4RDIA

Crystal structure of e. coli trna n6-threonylcarbamoyladenosine dehydratase, tcda
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
266
structure length
246
Chain Sequence
SVVISDAWRQRFGGTARLYGEKALQLFADAHICVVGIGGVGSWAAEALARTGIGAITLIDMDDVCVTNTNRQIHALRDNVGLAKAEVMAERIRQINPECRVTVVDDFVTPDNVAQYMSVGYSYVIDAIDSVRPKAALIAYCRRNKIPLVTTGGAGGQIDPTQIQVTDLAKTIQDPLAAKLRERLKSDFGVVKNSKGKLGVDCVFSTEALVYPQSSGFGAATMVTATFGFVAVSHALKKMMAKAARQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Escherichia coli TcdA (Also Known As CsdL) Reveals a Novel Topology and Provides Insight into the tRNA Binding Surface Required for N(6)-Threonylcarbamoyladenosine Dehydratase Activity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords tRNA threonylcarbamoyladenosine dehydratase
total genus 73
structure length 246
sequence length 266
chains with identical sequence B, C, D
ec nomenclature ec 6.1.-.-:
pdb deposition date 2014-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4rdiA00
3GVPA 2HRZA 3W8EA 5IXSA 2ZTMA 4W9NA 1H2BA 1QORA 5DDIP 2C20A 1B2LA 1DC3A 4RPKA 3OJLA 5LDGA 2QHXA 4NK5A 2X58A 1LRLA 2OXIA 3RUFA 3SJ7A 4UUOA 1RM4A 3E9NA 3KO8A 1RYEA 3NUGA 1DFGA 1IZ0A 2D8AA 2OBYA 1GUYA 4GBJA 2R6JA 4OO3A 1Z82A 1T26A 3WWYA 4Y98A 3VH4A 4YAKA 5IDYA 1PS9A 2FPIA 3E8XA 1D1TA 2V6GA 3FBGA 1HRDA 4MKXA 1N9GA 5CAEA 5JMPA 1P33A 2XXJA 2H9IA 3DQPA 5EIOA 2BFPA 3RAJA 5FFFA 4DIOA 3BYZA 5IG2A 3PHJA 2DTEA 2PKQP 2Q4BA 5TRTA 1PJLA 2VHVA 3ST7A 1SNYA 1DO8A 3BMOA 3TL3A 3PRJA 4GSKA 3HZZA 3W6ZA 3I5MA 3S2GA 3SLKA 1OFGA 1WZEA 2C29D 2YV3A 4DPKA 1PEDA 3BTSA 4BNLA 5B4UA 4IIVA 4HFMA 3E5RA 5EQDA 4Q3NA 4RPHA 5CPBA 4L4SA 3N7UA 3JD0A 4B3JA 4L9RA 2FR8A 3RJ9A 2UAGA 3ZU4A 3F6YA 5DULA 3JTMA 2NQ8A 4LVCA 5G0UA 1YRLA 3ZWAA 1KOLA 4UUNA 4CMIB 3WSWA 5JDCA 1Y9EA 1I2BA 2YFHA 3VZRA 1JAYA 1NP3A 2VUUA 2I3AA 3ONFA 3KYDB 1U28A 1JKFA 4DLBA 2XF8A 2FZEA 3WMWA 4MOWA 4C4OA 3S2FA 4LMRA 3TWOA 1U2GA 3NDIA 1PJBA 4FR5A 4NJMA 4B7UA 5CP8A 4WLOA 4PRLA 2WSBA 2IZZA 3DOCA 1O0SA 4I5DA 4YJHB 4CV1A 1Q2XA 1J6UA 3L6DA 5HRUA 4ALNA 1LSUA 2VYVD 4Z3DA 4A0SA 5KVCA 4HV4A 2PGJA 3B6ZA 3GLQA 5AXAA 1I2ZA 4HKTA 1HSZA 2NADA 4R51A 5I7FA 3WGTA 3LSYA 3EGOA 4AFNA 4QECA 2WD7B 2G82A 1EE2A 4D45A 2DTXA 2XPCA 4TQGA 3ZWCA 1HDZA 1RWBA 2VNAA 3UUWA 4Q9NA 2YY7A 4WCFC 1T2FA 1GD1O 1EVYA 3ORFA 4CQLB 1EFKA 3NTQA 3L9XA 2GDZA 1PL6A 1VRWA 4ZQBA 4D3SA 3AM5A 2D4AA 4C7KA 1LDMA 2IDZA 4WOJA 3GY0A 3UAGA 3GFGA 2XOXA 4QXMA 4TRMA 4B8WA 4GLOA 4JJFA 3WMXA 1DB3A 5BNIA 2HK7A 2JD2A 4FBGA 2DTDA 2PD3A 4F6LA 3PHIA 3ANMA 4D0SA 4FC6A 1DC5A 4W99A 1H94A 4PRKA 4E30A 1AGNA 2X6TA 2YHIA 4XRRA 4Z0PA 4MVJD 1CJCA 4HWKA 1SAYA 3D4NA 1U4SA 5GZ1A 5TJHA 3L6EA 3RFVA 3Q3CA 1UZNA 4BO8A 3K5PA 5JXWA 1U5CA 2PWZA 3MTJA 3JQ8B 4WGGA 2DAPA 2R00C 3D3WB 4CLRA 3KEOA 4ZQGA 2VWGA 1WP4A 3QP9A 4MIEA 4BO3A 3WBFA 1EVIA 1X1EA 1UXGA 2DT5A 6LDHA 1E6WA 3MJTA 2HU2A 2CFCA 2Q1UA 2PKRA 3K31A 3R0IA 4UVHA 4E6PA 5JYEA 1PGQA 4FFPA 5B12A 1Q7GA 1P0CA 2AE2A 3FBTA 4BV8A 1A9YA 1YO6A 2HKIA 4BHTA 4OQZA 2EP7A 1RYDA 1YXMA 1EE9A 2BFMA 3AU9A 2WYWA 1P1HA 1UDCA 2HMUA 3CIFA 2NVBA 1T2AA 3ZV5A 5ICMA 4BQRA 3GMSA 1K5HA 3ZV6A 1ENOA 2RIRA 1ID1A 3FF4A 3I6QA 3ZDFA 3H4VA 4PLPA 1PIWA 3GC6A 4QO7A 4XB1A 1AHIA 4LRTB 4RDHA 3C7AA 2VT3A 2C7GA 4NI5A 5JAZA 5KTKA 1HE2A 4GKVA 1XQ6A 3KSDO 2ZYAA 3BA1A 5I7SA 4R1SA 3QWAA 3SC6A 3VDQA 4CM4B 4FDAA 4GX2A 1YGYA 3HWRA 4XR9A 4CM6A 3Q0EA 4UEJA 1EUDA 3LLVA 4KOAA 3PLNA 1ADCA 1QMGA 2UVDA 1W4ZA 3JQCA 3QV1A 3U5TA 1J5PA 1WNTA 3CMMA 1OAAA 4OGWA 2X0IA 3S2EA 4E2XA 4J91A 4U6QA 4XKJA 4AJKA 3BAZA 3LK7A 1W73A 1NBOA 1WPQA 2G17A 1E77A 3H9QA 3E48A 1C0PA 4ZD6A 4PVDA 3WNVA 1Z75A 2JFFA 5G4KA 2WMDA 2X5OA 4WOKA 1E92A 4BQPA 5BR7A 1IZ9A 2NV6A 5JY1A 4IGFA 3EVTA 2AEMA 2HO5A 2Y1DA 4AL4A 1GV0A 2X5JO 3HADA 4U6SA 4BNXA 5EN4A 1JW9B 2J3HA 3JD3A 3ZWYA 3GNQA 3WGHA 2VOEA 3GG2A 3DFZA 1B14A 3BMCB 3E82A 3JD4A 2DKNA 3U0BA 4WUVA 1EK6A 4NBVA 3UW3A 3AI3A 4RF4A 3I1JA 4TROA 3AUSA 3I6IA 3WWZA 3DB2A 4FSHA 2X0JA 4RPGA 1Q7CA 4KUGA 5T6BA 4NFSA 3W8FA 1H6DA 4FOSA 2VYND 5JW6A 1WDLA 4EZBA 2CY0A 4K26A 3DZHA 4DGSA 4XRGA 1C1DB 4PZDA 2EKPA 3FNGA 1G6KA 4NMHA 1F8GA 3UFXA 1PL8A 2JJYA 5GZ3A 1CERA 2CF6A 1E1MA 3HJAA 2BKAA 1PWXA 1Z45A 3AM3A 3DBRB 3BTVA 3VTFA 4XIJA 3KEQA 5DOZA 2B5VA 2HJRA 2HRBA 3H8VA 4PVCA 4L74A 1PZHA 5A03A 2EP5A 3ZNNA 2DUWA 1IB6A 3IKVA 5CDYA 5TX7A 5TGDA 3B70A 2Q4EA 4I5EA 5F5NA 4ZU3A 4E13A 4EDFA 3OHSX 4FB5A 2W8ZA 5DZSA 4FGSA 4FPXA 3JQBA 5IN4A 2GF2A 5IZ4A 3G1UA 1DIRA 4OKNA 1W0CA 1FF9A 1JKIA 3HN7A 1ONOA 3UHAA 3GGGA 4ZQFA 5LC1A 1XGKA 3T7CA 3HQ4O 3ZWWA 4BMNA 4CLDA 1PGOA 2CSUA 4EI2A 3H6KA 5FWNA 1SB8A 2GZ3A 1ISMA 2QYSA 4E0BA 2Y99A 1FXSA 1PJTA 3D5QA 3IP1A 4Z6KA 4IS3A 4XZ3A 3GNSA 3OA0A 2CVQA 2JL1A 2DBZA 2FP4A 2RH8A 2WYVA 2B36A 3WXBA 3KV3O 3LC1O 3GNTA 1UZMA 3S2IA 4ND2A 1UDAA 1L7DA 2OBNA 3F47A 3CPSA 5K6AA 5JCJA 5HBRA 2JFHA 1FMCA 1YOVB 1M76A 1TA4A 3PYMA 3AFNA 4TRJA 4CQMD 4AVYA 1BG6A 4FW8A 4YT4A 1XHLA 2PTGA 1X7DA 1YDEA 3VZSA 3WGGA 3ITDA 5C5IA 2NTVA 4D7AA 4QFCA 5ADHA 4L8VA 5AXDA 1UZLA 3FRJA 4DMMA 5DNAA 1J0XO 3HDJA 3P2OA 1ZFNA 5C7IO 4FFLA 4WCFB 4FIZA 5JSFA 4ALKA 5EJ2A 4BIIA 3TDKA 2DQ4A 2FRDA 4W9NC 2FOIA 2ZQYA 5CPFA 3ROMA 4DQUA 5JNLA 1FDTA 1BSVA 4ILKA 1PZGA 4KDFA 2NWQA 3A1NA 5IDWA 5JAQA 1XA0A 3B1KA 1TT5A 4PN3A 5JO9A 1P1KA 1SOWA 4M55A 3DFUA 5KJ6A 2FHSA 1Y81A 3LF1A 3H9UA 3RASA 1QRRA 3OJOA 1DIHA 1JDJA 3PJFA 5T8KA 1R4MB 4BNYA 1VJ0A 5C7OO 3CZRA 3FR8A 4Q3AA 3EY4A 1MXFA 1Y9AA 4NQZA 1I3NA 2JCXA 5CEJA 5F1OA 5MDHA 3NV9A 5L4LA 3LQFA 2O2YA 4XYBA 1HF3A 3W4JA 3WX0A 4B4UA 1VJTA 4J16A 4R41A 1EDOA 4FS3A 4E2ZA 2PD6A 2I3GA 1A71A 2EW2A 3M1AA 1C0IA 3OIGA 1LDEA 2FSVA 2QRJA 3JYPA 4J2OA 1VKNA 2ZQZA 2FZWA 2O3SA 3EZLA 2A4KA 4N5LA 4Q3EA 1C3VA 3L4BA 3BMNB 1KEVA 4CMKA 2EEZA 3GQVA 2AA3A 5IXYA 2GN4A 5B37A 3G49A 3H5AA 4BGEA 1ISHA 4CM1A 2PA3A 4CJXA 4NU5A 5KOIA 1ZBQA 3IS3A 1PR9A 2EHDA 4PLHA 1BVRA 4DL9A 1GADO 5AXBA 1MGOA 4OOEA 4OHUA 3VDRA 4YT2A 1ZMOA 4YA6A 2IEDA 3GHHA 3VZPA 1LDBA 1EVJA 3MOGA 1V8BA 5A05A 4AJ4A 3ZWPA 2GGSA 1Y5MA 2CF5A 4RQUA 4UVGA 1ENYA 2V6FA 2VCYA 3RC9A 1P31A 1TEHA 1JAXA 4F46A 2X9NA 3CKYA 3EVNA 4R3WA 3WBBA 3E1KA 4QTZA 4MPDA 4RJTA 4TVBA 2O3QA 5TT0A 3NKLA 3G3EA 5BNFA 3UF0A 1RM5A 4IZIA 2EWMA 3RUHA 3MJEA 2JFGA 2X0RA 2OZPA 1SEPA 1LI4A 1LSSA 4W7HA 1JVSA 5A3JA 1GUZA 3FSRA 2NSDA 1BRMA 1CYDA 1YB4A 1R37A 1UXHA 3FWZA 2UDPA 3PI7A 2I65A 3I9NA 1GAEO 2CUKA 3AUUA 2VUTA 3PXXA 4YAJA 2EG9A 1ZO8A 5F3RA 4ZJUA 2PZLA 4E5NA 1G0OA 1DHTA 1YDWA 1WW8A 3R1IA 1MFZA 5L45A 4NBRA 1SMKA 1NTOA 1CWUA 3KYDA 2UV8A 3DBRA 1JN0A 2Y67A 3QVXA 3MOIA 3D5TA 3K8ZA 3PGXA 4AJOA 2UUOA 3ZHZA 4DVJA 2W2KB 5JLAA 4JXKA 3IDSA 1LA2A 1O9BA 1BXZA 2AG8A 4IDCA 2Q49A 4NJMB 3KYCB 3SBOA 4OKIA 2FPPA 4IDFA 4J90A 5TC4A 4CLOA 5CDGA 5CFZA 1N7GA 3PQEA 3CXRA 3GZNB 2FY8A 4AG3A 4BNIA 2FSSA 3JYOA 4HFNA 1BGVA 4B4OA 1KBZA 5K9ZA 1MG0A 5DOVA 4J7CA 1O95A 3H2SA 1P9LA 4R69A 2RH4A 3RBVA 4YR9A 2TMGA 2Q1SA 3DZGA 3E18A 4MVJH 4BNJA 4UVDA 2VRCA 3DL2A 3L07A 3AI1A 4BNZA 2BHLA 4BOYA 4RVGA 5JPIA 3AY3A 1XR3A 4NG5A 4B7CA 3TZHA 4LCEA 5BSFA 2OMEA 4YAIA 3LYLA 4E3ZA 2PKQO 3UCXA 1VL8A 3Q6IA 8ADHA 4P4NA 4EJ6A 4IXTA 3OQ6A 3I4FA 2HMWA 4O63O 5A5EA 4DC1A 4E2WA 5JCJD 3I9MA 1M6WA 5EMHA 4BUCA 4JGBA 1DAPA 3CZMA 2B0JA 4I5GA 1MP0A 2CMDA 3BMQB 4BB6A 5JFOA 2IODA 1A4IA 2O3JA 1T1SA 3OIDA 4TWRA 3ZU3A 1D7OA 1DRUA 5GY7A 2PFGA 4KUHA 2CD9A 4J0EA 5COBA 1X1TA 4L75A 3HN2A 1PX0A 2QQ5A 4RF3A 3HB5X 1GQQA 2QIOA 1YBAA 3PK0A 2C82A 1YB5A 4HNGA 4WPGA 1NVGA 1X0VA 3Q9NA 3NJ8A 1D1SA 1KVQA 1EBFA 3OBBA 1P1FA 2W98A 1U8FO 3ROQA 1EUZA 1GYPA 2OP1A 3W6UA 4WJZA 1B8VA 1MX3A 3ZWBA 3RCBA 3PJEA 3SC4A 1XDWA 3RSHA 5CDSA 4DBVO 3V1YA 2GD1O 4YDRA 1LLQA 1PJCA 1UH5A 2Q2VA 4FJ1A 4B4WA 1TI7A 4XJSA 3BHMA 3KM0A 5B4TA 4J6FA 3KLMX 1PJ2A 4E5PA 4E4YA 1GV1A 4BNVA 2EJVA 5IN5A 2BF7A 4CQMB 1U7TA 2GERA 1FDWA 3Q1LA 3PHGA 3F4LA 2LDXA 3C8MA 3ZWVA 1VL0A 4OIMA 4CLEA 4ND1A 3VKVA 2VYVA 4K1LA 4CL8A 5JS6A 4HFRA 1XEAA 2AQHA 3JQEA 4XQ9A 1IOLA 3NX4A 1IPFA 3FWNA 3PGJA 4UUMA 3D4OA 2V6BA 3WYEA 2QYTA 3DC2A 1B26A 4A5OA 4YYZA 4BL5A 1RM3A 2QZZA 4IJVA 4XWYA 3O8QB 2DVMA 3OEYA 1ZSYA 1N5DA 3QWHA 2DBRA 2VN8A 1JU9A 3OQBA 3Q2IA 3WQRA 1EDZA 4J1TA 4AJHA 2GASA 3DOOA 1NX6A 1PQWA 1CF2O 4MVJM 5A06A 2FN7A 1VPDA 4TSKA 3DOJA 2UUPA 4XQGA 4FCCA 4YACA 3OJEA 3ULKA 3L6OO 3U09A 5TSDA 2J6IA 3AY6A 1LJ8A 3WTBA 1NYTA 1IHXA 4IDAA 4HFJA 2IEBA 1OBFO 1LQTA 3ONDA 5ENVA 4A2CA 1N9GB 2VUSA 1ZH8A 4AJ1A 3O9ZA 3IQDB 3L0DA 4ZICA 1E1LA 2HUNA 1NASA 1I0ZA 4CL3A 3D0OA 5KCZA 4R5MA 3N58A 4J1SA 3ENNA 1GEEA 4PG6A 4CODB 2GZ2A 2AQ8A 2VTEA 2Q45A 1ZXLA 2BFOA 1OMOA 2Y93A 5G0SA 3RUAA 1X0XA 3W1VA 1GEGA 3OIFA 3GK3A 1SOVA 4NJOA 5F1PA 5G4LA 4GL4A 2CZCA 3AU8A 1U7HA 2HMVA 2Z1NA 3LC2O 4ALMA 3HDYA 4CM9A 5IZCA 1XCBA 1GU7A 3DZBA 3H9GA 1TVEA 2J3KA 4GKBA 1WVGA 1NR1A 4OQYA 4Q3CA 4BGVA 2YHUA 2ZYGA 3EZYA 3GR6A 3K2EA 3H9JA 3QHAA 4CUJA 1E7RA 3GPIA 4LCJA 1HZZA 5TF4A 2B83A 1M6HA 3P2YA 2C2YA 1MG5A 4ZVVA 2Y0CA 1R0SA 3JQ8A 4TRRA 3WGZA 1QV7A 2JKVA 3U4DA 3GZNA 4MKRA 2ZATA 3NTRA 1KYQA 1RKXA 1E3WB 4HNHA 5JMWA 3EMKA 3RJ5A 3DDNA 4QX6A 1H5QA 5KIAA 1ZEJA 2YDXA 1IL0A 4LMPA 1FDSA 1H9AA 1IULA 3JD2A 3X2EA 4G65A 1EFLA 1N8KA 4WLEA 3WR5A 4PLGA 2CDBA 2D59A 4A26A 3WS7A 1H2HA 5JO0A 1ZJZA 4AJJA 4YJFA 4KP7A 2YDYA 4LVUA 4RQTA 3NEPX 1SO8A 3RVDA 1DOHA 2C59A 3AK4A 4S3MA 3LT2A 3P5SA 3OQ1A 3IP3A 4GVXA 4MVJI 1BVUA 3MJ4A 1P74A 1D8AA 1ORRA 1XWFA 2EJWA 2WYUA 4XYEA 3SJUA 3DAPA 2QRKA 4M54A 3TNLA 3E9MA 2HLPA 3K6JA 3MWEB 2QW8A 3AUAA 4KQXA 2AQIA 3MTGA 1A4UA 1PJ4A 4J0FA 4MDHA 2PZJA 4OOFA 1K6XA 3ZWOA 5CDTA 4L76A 2O2SA 4J7UA 2BH9A 1E3WA 4O5OA 1B3RA 1T2DA 3V2UA 3VPGA 2A35A 2E49A 4B4VA 4GVLA 3IMFA 4XEHA 3G79A 1VSUA 2Q3EA 5A3VA 5ENDA 4DYVA 4GQAA 4PLTA 3RBXA 2WTBA 1Y5RA 1B0AA 4RLHA 3DWFA 3CE6A 3E5MA 4GAEA 3GDGA 1YONA 4I9NA 3DZKA 3GAFA 3DBHB 1SC6A 1JVBA 5KVQA 2I67A 3F1KA 3GUYA 1I3LA 3OF2A 1E1KA 5JDIA 3OEWA 1J49A 5I9NA 3UCFA 1NQ5A 3DTTA 2OL4A 2CDAA 3WFJA 3WJAA 4D46A 4W6ZA 5IAAA 1U3UA 4NIMA 4XYMA 3DEYX 4KWIA 1QG6A 1ADBA 5F5LA 4J4TA 4CV0A 5TLSA 1PJQA 1I24A 4AJEA 1JLLA 1T2CA 3RBZA 1GYQA 3MEQA 3ADOA 4H3VA 4BKUA 4ZRMA 4FFOA 1HE4A 3INRA 1A27A 3RU9A 2ZKLA 3WB9A 2IE0A 5DT9A 4DLLA 3ADPA 5I9MA 2Q50A 1DRWA 4RF5A 2IZ1A 1UR5A 2JCYA 3TOZA 1R4NB 2A9FA 3BMCA 4OMUA 3TF5A 4QSMA 5JYDA 1JQBA 4B8ZA 3ZGYA 4FOOA 4DYDA 1FDUA 3DZJA 3HNPA 1GCUA 4CLHA 4P22A 1R12A 1G0NA 1NXQA 4BS9A 2AG5A 3VPXA 3H3JA 4DPLA 1NWHA 4R16A 4H15A 3SEFA 3VPFA 3WOHA 2RCYA 4IS2A 4GWGA 1NWCA 2NUAA 4OJNA 5GMOA 1Q1NA 1UXKA 1VM6A 4M8SA 3ITKA 1ISJA 4E5MA 3I52A 3UOGA 4CR6A 4ZHSA 3TQHA 4MIYA 4R4JA 3U9LA 2E4AA 3KSUA 3UVEA 1HLPA 1YH3A 1A7KA 2BELA 1X15A 4UREA 1LEHA 1I32A 4OSOA 4CV3A 2GN6A 4M89A 3QE3A 2NVUB 1SZJG 3BTUA 4IZHA 3B1JA 4IUYA 1GPDG 2X9VA 1OC2A 3MJSA 2BLLA 4IDDA 4BNKA 2C2XA 5JDCC 5KJEA 4BNUA 1GY8A 3DBVO 1G1AA 1ONPA 3HFGA 1HDGO 1QYXA 3GMDA 2Q2QA 1HSOA 2DLDA 4JBHA 1VJ1A 2BGMA 3IOYA 3U62A 4EYEA 5EQFA 5FF9A 7ADHA 1Z6ZA 4O59O 2ZJ1A 2ZTLA 3WQSB 1OZAA 2JAHA 4EW6A 5EL0A 4E5YA 2WJPA 3FTPA 2V65A 2I9PA 1E7YA 5FEUA 4LSMA 2FWMX 1I3MA 2D5CA 1KY5A 4E33A 1QYCA 3ZHYA 1I01A 5ILOA 1Y7TA 4GSLA 4XB2A 3DONA 4NBTA 2WM3A 1ZKMA 4R1UA 2OOSA 1LLDA 1WAMA 1C14A 2BGKA 2Y0EA 4L4RA 4TRNA 1DIAA 1U3VA 3OFSA 4YBZA 4ID9A 1TB4A 5AOVA 2HMSA 2P9EA 4PGFA 1PQPA 4NR0A 4MJLA 3TZCA 3E9QA 5F1KA 2CNBA 1SBYA 4A27A 5CEEA 2W2LA 1DSSG 4ONEA 4IJWA 3TPCA 4AJIA 2DU8A 2EKLA 1BXKA 3MZ0A 1RPNA 3TRIA 1ADFA 1U3WA 4Z3KA 5JBIA 2X9GA 2DC1A 4YQZA 2WWRA 1R4NA 4D43A 1PTJA 2G76A 1KIFA 1O5IA 1O94A 3KOUA 3GAZA 3H5RA 1Q7BA 1P0FA 3DBLB 3VH1A 2C7VA 4R9SA 4BKRA 3WLEA 2DM6A 2DPHA 3UCEA 4M1QA 4CMHA 3GEDA 4JROA 4IQGA 1DLJA 4H7PA 4J4BA 1HKUA 1W8DA 3S8MA 4KQWA 2EW8A 4RORA 4DUPA 4XA8A 1R4MA 1BXGA 1KVTA 3JD1A 4MP8A 1P77A 4U7WA 3NRCA 1ZK3A 3JQ7A 4M87A 1PQUA 4LN1A 1E6UA 3A14A 3EDMA 4CR7A 4DREA 5A4DA 3SVTA 5KKAA 5TS3A 1K89A 4R68A 1QSGA 1PS0A 1PR3A 3TOXA 1V3VA 1XYGA 3DBLA 5BT9A 4B79A 4N18A 3VZQA 4CM4A 4J9VA 4Q3BA 4TKLA 4OSPA 1F17A 1QV6A 3V8BA 3NJ4A 1DRVA 4JIGA 5HWSA 1A72A 4QUKA 3F46A 1QLHA 2GZ1A 4R01A 2VWQA 3H65A 5IDXA 1CETA 4RV9A 3UGKA 1YS4A 3SLGA 2JHFA 3PYXA 3DR3A 4HBGA 2FPGA 4EUFA 3AW9A 3K9QO 1M75A 1GQYA 2Q99A 3KYCA 3BXXA 4B7XA 4YAGA 1T4BA 3KSZO 5KWEA 3TFOA 1WDKA 2Y05A 3OSUA 4BKPA 3H3FA 2Q1WA 4XGKA 5FI3A 3F4BA 1JTVA 3D64A 2PH5A 1EQUA 1RJWA 1U2DA 4E2YA 1SB9A 3MCVA 1MLDA 4UAGA 1N92A 3CTMA 1MC4A 1LXCA 1D4FA 4FFRA 3ENKA 3Q9UA 1HLDA 3KLPX 3F1LA 3VPHA 3I23A 3GZ4A 4DC0A 3HFSA 4RGBA 3F5QA 1PWZA 1E3EA 4D79A 1ZNQO 3D3EA 5T57A 2I76A 2V6MA 4FC7A 1QYWA 2JD1A 1UAGA 4G81A 3GGPA 4N54A 1B8UA 4M86A 5HS4A 4INAA 4NBUA 3GVXA 1BWSA 1H0KA 1L7EA 2X86A 1R0LA 4CMCA 2W4QA 1T4DA 5A02A 1ENZA 4BGIA 2VWPA 3UXYA 5G2OA 4FN4A 5L95A 1YBVA 4FD3A 2CVOA 5DN9A 3DAFA 1DPGA 1WWKA 1X14A 1ZK0A 4H16A 2FR0A 5T5QA 4DA9A 2PK3A 4U8GA 3GEGA 3GHYA 5A9SB 3CINA 1ADGA 1HDXA 1LUAA 4IINA 2YQ4A 4PLCA 2JCVA 4BNTA 5ER6A 2P4QA 5L53A 1M2WA 1LDYA 1CDOA 4HUJA 3ZV3A 4CUKA 2D2IA 3GGOA 3OJ0A 1SEVA 5DBGA 4PIVA 2NU8A 1Y8QA 1BHSA 5U4QA 1KERA 3RQSA 3NT5A 4U0KA 1UDBA 2PY6A 3W8DA 2WDZA 5IJZA 3O38A 1EVZA 3OM9A 3FI9A 3T4XA 5LDHA 5ILGA 1HT0A 4YB8A 3VH3A 2OUIA 3GDOA 4IQ0A 4W4TA 5LCXA 3ZNPA 5C7LO 2Y1CA 4CMBA 2GUGA 3AFMA 4EUHA 3KETA 3PPIA 1NFQA 3SXPA 4WLFA 4Z0TA 4MO2A 2EIHA 2D1YA 2HCTA 5KKCA 1CIVA 3A28A 4P8RA 5TT1A 2F1KA 2J5QA 2P9CA 3M6IA 3GUCA 2GSDA 5FYDA 3VVCA 3DHNA 1NPYA 2GYYA 3OETA 4EJMA 4N5MA 2B35A 1KVRA 3ONEA 3ZV4A 4D42A 2ZIZA 1NVMB 4II2A 3QY9A 3WDSA 1GDHA 1P1IA 3IJRA 1V35A 1DC6A 4YRAA 1ZK2A 3PZBA 2O23A 3HHPA 4Z9FA 3JQAA 3FPLA 3LT0A 2AE1A 4MVJE 4DRYA 3ZW9A 5DBFA 1I30A 2Z95A 1Y8QB 3MJVA 4ZGWA 3WTCA 5ITWA 1UXJA 4KWHA 1TXGA 1K6JA 4RVFA 4XQEA 2GR9A 3KXDA 4BGUA 4CLXA 4CM9D 4W7IA 1SCUA 3UN1A 2E37A 1I36A 4FJ0A 2C07A 5L7TA 1CEQA 2AEFA 1T25A 3NDRA 3F3SA 1IY8A 3KHUA 4J1NA 4PCVA 1HZJA 2EGHA 2UYYA 1HWYA 1WZIA 2YYYA 2B4RO 4W82A 4NDNE 3C7CB 4WEQA 3ZHBA 1UP6A 4IY1A 4XGIA 5CEFA 1NAHA 1IHYA 3AOGA 1Y8RA 5KJFA 3U3XA 3PZRA 3ASVA 4KUEA 3TZKA 4CM8A 1PS8A 4J1QA 4XD2A 4IDBA 3IAHA 4BO1A 2GRAA 2VWHA 1E3SA 4YQYA 4BVAA 5BSEA 1TT7A 3V5NA 1XQ1A 4GI2A 5A04A 1QXSA 4JP3A 4KZPA 3M2TA 1NVTA 1JKJA 1ZSNA 3CSDA 4IMPA 3FD8A 2NU7A 2PH3A 5JCXA 3FNEA 2EXXA 4XCVA 3PWSA 1XSEA 5L4NA 4DQXA 5TIIA 4WASA 5EERA 2O3UA 4KDEA 3DAGA 1C1DA 3WG9A 3L4BC 4UEKA 2X8LA 2GNAA 2YQ5A 1XKQA 3WGIA 3V2GA 1Y1PA 1U3TA 3EK2A 3C7DB 2EKQA 3NAQA 4E31A 4PG7A 1QR6A 3AWDA 1WLYA 3GDFA 3PWZA 3RWBA 3H7AA 3FNHA 3BMOB 3RD5A 3RFTA 4Y6PA 3X2FA 5T64A 1P1RA 2H5LA 2O7SA 2TMDA 1N2SA 1GFSA 3S1LA 3ZWMA 5KJCA 4CM8B 3KBOA 5TJ9A 1LC0A 4X54A 1ML3A 3ON5A 2OP0A 1F12A 2SCUA 1JWBB 3TL2A 1E0DA 1MFPA 4L0QA 3ROKA 3DHEA 3ZN2A 1RM0A 2P5YA 3F9IA 4WKGA 4CMEA 4ZRNA 1BMDA 1NM5A 4PFJA 2Q46A 3PEFA 1ZVMA 1P45A 4GX0A 3SX2A 3PHHA 3FNFA 4BO6A 1LRKA 2AQKA 2X4GA 4PG8A 2O48X 4YT5A 2PR2A 3EUWA 3COSA 3GRKA 1HL3A 3ZNQA 4CLRB 1AXGA 2VT2A 3UKOA 4CM7A 4J7XA 5FI5A 3JQGB 1MC5A 2POQX 3WGOA 4CPDA 1P1JA 1YL7A 2R00A 3PQDA 2E82A 1T2EA 2YFQA 3NDJA 2I99A 1U4OA 2BMAA 5IFLA 4Z9XA 1O8CA 2PD4A 2Y1GA 4HXYA 3R3SA 1FDVA 1R16A 4HP8A 4YCAA 4ND3A 4PLFA 1T1RA 1YOVA 2C5AA 5AQ1A 1DJNA 2PV7A 5DP2A 1Y8RB 1OC4A 4IJKA 3NYWA 4YRBA 4JJIA 4FFMA 2BD0A 1ISFA 1FK8A 4BKOA 1VKOA 3RUIA 1JA9A 3ZI0A 1YJ8A 3QWFA 3QVWA 4D41A 4N5NA 4DLAA 4ND5A 3JQBC 3VVBA 2HDHA 4IDGA 2I66A 2VHXA 1LDNA 2X5KO 3WJ7A 1DXYA 4FFNA 1B16A 3L77A 3NT2A 1Z73A 1LU9A 2J3JA 4UULA 5K6AC 2YV2A 4WLVA 3L4SO 4ITUA 5GZ6A 1DHRA 4GLLA 5THKA 1B15A 4P38A 1BW9B 1HYHA 2AMFA 4B3HA 4EEZA 3RC7A 3ROPA 1SPXA 3K2BA 3GVCA 3LT4A 1AE1A 5L7YA 3MJCA 4MVJP 5L7WA 4JJGA 5JAMA 5ICSA 4J3FA 1O89A 3ZWNA 4AJLA 3ANNA 4JN6B 3ICPA 5MGBA 4TVOA 2IYPA 3GN2A 4XDYA 1D3AA 1EMDA 2NNLD 3HSKA 1OI7A 2HQ1A 3PVZA 3WICA 1Z7BA 3ICCA 2WEKA 1NPTO 2Z1MA 3PHLA 4NK4A 4Y67A 5I8WA 3U49A 1I10A 1KC3A 4D3DA 4I9UA 1DAOA 3CMCO 3M2PA 4J49A 1B3BA 1VL6A 4JP2A 3FR7A 2QG4A 4ND4A 1ZCJA 1IYZA 1H9BA 1NAIA 5BQFA 3BMNA 3KYBA 4FJ2A 2D3TA 4G2NA 2RHRA 3JQAD 2G1UA 5L9AA 2NQTA 1LLUA 4WE3A 3T7EA 4GX1A 2DBVO 4F45A 1UUFA 3NT4A 1P3DA 3LU1A 2NVUA 4KMSA 3U4HA 1NFRA 3QVSA 2QX7A 2PLAA 2OORA 1Q0QA 3K96A 1YL5A 3W4IA 4BO7A 1HYEA 1LQUA 2WE8A 3I9LA 1AXEA 4E5KA 1NPDA 1KEPA 4II3A 5DCYA 4QFDA 2B37A 3R6DA 3DHYA 2OFPA 2X22A 1NQAO 1U8XX 3STHA 5L40A 2GLXA 2VHZA 3LVFO 5THQA 4IGEA 2X0NA 3T4EA 3JQFA 5JAIA 1S7CA 4TMFA 5AXCA 3EHEA 4N7RA 1X7GA 5EINA 4YWJA 4PG4A 3H5NA 4B3IA 1LSJA 4XR4A 3QSGA 3NGLA 2HAEA 3AOEC 1LSOA 3ZZNA 1GQ2A 1Q0LA 3RKUA 1CQIA 4MVJA 3WIDA 1NR7A 1KC1A 1TLTA 3KTDA 5JDIC 2GPTA 2WD8A 1VE9A 2EF1A 3A9WA 1WMBA 4RCVA 5COQA 3JQ6A 5T8KC 1HDRA 3PIIA 4DBZA 3GVIA 1U1IA 4BNHA 1YB1A 2ZB4A 1KEUA 3OMLA 1XELA 3N74A 4GWKA 3JYNA 3O8QA 2BI7A 4GMGA 4PLWA 1F14A 4L4XA 3AOEA 4PZCA 4UVEA 1O6ZA 3U4CA 4ZQEA 5I7EA 5JE8A 1K3TA 1R0KA 2WD7A 4ZQHA 1WMAA 4RVHA 1ZK1A 3WNQA 3D4PA 3DMTC 2A94A 1LC3A 3ZW8A 1XG5A 4CMGA 1KEWA 4PLYA 1KETA 5L4SA 3O26A 3PDJA 4Y8VA 1E7SA 3ETEA 5IZCC 2HK8A 4CV2A 2IRWA 3WGQA 1EZ4A 1ULUA 1YQGA 3OH8A 1HDCA 2VRBA 3P19A 4R5HA 3JSAA 2JHGA 2VHWA 3EYWA 4A73A 3A4VA 1H6AA 3AI2A 3GG9A 1R15A 5KNLA 3RUEA 2YUTA 2NM0A 4BO5A 1AUPA 2HMTA 3I9JA 3VOSA 2C54A 1VLLA 5BSHA 4XJTA 4YJGB 4CLOB 1WXDA 3CH6A 1N1EA 4LSWA 5CDUA 1UAYA 3BTOA 2EV9A 1HEUA 3WIEA 3ETDA 5KVVA 2C0CA 4HADA 3D1LA 1ZIDA 1LBEA 3BHJA 4RVUA 3VHRA 1H93A 4BKQA 4Z0HO 5U1PA 1R6DA 1YQDA 5G0TA 2X7HA 1NQTA 1DDOA 1HDYA 2VTDA 4NH4A 1F06A 1UXIA 4ALLA 4NNJA 4ZA2A 5JC1A 4NHEA 3D7LA 4IMRA 1J4AA 1F8FA 3RU7A 4D44A 1M66A 4RZIA 2VOJA 4IPTA 3GF4A 4L73A 5DP1A 3ETGA 1PSDA 3GVHA 5DCUA 3TZQA 2E48A 3BZUA 4J9UE 3C1AA 2OO5A 9LDBA 4KTVE 2DPGA 1N7HA 2ZTVA 4J2HA 2Y1OA 4RPLA 2BRUA 5A5FA 4ALIA 4GMFA 1HXHA 1FJHA 4IJUA 1K0UA 1V0JA 4ESOA 4CQLA 3V1TC 3IUSA 1GPJA 3A06A 4P4LA 4BNNA 3PFFA 1PU2A 1NHWA 3JCZA 1A5ZA 3MWDB 1JWAB 3RROA 3M1LA 1B8PA 3QW2A 3WSVA 3GA0A 2NTNA 2NU6A 3PJGA 3IUPA 3DO5A 3HDHA 4EITA 1GUFA 1VC2A 1UJMA 4OM8A 4MVJG 2P5UA 4HX5A 2ZK7A 2B5WA 2IZ0A 1MA0A 4I5FA 1XIVA 3L9WA 1S6YA 3BHIA 1PGNA 1XU7A 1EEHA 1I2CA 1V3TA 2ZYDA 4MIOA 1LRJA 4CR8A 3JQ9A 2CDCA 1KVSA 4CMAA 3FHLA 3LF2A 3P7MA 3PFWO 2HK9A 2DUUA 1HE5A 3ZU2A 4F3YA 4DMLA 3KZVA 3QVTA 2J5KA 1Z7EA 4Y6RA 4XX0A 1KVUA 1YVEI 1L1FA 4CMEC 4EBFA 4MP3A 3VTZA 3FTNA 1AHHA 2F00A 1E5LA 4RL6A 1NQOA 3I9KA 3CEAA 4WLUA 1GCOA 2J8ZA 1YBMA 3OP4A 1YL6A 3OA2A 3G0OA 4BNFA 4E12A 1H6CA 4OL9A 2B4QA 2RHCA 1EK5A 1ZUD1 3DBHA 1LLCA 3FPCA 1YJQA 5H81A 4OAQA 3H9EO 2BI8A 5A9RA 2AHRA 2H6EA 4JX8A 4NFHA 5DBIA 4BMVA 3RUDA 2X1HA 3KVOA 4K6CA 3OICA 4DPMA 4YJDA 1AN9A 1YQXA 1YWGO 4BB5A 4A7PA 2W90A 2ZCVA 3DMTA 3DMYA 1E7QA 4PLZA 4Y6SA 5KVSA 4JBIA 4UEOA 4CUZA 3BMQA 3C1TA 3PDUA 4IXWA 1F0YA 4WNCA 6ADHA 3RI3A 2ZB3A 2W2KA 2VZ0A 4HY3A 4DIBA 3E03A 1EUCA 3C1OA 1K6IA 4AJ2A 4R3NA 2VZ9A 5F21A 1C1XB 1ZJYA 3WLFA 2O4CA 2WE7A 2FMUA 4YTEA 5G0VA 1BTOA 3DXFA 4PLVA 4DQVA 2YW9A 3ABIA 3I4CA 3ZH2A 4Q3DA 4GGOA 1C0LA 4LISA 4IBOA 4RF2A 4BNMA 3W4KA 5JY6A 4OXKA 4FQ8A 4I08A 4NZ9A 3GRPA 4NPCA 1DBVO 4GH5A 2I6TA 4WCDA 3RKRA 4A10A 5KJ1A 1CRWG 4CMJA 4AJPA 3ASUA 3TJRA 1ZEMA 1XLTA 4IM7A 5COAA 1NFFA 3PTZA 4XDZA 3IIEA 4RDIA 4EGFA 9LDTA 4PZEA 1LX6A 3PLRA 3WQQA 5IF3A 5B4VA 5EESA 1IUKA 1U5AA 5DF1A 2IYOA 4O6VA 1E3JA 4IIUA 3NTOA 4JCOA 4XQCA 5G0WA 4CM5A 2ZB8A 4O1MA 4E32A 4GPD1 5J23A 1QLJA 4NFYA 2VRCD 3GT0A 3PP8A 3BIOA 4YEDA 1H6BA 4AJNA 4EJ0A 1E7MA 1C1XA 3GPDG 5JC8A 1ISGA 3GOHA 5H82A 3LDHA 3PQFA 4MKZA 2GN8A 1QYVA 4OXNA 2A92A 1DLIA 1W6UA 2BGLA 4XYLA 1MB4A 2QZ9A 4GX5A 4S1VA 2VZ8A 3WYBA 4DTIA 4ZN6A 2PZKA 1WDMA 4AICA 1HDOA 2E6UX 2YJZA 5T67A 4QQRA 3HUDA 3KRTA 2PGDA 2D5AA 1HE3A 2O50A 3QRWA 1QKIA 2O4UX 3F5SA 1P44A 4UVIA 1E3LA 3E6AA 4TZTA 1ARZA 4YJFB 3U4IA 2H63A 2ZTUA 3C3XA 1E5QA 2CVZA 4UUPA 3JQAB 1NHGA 3C24A 3I9OA 2YHIB 1U9JA 3INTA 4K6FA 4U5QA 3Q2KA 2P4HX 4M49A 1C0KA 4ALJA 3QA9A 4IDEA 4C7JA 5I8ZA 2DFDA 2P68A 4BO9A 2Y0DA 3D3WA 3TSCA 3VKUA 4TKMA 3RC1A 3I83A 2IXBA 2Y68A 2RBEA 1DC4A 1PGJA 2GO1A 5K0ZA 3EC7A 4CM3A 3AUTA 5CHEA 1ZMTA 1QYDA 4OXYA 2HSDA 1HTBA 1GZ6A 1V6AA 2PGLA 1GTMA 5ES3A 1A7AA 2J3IA 2I5PO 3JQ9C 3RFXA 3JQDA 5A1TA 4YXFA 4E21A 1LTHR 3HDQA 1KS9A 2XAAA 1DEHA 3IJPA 3K73O 3VPSA 1GZ3A 3QQPA 2X23A 1QP8A 3V1UA 3ZHXA 5HM8A 2D0IA 2Q2WA 2NLOA 3JQ7B 2Y66A 2H1SA 2W2LD 4EEXA 5H83A 3GN1A 4JLWA 4LRSB 5L51A 4BNWA 1YE3A 4QO8A 4A03A 1GZ4A 3RUCA 2VYNA 1CQJA 4XGNA 3FN4A 3TZ6A 1Z74A 1PJ3A 4R54A 1DIBA 3GEMA 4LGVA 5DCWA 1X13A 1B7GO 2G0TA 2VNSA 3DZFA 3O4RA 3UH1A 4WLNA 1E3IA 1A9ZA 4XYGA 4R1NA 5U9CA 5ER9A 2ZB7A 1DIGA 4RLSA 5G4KB 3QVOA 1R66A 1GYRA 7MDHA 2O3TA 1UP7A 4R9RA 2JAPA 4Y9DA 3IL2A 5IDQA 1GL3A 2V7PA 1BDBA 4NBWA 5HTOA 1MXHA 4J43A 3FCOA 2YV1A 5TQVA 3K30A 1IE3A 5CG2A 3QJ5A 5HS6A 4CQMA 4FGWA 2O7QA 1VSVA 4EUEA 3ZWXA 4YPOA 4LK3A 3PYLA 2P9GA 4WECA 5ITVA 2Y1EA 2ET6A 1HYGA 1PGPA 5BNTA 1Q0HA 5C37A 1M67A 2RAFA 2PNFA 2PZMA 4Q39A 2EGGA 2ZCUA 3RIHA 1ZZEA 3VAZA 3AY7A 4F6CA 1T24A 4MINA 1PJSA 4JQCA 1Y6JA 1ULSA 3JQGA 2NU9A 4JNKA 4GGPA 3JQFC 5L3ZA 3LT1A 4JK3A 2DFVA 4RO0A 3ZNOA 2YZ7A 2GCGA 2JD0A 2AXQA 3KB6A 3ANLA 1V9LA 2R2GA 4JBGA 4OYRA 1ENPA 2J5RA 4KTTE 3JV7A 4ROSA 5B1YA 8LDHA 4D3FA 1PZEA 1MUUA 3LLSA 1BXGB 3R3JA 1ZW1A 3JYQA 2EERA 4O0LA 2NACA 3QIVA 2Z5LA 2FR1A 4MVJF 3LC7O 1PL7A 3EAGA 1IPEA 1KY4A 3HG7A 1ONNA 4PG5A 4YJHA 4BO4A 4RPJA 5BSGA 1TT5B 2NVWA 2IXAA 1EBUA 4XIYA 1I3KA 3ZCXA 3GFBA 1I8TA 4DXHA 4I8XA 1HETA 3HE3A 1DFIA 1NNUA 3PJDA 4YRDA 1GR0A 5HA5A 4NU6A 1E6EA 4K28A 4URFA 3QLJA 2C5EA 3QWBA 3TN7A 4RZHA 2Q1TA 4I1IA 1E1NA 2BFAA 4MP6A 3HB4X 1OOEA 1BDMA 1X7HA 3EW7A 3WGYA 4BMSA 2AEJA 4J4HA 3B20A 3CUKA 3INGA 4YJGA 1DJQA 4DWVA 1V3UA 3OECA 3OJFA 1LDGA 5A9TA 1K2WA 4P4GA 5EPOA 5TNXA 2LDBA 4IQ8A 2P91A 1ZSVA 1XU9A 3K92A 4YVFA 1BW9A 3DZIA 4YT8A 1LNQA 1YKFA 2XXBA 2DBQA 2ZJ0A 2AW5A 4WEOA 3I3OA 3S55A 3NGXA 3RC2A 3WYCA 5CG1A 3V2HA 4D0RA 3AJRA 3G17A 1DFHA 4DIFA 4G5HA 4YAEA 5C3MA 4OH1A 2OHXA 2QRLA 3VH2A 1VI2A 3TFQA 4WK6A 2GN9A 4BNGA 4BV9A 4WCFA 3B1FA 4QEDA 4QT0A 3IKTA 2P2SA 4Z9YA 3UICA 3VC7A 4RVSA 4CMIA 4BO2A 1ZXBA 1EQ2A 3DTYA 3C85A 3AM4A 2NTJA 1ZK4A 3G1TA 1I33A 2O3RA 5I9LA 4LW8A 3IC5A 1PZFA 2B69A 2VQ3A 2Y1FA 3JYLA 2OGUA 4I9HA 3WFIA 3Q11A 2VHYA 3KUXA 4U0JA 3LZ6A 3GH3A 4R1TA 3ZU5A 1MV8A 3PIDA 3O03A 1UP4A 4K9DA 3H2ZA 1E7WA 1I5RA 1ISIA 1N1GA 4BO0A 4WNIA 3QWIA 5AYVA 2B4TO 2G5CA 2ILTA 5AVOA 5I7VA 4RVDA 5A9SA 2HJSA 4TZKA 3PWKA
chains in the Genus database with same CATH superfamily
3AJ9A 3W8EA 4CIDA 3WAGA 1WJGA 2VYFA 5IXSA 3U26A 4UUAA 1BS2A 1H2BA 3M3DA 3ZDRA 5DDIP 2C20A 3HVIA 1D6SA 1B2LA 1DC3A 3C15C 4RPKA 3OMXA 1BAPA 3SOPA 5BSKA 3IEMA 3VI4B 3H2KA 2OBLA 2XBLA 5AKJA 4HDQB 5CA1B 3TD6A 3E9NA 4PPQA 1RYEA 5DXFA 2FWRA 1TGYA 2WU4A 2OBYA 4Q48A 3ZJYA 3BK7A 4RL4A 3HH8A 4JLNA 4WFKA 5GONA 2CEAA 5K6TA 2VYQA 4G8JA 4LF9B 3ORRA 4XJXA 1PJ8A 2OLJA 3M4NA 4HXGA 3EZXA 3VH4A 3FVVA 5EZ5A 4EYGA 4YAKA 3IEXA 3T9BA 4Z4QA 3SNKA 2E5WA 3FBGA 1WMDA 2V6GA 1HRDA 5TVGA 1WCV1 4KXYA 4A2QA 1Y33E 5MN5A 3FE2A 2JLSA 4DJJA 5MN6A 2PIDA 1B76A 2H9IA 2ZYWX 3LO5A 1M6EX 1GZSA 4ASUD 5FA5A 1UMBB 5KTTA 3EIHA 1KGSA 2PKQP 4L50A 1XCGB 1OBVA 4N3CA 1PJLA 2VHVA 3IP8A 3OWXA 4M53A 2QTFA 4LYFA 2ZWOA 1RAGA 2VPWA 3WYDA 4COOA 4IG4A 1VYVA 2OT3B 2HYIC 3HZZA 4KE6A 2OHIA 5K01A 1E9SA 2VQ6A 1HT2E 1RCTE 3QITA 1W30A 4QDJA 1S4MA 1PEDA 4GI7A 1TZ2A 3DYVA 5KTSA 1V7PC 1ZVVA 4X60A 3OT1B 1KH2A 3HSSA 3O2SB 4RPHA 5JXHA 5LBIA 1SU6A 1DKPA 5CPBA 3N7UA 3LCVB 3DO6A 4L9RA 1XD2A 2FR8A 4QQFA 2ODNA 5J2UA 4YRFA 1BDJA 1FU7A 3GFSA 3CNQS 2X0FA 1F1BA 1BCRB 2FN4A 3KOWA 3N8GA 3S1AA 3STUA 4NCKA 5A2QA 1WKVA 2D1TA 5J5AA 1H4QA 3OPXA 1A9PA 2NVOA 3WZMA 3S0JA 1I6KA 3HYRA 3Q7SA 1RXVA 4CMIB 4IHAA 4X3PA 3HEAA 5BYBA 3DT6A 1AZSC 2WYIA 2G72A 3N6RA 5FXMA 3TTWA 2ZRJA 3JZDA 4D3XA 5B6IA 3JZFA 5AOBA 3SDBA 1U28A 2LGJA 1CF4A 2X40A 1KMQA 2R66A 5ETJA 3SYTA 1VPWA 1PNTA 2VPIA 1YBFA 1U2GA 4RIEA 4WXRA 2WWIA 2VJQA 3CF4G 3NDIA 4FR5A 4OHWA 1W59A 4QOEA 2ZDQA 4JY7A 2QI9F 4LI3X 4U2KA 3DNFA 4Q9KA 4PRLA 4DCSA 2QM7A 2V7VA 3N8IA 5JANA 2PUCA 4PFKA 4MB0A 4YJHB 4CV1A 1MJHA 2VAXA 3MGCA 1SIWA 2YWEA 3L6DA 4B75A 4ALNA 2PKCA 2VYVD 5HIMA 4A0SA 1K97A 3B8EA 5IJWA 2J45A 3T6KA 4UTPA 2BPOA 6CHYA 3GLQA 4KG7A 5EUQB 5JAPA 1FYDA 1A8QA 1I2ZA 4HKTA 4PAWA 2NADA 4FMBB 1UPCA 3UJPA 3WGTA 1TKAA 5I7FA 3EGOA 2VJMA 1CPYA 1V5GA 1WE2A 3JXEA 2CT8A 2H1CA 1EPUA 2IUFA 1PV1A 1FB5A 1YB7A 2XPCA 3CCFA 2I2WA 9MHTA 1C8VB 5D7BA 2NO7A 4A0GA 4MKHA 4YRGA 3N6XA 2YKGA 2OE2A 5D5PA 1JB1A 4G3XA 4OYLA 4CQLB 1OXBB 1W5FA 1Y1LA 4Z7NB 1AVTA 2CMHA 3HBMA 5JNLA 1B73A 2I6SA 4C7KA 2WB4A 1Z2CA 3ZV7A 1XKXA 3L7AA 5J4YA 1T0JB 1PZMA 3OCWA 3E8MA 2XOXA 1ESEA 2R8PA 3IEPA 4WERA 5IVDA 3RRYA 3WV5A 4FFVA 1B23P 1KJWA 4GLOA 1XP8A 4JJFA 4XUDA 3WMXA 1N6LA 1GTG1 5BNIA 2JD2A 3FZQA 4URZR 3NRJA 2DTDA 4EZIA 2PD3A 3IMEA 2HC9A 3ANMA 3CTPA 2RAVA 4C22A 1AZLA 1HO3A 2FDCA 4N76A 3QVLA 4GBMA 4JDUA 4QGAA 5L3QB 1EGQA 3UPUA 3OLVA 2P6NA 2R6AA 3LDUA 2YHIA 3ODGA 3BD7A 1QE0A 4DV6B 1PVVA 1EVKA 1RXYA 5TJHA 1OWOA 2IJGX 2AH5A 3DCYA 2JA1A 2FZVA 3K9CA 4FEAA 2CJYA 2ZJ2A 4KYVA 4ID3A 2YWGA 4PTZA 3F74A 5CNKA 5ALIA 3VDNB 4WGGA 2R00C 3D3WB 3DO8A 4CLRA 4EKDA 4UM5A 2EFYA 2ZE8A 3SQWA 1P2DA 3KALA 1WP4A 2BGUA 3PD1A 2FQQA 3KUUA 1EVIA 3LCJA 1UXGA 2DHQA 2DT5A 4P54A 5ALTA 2YYSA 3DLHA 2Q1UA 4UTRA 1Z2OX 1AB6A 1JHZA 4UVHA 2Q9UA 5C31A 1RHMA 4UZFA 1INLA 1T2VA 1E1RA 3HB1A 1HOTA 2X8JA 4XGQA 1Q7GA 3KAKA 3MBKA 4DQ0A 2AE2A 3FBTA 2HKIA 3K32A 3A2MA 1UT6A 4BHTA 3TECE 5CFPA 3GNLA 1RYDA 2BFMA 3OZUA 3NMUF 2YY6A 1NW6A 5BSWA 2DRIA 5IPFA 1T2AA 3D3NA 1RYHA 3GMSA 4BQRA 1K5HA 4D9CA 4MGKR 1T5BA 2RIRA 2ZUSA 2G83A 3LUBA 2WOOA 1F0PA 2BFWA 3LUJA 4PLPA 1PIWA 1NRXA 3C6ZA 3CNEA 3LO8A 1RMQA 2IHVA 5LQAA 5M29A 1OLSB 4JC4A 3UMBA 1Q0ZA 2R5WA 1JA1A 3KSDO 4GM0A 1GPNA 2ZYAA 1P0MA 3BA1A 5ICFA 4MPRA 4EG3A 2W9XA 1U0LA 2HFJA 2BF4A 2DQKA 4M21A 5IVKA 4TS9A 2WUFA 3M4ZA 3NOXA 4XTRA 3H11A 3Q0EA 4UEJA 4PZLA 3EF0A 1Y6QA 4YCDA 1BN6A 3FVQA 1EUDA 4OX9Y 3ANSA 1JI0A 3D6NB 3D6VA 1QMGA 1R8QA 3P9NA 1ZRMA 2IWHA 1U7UA 4MUXA 4ZVSA 4D92A 1REQB 2HA4A 3JQCA 3ZE7A 5KHOC 3D7RA 4WBNA 2C9CA 4UAUA 4E2XA 1ZZGA 4GECA 4Q4HA 3ES9A 1R8JA 4FN5A 4XKJA 5IBCA 1BJRE 2IEIA 2WJWA 4AO7A 1UIMA 3BAZA 3LK7A 1VFNA 1GNSA 1W73A 1EQAA 2G17A 2NZJA 1G20B 2RK3A 2HNBA 1FZQA 1UC8A 3QFSA 4Q1VA 4Y9RA 1FS5A 4ZI2A 1EFAA 1J20A 4N0QA 3SJZA 5AOAA 2GHTA 4J0IA 2IHNA 1GXSB 3P9SA 3CUUA 2IOFK 2WMDA 3L7YA 2ZIAA 4C3UA 2BHSA 5KYGA 3VV2A 2ZJ3A 2G1AA 2C42A 3LPMA 4QQ8A 4IGFA 1R27A 1U9ZA 3EVTA 3EZNA 2HO5A 4LECA 4PX5A 2X5JO 5EN4A 2NU7B 4QYXA 3JD3A 3VR3D 2FHPA 2F59A 3MIIA 3PUWA 5CVUA 3WGHA 4KO1S 1B14A 2DH6A 4JGIA 1MW8X 2IXDA 4UBOA 2JBHA 3RF6A 3NBZC 1U90A 3L4KA 2ZULA 4WUVA 5DNYB 1EK6A 1XVTA 2FVXA 5FPHA 3GLFE 5G1NA 3T35A 2JEOA 3AI3A 4IVNA 3I1JA 1WSAA 5GGXA 3I6IA 3RVSA 3WWZA 4JXJA 1Q7CA 2KBEA 3OZ7A 1WY5A 3N28A 3B9RA 1H6DA 1LJLA 3BD9A 3NIGB 1Q7RA 3FHOA 4EVQA 4KW7A 4EZBA 3TEJA 4JB8A 4MKIA 5JSYA 1JQDA 1D2CA 1Q19A 4GZ3A 4MJ3A 2PX0A 4ZHQA 5FADA 2BEUB 4R2HA 1N0HA 1DAFA 2AUNA 2ZETA 4R1QA 3CNBA 1NTRA 4QBFA 2WFLA 2OLEA 1F8GA 5CYPA 1G3QA 1XFAA 4WBSA 4EPRA 5GZ3A 3FTCA 1QDLB 2JBWA 1E1MA 3JVUA 2OBBA 3HJAA 2F8MA 2IHUA 1U3DA 2PFKA 3B1ZA 2LW7A 4XIJA 3KEQA 3RHZA 4G5GA 4WX2B 2HJRA 4OQPA 2HHAA 1P62B 3G68A 3H8VA 1EXNA 2BTQB 3EVCA 4CCSA 2H57A 3ENVA 4G4GA 2LR0A 4L74A 3HKCB 3UNXA 5A03A 4ASUA 3W5CA 3ZNNA 8AT1A 1EU1A 1NW8A 1U80A 3R2JA 1ZJWA 1IB6A 5JNVA 1USGA 1YDGA 1UWCA 2IYRA 3B70A 2F3PA 4L6AA 3BKWA 4XH9B 3QBJA 2DY0A 3WGJA 5KOYA 2VZEA 1JHVA 2EBUA 3OHSX 2BKEA 1WLSA 1E64A 4FPXA 1GNQA 3CT6A 1W88A 1IONA 3Q3GE 5JCOA 1W0CA 4GZLA 3NUQA 3QI2A 5BWLA 4WZAE 4AQYB 1Q2UA 1G7TA 5LC1A 1GLGA 1KAOA 3UB3A 3HQ4O 3HJFA 1BCSB 1OVGA 1TUGA 3R74A 4EI2A 1GTL1 3H2IA 1SB8A 3H6KA 1GRRA 1D2EA 4JQZA 3TR0A 3M1YA 4IWNA 3PEWA 4AB1A 1MO3A 4G97A 1FS6A 1QHEA 4OP3A 5G1PA 3D5QA 3K3PA 3UY4A 1KYXA 1I51A 4IS3A 5D5HA 2WHPB 4XZ3A 1WXHA 1KL7A 3CRW1 2NZ2A 5JD6A 1QLWA 1G16A 2JAQA 2WYVA 1AM4D 4K3VA 4QYWA 4URVR 2BEJA 1IAQA 3DLCA 3IEIA 3FDZB 5FB3A 3I3SR 3TLBA 1M2NA 4B74A 3S2IA 4ND2A 1L7DA 3F47A 2RBKA 2PZAA 3CPSA 3F6RA 1E2HA 1OHHD 2FJPA 1ACLA 1X3SA 5F12A 5IT5A 4LWQA 5HBRA 2H59A 2JFHA 1ECPA 3W05A 3WYAA 4S05A 3K6RA 4YREA 1XZIA 1LPNA 1M76A 2P0EA 3PYMA 5I45A 4RULA 1BG6A 3B52X 4FW8A 5B1IA 4CDGA 4YT4A 1DC7A 3D4LA 4MR8B 5F78A 5JATA 1FRZA 3GJ3A 2PTGA 1YDEA 5C5IA 2C84A 2D1RA 2PYDA 3ITDA 2WPNA 2J7PD 1P75A 3E1GA 4OL0A 4BLUA 4MIKA 3LIIA 1AUVA 4IOJA 5ITSA 4MPTA 4O4JF 2QD1A 3T7DA 3FDIA 3H1GA 3N2LA 3P2OA 5C7IO 2DWUA 2H9AA 2OV4A 5JNTA 1AHPA 4FFLA 1LF5A 1R6TA 1R6UA 4FIZA 4F8YA 1QGUB 2C4KA 3NANA 3RFFA 4DNFA 4L8YA 3U19A 4YP7A 3HBAA 4H1HA 4NMWA 3WISA 1DAMA 3SDZA 2BGTA 1Y5LA 4H7KA 4Y6LA 3LY8A 4JFAA 6GPBA 3TNFA 1FNDA 4ICIA 3KKLA 1GPUA 3A1NA 1Q20A 4MW0A 2AI2A 4Q4JB 3WDLA 1TJ5A 3B1KA 3OO0A 4PN3A 1P1KA 2GPYA 1XTJA 2CNWD 3BM5A 1PHPA 3II6X 4LPKA 4LZJA 2FHSA 2R7LA 2PMEA 3H9UA 3RASA 1QO0D 2UUAB 5T8KA 4BQNA 1R4MB 1VL2A 3LUAA 1O7JA 2QWXA 5C7OO 3CZRA 2EJCA 1V5FA 3FR8A 3G5MA 2V9ZA 1L4HA 1CYEA 4Q3AA 1MXFA 2QE7A 2WUVA 1EFTA 4NQZA 3IT3A 4AF7A 1CW2B 5I01A 5F3WB 4QDXA 4YJ3B 5HXAA 4EO9A 5CEJA 5F1OA 3NV9A 3LQFA 4LZPA 2GBGA 1XQ9A 1TPZA 1QCDA 1IZYA 3OCCA 4J16A 4KPGA 1EDOA 1E9BA 2XDQB 3WX0A 4B4UA 2I3GA 2EW2A 1YI8A 3W2FA 3FETA 3U5ZB 2PRSA 4BYMA 2JCBA 3OIGA 3GGJA 1LDEA 4Q47A 4BFUA 4Z3OA 2IFTA 2LBPA 3C5EA 4N5LA 2Z3WA 3Q3JB 5K3CA 3L4BA 1XLVA 3UJAA 3CIOA 4OV6B 2P65A 3GQVA 2F7SA 5IXYA 3SVLA 4BGEA 1ISHA 1J1ZA 2PA3A 5AHXA 2YWJA 1P0QA 2QJTA 5KOIA 2XCOA 3H6GA 2GESA 2YJ5A 1MQ9A 1UBMS 4DL9A 3OZAA 2ZSDA 2YS7A 2FEXA 4LXHA 1WZ2A 2Q8PA 2CLMB 4GE3A 2WQZA 2ODEA 2ZBEA 1FFBA 2H92A 3MOGA 4IZOA 1ABBA 2J08A 3TRFA 2H0AA 3HDVA 4EEKA 5A05A 1CKEA 3QYPA 3ZWPA 4JA0A 2QY6A 4MR7B 4Y1EA 4GEGA 4WN9A 4P34A 1Y5MA 2AS0A 2D7CA 2JAOA 5IBQA 4MWBA 3QEJA 4RQUA 4UVGA 2V6FA 4DDVA 3KQTA 5DM70 3Q7IA 2YVUA 4MCAA 5IWAB 2YFYA 2Z6VA 4YJKA 3ACCA 4GPIB 2REBA 3WK5A 4MCJA 3WBBA 2JPDA 4AG6A 1J8VA 4FLMA 1JH9A 2O3QA 5TT0A 3I04M 1D2GA 2IY7A 3NKLA 1OLUA 1ZHFA 4OHYA 5BNFA 4YR7A 5BV7A 1MABB 5DN6A 5LZ9A 1TAHA 3UF0A 1RM5A 3WOVA 2PJUA 1DUIA 4IZIA 1VKZA 4E03A 2JFGA 5GINE 2JLYA 2OZPA 1LI4A 1LSSA 1E0KA 1UC4B 4I46A 3WNDA 2JW5A 5A3JA 1TM3E 5ADUS 4WJKB 4C76A 2DY1A 2PA0A 4GOND 3MWDA 4ZCRA 1DS6A 3WGLA 3ANYB 3B82A 4M8IA 1CYDA 2YIJA 3GEIA 2J41A 1TFUA 4RW0A 5D00A 2VDJA 3FWZA 3AQIA 5K2MA 4JWTA 3PI7A 2I65A 3EISA 4JB3A 1GAEO 4I1RA 2GZSA 2VUTA 4MQUA 2OECA 4LNUA 1DL5A 1N5KA 3G2LA 3IDAA 2D00A 3DOFA 2WNHA 3HA3A 3BX1A 1SMKA 1C81A 2X2EA 2A0WA 2UV8A 3ZY3A 3BGDA 2Q2NA 2Y67A 1NBMA 3O8DA 4WKBA 2V03A 4F93B 3PGXA 2XMQA 2UUOA 4Z2YA 1FUUA 4BLTA 3Q8WA 4MVCA 4F4HA 1UKAA 2A57A 3T61A 4OPMA 4C5BA 4OKIA 1CP3A 3J7AC 2FPPA 3OP1A 4J90A 2XE6A 4K81B 3LUKA 4GZ6A 5IVIA 3BFPA 3WRYA 1NY5A 3ED5A 2WIDA 1T6YA 3I2YX 3JYOA 3PGVA 5AVYA 4C5AA 3KVRA 3QYFA 5DOVA 5BWCA 1UZAA 3VC3A 4KIWA 3H2SA 4KHZA 1UEIA 4B6EA 3N9IA 5C5CA 3RBVA 1G19A 4M0UA 4ZTZB 1JR2A 1RWKA 1YHYA 3DZGA 1V8OA 3LAWA 5EXPA 3BS4A 3E22B 4O4LA 2ABWA 1V11A 2B8JA 2VRCA 3DZCA 1NJSA 4OXXA 1ESCA 3WLRA 5MFZA 2G9ZA 3CLKA 2BHLA 4BOYA 5AVVA 3UBTA 2QZJA 5HM6A 1PJZA 1D07A 3PXAA 3W2TA 2ISQA 1I4LD 2JGKA 4YAIA 3CVYA 3LYLA 2JAXA 1JF8A 1SBZA 2FLWA 3AHJA 2PKQO 1S1MA 5FPQA 4Q34A 5I7RA 5K3EA 3H11B 4P4NA 5AHWA 1AQJA 3I4FA 2HMWA 5EHGA 4I2VA 3PQ3A 4DC1A 2G3YA 3I9MA 5DWQA 1IY0A 4TT8A 4JGBA 1DAPA 1XTTA 3CZMA 4YP5A 2B0JA 4G1FA 4B2IA 4Y6QA 1HNXB 4HGYA 2BUAA 3AESA 4BB6A 4MH0R 1W7AA 3ZU3A 3PTAA 1D7OA 1DRUA 5AUQA 4J0EA 4L75A 4YH1A 5ABPA 1FNSA 3EVGA 3LH5A 2LPMA 3CRZA 4RKQA 4EPVA 3GXOA 3I5AA 4RKYA 4RIFA 3HB5X 1GQQA 3IO3A 1Q1AA 4HNGA 1GAWA 2ES4A 1NVGA 1U3GA 1Z4QA 3IEKA 4LHEA 3H05A 3NM6B 3RPEA 4HVCA 3TNYA 4DJFC 3WL5A 4BASA 3EAQA 2CL0X 5LIPA 3KVVA 3FSEA 4ZGBA 1ZOIA 3UKJA 3C3MA 3KB1A 1I6MA 1OGYA 1GYPA 1DWPA 1JFRA 1M0EA 2WIKA 1TMYA 3FLBA 4KQEA 3ZWBA 1MRZA 3DQZA 4C2TA 2WSSA 4EQZA 3IJEB 2OGWA 5CDSA 4PEVA 4DBVO 4R7ZA 4MRMA 3V1YA 1U2TA 3ZVMA 3RM3A 3P9XA 1PJCA 1GN9A 1VPTA 1CUYA 2Q2VA 5EGNA 3TNJA 4B4WA 1EUQA 1KZ6A 4R9VA 1SXHA 1JVNA 3TW8B 1CJTC 1DINA 1WNFA 2A9OA 5J2TA 4J6FA 2WHQA 4E5PA 4BNVA 1U7TA 2H0RA 3FAKA 3H87A 2LDXA 3C3BA 3RRFA 1U11A 1VL0A 5GWXA 3LQQA 5B58T 1DO2A 3FLMA 1AO3A 3NOVA 4KMMA 1EVQA 3P4UA 4BRWA 1ZVJA 4D81A 4M1TA 2PX2A 2IPOA 4K1LA 1EEXB 4OI2A 4QNMA 2A84A 4G09A 1M1YE 2NZYA 4PZ0A 4YBRA 1X7YB 4RD6A 3UXMA 1IPFA 3FWNA 2PKXA 3PGJA 4AN0A 3IVGA 4B45A 3B1VA 4DVGA 1F2VA 3VYUB 3LLMA 1O77A 5E95A 3BXHA 3LHIA 2C7PA 1CDDA 2YC2C 5AP9A 4BL5A 3LCCA 2Y1WA 1RM3A 3KPYA 3PRKE 2QZZA 4XWYA 1RC8A 5DBHX 2DVMA 3IV6A 9GPBA 2RCNA 1N5DA 3QWHA 2W6NA 4CEHA 2DBRA 2VN8A 4FUQA 1JU9A 1XP5A 2UYGA 3CRNA 4YRIA 5HF6A 4QL3A 3WQRA 3WRVA 1U98A 4C05A 1Q6ZA 1MJ5A 4HDKB 4Q15A 3F96A 1S2NA 5AJZA 3DOOA 1FCJA 4MI3A 1E1QA 1UKEA 2E2WA 2YXDA 1Q3TA 1NX6A 4DEVA 2FCRA 1XDDA 1P0IA 1KNXA 1Z7YA 2ZQ5A 4UC0A 4AY5A 5KQLA 1R74A 1UJNA 1X1BA 1FP7A 1UOQA 5BVHA 5HQJA 5AI0A 1BOOA 2WKSA 4XQGA 4FCCA 3OJEA 1UKBA 5ARDA 1SU8A 4R2LA 3SS9X 1OI4A 2WF8A 2Y0BA 1RWPA 1Z6AA 3LVRE 4K03A 4Q66C 1U8CB 1IHXA 1VPVA 2ZVDA 3CBGA 1Y7HA 5C52B 3C8UA 2IW3A 4A2CA 4AIIA 5ENVA 4DUZB 3AVPA 2INGX 3P0HA 1RTTA 2TMYA 4TS3A 1OLXB 3RSOA 3O9ZA 5A4IS 1SBTA 3IQDB 3L0DA 3LX4A 5IRCD 3LQ1A 1WHTA 2NTEA 1I0ZA 5KCZA 2XGGA 4KRYA 4R5MA 1WUKS 2H00A 4M60A 3N58A 1JILA 4DWJA 1NBEA 2GLTA 3VUEA 2IK8A 2WUDA 2GZ2A 4MYSA 5JFTA 1Z34A 2VH1A 3DHWC 2Q29A 3VAAA 1QHXA 1VLHA 1LPBB 3EMBA 2BFOA 3OZIA 3P2JA 4S2UA 3RUAA 3VYVA 3K4HA 2MCFA 4YIHA 4D0GA 4L02A 4ZXPA 1KIMA 2XQIA 4NJOA 1ZMBA 2ATEA 2C88A 1GQSA 1EHYA 2G77B 1OTHA 3DM9B 3EZGA 3M6MD 3MVEA 4RMJA 1U7HA 2HMVA 5F1PA 3HP7A 5HE9A 1E18A 4HMOA 2ZWPA 1NURA 2QUAA 3HDYA 2KI5A 1Q7TA 5CM9C 3GCWA 3EG9B 2W6OA 3QK7A 4ZO6A 5FPPA 1CD5A 1V4NA 1NW9B 4EG6A 1NR1A 4BGVA 4Q3CA 2GBCA 2GCIA 2YHUA 4Y7DA 2QTBA 3MAJA 1KBQA 5ALSA 1ZGBA 1PR0A 2OFOA 2XRZA 1GAXA 1I0IA 2JIOA 1GG8A 3GR6A 1KKUA 2ALJA 2PWBA 3MS2A 3DD5A 3QHAA 4HH1A 3TX2A 3GPIA 1ZM7A 3MWEA 3MMSA 3D3QA 5TF4A 1Q77A 4LRWA 3AGPA 3EIFA 1XTQA 2ZU0C 1MG5A 4FXOA 4Q0MA 3BE6A 1DTWA 1DO0A 5HYVA 4OJMX 2O1WA 2ZATA 1RKXA 4LBYA 4XFDA 1JBEA 4LI0A 1MT3A 1NQXA 1WW3A 3IAS1 3V9AA 3RJ5A 3DDNA 8ABPA 1RQ2A 4RTLA 4PXYA 2PS9A 4Q9DA 4ZMBA 2NIPA 1QM5A 3M9WA 4KFTA 4RZ3A 2FW8A 1FDSA 4MYUA 1IULA 3FFXA 4JQSA 1DP4A 4ETNA 4UHCA 1V5EA 1IHUA 2V54A 4LBWA 1EFLA 4RK1A 8ATCA 4LJRA 4WLEA 2G09A 2XZDA 4PLGA 2CDBA 2D59A 1XZNA 3TTYA 3ZGXA 1Y8AA 3LOQA 3DTVB 4FKMA 1T5LA 1DKQA 1N2XA 2GEVA 2TYSB 3AEQA 3BXGA 3MJHA 4HSEA 2OTCA 1XWIA 3FOAA 1KYZA 1N2CA 1ZDMA 4KP7A 3RH0A 2C77A 3G2NA 3BJMA 2QAGA 3F78A 2AV6A 1SUFA 3OJXA 2GAFA 4AT1A 5AVSA 1DOHA 3F9RA 4GKJB 2IGTA 4S3MA 3IP3A 4RAOA 1BVUA 1P74A 4BAGA 1ORRA 1TLFA 4BIMA 1PAUA 3H1TA 3VJMA 4RFVA 1CY7A 2BEVA 4XYEA 3MWYW 4FP9A 4LWOA 2QR2A 4Z86A 4FILA 3TNLA 2J1LA 2OCAA 4M7WA 5IHPA 3AUAA 3U1VA 3U7IA 3VGJA 4CKEA 1A4UA 4DN6A 3OOYA 2PZJA 5H9WA 5CDTA 5B36A 1V3QE 1M1ZA 2UVQA 4L76A 4KK4A 3IDZA 4P0TA 3BGWA 5H1YA 3GFOA 5CVVA 3HLYA 4D97A 4E5SA 2A5GA 2O2SA 1KF0A 5D2CA 5D3MB 3V2UA 1Y4ZA 3SPXA 5EIWA 3FZYA 3CB2A 2A35A 5KYWA 3OEED 2LZ0A 3LUFA 4B4VA 2PJRA 4XEHA 5BSVA 2VL7A 1VSUA 2EKBA 2Q3EA 5DTIA 2FXVA 2KWIA 4DYVA 3PFIA 2JA2A 2H7XA 2QTVA 5JARA 3CE6A 4ZT6A 4C30A 1RYNA 3DZKA 2V7WA 5CIWA 3ZLTA 4O5AA 1JVBA 5KVQA 4XD7D 4MW6A 3F1KA 5IT9A 4OMCA 4REOA 1QQAA 1F20A 3O0TA 3WA6A 2FMXA 3JX9A 3KDAA 1J49A 3OEWA 2WNSA 3DTTA 2CDAA 4XYMA 4D8UA 1ADBA 1GGVA 2VLBA 4LAFA 1ZN8A 2C31A 1PJQA 2P77A 2XMGA 3DOIA 3NM4A 4JLVA 3JSXA 4R6XA 1W36B 2AN1A 1QR2A 4O4HB 1EXVA 1GYQA 2R751 3L5KA 3MEQA 3ABQB 1O5OA 3VV3A 4F7DA 2J9GA 5BT8A 1HE4A 1VJGA 5FTWA 3WB9A 4PQFA 2XGMA 3WBJA 5DT9A 2MSLA 1JI3A 3DDSA 3A58B 3TNDA 3VU0A 4BTLA 3O4IA 5LDDC 2CLCX 1T91A 4G5OA 2QRHA 4EFNA 3KQWA 3C3WA 4GG1A 5K8LA 3AHFA 3CLTD 4JH0A 1R4NB 5A0VA 3BMCA 2MSNA 3Q87B 3COZA 1IMOA 3GEPA 4GU5A 2DEUA 4ITRC 4NCHA 4QSMA 4UQPA 4B8ZA 4PHFA 3ZGYA 4GW3A 4CKZA 5JCZA 5JYDA 4CFSA 3C43A 4RZXA 1XVIA 1FDUA 2JGMA 2RJOA 1GCUA 3INYA 4P22A 5IJ0A 4X92A 3U48A 2VP9A 3R7WB 4ERXA 2HJHA 3H4TA 2Z56A 1HV8A 1KK3A 3HKBA 4DCPA 4KHPB 4G4SO 1ZGAA 4H15A 2PX4A 3VRHA 3WOHA 4IV0A 4X8HA 5TDHA 3R9IA 5CITA 2B78A 4KB5A 5GMOA 2WA2A 1WZNA 4PINA 2TS1A 1CVIA 4CKWB 3IHTA 1PK8A 4YRLA 4DSUA 1TK2A 1ZIOA 3IDOA 1DQSA 4LEIA 4WXMA 1ZN9A 4ARZB 1ORIA 2IQIA 1KP9A 4CR6A 4MIYA 1ZLYA 2GYUA 2UYQA 5AW8A 3W1WA 3U9LA 4LQ4A 1NULA 5I47A 3ZLUA 2RGYA 3NWOA 5AVWA 1QH0A 4HZGA 2BN4A 4UREA 1LEHA 1XKTA 1RWNA 3VDXA 3L43A 4KLZA 3WL6A 4B6QA 2XMDA 2GN6A 3IFSA 1IZ8A 1AIPA 1ZCZA 3T5AA 1KYVA 1GA6A 4MA5A 3QE3A 1TIBA 1DQNA 3BTUA 4IZHA 1E79A 1P8JA 2Z2KA 1L9XA 3HA5A 3UO8B 1EYZA 1XZJA 2X1LA 2N0SA 3MRSA 3V8QA 3I6BA 1EVEA 3KTOA 4EG5A 3FPGA 4YRMA 3VX4A 4IDDA 4OHPA 2Z6QA 2C2XA 4ZEXA 1SHUX 5JJCA 5JZSA 3UMMA 4HNSA 4IFEA 4Q01A 4NZPA 5DRTA 1DCKA 1IEXA 4OATA 1MABA 1EJ0A 2DLDA 3HGQA 2R11A 1YFKA 2IOFA 2ID8A 4EYEA 5IC5A 4Q7MB 1FE8A 2ZTLA 2LIVA 4WUTA 2N1BA 4EW6A 5IKEA 1GRNA 3IPLA 1I3MA 2OV6A 1KY5A 4DA8A 1SUEA 3MB5A 5EKDA 4HUQA 5ILOA 4OUKX 4XB2A 1L7BA 1PW5A 2HOQA 1QPGA 1X1AA 2WM3A 1GITA 3QUTA 4R1UA 5EWJA 3ZQJA 1LLDA 2RH5A 2D5BA 2VSQA 3H2YA 3TX6A 2Y0EA 2DKOA 3TM5A 2J3LA 1XTIA 4QYIA 4EY7A 1N6NA 4ID9A 4C4YA 1Q3HA 3ND5A 2HMSA 2VATA 1Q11A 1XZMA 4PGFA 3HLTA 3VOBA 5DX8A 3G2HA 3UK0A 4MJLA 4XUCA 3KX2A 1H4VB 4ZOBA 5F1KA 4EX7A 3L49A 1ODSA 4R0NA 5HIKA 5HQTA 2Y2UA 4ONEA 1YVUA 4IJWA 1IM2A 4YJ3F 4DFDA 2HW8A 4TM7A 2FG6C 4KLAA 4OQQA 3NPAA 1A5AB 1SUSA 3KOOA 3BIWA 1BXKA 3NXSA 4GI3A 4W5RA 5DI9A 3WY9A 3LL4A 3EQ2A 1RPNA 1N6PA 2ZAMA 1IY1A 3PQ2A 4Y2RA 2ECKA 2OYSA 3QXXA 2V9CA 1VE6A 2NO9A 4K6HA 2PFSA 4KGDA 5E3IA 5EZYF 4YQZA 1AKUA 1LS1A 1VJCA 5JSQA 4TL7A 1PTJA 3EW9A 4QTYA 4PN7A 3WKDA 1SVLA 5EIHA 3H5RA 3HBLA 2Q5HA 3IYLW 2FA9A 1P0FA 4PTYA 2REQB 4U9UA 1A2BA 1NBAA 2C7VA 2J5BA 3F98A 4R9SA 3JTEA 5LVAA 2DPHA 3IA2A 3ZXUB 4M1QA 4CMHA 4CF4A 1MB3A 1W9MA 3GYGA 1V6CA 4IQGA 4L2IB 4H7PA 3ROZA 3S28A 1XAJA 3QKTA 4KL8S 4ZKDA 5B7NA 2EW8A 1XWWA 5AFSA 3PE6A 3W34A 4K1XA 2RC5A 3ESRA 4GR9A 4KQ2A 3TSYA 4MRPA 4DUYB 4MP8A 1P77A 3B3JA 3PSAA 4U7WA 3D43A 2FZ5A 1ZK3A 3JQ7A 1LZLA 3R9WA 1M1YA 1SR8A 1JFFA 1LPMA 1XD2B 2WFZA 1CY4A 1E3MA 4PPGA 4XPZA 4Z99A 5KKAA 4DMGA 1BE6A 4V38A 4WESA 3KKOA 2A33A 1LVHA 2GCOA 4KN6A 3U16A 3TOXA 1V3VA 3LLUA 1XYGA 1MB0A 4WL0A 4B79A 4BCCA 4MQEB 5E3HA 2ECFA 4DCCA 3BEOA 3H97A 5EI5A 2ENWA 1PNOA 3A2KA 1K68A 4EARA 4JEIA 4TKLA 4OSPA 4OHKA 3IXQA 4MWTA 1DRVA 2PUDA 1A72A 4IP0A 4QUKA 3BF7A 4Q02A 4CTNA 4C2BA 4OD0A 1QZUA 3WKBA 4B47A 4FINA 5EUMA 3CVJA 3FYSA 4R84A 5AM0A 1QS0B 2QRZA 5ALDA 3DR3A 1FUIA 4TLMB 4EUFA 4MUYA 3AW9A 3CH5A 3K9QO 2VAVA 4HAUA 4PF1A 2AN9A 2Q99A 3BXXA 1KJIA 4R9NA 5ERXA 3MSXA 3OKPA 3Q3EA 1HORA 4NV1A 6ABPA 3KQMA 1WDKA 1C7IA 2EKDA 2JDIA 3OSUA 3QF4B 4XGKA 1LFDB 5FI3A 1VSQA 1JTVA 1GCAA 4MRMB 1F4PA 1CR6A 3CQ9A 3KKKA 4RJKA 1EQUA 2JBAA 1N0UA 4E2YA 2CKMA 3VO1A 3N5CA 3PD0A 1SB9A 3CTMA 2I78A 3IRVA 1JHRA 2AHOA 5ITZA 4OU4A 1U1GA 4FFRA 2P8SA 3Q9UA 2VPQA 3KLPX 4FMPA 2Z5GA 3D8RA 1E9AA 4DC0A 4B5LA 2I4MA 1PG2A 2IIPA 4ON9A 4B33A 4EELA 4EI8A 1TM4E 4BVGA 3MYRA 2ZSKA 1E3EA 1CV2A 2R8EA 5EIBC 1TD1A 1ZNQO 3GP8A 3H1EA 4LIPD 5T57A 1HLFA 2C8LA 2HQOA 4Z8YA 5EJEA 3OTHA 2IU6A 4MV8A 1UAGA 2ZU6A 1KWKA 2FPMA 2XB2A 3ND7A 4N54A 1B8UA 3A6FA 1EGAA 5D86A 1I5EA 3AB8A 1H0KA 2X86A 3V3TA 1SC9A 1AF7A 2FPUA 3CF0A 2V0CA 1T4DA 2D1FA 5A02A 1MIOA 4BGIA 4U6NA 1YRBA 2IHTA 5FKJA 2JJ1A 1CRQA 1H66A 4OQLA 2CVOA 4HLNA 3DAFA 4LZAA 5BYJA 3D02A 1EP1B 5T5QA 4M7RA 2WU1A 1C80A 2J07A 2PK3A 2AZ4A 2H2FA 4RETA 3PXCX 5CXQA 3LPNA 5JTUA 4L5CA 2AOUA 4HB4A 3K1AB 4TS4A 5C1IA 2MMCA 4AS2A 4FE4A 4PLCA 1G2IA 4JYZA 4R8RA 4MGEA 4MUFA 5E1DA 2YV4A 4CKYA 4G1UC 3A32A 1I0LA 1OH5A 4HUJA 4M4SA 2D2IA 3FG9A 3KLOA 4QAQA 2CXOA 3FYDA 3K8QA 4PZUA 1YACA 1EFUA 3AEZA 3DEAA 2ZPUA 4H1VA 4PIVA 2YJGA 2NU8A 1VHJA 2ZEJA 2I7XA 3B3AA 4ZZ2A 3E61A 4PQGA 2HBRA 4RXMA 1SCIA 3BD6A 5D51S 5DSTA 1VZ3A 1KERA 4H27A 3JASA 3RQSA 2WDZA 1SCUB 5I48A 1SVOA 5IJZA 1EVZA 1KFJB 1SY7A 2JGJA 3OTGA 2WTAA 3WB2A 2I91A 1HT0A 3IBYA 3VH3A 1AN0A 2OUIA 2PGOA 1YFLA 2M6RA 1IH8A 2IEAA 5BN3A 1JG3A 5C7LO 4QU0A 2I55A 1M2VB 1EKXA 2GUGA 1L2TA 4CMBA 4F5DA 5I4KA 4GUDA 3NC0C 2PSEA 3KETA 3TQQA 3SXPA 5AO9A 2E21A 2OCKA 2WMNB 2QS9A 5LKRA 1Z4OA 4GPZA 4MO2A 2EP8A 2L42A 4TYYA 1P73A 3SQNA 1ORDA 1R5JA 2NYVA 2X2PA 3V2IA 5KKCA 4FYWA 3SLRA 3V4LA 1CIVA 1NKTA 3TGWA 4G0VA 4WI1A 3R3YA 4ZTUB 2F1KA 2P9CA 1SKUA 3GJ4A 2AIRA 3N07A 1B6SA 4WCVA 1RLUA 1RAHA 4OP2A 3KUCA 4D42A 2WK1A 1VHWA 2GEUA 2ZIZA 1NVMB 3NJRA 4NEQA 2JLZA 3QY9A 3A3OA 1L5QA 1RZVA 4QBGB 1QG0A 1XV5A 3IJRA 1E96A 3P0EA 1DC6A 3EQZA 3NPMA 3D6AA 2QQ0A 1R3DA 3B6EA 3ICVA 3OZEA 3DNMA 3JQAA 3Q3HA 4RZUA 4JB2A 3LT0A 4XEUA 4DRYA 3VR6H 4E4TA 1U0EA 2FMFA 1NONA 4UCWA 1J0CA 3MJVA 5ITWA 3BB4A 4A0FA 4RCYA 4GD3Q 4KWHA 4RVFA 5FUMA 4D56A 3T06B 4JJ7A 4BGUA 4MYHA 4CM9D 2H4WA 3DJFA 5BRAA 3C6QA 2C07A 5K03A 1FS4A 1J8DA 5BUSA 3NDRA 2DT8A 3F3SA 4EJSA 1IY8A 1U2SA 1UMKA 1QRDA 4J1NA 4PE5B 5IVHA 2YZMA 1QBGA 3NWPA 2B4RO 3RU3A 3C7CB 4WEQA 1UBHS 3CGGA 1TAUA 1UP6A 3DTVA 4OBWA 5CEFA 1XZKA 1NAHA 3LUPA 3FFBA 1Y1KE 1C50A 1AKWA 2IPAB 1P4RA 2Y4OA 4OEHA 3DWGA 5E1MA 5ALYA 3ASVA 3EN0A 1DT5A 5D87A 1I7DA 4H7IA 2AXNA 4EUNA 4P7JA 3ZDXB 2JI9A 4MGIR 4J1QA 1YZLA 4XD2A 2YYZA 2CBXA 3COYA 1U28C 1QIKA 4JYMA 2VWHA 4YQYA 1LGYA 3NQ41 4R2MA 4WA8A 1TT7A 4BVAA 2Z43A 3CVXA 2E0IA 2RHHA 4JP3A 4DGQA 5BR1A 3VJRA 1CLEA 3BH7A 4AY4A 2VF8A 5JWOA 3CSDA 1XC7A 1YS6A 3GLIA 1LB1B 1AV6A 1U0SY 3FD8A 2NU7A 2PH3A 1P18A 4TV9A 4XCVA 1XK7A 4TX1A 3IT1A 4RGQA 1XSEA 3ET5A 3NFRA 5JZBA 5TIIA 3ZZUA 4HUTA 2CMGA 4JVLA 1IWBB 3ZHVA 2YJ6A 4ZHQB 2V9PA 2FW7A 2JFUA 5F9FA 5IARA 3ZWKA 3U3RA 4N82A 4PO3X 4GIBA 1GKYA 2YQ5A 3TEMA 1M0TA 1VCOA 2QY9A 4EGJA 2QAIA 2PRJA 3RS5A 2BEWB 2CL6X 4U39A 3WGIA 1Y6FA 4C0KA 2FOXA 2FNAA 2CUZA 2EKQA 2ZJ5A 1G1MA 3C7DB 3A05A 1MNAA 4QFBA 1T34A 2ZI4A 3AWDA 2W6IA 4FMDF 3BHNA 2IUSA 3PWZA 3FNHA 3BMOB 2OHJA 3N2GA 3RFTA 3MUNA 1ABEA 3Q5DA 4G1VA 1P1RA 1Z0SA 3CWCA 5DTQA 3UJNA 3MT9A 3NHRA 5E2IA 1GFSA 4HNTA 4ZCSA 4G84A 5KJCA 4EF5A 3NR2A 1WBBA 4F0JA 3E0XA 1KO8A 1IMJA 3ON5A 3D7MA 2ST1A 1JE1A 2FPSA 2OP0A 4Q1CA 1LZKA 3VO2A 3K1ZA 4MMYB 4B43A 2QN7A 1K63A 4L0QA 4RV5A