1QBGA

Crystal structure of human dt-diaphorase (nad(p)h oxidoreductase)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
272
structure length
272
Chain Sequence
VRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD(P)H DEHYDROGENASE [QUINONE] 1
publication title Crystal structure of human DT-diaphorase: a model for interaction with the cytotoxic prodrug 5-(aziridin-1-yl)-2,4-dinitrobenzamide (CB1954).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 83
structure length 272
sequence length 272
chains with identical sequence B, C, D
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 1999-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qbgA00
1ZWKA 4YAOA 4HS4A 1J8QA 1YCGA 3JSXA 5B3KA 1D4AA 3P0RA 1CZKA 4FGJA 4U7FA 4QOEA 4BMOB 3S2YA 4U7GA 1OFVA 3EDOA 2R97A 3OWHA 4PU0A 4YQEA 3N3BC 4N82A 3GFRA 4YALA 1ZWLA 1SG0A 3QFRA 3OJXA 2XODA 3OX3A 2QWXA 3OX1A 3W79A 3QE2A 5F12A 1X77A 1CZLA 3G5MA 2HPVA 4CETA 2M6RA 1XT6A 2FVXA 2RG1A 1DXOA 3HLYA 3GFQA 2B3DA 4ZVNA 3W78A 4M0CA 4NULA 4ZVLA 5F51A 2MWMA 4FX2A 2KLBA 4QOFA 1TLLA 4Y7CA 2QX9A 1ZX1A 4HEQA 4N9QA 3RPEA 1B1CA 3NHWA 5NULA 1AKUA 3NHKA 3LCMA 2F1OA 3FW1A 3OWXA 3B6KA 2ARKA 2QX4A 1AMOA 3B6JA 2D5IA 1FVXA 4H2DA 5JROA 2QR2A 2Z98A 2V5UA 1C7EA 3F90A 5EAIA 5LBTA 1FLAA 2OHJA 1SQSA 4Y9RA 1CZNA 2QMZA 2BZSA 3F6RA 3FX2A 1QR2A 5NLLA 3SVLA 3TE7A 3LT5A 3W7AA 3O73A 3D7NA 3NHRA 4LA4A 2OYSA 1FLNA 4F8YA 2M6SA 1RTTA 3NHUA 1E5DA 1WSBA 1H66A 5LLDA 1V4BA 2BN4A 1CZHA 2FZVA 3OJWA 2MTBA 1DX9A 1J9GA 4FGKA 1GG5A 4U7HA 3K20A 2N1MA 4R81A 1AKWA 4LTNA 1XYVA 6NULA 4ESEA 2OHHA 3N39C 1FLDA 1F4PA 4NLLA 5BUCA 1J9EA 1RLJA 4C14A 3NHSA 1D04A 3NLLA 4ICIA 4BMPB 5LJIA 5F4BA 5FX2A 3ES9A 4C0XA 2FX2A 3ZHOA 2FDXA 3U7RA 2XOEA 1T0IA 2FZ5A 3ESZA 4C0WA 2KQUA 1QRDA 4QODA 1QHEA 3U7IA 5TGZA 1T5BA 3NHJA 3NHPA 1AKTA 3O2NA 4Y9UA 2GSWA 3R6WA 1FLVA 5ULLA 2AMJA 2MT9A 3OX2A 4LAFA 1BU5A 4ZVMA 2R96A 4LTMA 3TEMA 3KEGA 2BF4A 3L9XA 2HNBA 3FVWA 4DILA 1CZUA 2BPOA 2Z9CA 3NHYA 1C7FA 4ZVKA 3ESYA 1VMEA 3EYWA 3K1YA 4YAUA 5FUQA 1AKVA 1AG9A 5A4KA 2Z9BA 3N3AC 5EA2A 2V9CA 5LMCA 1XI2A 4CF6A 3NHLA 1AHNA 2V5VA 2BMVA 5B3LA 2A5LA 2FOXA 3QFCA 1KBOA 3W77A 2QX6A 2QX8A 3FJOA 1DXQA 1FUEA 4QOHA 5EMNA 4N65A 4S24A 2Q9UA 1I1OA 4XDHA 1YOBA 1TIKA 4QOJA 1RCFA 4OXXA 3NFRA 1CZOA 3GFSA 2HNAA 1AKRA 3UXHA 1RLIA 1FTGA 4YAWA 4YAFA 1J9ZA 1JA1A 5FA6A 2QMYA 5LBUA 2Z9DA 3ESXA 2OHIA 2WC1A 1BVYF 3HA2A 1XYYA 4QOGA 1AKQA 1YCHA 1NNI1 5LVAA 1QBGA 3HR4A 2Q62A 1OBOA 1WSWA 1FX1A 1YCFA 3KAPA 4H6PA 4XDGA 2FAXA 4LTDA 3B6IA 5LJLA 4FGLA 1D03A 3NHFA 4GI5A 4C76A 4DIKA 2X2PA 3GAMA 4QOIA 3L9WA 1YKGA 4PTYA 2FCRA 1OBVA 3KAQA 3F2VA 3UXEA 1KBQA 3F6SA 4GQIA 1YRHA 1JA0A 2ZKIA 4DY4A 4J8PA 1YDGA 1AZLA 1CZRA 3KLBA 3FNIA 2FLVA 2X2OA 3OVMA 2MOKA 3B6MA 1H69A 4GR9A 4D02A 4PTZA 2W5UA 3TZBA
chains in the Genus database with same CATH superfamily
1IK4A 4MMZB 1ODKA 2B94A 3HVJA 5ELLA 2BTOA 3TQSA 1SHLA 3NJRA 4ZU3A 3Q87B 1J8QA 2IGBA 1Y5MA 5SYMA 1COWA 1N2EA 3TPZA 1J06A 3CFYA 1KFEB 1KZ1A 2FJUA 4JYCA 2Y9PB 4L2IA 2HW8A 1XRMA 1L4LA 1OBCA 2FH5B 2YN2A 3KHTA 5HGXA 1RWVA 2H11A 3C3BA 4IQ8A 5K01A 4CCYB 1QHSA 1CR6A 2ZJ7A 4IDDA 4U7FA 4J6EA 1U2PA 5FP0A 1DUVG 3F73A 4R8SA 1A8IA 1X19A 3BFJA 3EDOA 4Y6QA 2CLKB 5HILA 1RBMA 3UNXA 3BICA 4YHHB 3T99A 4U5QA 3ICQB 2C5BA 4NK4A 2ZXUA 2B0JA 1KH1A 3OBBA 4TWRA 1GQFA 1GUZA 1S2LA 1Y6ZA 1N5IA 3A32A 5JCZA 4KMOA 5EXXA 3ITKA 4GE3A 4O59O 1UEJA 3E8MA 1NN3A 5JYCA 5EVCA 1QMPA 4PLTA 4JR1A 1S4QA 4YJGB 1BE0A 3G5MA 4RL6A 3MLBA 1MDBA 2PZFA 5E2AA 5JY6A 1Q22A 2FVXA 3NPAA 3A6LA 3LUPA 3QVSA 1FRFS 3JPWA 3T15A 1ECJA 4YV7A 1KGSA 5J4VA 3L0IB 3WQQA 1GU1A 2ECPA 2PSJA 4AQYB 4JFAA 5MHTA 1F5SA 4GU5A 4EGAA 2WPDD 3WG9A 3UEOA 1O87A 3NBFA 1A96A 1IXYA 4F9EA 4QT0A 3S7ZA 2POQX 1R0KA 1ULHA 2QJOA 3A6FA 5IH7A 2WAXA 1EFRD 2FNAA 1FVHA 4RD6A 2UV8A 1K5DA 3UXMA 1I10A 4EKYA 1D9ZA 2XF8A 3HKCB 4L50A 4R6XA 2RK4A 2BKUA 2QUKA 3E81A 3KT3A 1WF3A 5JNLA 5C37A 1ZGGA 1HT0A 2PCJA 3V1KA 4GS5A 3SKYA 4QGAA 5JXHA 1IWBB 3BE5A 1B3BA 3AT1A 4F2HA 1GAXA 5IUKC 1XP5A 4F5EA 4BVLA 4JL5A 2EV9A 2PQ0A 4OMDA 4KVFA 4DR2B 4MQMA 1PFUA 1CW2B 4XVCA 4IMJB 3RSZA 3GJ5A 5IG2A 4WZBE 2VOEA 1KTVA 2DQ4A 4E03A 1VMIA 1LDYA 3GLKA 1MX9A 1Z8DA 5GM1A 3T5GA 2IEYA 1E0AA 1TM1E 2EJCA 1XF1A 1Z3CA 2CB9A 1MTOA 1SHZA 1FDOA 2I4TA 3AUSA 2YINC 3GJTA 2WI8A 4JOCA 5SZKB 4AJHA 2WVAA 2ZBGA 5KPDA 3VZPA 3U4MA 2Z56A 2I9PA 4XQ9A 3F3MA 2JGAA 1Y1TA 3EC2A 3N53A 4RF5A 3HN6A 4EEXA 3DYBA 4F3CA 4MLZA 1XXHA 3FMIA 1IHUA 1P0PA 3H2ZA 5DXFA 1YJBA 4Q3BA 4EI2A 5C3MA 4N0PA 3H5IA 3N0TA 4LFCB 3V3TA 4UBJA 1K8YB 4TL8A 2CLMB 5D01A 1T4CB 4EFMA 1IONA 1XMXA 2HJSA 4CR7A 3I62A 4FKBA 2W22A 4N6GA 3RREA 5JH7F 1HEUA 4GSKA 4OQZA 2IHZA 1OMOA 2QRGA 2D1QA 3H6HA 4BTLA 3I6MA 1C7EA 2IU3A 2OM2A 3R3UA 3ECSA 1FZQA 3QLVC 5GOTA 3T1VA 1M2OA 4HT3B 3PQ2A 2VF5X 4HLUA 3VDXA 3I5AA 1KYWA 1Q0QA 1I1NA 1HZZC 1G0NA 3FHJA 3AESB 1OY1A 5T7BA 2R4QA 2FPSA 1PD0A 2BCJQ 5H1YA 2K6GA 1BGVA 2QMZA 4YRRA 3SS7X 4RZXA 3KD2A 3P9YA 5K6AC 1ULUA 2IPXA 1SQ6A 1TECE 2OBLA 4EFLA 1QFZA 4ZTBA 3ZGNA 3MA0A 3MELA 4K26A 5F77A 5IJAA 5BN4A 2GKSA 2W6JD 3H4TA 1E7RA 1QLHA 2X0IA 2UYHA 1U0RA 2PIAA 4MUEA 3ZTTA 3NOOA 3EGXB 3DZKA 4EX7A 2D4HA 1GPWB 5AKKA 1X7HA 3BRSA 1ZH2A 3PQ7A 1P9NA 1R16A 1M7BA 2FETA 2O2IA 5KVQA 4D9IA 4J9VA 2WB2A 4AN4A 1KJWA 1W1IA 4Q3DA 3UJPA 3UM9A 1KYXA 2Q8QA 1NC3A 1CDDA 1JAYA 2KI5A 3KHKA 5CG2A 3ZX4A 3UJ6A 2FUNB 2GLTA 1CB0A 1FXSA 1QLJA 2Q5OA 3DTYA 3LGAA 3V4SA 4EM6A 1FBNA 2MIIA 2L17A 3EVDA 3SJAA 4I8DA 2P9GA 5ALSA 1G60A 4GT1A 4YV1A 1E98A 4IV8A 4TM8A 5DH9A 1YA6A 3OMLA 4DBZA 5HSGA 3PGKA 2LBPA 1WCXA 3TQQA 1PI3A 3LS2A 3EMBA 5JXGA 3EULA 2ES4A 1HG1A 2YCLA 2FEKA 3B85A 3K20A 3W9BA 2PX5A 2O8CA 2Q27A 5AK6A 3WIDA 3E84A 1A8PA 1P5HA 3A0RB 2RHRA 2ZJOA 4B6SA 4YP1A 4BFVA 1T9CA 1GNLA 4FSHA 3PUZA 4BMZA 1SB8A 4EKIA 1KYTA 2AMVA 2R8OA 2P9BA 1NU8A 3ICCA 2PV0A 3EARA 3D6TB 3OF5A 4RD1A 1Y63A 4MWSA 4F0JA 2BHSA 2VH5R 1NXQA 2EYQA 5K45A 2QM7A 1ULSA 3GT7A 4X85A 2W4IA 3DM9B 4MPDA 3BG5A 1VSBA 4KNVA 3I73A 4BCBA 1BZYA 2VHWA 1PT8A 1HV8A 3R76A 1CUWA 1LBEA 1EFVA 4NBKA 5IAKA 3TO5A 4O2BA 4RVCA 2ZIZA 1H2BA 4OAQA 4WPGA 2WHXA 1JDPA 5DBOA 1P0IA 4KFTA 4EFDA 3G2PA 1ONSA 1UM9A 4J0EA 1JDVA 4BNXA 2GPNA 3ICVA 2Z4SA 3EMVA 3KJGA 5SY9A 3BIOA 1K98A 3JZFA 2COEA 3LRTA 3LWDA 4M22A 2QRUA 3PXDA 2OY0A 3MWYW 2LKCA 1MW8X 3D1VA 1EVYA 1THMA 2HJVA 2PQ6A 4LYGA 3ZD7A 5J5AA 2DYKA 4MAFA 1DAHA 4LMRA 1U0OC 4REQB 3TQHA 1YS9A 4I4TA 2Z2YA 4AL4A 4B6QA 2ZE8A 1Y7HA 4HP8A 3EOBI 2AUMA 4YH1A 3PXBA 1YB7A 4RK1A 1KR2A 1GTMA 3P94A 3O3NB 4HB2A 4PPGA 4M7PA 1U9IC 4TLCA 5J23A 4AMYA 1TQHA 4W8GA 4F60A 1CUIA 1W1UA 2DHQA 4ILEA 3TJMA 1RXEA 4IS2A 3WK5A 3ZWCA 1PJ2A 2OZKA 1VDMA 1EX6A 2ZI3A 3BF7A 3FSRA 3HWWA 4IIUA 3UK1A 3AETA 4IDPA 4DQKA 4TGLA 5EP2A 1IB6A 1ZOPA 3L07A 4MQ6A 1WQ3A 1E3LA 2EWVA 1KXZA 3KFLA 3PFNA 2QPAA 4QG7A 4UDOA 4A6PA 1R74A 1EJ0A 1SUBA 4ZMSA 4YP5A 2YJZA 1SBNE 3BE4A 1V8PA 3TW6A 4GPBA 4UBLA 3ZKWB 2VPQA 2GSWA 1NYLA 1FLVA 4B6OA 1VPVA 1Z0UA 3AVXA 1QH8B 3VJKA 2P4UA 5K3AA 3S7TA 4OHFA 5AVZA 2R87A 2AJ8A 3G2QA 3JQCA 4ZAVA 4CMKA 4G23A 4N5LA 3PHLA 3KSRA 1YCDA 4ZAWA 3EVCA 1SQ5A 2IXAA 3ZHUA 1H05A 4TS1A 2QYHA 1W96A 2Y1XA 3BFXA 1Y1QA 3AZPA 3BXPA 3PUXA 1A4UA 3CCBA 3AKDA 3OCXA 3G8AA 1Y8CA 1DMRA 3ZHZA 3ZU3A 3ZWBA 1L7DA 1T0PA 4AJ2A 4RY2A 3NHBA 4WECA 4EMUA 2OECA 5FEUA 1ZNXA 3WNDA 3F6BX 2AD5A 4FGZA 1EHIA 3R3XA 1Q1ZA 2JATA 2WJ4A 3L84A 4QEKA 2OCKA 1FFGA 4UMFA 3ORHA 4G0VA 1PRYA 4NZOA 5H7XA 4N3NA 1Y1PA 4Z53A 5FUXA 1Z82A 3FDFA 5A4KA 2YZNA 4P9NA 2ZUDA 1D8TA 3R0VA 3G5AA 4TRRA 3UUWA 3GRAA 1M8JA 4GBMA 2VJDA 4JXJA 5EUCA 3G23A 3ZBPA 4U1RA 4C3UA 4OQXA 1NJ8A 2JLAA 1C8BA 4H9GA 4TQGA 4O4JA 4PYIA 3H18A 5EUBA 3CHYA 2Q1WA 3SIWA 2CXUA 2Z4RA 4TMXA 1H6CA 1W0KA 4TSRA 3SQMA 3SLGA 2V5VA 3A6KA 5DNVA 4E4RA 4BBZA 1MG5A 3K0CC 3JY6A 2FG6C 3M6WA 3DTVD 2UZ3A 2BTQA 4UJ5A 5DPMA 2FOXA 3RDPA 1IHOA 3C15C 1US8A 5FLEX 5HJ5A 1ZOOA 4J90A 3MJCA 3U1BA 4BV2A 2F8SA 3AJ8A 1BCRA 4KZPA 2F9LA 1I0IA 1VI5A 2V03A 2RC5A 3CSSA 4EG7A 5TJHA 4PTLA 1SG6A 5JWRA 1FQWA 5CDYA 4B8ZA 4KXMA 2BLNA 1M2VB 3VI3B 2EHDA 4RELA 2UUCB 1SCUA 1IMOA 2DUMA 4FMCB 1RPAA 2CJYA 4EGQA 2YMMA 5KNLA 4J4TA 4BQNA 4XDHA 1E2PA 2FR8C 2P6MA 3EAGA 2NNWB 1M1YB 1PF7E 3LDGA 5HZKA 1R0BA 2PHZA 3RHFA 1GZSA 2VDPB 4V0OA 5ECYA 3GEIA 2G71A 4JBGA 3A27A 2GO1A 3CX7A 1HFJA 2JDIA 3G5LA 3P2JA 4X93A 4O1IA 1D6JA 3GFPA 1E9VA 4UM9D 1WR8A 1X7XB 5LZ5A 3SJUA 2HWKA 3FGPA 1GDHA 4FWIB 4F4JA 3CG0A 1ESCA 1LNZA 4ETMA 4BV3A 1RHRA 5DCUA 3VJLA 1P9RA 1V41E 1PG0A 1EUZA 3H8WA 3KUUA 4Q0MA 1E3IA 3L8DA 4AXBA 4YAFA 1HC7A 3REQA 5L7WA 2CEKA 5SZIA 4ZTUB 1JZTA 1LS1A 2XPCA 4DJAA 3PT5A 3FZEA 4PLZA 2RBGA 4HUJA 1W5FA 4G4SP 3GGGA 2W2TA 4MWEA 3CRW1 1QP4A 1U2ZA 3DVAA 4H60A 4ISBA 3E3LA 3PQCA 2EX0A 3WDSA 5TS2A 3MD0A 3AILA 4GEKA 4XM2A 3V8VA 3S8EA 1XDDA 1Z7WA 1T9DA 1ZM9A 3GV0A 4PIVA 5IJWA 5IJ0A 5JWOA 1QO7A 3EXHB 5KNBA 1NNI1 2DX7A 3BTUA 4BX9A 2WSSA 4O2BF 3DEIA 4N9WA 4ZO4A 4B85A 1I8TA 3E0XA 4MCIA 4URWR 3WIVA 4ZJYA 4CEHA 3SMQA 5EJ2A 2GFHA 4A1OA 4XB2A 5TEVA 3I1IA 1G66A 1VE6A 4UTPA 3BSYA 3HR4A 3A1CA 3MT9A 1WWKA 4FDTA 4Z4GA 3O38A 3KZVA 2FHPA 5CW2A 4RJLA 5IC6A 5JAHA 5E0OA 4CKWB 2JFPA 2AQIA 2GZAA 3H9QA 3G1UA 5B1YA 3BRQA 3MTQA 3CONA 2ERYA 4GMKA 4M9QA 4I4TF 3STWA 2H0RA 1FB5A 4GC9A 4KU4A 3R9XA 3QVGA 3DFIA 1EFPB 2VC2B 2VPZA 3ASYA 4TMYA 4JN6B 2MSNA 2IWHA 2P78A 4EG0A 1N2XA 1LC0A 1H5QA 4OFWA 4HTFA 1R1DA 1H23A 1WJGA 2FEPA 1X80B 3WGHA 4QPCA 1BAPA 4GOMD 4UOZA 1YKGA 5DGHA 3DMNA 1QX3A 2NTVA 2OENG 5AXBA 2ZRNA 4YJ3B 2J1LA 3VDMA 4JNCA 2ZTHA 1D2NA 1PUJA 1RHMA 4M8IA 4WN9A 4D9NA 4C0BA 2JLYA 3A1TA 1GEGA 2CC2A 3LCJA 3U4IA 4OLHA 2Q1UA 1X7WB 3UXEA 1AS0A 5GZ1A 4J6FA 3WKCA 4E0BA 3W2HA 1C4KA 1EFDN 2YOGA 5CRIA 2ZKIA 2W6PA 3GEHA 5LCXA 1WKVA 2HLDA 3Q15C 3VPHA 3JWGA 1EP2B 3MBKA 1RRFA 4JLMA 3RTGA 3UAOA 3GGJA 2PYZA 3BFVA 3VU9B 4RQAA 4MYUA 3AUTA 1Z6XA 4BX8A 3ZW7A 3SFTA 1XNGA 5DRYA 1XZKA 3QEAZ 4PBRA 2FP4A 2ID9A 2IYUA 2VJPA 1AKYA 1TXGA 3H9EO 4LXUA 3I76A 4O02B 4WD3A 1P60A 4QXPA 4ZOLF 5AVKA 4C87A 5AM0A 4AUMA 1DSSG 3IRUA 4DG9A 1E2MA 3MLAA 4Y67A 3UWDA 4NARA 3CTPA 1TB4A 3I83A 2HJRA 2WD8A 1ENPA 1IH8A 4NZYA 3VI4B 2B30A 2F67A 2VSYA 2J08A 1KOJA 1AX9A 1CS0B 1V25A 1VIVA 5I7AA 1M8PA 3V7UA 3ROFA 5BYAA 2VDJA 1ZY2A 4OYHA 1I33A 5JSZB 4JLAA 1RWQA 4D3YA 4YMTA 4BRZA 1Y98A 1ZHHA 1LDMA 3F8WA 2RI0A 4PG6A 1HNZB 4KQ9A 3NDBB 1C3VA 4U00A 3UV7A 1CG6A 4JX9A 3JSXA 4MMYB 5EE1A 3FOZA 2DB3A 1ID1A 1TOAA 1K27A 4B74A 1XEFA 4HNRA 3EPPA 1GT91 1TKAA 3EFOB 4O4JF 4UQLA 5JR3A 4RHXA 1JB9A 1SKBA 1JBQA 2G7MC 1FTSA 2I3AA 2QTVA 3GW8A 3G02A 4RH0A 3T7CA 4B0PA 2IL1A 1IEQA 4UXIA 2WV7A 1N8SA 3A36A 3RABA 3QEJA 1JV2B 2ZSHA 4TLLB 4AZ3B 3LOUA 5GJWC 2DY0A 1GRRA 1QYVA 1D09A 3IQDB 4B87A 1J2UA 3AIOA 4KJXA 1ZXXA 1XCJA 4MA5A 1BWRA 3DD1A 5AD1A 2GZ1A 3MGAA 5A4IS 1CQWA 2DFKB 1DZIA 1EU1A 4QUGA 3FETA 1O5IA 1E4VA 2WF9A 1G55A 4EG4A 4QQFA 3RU2A 2GQ0A 3WFZA 3TCKA 4AIIA 4GYYA 2EG5A 1G4AE 4K9PA 4Q05A 4DA0A 3EEIA 2P41A 2Q3HA 3I0ZA 2F1JA 3W8NA 1FSPA 1X0VA 2DAPA 3EDRA 3H9JA 3NWJA 5CURA 3BQMB 4WCVA 3HV0A 3MQ4A 4DLBA 1D6SA 1FW6A 1TVKB 3LTEA 2JK0A 3BKWA 1QNLA 4FQ5A 4BPRA 3EBOA 4YN3A 1SBIA 5BR7A 1JG4A 4X41A 4XX1A 2P1ZA 1REQB 4L1KA 1K63A 4O5OA 4ZAYA 5C7OO 4IDQA 3TSOA 1NBME 2AG8A 2JCSA 3RC2A 1JEYB 3PFHA 3R7WB 2C0CA 3HK2A 3TR0A 3I23A 4IO0A 5JJLA 4PBSA 5G2OA 2H2IA 4DMFA 2E5WA 4ZVNA 4JYAB 3AHCA 4ZICA 1E7YA 3BJZA 3FWKA 1U28C 2GFQA 1J24A 2YHUA 2H4JA 2BBSA 1ZIOA 3OZXA 2RHHA 1M1YE 2DT8A 3ABRB 2AR9A 1QG4A 2BKAA 4II7A 2WNSA 4GOOD 1LDBA 2FZWA 3VX4A 1M6YA 5B37A 4DAOA 3CUYA 1FQJA 3JVDA 1CUBA 1K9VF 1C7ZA 3C48A 3ZU2A 4J16A 3ZHTA 2VYVD 4HEQA 4JEHA 5K0BA 3IEUA 5LMNB 3AFHA 3K31A 2JCXA 3PCXA 4BWVA 3ZWWA 4LHSA 1QRTA 5B30A 2F64A 5A5EA 1TJ4A 1ZIXA 2BZ1A 4DXHA 1A27A 4EECA 1N8KA 5KOJB 5BMVF 4Y3UA 2BMJA 3RNOA 2QD1A 1UANA 3CF0A 1YFZA 3TEJA 1KZ4A 3GP5A 1RMTA 3ZTWA 5I9LA 1CJCA 1ZK2A 1M0EA 1ISHA 2WA2A 4XVHA 1XK6A 4A91A 1XVLA 2FFHA 2O2CA 3HE3A 3DDZX 1C0PA 3M3PA 4F06A 2UUAB 2IYOA 4RPLA 3U0VA 3TBKA 3LOPA 2GEUA 4DJ5X 4LZAA 2IX3A 1IQPA 3CLRC 3UC9A 1XMQB 1U5BB 3EWNA 4PYRA 2YJ4A 3VYWA 3FXAA 3KV1A 1CCWA 4B4VA 5JS2A 3PFGA 1G1AA 2DPLA 2B3TA 1W4BA 5JROA 2HMUA 3HB4X 3IT2A 2QR2A 1X1TA 2A2ZA 5I01A 3TFWA 1OSNA 1ZBDA 2JW5A 1C0KA 2OORA 4RX1A 5CX4A 4ZYTA 5IDXA 3N8KA 1HTBA 1NT4A 5DNDA 1BJKA 3IKLA 4TVKA 3RFXA 4YRBA 3BCSA 4FT4A 2IS4A 1EESA 1A8HA 2RGNC 5AXCA 3KLNA 4BLPA 3PRHA 3RYCB 4XOUA 2HHAA 1Z88A 4IPTA 5FAXA 3QZUA 1FUUA 5L3VA 4LQ4A 1EQ2A 1N78A 1E1NA 2DTEA 4LNUB 3FSEA 1AV6A 2O06A 4HTAA 5F7ZA 3FX2A 4WKNA 1S2MA 1V7PC 2QDXA 2QTFA 5EJ4A 2NWQA 4B3HA 1T43A 1EEXB 2I87A 3WGKA 5BSTA 1OT3A 4Q16A 4PZPA 2L2QA 2YQZA 3HKBB 1XIVA 3D7NA 3IBCA 4HFJA 1Z28A 1XPRA 2VBCA 4LA4A 4WXEA 5EE9A 1BDBA 2CDNA 1O95D 1OILA 1YVDA 3GJYA 3HWX1 1JKXA 2AI3A 3IUJA 3QIVA 4Q9LA 2QN3A 3UMGA 2YASA 3M6LA 3NTRA 1OFIA 1PL8A 4CM8B 1M1NB 5LLTA 1UC9A 3EA0A 3O2SB 1XHFA 2SHKA 4GOJA 5IARA 1TC2A 4YT8A 2AT1A 1VFNA 3A06A 4BMSA 5IZCA 1OU4A 4RETA 5KC8A 2DUJA 4BV8A 1OTYA 2PZ8A 4KQGA 1U7HA 4O4IB 4YDSA 1VBFA 1KGDA 4KRYA 5HIIA 3OOWA 3O93A 1OI7A 1WSBA 2J3JA 3R6TA 1Z5WA 3MOGA 3QVKA 3MUEA 4JLOA 3RRBA 3HXOA 2PXCA 4EGJA 4WN3A 5SY6A 3AVVA 1DMSA 1PK8A 3NG1A 2HLNA 3H16A 5F5NA 4ARUA 3PQ4A 4XGKA 4O8ZA 1JR2A 4YAIA 4CQLA 1JSRA 2CD9A 2WINI 3PDUA 3IC5A 2HBRA 4C6TA 1AH2A 3DUFA 4YCBA 2IW1A 3VZRA 2ZW9A 2XADA 4DLRA 5ALQA 1XD2B 3VPXA 2ZBVA 5BVGB 1F2DA 1XBTA 2GZ2A 3CQ9A 3K05A 4ZEWA 5DSZA 1MHTA 2HO4A 2G76A 3I04M 4RHYA 5E4JA 4KLAA 1NXOA 1X1EA 3PBKA 1Q2XA 1GNTA 2ZJ4A 2OUKA 4H7JA 2XQKA 3EW7A 1HI9A 4GPEA 3RU3A 4AUKA 4C4SA 1TZJA 2IUUA 1SBHA 1Z6YA 2JD2A 1PQ4A 2FV8A 2GA9A 1E9FA 1G6HA 2BFOA 4LFBB 2CK3A 4HQFA 3P4UA 3OSZA 2X5NA 1GCGA 5LC1A 4AFNA 3KSMA 3KDPA 5A02A 3LY5A 1HOTA 4Q7KA 4RBNA 3DAFA 3LP6A 3F3YA 1F4PA 3IVGA 2B4YA 4D0SA 1B3RA 1YQEA 1GUYA 3FZNA 4D9KA 1G9TA 4FFLA 4HFNA 2AOUB 3LPAA 4IEEA 3CNLA 4FKZA 4QU8A 1QGED 2FQ1A 3BBPA 5ALYA 1PZGA 1RM3A 3T3OA 4ENTA 1VYUA 3V9PA 3BWXA 1LBHA 1P7YA 1HYHA 2WHEA 3QVOA 5JS8A 3X1DA 2MYPA 2QGFA 2GD2A 4U8GA 1DAIA 2DCMA 5JCJD 3OURA 1FZTA 4NU5A 4LPKA 4J0CA 4GM1A 1P4SA 1PZHA 2O2YA 3WRYA 2OCDA 5FL7D 4ZI7A 1PT6A 4FFVA 1KC1A 1I9CA 1YONA 1I3CA 3W1WA 4DMMA 1CY4A 4X63A 4OI0A 2UU9B 1KYZA 3DO6A 3JWJA 4U2BA 2DKFA 1DQSA 1P7ZA 1Q5PA 4FR2A 3AERA 1PYOA 2R5WA 4JP8A 4MYSA 3TNFA 4NRDA 1V11B 3FPHA 1YQGA 1YNOA 3W6OA 3ZY2A 3T9EA 3D02A 1YUMA 2ZSDA 4QE3A 3C98A 4U4AA 4R68A 3ZVRA 4KQKA 2YJGA 1BKSB 4CG3A 1HGXA 2OBXA 3KOUA 1NOKA 2IK8A 4QIHA 1VMDA 3JQFA 4KUHA 1Y5NA 1V5EA 2ZULA 2YUIA 4NE9A 4YK7A 4Z9BA 3H13A 1O6FA 4C0JA 3UT5B 3NJ8A 2CJPA 3Q9NA 1UDAA 4DIBA 1JXMA 4L8FA 3F6YA 1QP8A 1THTA 3T3NA 2GHIA 1LPOA 1UK8A 4I2VA 3J81k 1HNWB 5JJKA 2ZJ1A 2KS6A 1P2TA 3P9RA 4S3MA 3W3AD 2V6BA 3LP8A 3O4IA 1I5OA 1NUAA 1UFOA 5KYYA 2J30A 3B36A 1UBMS 4H4DA 1QIJA 1SCIA 4DLKA 3DL2A 4G9EA 1Y81A 3ICEA 1YTLA 2PT6A 4RESA 4F97A 1ISRA 1NVEA 4W5TA 2ZRGA 1YZFA 1T1SA 2JEYA 3K8QA 1QORA 1XHEA 1RRMA 3AHHA 1YMQA 4P81A 4NDZA 3H42B 4RLSA 5CDSA 2FZ4A 1RJFA 2AVNA 1T3ZA 1R3DA 3F49S 2C2GA 3D6HA 2UYOA 3LV8A 1PJZA 3ABIA 3BILA 2C3UA 1ITZA 1EH5A 4OMFG 5ERGB 3VKHA 3C3MA 1OKKD 2P2NA 3BL8A 3H7AA 3L46A 8OHMA 3CJQA 4ZVKA 1YQTA 1XU7A 1DXYA 2BDUA 1XFDA 3NWPA 3ABZA 1H8HD 3PQ5A 4LDPA 1T29A 3RR2A 1M2GA 1Z22A 2BGIA 2QRJA 3BGDA 4FYHA 1EBBA 4JNKA 4P4UA 3KUXA 2Z9BA 1Q1NA 1XZCA 3AHGA 3UMFA 5BURA 3WGIA 1E1MA 2D62A 3RC7A 5LXTF 2IHTA 1KE1A 1HKUA 1Y48E 1EFUA 4JBXA 1WHTB 4DLVA 3BZUA 1V7QA 1XELA 3GRUA 4Y1GA 1IATA 4EKEA 2O8DA 2QY9A 1K7EB 4HEHA 3NHLA 4XSGA 5KTOA 1J5XA 2POCA 3VU1A 4RGBA 3OIFA 1R8QA 2BFAA 4LVCA 2DHRA 4ZVPA 2IW3A 3VSDA 5EJFA 4GKKB 1VG0B 7MDHA 4R8MA 3QBJA 3V80A 4K0KB 3CXUA 5DGXA 3L8EA 4Y7DA 4L4SA 4CHGA 5K0GA 5DLDA 4BTEA 3V3KA 1G2QA 3EPRA 3W77A 2LNDA 3RYHB 4GI1A 2AQKA 1Z6GA 2FUCA 3JYLA 5ARDA 3UTCA 1PEAA 1TM7E 1V5WA 2DR0A 1TF7A 2QX6A 3I28A 1ADCA 4FFRA 4UNSA 4FCCA 5GZ6A 3KX2A 5ISMA 3LA8A 4RJKA 4LMBA 5KAPA 4LF8B 1MAWA 2QTLA 4KB5A 4ZEMA 2ABWA 4MYTA 4ZCMA 1R4MA 1Y6FA 2ONZA 3DW1X 5HXAA 4BNJA 1O96A 4FZRA 3ZU4A 3I72A 4TT8A 1XRRA 4KI0A 5KBYA 1ZM3A 1GPKA 2D0DA 1YZLA 1K92A 4CMEC 2HA7A 3V46A 3DAOA 4II3A 1WW2A 1ZXBA 3C2QA 4DPMA 2L82A 3UJBA 1XZEA 1OHHD 3PU6A 2Q3JA 2CFRA 4WWHA 5A5DA 1L3CA 4WW0A 2B2CA 3E70C 2FPGA 1QHFA 2K2QB 4CMBA 4LXQA 3LUKA 2HT6A 4PSCA 1EGHA 3LAWA 4Y9SA 3CW2A 3NH6A 3AJDA 2HOQA 3X1MA 5FA5A 4F21A 2BISA 3K30A 5CG1A 1JA1A 2CF6A 1SOMA 1E2KA 1K88A 1QDUA 5BNIA 2H0QA 1SVMA 1E9AA 1FMLA 3GAAA 4TPKA 1C3OA 1H0SA 4J3JA 1PNTA 3QIAA 4IIDA 4XDZA 4WJKB 2OK7A 4Y0VA 4O5AA 5JD5A 1U9ZA 1BCRB 5JY1A 1EK6A 2WZDA 5EZ6B 1VG9B 2GPTA 3MJFA 4CF4A 1BVYF 3HA2A 4QXMA 1PR1A 1PR9A 2IYXA 1GHTA 3HBNA 4JEIA 3TW4A 2WT9A 4TL6A 1Q1EA 1SCUB 1HA3A 4E51A 1USKA 3CR7A 1RC1A 3I8XA 4EYSA 3U3OA 5TVGA 4LZWA 4BE4A 5K3EA 3L93A 1HQKA 3RGGA 1O89A 1G8AA 1GLGA 1YR9A 2J48A 1KS2A 2DTDA 3DO8A 3RYFA 4TZ6A 4Z3KA 2Q2VA 5TT1A 2BBTA 3GCDA 4YUZA 4KXLA 3BIXA 2YIVX 5FBRB 5ALKA 1WUJS 2W48A 1Y82A 3VTZA 4EG3A 4F1WA 1BVHA 2ZTLA 3KHUA 3O0TA 1JEQA 4UARA 4KN5A 1GFIA 3GJXC 5JFGA 2H3HA 1K8XB 3BMNB 4ZKEA 3R9XB 2WUFA 3Q7SA 5L4LA 3FN4A 2Y1KA 1KDZA 5FLXA 5CDFA 1V8ZA 3OLQA 2YL2A 3HJAA 1TFUA 4RKRA 1LJUA 1UKAA 3IB6A 5BUZA 2Q0SA 3EEQA 4C76A 2F90A 4HX2A 1L9XA 3O21A 2X1LA 2NVBA 4F84A 5LSAA 4JEUA 5L6LB 4C7VA 3A2MA 4RDXA 3K9WA 1ECFA 1X1SA 2DWCA 3QEKA 1XU9A 4JIMA 4A4DA 1ZOSA 3ACDA 2GZSA 3L2OB 1Y6QA 3P97A 2QB5A 4HXGA 1Q0LA 4V0QA 1BYIA 1Z2AA 1C30B 3F5SA 4NX2A 1X92A 3BD9A 5CTAA 3TGLA 4HN9A 3QEMB 3FG9A 1EDOA 3ZGZA 3LKVA 3UOAB 4DSAA 1MVOA 1RJWA 1IJEA 2PD3A 1F51E 1NVBA 4B80A 3CMMA 5H68A 3T4XA 3ILXA 5DHFA 4CEHB 2GJKA 5DBIA 3EODA 4EYQA 5KYWB 1T5TA 1VPDA 3QXCA 3S0JA 1UFVA 1ZIYA 3IBSA 3DMHA 1YJCA 4DNXA 1KHHA 4OU5A 1EJ2A 2AN9A 4TWJA 3LRPA 4B75A 2WY2D 2C9YA 3T4EA 5ITZA 2V5AA 3EG9B 5B6JA 1O1YA 4YT2A 1PNRA 3RJ9A 2JAQA 1MNAA 1XAIA 2YVKA 5BQPA 1VYHA 4EO9A 1I01A 1K7SN 1O9BA 1DTSA 3FB4A 2PMBA 3WKEA 3DCJA 5BV2P 3DOIA 4JEMA 3FKSD 2JFOA 4CT0A 1CWUA 2R1ZA 3O3CA 2HMYB 4Q1BA 4HDQB 2W93A 2O3UA 5KWEA 1X6VA 2WAYA 4UC0A 2QBYA 3WSWA 4C30A 4M3NA 4BFXA 2ALJA 3NW9A 1ZRSA 4LSGA 2ERCA 5BSVA 2GK4A 4ASUA 1Z0DA 3ELBA 2Q3DA 2FCAA 4C7KA 3E4CA 4JV5B 1GR0A 3AJ9A 2FMTA 1VECA 4WN9B 5AIAA 2XE6A 4CKZA 1RPTA 3P9XA 4G1BA 3KOZA 2GEBA 1C1XB 4BNLA 1Z2DA 3RVMA 4MUGA 1OVGA 2X19A 1B6TA 1A0OA 1TL7C 3KDAA 4PZDA 3VZQA 3AVUA 2ISCA 1CJTC 4QU9A 2MSEB 3H1PA 1KYVA 3BSFA 1JIUA 3GG2A 2C77A 4JVOA 3HBLA 1ZUD1 4JS0A 4UNPA 1FMCA 4LHEA 4ZQHA 4N47A 2V98A 2FP4B 2XUQA 5EERA 1AHHA 2JLWA 4MDYA 4KN6A 3IXMA 2H08A 4A0FA 4UPEA 1JDZA 5ICSA 3D8RA 3PUIA 1CY1A 5BNFA 4KQJA 5BSUA 5TPWA 3H5NA 1XMSA 2Z8ZA 4OUDA 4MHOA 5ELXA 3ZOZA 1T36A 1LVGA 2Q8NA 3OTIA 1TO1E 4X94A 1X1BA 2CLSA 2A1IA 1KKLA 4MQBA 2OSVA 3GN2A 4MRMA 3VO9A 3SOPA 2ZRBA 1P2GA 3F47A 4J0IA 2W6MA 4KO4S 3WMEA 1G63A 1DLIA 2WKSA 4L4RA 4QQNA 2YWFA 4UUMA 1RHUA 4R9NA 2P8JA 3C24A 1KF0A 5FI0B 1SKYB 3CYFA 4Z2AA 1T2EA 1U5CA 1TEHA 2WU8A 1UJBA 4RV4A 2BHNA 1RI3A 4HNHA 2GM9A 1FFCA 2OD7A 2JZCA 2QQ5A 4M46A 1ICEA 1J2TA 1QFMA 3T3GA 3NGMA 3QWBA 4C6HA 3FNRA 1II8A 1X7YA 2Q9CA 2QTVB 3H1BA 2DFVA 3RC1A 1D5CA 1E2UA 1JS1X 2ODEA 2A14A 2PZMA 2WWRA 3QI7A 3USES 4IDFA 3PE3A 1MB0A 4NH0A 1DBQA 1UWKA 4Q4HB 4AY3A 1GA1A 1V1JA 4NHEA 2R7KA 4CTMA 1XQ6A 2CKDA 4GMHA 4JWTA 4ZCPA 1PZMA 4M9RA 5EPUA 5DBHX 4BNWA 2RAPA 4Y1RA 5EUMA 4DADA 2W2KB 3BH7A 1U4NA 2XUGA 2A5DA 2P6PA 3F4LA 2CHFA 2W0MA 4FFBA 1E7QA 1JVNA 1XJCA 3S3TA 2O7SA 3KWMA 1X1DA 1YIOA 2XJ9A 2B36A 3PTZA 1KWGA 4GYKA 4YRMA 3S81A 3BEDA 4LFAB 3D3EA 4MUAA 4UASA 3RAJA 1HYEA 2X9LA 5ALNA 4LK3A 2GLUA 2HRBA 2O3QA 4BNHA 3IV7A 2CF5A 1RXIA 1GNVA 4K88A 4RMNA 1EX9A 3UMMA 3AG6A 4P8RA 3KQYA 2PMCA 3BCUA 2IHVA 4KACA 1DB3A 4EH1A 1Q0HA 3IMCA 4HD8A 1CJBA 1JQAA 2FUG6 2H4FA 3HSSA 5HFNA 3U39A 2F8TA 5CM8B 2Z3ZA 4BDTA 2HADA 3OWXA 4BE9A 2ZI6A 4WDQA 5HZHA 1A72A 4N1AA 4CM4B 1ECPA 4H3KB 3D6FA 3WLKX 1R0SA 3ZZMA 4PFSA 4RZQA 4DREA 1XZFA 3EX7C 2VZEA 1IBMB 2WIKA 4OJQA 5JQGA 5BQ5A 3CLUD 4YB8A 4LQDA 2EQ5A 4P53A 4QGFA 2GUWA 4I5EA 4HXEB 3VAAA 3A3OA 4C6RA 4N49A 1ZK3A 5GIPE 3GP8A 2OFXA 5ALZA 1L7NA 1DV1A 1G5QA 2WWYA 1IXZA 3CJRA 1ESZA 4M0KA 1JKIA 3PP8A 3TPFA 3G89A 3A2NA 4PYQA 3BAZA 3LX4A 1Z36A 4I66A 5DN9A 1TM3E 3SR3A 4EHAA 5ITWA 4PAWA 1L4KA 2M98A 2ZPAA 5JVDA 1KEEB 2VPWA 5IX8A 3KOYA 5JO0A 1TGVA 1TJNA 2ZIXB 2ZJ3A 3ANLA 1LQTA 2YICA 3BK1A 3K35A 4JA0A 4WHMA 4YCJA 4ZCRA 4QZVA 2IHNA 1XCMA 2PVSA 4J03A 1NF9A 4BPBA 1KI3A 3U60B 3L7BA 2Y9MB 1JKJA 3KBBA 1ZJ4A 1A9YA 4Q00A 1W5AA 5DW3A 5HG0A 2H1SA 2Y6UA 2NYUA 4XJVA 2DUNA 3K1TA 3NHRA 1FQKA 4XPIB 2WD7B 3BD6A 4L16A 1JPUA 2C98A 1ND5A 2GN4A 3CLKA 4PXAA 1QGOA 2XCTB 2WAOA 4DM7A 1SWWA 3I34X 1JUDA 4U7JA 4NAUA 4F8YA 1TQ6A 3A1UA 2P11A 3LX8A 3PCRB 3MYYA 2J5QA 2JIZA 1NV8A 3MBOA 1E5DA 1ZBQA 4H1TA 4WCDA 3A9VA 5TPZD 3L7DA 2XMCA 3E1KA 1QS0B 3FHOA 1U6IA 3AHEA 4KL8S 3ZE0B 4EY4A 1A69A 1I80A 3UMYA 4GZ6A 2BI8A 5BYKA 5F2NA 2RGXA 5KOHB 4MR8A 2ILVA 1S7GA 1LSUA 3GCXA 5BMOA 1V1RA 3AEZA 4A1FA 3RFVA 3EHEA 3Q41A 3BT7A 2Y1DA 3N28A 3MT0A 1DDOA 3ORYA 4TROA 4DV0B 3TKAA 3E3MA 5FD8A 4UNQA 1GGFA 2C1EA 5LP6C 4HUQA 5ARCA 2CN1A 3PPYA 2BF7A 5JRDS 1U2SA 2GBGA 2QF7A 2GN2A 1ORIA 421PA 3UJCA 3AHIA 2HDWA 3A6JA 1JG6A 1OPRA 2OHGA 2JBHA 2VDNB 3KTAA 3OCCA 2FX3A 1C9KA 3AGQA 3M89A 5AXDA 2REOA 3A9TA 1QJ4A 4FSDA 4FYWA 4JJKA 2FR0A 1PD1A 2ODBA 3HCPA 5EXDA 3ZWKA 2ZIWB 1IN5A 3QWIA 1W46A 3VDQA 1FDTA 3D5QA 4NABA 3DZIA 4LJ8A 5BOSB 4FJ0A 1IU9A 1LLUA 2PRZA 4WNYA 5LZ7A 5JCOA 3KYBA 1IG0A 1V3UA 2ISQA 4LQLA 3VNAA 1WUIS 2J6BA 2W00A 4J29A 4CM9D 1N1GA 3EBPA 3QF4A 2HQBA 3OOYA 4IOKA 4CIYA 1AD2A 3TI7A 3HR7A 3WYBA 1UZAA 3BQNB 3O9MA 4ZGBA 3UAXA 1U1DA 2J7PA 3B8HA 3IOYA 4XB1A 2IPNA 1X0XA 2BELA 2I1WA 4C6TB 3HKDB 1ESMA 4CLHA 3DUFB 4J75A 5FX2A 2B5WA 4L5BA 5GV8A 2WU0A 2B61A 3ES9A 3NTUA 2LCQA 2DOKA 2Q49A 4YIHA 3KYDA 4JASB 1I36A 3JQ8B 2PR7A 3IODA 2NUAA 3S8MA 3ZZTA 2VTBA 2JCBA 1RYDA 2FDXA 2WJWA 1Z8HA 1P1BA 4TRMA 5IDVA 1B6RA 1IK6A 1P29A 3AP2A 4HH1A 4IV0A 1EZ4A 1Q1GA 1EWKA 4FNMA 1RE1A 4WGGA 1GPDG 2FPRA 4M1SA 1HFEL 5D85A 4FS3A 4L4XA 1E1QD 4KPFC 3CLTD 4XVQA 1YOVB 4OLBA 2Z95A 1O9HA 2MSDB 3WGZA 2CNLA 2GZMA 1X9GA 5A06A 3I52A 1VJ0A 3Q3EA 1M3SA 1VHTA 3R3HA 4NZZA 1Z7YA 4TTSA 3SI7A 3NHJA 3PNOA 2IBTA 3AL0C 2WAAA 1SKYE 2O4UX 2PO7A 1ZI6A 2IXBA 3BHIA 4I6GA 2CHQA 4JA2A 1B7GO 2CFCA 4OM7A 2D0PB 5EJAA 2O2ZA 2EFGA 3A1WA 4LYJA 2ONJA 5BR4A 8GPBA 3E9ZA 2VTKA 5HMMA 2QRNA 3RSGA 2V7QA 4FJ1A 4I8IA 4ACAA 3OZBA 1SN7A 3MNFA 3E9MA 1T8RA 4ALNA 3GY0A 1WNFA 2I6FA 1ZZGA 2GTHA 2I33A 3DBRB 4QAQA 5F35A 4HCJA 4N12A 4CV0A 2R8XA 3SVZA 5CFZA 4Q7EA 3FWNA 5IWCA 1HX7A 4DIUA 3GJ3A 1K86A 3PRYA 2BE9A 2JJQA 4LTMA 2E89A 4E15A 4ZI7B 5K20A 5L53A 3HJNA 5BW4A 1OJLA 2KBFA 1ZNQO 2Z2IA 3AWDA 4N0EA 3HZZA 4Z1MD 1LB1B 4FHFA 2QIPA 2BPOA 3PR1A 4MKHA 3DV0B 5EGSA 3AVYA 2OZPA 3IQFA 3D7SA 2B4TO 2X7XA 1VLZA 1ICIA 4LNAA 4G8CA 2E4YA 3T7TA 1I4TD 2ZCJA 1Q0ZA 1RFGE 4DCCA 1C3XA 3ZOKA 1JILA 2YDYA 4UCXA 2FLKA 4MJ3A 1JWBB 4X20A 1I7QB 4DNOA 4KMSA 2VWHA 3EC1A 3FLBA 5JQGF 8MHTA 4H1HA 4O4LF 3PXUA 5LOVF 5EC8A 3EC7A 3Q10A 4I55A 4OI2A 3PNPA 3WJ7A 3Q6MA 2HDHA 1ZNWA 2AX4A 4P7BA 2EJBA 2QTCA 1NLZA 1HT3A 4UE6A 1S02A 2P9QA 1J2YA 221PA 1D4ZA 3K1AA 3QPCA 3R0IA 4MCJA 3WFIA 3TAUA 4D97A 1ZHOA 2PMDA 4FBMA 2EBFX 1V9SA 1JDBB 4C7OA 3QF7A 1RZRD 3VR4D 1VBMA 3MUNA 5KYYB 3F7TA 2NYVA 1ILWA 2GEFA 2ZYDA 4IDNA 4MLPA 3WOVA 1IQRA 2DPHA 3QWAA 1I6MA 2NTEA 1L7AA 3GGPA 4GRAA 4JQYA 4R6WA 4U39A 4IUDS 1E4OA 4JI7B 3VDNB 4NZNA 1D0VA 4OM8A 4AKSA 2GRJA 2CW5A 1RIIA 2WTBA 1CUGA 1LTHR 1YZUA 2PZLA 3OG9A 5E2IA 3A04A 3JR3A 2ZUBA 1G4HA 3QFCA 2UYCA 2V65A 4MQEA 1MF7A 1Q0TA 4V38A 2CYBA 1PIWA 4ZCTA 4AJKA 2HPZA 4IXNA 4YAJA 5IJ9B 4UHFA 1P31A 1Q6YA 1WKBA 1QHIA 1NFFA 2VNHA 3ND5A 4LY3A 3VR1A 4N03A 4K9SA 4DPKA 4Z4EA 3VTFA 4TXNA 1ISSA 4OQFA 4OGGA 1L8QA 2NYAA 2NV0A 2C20A 1ETUA 2I62A 3RJ5A 1U8TA 3DOUA 4UTNA 4HGRA 1HSZA 4M1QA 4UHDA 1KFBB 3JD2A 2PDAA 4K8OA 1NJ1A 5JNWA 1QAQA 2PH3A 2ON6A 3O90A 2P2GA 1L5LA 4O3MA 1JI3A 5EWLA 5D87A 1N3YA 1VJ5A 2COKA 4JLBA 4Q4JA 4AY6A 1LY1A 2HC9A 4QJBA 5JADA 4NATA 1NQTA 1Z6PA 2RKBA 2WJGA 3NWEA 1J70A 3DE3X 1DJNA 3RSSA 4MWDA 4CLRB 2FPUA 3DB2A 4PC3A 1Z35A 2O7VA 3P9PA 2HSWA 3CF4G 5K3CA 1H22A 4OHZA 3I9LA 2HXYA 1ZVMA 5AKHA 1KJQA 2PZBA 3CEHA 3NYWA 2ZDHA 2XQFA 4HDOB 3P45A 4FFDA 4D9GA 2QR3A 3DMDA 4G5RA 4MK4A 3RQIA 3K0BA 2C5HA 4LRYA 2WVJA 3KELA 3WK9A 2E4XA 3G2KA 2XUAA 2PV7A 5CIWA 4EL0A 3Q88A 4D8XA 5EKTA 1R4MB 5IUNC 1ESDA 5ALDA 1MOZA 1JLKA 1ZD5A 4EQ6B 4W5QA 3MIIA 2FWJA 3I0NA 4J0HA 2UKDA 2P6UA 2V4ZA 2QI9C 2VXOA 2EARA 4CMIB 4MKFA 1D2MA 4RTKA 3WAJA 5JFOA 2OP0A 1C14A 1D4FA 4AC9A 5DIFA 3RV3A 2VI5A 3O8CA 1ZW6A 3U5TA 3KOWA 3G49A 4I1OA 1VCMA 5FDFA 3PC8A 4YCLA 5KSOA 3QKSA 4IIJA 4EGFA 4ZFNA 2FPGB 3AIKA 3E1GA 4IWXA 5JZOA 5J2UA 1OH7A 3RC9A 1Y8AA 3N58A 5KOIA 5A7FA 2EWWA 3DFMA 3K9CA 3AF6A 1ENYA 3KE9A 3W8RA 2ZRKA 1OXSC 3PXGA 3TFOA 2R11A 3O9VA 1EVEA 4JLDA 3OQOA 4FYJA 2A86A 3RVRA 1C3OB 2DFPA 1T5LA 3K1ZA 5EYPA 1D2EA 1C7QA 2CLDX 1O95C 3PWZA 3GMTA 1U3FA 2DBRA 1YDHA 4FPXA 2CMHA 1YRYE 4TTJA 2OA0A 4C4TA 4ZZ1A 5ALVA 3ND9A 4MYHA 3KVNA 4BO7A 2DTXA 5DI3B 2H1FA 4HNVA 1PDWA 1GTL1 2VPTA 2WUVA 1N7GA 3RARA 1NDQA 2G7ZA 3RK0A 5DNYB 2H1VA 2HBYA 2XZTA 3G0IA 3IIEA 2QUBA 1QHNA 3KB6A 4BQRA 4E21A 3IKJA 4PYMA 5CIYA 1USWA 2XNCA 4GVPA 3RVPA 2D3TA 5TMPA 3T3HA 2JFYA 1P77A 3LT4A 2FN4A 1WOMA 2DPGA 4P22A 1ZA2A 4G1CA 3UFBA 5GJBA 4GQIA 4QC2A 4UDNA 3IEKA 5ENVA 2D1RA 5DV9A 3RJTA 2D7JA 2IU6A 3JALB 5T67A 1S2NA 1OIWA 3K09C 1VKHA 3KKLA 2IS2A 1NVKA 3D6JA 3WLQA 2NXCA 3GYGA 3IT1A 1BMFD 4GBGA 1HTWA 4W5HA 3O3MB 4GGOA 1IIBA 2P0AA 3FNIA 3IEMA 3OY2A 1AF4A 3AO0B 1JHAA 5CT5A 2HJ9A 3KKMA 3FBGA 1O4VA 4J9UE 3RS2A 2TRSB 5BWMA 4F4FA 4IMRA 4JB2A 4UOQA 1RSZA 4Q9AA 4MV8A 4MZXA 1XZJA 3B6MA 3KP1A 4JJ4A 4EB6A 4PG4A 5K6RA 2GAAA 4ESHA 1PWHA 4F4HA 3GZNA 4HDMA 4DG8A 1OW3B 1PFKA 1YZVA 3M9WA 1OWOA 4M0FA 5AW4A 4PRZA 4RYDA 3C97A 2HIMA 3PL5A 4FDVA 4N5IX 1CRZA 1NOIA 3C16C 4I55F 2VVTA 5E6UA 1IWOA 4IS3A 4KLRA 5EPEA 1OFUA 4HH0A 1IY2A 3QA9A 4FIDA 5I7RA 5JSUA 4ZAZA 3RF6A 1XEXA 3D43A 3AJRA 4HDRA 3T5MA 3ZXYA 4JC5A 3N2KA 4HDAA 3EBLA 4PS0A 1OAOC 4TYNA 1N9GB 2EX1A 2V58A 2XZDA 2ZI9A 2DPMA 3SJCA 1GG9A 4CVNA 1DC8A 2AS0A 3AY6A 1FFBA 3E9QA 4NYIQ 1G17A 4B81A 4HXFB 5TXGA 4FOSA 4BN5A 2HEGA 1VCNA 1H6AA 4QDKA 3CF2A 1S2IA 3X1WA 4OMUA 1U3DA 3D6NB 3AEYA 1FDIA 2IYPA 2P9YA 4QECA 2PYIA 4KPUA 2BGKA 4NJEA 3ODGA 1O5OA 4HF7A 4ND8B 2JEZA 4F46A 2A94A 3GJ7A 3I5MA 4IVNA 5A62A 4AW9A 3ANNA 5AW0A 3KVOA 2WJPA 5FEMA 1Q0UA 3NIWA 1SCKA 2VS1A 3F9RA 4W8HA 4P4TA 5AVQA 4UEKA 5DTJA 3WVNA 1UFKA 1WY7A 1GPYA 4GZLA 4M1EA 1PT7A 5U4XA 4ARZA 1J1UA 5GONA 2G63A 2HLPA 1Q11A 2BE7A 1RRCA 1H0KA 4PCVA 3PHIA 5JAPA 1YHZA 3ZE8A 1OX6A 5HOQA 4JR0A 1DINA 4H15A 5IP5A 1SKAA 2UUPA 5U9CA 3ADDA 1TLFA 2Y8EA 3WIBA 5H83A 4AUNA 2G28A 1SO8A 2FEXA 3V42A 1O4WA 1SUEA 1QGDA 4RF4A 4Q4AB 3DEKA 4MRNA 4NG5A 5AICA 4CM6A 4JLNA 4JOBA 3S28A 5KQPA 1P2SA 3SHFA 1SOVA 2JJMA 2ZFUA 3SYMA 5CFNA 1RXVA 3A25A 2Z3VA 4X5OA 2MR5A 5A4JA 4XIYA 1Z45A 2UDPA 1QZTA 3DDWA 2NVUB 3J7AC 2OGUA 4CDMA 4AS2A 4OHBA 5HM8A 4MSUA 1HZZA 3RUFA 1B16A 2VUUA 1OYVA 2HGSA 1UQTA 3L0OA 2NP7A 2CXXA 2XDAA 4NOKA 1XFAA 4XEUA 3QGMA 3UENA 4D96A 4CTOA 1J8MF 1QFSA 2RHBA 2V7XA 5DULA 2GCNA 4EPWA 1T36B 4EA7A 3U48A 2GERA 3X1KA 3QTBA 4BQOA 4ODIA 4H6XA 3H2JA 3QUCA 4OKSA 1JAHA 2I3DA 3HI4A 1U98A 2YTZA 4HDNB 5HJ7A 5JSFA 1EXVA 5JD3A 5E3IA 3PWKA 1NIJA 1F6BA 4EHHA 1ML3A 3WNZA 5F23A 3RS9A 4RLFA 1E1RA 2QRLA 3H6GA 1VLJA 1XJQA 3IAM6 3KG2A 5NULA 3T95A 4E70A 5JEEA 1B4DA 1UH5A 2BT4A 2Z5VA 4HJXA 4O33A 1SBZA 1X14A 4HAXA 1DBWA 1EGMB 5K0NA 2IKSA 3KETA 2FUEA 1VZ3A 1C8LA 5ICGA 2AUTA 3OP1A 4WLUA 4IIJF 3RVNA 4BNDB 5JAOA 5HIJA 4LJ4A 5J2UF 3ORRA 4JBHA 5FBLB 2QX4A 1ZM2A 1Y0BA 2I29A 4OHMA 5B3JA 5TX7A 3SIPA 1JFTA 3PRJA 2E6UX 3FLMA 4MVJI 5LB2A 1HUQA 4A5SA 4R5MA 1Z5OA 2Q0HA 1FVXA 2QMHA 2J46A 3PJEA 5A6VA 2Y6VA 1HE3A 4DUYB 4IDHA 5CAEA 3D1JA 4E3ZA 2B69A 3PNBA 2OAQ1 4LX0A 5FYQA 5G3ZA 4D3FA 2C9DA 3CVXA 3JRWA 4I1IA 1Q7GA 4FQ8A 3WR5A 1NN1A 4ZANA 2FK8A 1JXAA 1MJGA 1H94A 3JTMA 1KDOA 2GAIA 3HFSA 4HYEA 4EG5A 1NE7A 4OD0A 1VE5A 1KRHA 1QV6A 1UK6A 5IHXA 4E1AA 4Y9RA 2BGLA 3CT4A 1NW9B 5BQXA 5EXEA 3G2MA 3TBHA 3R7NA 1J23A 1G291 4EZEA 4I14A 2QSUA 1QFXA 3EIUA 5B7NA 2JARA 3A4VA 3JQDA 4OH7A 2QM8A 5F52A 4CMAA 1DELA 3UPDA 1T35A 1U2GA 1ZZEA 3MCAA 1VP9A 4OJYA 4X1YA 2AEFA 3MCUA 1PWEA 4RHTA 4B4DA 1WZNA 4L6IA 2VXYA 2UVPB 4LVNA 2QJFA 1T5IA 1VJRA 2D1SA 3N9IA 4RWZA 5BV1A 1JG3A 3ZVMA 1AHIA 2VUTA 1L4EA 4MA4A 2DT5A 1FEZA 5I7VA 2WIAA 1SPBS 1V8BA 2ZB8A 3AFGA 3BFPA 3TQOA 1U63A 1Z74A 2I76A 3HM9A 3C3YA 7ADHA 3WHLA 3JQGB 3LTNC 4CUJA 2WJYA 1FUKA 1KI8A 2G83A 2OM6A 3U9TA 2ODQA 3NWOA 1IULA 1DHTA 1OV4A 2PX6A 2IYFA 5J40A 1X1RA 2O0HA 2O1XA 3AM5A 2FZEA 2JL1A 4OXKA 1U3GA 3FVVA 3MK31 4OCZA 1CQXA 2BGMA 1UPUA 2OYRA 2OZLA 2CXRA 2FG7C 2PH5A 2XA2A 2ZE5A 5E6SA 3NRCA 3S2IA 2CVFA 2ORWA 5JVDB 4J1TC 4B3FX 1DX9A 2ZJZA 4JP5A 1JQJC 2AKEA 3AVWA 2EP8A 3T7KA 1HLDA 1YK0A 2WAMA 1U2DA 4XE5A 2X0DA 5DM1A 3MM4A 4D74A 4YP9A 4DQVA 1Z4LA 1RRKA 2CFIA 2LCIA 2PJZA 1U0FA 3JV7A 2F00A 2QV0A 4PCAA 4CM1A 5CA1B 4OGWA 1CP3A 4WJZA 3OZRA 4C0LA 3E15A 2XGJA 1H2RS 4ZEXA 1ZUHA 1W6RA 1NBWB 2QVGA 1M34A 2J9RA 4KH0A 4UCWA 2C5EA 4IDEA 3JAMA 5BSWA 1SUPA 2BEWB 4ESEA 5A1JA 3N76A 4BMXA 4GZ3A 1JWAB 3OZSA 4NU8X 4MUNA 3WLFA 4TV9A 2FWRA 3K5PA 2JAHA 4AMBA 3PHJA 3NDJA 1JFLA 1FSGA 3H2HA 2H5EA 4AT1A 2A88A 3OM9A 1U9YA 2XI4A 2P62A 2AYZA 3PZBA 4MVJF 5FUBA 1QBKC 4BO5A 1A9QA 5EESA 2NM0A 3OKFA 5AVUA 3IAFA 3NVMB 3NHSA 1JNYA 3T06B 2W6ID 4M76B 5L3SB 1IUNA 4KAJA 5LUBA 2OQRA 4D98A 3FZGA 2OG1A 4FE7A 1TZCA 4TOIA 4PN3A 4HLQB 1XTRA 2AN3A 3MWDA 5I7EA 4UULA 2HPHA 4BVJA 2NOAA 1IZ8A 5EKSA 1G4UR 1SUCA 1ECCA 1LDGA 1KZ9A 2JKZA 2TMGA 3BMOB 4GNRA 5AVVA 4L76A 3B2EA 3K53A 1QHGA 3VPCA 3WRXC 1E77A 1PZXA 1NBOA 1EUDB 3R1IA 4KFSA 3N6VA 1WZEA 2QKYA 5C1BA 3DR5A 1ZH6A 4CKBB 5LR6A 2YIMA 1QKJA 2B1RA 2QE6A 1ZSYA 2H5LA 1XDUA 2UYQA 5C5EA 3I9V1 1GSIA 1K8QA 1L1RA 1GLNA 3M5PA 4B4KA 1YVEI 3I9OA 3SJZA 5LIRA 4ZQCB 3ESQA 3HP4A 1LWNA 5HF8A 1Z34A 4ZAFA 1RYNA 1KNQA 1ZJYA 3A0UA 2XWQA 3BE8A 1BU8A 3D2LA 3IIIA 1NKSA 2CWWA 5DHUA 3DLIA 3IX7A 4HRXA 4RK7A 3IUBA 1G20B 3OU6A 4LWOA 3FRHA 3NOVA 2AJTA 2AXNA 1NAIA 4KQ1A 2VRWA 1SVKA 4RLQA 4NTZA 3RUIA 3ZIUA 4EITA 2P5YA 4GL2A 3DTVB 2YHIB 4LAFA 4XIJA 4YRAA 5JNRA 3D0RA 2NLOA 3SJBA 3OIUA 4CEJB 1IN1A 1QSGA 1DC7A 3KZXA 3NT5A 1R7RA 5DT9A 4L08A 2G06A 5F2KA 1U6KA 1RE0A 1Z18A 2VBGA 2ZLBA 1WBDA 4G5QA 3TEMA 2V3VA 4MS1A 2CXTA 4PINA 1HMPA 1UJ2A 2X13A 5ADVA 1JZSA 4JP1A 3ZNQA 1QWOA 1AZWA 3WBFA 4AZ0A 4BVKA 3AOEA 2Z8YA 2Z1MA 5I9MA 4F3TA 4JSTA 2WTMA 2Z9CA 2CVPA 3NHYA 3LX6A 4HX5A 2XNSA 2XTZA 4EATA 4AY5A 8LDHA 4AN0A 1MLDA 1TT7A 1NVVR 2HRRA 4DBLC 1F0NA 1LPSA 4DUGD 2PWPA 1GGMA 4GVLA 1DEKA 4TLDA 1L1FA 5KOYA 1NSYA 1S01A 3BWBA 3ETLA 2REBA 2BEVA 2VRCD 4ZV9A 3AUFA 3FPSA 1GYPA 4W5JA 4FEGA 4M0LA 4UM9B 3N0VA 3PQ8A 1JPJA 3VV3A 3IIMA 3RU9A 1T0UA 1RRPA 3F96A 3K2IA 5B2FA 3RVQA 5J4HA 1XA3A 3O91A 3EGEA 3QXSA 4Z0NA 3ZD8A 2RHOA 3HHPA 2XKKA 1E3MA 3ABQB 5IC4A 5C34B 3DV2A 4CF6A 4H27A 4CIXA 2FQXA 4FSXA 1V45E 3JXEA 4R05A 3G8BA 4LY9A 3SC4A 3F7MA 2Q2QA 2C2KA 4P1ZA 5JPCA 3VOTA 2PLAA 3VX3A 1WEKA 3CVUA 1VRWA 3QVVA 1SVWA 2GPWA 3T3MB 3UUGA 1FYWA 3CEMA 4BGUA 3OA2A 1TEZA 3RANA 4BIIA 2LIVA 3EQ7A 1CUUA 1PR6A 4BRUA 5CLFA 4BP1A 2OCYC 3ANYB 5I9SA 4D99A 1MT3A 1S89A 3IEXA 5J59A 3ANMA 3T9FA 5B58C 3PTAA 3F6EX 5KYVA 4X20B 4OHUA 3HACA 3ZJYA 2OQVA 5CJJA 3ZE9A 5JMWA 5KJ1A 4BJHB 4LZZA 2I78A 1WZ2A 1M66A 5JSKA 4Q6BA 5LP6B 2CLEB 3OIVA 4DM3A 3T7EA 2AEEA 3RFTA 3QU7A 4V1CB 3I2HA 4O0LA 3ESRA 4V0NA 2CFTA 1UMKA 4F45A 3COYA 1IEWA 2F62A 2BM8A 4OXXA 4B6JA 2PX0A 1B0ZA 1VGQA 4JHXA 4LVUA 2HR1A 4OB8A 5IRCD 5HUJA 1A50B 3CZ9A 1FRNA 2CLHB 2VYNA 3GFSA 4R2KA 3PNVA 1K5GA 3L4BC 3LNTA 2XB4A 2J9GA 2LP4Y 3O84A 4NQRA 4MEJA 4ZRMA 2OBMA 4AMGA 4DYVA 3R44A 3CR8A 4P83A 5I4IA 3JQAD 1P8AA 1KK2A 1UC4B 4UEOA 1IPFA 4F4DA 4ZJPA 5E4TA 3ONFA 1QU2A 2MYUA 5FORA 4L6CA 1EXMA 1CHDA 3NBUA 2XXAA 1QB8A 3OE4A 4ZPJA 3ZIAD 1DJQA 5SYAA 1LXCA 4MWOA 2OGWA 1BGWA 3BL5A 1MOPA 2NU7A 1OYOA 1X3SA 2QDKA 1PX0A 1I0LA 3IP9A 4Z9AA 2ASEA 5I9NA 1ZICA 2WG2A 4J94A 3JAKA 2VP2A 3DFZA 3RHTA 3KU1A 2XYVA 1ZD3A 4NMHA 1DI0A 3ZBTA 3U3ZA 2BI4A 1NC1A 1IBCA 4PW0A 4IDAA 1KMHA 4MQFB 5K2OA 1TMGE 4UHBA 1OX5A 3RRZA 3RAPR 2LPMA 1AGRA 4FW9A 5KX5B 3D8BA 2SKDA 3ELUA 4RZHA 5D3KA 1BO6A 1G41A 2FN8A 5C7IO 1I24A 3VZSA 5C1DA 2G8NA 3R0JA 1FTNA 4ZP1A 4FDUA 1M8FA 2VHXA 1D7OA 4Y2JA 5TQJA 4BGDA 4L5IA 2DM6A 3GFGA 3EGOA 1D5WA 5JCPA 2Q5IA 4G8DA 4CGYA 2X2FA 3OPMA 2QP9X 1TM4E 1SQGA 1P5ZB 3ADOA 5AR1A 5FL3A 1E3SA 2P90A 4EQZA 3C7TA 3QXGA 3SGLA 4NICA 1BJTA 1V35A 1W49A 2PAFA 3EVGA 3GEGA 2PH1A 3GJQA 3R5KA 3T5DA 4F2PA 3UHJA 2FFJA 3T0FA 4M0EA 4AKIA 3G0BA 3C39A 3PC3A 4R1MA 4HQNA 1OA1A 3NKFA 5HKKA 1OZHA 1YE3A 2A1UB 2GPSA 3ROGA 1F2TB 2ZM5A 2BSQA 3IAS1 1GPH1 1K7FB 3GZJA 1CUYA 1DOHA 1NMEA 1Q19A 3H9BA 3LD9A 5EZQA 1ZM4A 3M4XA 4PM4A 4E5NA 2ECFA 4BEBA 4EVIA 3F9CA 3VR3A 1VKZA 4ZMBA 3VYVA 4IIEA 1NZDA 2G07A 4V0SA 3SE7A 4BXOA 3UMJA 3C4QA 4C78A 3MXOA 2XTMA 2QAGC 3C3WA 4TSFA 4X1IA 1RAEA 1W0JD 1LU9A 3AYXB 4DMUB 3K0FB 3L7JA 3SR0A 4GUAA 2BFNA 4FP9A 3O5AA 3PDJA 2AK3A 1CULC 2A9RA 3BGWA 3G17A 4TS4A 4R3WA 4Z6KA 5BT8A 2ZYWX 1F8GA 2QGNA 3HCNA 4J8PA 1YR6A 3ZQJA 1C3JA 1GZ7A 5IXYA 4HV4A 2PS1A 2FMHA 4AG6A 3WYCA 1E2LA 4EGCB 3ANXA 4OGFA 1C7RA 1V1MA 4N5HX 4RK6A 4P5EA 5ALRA 2I6TA 1CYEA 2ZKLA 5EYPB 1F3LA 2DF8A 3L4JA 1COZA 4PX2A 2Q41A 5DASA 1XX6A 4JENA 4HYTA 4UTZA 2PBZA 2RH5A 1EBFA 1E69A 1O3YA 3IP8A 1G20E 2VK1A 1YFLA 8ATCA 3MHPA 2PMKA 1Z7GA 1LSJA 1TCUA 3TTUA 4BB9A 1DEHA 1CC1S 1E8NA 1HDIA 2OESA 4GAEA 3VZDA 3EXFA 4FFSA 5K8JB 4EHJA 3GDFA 3H2GA 2AH5A 3CG4A 4IJ6A 4V0MA 2YDXA 2HMVA 2XYQA 4JC8A 4NOJA 1GUAA 1GSAA 4U7WA 5ALXA 1X94A 4LIPD 1L7PA 1U28A 1WD7A 2ZM6B 4R1TA 3IL2A 4PPYA 1DAKA 1IVNA 1Y9EA 4R1OA 3HPQA 5BY2A 1HQYE 3FTCA 3FCCA 2IXEA 2Z2XA 3DDUA 3MJRA 1M2NA 1NJ6A 3O4VA 3PTLA 3D4LA 2RMKA 1H4VB 4N0QA 3S5UA 1P33A 4TKUB 1PSWA 2GHTA 1Z4QA 3V9AA 2CJFA 3H9UA 3OZCA 1EGVB 1LJ8A 7GPBA 4M54A 5F21A 3COPA 1HF3A 4DA6A 5J4KA 4CEIA 1BEZA 3N3BC 1B6GA 3I9MA 2V4UA 5K8VA 5IYZA 1E5LA 1UBFA 1RJEA 4PNHA 3HBMA 1DQPA 5DW0A 1FFXA 2IQ5A 2O8EB 2DCUA 2A9FA 3CLTC 3OX3A 3S4YA 1G5RA 1PJ8A 2FPMA 4LVOA 4MUKA 2C5LA 4EB6B 3U7FB 5F12A 5IZ4A 1ARZA 2CE2X 2XH8A 4Q9DA 5F3DA 2WJAA 3R7LA 2ONYA 1V5IA 4KNWA 1NSTA 1CZLA 3NBQA 2R8ZA 2E7ZA 1YR8A 2FEOA 1YV9A 4XQEA 4PZ0A 5CA0F 4P4SB 2BEJA 3D2CA 3FWZA 5JLAA 4AF8A 4L5JA 5AM2A 5A0VA 1QK3A 2PD6A 3D1LA 4HSGA 4R4JA 1X9HA 4U3JB 1N5LA 2RG1A 3VKUA 4XYLA 5LU8A 3THRA 1KI7A 4TTTS 1QZXA 4RTRA 1N6IA 1QGAA 4QUHA 5CEFA 1T3SA 2EW1A 3JASB 1Z8NA 3QLJA 3OZUA 2J9XB 2V9ZA 1F6DA 4G0UA 5AVJA 3S99A 2LUOA 1Y89A 3IPRA 4N5MA 4Z4IA 1E18A 1QU3A 3L02A 2GPBA 1A7UA 5FLYA 4Q3EA 4HZUB 1M6EX 5EY5B 2OWDA 4CN9A 2Q4BA 5DHQA 2R68A 2P2LA 4FU0A 5F1KA 4COKA 4J1QA 1FUYB 3IS3A 1KXJA 2PVPA 2A84A 3K73O 4LJAA 4EELA 2E1PA 2PUVA 3UB4A 1T0JB 3H2BA 4OVKA 4YV0A 4NJEB 5JC8A 4PE5B 4KTTE 5A1TA 3RRMA 2V97A 4PANA 4CKCA 3W5BA 3H7IA 4UAJA 1AJEA 1TLLA 2QW0X 2RARA 3OT1A 1ONPA 3WGGA 3CW9A 2ZVJA 5CLHA 1N3BA 2ZSBA 4ZYVA 4WOBA 5ADWA 3Q3IA 2F6RA 2FW0A 3QNMA 3QJYA 4PLCA 3U3MA 4HADA 4IRUB 5GONB 3DSRA 3LYUA 4NG4A 3O75A 4GX1A 5K3FA 4C2AA 5BNWA 2EX4A 4GXTA 4OLJA 4HAUA 3P52A 3NHKA 5LQSA 4X91A 3H11A 1EE1A 2O57A 2RKOA 5DNAA 2NUTB 3TL6A 5L7TA 2Z6VA 4GGMX 5FADA 3AEKB 5CX1A 1SVIA 2BMFA 3NASA 2I2WA 1YVUA 1N9KA 2WSBA 3T5TA 3UHOA 1QIHA 4EW6A 5LZ2A 4L3OA 1GVNB 5C32A 3CV3A 3FWYA 1LLDA 2WWHA 3HCAA 4NFSA 5JIBA 4XGIA 1AA9A 3KT6A 1ZJJA 3GUYA 2C83A 5D51S 4RA6B 2DECA 4WAUA 1E2GA 3S70A 1SD2A 2VPPA 4AMVA 1JQBA 4K7JA 5CFMA 1PCXA 1UMDA 1B76A 4PC1A 4QLAA 4B2IA 1AF7A 3AB8A 2VF7A 3QU4A 3TIIA 5TARA 5K0EA 1Y9DA 1NVTA 3B5JA 2II6A 4G84A 4R54A 2YWEA 2AGVA 4PRYA 1QYCA 2HQSA 4BNVA 5L40A 1QTNA 2UXDB 3G7SA 3H5RA 1IZZA 1TYEB 1T1RA 2OHJA 2HU2A 3LSYA 1VJ1A 2Z09A 4QHTA 4QYMA 1KKMA 2L42A 4RVFA 4B7XA 2QN9A 2PG3A 3L1KA 5DLPA 3F6RA 1Z08A 1ZKMA 3SMVA 2A6PA 2PZEA 3V6MA 4LDNA 3DULA 4TTIA 1NXSA 4RFVA 2D8MA 1T3TA 2ADFA 2IIVA 2M6KA 4RK5A 1NJ2A 1D6MA 4GKJB 5IMSA 4H7EA 1AQUA 3RW9A 2QRPA 2UZ0A 1MIOA 3K9HA 4CV2A 4D6PA 2RAVA 2OXRA 2QVXX 3MXTA 2J6HA 1TK2A 4G2NA 2VWQA 4H6VA 3ZC3A 1RTTA 1TD9A 1CF4A 3I8OA 4I4CA 2DSNA 4ARAA 3U16A 4LJRA 4KLZA 5BW8A 3W5JA 5B4TA 5KNDD 2PN1A 5AM4A 2JFHA 5KSZA 1RQLA 4XR9A 4RANA 2AHOA 2UUBB 2D5CA 1KO4A 1CZHA 2JVKA 1QHXA 3OJWA 4ZVUA 2OCLA 4PLHA 3F4KA 4EMBA 2CNBA 1E8MA 1YI0A 1PVVA 3L8MA 1MDFA 4DT1B 1YS2X 3UAGA 4AWBA 5DZSA 2RJNA 4FE4A 1R6DA 1QYXA 3N7UA 1TRKA 1Y3CE 3JARB 4NCIA 4IHJA 1BFDA 4OJMX 4YPOA 2OMKA 3V8QA 1OI3A 4X1YB 3HYNA 1J0XO 3NX4A 3PB3A 3N2IA 4Y6OA 3OAAD 5E1DA 1N0UA 5E6RA 5M7EA 2JLSA 3W8DA 3V6LA 4INZA 4Y2SA 3T4PA 4DUZB 2G80A 1WLYA 1IXSB 3T52A 2FOIA 4MHSA 5TQ2A 1FLDA 1FRVA 1GQRA 5C9ZA 2ORIA 1P7CA 3F1KA 4I1RA 5FOTA 3CH7A 1A9XA 3R5SA 3ZDFA 3OUTA 1CYDA 5JBIA 2X4GA 2D5LA 5BSHA 3KQVA 1GL9B 1Q6ZA 2ZT7A 2YRXA 3WLIA 3FRJA 1IPHA 5E9QA 5BVHB 3M9LA 2VK4A 3DE6X 4NF2A 5I48A 5E6SB 1KQOA 2ORYA 2I99A 3KT0A 4TS3A 5FTMA 5JDIC 2BH2A 4JT8A 3CVJA 4IMIB 4EJSC 4KE7A 3GRYA 4X61A 3OZDA 4TWAA 5HKLA 3PPVA 5C7YA 4TUYA 3HU5A 1UDRA 1C1YA 1USVA 1E9BA 1VG8A 3X3HA 4FUQA 3COZA 4C0XA 4YRIA 4MUIA 4P4NA 1FTYA 3LRXA 1M72A 2PT5A 1IJKA 4WADA 2Q3CA 2XOEA 3LVQE 2ACWA 3HR8A 3FMGA 5REQB 1F2VA 1ODTC 2C2YA 2P5SA 3F74A 4EHIA 1NVUQ 1M33A 4PO1A 2QPOA 1PQWA 1RCUA 1XRQA 1KR5A 2J6IA 3KCNA 4P93A 4PO8A 1JG2A 1U0GA 2SNIE 2PEYA 1ORTA 1Q7RA 3RRJA 2BFDB 1FRZA 1JMYA 1Z9BA 4BKQA 4KE8A 4RADA 3W05A 2Y2UA 1T2FA 3O8DA 4TV9B 4DLYA 3TPCA 2GSDA 2XXBA 4LRTB 4MVJH 4YRFA 2CDBA 3E7XA 5AJZA 3RVJA 1YBAA 4NY1A 2AOTA 2BM1A 2FK7A 2JIBA 1JR3D 3ACBA 3V8RA 5IS2A 1IUKA 4BFWA 4FLMA 4WESB 1EFRA 4RVOA 3CEPB 3GNTA 5MGNA 3ZNOA 3KQQA 1YU9A 4PZUA 1ONOA 1ZLXA 2Y0CA 3RGWS 3GJ6A 4LOKA 3FOFC 3WTCA 1GRNA 2DKOA 2HBQA 2IRWA 2SECE 3M6XA 3Q12A 3QKUA 4AMUA 3DONA 2R6GA 1TAGA 5HPYB 1KRXA 2YWCA 2CYAA 2FGJA 1P19A 1L5ZA 3KZNA 4EY6A 5L7YA 1U3CA 3QUSA 4NKRA 1NQOA 3LC1O 4LS3A 1M8KA 3WLRA 3SQDA 4CL8A 4R3UC 4JLVA 4CZ2A 3CGGA 4DTCA 1H8ED 2QPTA 1P2BA 3UJNA 2QM0A 1R15A 3L8CA 1DIOB 1C7FA 5K3BA 4M98A 3F0TA 3R8CA 3FSGD 4PQGA 3ESYA 3CKKA 1VMEA 2CD7A 3EYWA 4RZUA 3PJFA 5DJ5A 3GLIA 1R6AA 3C5VA 2I8AA 2XGSA 3JYNA 3WBBA 4AY4A 3OEED 2BV3A 3I32A 1ZJ5A 1YQUA 1SEVA 4CCSA 3CVOA 4J7CA 3ND6A 1XEAA 4TKZA 5AJYA 3CKYA 1PR5A 3OUZA 2YVQA 3ZLBA 4LDZA 3I9JA 2F3TA 1V39A 2HREA 3IR5A 5DWVA 4CF5A 1IBLB 2FJPA 3DZHA 3Q1KA 3LQ4A 3MOIA 2QRKA 4IUCS 1MZVA 3P9CA 2OV1A 1FFHA 4U0KA 1UAGA 4F3NA 1FYFA 4RKYA 2VCEA 5A9SB 3JYOA 4RA9B 1XA0A 2O5EA 1IL0A 4IQ4A 2IXTA 1KEWA 3A6HA 1IBSA 4IIHA 1YACA 2ZWVA 4J0JA 1U5AA 2IZ7A 2UXBB 4E3WA 3KEFA 3CZRA 2ZB2A 1WW3A 3Q3VA 4BJ1A 4Z8YA 3ZV7A 1IOZA 1WY5A 2PTGA 4BUZA 2EFHB 3PLRA 4IOLA 3ON5A 5FQOA 3VGPA 4GG1A 3TS1A 1U3UA 2P40A 5EHNA 3MCWA 2YNMD 4MWZA 2F3UA 1FUEA 4BCDA 4BNYA 1QYDA 4O08A 2XQIA 4DV5B 2UYYA 3X2FA 4KI7A 3N0RA 3OESA 3PNLA 1Q21A 1TA4A 2O4CA 5DOZA 3JATA 3H2SA 5EVJA 1CFZA 4B48A 1NW6A 2DLCX 1UWVA 3HABA 3MMSA 4FOOA 5G0TA 5IT4A 3TNJA 3R3ZA 1JU4A 3T7RA 2I91A 1BA2A 1ODLA 2E4AA 4NYMR 4Q3LA 2CXNA 4XVUA 2PGAA 5I7WA 3LGSA 4ZA2A 3MT8A 3ZR4B 3TEFA 3VSBA 3FMPB 3AHFA 3ZWXA 4BYMA 2HIAA 4JX8A 2GN0A 4RVSA 1HWYA 3NB0A 3E4DA 2QIOA 3CS3A 1RLIA 2FSGA 3W5VA 1ND6A 1X7DA 1AK1A 5IBCA 2AL7A 2IP2A 4NCKA 1K4MA 3JWEA 3SDBA 1HH4A 4AU1A 1W5SA 5D7BA 2GVZC 5K0SA 1JF8A 3E3OA 3D59A 3ZYZA 4UUQA 1BHJA 5BN3A 3AIMA 4ZT3A 5CBPA 1D6NA 3DBHB 1WMEA 1ZL0A 3IP1A 4DLTA 1OAKA 4BVBA 5LBUA 3NRJA 4OBBA 4JJFA 1J0AA 1ES9A 5T3YA 3ESXA 3ZLVA 2QXYA 2YQ5A 3LI2A 5AW6A 2H1WA 5ILGA 1BRMA 2ZSJA 5TS3A 1N6KA 4QU0A 3STXA 2AKAB 4FYPA 2EKZA 3W2GA 1NBHA 2X9VA 4Z7NB 4YUXA 1CUSA 3COWA 5JNSA 4NBSA 2GK7A 2ODAA 3V7NA 1UKYA 4HZGA 3ZJ5A 5EJ8A 3U7GA 2D2FA 1SU8A 1T5SA 4R16A 4BNFA 4L72A 1A88A 1RVDA 3OJCA 5D2CA 2C82A 4QD3A 5KS2A 2KBEA 3E9EA 4ND3A 4PX5A 4HVLA 1Z4OA 2G40A 2E18A 1ECLA 1A1SA 1KI1A 1SU6A 2JFGA 2X7JA 3BJEA 5CVCA 3RSFA 4KITB 1OB5A 1H65A 1QLWA 5KYUA 2CUZA 2IF0A 4R71A 1O08A 2C5FA 1WSWA 2JGEA 2QJRA 3DWIA 3PNSA 4H6PA 5U4QA 4KXUA 3S1LA 3CM0A 4LTDA 1G8SA 1NMQA 5AUQA 1HORA 5G0SA 1DIHA 2OCBA 3AUYA 4DRXB 4MV1A 1YKFA 4PCLA 3IAUA 4WZAE 1B93A 3CX8A 4ALMA 4GC5A 4IDCA 3WLLA 1OXVA 2ZJ6A 3GA0A 4WNIA 2WFLB 1RYHA 3AM3A 5FH9A 4NJMA 4FKMA 2ZGVA 2X2PA 4N3CA 4EB8A 4KR7A 1EDBA 2GEJA 1D0IA 2BFEA 1CHNA 2VP4A 5EE0A 4MI9A 1I3MA 4B3RB 4X6UA 4Q24A 4ZOCA 1COWD 5A0FA 2PWAA 1R9GA 5KVAA 4UAVA 4C5BA 3EXAA 5LZ8A 3QYFA 3VKFA 1PT5A 4LDJA 5D1NA 1HE8B 2OQIA 4K8RB 3ZDDA 2AK2A 3WGUA 3L8FA 1MB9A 4REMA 1PEYA 4XCVA 3RKSA 3EPLA 2VDLB 4LYEA 2A1TS 4L8GA 3HGQA 2W2LA 3U3DA 3OLVA 4JUAA 3K9GA 4QDUA 3RUAA 2J5BA 2FWPA 4MVJM 4NCJA 4LYYA 3C3JA 1H9BA 2V96A 3FY4A 4K2AA 3RT1A 3LCUA 1DCTA 1NA5A 3CKMA 2FDCA 2J9FB 2FLVA 4RDIA 1JEDA 1W2HA 4BO0A 2VP5A 4NFLA 121PA 3I09A 3NRBA 2IP1A 1LFAA 2A0UA 2OCXA 3KQSA 3DG9A 4I4IA 3G9ZA 4NECA 3WKAA 4X62B 4O4HB 3ZLJA 1KJIA 1R5JA 3AC0A 4KEAA 3RBXA 2ST1A 1WDMA 2GD1O 4L15A 3FDJA 1IZ9A 2HCTA 3E9DA 3K9LA 4CFZA 4R1LA 1SAYA 1SULA 1ZWKA 3HJGA 4BQEA 1S8FA 1CR4A 2YV5A 2VPXA 3VR5H 5JJIA 3PLNA 4BFSA 2I9KA 2GM5A 2O2DA 3H8JA 3PR3A 4J0DA 3VHXA 5LYJF 5ED4A 4TT3A 2VHUA 3C70A 2X6QA 1CPYA 1H3NA 1XGKA 3C3XA 3CN9A 5DN6A 2QV7A 3UW3A 3L7NA 1IOLA 3O31A 1Z2CA 4BQPA 2EEPA 4ECEA 2VDWB 1GA4A 4U7GA 2PKQP 4QX6A 4CODB 3Q3HA 4YI5A 1JI0A 1KVSA 3NDPA 3SEFA 3BM5A 2PUGA 1Y3FE 2BONA 5C8ZA 3FPFA 3MW8A 4OXQA 1ZISA 3IUSA 3IAM1 3WYDA 5IASA 5KQLA 3CU5A 3DLPX 1A97A 3HXTA 2JC3A 1SG9A 4FMDB 3GPLA 1SXPA 1ISGA 1UP7A 1YQWA 1YO6A 3ETNA 3AR2A 2DGDA 3R8XA 1JAIA 1NUSA 2XKJE 2ZRFA 3CPSA 1K7CA 3FHLA 3ORSA 4R2XA 3T35A 1T91A 5H9WA 1UQRA 2I54A 4H59A 1RYFA 1YJXA 2WLSA