1QBGA

Crystal structure of human dt-diaphorase (nad(p)h oxidoreductase)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
272
structure length
272
Chain Sequence
VRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NAD(P)H DEHYDROGENASE [QUINONE] 1
publication title Crystal structure of human DT-diaphorase: a model for interaction with the cytotoxic prodrug 5-(aziridin-1-yl)-2,4-dinitrobenzamide (CB1954).
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 272
sequence length 272
chains with identical sequence B, C, D
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 1999-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qbgA00
5EMNA 4QOHA 1KBOA 4N9QA 1OFVA 1NNI1 1WSWA 3K1YA 5B3LA 4PTZA 2OYSA 5LVAA 2ZKIA 3KLBA 3OX2A 2MTBA 5LJLA 1DXOA 1SG0A 4CF6A 1AG9A 4YQEA 4YAUA 3HR4A 1CZKA 3NHPA 4ZVLA 3QFRA 2HNBA 2R96A 3KEGA 1H69A 2F1OA 1FLNA 3NHFA 4HEQA 1J9ZA 4ZVMA 5NLLA 2Q9UA 2MOKA 3QE2A 1TLLA 1BU5A 3NHSA 2FLVA 1XT6A 4YALA 3GFSA 4NULA 3ESYA 4NLLA 1ZWKA 5FX2A 4J8PA 2FZ5A 3KAQA 3QFCA 3FVWA 3L9WA 2A5LA 1C7EA 4GI5A 4OXXA 5LJIA 4C0WA 1JA0A 2BF4A 1FLAA 3D7NA 2D5IA 1YDGA 1AKTA 5EAIA 3G5MA 3K20A 2FOXA 2WC1A 4FGKA 3NLLA 3OJXA 2QX8A 4FGLA 3NHLA 1DXQA 3R6WA 1SQSA 4F8YA 1FUEA 2Z98A 3LT5A 4U7GA 2Z9CA 2HPVA 3W79A 3S2YA 2OHHA 4ZVKA 3RPEA 1D03A 1CZNA 3SVLA 5FA6A 2W5UA 4QOIA 4FX2A 3F90A 4DILA 3P0RA 4ZVNA 3B6MA 3ES9A 1FVXA 5FUQA 2QR2A 1GG5A 4HS4A 2B3DA 4C0XA 1CZOA 3NFRA 3OX1A 5B3KA 2Q62A 2BMVA 1YKGA 4N65A 4U7FA 2QX9A 1H66A 1DX9A 1BVYF 3FX2A 3GFRA 1RLIA 2QMYA 4QOFA 4Y9UA 4QOEA 1YCGA 4GQIA 1AKUA 3GAMA 3UXEA 3OWXA 3N39C 2XODA 3EYWA 3NHKA 4ESEA 5JROA 3HLYA 4C76A 2FCRA 4M0CA 2HNAA 3LCMA 3OWHA 1T5BA 2V9CA 1YCFA 3U7RA 2FDXA 3UXHA 3JSXA 2V5UA 1VMEA 1D04A 6NULA 1AMOA 1QBGA 3L9XA 2QX4A 1QRDA 1YOBA 3TEMA 2FVXA 1E5DA 1CZRA 3N3BC 3NHRA 4QOJA 3U7IA 4R81A 5TGZA 2OHIA 4H2DA 2N1MA 2Z9BA 5BUCA 3B6IA 3W78A 5F12A 2BN4A 5LLDA 3FNIA 1AZLA 1I1OA 1AHNA 3GFQA 2AMJA 4U7HA 1AKVA 1D4AA 5ULLA 1OBVA 2V5VA 3NHUA 1T0IA 2R97A 4BMPB 1WSBA 4LA4A 1XYVA 1CZHA 1FLVA 4XDHA 1JA1A 2BPOA 2KLBA 1CZLA 2BZSA 1XYYA 1QR2A 5LBUA 3O2NA 4DY4A 1X77A 4H6PA 4YAOA 3F6RA 2XOEA 3OJWA 2QWXA 3ZHOA 1AKRA 1YRHA 4DIKA 2FX2A 1RTTA 5EA2A 2FAXA 1J9EA 3NHYA 3OVMA 3ESZA 4PU0A 2Z9DA 3N3AC 1C7FA 1AKWA 4Y9RA 4YAWA 3KAPA 5LMCA 2OHJA 2X2OA 4QOGA 4YAFA 4GR9A 1TIKA 1YCHA 3EDOA 2MT9A 4XDGA 1RLJA 4S24A 1ZWLA 3F6SA 1ZX1A 1AKQA 2QMZA 1XI2A 1QHEA 3F2VA 5NULA 2M6RA 3OX3A 2KQUA 3NHJA 2M6SA 4PTYA 1V4BA 1CZUA 3B6KA 4ICIA 4LTNA 1FTGA 5LBTA 1OBOA 2FZVA 1J8QA 1RCFA 5F4BA 4BMOB 4LAFA 3O73A 4LTMA 1FLDA 4QODA 3NHWA 4D02A 3B6JA 4C14A 2QX6A 1F4PA 3FW1A 5A4KA 4Y7CA 2GSWA 3W77A 4CETA 3HA2A 3ESXA 1J9GA 2ARKA 5F51A 1FX1A 3TE7A 1B1CA 2X2PA 3W7AA 2RG1A 4FGJA 3TZBA 1KBQA 3FJOA 4LTDA 2MWMA 4N82A
chains in the Genus database with same CATH superfamily
1H0RA 3DEHA 1ZKMA 4ZT4A 3INGA 3NIWA 4MYHA 3BMCB 4J29A 3FSRA 2C9ZA 3K2BA 4N47A 5HOEA 2OVBA 2FSFA 5KJCA 2DHQA 3IIKA 5BN5A 5FP0A 3A6JA 2Q45A 2AI3A 4WOKA 3VAYA 5D1NA 1YA8A 3R0VA 8ABPA 1NU6A 4UU8A 2WFLB 5LLSA 4R6WA 2JLSA 2ZKIA 2XVAA 3KLBA 5CPFA 1EKXA 5BRNA 1L4YA 2YIJA 4MGHA 3QPBA 3FUCA 1ADBA 2CFSA 2E49A 4PONA 3X1KA 1RU3A 2XXJA 1M2EA 3EUAA 3QWHA 4YO8A 3ZTWA 4NU0A 2V3VA 4CF6A 1M7HA 2GXQA 5JAUA 4MYUA 1T8RA 3HFGA 4IF4A 5KYYA 1IZYA 2EWWA 2R1TB 2G6BA 5CPBA 1LI4A 4YMWA 3P7MA 2MSLA 1U3TA 2VJCA 4YRTA 1GGFA 4M7RA 4LJ5A 4PQFA 1RWQA 2DWQA 1V2HE 2GJ9A 4GI1A 2RH8A 3E7DA 3C24A 4M8IA 3CVXA 3OOJA 3RTAA 2E18A 5BSRA 3RVJA 3AM1A 4PX5A 3OTQA 1W581 2RAPA 1XPJA 4MQEB 2XX3A 3MJVA 4M9RA 1E3JA 1YI0A 4MYCA 1AKEA 2ZFUA 1E4OA 2XUAA 2ZYGA 2QY9A 4WJZA 3SMVA 5A06A 3ZDAA 1MO2A 2O7NA 2NUAA 3K31A 5EIBD 5BR8B 2L2QA 1YKSA 5ES3A 4ZVMA 3ZNOA 3C8ZA 3OCVA 2Q9UA 1R8QA 3G88A 4MR7B 3NHSA 1J90A 2P2GA 3P2YA 3LZDA 3RKSA 5CLLA 4KE7A 2XLCA 1UDCA 4J4BA 1DAHA 1ABFA 3KVNA 4WESA 3I0NA 5H8WA 1NNEA 1JNYA 4YALA 1Z16A 2QPLA 5G1OA 4AWBA 1G38A 1ADYA 3QPDA 3PWTA 1RJWA 5H3LA 2PZGA 4N6GA 5I8PA 4R2KA 1FC0A 1SVIA 3COWA 2Y93A 3TX6A 4D2IA 4EYSA 4KQIA 1KOJA 1XK6A 1ELOA 1QDUA 4NENB 1PG0A 5FUYA 2W4IA 3FDZA 3A7EA 2BEVB 4B7AA 2J0UA 3RFUA 1I5OA 4BV9A 5IKPA 5HDQA 3WWOA 4E14A 3HJUA 4Y6QA 4J1SA 1Q77A 1ESCA 5AK5A 4E46A 3UJNA 2A5LA 3OF5A 3FTFA 1GQ2A 3KIPA 4DSOA 4K03A 1KAEA 2FMXA 2NYUA 3N8GA 1ZITA 3VC1A 5DHUA 3OUUA 3O74A 4G8CA 5CXSA 5BSTA 2ZETA 5ED4A 2NO4A 3PHIA 3L6BA 3ORSA 2QD3A 4HDCA 4J2HA 3BMQB 1E2MA 2BRUA 2VA8A 4NICA 4WNAA 4BO2A 2NIPA 5HKOA 1EE2A 1YZ3A 1S8FA 4NATA 3UBMA 4B9EA 4BE9A 1FJ2A 1YDGA 3CUWA 2NZ2A 4M6WB 2OV6A 3D7RA 3CM0A 3EWNA 1B14A 3SX4A 3HDQA 1GNVA 2ZRLA 1GHTA 1X80A 2FMIA 1CJBA 4FGKA 3ADKA 4LXGA 4NTZA 5DCYA 3V8BA 3GFOA 4ROTA 1YNOA 3C4JA 3A4IA 4LHVA 1YTLA 4JCCA 5FPPA 4H3HB 2IH5A 2IU4A 1Y6QA 1E0AA 3UK1A 1E1MA 2YIMA 4OKIA 5KNDH 3EK2A 3VC2A 3F1KA 4IRXA 1ZY2A 4PNPA 3WSWA 2PUHA 1B3BA 1NHGA 2O0KA 3DKVA 3FY4A 5AKHA 2B6HA 2OV1A 2Q6OA 2XYHA 3RS7A 4X64B 1FPMA 4BO9A 1K0UA 1W5TA 1WUTA 5K1ZA 3R9WA 1P80A 3TQSA 2R86A 2JFVA 3ASVA 3EXG2 3H8WA 5CH5A 3SD7A 2I4OA 3WL8A 4JOBA 4YRAA 1SZCA 5BXQC 3H4TA 2YJ3A 4DG8A 3QGMA 1IBMB 1AK1A 3KEMA 1U3GA 4Q1VA 4GOOD 4ZVKA 3C6KA 2GHRA 3DO8A 2HU5A 3LQ1A 3PNKA 2GVDC 1N6IA 4MVJI 1KIMA 1UBLS 2PYZA 2O0JA 3GLHE 1FTYA 2QV0A 1KXZA 4IS3A 3ECCA 3G82C 3LBNA 2P1RA 1OHHD 3FCUB 5C4GB 3SJBA 3PNVA 2O57A 3DV9A 3AM4A 5PNTA 3DM9B 4WXMA 2X0JA 2NWQA 1WU8A 2J3MA 2Y1EA 2ZI5A 4FDUA 1UBKS 1SEPA 1ONBA 2ZIAA 4GO1A 1EESA 3PWZA 1BDHA 1UM8A 3CW8X 1ZZEA 4X60A 2H1OA 3PQ6A 1JJIA 1SOUA 2HCJB 4WIAA 4C0XA 5LXTF 1E79A 3BSWA 3QNMA 2AF3C 1QYDA 2JJMA 3KM0A 4KXWA 1F38A 1T5LA 2QJRA 1RPJA 3F0TA 2IY8A 4C7BA 1AV7A 5A3RA 3ZJVA 4D8TA 4RCVA 3DAYA 1U9IA 4G1BA 4KLRA 2RHJA 4H1WA 4JI8B 4BPRA 2P3SA 1KMHA 3ICCA 4PCUA 1ZXLA 4BWVA 1T3TA 1PG2A 5LXTA 5DLPA 3L8ZA 1UMBB 1C7IA 5TGDA 4MKHA 3S70A 1BVYF 2CMFA 2WSBA 4Q4AA 4B2IA 1PYDA 1Q21A 1TCBA 4R1UA 1NR1A 3I4FA 4WDRA 3K9NA 4TQAA 4B80A 3FX2A 3ADCA 4FM9A 2BGKA 3FCXA 1Z7GA 1MQ9A 3UMRA 3ZBTA 3O4GA 5TIIA 1KI9A 4NK4A 4Q02A 3OQ1A 3TQHA 1IPHA 5K3OA 2O8FB 3R2JA 4DCVA 3L02A 1U2DA 1EZ1A 2DC1A 4NESA 4P4GA 1UJBA 2FJUA 4KYTA 3E9YA 4L8FA 2H3EA 2FZKA 4NQRA 2WHRA 1QANA 3GJQA 2HF2A 4XARA 2OQ2A 4J07A 1WBDA 3DHYA 1BKYA 4PAMA 1PU2A 3L6EA 3EA4A 2O3UA 1U80A 2VHYA 2NTYC 3BMNB 2XUIA 3S2IA 3IJEB 3E8MA 5KQPA 5B4TA 4CLRA 3LPNA 3FRJA 1IY9A 3DFKA 4Q24A 4NFSA 1FBTA 2RKWA 1BX1A 3GRCA 3OUZA 4KX3A 2PJRA 2X6TA 1X38A 1CY2A 1NXWA 1G1MA 3JASA 3WYGA 2ANCA 4TTQA 2EW1A 5GONF 2VJQA 3CR7A 1PZEA 3JSXA 3EDMA 3HC7A 4Z9FA 1L7MA 4XVCA 3P2OA 1C8KA 4J0KA 1U2RA 1NQVA 3G2MA 3AUUA 2W6PA 4MRNA 4G24A 4F2DA 1Q50A 1RWOA 2XY4A 1O4WA 3ZI4A 1NMYA 3GEBA 5KTRA 2H2HA 5DYGA 3KSBC 3THYA 2SKCA 3PNLA 3SFZA 1LUAA 3N07A 3H04A 2B98A 3MTBA 4UTOA 3RSFA 4Q47A 3UG7A 4JB0A 2CLHB 1NXQA 2BFAA 2CLDX 2P6MA 4HTFB 1TYBE 2P67A 2ZJBA 3NHRA 4QOJA 2YS6A 1SD2A 4RLQA 5B1EA 4YDRA 1DEHA 5EC8A 2OHIA 3PUWA 5KNLA 5LKAA 2VZLA 3OTOB 3RLIA 1W75A 1UBHS 2H7YA 5JYBA 2JFOA 2YYYA 4BNNA 3FVTA 4M9XA 2VNSA 4AX8A 5EZQA 2Z2IA 3OQMA 1AOXA 2HMYB 2J3LA 1KWGA 2EFHB 4BFLA 4DV7B 3K1ZA 2ZRDA 5HE9A 4ZT3A 1ZCAA 3CW2A 1I9GA 3VOSA 4C4SA 2R1VB 3BPSA 3SDBA 4X1OA 3I92A 2XB9A 4MYDA 3HJTA 3KQNA 4FGZA 4OF4A 3IEMA 3W3AA 4UUPA 3W8FA 4F7DA 4LWOA 3B6IA 3N2NA 3OF3A 3TAUA 1XDZA 2A0YA 1NJ8A 1O94C 2PLNA 1AZLA 4X8OA 2HO4A 1V71A 2X23A 3DMGA 1DZ3A 2X0KA 2DUMA 3DBHA 5KJ1A 2P2YA 3Q2OA 4GYWA 2Q6KA 5JYCA 4DCOA 4BRWA 4CN8A 2P69A 2C4VA 4X6YA 1NMEA 2IXEA 3KSAC 3UV3A 5DULA 1NDQA 2R97A 1D09A 1Z74A 1GCUA 1PQ4A 2JK1A 4JT9A 1WXDA 2ZUSA 4M55A 3PTAA 4YA6A 2AYYA 1OLUB 1CUWA 1GYPA 4GM1A 2LDXA 1FFXA 1YR3A 4RCZA 1P7WA 4GGOA 1JMKC 5JVDF 2G06A 4PC7A 1FP6A 1Y7LA 4OMCA 3ZDCA 1P0QA 4CL0A 1XYYA 2QYOA 4A8JA 1ISPA 1XVLA 4F04A 3VDQA 3AERB 1RKQA 1SPBS 4NYIR 5K0EA 4MX8A 2JAHA 3OFND 4NECA 5DGIA 2FP4A 3HN6A 1HG0A 2EKQA 2KSQA 4DA7A 2E5LB 3CX8A 4URVR 4OSPA 5JVDA 2ONZA 1Z0IA 3R6LA 1W96A 4E12A 4RL6A 3PLAE 4GF5A 5DGDA 1UP4A 1XNQB 1X8LA 5GVSA 5AK0A 3H19A 1Z4NA 5JIBA 3OPNA 4L4RA 3QLUA 1Y3DE 3RRJA 3MVEA 2I7VA 3REQA 5D5PA 4G5OA 3TR5A 1GZSA 3HUFA 2ZTLA 5KTYA 5BPFA 4XVQA 4D3SA 1Y4UA 1I0LA 4H7PA 3VU8A 3QBEA 4ZO9A 4D79A 3CLHA 2PIAA 2P9GA 4JDPA 2Z9DA 4RE5A 4UULA 4EP1A 2GF9A 3QFSA 2OFXA 5KDLA 1DWQA 1IM5A 3Q6NA 5BP7A 3BAZA 4S35A 2Q2OA 3K70D 4QL3A 1EFVB 3GRPA 2IXAA 1ZCZA 2AFHE 3NXKA 3FROA 5IM5A 4GR9A 3L0OA 1WHTA 4HH3C 4HWSA 2FY8A 4HBGA 1KDVA 1N2CB 1YK0A 3OM1A 2ZTSA 3SE0A 2Y1FA 3EOZA 2F4NA 1T8UA 3C43A 4D99A 3PZRA 1MRSA 3HPRA 4N3AA 1W88A 4X62B 4O1HA 4FSXA 2OCXA 1BS1A 2F3RA 1M7BA 1RE0A 2RAUA 2VP4A 3T5DA 2VSYA 4FI3F 5JY6A 2VXYA 5DN6A 3EIXA 3FOAA 4XQCA 3KFXA 4QASA 4PC2A 2FE1A 1OWPA 2CSUA 2JH8A 4W82A 2IPNA 2ZAIA 3TZEA 5MN5A 3C5VA 3JAKA 2WTUA 1Z0AA 1GA6A 3GYBA 2HLNA 5JLAA 2QE7D 4TM8A 3T4XA 5A6SA 5JANA 1FSFA 3G59A 3RVSA 5JO0A 3OC0A 4RZ3A 3R3XA 1RXUA 1VPVA 3GFTA 5AJZA 4Z3DA 1XJ5A 3PUKA 4J3NA 1UZMA 2REXB 3H8JA 3HM2A 4RFSB 5D84A 4YYZA 4R6XA 1TA9A 2VT3A 1PVDA 3BKXA 1EBBA 2GA8A 1VKJA 2R87A 1ZH2A 2W2LA 3F9CA 4QTYA 3SVTA 3QM1A 4UJ3A 3GI1A 1OXBB 3PQ8A 3WNCA 2XRMA 4HNAB 2DTDA 4IIDA 1QSGA 1SVLA 3MTAA 1OXVA 3ACDA 4JFAA 2HJSA 2JFPA 3ZLTA 3KV1A 1KMMA 2KX7A 1JLKA 4U2EA 3SIPA 1AA6A 2RHCA 2ENWA 1R5OA 3QE4A 2Q46A 4L15A 2Q29A 2UZ1A 2OFFA 1JEYB 1I3CA 3ZKWB 2B1QA 3MZ0A 2ORED 2D5BA 4DCSA 1IJEA 2X42A 4XLTA 5SY4A 5BSHA 4MKIA 4NCBA 3KZVA 1M2HA 4KOAA 1NTOA 3W6PA 1AUVA 3LX5A 3PDWA 3C5HA 4M89A 4A8HA 1XQ1A 2VJKA 3K53A 1S2NA 4LAFA 4X20B 4DCUA 3V8RA 1KPHA 3NEPX 3OE7A 3LMKA 3CB4A 2WSMA 4PINA 5EIBC 2GT1A 2BTQA 1X14A 3L7MA 3P26A 4Q3OA 2X4DA 4R9UC 3JRWA 5A9TA 1KDZA 4PN3A 1K8ZB 5IT9A 2VUUA 3LLSA 4DZRA 3IP5A 4IIYA 1KPGA 3MGBA 1SCIA 2WILA 1AF7A 3NOVA 4MVJE 4PLFA 1QKKA 3F5FA 1SUIA 4FWIB 4F4CA 4HTAA 5AXAA 3W5JA 5IKMA 1CKEA 1CFZA 5K09A 2VK4A 3B6JA 4N12A 1JEOA 2OZLB 1L5MA 2R4QA 3RU7A 2A59A 3SFTA 2WIFA 5FWYB 4NH0A 3WGHA 3VR4A 4LZOA 1EK5A 2PE5A 2Y0CA 4J16A 5FJJA 3SQOA 4HK4A 1KEEA 5HVNA 5F1PA 5K3CA 3TQRA 1NULA 3PNSA 2NOAA 4MV8A 5TY0A 2W6NA 4BNXA 1L4EA 3K1JA 4DV5B 3U4QA 2DQSA 2IYQA 2WPDA 1XELA 4CPDA 1KVUA 3LCVB 3IOBA 4N4AA 4QYWA 1KQNA 5FWXA 3SEAA 2GWHA 2O1XA 3CKYA 4QUJA 4KR2A 3AI2A 3QBJA 1J97A 3LS2A 4WBSA 1XHLA 5I3CA 1HX7A 4R3NA 1VJ1A 1EVZA 1PBTA 3I01A 1MV8A 5KOJA 2WTXA 2PG3A 4PZUA 4ZOEA 4ZI5A 4MWDA 3N8HA 2VF5X 3E15A 3OZSA 4LQ4A 1JVNA 1KJYA 1WXWA 1XU7A 1J1IA 2AQHA 2CCGA 3QKSB 4QGAA 3AR7A 5I8ZA 5GP1A 3R5FA 1ISJA 3EG9B 3FJOA 4KK4A 4CMIB 4EUFA 5BVGA 3B78A 1SIOA 2EIXA 3OX4A 1XTVA 3IUSA 2WUDA 1EG7A 2PX6A 2Y0EA 3KAKA 3KQOA 3L0SA 4GAEA 4TYNA 3UV6A 3A04A 5IAGA 5CK5A 5C9ZA 1WWKA 2ZBUA 3QBTA 2FRXA 5HUQA 2SCUB 2NP7A 1K6EA 1LLCA 2O2DA 2X0NA 3MXOA 2FGKA 2QF7A 4ZARA 4ZEWA 4INZA 1XMVA 3AHJA 3FPHA 2DLNA 2W6MA 1VL2A 4TMKA 2GZ1A 3S68A 5KOHA 3OCCA 3A2KA 1UBNA 8LDHA 1WSWA 3DZJA 3R3ZA 2NZVG 1R0ZA 3WSTA 3JTEA 1IZ9A 4GHWA 2OYSA 2WIBA 3UWPA 5I7FA 3GFFA 1FFWA 2WAMA 2N47A 1B0ZA 1QDEA 4PXAA 2QM0A 3OX2A 1FNCA 1ZNWA 4WAUA 5EP2A 3DB1A 4L4XA 4PLZA 1U8EA 2J08A 1UPUA 2R44A 3I4LA 3OLCX 2JFBA 1DXOA 3NWBA 3Q7RA 2NU7A 1MW9X 1AXGA 1QVVA 4X66B 2JKYA 2EGHA 1HEIA 1KSGA 3AVXA 3PCRB 4YK7A 1FRVA 4PRKA 4Y6LA 2BE7A 4BUZA 3UW3A 4J75A 3P52A 4JIMA 1ULBA 1V2GA 4F5YA 4IQGA 3V34A 4X71A 1FNBA 1XZAA 3QG5A 1E6UA 4XDYA 2I87A 3OKFA 1OX4B 2VZ8A 2HBYA 4L8VA 4ALIA 4ZOLB 2X40A 1QGYA 2AN5A 1P5HA 2IA5A 3GOHA 1IFXA 1M6YA 1LSOA 2A14A 2W0MA 3KPUA 2VBIA 2YKGA 1UFRA 2ZYHA 3PC8A 1GAWA 4P31A 1EEXB 2FUNB 3UB2A 4ZMBA 4F60A 2P6UA 4MYRA 2II6A 2KB0A 4B8WA 2BI7A 2BP7A 1H4TA 3EISA 2H52A 3HRIA 2CLEB 4O25A 2FPGB 2V7WA 3ZTTA 2CXPA 1H2XA 5JSKA 2E6KA 3MTDA 5JMOA 3SF8A 4KITB 4ZOCA 3S7TA 3WA6A 1BWSA 3NUZA 1XJWA 4KKVA 1AQJA 2V6JA 4I55B 5I6DA 1F2UA 4JGGA 4BN5A 5D00A 1SC4A 1W5SA 3L8CA 3NYQA 3DOOA 3D8RA 4RKWA 3T1NA 1DFHA 2P4UA 3G8AA 4OHFA 3BIXA 1DO2A 2G5TA 1BHQ1 1N2SA 4RABA 1WDTA 2F3TA 1F5NA 2L82A 3QFCA 4V1CA 1R6TA 3HEMA 2JIRA 5D7NA 1JJ7A 2AN4A 3SEFA 4PN7A 5K5EA 4LMRA 4ZYLA 5CFZA 2CXSA 4LC1A 1DBWA 5JS7A 3E35A 3ZGNA 1PLLA 5TPWA 1TQDA 2H9IA 4F91B 5GZ3A 1EUCA 5IZCA 5HZGA 1RQLA 5LQSA 4ZYYA 2YC4C 2O0LA 3MSCA 1U7UA 1K08A 4EY5A 3HO1A 4ZXFA 1VCNA 4NFLA 5L40A 3BD6A 2UYCA 2I3ZA 2N1BA 3A11A 3SQNA 2HA7A 4BZQA 3KVYA 4S3MA 3Q98A 4ZEOA 5IAKA 3U3MA 2IYEA 5KPDA 1NPDA 4ZAGA 3U1VA 2WWWA 4PYJA 1DS6A 3GPLA 3J7AC 3A3OA 3DLTA 3NOXA 2EF0A 4UOQA 5SYMA 1KI7A 1IG0A 2RB5A 3BIJA 2YOHA 4ETIA 4X1IA 5AM1A 3SBXA 4QDTA 5AM2A 3OLVA 3Q10A 3R6WA 2I34A 5HILA 2CZCA 5FI0B 1LNQA 3PDCA 2PWYA 3EMKA 3RSCA 2C03A 3KOMA 3W3ZB 1C4XA 4XGQA 4EB0A 5BPHA 3HWWA 1ABEA 4YJDA 4AUKA 4D3FA 2CVPA 3D0OA 5EVCA 4B74A 3VFDA 5LQKA 4UMFA 4F46A 4D8YA 4U6NA 1QGOA 1N6OA 1SA0A 4C4OA 4XCXA 9GPBA 4A5OA 3GXOA 4F8JA 1HQDA 5CVVA 5EHQA 4AG5A 5JWRA 3PJRA 3A6ZA 1BVUA 2EJBA 4UOEA 3SP1A 1LVUA 2QAGC 4C3VA 3CPEA 1XD2A 4N5IX 2UUAB 2I4NA 1BOFA 3RC2A 1MW8X 3TI7A 4N48A 4DLRA 4M49A 4HLUC 4PX2A 2WD9A 3IPXA 1ZDMA 4ZZ1A 1AGYA 4YRQA 1NOKA 4NZZA 4C2UA 4A73A 3EXAA 2WWTA 3FJYA 5FUQA 5I48A 2JFYA 3GBSA 4IUBS 3M4JA 4DLAA 1MZPA 4IDNA 1ZRSA 1ZONA 2GOYA 3WOVA 4WBNB 3DYIA 5B36A 3DZCA 2BI4A 1BDJA 1G5QA 3FSJX 4QYIB 5COBA 3H4VA 4HX9A 4FOLA 5H0IA 3WDKA 2FPIB 2XE7A 4KXQA 3ZW7A 4BEWA 5K3EA 2A9OA 4YNBA 5B3KA 1Q83A 2YWFA 2W37A 1I9CA 2FUCA 2Y6VA 3KWJA 3LNTA 1OAOA 1JKJB 2DRIA 2XWBF 3O91A 4K6MA 4D98A 5CB4A 2O54A 3CF4G 2XD4A 3OTWA 1GPDG 3S1SA 4LBYA 5E7QA 4FMDB 4XGRA 3WK8A 2ZDQA 2IFTA 5AWFC 1MO5A 1FNSA 1DKQA 4P3OA 3V42A 4PG4A 2JAOA 3RG2A 1ZVVA 3WMRA 1F17A 1RRMA 2XPCA 2QTFA 2HWUA 2ORYA 2YV5A 2Z6VA 1ADGA 4BLPA 4MMXB 1VTKA 3CKKA 1LV7A 1B23P 1RWBA 4M0DA 1EFHA 4XSHA 1G21E 5E8RA 1GT6A 4RSRA 2CHVA 3CRNA 3GLGA 3SMQA 4RSMA 2G36A 2ZBPA 4EJ6A 4X3OA 4JS0A 1IY8A 1KGDA 2XIQA 3WRWA 4X45A 4EHDA 2FRVA 2JNWA 4YUYA 3MWGA 5EXTA 1W0KA 4K9MA 1W1WA 3GJ7A 4NOKA 4UE2A 4KZKA 3NHKA 3W6NA 4DWWA 5DH9A 5JMPA 4DCCA 4ESEA 1PUXA 2X9GA 5ADUS 4K28A 1GM5A 1M6EX 2GN0A 4NBUA 1DDGA 1OZHA 1THGA 3UJ9A 1Y6GA 3DCJA 4LJ6A 1W25A 4C76A 3WAGA 2HU2A 5LDHA 2QN9A 1R0XA 4MV4A 3UG6A 4L95C 5L3SA 4IDDA 1ODTC 2OORC 3PXAA 2NSLA 4RJTA 4HNSA 3C1UA 4U6QA 2KI5A 1IN1A 1G8YA 4PANA 3WLPA 3CLSD 4XQEA 1H23A 2DCMA 2V9CA 2V4ZA 3K70C 1GFWA 4R16A 4PSUA 4PLPA 5FKJA 2VSFA 1TZJA 4MVXA 3UAOA 2GN8A 3I76A 5BV8A 3ZCVA 1Y7PA 2DPXA 3FOBA 4OQZA 2YV4A 1KIAA 3NDBB 2WVJA 2KBFA 1RWPA 4N0PA 1Y6ZA 4KIGA 1QBGA 2YHAA 1IB0A 3KWFA 2P9YA 3D6FA 2QPTA 4IUYA 5ESXA 1EFKA 1YGPA 3ENZA 4DDKA 4DMRA 5EJ5A 5DO9A 2XWSA 3G2QA 1DE0A 2WF7A 1W1UA 3K05A 2PWAA 3FPCA 4TYPA 1VG9B 4FOSA 1N34B 1KY4A 4UMDA 2CLIB 3A1WA 4NYIQ 4OEHA 3RH0A 3L0DA 3SOZA 2XRZA 4TRNA 1VL1A 4Q3AA 5LOVB 1W4LA 3R20A 4PEVA 3PICA 4KSCA 2DJ5A 3OLYA 5EG5A 3O92A 2XUGA 3WGJA 1A5BB 4P4NA 4RJJA 2EZ4A 4ZVUA 2XIJA 3IT0A 2AUNA 5IUNC 4FB4A 4WY8A 3M6XA 4JR0A 3K92A 1KJ9A 4PNEA 1A7KA 1J8MF 1S1MA 4UUQA 4MV7A 2GHQA 1DHTA 3LT2A 3B53X 1C8VB 1JR3D 3BSFA 3WHPA 3WE7A 2ZLBA 2VDWA 4G67A 4ABYA 3KKQA 1DIRA 3DKPA 3EWAA 4P3PA 4BLUA 4F7WA 3GMDA 4GSYA 2R7MA 1MVNA 3L8HA 5FOWA 2Z08A 4JI2B 2NM0A 3OOHA 1VBNA 5AVOA 5EZ6B 3IMGA 3SIRA 3K71B 3GXBA 2IVFA 2BELA 4QGFA 1M1NB 3OPYA 2F8TA 3PRKE 4ALLA 4EB6A 5L6LB 3HJFA 2H7CA 1DEKA 1EVKA 4HYQA 2ZYTX 2VIIA 2JI7A 4II7A 5JSZB 1A95A 1M1YE 1YOVB 2HY7A 1ESEA 3QENA 4DGQA 3Q8MA 5EP4A 4C88A 4G0UA 3TMYA 3MELA 2OMKA 1M6HA 3B3FA 4BGUA 3QUQA 3L0PA 4GBJA 2C61A 3EEBA 4J7CA 1EFTA 5AHRA 1M9NA 4HQRA 4Y8VA 1AN0A 4PZAA 2AOTA 4MJ3A 3RSLA 2EP8A 1JXAA 4EGAA 3PUXA 3QKRB 4DR2B 5C8YB 2E82A 2JCSA 1JIQA 3C3DA 1LFAA 3HXKA 1C3OB 3JQ6A 4QJ4A 4CL8A 4D92A 2J7PA 5TMBA 1OPRA 4AECA 3IUNA 3VYRB 4CGYA 2ZCVA 3UMVA 3HNPA 3CW9A 2UDPA 4JAVC 1G8SA 2IEBA 1WPXA 5LZ8A 1GNQA 4H7HA 4F3TA 2Y92A 4FSHA 4B85A 4BVKA 4U5XA 4JR2A 2JFGA 1Q7BA 1A5AB 1E60A 1N5KA 2FG7C 2BMFA 2FX2A 2YINC 3I9JA 4MQ6A 4TKMA 4P4SB 1GNTA 3BZWA 5FR1A 4AKTA 3STWA 1QM5A 1I5EA 3KQKA 1DRVA 4ZP1A 1BKSB 1CUCA 1EP9A 2OKGA 2RGWA 3LAWA 1OCEA 3GNSA 3PQFA 3Q2KA 4RTOA 2AK2A 2IP1A 5DHRA 4DM7A 6GPBA 2MR6A 1Z33A 4QE3A 1RWXA 1AHHA 4EKEA 3KAPA 4N03A 4HEA6 1H1TA 2OBNA 5A05A 2JA2A 4L4SA 4G0QA 4DUGD 3E2MA 5CDUA 4IIVA 3KVVA 1XRRA 3KTOA 1ZR4A 2PAAA 4JI1B 2MINA 3G2IA 3CEMA 3GPCA 2BFOA 3PCXA 4YRZA 4CKCB 1GPJA 3IKJA 5B58T 1C7ZA 1NAIA 3Q9LA 5FHQA 1B93A 2C9BA 4MW9A 2JI6A 3NGLA 2HM7A 3KT6A 3NEJA 5ENVA 4ZANA 3K3PA 3OO0A 4MA0A 4MKRA 2EBUA 1JPJA 4BRSA 2VPTA 1W19A 1MT3A 1GTSA 5EKTA 3ONNA 3NTLA 2RGNC 2QXTA 4EUKA 4FHGA 2OHXA 3L8FA 4DLKA 2AFRA 3A2NA 4QJIA 1P33A 1XXLA 1U3DA 4AY6A 2M98A 2VOEA 4MK4A 1VKNA 3IUJA 4KAXA 5ELXA 3IPYA 2ZT7A 1OXSC 2Y67A 2BBOA 2QTCA 4YV2A 1IHDA 2ETXA 2O2IA 1E1DA 1Z12A 1ZN8A 2GVZC 3GD5A 2NXNA 1ESNA 1R0CA 2G63A 4M8SA 2OB2A 2Z1NA 1BGVA 1I14A 5HUJA 3BUSA 2H9AA 3RT9A 5C3MA 3IKTA 1KJIA 1CSEE 2A94A 3QU4A 3VR3D 2M6RA 4BC0A 1NI5A 2C96A 4NBWA 1PLJA 2BAGA 2OWDA 3WMEA 4CEJB 3ICQB 2B4RO 2CNOA 4R9SA 3JD2A 2JGAA 1WY7A 2NX2A 2FPUA 3Q3HA 4GIBA 3MT0A 5EJEA 2CKDA 1NVVR 3V4OA 4MLDA 2PX2A 2P9HA 4ZEVA 3N5KA 4HEHA 3CSUA 3W5BA 1J2JA 3FFAA 4OLHA 5DKFA 3I42A 1OZ0A 1PRYA 3CWCA 1CX9B 4V0MA 4EGCB 2DGDA 4LIPD 1YUMA 1QYCA 3W2HA 2P1DA 3IJPA 2FPPA 3IRVA 4F6RB 3EF1A 1WSDA 1LA2A 2Z8XA 5LA6A 2FPWA 2FSGA 2XRYA 3V1YA 1ZN2A 1SKYE 4XVRA 1PQYA 1XPOA 3FCYA 4OSEA 3IAXA 4HD8A 4RELA 5JC8A 1B8NA 2C88A 1B00A 4MIOA 4MKFA 2F1JA 4DABA 4KU4A 4GMGA 1JHVA 8ATCA 4D9BA 1JTFA 4C2TA 4FJ2A 1GN9A 2CFRA 1QE3A 5F4BA 4P81A 2WPNA 3ZWXA 1JXQA 1VBKA 4CEIA 1KRWA 3NAGA 3T3OA 3K8ZA 3OPXA 1NI4A 5EZYB 5KSWB 3LY8A 1G20B 2B0CA 5G3YA 2SBTA 4L74A 1EB9A 3WLAA 5CA1F 1I7LA 4QODA 3V6MA 4PYOA 1ZC3A 4GZ5A 1J23A 3JWGA 5HK9A 5G1PA 1E7RA 3IVMA 3ZDRA 3S29A 3LSYA 4ZQHA 1CJMA 4HADA 1WS6A 4KDRA 2YVQA 1B76A 4NZNA 1ZVMA 1ZH0A 1KA9H 3R5JA 5C7YA 5CA1A 3ANYB 4AWXA 2OL4A 1J0AA 1NJFA 4AC9A 1NVBA 3GN2A 1TK9A 1TTPB 1UBTS 3CNNA 1R6VA 4E0BA 4RBNA 3DW1X 4UVGA 1D2GA 1EFAA 5T8KC 3AQ4A 1VIMA 2X5XA 1BHJA 4LQDA 1IYZA 1FU4A 4A1FA 5HM6A 1HYGA 4I4LA 5GVRA 4FZ3A 4Z4FA 3D2LA 5CVUA 2X14A 3ELYA 2Q0XA 3VNUA 3CX4A 5IP5A 2XDAA 1IVNA 1WCYA 4I50F 4EFMA 1EXWA 2QRVB 3C8DA 4DMFA 1XCJA 1KAMA 4A0RA 1T0UA 3W4KA 3NFYA 4TT3D 3D81A 3OOYA 4Q4JB 4EK9A 1HRDA 5AVQA 1OH8A 4MDFA 1Z7EA 5DBOA 2X9VA 4S0ZA 1XLWA 2VHWA 3RYTC 2XMSA 4I50A 2JBAB 3BK1A 3EBOA 5DBIA 3L01A 1AF4A 3R7FA 1QIEA 4C1NA 2N42A 3VSCA 1JB1A 4ERXA 1NURA 1WPGA 2SKEA 4GDMA 3X2SA 1KBQA 3G1WA 4XRGA 1ZUNA 1I80A 4J6FA 4R9NA 3GEMA 3U9LA 4J7AA 2XNHA 2ZR7A 2MWMA 2W0SA 3IQHX 1BZYA 4CIYA 3C3KA 3FMVA 1C0KA 5CGZA 4ZU3A 1CIPA 1UOPA 2YY5A 1YR2A 1AK2A 3T3NA 1XEWY 3AO0B 3OMLA 4FPXA 3DZGA 4L9RA 5GPBA 2DVMA 1NLUA 4H3SA 2WU4A 2PUEA 3UGQA 4TTPA 5JISA 1CFJA 5IJ0B 1NP7A 2BEUB 2DUUA 4CDMA 2JLZA 1L7AA 4CODB 3HA7A 1Z0ZA 1PHPA 3RHZA 4GP7A 4I1RA 3I5UA 1D6JA 5KYVA 4RD4A 4YRLA 5IJXA 5M3BA 4YV1A 3GEEA 1EINA 4RK5A 3EZ2A 1JHQA 2HQRA 2MTBA 3E5NA 4EBFA 1N7GA 5T64A 3MRTA 2Y77A 2BR4A 2QGFA 2E0IA 1YE3A 1H93A 3LQ2A 2FPXA 1KU0A 3ZCRA 4X7BA 3BGOS 2QM3A 1HE2A 4L5AA 5DHQA 4YREA 1VKOA 1PWZA 1AIPA 1NN0A 3SS9X 1EGHA 5L51A 3CKMA 2PHZA 3FCCA 3PV0A 3RE1A 1ZD8A 3M0EA 3DSRA 1A9PA 4I8IA 2X22A 3QOYA 4XI9A 1KDPA 3UYKA 5C8VA 5E4TA 3W9BA 3TW8A 1VLLA 2HNBA 1E1RA 2PQ0A 2VR1A 4CQMB 4UU7A 1H2RS 1T26A 2IE0A 3ZJTA 1H3FA 4JJKA 1BS9A 1DEOA 1HT1E 1NUSA 4MQMA 4MQUA 2JK0A 3A6GA 2HLDD 3QI7A 4ARSA 5AOCA 2QN8A 1LB1B 1CF9A 1MR3F 2RG7A 4FYMA 3VHXA 1D5CA 2AR7A 2IODA 2JI8A 3EZFA 1E2IA 4PO8A 4RWEA 3RIHA 4PBSA 4YY3B 4I2NA 1SXGA 1BU5A 1KYVA 2PFGA 3OQIA 3PIRA 4LZLA 4MGIR 2BKLA 2HK6A 2XCOA 1NFFA 1ECJA 4HKTA 5E4FA 3ADBA 5M29A 3TBHA 1Q0ZA 2IS2A 1FYDA 3S5UA 3UMBA 4HFRA 4JX8A 4JSRA 1U65A 1Q7RA 4Q1FA 3OM8A 4BEBA 1LQTA 4FMPA 4F2GA 5E2BA 4Z7OB 4GWKA 4H18A 2K5UA 3INNA 3TTVA 1N8KA 1XWWA 1XRQA 5BNWA 4DSUA 1S8AA 3A6DA 4H35A 4XDZA 421PA 1TVCA 1ZGCA 3JQGA 2FZ5A 3QPAA 1G66A 3BRWD 5IWAB 1PL0A 7REQB 5D87A 4JJAA 1WLSA 1J8YF 5FADA 2AQKA 3F6CA 4IX1A 5J58A 1TKAA 3BRSA 4C5BA 4Q7MB 4RHUA 2X15A 2I67A 1QP8A 4IRUB 3W5HA 4BQPA 2ZJZA 3PRHA 2JLVA 4U00A 3OT1A 2H1WA 3QYAA 1YZNA 2OMEA 4KE6A 1LWNA 2OZPA 3Q7EA 4WINA 4X1KA 1ITZA 2WKSA 1OROA 4FDLA 3ACCA 4Z0NA 5IHPA 3LNCA 3T1TA 3DHEA 3CONA 1NP6A 4W4TA 1T10A 1Y8RB 4JK3A 3GLFE 3AJAA 1M1ZA 1E5TA 4IH4A 1D4ZA 3WICA 2WAAA 2VWQA 3Q85A 3CLSC 3GVCA 3I72A 4J7XA 5LYJB 2NO1A 4EW1A 4DJ5X 1Y81A 3OJXA 4OXYA 2DCUA 4CF5A 4ESHA 4E4RA 1V1RB 3DT8A 4OB8A 1B6RA 4WXRA 1P6QA 3R4CA 1PVOA 1OLSA 1BU8A 1MB3A 2I1LA 3TSZA 3NHLA 1AQNA 3KXDA 3WGOA 3HB7A 1G4AE 2QN2A 2O2GA 5HJ2A 1SQSA 2ERCA 2IDJA 2VPWA 4HB3A 3LOUA 2C2KA 4R7GA 2AC4A 3MOSA 2PT5A 2NNLD 3AHFA 1AU9A 3BH6A 1JI0A 1WA5A 2CFCA 5I7WA 4HEA1 3W8RA 4BMYA 5AW1A 5G02A 1ULHA 3W34A 4A2PA 2HPAA 1K63A 2B8TA 2EFCB 4BECA 5KX5B 1S4MA 3ETJA 2POQX 4IGKA 1L1QA 3KJZA 4U3JA 3FMGA 4CDGA 4E08A 5BV0A 4MLZA 2E87A 1JSRA 2OOSA 3MW8A 1RZUA 1WB5A 1RIIA 3BWXA 1K7FB 3GUHA 3UJ8A 2XW6A 1R12A 3KNZA 4B1FA 3FUUA 4OQFA 3MG9A 2G9QA 5I4CA 2P5UA 2VHJA 4DCMA 3H11B 4HS4A 1UZLA 4PWYA 5BNFA 4XGKA 4BX9A 1UPFA 2WMYA 3GVIA 3W1VA 4EPXA 1FNNA 3F3MA 3AUKA 4TWJA 2ZZNA 2EEPA 2W98A 2BSXA 2PGXA 3HCBA 1G8KA 1Z5VA 4L8LA 5EKDA 4C5AA 1P4AA 1VIDA 3KYJB 3TIFA 2W6ZA 3ZGOA 3CH7A 3R77A 5JLJA 4Q01A 3A31A 2GNAA 4NCHA 4BJ5A 2TECE 3ZDXB 5BWMA 3SYMA 1WUKS 3R3SA 3U60B 4BEJA 1P4JA 4TL7A 4Z8YA 4J4TA 4PPYA 1OZGA 1J24A 2FFJA 3GPDG 3HR8A 5KJFA 3GLTA 4YUWA 1U1FA 3M1LA 2HIMA 3BJMA 4MUKA 4XYLA 3FPJA 1FB5A 1G7TA 4CLXA 1N6KA 2B35A 2WDZA 3OZVA 4UTXA 4UJ5A 4CCSA 1TECE 4V2IA 3MINB 1KQFA 4ZGWA 1H6CA 4YH1A 1RXIA 3GDWA 1HDIA 3WRYA 1JEAA 4XOUA 4G1MB 1IAVA 2DG2A 3BICA 1SCUB 3UBTA 5GGYA 3PL5A 3D7KA 3SHOA 1J6UA 1JIVA 1DU4A 4GOND 5G41A 4JBYA 4D9FA 1NXPA 1SC1A 1P9RA 3H9EO 3H7IA 2GAFA 3A4MA 5KSYA 4YAJA 1EVQA 4WY2A 5FR2A 1EZZA 1YJCA 3GLIA 1SZDA 2W2OA 4R3UC 4ZQEA 4X84A 5D5HA 1JILA 2FYTA 1RPAA 1N36B 2F7SA 1R0BA 5EUMA 5DDIP 5A71A 1X1CA 4QATA 1ZSYA 4YS6A 4ENSA 2BWJA 2G5CA 2H5IA 4ITVA 2HA3A 1AZTA 2ESRA 2Q99A 3RC7A 4E5YA 2B6NA 1G3IA 1ZNYA 2GZSA 1R0LA 2HA2A 1U3VA 2QUZA 3UK7A 1TDJA 2FSPA 2V5UA 1VMEA 2H1SA 3B9BA 3AJEA 3B5IA 1U9CA 3EEFA 4NMXB 4BO8A 5CDYA 2WG0A 1ECBA 4FFPA 3VKFA 2A0WA 1I8TA 1QTIA 1TVMA 2QUHA 4Q7QA 5AKJA 5CURA 5H1YA 1Y82A 1XKLA 3ZU3A 3VPAA 3SGLA 4FE7A 3ZBUA 1WQ4A 4UZEA 1MC5A 1VE5A 1ESDA 3Q15C 1XTUA 3OIVA 5K4AA 4TYMA 2GFHA 2I03A 5JPIA 4JVLA 3AJ9A 4CKXA 4ZXPA 4IGFA 2BR5A 1BXRB 1MX1A 2EXXA 1G7CA 3EGIA 3WC4A 4RORA 2C7RA 4D25A 1NM5C 4R01A 1QLWA 4HNRA 1PJ4A 3AEQB 4N0DA 1NI3A 3AESB 4I3FA 3ZCSA 1SBIA 1P2SA 2GK6A 4S0XA 4DUYB 5T3YA 1J2RA 3OZEA 2Z30A 4CQLB 2ZYSA 2H92A 2NMVA 3BXHA 1N5RA 5U4QA 5JBNA 3DVAB 4E6EA 1N0VC 2DE0X 4DNPA 5D7BA 4DBZA 3GNLA 5AOAA 2EWVA 2FFHA 4BO7A 3WGIA 3AB3A 2H16A 1M66A 2WSSD 1TJ5A 1YNSA 2ZYRA 1V8FA 5LD2B 1T1GA 3EE6A 5AI5A 2Q6VA 4ZDJA 4MIEA 3KYCA 3LP8A 2IS4A 1EGQA 1JTVA 2DLDA 2Q4OA 3OJEA 3VO9A 2V3CC 2XADA 3MPUA 1KJZA 4Q4HB 3UF0A 1QYRA 2IH4A 2G3YA 2O8BB 5AOVA 4NPCA 2ZUBA 4HGYA 5L7TA 4IPTA 4KFUA 3V4VB 1RXSA 2OO5A 3UC5A 3SSAA 4E7PA 4F9GA 1ODSA 2OCIA 1WSBA 5CYPA 3EXEB 1RXWA 1BJRE 1JPUA 3DZHA 5LPNA 3PHCA 4COOA 3CBQA 2FWMX 5TARA 5J43A 1C29B 3KDAA 1LDEA 4G1FA 3FFXA 4O4IB 1JG3A 2AMYA 3DPSA 2YHIB 5FO0A 3R40A 4BLQA 4HSEA 5L8VA 4YAOA 5AKKA 4LYJA 3SIXA 1HURA 1MOSA 3LA6A 4Q4LA 5BMVB 1JQKA 2DY1A 4P7GA 3HB1A 1VJCA 3QKUA 4PWZA 5P8WA 3F7OA 3PEUA 3MWEB 1KFEB 2XOEA 2YRXA 5DB4A 1LTKA 2XEDA 2XSZA 3Q2IA 1T29A 4FDMA 4P83A 4DDMA 1HDZA 2H59A 4GBED 1QMGA 1U7WA 2QS9A 3HHEA 1P9WA 2OGTA 4TLCA 1EAYA 4FCTA 4DIKA 1NW4A 4G23A 4G9GA 4REQA 4JEIA 5DTIA 3B70A 2JJ2D 2JCXA 2E4WA 1CF4A 1ECCA 1NY5A 1UBRS 4GI3A 3R9KA 1K98A 2O3JA 3MA0A 3UK6A 3VHQA 3K7EA 5ICSA 2GPAA 3ODPA 4ALKA 3GJXC 2XOKA 3N3AC 2I2CA 2LCFA 5JDCC 4DCNA 2ZZKA 4LOLA 1NVVQ 1IDN1 1QB8A 1C41A 4LOIA 5IAOA 5LMCA 3RT7A 2PEYA 4LPKA 5CEEA 2W6JD 1J5EB 2IPMA 4EJSC 5JQGA 4MV5A 4U2KA 3K2EA 5MN4A 3FTQA 3ZVLA 4D4LA 4YMUA 4YAIA 1YL7A 2B7LA 2VWGA 3PQ4A 1QNLA 4Q1EA 1NYQA 4UTRA 2WHPA 5I7OA 1MEJA 1BXZA 4F86A 4UE6A 4KPEC 2HIGA 3I9V6 5TQ2B 5AUPB 2JF0A 2QG6A 1NJ2A 1Q5PA 3BQ9A 3R3WA 2GETA 1MXFA 2E2WA 1XK7A 2CK3D 1SFRA 1USUA 4ZT2A 1DJPA 3WV5A 5HW0A 1T3HA 4PZ9A 1FFGA 2DT5A 3N6XA 4H7FA 4ZO6A 1QOPB 1YZGA 2QZSA 1RRCA 5LZ9A 3GU3A 2RCYA 1G5PA 3KYDB 4G2NA 2UUBB 1DAEA 3V32A 4TXMA 1CHDA 3Q7PA 4LK2A 3BWDD 2HXYA 4KVGA 5HHTA 4B3RB 4FU0A 3CE6A 5EP3A 3V4FA 1P7YA 3LPMA 3VM6A 4AX4A 4W7SA 1NASA 4P6VF 2O5VA 5EJMA 3ZJ4A 3K1TA 4DJTA 3ZVMA 2VDOB 4BFXA 1PQWA 4FR0A 5FIUA 2YZMA 4E5SA 3PR2B 4MV9A 3AW9A 4OA8A 1T2CA 3EDQA 1HTTA 3CZAA 3CEHA 3OICA 3QXCA 4L5JA 3H4MA 3NANA 4ZALA 2DM6A 1G2OA 1ZGHA 4QKQA 3I2YX 4LMBA 4IXDA 3FYUB 4YP6A 4DA0A 5JH7F 3AM3A 2P9ZA 1X6VA 4GX2A 4FZ5A 4OGGA 4AZ3A 3TDNA 3EQ7A 3GQBB 2RHDA 2CV2A 3N75A 2LWIA 2CNWA 3NKFA 5FFFA 3B12A 2NZJA 3HI6A 4FQ7A 2GBPA 2I62A 3E22B 1Z26A 2Q2WA 3EXFB 4FEGA 2JIQA 3NBQA 4IGIA 3KZ1E 4Y2VA 1EUDB 4GMXA 1PJQA 4NCIA 3C4VA 1RSZA 4HOYA 1XTBA 5SYNA 1IVYA 1WCXA 3PQ3A 3F8TA 3EIUA 4QJBA 4HDSA 5DMXA 5CH3A 3T7KA 3TB6A 1VFPA 5IVHA 3T7SA 2ALJA 3QLTA 3IKVA 5HR5A 1J8QA 2Q4RA 4JJ7A 2JHFA 1N75A 2PBLA 2QMEA 2AG0A 3AL2A 4N6NA 5CA0A 3TCNA 5F7OA 1RZVA 2OV4A 4CKWB 1BD3A 1PSDA 2R6DA 1PD1A 2NO6A 2W6IA 3EMDA 3MN1A 2ORVA 3RFXA 4QGSA 3CHYA 5CIQA 2J41A 3RVPA 3FZNA 1PJBA 2DFPA 4HGOA 4JOCA 1T5OA 5P21A 4BAGA 2RBEA 1QQ5A 4MDHA 2I3DA 5EQDA 2MSKA 5DI3B 3JQ7A 4BLRA 2C4NA 4BUJA 5I9NA 4TWIA 2GCOA 1B8PA 4DSTA 2QX6A 4O4HF 2OBYA 2EATA 2WT8A 2R7KA 4ZZ2A 4AXBA 4DV1B 2G83A 4HNQA 4Y2RA 3KXKA 4I4TA 4D9MA 2XZPA 3M34A 1AMNA 1U8ZA 2LIVA 1NGSA 1Q84A 3F47A 3JRNA 2HD4A 4YRBA 3TJMA 4B83A 1IY0A 3CH5A 4FB5A 4A6PA 1USKA 2BKAA 4EUSA 4MAAA 1X2EA 3OPYI 1GDHA 4LPSA 1FEZA 3ZDQA 3M3PA 1EIWA 3RI3A 3R6TA 2HGZA 3K0FB 3LVFO 1PJ2A 4L1KA 5CLQA 1TMKA 1W73A 3MMSA 3R7SA 2OLEA 1I3OA 3K8OE 4L8YA 4HAOA 2GBLC 1IONA 1SXJA 1U1IA 2D3TA 2RB4A 4MUMA 3TW6A 4X63A 2G9ZA 3B38A 4GM4A 2X2PA 1S2GA 4W6QA 2IY7A 1TX4B 1TU3A 3ITEA 3R0JA 2VF8A 1WZCA 1R5NA 1MA3A 2DR3A 2GPJA 1PDWA 3F98A 4INJA 2Q7DA 2JI9A 1YJ5A 4EW2A 2ZIXA 2PH7A 4JXZA 1N1GA 1BD4A 5HCUA 4OMUA 3BXOA 5D8DA 5HYVA 3OH8A 2JVJA 3MWJA 1O9HA 1IBLB 3VYSB 1NBAA 1YB7A 5IN4A 2ZEJA 2E21A 4WMLA 1AS2A 3PPYA 4R8LA 1ZPDA 5GTDA 2EJCA 4U2DA 3EPLA 4PC1A 1VL8A 3QA9A 2C0PA 3IR6A 2Z4RA 3WGVA 2ZIVB 2FRDC 4K6FA 2E1RA 2R6AA 2YRFA 3JWIA 3TD6A 5C81A 5KIAA 5JNTA 5BN3B 2DPMA 4KPUB 3K1YA 4QRIA 5IH3A 1C4WA 2VATA 4I08A 1HYEA 1KORA 3ZE7A 3DVRX 4DM4A 1LXCA 3AEXA 4LJAA 3JQCA 4HQOA 4UD2A 4QQ8A 2XDYA 2K6GA 3ZW8A 3SR3A 2EBWA 4IEIA 3MJCA 3URMA 1MAWA 2I80A 2OILA 3RBXA 3LC2O 1Y33E 4Q9LA 4UDOA 3WYEA 4MIKA 3RRYA 5MF6A 2NAFA 3HR4A 2I0FA 3T7AA 4K9LA 2MYNA 3I09A 2AFIE 3L7CA 3I6MA 1YA4A 1XEAA 2IYPA 3IBTA 3GC6A 2A9FA 3PHJA 4FFBA 5DWQA 3KSRA 1QORA 6ADHA 5FWYA 2IEIA 1P2BA 1C9KA 5K20A 4PZ0A 1YQTA 5DOVA 5DZSA 1H69A 4LHXA 4LMPA 3ZH2A 3HDVA 4C08A 1M54A 4YCBA 2R79A 5E1DA 5NLLA 3AI1A 1ZH8A 3GNQA 3NORA 3SSNA 1JB9A 3OEED 4R51A 4X6UA 3QHPA 4YRDA 3NYIA 3X0DA 1NBOA 5HK8A 4A8TA 2Q21A 3PVSA 4IOKA 1N5DA 2AR0A 2PZ8A 3R44A 2BCEA 3CMCO 3PD1A 3F46A 3UCXA 4AMBA 4DJAA 1XEFA 1A88A 1Y7HA 1ST2A 3IALA 1QP4A 5J5CA 1C1XA 3USZA 5BSFA 4LXUA 1LDBA 5DHSA 3RGWS 4OHRA 1JALA 2W2QA 3H5IA 5MN6A 2Z2YA 4WK2B 4ZVQA 1LK7A 5ILOA 1GXSA 2K2WA 2BDUA 4EH1A 3MB8A 5B55A 3GELA 5ED0A 1MUUA 3DBRB 1QAQA 3WADA 5CDTA 1NW3A 1JR2A 5HZMA 2FK8A 4AKSA 1GKUB 5L7WA 4CKBB 1YZKA 3L9WA 3AF2A 1XVVA 4J6EA 5IKOA 5A6VA 1LDMA 2D5AA 1P2UA 4LVOA 4D6XA 1C7EA 4QO7A 1Z4LA 3WJAA 3ZHRA 1J39A 3KKMA 4AMVA 1VC2A 2F64A 3OU7A 7GPBA 2XCLA 1NG9A 5I7VA 2IIVA 3C6YA 3RRNA 1T2NA 2XEXA 2BF4A 2BTOA 1T36B 3MJDA 4GC9A 5M5BA 5B1YA 3L1KA 3KE9A 4NMLA 1JHMA 3GHYA 2NSDA 2H2AA 2OQRA 4MWCA 4FOOA 3RTEA 3WBBA 2CXNA 4KIWA 4RVCA 2VC2B 5CLGA 1HE1C 2VXBA 1QRSA 5DK6A 4N76A 1KJNA 3CMMA 4HYYA 4TV8F 5SY9A 4G5FA 1VXOA 3IQDB 5E4JA 1ECPA 2PM8A 4NKRA 5CCDA 3QHAA 3NIDB 4OLAA 4PAGA 4WV3A 3SYTA 4A4DA 3IS3A 3OF2A 2G1KA 5B12A 1JRLA 5M04A 2FSIA 2RK3A 4LDPA 4TV8A 4G8JA 3UB4A 1KYWA 3L1JA 4JJEA 4YI5A 3R7BA 1Z2AA 1JR3E 3NM4A 3OZBA 5JPCA 4Q4DA 1KARA 3A1DA 3DJFA 3I30X 1ZUD1 3H3XA 4TLAA 2QLLA 2WD8A 3H42B 4TMTA 1LPMA 2DFTA 3GUUA 4H17A 4PCAA 1ICIA 3KKZA 2XB8A 4TQGA 1H22A 4RXTA 3Q11A 1M2OA 4K9OA 4TSFA 1U3FA 4AO8A 3IULA 4UOZA 3TUZC 3B5EA 2NPOA 4PYLA 1D03A 1UIMA 1C1DA 1WMFA 5I45A 4JJFA 3SXUA 4Y1RB 2YBDA 3EHDA 2J9YB 1V26A 3NDRA 4IQ4A 1IQPA 3UHOA 1QH8A 3NAZA 2I65A 2WSYB 2NV2B 4I1VA 1QFMA 2XWPA 4IV5A 1X7YB 1WNTA 3R7WA 1G5TA 3EVFA 4YCDA 4B2YA 2XE6A 4JXXA 3BCRA 5FH9A 4PLYA 4OHZA 4X92A 3N0WA 4O4JF 1YDHA 5DGTA 1A9QA 1HK7A 3KTDA 4UZSA 3WIEA 2C07A 4NMWA 3FI9A 2CL6X 1PJRA 1ADJA 3W5UA 4EARA 1UBEA 4CM8A 5LKRA 2ECQA 2HQBA 3DFIA 4GBMA 1NE2A 4NRDA 5K2OA 3KQHA 1G7SA 4YACA 4Q1BA 4XWAA 3ROTA 1QCZA 4RJKA 4CF7A 4O4JA 5I7EA 4MWTA 4DLSA 3TL3A 1VG8A 1UFQA 1ZD5A 1YTUA 3T4EA 2CL0X 4AJNA 3A6PC 1VBMA 1ZJ6A 3IBYA 1EM8A 3WWPA 3S3TA 4U9IS 5IKEA 3N2EA 4Y1GA 4DJJA 2Y2VA 4ETNA 1ZBDA 4DXAA 1R4MA 2QRMA 2J4FA 4RADA 1OLXB 2Q5IA 5GJCA 1QUEA 2BBTA 3RQSA 1NSFA 1Z4JA 2UVPB 3H83A 3SBEA 2EFYA 4FEEA 2O8CA 3TCKA 1R1DA 1I7NA 2ZRFA 4RCYA 3DXXA 1M6WA 5JMTA 1IQUA 1F1JA 5DSZA 3UIEA 4EQ6A 1UMDA 2X1LA 1GVHA 1RI1A 1KP9A 5DCLA 3DTNA 3WMXA 2D1RA 3G5TA 4LQLA 3U19A 1D2EA 1YRLA 4KLCA 3HXMA 2DUJA 4C0KA 2QRJA 3UMMA 2PU7A 2OXFA 3OIGA 3KDSE 4KX5A 4WACA 2R60A 4YMSA 1FL9A 4C30A 4BNJA 2P0YA 4TLEA 3IJRA 3GPBA 3U9TA 4H15A 5ICEA 1EA7A 4L6AA 3JATB 5FBKA 3WXMA 1RQGA 3WDMA 5C8DA 3CEJA 2QSUA 5DM2A 4XWOA 1BYUA 4QFMA 1G9TA 2F17A 1AGXA 1ZK2A 4M21A 4XWTA 2H1VA 3ZZUA 2D7DA 3S2GA 2O5CA 2BT4A 1C80A 1LZLA 1Y98A 3CZCA 1QU3A 2AI1A 3VRHA 2OSBA 2XRFA 4F9FA 1UXKA 1UJ6A 2CXHA 1ATZA 2R8RA 2WDPA 3JR7A 1P1HA 4FC6A 4Q34A 3WMWA 2J3JA 3IR5A 1D7AA 3KT0A 2AJDA 3DHWC 4GI7A 3KVRA 4J90A 4BJHB 2C99A 4DNQA 1MRNA 4B3TB 1OMOA 3GMSA 3A6LA 4RV9A 1TQHA 3RHFA 4FYWA 3HBAA 5DXAA 1B0PA 4MQEA 4GKKB 3MWLA 3CPSA 6NULA 4AMGA 2A2ZA 2JIZA 3QEOA 5AW9A 3UGKA 3KEQA 2BL4A 4TS1A 4WRRA 4R8SA 1BCSB 3LUHA 1QRDA 4QJ5A 3TLGB 3LQYA 4IRMA 4EA9A 4FYXA 4BL5A 4YJ3F 2P27A 2FQQA 3WLOA 3DLHA 4YBZA 4GBGA 4Z9BA 4AUEA 3VOTA 1ABBA 4LRXA 5DNCA 5D1HA 5HJ7A 4EFKA 5TS3A 5MFZA 1YA6A 3CUKA 3O8DA 3SEQA 2I7CA 2ZIUB 5JXIA 1W7AA 3DFMA 3O9ZA 4O0MA 4LX8A 4E2FA 2PJDA 2G25A 4UUOA 3UUEA 3WDSA 2ZDGA 1CUGA 2A9VA 3G8YA 2BEVA 5CGQB 3T0IA 2A58A 4JYPA 3BCUA 4MWZA 1O6ZA 2OCBA 1LSUA 1MHPA 1DDIA 2I9PA 2EQBA 1L9XA 2XMBA 3BULA 1NLFA 1E0DA 4LHWA 2BJHA 5AHOA 5D01A 4PQRA 3M83A 2ODQA 4ENRA 1MJHA 5AUNB 4KPYA 4I4CA 2ZIEA 4K6GA 2JG3A 1E2PA 2Y27A 1YZQA 4IMIB 3T7EA 1U0TA 2I4IA 1SG6A 1XQ9A 1KZHA 5K0BA 1R66A 4PICA 2NTNA 1I30A 4DDWA 1HNXB 3ENVA 3KJQA 1UT6A 4MR9B 5DYWA 3SKYA 4QD3A 3A58B 1KZYC 3R23A 4I36A 1W35A 4JCOA 3UAVA 3RASA 1SWWA 4L50A 5K0NA 4B45A 1E3MA 2PUGA 2BGTA 1YZLA 1VE6A 3D54D 4GOMD 5CVEA 5ALQA 2X0FA 2AG6A 5LB2A 5JZSA 1FLVA 4KXUA 5J2TB 1O54A 3OHPA 4GKJB 1OE0A 5TVKA 4UPEA 4MW2A 2EP5A 3VVMA 1H2BA 2ES4A 5AVVA 4XFJA 1YJQA 3AF1A 2Z8ZA 4JVOA 5BYAA 2Y66A 1PNRA 1A9YA 4QDKA 4JC8A 3E8XA 4RPKA 3M7IA 4N49A 4CUKA 2EWMA 2V1UA 3VNBA 2C0QA 1UZAA 2Q4DA 1OI2A 4O2RA 1E1CA 2IZ1A 3NH6A 5DEIA 3DH0A 3IKLA 4ANFA 1SCDA 1JKXA 2R7LA 2B4YA 1MRZA 1TZBA 3AI3A 1TKCA 4JLMA 3OZUA 2Z5VA 4AD8A 2DETA 1HGXA 1OY1A 3DTVB 4DRXA 2JGJA 2JLAA 2V3WA 5IJAA 3V2HA 3WISA 4EG6A 1KOFA 2BH2A 4Z7QB 2FNAA 3GIDA 3ZWMA 3NKLA 3VAZA 3GFVA 3NX4A 5EJ9A 4OHXA 5ERYA 4N0QA 2NPFA 1UDXA 1AGPA 5KVQA 3A2LA 4QYSA 1BN7A 3CH4B 3ZHVA 3K6SB 4OAPA 4C89A 5FD8A 3H2IA 2QDKA 2V54A 3EGVA 2APJA 2K4MA 3RAEC 3OHSX 1YT5A 1OASA 3BG5A 3U26A 3A10A 2RHRA 3RUFA 5CUQA 4E1AA 4JJ8A 3BTUA 4YAFA 1PSWA 4IEFB 2CV1A 1GFZA 2GPTA 3WFJA 1R3DA 2VXCA 1CYEA 3U3XA 1G0OA 1IJFA 3UUFA 1CLUA 2NSYA 2AF4C 3I3OA 1ZC4A 3EDOA 3RJTA 3O8QA 4BZZA 3SJAA 3LWNA 4CMHA 4ND6A 3V9AA 5ALYA 2EZ8A 3C8MA 5DRYA 4C22A 2NVWA 1VMAA 1Z88A 2CVQA 4ODIA 3KQTA 4NHEA 5GQSA 1GSOA 2I1VB 1R8JA 4BO1A 1UMBA 2ACWA 3TNJA 3F6SA 3R09A 4G25A 4I4NA 5BNIA 5BQXA 5IVPA 1XLVA 2A9PA 2VPXA 2ZSHA 1WQ3A 1IAQA 3D3KA 1RYMA 2XUDA 3DDSA 3NBUA 5KVVA 1IJBA 2XJ4A 4P5EA 1UFVA 1SXQA 1JV2B 4RAOA 3MT7A 1CEQA 1NQAO 4G81A 1ZO8A 4V0ME 5BSMA 4DE5A 3U6KA 4D74A 1ZZGA 4BO0A 1QHEA 2OC4A 1JJBA 3LLMA 2C9DA 3ST7A 3QF7A 2YV1A 1T8PA 1RADA 2OV8A 5C80A 2R2AA 3TZHA 1EVLA 2QSZA 3ZBQA 1P4RA 2QGNA 3CT4A 1QV6A 2AGVA 2FEPA 3QV2A 4MW0A 3RK0A 3TW0A 4R7TA 4D8XA 2P9EA 3BMNA 1T6ZA 2P0AA 1Y9JA 3KQPA 4TTJA 3JQAB 1KVQA 4PAWA 1L7EA 1IQRA 3DOCA 3X43A 4DA9A 3PA6A 1KSJA 3B2QA 4PM4A 2OK8A 1KVTA 1SULA 1Z4KA 3JQEA 4BZPA 5BYKA 1R0WA 3GEHA 4GR5A 4PTYA 5ESDA 3ZV7A 3GA7A 1CRZA 4RVUA 3PNBA 2XKJE 1BEUB 4DZZA 5KNCD 5E9JA 2YW2A 3LM8A 4PO1A 3I0MA 3B6KA 4MRVA 4S1TA 1FQOA 4CZ2A 1BVRA 1DC4A 1FNDA 1R5BA 2UUPA 4OO3A 2OWEA 1MPTA 1VCMA 4QFCA 3V33A 3FNRA 4AJ4A 1F4LA 2FPLA 4ZDKA 3T5GA 4BWFB 1WW8A 4GVXA 2DFNA 4BPBA 1ZVJA 2A1IA 1T6XA 3LY9A 2GJ8A 4QEDA 3NRJA 5BN4B 4F4DA 1DKOA 2NUTB 1GGKA 5L3QB 1I1NA 4M1MA 3V2GA 3VH4A 4G86A 2X5NA 5BQ3A 1CR1A 1LK0A 4I1OA 1PL7A 3DL2A 2WIKA 4Q21A 2QQGA 4DT1B 1ZUWA 5CT4A 3CTPA 1UXIA 1SU8A 1P1CA 4P7JA 4QYMA 2BSAA 4TVOA 5HF9A 2VBGA 2XF2A 1H42A 3TFWA 4CCWA 1NZDA 3OZWA 2YWXA 4HDKB 1WHSB 3Q12A 3IIEA 1J2YA 4Q48A 1XNHA 1JU3A 2P9TA 4L72A 3WZLA 2FLWA 3NP9A 3CF4A 1ZVQA 4XVUA 1U2ZA 3PENA 4L9AA 4MWSA 5FUXA 1PIWA 1GZ3A 1NR5A 1IWOA 1E6CA 1M8GA 1SK8A 4QNNA 3TYXA 5EPOA 3D1VA 1ORIA 3IVAA 1D9ZA 3QXXA 4KR9A 2FX5A 3B1XA 1JQLB 2NVUA 2Z09A 3ROZA 3H2KA 3ONFA 4KHPB 1PTJA 3FIUA 3I1YA 2XTMA 4I9NA 2ARKA 4ND8B 1PE0A 2WW8A 2PBFA 3N7TA 2XNDA 4WE3A 3RUCA 3A1UA 3C3XA 1L8LA 3W5CA 4WKPA 3MMZA 4L57A 4L5YA 3G0BA 4WFIA 3WYAA 3W2IA 1CS0B 3L1UA 4UNIA 5J63A 2ERXA 4OHCA 3U0BA 4PLVA 2YR0A 2YYAA 1FSGA 1N9GB 2ET6A 1UBCA 2I8AA 2UYOA 3TZBA 3THWA 5LP6B 2YNMD 5FL3A 4FVTA 5AKXA 1TW2A 5AW4A 2H6EA 4HMQA 4TRJA 4XUCA 3MCWA 1G60A 4JITA 2IGTA 4OUKX 4CXMA 2V7XA 4UM5A 1QVAA 4LWQA 1UANA 3AERA 1XXHE 2VH2A 3KU1A 1R6UA 1V6SA 2CVZA 3W3AH 5AIBA 1NUAA 1PNVA 3IIJA 5JD6A 2DXIA 2D62A 5TF4A 1UEIA 2BFFB 1DIBA 2C5BA 1E2NA 4H6VA 5JFOA 4S1NA 3C1OA 4IVRA 4BQEA 2QLBA 3R4VA 4ZVPA 1WZ2A 1X1DA 2QRGA 4Z9AA 5E6RB 4EG7A 2EYQA 3L82B 3LX6A 3OFVA 2SKDA 2YWJA 5ALWA 2VA9A 2CJWB 1U7XA 3CISA 4BMCA 2CMGA 5TVGA 5KDOA 1JFFA 3HXLA 4IHKA 8AT1A 5E6UA 3JRXA 3Q1LA 4KFSA 4RD0A 1S7CA 4W9NA 4D4KA 1PW5A 4L3OA 4QTXA 4UATA 4YAUA 2P6OA 1UAGA 4KC0A 1Y42X 1U8YA 2FEXA 2WNHA 3FR8A 3K1AB 4M38A 1MDFA 4L22A 4MQFB 2W2PA 4JWKA 4EFDA 3ZWCA 1SHZA 2IOFA 3FNFA 3IURA 4KBYA 4NV0A 4TLLB 4W5HA 3HCNA 4EKGA 1DX6A 2FLKA 3D3NA 2COEA 4UHEA 3WLHA 2PUDA 2V03A 3FWPA 3NDPA 1QQAA 6LDHA 1CRQA 2PVPA 4MVYA 1RAFA 4JI6B 3ASYA 1EQAA 4YCCA 5KMGA 4AZTA 5IBQA 5B1DA 4DL9A 1IQ0A 5FNVB 3AONB 5J9FA 5ALFA 2MOKA 4QWWA 1ZIDA 4BNKA 5C8XA 5AKGA 1BROA 5A4DA 2OESA 2JLRA 1TJPB 3V8MA 4CWAA 1KEKA 1JKFA 4I19A 1U02A 1G3UA 4DQDA 4YQYA 3LUGA 2EQ5A 2WVGA 2PJZA 4JJ6A 1JU9A 5KTTA 3EXG1 2REQB 3IPCA 4EWLA 1T1EA 1N2GA 3K9GA 5FA8A 2C8LA 1U2TA 1UJNA 2J9FB 4ND3A 2FN3A 1R4NB 1DWPA 1RXEA 3O47A 5B58C 1U63A 4DIFA 5IEJA 3IELA 3T1OA 4U02A 5ECGC 3V1UA 2C3PA 4RFSA 3FTDA 3P9KA 1ONPA 1QH0A 4RQAA 3ITNA 5AHKA 3C1AA 5H4HA 2X0EA 2CXUA 4QLOA 3EQ6A 3A27A 1YE8A 2C2WA 3ECSA 4Y2GA 3WP1B 2GBCA 2WFAA 5A4AA 2VAMA 3P96A 4MGZR 4RTJA 3CJRA 4B3JA 1COWD 5HKLA 1G17A 1HORA 1HLGA 1RQPA 1TD1A 2G88A 2WP8J 1H2ZA 3URKA 5LJIA 3ENNA 3LE8A 4H3KB 4KQKA 1RPNA 4GNRA 3AOEC 2A4MA 3K5PA 2FH5B 4ZYTA 2H4ZA 3VSEA 1ZMRA 1U0EA 1DWUA 1Z2NX 2AX4A 3OC6A 1W9MA 2PUCA 1ODFA 1TXGA 1LBEA 1WDMA 1XKTA 3ZKWA 4ED9A 5AFSA 4DR1B 2PKCA 2C7OA 2XGJA 2WSIA 3OA0A 3BIOA 1HKUA 4LG1A 5EZSA 4TV9B 3AVWA 1PNQA 4P53A 3T9DA 4AB1A 2QL7A 3FDJA 2PMWB 4Z4QA 4OBXA 2X5OA 2CYBA 2X5KO 3DEKA 1IUOA 4OJNA 1OH7A 2XD9A 3DPIA 4X20A 1CRPA 1NXTA 2GEDA 1YVRA 3IDOA 2N75A 4GPAA 1ZCBA 2PNFA 4DTCA 4MB0A 3RROA 1O58A 2DFKB 4PSKA 1N2XA 2HDOA 3EAGA 4XYGA 2PGNA 5REQB 2IIQA 2Q0QA 1ZN9A 1RC8A 1VG0B 3TGWA 2C5GA 3TNFA 1C3JA 1PSZA 2GYUA 1L4FA 4A9AA 4ZFNA 2EL9A 3U4IA 4PXSA 4MWOA 3A26A 4AJEA 5FEMA 3WNZA 2CBZA 5L45A 1E5XA 5JCJA 1HE5A 2WAXA 4Q0MA 1GV1A 4LYHA 1B42A 3VR5D 3UAGA 3O1IC 5CU7A 1E7WA 1W0KD 5H81A 2H07A 4QOIA 3RTCA 4W5RA 1L6IA 4XASA 4B3SB 3TTUA 3I8SA 2FSVC 5IDVA 1HEUA 4BLTA 2WM9B 2NO0A 1TO6A 2R751 3ZCPA 1HQCA 1Z08A 3W5SA 3PL1A 5A5DA 3DDWA 3CXUA 2JJ8A 3EC2A 3RKRA 3UMSA 1G2PA 1J00A 1KYTA 1MB0A 3ONDA 3FA2A 4IO1A 3C6BA 4UC0A 1Y48E 4JB8A 3U7GA 4Q7EA 3F3SA 1KHTA 1CZOA 1B6GA 2GN2A 3IEXA 4G4SP 4I3GA 2VNHA 5ARDA 5I8WA 1E89A 2AMFA 3FTCA 1YIDA 3G68A 2YXNA 5JY1A 5D86A 5JXJA 2BMVA 1X74A 2ZSEA 2BFMA 4HG2A 3Q72A 2D1TA 4FZRA 1THZA 3EWIA 2C5AA 3QKSA 3ORQA 3RC3A 1I13A 1ZH6A 2HSDA 2O9JA 1S9HA 4ENVA 1PT7A 4HV4A 1D0SA 3ITKA 2QTVB 1DEAA 4ML3A 4ONEA 5JCOC 1CULC 1I4DD 1PGJA 1YZTA 4OP1A 4AIIA 4O2AF 5CD1A 3FVRA 2WABA 1SGWA 3PHHA 3AUYA 3GVPA 5E7MA 2VCEA 4K0RA 1ENZA 5JADA 4EI2A 2JFXA 3G9QA 3DCIA 3EYAA 4XIIA 2VTVA 2PXCA 3T1QA 2QM7A 2GPBA 2ATXA 1H5NA 3AWDA 1G8PA 3A3PA 2BFDA 3PHBE 4HVLA 1YBFA 4O2AA 1P7CA 1PGQA 3FOFC 5KNCH 2HL6A 3REGA 4Z5XA 4XWKA 3V8QA 1DFIA 1I0ZA 1VE3A 2A0FA 3M6VA 3LPLA 4HDOB 1OI7A 4FI3C 2JGMA 4TUYF 4MI1A 1QYVA 1KERA 1ULZA 1ZFNA 2FR8A 1JFRA 1BSVA 2H4XA 5IUKC 3GRVA 1BW9A 2INGX 3ZD7A 1ZN7A 2BM9A 4FMCF 4BVFA 1Z25A 4CRWB 2H57A 5EP1A 4KQCA 4XXHA 3V46A 2DT8A 3HDGA 4O33A 4RTKA 1B6SA 1WOYA 7MDHA 1KAHA 1BE8A 1A7UA 3BC1A 4MP8A 5EWLA 2B34A 3JZFA 4UREA 2A0KA 4TUYA 3GLRA 4RF4A 5LIRA 3FWHA 3AEKB 1PT9A 4AKIA 2VDQB 2YJTD 3AF3A 4FFMA 2VHCA 5ALVA 1N0WA 4OFWA 4IHQA 4YCMA 2WR8A 1XMOB 1V7ZA 1DV2A 3TR0A 1VKZA 1P7VA 2DUNA 2O2JA 4JT8A 1EB8A 4DB2A 3FMIA 1M75A 3ZNPA 1P8JA 2D1QA 1D04A 3T6KA 4F12A 1U3WA 3HRHA 3HV0A 4JBGA 2IUSA 4Y0AA 1WKBA 4MRPA 4JSYA 4C7OB 3ZDFA 3FVQA 3L9XA 3WTCA 2H0AA 3ED5A 1J0CA 1TCCA 2G4CA 4GXNA 4LUCA 2GK3A 1FFHA 5ESWA 3VI3B 4DDHA 4BX2A 1GY8A 3IDQA 3IRUA 721PA 4LBWA 5K4GA 2DEUA 5JXGA 2FDCA 1L5WA 4OIMA 3N7AA 1Q22A 1QUFA 5K8UA 1CZRA 4LQCA 1OBHA 3ZE0B 4Z0HO 4IINA 1PGOA 4D0LB 5BW8A 3D2CA 1F9AA 1RHQA 3DOHA 3ZWQA 1DG3A 3SE7A 4LRYA 2HMVA 2HWWA 4BNLA 4RD3A 3O1HB 4D4IA 3E9MA 4FEAA 1T0JB 4JJZA 5BOVA 4QZVA 1MPXA 2Z6AA 3JV7A 4X41A 4IYRA 4MJXA 5LMUB 4JJIA 1NATA 3DFZA 4IIFA 3JYPA 4IF6A 1K5GA 4L0MA 4RY0A 3KZOA 2G70A 4D9HA 3W05A 3IEVA 1R9GA 4GH5A 4MWEA 1A2BA 1KGSA 2BHSA 2F3PA 1RYYA 4M4SA 2XCTB 5HKAA 4KN9S 3PC6A 4BQFA 1E8NA 3VOBA 1SO8A 4G41A 4CKEB 5I9IA 3RB8A 4Q9NA 1JI3A 3BEDA 4YB8A 1NF3A 3U49A 3CPHA 3N53A 2LXNA 4M7OA 4TT8A 5F3RA 2ZSAA 3M8KA 5JI2E 4RESA 5HTOA 1WXFA 1XC7A 3PNYA 4KMSA 5ULLA 2BBSA 2V5VA 4LJ4A 3UV7A 1K7CA 4CU2A 4RUKA 1WVIA 1U8TA 4BMPB 2W2KA 1GKIA 2OM2A 1ZXBA 1E98A 2QY6A 1XYVA 3ON5A 2CZGA 3L8DA 4AW9A 4FJ0A 3A0RB 3ROGA 5CB0A 1HR0B 1R7RA 4LI3X 3LYHA 3QX8A 4YHBA 5KINB 3ABSB 1YRWA 1Y6RA 2XJ9A 4W1QA 4AP6A 1PZFA 3Q4GA 5DW3A 1K7SN 3LI2A 4CM6A 4EEKA 1NXXA 3TRIA 3L4SO 1ZR2A 1DBPA 3AEUB 3N9IA 4ROSA 3JQ9A 2XA9A 1OWLA 5EFZA 3PT5A 1L5FA 2HJRA 3EMVA 4KI0A 1Y6JA 3F6RA 4A0QA 2B9VA 3BOSA 2RC5A 3FCAA 4LCBA 2GASA 2IT1A 4BMDA 3RS2A 5HGXA 2I6TA 3AVQA 2HXSA 4FMBB 2B5VA 3QOXA 3F6EX 4EW6A 2R6CA 3KKKA 5HMMA 4DLPA 1QHIA 3HSYA 1A2OA 1X9GA 2CUNA 3VOAA 4CG2A 5BNZA 4AMYA 4JLPA 3BE5A 3D8BA 3SNHA 4H59A 4ZK2A 4HP8A 2PBRA 2X0RA 3OKCA 3SC2B 3H2YA 4GEGA 5HRAA 4XIFA 2IITA 5A7GA 2PQMA 2YVAA 3LUPA 1NMSA 2Y68A 4E70A 4IBOA 1JP7A 2NTVA 2ZJ7A 1DT3A 4DRZA 5ADVA 4MS4B 4NOMA 1G8MA 3VDNB 3B85A 4MUFA 3COSA 3LQQA 1UQRA 3S81A 4B7XA 4ZREA 1Z13A 3OG9A 3T61A 2X2OA 3NPMA 4D7AA 4P35A 1D1PA 3C70A 2OHOA 4WZBE 1XNRB 1D2CA 1TU4A 4ZJPA 2OXRA 1Y4DE 1OWOA 2V8OA 4OV6B 3QOWA 2BFEA 2DTXA 4CF3A 2P2ZA 3E9RA 4QO8A 3E1SA 4DG5A 1V39A 3OAAD 5JATA 3HWX1 4K3VA 1A50B 4IVNA 4DNFA 2ZRNA 3C6XA 3I8XA 2WQ7A 1RAEA 5ITZB 1KK2A 5HOQA 4H7JA 3M4YA 1G1AA 1JQ3A 3ANXA 4Q12A 4CMCA 2YNMC 1FS5A 5F5NA 4IIJF 3KKEA 5JNVA 2G5GX 5DMHA 4NZ9A 2Z5LA 4A2QA 1T13A 1X92A 1Y9AA 1QO0D 2Q1YA 4MTCA 4RLHA 2OENG 3ZZ0A 1JHOA 2QMZA 4G5RA 3SYKA 1DTEA 1NT2A 2FGJA 3OEWA 3EPHA 2YRWA 1NF8A 1BMFA 1XDBA 1KQ3A 2QR3A 5MFPA 4TTRA 4WN3A 1QLJA 3WGQA 4IIJA 3NGXA 3S6JA 3D4BA 4PHTA 3TF5A 5DNAA 2BBWA 3WGYA 1KZ7B 2FZEA 4LZNA 1NAHA 4XX0B 3U80A 1E1YA 5JAZA 3MT8A 4G63A 4UCWA 5NULA 2B1IA 3AR5A 4XX1A 2HMUA 4LY9A 4BX8A 1WXIA 3D64A 2VSXA 1TTQB 4FS8A 4ZAVA 4E07A 3F8SA 5ALJA 4EA8A 3DLPX 1KO1A 4NU5A 4KO1S 1NA5A 4ZN6A 1S02A 1KF0A 2XA1A 3DTTA 2EEZA 2C5FA 4P86A 3H84A 4OHOA 3C8UA 1Z5PA 2M6SA 1F5SA 4Q3EA 3BA6A 4R40A 3QSYA 3MJHA 3LDFA 4WK4B 5KO2A 1HLDA 3L0YA 1V4VA 1RAAA 3PQ7A 4NC9A 2GN6A 3DG9A 4J0JA 1V4BA 5JFGA 4LSGA 4GRDA 4HYTA 5C7OO 5A0TA 1CQIB 5JWHA 1CXZA 4MLCA 2NVBA 4C87A 2FMFA 1NBMD 3WGLA 1V16B 2XQKA 3ZWVA 3HN2A 1CJKC 4BVJA 2X1VA 1G6HA 2UUOA 3P19A 4HWRA 2IUUA 4B4OA 1P2TA 3H2ZA 1J0EA 1HM5A 2JKVA 4GICA 1N1EA 4NE7A 4BO5A 1OR8A 3CLUD 4F4FA 1QOZA 1JLSA 1R3UA 4ZVSA 3QVGA 4JJGA 3I32A 1UC5B 1C0EA 2AJCA 5EJ6A 4UNRA 1CC1S 3VR5H 4RPCA 1N2OA 1Z39A 4JHLA 1PK8A 3EW7A 5ECWA 3LFTA 4BNMA 2GKGA 2NU9B 1F8UA 3UOWA 4C0SA 3WIDA 1XMSA 4RTSA 1BA3A 2Q1SA 3R7AA 4DV6B 5HFAA 1NKVA 2QLMA 3F3KA 1ZBQA 3ZN2A 3H6KA 2K7FA 1ZINA 1LBTA 2JDIA 2WUFA 4I14A 1CY6A 3C7TA 1ZEJA 2ZYDA 2BGUA 5HQ3A 2EG9A 2AW3A 4D02A 3VVLA 1HBJA 1SXJE 5KTPA 2FVYA 2QTNA 2VQ3A 3SZ3A 5KQRA 5B4VA 4AJHA 5KU1A 1Z0SA 1F4PA 1LF5A 3GCDA 2HUPA 3RVDA 3UMYA 2ZDHA 3GWGA 4QA9A 5IYZB 1J1UA 2CDNA 2A78A 5DX8A 2VP2A 3ZDBA 1BXGA 3PJGA 4WKOA 3ZY4A 1NC1A 1RYBA 1DHRA 2ZXEA 3RRZA 3DZKA 3N05A 4FNOA 3WYCA 4BVHA 3BE6A 3W77A 4C6HA 1HNWB 4AZ0B 5I9MA 4DG9A 4B40A 4KQ1A 1U31A 2P91A 4DIOA 4QOSA 3D1LA 5YASA 5E6SA 5KYXB 2WKWA 3MOGA 3N0RA 2IHYA 5F35A 3BHIA 2VJYA 4BV8A 1J9GA 1P1KA 2FW6A 2O6HA 4FFOA 3BIFA 2C58A 4IG9A 3DD1A 5C0OE 3CVJA 2R5FA 2A1TS 3EIOA 1TNDA 3B1WA 2QRQA 3RHTA 5ITSA 3PG5A 1RZRA 1G16A 1FVOA 3F6BX 1E2JA 4KQFA 3V1MA 4BS9A 5JSZA 4OXQA 4ND2A 2YZ7A 1YOVA 3C85A 3C6ZA 3OHMA 4G4IA 5IJ9B 1IK4A 2X6QA 3WWYA 1E2KA 3LLVA 4UEOA 5B1SA 3GOQA 5FO1A 2RJ3A 1PT6A 4XD2A 1LW6E 1QMPA 3VHLB 4E33A 1AHPA 3L6OO 3QE9Y 3PDIA 4DN6A 1S8NA 4IJQA 2MYTA 1WVMA 4UDYX 3UXYA 5HNKA 3CIOA 4IDBA 3K0SA 3IIIA 5B2ZA 1GNRA 3PQ2A 3SJUA 4EAQA 3S55A 1YVEI 2QTBA 5BQOA 3BK7A 4M88A 2X76A 2PGIA 3GZJA 5IBRA 1DEXA 4HSGA 3CT6A 4WN9A 2GZ3A