1QBGA

Crystal structure of human dt-diaphorase (nad(p)h oxidoreductase)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
272
structure length
272
Chain Sequence
VRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD(P)H DEHYDROGENASE [QUINONE] 1
publication title Crystal structure of human DT-diaphorase: a model for interaction with the cytotoxic prodrug 5-(aziridin-1-yl)-2,4-dinitrobenzamide (CB1954).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 83
structure length 272
sequence length 272
chains with identical sequence B, C, D
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 1999-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qbgA00
3QE2A 1D04A 1RLJA 5F4BA 3KEGA 1JA1A 4QOJA 4S24A 5F12A 1FTGA 3B6KA 2FCRA 3N39C 1ZX1A 1D03A 1NNI1 4Y9UA 4N82A 4C0XA 3R6WA 4LAFA 1YCFA 3NHPA 3OJWA 2X2OA 3NHFA 4GQIA 4DY4A 2V5VA 3NHSA 3NHJA 4PU0A 5JROA 1RTTA 4HS4A 3KAQA 1KBQA 2OHJA 4ZVLA 5LBUA 5NULA 4YAWA 4QODA 1YCGA 5EA2A 4PTZA 2BMVA 4PTYA 3NHKA 1RLIA 3L9XA 2V5UA 1JA0A 1RCFA 3FNIA 3F90A 2ARKA 2FOXA 2MOKA 3TZBA 3OX1A 4QOGA 3GFRA 3KAPA 3GAMA 3U7IA 4H2DA 3S2YA 3NHRA 3ES9A 2MT9A 2QX9A 3OX3A 3OVMA 2R97A 1H69A 4C76A 4ESEA 4DILA 4YAFA 2Z9DA 5LLDA 4C14A 1AKWA 5B3LA 5NLLA 2BN4A 1KBOA 5BUCA 2QX6A 4H6PA 3OWHA 4DIKA 5B3KA 5LJLA 1TLLA 3KLBA 1XYVA 4HEQA 1WSBA 3HA2A 4OXXA 1F4PA 2FDXA 3N3BC 2OYSA 1OFVA 3GFQA 3QFRA 3FW1A 1QR2A 2Z9CA 3OX2A 4GR9A 4FGKA 5A4KA 3W78A 4M0CA 3JSXA 2MWMA 4FX2A 3EDOA 2ZKIA 2N1MA 1V4BA 3G5MA 2QWXA 1BU5A 2M6RA 4N9QA 1XT6A 3NFRA 1FLAA 2BZSA 1DXOA 5FUQA 1CZUA 2BPOA 2QX4A 5LVAA 1XYYA 3F6SA 1SQSA 3F2VA 5ULLA 6NULA 3ESYA 2GSWA 1DXQA 3LCMA 1OBOA 2OHHA 4XDHA 4ZVNA 3D7NA 3FVWA 4R81A 2FAXA 2FX2A 3U7RA 4C0WA 2Q62A 1CZNA 2V9CA 4BMPB 3W7AA 3NHWA 3N3AC 2MTBA 1FUEA 1AKTA 1XI2A 3OWXA 1C7EA 4FGJA 3B6IA 1T0IA 3TEMA 1QHEA 3QFCA 3UXHA 1OBVA 2OHIA 1QRDA 5FX2A 4BMOB 3GFSA 2FZ5A 2W5UA 5FA6A 4Y7CA 4F8YA 1C7FA 1YOBA 1YCHA 3TE7A 1AKQA 1J9GA 3RPEA 3P0RA 1T5BA 5EMNA 1D4AA 2QX8A 4QOHA 1H66A 2HNAA 3NHUA 3OJXA 2M6SA 3SVLA 1FX1A 1AG9A 1FLVA 4D02A 4ZVMA 1ZWKA 1B1CA 2KQUA 3F6RA 1X77A 4GI5A 4LA4A 2HNBA 1SG0A 1DX9A 2QR2A 3LT5A 1YKGA 4NULA 3W77A 4ZVKA 3FX2A 1AKVA 3ESZA 5LMCA 1J8QA 4YAOA 3B6JA 3HLYA 3UXEA 1ZWLA 2RG1A 1AKUA 3W79A 3NHLA 5TGZA 4XDGA 3L9WA 4CETA 4QOIA 1YDGA 4NLLA 1AMOA 3K20A 2D5IA 4YALA 5LBTA 4LTMA 1YRHA 1CZRA 2KLBA 1CZHA 1FLDA 1FLNA 4LTDA 1AHNA 1CZOA 2R96A 3NLLA 4QOFA 5LJIA 4Y9RA 2HPVA 2F1OA 2XODA 3O73A 2QMZA 4U7HA 4FGLA 3K1YA 4CF6A 2QMYA 5EAIA 1E5DA 2FZVA 1J9ZA 1GG5A 3B6MA 4N65A 2A5LA 3HR4A 1WSWA 1AZLA 3NHYA 4U7GA 1QBGA 2FLVA 4YAUA 2X2PA 4LTNA 3FJOA 1CZLA 2BF4A 1AKRA 3EYWA 4ICIA 2XOEA 2AMJA 1BVYF 2B3DA 3ZHOA 2FVXA 5F51A 1VMEA 1I1OA 4YQEA 3ESXA 2Z98A 1J9EA 1FVXA 2WC1A 4J8PA 4QOEA 1CZKA 2Q9UA 3O2NA 2Z9BA 1TIKA 4U7FA
chains in the Genus database with same CATH superfamily
3G2IA 3Q10A 1IC6A 2Y1FA 3GF4A 3EVFA 5BYAA 4YCLA 5BVGB 2G9VA 5KNDD 2FSIA 3TJMA 4ZI7F 4HVTA 1JR3E 4ITVA 2ACWA 4C7MA 4CMIA 1FCJA 3S1SA 4GIBA 5HOQA 1SC3A 5C1PA 4ZXPA 2JFQA 1NGSA 1T4MA 1N2HA 4FHGA 4KN5A 2YZ2A 5F78A 3H8JA 4DCSA 2IE8A 5B36A 1DMSA 5AK0A 1JFTA 3M5CA 3PL1A 3S29A 1SHJA 3MILA 4FEYA 4J91A 1GIAA 3UYKA 5FD8A 5L53A 3ZKAA 3B6KA 3U0BA 4II3A 2NVUB 3ND5A 3R0ZA 3V7FA 3UV3A 4ZJZA 4GKJB 3BM5A 5YASA 2I3ZA 5EOVA 1MMFB 1B6SA 2XMSA 5CFRA 5F98A 5JYDA 4RXMA 4QKQA 3ABOB 1K66A 3D2CA 3IIKA 5KC8A 1XCGB 3CXRA 5KTKA 4NCKA 3HJNA 2WFLB 4NU5A 4ZDWA 3HJFA 1EFLA 4QXMA 5GP1A 5HRAA 2KHZA 2ZSFA 1KC1A 1L5WA 1YVUA 3Q87B 4I1UA 3AKEA 3F8TA 2NP6A 4D4JA 1E79D 2BFCA 3A4IA 1U8AA 3AF1A 5FWAA 1ZUIA 2M6KA 4YO8A 1J42A 1GSIA 2P2LA 1Q0LA 2ZUEA 3UHFA 4IZ6A 2R8RA 3WQQA 2ABWA 1AQUA 4OBWA 5EXXA 3MB8A 5BW6B 3K09C 1I2AA 4JH0A 3ZU2A 2BMAA 2ZGVA 2MMCA 2PS9A 3B6ZA 3NP9A 3LBFA 5CJPA 1TCUA 4MDFA 2I2WA 2P65A 2B21A 3OPVA 1JHMA 4AURA 4U7TB 3I6YA 4GP6A 4B2IA 3ROMA 1CVRA 1R8SA 1Z5NA 1UJ5A 1KC3A 4NOLA 4KR9A 5L40A 1DB3A 4DCGA 5A9SA 1E61A 2XV1A 3MWGA 4WHMA 1P39A 3W4IA 2V5UA 3LXXA 5LU9A 1SCUA 1Y37A 1LF5A 1S2IA 2FG5A 2RFLA 2ZE7A 3U48A 3PNBA 3VU3A 4FB4A 2AN5A 1BXRA 1MO3A 2VIIA 4WBSA 4LF7B 2C78A 1KNXA 1PGJA 1K7FB 3GJ8A 2ZAOA 1JIJA 3DDNA 3R5SA 2BP7B 4W1QA 4GOJA 3T4EA 1XCMA 4MUEA 2J4CA 1T0BA 2PAAA 4EYKA 3D6VA 3MGGA 4IJMA 2YYZA 5C2JB 4PIVA 3WL6A 3RWMB 3MPUA 1U98A 4D9FA 1OWNA 5ER6A 1RHJA 5K3CA 4GKKB 3OVMA 2P77A 1ACJA 1G55A 3RS5A 1ZGJA 2R97A 4Z9XA 1Y7LA 1PQPA 2NV2B 3GEBA 3ZUPA 4OOEA 2OHOA 2WHXA 2J7PD 3PXDA 1L7RA 1RYMA 3KM0A 2BCGY 3NEYA 1AUOA 2HJRA 4MGZR 4JI3B 1BQ4A 3WGHA 2H16A 1PRYA 4QNMA 2OD9A 4HO1X 2KYRA 3JQQA 4MIEA 4HBZA 2H07A 3AVWA 2O4CA 3MB5A 4FYHA 4RD4A 1OI7A 4I4TA 2APJA 2OFPA 3CB4A 1Y34E 2JGMA 4JJ7A 1IOVA 1LV8A 4RF3A 1G2QA 2DOKA 3P26A 3U9LA 3RI3A 2O6LA 4FHDA 1ZZGA 2VTVA 4RJIA 1AUPA 4C7KA 3PEVA 2D2FA 2CXUA 5D01A 1E2DA 2XB2A 1CJBA 1T9GR 4V0KA 3STTA 2AFVA 1Z3IX 4L4YA 2WD8A 5JMWA 2VA8A 5JNLA 1G2IA 5TS3A 2A1IA 2FP4A 5F2EA 3ZN2A 2FETA 4E5SA 1O08A 4IHKA 1VDZA 4I6GA 4FT4A 4LECA 3AFIA 2UZ1A 3C1UA 2WG2A 3T99A 3V4LA 4HMOA 1EQAA 2HCTA 2R6FA 2SHKA 5L7YA 1VKRA 5SY4A 4GM4A 2HJHA 1YR2A 1C3EA 4IZIA 5HQTA 3BGSA 1DOHA 1JEEA 2QRMA 3C41J 1NV9A 4RQUA 2I66A 1GGVA 1DT5A 1SUAA 4HNQA 4Q05A 1FFYA 1E4OA 1EFPB 4OSOA 2BGLA 1N9KA 3LVQE 4QU0A 1GDTA 3LQ1A 1N8KA 1A7UA 3G8CA 1N0WA 5BMVF 1QB8A 4YPFA 1NVWQ 4U2DA 4V38A 4LE2A 4YMHA 3B5EA 3KQNA 4LJ5A 4ZQEA 5T4EA 5M29A 2JLAA 2DUNA 3VXKA 3GFPA 1PNOA 3L7JA 4ER3A 4NAHA 3RUAA 2TMKA 1QOQB 3C3YA 1PJTA 1MDFA 1WIWA 4C5AA 2P90A 5AUPB 5LD2C 1NLZA 2RHOA 3BBPA 1H4QA 2ZITA 2DFVA 1C0KA 3JSXA 1OTXA 4B32A 2MWMA 2ZB7A 3E8SA 1MB2A 2NU6B 2D7DA 2FWJA 4X1YA 4E33A 4MA0A 4B9AA 2I7TA 2PGIA 3AEZA 2NO7A 3B7PA 1IZYA 2PEYA 3ZZ1A 2J4DA 3WYEA 4HZUB 4U6QA 2QT0A 5F5LA 1HEIA 4HNTA 1TD9A 3T1NA 3FFWA 2JIRA 2VVTA 1PEKE 3QH4A 4PC6A 4EMSA 2Z3ZA 1F12A 5JH7B 2J32A 5K8IA 4B6OA 2FPIB 4DGQA 3QVMA 1PWYE 2WJVA 4NRDA 2PNJA 4C2BA 1U2GC 1XEAA 2IL1A 3DQPA 1G9SA 4WY2A 4F12A 2Q8NA 1X1SA 1QCCA 5FUVA 1XMPA 3KALA 4RTNA 1ATZA 3PR1A 1FX0A 2H7VA 2EOAA 6NULA 3EA0A 3L7MA 3OQHA 1M2WA 5GGXA 3J7TA 5HIIA 1G3MA 3GZNB 4JR2A 1TOAA 1C1HA 1E94E 5E6UA 3V5NA 3ERCA 1B93A 2CGEA 3FGPA 3E15A 4LK2A 5ALXA 3W9SA 2OENG 3GLKA 2P9ZA 2FN7A 4LOIA 2QVZX 3LPNA 4JVSB 4UCXA 2VAMA 1IBLB 4RY8A 4ZCQA 4JLDA 3G23A 4W9MC 1EA7A 2GHIA 2M1ZA 1WUIS 4CF4A 4J0HA 4YFYA 2IYRA 5DGIA 1U81A 4LHXA 2OCLA 4BQNA 1T8RA 3O4HA 1FFWA 4G9BA 4XX1A 1YHZA 2OBNA 3KEOA 4LY9A 4D9IA 2W2XA 4JA2A 1FUEA 1N2CA 4KN6A 3TD9A 8AT1A 4UHEA 1ADFA 1B41A 1ZVMA 2AC7A 1AKTA 3DR3A 3G88A 3V4OA 4F3NA 5HKKA 3GNQA 4MR8A 3W90A 3MS7A 3OE1A 1F38A 1Q14A 1T4DA 2JKYA 2VHTA 3BRSA 5ESRA 4E15A 4FMDF 1NXPA 5ELLA 4EF5A 1WCIB 3M9XA 3OQIB 2HIMA 4HK4A 1T35A 3AUYA 3V33A 1MAWA 4GLOA 2WFMA 2VZEA 3L02A 3PFKA 3UFBA 3ONNA 3ZE8A 1SQ0A 1RXVA 1V5IA 1Z74A 4AX8A 3GP5A 5FRDA 1NBHA 5ALRA 3ETLA 3HVHA 1V5GA 4PG4A 3O47A 4TKVB 3BK2A 2QRGA 1Q1AA 5ESXA 2OHIA 1J1ZA 1KDTA 2ATIA 2WU1A 2XVMA 1XTZA 1Y8QB 3ED1A 3FYHA 1UT8A 3BIXA 3CUUA 3H2SA 3KZKA 3M5PA 1RI4A 2QL7A 2JCXA 3O93A 1P0IA 4UPDA 2C7PA 1EFVA 2HPHA 4B75A 1PYDA 2XA1A 3ACCA 3LA8A 1T1SA 2HK8A 4GH5A 5H80A 3RYFA 2LD4A 3SNKA 1V35A 3WP1B 2EFYA 3KKMA 1SXGA 4M1WA 1R6VA 3S70A 2FF7A 3T3DA 3ZDXB 4C08A 4II7A 2F1HA 4NX2A 5FH9A 1GL9B 1K8ZB 5B53A 5HIKA 2QUZA 3EDQA 2AVNA 2W2OA 2CFCA 5K0NA 3GYBA 3PWTA 4M9QA 1QVAA 2D3TA 4I1RA 3S55A 4XGKA 4ZI7B 4V02A 2E5LB 1F8UA 1V37A 2HIGA 3MGCA 4P2GA 3DFKA 4JHLA 2WNSA 5EGSA 2BTQA 3KOWA 1JEYB 1Z2DA 3DP9A 2HWKA 3ETDA 4N0EA 1QYVA 3TRDA 1ZHFA 5G0WA 4X63A 1YIDA 3EYAA 3C7CB 1AF7A 1Y3FE 1JX6A 3Q9NA 3ER6A 4L6AA 4BLTA 1D4FA 4CGYA 4J76A 2OXEA 3IE1A 1NVBA 3K0AA 2GHRA 3NTXA 1E58A 2VSFA 4IJ6A 3UMFA 2EJBA 2H2DA 4PLHA 4Q66C 4QBFA 3OTQA 4U02A 3AF5A 4KJXA 4NK5A 1JNXX 1T9BA 2G8NA 3A4MA 3PHBE 4LPSA 3LC1O 3S2GA 1RBYA 1DCMA 1W2WB 2ZANA 1B1CA 4DB2A 2IK8A 3KVYA 2Q50A 4DZRA 2HEGA 1DEXA 3G0OA 3G5LA 2DR3A 5EIOA 1C81A 1XHFA 4C3OB 5BN3A 1OUMA 1ISPA 2D0OB 1DAMA 3H8WA 2QS9A 1HDGO 4KODA 2A57A 4ACBA 1BX1A 5GJBA 3O9ZA 1L4LA 5ALSA 1NBAA 5F7ZA 2NSYA 5BT8A 5AVQA 3ONVA 4FFDA 1UBHS 2I6QA 4GE3A 2J0SA 3ZCSA 1OWPA 2CF6A 1G3QA 2F43A 5AVRA 3NI2A 1Z47A 2PQMA 2PZ8A 3Q3IA 3V00A 3VR4A 2R25B 3LX5A 4BXOA 1JLSA 1JAZA 1ODLA 2EYUA 2QZZA 2EU8A 4I1IA 3S2FA 4UBJA 4QUHA 2VDNB 4KUEA 4LXQA 4B3XA 4D4KA 2WRZA 5GZ3A 2GJ4A 4TYWA 3ZIUA 2IDJA 2QJWA 1Y89A 4WBXC 5KYUA 5JAIA 1Q74A 3CNNA 4KACA 4C05A 5E95A 4L5AA 1V1MB 1XZNA 4MR7B 4F84A 5A1JA 3AR7A 1RKBA 1QIMA 4MS1A 2FLWA 3IQXA 4R7TA 4FYMA 5IMBA 5FTLA 1PR0A 1EFRA 5A7GA 4MA4A 2ZRGA 3BGVA 3IAUA 4CT5A 2YV4A 5AM1A 3W4JA 3EBLA 3H4TA 9ABPA 4WY5A 1K0FA 4IIYA 2IC5A 3WKDA 3LS2A 4UJ3A 4BO2A 2EQBA 4IGAA 2VHEA 3I23A 1PK7A 1U1CA 1S8AA 2H6EA 3KKZA 1BGWA 4LJYA 4OFWA 1L4YA 1V2HE 4NJMB 5E7IA 1UDWA 3F4BA 3TRKA 4Q7QA 2OXCA 5BSGA 4CFYA 3NAGA 4NMWA 1UFOA 3GBVA 3PFIA 1G21E 1MTOA 3L9WA 3LVBA 4YCCA 4LCJA 3ZQ6A 4BO3A 4K6FA 1FNSA 1US8A 3QBEA 5A5EA 4CMEC 5K09A 3PUKA 4HPXB 4QTUB 1T9KA 4A0HA 1X80B 1T5DX 4WY8A 4Y1RA 1XGKA 2PQ2A 4GPBA 4DABA 4Z7NB 5LQCA 1LDNA 2A86A 5IVHA 4LTMA 5EMMA 3AW8A 1PGOA 2WJJA 1JG3A 3BFVA 3NBUA 3OSUA 1WEHA 5DWDA 1JMKC 3R2JA 3BSYA 3FR8A 2XECA 3QLUC 5A2QA 2C97A 1UQUA 3LUJA 3T5MA 4E32A 1FMLA 1Q20A 3GGSA 1YA4A 2H85A 2FEXA 1J70A 1NU8A 1ULSA 3BMQB 3MJ4A 2DWQA 1TD1A 3EZFA 3Q2OA 1V11B 3AEUA 1ZUWA 3BEDA 3FPJA 5LJIA 4Z5XA 4LC1A 4A36A 4RUKA 5HF5A 5B7GA 4OO3A 1VGVA 3TXAA 4EOGA 4JASB 4M0MA 1IEQA 2WG1A 3GPDG 4H59A 1GPJA 4K9SA 4BNZA 3NH6A 5DKFA 2BVNA 4LJLA 3BFKA 1NONA 2DJ5A 2FEOA 1VSBA 2JFUA 1P9OA 3HBFA 2B1IA 3PWSA 5I51A 4E7OA 1I3OA 2XB8A 4U7DA 3RIGA 1CFZA 5AICA 2EKBA 5JAOA 2QQ0A 1NHGA 1BMQA 2RKOA 3OTWA 1WZUA 2BKLA 4GPEA 3AYXB 2EGUA 821PA 2GK4A 1HTWA 1DFIA 5FUWA 3E27A 5AKHA 4Z4GA 3I2IA 1XKXA 4NCHA 2DCUA 1FJXA 3AG6A 4ND1A 4CGZA 4QPZA 3TCKA 4Z4IA 1DI0A 3WIOA 3DBVO 4BMNA 1Z6TA 5LL6P 4QVIA 2ONKA 1H6DA 4Y98A 5BXYA 2XW6A 2HEIA 1FJHA 3GT7A 1AKNA 4ZAFA 1L5HA 1XD2A 2QN3A 3SDZA 4R2HA 1NRWA 4ANFA 2HGZA 3IELA 4HWSA 4PX2A 1C1DB 2Y67A 4L78A 5AHXA 3JQAD 5GIOE 3A2KA 2TYSB 3PC8C 4MYUA 1ICEA 3UKJA 1QFZA 2GBGA 2ZUSA 3D3WB 3RH0A 5CA1B 4CF7A 1TNDA 1X42A 2GARA 5JECA 1KF0A 5LXTF 1K06A 2GBLC 3HABA 4IJUA 2RGNC 4XA8A 2VHWA 1G42A 1IUOA 3RSQA 1JZSA 1YBVA 2I5PO 1FNMA 2V8OA 4RSRA 3GBPA 4ZHQF 2P2YA 4JGIA 1T2AA 5HZMA 2JEZA 1G6Q1 3GJTA 2BHLA 4CG3A 1P9LA 1O0CA 2R68A 1ODFA 4IWNA 2ODAA 4YP9A 4LF5B 1HNWB 4BQFA 4YQZA 2I6GA 4CUZA 3CRNA 3OIGA 1EUYA 4C78A 3Q40A 4WWHA 4IDBA 2YUTA 1Z0ZA 1Z7GA 1UFKA 3GDOA 4I3FA 4IVRA 2X6RA 3CPSA 3U16A 3THWB 3EXHB 4FD3A 4Q4HB 3C74A 4MVCA 3E7WA 3VZDA 4ZHSA 1IIBA 1HO3A 4GVXA 4RF2A 1PP4A 4U7FA 5LMNB 4Z51A 5FDFA 4PLFA 5GAJA 3LTEA 4KFRA 5GJWC 3TW6A 1U80A 4MO9A 3BHMA 5B1HA 1ZL2A 4CTOA 3IEUA 3SF8B 4Q9LA 5IWCA 3UNXA 5JYCA 5FB3A 2BJHA 4ZMRA 1MX5A 2AT1A 1Z75A 3GPCA 1D6JA 2XT6A 3O4IA 4NDZA 4WVFA 2GZDA 3K5HA 2DU8A 2YRXA 3DSRA 4M4SA 3K5PA 2OZKA 2QT1A 4GMDA 2BBSA 1S96A 2P9HA 2AJBA 3R7LA 2GH1A 5LMUB 2Q9AA 3U9TA 1ULBA 3SJCA 3AXSA 1HV8A 3EARA 1L8OA 2XDYA 3GUHA 3PCTA 2RDMA 4Q7JB 4URWR 5CDGA 5DHQA 2EX0A 1U0FA 5CNMA 1MENA 2P3OA 3ICCA 1KOLA 3OTOB 5C9ZA 1RJ9B 2QQEA 5FOTA 3T94A 2FE1A 3JWPA 5FOVA 1E4YA 2UVDA 4XB2A 3KIPA 1VE6A 3WSWA 3EUFA 4D6XA 3TB4A 3TGWA 1P2BA 4GX1A 1SG6A 3DWGA 1BVUA 1YSCA 2WI8A 1P81A 3KYDB 3PNYA 4FMDB 4H3HB 5COBA 4MLPA 4XVQA 3VR3A 4RTJA 4JIGA 3BK1A 4ABTA 3ECCA 5FNZA 2HCRA 3QIVA 3OZCA 2MCFA 4LDPA 4E6PA 2ZB3A 2W9XA 1YNOA 3JVUA 3B1KA 3I58A 4UAGA 3CZ4A 3QU9A 4CNBA 1J2UA 3H3XA 4OBBA 2D2VA 1XZJA 5I48A 3L4JA 3FDXA 1PZXA 1VJRA 4OGGA 5I8ZA 1VOTA 2X5KO 1YH3A 1N2GA 1KPGA 4MQ4A 4AKGA 2F90A 2VKQA 2DERA 1FTNA 2D8MA 2J9FA 4WZ6A 5EJ5A 4Z3OA 1Y0BA 2RK4A 1NSTA 2VCYA 4ENUA 4CEIB 3CE9A 5DXJA 3A9CA 3C8DA 2G72A 1KZGB 2FR8A 2ZETA 3C1TA 1BRMA 1E1RD 1TTHA 3REQA 1L4KA 2BELA 1MQ9A 3THXA 1USUA 3IQWA 3P0FA 3RWOA 3R5FA 4RD0A 3Q4GA 5TIIA 3QEBZ 2IH4A 2GDJA 2WSLA 2O7NA 2YJ3A 3KOOA 4X7RA 3ASYA 1I9CA 3ZEIA 4JYZA 2ZCJA 2FXIA 2O0MA 3K1AA 3I5YA 1N6IA 5J9FA 3KXKA 3DBHB 1QG6A 3ZKWA 3IKVA 3SBOA 3D4OA 2E18A 4R2JA 3DDHA 4YREA 3ZDQA 4X65B 2G82A 2WYIA 3LXUX 2BE9A 3WK5A 5KJ1A 1C7RA 1CUAA 2GM4A 3Q3VA 1ZA2A 1QIHA 1GU7A 1T4BA 3AJ8A 2JD2A 2A59A 5CT9A 1PUIA 5SZKB 2G0NA 4LKRA 4KLCA 5AQ1A 3OMLA 3T6KA 3L4EA 2G80A 1ES9A 3MZ0A 4GSKA 4PLGA 2EG9A 3FBTA 4ESEA 1LPNA 1HKHA 3OCCA 4L9WA 1V6AA 2FPWA 3RFUA 2O7QA 3QOWA 3HP4A 1HX7A 1NI5A 1RW4A 4WKNA 1PL8A 5HIAA 3T15A 4AB1A 2IZ1A 2AG0A 2K2QB 3IC5A 4M7PA 2QZ9A 1ZA1A 2R00C 2AUMA 2QMQA 4MKRA 4RHFA 3OPYA 4DOMA 5IASA 5J4YA 3RHSA 1WD7A 2RJOA 3BE6A 3W1VA 3R5HA 4F2GA 1XAIA 3EIHA 1DZIA 1QGUB 5K3FA 3QVGB 2XDQB 1B14A 1G8FA 2FTKE 1OLSA 1Y9DA 4EVIA 3DT6A 1TLLA 5BOVA 1ZOPA 2D3WA 1DAKA 2Q5OA 1Z7YA 3EZNA 4ZPXA 1R37A 3QZUA 3ENQA 2VTKA 1N33B 1MPTA 1BMTA 2UYGA 2EXXA 1VSUA 3WG9A 1ILEA 2DBRA 4NFLA 2UZ3A 3BJMA 3SXJA 2HCBA 4KXWA 3RREA 5H4HA 4OAQA 1WLYA 4H7KA 3BSFA 2ZSEA 3AKDA 2JGAA 4PE5B 4X8HA 5AM2A 3Q41A 4W82A 3UJ9A 2R7LA 3M4XA 2ZDHA 3INNA 5A9TA 3HKDA 3ZJTA 2IYFA 4W6ZA 4BKQA 2AL7A 2H65A 4RXTA 5THKA 1GEGA 4JUIA 4G56A 1XLTC 2IUUA 2IF2A 2VH1A 3WYAA 1U0EA 2R8XA 4Z4FA 4LJ7A 4NU0A 4YMVA 4HXFB 3TGPA 1DC4A 4XQGA 1CIJA 4GR9A 2B8JA 2Z3WA 1JPJA 4NEGA 2JIDA 1CUWA 3K2BA 1TVKA 3BWVA 4I9GA 2YOGA 4OK6A 4EYEA 2ALJA 4EG5A 5C52B 2PBRA 2QMEA 2XQKA 3ABZA 2J0UB 3CU5A 3TQCA 3ANTA 2A5YB 1QK4A 2VWHA 4OUDA 1HORA 1TQHA 3SHOA 1NJGA 1E9EA 5DLDA 4DBZA 4Z4HA 4WAUA 3GD5A 2P8SA 1TAHA 2IUTA 3IO5A 4J0JA 1MCZA 1ESEA 1Q1ZA 3WMGA 3B1VA 4ETMA 3UJPA 1ZRMA 3RVBA 1DWPA 4KVZA 3QVUA 4ZCLA 1SO8A 4JQOA 3E4DA 4CKWA 1GOTA 1JLRA 1YA8A 2BFDB 3BCUA 4MSUA 4FCWA 3TQIA 5C7YA 4JUDX 1UP4A 1F7VA 1SUEA 1E3SA 4HUQB 4YRNA 4U2CA 3T5BA 1VSQA 4J7AA 5F1KA 1IBCA 2QZSA 4RAQA 5TT0A 4RANA 1KJJA 4K8OA 4H7PA 3VVMA 3NNNA 1IBSA 1HE5A 3CONA 2ZSJA 1DAFA 1PS0A 5CDSA 5KNDH 1JKXA 4K05A 1LRLA 4HAZA 1WM1A 4XIYA 5IXSA 5JZVA 2DKFA 2PX2A 4LF8B 1BJRE 5IUKC 2RH4A 3F2VA 3NVAA 1EJ6A 3BB4A 3F5MA 3VX3A 4JOSA 3N07A 1DXQA 1HTBA 4JR1A 5KX5A 2O5RA 2BTEA 1I3KA 2WIJA 3D6NB 1OI2A 3I76A 3ID6C 5AH0A 3BIWA 5CDTA 4FM9A 4DN6A 3LPLA 1ZQ1A 4IL5A 3IILA 3TFWA 4GG1A 3TTUA 3R20A 5BSEA 1GCUA 3B52X 4MTCA 1DJQA 2O8BA 2ZYSA 3EXEA 3E48A 3B1YA 1M1NA 3R3VA 3VPHA 2EQAA 4S1NA 3W7AA 3OQ1A 4LHSA 3AI1A 2XA2A 1QWOA 3AC0A 1NI3A 3HMKA 5ER9A 1VJDA 1IZ9A 1PFWA 3QK7A 4G65A 3EWIA 2NXNA 4X6XA 4L2IA 4IDHA 2HA6A 3BRWA 2BHSA 5DBGA 5K2MA 4AG3A 4YRKA 4TWAA 2BGTA 2JK0A 4IJWA 4CG1A 4YMLA 2IU0A 3OWXA 4XD2A 4D81A 1YB1A 3C8ZA 5IN4A 3HUUA 5EUBA 3L04A 4JJZA 3GEEA 3PRJA 4LWOA 2W37A 2QMOA 2DFKB 3H5AA 1U2PA 4CM9A 1GPDG 1GPYA 2Q27A 1IXKA 5E7QA 3T3MB 3WO1A 4EA7A 2CVFA 1PDOA 1TQ2A 2HYDA 2FEAA 1M76A 3MCZA 3TEMA 3VO8A 5IVDA 1K3TA 2G0AA 3H0EA 4EHHA 1NM5A 1HM5A 4OM7A 5LYJA 3UXHA 5CVTA 5MGBA 1OBVA 2HB6A 3GGOA 4NZYA 2CE7A 3FKSA 4Q6BA 4M38A 1ULZA 1K97A 5CYPA 4ROSA 4C5BA 2OORC 3DDWA 2HF7A 2QTVA 4MHOA 4N8EA 3RVPA 3PK0A 4AO7A 5LQAA 2EFDB 4CF3A 1L5QA 4UTXA 4K9LA 1HNZB 3LK7A 3OE5A 1WUJS 4TLBA 2ZXUA 2DBQA 5L7TA 1WW8A 2JBWA 1C9EA 3CEHA 1NOIA 1AMUA 3DLBA 3MJCA 5FBZA 4LSWA 4XYMA 5IAJA 5CNIA 1GLNA 4UE6A 3RUDA 2VKTA 1K63A 1VXRA 3N59A 4CHTA 5A4MS 3H2GA 5JATA 1UC8A 1O7JA 2PRKA 1SHLA 1KORA 3BILA 1GHTA 3RS3A 2WINI 2XRYA 3GJXC 4CUKA 3G9XA 3VJRA 1WBDA 4AC9A 4MEJA 3RFXA 5HUQA 3HVKA 3O8BA 1SIBE 2G4VA 1XNQB 2V7QA 1VPTA 3K5IA 4RKYA 3CG0A 3Q2IA 2C29D 1KDOA 2F64A 3AV0B 3C98A 3G2MA 3KJHA 3L4BC 3LGSA 3SYKA 2H29A 2I87A 2PUJA 3DWFA 1WDLA 1ORVA 3KQWA 1LVGA 3B2NA 3LCRA 2G40A 2FRVA 3ZGYA 3QRWA 5DI3A 2QP3A 3LKVA 3KWJA 4I1YA 1H1DA 2Q3HA 3WISA 1E2NA 5CTAA 1WQ4A 4GU5A 5C37A 1Y3DE 5C8VA 4U2KA 2KQUA 5ALNA 2FWMX 2BM0A 5JDCA 1I2DA 3KHSA 2DRIA 2ZYTX 3MJFA 5FAXA 5HKOA 3GLGE 1RI3A 5FTNA 4BOYA 4DANA 3NXSA 5A0FA 4FBGA 4TXJA 4HDKB 4KVAA 5ALLA 3ZY4A 1WRBA 1E1QD 2FFJA 5C8YA 4RNDB 3EAFA 3VX4A 2GN2A 4D26A 5J4LA 1WXHA 4B3RB 1JTVA 2X1MA 2YY5A 1YKGA 1L8XA 1FUIA 3VR2A 2BM9A 1N7GA 1TJYA 3W3AD 1O95C 2HA3A 4ZVKA 1GG8A 1VPDA 4YIHA 3L4KA 4KTTE 5KSPA 4UZFA 1XWIA 2OQ2A 1WCXA 3T61A 4J6EA 2BW0A 2VBFA 4Z1MD 4TYYA 1T15A 1WOMA 4IH1A 1E0AA 3R40A 4J90A 3TI7A 2HZ7A 1ACLA 3C8HA 4BVGA 1U7PA 4C5CA 1ZOSA 5KDDA 3MERA 3ZDEA 3GEIA 2FFHA 5A4IS 1JEQA 3HWWA 1E2JA 3EXG2 2QL9A 1YDHA 3DW3X 4G8JA 2WZQA 1CY7A 1KP3A 1Q6YA 3DEAA 4I2VA 1JFVA 3AV3A 3L0ZA 1R7RA 5FWYB 1VSVA 2O3UA 2R2AA 2XUAA 1J0CA 4B6EA 1GAQA 2G04A 4Y6QA 1ZLYA 2JJ2D 4BFSA 1Z2PX 3HCBA 2PT5A 4CETA 4KPEC 2GPAA 5IJAA 4GM0A 4BB6A 2CFTA 1MTZA 1OH8A 1U0RA 1ZUNB 4L0DA 4NR0A 3LBAA 3QHPA 3I4FA 4DV6B 1X7YB 1UKCA 3CH7A 5AXCA 5FTJA 3W2EA 2PFKA 5C8DA 3DOOA 3FWNA 1W581 2I8CA 2IHZA 2WZDA 1SKAA 3F7NA 1LPAB 3G5AA 5BNFA 1TJNA 2AK3A 4HDOB 2EJWA 1QG0A 4J3FA 5LR6A 4Q6WA 2I29A 2IDZA 5ALWA 1Q15A 1O57A 1XZCA 3SLKA 5DM2A 1MDBA 3PPWA 4ZZ3A 4RGBA 2VDKB 1UWLA 2DSNA 4G97A 1W94A 3LY9A 4HYTA 3ZXUB 2WDZA 2O5CA 1CJKC 4OK3A 3HGTA 1UANA 1RKQA 4YI5A 2XRMA 3CPEA 1CZOA 4YJ3F 3AETB 1AS0A 1ORWA 1T9HA 4EHBA 5CIYA 4K26A 3A70A 5DPMA 4EPVA 1M6VB 1LI7A 2EW1A 3KJFA 3UCXA 4KBYA 4DT1A 2FSSA 4ALNA 2GVZC 1D5WA 5AW1A 2GILA 2M98A 4JXKA 4Y6SA 3RC3A 1Z17A 2AW5A 3GJQA 3W8RA 4BVAA 3PEEA 4TRJA 4DV2B 3G02A 1WXWA 2GN6A 1M2NA 1B0PA 1Z7WA 2OSBA 4JEMA 1RWXA 4GQAA 1LQUA 2OL4A 1F3OA 3AU9A 1QV7A 4WN9A 4UOEA 3ADBA 1Q50A 1TMKA 2XWPA 4GF5A 4QOSA 4FGLA 4FKMA 5AVVA 5EJAA 2ZJFA 3BXXA 3HVUA 4JC5A 4US2R 5CDYA 4OYLA 4CQMD 4YK7A 3SEQA 4EUKA 5LU8A 5EQDA 2C00A 3F1KA 2QZPA 3KE8A 1VHQA 4JQZA 3RK4A 4AUKA 1M66A 3ESCA 3CLTD 3ULKA 1UP6A 1WCYA 2MYTA 1IHXA 1YZHA 1XMQB 1QF9A 4FEEA 1FZTA 3LQ4A 1RBMA 3V2GA 1HUQA 2PGNA 4GRIA 1Q6ZA 3COSA 3DTNA 2OC9A 3C5VA 3M6IA 4N54A 4MJLA 2FJPA 4HMPA 5HFJA 1G5TA 1U7UA 2O48X 5CW1A 4ZWNA 1F2TA 2J85A 3JXEA 5KPJA 1UBSB 3LHIA 5ICMA 3OI7A 2QUJA 5K0TA 3D7MA 4AX4A 5DDIP 1JYEA 3KAKA 2FN8A 2PY6A 4L5JA 1APBA 3PVCA 4N0PA 4YB8A 3VH4A 1AA6A 2R1VB 5FEMA 4GI3A 1EUQA 3MOSA 1N8SA 3GARA 4KJZA 4N12A 1SIUA 4IV0A 2XGJA 3QOYA 3BE8A 3ASUA 4LSMA 2ZS8A 2P1DA 5F51A 3HHPA 1QAMA 1VMEA 2GN1A 3D8TA 4M1SA 4ZU3A 4WLEA 1W5TA 4G37A 4YQEA 4CEHA 1AK9A 2XQVA 1T3SA 2O3TA 5E4TA 1MABA 3EZXA 1MXHA 1MB9A 3DV0A 2HJWA 3EXHC 3O3CA 5J47A 1PU2A 2XTNA 3T41A 4JP3A 1GKKA 3AZQA 3DMTA 1EWKA 1JXMA 4HNHA 1FQKA 4W8OA 4HNUA 5JD4A 4KKVA 4MGIR 2BFOA 3VVLA 2PBZA 1B74A 3RUFA 2OBFA 1U7ZA 4REQA 1R10A 1THTA 2H5LA 3DTVA 3L0CA 2WFZA 3GOHA 1HEYA 4MB2A 3LMKA 5AHOA 2FPPA 3ZHSA 1M1UA 2YWRA 2O59A 1I3NA 1QF7A 1JIUA 3QELB 2Q21A 2BJWA 4HQ6A 3A06A 1MEOA 3TM4A 2A67A 4A8JA 1EE2A 5K3BA 5IDXA 1XTKA 3HDYA 3WNZA 5FTKA 1Y8AA 2ZI7A 3VYSB 2VCEA 2XXJA 1PSDA 3A3PA 2XADA 4S24A 2PKRA 2J6BA 4B43A 1TAGA 1C2YA 2HT6A 5HE8A 5EJ9A 4DW8A 5K20A 2JIPA 3QW2A 3WLEA 1FTGA 1RT9A 3D3QA 2OCIA 3IUEA 4NSNA 2VXYA 1C3LA 1ZCFA 3UK1A 3WQSB 2XYQA 1SK8A 2ZVDA 2JHGA 4UDNA 3TTWA 4OHKA 4AK9A 4D6PA 5K0CA 1GNRA 2YVAA 3I8XA 5FWXB 1B8VA 4I6EA 4QXPA 1K6XA 3OQ6A 3LM8A 3UZUA 4E5DA 5L51A 1LLFA 3HO6A 3R9KA 1M34B 1RWMA 1O6CA 1HDZA 4L8FA 4TWZA 4EGAA 1B6RA 5BOSA 5BUSA 4KGDA 4HS9A 3KT6A 3OEED 5DLPA 1I6LA 4OXRA 2ORIA 1IVSA 3NHPA 1H2ZA 2WT9A 3GELA 4U9IS 3RC2A 4O4JB 4WECA 3RW9A 2ANCA 3KL4A 2QRZA 1NYTA 2D2EA 1GA6A 2R1TB 5E9QA 3A58B 5CEEA 2NAPA 4XOUA 2HKIA 3ZH2A 1I94B 2GF2A 1L5YA 3PUZA 5DH9A 1LJ8A 4MV3A 4C30A 1YACA 1TKBA 3OJFA 1ZVVA 5JXIA 2QROA 5TS2A 5L6MB 3E7FA 1W4BA 1XEFA 4RDIA 5JG7A 2QJTA 4UZSA 5HYVA 4TV8F 1P4AA 4XSGA 3EIQA 4WK4B 1IAVA 4HLDA 4RS3A 4L3VA 2P4SA 3ZW7A 3ZQKA 2RC6A 2VNAA 1NVEA 4J4HA 2IV2X 3ZWVA 3KQKA 5JCOC 1C3XA 2O3QA 5JU6A 3V3KA 1E9FA 1VLZA 3KR1A 4WJZA 1FU4A 1L3BA 5CG1A 3KTDA 2XT0A 4GSLA 3U7JA 3UJHA 1KQOA 4D0GA 4ZP1A 4EG3A 4DR1B 3BFPA 3MEQA 1AOXA 4B3FX 1CW2B 1Z45A 2R48A 1GQOA 3ABQB 1GGEA 4WKOA 4GSYA 5C5EA 3CXUA 3LFTA 4QOGA 4QO8A 2H4WA 4DNQA 1GQ2A 1N8NA 1NDQA 4AMVA 4DSOA 4MUNA 1R6BX 4LGCA 1XALA 2IPLA 2IZ5A 3U7IA 1J49A 4KSYA 2Q6KA 1AS2A 1YC5A 2CNDA 2WD7B 4J2HA 2BGNA 2H08A 4RPIA 4C6TB 2C9DA 2QTZA 3ZI4A 2GERA 1VI6A 1WO8A 1XTJA 2WICA 4UXHA 4JVNA 1H2EA 5HXAA 4KG7A 4QELA 4OHVA 3TF5A 4YCJA 1GVNB 4WKCA 3DEIA 2OKGA 2P3LA 4Q24A 4QATA 4C43A 5IC4A 5E4JA 5FP0A 4L15A 3UMBA 5FJIA 1SC9A 1SBHA 3PYXA 1K3UB 1VL0A 2X40A 3NVKI 4EL5A 4L5CA 3KP1A 2Q41A 1MHTA 4LY0A 4UVGA 3GLUA 5CU7A 1WD5A 5IAOA 4NZOA 3G2JA 2JARA 1QE0A 1PIWA 1HSOA 4PSKA 4OQDA 1DQPA 1KPHA 3L5OA 2HWYA 3JWJA 4EYGA 4QDUA 3R3WA 3PE6A 2XUDA 3PB3A 3E22B 2J5BA 1I2ZA 1KBOA 5IF9A 5JC8A 1Y33E 5I8PA 1C3OB 3O94A 4NYIR 1AD2A 1KH2A 5HZHA 1UM8A 3RROA 1SXPA 3AUTA 3HCWA 1SUCA 3AFGA 1P1CA 4R8RA 1CY6A 3O8NA 1TRKA 3OHMA 4M1TA 1QYWA 2R60A 5HMMA 4E31A 1BRTA 4CWAA 4OXXA 2MSCB 3OPQA 1QU2A 2LZ0A 2ZSUA 2XQGA 1UMBB 3ZUGA 2G9QA 4MIKA 1CD5A 2CBXA 3R7AA 3QMMA 4XVUA 1A9YA 3L5KA 3FETA 2C8KA 1Q92A 3DVSX 3MCTA 1W8DA 3EISA 3QFRA 4DREA 1D2AA 3EW9A 2GTPA 2ZJAA 3PQDA 1GL7A 2CDCA 2QPTA 4RGYA 1OXBB 1G8JA 2A1UB 3ZWAA 2AC4A 3OA0A 1YULA 1B76A 1MHPA 2X4LA 4LYEA 2HQ1A 2DVMA 4JIMA 5LN1A 3HB7A 3G0HA 4LSGA 1E7SA 4BEJA 3OOYA 1P2GA 2TMGA 3NYRA 2I7VA 2WOOA 2PYDA 4K9KA 5I9TA 5BP7A 1LWNA 3LU1A 4IDQA 1A1SA 2WY2D 5I7UA 2QMUA 3QI7A 5EE1A 1DPFA 2OCPA 3IMKA 4J0QA 1ZKMA 2OYRA 5JASA 4LRQA 1A27A 4XJTA 1QG2A 4F92B 2GK7A 2WZBA 3DF9A 1BX0A 2IT1A 4RM2A 2BEKA 4QNRA 1ENZA 4AY4A 5B6PA 1NU6A 3EF1A 2BSAA 1G6HA 2BFPA 4QHSA 4E2FA 4TYQA 1JHQA 4OVKA 3T9AA 5JSUA 3PD0A 4BRSA 4MJ7A 4DLXA 3D0OA 3QA9A 2GAJA 3KTAA 2BEVA 4N47A 2GM3A 2ZJ4A 4EZBA 3G8BA 4LE0A 2Z0MA 3COZA 4FGUA 3QPAA 4YJ3B 2FDRA 2W22A 3JALB 1EB8A 3IAEA 1QIGA 4FCVA 3HDTA 4JGBA 3C43A 5CURA 1KNQA 2I9PA 3PTZA 4KQ9A 4A3SA 1C9YA 4GYYA 2CSXA 3KZVA 4UUOA 3M34A 5DJ5A 4TZTA 1WSDA 4XYEA 4ER5A 2WF7A 3FDZB 1M34E 1Z0IA 3UAZA 4EKDA 1XD9A 2B4TO 4F60A 1OT3A 4L7VA 5D84A 1JILA 1KEWA 1XT6A 2P7HA 3EWAA 4CMGA 4E88A 1GYPA 2VTDA 3Q7TA 4IVPA 4UVHA 3VVCA 4BV9A 1T91A 5CK5A 1A5SB 1H0KA 1HZJA 1VLHA 2ZRBA 3BSWA 4JD5A 4B82A 4E2YA 2JGDB 4ND7A 5K0SA 1X38A 2GGSA 1CHNA 4UASA 1XYYA 3BXPA 1W48A 1QVWA 3AF0A 2I4NA 3OO0A 2GSWA 1HGXA 2JBAA 2IF0A 5FLKA 2AF3C 3GN2A 1UL1X 3F6EX 4G5SA 3OKCA 1P4JA 2AGVA 2PV0A 5BV2P 4UBLA 1RM4A 5EL0A 3U7EB 3TSOA 4ASUA 3A6FA 1UQRA 1ZCBA 2A7XA 5AO9A 1AO0A 5AI0A 5J23A 1ABBA 1DBRA 1CZNA 1Z38A 3IMEA 1PQ4A 4A73A 2NUAB 3JQAB 1Y4UA 5A6SB 3RBXA 2V1UA 1ECFA 2ST1A 3H13A 1W4CA 2B5OA 4MARA 3D4LA 4X7MA 4E3ZA 3MINB 3SJ7A 3QPDA 5JS2A 2FWNA 1PV4A 3H1PA 4NPAA 1OSNA 1E1NA 2W00A 4L74A 4GICA 3OQNA 3FI0A 1ZJ6A 1Y80A 1RAAA 4WBNA 1RQLA 4LNUB 4X64B 1C7EA 4XLTA 4UXJA 3QBDA 1WX1A 2NSLA 1DEKA 3L7NA 4J3NA 1KAOA 3RQSA 3WSTA 2IHTA 4HFJA 4WK6A 5EHGA 3QTBA 3UJ8A 3W5DA 4LDNA 3U4CA 4BB0A 3JU3A 1RADA 3P5BA 3WLPA 4G1VA 1CU1A 4C4PA 1TJ4A 5A5DA 2ZU0C 2W8BB 4IIUA 2VOJA 3W5JA 3A1CA 3V1UA 4M8SA 3RSCA 4HVCA 4BMDA 1QOZA 3IKJA 3TN7A 1TQ8A 2FWAA 1JHXA 1ND6A 3DT8A 3PR2B 4ZKEA 5JADA 2DKOA 2O2ZA 2O2JA 1U8TA 3VO1A 3LZ6A 2X8LA 3S28A 3IJEB 2HPAA 1X19A 1NKVA 4ZT3A 3QE4A 3ADCA 4OEHA 1TM7E 2JPDA 1XNJA 4PFKA 5FQOA 1RXWA 1CIVA 1RI2A 3LJKA 1O3YA 3WGUA 1PX2A 1XL1A 2YVLA 3PGLA 1BNCA 2FOLA 4KXNA 2MDTA 2FPGB 5THXA 1FFXB 2G9ZA 2RCNA 4HB4A 1G4HA 4RVGA 1DL5A 5KNBA 3HADA 2QX8A 2CXSA 2YKGA 2BGJA 1FS5A 3M2PA 3FUWA 2DBYA 4YV1A 3OJXA 1UT5A 4K6KA 1ULHA 3L6CA 4FIZA 1G41A 1LLUA 2H8GA 3FHLA 3LXRA 1EK1A 4YCSA 2RI0A 4OX9B 4FIDA 1OGJA 3PSAA 2Y2UA 4EY7A 1EVLA 3EGOA 4YR9A 4O4LF 1USVA 3LBNA 4G09A 5EJEA 1X9HA 2Z8YA 4QJ5A 5DI9A 4M49A 1UQTA 3EZYA 5CX1B 1KVTA 2AD1A 5DMHA 5H7XA 1YS1X 1M8GA 2WB2A 1F8GA 2O5VA 1B43A 4MV9A 1ZD5A 5I4IA 3VOTA 4LMPA 2LV8A 1TTTA 3T3PB 2PEZA 2CW5A 1J99A 1JPUA 3CKKA 2HBRA 2FSFA 4H7EA 4F45A 1F0YA 2CZQA 4Q3DA 4BJHB 1ADGA 3SN6A 2PUVA 1NW9B 4EB6B 1MJGM 2YN4A 5DGTA 3JARA 3TIFA 2CB9A 1UH5A 4KR0A 3CISA 1QXSA 2IY9A 2XCQA 3RF6A 5MF6A 1AKVA 4XKJA 5IJ0B 3ZD9A 1ZIDA 4AKHA 1H0RA 2AN4A 5IULC 4YAOA 2O05A 2P4QA 4MQUA 1NDHA 5CLHA 5EIXA 1EFCA 1H2XA 1U2ZA 1XMVA 1HZZC 2OC4A 3ORFA 5ALDA 2FW8A 2VYVA 2B1JA 1O5OA 3ZD7A 4N39A 3WDKA 1U0JA 3P9IA 5CA0F 4C7OB 4WT7A 2VCHA 3DV9A 2OZLB 3IE0A 1AKUA 4GGPA 1KFJB 1HPLA 1MO6A 1KP2A 2OB1A 4G85A 4DUYB 2QTLA 2O8CA 1O6ZA 2WAOA 1KZ4A 3PXEA 2AKEA 1XTRA 7GPBA 3ICOA 4FKZA 3K70D 5HKKD 1Y8RB 2ZRLA 1ZLXA 4PYMA 3KWMA 5KWSA 2I2FA 4M1EA 1UPXA 3BCRA 1XQWA 2I2AA 3FMOB 3PKJA 4LRSB 2W6JA 2OFWA 4IQFA 5CVVA 2ZJ7A 4G8DA 1F1JA 3GCXA 1EWRA 4DQDA 3QIAA 4N1AA 2C42A 8ADHA 1ZN9A 2GI4A 3KD2A 4ARVA 3FGOA 5CBPA 4YALA 1QFJA 5SZJA 3F3MA 2ES4A 4I5FA 3U62A 3KHTA 1Z68A 3HB4X 4HNVA 3G0GA 2DPYA 4TXMA 1J5PA 2R8OA 4EG4A 1IPHA 2CHGA 2DUJA 4RE5A 4QVGA 5EPEA 3ELBA 2HV8A 3O03A 1D1PA 3O0TA 4L9AA 4EHIA 1IZZA 2EBWA 3N28A 4II2A 5L3RA 2WKPA 1GTMA 4CFSA 3B20A 4QQKA 5ADVA 1XTPA 2IOQA 1XFAA 3FNRA 2NO6A 3NOOA 1KMQA 4RMGA 2A1TS 4B87A 1D2RA 1PJCA 1UBGA 2CEKA 1U1GA 2I78A 3D4BA 2I9KA 4JC0A 2DE0X 4R1LA 3S5UA 3RNLA 2QUIA 4RQBA 4A16A 4DG5A 5KQSA 1RIIA 2QQFA 3QSGA 5BSUA 4BO6A 3L79A 4Q3CA 2YV3A 4MV6A 4AZTA 4IIHA 3CR7A 2V3VA 3CLRD 3I34X 1TTPB 2VHCA 3Q6IA 3ND6A 2NZWA 3L06A 3O73A 4FUTA 2VH5R 2O0HA 3L0DA 4A2WA 5AW9A 1JG6A 1U02A 3CUWA 1PJ2A 3OESA 3OHPA 2QMYA 2OGSA 1RYNA 1T6NA 1XZLA 1JSXA 1Q1BA 4BZPA 1CS4C 4G1FA 4CM1A 4E07A 2ID4A 1E3JA 4TLLB 2BY4A 3WWYA 5GV8A 3LDUA 3R24A 3G1UA 3BH6A 4G5RA 5G4LA 5C5IA 3GMSA 1VZ3A 5ALGA 3QP9A 5IYZA 4QNNA 3GLTA 3IUPA 4Z0NA 3AIIA 3T3NA 3DS8A 4S35A 4RJTA 2I2CA 2QRJA 5C1BA 5JJ5A 1SRRA 2E4VA 4Y1EA 2GJSA 3PU6A 3VR4D 1TM3E 5LQMA 1ZXLA 2QN9A 4LTNA 3TX6A 3EIUA 4EWLA 1GZ6A 1CZLA 2AN9A 3C3BA 4XYGA 5EWMB 4DZTA 3I92A 5I7WA 1BGXT 1H3NA 5IC5A 1O96A 1Q0ZA 3X1XA 4GPIB 4XB6B 2XUJA 4GL2A 4X1KB 2XOEA 4WNAA 2A9PA 5J1TB 2Q6LA 4LFCB 4F5DA 4IWYA 3KWFA 4P92A 2PJZA 3AOEA 3AY3A 1GZUA 3OETA 4EH1A 2H06A 4EABA 4KMMA 3UWDA 1UPUA 3NGMA 1EFRD 4OP3A 4H77A 4ZQFA 4IUYA 1HR0B 4HDQB 2HCFA 3JWIA 2W90A 3KQPA 5D6OA 2E4ZA 4BVKA 1KEEB 2DY0A 2OVFA 3H1GA 4D25A 4JBIA 4K3VA 3VSDA 1ZH4A 3EPJA 4UATA 3I3OA 3IMCA 3VPFA 2VPXA 4G0XA 4G0NA 3BH7A 3MHPA 4NNJA 4H18A 4JYBA 1F51E 4A4DA 1NT2A 2ZBEA 4IOJA 4LY3A 2WE7A 4W9NA 3EVGA 5A5VA 1N5IA 4MGYR 4YMGA 5EKDA 1DAOA 5AW0A 2OTCA 4JAVC 1YZTA 3AHCA 1BHJA 2RGDA 3SCZA 2HT1A 3A1TA 4JA0A 3IOEA 4TWRA 4RY0A 3WV5A 4C03A 3V34A 5C8ZA 4R54A 2CNBA 2GCEA 5EJMA 2PRIA 4NOMA 2O1SA 4K40A 3K7EA 1QQ6A 2E89A 2J0VA 3BTVA 4GL4A 3F6PA 3V1LA 3ZLTA 3BD6A 3K4HA 3SXUB 4HYQA 5FHRA 1WR8A 3W6NA 2FUG6 3GDHA 3WBBA 4LXUA 5LLTA 1FDUA 2FMTA 1EDEA 2G17A 2OVBA 2WUWE 4WCVA 1CJMA 4Y9UA 3OM8A 3U4HA 1N5OX 4TS4A 3IODA 4Y9DA 2CXXA 3MG9A 4C21A 5IEJA 1KA9H 1K75A 1NC1A 1HFEL 1P5JA 3NHMA 3QX9A 4OYHA 3V6LA 2ZZMA 1GTVA 2V7WA 3UOAB 1NVVQ 4OMDA 1PVVA 3VZPA 7ADHA 3NATA 5J43A 2V5VA 3DMNA 4DCOA 4K6MA 4AUNA 1CULC 4HLCA 3UJBA 1OXMA 4FDMA 3K53A 4C29A 1WUKS 3L0OA 3NBFA 5E4FA 5EQFA 5KWIA 2YOHA 4YRLA 4R8KA 1PG2A 3KAQA 5AI5A 1QB7A 3EVTA 3GRVA 3EHDA 4LHVA 4PZ0A 4WRRA 1J23A 4FMCF 5E0KB 1AE1A 2WUGA 1YK1A 2KI5A 2WIGA 3DC7A 4KEAA 1LPSA 2XZTA 3O4GA 3NAZA 4J1QA 1J6UA 3U3DA 1GTSA 1Z2CA 3B85A 1SU8A 3CWQA 3TX2A 4TLDA 1YCGA 1GFIA 4TS1A 5AVOA 1R8XA 4KL8S 1C7QA 1KJNA 3EK2A 4G4JA 3PQ2A 1V7PC 3K5WA 7AT1A 1LK7A 1ZVJA 4G5HA 4DBLE 3IVMA 2GRAA 4BRWA 1O94C 1CRWG 3ETGA 1W44A 1A9ZA 5BV7A 3E2MA 4NMMA 5KOJB 3NUGA 3MMSA 2IEDA 2PYIA 5EXEA 5HCIA 5IHPA 5K4AA 3K1ZA 4EQ6A 3GWGA 2QU7A 1RM3A 3ZWNA 2JAUA 1OLXA 4G4SO 1XZKA 2D54A 2XAAA 3VZRA 1W1WA 4BCDA 5T41A 2PMBA 3D3NA 3L3BA 2C4UA 3SOZA 1IXYA 1E3TA 3PUIA 5EKUA 3NV9A 4MQLA 1TQDA 3CW8X 3KJZA 3OZUA 2I76A 4R1UA 1EVEA 1PG0A 3H42B 2BONA 1B8NA 1T1EA 3IT1A 2PQ6A 1WETA 2VRCA 3ZBPA 4POOA 3U3MA 1BQ3A 3ORYA 2RCYA 4S1TA 5CRIA 4J0EA 1J22A 1EM6A 2IU6A 3FMPB 3KRTA 3OU2A 3PXXA 1D2EA 2JIOA 2IYEA 5EMHA 5LIRA 1E1DA 3ZZNA 1OBFO 3BE4A 2F2TA 1U9IC 3O9MA 2QPAA 3WRWA 1UWKA 3RAGA 2GFQA 3K6JA 3L1KA 4HEA1 4M98A 2Z8ZA 3KJEA 2G4CA 2F3SA 4TQUS 3N87A 4KC0A 3A28A 1GUYA 4DCTA 4QJBA 5LSAA 1R9NA 4IKEA 5EN4A 2CJWA 1WXQA 1ZM2A 1PBNA 4IQ8A 2PSJA 1S01A 2BFBB 2NTJA 3OOHA 4BCCA 1RAIA 5E3IA 2C2ZA 3I39X 3OWHA 5GJCA 3RLIA 4JNCA 4CMKA 1S3SA 3I04A 3EGDB 3T9DA 4A5OA 1U8EA 2RGCA 2EW2A 3IAAA 5BY2A 2OGWA 1XZQA 4G1EB 3AVQA 2GAOA 1WSBA 3IBGA 2J3DA 4DBVO 4P0PB 4GLJA 3U4GA 5TMDA 3E18A 1UMCA 1WHSB 3QG5A 4QUKA 2FDXA 5HK9A 5IPFA 1TVCA 5CIQA 1ZNQO 2R87A 4MS4A 4FZJA 5CD9A 3LYLA 2P9EA 2DH5A 2PKQO 1TT7A 1K4YA 1G21A 2Y4OA 1R1DA 1TEZA 2NYUA 3P9YA 2HO4A 3AKYA 2VJLA 2G63A 3HRIA 3NYWA 1UAAA 4H08A 1W0KA 4QGHA 4Q9DA 1X15A 3RKUA 2CL6X 3VR3D 2Y27A 3K8YA 3MMPA 1PTJC 4IM7A 4Z9FA 4ZEMA 1F06A 2Z2YA 2QIPA 1MC5A 2J45A 4KQ6A 4OUKX 1MVOA 2W83A 4UNNA 3VKWA 4JX8A 1WBBA 1KAHA 2H57A 2XCTB 4DV4B 5H5JA 2BE7A 1WCWA 3T5AA 3T1HB 1NKSA 1ABFA 4CQLB 2XE8A 4KR2A 2R6AA 2O0KA 2ZCVA 4UKDA 3VHXA 1H9AA 2CV2A 4P3OA 4CMAA 3TD6A 3ZJ5A 1NHWA 3OMXA 2VT7A 4JB3A 1IIRA 1T4CB 2NM0A 1YJCA 2C4KA 4PCUA 5FA5A 4ZVQA 3QEOA 1VYVA 4RY9A 2EP7A 2YFYA 5EJGA 2SCUB 1JAYA 4G0UA 5BO5A 2J0QA 3O90A 2OV3A 1X1AA 2W4MA 2E1PA 2YS7A 4GZ3A 2B78A 4UW9A 5FO0A 4V3CA 3RVNA 4RK1A 3R3ZA 4UUPA 2G07A 4ZT5A 1E6UA 2FLKA 2Z08A 3WLMA 1OWOA 1FDSA 3FCXA 3BQMB 4TL6A 5D2CA 3SEZA 4DMHA 5CFNA 2HA5A 3JQ9C 3NTQA 4IXMA 4V0QA 1R0LA 2H3EA 4L07A 4LDJA 5F2KA 2FSHA 5TGTA 2FSVC 1I36A 3ZLJA 5IFLA 5H70A 1CDOA 2QTGA 4J4BA 4YFVA 1R6DA 3Q3HA 4AZSA 2W0MA 2PT9A 3M9WA 3DBRA 4CU2A 1PFYA 1R15A 1R0BA 3RVQA 1G8KA 3DM9B 4B7AA 3AWIA 4GX5A 4CQMB 1N2ZA 3IYLW 1XJWA 1AUVA 2XDWA 3THYB 3RSGA 1WY5A 3ED5A 2ZR7A 4NAVA 2QTFA 3W2HA 3LCMA 1T24A 2MYNA 3C15C 1TUEA 2YQ4A 3PEUA 3WLNA 3D8RA 3LY8A 1LKZA 3D43A 4AMBA 4E2ZA 4H0CA 2QTTA 4YUAA 2FAXA 1YR6A 2FX2A 3MJVA 4JI8B 1GY8A 1THGA 3I6BA 3A2MA 4IFTA 4M60A 4Q4AB 1OH7A 2WJYA 1UXKA 3O82A 4UJ5A 5TJHA 7REQB 1ATIA 4RQAA 3N3AC 2SBTA 3VR5H 4ZYVA 4C0SA 1O5IA 3CF2A 4FHCA 3L6BA 3E9CA 1XBTA 2GQ0A 1MEEA 1TQ4A 2H1RA 3IJPA 4LZZA 1XPUA 1KZ6A 3OQBA 2ID7A 1F60A 4HI0E 5P8WA 2C20A 3ZBUA 4LV8B 3LZCA 4NZPA 1YASA 3RIXA 4MCIA 4QSMA 1DZ3A 4CVNA 2B3TA 5GOZA 5LBIA 1ZAKA 2R8PA 5CK4A 2AG1A 3SQLA 2D1YA 2XMCA 3A6DA 4X1IB 4RMIA 4N9WA 2ERCA 1QGYA 1T8PA 1WUTA 4M88A 4DXAA 1FPQA 4KYVA 3EX7C 2GZHA 1WMSA 2A84A 3DKIA 2CV1A 3FPCA 1J56A 1KO4A 1TCBA 4G1CA 3FCCA 4IW3B 2UXBB 4D9NA 1R66A 1Y9ZA 4JDPA 1OX4A 2IA5A 3DDUA 1SA0A 4IQGA 4G0YA 3EGEA 3BS4A 2ZIXB 3BTOA 4BLQA 4NP6A 4X8OA 2XB9A 5C34B 1MIHA 3MA0A 3CFYA 4WNIA 3OF5A 2D13A 3CUSA 4Y7CA 2R2GA 5ARCA 1Y4ZA 4OHYA 1DU4A 1E2PA 1NY5A 1M2VB 1JHAA 2ZDGA 4YRZA 3NTLA 3GIWA 1DKUA 4BPRA 4EG6A 2XXAB 1QHYA 3RBAA 3CJQA 2X22A 3C4QA 3ESBA 2FPLA 1QJCA 2AQKA 2X8BA 4BQSA 2WQ7A 4KR6A 2VZLA 2AOUA 3OLCX 2XXBA 3PJEA 4TX1A 3VR6A 3NAQA 2O7RA 3NBZC 3TE7A 3UGKA 5REQA 4CDMA 4C6SA 4NPCA 4DTCA 5DX0A 2AOWA 3FRJA 2GBFA 4Q4DA 5JXJA 3P2EA 4K6OA 3SYNA 3ZHZA 2QYSA 3NWPA 4E12A 2FK8A 3IP7A 3L2OB 2YJ5A 3K0FB 1U9CA 1XA0A 3F67A 4JI0B 4L3OA 2IW3A 4WOKA 3NBYC 2QTCA 1QX3A 1QPBA 3R6GA 4F56A 5I9NA 4CLRA 1PEAA 3TRJA 1K4MA 2J7KA 4HR7A 4YT8A 1N2SA 2FMFA 2PXCA 3GAFA 5EXTA 2YHBA 3SEFA 4ZRNA 2O2IA 4X20B 1P5FA 4Z3KA 2BEWB 5CLJA 1F8XA 4F2PA 1VB5A 2NPOA 4EFNA 4ZV7A 3B3GA 4AKEA 2FUG1 3EFEA 1QE3A 4E4YA 1GP2A 5A3QA 5A62A 5K8JB 2N42A 4EGQA 5AVWA 1DX9A 2E4AA 1FZQA 3VC7A 1RWQA 5DYNA 4XIFA 1YDMA 2QGZA 2AMFA 2JB9A 1GL3A 1WNTA 2BM8A 4FMCB 2ONCA 1S2LA 2WMNB 3JYQA 5JS6A 3EB9A 3KKNA 5JZMA 4JJIA 4KRFA 3TOSA 2Q5HA 2HSGA 1U3FA 2C98A 2X7XA 1TK3A 3A2NA 4ALIA 3LLCA 2ETVA 3FPLA 2BIFA 2NZYA 3G9ZA 5EMKA 4AO8A 1EBUA 3QEAZ 1KU0A 4NENB 1H2HA 5BNTA 4F4JA 1E0SA 1IWOA 1XOIA 1TZ2A 2XB6A 3GUUA 4LJ6A 3LVRE 3GLIB 3QY0A 3FYDA 5ALPA 2UXCB 1PN3A 3VI4B 5DASA 3T4PA 2UYYA 5DM4A 3SYTA 4HAIA 1CLUA 1XVAA 5K8TA 2QW8A 2R8ZA 3E9EA 1QHHA 1G6KA 1U28A 1E60A 3CEPB 3TR6A 5HDQA 4QWMA 2ONZA 1K8QA 4AP5A 4EKIA 5LZ5A 3QPWA 3BRWD 1NF2A 4AY5A 4MUAA 1ORDA 4CR6A 3WBKA 3AJRA 4OIFA 1UMDB 4I66A 5LQDA 3ORHA 3PIRA 3WR5A 3C14C 3O91A 1YMQA 3HV0A 2ODWA 4GMHA 1BN7A 2LRHA 3HM9A 3P20A 4XTRA 4CM9D 3NRBA 2KE5A 4B5LA 3UF0A 3QUQA 4LBYA 1C0EA 1JFFB 1YDGA 1I2BA 4FFMA 4QGAA 5KAMA 5BMVA 5LNK1 2MYUA 2DTDA 3F4LA 4MKGA 2KS6A 3UKOA 2YN0A 4K6HA 1VA5A 3FKSD 4G26A 1DFGA 1L4HA 3KXDA 3S4YA 4KFCA 3DW1X 4AJHA 1CZRA 1N0UA 1BXGB 1NQOA 1XWFA 3IEXA 4MYHA 3ZOKA 2G25A 1YL7A 3M81A 4B3DA 1DX4A 3BL5A 4HBGA 1FBTA 2NTYC 2GBCA 3FPSA 3WGNA 1E7YA 1TGVA 4GW3A 2Q6OA 4N6NA 5AM5A 2B0CA 3Q8KA 1ZGZA 3O3OB 3PIDA 4KN9S 5TVGA 3FWZA 3RSOA 5KQLA 1ZXXA 3GNSA 1YVRA 4YPOA 3CF4G 1DWOA 3VBCA 4CMIB 1H9BA 2X0JA 2R96A 5ES3A 1W25A 2VQ3A 4E94A 4YT4A 2PMFA 3QXCA 5G41A 1DTWA 2A0FA 4Q21A 3HCAA 4U9HS 3GLFA 4DMUB 1IHPA 2X0RA 4D74A 1EA5A 2JA1A 4FDTA 4K1XA 1MZPA 2V7QD 4P2BA 4P3YA 5AJWA 1QSGA 1U2DC 1IEVA 4LYJA 5K8LA 4C04A 2E7ZA 1ZU4A 3WGMA 3FFXA 5JZSA 1P33A 3AWDA 1GILA 2F9FA 2Q4BA 2I3GA 2WWHA 2SKDA 4I3GA 5EIHA 1TFUA 2EX4A 4RJKA 1KDZA 2JVKA 3R3HA 3UV6A 4AZ3A 3EZLA 1RWOA 1KI4A 3FCUB 3IAS6 1T2UA 3QVLA 1NN3A 2K4MA 1CE8A 4KIWA 4NZ9A 5FV7A 3UK2A 1XSEA 3KFXA 1YJBA 1WPQA 2ZWVA 3LW7A 3P0IA 4KWEA 1PJRA 2LXNA 4A6DA 1LC0A 4F9EA 2BH9A 3AR4A 4KUHA 5JARA 1Z5OA 4UMFA 1CY8A 1G4UR 1GR0A 2BFCB 2FZVA 4Q18A 3RT9A 4RTOA 4OFBA 1GSHA 3WX0A 2RHTA 2R11A 3QLVC 4IYJA 2AXQA 1K5GA 4K87A 3HB5X 4TUYA 1AGPA 3GJ6A 1TYCA 1WHTA 3L0IB 2VJPA 2ZATA 3MPOA 3TQQA 3U80A 4UZEA 3ROEA 4YASA 1VTKA 4REOA 1L1EA 2ZTMA 5EQJB 3FH0A 1KI6A 1U8XX 5HMLA 4HVLA 2LWIA 5CNKA 1X1CA 3DLHA 4BVEA 2I0FA 4D3SA 3VR2D 6CHYA 1NG9A 3JWEA 2GJAA 5MN5A 3N70A 1HOXA 3DO8A 2DC1A 2I33A 4HDCA 5BSMA 5FAKA 4IF4A 1Z39A 5HUJA 1W7AA 5LM3A 2J30A 4AIRA 2C2GA 4ZO6A 5A9SB 1OB2A 3I9FA 2C54A 2YZGA 4IG9A 1UAYA 1SCUB 2XKJE 4GFDA 2UYCA 5DOZA 5CLIA 3A3NA 1PFVA 1SVKA 2YTZA 1BXRB 1AHPA 3I6IA 4XCQA 2NACA 1M2JA 2NVOA 5F2OA 4AW9A 2LTAA 3ZDYB 1QRAA 1QRTA 3GPIA 2ACKA 1YI8A 2OZVA 3ASZA 3M89A 5HBRA 1YDEA 2YXBA 4E1AA 3K0CC 3R7SA 1XZPA 3CZAA 1NE7A 3GFTA 2E5WA 5C80A 3LT0A 2QSYA 2O2CA 3G79A 4BGIA 1FRQA 4LVCA 3L8YA 4EG8A 1ZKDA 1CG6A 3IBSA 4TL8A 1USKA 5FBHA 4MIYA 2ACEA 3NDPA 1HFKA 1MG0A 5ISMA 1RLTA 3NW9A 3AINA 4KK4A 5GPBA 1MAHA 1A2KC 1GAXA 3DDOA 3GDWA 5LP6F 3N9IA 2FE4A 1UOOA 1H4TA 2C5BA 1JQJC 2FOIA 3OPYI 3JQGA 3GHHA 5CM2Z 2PGAA 3ZE9A 5D7BA 1XDSA 2I1LA 1UADA 3IBYA 4I4TB 1YVDA 2VYCA 3BIJA 4CPDA 2WWRA 4TZ6A 1U65A 4RVFA 1GZ4A 4ZEOA 3DKVA 3WV4A 4MW7A 3THOA 1SBQA 2JHFA 3PIIA 4ZZ1A 3ZWCA 4NBNA 3GLIE 3HUEA 1TI7A 3NIBA 1GU0A 3BD9A 1XL0A 3DLCA 2X9QA 2DZDA 4TOIA 4IWXA 4BKRA 3RYCA 2OXIA 1GYQA 3KEMA 3LDGA 5ERGB 2Y1KA 1NG1A 2B8WA 2FP4B 2I6SA 2NUPA 3OJEA 4KXLA 4KVFA 4L8YA 4M8KA 4X3OA 3ZWKA 2YJ6A 1JEOA 3IB3A 2BBWA 1E69A 4PZUA 3ZHQA 4HDAA 3TPZA 2UZ1B 1I14A 3UWOA 2GZAA 4BFTA 4CMHA 5IS2A 1CETA 3S81A 1U99A 5EGNA 2EBFX 1JSLA 3V1KA 4WZAE 3OICA 3WB1A 3SZUA 3HCFA 3CRZA 1KS2A 2O4UX 2OBXA 5JROA 1BEZA 2XKKA 4FGWA 1H85A 1LDBA 3A9VA 4ZVVA 2CFOA 3U1TA 1JFSA 1E8MA 1NUAA 4O6VA 4EPRA 1SELA 2VBCA 2Z1NA 2DLCX 3VNUA 4HX5A 2K6GA 1L7OA 5DCWA 3OQVA 3T7EA 2TS1A 6PFKA 4GNKA 1SB8A 3FSEA 1ZMOA 2FZEA 1SOAA 3OCXA 2HU2A 2D5BA 4PNZA 2ZS7A 3HL4A 2NZ8A 3I0ZA 3ZTYA 2IHJA 4PRLA 2ZW9A 2NGRA 4CDNA 3G9TA 1QP8A 5CH3A 1WQ1R 4MWGA 4BV3A 1JEDA 1EZZA 2O50A 4ZCPA 4N3BA 3ONWA 1PK9A 2V74B 5FR1A 2YBEA 2PLRA 3G2OA 2FOXA 2JLRA 1BS2A 4OHWA 5AI6A 2CWDA 2PMEA 3GNTA 3KLNA 3KSDO 4HXYA 5FUXA 4X1YB 3DUFA 1GNLA 4XH9B 3RTDA 4LHYA 5FIUA 3IR7A 4GOXA 5C81A 2JFHA 5F1YA 4LQDA 2WWFA 2JLYA 2Y05A 3ZLBA 5EIAA 4XSVA 3W8EA 4IJ5A 2JCSA 2JHAA 3O83A 3G85A 3GDGA 1E3EA 3L49A 4N01A 2IVFA 4NS1A 1YZGA 4RSMA 2Y0DA 3L40A 1JQ3A 5I9SA 3GLGA 4YT5A 3AW9A 5CHEA 4IKOA 3M2TA 5ECGC 5I3ZA 4XDYA 1K7CA 1Q7GA 1QVRA 2QDKA 4MKXA 4MPTA 4YAJA 1VI2A 5JMPA 5GVSA 2BAGA 5IJ9A 2EGGA 3CLHA 1E1KA 4NK4A 2ZUFA 1XVUA 1LD3A 2AZXA 3TVTA 1JKIA 5KBYA 4IIVA 1DIAA 4NH4A 3QUSA 3ZQ4A 4YAFA 4F3CA 3TNYA 1KDRA 1LRJA 4U6SA 3QWFA 1FX0B 1H42A 3R8FA 3CX8A 2XYRA 4C14A 2GNPA 1X1BA 4QSHA 3EA5A 3PR3A 5E6UB 3NH9A 2PUAA 4YAIA 2LVBA 4FXOA 3DVAA 2BN4A 4W1PA 3DTVD 2NSHA 3O92A 3WYBA 1R5BA 5HCUA 5JBIA 1MN6A 3BREA 3TNFA 4MRPA 2CJYA 4E6EA 1M72A 3R1IA 1RYBA 3NWOA 3ORRA 3UJ3X 3B89A 4CKEB 3HK2A 3I9MA 2Q5LA 4RZ2A 4HYYA 1BYUA 2VJCA 2ZSBA 4EM6A 1VJGA 3UJDA 4BNNA 1D2NA 2YR0A 3MNFA 1ONSA 3MLBA 3N74A 3PNPA 2PKEA 4L0QA 2QSZA 2OFXA 4D8WA 3EMBA 2ZBFA 4D44A 4EI7A 4C7BA 1EDBA 5CAEA 1N2CB 4K9RA 4OJQA 1INLA 2D0DA 3JQ7A 6LDHA 5JWRA 1WVGA 1YQXA 3K70B 1DBWA 1YRAA 4MR8B 3DEKA 3PUWA 2IE0A 2VP2A 1KBZA 2IYSA 3TR5A 3HV2A 1CS0A 2WJAA 4BZWA 2D4AA 3LRPA 2AZMA 3DL4A 4JI4B 4K9MA 3H8VA 4ZVSA 3VHQA 2HLHA 5BSHA 1M73E 2X8WA 2H4XA 4PN7A 1E62A 1NNLA 1Z4MA 4LBZA 1ISFA 1T5HX 2EF1A 5JFTA 4BY9E 4NCBA 1YR1A 1HMPA 4D3YA 2KPOA 4JLAA 5ITSA 2QPOA 3VR4H 3JTMA 3K2QA 2AK2A 5LZ4A 1XR3A 3M6WA 2CFRA 1E2BA 4Y67A 3PQCA 4WOPA 2RAUA 1VC2A 3IBFA 4KDRA 3GVHA 5DTQA 4L3WA 3TSZA 4Q3EA 1BFKA 3ZYCA 1E0DA 4FX5A 5B57C 1O4VA 3ICPA 2NQ8A 2ZPTX 1EFVB 3A6LA 3H87A 4TSFA 3E1GA 3UANA 3EUAA 5TT1A 1LNZA 3RYFB 4AJKA 2JI7A 4CQNA 1EE9A 1YJ5A 4R05A 5C32A 4I1PA 1BCSA 1E7WA 1P6XA 1ETHA 3JZDA 4U2FA 1EFTA 5FHQA 4F97A 4MR9A 5JJBA 5JPDA 4M6WA 5JQWA 4R69A 2BSQA 2HQRA 5BN1A 5JZ9A 2HGSA 1YBMA 1RAFA 5ENVA 5DFAA 3MIIA 2VNHA 1T3ZA 1FU7A 5LXTA 1CRQA 1H3EA 1KFBB 1OZAA 2ZUBA 2WSYB 3M1IA 5AW7A 2BTQB 4QJ3A 1N32B 5ECYA 3U4DA 5BMOA 4TZKA 1VBFA 4H4DA 1G5QA 4E46A 4ZHQA 2SECE 4CIWA 5JFGA 2OG1A 4WOJA 3P9NA 4D3DA 3ZHTA 4R9VA 1ELOA 4PIPA 1PL0A 4DDHA 1ZCAA 3P2IA 1PK8A 3K0AB 4HVAA 4RIFA 4DKJA 4GDFA 3T54A 3GFBA 1H8EA 2Z6QA 1YE8A 2AHOA 3T1QA 1K27A 3FPAA 1UIMA 1I5RA 2I2BA 2QEQA 3CVVA 1JXAA 4E11A 1YXMA 1UBRS 3CLTC 5CVJA 4BU1A 3F3YA 2FKAA 3ESYA 5BWOA 1RAEA 1EPUA 1PNQA 1X9IA 2PXHA 2ZR9A 2HJVA 4LMRA 1DV1A 4WEQA 5CT6A 9MHTA 3FTFA 1ILWA 3IEMA 5BN3B 2HCJB 3H4MA 4HC4A 4RF5A 4DR3B 1MO4A 1DQSA 2ZYAA 5IKPA 4EG1A 3UQYS 2ODTX 2WAAA 2BFFB 4BV2A 5DGHA 4FK8A 5COQA 2P40A 1SD2A 5EZ5A 5A7FA 3L6RA 4MVYA 2BHRA 2B9EA 2PZAA 4QYMA 4NESA 5AQEA 2F43B 2ZSDA 2YBDA 1GG2A 2ZIUB 1GRVA 4MUFA 3VMFA 3WB0A 5A71A 3U7GA 4Y9SA 3N8KA 3IAS1 2ZXEA 5ALEA 4YRSA 3GVIA 4L6IA 1XDZA 4MDYA 1BE0A 5CCDA 4NBLA 2AD5A 3WJ7A 2H54A 5A4AA 1FOEB 1TCCA 3FA2A 2O1WA 4FVTA 4FW8A 1WAMA 5KYUB 4QBIA 2AQIA 4IIJF 3BK7A 3VU0A 4D98A 4AWAA 1OXKB 1QKJA 2X6TA 1P3DA 1P74A 1T5TA 2YINC 4Q4LA 5DLEA 4ZU6X 5BURA 1LS6A 4KLAA 4MS1B 2ZFUA 2RHRA 2XTZA 4GX0A 3SGLA 1W8IA 5EIEA 4BNXA 5GZ6A 1KJWA 2PX6A 3S1LA 3T52A 1O89A 1R27A 4C0AC 5GIPE 3U4QB 1H2BA 2HLNA 4G81A 1PI3A 2X5NA 3STVA 3ZXSA 4CIVA 1P17A 4BMZA 2H0QA 2VP3A 4KH0A 5DTEA 5AI4A 4BMOB 4NV3A 2FZ5A 3FSGD 2OO3A 4PSAA 3PRKE 2Z43A 4OYYA 3ZE6A 4YTEA 3OT1A 4PGHA 3P52A 4MOWA 1C7FA 1US8B 2AEMA 2J3IA 1VMKA 3OMWA 4TMFA 4EHNA 4JBYA 4DA0A 5PNTA 3IIJA 2V96A 3F9RA 4ADSG 4Y1RB 3NOQA 1W34A 1YCHA 3G8YA 3PV0A 1EH5A 2QTBA 4Q48A 5KKAA 5IDWA 2R65A 2GPNA 1O6GA 3GRUA 3LL7A 4NF2A 4U2GA 1E3LA 1S4QA 3CZQA 3LVFO 1MQSA 1EGVB 3ZHVA 2L17A 4BVBA 4W5QA 2HA0A 3EBOA 4ZK2A 4AKIA 1T5BA 5KYYB 4R4JA 2CF5A 2PLNA 3F49S 2GWHA 1QQ7A 3FOAA 3OG9A 4WESA 5DHAA 3WNCA 3JPWA 4D9EA 1I1NA 2JGJA 1SHZA 1U8FO 2DBVO 2WM3A 1SXHA 2X14A 3PNOA 4QGFA 4K9QA 3N8NA 5JTTA 4V03A 1Y42X 1J00A 1N2CE 3AEUB 1I5OA 1QZZA 1NT4A 1YGPA 3FMVA 3SC3A 2F1JA 1LS1A 4KXXA 5DBIA 4BN5A 1Z16A 4Q9KA 2FJUA 2ZU6A 2NZVG 3AFNA 3BJEA 3D8UA 3TOCA 1CR6A 2FMIA 4UE3S 3MMXA 1IRIA 2V6MA 3JRXA 3ANXA 4G8CA 2DCMA 1TIPA 1X77A 3BICA 2V7UA 4D79A 2G1JA 5CJJA 4J16C 1Z0UA 4ODIA 3AI7A 4U7JA 3TZCA 3TFOA 8ATCA 1GU1A 4IIFA 3TQFA 5FJJA 3LQRA 1N0VC 3H7AA 4RCYA 5KX5F 5D8DA 3GLFE 1KSHA 2CNLA 4DARA 1YK0A 2NO0A 2HADA 3F96A 2ZKLA 3INTA 3DZKA 3W9UA 4EBBA 5HE9A 3DM5A 3H18A 5CW2A 2O8FA 1NXTA 3HKEA 1N92A 1T2CA 2D1RA 2OXFA 4LS3A 1HYBA 3NHZA 2ZAIA 2IHBA 4ASUD 3QWHA 4NATA 4YJGA 3I28A 4OI4A 3KKEA 3TZQA 1L5HB 2ZQYA 1XD2B 3MXOA 5P21A 3ZE2B 2P5SA 3FSJX 4MKZA 4O08A 3HCPA 1IHDA 2QTNA 1J8FA 2X0NA 4HHEA 1WVIA 3N6VA 4RZUA 4ZYZA 5IU6A 5JD5A 1VCNA 3GEMA 4UDXX 2OBMA 2DPMA 5A0VA 1J8YF 1HLFA 1GFZA 5ELXA 4JT2A 3P71T 4PM4A 1FIUA 3V9AA 4HJRA 3N2ZB 5ALOA 1OYVA 1B00A 1VPLA 1UFRA 2ZAMA 3NHLA 1J7JA 1NMQA 1W5FA 1RMTA 1XCOA 2D1FA 4O5OA 1PT8A 2I67A 3F97A 1RC1A 3D0QA 3IULA 4WADA 1JT2A 2IYXA 5J5VA 3MJTA 3H9JA 1AM4D 2PMWB 4Y2RA 4Q7LA 4TN5A 4MWCA 5DHFA 1EX6A 2YQZA 4YUZA 5LYJF 3AVTA 4FHFA 4MRMA 1L7QA 2PGXA 2CHUA 1GPAA 5CLLA 4IHAA 5J63A 3BQNB 1ADYA 1IULA 4MCHA 5ECDA 4F96A 4Q0MA 1R0ZA 3KQVA 1IK6A 1X8JA 3C1AA 2A4KA 2WUVA 3OF2A 1P62B 3K2IA 3Q0IA 4M46A 4MQ6A 4PC2A 1A4RA 3S8EA 2P2ZA 4P7JA 4QJIA 4UHCA 1DHTA 4JMLA 4C0BA 4LTDA 4A92A 3Q5DA 3VDXA 5JLAA 5IT0A 1BA3A 1P0QA 4ES6A 4DJDC 4MLZA 1LJLA 3R7WA 3OTHA 4RVNA 3ZCPA 1EB9A 4ZJUA 2WU8A 1UOQA 3W04A 5E9WA 4YRBA 2FW0A 3WSVA 5AM3A 1JAHA 4KDCA 4HQRA 4DUPA 3KD3A 4Y9TA 3NKFA 1NMEA 1EVQA 1RQRA 2C8JA 2HPVA 5KNBD 1W88A 3QKTA 3N53A 1KZ9A 4RJLA 1KZHA 4AJ9A 4I4NA 4P80A 1QUFA 3R0JA 4ZO9A 4UOQA 2H0RA 4Y1GA 1THZA 3RU9A 4DEVA 1R9JA 2EW8A 1G60A 3FOFC 3WGJA 1L5NA 2V7EA 7MHTA 3HE3A 3CKMA 1E4VA 3H5LA 3L07A 3NIFB 4N7BA 5DB4A 1Y7TA 2P3SA 2QG6A 2UYQA 4NONA 4DPKA 5EHZA 1KJQA 2XTMA 4OFXA 4PZEA 3VC1A 4G23A 4JVMA 2WKRA 2XRFA 3R23A 3SDSA 1R5NA 3SR3A 1V7ZA 1ECPA 4RKFA 4TGLA 4KR3A 2Q4EA 3RRXA 2RHWA 4B0PA 1Y1SA 1QCDA 1UJBA 3GLSA 5C5CA 4EMTA 2BZGA 1TYZA 4FDAA 1V1RA 4K9NA 4X3CA 5J3JA 4KGXA 1A9PA 2I2XB 3OECA 3LA6A 3HDHA 1BG6A 1Y5MA 3OCUA 3RUEA 4BEBA 3CNOA 1Y9AA 3ZY5A 5IUJC 1ODIA 2ZYHA 3CNQS 1MRZA 1COZA 5I7OA 2OAGA 1JHRA 3O75A 1NN1A 4KQHA 1W46A 3DDSA 3N2GA 3CRVA 5KHOC 2AJTA 2NO4A 3AY7A 2J9FB 2PT7A 3NNDA 3GEGA 4ME6A 3WQRA 1DIRA 4EP1A 3BF7A 1QZTA 4O02B 4ICIA 1QFYA 1NQUA 3FG9A 4LUCA 3THSA 4DLZA 2W93A 1Z28A 1Q1GA 4JJAA 1IUKA 1QH0A 4OI1A 3REQB 3CVOA 2H7YA 2AMYA 1A5BB 2RH5A 3PDHA 4OQQA 4BLRA 1RWKA 2GEVA 2B3DA 4Z4EA 3IMGA 3D5TA 1OV4A 3THXB 3LC7O 2WM2A 2NXWA 2VYVD 4QDKA 4UVDA 3RASA 4ENRA 1TRHA 3ROXA 4EVRA 1O6FA 1NBMA 2H1WA 4DCPA 3KV1A 3K1AB 4PLTA 1VKNA 5AUQA 1U2SA 4ALKA 3PPIA 1E2IA 3R4CA 2QVBA 2RAPA 3ZKWB 1YI1A 2VTEA 2J9GA 2XTJA 4JBLA 3I9KA 3F7OA 1K9SA 2GETA 2Z8YM 5GINE 3I01M 2Z9BA 2M1XA 3CVWA 3DZIA 2QM0A 1EIZA 1PJAA 1RR6A 2H18A 2W6JD 4IXNA 1UEJA 2VDMB 4XUDA 4M22A 4LGMA 3ELDA 3ISVA 4YA6A 4LQCA 2II6A 4B73A 2F67A 1E63A 4NCXA 5AUOB 3NETA 3UOWA 2I4MA 4QG3A 3RC7A 4M1OA 2GEKA 1CERA 2A14A 2ZIGA 1UBJS 2A78A 1H2YA 2GYVA 1DKQA 2MSNA 1AF4A 2Q6IA 3K8QA 3N8GA 2VF4X 4G4IA 4ZODA 3PX2A 2RI6A 3OPYB 1X6VA 1ZX1A 1N57A 2HDHA 1SZPA