4RDIA

Crystal structure of e. coli trna n6-threonylcarbamoyladenosine dehydratase, tcda
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
266
structure length
246
Chain Sequence
SVVISDAWRQRFGGTARLYGEKALQLFADAHICVVGIGGVGSWAAEALARTGIGAITLIDMDDVCVTNTNRQIHALRDNVGLAKAEVMAERIRQINPECRVTVVDDFVTPDNVAQYMSVGYSYVIDAIDSVRPKAALIAYCRRNKIPLVTTGGAGGQIDPTQIQVTDLAKTIQDPLAAKLRERLKSDFGVVKNSKGKLGVDCVFSTEALVYPQSSGFGAATMVTATFGFVAVSHALKKMMAKAARQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Escherichia coli TcdA (Also Known As CsdL) Reveals a Novel Topology and Provides Insight into the tRNA Binding Surface Required for N(6)-Threonylcarbamoyladenosine Dehydratase Activity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords tRNA threonylcarbamoyladenosine dehydratase
total genus 73
structure length 246
sequence length 266
chains with identical sequence B, C, D
ec nomenclature ec 6.1.-.-:
pdb deposition date 2014-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4rdiA00
4DIOA 4Z0PA 1P1HA 3F9IA 1OC2A 4MVJP 5JDIA 2P2SA 5BQFA 1MP0A 1WP4A 4JXKA 1JDJA 3IDSA 1R37A 5COBA 3UW3A 3TPCA 1N9GA 1GV1A 2C7VA 3WGTA 1SEVA 4PVDA 4J0FA 4AL4A 3WDSA 2P9EA 1ZFNA 1YGYA 1FDTA 4BKQA 4PZCA 1KBZA 5T57A 1B3RA 3GGOA 1GDHA 1BVUA 3JQGB 1TI7A 4K26A 1YQGA 4WNIA 5T8KC 4D45A 4JLWA 4M55A 3DL2A 3H4VA 3JQ8B 5CDTA 4E13A 3DOOA 2NU8A 4XRRA 1WPQA 2JD1A 1YBVA 3KLMX 1IHYA 5CP8A 1U3UA 5JLAA 4CL3A 5J23A 3UN1A 1SCUA 3W4JA 3IUSA 1MX3A 4FN4A 5AXDA 4Z3KA 4IDAA 3VPFA 4DA9A 3WJAA 1QR6A 2DPHA 2R00C 2I99A 5JY6A 4MVJD 1BMDA 2YV3A 1UJMA 4GLLA 3RC1A 1NVMB 2RBEA 4TSKA 5HBRA 4MO2A 4DQVA 5K0ZA 3WLEA 5KJ6A 4PRKA 4RDHA 4WCFB 3DZHA 4R51A 3WXBA 5KVVA 4BO5A 1Q0HA 3WQRA 5CDUA 2Y1FA 2GO1A 3R0IA 4L4XA 1XR3A 3GMDA 1O94A 3HJAA 3JQGA 5GZ1A 4CMCA 3N58A 4G2NA 4U0JA 2RIRA 4A10A 2YHUA 3WYCA 4LCJA 1ZZEA 3ZWPA 5DP2A 1AXEA 4BKRA 5CEFA 1FMCA 4UUPA 5KNLA 2AQ8A 4MVJE 4ZGWA 2WD7A 1HE5A 4ZQEA 4HADA 1JLLA 3S1LA 3RFVA 4YR9A 2BHLA 2JD2A 3ZNPA 1DEHA 1AHHA 2C20A 1GCUA 3O4RA 3HN2A 4GX2A 1YL5A 1XCBA 4U6SA 4W9NC 2DTDA 5AXAA 1C0LA 3LVFO 1D8AA 3F5SA 1NQOA 5EQDA 2W98A 4MOWA 3AUAA 3QJ5A 1G0NA 3RJ9A 1BXZA 2J6IA 3C1OA 2GYYA 3BA1A 4AJ4A 5KJCA 4NNJA 1T2FA 1L7DA 3GPIA 1JU9A 1ZXLA 3DZGA 4G65A 3WTBA 2WYWA 4P4NA 3WMXA 1NWCA 3DTYA 5DCYA 1R4NA 3ZNNA 1O0SA 1C0IA 2EJWA 4UAGA 1AE1A 3OA0A 4HUJA 3UKOA 4O63O 4CV1A 4CJXA 2GZ1A 1NYTA 3G17A 4FIZA 5ADHA 3ETGA 3AK4A 1I10A 1MC4A 1U8XX 3ZWOA 1U3WA 1PSDA 3PP8A 1K6IA 4IUYA 4FPXA 3U9LA 2C5EA 4K6FA 5GY7A 1CDOA 5H81A 3DOCA 3RIHA 4RPGA 5C5IA 1R0LA 4CM7A 4QUKA 4WECA 1N1EA 4ND5A 2O3RA 2YV2A 4RORA 1A7KA 3KXDA 4RQUA 3E9QA 4JK3A 3KYBA 4UVHA 5A05A 3SBOA 1E1NA 1Z7BA 3FPLA 2GPTA 4O1MA 5A9SB 2RHCA 3Q3CA 4ZVVA 4OXYA 4NZ9A 1LSOA 4ALKA 4ZJUA 5JW6A 3R3JA 4J91A 4H16A 2C2YA 4DLLA 3PZBA 2NTVA 4MIEA 3IUPA 2YW9A 3W8FA 4Q3EA 8ADHA 5U4QA 3K9QO 3EW7A 2JCXA 4YT2A 3K96A 1QG6A 1BXKA 2GN6A 1ZSYA 5IFLA 3KBOA 3H5AA 1H6AA 3RUEA 3TFOA 2EG9A 4I5GA 1ZO8A 4IGEA 1NVTA 4DVJA 1WNTA 2CUKA 3FSRA 5I8WA 1UUFA 4DPMA 4MPDA 1T2DA 2UYYA 3GN2A 3JQ6A 3K2EA 1DC6A 2YQ5A 2FR0A 2C07A 1H94A 1DC5A 1HE4A 2Q1TA 5JYDA 3JQ9A 2OGUA 1VSUA 4E5KA 3UCXA 5L7TA 2Q50A 5CDGA 4CM4B 4EUFA 3C1TA 5K6AC 5I7FA 4ND4A 4CM3A 4B4VA 2C5AA 2VHXA 1A72A 1E5LA 4R3NA 1F06A 3ADPA 3OIDA 4B4WA 5T67A 5JO9A 5L4SA 2WYVA 1RPNA 2Q3EA 4XD2A 4BGEA 1DDOA 3TZCA 3DBVO 2Q45A 1ZK1A 1V3TA 5DDIP 1UR5A 5G2OA 3GH3A 3WFJA 1TA4A 1LSSA 1QMGA 2HMTA 6LDHA 1H2HA 2FPPA 4YJFB 4Q3BA 1NM5A 1ZVMA 3HSKA 3BMQA 4MKRA 4ND2A 4P8RA 4DQXA 3WNQA 1JAYA 3GQVA 4KUEA 3BTOA 4BQRA 4F3YA 1XU7A 2V6MA 3H6KA 3VH1A 1X14A 3EVTA 4GKVA 4OAQA 4CPDA 2BKAA 1ONPA 2WD8A 4DREA 2YV1A 3DDNA 2PLAA 4D46A 4BV8A 3UCFA 2G76A 5G0WA 1GZ6A 5DBFA 1YVEI 3LT2A 4TWRA 3RC2A 5CAEA 2OFPA 3PQDA 1DLJA 4D3DA 3AM3A 4HX5A 4IDBA 3JQFC 2WYUA 2BGMA 2O3SA 1VC2A 5A9RA 3OEYA 4E6PA 4XQGA 2DT5A 5T8KA 1ARZA 5I7SA 5ENVA 3JQ9C 2X0JA 4RL6A 3ZH2A 4TZKA 4MP6A 2CF6A 4IJUA 4R1NA 1KEPA 2GN8A 4E5YA 2C82A 5L9AA 1K5HA 3VPGA 2PY6A 1LQUA 1HXHA 3WLFA 2EKLA 4AJHA 4R9RA 4E0BA 4LN1A 5TLSA 2CFCA 1UZMA 4GQAA 2DBRA 2Y0CA 1JW9B 3JYLA 1E7SA 4GGOA 4RZHA 5EIOA 1QYDA 3JD1A 4XDZA 3S2GA 5G0VA 3EAGA 2J5KA 3JTMA 3HDQA 2G1UA 1JKFA 2DKNA 3ZWVA 1ZK0A 1GAEO 4R4JA 1R16A 5GMOA 2A92A 2W8ZA 1GV0A 3TL2A 1IE3A 1DC3A 3E8XA 3GDGA 3KZVA 5A5FA 4KTVE 3IKVA 4JBGA 1QLJA 3PYMA 3RUIA 2VYND 1NASA 3Q6IA 2NVUA 1AGNA 5A9TA 1DRUA 3SX2A 3UUWA 4L76A 2YHIB 3GFGA 4FOSA 4PLYA 1X1TA 2NTJA 3D1LA 3KUXA 5ICSA 1ENPA 1A4IA 4JJGA 3VVCA 4HBGA 1MUUA 3PJFA 1H93A 2ZATA 4KMSA 3JQFA 3PRJA 2P91A 2V6GA 1V8BA 1PJBA 2PZJA 4FGWA 5JXWA 4ZQFA 4NK5A 2I3GA 2Q1WA 3DAFA 3AY7A 2J5QA 4MDHA 4R3WA 5CDYA 1Y8QA 1H9BA 2VUUA 3TJRA 1NP3A 3L6DA 4WASA 2FHSA 4ZRMA 1HDRA 3TL3A 2I9PA 3U4DA 2VHWA 2VWGA 4CUKA 3EMKA 3KYCB 4P4LA 2GASA 4Y98A 1KVUA 1LXCA 2NVWA 2H1SA 2O2YA 1EK5A 1PL8A 1YOVA 4OH1A 4XX0A 2FY8A 3PHJA 3AOEC 2PFGA 5EQFA 4O5OA 4RF5A 4CV3A 4ALNA 2TMGA 3PQEA 4AJIA 5TIIA 1PS9A 2Y66A 1MB4A 4GSLA 3FNGA 5THQA 2IXBA 3MWDB 5TT0A 3LT0A 4TRMA 2BI8A 5EMHA 2OBNA 3E18A 3RCBA 3AUUA 3CMMA 5K6AA 3VZSA 4NJOA 1EVZA 1ISGA 3B1JA 3DZIA 3I9KA 5ER9A 1ONOA 1YDWA 2JHGA 5ES3A 4XYLA 3I23A 3OH8A 4DBVO 3QVSA 1YXMA 2WSBA 2EW8A 2Y99A 5B4VA 2ZTUA 1C1DA 2GSDA 2FSVA 2XXJA 2ZYAA 3FWNA 3DTTA 3EDMA 2Q49A 2J3KA 1DFIA 4IDGA 1MXHA 5ITWA 1HYGA 4R5HA 1AHIA 4AJLA 5HTOA 1L7EA 3A4VA 4BO0A 2PKRA 1ADCA 4CMEC 3I3OA 2ZJ0A 2UV8A 1GPJA 2PZKA 1PJSA 4GMGA 4DYDA 2FR8A 3DONA 3V8BA 2WMDA 3I9LA 4RDIA 4YAIA 3H3FA 3RASA 3TZKA 2DFDA 3JQCA 1LDNA 3RJ5A 1Q7GA 2G5CA 2JAHA 1KERA 3BMOB 4GSKA 4J9VA 1CEQA 2JCYA 4CLRB 1DIHA 5KKAA 3ROQA 1H5QA 3EUWA 3MJEA 1QYXA 1HETA 3NJ8A 3PHLA 3WNVA 1UXKA 4Z9XA 1ZSNA 4CLXA 4JBHA 5TS3A 4ZQGA 3NAQA 4GKBA 5I7VA 4LVUA 3W8EA 1YKFA 3GDOA 1LLCA 3CXRA 2ZB7A 2PZLA 3ABIA 1Z75A 4I5EA 3TN7A 4KQWA 4TVOA 4LMRA 4ZRNA 5HS4A 3RUFA 1JN0A 1P0CA 2O7QA 1J4AA 3ETEA 4HY3A 1T1RA 4RPHA 3PWZA 4IM7A 2Z95A 1YJ8A 2HKIA 3C7CB 1N92A 2GRAA 4G81A 3RQSA 3ZGYA 1XGKA 1JA9A 1ZIDA 2PTGA 4GH5A 4RF2A 5JCJD 3IJPA 1EVIA 5I9LA 5AQ1A 2Y1EA 5JDIC 3IL2A 3QA9A 3FCOA 3KLPX 3H9EO 4YRBA 4CLRA 2QG4A 1SZJG 3NUGA 5C7LO 3RU9A 2WTBA 3A14A 1KY5A 1V9LA 3S55A 4WGGA 3SC6A 4PG8A 5A1TA 3PIDA 5FEUA 4B8ZA 1ULUA 4AJ1A 4E4YA 1Y8RA 2QZ9A 4R01A 4XRGA 2NQTA 3D3EA 3GNSA 4N18A 1IY8A 1Z45A 4NJMA 4Y6PA 2NSDA 4QQRA 3C3XA 4BO1A 4M49A 5DP1A 4CMIB 3RU7A 3GHHA 3GAZA 1E3WA 2GUGA 1X7HA 4JNKA 4EJ6A 2NQ8A 1B0AA 3KM0A 1BDMA 4W82A 5GZ6A 4RV9A 1XYGA 1N9GB 1ISJA 3G1UA 1HDCA 1VI2A 1YJQA 2HUNA 3P2YA 3HE3A 3RBZA 3FHLA 3FR8A 3GVCA 4NHEA 4CQMB 4B8WA 3DHEA 5H83A 1B8PA 2O48X 4GVLA 3Q2IA 3I52A 3SC4A 1SO8A 3UCEA 3ZWCA 4JBIA 1ORRA 3OQ6A 3HN7A 4MIYA 3CZMA 1B8UA 2J3IA 1K89A 3C85A 4PLHA 1N1GA 5B1YA 5TX7A 5T64A 3WYEA 3TZ6A 4DL9A 2PR2A 2VZ0A 3CZRA 3R3SA 2V6FA 3DMTA 4C7JA 2O23A 5L7YA 2PD3A 4CQLB 3KETA 2YY7A 1I3KA 2OHXA 3K92A 1UAGA 2DBQA 4BO6A 2VUTA 4F6CA 3IS3A 4HFMA 1H2BA 2X22A 4GI2A 1QV7A 4YCAA 5A5EA 3AFMA 4BQPA 4YA6A 5I9NA 1H6DA 1EZ4A 1VRWA 4WLFA 1N2SA 1W0CA 4LISA 2B5WA 1NFFA 1VJTA 4RPKA 3W4IA 4E2WA 3L9WA 3MJ4A 4RCVA 4Z9YA 2D5CA 2W2LD 1KETA 3DHNA 3GEGA 5MGBA 1UXGA 4YJHA 1YQDA 4IPTA 1H6CA 1ZKMA 1VL6A 3GGPA 4Z0HO 3HB4X 4UUNA 2JFFA 2VNAA 1CYDA 2AEFA 3BHJA 3PHIA 3QWHA 5COAA 1D3AA 3U0BA 5KVSA 1T4DA 3GRPA 3ICPA 4TKLA 2VWHA 4U6QA 5G4KA 4ALLA 4J7XA 2P9CA 2ET6A 1PS0A 3CUKA 2JFGA 4I9UA 3RWBA 3ZHYA 4EGFA 4XIYA 3B20A 3MJTA 1P9LA 4ID9A 1VKOA 1YRLA 2XPCA 4FFLA 4Y9DA 5TQVA 3GT0A 4DPKA 1YDEA 4J1QA 3HUDA 1PQWA 3FR7A 4JROA 4K6CA 3VKVA 5KVCA 1ZK3A 3MTGA 4WOJA 3OA2A 3EC7A 4ND1A 4R1UA 1HSOA 3QVXA 4F6LA 4O0LA 4WEOA 4CM8B 1R4NB 4J4HA 5TT1A 4Z3DA 4FFPA 1NXQA 2PD6A 4W99A 5THKA 5TF4A 4B79A 4YJHB 1FDUA 3WFIA 4DPLA 4AJKA 1YB4A 1LLDA 4UEJA 3GVIA 3GG9A 1WXDA 3V1UA 5FFFA 3NT2A 4YEDA 1NTOA 1HRDA 1JTVA 1IB6A 2DLDA 2X0NA 2QQ5A 1M6HA 2VN8A 3JQ7B 3HADA 5DOZA 4TQGA 1ZJYA 3LC1O 1NPDA 2EHDA 1M2WA 4YB8A 1W4ZA 4JP3A 2Y1OA 3PIIA 1PGPA 4QT0A 3FTPA 4FC6A 2WJPA 3TFQA 1ML3A 1PZGA 1JAXA 1OFGA 1IULA 3QIVA 4BMSA 3Q2KA 3AUSA 1IYZA 2ILTA 5EINA 1PS8A 2R2GA 2DQ4A 4NFYA 1IL0A 1N7HA 2AG8A 2BGKA 3DQPA 4YT5A 4D3FA 4UVIA 1N8KA 4UUOA 3ZCXA 2JFHA 3LDHA 3WB9A 5LDHA 3NEPX 4H3VA 1GZ3A 2HDHA 2X9GA 1MG0A 4QO8A 1I01A 4ALIA 3ZWWA 2Q4EA 1LDBA 2TMDA 3C7AA 3AOEA 3I6IA 4NU6A 5CPBA 2J5RA 5F1OA 3S2EA 5AXBA 3TOZA 3GG2A 4EYEA 1GR0A 1QXSA 3OIFA 4XYMA 3UAGA 4BB6A 4D44A 2DUUA 3Q9UA 3VZPA 2QYTA 3WR5A 2I76A 4E30A 2E48A 1C3VA 1LLUA 3E1KA 2AQHA 3GZ4A 5HM8A 4BGUA 1UZNA 1XWFA 2F1KA 2CVOA 1WMBA 1X0XA 2O7SA 2FSSA 1Y8QB 2OL4A 2WE8A 1XIVA 2DBZA 3DFUA 1K0UA 5DCUA 4E12A 5BSHA 3WG9A 4YYZA 3ZDFA 4BNMA 4U8GA 3AU8A 1I2CA 4TVBA 3KYCA 1PGQA 1P1FA 2BFOA 1DOHA 3K8ZA 4U5QA 2WE7A 3EY4A 4EZBA 4D79A 1DLIA 2D0IA 3GY0A 4LVCA 1FK8A 2B4QA 1U5CA 2H9IA 2D5AA 1KOLA 3RBXA 1GFSA 1HZZA 3V1YA 3NTQA 3FI9A 2ZIZA 4U7WA 2ZCUA 2GR9A 1PR3A 5BR7A 5U9CA 2EP7A 4WNCA 5TRTA 1GUFA 5JE8A 3DBLB 3H65A 4WEQA 3WSVA 3P5SA 2D2IA 2HMWA 2O3UA 3QWFA 4RVFA 4PG6A 3AI3A 4BNIA 4L73A 3F4BA 3I9MA 5LCXA 1C1XB 1J49A 2PKQO 5CG1A 1A7AA 1GY8A 4IDEA 2B69A 2ZYGA 5B12A 3H9QA 2GDZA 1PX0A 3SEFA 4PVCA 1Y6JA 3PFWO 1E7QA 5KKCA 4YAJA 4FOOA 1Y5RA 3QWBA 4MP8A 1K6XA 3Q1LA 3MJVA 4IXTA 4BNUA 3TNLA 5ENDA 1P31A 4RZIA 1E3JA 2IRWA 4E2XA 2G0TA 2NNLD 2B0JA 3HQ4O 4JGBA 3D4PA 1HDXA 1E6WA 4LMPA 4R1SA 4XR9A 5A3JA 4EEZA 2EP5A 3A06A 5JAIA 3IKTA 3GDFA 4BNKA 4E5NA 3WGGA 5B4UA 1E6EA 3JD3A 4NR0A 4UVEA 3ROPA 4XA8A 3WQSB 3BMNA 5HRUA 4Z0TA 3U4CA 2H63A 2O3QA 1SC6A 4J6FA 1D1TA 2X0IA 7MDHA 2ZTLA 4II3A 2QHXA 2OP0A 3ITDA 1UDBA 3OJLA 1UDCA 4XQCA 3ONDA 4MVJA 4XWYA 5A4DA 3FRJA 4BUCA 3QSGA 1ZBQA 1ISHA 2X5JO 5FWNA 1EK6A 1QKIA 1E0DA 1MA0A 1NAHA 4I1IA 4J1SA 1P44A 2PWZA 4IXWA 1Q7BA 4YTEA 4ZA2A 1P45A 5EL0A 3H7AA 3BXXA 3M1LA 3QV1A 1T2AA 1U5AA 4OHUA 1U2GA 4PZDA 2NM0A 2HMUA 3AM5A 3RFTA 2HMSA 4BNWA 3L6EA 4I5FA 1YE3A 4FSHA 2BD0A 3RUHA 3ZWAA 2A94A 2YHIA 4IIUA 4I9HA 1R0SA 4ZD6A 4Y67A 3L07A 2VYVA 3ZW9A 1VJ1A 3SLKA 4MVJM 1X13A 3CIFA 3G0OA 1UH5A 5F5LA 4FFRA 1B7GO 4QFCA 3ZNOA 1E3SA 4HNHA 3GA0A 1Y8RB 4J2OA 4XYEA 5IDWA 4IINA 1P3DA 3LK7A 1PZHA 1T24A 1CETA 5JAQA 3JYOA 4PZEA 1I2ZA 4IDDA 1A9ZA 4CM5A 4KP7A 4BO7A 1E3WB 1D7OA 3VH3A 1MFZA 4J90A 3WQQA 1P0FA 1Y9EA 5B37A 1DFHA 1BXGA 1ZMTA 5BNFA 4UULA 1QYWA 3FBTA 3ZWBA 1KYQA 1GD1O 1SOVA 3DHYA 4ROSA 4BNJA 2CDBA 3ULKA 1OAAA 2RHRA 1WWKA 3OJEA 3ZV3A 3LZ6A 1NNUA 1U1IA 3VC7A 4WKGA 4GMFA 4ZN6A 5A06A 5KJEA 3V2GA 5FI5A 2EXXA 1I36A 3GUCA 5TJHA 2BLLA 1MV8A 1YB5A 1I30A 1ZK2A 1EVJA 1PQUA 4EDFA 3JQAB 4LSWA 4GX0A 4AJJA 1TXGA 4E3ZA 4HXYA 1EUZA 2DU8A 4RVDA 1P1IA 1JWBB 3CE6A 2PV7A 1BXGB 4RPJA 1GL3A 1YH3A 2JAPA 3EK2A 4ITUA 4E2ZA 1X0VA 2I6TA 4L4SA 2X5KO 4BO2A 4E21A 1DPGA 3DOJA 4OSPA 4EUHA 1FDSA 5B4TA 3K2BA 3KEOA 5IZCA 1BW9A 1CQJA 4K28A 4J16A 3AJRA 2FR1A 4O59O 3ICCA 3KHUA 1DRVA 3AI1A 4S3MA 4E31A 1R0KA 1MXFA 1GU7A 5G4LA 1EVYA 1NFRA 1PZEA 4ZHSA 3D4OA 4QSMA 2QRLA 4TZTA 2VUSA 4J43A 1GZ4A 4CR6A 1UXIA 3BTVA 3BMOA 4BNXA 4HKTA 3T7EA 1PWZA 3DBHB 2DPGA 3GOHA 1HDGO 2H5LA 3LF2A 3GK3A 3MOGA 3ZU4A 2RAFA 3KOUA 4M8SA 4XJTA 3OQBA 4MKXA 2X58A 4BNZA 3OQ1A 4J4TA 4X54A 2AQKA 5U1PA 3EZYA 3JQAD 1HDYA 2VYNA 1IPEA 4J1NA 4OQYA 3PLNA 3QVTA 4BL5A 2BFPA 1VM6A 3ZHBA 1RKXA 3BMCA 2EJVA 4H15A 1XLTA 3AI2A 3OF2A 4HWKA 4BNGA 5DOVA 4W9NA 3F46A 4BO3A 2GZ2A 4PLZA 3DAPA 3INTA 2VHVA 3H2ZA 3OMLA 4JP2A 5L3ZA 1EDOA 3GRKA 3K30A 4IJKA 5FYDA 4JJFA 3ZWNA 2J8ZA 4O6VA 4DRYA 1QSGA 5KJ1A 2B4TO 3JYQA 1KEUA 4BO9A 2EW2A 4CLDA 4P22A 2NUAA 3IQDB 4MP3A 3OM9A 5BNIA 4XDYA 3INGA 3MZ0A 3OIGA 5AXCA 2RCYA 3QWAA 4UVDA 1E1MA 2W2KA 1ISMA 2X0RA 2FRDA 4IY1A 3H9JA 5EJ2A 1LRJA 3ZHXA 3DBRA 4DLAA 1RM5A 3ON5A 1XEAA 3N74A 1WVGA 3BIOA 5CDSA 5EN4A 3LT4A 1DIRA 5EESA 4CUZA 3VH4A 4BV9A 3AUTA 2Q2QA 3LSYA 4XQ9A 4ALMA 4B7CA 1EE2A 1LC0A 1KVSA 1VPDA 1I5RA 3DZBA 3OP4A 2BFMA 4FS3A 1RM4A 2YDYA 3C7DB 4CMHA 1RM3A 1XQ1A 4EUEA 1YBMA 2YUTA 4GPD1 3OJOA 1ADBA 2Q1UA 2FP4A 1HDOA 3DZFA 3P2OA 3W6ZA 2D4AA 4RVUA 2CF5A 3ANMA 3PFFA 1OC4A 4INAA 4NK4A 4XYGA 3WTCA 4CR8A 2GN9A 1PGJA 2IODA 1U7HA 2GZ3A 2HK7A 4DIBA 1GEGA 4MVJI 5JY1A 5L4NA 1I33A 2EGGA 4XCVA 3E5MA 3PEFA 1Y9AA 3AWDA 3D7LA 2C59A 2PNFA 4TRJA 3WX0A 4BMVA 1H0KA 4DTIA 4WE3A 4CM9A 2QW8A 4OMUA 4YBZA 4NBVA 3PZRA 2PH3A 1P1JA 1HTBA 1IZ9A 4XQEA 4CQLA 3ZWMA 1GYRA 4D42A 1MG5A 4I5DA 4YJFA 2AHRA 1B3BA 2PK3A 4YAGA 1P33A 3WIEA 3G79A 1HYHA 3HNPA 4PN3A 3RBVA 3VTZA 3ROMA 2AW5A 3M1AA 1BG6A 1S6YA 3CSDA 3OETA 1LA2A 2EEZA 4PGFA 4WLUA 5T6BA 5AOVA 4RLSA 2UVDA 2X4GA 3JQBA 4UUMA 2HMVA 2AQIA 3QVOA 4RVHA 3S2IA 3ZU3A 1HLPA 1E6UA 2X5OA 1BSVA 4N54A 1U4OA 4GBJA 3E9NA 3JV7A 3K31A 1K3TA 3LF1A 1Q2XA 4DMLA 5IZ4A 4I8XA 1T1SA 1EFKA 2PZMA 2ZJ1A 2VZ8A 4QECA 4YQZA 1B8VA 2OORA 3BHMA 3RUAA 8LDHA 3ZI0A 3OSUA 2OZPA 3I9JA 4YVFA 1LQTA 4TRNA 5A3VA 5CPFA 1HKUA 5IXSA 2FOIA 2P4QA 5I8ZA 2B4RO 2NU9A 4JN6B 2IZ0A 3CTMA 2Y68A 1IHXA 1R4MA 1UP4A 5L7WA 1NVGA 2R00A 4NI5A 2ZYDA 4M1QA 1SEPA 4DQUA 2Y05A 4BGVA 4A2CA 3U3XA 1BRMA 1PJLA 4KDEA 3FNEA 4HFNA 5BT9A 4OSOA 3W4KA 1LJ8A 4BKPA 4PG5A 5IN5A 4DIFA 2XXBA 1M75A 2B83A 3NGLA 4NU5A 4CM8A 4TKMA 5C7OO 4AFNA 4C7KA 1PIWA 1JKIA 4GWGA 4CM9D 5LC1A 1LBEA 1I3LA 3GVXA 4Q39A 2FZEA 9LDBA 4W6ZA 4CMEA 1NHGA 4AJEA 5IF3A 1NQTA 3MOIA 3PDJA 3KSDO 3BMNB 3TSCA 3LC7O 5IG2A 3D0OA 3PPIA 5ITVA 1HEUA 1U8FO 2VRBA 2RH8A 3UXYA 2P4HX 1DIGA 2FZWA 2VNSA 3IMFA 3P7MA 4AJPA 2DAPA 3ASVA 3JQBC 4MVJG 4PG7A 1QP8A 3E48A 3EGOA 2CVQA 3I4CA 4XJSA 4FC7A 1NPYA 3RAJA 1VJ0A 3HDJA 1GTMA 3PK0A 4J9UE 3TF5A 5CHEA 1ZJZA 3FPCA 1EFLA 4HP8A 1LI4A 4IZIA 4J1TA 4YRAA 1JVBA 1XG5A 1NAIA 4M54A 4JQCA 5L45A 4BMNA 3H2SA 1N7GA 2PH5A 1LUAA 3EYWA 4N5MA 1TVEA 3UHAA 3R6DA 3WGIA 1T25A 4XIJA 4GVXA 5K9ZA 1YWGO 4FCCA 2V7PA 4R1TA 1G1AA 4OJNA 1V0JA 2D59A 4JX8A 4Y6SA 1DXYA 2HU2A 3CPSA 3GEMA 3I9NA 4RGBA 3RSHA 3LT1A 1ZEMA 3V2HA 1LRKA 5MDHA 1YB1A 2Q2WA 2B36A 2IYPA 3GGGA 3WS7A 1UZLA 5AVOA 3IP1A 3NT4A 1NWHA 2VRCA 1ZW1A 5CG2A 2BH9A 2OUIA 4RF4A 3KSUA 5I7EA 3RKRA 1U4SA 1PJ3A 1B15A 1NQAO 3PDUA 4BNNA 1TB4A 5G0TA 3D64A 1CERA 2VZ9A 1PJTA 2Q2VA 1QLHA 4I9NA 4EEXA 1SOWA 3HZZA 3WBBA 3ASUA 4HFJA 3PYXA 4ZQBA 4J7CA 4ZICA 1KVQA 1RJWA 1CF2O 3DR3A 1PR9A 4BHTA 4DBZA 1E3LA 1KIFA 2P5UA 1KS9A 2WWRA 4PLCA 5I9MA 5JSFA 3E82A 3DBLA 3KV3O 3GHYA 3JSAA 3M2PA 1C1XA 1Q1NA 5IDYA 4IQ8A 4MINA 2PKQP 5AYVA 4FQ8A 2CD9A 3PTZA 5JCXA 2GLXA 1PWXA 1HDZA 4FD3A 1EMDA 1IPFA 1YQXA 1KVRA 1ZEJA 1LDGA 1C0KA 3S8MA 3UF0A 2O4CA 2Q46A 3BZUA 1G6KA 5CFZA 4BO8A 1MFPA 1BW9B 2AEMA 3CMCO 1DHRA 1GQ2A 2HO5A 1ISFA 4PCVA 4RLHA 4XR4A 3CH6A 1DAPA 4OXKA 1O89A 4J2HA 4Q3AA 1T2CA 3KSZO 3QHAA 1Z6ZA 5F21A 3ZZNA 2AA3A 3QW2A 3DBHA 2DC1A 5TJ9A 4DXHA 4NPCA 4DGSA 5DULA 2OOSA 2Z1MA 3EVNA 2ZQYA 5KOIA 3VDRA 2BI7A 3QWIA 4GX1A 3WOHA 2V6BA 3V5NA 3GFBA 1SPXA 2EF1A 1QV6A 3ETDA 3D5TA 1NX6A 4CM6A 4CMIA 2ZK7A 3ZWXA 5F1PA 2X9NA 4F46A 1PGNA 1N5DA 2GD1O 3BAZA 3TZHA 3QE3A 1JWAB 3HDYA 5BSFA 2X7HA 1E7YA 1QYCA 1DJQA 4EI2A 4PLGA 4OOEA 3PJEA 3PVZA 4IJWA 2HQ1A 1FJHA 3H5NA 3L0DA 2I65A 5DBGA 4CQMD 4IDCA 3WSWA 4KZPA 3DFZA 4HFRA 2JKVA 4FR5A 4CQMA 5L53A 4HNGA 3WWZA 5A03A 2HLPA 1GEEA 4WOKA 1PL7A 1BGVA 1XQ6A 4P4GA 3HFSA 3ITKA 1LSJA 4QX6A 1A27A 2E4AA 3HWRA 1O9BA 3JYPA 4LRTB 4IMPA 4J7UA 1WZIA 5CEEA 4CUJA 4W7HA 1HT0A 4IMRA 1WAMA 2A9FA 3OHSX 4MKZA 4YJGA 3JD0A 3DXFA 3F6YA 1UXHA 2QRJA 1R66A 3L9XA 3PYLA 2JHFA 3OICA 5JFOA 4NBWA 3WJ7A 1UDAA 3A1NA 3SJ7A 4Z9FA 1DC4A 3I6QA 3AOGA 3O9ZA 5IXYA 1U2DA 2ZB8A 3FWZA 2NU6A 3RD5A 1BVRA 4M87A 4EITA 1Y7TA 4FW8A 1QYVA 1XU9A 2QYSA 1LRLA 4FGSA 4YT4A 1U3TA 4P38A 4QXMA 4NFSA 3X2EA 5G0UA 3KB6A 1A5ZA 3AW9A 4YPOA 3INRA 4OKNA 4DMMA 4YWJA 4R54A 4D43A 1GQQA 4J49A 4XYBA 4PFJA 2PD4A 4AICA 5GZ3A 3M6IA 3JD4A 1VSVA 5IZCC 2Q1SA 1ZMOA 5ICMA 1PJCA 3UVEA 1R15A 1MGOA 2HCTA 2B37A 3FF4A 1DB3A 2NLOA 3I4FA 3JQAA 4PLFA 3U09A 3KO8A 1WDLA 1F8FA 2ZTMA 1PL6A 4OO3A 1J5PA 1P1RA 2BRUA 3M2TA 4YRDA 2Z1NA 3OJ0A 3WIDA 5T5QA 2ZQZA 4RQTA 3VTFA 1ONNA 2HAEA 3E5RA 3GN1A 3T7CA 1SNYA 4NIMA 3BHIA 4XB2A 2JL1A 4II2A 3U62A 4AG3A 1HLDA 3H9GA 3KVOA 1C14A 3D3WB 3LYLA 1CIVA 1FXSA 2EKPA 1V3VA 3NYWA 1YONA 2G82A 1TT7A 4Q9NA 3U4HA 4KTTE 4OM8A 4URFA 1Q0LA 4FBGA 4RVSA 4DLBA 3HHPA 3JCZA 1OOEA 1I3NA 4JCOA 2NADA 2IE0A 4E33A 5A04A 4L0QA 5CEJA 3WYBA 3NRCA 4QTZA 1HYEA 4NBUA 3NV9A 1R12A 2AG5A 3FD8A 3BMQB 1IOLA 3RFXA 1WDKA 1I2BA 5A02A 3NDRA 7ADHA 4A03A 1I3MA 3NKLA 1IZ0A 3KYDA 5BSEA 2WM3A 3QRWA 1GYPA 1RYDA 1KVTA 1O6ZA 1LC3A 2O3TA 1SB9A 1EBUA 2BMAA 2Y1GA 3NX4A 3BMCB 1SBYA 5TSDA 3FN4A 3ZU2A 2I5PO 1I0ZA 3I83A 1E5QA 3ANLA 4Q3DA 2WDZA 1GUZA 3T4XA 1F14A 1E1LA 1WLYA 2CDCA 4CODB 3COSA 2HJSA 4OXNA 3K6JA 4KUGA 1UAYA 4BNHA 4LSMA 3AY3A 3MJCA 4Q3CA 3GLQA 3MTJA 1X15A 2I67A 1CJCA 4L8VA 2R6JA 4PRLA 4WLNA 3DC2A 1WMAA 2C54A 1E7MA 5C7IO 4NMHA 5IJZA 5KCZA 2O2SA 4ONEA 5JMPA 1VL8A 1ZSVA 3ZW8A 1O5IA 4FFMA 2SCUA 2X86A 3DBRB 2E6UX 3WGYA 4C4OA 4OIMA 1RWBA 5EPOA 3HB5X 1NR1A 4GX5A 4E2YA 3H5RA 2D8AA 5KVQA 3MWEB 4AJOA 4DC0A 1ZK4A 2NTNA 3H9UA 1TEHA 4Y6RA 3VPHA 4B3JA 3VZQA 3G49A 2DM6A 1E7RA 3O26A 5L95A 1RM0A 4B3IA 2X9VA 1EQUA 3OECA 4PLPA 3SVTA 2YZ7A 2ZB4A 4CMKA 1F12A 3AFNA 3F47A 2HK9A 3Q9NA 3NJ4A 2OP1A 2Y1CA 2QZZA 1ZH8A 2I3AA 4R16A 1OZAA 3F3SA 3WGQA 3ADOA 4B3HA 2Z5LA 3E6AA 4FB5A 3SJUA 3RC9A 3VDQA 3L4BA 4R41A 3NT5A 4KUHA 5F1KA 1XELA 1PQPA 1YS4A 5DN9A 3JQ8A 3FBGA 4ND3A 3ANNA 3MJSA 4WCDA 3GNTA 1XHLA 4DUPA 2DTXA 2J3HA 1W6UA 1DBVO 2NV6A 2B35A 1Y81A 4GAEA 5IDXA 4CV2A 1D4FA 4IQGA 1ZXBA 4UEKA 1I8TA 3PGXA 3UOGA 3VPSA 4CMBA 2HJRA 1T4BA 3PLRA 4R5MA 4PLTA 4CM1A 3UICA 4WLVA 2IYOA 3KTDA 2Y93A 4A27A 3OFSA 1J6UA 2Q4BA 1LLQA 1YL7A 2EIHA 1AUPA 3U5TA 3W8DA 2Y0EA 4WCFA 1YOVB 2W90A 5JCJA 4XGNA 1A9YA 3F4LA 4OL9A 1KEVA 3H3JA 1KC3A 2GNAA 3PWSA 5DZSA 2W2LA 3ZV6A 5IDQA 4IJVA 1E77A 2X6TA 4BKOA 2Q99A 4JIGA 4B4UA 1A71A 2P9GA 1EDZA 1U7TA 3I1JA 3P19A 1AN9A 3ZV5A 5LDGA 2C2XA 3ROKA 4MIOA 4G5HA 4N7RA 1KEWA 1MLDA 1ENYA 3IOYA 1U9JA 3HFGA 4R9SA 2V65A 2H6EA 2PGLA 2VTEA 4PLVA 3RUCA 2CNBA 5KTKA 1NR7A 4QO7A 1K2WA 5IN4A 1PZFA 2YFQA 1GADO 3K5PA 5DT9A 4UEOA 3NDIA 3WWYA 1E3EA 3ENNA 1HL3A 4CR7A 3FNHA 3V1TC 2BGLA 2VCYA 1LDYA 4OOFA 4TMFA 3ORFA 3OJFA 2IXAA 4D0SA 1FF9A 1LU9A 1GPDG 2JD0A 1UP7A 5ILOA 1YBAA 4FFOA 2P5YA 5KIAA 2GCGA 1PTJA 2FPGA 2VT3A 5TC4A 1YL6A 2IEBA 1ULSA 4NQZA 4IS3A 2FWMX 1VLLA 1GYQA 4OYRA 1ZUD1 2YYYA 3LLSA 1HSZA 4Q3NA 2VT2A 1M76A 1LSUA 3PXXA 4BVAA 2UDPA 2GF2A 4KWHA 4D0RA 2P68A 4RF3A 3DO5A 4IDFA 3ZU5A 1E92A 3KEQA 1K6JA 2BF7A 3O03A 2GERA 2AE1A 2VHZA 4PIVA 5JPIA 4CL8A 3GEDA 3VHRA 3B1KA 1GCOA 2UUPA 2YFHA 4EBFA 1P74A 3B70A 4Z6KA 4R69A 4BNVA 4RVGA 4UREA 2CVZA 2DFVA 1PJ2A 4BGIA 3DMTC 4YAEA 4L74A 3AY6A 4FJ0A 4BB5A 4BNFA 1DIBA 3D5QA 3PGJA 4W7IA 1ENZA 5DNAA 3PJGA 1UXJA 2C29D 4RPLA 4NDNE 3C1AA 1DSSG 3QP9A 4A7PA 3RKUA 1ADGA 2VHYA 1ID1A 1DHTA 4FFNA 3ZV4A 2JCVA 4YXFA 5A9SA 2ZCVA 4MJLA 3L6OO 4LGVA 2B5VA 3MCVA 4TRRA 2EWMA 3SXPA 6ADHA 1WZEA 3HG7A 3JYNA 2CDAA 4XEHA 5ER6A 1LDEA 4Y8VA 1TT5A 2DVMA 3RC7A 3LU1A 4A5OA 1ADFA 1O8CA 3O38A 3UFXA 5JAZA 5JMWA 1PEDA 3ZN2A 2VWQA 2DTEA 4CLEA 1B16A 5COQA 5HWSA 2D3TA 1S7CA 4A26A 4XZ3A 3LC2O 2DUWA 4KWIA 1H6BA 1JKJA 1W8DA 3PHGA 1LX6A 3GC6A 1DRWA 2A35A 4DWVA 4HV4A 3RUDA 3TZQA 4H7PA 2C7GA 3GVHA 3IAHA 2HSDA 1Q7CA 3A9WA 3S2FA 2A4KA 4YACA 4MVJF 3ZHZA 4U0KA 1GUYA 4NBRA 3TDKA 1MC5A 3H8VA 3KRTA 3GVPA 4D3SA 3DB2A 1B14A 3G3EA 2EKQA 4AJ2A 5C3MA 1R6DA 3BYZA 1SAYA 4QEDA 4B4OA 1TLTA 1ENOA 1Q0QA 2XF8A 3C24A 4J3FA 1TT5B 1Y5MA 3PHHA 2X23A 3Q0EA 4IS2A 4YJDA 4BNTA 4PLWA 2VRCD 1BTOA 2WD7B 3SLGA 1U3VA 1G0OA 2UAGA 2HRBA 4R68A 1CWUA 1B26A 4YDRA 1ISIA 4EJMA 4N5LA 2QIOA 4N5NA 4WK6A 4GGPA 5KJFA 4XGIA 4A0SA 2VQ3A 3TWOA 1X7DA 2OO5A 1PJQA 2GN4A 3OEWA 4GLOA 2O4UX 1LEHA 2PA3A 3DWFA 2IZ1A 1I32A 1E1KA 4CMAA 2Y67A 5HS6A 3CINA 5L51A 1EBFA 4WUVA 3EZLA 1P1KA 1WW8A 3FNFA 1HZJA 4J4BA 3DAGA 2O3JA 2RH4A 5ILGA 1OMOA 2OBYA 5JDCC 4D7AA 3GAFA 5JS6A 3D3WA 4OGWA 5TGDA 1Z73A 1A4UA 4GWKA 4NFHA 3X2FA 2Y1DA 1T26A 3I5MA 3MEQA 3GUYA 3WGHA 1YO6A 3WGOA 4K9DA 1LNQA 2E37A 1CRWG 2HK8A 1HE2A 1CQIA 1Z74A 3O8QB 3ENKA 2CY0A 1VKNA 1B2LA 1E7WA 3NTOA 4F45A 5L40A 2W2KB 2EV9A 3VVBA 2WEKA 2GGSA 5G4KB 4PG4A 2JJYA 4WCFC 1PU2A 2IZZA 3B1FA 4XKJA 1XSEA 4QFDA 2VYVD 2ZTVA 3B6ZA 3C8MA 2VWPA 5FF9A 2FPIA 1OI7A 4WJZA 3KYDB 3QQPA 4LRSB 4BKUA 4DC1A 3IIEA 4ZQHA 9LDTA 2E82A 3D4NA 3L4BC 2BELA 1M66A 4WLOA 4E5MA 3VKUA 1Z7EA 3HDHA 4XB1A 4B7XA 1H9AA 3PI7A 5TNXA 3U49A 4CV0A 5BNTA 4RJTA 1DO8A 1EUCA 2CZCA 1XKQA 1V6AA 2F00A 4E5PA 2I66A 3PWKA 1NQ5A 2FMUA 2YQ4A 1VL0A 2X8LA 4IGFA 3O8QA 5JYEA 4IIVA 4EW6A 2BFAA 1ZCJA 3BTUA 4L9RA 4YT8A 1X1EA 3IC5A 3ONEA 3JQ7A 1SB8A 2NWQA 3CKYA 3Q11A 3QVWA 1E3IA 3ONFA 2LDXA 3LLVA 1Z82A 4BS9A 2NACA 4YJGB 1GQYA 4BIIA 4D41A 5BSGA 4UVGA 2POQX 2J3JA 3G1TA 3JD2A 3RI3A 4KDFA 3GF4A 5G0SA 3W1VA 1KY4A 1DAOA 3CEAA 5EERA 1PGOA 4BOYA 3TOXA 5IAAA 3VAZA 3PJDA 3T4EA 4BNYA 1LDMA 1PJ4A 4NH4A 4NBTA 3TRIA 1F0YA 5JC1A 3UGKA 3F1KA 4IBOA 4ILKA 4OKIA 4FJ1A 5F3RA 2QRKA 4CM4A 2IEDA 1EE9A 1XA0A 3E03A 4M89A 3WBFA 5KWEA 4AJNA 3TQHA 1OBFO 4YAKA 2UUOA 3ZNQA 4FJ2A 2C0CA 4M86A 4GL4A 2CSUA 5JDCA 1EUDA 2NVBA 3DMYA 1XDWA 1X7GA 1VE9A 1J0XO 1DIAA 4S1VA 3VPXA 3AM4A 3NGXA 4JJIA 1KC1A 3W6UA 4KOAA 1UP6A 2OMEA 3R1IA 2EGHA 1BWSA 1R4MB 2LDBA 4CMJA 4BNLA 3VH2A 5JNLA 1FDVA 2PGDA 2IDZA 2OXIA 4OQZA 3ZWYA 1NFQA 2X1HA 1HWYA 3QY9A 1ZNQO 1D1SA 1C1DB 5L4LA 3L4SO 3LQFA 4CMGA 1JVSA 3GR6A 2ZB3A 1AXGA 1F8GA 5DBIA 2VTDA 5DF1A 4ZU3A 2Y0DA 4CLOB 1L1FA 3V2UA 2XOXA 3RROA 1V3UA 3WICA 1V35A 3GMSA 2ZKLA 3DEYX 2G17A 2W4QA 2VOEA 3GZNA 2AEJA 3OBBA 2O50A 4J0EA 1LTHR 2CMDA 3JQEA 4WPGA 3RVDA 2YDXA 4E32A 4EJ0A 3IP3A 1FDWA 3F5QA 4XGKA 1HE3A 5DCWA 3PQFA 4YQYA 1HF3A 1QRRA 1EQ2A 3ST7A 1JQBA 3WGZA 1M67A 1C0PA 1BDBA 2NU7A 4BO4A 1WDMA 2QX7A 1DJNA 3U4IA 4TROA 3EHEA 3AU9A 3GPDG 4K1LA 2E49A 3NDJA 1NPTO 3VOSA 3N7UA 1M6WA 4FDAA 4W4TA 2YJZA 3VZRA 4CLOA 2VOJA 3FTNA 1T2EA 4RO0A 2FN7A 4L75A 3DZKA 3UH1A 4L4RA 2AE2A 3WMWA 4LK3A 4DYVA 2NVUB 4I08A 3NTRA 1O95A 4IQ0A 4ESOA 3A28A 3GZNB 2AXQA 4MVJH 1P77A 2D1YA 5JO0A 3IJRA 5C37A 3JQDA 5JAMA 2HRZA 1NBOA 2PGJA 3GNQA 1U28A 4B7UA 3E9MA 1IUKA 1I24A 2EERA 4NG5A 5HA5A 1BHSA 1EEHA 1W73A 2AMFA 5F5NA 4IZHA 1DFGA 4ALJA 1QORA 4CLHA 3BTSA 4LW8A 2XAAA 4A73A 4WLEA 4LCEA 1F17A 5FI3A 3K73O 3STHA 4AVYA 1RYEA 3I9OA 3F1LA 3DZJA 3QLJA 4KQXA 5H82A 1SMKA 2DBVO 4NJMB 3L77A 1Y1PA 5JBIA 5JC8A 1NHWA
chains in the Genus database with same CATH superfamily
5B7NA 3LHSA 1TD1A 2XUPA 4AG6A 3DLBA 2G67A 3F9IA 3D54D 1M1NB 2VK1A 4OF4A 5B6IA 5TPZD 5JDIA 4DKXA 3LH5A 3IDSA 1E32A 4KXVA 3TMKA 3BN3A 2IUFA 1XWWA 1YGYA 3OE1A 1FDTA 2WWFA 3D6JA 4FZRA 5JZOA 4XGQA 1IMOA 2I22A 4K9NA 4G86A 1E2UA 4ZVMA 4WNIA 4K26A 1TI7A 3IVXA 1L5YA 1MD9A 2OXCA 1ESMA 3KNZA 3O73A 4YO7A 1CSEE 3FLEA 4TS9A 5BW6B 1QMPA 3BGDA 1KJZA 3DL2A 1QIIA 5DASA 5ALJA 4JQYA 3KALA 5CDTA 1ST2A 3OPYB 3W3ZB 4K8RB 4OLFA 4V3CA 3UANA 2EWVA 5G1NA 1YBVA 3IKLA 1IHYA 2UXCB 1YT5A 3D4BA 3W79A 5JLAA 1YHYA 4PIMA 1E9EA 1EDDA 1XFDA 1W4AA 3OFKA 3DV0A 4JC0A 4JI6B 3IUSA 3U3ZA 3U44A 1M1ZA 1KO8A 3N2ZB 2HNAA 5CVUA 4DA9A 1ZGHA 2R00C 4JS0A 5JY6A 1Z4LA 2R4QA 4JLDA 1V5GA 5AHOA 2XSZD 1BMDA 4GLLA 1UJMA 4CGZA 1YTLA 1MTOA 3M4JA 2BKEA 2JFNA 3GAMA 2CNWD 3HBJA 4IX9A 2ZWAA 3A9TA 4MO2A 1RRPA 3HVKA 3DE7X 3RSCA 2OV2A 2XMBA 4BJ3A 1ODCA 3DZHA 4MWDA 4R51A 2YS7A 4M1OA 5C8YA 5EWJA 2TYSB 2A3RA 5FA6A 2GD0A 3IJEB 3DKIA 1EM8A 2GUWA 2GO1A 3R0IA 4L07A 4L4YA 5E9JA 3KC2A 3DE3X 4CMCA 2ETXA 1YQ9A 4ZC8A 2P77A 1EGQA 2WICA 3WYCA 3AJAA 1JFVA 1GU0A 3HUUA 3WHKA 3ZWPA 5DP2A 1E4YA 1FMCA 2WHPB 4WZBA 5ESRA 2L82A 1WTCA 4ENRA 4ZGWA 1BWPA 2WD7A 1HE5A 4GWLA 4HADA 5CXXA 2G1AA 1OLUA 1TCAA 2WY2D 5K3OA 2XE7A 2JD2A 1VGVA 4R83A 4W9NC 3HN2A 1G60A 3EXIA 3SBXA 4AMBA 1RXWA 5BN5A 1MO5A 2Z0MA 2WMYA 4B31A 1NQOA 1Z83A 1UEIA 2W98A 3T5AA 1BXZA 4D9KA 4L4ZA 5FUWA 1YNOA 1LGYA 2GJ9A 4NXNB 1AH2A 1T2FA 2IYSA 3COZA 1W5AA 3HCPA 3P96A 1IOVA 4AIRA 1ULZA 2PS3A 4KE9A 5K3EA 5GGYA 1JU9A 4BN5A 4F21A 3R9XB 4MUKA 2C7RA 3ZDAA 1JFRA 2RGNC 4WT7A 3WTBA 5C8YB 5FWXB 5K4HA 2BGWA 1WHTA 3ETLA 5FP0A 4LZNA 1UT8A 5KYWB 2BFCA 1AQ6A 4M0PA 5DHQA 5DCYA 4ZZ2A 3RWMB 3W8RA 2FPMA 4DLUA 2ZZNA 2OGTA 1C9NA 4DWWA 3V1LA 4YJ3A 1DGQA 4Q3OA 1U31A 4HUJA 2JW5A 3USZA 2AX3A 2IIQA 2Q62A 4CJXA 2GZ1A 1OLUB 3MB8A 4UMVA 5EC8A 2JRLA 4IHKA 5ADHA 1CDEA 1ZD4A 3HCOA 3AK4A 3ZWOA 2OWEA 2H00A 5DEIA 4L9AA 2Y8EA 4N3AA 5EE0A 3WLMA 1TKBA 1UQUA 1Z07A 5LZ2A 3S8EA 1U3WA 1Y9ZA 1XNJA 4N3NA 5FHRA 1YZ3A 3HY3A 4CVNA 2O8FB 4PQEA 1UKYA 3TZLA 3AEQB 3DOEA 1X7XA 5FL7D 4IUYA 2G88A 1SD5A 4C1NA 2G07A 2OCDA 3VR3D 5CW1A 5GY7A 1T1GA 3UJ7A 1GTJ1 5IW8A 2HHLA 3PNBA 1KA9H 4IVNA 5H81A 5HCNA 4DUYB 3AVWA 5B1IA 1UMKA 1PTKA 3ZG6A 3EGVA 3ICQB 1UDWA 3H1GA 1QHGA 3N28A 1WHTB 5JZ9A 1H3NA 4RORA 2YV2A 4PGHA 4RQUA 4B34A 4I7EA 2QMOA 3FZNA 1FNSA 1YQEA 1JEYB 5BWMA 1IJKA 3OTHA 3CUUA 4Y6QA 4Q9HA 1IG0A 3THOA 3T4UA 4UFPA 2VP4A 1AOXA 1ZIPA 3FPLA 1WDWB 1X1RA 2LV8A 3E8MA 4BQQA 1M8JA 4OXYA 3GZJA 3PA8A 1N5IA 3PXDA 5M3BA 4RD4A 2GFIA 3R3JA 3V8PA 1NDUA 2CLCX 4H16A 4DDVA 1JJFA 4A36A 3PIRA 3PZBA 4FI3C 2JDIA 3RG2A 2YW9A 1M5RA 2IHZA 1YR3A 3T1OA 1NR5A 2B2CA 3OMXA 1SXGA 4JZYA 1SUCA 1XNGA 2JAQA 1KZGB 1YRAA 3FZQA 1BXKA 2HW8A 3R3WA 1L4FA 1ZG3A 4M1KA 2HCBA 1PJAA 4KEAA 3SICE 3DSRA 1H6AA 1KYYA 2BE7A 5JZVA 1JKJB 2IBMA 5LU8A 1CUWA 4QJ4A 2EG9A 2ZJ4A 1NJFA 2Q3JA 1NIJA 3EA0A 1EZ1A 3D0RA 4TTJA 2OY0A 2ZJAA 3FSRA 5I8WA 3IQIX 4ZCQA 3IUEA 1QDEA 3ECSA 5E1OA 3RANA 4R2XA 4QG3A 1DC6A 1H66A 1U0EA 2FR0A 2C07A 1H94A 3AJ9A 1HE4A 4XTCS 3UK0A 3JQ9A 1SIOA 2JLQA 2OGUA 1KZHA 4UXHA 3QEJA 2WPDD 3UCXA 5LQNA 4B75A 4J6EA 3HKDA 2JFOA 4FNGA 3F7TA 5KVAA 1VB3A 2BTOA 3C1TA 4LRWA 5K6AC 3O82A 5I7FA 2QMZA 4CM3A 1ZH0A 4PIPA 4BUZA 5ADVA 4X1YA 2VHXA 4LHYA 1A72A 4R3NA 3ADPA 3ODPA 1T5DX 3OIDA 3QU4A 3JYHA 2ISQA 3L0CA 4FKZA 4BVJA 5T4FA 2C7QA 4XD2A 3L8MA 4BGEA 2VFAA 1C7QA 1FNNA 4EKDA 1DDOA 1C2TA 3TZCA 3DBVO 1O94C 1T0JB 5DDIP 1UR5A 3ISVA 4L72A 1TA4A 3B9RA 2LGJA 1NOIA 3KLBA 1SRQA 5ESDA 1YCGA 4LDRA 4IHQA 4B76A 3JWPA 4YHHB 2A0KA 3HVRA 3B38A 4WGFA 4MRVA 2F1HA 1H2HA 3W5DA 2FPPA 4IZ6A 3NWJA 4RK6A 1ZVMA 2JIZD 2Y1XA 3BMQA 1GNQA 1W34A 1WW2A 4DQXA 4DV1B 4M0LA 2BL4A 2NXNA 5EJIA 3HKBB 1XU7A 2WNHA 4MNTA 3FI0A 2ATIA 1Y5LA 3TR0A 2GXQA 3QA3E 3PI6A 1BFDA 3KJNA 3UY4A 1R6TA 2EGUA 4GKVA 1U9IC 4UM7A 2ZSJA 4GOLD 4DREA 1TQHA 1XRPA 3DDNA 4QGAA 2HF2A 4PYNA 3JASA 1GZ6A 2JA2A 1NF9A 5TMPA 1YVEI 2WHRA 4DM3A 3TW8A 1KSHA 3R5TA 3M0EA 1FRVA 2E4ZA 3MAAC 3AM3A 2RD2A 1KJYA 4IDBA 4BLRA 1HMPA 2J0SA 2O3SA 1RKBA 4HB2A 4JLBA 4DSOA 2R8ZA 2GKGA 1DQSA 4E6PA 1NKTA 1K86A 4XQGA 1O94D 4Y7CA 3MXTA 3WGUA 3JVUA 3WAGA 1E2HA 2F4VB 5ENVA 4OREX 3SS7X 4MR8A 4KSCA 4BX9A 4R7ZA 4F56A 2QLLA 1PNQA 3TLCA 3FTCA 4JR2A 3L6CA 3Q5DA 4MLPA 4R1NA 4AN1A 5KNCH 1FFWA 3IPRA 3KVYA 3L7AA 3NIBA 4KRXA 4DY4A 3WO0A 1KNXA 1V8FA 2QVCA 1E5XA 1SHTX 2AX4A 4LN1A 5EPEA 2CFCA 3MA0A 1SUWA 2EJBA 4NONA 3L92A 1TJ4A 2BIFA 2IEAA 1IWPB 2VATA 2Y0CA 1JAHA 3PQ7A 4GQAA 3JYLA 4PHFA 5ALTA 4JKIA 2R8XA 2HIAA 2IV3A 5LWHA 3ZH9B 1GCIA 1DVRA 3EAGA 1NJGA 3I1IA 1IUOA 3P9CA 3HDQA 4UE3S 2G1UA 3VISA 3ZWVA 2HJVA 2JIOA 3WK7A 4CI0B 4W5QA 2A92A 2ENWA 3LUFA 2XE6A 3TL2A 2X42A 2XMDA 2X0EA 3GDGA 4E4RA 1XU4A 1MQ8B 3C6MA 2FZLA 2FQYA 3PGKA 2YMLA 4KTVE 5FNVA 1F8UA 3IKVA 1QLJA 1ZNYA 4FOPA 3E4CA 5ANRB 4HF7A 3LY8A 3I32A 1JJVA 1II9A 2NVUA 3PEEA 1AGNA 4NS1A 3AFGA 4OJMX 5A5GA 5DK4A 1CHNA 1KIMA 3UUWA 4B0PA 2V9PA 4XLZA 2XCSB 4D25A 4NOMA 4QYIB 3QPCA 5EY5B 5I9BA 5TGTA 3S2YA 4H60A 3K72B 3O8RA 4TS4A 2G09A 2IPXA 3HR8A 4JJGA 4HAXA 1LBSA 3IR7A 4HBGA 3GLIA 4ZVOA 3LS2A 2QS9A 3CLHA 2VA8A 3K1JA 3RU3A 1IHUA 2JVKA 4L8WB 4KPFC 3A7DA 2ZATA 1PG5A 1IXKA 2OV8A 2NOAA 4MW9A 4ZQFA 1E9VA 5DBOA 2YV4A 2NTYC 4LJ5A 3LHDA 4NK5A 4CKYA 4LXHA 4ESEA 2Q1WA 1FRFS 2OZEA 4K6GA 4LIPD 4MYRA 5FWYB 2WOJA 3FTQA 3S5UA 5I8PA 3GU3A 4OX9B 1DZIA 4UCFA 3GX1A 4R3WA 3AHJA 4OGKA 5KPDA 1UJNA 1Y5NA 5BSRA 3L6DA 5CFOA 2IP4A 4HMOA 4EIWA 1F9EA 3DCJA 1DXOA 2EKBA 3KCNA 4HPXB 1VG1A 2XNJA 3W3AH 3LY9A 4NC9A 1KVUA 3H7IA 9ABPA 4PW0A 2WOOA 1EK5A 1JHXA 1P9RA 3SE7A 5KNDD 2AN9A 4GC9A 4S2EA 4E07A 4E15A 1MQSA 4A8JC 4O5OA 5A6VA 2A5LA 4ALNA 4A91A 2TMGA 4GPBA 5KTMA 5AJUA 1HFJA 4AJIA 1MO4A 1EX7A 4UHBA 1ZLXA 2GFHA 1FP4B 2YIVX 1ISSA 3A3YA 1FL9A 3E9DA 4A1OA 4AN4A 1MB4A 1RXSA 2R8OA 4AMGA 4WN9A 1CJKC 3FNGA 2WSSD 1BQEA 4B6JA 5TT0A 1MV5A 1QYRA 1STOA 1VYHA 3MWDB 3CVYA 2BP7B 2PNJA 1TTTA 4PO3X 1IBRA 4KR6A 1ICIA 3SHVA 1GL9B 1ISGA 3GAAA 1WY5A 3I9KA 2BWJA 4JSTA 3UMSA 4IHAA 5LIPA 1ADJA 2IXDA 1I0LA 3HR4A 4YXWA 4DCJA 2I62A 3CLTC 3QVSA 2V8BA 1Z4MA 4MS4B 2WSBA 4EFKA 2FSVA 2C0QA 2ZYAA 3F49S 4YRZA 1O58A 3EDMA 4DLZA 3QFRA 3L0BA 4B46A 4KQ2A 1P91A 2OQRA 1U28C 1J8VA 1VLQA 3IP7A 2VUIB 4HGZA 1EVLA 1HYGA 2NTEA 1AHIA 5FR2A 1Y8ZA 4WK0B 4EPWA 4YMVA 3K9WA 1W25A 4BO0A 1DDGA 3A4YA 3OJWA 4CMEC 2RMKA 4GR5A 1AK2A 3I3OA 1SULA 1ZM9A 2ZJ0A 3LE8A 1GPJA 1N6IA 1C8BA 5HBGA 3R2JA 2VAXA 2WMDA 1IQ0A 1K4MA 4RDIA 1VG9B 2NN3C 1VE3A 2J9RA 3GW8A 1IZ7A 3BDAA 3PC2A 3A25A 4H6WA 1GRVA 2G5CA 1KERA 4J9VA 2CEAA 3DQZA 4TL9A 5FNVF 1IEXA 2JCYA 2Q0XA 4JZKA 4AF6A 2O8DA 2GK4A 1EIWA 3WI7A 1NRJB 5J4KA 5SYNA 3EUWA 5BNZA 1U1FA 5I5GA 4XSGA 2J4FA 1RJDA 5LYJA 1UXKA 3I28A 3CB4A 3ZZ1A 3I2IA 4CLXA 3I92A 3FNRA 3ZYZA 1PT5A 2BGIA 1VDZA 3QYPA 4O29A 5CGZA 2JPDA 4MWEA 2D00A 3TW4A 4QUJA 5T7BA 1SUDA 4GYYA 1E0KA 3GDOA 2DWQA 1H42A 3C6KA 3CX4A 2JJQA 1E66A 4RULA 4DCGA 2PZFA 3HCDA 2IUSA 4CL0A 5HS4A 4ZRNA 3VU1A 1FYFA 1L4UA 1SBHA 3ETEA 4HY3A 4OHPA 5DWDA 3RSFA 1KO1A 2HA0A 4IM7A 1YJ8A 1N92A 1P75A 3JQPA 1ZD1A 3HSSA 2PTGA 3UGQA 4IFEA 5J2TF 2CXPA 2GEUA 2JDID 1MT0A 3C43A 4WDRA 5EIHA 3IAS1 1FZTA 2ILVA 3C7TA 5DWVA 3UAWA 1SXHA 5AKXA 3FCOA 2FEPA 4IIEA 4YRBA 1SZJG 1SHKA 4IXDA 1YFLA 1A1VA 2JGAA 3LK6A 1FFAA 2QBYB 2VJMA 3OPXA 2QP4A 1KY5A 1V9LA 3A14A 4AS3A 4L27A 3KUKA 3T5MA 1Y8RA 4OTZA 5EJMA 2R7MA 1ZM3A 5FUBA 2V4UA 3K20A 2OO3A 1CV2A 5EZ6B 3S6JA 4ASUA 2NSDA 4AURA 1Z5VA 4L8GA 2H5EA 3C3XA 3JZDA 1DC8A 3QE0A 4BO1A 4M49A 4RTPA 5DP1A 4FEGA 1R5JA 3IT3A 1C30B 3GAZA 4F91B 1X7HA 4B3FX 4EJ6A 3CURA 2A1UA 1N5MA 2AKAB 2BMWA 1B0AA 1G55A 1DTSA 1RLOA 4RZQA 5GZ6A 1Q7EA 4AUKA 4Y2SA 3PXUA 1QV9A 1EI9A 3BB4A 1JA0A 2HUNA 3EG9B 4ZCLA 4Z4FA 4CETA 3KTFA 4RSGA 4U02A 4BLTA 4K9MA 1FUIA 1T4MA 4G8DA 5DXJA 4ZV4A 3RBZA 3SI7A 1F38A 2Y0PA 2VEDA 2OUKA 4G0OA 2OD7A 8MHTA 2YMQA 1IJBA 5AUPB 4B6SA 1O8BA 2FGJA 3EXG1 2AL7A 1ORRA 2ZRLA 3B89A 1KDRA 4MWZA 4EVQA 4X0EA 3HN7A 3SQXA 1ZBDA 2IDJA 4PLHA 1UBOS 4AY2A 5B1YA 5TX7A 1OZGA 5LNK1 1MOPA 4IWNA 4PZAA 3WYEA 3OZEA 3ABZA 2YHSA 2PR2A 1CJSA 1PBNA 2VZ0A 3KOYA 3M9WA 4HDRB 3VJKA 4ABYA 2V6FA 4F2HA 2O23A 3PICA 4ZGGA 5J4YA 3IQXA 3W0LB 2QL7A 1I3KA 4AKEA 2AN4A 4BO6A 2DBQA 4A6DA 4F6CA 2VUTA 4NZYA 4UU8A 5AW3A 2XB8A 4J0IA 5E95A 4KNVA 5CM2Z 1J2UA 1KI4A 1C7FA 1V41E 2X22A 1O6GA 1SG0A 3B9BA 3HB0A 1F8XA 3AP2A 4YCAA 3C4VA 5BN3B 1Y7IA 3AFMA 1DJOA 3O83A 4LWZA 3DOUA 4NV0A 3T15A 3AILA 4WLFA 1EZ4A 3BSFA 1EB8A 4MMXB 4B3BA 1N2SA 4LISA 3SHQA 3HXQA 1WSWA 1VJTA 1GPKA 3ZGOA 4B73A 2NUTB 3KPUA 3DEFA 4L1KA 2D62A 1NBHA 2HRQA 2XWQA 3KPVA 4HQFA 2WMOB 4QPJC 5FB3A 5C34B 4CIXA 2YXDA 1DBPA 1X77A 1FDIA 1GFZA 4Z9YA 5FBHA 1N2CE 3P9QA 2IYZA 3A3PA 3Q5EA 5CJPA 4MDYA 5MGBA 5A2QA 2BJWA 2V59A 3KFLA 4IPTA 1EX9A 2DR3A 1A9SA 1ZKMA 1S2OA 2HF7A 5E0KB 3GGPA 3C3KA 4FOLA 4V0LA 5EGSA 3HL4A 5KZMB 3I0ZA 3T9DA 2JFFA 2VNAA 3L4KA 3PHIA 4ZYXA 1QVZA 4M1SA 1BDJA 3ML1A 2HYIC 5KVSA 2I3DA 3D3JA 3GRPA 1AZSC 3NHAA 4G5RA 4GLFA 1YQUA 2VH5R 4J7XA 3RF6A 4ALLA 2WTEA 1VYTA 1OIWA 1R8SA 4IGKA 2OENG 1FFHA 1PS0A 2QRMA 4DC9A 3E4DA 4LJAA 3PQ2A 1KAGA 4I9UA 3M5WA 5C7YA 3AB8A 4XIYA 2ESRA 2I33A 3MJTA 4ZQIA 3SYKA 4ID9A 3OC0A 5TQVA 3PDHA 4DPKA 2C2KA 3HUDA 3OQHA 5DYNA 3DBIA 1BKDR 5KVCA 5FFNA 3VJRA 4H3SA 3JW8A 4UEQA 2A4MA 5FPTA 4C2BA 3QUBA 1D03A 2R79A 1K6MA 4ND1A 2E4UA 4R7TA 4KPGA 3Q0TA 4WEOA 3CWQA 4F6LA 1ZVVA 4F84A 1VIDA 2O8CB 2JAWA 3BDVA 5TT1A 1NXQA 1W35A 2JLVA 1QIEA 5B2EA 4B79A 4YJHB 3B12A 1CVRA 1FVFA 1ZOOA 1ZQ1A 2JGNA 1YB4A 4B40A 3GVIA 5FLYA 5LXTA 1A2OA 5H9WA 5J3JA 3GLUA 1D07A 4R8RA 3ED1A 1W76A 1OB2A 3S2SA 5B7PA 3BEOA 4LGCA 2WI8A 3EGIA 2HZ7A 4C29A 4F86A 2DLDA 3BUSA 3NRBA 3V33A 3JQ7B 1E2QA 4E14A 1RPTA 3GPCA 3HADA 3ZZ0A 3QX8A 3HBNA 4EPXA 3OUTA 5CB0A 1HOTA 5LD2B 4HNAA 1NRIA 3SNKA 5IWAB 2VJKA 3TLZA 3QXGA 1GGFA 4MUFA 3SMVA 3FTPA 3NYQA 4UQPA 5AOCA 2WJPA 1Q2UA 2C3YA 1JAXA 4LC0A 3TW6A 1CF4A 3QIVA 1FC0A 1IYZA 3AUSA 2F8LA 1M2GA 3MWGA 1KEZA 2WKSA 4DAOA 2BT4A 4Q1FA 1MZPA 2PQ6A 1PNTA 3BWDD 3FDFA 1SCQA 1Z4JA 4UUOA 2IW3A 5GOZA 3U80A 2G5TA 5LDHA 2RGXA 5CTJA 4UNQA 621PA 1N6NA 3RC3A 1W36D 4B3GA 1P5FA 2PEZA 1V39A 3C15C 4YASA 1ESZA 3SBDA 2J0VA 4FEYA 3OTOB 3SLRA 1GNTA 3KOOA 1MG0A 1RAFA 1I01A 2Y9PB 4PWZA 5F12A 2JFYA 3ZZNA 1PDVA 1JAZA 1J33A 2Q4EA 1FFBA 3I6IA 4JT9A 4K0RA 2HA2A 5CPBA 3UVEA 4BWVA 5KMGA 5AXBA 2ZT7A 3MS2A 4JI4B 1QXSA 5DEOA 3FOAA 4H0FA 3I72A 3OIFA 4UHJA 1OF1A 4XYMA 1FXUA 5EUQB 3UAGA 4IG4A 5TARA 1EFUA 5CIYA 1SFRA 5I7AA 1SGWA 1H8EA 1L4EA 3GEEA 3RYHA 2QR2A 4Q05A 2ZUTA 1C3VA 1LLUA 1NW3A 1QGUB 2AQHA 4RQAA 4XWGA 3GT7A 5JXGA 4H7JA 4G37A 2O1SA 1RI3A 2R6DA 4P36A 1RJ9B 1HH4A 1U6KA 2EP8A 3Q15C 5CH3A 4QGHA 3PEWA 3DXZA 1QGED 1Y8QB 4YCSA 4HB3A 1UOOA 1CY7A 4YMWA 3UJ9A 1G4AE 2IY8A 3UMGA 3THXB 4YP5A 1NSFA 1OQAA 3K9HA 2X2EA 3WG9A 2DHDA 2W43A 3IERA 3T5GA 1WM1A 3PNYA 3COVA 4N0DA 4JX9A 5DBEX 4TVBA 4DEVA 1C7EA 3IQEA 1BU5A 3NPAA 4AP9A 1PGQA 2CWWA 2ZYSA 2QNBA 2WE7A 3JZAA 4F3RA 2EATA 3NW9A 3GRAA 4MZXA 2AOUA 1DLIA 5KMGB 3VO1A 4KQHA 5FPHA 1VBMA 2RGWA 3R44A 4MQUA 3SCZA 3L05A 1SELA 3G8DA 1Z62A 4KB5A 5ICEA 3EGEA 3JVDA 2GR9A 5REQB 1IOWA 3VBCA 5SYAA 2EP7A 1RU3A 3BULA 3LLUA 1G2PA 5BR7A 2VNKA 1IEWA 2R97A 4PX2A 3EXEB 2QY6A 4IIGA 5C5DA 1EXMA 2Q7DA 2A78A 2FH5B 3WSVA 4RZ2A 3VPCA 4Q4CA 1DUVG 2HMWA 5D7NA 4ZREA 4PG6A 4FGKA 3WGMA 3F4BA 1BS1A 5EPUA 1YAJA 4IDEA 4AROA 2B69A 5EIXA 3BGSA 3SEFA 3ZVMA 3QENA 3G82C 1Y6JA 5K3CA 1E3TA 3DE5X 2AVNA 3GUZA 4FOOA 1UKVY 1Y5RA 3ROXA 5BVGB 4JUIA 1K6XA 1I3CA 4IXTA 4BNUA 5K8CA 5EVCA 1G5IA 1XYVA 1E3JA 4A0QA 1RE0A 1MDFA 3KD2A 3RYTC 4E2XA 3GLHE 3R3ZA 2REOA 1THTA 1AO0A 3D4PA 3BXGA 1HDXA 2QP3A 5A3JA 4LMPA 3ESAA 5CLQA 4KGXA 1Y7PA 4AF7A 2EP5A 4C0AC 2GZRA 3IKTA 1TNDA 4HNSA 4LXIA 3ZCRA 2DWOA 4E5NA 3TGLA 5B4UA 3PXCX 2F1IA 1NE7A 3CNEA 1LLFA 1WDTA 1YQQA 4NICA 2B8NA 2XUFA 5EUMA 5D1NA 2Y2VA 4Z0TA 5HRUA 1KU0A 1J25A 4C4YA 1SC6A 2GN2A 4H4CA 4JV5B 2O8DB 2QHXA 4R0NA 3CX6A 1UDBA 4TYNA 4QLBA 3OJLA 5LQJA 1UDCA 4L95C 4ON9A 4ERXA 2IBTA 5A4DA 4U3JA 1NMXA 4PQYA 5IKXA 2X5JO 1QKIA 1BQ3A 2J31A 4RY8A 2HT6A 2VSOA 1FJGB 1N2JA 1ZU5A 1VIAA 2PWZA 4IXWA 1LV8A 4ZA2A 5EL0A 2PZGA 5LQMA 3BXXA 2QX4A 1W9MA 2Q3MA 3QV1A 1U5AA 2ODQA 3SM9A 1P19A 4HTAA 2JFVA 2PUFA 1BROA 3DM9B 3I2FA 4N8EA 3V4VB 2HMSA 3WB0A 5JJ5A 4DR7B 2OPHA 1QIFA 2C9OA 3H04A 1ZN2A 1EFVB 2J46A 3ZWAA 5AWFC 3ITNA 2YHIA 1FTWA 4I8DA 4K1XA 4YJ3F 4I9HA 4B47A 3ZW9A 2VYVA 1W5FA 2G7MC 5HTKA 5FOVA 3EB9A 3ZLBA 3A32A 3P1JA 4FYWA 1MAWA 2INGX 3EVGA 1UH5A 2PKYX 2GETA 3BKWA 4I0WB 1Q17A 2EBFX 1YFZA 2P30A 2W2QA 4LYEA 3IPLA 3KX2A 1E3SA 1HG0A 4QFCA 3B5JA 3TIVA 4EQ6A 4KXWA 3A04A 4LXQA 3KLNA 4XYEA 1T0HB 1Y82A 3R5HA 1VP9A 4IINA 4AYTA 5IDWA 4ZOLF 3ZJTA 3M5DA 2DGDA 1PZHA 1T24A 1U2DC 1CETA 2FX3A 5CLJA 4GUAA 4EY8A 3EAQA 4Y9SA 1QS0A 3G2QA 2ZJ2A 4KP7A 4BO7A 1KAOA 1ATZA 2IHNA 1E3WB 1XCOA 3A26A 1UBCA 3BF7A 1D9XA 3LYUA 4QPCA 5M34A 2REBA 1P0FA 3WQQA 3CRRA 2ARKA 2XHEA 5B37A 1TYZA 5HJ5A 4EBBA 2P79A 5A1TA 5BNFA 3QNMA 3IUQA 1KYQA 3RS0A 2RGAA 1P2UA 2PSJA 4P54A 5KOHA 3DHYA 4NENA 3PFHA 2CDBA 3G0DA 4ATNA 1PW5A 5D85A 1XRLA 3OJEA 3GLFA 4KE6A 4L2IB 4MAMA 4D0NA 3L0ZA 1NNUA 3EN0A 1D1PA 1J22A 2RKOA 1U1IA 3BK1A 1XTIA 3B36A 2MINA 2QIPA 3K09C 4WKGA 3DTVB 3FLBA 2ANCA 2NO6A 2KPOA 1YMVA 2XCTB 1QHXA 2EXXA 3IDOA 1J07A 3QK7A 1H69A 1I36A 2Z83A 3D4LA 3KHKA 3SSMA 2ZUEA 1B73A 3A11A 3E5NA 4MITA 1QRAA 4KQJA 3DMDA 4XPZA 4HAWA 1MV8A 2G63A 2HQOA 4W5NA 3FAKA 4JWTA 1XEWX 3TOSA 1YVUA 2FPWA 1CJVC 3C39A 4GMKA 4FX2A 4RM2A 2XMQA 2ZWVA 4KK3A 4GX0A 3E9CA 4QAQA 4URYR 1XMPA 1FP2A 3K05A 4YWHA 1W2GA 5AKYA 2H52A 3ECCA 4YLGA 2GF9A 4R6XA 1ZAKA 1K5DA 2J9YB 4KXUA 2IZ7A 1GRNA 2JAPA 2RHMA 3RS3A 4CHGA 4E2ZA 1KJ9A 1RJFA 2I6TA 2M6SA 1F2UB 1UZUA 3JVIA 1FDSA 1SCIA 2E2WA 1HO3A 5TPZA 3R9KA 3RVPA 2VXBA 3KEOA 1EA5A 4Y2RA 1L5NA 4Z51A 1BW9A 4L2IA 4NE7A 1MC1A 4COOA 1QQAA 2GM3A 2FR1A 2DYKA 4O59O 3SJAA 3OZIA 3KHUA 4G84A 3OI7A 4F5EA 3OQPA 1TYAE 3BILA 1GU7A 3TXYA 3ZIUA 1OWLA 1W87A 2C4NA 3D4OA 4G9GA 4J43A 3IVMA 4QSMA 2YUIA 3O0DA 4KQ1A 2I7DA 3ZOZA 4P5PA 3AP1A 3FUVA 4R1MA 4UM9B 3VOAA 2GVDC 4DBLE 1PWZA 1X9HA 3ABQB 2DPGA 4XIIA 3SSAA 1Q95A 4KQ9A 2H5LA 2J59A 4LVOA 3GK3A 1QBKC 1CDDA 3OZWA 4M21A 3ZU4A 1NULA 1MB2A 4M8SA 1TOAA 1USIA 3Q7SA 2OFFA 5E9QA 1NN3A 1UJCA 3ND6A 1QBGA 3USES 3CX3A 3WGLA 4B5KA 4J4TA 3KVRA 1JJIA 2P6OA 2ZDHA 3PD7A 4X54A 4KLNA 4BEJA 2V4MA 3DDOA 1SU6A 2J0UA 3GJRA 4PPFA 3TLGA 1D7AA 5J4HA 2R2AA 3N70A 3QF4B 4RWZA 5BV0A 1OREA 2AJCA 2FB9A 2IF2A 1QGOA 2PRYA 1NXSA 3D8UA 3DCNA 3QVTA 4J1NA 3WIUA 1XLWA 3BMCA 1TUEA 5C8ZA 5EMLA 1RDFA 3AI2A 4Q7EA 4OHYA 5DOVA 2GZ2A 4D3YA 4YRSA 3N8HA 1TIPA 4HNRA 2OSVA 4S1WA 4TMXA 1CZLA 1K97A 3DF7A 1TMYA 4JJFA 1D6NA 2AZMA 2XQIA 4DRYA 2FP4B 3S29A 3TCXB 4LHXA 2BDEA 3X1YA 1ILWA 1KEUA 2AZDA 2EW2A 3A4MA 3H1PA 3IQDB 3QKSB 4MP3A 4M7OA 5KOJA 3HY6A 4J0JA 3INGA 2VK2A 2RCYA 1E1MA 2W2KA 4L16A 4ZO6A 1E9BA 5EJ2A 2ZJBA 4JT4A 1BXRA 2PT6A 5FTKA 3FOBA 4J94A 3HWWA 2QE6A 2O5EA 4LZZA 3L7LA 1OT5A 1S2MA 1WVGA 3FFAA 3GMIA 3BIOA 4X1KB 1ORVA 3PE6A 3QE9Y 1VA5A 3WIBA 3F2VA 4PO9A 5K09A 5AR1A 3GLRA 4DA4A 1YB6A 3KSAC 1EE2A 4M7RA 1UIMA 1LC0A 4WV3A 4NJEB 3KOMA 2C78A 4YALA 1QOZA 1VL5A 4NARA 5FUVA 3ES9A 1SQGA 4U2GA 3UJCA 3HJBA 2HR1A 1RM4A 1TUBA 1XZCA 2QYOA 2ZI6A 1YC2A 4LBZA 4U7FA 5EXDA 5JARA 3U9SA 3JQRA 2YDYA 3C7DB 1P2FA 1RM3A 1XQ1A 1YBMA 3U7HB 3VU3A 1R3UA 3CLKA 3Q7QA 4KLRA 1QDLB 3A1DA 4QDXA 3U1TA 1YMQA 2JJ8A 1KMCA 4IILA 1NJSA 4X6YA 3UAXA 4INAA 4B2PA 1IN8A 1FZQA 4N0EA 3H2BA 2CVPA 1CJMA 4KYVA 1H85A 5FX2A 1U7HA 3MTEA 2HK7A 4DIBA 1CYEA 4EYQA 3F3YA 5L4NA 1I33A 5A4JA 1YTUA 1UC5B 1Y9AA 1ZRMA 2DWCA 3AWDA 4MW2A 3WWOA 1H0KA 2UZAA 4WE3A 3AKDA 4RD0A 4OMUA 3AVUA 2Z9DA 1RKQA 1Z2OX 2RGNA 1X1BA 2J41A 1NY6A 2PJUA 2ZRGA 2GPWA 3IMKA 3V1KA 1P1JA 4AUNA 3A2LA 4EG7A 1QGUA 3RLIA 5HDBB 2WABA 1EUQA 4YAGA 4I5DA 4YJFA 2AHRA 2PK3A 3NXSA 4O08A 4EO7A 8ABPA 4YPFA 1O97C 1K7YA 1EHYA 4OHWA 1F4VA 1LBQA 2UVPB 2ZM5A 4Y1EA 5T6BA 1BG6A 1FS6A 2YZGA 3QPWA 4PGFA 2VO1A 5BN3A 2MYUA 3TG8A 2UYGA 2C3MA 3JY6A 1FDOA 4RLSA 4MV0A 1BHJA 4DR4B 2LBPA 1L5GB 1JPUA 1ZM4A 2P27A 4MSUA 3R9WA 3JQBA 1AUXA 4EKEA 5IJWA 4RVHA 2ZRFA 5T4EA 1HLPA 3S2IA 2X5OA 1BSVA 1E69A 5IDVA 2ODBA 3O74A 1MOQA 3E9NA 4GBJA 2FXVA 3I9FA 4RDCA 3K31A 1K3TA 3KTAA 2PX5A 3TQTA 5IZ4A 4H1HA 3CY6A 4ME6A 3WJ1A 4I8XA 1PFGA 2Z30A 1T1SA 2DCUA 5AK6A 5T4BA 2A5FA 2PZMA 3DFIA 3L4EA 3RWOA 1D8TA 1E8DA 2WQ6A 4C0SA 2JAXA 1JR6A 4BVKA 2OORA 3NHJA 2ECQA 4ADSG 1NG9A 3OSUA 4YVFA 2ZU0C 5AI8A 5BR4A 4DR3B 2DEUA 5A3VA 1N3BA 4FZJA 2FOIA 2EL9A 2L17A 5SY6A 3W1WA 1J0BA 2B4RO 2BTQA 4OJYA 4FKBA 3C3BA 4JN6B 1X8LA 4A6EA 3LFTA 1ZIOA 1Z7YA 3KQPA 1U8AA 2CL7X 4JCCA 4M1EA 3WLAA 2C03A 5L7WA 1NLFA 1XZEA 1GA1A 1X86B 2C4WA 2ZYDA 1CUAA 4M1QA 4NE9A 1IY2A 1SEPA 4QU5A 4MR9B 2Y05A 4A2CA 5A0TA 1BRMA 2JBHA 4P4SA 5AJXA 3T9CA 1X70A 1G42A 1NVBA 2JCGA 2B7BA 3FNEA 4CKWA 3W4KA 3ZGLA 2AC2A 3OP1A 3VX4A 2GAFA 3DLTA 4NDAA 4ZXPA 3W2GA 5AMXA 5JG7A 4GWGA 5B64A 5K0TA 1R50A 1QVRA 2YOHA 3SKYA 1Q11A 2P2DA 2MR6A 4X94A 4LI0A 1KI8A 2QU8A 3GVXA 4TMTA 2I3ZA 4EHDA 4QLAA 9LDBA 1IWOA 1QLWA 4F2GA 3HBFA 1ETUA 4AJEA 2W2MA 3KUUA 3WC4A 1GLNA 1OLSB 2XVXA 3N2YA 1NA5A 2REQB 2HA5A 4LF5B 3RR2A 3LC7O 5EKDA 4TS1A 4LY0A 4MW7A 2EX1A 1MIHA 1HEUA 2WHQA 3DO8A 2VRBA 4Q7LA 4I2VA 1X3LA 5A4IS 4TTRA 4AJPA 2PZ8A 4DSTA 2DAPA 3U16A 1QP0A 3GGJA 1U6JA 3CLRC 4TV8B 1QP8A 1SOUA 1XQVA 3U19A 3EIUA 1Z3IX 4XJSA 1C7RA 3FDXA 2VXYA 3GJSA 3LC0A 1NPYA 3RAJA 3OKCA 4BRWA 3A8TA 1QTQA 3O7MA 3PK0A 4ZCIA 2XUAA 2DWPA 1A88A 1ZJZA 2HQRA 3QKRB 2EZ4A 1EFLA 10MHA 2QD5A 4MW0A 1JVBA 4U7JA 4P93A 4JEIA 3MRXA 3H2SA 3O8BA 4YRIA 2IHVA 1JAIA 4PX3A 1LUAA 1Z28A 3EYWA 2HPVA 4Q4JB 5AKEA 3F7MA 1NDHA 1KEEB 4Q00A 4HDCA 3HYTA 2P2ZA 3LVBA 3UA3A 2CLOB 3R3UA 2Z6QA 4ZO7A 1AV6A 4FFWA 5BMVB 3A1SA 2VCEA 2IEZA 3FCEA 4R8VA 1RSZA 5K9ZA 2JANA 3AL0C 1YWGO 4FCCA 3PTAA 3KFVA 2V7PA 2OZLB 2XW6A 4OJNA 4CQJA 4TUYB 3RS8A 1DXYA 2JJ1D 5F98A 4RY9A 1OX5A 3D1VA 4WNAA 1CE8B 2JK0A 3EVCA 2I2CA 3V2HA 4KK4A 2VPZA 1PT7A 1BH2A 5HIKA 3TQCA 4ZAYA 3E9EA 2Q2WA 1AB6A 4RK4A 2Z6UA 1BRTA 1N2GA 2IYPA 3ZIAA 5C3UA 4NCAA 3WS7A 4DE5A 4OK5A 1CS4C 4OHFA 5AVOA 4ZVNA 4DQ0A 4DMFA 3QLTA 2RJNA 4KHZA 4F97A 3G2MA 3BPSA 4NF2A 2O1EA 1Q92A 3QEOA 2AH5A 3NC4A 3WWPA 1H2WA 1W46A 1QS0B 5C1OA 2HWUA 3HXMA 5GONB 3MT9A 5I7EA 5HPYB 3EOAI 4JLJA 2GAOA 1HT3A 1LFAA 1YZYA 3SR0A 3KAJA 1I94B 3OLWA 2XT6A 1HG1A 2GVNA 2RAVA 2Q2VA 1QLHA 5F2OA 3GI1A 4O2BF 4UUAA 2AJBA 4EEXA 1N1MA 3HZZA 4NDZA 4Q6BA 4F6RA 3AM1A 2XA1A 4JR0A 4OXXA 4TV9F 3PYXA 1S7GA 1PFQA 1UCFA 2E4WA 3DMPA 4LZJA 1NI4A 4J7CA 3RSZA 4L7QA 4G9EA 4POOA 4HRAA 2AXEA 3MVEA 1H2YA 2WIBA 2A5JA 2DSTA 4HWRA 4HH0A 4BHTA 3CUEF 3AFHA 3SS8A 5FIUA 3LHKA 4CNBA 1KIFA 2WWRA 4ROTA 2HSJA 1D6JA 1VXOA 3DBLA 1VFPA 1K9SA 3I6YA 3KV3O 1KZ6A 3IB3A 1SVNA 3Q9SA 1KMMA 2DE0X 4LPSA 1FTQA 1SBCA 4HDQB 2Q9BA 2H4YA 3M2PA 3OLQA 4NX2A 4BP8A 1Q1NA 2HHJA 4IQ8A 3G9QA 4REQA 5GONF 2OC4A 4CWAA 4FQ8A 1NONA 1V4NA 3KOWA 4LY6A 3PTZA 1ABFA 1L3IA 2JIBA 2GLXA 3OEED 3PEYA 2CHEA 3ZQ4A 1C4XA 1EMDA 1GPAA 2VDVE 4PHHA 4AKTA 4Z86A 3LIIA 1CY6A 4ZEMA 1EVQA 3I01M 1KVRA 4EH1A 4HQLA 4AT1A 5JD6A 3S8MA 3UF0A 3F97A 1FUUA 4Q12A 4AZVA 3WL5A 1Z8HA 1WJGA 2ZRQA 3DV2A 4NNOA 1MFPA 3L8ZA 2AEMA 3AUFA 1DHRA 1N3YA 4XR4A 3FFBA 1ISFA 4RLHA 4QELA 4P0QB 3IOBA 1ZOIA 2IXFA 1T2CA 5F7ZA 1DX4A 1RP1A 2D1FA 3DT8A 1FUYB 3KSZO 4L3OA 2FPGB 1H0RA 2HA4A 3EEIA 3FYHA 4G01B 4OGFA 4ACBA 3T9FA 2OV6A 5FO0A 5F21A 1AXRA 3FYUC 4TGLA 5E7JA 3ID6C 3L6RA 3Q8XB 5CLHA 5F3DA 3RSQA 2I54A 1O77A 2P4SA 3QV2A 3G0CA 2GK3A 4QXOA 5FV7A 3SXUB 4XVRA 2ZJOA 5H4HA 5JD5A 2OOSA 2Z1MA 2IHTA 2XVMA 3KKZA