4RDIA

Crystal structure of e. coli trna n6-threonylcarbamoyladenosine dehydratase, tcda
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
266
structure length
246
Chain Sequence
SVVISDAWRQRFGGTARLYGEKALQLFADAHICVVGIGGVGSWAAEALARTGIGAITLIDMDDVCVTNTNRQIHALRDNVGLAKAEVMAERIRQINPECRVTVVDDFVTPDNVAQYMSVGYSYVIDAIDSVRPKAALIAYCRRNKIPLVTTGGAGGQIDPTQIQVTDLAKTIQDPLAAKLRERLKSDFGVVKNSKGKLGVDCVFSTEALVYPQSSGFGAATMVTATFGFVAVSHALKKMMAKAARQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA threonylcarbamoyladenosine dehydratase
publication title The Structure of Escherichia coli TcdA (Also Known As CsdL) Reveals a Novel Topology and Provides Insight into the tRNA Binding Surface Required for N(6)-Threonylcarbamoyladenosine Dehydratase Activity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 73
structure length 246
sequence length 266
chains with identical sequence B, C, D
ec nomenclature ec 6.1.-.-:
pdb deposition date 2014-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4rdiA00
4GI2A 3GGOA 1GR0A 3GZNB 2Q99A 3OICA 4A2CA 1VLLA 4G5HA 1W73A 1QXSA 4IGEA 1NTOA 3WOHA 4J0EA 1BW9B 4IUYA 4KWIA 1LBEA 1R66A 2XF8A 4KUGA 4XYEA 1NVMB 1NPDA 2R00A 3F4LA 4R68A 2BGKA 1DAPA 4E5KA 3FR8A 1YOVA 2NVBA 5I9NA 2FSVA 1N1GA 3F5SA 4ZQFA 1U3VA 1LEHA 3NJ8A 4LW8A 1H2BA 4NBRA 1O6ZA 2O3TA 4WGGA 4IIUA 2ZYDA 2YHIA 3MJEA 4INAA 3JCZA 1LNQA 3NUGA 5ILGA 1OOEA 3VOSA 1HE3A 3DL2A 1WW8A 1YL5A 4WASA 3UCFA 4CUZA 1BVRA 4YJFA 4JIGA 1A72A 3FF4A 4CMIB 2B4RO 3JD1A 1ZMOA 1LU9A 2GERA 2HMUA 4RJTA 4BNMA 2DTEA 4ZRMA 3DZGA 2D4AA 3O9ZA 2EJWA 4QQRA 1X7HA 4C7JA 5EL0A 2D2IA 2H6EA 2V7PA 1ZFNA 1WDMA 4FR5A 4FFPA 4BNGA 4ALIA 3KEQA 4PVCA 5JPIA 2DAPA 2DT5A 3GN1A 1HL3A 4D3SA 2NWQA 4NBUA 2HAEA 3CEAA 3JQFC 4E2WA 1E1NA 2AE2A 4NZ9A 2C59A 4GMFA 4AVYA 1RJWA 2FHSA 6ADHA 1JVSA 1C1XB 3L9WA 5AXDA 5GMOA 4R69A 1LDEA 1XQ1A 4RV9A 5LDGA 3DFZA 2YQ4A 3FNFA 1OMOA 4GQAA 2EIHA 1VPDA 4XGNA 3WGTA 4BNZA 4EBFA 1PGOA 4FGWA 4H7PA 4DPKA 3PK0A 3L4BA 1KEVA 4WEQA 1DC6A 3QVWA 3LVFO 3FHLA 5JDIC 1FF9A 4UVDA 5EQDA 4BV8A 3NX4A 3KYDA 1S6YA 4LMRA 5BR7A 3EY4A 1E6EA 3WJ7A 1PS8A 2NVUB 4DIFA 3NYWA 2C7GA 4RCVA 3U5TA 1OZAA 2IEDA 1R0SA 4K9DA 4CJXA 4MP3A 1U3WA 4R4JA 1I3LA 2NQ8A 2NNLD 1SMKA 1U2DA 3GUCA 3GZNA 5DCYA 1Z7EA 3VVCA 5I7EA 4CPDA 4ND3A 4NH4A 1O5IA 4Y8VA 4TVOA 5JW6A 3FI9A 3NEPX 4NBVA 1BW9A 4YB8A 3A1NA 3ANNA 3NGLA 1E3IA 5K9ZA 4RF4A 3D4PA 3JYQA 2POQX 1WDKA 2Q2WA 4IS2A 1C0PA 2DVMA 4PG6A 5DBGA 5JYDA 2FY8A 3GH3A 3RC1A 4PG8A 3AY3A 4IDGA 1UXGA 1KC3A 2O2YA 2WDZA 2X0JA 1SAYA 5B37A 4E12A 2CF5A 3DMTC 1NWHA 2RHRA 5JCJD 3BMNB 5TRTA 4QFCA 4PZEA 3HFGA 4R9SA 1P1RA 1IB6A 1DJNA 1K2WA 1E3LA 2NTVA 2Q50A 4BNJA 3KVOA 4MKRA 2O3RA 2Q1WA 4U7WA 4QT0A 4ND2A 3S55A 1PZEA 1XU9A 3NAQA 4MKZA 1PL6A 4UEJA 3IOYA 2NACA 2VQ3A 3RFXA 2IZZA 4DQVA 1EBFA 4CM8B 5HWSA 3VC7A 1SOVA 3AY6A 4R01A 4U6QA 4ND4A 2J5KA 2HU2A 3ZV5A 2FPGA 4XJTA 4CLEA 1KVQA 1GQ2A 4NMHA 1CQJA 3W1VA 5C3MA 3MJVA 2OO5A 3K8ZA 2X4GA 1DC3A 4OIMA 1R0LA 2CVQA 1ONPA 1BMDA 1GY8A 5IJZA 1C1XA 4IJKA 5L4LA 1N1EA 3LLSA 4PZDA 5CP8A 1WWKA 3IMFA 5CDUA 2OBNA 5DNAA 2ZK7A 3NDRA 2JCYA 1A9YA 2GZ3A 3DZFA 5IAAA 1CETA 1F0YA 3CH6A 4XWYA 1EQUA 3TQHA 1JLLA 1E7QA 4J1NA 4CL8A 1P0CA 3DHNA 2FZEA 4XX0A 4CLHA 3E5RA 1MC4A 2H63A 1DFIA 3QE3A 1LTHR 2EGHA 3EHEA 2NU9A 4MO2A 2HO5A 2P9CA 1FDWA 2VUUA 4IDAA 1RM5A 5KKAA 3WGQA 5JAZA 2NVUA 1UP6A 2DFDA 4R3WA 3E82A 1R4NB 1TT7A 4J7UA 2PR2A 3JQBA 3ZWWA 1D4FA 3GRPA 3H9EO 1NXQA 1D1SA 1MFPA 3S1LA 3B1FA 4UULA 3MJTA 1YO6A 4TRNA 3DTYA 3W4IA 3IKTA 4D45A 5ICSA 1VJ1A 4BS9A 3KV3O 4GGOA 4MPDA 3AWDA 2UAGA 1W4ZA 5CDYA 1XELA 2Q1SA 2OUIA 1YJ8A 3V2HA 3LZ6A 4Y6PA 1LI4A 5IG2A 1BHSA 1Y7TA 3RBVA 1CDOA 1HEUA 1HYHA 2Q2QA 3ZWXA 5CAEA 4EDFA 1B0AA 1PX0A 3PP8A 2VTDA 4LGVA 4OKIA 3V2GA 3VDRA 4WCFB 2JFGA 3BMNA 2RHCA 1SO8A 3C1OA 4QTZA 4ALKA 1LSJA 2GSDA 3C8MA 2OORA 1JTVA 4O6VA 2CFCA 1PGPA 4CM6A 4BO1A 3GMSA 1N2SA 2A9FA 2PGDA 1UDBA 3QLJA 4CLOA 1YGYA 1E7MA 1O8CA 3ZZNA 3TFOA 2HMVA 3JQAD 3LC1O 3UKOA 3OA2A 3BMOB 1ZK2A 4RLHA 2ZQYA 1CJCA 3MTJA 2O7QA 3R1IA 3WQQA 4CM8A 4PZCA 2CDAA 4H15A 3PHHA 1B14A 4WNCA 3ITDA 2YJZA 3ZV3A 3ICCA 3WWYA 3H5RA 4HFRA 2BF7A 4CMEC 1NVGA 2YV2A 5TIIA 7ADHA 4A03A 1F12A 1NQ5A 4PLVA 3RIHA 3JQ9A 4YJGB 4BNTA 3DAGA 4IBOA 4IDDA 4NI5A 3U3XA 1ISIA 2Y1CA 3RC2A 1R37A 2VTEA 4LSWA 2W90A 1LDGA 3D5QA 1XEAA 2PH3A 1HZJA 2GDZA 3GRKA 1IE3A 1HDYA 3P5SA 3UN1A 2BGMA 1O94A 4RVDA 4Z3KA 2PD6A 3FR7A 2X22A 1HDXA 2Z1MA 5DCUA 4TVBA 4OKNA 5ICMA 3GR6A 5KWEA 4KQXA 3GLQA 4TMFA 4DIOA 1T26A 2BFPA 4MVJE 1BXZA 3BTOA 2VZ8A 2VT3A 4OOEA 4AJIA 1TEHA 1WPQA 1ZEMA 4Y6SA 4OSOA 1HE2A 3CZMA 3OQ1A 2AQHA 2AQKA 4IXWA 4BIIA 3H8VA 2OMEA 2PKQP 3IIEA 1Z73A 3KXDA 3N7UA 4HADA 3QSGA 2Y68A 4DTIA 1E3WB 2GUGA 2YDXA 1DB3A 1EDZA 1Y8RB 2AXQA 4FBGA 3V2UA 4AICA 2WD8A 4BVAA 4OXYA 3FBTA 4BO3A 3GGPA 2ZATA 2OOSA 4Z0PA 3JD3A 2AHRA 2B37A 3DAFA 3AOGA 5JSFA 3PPIA 1OI7A 3V1UA 3Q0EA 3WR5A 3E9QA 4MOWA 4GAEA 1AUPA 1A7KA 4TROA 3SLKA 1U3TA 3EAGA 3BA1A 2HQ1A 4I9HA 5T8KA 2NU7A 1XDWA 3IAHA 4II2A 1BRMA 5EJ2A 4N5MA 1EK6A 4DYDA 1B2LA 2SCUA 4WKGA 4DIBA 2EKQA 2B0JA 2UUOA 3LT1A 1ENPA 5G4KA 2Q46A 2NLOA 5TF4A 4FC6A 4WCFA 4G2NA 1U2GA 3RKUA 1NHGA 1HSOA 5DP2A 2VRCD 3IQDB 1ZCJA 3SC4A 4GLLA 1DIRA 2EEZA 5L53A 2BFMA 2PA3A 4F3YA 5I9MA 1RWBA 4PG4A 3ZW9A 4ITUA 4BKPA 4N18A 3GF4A 4ZQBA 2PTGA 2Q3EA 2GNAA 4NU5A 4O0LA 1PGNA 4JN6B 2X58A 3HDQA 4FOSA 3KYBA 3PIDA 2B83A 2CY0A 2NTJA 3TPCA 3JD0A 4FSHA 4L9RA 4OH1A 4TKMA 3PEFA 3I3OA 3UFXA 4YJGA 1DC5A 3HB4X 4E21A 1Y8QA 1I0ZA 3DZIA 4BO9A 3I9JA 3MWEB 3PQDA 4TRRA 2J3KA 1U8FO 4WECA 4II3A 4CLRB 4XR9A 3MWDB 3EYWA 2O50A 4LISA 4UREA 4ZQEA 4PIVA 1G0OA 5A03A 3RASA 1QMGA 3U62A 5BNFA 3OQ6A 4UEKA 8ADHA 3NT5A 5MGBA 2OL4A 4BKUA 3BTVA 4L4SA 3G1TA 1V3VA 1XU7A 4MVJH 1H6CA 1H6AA 1H6BA 2PY6A 2R00C 1G6KA 5DBFA 3GZ4A 5H83A 1C0LA 1DRVA 1R0KA 4B8ZA 1MFZA 1SEPA 2PLAA 4A10A 1UAGA 4NNJA 1DLIA 1OC4A 1JQBA 1X0VA 4BV9A 4XQCA 4L0QA 1ISJA 2GO1A 3S2IA 3L07A 4IY1A 5I8WA 1ULSA 3E18A 1E3WA 3H7AA 3JQDA 2TMDA 4NJOA 1P1HA 5F21A 4Z9YA 1EVJA 3MZ0A 4BMVA 4E6PA 5J23A 3PLNA 1T1SA 5B1YA 5KKCA 2O3JA 1C1DA 3TZ6A 2EERA 2WE8A 3WYEA 1XSEA 2PZJA 3P19A 2VRBA 1NAIA 3BXXA 1YRLA 3Q2IA 1U3UA 3PJGA 4NDNE 1HWYA 4YTEA 2WJPA 3RUHA 4DBZA 4IJUA 3GDFA 5TT0A 3RQSA 4Y9DA 4TKLA 3MJSA 3OJOA 1VSUA 3AJRA 3GDOA 4N5LA 4MIEA 4AG3A 3UUWA 4NBTA 3F5QA 4KQWA 5CPFA 1B3BA 2YV1A 3PHIA 5JLAA 4FB5A 3WGIA 1EDOA 1ZIDA 1L1FA 2QIOA 2ZTVA 3WMXA 4PN3A 1HETA 2DBRA 2GZ2A 3I9OA 1JAXA 2BH9A 3AUAA 4E4YA 3U49A 1FMCA 2D8AA 3VPHA 4M55A 5A5EA 3DZHA 2VWGA 2GR9A 4BO6A 3K30A 1U8XX 4RL6A 3OIDA 5LCXA 4GH5A 2VNAA 3B1JA 3L4BC 2EKPA 1VKOA 3H65A 5L7YA 3AI1A 4BUCA 4J6FA 5KVCA 1LXCA 2G1UA 4BKRA 5DP1A 3G3EA 4UUMA 4P8RA 3ROMA 3W4KA 1YJQA 2PD4A 5THKA 1Y9AA 3L6EA 2D3TA 2B35A 1KY4A 1NQTA 2QRJA 3WIEA 2IZ0A 9LDTA 5GZ1A 2A4KA 1ZUD1 3OJEA 3O38A 3KHUA 4FC7A 4CLRA 3E03A 1ARZA 4PRKA 3DOOA 3PQEA 4ZQGA 3NTOA 4N7RA 4Z0TA 2EV9A 4LVUA 2DC1A 3QWIA 2G82A 1GEGA 5JAIA 1WXDA 3GC6A 1N7GA 4NHEA 4ALNA 2W2LD 4BO0A 2GN9A 4EJ0A 4S1VA 1AHIA 1PGQA 4YAEA 5F1PA 1T24A 1E77A 4IINA 1WAMA 2AA3A 3MJ4A 2FR0A 3RU9A 4DXHA 4ZICA 3LF1A 4ZU3A 1I33A 3TOZA 4L74A 4O59O 4ND1A 3O4RA 4YRDA 4BKQA 3N58A 4MP6A 5HM8A 3I6IA 3FRJA 1YS4A 1YQGA 4W7IA 3DONA 1B3RA 2GGSA 2ZB3A 3E1KA 2C82A 3OIGA 2ZTLA 4CQMD 1ZBQA 4OJNA 2JD0A 3KSZO 4RPJA 4DPLA 4J9UE 1U4OA 2HUNA 2VYND 3WQRA 3K31A 2ZJ0A 4I5EA 4XGKA 3K6JA 4YBZA 1J6UA 2BI7A 2EP5A 3F3SA 4R5HA 2DFVA 4A26A 1I2BA 2O3QA 1Z6ZA 1A4UA 3QVOA 1ML3A 3ZWNA 4I1IA 4CR7A 4J91A 2YYYA 2ET6A 1N7HA 3COSA 1MV8A 3QRWA 3STHA 1UR5A 4OYRA 1XQ6A 3CSDA 3VH4A 4FD3A 4MDHA 3RUFA 4ESOA 4Q3AA 4BMNA 1LDMA 1EZ4A 4GMGA 1RM0A 2EF1A 2C20A 3EVTA 4EZBA 3KRTA 3VPGA 4Z3DA 2VOJA 4UVIA 3A4VA 4E2ZA 4M1QA 3ICPA 3FD8A 3PJEA 1N8KA 1Q0QA 3DC2A 3PRJA 4TWRA 4XYBA 1E1MA 2G0TA 5DBIA 4JP3A 1P3DA 1E3SA 3QIVA 1EUDA 2VUTA 4KUHA 4WLNA 1GD1O 2I5PO 4WCDA 3K2EA 1I2CA 3OJFA 4KMSA 1HDCA 4PCVA 2V6MA 1GQQA 1YDWA 1V0JA 3CPSA 4ZN6A 3GPIA 1PJQA 3AM5A 4K1LA 2PNFA 5AOVA 5IXSA 2EJVA 7MDHA 3JQEA 4UVHA 1DIGA 3PFWO 4IS3A 3EMKA 2FN7A 3V1TC 2PV7A 4CV3A 3E5MA 1QG6A 3JQBC 4HWKA 4UVEA 1MX3A 1QORA 2HSDA 3GFBA 4CMBA 1CIVA 4RZHA 3MEQA 3QVXA 3W8EA 3ULKA 1BDMA 1E6WA 1WP4A 2DBZA 4BGEA 5L4SA 1WDLA 3ZN2A 1UZLA 1EK5A 1A9ZA 1BG6A 5A5FA 1W6UA 2B4QA 2XPCA 3BAZA 2O4UX 1GYQA 1AXGA 1JWAB 4HKTA 4KOAA 1BXGB 4KDEA 1QYCA 4LRSB 2LDXA 2D0IA 3NKLA 3Q3CA 3T4XA 1LSUA 1O95A 4DQUA 5KVSA 1X1EA 3RUIA 4B7UA 3GOHA 4XJSA 1Z75A 4NFSA 2W8ZA 3NGXA 2IE0A 4IPTA 4E13A 5TJHA 5ITVA 4IMRA 4FFLA 3TWOA 3F1LA 4BNWA 2W2KB 4GLOA 3ZHYA 2VT2A 1H93A 1F8GA 1PJ2A 5HBRA 4WNIA 4RVUA 1I3MA 4URFA 3I1JA 3WGHA 4AJOA 4CR8A 3HDYA 4DC0A 2AG5A 2BFOA 3ADPA 5HA5A 1Y6JA 4RVGA 4DMLA 3WMWA 4WE3A 3CMCO 1HLDA 1IY8A 3JQ7B 2AG8A 4YVFA 2NM0A 1QSGA 3X2EA 1V3UA 5TGDA 4XA8A 1DRWA 4AJEA 5JDCA 1S7CA 1PJBA 3PXXA 5LDHA 3IS3A 4PLPA 1XLTA 1PU2A 3I23A 3JQ9C 1P1FA 2P4HX 3JQAB 2QW8A 3ASVA 3F9IA 3PFFA 4OO3A 1P44A 5F1OA 1IL0A 4L75A 1I2ZA 4D43A 2VYVA 4EW6A 2DKNA 1ZEJA 4XD2A 1CWUA 1UJMA 3C1TA 4YQYA 4ZGWA 5CHEA 5IXYA 2X8LA 1SC6A 1ZH8A 5A04A 1E0DA 3W6UA 2Q1TA 4DREA 1ZK3A 2Q45A 3BIOA 2QRLA 4IIVA 1NFRA 1P31A 3QWHA 4CR6A 2QHXA 3HB5X 2Z95A 1ENOA 3MCVA 4MVJA 4XB2A 5AYVA 2LDBA 3INRA 2P4QA 4I5DA 2AEFA 1NFQA 1D1TA 5B4UA 5K6AA 3L4SO 5JE8A 2R6JA 2VWPA 3FSRA 3BHMA 1KVTA 3OH8A 4DMMA 1LX6A 2IEBA 4DLBA 1ADCA 4YA6A 4IDBA 3V1YA 2ZTUA 2F1KA 1AGNA 1KETA 2GZ1A 4E3ZA 4YAGA 1PS9A 4JJFA 4D3DA 3TF5A 4XYLA 5FFFA 3GA0A 5C7OO 1YBAA 3Q11A 4CMIA 4GPD1 1CF2O 1ISFA 4DPMA 4WUVA 5T8KC 1D3AA 1KEUA 4U0JA 2VCYA 3GGGA 4WLOA 2JKVA 5BNTA 3QWAA 1AE1A 3GVCA 4J43A 1KVSA 2IYOA 4PLZA 4YAIA 3NV9A 4FGSA 3HFSA 4WCFC 5JAMA 3LSYA 1TI7A 4DL9A 2GN6A 4CL3A 1H6DA 2W2KA 2OP0A 3LDHA 1XYGA 2Q49A 3G49A 5JMWA 4Y98A 4CM5A 2E6UX 3F46A 5IZCA 2Y66A 3QJ5A 4J9VA 5BQFA 4ZHSA 3JYPA 1DJQA 4MVJM 1ZK0A 5BSHA 2C07A 4LRTB 1X14A 1ZSVA 1BGVA 4MJLA 1XWFA 2B36A 4J3FA 4IDCA 3IKVA 1QLJA 3E48A 4F6LA 4TZKA 2AQ8A 4J0FA 3WGGA 1HLPA 3IJPA 2A94A 2ZJ1A 3WFJA 3IUPA 3UAGA 4PLGA 4PFJA 3L6DA 1SZJG 2XXJA 1DAOA 4KWHA 3BMCB 3PGJA 1H9AA 2EKLA 1F14A 1Q0HA 3NTRA 3S2GA 5EINA 2GF2A 1QV7A 4G81A 3JQAA 3TZCA 1Z74A 5B4VA 4LVCA 3TNLA 2HJRA 3WICA 1EMDA 4JLWA 3UHAA 1P45A 4BGUA 3ZV4A 1GZ3A 4BNXA 4WLUA 3U0BA 1OBFO 3IL2A 4E5PA 5BSGA 3DEYX 5HS6A 5FI5A 4D42A 1YQXA 3HHPA 4BNIA 5B4TA 4N54A 4YT4A 1NM5A 2D59A 1UP4A 1YWGO 3D3WB 5CFZA 2RAFA 3H9UA 5IF3A 2FRDA 2HMWA 3ZWOA 4K6CA 3VH1A 1PR9A 5CG2A 3ONDA 1VM6A 2FOIA 3EUWA 1DIHA 1V9LA 1R15A 3HDJA 3ITKA 4QFDA 4U8GA 1X13A 3GNSA 1I8TA 4IGFA 4XR4A 4PVDA 1DOHA 2I3AA 1PS0A 1UZMA 3OBBA 2E4AA 2PH5A 1GV0A 1RYEA 5KJFA 2AEMA 5ENVA 4GX5A 3DAPA 5CDGA 2HDHA 2AMFA 3TDKA 1GUFA 2Q4BA 3I9KA 4A27A 3H3JA 1BDBA 1AHHA 2O3UA 1I32A 3WJAA 1PEDA 4HNHA 4XIYA 2NQTA 5G0UA 3NRCA 2NU8A 4AJ1A 4YRAA 2GLXA 5JMPA 3ENNA 2J5QA 2B69A 1YVEI 4YACA 4Z9FA 3LT2A 3H5AA 4C7KA 1HYGA 4P4LA 4G65A 5DULA 4GVLA 2FP4A 2JCVA 5TT1A 1Y5MA 3DOJA 2CDCA 2J8ZA 2ZKLA 4FJ1A 2WYVA 1IUKA 4MVJG 4YAJA 2WYUA 4WLFA 1KOLA 4XEHA 4XDZA 3U4CA 1Y1PA 2RCYA 4FCCA 1GYPA 1C0IA 2J3HA 1O9BA 2OZPA 2GD1O 3OQBA 3JYLA 2Y1FA 4NPCA 1ZK4A 3GY0A 2WEKA 2J5RA 1WLYA 1HE5A 1QP8A 1YDEA 1L7DA 1YH3A 4L8VA 3DXFA 2HMTA 1XR3A 5L4NA 1PZHA 4XDYA 5G0TA 4MP8A 3RC9A 2CZCA 3GFGA 3P2OA 3Q1LA 2C5AA 4MINA 4OAQA 3KYCB 1GTMA 3BMCA 3QVTA 2J6IA 2X0IA 5KCZA 1FDSA 3DBRB 1GZ4A 3MTGA 4EUEA 3A14A 3ZNQA 1H94A 2QRKA 3D5TA 4OXKA 4A73A 3ASUA 4F6CA 1CERA 3ZNOA 4GSKA 3PZBA 3ZWVA 3WNVA 1LQTA 3ZNNA 2Q1UA 1IULA 1GFSA 2GCGA 4DLLA 1UP7A 4A7PA 1IZ0A 3QA9A 2BFAA 3W8FA 4I9UA 3R0IA 4Q3EA 2X1HA 1R4NA 1B8UA 3K96A 4L4XA 3WYCA 3QP9A 1JKFA 3A28A 2JFHA 3JQ6A 4CV0A 3UOGA 5A9SB 1NYTA 1SOWA 5AXAA 5CG1A 4W7HA 4ZQHA 3C1AA 3GDGA 1Z82A 3WYBA 1D7OA 2Y0CA 3GVXA 1Y9EA 1ORRA 1UDAA 4JQCA 4IQ8A 1X7GA 3W6ZA 1BVUA 3NJ4A 3RD5A 4FIZA 3VPFA 5CDTA 4CV1A 1GCUA 4BO5A 3ORFA 5I7VA 3U9LA 4DRYA 4UAGA 4U6SA 4DLAA 2GN4A 1ZJZA 2V6BA 2PGJA 4BNFA 4D0RA 3D7LA 3R6DA 3DFUA 3DZBA 1E5LA 5FYDA 1I24A 1U5CA 1WMAA 3EK2A 4BGVA 3TRIA 4HP8A 4B8WA 2I76A 1DIBA 4AJJA 4W9NA 1K6IA 4J4BA 1EBUA 3HADA 4YYZA 4P4GA 4B4UA 5HS4A 3PWKA 4NR0A 4FFOA 3JV7A 4E5NA 3OHSX 1VL0A 1DDOA 3RVDA 4BO8A 3DBHB 3GEGA 2JFFA 5GY7A 4BO4A 1QLHA 4CM7A 5A1TA 1KVRA 1UZNA 3BMOA 4YT2A 4GBJA 1KC1A 4MKXA 1PSDA 4U5QA 4ND5A 2E48A 3GVIA 2FR1A 2ZIZA 3V8BA 2HK8A 1LSOA 1M6WA 1NR1A 3AM4A 4QXMA 1HE4A 4CM3A 1C14A 3SVTA 2EP7A 1KYQA 3C7CB 3JD4A 5ER9A 3L6OO 4PLWA 3ZV6A 1FDTA 2IXAA 2A35A 5GZ3A 2QYSA 3KSUA 4J1QA 4U0KA 2QQ5A 1KERA 2PWZA 3TSCA 4JNKA 3V5NA 3DO5A 4X54A 2YZ7A 4D46A 5A06A 4GL4A 1ZKMA 4R3NA 1LC3A 4IDEA 2DPHA 2DU8A 3G79A 1PWXA 1GL3A 4B4WA 4HBGA 2NTNA 3FCOA 4J4TA 3INTA 2YV3A 5ER6A 1HDZA 3H9GA 4UUPA 3DBRA 2G76A 3AUUA 5DT9A 4NK5A 4WLVA 2E82A 1TT5B 5KVQA 2C2XA 3RFTA 1CEQA 4OXNA 2PKQO 4CLDA 4XRRA 1A7AA 1ISGA 3ADOA 4FS3A 5BSFA 2WWRA 3HUDA 1B8VA 2VHZA 1Z7BA 2WMDA 4R5MA 1GZ6A 4E0BA 2X6TA 4DYVA 1P33A 4CMCA 2UYYA 4KDFA 4HX5A 1A5ZA 2VZ0A 5COAA 1OAAA 2DBQA 4GX2A 3HN7A 4IXTA 4R41A 4UUOA 1Y8RA 3OJLA 4HV4A 1R4MB 1N9GB 4OMUA 1LQUA 1WZIA 4FOOA 5A9SA 1CRWG 5F1KA 1GDHA 1DSSG 2ILTA 2DPGA 1YXMA 4TQGA 3VZQA 4PLYA 4BGIA 2PKRA 1LSSA 1RM4A 2DQ4A 3PQFA 5L9AA 2AQIA 1R16A 1T2EA 3D3EA 4GKVA 1UUFA 4Q39A 4A5OA 5IDQA 1Q2XA 1K6JA 1F17A 4WLEA 1YL6A 3LC7O 4QUKA 3LT4A 5F5NA 1VL6A 5FEUA 1PL8A 3FNHA 3VKVA 3LLVA 3VZRA 1W8DA 3RJ9A 3M6IA 4CM4B 1H0KA 3M1AA 1UXHA 2Y1GA 2CVZA 4J90A 3SLGA 1XIVA 4W99A 1DXYA 2Z5LA 3GEMA 5EQFA 3ZHBA 2ZB7A 3LQFA 3DZKA 1PJTA 4EEZA 3Q2KA 4LN1A 4XIJA 2X0NA 1Q7CA 3ZDFA 5COQA 5JC8A 4JJIA 3ZWAA 1I36A 3AUTA 3QV1A 4HFMA 4BL5A 4O63O 1LDBA 2VHWA 1XCBA 3ROQA 3WLFA 3ZWPA 5JDCC 1QYXA 4QEDA 2RBEA 5U1PA 4KTTE 3S2FA 3U4HA 4CV2A 4D0SA 2GYYA 4ZJUA 1B16A 3ETGA 3OF2A 1U5AA 1ID1A 1LLQA 1PZFA 1SB8A 5A9TA 1MP0A 1DEHA 3T7CA 2QZ9A 4CQLB 2VNSA 1LUAA 4GSLA 3F6YA 4BQRA 1T25A 3FTPA 3ONEA 4HFNA 2H1SA 3U4DA 3I4CA 4Q3BA 3UICA 4RLSA 4AJPA 4OL9A 3FNGA 5EESA 2UVDA 4EUHA 2IODA 4K28A 1Y81A 1A71A 3H5NA 4HUJA 4ID9A 1EQ2A 2Y1DA 3WS7A 5L40A 2A92A 1TT5A 1E3EA 4CM9A 4EYEA 3W4JA 5C37A 5K6AC 4OGWA 3WTCA 1T4BA 3T4EA 2BMAA 1TB4A 4LSMA 2BRUA 4NJMB 5A3JA 3OFSA 4NFHA 2HLPA 1PZGA 1X0XA 1QRRA 1YOVB 3UCEA 2HCTA 3CXRA 2YQ5A 4E33A 1M66A 1I01A 3VAZA 2YDYA 1EVYA 5HTOA 1Q1NA 1N5DA 2PZKA 3VZSA 3RCBA 1M75A 3RKRA 1TXGA 4EI2A 4Y67A 1R4MA 1N9GA 3RWBA 2DLDA 2NU6A 2Y67A 5TJ9A 3L77A 3OIFA 5BT9A 1M76A 4BQPA 3RUAA 4XYGA 3S2EA 1YE3A 1EEHA 4O5OA 3EZYA 1DFHA 4Z6KA 5TNXA 4WJZA 4R9RA 3FPLA 1ZK1A 2FR8A 3FBGA 4AFNA 3K9QO 4YXFA 5JO0A 1HDRA 2VWQA 3E6AA 1NQAO 4NG5A 1J0XO 3CE6A 4PLFA 1ADFA 2YFHA 5THQA 3K2BA 5T67A 3GAFA 5TLSA 3KETA 3WBBA 5GZ6A 5A9RA 1VKNA 1YONA 2Y99A 5KTKA 1UXKA 4IMPA 5IZCC 4FJ2A 3PLRA 1V8BA 2NADA 3H4VA 4RF3A 4RO0A 4YQZA 3ZU4A 4Q3DA 3GUYA 5A3VA 4CMGA 4XQ9A 3EDMA 3GAZA 4A0SA 1VSVA 3GMDA 4YWJA 1L7EA 2BI8A 3IP1A 5JXWA 1OFGA 4HY3A 4CMJA 1RKXA 1OC2A 1GQYA 2O2SA 3INGA 4P22A 2O23A 2DUWA 3ZU5A 1DBVO 3RUDA 4BOYA 5HRUA 3A06A 4XKJA 4YT5A 1BWSA 5A05A 4OM8A 3SEFA 4NK4A 2CUKA 3VZPA 2IYPA 4BMSA 1DIAA 2CF6A 3GT0A 4RPHA 1QYVA 4JBIA 1NNUA 4P4NA 3D0OA 3OJ0A 4TZTA 1KEWA 2G5CA 4B4OA 2AEJA 4BNVA 2GN8A 3AOEA 3PHLA 2XAAA 1E92A 2Y05A 3CKYA 4OHUA 2ZB4A 1G0NA 5AXBA 4NIMA 5ENDA 3GHHA 1GCOA 3JTMA 1DC4A 4HFJA 4B3IA 1GAEO 1XKQA 2X86A 3WLEA 2Y0DA 3ZWMA 4AJNA 1U7HA 3GVHA 3K73O 2VWHA 3M2TA 1F06A 4NJMA 4KZPA 3PIIA 2ZTMA 2BHLA 1DFGA 1V35A 3L0DA 1P74A 3TN7A 4JK3A 3JD2A 3UH1A 1A4IA 4ONEA 1DHTA 4HXYA 3Q9NA 4Q9NA 5AVOA 1RPNA 2ZYAA 1YB5A 2Y1OA 2X7HA 4H16A 3IC5A 4BO7A 2HRZA 1ZZEA 1E1LA 3EZLA 2PZLA 4OQZA 3LF2A 2H5LA 4R1UA 2EWMA 2GPTA 2BGLA 3UCXA 2RIRA 4MVJF 1HF3A 9LDBA 5EN4A 1GV1A 1RM3A 4GKBA 2O7SA 4NU6A 4J4HA 2RH4A 3RBZA 1LC0A 4S3MA 5JCJA 3SXPA 2RH8A 3H9JA 2EW2A 4C4OA 4IJVA 1NVTA 3JYOA 1ZXLA 3KM0A 4EEXA 5JS6A 3GVPA 5JAQA 1IHYA 1NR7A 5L95A 4OSPA 1MGOA 1ONNA 1T2DA 2CD9A 3KLPX 5I8ZA 4DQXA 3QW2A 1ISMA 3H9QA 1EUZA 2GRAA 3WNQA 4IJWA 5F5LA 3ZHZA 4AL4A 1ZJYA 4GVXA 5BSEA 5IN4A 2H9IA 1U7TA 3ZCXA 3RFVA 2QZZA 4FN4A 1PL7A 3ETDA 2V6GA 1SNYA 5T6BA 3HJAA 3HG7A 4W6ZA 3G1UA 2TMGA 1H2HA 3VVBA 3AFNA 1MA0A 4IQGA 2UDPA 3M1LA 2D5CA 2ZYGA 2I6TA 2VHYA 4EUFA 3AU9A 2QX7A 3WSVA 1KIFA 3HWRA 1VJ0A 2G17A 1GEEA 1IPEA 1HSZA 1IYZA 2D1YA 5JBIA 2HMSA 5CPBA 1LA2A 5T57A 4B79A 1QYDA 5MDHA 4FQ8A 4TSKA 5TQVA 2WYWA 6LDHA 3R3SA 5L7TA 3UGKA 3OSUA 1IZ9A 1HXHA 1Q0LA 1SPXA 1ZNQO 2YUTA 3WBFA 4LMPA 4CUJA 3WWZA 1A27A 1ISHA 1LDNA 1GUYA 3PHJA 3WTBA 4B3JA 4DA9A 2YW9A 1JU9A 3IDSA 5JY6A 2UV8A 1QV6A 4B3HA 3BTUA 2FZWA 2Q2VA 1BXGA 1FDVA 1R12A 4I08A 4TRMA 5KOIA 4BNKA 1X1TA 3KSDO 1ADBA 4R16A 3I83A 1NP3A 3WXBA 2C54A 2YHUA 3N74A 4DUPA 5I9LA 3JSAA 4Z9XA 2NV6A 5C7LO 2X23A 1HKUA 3MJCA 3VTFA 2DM6A 4UEOA 4BNNA 3FNEA 1DLJA 1HYEA 1E5QA 4J7CA 5TC4A 4GX0A 4UUNA 3H3FA 4W4TA 4W9NC 3H2ZA 3K5PA 3ETEA 2ZCUA 4RPGA 5IFLA 1VL8A 3F47A 3KO8A 3E9MA 1IOLA 4BKOA 4CLOB 5ADHA 2EGGA 4EGFA 2WE7A 1KY5A 1U9JA 2O4CA 4N5NA 3BHJA 1EVZA 3JQ7A 1E7WA 2C5EA 3CMMA 2VYVD 3AFMA 1PIWA 3QVSA 3PWZA 3B1KA 3NT2A 2O3SA 4UVGA 4MIOA 1O89A 2EXXA 3KZVA 2QYTA 1DHRA 5JFOA 3WIDA 3K92A 2JHFA 3CIFA 3CINA 3G17A 2I65A 3I52A 3VTZA 1P9LA 2Z1NA 5EIOA 1V3TA 3ZWBA 3ONFA 2NUAA 2JAPA 2QG4A 4MVJD 4BHTA 2O48X 1NX6A 3RJ5A 2P91A 3JYNA 1QYWA 1T1RA 3P7MA 4FW8A 4IQ0A 4J2HA 1E6UA 5DDIP 5JC1A 2AW5A 2HKIA 4XZ3A 4XYMA 4DGSA 2VOEA 3PTZA 1IPFA 1NPTO 3DMYA 5CEJA 2UUPA 1K5HA 2C7VA 3WDSA 3VH3A 3VHRA 2VUSA 1U4SA 1GPJA 4PLTA 4Q3NA 2DTDA 4IZHA 4CMKA 3CTMA 2PZMA 5G0VA 4I9NA 3TFQA 3UXYA 4H3VA 4NBWA 5JCXA 1PTJA 1UDCA 4YT8A 3AI3A 4XQGA 5I7FA 4WOJA 5IDXA 3ROPA 3AI2A 1E7YA 3JQ8B 3AUSA 2GASA 3PYXA 4ALMA 3VKUA 1G1AA 3DBVO 4YRBA 3P2YA 4RQTA 2YY7A 1WMBA 4J16A 4ZA2A 3H2SA 1NASA 4YPOA 3GK3A 2C29D 3KEOA 1P0FA 1LLUA 5BNIA 4M8SA 1JVBA 2JD2A 4R1NA 1E7RA 1HRDA 2J3IA 2PK3A 5TS3A 5KJ1A 4OOFA 1GYRA 5LC1A 1SBYA 4LCEA 1XA0A 2HRBA 5G4LA 1KEPA 4YAKA 3I9MA 2EG9A 3C85A 3UF0A 2X5OA 2C0CA 1SCUA 4KP7A 5G4KB 1U28A 4WOKA 3IUSA 3MOGA 5L45A 4CODB 1I5RA 4JBGA 3IP3A 1B26A 4AJ2A 4Y6RA 3TJRA 1FXSA 3D64A 4GWGA 1WVGA 3SJUA 1PQPA 5A4DA 4JGBA 5JYEA 2WM3A 1YB4A 3Q6IA 4W82A 5F3RA 3JQFA 4R54A 2W4QA 4FJ0A 1X15A 5IDYA 4AJKA 4L4RA 3ON5A 3ENKA 2J3JA 2HJSA 4QO7A 2B5VA 2JL1A 1PJ3A 3VDQA 5KNLA 2NSDA 4PRLA 3HDHA 3IJRA 1M6HA 2IZ1A 3WB9A 1W0CA 2VRCA 1PJCA 1MB4A 1JW9B 3D4NA 1WNTA 3QY9A 3AM3A 4IZIA 4Z0HO 4AJHA 2WTBA 2CSUA 5ILOA 1ZMTA 4F45A 3PVZA 3I6QA 4IM7A 1Y5RA 3PYLA 3ANMA 1Y8QB 4K26A 4RGBA 3QWBA 2NVWA 5JDIA 1E7SA 3I5MA 3PWSA 1K89A 1NAHA 4YR9A 4XRGA 5T64A 3I9LA 3M2PA 5TX7A 3GG9A 2VHXA 2PFGA 1I10A 3HZZA 3KTDA 1J4AA 3PYMA 4MVJI 4JCOA 3D3WA 1ONOA 4BB6A 5AXCA 2JHGA 3BHIA 1MXHA 4KTVE 1JDJA 3GPDG 4ROSA 4ALJA 1HTBA 1K3TA 2JD1A 5DN9A 5JO9A 1D8AA 1UAYA 3ROKA 2W98A 1PGJA 2FPIA 3RUCA 5G2OA 3JQCA 5DOZA 1LRJA 2FWMX 3PJFA 2E37A 2WSBA 4WEOA 2X9GA 1ENYA 3LT0A 4OQYA 5EERA 3WFIA 5COBA 3GG2A 3TOXA 3C7DB 2B5WA 1P1IA 3OECA 4AJ4A 3CZRA 4PLHA 5JY1A 4Q3CA 4E2XA 3JQ8A 1I3KA 3C7AA 1HDOA 4RDHA 2Y93A 4I5FA 2HK7A 2X5KO 3DHEA 4E5MA 3HQ4O 4WK6A 1BXKA 1C1DB 3DMTA 3DBLB 5KIAA 1TLTA 1GADO 1PJSA 4FFNA 1GUZA 4PLCA 1VRWA 3TZQA 1LLCA 3KUXA 1MLDA 1ZVMA 3EGOA 3QQPA 5FWNA 3A9WA 3RUEA 1J49A 3GNQA 3RROA 4BNUA 3NDJA 3DQPA 3RSHA 4PGFA 1VJTA 4FDAA 4JBHA 1JKJA 3FWZA 3FN4A 1H5QA 4D41A 3F1KA 2I9PA 4M49A 5KJCA 3EW7A 1UXJA 3GHYA 5FF9A 3SBOA 4BB5A 2P5YA 4CQMB 4YJDA 2C2YA 1ULUA 2EHDA 4BO2A 3LU1A 4RZIA 4RF2A 4BNLA 3R3JA 4D3FA 4YCAA 1Q7GA 3E9NA 2OFPA 5C7IO 4L76A 3BZUA 4XQEA 4GX1A 5EPOA 5T5QA 1JA9A 1M2WA 4K6FA 4XGIA 4FPXA 1HT0A 1JKIA 2V65A 3DZJA 4RQUA 2I3GA 3U4IA 5A02A 2XOXA 1DO8A 1E1KA 3C3XA 3EVNA 4YJHB 3VPXA 2BLLA 4J1SA 3ZU2A 1ENZA 2D5AA 2OGUA 2P2SA 3BYZA 1C3VA 3KB6A 3VH2A 1CQIA 1QKIA 1TA4A 3AU8A 1NQOA 1QR6A 5KVVA 2CMDA 2FPPA 3RAJA 3KYCA 1AN9A 3RU7A 3WGZA 5DZSA 5KJEA 3OA0A 4ZD6A 1P77A 3SJ7A 1FDUA 3BMQB 1GU7A 2YFQA 4M86A 4YEDA 2AE1A 1DPGA 2Y0EA 4DVJA 2B4TO 4E2YA 5FI3A 4MVJP 1MG5A 1XGKA 5B12A 3T7EA 1WZEA 4B4VA 3WGOA 3AOEC 3WSWA 4HNGA 3LK7A 4J1TA 4E5YA 4R51A 2OXIA 2OP1A 1MC5A 4JP2A 2CNBA 5EMHA 5IN5A 5DOVA 1LRLA 1X7DA 1VC2A 1C0KA 3TZHA 1I3NA 3PGXA 1MXFA 1T2AA 3OEWA 4IDFA 1LRKA 2FMUA 2R2GA 2BKAA 3SC6A 4CLXA 3KOUA 1EVIA 1ADGA 3G0OA 3ZGYA 2Q4EA 4AJLA 4M89A 3L9XA 2JJYA 4ZRNA 1XHLA 3ZWYA 4FFRA 3WX0A 4B7CA 1RYDA 4PG5A 5L7WA 2VN8A 5CEFA 3KLMX 4LCJA 1EUCA 3RBXA 4R1SA 1EFKA 1HDGO 1FK8A 1SB9A 1B8PA 3GNTA 4PG7A 3DOCA 4JXKA 4EJMA 2W2LA 1YKFA 1V6AA 2BELA 3OETA 4NFYA 1EE9A 3DBLA 3H6KA 2VZ9A 3O03A 4O1MA 1K0UA 3DHYA 3OM9A 1YBMA 1VI2A 4M87A 4RVFA 2OHXA 3PDUA 4D44A 1JAYA 4QO8A 4QX6A 5ITWA 4TRJA 1NBOA 1ZW1A 3MOIA 3DBHA 3WQSB 3ZHXA 4P38A 4CMHA 4RPKA 4R1TA 2DTXA 4DC1A 4E32A 3RC7A 3JQGB 5C5IA 3ZI0A 1T2CA 4CQMA 1XG5A 2HK9A 2JCXA 1PJ4A 1UH5A 4LK3A 3ZW8A 3S8MA 2IRWA 1JN0A 2VYNA 3HE3A 4D79A 1E3JA 1P1KA 3GN2A 4CMEA 2X9VA 3O8QB 2WD7B 3QHAA 4BNHA 2ZB8A 3B70A 4EJ6A 3ZNPA 4YJHA 1NPYA 4JX8A 4RVSA 3PDJA 3OMLA 2E49A 3DTTA 3HNPA 4DWVA 3PZRA 4WPGA 3B20A 4CM1A 1YBVA 3EC7A 4XCVA 3RI3A 4BNYA 3D4OA 3WG9A 4GWKA 1GPDG 4JROA 1T4DA 1EE2A 4F46A 1NWCA 1U1IA 1Q7BA 1ZSNA 1M67A 3DWFA 2X9NA 3FTNA 2F00A 5G0WA 3VPSA 1UXIA 2P68A 3BMQA 4ZVVA 4D7AA 2I99A 4DBVO 5IZ4A 2I66A 4RF5A 5JNLA 4E30A 3FPCA 1KBZA 4L73A 1PWZA 5DF1A 2CDBA 3UVEA 1LDYA 2Y1EA 5ES3A 2FSSA 1HZZA 5H82A 3AK4A 3LC2O 3AW9A 4CUKA 1LLDA 1PR3A 5L3ZA 3ZWCA 3I9NA 1R6DA 5K0ZA 2PD3A 4J49A 3PJDA 1YB1A 3ABIA 5KJ6A 3OP4A 2PGLA 3Q9UA 1YL7A 4E31A 4RDIA 2YHIB 1N92A 3X2FA 3FWNA 3DDNA 1Z45A 3PI7A 1TVEA 3NTQA 4NQZA 4ALLA 2IXBA 1VE9A 1BSVA 1FJHA 4EITA 5G0SA 4M54A 3I4FA 2IDZA 4CMAA 8LDHA 2I67A 5H81A 4YJFB 4JJGA 5AQ1A 1P1JA 4I5GA 1ZSYA 1O0SA 2JAHA 2X5JO 3AY7A 1J5PA 2EW8A 2VHVA 1B7GO 4RVHA 3GEDA 5U4QA 1EFLA 3TL2A 1PQWA 5DCWA 4QSMA 4CM4A 3F4BA 1PQUA 3DR3A 1NHWA 1LJ8A 3B6ZA 3ZH2A 1SEVA 2P9GA 5IDWA 2OBYA 1H9BA 3HN2A 3E8XA 3KBOA 3NDIA 4QECA 3ZU3A 3TZKA 3DB2A 3U09A 4RORA 1B15A 1K6XA 3GQVA 3C24A 4B7XA 2DBVO 5L51A 4FFMA 1PJLA 1YQDA 2XXBA 3NT4A 3UW3A 4GGPA 2ZCVA 3SX2A 1NFFA 2P9EA 3OEYA 1JWBB 3ANLA 4MIYA 4I8XA 5CDSA 5TSDA 1DRUA 1IHXA 4KUEA 1MUUA 2DUUA 4ILKA 5CEEA 3HSKA 3PHGA 3QWFA 3JQGA 3W8DA 4YDRA 5U9CA 3CUKA 2V6FA 3WGYA 2CVOA 4J2OA 3O8QA 2P5UA 2WD7A 4XB1A 3BTSA 1MG0A 1ZO8A 3ST7A 1KS9A 1ZXBA 4CQLA 1BTOA 3KYDB 4CM9D 1CYDA 1KVUA 3LYLA 5I7SA 4J7XA 1AXEA 2BD0A 2X0RA 1F8FA 3D1LA 1T2FA 4RPLA 2ZQZA 1I30A 3TL3A 3O26A
chains in the Genus database with same CATH superfamily
4GI2A 1E3QA 4AX8A 4WN9A 1CC1S 2F62A 3HNOA 2Q99A 3OICA 3RK0A 5LSAA 1TRKA 2OEPA 1ST3A 2HV8A 3WRYA 1QKJA 1QXSA 3K7EA 1NTOA 5ALQA 4IQFA 4J0EA 1BW9B 4DJEC 3MMXA 5CDFE 4W5OA 3GD7A 2XF8A 4KUGA 4K7JA 4XYEA 3FFAA 5GWXA 4CU5A 4Q00A 2VAMA 2HFKA 1LI5A 1T2NA 3DXXA 3NTLA 2HIGA 2ZKIA 3W5SA 4A0QA 4E5KA 3FR8A 4N0QA 5ALRA 3VYVA 1G3IA 3UV3A 3DP9A 3U0VA 5H9VA 2X9LA 1DJPA 4NP6A 2IDKA 4R2LA 3KCQA 4LTMA 4PBSA 4KOEC 4MV8A 5HOQA 3MJEA 3TJZA 2XCSB 4INAA 2ILVA 2I2AA 5CB4B 1LNQA 1OXMA 3VOSA 3BQNB 5LP6F 1E9BA 2C78A 1TYAE 1ZITA 1X94A 2R6CA 3VM6A 2H52A 4WASA 1X7XB 2RAUA 3V4FA 3IT0A 1BVRA 4JUDX 4L3WA 4DLRA 3PJRA 1DVRA 1HQDA 2QRPA 3VZBA 3FAZA 4HNQA 3REFA 1LU9A 3KWLA 2Z9BA 4HNAB 5EVJA 1RCUA 3UWKA 5BUCA 2DTEA 4ZRMA 3T7IA 9MHTA 5FD8A 3BOSA 4GOMD 3UPUA 4O08A 2DHQA 3RIMA 1YRQA 2D4AA 4HQKA 1V95A 1AQIA 4QTTB 4BBJA 1U0BB 4C4RA 3KEGA 4K9OA 3THRA 4KKXB 4RELA 2RD2A 1MW8X 1TC2A 1ZFNA 1IIBA 3KYIB 4FR5A 3RS7A 3C98A 4BNGA 3MD9A 1TK2A 4D3SA 4NBLA 5A7GA 2NWQA 4MARA 4HQ0A 5EI5A 2HAEA 3IAEA 1R6XA 3SE7A 1UQRA 2ZUEA 4PPNA 2RCNA 2AE2A 4L9WA 5AIBA 1Z35A 1ECGA 3C2QA 4RANA 3HVJA 1M0EA 4A9AA 1W2GA 2AI1A 3BF7A 2RB5A 1EZZA 1GCGA 2FHSA 4GZ5A 4MS3B 3VOBA 4DS3A 1JVSA 3L9WA 1N3IA 2XQIA 2Q0XA 5EP4A 5JFGA 5KWJA 4BNDB 1XRNA 1XQ1A 2VF7A 3HUFA 3JZDA 4RV9A 2R6DA 4OMFG 3ZCSA 3OCWA 1OMOA 3KT3A 1VMEA 1TMKA 3CKLA 3M6XA 2EFDB 3ELYA 4HDQB 3WJ1A 4JFAA 5JYCA 4EBFA 3ITEA 4H7PA 4HF7A 2VJDA 3BE6A 2FXIA 1ISSA 3K8QA 5EWMA 3HVUA 1RWMA 4YMLA 1DC6A 1FMLA 2QL6A 3L43A 4XEUA 5ECYA 3LVFO 3FHTA 5HUHA 2V3WA 2FEMA 3OZTA 2YN4A 3OX2A 4BZXA 1VKJA 2QOEA 4QPJC 5AJUA 2PNJA 1PVOA 3BDAA 1AK9A 4OHKA 3UW1A 3WLQA 1PG0A 2OR3A 4V1CA 2N1BA 2JFNA 2ECKA 3MT7A 1PS8A 3FWYA 3OOHA 4F1JA 3EN0A 3R5JA 5CB6A 2QP3A 3HCFA 1MOSA 1QF7A 4UU1A 5AO9A 3V55A 1Q3HA 1ZUHA 3H2HA 5ADVA 5LD2B 2O6LA 3HVIA 3HB9A 1I3LA 2NQ8A 2NNLD 3V8PA 3W6PA 1WUJS 3A2MA 2B1QA 5I7EA 5KBYA 5CXSA 3A6JA 3FRIA 4NH4A 4JGGA 2CNWD 4Y8VA 5LQCA 4R0MA 4QUAA 1RW4A 1H5NA 1P2SA 1PFVA 1XLUA 3MBOA 4LE1A 2OYRA 4GG1A 1D07A 4GOKA 1CQZA 4YB8A 2QIPA 3KPUA 1VHJA 1JFFB 1UPUA 3IQGX 1E3IA 1ZL0A 2BGRA 5FJJA 5GQSA 1NW6A 1UPCA 1ZJ6A 2YRXA 2MCFA 1WDKA 1W29A 4F0JA 2F3PA 4IS2A 3ESCA 3N8KA 3JAKA 3EF3A 3T1TA 2XNDA 1C7QA 2OSVA 3GH3A 3ZUGA 3E35A 3K9NA 4A6XA 4ARBA 3CHYA 2VDQB 4LECA 2XA2A 4EWLA 1T8RA 1U0RA 4PG8A 2DMRA 2VXCA 3JATA 1YVDA 5EKTA 4E94A 8ATCA 3ZGNA 3PSHA 3R3XA 4HVAA 5FA5A 5TEVA 3HCEA 4F91B 5B37A 1P62B 1JDZA 1IG3A 1PAUA 2CF5A 1NYLA 3I6ZA 1NWHA 3P0HA 1ZNZA 4PSVA 4QGFA 2GOYA 3W3ZB 3EIQA 5E6RA 4REOA 2QXUA 2VCEA 4GYWA 4LOKA 2OLKA 2VJNA 1J8MF 1OI4A 2CXPA 4G8JA 3EXAA 3HFGA 2EQBA 2DFPA 1P1RA 5FT9A 4UNSA 2OXFA 1XPOA 2NTVA 2Q50A 4I8DA 3CLVA 2MSEB 3KVOA 2GETA 1PG5A 4MKRA 1YZUA 2Q1WA 3ZX4A 2Q9CA 5HDQA 3MD0A 2H3EA 2Z30A 3S55A 3LUGA 1RC0A 4UEJA 2N47A 5F3WB 4EG0A 3IOYA 4AZ0B 3EGWA 1QHHA 4MCIA 3R9KA 3PQ5A 2F90A 3DEFA 1CY8A 1EVQA 2X8AA 2X15A 5HWSA 3S68A 4R01A 2VBCA 4HXEB 2WSSD 2KPOA 1F4LA 2V7UA 2C3UA 2HU2A 1THZA 4CYMA 2WM8A 1GQ2A 1SU6A 2JJMA 1GO2A 3IEPA 2R96A 4IH9A 3HGQA 4HYQA 1K98A 3QE0A 1KAOA 2OO5A 1BH2A 1EFRD 5A7HA 1DC3A 3ZGXA 3COPA 1FW8A 3RRBA 2ONCA 1FFCA 1GGKA 5CTJA 2FMFA 2FEWB 1AT1A 1BMDA 1GY8A 2C42A 2YZKA 1KI8A 4I99A 3K72B 5L4LA 3LRTA 1YDFA 2WTAA 3FNBA 1WUKS 3FJOA 4NSNA 4HPJB 3IMFA 1A98A 1M1YB 2IGBA 2IYVA 3KOXA 5JH7F 5DNAA 1N2ZA 1L5YA 2X0EA 1HDEA 2CDNA 2GWRA 3NDRA 2X8JB 2NAPA 3DZFA 4RNDB 4BJHB 4GS5A 1GKUB 2Z1DA 4D9JA 4DV1B 4N3NA 4DLXA 3NBYC 1KQPA 1WG8A 2R86A 3BXZA 4J1NA 4CL8A 1M2HA 6REQB 1NKTA 2YFYA 1Z29A 2WYHA 3AHCA 3WGMA 1O5OA 2YS6A 2IIBA 4TYWA 4WKBA 4X7PA 4NBVA 1JHOA 2EGHA 4MO2A 3HY6A 3RK4A 2VUUA 3AHIA 1VIVA 1U2RA 3OSZA 3MWJA 2WFMA 1G1MA 2VK4A 5CU7A 5TGZA 2XLCA 1XZGA 3BQ9A 4Q01A 3NM5A 2HPZA 4PIPA 4TYPA 5BMVF 5KYXA 4R9UC 3SYRA 1Z5OA 1MABA 3IBCA 4OJYA 3TQCA 5E3IA 1W88B 3GRPA 3S1LA 1CNEA 4PNEA 4JT8A 4PYJA 1XCPA 5D2CA 4QPNA 2Q3MA 1YS2X 2Z2YA 3MJTA 4J7AA 2JGKA 3PENA 4LAFA 4TRNA 2YXPX 4PCAA 1XU4A 3TLEA 3JAMA 2VDWA 2B8JA 4BS9A 2HRCA 2VR1A 4GGOA 5H83A 5I9TA 1JZSA 3AWDA 2GCOB 5CIWA 4A2WA 3WAGA 2WQ7A 2ZAYA 3TIVA 5CDYA 1LGYA 5I3ZA 1YQWA 5IC6A 1CUGA 1YJ8A 1LI4A 1JAHA 1L5HB 2G4CA 3KQYA 4MYCA 4QOIA 5IG2A 3NBUA 3BDVA 3B36A 2SCUB 3BB3A 2VTDA 4P84A 3AVPA 3IEKA 4HTFA 2JFGA 5JPDA 1M54A 1SO8A 5DT2A 1G3QA 4E1VA 1LSJA 2BZ1A 2QKYA 5AHRA 5FX2A 1BDJA 2W6JD 4O6VA 5CVUA 1CQPA 3PD7A 3T3OA 1G21E 2WTEA 4A8TA 1HK7A 2XCTB 2AG1A 3CUVA 5DNUA 2FG5A 2J9XB 1AUXA 2A9FA 3CRMA 4CBVA 2ATEA 1GT6A 3KXIA 2EP8A 1DRJA 3ZZNA 3LECA 1DMSA 1M2OA 3PITA 5KTTA 2D2FA 3DEIA 4E5DA 3QMMA 2ZQYA 2Q6VA 2CV1A 2IWHA 3MTJA 3WQQA 1H23A 1UIMA 1KMNA 1YZFA 3O4GA 1IN4A 2CDAA 1XEFA 3KKQA 1GZHB 1B14A 2IEYA 3FSGA 4WNCA 3BPSA 3N0TA 3ZV3A 2ZXEA 5FUBA 3ICCA 3WWYA 2RGNC 1JQEA 4HFRA 2R79A 1OYWA 1FVXA 3DPUA 5TIIA 3RODA 4NCHA 3MVEA 4Q7LA 1YCDA 1ISIA 2HSWA 2QF7A 1L4NA 3G9ZA 2Y1CA 3HXLA 2TMKA 1U0OC 1R37A 1CB0A 3QHPA 1PK9A 2GEDA 3SC2B 5IUKC 2W90A 4QD3A 3VO1A 3BCHA 3WI7A 3AP3A 4OJMX 1EWTA 3GRKA 1HZJA 3KWMA 1M5TA 2XEXA 4HD8A 5K8UA 1HDYA 3P5SA 2BGMA 5H3LA 2PD6A 4EDHA 4RZ3A 5JNRA 2X22A 2Z1MA 1V1MA 2HBZA 3FXAA 1QLWA 5KX5A 3OE5A 2VPTA 1U0EA 2FW0A 2GCIA 4MQMA 4Y2UA 5FNVA 3MIIA 5MN5A 4MVJE 3EVCA 5KYNA 2O52A 3R3WA 4J0JA 1SUSA 3G8AA 3MRTA 4TMVA 5C7YA 2JGJA 3M1IA 4OSOA 3OUZA 1WPGA 3CZMA 2AQHA 4TLLB 1MIOB 4TUYA 5B58C 1K7SN 1ZCZA 4X84A 1QH1A 1TVKA 3GJ0A 1YZTA 3QSGA 3RJTA 3UK6A 1WU7A 3V42A 1AKRA 1E3WB 5C8ZA 3I62A 2GUGA 5AOBA 4OXYA 1S3GA 1ZU5A 2JIRA 1IBRA 4M7PA 5TPWA 4HGPA 4PV7A 3NHYA 4QM6A 1Z12A 4UU0A 1E98A 1U81A 3AOGA 3DC7A 1VTKA 4KAAA 4MCHA 3ZKWA 3WR5A 2HUPA 3E9QA 2GO7A 3SJZA 2O06A 2PT6A 2XODA 1AUPA 1QC5B 1A7KA 2HJVA 3AEKA 3OQHA 4BLSA 3N2LA 1CUDA 1HG0A 1N5KA 2JK1A 3D8TA 3Q5DA 1E66A 4Q03A 1L5KA 3B9RA 2IH2A 1QO0A 2QN3A 1S8NA 2OFXA 1NW5A 2JJ2A 4XCQA 4ZYUA 1XDWA 3IAHA 5EJ2A 1BRMA 1JR4A 2B4YA 1Y3DE 2NO7A 2P3QA 4RM3A 2GBGA 1L7VC 1QO7A 3FGNA 1B2LA 3AZPA 1GA4A 4WKGA 4DR7B 2V54A 2JAWA 2B0JA 4EGSA 1BFDA 5FTMA 1OI2A 4B6RA 4V03A 2NLOA 2QDKA 1U1EA 5D01A 1YVPA 3V4PB 1NHGA 5LMCA 4D9EA 1UK6A 4HRAA 5DP2A 4BLVA 2F8TA 2Q5EA 3E53A 3IQDB 5AUPB 3SC4A 4AS2A 1N5IA 4RHXA 2ORVA 2J48A 1PD0A 2FI1A 1XZQA 4DSNA 2PA3A 4F3YA 2CXTA 5FCDA 4KITB 1S2GA 1TADA 4PG4A 1ZBDA 3H19A 1IZZA 2BGNA 2CCKA 1NDQA 3LQKA 4ITUA 4N18A 4BKPA 1YFJA 4CHGA 3A58B 2O0HA 5KYGA 3HJFA 2Q3EA 1T5OA 4ZJZA 2YOGA 4RHFA 2WFAA 4O0LA 5E1MA 1D0VA 5FPPA 5JCPA 3K1AA 3QMVA 1PGNA 1XD8A 4CIYA 4RZQA 1TVMA 2ATIA 4HBZA 2H2HA 2G0NA 4HGNA 5E8JA 3KYBA 2B83A 4G0OA 2NYAA 3TPCA 4L9RA 1EEXB 4OH1A 1KZ9A 4A8JC 3H42B 1FX1A 4OHRA 4ZT6A 1Q17A 1UPTA 3UFXA 3K70D 1E8DA 1R0ZA 2BEJA 3HB4X 5C5CA 1Y8QA 1I0ZA 3DZIA 3WLJA 3CVUA 3IQFA 1U8FO 1IPHA 3GJ7A 2WMNB 4MVXA 3KCNA 4CLRB 4J2TA 2JFQA 2OM2A 5KC8A 4BFUA 2HSJA 4V0LA 5AKZA 4RGYA 3V8VA 2TECE 5BN3A 1LZLA 3DVRX 3SHWA 2ZRNA 3H5IA 4I3FA 3RASA 3WLAA 1EFAA 3UG6A 2JBAA 2OAP1 3CR8A 1L5FA 3GWZA 3K9BA 5AKIA 5G1PA 5BNFA 3UGTA 4W1QA 3UV7A 1B93A 1GSAA 4UHBA 5C8YA 2OL4A 3AR2A 3ZIAD 4WK2B 1IJFA 3G8BA 1D09A 3VU9A 2XUKA 1H6BA 5DBFA 3GZ4A 1MHPA 3Q7IA 1XFAA 5JNUA 2QUZA 2GPNA 4A10A 4DJTA 2PLAA 1Q92A 4QXQA 1Q74A 4YROA 4BV9A 3D59A 4MW1A 1TKCA 4QFBA 4NESA 4JLMA 4Z86A 4QGSA 2GO1A 3MUNA 4N03A 5LZ4A 1D6MA 4I2VA 1I6KA 1Q7TA 4YJ2F 4YFYA 1SU7A 4MUKA 3ZCUA 2QNRA 3AJEA 4C9BA 3GCZA 4I1PA 1AVTA 3JQDA 4NJOA 1JR3E 4Z9YA 3MZ0A 1TFUA 5J23A 2Z4TA 2CLIB 2FW9A 1A8QA 1G4HA 1SG0A 1JDBB 2O0LA 2GILA 3TXAA 5C1BA 3R5FA 4DABA 1TE2A 1C1DA 2IDMA 1CUVA 3OP1A 4MUEA 2V8OA 3LH5A 1M2NA 2WE8A 3MB5A 5ABPA 2CSXA 3BK1A 2H9AA 3AGQA 4V0SA 4Y7DA 4PY2A 2VP6A 1M2EA 2H06A 1E9CA 4KYTA 1SUCA 2VRBA 4C29A 3M3PA 1FFAA 1YRLA 2BFDA 1U3UA 5JAUA 5DGTA 4IIEA 3HKCB 1B0PA 1AV7A 3PJGA 3G23A 3VR0A 4EB6A 1KJWA 2ZETA 3NBFA 2IYSA 4FNAA 4NDNE 2I7DA 4A6EA 1NF2A 4BN5A 5JPCA 1HC7A 3T5PA 3V6MA 1RPJA 3GDFA 2XQKA 4Y9DA 3MAGA 4TKLA 2A3NA 5HCIA 2R25B 4ENRA 5KEIA 1VSUA 1Z7WA 3AJRA 1H65A 3Q4GA 3WDKA 4XVCA 2CC2A 2DHRA 3D8HA 4JHXA 3UUWA 2PUTA 1G63A 1R6TA 2B7CA 4AUKA 4EA8A 3OE7A 4Q7EA 3KVYA 4FB5A 2O8VA 1VGRA 2QIOA 2ZTVA 4HSGA 3GUHA 4GEKA 2RKWA 1HETA 1Q19A 2GBPA 2WABA 3I9OA 4WKNA 3QF7A 4XDHA 4X61A 4ZYZA 5FV7A 3C3MA 3T41A 5HJEA 1VXRA 2ID7A 1JFTA 5FPHA 5AOAA 2P2YA 3UGQA 1TCCA 3I2FA 3OEHA 4ENPA 4LYHA 1Y4UA 2PJZA 5KDLA 2E4YA 2GYVA 4KNWA 3C6YA 3K30A 3V34A 4BRSA 3PQ2A 4B34A 3D7RA 2A2ZA 1FRVA 3NUQA 1OKKD 3HYNA 5L7YA 1IY2A 1Y5LA 4HGZA 4J6FA 4DSOA 5KVCA 3GMTA 1B6GA 1TZCA 1G7CA 1M8FA 2G1UA 1FTGA 3KU4A 5L3SA 3UV6A 3WHIA 1DV2A 2QEQA 5EHIA 2PD4A 3EH1A 1Y9AA 5DO9A 4CKXA 2D3TA 5BMOA 3ESAA 2QRJA 4PYMA 4FOPA 4RKEA 1N4DA 2WP0A 1BOOA 4KR3A 3KOWA 5KYUB 1TO6A 2QLNA 4KYUA 3DFKA 4N7RA 4UDOA 5EC8A 3SF0A 4Z0TA 4AZVA 2PSFA 4CI0B 2FOXA 2EV9A 3ME5A 1U2DC 3VVLA 2AN9A 4J94A 2FU5C 1N7IA 4A1OA 1PFKA 2PQ0A 2BEUA 1Q14A 3LBYA 2PA0A 4L2IA 1T91A 4W1PA 4Y1RB 3SP1A 3UY4A 3EF0A 4DADA 2ACEA 1JYSA 3Q9SA 1JKXA 4S1PA 1Q11A 4JLBA 4K9NA 3ZI7A 3ML1A 1I4LD 3DFIA 5HFNA 1N7GA 3K05A 1WB5A 3DP7A 4ALNA 2BP7A 2ZYSA 1Z5GA 2DPMA 1OXSC 9ATCA 4B2LA 1FYEA 1PDOA 2K7FA 1T5BA 4YAEA 4DG5A 5F1PA 4EECA 1T24A 3PTAA 3OCCA 3DMNA 1N2GA 4IINA 5LN1A 1QAOA 4TL7A 4P5PA 4S1TA 1KDTA 2VRNA 1E0KA 4WK4B 2PUDA 2YY5A 4ZCLA 2J07A 2HB6A 5CNMA 1JSZA 2B78A 2ZFUA 4KQ1A 4O59O 3GJ4A 2YXNA 2PR7A 3O3CA 3GJYA 1P3JA 3FRJA 1G21B 1ZD3A 2G9ZA 1B3RA 2JI7A 2ZB3A 3E1KA 2FOLA 3RSCA 1QFSA 3IA7A 4R1PA 5ALZA 3RTCA 3FSJX 4H4CA 1ZBQA 2VNJA 4UATA 4DAEA 3EUFA 1IN8A 3BE5A 3P9CA 1U4OA 3PFNA 4KEAA 4HDNB 4JI3B 1HR0B 1R9NA 3KKMA 4JHLA 4QYIA 2E3JA 4X20B 5SICE 2QENA 4OHMA 3URMA 2QE7A 2EP5A 2BI7A 3F3SA 4H2DA 4ZCPA 1Z6ZA 4N7MA 2JLUA 4EF6A 5EQTA 1X9GA 1MNQA 2OOKA 4I1IA 4JJAA 2MYUA 2VJPA 4B6QA 3LPNA 1CPYA 3BKWA 2ET6A 1N7HA 2WYOA 3COSA 2ZUVA 3QRWA 1SH7A 3BIXA 5AMXA 3FRHA 3I72A 2FG6C 1J06A 1XQ6A 2EW1A 3VH4A 4MDHA 5CFPA 5KDOA 4RD4A 1PT9A 4BMNA 3SQDA 3A9TA 4UXJA 2AJLI 3HJTA 3KZKA 3Q8MA 2CB9A 2W48A 3ENZA 3BJEA 4M9XA 1K4KA 2ZJ5A 4EZBA 3RAEC 4MB2A 2FSHA 2VJYA 3N2KB 2FZVA 4Z3DA 4K9PA 3VYSB 4AIRA 2AXEA 2E2WA 2I6SA 4M9RA 4MQFA 1ONSA 3PJEA 1LK0A 1YS9A 4L85A 3WRXA 5FORA 1LPNA 3RREA 5F9FA 1MD9A 4TWRA 2V0GA 1E1MA 2G0TA 3AUKA 1QS0B 3M9WA 1QZZA 1W52X 2IHUA 4OHZA 3CJTA 5ALTA 5YASA 4JI7B 1WNFA 1JKMA 1GD1O 2ZYWX 4YREA 2I5PO 4WCDA 3K2EA 5K0NA 1US8A 5KTPA 2A5YB 2ZIUB 3B1VA 2V6MA 2OB2A 1GQQA 5IABA 3CPSA 3IVMA 4R8MA 4D9CA 3TXXA 4I4NA 5AHOA 4D74A 1YJBA 1VKZA 3OJCA 5IVKA 1L5ZA 3A1SA 2PNFA 4M7WA 2C04A 3LUCA 3A3PA 1T1JA 3C5VA 3TQSA 3UWDA 3ORSA 1VMIA 3HBJA 4QAQA 3JQEA 4NKRA 3K15A 2Q1XA 1VBMA 2OVBA 3AEQB 5BQ5A 4QUJA 4CV3A 3FNRA 3LX5A 5BYAA 1U1GA 1VG9B 1QG6A 3BUSA 5I5GA 3RYCB 1P7CA 3GCGA 3JQBC 2Q6OA 5JSHA 1XA3A 3OPNA 4CMBA 3RIYA 1O7JA 4FTWA 1KRWA 3EZ7A 5AJHA 1S8OA 1O54A 1BDMA 1E6WA 1H3EA 4XFKA 2DBZA 2P4EA 4PX2A 3ZN2A 4RSGA 3HM2A 1A9ZA 1DKRA 3RS2A 4XJXA 3CW9A 1W0JD 4FLMA 1JHAA 2C3YA 4ZHQF 1E0SA 1I7SB 3HP7A 1AXGA 1NVKA 4HKTA 1QYCA 5HHTA 4DA8A 1VG8A 1CS0B 2LDXA 1GZVA 4ENUA 1O95A 2CDRA 4DQUA 1KI1A 3R3VA 4BB0A 1RYFA 1X1EA 5K0BA 3RUIA 1WEKA 2BM8A 3CFYA 1Y3AA 2E4VA 3GOHA 4NFSA 3AB8A 4DLTA 1V6CA 3MG9A 1U1CA 2IE0A 2QAJA 4IPTA 1T0BA 2EHJA 3ZLUA 3SFTA 2CEKA 1XQXA 1Y4ZA 2YJ6A 2QYHA 4IMRA 1CXZA 4UZFA 1IY0A 4YALA 5F2OA 3T0GA 2EC5A 3VYUB 4CETA 2OORC 1YQTA 2AOUA 3OVMA 4JJEA 1F8GA 1PJ2A 3LP6A 4TTIA 4WNIA 4ZOBA 4DGQA 4RVUA 4HVCA 3I1JA 1GFZA 2ERXA 2H5JA 3ADPA 2FGKA 3OOSA 4XWTA 1Y6JA 4R2WA 3K32A 1QWSA 4RVGA 4COOA 4DMLA 1LH0A 3WMWA 2Z8YA 3BWBA 4QLOA 3SZLA 4ER5A 2VAXA 5HBGA 4F60A 4EVSA 2ZWMA 1PT6A 3WGVA 1HLDA 5KTMA 4YVFA 1L4HA 4EYKA 3N86A 2CL5A 2NM0A 2HGSA 2QL5A 2VATA 2B99A 1QSGA 3F6BX 3G2HA 3ZVLA 1HT1E 3REOA 5EYPA 1PSWA 4H1HA 3GLIE 2D0OB 2A1UA 3QX9A 1BE6A 1EG7A 5HCNA 5AM0A 3V3TA 3KTOA 1H05A 3VPCA 1UOPA 2BKEA 3CVOA 2WTMA 1E2QA 1ESZA 1G55A 1PJBA 3VHQA 4PGAA 1ZRNA 3PUKA 3ZUPA 3R8CA 4LC9A 1RQNA 4RIIA 1P1FA 1MOQA 5JMTA 3JQAB 1UODA 4N0PA 1XTIA 3G89A 3KQSA 3OTGA 4PWYA 4JI1B 4GOXA 2GTIA 3QVVA 4WHMA 4F7WA 4D43A 2VYVA 1NUSA 1V8FA 3FDIA 1HTTA 2AC4A 2BGTA 3CJQA 3HU3A 5IPFA 2FFBA 2YASA 1HE8B 1M1XB 1SC6A 1VLHA 1H8ED 1E0DA 2W93A 3L18A 2BFCA 2Q1TA 1P72A 4NYJR 4OQFA 5KAPA 3DMFA 3RHZA 1X7WB 4INJA 3I6BA 2H17A 2QRLA 5BRJA 1T3TA 2ZI4A 4NYMR 1G8MA 1NFRA 4IIVA 1P31A 4MJ7A 4QTUB 2HHHB 3QWHA 2QHXA 4DKJA 3HB5X 4H3HB 2FEOA 2Z95A 3K9GA 3ZE6A 3B82A 1YHNA 2KW5A 5AT1A 3OPQA 2FFRA 1YNOA 2I62A 1G4UR 2AEFA 2P4QA 4MA5A 1NFQA 1YD7A 4Q3KA 3S70A 2EDCA 3UT0A 5K6AA 2M2IA 3KJQA 1H4QA 3L4SO 4BU0A 1YZKA 1EAMA 1MQAA 2IVFA 2R6JA 3P9PA 4J07A 3IDQA 2F48A 2R66A 3OF5A 1ZQ9A 4MRRA 4ZMBA 5DNYB 3EB9A 3HHEA 4EGCB 5FQNA 3SU8A 2P79A 4PHGA 1AMNA 3EIFA 3OTWA 1ADCA 3EVFA 3CR7A 4YA6A 4Z53A 1CVIA 4IDBA 1NF9A 2F1KA 1VJDA 1VPVA 3HA2A 1AGNA 4FHFA 5CB4A 1KETA 2GFQA 1RHRA 5ESDA 1H1DA 1CUIA 4FOTA 3KBBA 2RGXA 5M2QA 5J1SB 3NNSA 2SECE 3I5XA 4XYLA 4C0JA 1KYIA 1UF9A 2CLSA 2JRCA 1CS4C 4GPD1 1CF2O 2ZWPA 2WAXA 2FP4B 4DPMA 1M6VB 5T8KC 1D3AA 4LXIA 2IEZA 2XNHA 4P81A 3GGGA 3LUBA 3NOXA 4WLOA 2JKVA 1QRTA 1CCWA 1IONA 1KP9A 1PCXA 4J43A 2VRWA 4WWHA 5TARA 2PMEA 1PR2A 3V32A 4F4UA 1KVSA 5LYJB 1OROA 3H4MA 1M2VB 3NV9A 3HWWA 4M2LA 4ZOAA 4DT1B 5JAMA 1ZRHA 3UJNA 5K0GA 4JVMA 3UMBA 1H6DA 2IXTA 1PYGA 1E2KA 1QUEA 5F2EA 4LJYA 2UZ4A 4IFBA 2XD9A 4GEGA 3BWCA 3UO8B 5LKRA 4YAUA 1ATIA 3AW8A 3RT9A 4EHFA 1RNLA 4ZHSA 5REQB 1O4VA 4RC9A 2MSDB 4YRQA 1RZ3A 2C07A 1SBNE 1X14A 1JPVA 4QPPA 4MJLA 4TYNA 3V2IA 3DD5A 3HXPA 4GE3A 4R1LA 1IAQA 1MU0A 1L2TA 3E48A 4Z7QB 5KDDA 3UBMA 3W8NA 5BYJA 4RMNA 1C9JA 3WFJA 4BNDA 3G2KA 4PLGA 2JEYA 2QJWA 4PFJA 4PQEA 2XXJA 4UD2A 2WPDD 3BMCB 1AM4D 3TW8B 1H9AA 5AVJA 16PKA 4JJ7A 4DMFA 1F14A 1BX0A 1G9SA 4MRPA 2FF7A 1NUUA 5GVSA 1YIDA 2P6OA 1DAHA 5EINA 2OWDA 3TZCA 1Z74A 1OTYA 1VYVA 5FAXA 2PPVA 3ZHOA 2HJRA 4YECA 4KREA 4HL6A 3DXZA 4QHSA 4JLWA 2OV4A 2UYHA 2XNKA 1U7DA 4BNXA 2DHDA 4K9SA 1OBFO 4LXHA 4IR7A 4E5PA 4FSDA 1PYDA 2OCKA 1O1YA 3HHPA 2C57A 3G8CA 3STWA 1Z2CA 4OP2A 5B4TA 1Q0ZA 1NM5A 1OR8A 4MICA 1YWGO 4G41A 3H8SA 4G89A 5IF3A 2FRDA 2HMWA 2WT9A 1DKPA 3N05A 5EFZA 5CG2A 4MJXA 1EP9A 3ONDA 2WI8A 1RWVA 1W36B 2F1OA 4KQHA 5BV2P 1V26A 4QVIA 4ML3A 3ABRB 2B1GA 2FPIB 5EZYF 2H7XA 1YR8A 1FRFS 1N2CE 4IDQA 1QWOA 4XR4A 4RIFA 1J20A 1WCWA 3K0KA 2E4AA 1BGWA 4URXR 3WWCA 5BR8B 4PHTA 4I55F 1Y8ZA 2OAEA 3G2MA 4D99A 2ZSUA 3HBAA 4YYEA 1Q1QA 3MPOA 4M0FA 1O96B 4IIJB 1ZG3A 4QYTA 4W1SA 5HOEA 1TEVA 1BDBA 1SVSA 5EE5B 3JS5A 4ZAXA 3HRIA 2L0XA 2EBHX 1ZN8A 3GLGA 1CSEE 2FF5A 3C6QA 1J1UA 5AW3A 3ENNA 3TD2A 3ACCA 4YACA 3LT2A 3H5AA 1W5SA 4C7KA 2G36A 2XTNA 5DULA 5JH7A 2H5EA 3EEOA 1ID8A 3EVZA 5IKOA 4UEWA 4CCYA 2NN3C 4ZXPA 2OZLB 2OKCA 5K8IA 1IUKA 1JGTA 1K08A 4AZ0A 3R7FA 2QN9A 5C7IO 3ZDCA 2UZ3A 4RIHA 4YAJA 4WLFA 2ONYA 1KOLA 2F4NA 4XEHA 3W2IA 5DHTA 3RO7A 5I7HA 1I3CA 2YICA 3K1ZA 2JGDB 2O2DA 1CF9A 2WF8A 1M34A 1FTYA 1ZYUA 3U16A 3L84A 4C7OB 1PUJA 4MQUA 4MUBA 2XYGA 1HFEL 4B48A 5LXTB 3O31A 2ZS7A 4L7QA 1EIWA 4TSRA 5HQ3B 2V74B 4ZTBA 3ITNA 1W5BA 5BMVA 2ALJA 1L7DA 1S3FA 1EU1A 4HN9A 2B7LA 1VSTA 4J29A 1QF6A 2ZBDA 3THYB 3B1ZA 5G0TA 3JXEA 5HKKA 4C08A 1A97A 4DXDA 1NNLA 1VPEA 3RC9A 5B7NA 1W59A 1EGHA 1TW3A 3CLSC 4WTOA 1FCJA 3IAAA 7REQB 3Q1LA 4AU1A 4DQLA 2EGUA 4HB2A 4MINA 1YMQA 1KJJA 1ORDA 1KK0A 1FB5A 4W99A 4M9UA 4KG7A 3THOA 1NBAA 2X8JA 4LYJA 4MUFA 9ABPA 3MBIA 4JUAA 1Z5ZA 3PFBA 2EWVA 3D5TA 4C5BA 1X87A 4UBKA 3L7KA 3ASUA 4F6CA 2FAXA 2JFYA 3EXHC 5B1EA 3PZBA 3SS8A 2W6PA 2QUBA 3SKXA 1A9SA 4RXMA 2GCGA 2WKRA 1N57A 1AK2A 4Q4CA 4DLLA 3R4CA 5F52A 1UP7A 4RA9B 3WB0A 2NT4A 3A4NA 3QA9A 4YLYA 4R6WA 2QXTA 3ABZA 5IASA 4MQEA 1CUWA 3D7MA 2HDNB 1AOXA 3R0IA 3MCTA 2JIOA 4GI5A 4Q3EA 1NW8A 5DTJA 3DMHA 1EBBA 1D2AA 4L4XA 4QYSA 2IPXA 4LBWA 1GDDA 1W85B 3A28A 2JFHA 1ZA2A 3KOOA 2XCIA 3N76A 1K5PA 4HQLA 1T5HX 4W7HA 2PZGA 1IQ0A 4WBNB 1XLWA 2MT9A 2Y0CA 3QE9Y 4FYIA 1QIKA 4H6VA 3BILA 1X7GA 1WW2A 1EM8B 3EXFB 3O47A 3NJ4A 3L7AA 3RBAA 4PO9A 2OBFA 1Q22A 3RD5A 3S28A 5CDTA 1DTSA 5B3JC 3BXFA 3I5UA 4XLZA 2JGMA 1J8QA 4IVQA 3OJWA 4AMYA 1BH6A 1D6SA 2FZCA 1GKLA 4DRYA 1N75A 2I7XA 4U6SA 1CHDA 3GUZA 1JIXA 3O7MA 1CR4A 1SIUA 2BE7A 4OK5A 3D7LA 3DZBA 5IDVA 3RAGA 4J3JA 2G4LA 1GR1A 2BEKA 3EW9A 4H35A 4IV5A 1TCAA 4P3YA 5DLDA 7MHTA 4HP8A 3ICOA 1GRVA 2C5GA 4W9NA 4H4DA 1EBUA 2B92A 5HSGA 4ZYLA 3M8KA 4YYZA 2P9JA 4TL6A 3PWKA 4EPRA 4FFOA 4G67A 1CQXA 3CUSA 3JV7A 3MINB 4E5NA 1VL0A 1OA0A 1Y1KE 1JHRA 2P30A 3GLIB 4AD8A 1ZIOA 5H4HA 1EJ2A 3MBKA 3PQ3A 4MWBA 1PSDA 2CMFA 3K35A 4OYYA 2WHPB 1P2DA 2V3CC 3A9RA 4Q7QA 2FSIA 1Z4QA 4FEAA 4HWRA 4MS1B 1U1DA 2JZNA 1YE5A 3AHDA 1M6WA 5ED0A 4X71A 1C14A 2CK3D 4I4CA 4QPDA 3JTEA 2WHXA 3JR7A 5FL7D 1H42A 4FYXA 4FLFA 2UU9B 5ER9A 2IUEA 1JAZA 1JI0A 4JI5B 3ZV6A 1EGAA 4LF9B 4RW0A 4B3CA 3A31A 3BL5A 5CMLA 5GZ3A 4J1QA 4QA9A 3SJCA 4U0KA 4EPTA 3TSCA 3H83A 3KTAA 2YZ7A 1UJNA 2WSIA 2CXUA 2FSUA 4MWDA 3NLLA 3R41A 4GL4A 1RXVA 1ZKMA 4NZNA 5MFPA 1XWIA 1Q1AA 2DPHA 3GLHB 1GXSB 2E1PA 2QTFA 2VHTA 3X0DA 2AR7A 4J4TA 3S99A 3INYA 2YV3A 3TKAA 1V7QA 2C5HA 2JBHA 3DBRA 3AUUA 4WXEA 5IX8A 1AZTA 3G02A 5LU9A 4NK5A 1JG4A 5BPFA 3CB2A 1TT5B 5EAIA 1GG8A 3RAPR 2C2XA 3RFTA 3GJZA 1XMPA 4OXNA 4CLDA 5IM4F 3AMVA 1A7AA 1ISGA 1DWPA 2X19A 4FS3A 5JOQA 4LF4B 1B8VA 2VHZA 2WMDA 5A0VA 2DPXA 2QJFA 3HYTA 4QT4A 4NEGA 1MIOA 3S0JA 5EMNA 1XZDA 2VXBA 3GELA 5AKXA 1SOUA 2PYIA 2ERCA 3E2IA 5COAA 1OAAA 2DBQA 5KTNA 3G82C 2JFZA 4UUOA 2OBBA 3H6GA 3OM1A 3DZDA 1N6KA 1HG1A 2RGYA 3IURA 4OMUA 1LQUA 5JSYA 1X1AA 5TEWA 4HV4A 1CRWG 4BP3A 2JI6A 1M72A 4G1CA 1B1AA 4MRMB 4ENTA 2NU6B 3I8OA 3PG5A 3QFCA 1YXMA 4M7RA 4Q82A 1OE0A 1K8QA 1L5LA 3RW9A 4QELA 3SSAA 3VZQA 5CK5A 4BGIA 5F23A 1X92A 3IMKA 2VVTA 3QLEA 4I46A 2RHLA 1RM4A 1P5FA 4IHJF 4OIFA 1EB8A 4ZVQA 1XQWA 3DT6A 5L9AA 3FYUB 1T2EA 3OKFA 2OZKA 3D3EA 4GKVA 5ALJA 4A5OA 1W0KD 1UM9B 4B43A 4WLEA 4HPWA 2O2GA 2ZR9A 1FRZA 1YL6A 4G24A 4QUKA 4UMDA 2JI8A 1SVNA 1VL6A 2XY4A 4PU0A 3U3KA 2VXOA 1CLUA 3PCXA 3VZRA 1H8HA 3RJ9A 4KVZA 1X74A 4CM4B 3WMGA 1QE0A 3WXMA 5H7XA 4N0MA 3UXMA 2TMYA 1LPOA 4KRXA 4WXYB 3SLGA 1XIVA 4NE2A 4CL0A 4D4MA 2P6MA 4MW2A 4YQEA 4GP6A 5EQFA 1T29A 2CBGA 2HA2A 3LQFA 2XADA 2NTEA 1QG0A 2FDRA 1ZR4A 3T3EA 5IT4A 3SE0A 3FYDA 4LN1A 1XJWA 4W5HA 5EJ8A 5JD5A 1XQ9A 4WZBE 3H2YA 3ZDFA 2CFIA 4CLRA 1FA9A 2XA9A 4LRWA 4LXTA 1TGVA 1MO5A 4FE3A 3ZLBA 4D9MA 1JEOA 4OAOA 4LZJA 1AKVA 3ROQA 5CM2Z 5HYVA 3QF4B 3WLFA 2HEIA 1SD1A 4M9SA 5IW8A 5JDCC 4QEDA 4EI7A 5U1PA 1YRYE 3U4HA 4CV2A 1OH7A 3UJPA 1TEXA 5EZQA 5FFNA 4G85A 4JBYA 4ARIA 4L8GA 3OF2A 3FFXA 1XLTC 3IAM6 4F3CA 5J4VA 1XPRA 5C32A 3EC1A 2IHKA 1SPBS 4HSEA 2YZ2A 4QU9A 2QZ9A 1IZ8A 5H70A 2E5WA 2HY7A 3BS4A 1MNAA 1SZCA 3AF3A 4ETWA 4YJ2A 2IF2A 4IYRA 2FVXA 2XVZA 3ANXA 1ONBA 4GSLA 3F6YA 2B1IA 3NHLA 1Z18A 4MI1A 3TE7A 2MWMA 3IUMA 2HJGA 2JAXA 2A1TS 2C4HA 3RF6A 1TTTA 3A36A 5ALXA 3B5EA 4BEJA 3FNGA 3EEQA 4CKEB 4O4HF 3D31A 3AESA 4K28A 5ESXA 5G3ZA 1Y81A 3D81A 4AUNA 5JHHB 1V5EA 2WVAA 2V9CA 2J9GA 1GGHA 2H1FA 1OX5A 5CX1B 1G8PA 4TN5A 4QBGB 2PKXA 4U63A 5LQSA 1WKVA 1N2CB 2PV0A 4F9EA 5L40A 2CV2A 3X1MA 3ZR4B 3FGOA 2NSYA 1PV1A 5JYBA 1JXAA 2Q4TA 4DRZA 4OXRA 3WTCA 1OLUB 2BE9A 1TB4A 1MJGA 3FLEA 4M1ZA 5JVDF 4PC1A 4HK4A 5A3JA 4PPFA 3OMWA 1ULHA 4B73A 1X0XA 4HMPA 4ISCA 3P52A 1FTQA 1E5TA 1G8GA 2HCTA 3CXRA 2YQ5A 3H6HA 3KC2A 4NE7A 4TMZA 3UWOA 5EMLA 3M6VA 1Z13A 4B82A 4BVGA 1U04A 4BBPA 3FPGA 1M5UA 3EG9A 1PT7A 3W7BA 3ZTTA 1QIMA 4EI2A 4RESA 3DT8A 4OPMA 1EP1B 1R4MA 1Y6ZA 3LUAA 3B51X 2PBFA 5AM5A 1JIIA 3ADBA 5IVHA 2DLDA 2VSQA 2BCEA 3B6JA 3L77A 4ERNA 3H2GA 3ND8A 2WIJA 3B13B 4YRLA 2BONA 3T5CA 1E9RA 3RUAA 3AFIA 2YL2A 4LDNA 4O5OA 1NV9A 2E1RA 4Z6KA 2CJWB 4Q37A 5FB3A 2R8XA 1ZK1A 3ER6A 4LYDA 4W5JA 2REQA 5JO0A 4OQMA 3HKCA 4KK3A 2VWQA 4P3NA 5GONB 3QVLA 1SQGA 1LJLA 2JDIA 4LJ8A 4PLFA 1MX9A 1DT3A 2MSCB 2PFSA 2JLZA