA 2XCTB 2GCGA 1N32B 3GCDA 5HDBB 4QNNA 3AZPA 721PA 4KXVA 1TE2A 3UXHA 4YUZA 1E69A 1AGYA 4W1RA 4TZ6A 5TQ0A 1AK2A 2YYYA 1K8YB 4F91B 4E2FA 3BMXA 2HQBA 4KH0A 4DSZA 1OXVA 4RK5A 2C99A 4LA4A 2RBEA 1BDBA 1IB0A 2GZMA 1QYIA 2O3SA 3E7PA 3N59A 5DCWA 4E5MA 1JLLA 3NHWA 3RFFA 3M89A 1V7QA 1V8PA 2BCGY 2F4NA 4QTZA 4TWZA 5JY1A 4YHHB 3IKTA 1KERA 3GARA 1M6VA 4GC9A 1C80A 3I39X 1G8PA 2DWOA 2PZBA 3MGAA 3VDQA 4M7PA 1Z0AA 1V35A 3C4VA 4UBKA 1FP7A 3ZHZA 4AP6A 3JWGA 1PEKE 2F3PA 3MWDB 1TLFA 5CX1B 2G4CA 2UZ1A 2IYEA 4DMMA 1I0LA 5EERA 1HETA 3WLEA 4N41A 4OHVA 4B84A 1NLYA 4CWAA 2C7PA 3PFBA 3KDAA 2W2XA 4YJ3A 5FR2A 4YBRA 5A4FS 5C4IA 4DY6A 1X8JA 1AQNA 1JG3A 4ZVOA 2XF2A 2G80A 3M6UA 5KWJA 2OGTA 4U9UA 1IHDA 1YZNA 5DK4A 4HDMA 5JJCA 1ZPDA 1Z25A 4O1HA 1D7AA 1IAVA 4IJMA 4MQFA 1FTSA 3ZGOA 3AR3A 1X1AA 2H4HA 3ZGYA 3KOYA 1TMGE 1NVTA 3G2JA 3WLLA 5IANA 2OV2A 3FHTA 2XMBA 4YGXB 4MRVA 3ANNA 1B0AA 2BHSA 5IUKC 2XRMA 1OZHA 4X65B 3DZJA 4YJ2F 4E2YA 4OUKX 4Z6KA 1CE8A 5KJ1A 1GOTA 5BYKA 4OHZA 4EW1A 3PZRA 4PYIA 2TECE 4E31A 1MNQA 4G0OA 5IS2A 3MJEA 1P72A 3HVIA 3R3WA 2R3SA 1A8IA 2D5LA 3ZWQA 3MLBA 1G5IA 2R47A 4Y6QA 2YQ4A 4MOWA 5KOJA 3BQNB 3F0TA 3V33A 1OXKB 2CK3D 3IXQA 3O1JC 1VHQA 3G2MA 3Q10A 2QP3A 1YZ3A 1Z2PX 2PKQP 2IPMA 1M2OB 1V5IA 3E3MA 1WCIA 3HYSA 3M33A 2QVXX 1O4VA 1XMPA 4B3FX 1XLUA 1BMFA 2QVBA 1U8CB 1KAQA 4HNRA 3D7MA 2C5GA 3EN0A 5AKXA 3W2FA 3JYOA 5EJFA 3GPBA 2Q4BA 2BH9A 2PBZA 4RK0A 4DIBA 1M2EA 4WT7A 4DARA 3C6QA 4FE7A 1X1EA 2V7QD 3X1YA 3ZE2B 1J1UA 1UAYA 2WU8A 1ZIDA 2ETXA 2RH4A 3AM4A 2EFDB 3ETEA 4L8FA 1D0VA 1UJ4A 1XA4A 1OV4A 2PKXA 2R6CA 3KZKA 2BRUA 3LRXA 3M4ZA 3OQJA 4RNCA 1M1YE 2H4YA 1HDOA 5C8YA 4D92A 6REQB 5AVXA 4Y6GB 1P1HA 1TKCA 1RXWA 1ULHA 1VL6A 4N3BA 2QIOA 3QF4A 3KFLA 1FTWA 3B9QA 3W5BA 1RC8A 5B1SA 2VBIA 2I5PO 3OETA 4M7RA 2XT9A 4P0QB 2FE4A 1U7ZA 2X5JO 4OHFA 2X8LA 4UM7A 2FPUA 2IYUA 2IH2A 4EY4A 4NBRA 1AKRA 4OGWA 3SYTA 4X24A 4RZIA 1U0OC 5EQFA 5CXSA 3T3MB 1WNFA 3H9BA 2G5CA 2GCEA 4OP3A 5C81A 2F8SA 3AU9A 2P9QA 1TM2A 3IEIA 2JHPA 4P3YA 2YOHA 3CA8A 3ZDDA 4B8WA 5D7NA 1RPJA 1T0BA 3BKXA 1G3UA 5CG1A 2XVXA 1B7GO 1GG9A 1M2NA 1TLLA 5H4HA 1MFZA 2EWMA 2HEIA 5EQDA 2O8BB 4J4HA 4MYCA 2HUNA 1F2DA 3H7IA 4DWWA 4HO1X 4F6LA 3HE3A 2D1RA 1E1QD 5HPYB 2C9BA 1UADA 3MTBA 1EHCA 1PT9A 3FTQA 3I12A 2OY0A 5FOSA 2EDAA 2CNDA 2BM8A 3CLUD 4PFSA 3L0ZA 3PX2A 3EEYA 3ZK8A 2WFAA 4KQ6A 4EG3A 5DGXA 1R0WA 4ODIA 3FPGA 5TGDA 1GEGA 1XDDA 2W4MA 3K0HA 4A27A 1QS0B 2FWIA 1QH1A 4N1AA 3ETLA 2JK1A 3KYIB 5AKKA 4KDFA 2YFKA 3OSUA 1RIIA 3TNFA 1B14A 2JLRA 4ARSA 1BOOA 1OCEA 4PU0A 5BQPA 2GLUA 3TOCA 4AZSA 1SRRA 4QHTA 2HIHA 5FL7A 2R7AA 1N2OA 2WUEA 2AQKA 4L8YA 1W0KA 4LF8B 1MB0A 1AQLA 1SCKA 3KAPA 3QXSA 3A9TA 2I1QA 2JIZA 3G9XA 3ILHA 3OM1A 4FMCB 1IHXA 4TV9B 3CM0A 3RS4A 1YOVB 2C9DA 3CRZA 3TZEA 3ER9A 2EG5A 2NSLA 2P5SA 1XZNA 4MQ4A 1IBMB 3TNLA 4RFVA 2QQGA 3M6XA 1G291 3QPAA 4Y2VA 3JVDA 1ZOPA 3M1AA 2ORIA 1EVZA 1NR7A 1FFBA 1H0KA 1TEXA 2JIBA 2QV0A 1KI6B 4FFWA 5B3AA 3DO8A 4X71A 2JVJA 3VPCA 2YJNA 4JI7B 2OP0A 3FPSA 1SOMA 1CUDA 3E3NA 2ZWPA 5B1HA 2HHCA 1U2ZA 2YJ6A 4P98A 1R12A 1ZSNA 2QRGA 1T8RA 3FWKA 3PB3A 1JFFA 2IY8A 1W88A 2IHUA 1PYDA 2RK4A 3JQAD 3QYJA 1T1JA 3O26A 1NR1A 4M0FA 3OJCA 5DHSA 3WP1B 4EZBA 2ZUSA 3I9MA 4QGFA 4DUYB 2GWRA 1D2CA 2KBEA 2Y66A 5CLGA 4EYEA 1KC3A 2C8VA 2EDCA 2HI0A 1JWAB 3PGA1 3MJHA 3R3SA 3BL8A