4RDIA

Crystal structure of e. coli trna n6-threonylcarbamoyladenosine dehydratase, tcda
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
266
structure length
246
Chain Sequence
SVVISDAWRQRFGGTARLYGEKALQLFADAHICVVGIGGVGSWAAEALARTGIGAITLIDMDDVCVTNTNRQIHALRDNVGLAKAEVMAERIRQINPECRVTVVDDFVTPDNVAQYMSVGYSYVIDAIDSVRPKAALIAYCRRNKIPLVTTGGAGGQIDPTQIQVTDLAKTIQDPLAAKLRERLKSDFGVVKNSKGKLGVDCVFSTEALVYPQSSGFGAATMVTATFGFVAVSHALKKMMAKAARQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Escherichia coli TcdA (Also Known As CsdL) Reveals a Novel Topology and Provides Insight into the tRNA Binding Surface Required for N(6)-Threonylcarbamoyladenosine Dehydratase Activity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords tRNA threonylcarbamoyladenosine dehydratase
total genus 73
structure length 246
sequence length 266
chains with identical sequence B, C, D
ec nomenclature ec 6.1.-.-:
pdb deposition date 2014-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4rdiA00
1ZH8A 3SLGA 3ORFA 4IDAA 2VNAA 2YDXA 3K31A 2VHXA 4XB1A 4OM8A 4RVGA 4O63O 3WGGA 1K6XA 1WLYA 4I5EA 5IZCA 4D7AA 2OGUA 2VYND 4BNIA 4YT4A 3DXFA 4Y67A 4UUOA 4ESOA 1QYCA 5CDTA 3ITKA 3OEYA 2NQ8A 2GGSA 2PGJA 4JBHA 5T5QA 4W4TA 5G0WA 1Q7CA 1L7DA 2ZTVA 4B3JA 2YHIB 3KBOA 3ZWMA 4BNFA 3DBLB 3WDSA 5T67A 4D3SA 4Y8VA 1PQPA 2VN8A 3PHJA 5F5NA 1TEHA 2AHRA 2DKNA 4GAEA 4WASA 3ROQA 3OBBA 3KYCA 1GYQA 3PDJA 5DCWA 5KTKA 4BGIA 4RORA 1I3NA 3F3SA 2CSUA 3WOHA 3OH8A 3ANLA 3NX4A 2UAGA 3A14A 1Z7BA 1Y5MA 5JCJD 4E3ZA 1CQIA 2CDBA 2PZMA 3KSUA 2X5OA 4KUGA 4AJ2A 2HCTA 4MVJP 5IZ4A 4OSOA 4BNGA 2P2SA 3I9NA 4TSKA 3T4EA 5COBA 5J23A 3QWIA 2HMTA 3K92A 1GV1A 5TS3A 1GL3A 3GY0A 5CPBA 3O9ZA 2VHYA 2A9FA 2HU2A 3ZWNA 3JQFA 1HWYA 1LLQA 1VI2A 4KMSA 1IUKA 1Z6ZA 3GG9A 5F5LA 4YRBA 3KXDA 3P2OA 1I36A 4OQZA 2UYYA 2WYWA 4MP8A 2I3AA 1NYTA 2ZB4A 1MXHA 1I2ZA 1ZSNA 2D8AA 3W1VA 1ZEMA 2Y0EA 4RGBA 3H3JA 4LCEA 3HG7A 9LDBA 4XYLA 2W2KA 3ASVA 1LDBA 4WEQA 2ZKLA 5JW6A 1N1GA 4LK3A 1A4IA 5KCZA 1W8DA 4U7WA 3MOGA 3DZJA 1M66A 2B0JA 2JCXA 4QEDA 4YJFA 3ONFA 3QJ5A 1Y9AA 4DLBA 4ONEA 4ZA2A 4YACA 1I0ZA 1LDEA 1P1JA 4DRYA 3FTPA 1X7HA 1D3AA 1FJHA 4RCVA 3H65A 2OZPA 4BGEA 1I3KA 5JAQA 4INAA 5A5FA 5COAA 1A9ZA 2EGHA 3B1KA 4J1SA 2GCGA 3M2PA 2F00A 1DLJA 1GQYA 1PZEA 4R1SA 1E7SA 5G4KB 1NVTA 4H3VA 1E3WB 1XHLA 3I52A 1GUFA 2W2LA 4PLTA 4DIOA 2YHUA 5ENVA 3TFQA 4XIJA 1E3WA 1DLIA 3KHUA 1D1SA 6ADHA 2DBRA 1T2FA 3JQ8A 5TC4A 1O0SA 1NVMB 1LLDA 2Z5LA 1T2EA 1ZK2A 2WD7A 4HKTA 3ZGYA 3GVXA 5DF1A 1V3TA 3LQFA 2A92A 3HJAA 1VM6A 4DLLA 2CF6A 4F6CA 2X0RA 3KLPX 1U3TA 3PFWO 3PYLA 2WJPA 3I6IA 3PJGA 5DBFA 4YYZA 1H2HA 4D46A 1G6KA 5CDUA 3FWZA 1X15A 4RPHA 3CPSA 1R15A 1YWGO 2HMUA 1NQAO 4YT2A 1U3WA 4GLOA 3PLRA 4RPGA 3ZCXA 4ZJUA 5IZCC 3ONEA 2CMDA 4N7RA 4BNUA 1IHXA 1R0LA 1KIFA 1XGKA 3L9XA 1NWHA 4OHUA 3GGOA 5MDHA 4W9NC 3AW9A 3OSUA 1MGOA 2C29D 3DB2A 3UCFA 3FNFA 4A26A 2EWMA 4RVDA 4YJGA 1E3JA 4UEOA 3DOCA 5BT9A 4IM7A 3U49A 3EMKA 4E2ZA 2PKQP 1L7EA 4J0FA 3IKVA 4WE3A 2IYOA 2NUAA 4FJ1A 4Z6KA 4TVBA 3ST7A 3WFJA 4IZIA 3V5NA 1OAAA 2DTEA 4DBZA 4KQWA 1DJNA 4EITA 4MO2A 4E2YA 3W4KA 1I10A 4J1QA 2C5EA 4LRSB 4FD3A 3VH4A 4FQ8A 3EC7A 1PL7A 1U9JA 4ZN6A 2FZWA 2A4KA 3QVWA 4P4GA 2DPHA 3K73O 3RQSA 2IEDA 2P9GA 5F1PA 1O5IA 3GC6A 1GUZA 3H5AA 2Y93A 3ZW9A 1EVZA 4E32A 1E1LA 3PFFA 3NEPX 3VHRA 5JS6A 1K5HA 4RZHA 4GX1A 4ALNA 1DAOA 1B0AA 4BB5A 3WGTA 2XAAA 4Z9XA 4BO6A 5JO0A 4YJHA 1F17A 1H9AA 1UXKA 4QTZA 3O8QA 5L9AA 2QG4A 3HHPA 4I9UA 3WYCA 1UXGA 4D0SA 5KVCA 1UP7A 2W90A 1PJ2A 4MVJE 3RSHA 5LCXA 4CQLB 4I9NA 4AJ1A 1NM5A 4FN4A 1Y8RB 3C1TA 1PU2A 3GN1A 1VJ0A 1ENOA 3C3XA 1L1FA 3JQBC 1I01A 1BG6A 3JQBA 3E82A 3LF2A 4A2CA 2H6EA 1HE3A 4HUJA 4ZQFA 3WBFA 4L4XA 2AXQA 1HL3A 3L6OO 1ZKMA 3GOHA 4YA6A 1UAGA 4A5OA 1LLCA 2O7QA 4CV0A 4J2OA 4R41A 4DIFA 1YQXA 2DBQA 4AJLA 4CV3A 3M1AA 1N8KA 2DAPA 5L45A 1SCUA 3R0IA 2LDBA 3JTMA 5TT1A 1JU9A 3LT4A 2Q1SA 3DMTC 4GBJA 4IDGA 3U4DA 4WOJA 4CM4B 5C7LO 3D4NA 5I8WA 1YXMA 5JBIA 4B7CA 4DPMA 3SVTA 1SEPA 5ER6A 2I3GA 3L0DA 3PHHA 5L95A 1MFZA 3VPFA 1LRJA 3ITDA 1WXDA 1WW8A 1N9GA 4UUPA 3TL2A 1UXHA 4BO2A 4MJLA 3AY7A 4ZU3A 4UEJA 1NFQA 3G79A 1QMGA 4ZQBA 3WNVA 4EW6A 4ZVVA 5DCUA 5JAZA 1BRMA 5AXAA 4ZHSA 2C20A 4LVCA 4L8VA 1BWSA 1AGNA 2PR2A 4IQGA 4CR8A 3H9QA 3D0OA 3DFUA 3FNHA 4M54A 1RYEA 4YRAA 4M89A 4HADA 3Q9NA 4KOAA 4JROA 3JQ6A 4ND1A 3M2TA 4YJGB 5B4TA 4L0QA 2GPTA 2EG9A 2O2YA 1RYDA 2OOSA 1DXYA 1MP0A 1ZXBA 2ZATA 3DZIA 4R16A 4HFNA 2NQTA 1SO8A 4DMMA 4TZKA 3NT5A 3QWAA 3LT2A 4AJ4A 3MTJA 4WEOA 2OMEA 2GNAA 1PSDA 2DTXA 3ZWYA 2YZ7A 4CLXA 4U8GA 2ZB8A 4YQZA 1K3TA 1P1KA 1EDOA 2GASA 3HDJA 4QT0A 4YDRA 2WYVA 2Y0DA 2X9GA 2EERA 1BDBA 3SC6A 2CDAA 5L4SA 1I8TA 2OP1A 2P68A 2UUOA 1GDHA 4NHEA 3E8XA 1QRRA 1PJLA 5CDGA 1RM3A 3AI3A 4ZRMA 4NBWA 1BTOA 5BSEA 4GKVA 3RBZA 2DPGA 3SXPA 3S2EA 3A06A 3OJLA 4I5DA 3VOSA 1ISIA 1LDGA 1X1EA 1KC1A 4LCJA 2FSVA 1O9BA 3JQAD 1WZIA 2DC1A 3UOGA 4TKMA 4BMVA 1W4ZA 3F46A 1P1HA 2O3TA 4MVJG 1EBUA 2R2GA 2XOXA 3LZ6A 3M6IA 1NPTO 4EI2A 1F14A 4WUVA 1G0NA 2P4HX 5TT0A 1UP6A 3NV9A 2EEZA 3WTBA 1PJQA 3HN7A 4MIEA 4BKUA 5IDQA 2O48X 5ILGA 1J4AA 3KO8A 2ZTMA 4OMUA 3JYLA 5A03A 4FPXA 5ENDA 4J7XA 3UHAA 4BO5A 4ITUA 2R00C 5GY7A 4E0BA 3SJUA 5CDSA 4FFOA 1GAEO 4NR0A 2GZ2A 4NNJA 4PLPA 1J5PA 4KDFA 4DPKA 4WLFA 3D4PA 2VWHA 3CH6A 1C0LA 2VWGA 4PG5A 3D3WA 4PRKA 3CKYA 4R54A 4TWRA 4LGVA 1BXGB 1Q2XA 4H15A 5JO9A 4GX2A 5JLAA 4B4WA 3QP9A 5JC1A 3NKLA 4CM9A 3PWSA 1DRUA 1U5CA 4CR6A 3VH2A 5EMHA 4TVOA 4I5GA 3DZKA 4WCFC 2JFFA 1JQBA 1EEHA 2AEFA 4UUNA 2NWQA 5A9SA 2NACA 4WLVA 3X2FA 3NAQA 3DBHA 3KUXA 5FFFA 3GNSA 4K9DA 3GQVA 3VKVA 3MJ4A 4J2HA 1VC2A 5CFZA 2EGGA 2H9IA 2AW5A 3F6YA 3RFVA 4KDEA 3EUWA 2X0JA 2X58A 3D64A 3FBGA 4RL6A 3N74A 3COSA 3VC7A 4JJGA 1U2GA 2GSDA 2OL4A 3G17A 3GT0A 5HS6A 3V2UA 4UREA 1B26A 3UICA 4EJMA 2ZIZA 3VZRA 1YONA 3H6KA 4E6PA 4J7CA 3BMCA 1WPQA 2C59A 1DC6A 3GFGA 1KVSA 2X9NA 5JY6A 9LDTA 4N54A 3KYCB 1HT0A 1P31A 4NBRA 3WFIA 2B69A 1S6YA 3BYZA 4TRJA 1FDVA 1AXEA 3HB4X 4P38A 3U5TA 3HSKA 3KETA 2HMVA 4GGPA 4NJMB 4DREA 2QIOA 3PQEA 2Q49A 5JY1A 3IDSA 4OL9A 1EVIA 5G2OA 2DVMA 3GFBA 5HA5A 4RVUA 4UVIA 1B2LA 1TT5A 1HDXA 3FNGA 4NBUA 4CQLA 4IDDA 4IJVA 3CMCO 4XGKA 1UAYA 4FFNA 3FTNA 5IXYA 4RDHA 2X22A 3GMSA 4IINA 1PGJA 1X0XA 1KVUA 4OJNA 3IUPA 3GDOA 5COQA 3FWNA 1H6DA 1ZK4A 3S2FA 4CLEA 3WTCA 3B70A 3U4HA 4YJHB 5L51A 5L7YA 1Y8RA 5DNAA 3VZSA 5GZ3A 1DDOA 4C7KA 3DTYA 4DLAA 4Q39A 5L7WA 1PIWA 1PJSA 1ID1A 4J43A 2WYUA 1WWKA 3C8MA 4GPD1 2P91A 5A05A 3WQQA 4ZGWA 4WECA 1DFGA 4Y98A 3SJ7A 3PJFA 4BO7A 4NJMA 1ZNQO 3WG9A 4RF2A 1Z73A 1PJCA 3DONA 2NU9A 3INGA 3GPDG 3E5RA 3R6DA 5FWNA 3SBOA 4J9VA 5T6BA 3ZU4A 4HV4A 4W7IA 5K6AA 2PH5A 1EE9A 4RVSA 1NFRA 3HADA 3QVSA 4KTTE 3U62A 1LQUA 4RLHA 1E77A 1KOLA 1YE3A 1C1XA 3WYBA 1PQUA 4NIMA 1VL0A 1EDZA 4WOKA 3FN4A 1NQTA 4I9HA 3TZKA 1ISFA 4ID9A 2VNSA 3K30A 3WGYA 3Q6IA 3HDHA 3GR6A 2IDZA 3OIDA 5TX7A 5JXWA 4J0EA 1ZK1A 3INRA 4U5QA 2J8ZA 1O8CA 4RPLA 4A73A 2AQHA 2G5CA 4O5OA 3AUSA 1YVEI 2PKQO 1VKOA 1H6BA 2AEMA 3AU8A 1R37A 3TZHA 1I2BA 5A9SB 4ALIA 1UP4A 3OFSA 3QQPA 2OFPA 4DWVA 3WR5A 2P5UA 1E1MA 3SEFA 1NR7A 3IS3A 1EBFA 1VE9A 1PZFA 1GCUA 1FF9A 4QUKA 2CUKA 3OA0A 3LT1A 4L73A 1WDLA 2FHSA 1GTMA 4WK6A 4UEKA 3FHLA 5JAIA 1M67A 1I3LA 1QSGA 1FDTA 3SLKA 1DB3A 5JDCA 2D5CA 1ULSA 1TLTA 3VPXA 5EESA 1LC0A 4PVCA 3ADPA 3AI1A 4OSPA 3WX0A 5EJ2A 1X1TA 1UH5A 4XQ9A 1GYRA 4MIOA 4CR7A 1MV8A 3WSVA 2CVZA 3QVXA 2GZ1A 4PZDA 4Y6RA 1RKXA 1ZJYA 5KJ6A 5THQA 4W82A 1E7RA 3EGOA 3ANNA 2GD1O 3OMLA 1SC6A 3BHMA 1R6DA 5KVQA 1Q1NA 1UXIA 4PLGA 1LQTA 2D5AA 5KJFA 3NUGA 1NWCA 1P0FA 1YBMA 3U0BA 3WXBA 2VOJA 2J6IA 1C0KA 3I9JA 4E21A 5ICSA 2BFOA 4RQUA 5JSFA 1X13A 1OC2A 4JNKA 1KEUA 1MX3A 2FPGA 4H16A 2BGMA 3PRJA 2VCYA 2CDCA 2ZTLA 4CLOA 1O6ZA 3BA1A 3DQPA 1W6UA 1PL8A 2H5LA 3E1KA 5CP8A 3HUDA 5TRTA 3GEDA 3F1LA 3GGPA 4IJKA 1YRLA 2DFVA 4YJFB 1WDMA 2IZ1A 1GQ2A 2DU8A 1HDZA 5EIOA 2BMAA 2B36A 4M86A 4WLOA 1HYHA 2VZ9A 3TPCA 4D41A 2ZQZA 1ZMTA 4E31A 5BSHA 3UVEA 1XIVA 1MXFA 5JC8A 4FC7A 5TIIA 2WTBA 2X9VA 1FMCA 1N7HA 3G1TA 4RDIA 1DIBA 2D0IA 3FRJA 4PLVA 2NADA 2PZKA 1PX0A 5FF9A 2DTDA 5BNTA 2NVBA 4PZEA 3DZGA 4A03A 1BSVA 2ZK7A 1A4UA 2YY7A 4EJ6A 2WE7A 3FPLA 3JYQA 4EUEA 5LDGA 4R01A 3WNQA 1ZK0A 1PZHA 3ENKA 3NT4A 2YUTA 3AU9A 2V6MA 3WGIA 2HSDA 4P22A 4DMLA 2AG8A 4CMEA 2C7GA 4JBGA 1DRWA 5KVVA 3PIIA 5ADHA 2VTDA 4DIBA 5I7SA 4OIMA 4A10A 2NSDA 4CMGA 2AQKA 3V2GA 2E6UX 2D3TA 2EKLA 1I30A 2EV9A 2E82A 4YR9A 7ADHA 4E2XA 3NTRA 2W98A 3DC2A 4GX5A 2V6GA 3RJ9A 4E5PA 3P19A 1DPGA 3WIEA 4BV9A 5BNFA 4AG3A 3MOIA 1ZO8A 1LSJA 2VYNA 2A35A 1XKQA 3JYNA 5A06A 1TB4A 1ENPA 4HFMA 4ALMA 3ZWBA 5L4LA 4MVJF 4E33A 4ZD6A 2J3JA 1F12A 3L4SO 4CM4A 3EZYA 4R3NA 5L40A 3GG2A 4IMPA 4O59O 3AJRA 4BNMA 1I3MA 4M55A 1ZUD1 1R16A 2BH9A 3HN2A 1IL0A 1HSOA 3QWHA 1J0XO 1DIRA 4URFA 2VQ3A 1X7GA 2C54A 4CMBA 2IZZA 1HETA 3JD4A 1XEAA 3BXXA 4D3DA 3AOGA 3QWBA 2B5VA 1RM0A 4OKIA 2XXJA 1EQUA 2AE1A 1TT5B 3Q9UA 4UVHA 1C0PA 1R4NA 3TOZA 3BMNA 4BQPA 4CMAA 3IUSA 3PEFA 2I76A 3W6ZA 3MWEB 4XQEA 4QFDA 2X23A 5ICMA 1XU9A 1Z74A 1X14A 3H5NA 3KSDO 1I2CA 3ZHYA 4CV2A 1JDJA 1DOHA 1BHSA 4K1LA 3T7EA 2B83A 1SPXA 1B3RA 2VUTA 3OEWA 3H4VA 1E5LA 4XR4A 1YJ8A 5FEUA 3PHGA 2PV7A 4B3IA 3UN1A 3QSGA 4AJKA 3HE3A 5DOZA 1EE2A 3GN2A 1LU9A 4YBZA 1GV0A 5BR7A 1JWBB 3U09A 3AM3A 1C14A 3FR7A 1ISJA 4EZBA 1SB8A 5DBIA 3ZNPA 1JVBA 3LSYA 3LT0A 4N5MA 4XYBA 1GPDG 2HDHA 2Q50A 3PWZA 3UH1A 2V65A 4EJ0A 2O3QA 1ZW1A 4RLSA 3JD0A 2YV2A 3EYWA 3BMOB 3UFXA 2EKQA 4PG8A 1PWZA 2AA3A 2PA3A 3SX2A 3TWOA 4LSWA 3UCXA 3ETDA 4E5MA 4CM3A 4YXFA 2C82A 3LC1O 1H6CA 1YL7A 3DOOA 2QHXA 4NU5A 3MZ0A 3FBTA 1CERA 2JFHA 4IIVA 1V35A 3UF0A 2EKPA 3WGQA 1K2WA 3D4OA 4BKQA 1AUPA 2JL1A 2Y68A 4MVJD 3ZW8A 1GYPA 3RC9A 2Q1WA 2Q45A 1KBZA 3UXYA 1HDRA 4AJNA 3PTZA 3WGZA 1V8BA 4OKNA 3PZRA 4WPGA 4YAKA 4YCAA 3GLQA 2EJWA 4ZQHA 4RJTA 2O4UX 1NR1A 4WLNA 4D45A 4DYVA 3PIDA 4FC6A 1W0CA 2TMDA 2HUNA 3VDRA 2JCYA 4BS9A 3GRPA 3ETGA 1XG5A 1XA0A 1A9YA 1D7OA 3BTUA 3DAPA 4W99A 3L07A 4RPJA 2YYYA 2EJVA 3ROMA 4E5KA 1GADO 1CYDA 2IRWA 1UDBA 1VJ1A 5I7VA 5G4LA 5TSDA 4JLWA 1UUFA 2E48A 2Y05A 3VH3A 3G3EA 3N58A 4GVLA 4LISA 3GNTA 4WKGA 2NTVA 3ZU3A 4JX8A 3JQ7A 1WZEA 1NPDA 4PLHA 3WGOA 4XJTA 3PJEA 3CTMA 3ANMA 3ZDFA 4LN1A 4JBIA 4DUPA 5TJ9A 3KZVA 1YB5A 2NU6A 3WQRA 4ZICA 2EF1A 1ENZA 1U7TA 3GAFA 5G4KA 3RBVA 4MINA 3ZU2A 1ZFNA 4IIUA 3VH1A 1NVGA 3TDKA 5JPIA 2X0NA 5THKA 1CF2O 1LXCA 4II3A 1UZMA 3E03A 1FXSA 4PN3A 3AY6A 3WIDA 1Q0QA 4JIGA 4CMCA 1O94A 3NTQA 3PP8A 4NMHA 2O2SA 1CWUA 1KVTA 1NFFA 4WGGA 1HE5A 1YL5A 1MFPA 4KZPA 1SNYA 3ON5A 5F1KA 5AXDA 1I5RA 1SEVA 3F5QA 5HBRA 1O89A 3EHEA 2WSBA 1P44A 3OIGA 4A0SA 1ADFA 1A7KA 2IXBA 4BNNA 5CEFA 3S8MA 4YT5A 1WAMA 3AOEA 4XKJA 4ND4A 1BMDA 1F0YA 3IL2A 3WYEA 3X2EA 3F4LA 2Q3EA 4OAQA 1VSVA 1KY4A 3TFOA 2CD9A 4D79A 4NPCA 4XRRA 3VDQA 1CJCA 2GN9A 2Q2VA 4GWKA 3AFNA 1E7MA 5AXBA 3QW2A 1VKNA 4LVUA 1GPJA 2I6TA 1LUAA 2DBVO 2X4GA 1V6AA 1XR3A 3RBXA 1XLTA 3DHNA 5KOIA 3JV7A 3TQHA 1MLDA 4UULA 3BMCB 4RQTA 1F8FA 1S7CA 1UDAA 2VZ0A 2VYVD 4XD2A 4AJPA 4FJ0A 1KS9A 1A27A 3G0OA 3RUDA 3DBRA 5CEJA 4FJ2A 3F47A 3KLMX 4NJOA 1B16A 4X54A 1ZBQA 3H5RA 4MDHA 4IBOA 1IULA 3BTSA 1HYEA 1KETA 3O38A 1SAYA 1QV7A 2JD0A 4K6CA 5G0UA 3WJ7A 5H81A 3PQDA 3RUFA 3ETEA 1NAIA 3VPHA 1SBYA 3PHLA 1BVRA 1NP3A 3PGXA 1Z82A 1DFHA 2BFAA 4NBTA 4I5FA 2DQ4A 1IY8A 2VRBA 5KJEA 2XPCA 2VT3A 3LK7A 4NFYA 4XCVA 2DUWA 3H7AA 4E5NA 1BXGA 4DVJA 3L77A 2FWMX 4FFMA 1M75A 2CZCA 1H0KA 3KEQA 1LLUA 3DR3A 5DCYA 5HS4A 5AVOA 1CDOA 1HYGA 3ZI0A 4JGBA 1Q7BA 1ENYA 2Y66A 4NI5A 3VZQA 2BKAA 2LDXA 3MWDB 3RFXA 1P9LA 1YBAA 4B8WA 4BOYA 3EY4A 4RV9A 3AI2A 3BHIA 2O3SA 5GZ1A 4J4BA 4NK4A 2PY6A 1KYQA 5ITVA 4YAJA 3ZU5A 1NNUA 1ZXLA 3C7DB 3PI7A 3UAGA 4CMHA 4QO7A 1N2SA 1KERA 2XXBA 3W4IA 1EVYA 1HZJA 3RIHA 3JYOA 1PJ4A 6LDHA 5C37A 3PYMA 3BHJA 1IB6A 1WP4A 2Q2WA 2CFCA 5FI5A 4CUJA 1EUDA 3PXXA 4OH1A 4CM6A 1A7AA 4DL9A 1J6UA 4XZ3A 1AN9A 1XYGA 3ZHBA 1JA9A 3WJAA 4BO3A 3NJ8A 1OFGA 1NASA 3WBBA 2GF2A 3RC2A 5IF3A 1T2AA 3PJDA 3LC7O 5LDHA 1J49A 4HXYA 4JP3A 4RF3A 3RUCA 1MC5A 1EUCA 3JD2A 3OQ1A 3FNEA 3OP4A 2J3HA 2UVDA 1YOVB 5DULA 4IXWA 4BNLA 1FDUA 4DQUA 4I1IA 5B4UA 4MOWA 1QXSA 1K89A 4QQRA 3DL2A 4KWHA 1EQ2A 1R12A 3PDUA 2J5RA 4R5HA 4CLRB 1RPNA 5CG2A 2NVWA 4ILKA 1JKFA 5IDYA 2ZYAA 1VSUA 2VHVA 4R4JA 5I9LA 1Z45A 4BKOA 2NM0A 2JKVA 1ARZA 2FR8A 2DFDA 2GUGA 2HK9A 3N7UA 1B3BA 2HQ1A 5L3ZA 3K2EA 4Q9NA 3G49A 2IE0A 1R66A 2ZCUA 5MGBA 2Y67A 5C5IA 3ZV6A 3CMMA 4XR9A 4J3FA 3A28A 5AQ1A 3BMOA 3DEYX 2JHFA 1NHWA 1DEHA 3DZBA 3HDQA 1H5QA 3KOUA 1ADGA 3OETA 5AYVA 4PVDA 2NNLD 3UGKA 4HX5A 5A04A 1DIGA 1QLJA 4AICA 1ZEJA 4C7JA 4KWIA 3IQDB 3AY3A 3GA0A 3I1JA 3AUAA 4XQGA 2YW9A 3ULKA 5B1YA 1B8VA 2I9PA 1YS4A 4I08A 4CMKA 4GMFA 4LRTB 3AUUA 3NDJA 4B4OA 2QRLA 1JN0A 3DZFA 2ZCVA 3MJCA 4ND2A 4U0KA 2P4QA 1TT7A 3MEQA 1ISHA 1T1RA 3MJVA 4IGFA 4D3FA 5JDCC 1GCOA 1GEGA 1YB4A 1OOEA 3OJ0A 4II2A 2O4CA 5KVSA 2AG5A 4QSMA 4P4LA 7MDHA 4ALKA 5KJCA 1QYXA 2JAHA 1T4BA 4PLFA 2RHRA 1HKUA 1UZLA 4H7PA 4CL3A 1JLLA 4J6FA 3GNQA 3PGJA 2BHLA 1ULUA 2PFGA 2FY8A 2Q2QA 5U1PA 3RAJA 4PCVA 2YV3A 4HBGA 2BI8A 3PLNA 3QLJA 4OGWA 3JQAB 2WD7B 1D8AA 2B4RO 4TZTA 4TRMA 2J5KA 4O0LA 4EEXA 3BMNB 5JMWA 1W73A 3ICPA 2V6FA 3ZHZA 2PGLA 2IXAA 4G81A 3ZWVA 4ALLA 1HLPA 5K9ZA 3ZWAA 2X0IA 1PGPA 3S2GA 1E0DA 4ZQGA 4XEHA 4BL5A 3DOJA 2I65A 3WGHA 4FCCA 1HDOA 1Q0LA 3ENNA 4BB6A 1XQ1A 5C7IO 3JCZA 2A94A 2C7VA 2OBYA 3GZ4A 2PH3A 3G1UA 2RH4A 4CMEC 3OJFA 3KYDB 4CQMD 1U3UA 1DSSG 4CL8A 4WJZA 2OO5A 3OHSX 4N5LA 3PQFA 3MJEA 3E18A 2H63A 3BIOA 3BMQA 5EPOA 4DQVA 1NTOA 5JAMA 2BLLA 5HTOA 1T26A 3WS7A 3ZWWA 2FSSA 2NTNA 1GQQA 3HDYA 1PTJA 1B8PA 5DOVA 4XJSA 1LNQA 3RJ5A 4IUYA 1IYZA 2Q46A 4L75A 3VPGA 4YVFA 1PWXA 2VHZA 2G0TA 4BGVA 1DRVA 1Y6JA 4MVJM 3DHYA 2C07A 2FR0A 3JD3A 2YHIA 2EIHA 1JAXA 1KEWA 2PNFA 3QRWA 1HLDA 2B37A 3IP3A 2Y1GA 4P8RA 4FB5A 1VJTA 1VLLA 5K6AC 3C24A 1HRDA 2XF8A 3EZLA 4Q3AA 4ZQEA 3U9LA 3FF4A 4HFRA 3JYPA 4L74A 5JFOA 1QYDA 1T25A 4K26A 5JYDA 1QV6A 1X7DA 2B4QA 3W4JA 4BNHA 4IMRA 3B6ZA 3K5PA 1ZK3A 1PJTA 2PK3A 2VRCD 4FSHA 4N5NA 3ZNQA 4Y6SA 3VVBA 1KY5A 1IHYA 1LI4A 3NTOA 5JNLA 2YQ4A 4AL4A 4EDFA 4MVJI 3HZZA 2C2XA 3OM9A 1EZ4A 1HE2A 2H1SA 4D44A 1XCBA 4DPLA 4FGWA 1KC3A 3EVNA 3KEOA 3KVOA 4F3YA 4BO1A 3ONDA 1VPDA 5G0VA 1IE3A 4Q3EA 1E6UA 1VL8A 5A9TA 1JAYA 3DFZA 4J4HA 2NVUA 3WLEA 4BO9A 2GYYA 3A4VA 3W8DA 4S1VA 3NDIA 1C3VA 1RM4A 3ZWXA 2W2KB 4GL4A 5A4DA 2CVQA 5KKAA 1GEEA 2VWQA 1N5DA 3I9LA 2VYVA 1K0UA 4R51A 4XB2A 5HM8A 1PS9A 4YAIA 4FFLA 4Q3NA 5KWEA 5DBGA 3DBLA 4LMPA 2F1KA 3C1AA 3GVIA 3JQ8B 3P2YA 2YFQA 1EK6A 1O95A 1WNTA 1QORA 4OXKA 4J1NA 8LDHA 3LF1A 2AQ8A 1MG5A 4QFCA 3C1OA 3OF2A 2CVOA 5L7TA 3TF5A 1VRWA 3I83A 3OICA 4GVXA 2IEBA 4BNYA 5JDIA 5EN4A 3JQDA 2Q1TA 3F1KA 2IYPA 4PLZA 1H94A 3D1LA 3CIFA 3DO5A 1BXKA 1ONPA 3A9WA 1JKJA 3ICCA 2R6JA 4BQRA 1U1IA 4BO4A 2W4QA 4CMIA 2QW8A 2HK7A 3H9GA 3VKUA 4NDNE 3RVDA 2C2YA 2HMWA 1UR5A 2DT5A 3F9IA 3RU7A 3WMXA 1BGVA 2PD4A 5B12A 4TROA 4B7XA 2HK8A 1XQ6A 1JKIA 5H82A 4ROSA 1JTVA 4JXKA 4KUEA 3F4BA 5BSGA 1WMAA 3DMTA 4CLRA 1LBEA 1E3EA 1GZ3A 3KYBA 3W8FA 2PTGA 3H2SA 3IP1A 4MP6A 3K8ZA 1R4MA 4G65A 3GZNA 1GU7A 3WQSB 3JQGA 1A72A 1Y9EA 3TJRA 3H9UA 3Q0EA 3QA9A 1MA0A 2NTJA 2NV6A 3VZPA 2HO5A 1CEQA 2FOIA 3CZMA 1YJQA 2BD0A 1PS8A 1X0VA 3JQ9C 2OP0A 1PR3A 1UJMA 4CM9D 5JMPA 2PD3A 4DTIA 3CUKA 3NGLA 1P0CA 3E5MA 4F6LA 4CJXA 1C1XB 3JQAA 5IAAA 4OOFA 3LLSA 4OQYA 2FMUA 2JHGA 3K6JA 1LRKA 1YKFA 2BELA 2HJSA 5F21A 1P33A 1R0KA 1PS0A 5B4VA 4BO0A 3RC1A 3EK2A 2B5WA 3GGGA 1AHHA 3WB9A 2Y1FA 4YRDA 2RCYA 4IGEA 2CF5A 4OO3A 1N7GA 1LTHR 5T57A 3ZNNA 1VL6A 1PGQA 4NFSA 4PG4A 3U4CA 3VVCA 1D1TA 2BRUA 5L53A 4RZIA 4JJIA 1SMKA 2VUSA 4EBFA 4BO8A 4B4VA 1E3SA 4DQXA 1DHRA 4MIYA 3R1IA 1WDKA 4BUCA 4OYRA 3GH3A 5G0SA 2YDYA 1Z75A 4Q3DA 4D0RA 1YH3A 2EP5A 1V0JA 1Z7EA 1DHTA 3ROKA 3E9NA 2D1YA 2X8LA 3WWZA 2BI7A 1TXGA 4B4UA 2FRDA 2HJRA 1PQWA 1LC3A 1B15A 2QYTA 4FIZA 5IXSA 5I9NA 1H9BA 4J7UA 2AQIA 1R4MB 3LU1A 4Z3DA 2O23A 4A27A 3L4BA 4Z9FA 4XRGA 1DBVO 2O3UA 4CODB 1EFKA 3HNPA 3GUYA 4W7HA 1P1IA 1IPEA 2VRCA 3VAZA 3RU9A 4E30A 1ISGA 4Q3CA 4AJOA 1LSOA 2YJZA 1TA4A 1NX6A 5IN5A 1P3DA 1Q7GA 4TRRA 1E7QA 1ZSVA 4CMIB 2CY0A 2D59A 2BF7A 4J4TA 1FDSA 3AUTA 4NU6A 3VTFA 2UUPA 2P5YA 5FYDA 2ZYDA 1P74A 2X1HA 5JYEA 4PZCA 4PG6A 4NBVA 3I4CA 3KTDA 4YEDA 1OBFO 2E37A 4Z3KA 1M6HA 1ZIDA 5BQFA 1Y5RA 5TNXA 1KVQA 3EVTA 4XQCA 1RM5A 4OOEA 2OHXA 1PZGA 3BZUA 2ZB3A 3JQCA 2Y1OA 3DTTA 3GMDA 4R1UA 3CZRA 4OXYA 3RI3A 3OQBA 2GLXA 1I33A 2G76A 2OORA 3KRTA 1CQJA 1U4SA 4MPDA 5CDYA 4PLCA 1YDEA 2UV8A 5T8KC 3TN7A 2FR1A 3I5MA 1E6WA 4QX6A 2VOEA 3INTA 3Q2KA 2J3KA 2WMDA 4FFPA 3DWFA 3HFGA 4XYEA 1MG0A 2AMFA 2BFPA 4IDCA 4NFHA 5JE8A 4ALJA 1LX6A 1G1AA 2W2LD 3B20A 1U28A 3WICA 4F45A 4YT8A 3E9QA 2WD8A 1EFLA 1LSUA 4G5HA 2RH8A 4I8XA 1U8FO 1TVEA 4J16A 4XYMA 4YB8A 3I9MA 4JJFA 5K0ZA 1B8UA 1GUYA 4RPKA 1GD1O 4A7PA 2O7SA 2Q4EA 2PLAA 4Z0HO 2NVUB 1V9LA 1YQDA 3TZ6A 5JCJA 4JK3A 1BW9A 3IOYA 3AK4A 1JW9B 4FOOA 3R3JA 1LDYA 1R4NB 4K6FA 2Y0CA 3D5QA 3OQ6A 5ES3A 5A02A 4YAEA 3WWYA 4E4YA 3KV3O 4B79A 4MKRA 3FD8A 4AJJA 3H9EO 4CM8B 1D4FA 1OI7A 1E6EA 2GN8A 3L4BC 2HLPA 1UXJA 1I32A 4R3WA 4BNVA 5CPFA 4Y9DA 4O1MA 2ZJ0A 2QZ9A 1SOVA 2DLDA 2VHWA 3IC5A 3NYWA 2V7PA 4IZHA 1QLHA 4IQ8A 2EHDA 4IDFA 4TKLA 2WDZA 1NHGA 4Q3BA 5TGDA 5B37A 2QYSA 2I67A 2VUUA 4GH5A 2OBNA 2YQ5A 3ZV3A 3I4FA 4BMSA 4UUMA 2Z95A 1A71A 1ISMA 5U4QA 3A1NA 5BNIA 5LC1A 4CQMB 3H3FA 3AWDA 4KUHA 3QWFA 3TZCA 4GKBA 3V8BA 1V3VA 1E5QA 3PK0A 4JCOA 4U6SA 3VPSA 4E2WA 5EQFA 1TI7A 3KYDA 3EAGA 4CPDA 3I9KA 2X5KO 4WLUA 4C4OA 3W6UA 3RC7A 1YQGA 3QIVA 3RUAA 3Q2IA 3TOXA 4LSMA 1MC4A 5AXCA 2AEJA 2X5JO 3QVTA 5A5EA 1HE4A 5BSFA 4IDBA 4PLYA 2O50A 4FDAA 8ADHA 2QRKA 3PWKA 5EQDA 2EW8A 4M49A 4R9RA 4UVGA 3ZV5A 3MJSA 3BTOA 3QY9A 2GERA 1T24A 4IDEA 1GFSA 2IODA 2JD1A 4HY3A 2Z1NA 3S1LA 2PKRA 3QV1A 1HSZA 4GQAA 3CE6A 2QZZA 1E3LA 2FN7A 2NLOA 4IPTA 2O3RA 2Q1UA 5AOVA 4IY1A 4UVEA 1YBVA 3D7LA 5A3VA 3ZNOA 4KTVE 1MUUA 4P4NA 1I24A 1MB4A 4AVYA 1QR6A 1OMOA 2JFGA 3RUIA 4M1QA 1ORRA 3KM0A 1FK8A 1K6IA 4YWJA 4M8SA 3NDRA 4GGOA 4IJWA 4EUHA 2HMSA 4NG5A 3I3OA 1EUZA 3V1UA 1DFIA 1IOLA 4NQZA 1N92A 2NU8A 2R00A 3GF4A 2VTEA 4JQCA 1DO8A 1U2DA 2E4AA 2P9CA 5T8KA 4O6VA 4BVAA 2Y1EA 2OXIA 4YQYA 5IJZA 1T4DA 3IMFA 3B1FA 2EP7A 1PJBA 1LRLA 1C1DA 1F8GA 5GZ6A 4L4RA 3H2ZA 3EDMA 3GAZA 2WM3A 5EINA 3EW7A 2QX7A 2TMGA 1UDCA 3OJEA 1UZNA 2QQ5A 5EERA 3R3SA 3I23A 2YFHA 3RUHA 3OIFA 4EGFA 1AXGA 4J9UE 1HTBA 5HWSA 4FBGA 2V6BA 3RFTA 2SCUA 2X86A 3WSWA 3W8EA 1ZZEA 1P1FA 2CNBA 3LC2O 3Q1LA 4EYEA 3O8QB 1CIVA 4DBVO 3CEAA 2BGKA 2VWPA 1OZAA 1IZ0A 1F06A 2PGDA 2WEKA 3BAZA 5H83A 5CEEA 1PL6A 3NRCA 1B7GO 2YV1A 1XELA 3GRKA 4XDZA 3UUWA 2Z1MA 5JCXA 4MKXA 1E3IA 4RO0A 3FCOA 3RKRA 3V2HA 1DJQA 2B35A 2DBZA 2O3JA 2ZTUA 4AJHA 2G1UA 1WVGA 2ZQYA 2VZ8A 5GMOA 3GDGA 4YJDA 4IJUA 5ITWA 3I9OA 4GX0A 4FR5A 5F1OA 2RBEA 3L6DA 3TL3A 1E7YA 1RJWA 1NQOA 5DZSA 2DUUA 4J91A 4Y6PA 2RHCA 4E13A 4BNWA 2I5PO 2PD6A 3I6QA 3DZHA 3S2IA 3DBHB 1R0SA 2PWZA 2Y1CA 3K96A 3IKTA 3DMYA 3MCVA 1E1NA 1M76A 1IPFA 3TRIA 1SB9A 5CG1A 2PZLA 3OECA 4Z9YA 4CUKA 3GEMA 5DP1A 5KIAA 4YAGA 1A5ZA 4PLWA 1BVUA 5EL0A 3GHHA 2GO1A 4GSKA 4IS2A 1XWFA 4TRNA 3BTVA 1H6AA 1NQ5A 4G2NA 4XIYA 3Q3CA 4CLDA 3IIEA 2C0CA 1T2CA 1LEHA 4K28A 1GZ6A 3K9QO 1U3VA 1DC3A 1U7HA 3LVFO 4QO8A 3PHIA 3ROPA 1QG6A 4B7UA 1HZZA 2JD2A 2WE8A 3RD5A 4CQMA 3GK3A 1YOVA 5I9MA 3PYXA 4BKPA 2GN6A 4GMGA 3KB6A 1U8XX 4PFJA 4CUZA 1LDMA 4B3HA 3E48A 4R68A 5A3JA 5IN4A 1Y8QA 4IS3A 1H93A 3D3EA 4DGSA 1K6JA 1P45A 1OC4A 4W6ZA 4WNCA 1B14A 4GSLA 3TNLA 1YGYA 2HKIA 1WMBA 3MJTA 1ONOA 1U5AA 1ZVMA 2NU7A 5CHEA 5TJHA 2PZJA 4LMRA 1U4OA 1HXHA 3P7MA 4XGNA 5I8ZA 3RKUA 2D4AA 4XA8A 3NT2A 2HAEA 4BNXA 3FSRA 1M2WA 3ZWCA 3C7AA 5HRUA 3K2BA 3L9WA 1G0OA 1HDYA 3RWBA 2Q4BA 2RAFA 2JJYA 3T4XA 1C1DB 2GZ3A 5G0TA 4AJEA 4CM8A 3NGXA 4YPOA 1PGNA 4BV8A 1GR0A 2EW2A 3JD1A 4IXTA 3GDFA 4B8ZA 2E49A 3GVPA 1DIHA 4DA9A 2RIRA 1E7WA 1SOWA 3V1TC 4BNJA 1N1EA 3LDHA 1ZJZA 2UDPA 3IAHA 4Z0TA 4GLLA 5KJ1A 1C0IA 3QHAA 4MP3A 1Q0HA 3S55A 3E6AA 3TSCA 4BNKA 4TQGA 1ONNA 3V1YA 3ZHXA 1EK5A 3GVHA 4RVHA 1P77A 4AFNA 4R9SA 3PZBA 2P9EA 2FPPA 3HFSA 3BMQB 2DM6A 3HQ4O 3LYLA 3STHA 1HDGO 1PJ3A 3QE3A 3ZZNA 1KEPA 4QECA 1JVSA 4CM5A 2C5AA 4D43A 2AE2A 5C7OO 4WCFA 4ND5A 4HWKA 3DBVO 5CAEA 3LLVA 3ADOA 4MVJH 1ZSYA 4U6QA 4R5MA 1JWAB 1QP8A 4W9NA 4TMFA 4WCFB 5T64A 1HF3A 3HB5X 1HEUA 1YB1A 3AM5A 3T7CA 1KEVA 2J3IA 2X6TA 4RF4A 3MTGA 2POQX 4FW8A 4HNHA 4HP8A 5DDIP 4Z0PA 2I99A 1XSEA 4FGSA 1PGOA 2WWRA 1E92A 3JQEA 4BIIA 1ADCA 2JAPA 4BGUA 3JQ9A 3DBRB 3D5TA 2J5QA 3ZH2A 5F3RA 1IZ9A 3TZQA 2GDZA 4WCDA 3WLFA 1HDCA 4CMJA 4R1NA 1LDNA 1V3UA 2ET6A 3ZWPA 3U4IA 1NAHA 1XDWA 2G17A 5KKCA 1DAPA 4L4SA 3AM4A 3SC4A 3FI9A 3ASUA 4CM1A 5DN9A 5IFLA 2FP4A 4PG7A 2GRAA 3WMWA 4BMNA 1T1SA 1AHIA 2FPIA 3IJRA 4YTEA 5IG2A 1Y1PA 2IZ0A 1DIAA 2D2IA 3E9MA 1CETA 4D42A 3DHEA 5I7EA 3CXRA 2VT2A 4DYDA 2I66A 3O4RA 2ZB7A 2ZJ1A 1GY8A 1KVRA 3O03A 4CLOB 3OA2A 4CV1A 4BKRA 3PVZA 4S3MA 4UAGA 1BDMA 3RUEA 4KQXA 3CINA 4LW8A 5IDWA 5DT9A 5FI3A 1ADBA 3M1LA 2HRZA 4XWYA 3ZV4A 3C7CB 2EXXA 4AJIA 2X7HA 3CSDA 4IQ0A 1Y8QB 4N18A 5TQVA 1XU7A 4J90A 1BXZA 1YDWA 3DAFA 1YO6A 2BGLA 5KNLA 1DC4A 4KP7A 2JCVA 3GPIA 1NBOA 4GI2A 3ZWOA 2Y99A 4L9RA 4PIVA 2Y1DA 3UW3A 4F46A 4R1TA 1E1KA 3QVOA 4DC1A 4PRLA 5TLSA 4XGIA 4EUFA 1FDWA 1Y7TA 3GHYA 4U0JA 5A9RA 4JP2A 1BW9B 3F5SA 5A1TA 3U3XA 3L6EA 1M6WA 3B1JA 1CRWG 2G82A 1PEDA 3UCEA 4NH4A 1NPYA 4DC0A 1ZMOA 1QYWA 2GR9A 4M87A 4WLEA 1QYVA 4BNTA 3P5SA 4FOSA 1EVJA 4DXHA 1QKIA 1Y81A 3O26A 4GWGA 1AE1A 1SZJG 3JQ7B 1PR9A 2BFMA 5ILOA 3DAGA 4RVFA 4ZRNA 4ND3A 3FR8A 2W8ZA 2ZYGA 3RASA 4J49A 4MVJA 5U9CA 1ZCJA 5TF4A 5I7FA 5DP2A 4J1TA 2ILTA 4RF5A 3RCBA 1P1RA 3Q11A 3IJPA 2B4TO 4WNIA 1LJ8A 4QXMA 3JQFC 1EMDA 2OUIA 3RROA 3KSZO 3AOEC 4CM7A 4EEZA 1DC5A 4CLHA 3JSAA 4FFRA 3H8VA 1LSSA 1N9GB 3JQGB 3FPCA 4XX0A 1T2DA 2GN4A 3GZNB 5C3MA 2Q99A 4OXNA 4NK5A 3UKOA 4HFJA 4MKZA 4XDYA 3H9JA 3VTZA 5L4NA 5IDXA 1ML3A 3HWRA 3NJ4A 2QRJA 4XYGA 4E5YA 1YL6A 3GEGA 1H2BA 1GZ4A 3D3WB 4FS3A 4R69A 3ABIA 3GUCA 3DDNA 3GVCA 5JDIC 4PGFA 4UVDA 1RWBA 1NXQA 2HRBA 3ZN2A 3OJOA 3PPIA 4L76A 3C85A 4HNGA 4E12A 1LA2A 2FZEA 4NZ9A 4BNZA 4BHTA 3AFMA 5ER9A 4JN6B
chains in the Genus database with same CATH superfamily
2QLTA 3B6MA 1D4OA 3VGPA 4IDAA 1NR5A 2VNAA 4X90A 2YDXA 3K31A 2VHXA 2H5EA 2GKSA 4RVCA 3KVVA 4TXLA 4EATA 2XIJA 4I5EA 5JLJA 2QM0A 1XE3A 4QU0A 1BFUA 3F6EX 3MYYA 2OGUA 4L0CA 4DEXA 3SHWA 4UUOA 2H8GA 3WL4A 1R4ZA 2V59A 4OHVA 3OEYA 4H27A 2GBFA 5CCDA 2H1LA 5CB0A 1TYAE 5HE9A 5FOUA 2GGSA 2PGJA 4OHYA 1II8A 1BA2A 4R31A 5EMKA 1YZ3A 1LKZA 3OZDA 2VF5X 3NWOA 4I9FA 3QUTA 1DNPA 5EE3A 4EG3A 1Q7CA 1XZLA 4TVSA 4EUNA 4KFUA 5HIKA 1WOYA 5JJCA 5CNKA 2RH9B 3OCWA 2OE2A 4BNFA 2J7KA 3IPCA 2R751 4EY8A 1GSIA 4MUNA 3KT6A 2AHRA 2OSVA 2QJWA 4GAEA 1MQSA 1SU4A 2JCSA 1NDUA 4F71A 5KNBA 4D26A 1GYQA 2W70A 4M0PA 3IAXA 1RXYA 3VHXB 2IPOA 2JEOA 3GL9A 2QSYA 4PPGA 3WOHA 5ANRB 2P4EA 4P84A 3NX4A 1R8JA 1Z5GA 1Z7BA 3NANA 2RGDA 2Q62A 2RMKA 3G8YA 1PF7E 3KSUA 4LYEA 4PS1A 3NRBA 4AJ2A 2L69A 4M99A 1HT3A 2HCTA 4JLOA 2R7LA 3WGMA 1G9TA 4BNGA 2P2SA 1EJ2A 2DPLA 2Y0PA 5ALJA 2SHKA 1H65A 2BFFA 3W2TA 2PUCA 4MVWA 1SVMA 1RPTA 1G291 2C96A 1F5SA 4A4DA 5HP4A 4G37A 3O8NA 3HV2A 4U3JB 3THYB 1CUWA 4RXTA 4WSOA 1AZSC 5BMOA 4N0DA 4N9WA 3JAWA 1B0UA 2GAFA 2P9JA 3FDZB 2Y8EA 3W7AA 1H2FA 3T6KA 5L3QA 4JBYA 5CCEA 9GPBA 1VI2A 2H2IA 4KMSA 4QRIA 1Z6ZA 3SYNA 1YVUA 4N7MA 3KXDA 1P9RA 3LWDA 1XNJA 1TKBA 3JATA 2I3AA 1I1QB 3OC6A 4NAVA 5MN5A 2BSQA 1MXHA 1N9ZA 3OZGA 3W1VA 5CH5A 3I05A 2ZDGA 4NABA 3DL4A 2Y0EA 5AT1A 2Q3MA 4RGBA 5D01A 2R62A 3HG7A 4UM5A 1JHZA 2W2KA 3TZLA 4XYLA 1VA4A 1X7WA 4F8JA 1MBZA 3H11A 3ILVA 4E51A 3ELYA 5KCZA 4FONA 5A7FA 3QNMA 2HJ9A 3MOGA 1P4GA 5TV2A 1EIZA 4PAQA 2WIGA 2M6KA 5EE9A 1M66A 1QWSA 3SS8A 4DHEA 4BLPA 3QH4A 3QJ5A 1TZ2A 4DIEA 5B7PA 1A96A 1YRBA 3AR6A 5SZHB 4JEHA 3RRXA 3LXXA 4KDCA 1JEYA 4YACA 1LDEA 1P1JA 5TF0A 4U9IS 5JIBA 3N2EA 3CLVA 3HR8A 2XCLA 1FJHA 4UQPA 2XDQA 3I28A 3ZKWA 2OZPA 3KCQA 2ZJ6A 1M2FA 4M8KA 3WGLA 3IULA 1N0IA 2RI1A 4ZTBA 3B1KA 4H7FA 4TWIA 4NYJQ 5BYBA 2GCGA 1FS6A 3B5IA 3ZUGA 3PPWA 1JAHA 4N0MA 1GQYA 3IP9A 1E7SA 1E1RA 4AKTA 4ZOBA 1GUFA 4KO1S 1QK4A 3NOQA 4RTRA 5LKRA 1E3WA 2G08A 4ZJPA 4G5OA 4GZ6A 2W2PA 3W0LB 1D1SA 4DQLA 2DBRA 2WPDD 3UK6A 5K3EA 4X61A 5CT9A 3E7DA 3CGWA 3QJGA 1LLDA 4YGXB 3B2EA 2FEXA 4KPYA 4P3OA 1WU7A 1HORA 2ZI9A 2BFEB 1DAMA 2AGVA 1IBCA 1KDRA 3CEMA 1V3TA 3LQFA 3OM8A 3HJAA 1VM6A 4QTUB 3S2YA 1N0UA 3WZ2A 3IHTA 3A26A 4URVR 1CUFA 2X0RA 3PFWO 2BGIA 2WJPA 3PCRB 4L4ZA 4X84A 3PJGA 5SZKB 3BH6A 4Q18A 4D46A 4UU7A 1IAQA 1EH5A 4Z8XA 4KAJA 1AZTA 4DDVA 2WZQA 3RYFB 2F3PA 3SIXA 1F9EA 3G8BA 4ZVOA 5FWXA 4YUVA 3C8UA 3PFHA 3ZCXA 2ADMA 4KX5A 5IZCC 1RLTA 1ZRSA 1LTKA 3IUQA 5FUMA 1IN1A 3SX0A 2OGTA 1P5HA 1KO4A 3AKEA 3ZDYB 4BBAA 5B36A 1FFAA 1XGKA 5D3ZA 5LPNA 4EYSA 4W9NC 3AW9A 2XIQA 1JDUA 4NU0A 2O8CA 1ECCA 1FU7A 3WK5A 4BNDA 3KFXA 3UCFA 1NVXQ 4OHCA 3FNFA 4WTOA 2R44A 3T15A 3DEZA 5KYXB 4L95C 1WCIA 2AW3A 2PKWA 2EWMA 2CBGA 4RVDA 4YJGA 1E3JA 2DYKA 4LI3X 4CL0A 1IBRA 1QQ6A 1JIIA 2PWAA 2WDPA 3DOCA 1W1WA 3A0UA 3DVSX 3N2GA 3ESDA 5DVZA 3WLKX 1IIRA 3A05A 3U49A 4AQYB 1TJYA 2OORC 1L3BA 3DDHA 4WESB 3CNHA 5DTEA 4C05A 4DCPA 2ZUSA 4PNHA 5IANA 5JBQA 1L7EA 2P1ZA 3A3OA 3QMVA 1NV9A 1N2IA 3TMKA 4IJQA 4MS3A 5HNKA 4WE3A 1NF9A 1PYGA 2NUAA 5KCMA 2DQZA 3HKDB 3V5NA 1UM9A 2Q6IA 1FFHA 1OVMA 2NSJA 1RXIA 4MO2A 1WXWA 3IUYA 2IUUA 4JI4B 2WJGA 2O7RA 1SUFA 4LRSB 1LPPA 3EC7A 4MYUA 3LPLA 2QZJA 2FZWA 2WJHA 2TS1A 2BZ1A 3A4IA 4Z1MD 1K86A 1P81A 3PXDA 5C4GB 3D3NA 3ZE8A 4WFIA 1GUZA 1QLWA 2Z9CA 3H5AA 3GFQA 2Y93A 3THXB 1EWTA 2MSNA 4N39A 1JB9A 2YRWA 3PFFA 4C9BA 3NEPX 3B7PA 5KU7A 1CHNA 1ZD4A 4DE5A 1L4GA 1VXOA 2IC5A 2V7UA 1PV2A 5CDHA 3AFGA 3TH5A 4H4DA 1U9YA 4BO6A 5JO0A 1XQVA 2VRNA 4KGZA 2INGX 3K9LA 3MLEA 4YJHA 1F17A 1UXKA 3L1JA 1WUYA 5JRJA 4MK4A 2J0SA 4OVKA 5AKJA 1WO8A 4BLQA 2AOUA 4D0SA 1UPTA 4Y0VA 5B3JA 3A10A 5JNSA 2A0UA 1TJ3A 1DXOA 3RSHA 1KAGA 5FYQA 2GLUA 1GZ7A 1A1VA 2VSXA 3FMOB 1NVVR 1Y8RB 3UV3A 1M8PA 1DTSA 4HPWA 1EG7A 1PU2A 3GN1A 3HJBA 3M82A 4M7OA 3C3XA 4EYGA 3MRTA 2F1OA 3O75A 3DCNA 4CT5A 5DXFA 4FILA 4ZZIA 1BKDR 3LF2A 3JQBA 4JLDA 2H6EA 2BEUB 1B76A 4K9LA 2XUGA 3TUIC 3WBFA 5GIPE 2WJZB 2PXAA 3E5HA 1M8FA 1L4YA 3L6OO 2AK2A 1CZLA 1V5IA 1UAGA 2B5OA 3NHUA 5H9VA 3UXMA 3L43A 4M1TA 1XVLA 3I09A 2YIMA 3V8EA 4RSRA 3PNLA 3B3QA 1U1GA 1G20B 3WSTA 4CV3A 1VBMA 2IJGX 5CNMA 1BCSB 2BKXA 4W7SA 5AK0A 2PGIA 3JTMA 4NATA 5TT1A 3KKKA 4FX2A 3R3WA 5DHQA 5I4BA 4AY3A 5C7LO 1KOJA 2XDAA 3H9CA 4N03A 4CWAA 5I8WA 4NBNA 2IYNA 2AZ4A 2J67A 2BISA 5AKZA 4YMVA 4KN8A 4YPOA 2F90A 2O5VA 3OTGA 1WW8A 3N8KA 3HK2A 1H2RS 1M6YA 4BO2A 1JH8A 1L5WA 4EPTA 4IZ6A 1I2MA 3AY7A 3I39X 3QMWA 4Q4JA 1NFQA 1R5JA 1QMGA 2X2OA 3QF4B 3RHSA 4ZQCB 4EW6A 2XA1A 4ZVVA 5DCUA 5JAZA 1VDZA 1JIUA 2QV0A 1V47A 1MORA 3CLKA 3THSA 4PZUA 3TR0A 4BQSA 5H4GA 4H9GA 5TEWA 1Z0KA 2QUIA 2FZKA 5CM9C 1AGNA 4PU0A 1ND6A 5TVKA 3NHSA 5KEIA 4OK5A 3K1AA 4M0DA 1C7ZA 3FNHA 1SGWA 3BB4A 4QPNA 3ZVKA 2HT1A 4JD5A 4NMWA 1W1UA 1RMQA 4L8YA 3X1WA 3OKPA 1Y3DE 4M89A 3EXG1 3DAHA 3Q10A 3LCCA 4KOAA 4JROA 3WO1A 1ESEA 1NJ2A 4YJGB 5EXSA 4M6WA 4U39A 4GC5A 1NXSA 3W5UA 3C3YA 2OOSA 1MP0A 4HFNA 4Q47A 2H1IA 3AONB 4JL8A 1KQNA 1RZRD 4XIFA 3PC6A 4TZKA 1R6XA 4KN6A 3SYKA 1NW7A 1Z5UA 3TIXB 2YV5A 4KXXA 3CPHA 2UZ1A 3GLHE 1CR2A 5F12A 3WNBA 4A91A 4AJ4A 1KH2A 5EUBA 5KWIA 3QOXA 2OMEA 2O8BA 2BWJA 3GCDA 5ELLA 1PSDA 2AHOA 1NU6A 3QELA 1UADA 2XZLA 4CLXA 3RREA 1YA8A 2BMWA 4DRZA 4CI0B 2E5FA 4MLPA 1D2RA 4A8HA 1K3TA 2VDLB 3ROXA 1GUBA 1EDOA 2PL1A 1NULA 3MFYA 2DPXA 5HZGA 5T5QA 1DQYA 2HV8A 3HDJA 3QW4B 1KO1A 2WYVA 2ERXA 3NIDB 4WNAB 3SC6A 2BJHA 1CUSA 4EFLA 2UUOA 4NHEA 2OCYC 3E8XA 1QRRA 4C3VA 3INNA 1Q1QA 5CDGA 1JE0A 4KN9S 1MHTA 4LQDA 4A8TA 4TLMB 1OBVA 1BTOA 5DMXA 3W9YA 1QG4A 4GKVA 1ZVQA 3RBZA 1IJBA 2LZ0A 4KOEC 1R8XA 4I5DA 1YV9A 3CX7A 3NPMA 4FZRA 4LRWA 2AN5A 2FVYA 4LCJA 1D6NA 1O9BA 1WBBA 2CL0X 5A4AA 1XVAA 4DW8A 1NKSA 2DC1A 4KBFA 1W4ZA 3SLRA 2O3TA 1Z12A 3UOWA 1EBUA 2R2GA 3KWMA 2VJKA 4OH7A 4C1NA 3Q3EA 5I7AA 4DUZB 3U4QB 4WUVA 2VVTA 4Y6LA 3TLMA 4HUQA 1NI4A 5A6SA 1U8TA 5TT0A 2DFKB 2FI1A 4ARSA 1KBOA 4AMVA 3PDIA 2C78A 1RACA 3NV9A 4QAJA 4BKUA 3HN7A 1MX1A 4CQLB 4QARA 4Z7QB 5K0TA 3BWDD 1T6YA 1YCDA 2PUFA 3AEZA 3KJHA 3KO8A 2ZTMA 3GUHA 4OMUA 3JYLA 3FG9A 3L0OA 1OYYA 5A03A 4J7XA 4H6XA 3UHAA 2PLWA 1X1CA 1CUBA 4LXXA 5K7SA 3SVLA 3HA5A 4C4PA 2MU1A 5KX5A 2DKFA 4K88A 5LQUA 1J5PA 2BP7B 3BIJA 2D1QA 1C8KA 3M6VA 5GPBA 2PNJA 2Y2UA 5EZ5A 2VLBA 3I6MA 2CBXA 1NKVA 1V5FA 2BYTA 4PRKA 2X6RA 4FOPA 4R54A 5JZOA 2AR0A 5JO9A 4EB6A 1JGTA 2IYWA 1CT9A 1WXFA 3NHWA 4B4WA 3NONA 2VRWA 1IN6A 3WAGA 2GZRA 3QP9A 4NC9A 2F55A 4A2QA 2ZANA 3NYQA 4MPRA 4P7JA 2HCRA 1OXXK 4CR6A 2QUHA 1X7XB 2Y71A 1U2RA 3VH2A 5EMHA 4TVOA 1P6UA 4L8GA 4I5GA 3WL8A 1TLLA 3RYTC 3O8CA 3TLAA 1JILA 1RTKA 1UMKA 4MUFA 3AERB 4WLVA 1MF7A 1E32A 5EMJA 5FB3A 2C4UA 4X5OA 3FFXA 1SBIA 2G1JA 2QJTA 3VKVA 4KLZA 1EA7A 1SXIA 2JEZA 4EKGA 3KR0A 2EGGA 2H9IA 2HM7A 3RFVA 1I6WA 4MTCA 4PBSA 2XUQA 4KDEA 3EUWA 3I2FA 4M8LA 1OYOA 2XQGA 1I4EB 4WL0A 1E63A 2VXCA 1K0FA 1LPBB 2BM8A 2O2JA 4V0LA 1B26A 5KUTA 4RM3A 4Y9RA 4EJMA 2DSTA 4L8WB 4O8CA 1YONA 1G21E 1USKA 4JBXA 3T0GA 4HQKA 4J7CA 3X1ZA 2ILVA 5J5VA 5FWYB 3NMUF 3HACA 1Z6GA 4DJJA 2I2WA 3MOSA 1E1QA 5EJEA 2N47A 2J41A 5DYYA 4N8SA 9LDTA 1AIPA 1P31A 2P78A 3O8OB 5AQEA 3WFIA 2B69A 1DUVG 1KNXA 1S6YA 1UCFA 2EEPA 1JYEA 3BYZA 3FPBA 3OOEA 1UIMA 4ME6A 4O25A 4P38A 1KNQA 4J0HA 4X6XA 3KETA 3U1VA 1Z29A 4NJMB 4DREA 3O31A 1U0GA 3PQEA 3TEJA 1SKMA 5JY1A 2I3ZA 2PKEA 1QS0A 3A8TA 1WKCA 4OL9A 3WLAA 3Q8MA 3BGDA 3F49S 4GPAA 4RV5A 2EFEB 4YASA 4UVIA 1NUHA 3A4NA 5G1OA 1HDXA 1MW9X 3GLTA 1ABFA 3A04A 1UAYA 1W4RA 3FTNA 1KAEA 2BKLA 1OZHA 3G2IA 4FFNA 4IINA 1DWOA 2WU8A 1TPYA 1WHTB 2OBLA 2FYTA 1WCWA 2WWFA 3GDOA 3IUPA 3FWNA 5C5DA 3U7IA 3B85A 1DKQA 5GGYA 3ZE6A 4KFSA 3DLPX 3KHSA 2OVFA 3CNQS 3THWA 2J0UA 1TD9A 5L7YA 3NKVA 4LYFA 3VR6A 4C88A 4EKYA 1JXAA 1CFJA 2CK3A 2GAOA 3DTYA 3L6RA 3V7WA 4GYYA 3ZZ0A 4EHDA 5BMVA 1H2ZA 1TTPB 2WVJA 4B3FX 4F3RA 2CN1A 2RI6A 1M74A 4DWOA 1FFYA 2EIXA 3CVXA 4HYEA 2WYUA 1WWKA 1ZNYA 2GN1A 3VBEA 2V55B 2P91A 3PGA1 3R7LA 4D4GA 2E0IA 5D3MA 2B2CA 2MCFA 3KJIA 3W2IA 3SYRA 3WRXC 1W581 4ZGWA 3JY6A 5EHXA 3BZBA 5C8YA 2H4XA 1ZNQO 1AVTA 4M37A 3UJ3X 4AYWA 2Z3WA 9ABPA 1TFRA 4RF2A 1AO0A 3INGA 4C0LA 4P54A 3E5RA 5LP6C 3F6SA 3G7UA 4GI3A 4I8DA 2OV4A 1Z0ZA 2VPZA 2WAAA 1W4AA 2BR5A 2E7ZA 3JARB 4J9VA 4TSRA 3G2NA 4W7IA 3SBOA 3ZU4A 5KOHB 2WMYA 5MN6A 3AVUA 4KTTE 1ZQ1A 1ORDA 1CR4A 3U62A 1S3GA 3DCJA 4RLHA 2BM9A 1TKRA 1KOLA 5K0BA 3WYBA 3AHGA 3ZPXA 4XB6B 1VL0A 2L82A 3DL0A 1QH8B 2CLLB 2VAPA 3PNYA 1BEEA 4I9HA 3TZKA 1HC7A 1V1JA 1SBNE 3F9CA 3DE5X 2HWXA 2FMIA 3GR6A 4UU8A 3R23A 3ISJA 3D7KA 2HQOA 5LUAA 4YJ2F 3INRA 4TV9A 4U5QA 3N8DA 4JI7B 4LEIA 4LV8B 4OXIA 2G5CA 4TXMA 3LY8A 1JKMA 1DU4A 1P7ZA 2PKQO 3TIGA 4LF7B 1L5OA 2AEMA 3AU8A 1Q16A 4E22A 4M9SA 5A9SB 3V4VB 4ZVQA 3OE4A 4JXXA 5JASA 5SZIA 1OBCA 3WR5A 2P5UA 3R6WA 4G1FA 3SEFA 1VKZA 5BO5A 4ZGBA 1VE9A 1PZFA 4YJ2A 1FF9A 3IR6A 4QUKA 3X0DA 3LT1A 3CPEA 2XRMA 1S2GA 1WDLA 2RHWA 3JWIA 4UEKA 3C5WP 1NXTA 5JAIA 1CK4A 2X41A 4D3ZA 5JSHA 3QENA 3DZDA 2OHHA 3EZXA 5LBTA 5C46F 1I3LA 1AQYA 2X2PA 5HZMA 5I9IA 4K81B 3B5EA 3KFLA 1FDTA 3R76A 1ULSA 2BFWA 1TLTA 4D2IA 2GCOA 2HT6A 5EESA 4DEYA 4B80A 4G4SO 3QLUC 4LIPD 3LHFA 5EJ2A 4AP9A 2Z2YA 4R83A 3MGGA 4RXUA 3W1WA 4MIOA 3V4SA 5TGTA 4NV3A 3SNHA 4CR7A 4ZIRA 4DA4A 1MV8A 3BPSA 3C7TA 3L7BA 4WH0A 5DI3B 4PONA 4AMUA 1TC1A 4UZFA 5EEHA 4AURA 5BY2A 1RKXA 3IAM6 3W5CA 2O1XA 4UNSA 1CE8B 3EGOA 3IKLA 2PO7A 1S8OA 1EFVA 2G7MC 4DLUA 5MFPA 3OMLA 5F98A 4PPNA 2WQ6A 2QE7A 2C5HA 2QQGA 4HOYA 5KVQA 2DB3A 2P9QA 2C88A 1O7JA 3DLCA 5KJFA 2CDRA 2CCKA 5KTYA 1U7XA 3GJ4A 2FEMA 2FETA 2VFAA 2XZPA 2ZWMA 4E21A 2BFOA 4RQUA 3AJDA 3HXTA 3K94A 4ASUA 2X4IA 1Y6GA 1MX3A 2FPGA 4H16A 4CNBA 3PRJA 3OOHA 4KAAA 1JLMA 5AKYA 2CDCA 5B58T 5BUZA 1V4NA 4CLOA 3MLAA 4HWTA 5EZQA 3DQPA 2UKDA 4TS9A 4WKOA 1RBQA 1RWQA 2H5LA 3UWPA 5DI3A 5FUVA 3P2JA 1N33B 2G0NA 2VC2B 3E4DA 1PFWA 1F4LA 1O6BA 3F1LA 2A33A 3FMFA 1X2BA 3EVAA 1LTQA 4O4LB 2WHXA 4Q93A 1Z4NA 4YJ3A 5EIOA 1EIWA 2RB4A 2B36A 4M86A 3G9ZA 5BN5A 1HYHA 1JEEA 5TDHA 3K4HA 1UWLA 2WM9B 1VL2A 2YWEA 1ZMTA 1BYUA 2ATVA 2IWRA 4HAIA 1GGJA 4MKHA 3UVEA 4DOMA 4L1KA 2F6RA 1T5SA 4FC7A 4LXIA 2IYAA 1A9OA 2R3SA 3G1TA 3HDGA 4O4HF 3WDKA 3U13A 4PO9A 3WO0A 3CLHA 3FRJA 2NADA 4I99A 1PX0A 2XUZA 1W85B 3LL7A 4I4CA 4OP3A 1YR1A 1VJ5A 3PX3A 3A6PC 5BOVA 2DHRA 1SC3A 1EX9A 2IV7A 3N0VA 4UFPA 1MOQA 3FOFC 2AOXA 3NXSA 3O84A 5C80A 1N2EA 2Q27A 3FJOA 3O3NB 4R01A 4RIFA 3FUWA 1RQXA 3NT4A 4R0NA 3P27A 2H2WA 2QD4A 5EIWA 2C31A 2HSDA 1TFUA 4QWWA 5CA0B 1R6VA 4GMHA 3FNQA 1WVIA 5KVVA 2VTDA 4A10A 2D1FA 1IY9A 2NSDA 3UPTA 5J2TF 1O87A 3BDVA 2O9JA 2E6UX 2O8VA 2EV9A 2EKLA 2EQBA 4MKGA 4KR6A 3NTRA 2IIBA 3R3VA 4P3PA 4TSFA 2V6GA 5JHHB 5LYJB 1MABA 4ZVLA 4JWTA 2Y1WA 3P19A 1K7SN 2ATIA 3TR6A 4YC7A 3JASB 3WIEA 5AW8A 3FVWA 5BSWA 2IYEA 5EJAA 2DF8A 3CV3A 5LQMA 1N6RA 1L5GB 3U7RA 2A35A 3UXHA 3EFBA 3IQFA 2ZM5A 2FFHA 1QH1B 4D3XA 1FCJA 2ZSUA 3HMKA 3HB9A 2C3UA 4C0BA 3CZPA 4R3NA 2H2GA 2BOVA 4URZR 1XQXA 3FUCA 4O59O 1VL1A 4KE7A 2H1OA 4M55A 3WBJA 1HTWA 1P7PA 4KNYA 1KI7A 3QWHA 1J42A 3ETLA 5GTDA 1O9GA 2FRDC 3GLHA 2YJ5A 1PD0A 1HETA 3JD4A 1XEAA 2YXEA 4U3JA 1F3OA 2Z4SA 1JQJC 3EEOA 4D8YA 2YFYA 1ZWLA 2NUPA 1IY1A 1RI2A 2B5VA 2O0KA 2GVZC 1EWVA 4R1PA 2COEA 3RVSA 1UM8A 2RJ3A 2XOKD 3KAJA 4RMGA 4V3BA 4S0ZA 1EQUA 1HURA 1SVNA 3E7PA 4LG1A 1R4NA 4RK0A 4EKIA 3RSOA 1RAGA 4CQNA 1Y6FA 1Z0DA 1E9AA 1L5FA 2X23A 1XU9A 1Z74A 2F1HA 1FB5A 5JALA 4CV2A 2A9OA 1Z6AA 1EB8A 2ZVQX 1XXHA 1UKVY 3IELA 3AV0B 1BE0A 5FNVB 2VUTA 3EVCA 5A3SA 4FCTA 2HLHA 3BXGA 2FZCA 3CZAA 2OCDA 4IOMA 1E5LA 2NPFA 5FEUA 1YJ8A 2EJCA 1YI1A 4B3IA 1V8FA 4DV0B 1A0OA 1SIBE 1AY0A 3ESXA 5F2NA 2CXRA 3VR2D 4KWEA 3HV0A 3NNDA 3FCYA 5AVZA 1LU9A 1CY8A 5EMLA 5DM1A 1GV0A 1UMCB 4BXOA 4UD6A 1W59A 4FEYA 2A14A 5K6RA 3NG1A 1KDPA 2ID8A 4CKWB 5IASA 3HTXA 2FNAA 5CD9A 1NV8A 4NYIR 3LSYA 4W9RA 2R1VA 1K4YA 3KR9A 2R60A 3MYRA 4XYBA 1Z17A 3LSTA 1NLYA 4NP6A 5CMLA 2BGUA 2Q9AA 3P0FA 1NJSA 1IHUA 2Q50A 2ZJ2A 3PWZA 3UH1A 1NVKA 1ORTA 1NKTA 1KY2A 3DEKA 5FO1A 2NXEA 1P4SA 4I4TF 1OW3B 3C3PA 3ZQUA 4KBYA 2PA3A 2GEUA 3KE8A 2ODAA 5FIUA 3SX2A 4ZMBA 3MWKA 1Z2NX 1E2KA 4FEAA 4EPRA 1OGYA 3EVFA 4R2IA 1LBTA 2NZUG 1BROA 2Q5HA 3UNXA 5JFGA 5ALXA 5DMHA 4I4LA 1Y8AA 1H6CA 4L8FA 4MO9A 2FJPA 2NTEA 1U90A 1X7ZA 3E22A 3FBTA 1TQDA 3NBMA 4FUTA 1LPSA 1V35A 1WULS 2HQRA 4DY4A 1REQB 1XN4A 2AG1A 3QKTA 2JLZA 2EKPA 1U8UA 4UEWA 3WGQA 5KVAA 3BL8A 4PGGA 1H5NA 2J5XA 2XB2A 3ZW8A 1BS2A 4UTOA 2V3VA 3F90A 5KNCA 3RC9A 3WB0A 2B9EA 2Q1WA 3ADDA 4X1KB 2Q45A 1R74A 1KBZA 4MCAA 5FLEX 1K6MA 1HDRA 1XFDA 3MD0A 3U16A 3WLLA 1MR3F 3AQIA 3RIYA 5KX5B 4WPGA 3WGNA 4BVBA 2EZ9A 2J3QA 2RSLA 3IKJA 2JANA 2EJWA 3SVZA 3GP3A 3UZUA 4B6FA 5IJ9B 1E2LA 4P82A 4DYVA 3WLHA 4D45A 3PIDA 2P2ZA 2G9UA 4ZDKA 2Z2IA 3DMPA 4CFYA 5LLDA 4W1RA 3OPMA 3VDRA 2ZI7A 3MLBA 4FYXA 1QP4A 3WVNA 3GRPA 3K6SB 1XG5A 2NZ2A 1HH4A 4MPPA 4WN9A 2JFOA 3CF6R 1A9YA 1WW2A 3NWPA 1L7QA 1AV6A 2HUPA 1PBNA 1GADO 2IRWA 3BXEA 5A6SB 3ROMA 1YZUA 3H1BA 1RHUA 5I7VA 2AOTB 5BYAA 3ZY6A 1G8JA 1VI6A 3S40A 4NEQA 1DUSA 2E48A 2Y05A 3OU7A 4P3NA 5KBYA 3QKIA 2A5YB 4ZCTA 4FWTA 5AUQA 1B93A 3HYNA 5AI0A 5BR8B 3CW8X 1NU8A 2FN9A 3PKIA 2VCHA 3TS1A 4KI0A 1P17A 2JGMA 2N0SA 4PLHA 2X8AA 3WGOA 1V3QE 1NMEA 3U31A 4RMNA 3ZDFA 1K5DA 4LN1A 4JBIA 3U09A 5K1ZA 4BECA 3IOBA 1EGAA 5EHNA 2VJAA 1RI1A 2ZJOA 3I9V6 5MFZA 3NBUA 4YRZA 3O8RA 4YRIA 4WJKB 4IIUA 3MWFA 4R8KA 4Q03A 4X71A 5BWCA 4PC2A 1OXKB 3TDKA 5JPIA 2X0NA 2GYVA 3VV2A 4BZWA 3QFSA 1HQCA 4P4TA 4PX5A 4JB0A 4ER5A 3ER9A 4XGQA 2IHKA 4R2LA 1FXSA 2J85A 4G5QA 3KTOA 3AY6A 4HB0A 1YRAA 3FYUC 3VPAA 1R6BX 1WL8A 4ZCQA 1ZZGA 3RVOA 4V1CI 1VJGA 2V7TA 3NTQA 2RB5A 3PP8A 5KNBH 1V96A 2RHGB 2O2SA 4FGKA 4NMHA 4YUZA 4W6QA 2ZCJA 3KSBC 1HE5A 1WP9A 3BGOS 4F7WA 4IAOA 3ONWA 1RAAA 1TECE 1U8EA 5F1KA 1VJCA 1J39A 1SEVA 2PIDA 3RABA 3ZDQA 1X80A 3EHEA 1YQEA 3I9V1 4K6HA 4MWZA 1UT8A 4A0SA 5JCPA 2CHVA 3S8MA 2NO7A 4U4AA 4JA2A 4YT5A 1Y6ZA 2QUAA 1OF1A 2HOQA 4ND4A 1IEVA 3X2EA 1D1QA 3BWCA 3OJWA 3U7QA 2I2AA 4XVUA 1GGNA 1KY4A 2A57A 2EF0A 3RIMA 4HRXA 5FA6A 2WILA 4D79A 1UDRA 1IG0A 4XRRA 4Q19A 3IOCA 4PICA 4KRYA 2GN9A 2Q2VA 1XEWX 1E7MA 2QTRA 3QI2A 4AZ3B 1HGXA 2QN6A 4W8HA 2I6TA 3K32A 3O1HB 1LUAA 4BX2A 3OAAA 1A5BB 3RBXA 4EHLA 3K05A 3KPVA 3EG5A 1EBBA 2GI4A 3QMPA 4PYMA 5IBQA 5K3BA 3G88A 1GTZA 2YHBA 2UVPB 3QG5A 2YRFA 2W43A 4B40A 4BMPB 2FW1A 1JAZA 1E2IA 4JS0A 1Y1SA 2J3MA 4N5DA 3IFSA 4RQTA 1AA6A 1I7NA 1QOZA 1HOXA 3GP8A 1BU5A 3LPAA 3FLAA 3PSAA 4RU1A 1UOOA 2BY4A 3K0KA 4C4ZA 4D4MA 2OR3A 3RUDA 1A27A 1L5ZA 4HLQB 2AZXA 3W6NA 1JR6A 1B6TA 4JP5A 5MF6A 3BOSA 3UC9A 3KLMX 1QTNA 1MAAA 5IAKA 3WWOA 3NAGA 1PJRA 2D7JA 3TTUA 1I2AA 2YCBA 4MDHA 2C42A 3LUAA 5ILQA 1H22A 1G8PA 4WRRA 3F9RA 1SAYA 2JD0A 4K6CA 5EEGA 5G0UA 3TO5A 3WJ7A 3BE8A 1EXDA 4QHYA 5H81A 4GPEA 3EXIB 1G8KA 4P58A 3NHAA 5IP5A 3WMGA 5HJEA 1SBYA 4U7DA 5DXJA 3PHLA 4US2R 2NYUA 1NP3A 3D7RA 2CV2A 1KKMA 3PGXA 4J75A 4QBFA 5KU1A 3F5DA 4EB8A 3UTDA 2XJ9A 4D4HA 4RQBA 4OXQA 3ZDAA 1P2SA 1IY8A 4CKEB 1E3TA 3AR7A 2VRBA 1V11A 2W0SA 3NAZA 4TTQA 3STWA 4B17A 5LQAA 1QFXA 1B6SA 4E07A 4QYIB 4XCVA 1QF6A 1RRKA 1QTRA 3SQLA 1D9XA 1ZH6A 1XZBA 2FWMX 1W75A 1M75A 1YB7A 2CL5A 2RAVA 3GAAA 3P0RA 4FFMA 5KQMA 3D0KA 2IPAB 3KEQA 1C7IA 4HNVA 5DCYA 1GTVA 1KXZA 2HXSA 2R97A 3BRSA 4S24A 4JFAA 8AT1A 3KKZA 1Q2UA 3AJ8A 4NI5A 3DTNA 1TUGA 4JYMA 5HJ2A 3VZQA 4BDTA 4EI7A 3MWDB 3SX4A 2VTBB 3DAOA 2C8KA 1P9LA 3RFXA 3RVMA 1E4VA 2GT1A 3EY4A 4RV9A 1Z0UA 5BV0A 1B6GA 1UJ4A 3PUVA 4L2IA 4L5BA 1MQ8B 3NHLA 3R0ZA 5GZ1A 3VX4A 2C9CA 3FWHA 1U8AA 4LOLA 3TQQA 3WI7A 3KQPA 4YAJA 5G3ZA 1EXVA 3UAGA 4NE7A 3FMPB 2XUIA 4CMHA 5KINB 3OX1A 1JPNA 1X1RA 4OQQA 2W42A 1HZJA 1EYZA 4OQFA 5IVKA 1NN3A 1K6EA 3PFGA 1DRKA 2QAIA 2G72A 3SOZA 5HM6A 3KQLA 4Y7DA 3FNBA 3NEJA 4M4SA 1UPBA 3BWVA 1WP4A 2VF8A 3EZ7A 3HKDA 2FSHA 2Q2WA 5KWVA 1V2GA 3ZIUA 2V54A 1M5UA 3G9TA 1A7AA 4Q4AB 1ZUIA 4QPCA 4BO3A 4XZ3A 3N59A 4YPVA 1FDOA 4O5AA 1H8HD 1JDBB 2GF2A 3WBBA 5AK6A 3UY4A 3ZK9A 2IBTA 4MSUA 1KRXA 1FLDA 3LC7O 2FW7A 1J49A 3HCWA 1KQ3A 4JP3A 2R96A 3OQ1A 4KLNA 3K6RA 1BRTA 1H2AS 1SKAA 1TVCA 3N2GB 3CVYA 3M5WA 4IXWA 2C2KA 5JS2A 4BNLA 4DQUA 2B98A 5B4UA 3H5IA 4EHHA 2V0CA 4ZAXA 2O8CB 2ZJAA 1EQ2A 3WHPA 3KQYA 2VP0A 3M6WA 3BCSA 2WUDA 4CLRB 4M7WA 1XTIA 2X9QA 4IFBA 1ECLA 5IDYA 2VHVA 5DHFA 5ADWA 4JXZA 5I9LA 5FWXB 3MB5A 4LC0A 1KMIY 3RSLA 2NM0A 2Q3HA 2FR8A 1NYQA 2HK9A 2OHJA 2BUBA 4TKVB 1QRUA 1VFPA 5DHRA 2Q6VA 4EKEA 3UT5B 4UTPA 1DPFA 5AD1A 2HV9A 3LPMA 5L3SB 2XTAA 5C5IA 1HFEL 2FFQA 3ZV6A 1Z7WA 4JIMA 2AJLI 1AQLA 1P18A 1ZOSA 3IR5A 5KOJB 3AVVA 3UFXB 1APBA 4CGYA 1HQKA 4QDJA 5EQJB 2W2QA 3KOUA 4GS5A 1NBMA 3OE1A 1YIAA 1Q6ZA 5AYVA 2C92A 4ZDWA 3PA6A 4TS1A 3UGKA 3DUFB 3O92A 1DIGA 1QLJA 2QE7D 3AR8A 1T8RA 3IB6A 4LOHA 4QYTA 4S12A 2PMBA 2VL7A 1E60A 2EZUA 3LYHA 1QG2A 3K0AB 3JXEA 1I7DA 3I1JA 4XQGA 3KZKA 3CCCA 1J22A 1EXWA 2YNMA 3THRA 1AZLA 1B8VA 4JR2A 3U9SA 2P6PA 3X43A 1XZJA 2PU7A 1OILA 4I08A 4GMFA 1UC4B 5JJIA 3NDJA 4FYHA 1I51A 1SKQA 1XPUA 3DZFA 3TKAA 2ZCVA 1EDEA 4YCNA 4RTJA 4RELA 2LRHA 3DMDA 3IXMA 2H1VA 3MEQA 1QVZA 5IVPA 2G70A 2BJWA 2YXBA 3S2UA 1G20E 2OGWA 3QJYA 4DA8A 1GCOA 1YB4A 2RARA 3ASZA 1J0EA 1WPXA 4MW5A 5KVSA 1NI3A 4MJ3A 1T9GR 2YVAA 4PYKA 1QYXA 2V7GA 2NXCA 1YFJA 4PLFA 1ZM4A 5H68A 5KZMB 4HLDA 3V4OA 4M53A 1BMTA 2FUEA 5K0NA 4H7PA 3NTUA 1IMJA 3PGJA 1W5TA 2BHLA 4ESHA 3TSAA 1GPWB 4FFDA 1E9RA 2PFGA 2FY8A 2HREA 2JF0A 5U1PA 4DMFA 2FLVA 5B1HA 1U81A 2YV3A 2VKQA 3OZTA 3C3WA 4FFBB 4HBGA 2O1SA 4ND8A 2IV3A 3UKJA 1EFRA 2J5BA 2OILA 2WD7B 2B4RO 3AG6A 4K6MA 5ITSA 5HF6A 4KNWA 3BE4A 2WJYA 3ICPA 1FC0A 3C39A 2PGLA 2IXAA 4I7EA 4Y6QA 5TQ0B 3HA7A 4C3ZA 4QFBA 1NMZA 2ZZMA 3B48A 1ITZA 4BYMA 4HN9A 2JH3A 5I51A 2ZWVA 2WWWA 5E6UA 421PA 3PF8A 4JQOA 3ORSA 3S2GA 2JIRA 2GRJA 2EJBA 5I5EA 3RIEA 3ECSA 3DOJA 3QE9Y 1Z2DA 3H99A 1ZWKA 4FCCA 3WGHA 4FGLA 4AMGA 5IKOA 2ZSFA 1CNFA 1Q0LA 5ELMA 1JBEA 1OLSB 4KN5A 3A4TA 3PUHA 1U0BB 3ENNA 4MICA 4BB6A 4B2YA 1JECA 1Z37A 3N6XA 4O4JB 2PL9A 4BVJA 2XE7A 5EP3A 4M3NA 3U56A 2OPHA 3W5VA 4CMEC 3OJFA 1IBLB 1V25A 3AVPA 1GPNA 3B1XA 4CL8A 4WJZA 2IZOA 4UHFA 4HH1A 3AVTA 5CYFA 3E18A 1XLVA 4AO7A 4OL0A 1QE3A 2JHPA 5F7ZA 1MW8X 5BSUA 4AK9A 8ATCA 4DQVA 2AX4A 5K8CA 1D2MA 4AZ0B 3WZLA 5HTOA 3ZWWA 1OJLA 1SVSA 3DO8A 5DTIA 4DCMA 1D07A 4XJSA 3RJ5A 5IMBA 1IYZA 2Q46A 4L75A 1QB8A 2OAGA 5EJ9A 2W6ID 1F7UA 3DP9A 2G0TA 5HF8A 4MVJM 1U7ZA 4EX6A 1OCEA 2FMFA 1J9ZA 3FBWA 3GI1A 1NUAA 2A5GA 3EGDB 2O8FA 1WMDA 2WT4A 4RMHA 1VJTA 5DX1A 4RY8A 1AKUA 2DRIA 1DG1G 3EZLA 3L3BA 3BX1A 1YK0A 4NENB 2ZYSA 1T43A 4MAFA 4I4IA 4L74A 1F8UA 1ZIYA 3JYPA 1U8CB 3LO5A 1QYDA 5FL3A 1GITA 1T25A 3ABOB 4K26A 1J7JA 1JEJA 1QV6A 1X7DA 2YZGA 2IZ5A 4BNHA 5JYDA 3K5PA 2ZRCA 3CRQA 1VE1A 2MINA 4PPQA 4Y6SA 4B7AA 1IOZA 5JNLA 2VT6A 4Q1AA 5DWVA 4FFBA 4FMBB 2YQ4A 3MELA 4HJRA 2IYUA 4TOIA 1MAWA 4X20A 5SYMA 4IUDS 4Y30A 4KZKA 1VLZA 3WYFA 1QFSA 3A1TA 4EA7A 5ICEA 2UZ4A 4PCUA 5EUCA 3ZBUA 4ZK2A 1WABA 4HAYA 3WB2A 3WWCA 5BUQA 4F3YA 3EAQA 1IE3A 3OU2A 3NHMA 1E6UA 1R6UA 1V7ZA 5A9TA 4MCJA 3UBMA 3COWA 3G85A 4J4HA 3WLEA 2RAPA 3EXAA 2YRXA 3D43A 3A4VA 4XOUA 3LJKA 1RM4A 2D5BA 4DT1A 1S2DA 3LK6A 3EVEA 4O2AA 2I7VA 5D85A 1JEYB 4OQ4A 3G0BA 4QYXA 5LZ5A 3TAUA 5LOVA 3EDCA 4G0NA 2PGNA 3FSGD 4FFLA 3L7DA 4Q3NA 3OD5A 3FI0A 3IMEA 4Q7KA 3IDQA 4LMPA 3RJMA 3JQ8B 3U3ZA 3I4LA 2FCRA 2YFQA 3AF5A 1EK6A 1R3DA 3HS3A 5JYCA 4OXKA 4J1NA 8LDHA 1KU0A 1JHOA 1ZMBA 3LF1A 1K75A 1RLIA 3UA4A 3HSSA 3QEMB 1IU9A 3SJAA 1SUWA 1XJ0A 1XV5A 4QFCA 3RYIA 2O0LA 5AVTA 5L7TA 5B1EA 2WUGA 1HNXB 1Z39A 1T36A 4P35A 2HF8A 1CDEA 3HNRA 3I83A 4GVXA 4LVOA 1ZMRA 3QUSA 4ZO4A 4BNYA 1Q0TA 3HCAA 4ZVSA 3GJ6A 4D8WA 3VYUB 2IYPA