1QBGA

Crystal structure of human dt-diaphorase (nad(p)h oxidoreductase)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
272
structure length
272
Chain Sequence
b'VRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD(P)H DEHYDROGENASE [QUINONE] 1
publication title Crystal structure of human DT-diaphorase: a model for interaction with the cytotoxic prodrug 5-(aziridin-1-yl)-2,4-dinitrobenzamide (CB1954).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 83
structure length 272
sequence length 272
chains with identical sequence B, C, D
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 1999-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qbgA00
4ZVKA 3ESZA 1B1CA 2V5VA 3TEMA 1FUEA 1CZLA 3NHSA 4QOIA 3LCMA 4Y9RA 4U7GA 3ES9A 1AMOA 2MOKA 2R97A 1WSBA 4NLLA 1YDGA 3SVLA 4N65A 3EYWA 4QOEA 3U7RA 1WSWA 4NULA 2OHJA 2ZKIA 4LTMA 3QE2A 3OX2A 4C14A 1E5DA 4LA4A 2BZSA 3EDOA 4HEQA 4LTDA 1BVYF 1TLLA 2QMYA 4R81A 1RCFA 1YOBA 1XT6A 1YCGA 5B3LA 1AKWA 2X2OA 2A5LA 1CZOA 2FLVA 4FGKA 4ICIA 4M0CA 5LBTA 1AKTA 2XODA 3FX2A 1X77A 4DIKA 4QOFA 3ESYA 4PTZA 4CETA 2HNBA 4S24A 2R96A 3OX1A 1CZRA 2OYSA 1YRHA 2OHHA 3NFRA 3W7AA 2FX2A 2KLBA 2QR2A 3FNIA 2FVXA 4FGLA 3GAMA 1C7FA 3NHLA 3QFRA 2FZ5A 1KBOA 3NHWA 1F4PA 5TGZA 4YAOA 3KAPA 4XDHA 4ZVLA 1SG0A 5F4BA 2W5UA 4QOHA 4LTNA 3OJWA 1J9ZA 2Z98A 1FLDA 1CZKA 3KEGA 1XYYA 1DXQA 3KLBA 5F51A 2XOEA 2V5UA 2F1OA 3NHJA 3UXEA 3UXHA 4HS4A 3NHUA 2Z9BA 2FAXA 2B3DA 1J8QA 4C0XA 3N39C 6NULA 3KAQA 4C76A 3D7NA 1YKGA 3B6MA 1QRDA 3U7IA 1CZNA 3W77A 4DILA 2FOXA 2QX8A 3K1YA 5EA2A 1VMEA 1FTGA 5FUQA 2OHIA 3JSXA 4QOGA 2KQUA 1GG5A 1AKRA 3NHFA 2RG1A 3R6WA 1FX1A 1V4BA 3N3BC 4U7HA 4U7FA 5LJLA 5NULA 5LLDA 1AKUA 2AMJA 3K20A 1QBGA 2V9CA 4QOJA 2FDXA 1YCHA 2Q62A 1OBOA 3O2NA 3NLLA 3ZHOA 1FLAA 5EAIA 3GFQA 3L9WA 1H69A 2MWMA 2X2PA 3FJOA 3ESXA 3NHYA 3OVMA 1AKVA 4Y7CA 2WC1A 3W78A 2MTBA 4J8PA 2M6RA 1J9GA 5LMCA 2Q9UA 3O73A 5LVAA 1NNI1 5BUCA 3L9XA 2MT9A 1RLJA 3FW1A 1ZX1A 3B6JA 5EMNA 3F90A 4FGJA 4H2DA 4GQIA 1FLNA 2QWXA 3LT5A 1RLIA 5FX2A 4BMOB 5LJIA 4GR9A 5JROA 1C7EA 4FX2A 1ZWLA 1TIKA 3HR4A 4CF6A 2N1MA 2FZVA 1BU5A 3TE7A 1SQSA 1AZLA 1QHEA 2QX4A 2BN4A 2GSWA 5NLLA 1JA1A 2QX6A 2HPVA 5ULLA 1T0IA 3NHRA 2QX9A 4BMPB 4ZVNA 1JA0A 3NHKA 2M6SA 2HNAA 1T5BA 2Z9CA 1AKQA 3QFCA 1KBQA 1RTTA 3OWXA 3OJXA 2D5IA 3OWHA 4PU0A 1XI2A 1DXOA 4ZVMA 3RPEA 5FA6A 3N3AC 1AHNA 3S2YA 3NHPA 3TZBA 4ESEA 4H6PA 4F8YA 2ARKA 2BPOA 1XYVA 1CZHA 1QR2A 1H66A 1OBVA 3B6IA 2QMZA 3F2VA 4YAWA 1CZUA 4N9QA 3B6KA 2Z9DA 2BF4A 4YALA 3P0RA 1I1OA 3F6RA 5LBUA 2BMVA 4DY4A 3GFSA 4PTYA 1YCFA 1D04A 5F12A 5B3KA 4YAFA 1D03A 4YAUA 3G5MA 1DX9A 1D4AA 3HLYA 3HA2A 3F6SA 3GFRA 3FVWA 1ZWKA 4GI5A 1AG9A 4XDGA 1OFVA 4QODA 3OX3A 1FLVA 4C0WA 4LAFA 2FCRA 4Y9UA 4N82A 3W79A 4OXXA 4D02A 5A4KA 1FVXA 1J9EA 4YQEA
chains in the Genus database with same CATH superfamily
3FAKA 3HUEA 2ZS9A 3IA2A 3OE5A 4B09A 4OFWA 4BWFB 3AF0A 3LV8A 1XTBA 2FLKA 3O0DA 4CMGA 2XXAB 1KAHA 3H1GA 3M1IA 1I6KA 1P60A 1VSQA 4NDAA 4NDZA 5DSZA 4MCIA 4P6VF 4HFJA 4HWKA 5CH5A 1G8SA 2EQBA 4L8GA 4NAUA 4PEVA 5AW1A 1TGYA 4GP6A 5JS2A 5HOQA 2FRDA 1JQEA 1CNFA 4FBGA 4G0UA 5AW0A 3WBFA 1UPBA 1CRWG 4NH0A 1L7XA 1Z28A 3O93A 4FDUA 3PDIB 4AWXA 4YLYA 1HFJA 4UFOA 1Y48E 3PNLA 3NTLA 2ONJA 1W6RA 4G1MB 3F8WA 1SBNE 3R76A 4MIKA 3VYUB 1E2IA 1JIQA 2PSEA 4KGXA 1D6JA 1RQGA 3OIUA 4B7ZA 4JROA 4K86A 3U4AA 2HQ1A 4ATNA 1PO7A 1L1QA 2PGDA 3A4YA 2Q5HA 1M7GA 5JWRA 1DZ3A 1ZCZA 4Y18A 5CAEA 4G8CA 4NG5A 1XQ6A 4QOEA 3H11B 3W9BA 4EMSA 4FD2A 4CMCA 2YJNA 1M10A 4R9UC 2CMFA 4TSKA 5DLQC 3LHDA 5LMNB 4LRXA 4G67A 1NFRA 1DT5A 2KYRA 1Q21A 3OX2A 4QELA 1E96A 2G25A 4DY6A 5CD1A 3A6PC 1X9HA 1H05A 1LJUA 4TLCA 4TTRA 1GEGA 4Q4AA 1UMDB 2W2LD 4PLYA 2RBGA 1JNXX 4HCJA 2F3TA 3H8JA 2XV1A 4E4TA 4JD5A 1VGRA 4QEDA 5KYNA 2VPXA 4JQSA 2ACVA 4FLMA 3BCRA 1TM7E 1ZI9A 3W7VA 2Y1FA 5HMLA 5TGTA 2PBZA 2IX9A 4Y2VA 1UPXA 2OP1A 4R81A 3INRA 4KDCA 2XGMA 3UC9A 3UYLA 4IAOA 5KQLA 4MWEA 3FTFA 1MB0A 2AJDA 1BHQ1 2YJGA 3OTIA 3QVSA 4U7DA 2B99A 4KOAA 3I83A 3PNYA 2OVFA 1CLUA 2CLLB 3ONVA 1Y3IA 4OXRA 4KLNA 5FAKA 3URMA 3ON5A 3QE9Y 3SNKA 2APJA 4B76A 1S02A 1WCV1 2AW3A 3G13A 1R4ZA 3H2YA 4MP3A 5DV9A 3WKBA 1ZXBA 3A1UA 2GKSA 2XMDA 4KAAA 4CTJA 9ATCA 4FGKA 1I2DA 1E3SA 2QLBA 3PD7A 4QYWA 1MEEA 2N0SA 3ISJA 1LC0A 5DIZA 2FPPA 3ENKA 1A72A 4IOLA 4GW3A 3V1TC 3CUTA 4UD2A 4JC5A 1L7MA 1Z2DA 2CZGA 4V38A 1L0BA 2AD1A 2X76A 4MUYA 3PIDA 2Z09A 1QDUA 4EJSA 4E7PA 3ZV6A 5EIEA 2B8WA 2OBNA 1KZGB 1ORIA 1RWNA 3MMPA 4RH3A 1IIRA 3CRMA 4YTEA 1UXKA 4HRAA 1QCDA 2Z4SA 3AL3A 4RMHA 4F4JA 1N1EA 1H65A 3NR2A 2QRNA 4HZIA 1QVRA 3NOQA 4Z2AA 2B4YA 3NFRA 1TVCA 2EU8A 1M34A 4I6EA 4QOSA 4FWTA 1RRPA 1F2UB 2E4VA 1J1ZA 3HCNA 5JRZA 1VKHA 4XLZA 4PNPA 2GZHA 2R00C 4QLOA 2PH7A 4AJKA 3O8BA 2J7PD 4DDTA 5F1YA 3UT0A 2H0RA 4QHYA 3Q7EA 2H8KA 2PS0A 3QTTA 4YRQA 2B4QA 3O2JA 1TO1E 4A82A 4IIGA 3J7AC 2XGOA 4GI1A 1L5OA 3VZRA 4F11A 1T2VA 1EX1A 3A4TA 3MCUA 4MUJA 1FVFA 2H57A 3CNQS 1VCHA 3O21A 2AQHA 5JPCA 2R8OA 2JJ2A 3IJ5A 2BMEA 5AM1A 1XD9A 3Q8KA 3CZQA 2R8ZA 4X3OA 4AKGA 3GNSA 4X9XA 5KI6A 3AOEA 3HKBB 1FXSA 1XZKA 5T4BA 4V0MA 3QBTA 1QHGA 4LJRA 3I8XA 1FLDA 4LF6B 3OA0A 5PNTA 2I91A 1CZKA 1GPYA 3IDAA 2Q1SA 2C5AA 3HM2A 3I6ZA 2O8EA 4D4MA 1FY2A 3V7UA 2YHUA 3VH2A 1HOXA 4L8VA 3V97A 2A9FA 1ZCBA 2R79A 4IDAA 5LNK1 1FXWA 2R7KA 2W98A 4C6TB 4NPHA 4AMUA 3WSVA 3SJZA 4C04A 3T3GA 4B74A 2PCLA 1X9GA 4JGGA 3ESDA 2XEDA 4P4TA 4F2DA 1G20A 5ELLA 1RI2A 1PZHA 4JGBA 3WA6A 3RNLA 3HJBA 3V7WA 5JISA 5JI3E 4X0EA 1L4NA 4YP1A 3TH5A 4NU8X 5AKKA 4DB2A 1F60A 5AVXA 4G09A 3C3DA 1G8KA 3F3MA 1FNCA 2HF9A 2Q3HA 6REQA 1UBTS 2O1WA 5EKDA 1XTTA 3BK1A 3KEQA 3R7WA 3I53A 2X8LA 1L3BA 3EDQA 5DOZA 2XA9A 4R3UC 3K0FB 4YK7A 5J40A 4C0XA 3FD8A 1ISIA 5KKAA 1B16A 1J07A 2VPWA 3GBPA 3KLPX 4JU8A 4MVJP 4RVHA 2VIIA 3KAQA 1WPQA 2Q1WA 2ET6A 4OY3A 1DP4A 4PYIA 1EFPA 1O57A 4CJXA 2V6MA 4DFDA 1NUPA 1NW6A 3DQPA 1M6HA 1JRLA 3RWOA 1OAOC 4G8JA 1OZFA 1SVLA 2I2FA 1KJZA 4KN8A 5J43A 1JFSA 2QRLA 1E77A 1XTUA 5FWDA 1BJKA 4DLTA 3A3KA 3LLVA 1IAVA 2J30A 5JXGA 3NBMA 1J2JA 3W5BA 3P4UA 3HDVA 1I5RA 4XA8A 4XFDA 3A7DA 1KI7A 3EPRA 3ABOB 4ZK6A 3HS3A 4M1OA 7YASA 1UM9B 4X8OA 3TB6A 4EY4A 3JSXA 4YMIA 4ZYYA 4RKWA 2ZYGA 4P1ZA 2VTKA 1ND6A 3ZOZA 4D4GA 2EX0A 3AVYA 1SBHA 4PG5A 1NW3A 2C92A 2QENA 4FFWA 3I4FA 1FFBA 3MFYA 3U39A 4Z9FA 5FTMA 4DIBA 5DP1A 3NHFA 4YP5A 1S3SA 3UFXA 3G02A 3OIYA 4ZOQI 4PYJA 3U4QB 3RT7A 3C5HA 2O54A 1MPXA 1E5TA 3NEPX 3QKSA 4OHVA 4UUQA 5J2TA 3DTNA 1DAPA 1E1YA 2W90A 1V4BA 3JATB 4KV9A 2CD9A 2P9YA 5FL3A 4LOIA 1AUOA 3LFUA 3Q7RA 4GPBA 3SJCA 3T3EA 1T1GA 1DVRA 1KJIA 2AOUA 1OBFO 3PE6A 3KTFA 5G2OA 2I7VA 3UN1A 3PGMA 5F7XA 2HK8A 3U13A 2FEMA 2C2GA 3DL0A 2AMJA 3GJZA 4O6VA 4CDRA 1ZL2A 4HDNA 2IUSA 3SQXA 1P75A 4MKIA 2VF7A 2ZYIA 2W6ZA 3AWIA 5K4GA 3ZHSA 1YCHA 3NLLA 4U0JA 4HFRA 1SQFA 2GKOA 3QUQA 9LDBA 3A6JA 4W9NA 1V39A 3OHPA 2DHEA 2YXNA 2ZRBA 3ZBQA 3S2FA 4O2AB 3BGVA 4QVGA 4JEIA 2MWMA 1X13A 2IOQA 1ZSYA 2X2PA 4AKTA 4DDMA 3P9PA 4ZWNA 1TF2A 3QVOA 1TFRA 3C74A 3FSGD 4Z0TA 4OHWA 5IUNC 1DBQA 2XY4A 2WK1A 5JMWA 4WDQA 1KZYC 1KXJA 3OSZA 5ALLA 2ID9A 3L7YA 1YXMA 3K15A 4ZQEA 2FFQA 4P36A 3MLAA 4K5QA 1L3IA 2IYVA 2DUNA 1E92A 2PWYA 4FYIA 1DL5A 2ZBFA 3L7BA 5LMCA 4NFYA 4MX8A 3ZOKA 3AP1A 1YD7A 4FR2A 1T9GR 3E1KA 1KDTA 4KC0A 4E0BA 2ZUEA 2OZEA 2YY6A 4P7GA 3QXCA 4BO2A 2ZT8A 4RPJA 3OJLA 5BUCA 1K9VF 1GDDA 2X9VA 4QE3A 4DIFA 2YMPA 4S1PA 3TQOA 4CF3A 2QRUA 1LPBB 2IFTA 2QG6A 2VQ3A 3L7KA 2GFHA 3NJ4A 1X38A 1Y7TA 4TXJA 2RGYA 1EGVB 2CVPA 3E03A 3NIDB 5DSTA 5BSMA 2AFVA 1Y8RA 3X2EA 1H4SA 1PF7E 4KBYA 4ISCA 1TJ4A 1EVQA 3P2IA 3O8QB 4AJHA 2OCAA 2ZRLA 1K4MA 1LPMA 3RYCB 3V8BA 2Z6AA 2O8CA 2EBFX 2F3UA 2WSBA 3DWIA 3NYWA 2BTQB 1I2BA 3AZQA 4GI3A 3W8RA 1U0BB 3FI0A 1JUDA 1A8QA 4PSUA 3I4CA 1FXUA 4HG2A 3WIBA 3UK1A 3N28A 1Z16A 4QVKA 3UNXA 4LCJA 1TKAA 1TZKA 1R5OA 2V7BA 1WXGA 2A0YA 1PKEA 2QT0A 4G9EA 4RK0A 3WDKA 5CHYA 2HGZA 3WGLA 3OZVA 5GADl 1HTWA 1SXJE 2X22A 4YP6A 4LGMA 1AJEA 2NAFA 2DSTA 3UIEA 4YT8A 4DZTA 5DVZA 4LXTA 4WJKB 2WUWE 4GBGA 5FPPA 3F5FA 5DHUA 5EJGA 3CKYA 4QBFA 2ZSHA 1X1CA 2JAWA 2XZLA 3K6SB 4TSFA 4WWHA 4CKEA 2YHBA 1T24A 1V5GA 1YJQA 1JHAA 2P67A 4E4RA 5I3CA 1FYWA 4IDNA 3CR8A 1SURA 4LZWA 2H2GA 2PU5A 4IVRA 4RZXA 1T0IA 2HZBA 3HBNA 4IWYA 2WJGA 4BMPB 4XEHA 2OV6A 2ERYA 2YV2A 4IQ8A 4ZVNA 2PKEA 4INPA 4REOA 1BEUB 2F9LA 2FVYA 4OA5A 3GRYA 4RPCA 4UUMA 5HG0A 4IGKA 4LGCA 1X94A 4GMHA 5K0JA 4MHSA 5JZMA 3MVEA 3ADPA 3E7PA 4EUKA 1A7UA 1ECJA 1LH0A 3JQ8A 3BXEA 3LIIA 2PNFA 3O4HA 1OTYA 3F8SA 4GQAA 1YR2A 4IDCA 5HDQA 4DHEA 5ADUS 4MRRA 2M6LA 4FUQA 2YKGA 4AC9A 2B4TO 3LKDA 5LCXA 1T5DX 2Y1XA 4IXMA 4N5MA 2WIFA 4AWBA 4CM8B 3OPYB 3RU2A 4QQNA 4NK5A 1PN3A 3EG9A 3VR2D 4DPKA 1IEWA 4GG1A 1NVAA 3QXXA 3NHBA 3UBMA 1XRPA 3ASYA 3AY0A 3L02A 4AZ0B 4FINA 2JLSA 2ZBDA 4NS1A 2UXBB 1M1ZA 4OI4A 3D3EA 3QVGA 5JCPA 1JLHA 1VPTA 221PA 3H2HA 4GH5A 4O0LA 1XVIA 2GEFA 4MYDA 3M4JA 4WXEA 2ZB3A 4RL4A 3LD9A 1JKMA 1NDQA 1FS4A 1NBHA 2F43B 4OHMA 2BMDA 2P9FA 3HZZA 3KD3A 4IZIA 4MB2A 2XB8A 3T95A 4G63A 1MW8X 2XUHA 2FMHA 2WHEA 4Z4HA 4MVXA 4UM9D 1LPPA 4XTRA 3ER9A 3G85A 4OL9A 4RV9A 4OJKA 1X1TA 1TTPB 4FNAA 2GCNA 2HTEA 3CWCA 1ZUHA 3H84A 4MJXA 4DLVA 2AT1A 3GOHA 4TWBA 4EMTA 2C3MA 4LJ6A 5J1SB 3LHKA 3RFVA 3QWBA 1DAKA 5DHSA 2QMZA 4N4AA 2YVKA 4XIGS 1QG2A 4DA9A 3GLQA 1OASA 1OPXA 1Q1AA 4R4JA 2I76A 1QHHB 2K2QB 2X0IA 1XRQA 1G5QA 1XVTA 4ARCA 1JFTA 1O95D 1WHSB 3VO1A 4WOJA 2LIPA 3BILA 2A4MA 1PT5A 1CJTC 1M76A 4QATA 3MTDA 4KVFA 4LYJA 4UJ3A 1BWRA 1QHFA 2DTXA 3NEJA 3T52A 4MQBA 2AEEA 2KPOA 3EISA 4BNIA 1CUFA 1KEWA 3W1EA 5DWQA 4D9MA 3N2KA 3WWPA 1H2BA 2WG2A 4MUAA 4DLAA 4CKWB 4DA6A 5C7IO 2CDNA 1D04A 2WSMA 3MINB 1J56A 2C2MA 1PR1A 4GKJB 2D3WA 4DIEA 5HSGA 2RJ3A 4JCOA 1XZDA 4MGKR 4CIWA 4BGEA 3LRPA 2AMYA 1M7BA 4HMQA 4J29A 3A1DA 4ZDKA 4U3JA 1T9GS 2HA4A 4JBIA 5LYJB 1XQXA 1Q0ZA 2BGNA 2J48A 1SIOA 3R5KA 5CVTA 4ZYXA 2YN0A 3HA2A 1GTG1 3A1TA 2ICAA 3B53X 3MS7A 2VTBB 4MQ6A 4RJJA 1XAIA 2ISCA 3FPBA 4D5EA 3AKCA 4OB8A 3VR3D 3UMYA 4L73A 4M83A 4HBZA 1XQWA 3IYLW 1COWA 2GRAA 4C0WA 3GQVA 3ZCTA 1W73A 1E0JA 1RD4A 2B34A 2X6RA 3PFBA 5FADA 1HT3A 4AVYA 1U1EA 2WAMA 3K4HA 4FW9A 3KYCB 4M8IA 3I05A 1GP2A 4TTAA 4BRWA 2EHDA 2RI0A 4E5UA 2AWNA 1ZUWA 4EWLA 2R86A 5EPOA 3PHCA 4TPKA 4BWVA 2DVMA 1VLJA 3F97A 2JS7A 1U5CA 1CRPA 2VJKA 5K8UA 4YV2A 4D5GA 4QDTA 1YRBA 1N75A 5DYIA 3GCDA 1X7YB 3FCCA 2DFLA 4C6SA 4HMPA 4MDYA 1P29A 4XGIA 4UU1A 2O5EA 1SHUX 3Q6IA 5FQNA 4OK5A 2AEMA 4DREA 3HHEA 1IOZA 3FB1A 4HAIA 1BXZA 1Q19A 1J8VA 2NVWA 3T7RA 4EW6A 4DR3B 3GFFA 2YXBA 4O3FA 3LECA 1C1DB 2RGNC 3D5QA 4Z9YA 1U7DA 2WYIA 4EQ6B 1T2EA 2AFIA 2AZTA 2ZBUA 3EVNA 5BY2A 2Q9BA 2RHGB 4QXAA 4UZFA 3MTIA 1POWA 2JG3A 3A2KA 1EZ4A 3LCMA 4IIJF 4K6KA 4AB1A 3TZEA 1WNTA 4RD0A 1D09A 3Q10A 4TXHA 3WOVA 3KSBC 2IH4A 4J49A 1JEQA 3MMXA 4K9SA 3U1BA 1R0BA 4YI3A 1SN7A 5CBKA 1AXGA 2UUOA 4LKRA 3L0DA 5E95A 5K3CA 4DXDA 3RVMA 4S05A 1BXRB 1ECBA 3PB3A 4G84A 4MINA 1L5QA 2A1UA 2XNDD 3RAFC 2A5JA 4EY6A 4HTFA 1CUXA 2YOGA 4YR7A 1NN1A 3ISVA 4RY8A 2DXIA 1SHLA 2R6ZA 3R0JA 2ZKIA 3UWOA 4MS4A 1EJBA 3GGPA 1UBMS 5AK3A 5DK6A 5FR1A 2BF7A 4Z5XA 4L4YA 4I3HA 1K7YA 5I7UA 2IU4A 1PKXA 2PA3A 3D2AA 3F3YA 2CLIB 4OKSA 3CISA 1NI3A 2G28A 3Q3JB 1LGYA 4AUKA 4CHGA 2N46A 3F49S 1C9DB 4CVNA 1VP3A 1IBSA 1QYDA 3HI6A 4W5JA 3H1TA 3ZNNA 3K2EA 4J0DA 2YZGA 4AO8A 3KSRA 4BLRA 4EHHA 4M0MA 5DXFA 4FTWA 2VBCA 2FQQA 3OA2A 1IULA 4MR9B 3SBXA 3RS2A 3DGEC 1VL5A 3BOSA 4HQKA 4KXNA 2VJAA 4N5DA 4WFJA 3MJTA 3SXUA 3FUTA 1UOOA 3C8UA 4A27A 3PHLA 1M1NB 2GESA 3KT3A 3I6BA 1CXZA 1IZ8A 1YE3A 3HZOA 4N5HX 5AVOA 1E3MA 1OLXB 1TCUA 2J7KA 2D0IA 4RHFA 3EXG2 4C7BA 1F1BA 4MW0A 3VR6A 2BKEA 3HC7A 2AYYA 3O31A 1EBFA 1IHPA 2G1JA 3I5AA 3NVAA 3Q1LA 5IARA 2XDQB 4RL6A 3ZY5A 1E32A 1Z68A 3BXXA 4B82A 3I2IA 4R1SA 1WDWB 4GLBA 1BROA 3KKMA 4LMRA 1FTYA 4J2HA 2FUNB 4ND1A 5T4EA 1BHSA 1JEEA 2B9EA 1FX0A 1WCWA 1V2HE 4ND5A 1Z0KA 4EHKA 3M6WA 4CMJA 4CQLB 5EIBC 4D6YA 4B34A 2ZTSA 2QR2A 3IDOA 3KE9A 1BA2A 5HRCA 1SFRA 5DEOA 4DJ5X 4F60A 1IRXA 3B8HA 3KQMA 2KSQA 1Z17A 1JQ3A 3D0RA 3IJPA 1AHIA 1QAMA 3KOWA 5CYOA 1IBKB 3ET4A 1KE2A 1JDBC 2OGSA 3SYKA 3QV1A 2JFXA 4FWBA 3VR4H 2WNHA 3NHWA 2QNBA 4W6ZA 5L3SA 1PNTA 4DWOA 4D46A 1Y3FE 1UXHA 1L8QA 1ULBA 3ETDA 3EZFA 3KZNA 3QYFA 1RP7A 5HRAA 4OLAA 2MSNA 2G9VA 3LW8A 4YRSA 1OU4A 3IJRA 3NUQA 4KMOA 4LYEA 3T15A 3GBVA 1L7OA 1LBQA 1YULA 3BMOB 3HLKA 4L4SA 4W7IA 3W3AD 4B4OA 2ZROA 3HVHA 4PAOA 2ZBGA 1C0EA 2BCEA 1V1MB 1Z7GA 2GLXA 3MD9A 3ORHA 4EVRA 1KVRA 1L5HB 1J1UA 2HAEA 3ZGOA 4ENQA 2CXXA 2X6QA 4B5LA 2I3DA 4HV4A 5I4KA 4DADA 4X90A 4K9NA 1E69A 3FIJA 1F5SA 1Y33E 5TC4A 1QDLB 1BC5A 2QQ5A 3TPZA 3CZCA 1EFVB 4FHZA 1FP4B 4E46A 1XEXA 5TE9A 2O9JA 1RYDA 2XGGA 3UMCA 4JT8A 3PNKA 4D9IA 4X1YA 4QVIA 3OQNA 2ACEA 2SCUB 4KMRA 1EPUA 3KG2A 4EG4A 5F9HA 1MAUA 1QTNA 2I7DA 5AXBA 1QZ3A 3S8MA 4HDRA 6AT1A 3UXEA 3E3MA 5F3RA 3VDQA 2MIIA 2EW1A 3NVMB 3E27A 1MQ8B 4F2HA 1JA9A 3ASVA 3TRHA 1UQUA 1JHVA 1NA5A 1AKMA 2WSIA 3FRIA 3L06A 2JVKA 1WWKA 1BE0A 3E8XA 2LTAA 3HJFA 3I8SA 3K09A 4KPGA 3A4LA 2BR4A 1ETHA 2Q27A 4FSXA 1WUTA 2Z9BA 1RHKA 3O3NB 5LZ5A 4KK4A 2IEGA 4H9GA 1J2UA 3Q41A 2OO7A 5AH0A 4JIMA 2O59A 3I9FA 1T0UA 3FGOA 2PNJA 2ZRFA 3EXIB 3BG5A 3KXDA 3ORYA 3PGKA 4QARA 3ST7A 2WYHA 2P2LA 4F4FA 1DOAA 2F3QA 1JIJA 2VSYA 3WJ7A 4BPBA 1K92A 4UDXX 2W2NA 3PQDA 3WNDA 4F71A 4Y2JA 1BJTA 1ZK4A 4IMPA 4B9AA 2WD7B 2DWQA 5HBRA 2PKYX 4OVKA 4FMPA 3HL4A 5K51A 5DJ5A 3W77A 2CHUA 3RTGA 5KTKA 2I9KA 3AESB 2BHTA 3F47A 3PRHA 3CR7A 4N49A 5TPZA 5LNK6 4B8WA 1VYUA 1UBLS 3VU1A 3G2JA 4F38A 1W581 5A3QA 1CUJA 3RSQA 2H1LA 3WQRA 1ZH4A 6PFKA 4DCUA 3NKFA 5E0KB 2WPNA 3TSCA 5K6TA 5LDDC 3RQSA 1XMQB 2FMUA 2DX7A 5E6RA 1ISJA 2UXCB 2E49A 4CCAA 4D3DA 2OENG 4EFDA 1XRSB 3KR0A 1CE8A 1U9IC 3AEQB 3IV7A 4I6JA 4KQMA 4TSRA 3TAHA 4ALJA 2Z4TA 3K73O 4DV7B 4B1FA 2PMEA 2IZ1A 1JX6A 4Y1RA 2PKQO 2GPAA 4AY3A 5G4KA 1NW7A 3IBFA 4ZI7F 2QUIA 1CUZA 4HFMA 1SU7A 1NQTA 4ZPJA 1G8HA 1E7WA 4E13A 4X3PA 5EKXA 2W71A 5JNLA 4WBNA 2R44A 4BOYA 3MWDB 1YT5A 4R8RA 5BQ3A 1K9SA 1Q1ZA 4GR4A 2MMGA 3LUGA 4RQTA 3MEQA 2DFKB 4LV8B 3WXMA 5JVDA 1RVV1 4E7OA 1MD9A 5L4SA 4ZXPA 1UXGA 1N0HA 3SOPA 5ICCA 3K1TA 1T2UA 1BHJA 4F3CA 4XM1A 2XADA 3PX7A 3T99A 4LOHA 2XNJA 3MILA 3IP3A 5AI9A 3H1AA 3TFWA 5TQ2B 3EIUA 3LH5A 3PI7A 4RXMA 2PRJA 4NG4A 4F4UA 4F84A 2UUBB 1OCEA 4E30A 3FDXA 4EVIA 2ODQA 2UZ1B 3YASA 3AL2A 1PYOA 5TVGA 3TQTA 2QJFA 4QREA 4MROA 1JZQA 4IDGA 4KQCA 1M2NA 1RBZA 4R8VA 2CDCA 1N9GB 4RHEA 3COWA 3MJFA 5A4MS 1U2SA 4FHCA 4A4DA 3NIFB 4DMFA 2NU6B 1F9EA 3HGMA 1SU4A 4JMLA 3ZVNA 4H31A 1X1BA 3B3JA 4IOMA 4WNIA 3A4IA 3WGTA 1T4DA 3BMQB 2XITA 3VPXA 3H86A 4QUHA 3WQQA 2KBFA 3OF3A 4QPNA 4RLFA 4LDQA 5DBGA 5B64A 5JQGA 1S0UA 2AKEA 3D7KA 1WEHA 2I3BA 2I7TA 4ONEA 5FUMA 1RZRD 2VDVE 1N2BA 1H6DA 2OO5C 4RDXA 1Q5PA 3NHZA 4OCZA 4RWZA 4QEKA 4RFSA 1SVIA 2PQ6A 2GF0A 3L6BA 3MJ4A 4KAJA 2E37A 5JCXA 3OP1A 1QK3A 4UU0A 3BEDA 4XWTA 2JGFA 3M34A 3DZIA 4N0PA 5HPYB 2O6HA 1USKA 4KVGA 2QWXA 4BAUA 3O75A 3Q8MA 1PJ2A 3V1NA 1R3UA 3HP7A 5TQ0A 4EMBA 1SVKA 1Z4LA 2GK4A 2RHHA 5ES3A 2YIDA 3E9ZA 1PZXA 4BCCA 2HREA 3UC5A 2Q0HA 4V1CA 2VRNA 4BBPA 4ZI3A 3OF5A 4LBZA 1CU1A 2IHBA 4YUXA 3ELBA 2YN4A 2F4VB 2NZYA 5DHRA 4XWKA 2G82A 2ZR8A 4PNHA 3U3XA 1D4FA 3ZE0B 1QVWA 2DB3A 1T6NA 1INLA 5HQ3A 5F5NA 3HKDB 4RY2A 3JQQA 1RFGE 3TZCA 3N0TA 5ITSA 2JIRA 4JLVA 2B92A 4DWWA 4OFXA 4O3MA 1BOOA 5A7GA 1WG8A 1G7CA 1DEXA 4IKPA 2DQYA 2IP1A 1XNHA 3QGMA 1W93A 2ZRNA 5IHXA 4KX5A 1B8UA 3LUDA 4NHOA 4EJ0A 4HNUA 4AI6A 5GONA 1QNFA 3JD4A 4M1KA 1U65A 1CR1A 1L5WA 1I7PA 2R6CA 2RAUA 2BN4A 1K8QA 3I9JA 4FZJA 3ZHYA 2YUIA 4X62B 3WWCA 4LXIA 2KW5A 2NLOA 3EDRA 1GCIA 5K8JB 1AF7A 2ZT6A 4XQ0A 1C8LA 3FBWA 4DVGA 4KX3A 2QROA 1G6Q1 2EG9A 2AE2A 2VSQA 3LL7A 2R5NA 3I6QA 3TRKA 2L42A 2GYUA 2QBYA 2ONCA 2XKJE 5BVGB 5DBEX 3WGKA 1ZPDA 4HDAA 3T38A 3BMNB 3A3PA 4MH0R 3ZCVA 3ZLUA 1FYDA 4K6HA 2HDWA 3BJIC 3E3AA 3OJCA 1SXHA 4U9UA 3PC2A 1PR2A 1O1YA 1K8XB 1K8ZB 3LYAA 5BORA 3P2YA 1HDRA 1TKCA 2FR1A 4PIVA 2DJ5A 4JXXA 4JQOA 5IUJC 1ZHOA 3ZU4A 3GRRA 1CNMA 4WXYB 5CB4F 4HN4B 2Z43A 4DN6A 1YL7A 4XR9A 5AK0A 3QMVA 3TINA 3ZJUA 1ZH2A 3EEYA 4PONA 1LV7A 5LKAA 2UXDB 3LX4A 1N2GA 3RVPA 2FSVC 4ZFNA 1PEKE 2XR1A 1O9GA 2ONYA 2ZREA 3AIKA 3OFND 5ER6A 1QPZA 1QHYA 1Z22A 3AETA 1EUDA 4Y67A 5AOBA 3IB3A 5T6BA 1QRUA 1TQDA 2BR5A 4OBEA 3RKRA 5KDDA 2C7QA 3C97A 5EZYA 1J6UA 2H3HA 4L6IA 2XA1A 5AR1A 3IMCA 2QTVB 3KEFA 4R2HA 1GG9A 1R4NA 3DF9A 3NC0C 4BNVA 1GM5A 3K0AB 2ZT5A 4AIRA 4BX8A 3C3WA 3QPUA 1QP0A 4H4CA 4BB0A 1IXYA 3S6JA 2AKAB 1XB2A 1ZHFA 5GJVC 4WBSA 3L4SO 4IJMA 5EXDA 1M67A 4NBUA 1R0ZA 2C0QA 1SUFA 4HDCA 4Y6OA 1UJ5A 2FWMX 3ANNA 3KJEA 3OT1A 1T36A 2FWNA 4MW1A 4A0QA 2ZT7A 4H7KA 4QUKA 2ISSD 4D0LB 3SBEA 4I55A 2JGDA 3ZWKA 1UBOS 2W8BA 4UDOA 2R1VB 3O03A 5HZKA 1ZIPA 3FPHA 3QBJA 2WB4A 3CG4A 5DHQA 2GEUA 1L8LA 4JEUA 3PKIA 1DKPA 4DM4A 2HTFA 2W7TA 3Q9LA 1L4FA 4L95C 5BW5A 3K9FC 2QVXX 2O3JA 4QDOA 1JP7A 1TJ3A 4UTRA 4LY0A 1PJAA 3VR5D 1GA6A 1FDIA 3DDZX 3QTBA 4FIZA 4RHYA 2HMSA 2BGLA 1DV2A 4AFNA 4BKRA 3GLGA 2XHEA 4A6XA 3RHTA 2AXQA 3M8KA 3IILA 3BSWA 3KALA 4GPD1 2EC5A 4NZZA 5KPJA 2YVQA 4DM7A 1NE7A 1P8AA 1Q77A 2PVPA 4AD8A 2QIOA 3GC6A 4TV9A 4UDYX 5FUYA 1REQB 2RBEA 2WFAA 3IQFA 2B2CA 1LBEA 3FYUC 5SZHB 1NOKA 2WI8A 3GT3A 4J7XA 2JIZD 1U3CA 4YIKA 4HGRA 2PT9A 4GWGA 5GV7A 4NBKA 2OFFA 2V74B 3EZYA 5BP7A 1OWOA 5BMVA 4JI6B 3ESAA 1A4IA 1L4KA 4TMVA 2AC2A 3PRKE 1UBSB 4KXUA 1DGQA 2G4VA 4X45A 5A7HA 2JJ8A 4LNUA 4LWPA 3AU8A 1IXKA 2WTBA 3I52A 4JR0A 1U6IA 2J3MA 3EMVA 4LW8A 4QODA 3EG5A 3R74A 3E2MA 1B3BA 4GSLA 3I23A 3SKXA 5H9WA 2VNHA 1PX2A 1LF5A 1V6SA 1RPTA 2YJZA 1BDJA 3E9CA 5AVWA 4KVAA 3FZGA 1VM6A 2ZXEA 1DRKA 1U99A 2XGJA 2HI0A 4PTLA 4DMLA 1RKVA 4INJA 3AB7A 1YAJA 1MOPA 3JY6A 6Q21A 4LRWA 1GPJA 1SHZA 4ZGWA 3QYPA 5CYPA 1Y8CA 2YVUA 1W9MA 2PGIA 3BRCA 1YMUA 4NL4H 1JDUA 2OYCA 3B9RA 4X66B 1JZTA 3I4LA 2IYQA 1U2ZA 2JEOA 1XTKA 2P4UA 3C0KA 1GRNA 5LU8A 1V95A 2R00A 4TL6A 1ZGJA 1PD1A 1NUQA 3FTDA 1Q7EA 1EB9A 3LZCA 821PA 4PLVA 4DCOA 2PQMA 2DQ4A 3WRWA 3IUMA 2ZYUX 3CT4A 4HX5A 1MO6A 1YWGO 4IL5A 3SZGA 3C4QA 3TIXB 4TL7A 2WKSA 4GKKB 4WESB 1RBMA 1VC2A 5JR3A 3OM9A 3KSAC 2Z6QA 2VJPA 3GROA 4RGYA 3EOBI 3TPCA 3G0CA 1UC5B 4DMCA 3JALA 4YH1A 4PXAA 1TTTA 1SUDA 3ECCA 4U7GA 1ST3A 1UKVY 3ES9A 3MYYA 4M60A 3RS5A 3R6LA 5KYXA 2TMDA 5T3UA 2B5OA 2JIBA 2P6MA 2W6OA 1E8MA 3H13A 5I4CA 4CGZA 4G0NA 1KTVA 3HP4A 5CTJA 4QYXA 4ZC8A 2P40A 4LVNA 3T1TA 3KK0A 4D80A 1V71A 3CNHA 1OC4A 1P5FA 5BSEA 4U6QA 3OBIA 4XGRA 3A6HA 4CI9A 4U2KA 2OQ2A 5CURA 4KLZA 3JW8A 1SXJB 3E7DA 2QJRA 2OHJA 2BMJA 2QE7A 3RUFA 3OT4A 4MR7A 4DJEC 4H27A 4R1NA 2IDMA 5F35A 1OXTA 3KKKA 4OB6A 3SDZA 3FVQA 1OIXA 4FCWA 3UJ8A 3UMGA 3ZI0A 3ZWVA 2X42A 4BFWA 1BGWA 2FEPA 3PVCA 2JFNA 2P3SA 1JGTA 4Y2GA 1ECLA 3DT9A 2QNRA 1PS0A 3RROA 1X3SA 2BFWA 2GFQA 2PT6A 4OJYA 4N0EA 3GJXC 2V1XA 4EOGA 3UHAA 2XKKA 1KBZA 1MQ9A 2CFCA 4MQ5A 3PC3A 2JCVA 4L9SA 3OCXA 3H5OA 4KIUA 3LO5A 1ADCA 1KU0A 1RFLA 2HUNA 2PLAA 4UAJA 1JJAA 3B1ZA 1JDVA 4V0KA 1G7SA 3PLRA 5BR1A 4EHBA 4GVPA 5CA0F 1M0TA 3ZVMA 1BRTA 5CGZA 4OA8A 3S55A 1SCIA 1OAOA 2XCOA 4TKMA 3U1VA 3O8OB 3P7MA 1C0LA 1Q3TA 3QITA 4L0MA 1KMCA 3P9RA 2QN1A 4UZSA 2IS1A 4C22A 1JIXA 5JT1A 4J94A 3N5KA 4ABYA 1E2QA 5LOVB 1ML4A 5BMOA 1WRBA 4R2JA 3OZSA 5CGQB 2Z5LA 5L4LA 1DO8A 4E07A 2VDNB 2XGSA 5AJYA 1H6CA 1SCQA 1XTIA 1P44A 4R05A 2QN3A 4S24A 3HWWA 1GSHA 3AB8A 3PCTA 4B3DA 1ULUA 1J4AA 3C6KA 1R0LA 1JSRA 2ZK7A 1Z82A 2WSYB 4HLCA 3WLJA 3BJEA 3T7CA 2IBSA 3LQQA 4MUIA 1Q20A 2YC2C 4ALIA 1JSZA 1GUYA 1I3KA 1ORRA 1PSWA 1W5SA 2XA2A 4ND7A 4JL8A 3ZE2B 4ARSA 2AFRA 1ZD8A 4JT9A 3WG9A 4CM7A 4V1CI 5AOAA 4K6MA 1R8YA 2VDWA 2IIPA 3VKFA 1WP9A 2N3ZA 4KFUA 4MGHA 4D9JA 2YWGA 4RK5A 4TWRA 4ZVUA 2R25B 4YAOA 2AR7A 2F9FA 4NNPA 2ADFA 1Z6YA 1N7GA 2P2CA 3CX8A 3VUFA 2O7NA 1SG0A 4CKBB 3GVPA 4O4IF 4WA8A 5AUNB 5ES4B 3TQFA 1K66A 2GPSA 3NBKA 2KBEA 4DUGA 2P62A 4D1YA 5BQFA 2R2GA 3STHA 1YHYA 5IWCA 2ZAMA 3MOGA 1U04A 2QZSA 4G3XA 2O5VA 2O7VA 3WBKA 2Y1WA 1VHTA 1Z83A 1Y1KE 3I01A 2EBUA 3IOMA 5FTNA 1DXQA 5JPDA 3RV3A 4N7RA 2JIPA 4MYHA 1G8YA 3WTCA 2Q8QA 2ASEA 1O5TA 1GZ7A 4I9GA 4OHFA 5HKKA 3H65A 4QM7A 3LUCA 1TMOA 4LJKA 4BFYA 3KZMA 1D9ZA 3IE2A 1NNLA 3FZQA 4LJLA 5AJVB 3PQ4A 3PQ3A 1KMIY 2BFAA 1RHUA 1UMCB 2D1FA 2H16A 2PWPA 3C8MA 5JSKA 3L4EA 5TS3A 2OLEA 2X5OA 1IWOA 3D6FA 3KSZO 3KQOA 4DLPA 4DR4B 1GG2A 3ROMA 3HNPA 4RIFA 1PT7A 2V9ZA 3G7SA 1B7GO 1VJGA 4Z9BA 4NZMA 2GYWA 4Q9LA 4GT1A 2E1RA 3QY0A 4FM9A 1MB9A 1U3TA 4M6WB 4BE9A 4TYYA 3DDWA 2PXCA 1ZUNA 3OC6A 4NU6A 5DYYA 4DG8A 3SX4A 5ILQA 1FU7A 2B3DA 2P2YA 4QFMA 5FOSA 3VTAA 4DNOA 5IZCC 3N8KA 1J8QA 5DB4A 2GHTA 3TOVA 3X0DA 3AFNA 2NUPB 1ZAYA 4PC7A 4MPDA 5BOSA 3Q6MA 3I9NA 4ER3A 3RBAA 4C2TA 4U4AA 4K28A 4DCNA 3LMKA 5JIBA 3C5WP 2H2HA 2JLBA 4TKVB 2P9QA 3R23A 2AJTA 5EE3A 4EG5A 4UOEA 3E7FA 3DOFA 1R0CA 2PUEA 4I4CA 2DUUA 1LLDA 5A4JA 2ODWA 3JRXA 1SUCA 1G5PA 1WZCA 2X4DA 4J0CA 1DEOA 1XZFA 2RGBA 3ZS8A 5I9NA 4UNPA 2B8NA 2CBZA 4RC9A 5CH3A 4FFDA 3WFJA 4GX0A 5H70A 4LJ9A 1ZZGA 4MYCA 2DPXA 3G8DA 4MV8A 3AF4A 1FTGA 3HUUA 4LSMA 2BEUA 1Q3HA 3VPBA 3AM5A 3SC6A 2GB4A 1AHPA 4G37A 3L8GA 3NPAA 4EHDA 3PFCA 5CFNA 4HDKA 4MDFA 4MRSA 3UXMA 1NU8A 4CHTA 1V1JA 1D2RA 4NZPA 1JQ5A 1Y1LA 2D1YA 4LK2A 2A9OA 3U62A 3TFOA 2VHWA 3OF2A 4WCFC 1KY5A 1U2RA 2ASVA 1DRJA 1E4EB 1D8TA 1RMTA 1YK0A 3KHUA 3LY5A 1H2HA 1NMSA 3RTEA 4DV5B 3B1YA 5G0WA 3WIOA 1O0CA 2H17A 5DHFA 5A6SB 3AFOA 3DLHA 1II9A 5ALRA 3FYCA 3O1JC 4HUQA 3FTCA 1AKEA 4E5YA 1Q2XA 5F7ZA 2X7XA 3V4SA 1RS0A 1WSAA 1R8QA 3HJNA 3NORA 2I6FA 3DUWA 3QH4A 3NTRA 3VM6A 1I3CA 5KOHA 4DOMA 4BQPA 4IDPA 3K2QA 2NOAA 2BDUA 3PD0A 2MSCB 1Y6QA 2GN4A 2I67A 1TYZA 2XOKA 1XZBA 2JAXA 4JYMA 2FDCA 1ULSA 2MMCA 1DLIA 1KYQA 4PG7A 3TR5A 3FF4A 5JADA 3IBTA 1J8MF 1O8BA 5HK8A 3D3KA 3ND5A 1AE1A 1W4CA 1YHZA 2MYPA 4IEIA 4IR7A 2BYTA 3SM3A 4BYGA 1NVBA 1SC6A 5U4QA 2UV8A 4FC6A 4Y0NA 1P7WA 1COZA 3JASA 1HKHA 2CGEA 3GCGA 2K2WA 4RCVA 4YMGA 2R66A 4FFLA 3RABA 5LDHA 3TUZC 2AX4A 5AVQA 4OUDA 1Z3CA 2WIJA 3QQPA 2REBA 3R3YA 5LVAA 5HM8A 4LWOA 4LF8B 3KR1A 3CRVA 4B5KA 2Q1UA 2V6FA 2JGEA 1AGNA 3D4IA 3ND6A 1NVDA 2REQB 2PS9A 4B4KA 4OQYA 2HMTA 5C8ZA 4NU0A 4YRBA 4PWZA 3T35A 1ZH0A 2AN1A 4E5MA 8ATCA 5A71A 2NXJA 5HQTA 1J2RA 3RYIB 5JYDA 5HZMA 1DBRA 1MEOA 2IS2A 3KWMA 1TK3A 5JATA 3K94A 1QGUB 2QD5A 3HN7A 4IDDA 2HWWA 4A0HA 1HYQA 2P9JA 1WB5A 1P2BA 2G08A 2G71A 4OHRA 2GXAA 1LDEA 1TT5A 4E2FA 1Z73A 1NUSA 4JJZA 4DV6B 3AHIA 3UO8B 4Y6SA 2P1RA 1VI5A 3HXLA 5AJHA 2CV2A 4Q7EA 4WFIA 5G3YA 4ZVQA 4M89A 5ECYA 4TZ6A 2GEBA 3BGIA 5EY5B 5EQFA 1EINA 1P0QA 4B7XA 4RTMA 1FS6A 4KE8A 5EVCA 3VZQA 1POXA 2AG1A 3MWFA 2Z1NA 4RD2A 5I9BA 4DVJA 1NC3A 1Z4NA 2JFYA 2M1ZA 1W36B 3P9QA 3U3ZA 2X15A 5I9IA 2BLNA 3DAYA 3PUWA 3DPIA 1ZM3A 1N2CE 2MYUA 3R2JA 3SZMA 4JI4B 3L49A 1AU9A 1FE8A 1PNVA 1IATA 1G9XA 1TIBA 2O06A 3QE0A 4TL9A 3TS1A 3X2SA 3QNMA 1DWUA 2W6ID 1RYMA 4US0R 2G5TA 1UXIA 2J6IA 1CUBA 4U7JA 1OF1A 2F90A 3ZQKA 4Q7QA 3BRWA 2Z95A 1LU9A 1Y7IA 3K32A 2PRZA 2CLDX 3CXRA 2X40A 5LA6B 4DSZA 2BSQA 1CUIA 3F2IA 4NCIA 3ELWA 3GOQA 4W5OA 5D6OA 2CMHA 1BO6A 3MNFA 1AZLA 3H1BA 1DBPA 4D9BA 5CYGA 3PI6A 4Q48A 4ETNA 1KRXA 3HACA 1RZVA 4JUBA 1W0JA 1QFSA 3FNRA 4S04A 1P1FA 1PLKA 2R4QA 3GEDA 4G1CA 4ZCRA 1C81A 2Q3FA 4HH1A 5PGMA 1OZAA 1BGVA 1WKCA 3SEAA 3DAGA 5HA5A 2CXOA 4KQHA 2GPJA 2Q21A 1EK6A 2Y27A 4OMDA 4V02A 3KT6A 1QGZA 4BZPA 1E3WB 2J9FA 3ET5A 1MVOA 4RLQA 4XSVA 5AXAA 4HQ0A 3ZUGA 5KSYA 2VAXA 4MS1B 2RHLA 3I76A 4PYLA 3RS0A 1UC4B 1ADFA 1AKQA 2QG4A 3N05A 3OM1A 4PQYA 4W1PA 1Z6TA 3WISA 5CDGA 3QA9A 3BMCA 2JHGA 1VE6A 1B4DA 2VJCA 3BA1A 3MHTA 3KJIA 2WKQA 4G41A 5KU7A 3OWHA 2YWCA 1KY2A 4PU0A 4HGZA 3Q3VA 1ZNWA 4L5YA 3ROQA 3MBIA 1DXOA 1FYVA 3M6XA 4MLZA 4UATA 4ZCSA 4BJ1A 1P4GA 1SBQA 1T3LA 3EE6A 4JV5B 2WM2A 5K0FA 1CY2A 2ODEA 3MIZA 2NYVA 1JQBA 5GAJA 1G6OA 3TTTA 3UMJA 1P1KA 4MQMA 5BYJA 2VEDA 3FDZA 1U1IA 4NESA 3JAKB 3EVTA 1Q0TA 1T6ZA 1Y8ZA 3VO2A 2B1RA 3JYQA 2RGNA 2YINC 3LW7A 3NUGA 1TW2A 2LKCA 2P30A 5EN4A 3THSA 3F7MA 1T3SA 1EE9A 3KR2A 4NX2A 4DJDC 1DCTA 1XTPA 4PIMA 2PTHA 4QHSA 2FXIA 3R7WB 1ZU5A 4M7PA 5TMPA 1J8DA 1JI0A 5JXJA 3PVSA 2JHFA 2QX7A 1U80A 1XYVA 1Y5IA 4RVGA 5JE8A 1TZBA 1S1CA 1DJQA 3CFYA 5LR6A 4B6OA 3K35A 2FEOA 2GZ1A 3BZBA 3FHOA 1VBFA 3O94A 5ERYA 5GZ6A 4JJEA 3WQBA 5AVTA 4YVFA 1U8FO 3BAFA 2Y0PA 3D1LA 1A8SA 1YDFA 5KHOC 3CJRA 2OV4A 1WXWA 4RD3A 1QC5B 1V47A 4II2A 4CMEC 5JFGA 4B3JA 2AN4A 3I62A 4EJFA 1H85A 3DOHA 1QGAA 2HA2A 5AKEA 5FWXA 3OU6A 4BO1A 2CSXA 1CJSA 3G9ZA 5HCUA 4LZJA 5KAMA 4HYQA 1K7SN 4M0LA 3WX0A 2DMRA 2V7VA 3CZPA 4CKCB 1QP7A 2A6PA 4HX9A 2G70A 3EIHA 5FNVA 1RXYA 3EIOA 3IP9A 1AC5A 1DAEA 3V8VA 4GWLA 1XRMA 3ASZA 3W8DA 4BCBA 4D0RA 1KTIA 2Y2VA 2ZAGA 3BIWA 5G40A 2E5WA 5F12A 2ZPAA 4C0KA 2WOJA 1LFDB 5JO0A 2WVGA 5DLPA 4B6GA 4ETMA 1GZHB 5EZ5A 2PUFA 1QLJA 3KXKA 3A6FA 3DHWC 3JD3A 5BSTA 5P21A 5FBVB 2Q1TA 1U31A 2BFBB 4JQYA 4D9HA 2VHQA 2B3TA 5U4XA 1I7NA 3PPVA 2Q6IA 4UHHA 4EJ2A 1QGYA 2JJ2D 2I4NA 2J9GA 1Z45A 4EHFA 3IVXA 3F98A 3QVUA 2ESRA 6LDHA 1R0RE 1EWRA 1N5LA 3NJ8A 4Y2RA 2DLDA 3UKJA 1OFVA 1NVXQ 1Z8FA 4HWSA 1AUQA 4QHTA 3P9NA 1T43A 1I1QB 3H42B 4BP1A 2JLXA 4KR3A 3AL0C 4E1BA 1RM0A 3WVNA 1VLZA 5CPFA 421PA 3THOA 3D6HA 4PANA 2AHRA 1CYDA 1IVYA 1W5FA 4S0ZA 2XW6A 3M9XA 4RBNA 1GPKA 1JYSA 1KP9A 3KB1A 2VZ0A 1LQUA 1FRZA 3B3AA 3L7NA 4GPTA 1QO0A 2Z2JA 4PLPA 1ODIA 3KOXA 3HCBA 1NT4A 1XAHA 2OMKA 1E62A 1CTQA 3A8TA 4Q4HA 5H59A 4JOCA 4B83A 1HEYA 5JAMA 2H65A 3D7RA 3QELB 4K9DA 1WQ1R 3LPAA 4WY8A 3D3WA 2NN3C 1WR8A 4Q9DA 4DCPA 4CT5A 4XB2A 2EFGA 2NO6A 3FMPB 2B30A 1QZXA 4HJXA 1ECGA 5KAPA 3VOAA 1C29B 1EK5A 4MEBA 4YQFA 1N2OA 3I6YA 4WZBE 4YAGA 2I66A 3SIWA 1UM8A 2Y1OA 1T91A 1UMKA 3IUYA 1WP4A 2C9YA 3Q3HA 1IN4A 1A50B 1PU2A 3ANSA 3T0FA 3OQMA 1FIUA 1N1DA 2I4TA 1C3VA 1PUIA 2C57A 1YJBA 5E6SA 4AG6A 3KTAB 3V48A 3LQKA 4ON9A 5HM6A 5FI1B 1ZQ9A 4C2UA 1OAKA 4R98A 1JEYA 2Z5VA 2YHSA 2NVUB 1UF9A 2ECKA 3KVOA 3OEWA 1YQUA 4D3ZA 4ZREA 2CCJA 4CCYB 3F6EX 4IH4A 5TQVA 4G0OA 2JLZA 2RHRA 1BYIA 1Y8RB 4LKOA 4BO0A 2VDMB 4XIIA 1FDTA 5FOUA 1CS0A 1TM3E 3C3PA 1MT3A 3CEPB 3VHLB 3IODA 5BVHA 1SZCA 4NYJR 3HWRA 3U17A 1WA5A 1PZMA 3SHOA 3EAQA 2C7PA 2PMWB 1QGDA 2OC9A 1RAGA 2ZSUA 4IRXA 4XX0A 1GQOA 5CIWA 1PUXA 4QICA 3SFZA 2DFPA 1R15A 4C89A 2ACKA 2VDOB 5ARCA 4CL3A 4EY5A 3LQ2A 3DE2X 4BO4A 2VAVA 1QIEA 3EQ8A 3SS8A 1PJBA 3PL5A 3PD1A 3U7QA 4LC1A 3QF4A 2XYRA 4MV1A 3L40A 1Z5GA 3KIPA 4PQGA 2H7YA 4DLBA 4NATA 2C88A 1NURA 3D9QX 1LDNA 5HUHA 3ROZA 3OESA 3M5PA 3Q40A 4EI9A 4N8SA 2CD7A 1RAFA 1WUJS 3IAHA 4QPJC 1YB5A 2D2VA 1KYVA 2ZZNA 4TTQA 5IT5A 1BVYF 2VDJA 2IH5A 5BSKA 3EIFA 3QENA 5LZ4A 3GEEA 3H4TA 1CEQA 2IZ0A 1IQPA 3NAZA 3LCCA 4TLLB 2QRVB 3MFQA 4IJKA 3VJMA 4B8YA 1N2XA 2R1TA 2XZDA 1B6TA 1N8NA 5CNMA 4DEXA 1FVOA 3PPYA 3CO5A 5AHOA 1Z7WA 5H16A 4EH1A 3CVUA 4AY5A 3V33A 1RRFA 2WV9A 4I81A 5JFTA 4AULA 3AHHA 3RAGA 4MCJA 2OZKA 4I2VA 3TKAA 4U1RA 1XDBA 3P0FA 5JSYA 3LKZA 1I4LD 4BNFA 1IWPB 4XVUA 2O20A 1B00A 5CLGA 4ZAVA 3DOOA 1RPNA 5EHXA 5LBTA 5CX4A 5DNUA 2YHIB 3GW8A 1KYIA 2PAFA 4PWYA 4MV3A 5ILGA 2PUGA 1J2EA 2VT2A 121PA 4JFAA 1K5HA 5JALA 4GR5A 1D1PA 2QAGC 3EX7C 4PW0A 4BFXA 4YRIA 8ADHA 1RXUA 1TVEA 3K6RA 3SM9A 2F67A 3CB2A 5CR9A 1LXCA 3P9XA 5SYAA 4XJVA 1X7WB 4YT4A 1CEXA 4K46A 1YQEA 1J8YF 1P4HA 3EZXA 3LBNA 1KQNA 5DNYB 1NOIA 1G6KA 3HCRA 1ZRNA 5DYTA 4MPTA 2VAMA 1F1JA 2VYND 3KB8A 3OOSA 3PSAA 1P6QA 4HB0A 1T1SA 1ZITA 2DCUA 3WLOA 4AMGA 4DNPA 5G0SA 3NIBA 3KV3O 4ZALA 1DEAA 4TS3A 2QDXA 3WLQA 4G0WA 1K3UB 3QVGB 3I3SR 3DHEA 1UT6A 1FSZA 3V1LA 4F5DA 4RSGA 2BFPA 4TMTA 4A2CA 1XRJA 3DEFA 4BO3A 1GGKA 3LGSA 4LDJA 1II0A 2ZEJA 1JMKC 3L18A 4FMDF 1VMIA 4CLOA 4UNNA 5P8WA 3G8CA 4BU1A 1JG6A 1Z33A 3T9FA 5HUQA 1CUAA 3EZNA 1H3EA 2Q3EA 4ZVLA 1JG4A 3HYNA 3PFWO 2X0KA 4CI0B 4Q4JB 1KY3A 1Y89A 1T0JB 3GJQA 4G56A 4MO9A 5I8PA 1ZH6A 1AQ6A 1IN8A 4EEZA 2HQSA 1ORDA 2XEXA 1UBKS 4L3VA 4KR2A 3GDFA 5KZMB 2YUTA 2YVLA 2FW6A 5I48A 1ZMTA 1ZJJA 3FYDA 4B4VA 4ARVA 4CM3A 2QMHA 2JKZA 3O4GA 5I4IA 1HXHA 1W76A 2F55A 1LPAB 3PXXA 3EWIA 7ADHA 2GZMA 2ZUBA 1FQJA 1WX1A 3SX2A 3BD7A 4Z3KA 1M1YE 3VR0A 3DEAA 3NTUA 4WN9B 4L15A 3VAZA 3VOTA 1O96B 1N25A 1YZHA 2IHJA 3LT2A 4HH0A 1T2FA 3IKTA 1I2MA 5JUWA 2PWAA 1L4UA 2CJFA 1CEYA 1MX1A 4EO4A 1QLHA 2C94A 3DBOB 4B73A 2JASA 4F21A 1ZR4A 2ZIAA 4DANA 4BTEA 3BDIA 4UTPA 1XZ8A 1W8DA 2H5EA 2MINB 4H1WA 1LX7A 2EL9A 2WPDD 3EQZA 3LWDA 2R65A 3LK6A 1T9DA 3EGDB 3O74A 3RVOA 1YL5A 3NBAA 4YXWA 2P8JA 3GD7A 3S2UA 3FWKA 1K7EB 5JH7A 3RUHA 2C5FA 3SYTA 1IZ7A 3EGXB 2Y1DA 1CQIB 3AVQA 1CUWA 2OO5A 3NHUA 3K9NA 1HETA 2ZQZA 5LQNA 2ZUDA 4TSFD 2FP3A 3DV0B 2XTNA 4PLWA 4EPTA 4X64B 1E0DA 3GLTA 1AQLA 2H5LA 3L46A 1PGOA 2IZ6A 2Q5OA 4A6DA 1HG1A 4J1SA 1I4DD 3FH0A 3PNMA 4IQGA 4U3JB 4BNHA 3IDQA 3WGYA 5TV2A 3JQBC 4WV3A 3AR4A 4PZEA 2JLWA 3WTBA 4ZQFA 3R3XA 1AGRA 3NM4A 5IDWA 1L7QA 4YP7A 2P9TA 1MBZA 1Z36A 1J5PA 2XVZA 5A2QA 1KEUA 5JEEA 2P11A 1OWNA 4X6LA 4DIMA 4FI3C 2YS7A 1G3QA 4X60A 1Y8QA 4XIJA 4ZDWA 5IYZB 1JKXA 3O26A 3PDHA 3WDMA 5KTTA 1Z4QA 4KMMA 2F8SA 2CF6A 4R8MA 5HE8A 4RLSA 1XK7A 4A8JC 1YKFA 3KYDB 3ER8A 1RI5A 1KEKA 1TZ2A 4O8ZA 3CCFA 2P79A 5J2UF 4IHJF 2NSDA 2IYUA 3LC0A 5IAEA 5DNVA 5CDUA 2G9QA 4O2BB 2BM0A 2XDYA 3NKLA 1MX3A 2DBRA 2HCBA 1VHLA 3SIRA 4ZVVA 1HZJA 1FX1A 3DTVA 4BMCA 5AO9A 2P9BA 3VGJA 4W4TA 1F38A 3W1WA 1D4ZA 3TCXB 2EHJA 3BWCA 2FRVA 2FCAA 1Z2CA 5GQSA 4DMUB 4J90A 4BGDA 4MMYB 1E9AA 4G85A 2WQ7A 1Q6ZA 1NJ6A 3OZWA 1ZFNA 3B13B 1TE2A 3DMNA 3OZIA 4J0QA 4K6GA 4J2OA 3Q8XB 3QLEA 2XWQA 5IJWA 4FU0A 5LQDA 2H5IA 2V9CA 3TNJA 4GWKA 4ENWA 4HT3B 3U7FB 3O2NA 4NJEA 4PINA 2BHLA 3JQGB 1CQXA 3L3BA 4I50B 3ENZA 5FXMA 1OKKA 4DE5A 3RGWS 1TU3A 1UFQA 1H69A 2J3DA 3LKVA 5H4HA 1Q0PA 1Y7HA 1PZFA 3FJOA 2D5AA 2AOTB 2DRIA 5LMZA 3EQ2A 4CMKA 3L4KA 3CTMA 1F4LA 3PC8C 4YCDA 1RI3A 1P3DA 1OFGA 1M72A 2WC1A 3LWZA 5AI5A 5D7BA 2GHQA 1YA6A 3W78A 4HDOB 4WQMA 3FUXA 3OQJA 4G5HA 2FETA 1ZG3A 5ENZA 1CCWA 2M6RA 1Q95A 4MS4B 3EEOA 1YZFA 5L3ZA 1ZD1A 4BEJA 5CDFE 5DO9A 4YY3B 1M2GA 3H3JA 4NBSA 3DDCA 2FSVA 2VS1A 1V96A 3PUIA 3CX3A 5SICE 1EFTA 3NP9A 2ZVDA 4YC7A 1WKVA 2Q6LA 5FEMA 5H80A 1SUEA 5HFAA 1RQLA 4N54A 4G0MA 4Q3LA 2C8JA 1M6YA 2P6PA 3TCKA 5EFOA 2FW1A 3ILYA 4HQLA 4M49A 3WFZA 5LWHA 3P26A 1YRAA 3MGKA 4QBTA 2PYDA 3VV2A 3DKVA 3WKEA 1T10A 4EHAA 5I7SA 3X1YA 1PGQA 1Z74A 1CUYA 1SD5A 1ZGAA 1AV6A 5IT4A 2OORC 1KHTA 1UL1X 1YQQA 3D5TA 1GUFA 3QF7A 4WXRA 4A6PA 4LIPD 1LPSA 5EQDA 1TCBA 1ESEA 3OJFA 3OZDA 3OQIA 4CE6A 1KWGA 1UWCA 2N47A 3HJAA 4YJGB 4AO6A 1GILA 1U3DA 1NW5A 3HE3A 1M6VB 5TDHA 4PCLA 1COWD 1DI0A 3JYOA 5DBOA 2PU7A 4N41A 2NV0A 1LBTA 1PT9A 4WGFA 4IY1A 1QCYA 2OUKA 4BYMA 5KNDA 3HV2A 3ZZMA 4TLBA 2QM0A 1PGJA 2FFBA 1ODCA 1PS8A 2DGDA 3DVAA 4PAWA 1I1NA 5AVZA 4MUHA 3SEFA 1CETA 5TMEA 2DFVA 2R6HA 1YDWA 1NOJA 2O4UX 4UVGA 2JCBA 2JBAB 3P9ZA 2HQBA 4OPMA 2PGJA 1ZH8A 2Z56A 4IFTA 5CLIA 5TX7A 4DQDA 2FG5A 4F06A 2VNAA 3UMSA 3FSJX 2PZMA 3MT8A 2ZJ7A 4RK7A 3PYXA 1SQSA 2Z83A 1EFAA 4V0RA 3DUFA 1GHTA 2HCTA 4XVRA 5JCZA 1VSVA 3FYUA 3THYA 1GV0A 3C48A 4RMNA 4W7HA 4EYSA 3E8SA 4EPWA 4LJ4A 2WMOB 4KQ1A 1I0ZA 4M7RA 2HQOA 4OHOA 4I1SA 4YDRA 3SBOA 2XWPA 3NXKA 2Y1EA 3ZWBA 3OZBA 4RX1A 4FEYA 5TRTA 2PBLA 3UT5A 1LSJA 4R54A 1U0GA 3E9MA 1GTVA 1CJUC 4QPPA 2PKXA 4XDYA 3D4BA 1PEYA 1XKQA 2M6SA 2OV1A 5IM4A 1ENZA 4R16A 1Q7GA 3W6ZA 2RH5A 1S7CA 3L7IA 4E4YA 3R6GA 3U5TA 1YF3A 3F1LA 1XKLA 2NUTA 4XYMA 4DC0A 1CJCA 1IH8A 4KR6A 9MHTA 2CB9A 1D2HA 3T7TA 3LJKA 2CLMB 2QQEA 4JDPA 1XEXB 4G5FA 1IXSB 5IAAA 4G1EB 1R6DA 2OCKA 3K0BA 4DLUA 4WLFA 3ZK8A 2ZSBA 3PHGA 1DXYA 1OW3B 2E87A 3OLYA 4LHEA 4PZ9A 1PIWA 3T7EA 4CIVA 1F0YA 2P2NA 3H6KA 3PA6A 4HDRB 5FA6A 1G4UR 4GVLA 4REMA 4A8TA 3S2YA 1WBDA 4R84A 3UJHA 3WGIA 1SKBA 4RLHA 4AJJA 2AOVA 2QF7A 1C0KA 5MGNA 1CP3A 2PXXA 1KPHA 2JFFA 3GL9A 3JARA 4LZZA 1NZDA 4KYTA 5C8XA 3KSUA 3OLZA 3TSZA 4D4IA 4KQGA 2Z4RA 4D8XA 1CRLA 2UYGA 5C8YA 2BFOA 1RHJA 5D86A 1EQUA 4H3SA 1ZICA 4TQ9A 3FMOB 2YMMA 1CD5A 2XVYA 4OHZA 3ILSA 4P3OA 2R5WA 4JXKA 2B94A 1IUNA 3AHEA 1NRWA 3HN2A 3VBCA 4TYWA 1CIVA 3A3OA 5IEJA 2V4ZA 3TR0A 3CKMA 3TL2A 1E5XA 1AK1A 4KRYA 4CF4A 3VR6D 1A9QA 3JRWA 4ID9A 2PVSA 4P4GA 5F7JA 3AGQA 2N42A 5HTKA 2BE7A 4CWAA 4BS9A 2HQRA 5JARA 3KQSA 1UBEA 1VL6A 2RI6A 1NP6A 4RA6B 2FV8A 2O2HA 5LP6C 3THRA 3UCEA 4D0NA 1XELA 1TAUA 2ABWA 4KTVE 1RQ2A 5A5FA 4WKOA 4P84A 1TDJA 2Z8ZA 3AERA 5CA1B 1GPH1 1NLFA 1BFUA 2LZ0A 3MGGA 4J0FA 4PR0A 4BBJA 3AHCA 2P5YA 3TLMA 2X4GA 4QPDA 4EHNA 3WLHA 2YMQA 3E1GA 2IDJA 1A4RA 1FXWF 1ZVJA 4NBNA 3HH8A 2CVHA 1QZUA 1T5OA 3WMRA 1FA9A 3L7AA 4P08A 4ZANA 4UHKA 4JYZA 1F2TB 2A5FA 2I80A 2OFXA 3ZVKA 4H15A 4HPJB 1RYEA 3H5LA 1C7QA 1ZW1A 3JAMA 2IWRA 2V8OA 3QFSA 5KTNA 2Y05A 3WP1B 3NMUF 5E9JA 5KCMA 4UHCA 2HA0A 4MICA 1Z4IA 2QV0A 3OMXA 4DQ0A 3HYTA 3NWBA 1PP4A 3PF9A 3R3WA 1U0JA 1IY2A 5EJMA 5JVDB 4PGAA 3FVWA 5EWMB 4PYMA 4RJLA 3DKKA 1SOUA 2C5LA 4I5EA 1RT9A 1KSJA 2EZTA 4Q9KA 2C9DA 2W6QA 4ZHQA 5JNRA 5JJBA 1G3RA 1KXZA 1XCBA 4RPGA 1R6BX 1GGVA 3AQIA 1U98A 2HO5A 4HHEA 4WNAB 2JGRA 3TW8B 1BZYA 1DDGA 3IKLA 1SCNE 1UDXA 1JE0A 1S1MA 1LBIA 4LWQA 1PR9A 4LJ8A 5EEGA 3TVYA 4EEXA 5A1TA 1BKSB 4Y9UA 3KP1A 1RQXA 3ZKWB 1MO3A 4F8EA 2X9QA 3QJGA 3N75A 1V4VA 4Y3UA 1U63A 3H97A 4CT0A 1VYHA 1U7WA 1IWBB 3C3KA 3HEAA 2HK7A 4OXXA 4UNSA 2QYOA 5C7OO 8ABPA 1WV1A 1B8PA 4ABTA 3HY6A 2DBVO 3B85A 3WNZA 2VWPA 2ENUA 3TNFA 4BMVA 1NVVR 4YQEA 3U3MA 2QPTA 3A3NA 2GSDA 4M9SA 1D0SA 1PHPA 4R1MA 4WZZA 3N5CA 4BO6A 2WJPA 2GAIA 4KKXB 1WS6A 4JT2A 3TSOA 3GMTA 2C4NA 2H0AA 2MSWA 2VYVA 4G23A 1M2EA 3OOJA 4O25A 4YRAA 2V5VA 1J24A 1BSVA 4NJOA 3GR6A 3V1KA 1YKSA 4NZNA 1Z8NA 1WKBA 1G3MA 4FFRA 1RYYA 3CE6A 3R44A 4QOIA 5EJ6A 1ZD9A 3ZZTA 3SF0A 3EWSA 1P4AA 2VHZA 3HJCA 1JI3A 3B60A 1A27A 3SJ7A 3SKYA 5F9MA 4E21A 1MH1A 1JEDA 5J2TF 3NHMA 5CNIA 2XRMA 1RMYA 4BMXA 3IBYA 5ALVA 3H3XA 1U28C 1EVKA 1GL7A 3JYPA 1QV9A 2GTIA 2YC4C 2I6SA 3QLJA 1QYIA 5ISMA 1O0BA 2X1LA 3LUPA 3RJ5A 1RM5A 3BPSA 2W2XA 1N2CB 2A9KA 3HU5A 4UC0A 3ZHZA 5TPZD 1DEKA 1IBCA 3VYRB 1SRRA 1K3FA 2V4UA 2VUIB 1WV0A 2H00A 3QI2A 1OH7A 5I9MA 1R66A 1W59A 1X9IA 2VSNA 5DDIP 1OVMA 2QSUA 2ON6A 3ZR4B 4LTMA 1C4WA 3ISTA 5A9RA 3I09A 1NF3A 3EHDA 4BFSA 4YP0A 5KQRA 1DMRA 4EITA 4GEKA 2OZVA 1RWMA 2YNMC 4IO1A 1P7PA 2D1SA 4FQ7A 1EDZA 1Y80A 1GRCA 2H1RA 2KE5A 4GU5A 4PYKA 5B36A 4L08A 5EG5A 5DNWA 4AX8A 3WQHA 5JAUA 5KKNB 1ICIA 1EQAA 1M7HA 1NMXA 4XPIA 3R1IA 4FYHA 1Z6ZA 1R0SA 4RFVA 4ZICA 1I01A 1XDUA 4FFMA 1FSGA 2CEAA 3F4KA 2B20A 1YVEI 2YXLA 1FDOA 2Y67A 4MTLA 3T7IA 5IZCA 5GONB 3E5MA 1VIDA 1WQ3A 4ZZ2A 3ZE9A 1GNVA 5D1HA 5B7PA 1LLCA 3ZDQA 2Q6KA 3W4JA 2F6RA 3NM5A 4Z8XA 2ZR9A 3REQA 1E7MA 5DI3A 1JU9A 1E61A 1IL0A 2X19A 4JMPA 4ND6A 1T5LA 7AT1A 2ADOA 4XQCA 5KYKA 2QVGA 4QASA 3Q2KA 4MVYA 4B32A 1V8DA 4II3A 5JJKA 1IPFA 3WDLA 1GZDA 4CM1A 1V35A 3QNWA 1XVUA 2QZ4A 4BQNA 1Y1TA 1ODFA 4O4HB 3WMFA 5KNCA 3MOIA 4D2IA 4ZQIA 2IH2A 3IXQA 1ZOPA 2ZP1A 2QRKA 4OXKA 2BIFA 3HJUA 3KE8A 3GX1A 2AQ8A 4FT2A 3WGUA 4YRNA 5L3QB 3MB5A 3VX4A 3N0WA 1QVAA 2GT1A 1DG1G 1R6VA 3EY4A 3HJRA 4H7FA 2A30A 4L7VA 4JKOA 2A57A 2JZCA 5JW6A 1PJ3A 1RJ9B 3IERA 1PWHA 3DLTA 1HDOA 1SOWA 1YASA 3PYMA 4WCFA 5IVIA 1VCOA 3JPYA 4L5JA 2WIBA 3MG9A 4W6QA 5CK4A 4WI1A 3BGDA 4D3XA 5TPWB 4DJFC 5JWHA 2ODNA 2O3TA 3GGJA 5GZ3A 3ROEA 2EJBA 3USZA 3N2NA 4QYMA 3PTZA 2CZCA 4ND8B 4AECA 2Y8EA 3KELA 4TT3A 1EUDB 3M9LA 5BQPA 5TF0A 5L4NA 3OZGA 4RF4A 5KTRA 5DGDA 1QH9A 1TUBA 2FQYA 4PYOA 4B3BA 5EXEA 4R2XA 2ID8A 3E0XA 4P38A 4Q01A 4NNOA 3RHZA 4BQFA 2HWKA 2IUUA 1QORA 1E2FA 2WJJA 1P2FA 3UHFA 4AYWA 3PXBA 5F4BA 5BN5B 3QSYA 1W9HA 4IBOA 2B1GA 4QG3A 1SIBE 1K8RA 3CBQA 3K8QA 4AIIA 1PHRA 2XQVA 1G9TA 1UK8A 2A35A 1N9ZA 2WOOA 4KXYA 5KPDA 2O8BA 3NETA 4L8YA 3O4RA 2O0KA 1EJ6A 3RS9A 3N58A 1V9LA 5KX5B 1QX3A 2G7ZA 2VYCA 3QE4A 4AJEA 4I55B 1KP3A 1T3HA 2EWWA 3KKLA 5DYGA 5EVJA 5JHHB 5KJ1A 1BVHA 1NGSA 1Z4OA 3UUEA 1DFHA 1E66A 3FWNA 4YPFA 3ZX5A 4BC0A 4YMUA 5AW2A 3PV0A 4OO3A 4JVMA 4UAVA 2XZOA 3R9XA 1KZ6A 2QD2A 4X1OA 1Z47A 2DWOA 3P2KA 4W9RA 4PSKA 1KKLA 5MGBA 2JLVA 1I4EB 4YFVA 4Q6WA 3QHAA 2V7XA 4R9VA 4KH1A 3DNFA 3P19A 2H29A 1JMYA 2X86A 3I37X 4L8FA 4M0FA 4UZEA 5ALGA 2BMFA 3TNLA 3ICQB 3A6LA 3LAWA 4LECA 3WP0A 5FD8A 4HI0E 3CLTC 4M36A 1E79A 1USGA 1JIVA 2CLOB 1RXIA 3C85A 4FMCF 3ZU2A 4IIFA 3H2ZA 5IJ0A 2Y1GA 2DH6A 2IHTA 4IWNA 1P4JA 3NWJA 4XYBA 2LWIA 1US8A 3S28A 4BDTA 3AUFA 4FZRA 3IVAA 4YT5A 3BXPA 1X7GA 4LSZA 4MR8A 1E4YA 1ENOA 4H1TA 3Q7SA 1O03A 2E3JA 4AY6A 4LNUB 4BNJA 1XTJA 4C7JA 2F00A 2I7XA 3GELA 4KDEA 3EAFA 3P9KA 5F33A 3F5DA 3W5CA 5JV5A 2VP4A 4GUAA 1KNQA 3BSFA 4HTAA 1OPRA 1Z75A 4RPHA 3JYNA 3E4DA 3F6BX 3OJOA 4MSUA 4ENRA 1HKUA 3PFFA 3AEKB 4Q7MB 4JUCA 5EA2A 1E5VA 3SBDA 1M83A 3U4HA 3V4OA 3FDIA 4WZBB 5FUQA 2OK7A 4MP8A 1UP4A 1GGMA 5HXAA 2AMLA 2OXFA 4IIDA 1J20A 3KKEA 1NJFA 1Y1SA 1DQSA 1PS9A 1C30B 1K6JA 3IP8A 2IV7A 2WAXA 3TE6A 2YW2A 5A0TA 1M2JA 4PS1A 4A73A 2L18A 2QTLA 4DQUA 5ADVA 3PEEA 2O8DA 3SF8A 5IVHA 3TD6A 3ZXYA 4PYRA 3AFIA 4JVLA 4IEEA 4X54A 4XLTA 3SAJA 3SSMA 1HURA 2ZRHA 1FMCA 4QG7A 3IIJA 3WHPA 4Z4GA 2F3RA 2YYSA 3CBGA 1HNZB 2Q99A 5EUQB 1MGPA 1PDVA 1ORVA 3E22B 3ZI7A 1T29A 5BRAA 6CHYA 1A9ZA 1B41A 1DBIA 2XT9A 1RABA 2AEJA 4Q7LA 1EXVA 4L72A 2XCRB 3TLYA 1WXDA 5JPIA 2JA1A 2Q62A 4IWXA 1SUSA 4JGIA 4JITA 4CUJA 5BNZA 2WWVD 2GM9A 3H1PA 3IP5A 1OFTA 4B3FX 1YI0A 2OECA 3T8YA 2DKNA 2KM1A 1JDZA 4BP8A 4F3KA 3GRZA 4IZHA 2ZJ8A 2CNKA 3COVA 3IIEA 1AKVA 4BUJA 4KQ9A 1IUPA 4MWBA 1JHYA 5IXJA 3QPWA 4TT8A 4Z4FA 2BE9A 2EDAA 3CH7A 4M54A 1HE5A 1UXOA 2Y2UA 4JSYA 1NYTA 1QO7A 3BE5A 1LV8A 5E6UA 1BH6A 1XNQB 3B5JA 3IAS1 3O73A 1CUHA 1NIJA 1WZNA 4BNZA 4BP3A 5LZ2A 3Q15C 4I9HA 1BU8A 3KB6A 1W85A 3ADCA 2MT9A 4GRIA 1E1QA 2GI4A 2WWIA 3HO8A 3Q5DA 2C83A 4X71A 3IKMB 4IMIB 4BV9A 2ZQ5A 3W2IA 4RJKA 4UAUA 1MB2A 2AS0A 1T0PA 1ISHA 3EC1A 3HSSA 3DVSX 3DZJA 3FYSA 2CDAA 2WHPA 1YRYE 3V4RA 4Z8YA 2IBTA 1LPOA 3LNCA 1UKCA 3TFQA 4AT1A 2G0AA 1EFUA 4G4SO 1PQYA 4ERNA 5B5SA 1JEJA 4U2DA 2YWBA 5JD6A 2H7VA 2IIQA 4Q9IA 3DBHA 1TAGA 2YIMA 3TOZA 4G6ZA 2PUWA 1E7RA 3A37A 4M76B 4IX1A 4QU0A 1GGJA 4CMEA 2CN1A 2IY7A 4HL6A 2OB1A 2EVWX 1OV4A 4DC9A 5A03A 1DJLA 4Y2XA 4QBGB 4F9FA 2XJ4A 4A7PA 2ZJBA 3USES 1NX6A 3DEJA 2JGLA 1EHIA 2Z04A 4J0GA 5ICEA 3W5AA 3C5VA 1JWAB 1KPIA 1FL9A 1IDN1 1NBEA 3CVJA 1Z0AA 4KO1S 4M98A 4PYQA 4RIEA 4Q1EA 4UU7A 1DIOB 5IAGA 3ZGVA 4OQ4A 3RCBA 1PNOA 3IS3A 3K0EA 3HXMA 1LBSA 3R0XA 2ZI4A 4JC8A 1WBJB 5ANRB 4YLEA 3ZDDA 1ZO8A 2RJOA 2B4RO 4DLZA 4ZRDA 5B3JC 2V3CC 1G5IA 4P0QB 4PRLA 2FN3A 4AZ3A 1E63A 3PQ7A 3GZTB 2FPIB 2V65A 1CVLA 4ITUA 5AK5A 3T3OA 4YRGA 2VT6A 2I2AA 1KPGA 3A36A 1U7ZA 4OGWA 1CP2A 3RVSA 3WZLA 4GOKA 1JVNA 1TZMA 2HPAA 3DE4X 4MKXA 3CKKA 5AJWA 2JPDA 1JIKA 1PWZA 3GF4A 2VDWB 4N3AA 4UULA 1JA1A 3UMFA 1RWPA 2IYSA 1EGMB 4HAWA 4IV8A 1M8GA 5A1JA 2HPVA 3NS7A 3QVMA 4P0TA 1U9YA 2FQWA 4GE3A 4PCVA 2RKOA 5J58A 2H18A 3TLGB 1YFZA 3MM4A 3NOVA 4K81B 4X8HA 3TLZA 3D64A 4KJZA 4LY6A 1HWYA 1M1YB 3BD8A 1QH8A 3KZVA 3MMSA 3MTBA 1A69A 1RXCA 2YV1A 1T4GA 3PIIA 4P33A 1J42A 2HF2A 2FN4A 5KYYA 3SQMA 5AUPB 1X7ZB 2YIJA 4ZRNA 3SNHA 3TNYA 3UQYS 4ZZ0A 2QMOA 5LB4A 4F5WA 5K8LA 5FUVA 1NSTA 4KJXA 1LEHA 5FPTA 3H9JA 5A6VA 5LFAA 5CVCA 4FDMA 2D5IA 1MQSA 2QE7D 3M4XA 3A14A 4N7MA 1ZM2A 2E85A 4WAUA 2PIAA 5ALFA 3ZD8A 2X41A 1A96A 1VKJA 3GPCA 4C6HA 5CP8A 4RUKA 7MDHA 2A59A 4NZOA 2AK2A 4S1TA 1B6SA 1SBZA 2BMAA 1XU9A 2JFOA 4U7WA 4UM5A 1GPBA 1UWVA 1ES9A 2CWWA 3M5DA 4LOJA 3LCJA 3SVTA 3AIIA 4G65A 2H4HA 2A3RA 5TMBA 4EKDA 1BMDA 2QN6A 2Q46A 1E8DA 2BP7B 4QU5A 2GCPA 1V5IA 3E81A 3PEVA 1QH1A 4FOTA 5IG2A 1CS4C 4X3CA 1LQ2A 4TMZA 2GVDC 2GAOA 1RXVA 4LRQA 2WNIA 2PL9A 3PWTA 1PD0A 4YJHA 4MKHA 4O0MA 1NI4B 5CRIA 3TF5A 4URZR 2B1JA 2VWHA 5FIUA 1UKEA 3F1KA 3DCNA 4ZOLB 4ZU6X 1NBIA 4XAQA 3G68A 4ZKEA 5AW9A 2GEKA 4Y2TA 5DCWA 4WNCA 4BIMA 1FYFA 3DQQA 3IIMA 1L5GB 1U5BA 1CZHA 3BKWA 2SKEA 1A4XA 4I8IA 4PC2A 4GYWA 4E1AA 4PE5B 4F6RA 1NATA 2GN6A 5EJAA 4MQEB 3IMFA 3W06A 1BDHA 4TYMA 5CM2Z 3IO3A 1GL3A 1W94A 2XHZA 1TKBA 4PHFA 1KI4A 4KXWA 4NYJQ 3OUUA 3TYXA 4ASUA 3GJ4A 4O4JB 3U0BA 2B7BA 1QFZA 4E70A 1SC9A 3CPSA 4LCBA 2ALJA 2Z9DA 1PFUA 3WB1A 3IHKA 1G8JA 1U7OA 1XU7A 2J3LA 4ZCQA 1EVEA 2G83A 1C5KA 1J99A 4AKIA 1PWXA 4O63O 1KHHA 4QO7A 1MB3A 2BEUB 1Z5NA 1P1HA 4JNCA 4GF5A 3E61A 3INNA 1UAAA 3HVJA 2NZVG 1N5KA 3ANLA 3EFOB 2IJGX 4TLDA 4DV1B 4PXYA 1CQPA 3MC1A 4L6AA 4LWZA 3KXIA 1KS9A 4N9WA 1SWWA 1NSFA 1U8AA 1BEZA 4JX9A 3SN6A 1SVNA 1A9XB 2ZWMA 1QIIA 3R3HA 5CCEA 4EO7A 1JLLB 1KI8A 3TD2A 2C77A 5B7GA 3IJEB 1BXGA 3FBGA 3TLEA 2QA5A 3AUYA 3DXFA 2Q2QA 2G09A 2PGNA 1L8AA 2HU5A 4JJAA 1JF8A 2WWHA 1NVWQ 3O7MA 2IYEA 3P20A 4HUQB 4MQFA 1DX6A 1M6WA 4QFDA 1AMUA 1LB1B 1SAYA 2YYZA 3PXDA 5CFRA 5KS2A 1NC1A 1I7LA 4MIOA 1E0AA 3U3JA 4BZZA 2EP8A 2WICA 2IVZA 4J0EA 4D9FA 4XDGA 4DUGD 1KQGA 1NVKA 2OM2A 1FFSA 1P1IA 1OH8A 5D00A 3NATA 3G6WA 5JAPA 2O05A 2C58A 1PRYA 3EC7A 2QAGA 3ND7A 3RYHA 3LUFA 4NH4A 3A9VA 4PLTA 1JFFA 3WLRA 1K4YA 1JQLB 2FPKA 3EUAA 1NQVA 1V8ZA 1OIVA 3DZDA 3KR9A 4HJRA 2AF3C 4Q00A 1N5RA 1IY8A 4I2NA 3JWGA 4HH3C 1Z8HA 2FPLA 2C7RA 4C87A 3LX8A 4WZAE 3W79A 3LLCA 2P0EA 3GCWA 1J00A 4YREA 2QI9C 4IZOA 3WHIA 1W0KA 3ANXA 4IIYA 4D02A 4OHYA 3P52A 3RLFA 1G59A 4NMMA 1D2MA 2QY6A 3VC1A 2BGIA 1CUEA 2ZB2A 4UOQA 2IKQA 3SEQA 1ZLYA 2ZIVB 2B83A 1RWXA 4KVZA 4R2KA 4J1TC 1KORA 1BWPA 3OCWA 4PQEA 4ZU1X 3I73A 5ALSA 3TD9A 4D57A 4FVTA 4H7EA 2FEAA 2W2KB 4HGYA 4N0DA 4Q47A 1PUJA 4I4TA 2IITA 4TL8A 4UJ5A 2FN7A 3ZJYA 4BQEA 2QMQA 2A33A 2QS9A 3L6CA 3O90A 2BY4A 4CQMA 3R0QA 3A2NA 5ALIA 1DJPA 2A0FA 1DAFA 4P9NA 3NWEA 3WK9A 1IEQA 1YOVA 4V0LA 2IEZA 2LNDA 3BWMA 2PDAA 2AK3A 3KHTA 4N40A 1MOSA 4TKUA 3BA6A 3RKSA 3T1NA 4F6CA 1NNEA 2OAGA 3T9BA 2CUZA 4OIMA 2MOKA 1T9HA 4WBNF 2QPOA 2J0UB 2QGFA 2BKUA 2PE5A 3TR6A 4WRRA 2WUGA 1TB4A 4AJPA 4URFA 5JVDF 2V3VA 2HFJA