4RDIA

Crystal structure of e. coli trna n6-threonylcarbamoyladenosine dehydratase, tcda
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
266
structure length
246
Chain Sequence
SVVISDAWRQRFGGTARLYGEKALQLFADAHICVVGIGGVGSWAAEALARTGIGAITLIDMDDVCVTNTNRQIHALRDNVGLAKAEVMAERIRQINPECRVTVVDDFVTPDNVAQYMSVGYSYVIDAIDSVRPKAALIAYCRRNKIPLVTTGGAGGQIDPTQIQVTDLAKTIQDPLAAKLRERLKSDFGVVKNSKGKLGVDCVFSTEALVYPQSSGFGAATMVTATFGFVAVSHALKKMMAKAARQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords tRNA threonylcarbamoyladenosine dehydratase
publication title The Structure of Escherichia coli TcdA (Also Known As CsdL) Reveals a Novel Topology and Provides Insight into the tRNA Binding Surface Required for N(6)-Threonylcarbamoyladenosine Dehydratase Activity.
pubmed doi rcsb
source organism Escherichia coli
total genus 73
structure length 246
sequence length 266
chains with identical sequence B, C, D
ec nomenclature ec 6.1.-.-:
pdb deposition date 2014-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4rdiA00
1EE9A 1DJQA 5MDHA 3ZWXA 2Y67A 4C7KA 2H6EA 2VNSA 4MVJI 4UVHA 1I32A 5JDIA 3I83A 4XCVA 1N9GA 2P5YA 3ETDA 1JWBB 1IB6A 1I36A 1WMBA 3RKUA 1YB4A 3WWYA 4E3ZA 3U09A 1XLTA 2X5KO 3WFJA 3ZV5A 1CIVA 4RVDA 1QYCA 4IJKA 1GCOA 3VDRA 1GCUA 3GUYA 3DBHA 2GZ2A 4A5OA 4I9HA 2A94A 4FOSA 1GTMA 3RC2A 4FC6A 4GX5A 3DMTC 1TT5A 1YH3A 2HK7A 2VHYA 5EIOA 1UXIA 2D5CA 3U5TA 4Q39A 4FGSA 4GLOA 2EHDA 1X0VA 2POQX 3TN7A 1H94A 3RBZA 5IZ4A 4XKJA 1GY8A 1ISHA 3PWKA 3F47A 2VYNA 1LC0A 4CR6A 5B37A 4IM7A 2X0JA 4IXWA 3ZWPA 4AJPA 3K73O 4EYEA 4PG4A 5CDTA 4J4BA 1I3LA 3ZHYA 2AQHA 1M2WA 4XGIA 5IZCC 3C7DB 3RU7A 1K5HA 1RJWA 2I66A 3S2GA 1NAIA 1G0NA 5LDHA 3NDJA 5GZ1A 1T4BA 4LSMA 1BGVA 1B8PA 2BKAA 2C5AA 3HWRA 2PGDA 3UCEA 3UF0A 4GMFA 1P1RA 3HSKA 5ENVA 2YYYA 2X9GA 3GA0A 3PYLA 3RCBA 2NM0A 1DDOA 2QZ9A 3F4BA 1VPDA 2DTXA 1J49A 2DBRA 5ADHA 2E4AA 3AFNA 4ALKA 4B3IA 4J3FA 1ZXLA 1YQGA 2ZKLA 5A04A 3KYCB 1HT0A 2C54A 1DO8A 2OL4A 3EGOA 4DA9A 3QWFA 3MCVA 3EAGA 3DZFA 4BNTA 1U4OA 5L4SA 2FZWA 4TRNA 5CPFA 3TOXA 2VCYA 2P4QA 2O7QA 2VT2A 4WASA 2ZTMA 3ADPA 2J5KA 3TRIA 4CL8A 4DGSA 6LDHA 2J5RA 1MXHA 2Y1EA 4YB8A 3WQRA 4WCFA 4ALIA 5T6BA 1EVZA 1DHTA 4G81A 1N8KA 1DIGA 5A3JA 1K6JA 3RUEA 3RBVA 2Y1FA 3U9LA 5JDIC 4TRJA 1B7GO 3RUCA 3OFSA 2NV6A 1EEHA 3WIDA 4RVFA 4RVGA 1H6AA 3PHIA 5A9TA 4NU5A 4NZ9A 4WGGA 1DOHA 4R69A 3EDMA 2GO1A 3LZ6A 1PL8A 3ORFA 3T7CA 3ASVA 4DPLA 1OI7A 2UYYA 3DFZA 1JKJA 1NVGA 3GDGA 1R16A 4O5OA 3GEMA 1LI4A 3WBBA 3CSDA 1I2CA 3NTRA 4K26A 1O0SA 5HRUA 4AJ2A 3ZV4A 2NNLD 4ZVVA 5T5QA 1O89A 2BGKA 1HEUA 4WJZA 4EDFA 1SNYA 2ZATA 3GGOA 4FFPA 3VDQA 1LEHA 3KVOA 3QVWA 2AEMA 1XHLA 3VPXA 1JAXA 3FTPA 3E6AA 4JP2A 3IOYA 3TSCA 4RPJA 4DIFA 5CG1A 3MEQA 2QHXA 1LNQA 3ZWNA 1C14A 1X15A 1FDTA 3JQ7B 3IQDB 3AW9A 4HY3A 5G2OA 1LLQA 3C3XA 2GZ3A 3QV1A 1GZ3A 3IC5A 4NQZA 2YUTA 4LCEA 3V2UA 4Y8VA 4HFMA 3HHPA 4NIMA 1IZ9A 5DN9A 1ONPA 1VL8A 2JCYA 4P4LA 4GH5A 1MC5A 4RPGA 3IJPA 4HNGA 5DCUA 3CEAA 2OP1A 2UUOA 2G1UA 3ANLA 4R51A 1AHHA 2O2YA 2NU6A 2D1YA 3MJEA 5JO0A 3LT2A 4I9NA 1VM6A 4R5HA 3W4KA 2C59A 3D4NA 4RLSA 5BQFA 1A4IA 2NVBA 4UEJA 1NNUA 4AVYA 4CLOA 1U8XX 3D5QA 3NT5A 4WLVA 1GUZA 4YJHA 4E2ZA 1VLLA 1ZIDA 4K1LA 1NX6A 4BKRA 1EDOA 3EVTA 2AHRA 2ZB8A 3GZNB 3R3JA 5EINA 1DIAA 4JJIA 4KDFA 4WCFC 3VH3A 4J43A 3RU9A 1E3LA 3U62A 4KTVE 4FR5A 3DTYA 4WLFA 2A9FA 1T2EA 2PZLA 4OXYA 4BNYA 5L7WA 4GX2A 4OQZA 1EVIA 2EXXA 3Q6IA 1YONA 4RF2A 1HXHA 1NWCA 3DR3A 5HWSA 3LF2A 3H3FA 4JGBA 2JCVA 2ZYGA 3OJEA 3AUTA 3D4PA 2EG9A 4XR4A 5G0UA 4E21A 4UAGA 3X2FA 1EFKA 1PU2A 1J4AA 2NVUA 1E7WA 1HDRA 1JN0A 3C8MA 2VYVA 2V6MA 2GZ1A 3BMNA 2ZTVA 4WE3A 4GKBA 4IIVA 4BO4A 5HA5A 4R54A 1HZZA 2DTDA 2RH4A 2YHIB 2PZKA 4MVJF 1PEDA 1LSSA 4TVBA 4M55A 3PRJA 3ZI0A 2PTGA 3AM3A 3P7MA 3BIOA 3DHEA 3KSZO 3NEPX 4B3JA 1DC5A 3AFMA 5DCYA 1Q0HA 2GN6A 3P5SA 4NR0A 5A1TA 2CF5A 3GLQA 4QT0A 1HDYA 3RKRA 4E33A 3ICCA 3LK7A 5I7SA 4W7IA 1T24A 2DFVA 4RQTA 4KUHA 4RDIA 2JJYA 1CWUA 3NYWA 4BMVA 3CH6A 4WCDA 4IY1A 7MDHA 3DOOA 2VRCA 1IPEA 2WM3A 3W4IA 1CQIA 2QRLA 1KEPA 3KEQA 1E1NA 4RF5A 3ITKA 5G4LA 1M75A 2Y0DA 4LVUA 3T4XA 4MOWA 2IEBA 4Q3EA 2VHZA 2NU8A 2VNAA 4MVJM 5JAQA 2P9CA 5B4TA 5CEEA 2DQ4A 1KVUA 3RJ5A 2YFQA 3EVNA 4XQCA 2B5WA 2E48A 4A27A 3DZGA 1ZMTA 1R12A 1NVTA 3MOGA 2NU7A 1HRDA 1PJBA 4H3VA 4Y6RA 5TT1A 3NKLA 3W8EA 1KY5A 3WNQA 2W2KB 5A9SA 3K92A 1AN9A 1Y5MA 3WX0A 3GHHA 5HS6A 4CR7A 3FBGA 1CRWG 4IBOA 3UAGA 3FI9A 8LDHA 1R37A 5F21A 1DBVO 1O5IA 1RYEA 2EWMA 3WB9A 9LDTA 2NQ8A 1UDCA 4NDNE 2ZJ0A 3I3OA 3QWIA 1UZLA 1Q7CA 5MGBA 4URFA 3QY9A 3K8ZA 1UH5A 3DBLB 1X7HA 4UUNA 4CQLB 2C29D 3EZYA 3E9QA 4TZTA 2FHSA 3RIHA 5KVVA 4YRBA 5FYDA 3U49A 4BB6A 3TZCA 3B1KA 4BO0A 3RFXA 1ZSYA 4ZQGA 3RJ9A 3TWOA 3H5AA 3JQGA 3V1UA 2H5LA 3V5NA 4E2XA 1GZ6A 3PQDA 1PX0A 1C0LA 4BNZA 3RUAA 1WNTA 3CKYA 1R0LA 5IDQA 4RPLA 2QQ5A 5F5LA 1CQJA 3OSUA 1M67A 2Y1OA 3UCXA 3CUKA 2X5JO 3SC4A 3GY0A 4IDBA 1E1LA 3KLMX 3N7UA 3RUHA 3OA0A 4TZKA 1ZZEA 3AWDA 3NDRA 1R4NB 2NWQA 1UR5A 2PLAA 1ZJYA 4YJGA 1AHIA 2B37A 3Q11A 1HETA 4AJHA 2B35A 4JBGA 1Y9AA 5C5IA 3E9MA 2X22A 3WIEA 2DKNA 3WICA 3VZPA 4CR8A 5KWEA 5L4NA 3AM5A 4J7CA 1ZJZA 4F3YA 5IJZA 3GEGA 5DP2A 2EKQA 5G0SA 2VHVA 1SOVA 1ZXBA 3CMCO 2B69A 3F5SA 3AM4A 3GHYA 4NFHA 1ML3A 3GR6A 4L4SA 4YAEA 2BFAA 1OOEA 1YQDA 2W2LA 4QSMA 4BNXA 4DVJA 4PLYA 2EJVA 4U0JA 2G17A 2EP5A 4TSKA 4GAEA 4ITUA 1PJSA 2HMTA 3VPFA 1KEWA 3MWEB 3H9EO 1JAYA 2PWZA 1F8FA 1K0UA 3BZUA 1O94A 3I52A 1QXSA 3OP4A 2Z1MA 4D43A 3MWDB 4BNUA 4CLRA 1Q1NA 4JJGA 4W99A 4CQMD 3EK2A 3LDHA 1LQTA 2EW8A 1ZK3A 4KWHA 5BR7A 2C20A 1ZK0A 2XXJA 4RL6A 2IDZA 1P0CA 2OORA 1TXGA 4I9UA 5TT0A 3IIEA 1MFZA 5AXAA 4UUMA 4FW8A 4HXYA 1BW9B 2GCGA 2OXIA 2D0IA 5TC4A 1B8UA 3GVHA 4Y98A 5ITWA 2PGJA 3GFGA 2W90A 3C85A 3DHNA 1C1DA 3KLPX 1E6EA 1G0OA 2I99A 3QWHA 1A7KA 3I9LA 4OGWA 4BIIA 5AVOA 1H5QA 4CM9D 2BLLA 3GZ4A 5JCXA 4GLLA 3ASUA 1KVSA 1YKFA 2PV7A 5BSHA 3LC2O 3FD8A 3JQ8B 4DLBA 4DIOA 3Q0EA 1I2ZA 4CM8A 4M87A 3I9KA 4FDAA 3IUPA 5ES3A 1E3WB 1WMAA 1E5LA 4W6ZA 4XQEA 1P9LA 1DFGA 3PJDA 2VWPA 3EY4A 1U2DA 5F3RA 3C7AA 1LDNA 1QLHA 2FY8A 1LX6A 2I3AA 1HZJA 1D4FA 1CEQA 4ZICA 4J0EA 1OC4A 1IL0A 1E1MA 3U4HA 2B5VA 4IDDA 1YB1A 1MB4A 1ULSA 2BFOA 3IMFA 4PZCA 1XG5A 2GPTA 3BMCB 3RFTA 1LDYA 2O7SA 2VHWA 1F14A 5EQFA 2GERA 3GVPA 1RKXA 3FCOA 5K0ZA 2EKLA 1UXKA 4QO8A 4XQGA 3G3EA 3GG9A 2FRDA 1KEUA 3I9JA 4WEQA 3ZGYA 1N7GA 1HE5A 2J3JA 3D64A 3GOHA 4KUGA 4TROA 5KJ6A 3F1KA 1V3VA 4XR9A 1NWHA 4XB1A 1QYDA 3ON5A 4BNHA 2VRBA 3KBOA 4B7CA 3K2BA 1ZO8A 4PLCA 1Z82A 2OOSA 2P4HX 2BHLA 4MIYA 2PA3A 3JQBA 2QW8A 3JD4A 3PGJA 5I9MA 4OSPA 3K2EA 3C1TA 3LT0A 2FMUA 3DBRB 1K89A 1LC3A 3RD5A 4II2A 2VWGA 4BHTA 1V3TA 2DTEA 1EVJA 4BUCA 5TF4A 3WGQA 3OIGA 1AXGA 3KYDA 1CF2O 4I1IA 3WWZA 3ITDA 1I33A 1E3IA 1ENOA 1X7DA 4E5YA 1PR3A 4YT8A 4BO6A 3K5PA 4BNFA 1ZMOA 3DAPA 3JQ6A 4M54A 1UXJA 1E7YA 4ZQBA 2CVQA 3GT0A 4BGUA 4YDRA 4GVXA 1HE4A 1WDLA 4R68A 5TRTA 2B4TO 2HQ1A 1I3KA 1LRKA 3HADA 1U1IA 1P44A 1ZKMA 2AE1A 4FC7A 1DIHA 5JE8A 2HSDA 1C3VA 2XF8A 1R0SA 4E0BA 1U3TA 5T64A 2QZZA 4R1NA 4S3MA 4AG3A 5CHEA 4E13A 4DXHA 1KS9A 4LISA 3F3SA 1N5DA 4CM4A 4OQYA 1V0JA 2O50A 3LF1A 3VPHA 5CDSA 3E48A 4Z0TA 1FDSA 1PGNA 3WLFA 2I6TA 4HWKA 1BXZA 5IDXA 3GRKA 3GNTA 1QP8A 3QA9A 5I7FA 2RIRA 3KOUA 3RASA 3X2EA 3WMXA 3NGXA 2X86A 1ORRA 3DBVO 3D3WA 4PLWA 4EW6A 4ILKA 3OEWA 1U4SA 2Y66A 5CDUA 1Q7BA 2Q45A 4BB5A 1AXEA 4CLXA 4CM7A 4XYMA 2HLPA 3IKTA 5BT9A 3KSDO 5GY7A 3E03A 5C7LO 1KYQA 3VAZA 3WGOA 2AMFA 1JDJA 4BMSA 3B1FA 2CVOA 5GMOA 1T2CA 4XX0A 3HJAA 4UEOA 3EC7A 4YTEA 4TKMA 3L9WA 1BXGB 4FFOA 4ALNA 2HU2A 2BI8A 1C0IA 1HE3A 4BO5A 4JLWA 5FI5A 3JQBC 1DFIA 2C2XA 4EITA 4C7JA 2JL1A 1E7QA 2XOXA 2GNAA 3OF2A 1YE3A 4JBHA 3GNSA 5AXCA 1JQBA 3VZSA 4Z9YA 1R66A 4J7UA 4YAJA 3PZBA 1Y8RA 3L6OO 1U8FO 2FWMX 1XDWA 3QLJA 3OHSX 3JD3A 5L53A 1EZ4A 5ER9A 2PGLA 3L0DA 4YAGA 3PJGA 3FF4A 2RCYA 1XQ6A 1IOLA 3GVXA 4D3SA 3SVTA 4OM8A 4I5FA 2FPIA 1TA4A 4IPTA 3E8XA 4YQYA 1HYHA 4FSHA 4IMPA 3RVDA 3ZNQA 4UVDA 3WYEA 4NBUA 3CINA 2SCUA 3RC9A 1ULUA 4UUOA 5HS4A 1V9LA 4BNNA 3NX4A 3SLGA 4GWGA 4S1VA 3QHAA 3W6UA 2O2SA 4Z0PA 5KJEA 4PG8A 3NTOA 3N74A 1WDMA 4IZIA 2FR1A 1SBYA 3M6IA 3NUGA 2ZCVA 4IMRA 3DZIA 3GN1A 1GZ4A 3F1LA 3F5QA 2CZCA 1FJHA 4ND3A 3A4VA 2ZTLA 3D0OA 3HN7A 3DBHB 4DL9A 4U7WA 5F1OA 2X5OA 4GPD1 3MJCA 4L4RA 4EJMA 4YXFA 2NADA 1IULA 1KERA 3Q2KA 4UVGA 5JAZA 2OBNA 3MTJA 3HN2A 1ISJA 2VOEA 5KVQA 4HADA 5T8KA 3JQEA 1DC6A 2OFPA 4BMNA 1X14A 3GDOA 3PI7A 4JNKA 1Z7EA 1E6UA 1BDBA 5DDIP 3QW2A 3CTMA 3R0IA 4B4UA 4CV2A 1PJLA 4CMIA 4RGBA 7ADHA 5JMWA 4O0LA 4XRRA 3EUWA 3F6YA 2GDZA 4RZHA 5BSEA 4IGFA 2PR2A 2BRUA 3RUFA 1BXKA 5BSFA 5B1YA 3VPSA 1DIBA 3SBOA 4CMKA 1ISGA 3PHGA 3OQ6A 1KVTA 3KSUA 1P74A 2Y0EA 4G5HA 3FSRA 4AJLA 3QVTA 4BGIA 2AW5A 3AU9A 3WGYA 2ZB4A 4ID9A 1GQQA 1IUKA 1SMKA 1A9ZA 3I5MA 2FN7A 4NBRA 4PFJA 2PNFA 1H6CA 1E3SA 4R1TA 4ZQEA 5ILGA 4ZJUA 3CZMA 1UXGA 1JTVA 1JU9A 4K6CA 1NASA 2VN8A 1MFPA 3SLKA 1IZ0A 1PZHA 4J0FA 4WLNA 4BNVA 5IFLA 4WLUA 4CMBA 1IE3A 3PJEA 4ROSA 4ND1A 2FZEA 1A4UA 1EQ2A 2PFGA 1HDZA 1K3TA 1FF9A 3KYBA 4J16A 2EKPA 3PDUA 4Z3DA 1U2GA 5TSDA 3H2SA 4XEHA 3TL3A 1X1EA 3BMOB 1VSVA 4BKQA 3AI1A 3DZJA 1A9YA 1G1AA 3KYCA 1F8GA 4AJKA 4JIGA 2GRAA 3G1TA 4TQGA 1GYQA 2C2YA 2HO5A 2OGUA 1YL6A 4CV1A 3LT1A 3PLNA 5U4QA 3O8QB 3WS7A 5BSGA 4FFRA 3K9QO 1ZH8A 2X7HA 2J6IA 5BNTA 1PIWA 3QSGA 1TEHA 2Y05A 1HDCA 4PRLA 4PLFA 2GD1O 1JA9A 3Q1LA 3CMMA 4KQWA 1NM5A 2JHFA 1P1IA 4LK3A 3VZRA 1F06A 4OAQA 4BKPA 1UXHA 4OYRA 3E1KA 3EHEA 2JAPA 1MP0A 4E30A 2OUIA 4AJEA 1YJ8A 3WR5A 5T8KC 4R3WA 1ZEJA 2JD1A 2JCXA 1HLPA 1T1RA 4BNWA 5I7EA 4U8GA 2EIHA 2VQ3A 1EK5A 2WMDA 1SCUA 5JSFA 3KETA 2Y1DA 1HDXA 3V1TC 1O6ZA 1UP6A 4ZU3A 2HAEA 1P1JA 1U28A 3GGGA 3RQSA 4CUJA 2BD0A 3DOCA 5JC1A 4CLEA 3GAFA 1DC3A 4R41A 4NBVA 4N18A 3JYOA 1KY4A 3ROKA 3JQ7A 3MJVA 4E2WA 5KKCA 1LLUA 4BV9A 4H15A 4YJDA 3TDKA 2BELA 1MA0A 2FP4A 2IXAA 2VUSA 5KNLA 1XCBA 5F1KA 4PVCA 3GEDA 3PEFA 3QVOA 1OBFO 4PVDA 1VKOA 5TS3A 5JYEA 2DM6A 1YBVA 2EGHA 3L6DA 3ZN2A 4QFDA 3TOZA 1QYWA 1DFHA 3G0OA 1LDMA 2IRWA 3DO5A 2PH5A 2IZ0A 2HCTA 3A28A 5JFOA 4OKNA 1GPDG 2AA3A 4RVUA 3WTCA 4FFNA 1LQUA 3BYZA 2EEZA 3HZZA 2O4UX 3ANNA 1DLJA 4NBTA 1X7GA 4UREA 3IUSA 2HRBA 4Q3AA 2O3SA 2UDPA 5TJHA 4BO1A 2NQTA 1B0AA 4BO3A 1HYEA 2EF1A 2ZB7A 4EZBA 3B70A 4ZQHA 3ST7A 3GF4A 1FMCA 5KVCA 2HJRA 3GZNA 2YDXA 4MKRA 3OBBA 2HMUA 4CMEA 4CMJA 2ZB3A 3GNQA 4IZHA 5KJFA 4K9DA 1MV8A 5JLAA 5B4VA 4U0KA 2BF7A 2YY7A 1Y6JA 1MG0A 1DB3A 2Q1TA 4R3NA 5DNAA 1VJTA 4YAKA 5JC8A 1B14A 4XA8A 1B15A 1SAYA 4DWVA 4NJMA 3STHA 2NVUB 1M66A 1J5PA 3BMNB 4IDEA 4XJSA 1L1FA 4D7AA 1F12A 1GYRA 4FBGA 3RC1A 1BMDA 1HYGA 1CYDA 3H9GA 2Q2QA 2X0IA 4OXNA 4W4TA 5IXSA 4JQCA 5DP1A 2WWRA 3PLRA 1I24A 4MPDA 4PLTA 3FTNA 3W8FA 4BO8A 1LJ8A 3L6EA 4FGWA 4BNMA 5LDGA 4E5NA 4E12A 4R5MA 2X6TA 3EZLA 1NQTA 1VRWA 4FFMA 3ZCXA 3NJ4A 2QG4A 1ENZA 2HDHA 3IAHA 1PZEA 2GLXA 4QTZA 1VI2A 1SB8A 3JD2A 2YHIA 1LLDA 1GEEA 2NVWA 1AE1A 1PJ3A 4WLOA 1XEAA 2GN8A 5A5EA 2VZ9A 1MGOA 2VT3A 2QIOA 1GD1O 1X0XA 2D8AA 1H6DA 2PD6A 3M1AA 4NHEA 4PCVA 3P2OA 2X9VA 2C07A 4J2HA 3F46A 1D1TA 4J2OA 4AL4A 4U5QA 2A92A 3GPIA 4R1UA 4M49A 1S6YA 4A7PA 3WGZA 1UAYA 4DQXA 5EQDA 2IXBA 3OH8A 4MP6A 3ENNA 3CE6A 3LVFO 3U4IA 4FQ8A 4YEDA 4QECA 1DEHA 1O9BA 3S8MA 1OMOA 1UP4A 1YRLA 5F1PA 5I8WA 1J0XO 4CV0A 4EUFA 4GI2A 4OL9A 4DMLA 4F6CA 3D5TA 4O63O 1OFGA 4J6FA 1KOLA 2HMWA 1ONNA 3KEOA 3OA2A 4J1NA 4GSLA 4A03A 5EERA 2FR8A 2I5PO 3IP1A 5DCWA 2E82A 4LN1A 2AQ8A 5L40A 1XU9A 3ROPA 2QYSA 3TZHA 1E7RA 5JCJA 4CMEC 4GGOA 2ET6A 2FSVA 5IN5A 4D3DA 3E18A 1UJMA 4BNIA 2W2KA 1E7SA 2JFHA 3WFIA 3DB2A 3R6DA 4RV9A 4B7XA 4BQRA 2CSUA 1YGYA 2O3TA 3D3EA 1EMDA 3D1LA 2WSBA 2DU8A 4FFLA 1O8CA 3ROMA 5COQA 2HK9A 3H4VA 3JSAA 3ZU2A 1E6WA 4NU6A 3DBLA 1AGNA 1PWZA 4CMGA 1PQPA 1RM4A 1Y8QB 4L0QA 3RBXA 2WD7A 3WSWA 4CQLA 3ADOA 3ONDA 5C3MA 2EERA 3QE3A 5KTKA 4Z9XA 1D1SA 2O3UA 4ALLA 4J7XA 3FHLA 4JN6B 3G49A 3ZU5A 2UUPA 3WYCA 4MKXA 4AJIA 4ESOA 2LDXA 2WE7A 1IHXA 1PS9A 1KETA 1UDAA 1WLYA 2I76A 4QO7A 4OHUA 3DMYA 4RLHA 3UXYA 2PZMA 2YW9A 3W4JA 1YDWA 2I67A 4N5MA 4Q9NA 3O9ZA 4WK6A 3RUDA 5AXDA 2OMEA 1PWXA 1QMGA 1A27A 4YQZA 4TMFA 4MVJE 4N5LA 5LC1A 4CM3A 4JJFA 1YDEA 1E3EA 4RDHA 2FSSA 4UVIA 4D46A 1R4NA 1WPQA 1P1KA 2CDCA 4WKGA 4OOFA 3PK0A 4PLPA 3ZWMA 4W82A 1XIVA 1NTOA 4HKTA 1JKIA 2C5EA 1GFSA 3NT4A 4E5PA 3UICA 4OOEA 2C7VA 1X1TA 2F00A 4LCJA 3BMQB 3OJLA 4L4XA 1HL3A 4B4VA 2NACA 3NTQA 3FWNA 1T1SA 3AY7A 5L95A 1B16A 4CMHA 3L4BA 3VKVA 5A3VA 1I30A 4TRMA 5H82A 4XYEA 2CF6A 4H7PA 4BGEA 4DREA 1HSOA 1E7MA 2ZCUA 2JFFA 4WOJA 1IYZA 4CUKA 5IXYA 3Q9NA 4AJJA 2UAGA 4Z3KA 1B8VA 1ZK2A 1VL6A 3G79A 1RM3A 3PFWO 2PKQO 4N54A 1SEPA 4U6QA 3RI3A 4M1QA 4XWYA 2E37A 2G0TA 2VWQA 1LU9A 2AEJA 3O03A 1BRMA 2EGGA 3UN1A 3FWZA 4IJVA 5HM8A 3JD1A 1QV6A 4YBZA 2DC1A 5KJ1A 3HFSA 3R1IA 4CM1A 5H83A 4CM8B 1YOVB 3MOIA 3UGKA 4OXKA 3WGTA 1C0PA 2H1SA 4R01A 4DC1A 1E5QA 5KIAA 3DL2A 2E49A 1T2DA 4NPCA 4DPKA 3KXDA 2VYND 3DZHA 4XGNA 1J6UA 4JK3A 1C1XB 5COBA 3DAFA 2V7PA 3JQ8A 5HTOA 1B26A 1U9JA 2X58A 4GBJA 4MDHA 4MVJG 1E3WA 2QYTA 3DZKA 3HDJA 1C0KA 5KOIA 4RJTA 1NR1A 4YJFA 1AUPA 3UOGA 1QG6A 1H9BA 3Q9UA 3VZQA 1SO8A 4Z6KA 3NAQA 3JQAA 3KTDA 2P9GA 1ADFA 3CZRA 1JVSA 3H2ZA 3IDSA 3BTOA 1RM0A 1TVEA 2NLOA 4H16A 1ZSVA 1UZMA 4DMMA 2ZIZA 4XRGA 1O95A 4IIUA 1NXQA 4BL5A 3I9OA 4LSWA 4INAA 1QV7A 2DVMA 3CPSA 2VZ8A 4GKVA 1QRRA 5FI3A 3JCZA 2RHCA 3RAJA 5JNLA 5TLSA 1P33A 4M89A 4X54A 4C4OA 5JS6A 2DT5A 4MO2A 4GX1A 1CDOA 4WNCA 3E5RA 4R9SA 1U3UA 2LDBA 2IEDA 3U0BA 4FN4A 2W8ZA 4D45A 2J3KA 3P19A 3L4BC 2Y93A 4IS2A 1VKNA 3TF5A 2OBYA 1ZFNA 4MVJA 2WYVA 1ADBA 1P31A 1PGPA 3G17A 2F1KA 4XQ9A 2WEKA 2A35A 4AJ4A 1NYTA 1BG6A 5HBRA 3GMSA 4KUEA 1OC2A 4FS3A 1Y81A 4FCCA 5H81A 1H0KA 4MVJP 4A73A 1NAHA 5AYVA 2D5AA 3WGHA 4B7UA 2JAHA 4YYZA 2D59A 4GMGA 1W4ZA 2ILTA 1B3BA 3UW3A 1H2BA 5IAAA 3W6ZA 2DBVO 4W9NA 1R4MB 5U1PA 1LSUA 4YT4A 2D2IA 4FIZA 4ZN6A 3B20A 4UEKA 5G4KB 4HFJA 4KOAA 1HTBA 1GADO 1E1KA 1N1GA 4DTIA 4PG5A 4G65A 2PZJA 3HB5X 4Y67A 4CM4B 2ZK7A 4P4GA 1I8TA 4KQXA 4NBWA 5LCXA 5L51A 1P0FA 2W4QA 1JVBA 4F6LA 1P1HA 5DT9A 1UAGA 3VVBA 3WJAA 4AICA 3ZWYA 1DAOA 5DOVA 1PL6A 3OETA 2CUKA 5KKAA 4E2YA 1Z7BA 3OIFA 1YBMA 3GFBA 2FPPA 3H9JA 4XIJA 4P22A 3FBTA 1YO6A 4Q3DA 4D0SA 5JO9A 1S7CA 3JD0A 4ALMA 5JYDA 3GN2A 1T25A 3GC6A 2Q50A 3KO8A 3NV9A 4BKUA 4U6SA 4BNGA 2FOIA 3OMLA 4XB2A 1H6BA 5CPBA 3N58A 3WGIA 5CG2A 4BO9A 1YQXA 3SX2A 3FNGA 3ETEA 4JX8A 3HG7A 4QQRA 3DEYX 3ONFA 5L7TA 1N2SA 3WGGA 4G2NA 3DHYA 1E0DA 4B4OA 3ZV3A 5ICMA 2VZ0A 1WZEA 4E31A 5I7VA 2YV1A 3GVCA 4P38A 3E9NA 4ONEA 4PG7A 3HUDA 3NT2A 5ENDA 4YT2A 1FXSA 1V3UA 2X23A 3AOEA 1I2BA 3OICA 4EEZA 2Q4EA 1BXGA 1ADCA 2X0NA 4B4WA 4CLDA 3WLEA 4CQMB 3VTZA 1KIFA 2JFGA 3B6ZA 3AK4A 3JTMA 5L4LA 3TFQA 3WMWA 3KUXA 4CJXA 4UUPA 3ZNPA 4DPMA 4E32A 4MP3A 4YCAA 4NJOA 2RHRA 3WSVA 1EUCA 1HDOA 4TVOA 1N9GB 1I3MA 2ZQZA 2R6JA 1JW9B 1TLTA 3JV7A 4NH4A 4KTTE 2BGMA 1ARZA 2CFCA 1QKIA 4W9NC 4II3A 4M86A 3ZWOA 3U4DA 1ZCJA 4ND2A 5FFFA 5EMHA 4FOOA 1PQWA 2VYVD 4FD3A 1NFRA 5JW6A 3VVCA 1DHRA 8ADHA 4A10A 4KMSA 3AI2A 3ZWCA 4L76A 2V6BA 4O6VA 3ZNOA 4IQ8A 1Q0LA 4Y6PA 3AY6A 4J4HA 1TT5B 3I6QA 1W73A 3TQHA 1UDBA 2TMDA 4MJLA 2VUUA 3JQFA 3WNVA 2DFDA 2I65A 3QQPA 4L75A 1GEGA 4XYLA 4IGEA 4CM9A 1FDVA 2BFMA 4L74A 2B4QA 3B1JA 3BHMA 4WLEA 2B4RO 1NPYA 3DZBA 3F9IA 1PJCA 4CPDA 1N92A 4CL3A 3SC6A 3COSA 2G76A 2IYPA 4CMIB 4QFCA 2GSDA 3FNHA 4PLVA 2VRCD 3SJUA 3AI3A 2J8ZA 1Q0QA 5G0TA 5I9LA 3OEYA 4E5KA 1XQ1A 2X9NA 1RYDA 2R2GA 1V8BA 1HDGO 3BTUA 3WQQA 3UUWA 4LMPA 1B2LA 1P45A 2GGSA 4ZRNA 5K6AC 4JXKA 3KHUA 5BNIA 4XGKA 3TZQA 4KZPA 1KVQA 2VTEA 5DOZA 4ZHSA 3RC7A 1YBAA 3ULKA 5TGDA 3GQVA 4WEOA 3GK3A 1KBZA 2OHXA 2PKRA 4WNIA 1PS8A 3AOEC 3GG2A 3INRA 4BS9A 5JAIA 1KC1A 1ISMA 4GVLA 3PTZA 3OQ1A 4EJ6A 1QR6A 1NVMB 2QRKA 3HB4X 5CEFA 2WYUA 1PR9A 3C1OA 5CP8A 4DBZA 1JKFA 2Q46A 2PK3A 1PL7A 4Q3CA 4WCFB 5L3ZA 4A26A 4D44A 3GH3A 5TJ9A 2Z95A 1ZNQO 3QRWA 2O4CA 2RH8A 2PH3A 5JCJD 1Z73A 1NFFA 2H63A 2HKIA 4IXTA 3KM0A 2J5QA 4K28A 1F17A 3BA1A 1XELA 1WAMA 5I9NA 1Y7TA 4P8RA 3LQFA 4DBVO 3BMOA 1SC6A 1P3DA 1SPXA 4CV3A 1N7HA 3LC1O 4IDAA 1WXDA 4J91A 3RWBA 4AJNA 1W8DA 1A72A 4PZDA 5KJCA 3S55A 1XYGA 2P5UA 3ENKA 3T7EA 3ZU4A 1GR0A 5CDGA 3C7CB 1ZUD1 4L9RA 3LLSA 3O8QA 4J1SA 4CODB 3JQFC 3ZW8A 2QX7A 2O3RA 4I5DA 1Q2XA 2AEFA 3UHAA 5A03A 4KWIA 5COAA 2GUGA 3CIFA 4J9UE 1YL7A 1I10A 4IDCA 1Z6ZA 4XYGA 1Z75A 1T4DA 2CVZA 4IQ0A 3TFOA 3S2FA 2OP0A 5A4DA 2G5CA 2IODA 3KV3O 3VTFA 5C7IO 1CETA 1I3NA 2W2LD 4YVFA 5IF3A 5CFZA 3OIDA 4RCVA 3K96A 3QWBA 3LU1A 3UH1A 3AOGA 3UVEA 4P4NA 1BVRA 2D3TA 4XDZA 3TPCA 1U3VA 1NHWA 3QIVA 5FWNA 2Q49A 4FJ0A 2YQ5A 2V6GA 3H65A 4HV4A 3AUUA 5CEJA 2FPGA 4D3FA 3DFUA 3PJFA 3OQBA 2P2SA 4RVSA 1M76A 3W1VA 3S1LA 3IL2A 4IJWA 1P77A 1PJ2A 4MKZA 3W8DA 5IG2A 4R16A 4QXMA 3A1NA 4IINA 4BKOA 1PJQA 1NQAO 3PHHA 3L77A 3PWZA 4O1MA 4EEXA 2NUAA 3H6KA 4CLOB 4EUHA 2I9PA 1WDKA 3H8VA 4FJ2A 4YJHB 1ID1A 1XKQA 4IJUA 1QYXA 5I8ZA 4XDYA 5CAEA 4EGFA 2H9IA 1DLIA 6ADHA 4YRDA 2JKVA 1D7OA 2X1HA 2ZYDA 4BO2A 4ND5A 3HNPA 4ZA2A 5U9CA 5JAMA 5L45A 5T67A 4GQAA 3MTGA 3R3SA 3NRCA 2O3JA 5G0WA 3U4CA 3H5NA 1NQ5A 2AE2A 3SJ7A 1DC4A 4GSKA 3ZU3A 4PN3A 1GU7A 4FB5A 1EK6A 4YT5A 2V6FA 3ZZNA 3L9XA 4PG6A 3LC7O 4JCOA 4RO0A 2NTNA 3LT4A 3CXRA 3NJ8A 4M8SA 4Q3BA 4F45A 2FR0A 2ZQYA 5KVSA 2OO5A 1U7HA 3PQEA 2P9EA 3AJRA 4I08A 2O3QA 4JP3A 3NGLA 1LDGA 2VOJA 1PGQA 2C7GA 5JY6A 4LVCA 3ZW9A 2XXBA 4O59O 1MG5A 5TNXA 2AQKA 3VH4A 4NJMB 4RVHA 4J1QA 1LXCA 3ZV6A 3LLVA 3H3JA 2Y1CA 4K6FA 4NFSA 4D79A 4D0RA 2AXQA 3TZKA 4IQGA 2IYOA 3A9WA 3LYLA 2IZZA 3BHJA 2E6UX 2Q99A 1RWBA 1BVUA 1Q7GA 3ZHXA 1EBFA 3PYXA 1XU7A 1FDUA 5EL0A 1JLLA 3V2HA 3WBFA 4E6PA 4YRAA 1I01A 3JQAD 5IDWA 3V1YA 5ITVA 1NBOA 3UCFA 4PLGA 1GPJA 2PD4A 5GZ6A 3ETGA 2HUNA 3RUIA 1E92A 2I3GA 1Z74A 3D7LA 2DBZA 3GGPA 3WYBA 5CDYA 2AG8A 2RAFA 2NTJA 3E82A 1GV0A 1HF3A 1PJTA 3PP8A 1LSOA 3HDYA 2XAAA 1NPDA 1RM5A 2J3IA 1K6IA 3HDQA 2DPGA 3UFXA 4AJOA 1LDEA 1EUZA 5G0VA 3ZWBA 2HMSA 3MJSA 2DPHA 4FPXA 4B79A 2Q3EA 3PZRA 1HSZA 2EP7A 4IS3A 1MLDA 5J23A 4FJ1A 4MVJD 1H93A 3KZVA 4R1SA 5K9ZA 2Y1GA 2BGLA 1ZSNA 1LTHR 2Q2VA 3ANMA 4OMUA 1GUFA 3MJTA 3SXPA 1UUFA 1ZK4A 3HDHA 5JMPA 5A9SB 2AQIA 3TJRA 3GDFA 1IHYA 4GWKA 3JYLA 1LRLA 1NR7A 2XPCA 2B36A 3FPCA 4J90A 3TZ6A 1WP4A 1IPFA 1WVGA 2GN4A 2CMDA 3DWFA 3WQSB 1E3JA 1SEVA 4JBIA 4D41A 4BOYA 3EYWA 2AG5A 3DDNA 4PLZA 2B0JA 1DAPA 5DBGA 1OZAA 4J4TA 2EV9A 2GN9A 2PY6A 3JQGB 3FR7A 3I1JA 4RF3A 4DIBA 4Y9DA 1KC3A 1VJ1A 4HUJA 5JDCA 4HX5A 1DRWA 4MINA 4DYVA 3ZWVA 5TIIA 2WD7B 4AFNA 3DONA 4QEDA 2A4KA 3FRJA 5BNFA 3U3XA 3OJ0A 1PTJA 1A7AA 2D4AA 2GASA 4CLHA 3V8BA 1ONOA 2G82A 4UVEA 1DXYA 3UKOA 3K6JA 4CMCA 3PDJA 4YACA 1YJQA 4YJGB 3HE3A 3RFVA 1WW8A 3JQDA 1BSVA 1DIRA 4IDFA 4WUVA 4XIYA 1EVYA 2GYYA 2VWHA 4XYBA 1TB4A 1NFQA 2GF2A 1Y8QA 2CNBA 2X4GA 1BTOA 2TMGA 3INGA 3JQCA 2X0RA 1PGOA 3ZWWA 2Z1NA 1ADGA 3HQ4O 2WYWA 4MP8A 4HP8A 1SZJG 1QSGA 3JYPA 5A02A 1Y1PA 3ZHZA 1HE2A 2Q1UA 4I5GA 4HNHA 1E77A 1R0KA 4B3HA 3DC2A 3DAGA 4L73A 4XZ3A 4NMHA 3WXBA 2WJPA 1YS4A 3QVSA 5L7YA 3TL2A 4HBGA 4ZQFA 1T2FA 1ZVMA 4Q3NA 3JYQA 4GL4A 4DLLA 4IDGA 4CLRB 3BHIA 4CM6A 4EJ0A 5A9RA 2YV3A 3Q3CA 2YHUA 3SEFA 4NI5A 1L7EA 3G1UA 3H7AA 1U5AA 3VOSA 1GQYA 1LRJA 1P1FA 3A06A 4YA6A 4KP7A 3Q2IA 2YZ7A 4OSOA 2JHGA 5JBIA 1DRUA 2Q1WA 4AJ1A 4QUKA 3WOHA 3ONEA 2VUTA 3BMQA 3IKVA 4OIMA 2CD9A 1NP3A 3TNLA 4TRRA 3S2IA 4KDEA 3VC7A 1M6HA 1C1DB 1VJ0A 2DLDA 3AY3A 3OM9A 4J9VA 5IN4A 3C24A 4LW8A 4NFYA 2PD3A 4BNJA 3PWSA 4RZIA 4EUEA 4YPOA 1NQOA 1TI7A 1XGKA 4A0SA 2C0CA 3MJ4A 1BHSA 2PKQP 2UVDA 4RF4A 1WZIA 2WDZA 4LMRA 4Z0HO 3WDSA 1I0ZA 1EBUA 3BAZA 3O38A 1BW9A 2B83A 5EN4A 2Z5LA 2BH9A 5FF9A 1PZGA 5DULA 5JDCC 3F4LA 1BWSA 3LSYA 1T26A 1HLDA 2NU9A 4N7RA 4BQPA 4NK4A 3BXXA 4TKLA 4BO7A 1VE9A 1RPNA 2Y68A 4I5EA 1LSJA 5A06A 4PLHA 1PJ4A 4OH1A 3VHRA 1K6XA 3M1LA 1MX3A 3I9NA 1GUYA 5THQA 4E4YA 1PZFA 4CUZA 5C37A 2DUUA 1YOVA 3AUAA 3PFFA 4Y6SA 1VSUA 5JY1A 2R00A 1LLCA 1DSSG 4NNJA 1XR3A 1CJCA 4RPKA 4YJFB 1VL0A 3ZHBA 4W7HA 4DQVA 4F46A 2RBEA 1ZBQA 1XA0A 9LDBA 4NK5A 2YDYA 3JQAB 4CM5A 2ZJ1A 3T4EA 4GGPA 2EJWA 5DBFA 4YAIA 5ILOA 5DBIA 1C1XA 2Y99A 4JROA 1BDMA 4A2CA 4WOKA 3HFGA 4J1TA 4BNKA 3ZH2A 3BMCA 5JPIA 5B12A 3DQPA 4HFNA 2VHXA 4DQUA 1T2AA 1VC2A 1ZW1A 2HMVA 2W98A 5DF1A 5AQ1A 4ZGWA 1ISFA 3RSHA 3PHJA 2BFPA 3PHLA 4DC0A 4L8VA 4LRSB 4MIEA 5JXWA 5TQVA 1WWKA 3QP9A 1YVEI 3PIDA 4PGFA 1YL5A 5EPOA 3JQ9A 1LBEA 1R6DA 2IE0A 3ICPA 4DLAA 1PSDA 3PYMA 1EFLA 5THKA 4D42A 1PQUA 2J3HA 3KYDB 3L07A 3O26A 1ENYA 4RQUA 1EE2A 2HRZA 2IZ1A 2JD2A 3EMKA 1U5CA 4ND4A 3WJ7A 2YFHA 4WECA 3I4FA 3S2EA 4DUPA 3V2GA 1KVRA 2CDBA 2QRJA 4UULA 1MC4A 3O4RA 4QX6A 4J49A 1B3RA 4PIVA 5EJ2A 1M6WA 4MIOA 1DJNA 2GR9A 3DBRA 3FPLA 3IS3A 3NDIA 1CERA 3PPIA 2HJSA 2WE8A 3GVIA 3H5RA 3PGXA 3FNEA 4B8ZA 3PIIA 2HK8A 4IUYA 4YR9A 1PS0A 1MXFA 1V6AA 4EBFA 3H9QA 4XD2A 3I9MA 4DRYA 4BV8A 2WD8A 5A05A 1KEVA 2WTBA 2O48X 1A5ZA 2YQ4A 4LRTB 1D8AA 1A71A 5AOVA 4DYDA 4PZEA 2JD0A 2NTVA 4R9RA 5FEUA 4B8WA 2DBQA 4ZD6A 3PQFA 3ZWAA 2X8LA 3GRPA 1N1EA 1Z45A 3L4SO 4YWJA 3VH1A 2OZPA 3BTSA 1IY8A 1U7TA 3DOJA 1F0YA 1SB9A 3WG9A 1YWGO 3PXXA 3E5MA 1D3AA 4WPGA 4ZRMA 2YV2A 1PGJA 1XWFA 3GMDA 1R4MA 1YXMA 2Q2WA 3IP3A 5IDYA 4XJTA 1GQ2A 2Q1SA 1XSEA 1LUAA 2ZTUA 3K31A 1NHGA 4RORA 2DUWA 5G4KA 3WTBA 1HKUA 1L7DA 3D3WB 3I4CA 1LA2A 3H9UA 3JYNA 5T57A 1ENPA 4ALJA 3M2PA 2NSDA 3FN4A 5AXBA 2R00C 1YB5A 5A5FA 3DMTA 4I8XA 1K2WA 1NPTO 4BNLA 1JWAB 5C7OO 3RROA 1U3WA 1W0CA 5EESA 5B4UA 1FK8A 3BTVA 3QJ5A 2CDAA 3OJFA 4PRKA 2ZYAA 2VTDA 3KB6A 4TWRA 1ZEMA 5K6AA 4E5MA 4BVAA 4OJNA 1H2HA 2DAPA 5F5NA 1X13A 1I5RA 3D4OA 2EW2A 4RPHA 1LDBA 1UZNA 1TT7A 3M2TA 4MVJH 2V65A 3QWAA 1W6UA 2C82A 3FR8A 3I23A 1V35A 3QVXA 1QORA 1FDWA 5IZCA 1GV1A 2BMAA 3EW7A 1MUUA 1QLJA 2CY0A 1OAAA 1ZK1A 1Y8RB 3C1AA 4Z9FA 3JQ9C 1DPGA 3OECA 4GX0A 3AUSA 1UP7A 1ISIA 1H9AA 5ICSA 1HWYA 2Q4BA 2Y0CA 4N5NA 3AU8A 2P91A 1EDZA 1GYPA 1Y5RA 2P68A 1EQUA 2UV8A 4OKIA 3ABIA 5TX7A 3DTTA 4CMAA 3VKUA 4EI2A 5ER6A 3ZDFA 1R15A 4NG5A 1SOWA 2O23A 1DRVA 2YJZA 3K30A 3OJOA 3VPGA 3GPDG 5KCZA 3IJRA 3MZ0A 3VH2A 3DXFA 4OO3A 1GDHA 1QYVA 3KRTA 3ROQA 2BI7A 5GZ3A 3GAZA 1GAEO 3A14A 3GUCA 4CQMA 3P2YA 1GL3A 4LGVA 3INTA 1EUDA 3I6IA 3PVZA 5DZSA 4BGVA 3ZNNA 3FNFA 1G6KA 1Y9EA 5L9AA 4HFRA 4R4JA
chains in the Genus database with same CATH superfamily
1EE9A 1DJQA 2VHCA 3HA2A 3TH5A 5MDHA 2H6EA 4DV2B 3UTDA 4H77A 4O1HA 1WTAA 1XMQB 3OM1A 2QKYA 1KI6B 1W2HA 1I32A 2Q4TA 3QLTA 5C46F 2IDMA 2YOHA 1GT6A 3LMKA 1L9XA 3I83A 4MV9A 1N9GA 4KQMA 2P5YA 2Z1DA 4HXEB 3W7AA 5A71A 2ZBPA 4MR8B 1QO0D 3EVBA 1JWBB 3FPSA 1IONA 2J33A 3OZRA 3UMJA 4E3ZA 3WWYA 3EXHC 2X5KO 3WFJA 1CIVA 4Q1VA 1QYCA 4HATA 2C2OA 3AHEA 1P7ZA 2C9DA 3IQGX 3VYUB 5JADA 2GNOA 4GBED 2V0CA 2O8FA 2HF9A 3DBHA 2A0KA 1F2DA 2CNWD 4WBNB 1UBCA 4P83A 1I9GA 5F78A 1PKEA 4CNQA 1E2UA 1ZA2A 1SVMA 2GHTA 4O2AB 3IJ5A 5DHTA 1GTMA 2XW6A 3CSUA 3NIGB 3H1TA 3U1VA 3ZKWB 1Z22A 4CYMA 4DADA 1N9KA 2GK4A 3NEJA 3U40A 2FK7A 3FTFA 2EQ5A 5CK5A 3TKAA 3MT0A 3ABZA 4N5DA 1RYBA 3G5UA 3UHFA 4CT4B 3LQ4A 1JDBB 2LCIA 4KRGA 2EHDA 1X0VA 2QORA 3TNJA 4CMIB 5IZ4A 4XKJA 1GXSA 2ZR0A 1ADJA 3DO8A 1BMFD 1KFKB 1KMQA 2H85A 2YICA 3IBYA 4MAAA 3UOWA 4I81A 4E1BA 5EJ9A 4TXHA 3UK1A 1FSFA 4JUDX 1Y9JA 3GJ7A 3N2IA 4U7PB 1N4DA 1F0NA 3HACA 4X24A 3K73O 3T7RA 3LYHA 4O29A 2ACEA 2PQ6A 1VIAA 1X2EA 1M2GA 3KJNA 3B7GA 4X6UA 3ME5A 1N57A 3D3KA 1E0AA 1Z5GA 1J1ZA 1V11B 4A0RA 1RJ9A 2X8BA 1E66A 3C7DB 3RU7A 1UKYA 3TG2A 4R84A 3EODA 2JBWA 2LE0A 3S2GA 1E3MA 5K8TA 3NBFA 3UPTA 1I2AA 3NDJA 4D82A 1T4BA 2PXCA 5BV2P 4P7GA 1B8PA 1Y33E 2C2KA 4RLQA 3HWRA 3UPUA 4GDFA 2Z58A 4TL9A 4D4LA 4OGKA 4ATNA 2CXPA 4L6IA 3P45A 2C00A 3O6VA 1BWPA 1NMEA 3R4CA 4ZHQA 5ENVA 1IQ0A 1D6SA 3G7UA 5ESXA 3SDSA 2O7NA 1AQJA 2NM0A 2R11A 4P3PA 1RW4A 1VPDA 5GIPE 3AF4A 3QZUA 2GAFA 3DTVB 5C4GB 5ADHA 3GXOA 2EARA 4NCBA 1G6HA 1XF1A 1WY7A 1E79A 2E4AA 2IHKA 3AFNA 1EWVA 1FOEB 2BBWA 1E4OA 1ZXLA 3P0FA 4J3FA 4FNMA 4M9QA 5A04A 2WM2A 1AH2A 1YAJA 5BWCA 3K20A 1NJ2A 1YCGA 1MO6A 4LGCA 4F97A 3EDQA 5IF9A 3G82C 2VJPA 2I2BA 3QWFA 4BNTA 1CG6A 4ENQA 1U0RA 3KJEA 3DLBA 2VT2A 1G16A 3JWJA 1JIQA 1Q0RA 2J5KA 4CL8A 5I7UA 3Q7EA 1FTSA 3WQRA 1EEXB 2MMCA 5F3DA 3DL0A 1QGED 2RHTA 5T6BA 1DHTA 4IHJF 2NW6A 1T5TA 3C6XA 3E9ZA 3GIWA 4BMZA 4YI5A 1TM4E 2F9LA 2DPMA 2BEUB 2EJUA 2YIDA 4AUEA 1T2NA 3F98A 3UKDA 2BTQA 2D13A 1U7XA 4FOTA 5B3KA 3RAEC 2QSJA 1QFSA 2VTBA 2C77A 2XBMA 4F06A 4RVFA 4F72A 3ZJUA 4UM9D 2EQAA 4ZI7F 1OLOA 4L0DA 4NU5A 4NZ9A 1JHDA 2XCQA 1DOHA 3D1VA 4ASUA 4CKYA 2XJ4A 1Q20A 2ZM6B 5HDQA 4FBLA 4ZDKA 1WE2A 4JI3B 1KI4A 4CFYA 1PK8A 1PYGA 1ZYUA 2HJHA 4TT3D 4DPLA 4JEUA 5CJJA 2XGGA 2PSJA 1G4UR 1VMEA 1LI4A 2GAAA 3CPHA 3EN0A 3GEMA 1I2CA 5ARBA 3OTQA 2IDKA 5HRUA 4EA6A 2BGRA 2C4HA 1CF4A 2GX6A 3L1IA 3JY6A 2NNLD 3A6EA 2QT0A 3A10A 1HEUA 2FFJA 3I6BA 4MUGA 5DHQA 2BSAA 1M74A 4PN7A 3GGOA 4FFPA 3KVOA 5AI0A 3QVWA 2E21A 4D26A 1CVIA 1V4VA 2NYUA 2H51A 2JARA 3NYIA 3D4BA 2RB4A 3QHQA 2R86A 2HLDD 4EO9A 2QLNA 1AK9A 4DIFA 4MUMA 1YULA 2QHXA 3EPPA 4JI0B 4OG2A 2WSMA 1E1RD 3OQNA 5F7ZA 4HY3A 3GBPA 2B98A 2NP6A 5G2OA 1Y8CA 4WESB 2I3BA 2A9JA 1FBNA 1RAEA 4RNDB 4F8JA 2JLVA 3W8RA 3QV1A 3PUYA 1FS4A 2VQDA 1GZ3A 3IC5A 4NQZA 1WEKA 3IO3A 4LCEA 4RK0A 4W5QA 3CLRC 3OIVA 4Y8VA 4S2EA 4F86A 4YV7A 5JD6A 3LWZA 5BO5A 1IZ9A 2EG5A 4KIWA 2W6QA 3C15C 3C3PA 1XNHA 1PO7A 2QGFA 5BN4A 4GH5A 3QBDA 3NR2A 4H6PA 1LBHA 3CEAA 5F2OA 1QVVA 2OP1A 2WINI 5C7YA 3WIBA 5JIBA 1Z17A 4R51A 5B1HA 1AHHA 2NU6A 1Y0BA 4KE6A 1Z6TA 2ZRCA 4RPCA 2PRZA 4ZCPA 3H2KA 2AN4A 5JO0A 1OR8A 3LT2A 1VM6A 2OB1A 5SY9A 3CIOA 3IHLA 4BVGA 4TTTS 5TMEA 3TW6A 1WB9A 1SXHA 4QTTB 4ZJZA 2QK4A 2FHPA 4O2LA 1D09A 3D5QA 5IX8A 4EECA 3PNLA 4E2ZA 1B0UA 2PZ8A 2V54A 2ZSFA 1D0IA 4TUYB 1DKRA 1PP4A 2JCGA 3HUUA 3AQIA 4OXQA 3FVTA 4PIPA 4QEKA 4WV3A 2VATA 3BX1A 1E9SA 1WDWB 3BXEA 1WU7A 1FX0A 3B3JA 2FWRA 3R3JA 4WKPA 5DXAA 3IAAA 5EINA 1DIAA 4TYMA 2UYGA 3ZD7A 3GEHA 4DQLA 5KTPA 4PO9A 2JGLA 4TMXA 1X7WB 2VF7A 2X0FA 4WCFC 1G3MA 1RKQA 4X0EA 4YYEA 4BLOA 5I48A 3THYA 3RU9A 4CVNA 1J0EA 2IXGA 4FR5A 3HB0A 3QX9A 3BM5A 3F8SA 4HGOA 2PZLA 1UJBA 5L7WA 4GX2A 3T5GA 3WNZA 2EXXA 3QYJA 5IP5A 3SKXA 1ZW6A 3B12A 2FX5A 3C5EA 1JHPA 3H3FA 5HZMA 3GLIE 4Z9BA 2R96A 4B6PA 2W43A 4MDFA 4B83A 4K7JA 2ZYGA 3OJEA 1N7JA 2H92A 2Q9CA 3AUTA 1NT2A 2I0FA 1FTQA 3PD0A 2AB0A 5G0UA 4E21A 3T95A 3QPVA 1PU2A 1G8SA 2V4UA 4NYMQ 4TYNA 5BSUA 2H4XA 3I42A 3M6WA 1JN0A 3PXGA 4N6NA 2GZ1A 3BMNA 1E98A 4QYXA 3ZI7A 3PUJA 1E1DA 1GPWB 5ALFA 4BO4A 4KE9A 5KSOA 1EFHA 1ZGGA 4KRYA 2BI4A 2NZYA 1HZZA 1M2OB 2DTDA 4HZIA 4R54A 2RH4A 3HY3A 3N5CA 2HHAA 4KLZA 4C2AA 4B17A 5J43A 4L5JA 4Y2PA 1GDTA 3DHEA 2X42A 4HNAA 1H05A 3IUMA 1XMOB 2ZRDA 3C43A 4B3JA 3AFMA 3GCXA 4RX1A 5DCYA 2XQVA 1Q0HA 4A16A 3OHPA 3P5SA 4NR0A 3NC4A 3AERB 4E33A 1IZ8A 4DMHA 2I3DA 2SKDA 3UT6A 1QP4A 1GSHA 2CUNA 4FHCA 5FBWB 5I7SA 4W7IA 1T24A 1T91A 1Y7PA 2PSDA 1U8AA 3FZGA 2J1LA 2OCGA 4RQTA 5FUVA 1K4KA 5B7NA 1Z4KA 4REQB 1RSZA 4JSYA 3CH6A 3EEOA 4P3NA 1HFWA 2F4NA 3DOOA 1N0WA 1M1YB 1FFXA 2IP4A 2WIKA 4G9BA 3CZCA 4EKEA 4Q9IA 1IPEA 5A3SA 3H75A 2PUCA 2BIFA 3OF5A 2C31A 3AFGA 5D7BA 1ZU5A 5ALSA 1KEPA 1E1NA 4DLSA 2FX3A 3I2GA 2FUG1 1V4BA 2XKJE 3TCKA 2CLFB 2OGZA 3RRFA 4DM4A 6Q21A 3LTNC 5DXFA 4BYMA 3F78A 4YRTA 4DG9A 1A9XB 1FP4A 1JSCA 3EAFA 4V3CA 3AGQA 2Y0BA 4TXNA 5E3IA 1BROA 2P9CA 4CRWB 1KJNA 2GM5A 1EH5A 2IPLA 2PO5A 2XAUA 5AM0A 4YXWA 1KPIA 4XQCA 2B5WA 1V4NA 3N2ZB 2E48A 3DZGA 4KXWA 2GEVA 2IT1A 1CJUC 1NUUA 2OMKA 3MJRA 3MTEA 1WB5A 5TQ0A 4C04A 1HRDA 4BC1A 1PJBA 2IY7A 2SKCA 4HPWA 2XWPA 1P4GA 3I2HA 1UDWA 1X7ZB 3C41J 3DCJA 4FTWA 4Q4DA 1KY5A 1W46A 2FFQA 1SC9A 3WNQA 1UBEA 3MNFA 3O1IC 2UZ3A 5JNSA 2QUZA 1Y5MA 2XDAA 3GT4A 3O0DA 4H1HA 4XEUA 2M1XA 2M6RA 5HS6A 4AF7A 2JIZD 5C5EA 4IBOA 1I6WA 5AJXA 5B7QA 1DBVO 2AWOA 2F3PA 4AYWA 2EWMA 1FMJA 4FE7A 3WB9A 4TLDA 4ZVSA 2R1TA 3K6KA 1M34B 2D06A 3BH0A 3DD5A 4UM7A 3VV2A 3K8ZA 1A5TA 5JPCA 4UUNA 1J25A 2BGWA 3BGOS 3NOVA 1NP7A 2RGBA 1YI8A 3MD0A 2KHZA 2VLIA 3UMRA 4F3RA 2FHSA 1IATA 4C4XA 4E5UA 2CE7A 1OLUA 2M1ZA 2EFCB 2ZUDA 1Y3BE 2JFPA 3L0CA 3TZCA 3UV3A 3W7BA 1ZSYA 1BHJA 2IVZA 1FFAA 1AC5A 1PJZA 2F9MA 1G8KA 2YYSA 3CRQA 3WMEA 4BXOA 3H5AA 3BFXA 3DB1A 3H05A 2H9YA 5E1BA 1R0RE 2GK7A 3UUEA 5HZGA 2VT7A 4UUAA 3PQDA 1VIDA 5EGNA 2JF0A 2A84A 1N0UA 3BF8A 2CJYA 2PQ0A 3UUFA 4B35A 1WNTA 3CKYA 4HB0A 1NVEA 2C8KA 2QDXA 5F5LA 3VR6H 3ELYA 5IDQA 3F97A 3HPQA 3H5OA 3OSUA 2YWRA 4IHJB 2E7ZA 2QVBA 3RYHB 3QEAZ 4IGIA 3W34A 3W5VA 4KRFA 1RWPA 5ALRA 3SC4A 2CLSA 2DR0A 3GY0A 3RANA 2O52A 1AKWA 2M98A 4JLAA 1ZI8A 4D81A 3DMHA 1F7UA 3DDUA 2IYQA 4JOCA 2NWQA 2NZXA 1UR5A 2ZBDA 2PLAA 3D0KA 4EGQA 4JHLA 5EYPA 1KI2A 5K8CA 3RARA 3Q11A 3N86A 4GG1A 3SF0A 1T5DX 5ELLA 1L6IA 3HM2A 4U7FA 4YQFA 5KTSA 1R8QA 4Q1EA 2VXYA 3TTWA 3K6RA 1Y7HA 5AIAA 3BXZA 3KZXA 5KWEA 3BCHA 4RY8A 2JH8A 1QGUB 1WCIB 1ZJZA 4J7CA 2EKQA 3GAMA 1M5RA 2NUBA 5FNZA 2C5BA 1RI5A 1ZXBA 3ZE6A 5EE1A 2B69A 3F5SA 3AM4A 3NC0C 5NULA 3T3OA 2BGIA 4L4SA 2BFAA 2XVZA 3FDZA 1DEXA 3HP1A 1EGMB 1YQDA 4KG7A 4NMXB 4QSMA 4PLYA 2EJVA 4MA5A 1KGSA 3E58A 1Y1SA 4U0JA 4XSHA 4RH1A 2ZJOA 3LE8A 1CNMA 3VPFA 1KEWA 3MWEB 1DZ3A 4KDCA 3GRZA 2VJMB 1QZTA 3BZUA 4O4LF 3UQYS 3I9V6 1ZM4A 1HI9A 1RWOA 4B33A 1Y1QA 5JALA 2Z1MA 3RTAA 1ZX1A 1YS9A 3EVGA 1AUQA 4P4TA 3V9PA 1VJDA 4FILA 3H8WA 5DNYB 4NZPA 2CN1A 1ZK3A 1W25A 2C20A 4MPTA 3P9KA 1ZD5A 1PUXA 2EKDA 1FSZA 1H66A 2F1RA 2HMAA 5IH7A 1AKEA 1N8TA 3MQFA 2IDZA 5AQEA 3EVAA 5G3YA 1P0CA 4BVEA 3LOUA 3DKVA 3TBFA 5EJ5A 5SICE 3Q3GE 1K5GA 3MS2A 4UUMA 1FJ2A 1F20A 4UJ5A 3G5LA 1BW9B 2GCGA 2X3FA 4JB2A 3VU9B 5TC4A 3K71B 1B8UA 4JDUA 1QZ3A 4D9CA 3L5KA 3BDIA 3OJWA 1IVNA 1USIA 3C85A 3A3OA 3DQZA 3KPVA 3LBNA 4N82A 2C8LA 4FHEA 4XLTA 5FL3A 3LP5A 5IMBA 1ND5A 4BIIA 2HMYB 2BLLA 3EB9A 2GFQA 3GRRA 2NGRA 3GZ4A 3OFKA 3V4VB 2J67A 5IC6A 2BYTA 1FMFA 1YDMA 1JEOA 1ST2A 2AXNA 2Y1XA 1GFZA 2Q3FA 3V32A 3SVZA 1V5WA 3FD8A 3NWBA 1OI2A 2G7MC 4YI3A 3IGFA 4CGZA 3KIPA 1G20B 1OFUA 2WUEA 4XJVA 4CM8A 1YNOA 3BFJA 5JCPA 1TRKA 1F2UB 4FDAA 1G5RA 1LI5A 4NCNA 4NXNB 5TPZA 4RTJA 4WN9B 1WMAA 1J7KA 4RELA 4XQEA 5D5PA 3VKFA 1P9LA 3NBAA 5ALDA 1O58A 2L42A 3PJDA 1U7UA 3EY4A 1U2DA 3GT3A 4PTLA 4UDNA 5F3RA 1H2RS 1D6MA 1ZHHA 1RHKA 2JANA 4INPA 1QLHA 2FY8A 3OC6A 1LX6A 2OWEA 4U02A 5AVUA 1AIPA 1OXTA 1BXRB 4EGSA 4J76A 5B55A 1IBMB 1VG0B 3KV1A 2JGDA 4TWAA 4C5CA 5B1EA 2ZUCA 1GUAA 1ULAA 1E1MA 2OHJA 4IDDA 2QX6A 2HRQA 2CDNA 4Y9SA 2VSFA 2ZAIA 5AI5A 5FOXA 5L8VA 1ULSA 3CEHA 2BFOA 3OTHA 1KI7A 5HF9A 3GLGE 1Y9ZA 2C2GA 4NCAA 3VKHA 3MUEA 1LDYA 4B3BA 2ZG6A 5EQFA 5J63A 3WBKA 4RZQA 5A4KA 2RFLA 3HCEA 1Q0UA 4LMBA 5LLDA 2FLKA 3CCBA 3ADBA 1WIWA 4OYHA 4KXXA 4DDUA 3IIKA 4QO8A 1RWMA 2C4WA 3R3UA 3PXBA 4M7OA 2Q6TA 3M6MD 3TAXA 4XM1A 3I9JA 3UJ3X 3IEPA 3CISA 1JPVA 4PSVA 4TROA 5KJ6A 1AVTA 2BY4A 3F1KA 1M2HA 4XR9A 3OCYA 4RD1A 4P5PA 4XB1A 1VBNA 2MHCA 4BNHA 3KBOA 3H83A 5SYMA 2MYUA 5FOQA 3RTCA 5KQGA 2IU4A 4EAAA 3JQBA 2NSLA 4K8RB 5AW6A 5JS1A 3DUWA 2E4UA 3Q3EA 3WLJA 2CV2A 3NNSA 3ZTTA 3OQIA 1ODFA 3SQNA 1GU0A 1CDDA 4TV9A 2JAUA 2XKAA 3RYIA 4KI0A 3UB4A 3KVYA 1K89A 1KDZA 1CW2B 4AS3A 1RPAA 4BQNA 1L7QA 3VYWA 3C3MA 5CA1A 4A8JA 2A3RA 2MSWA 4GPEA 2P6RA 2DTEA 4LXUA 4S05A 3KHSA 2W2PA 4AZ0B 3ER8A 1PVOA 3IOCA 3SR4A 5H4GA 3OIGA 1J9GA 1QIEA 2EVWX 2J59A 2Y6UA 4IIJA 4IIEA 2OORC 3E3AA 5FOWA 3W5JA 5EKUA 2J0QA 4WJKB 4P9NA 4QL3A 1MU0A 3R40A 3UBTA 1X7DA 1AQYA 2SECE 1E0SA 5DTQA 4E5YA 5BXQC 3H11A 1BD4A 2GNPA 3HR4A 1E64A 4IX1A 4BO6A 2F17A 4BNFA 4M54A 5IW8A 3JQ6A 1NBWB 1E7YA 2QP3A 2PIAA 4KYIB 4ND8B 5IJAA 2XE6A 3HDGA 4BFCA 1V48A 1OXKB 1O2DA 2PVPA 2GPWA 3LM8A 4R68A 4OGGA 1CR1A 2B4TO 2HQ1A 1CUSA 1GAJA 3R4VA 1JIUA 1ZGCA 2FOXA 2DJIA 3D5EA 4FC7A 4F6RB 4S1OA 1JEYA 5JE8A 4JI2B 2XF8A 4I50A 2AW3A 1G8GA 1DAFA 1SOMA 2FFBA 2QLJA 4QGFA 1KEEB 2FPPB 4R1NA 1MEJA 4S3MA 5AFSA 1HNZB 2G80A 4R8LA 4E13A 2H8GA 2IBTA 2G67A 4LISA 1O6GA 5ELXA 2O50A 3UW1A 1GT91 2ZYVX 1H2WA 1HPLA 2C9BA 3L01A 5CDSA 4Z0TA 2GTHA 4HK4A 2C0QA 1PGNA 1ZN9A 3H1AA 2QM7A 4QASA 1QHSA 5IYZF 1IHPA 4Y2VA 3ZHUA 2ZCJA 2ZT8A 3AJAA 3B3FA 3VHXA 3NHWA 2B20A 1XZDA 4ZK2A 3EYAA 3SC2A 2WJHA 2RIRA 2IFTA 3AVOA 5FLKA 1FEZA 3CH4B 3IBCA 2WAOA 1IOZA 3ZGXA 2X86A 4AX8A 1Q1GA 1Z6PA 2EQBA 2OLJA 1FLAA 2WW8A 4EW6A 5IULC 3F5FA 4MQ4A 5DGIA 3OEWA 4RH0A 2HK6A 2ZUVA 1L5KA 5CDUA 1Q7BA 2Q45A 1YUNA 3QKTA 5EUBA 4L4YA 3RAFC 1EDEA 3UV7A 6ABPA 4CLXA 3JALA 3U4QA 3G6WA 4UTRA 4LWOA 1NVFA 4E14A 3P52A 5C7LO 4ZIRA 4FD2A 2CSXA 3KQMA 2AMFA 3LK6A 4DDTA 1PR4A 4Y2GA 2E4WA 4KFSA 5GMOA 5JG7A 4XX0A 4II7A 2P3QA 4TKMA 3KJQA 1V96A 1H2AS 3FYSA 2R7MA 3MM4A 2CV0A 1NW9B 3KKOA 2HU2A 4LYEA 1C0IA 2NMVA 4OBWA 1KEKA 1DFIA 2C2XA 4EITA 3L7MA 4P7FA 3ROTA 4C7JA 1YFZA 1E7QA 3A37A 2IS4A 3ECSA 4R2XA 1IAQA 2FTKE 4JBHA 3GNSA 4OHCA 1EVKA 1JQBA 5LB4A 1ZCZA 5C8ZA 3PZBA 2FE1A 3E05A 3X1YA 1EUCB 2HA5A 4OD0A 3QPDA 4LXHA 3SX0A 2AVDA 1EZ4A 3GJXC 3L0DA 2P2CA 5JSKA 2Q3CA 4YAGA 4WZBA 3FSJX 1KQOA 1R8SA 2A7QA 2LKDA 3S1AB 3OCUA 4HDMB 1S1MA 3OEEA 2FPIA 2C3YA 1RAIA 3CSSA 5JNTA 2C7PA 1W85A 1KAEA 1CUVA 2DKFA 4FSHA 4IMPA 2ZAOA 1B1AA 1ODIA 1HDEA 1LGYA 1U11A 1QGOA 4B09A 1CRPA 3ACDA 1XF9A 4HWRA 3RC8A 3RC9A 3OOEA 5HS4A 2Q9AA 4GWGA 4EW3A 2FMXA 3FF1A 4S1VA 4WK4B 3NTOA 3WE7A 4R8VA 1NJ1A 5ICCA 1U9YA 3I92A 1P80A 3N8IA 4ZCIA 1OPRA 1K5DA 2BW0A 5EWLB 4IMRA 1M5TA 3DZIA 1GZ4A 1MABA 3KAKA 2CZCA 3SZLA 3BWEA 2QTZA 4H0FA 3A4VA 1XXHE 3B1ZA 5HR5A 1IN8A 2FSGA 3HN7A 2FEAA 3F7NA 4XVRA 4HAIA 5B3LA 3FFTA 3D3QA 2X5OA 4OHBA 3A3YA 3AIIA 2F4VB 3O31A 3HRKA 4A92A 1X19A 3K9GA 3HJTA 2OBNA 4M1OA 3MTJA 3VU8A 1SUBA 3BK1A 1I0IA 1IB0A 3ENWA 3QTLA 2H31A 2ID4A 4HDRA 5JSZB 5A7FA 1N5LA 4EJSC 2OFPA 1W4AA 4BMNA 1J0BA 3OZUA 4O4HB 3PI7A 3WYFA 5F4ZA 4JNKA 1IM2A 2W2XA 3HVJA 2QNRA 5CM8B 1Z7EA 4U2CA 3RIEA 1WHSB 4RTRA 1UOQA 5P8WA 5E4TA 3NW9A 4CMIA 8GPBA 5FO0A 2BGUA 3IPYA 2YUIA 2JJ2A 3GO4A 3PFIA 4UMVA 2QTVA 4O0LA 1RBQA 4BAGA 1H65A 1GRVA 2ECQA 2QYHA 5HNKA 2P35A 2GI4A 2R84A 3KOMA 3SP1A 2C94A 3AESA 1B6SA 3QKWA 4H7KA 4MYRA 4PXAA 5TGZA 4E15A 5A3QA 4B0OA 3SYMA 5KNDA 4KQ2A 4XTRA 1DIBA 1DU4A 3GIDA 3SBOA 1KFBB 1WCXA 3A9CA 1ODSA 1XDDA 1KVTA 2VBCA 1X92A 2Y0EA 3KOOA 5C4IA 1D2NA 3KPWA 4FLFA 3OCWA 3AU9A 2ZB4A 3BWYA 4KREA 3V46A 3TQOA 4C5AA 3I5MA 4PFJA 4LRUA 3BMXA 3UAOA 1RKVA 2FW1A 3C1UA 3GFTA 2FH5B 1T43A 2JKYA 1G8MA 4K6CA 2DUJA 2GUWA 4K9PA 4P3XA 1PAUA 3QV2A 1DARA 1RYNA 4WLUA 4C87A 2COUA 4I4LA 1VL2A 2FZEA 2Q5QA 1E2PA 2JGEA 4RQAA 5KWIA 3L49A 5F51A 1U94A 2P8JA 5F7XA 1DNPA 2W93A 4I4CA 4J16A 1E2NA 1F8YA 1P0IA 4Z3DA 1G1MA 3R0ZA 3USZA 4DEVA 4PO1A 5JNVA 2A0XA 2AFIA 4B31A 4CF3A 1T9DA 1MC1A 2DH6A 1X1EA 3TL3A 4XWKA 4LY9A 5JV5A 4BKQA 5MGNA 1SIBE 4M9RA 2QL9A 3GA7A 4ZOLF 1JQDA 1N5MA 3D2LA 2XCIA 1G1AA 3KYCA 1ZNWA 3Q0IA 1FMTA 4W1QA 1RLOA 1M0EA 1XPOA 4ZFNA 1W4BA 1P9NA 2BEVB 2JAQA 1U90A 1OXSC 2IK8A 3HDTA 5BSGA 2YXBA 3KSRA 2Q29A 3V00A 4MCAA 2J6IA 5BQ5A 4QUAA 5FBLB 1PIWA 1CJSA 3QYPA 2O2GA 3K1TA 4A6EA 4AKSA 1LY1A 4CWAA 2Y05A 2WP0A 3K0EA 4OHYA 4BBAA 2BGTA 3MAGA 1RVV1 2O5EA 1A69A 1A95A 4RWZA 2JHFA 3P97A 1AU9A 1Q7EA 5FWDA 1VE6A 1WVMA 1ZI9A 4BKPA 1SD5A 1OLSA 3OI7A 4OYRA 2OBLA 1L3CA 2A5YB 2MINB 2XTNA 1MP0A 3A3PA 3PQ4A 4LYHA 5AHKA 2FZ4A 3TRFA 4I1RA 3WR5A 1XA4A 2V5UA 3P94A 1QDLB 5F33A 5T8KC 3EVCA 3FPHA 2FQXA 4Q01A 3O9VA 2J3MA 3FPJA 3R0JA 3EA5A 5AVTA 2JD1A 2XA2A 5AVRA 3B78A 3C8DA 1XXLA 3WYAA 1K98A 3ZCRA 4LDAA 4LY3A 4BNWA 5KC9A 3VDXA 6ADHA 1SHKA 3DPIA 2VK8A 2QVGA 3NVMB 4DHWA 1ZWKA 2EIHA 1J21A 2QE7A 1DWOA 2ZIEA 3NBKA 2QX9A 5DLDA 3UK7A 2C2ZA 1ES9A 1EK5A 2EL9A 2O2EA 2V6IA 3WRXA 4AP6A 5K3SA 2ZZKA 1XZPA 3UGTA 2QRQA 1HDXA 1UFRA 3CW8X 4UTOA 3HBNA 1UP6A 2JH9A 1TYEB 4X00A 3A58B 5CXXA 4B3XA 3GLFA 1XX6A 1ESEA 3GGGA 1ESCA 4H6XA 1DWPA 3HLYA 4MRMA 3T12A 3KTAB 4CUJA 4CETA 3HTXA 3S3TA 3IEKA 2GJKA 2NUAB 4GPAA 1S8NA 4N18A 4TWBA 1GUDA 1XALA 3JYOA 2JFZA 3BIWA 4AKEA 2D1RA 3HJUA 4CFZA 1H9CA 4PF1A 1LK7A 5HPYB 4Q7QA 4BV9A 3VYVA 4G5GA 4G6ZA 1VSTA 1ITZA 3TDKA 3GLTA 3MMPA 2BELA 4HWGA 3BVPA 4BE9A 3KQKA 1E0JA 2FZLA 4R1QA 4C2BA 1XKTA 3LPDA 4G2TA 3O7WA 3PEFA 1O7JA 1OBFO 4PPQA 5JYEA 3AHHA 4JLVA 4Q4HB 1OWMA 2BEWB 1O03A 2Q5JA 3TQRA 4NBSA 4NMMA 1DFHA 2YOFA 4BEVA 5JZSA 1P4JA 1IN6A 2IL1A 2IRWA 2PKYX 2QR2A 2PH5A 3TIIA 4CIBA 3PC8A 1L1RA 4QRHA 1VA4A 3A28A 2ZR8A 4ND7A 2WOOA 1SHUX 1GPDG 2AA3A 1U2GC 3D8HA 1EM6A 1RXVA 5K0SA 5CCBA 1XEXA 3BYZA 2EEZA 2O4UX 1X7GA 3LHSA 1Z34A 2HRBA 5J3JA 2QJFA 3VU3A 3L0BA 5BQXA 3L4JA 5A0TA 1HYEA 4P7BA 2EF1A 3FTCA 5FHQA 3TM5A 1CUBA 3B70A 3OBIA 1FSSA 1ZR2A 3DWIA 2HJRA 4K6GA 3GZNA 4MKRA 1JB1A 3DNPA 3JPWA 1QP0A 1LPBB 5KJFA 3PFBA 3JZMA 3GCGA 2DJ5A 3ISTA 3C6MA 3IV6A 1J2TA 2CFIA 3WMRA 1KK1A 2E18A 1GGVA 2ZXFA 3K09C 4R3UC 5CDFE 1MG0A 2HNKA 2QRPA 1WCV1 3ORSA 1YR9A 4YAKA 4NY1A 4X65B 5JC8A 1VE7A 1ECGA 1NM5C 4XA8A 4DWVA 4NJMA 5AW9A 4K8OA 4M0MA 2F48A 1CXZA 3MWFA 4OKSA 1M2EA 3I72A 4FT2A 5HFJA 3IPXA 3TPFA 2J4DA 2VPZA 4GBGA 5AOBA 3V8QA 5IANA 5JVDA 4GC5A 3IAXA 1O4WA 4MWEA 4X95A 3ND5A 5DP1A 1CQZA 4BO8A 5FAXA 1EP2B 4E5NA 4FGWA 4TMZA 2PUAA 1W19A 2HU8A 3BCUA 2ATEA 4EB8A 4KQKA 1DV2A 4C0QC 1WL8A 1O8BA 3EZLA 2WTUA 3ZCXA 3OQOA 3BCSA 2DT8A 3EGDB 5AJWA 4K9QA 4Q9LA 3VR5H 2HT6A 2M32A 1W36C 1U28C 5E0KB 3JD2A 1RQNA 5EXDA 1GEEA 2P9BA 3RFUA 4QM7A 1AE1A 1INLA 4YMWA 1R0ZA 5LU9A 1N3YA 5B1SA 4AKIA 5A5EA 3HBLA 1TIKA 3J81A 4C0JA 2VZ9A 1CYEA 5EE0A 4EPWA 1KARA 5BN3B 3A1TA 1JR6A 4FR0A 4BBZA 3WGMA 5B2EA 2XMGA 4TL8A 2I33A 4NHEA 3HSYA 5K3AA 3SMQA 4DN6A 3QF4B 1Q1ZA 3F46A 4KVFA 4HDSB 3N0TA 2AYYA 4U5QA 1E1CB 1ICEA 3GPIA 3MMSA 3VM6A 4R1UA 1N36B 5AKXA 9ABPA 4EPYA 2Z43A 5AP9A 1UAYA 4DQXA 3PD7A 2ORYA 1VJCA 4D99A 4F8YA 1FRQA 1URPA 1MVLA 2B1JA 4FQ8A 4F84A 3G9UA 4YEDA 5FPQA 4BVKA 1DEHA 1QPZA 1O9BA 4QEZA 1OJLA 1S8FA 5CVUA 1G4AE 5I8WA 1TZCA 4JZYA 5G41A 1GCAA 1PV4A 3CXUA 1W96A 1AT1A 2W58A 3G2PA 5FFMA 4DMLA 3TQCA 1CUXA 3D5TA 1OFGA 4LHXA 4X64B 4DT1B 2JLAA 5EY5B 3KE8A 4B4KA 1G21E 3QXXA 5KEIA 3BWVA 1ULBA 4EPXA 4EHKA 4J1NA 1OGIA 3WKDA 1MT3A 1ABFA 3LV8A 3KLNA 3R7AA 2QMQA 4RK6A 1GIAA 3IP1A 3D0QA 5ENZA 1O1YA 2A5DA 4FDMA 1WHTB 2V0NA 5DCWA 4ZEVA 1DKPA 3A6PC 3L7NA 1NT4A 2AQ8A 1KHTA 3T3DA 3MQ2A 4MS1B 1DTWB 1E7RA 5LYYA 2ET6A 2M9MA 4ZEOA 3E18A 2QVZX 4G5RA 2OV1A 1MJ5A 2GWHA 4BQRA 4RV9A 2CSUA 5IAEA 2OXFA 3CBGA 1FVOA 2IHUA 2PYIA 2CZGA 3D3EA 3QYFA 2GHRA 4XM2A 1EMDA 1CF9A 3D1LA 3QMVA 1DMRA 2DPXA 4IDOA 2AV6A 2FW6A 2QMEA 3HU3A 3MS7A 2VS1A 1O8CA 3FUWA 1NUQA 2HK9A 1KKUA 1YMUA 3F74A 3I4LA 4ZYXA 3ZU2A 1PWZA 3CUEF 1Y8QB 3WSWA 4IKPA 2CLCX 2I71A 5JZBA 2XEDA 3WJ2A 2OBMA 3ZWKA 1XFAA 1W1IA 4M1WA 4ZOLB 4WX2B 3V1NA 1M54A 4MKXA 3OCCA 2LDXA 1W34A 3FMVA 1PS9A 1J90A 1JA1A 3ADDA 1IK4A 1DAIA 4RLHA 1VIMA 3OOHA 2G72A 2X7JA 1IJKA 1DCFA 1IDN1 2I67A 3FM9A 1IBKB 3R6WA 1CR6A 1LFAA 4EKGA 3VC3A 1E60A 1CR4A 1PWXA 1QMGA 3PC7A 5ALZA 2E4XA 2OZLB 4RSHA 5DX0A 4IFBA 4JJ6A 4HL6A 4CM3A 1PV2A 4BTEA 1HRKA 3B6EA 1ECJA 4XWAA 1YDEA 3E22B 3W9SA 1WXEA 2IY8A 3A4NA 4RDHA 2FSSA 1V8FA 1R4NA 1P1KA 2FEKA 2CDCA 1E99A 2VXBA 4FGZA 5IJ9A 5C51B 2FMKA 4GO1A 2EWVA 3IT1A 3ZWMA 1DQZA 3M3DA 3VPAA 4PHFA 1TW3A 1JKIA 2XMBA 4HVLA 2QUJA 3IR6A 1HC7A 3PHHA 5D1HA 1U8YA 1X1TA 3OJLA 4L4XA 1TUIA 2FF5A 1VSBA 2NACA 3P2IA 2WBLC 4YCMA 2UZ1B 4Y1GA 1GNTA 4KGVA 2F2TA 3OEED 1YF3A 2I4LA 4KK3A 2O8EB 1B16A 2C3OA 4XUCA 4D0LB 1F6DA 1K7EB 5JFGA 5TQ2A 2SBTA 1HV8A 3FPFA 2FRXA 3GJ6A 4XYEA 3IJEB 1FRFS 5J4YA 4XXHA 5JROA 2A9QA 4BGEA 4Q7MB 1E7MA 4KFUA 4WOJA 1IYZA 1E6LA 2J9FA 3Q9NA 2BKVA 4NZOA 5KDLA 2UAGA 5F2NA 1L7MA 1THGA 1U0FA 5K2OA 3TNYA 5FO1A 1ZGAA 2HZ7A 2I03A 3MWDA 1BU5A 1RM3A 1JG7A 3PFWO 4O33A 5T6MA 4RABA 1I4DD 4N54A 1XRQA 2VAVA 2OBXA 1FYVA 1IZZA 1WPXA 4LBZA 2CLLB 1SEPA 2G5PA 5LYJA 3RI3A 4XWYA 4LS3A 2E37A 3ZE8A 3QU9A 3FTQA 3O03A 1BRMA 3CX3A 2FSVC 3NWOA 3CF2A 3SOPA 1QV6A 4OK5A 2H48A 4OK3A 5CH8A 1NJ8A 2WK1A 5KJ1A 2C96A 1BOOA 4U2BA 4ZVMA 5YASA 5K0GA 4LYAA 4DCSA 4Q93A 1YOVB 3GFPA 3UGKA 4Z7OB 4OXKA 1C0PA 2D0DA 1XO1A 2H1SA 2XZDA 4TGLA 1E5QA 4WXPA 4DC1A 5KIAA 2FQWA 3RU2A 2QTMA 3DL2A 2E49A 2H4YA 4MPRA 3FOZA 1L7VC 5CIWA 2F9FA 1U6JA 3IXQA 4DPKA 3GOQA 3A11A 4ZVQA 1WD7A 5LXTB 5COBA 1TCUA 1R6TA 5KU1A 1M6VA 4P33A 1RLJA 4ZZ3A 1E2JA 2JI4A 1B26A 2YIJA 1U9JA 2X58A 2PVCA 4J03A 2F62A 2HQRA 5KOIA 3HDJA 1C0KA 3L5OA 1CZLA 2I55A 1IN5A 2O0LA 2YJ4A 3A1VA 3NH9A 4YJFA 3UOGA 1QG6A 3VMFA 3Q9UA 2PAFA 5HIIA 4AN0A 4DSUA 4EG4A 2QTLA 3KTDA 3H18A 4X6XA 3GCZA 3A1UA 4KQGA 2BGJA 2BONA 3C6KA 2C5SA 3H2ZA 3I6ZA 3ZJYA 2A1TS 3JTEA 5B6PA 2IQIA 1TVEA 3E35A 4M3NA 4AIIA 1NW7A 4QODA 1OLXA 1K75A 4NF2A 3IQXA 1UT8A 3FHJA 1EVQA 1NXQA 4FGLA 3DEIA 1JHYA 1XTJA 2AL7A 5CLJA 1QV7A 2DVMA 3KUUA 4BFSA 1K08A 4OQXA 2VZ8A 3I1FA 1JE1A 2OHFA 4NZNA 1VBMA 4ROTA 1JEQB 2VFAA 3FWYA 3K0HA 5FI3A 3EFOB 5E8JA 2Z8YM 1U8ZA 2RHCA 4FUTA 3UNXA 3VC1A 2FXIA 5HQ3A 5JNLA 4JI7B 3I76A 1P33A 1Q92A 1YC2A 2DT5A 4Q6WA 5FDFA 2ZJ7A 3CC8A 3V3TA 5HKBA 4X1KA 1U0JA 1DQNA 1F6BA 3NWPA 4KR6A 2H1CA 4YRCA 2MU1A 3GQBB 5LZ2A 1N2CB 3U0BA 1FFWA 4C01A 2W8ZA 3HCPA 3D6VA 4FOLA 4G1EB 1PI3A 2ZU0C 1Q7TA 3GFSA 2OBYA 1TGVA 1ZFNA 4MVJA 5DGHA 2D2FA 3BSWA 4R2LA 5KYWA 3VOAA 2WQ6A 1P31A 5LQNA 1PGPA 5BV7A 1FJGB 4BP3A 1RXIA 5DO9A 4XQ9A 2HBRA 3AONB 2A35A 3OIUA 4AJ4A 4LXXA 1ZIPA 1TJNA 1VE1A 2GPSA 2HWWA 4B82A 3KEGA 5FWXB 3E1SA 1SY7A 1UT6A 4FCCA 4QU9A 1OXBB 3WGHA 4B7UA 3RC3A 1U5BA 2D59A 4KPUA 16PKA 2QX4A 3E9YA 1UJ6A 1RABA 2HPHA 4JB3A 1LSUA 3ONWA 4FIZA 4ZN6A 1JFVA 5KINB 1ZL0A 2HL6A 4GZ6A 4KOAA 3IURA 2WIGA 4DTIA 2O05A 1W35A 3NQ41 4CM4B 1I8TA 4FFDA 2I2AA 4KQXA 5WRFA 4L8YA 4WZZA 3QJGA 4RV5A 1VFNA 4F6LA 3FDIA 5KNCH 2K2QB 1NN5A 1UAGA 1X70A 4ED9A 3AY0A 3AKYA 2F64A 4GEGA 1T4GA 5FRDA 3RR2A 3ZWYA 1DAOA 3ND9A 5E7JA 1OILA 4EUKA 4Z49A 1S5PA 1YRBA 2CUKA 3LGSA 4NTZA 2ENUA 2V5AA 3AF6A 1ID8A 1XRNA 1KDYA 1Z7BA 1EJ2A 4XLLA 2HYIC 2GJ8A 3OIFA 1IHOA 2G09A 3GFBA 3H9JA 1HORA 4XIJA 2IH2A 5IVHA 4YWHA 1QIGA 1Y37A 1MA3A 1R5BA 2H4ZA 4B3SB 1RQXA 3L7LA 5JO9A 2IYXA 1RMQA 1S7CA 1XRMA 3G9TA 3P0JA 3FLAA 5AJHA 4EX7A 4RDXA 3KR0A 2LWIA 4QDOA 5JMTA 4HGPA 1T25A 2O8VA 3NV9A 3O21A 4L1KA