4RDIA

Crystal structure of e. coli trna n6-threonylcarbamoyladenosine dehydratase, tcda
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
266
structure length
246
Chain Sequence
b'SVVISDAWRQRFGGTARLYGEKALQLFADAHICVVGIGGVGSWAAEALARTGIGAITLIDMDDVCVTNTNRQIHALRDNVGLAKAEVMAERIRQINPECRVTVVDDFVTPDNVAQYMSVGYSYVIDAIDSVRPKAALIAYCRRNKIPLVTTGGAGGQIDPTQIQVTDLAKTIQDPLAAKLRERLKSDFGVVKNSKGKLGVDCVFSTEALVYPQSSGFGAATMVTATFGFVAVSHALKKMMAKAARQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA threonylcarbamoyladenosine dehydratase
publication title The Structure of Escherichia coli TcdA (Also Known As CsdL) Reveals a Novel Topology and Provides Insight into the tRNA Binding Surface Required for N(6)-Threonylcarbamoyladenosine Dehydratase Activity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 73
structure length 246
sequence length 266
chains with identical sequence B, C, D
ec nomenclature ec 6.1.-.-:
pdb deposition date 2014-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4rdiA00
4CM9D 3D5QA 1ZVMA 4E6PA 3NDIA 1NP3A 4H16A 5LCXA 3TZ6A 2XOXA 3FTPA 3G79A 3LT2A 4RPGA 3KRTA 1KEVA 2PH5A 3PGJA 3RUHA 4GX1A 2BF7A 2BGKA 2LDBA 3GN1A 2JD1A 3PQEA 1PJSA 1ZK4A 2VRCD 2YDYA 3DZBA 3DR3A 4A26A 1T2EA 2BFMA 4U0JA 3AOGA 4ALIA 3NKLA 4LSWA 2W2KA 4YCAA 1DOHA 2WE8A 1SPXA 3RWBA 4RPHA 3RBVA 1H93A 4KDEA 4WCDA 1ENPA 1E6WA 1H9BA 1I10A 1ULSA 3CXRA 4PLGA 3VDQA 1ZJYA 3T4EA 4K6CA 4CM5A 1R66A 2FR1A 1QSGA 2J3IA 2VHXA 2NQ8A 4FFMA 4N7RA 3VPGA 1YS4A 1RM4A 2JL1A 5JAZA 1PJ3A 1ML3A 4UEOA 1V0JA 2G76A 5I7VA 3ICCA 1ENOA 2WD7B 4IIUA 3JD1A 2C7GA 2OUIA 1EDZA 4AFNA 3JQ6A 3ZCXA 1AXEA 3ZW8A 3U4IA 2O48X 3OJOA 2O3QA 2CMDA 3SVTA 4BKRA 1KERA 1ISHA 5ICMA 4URFA 3VC7A 3OETA 4U6QA 1R37A 3ZNPA 1DRVA 2OL4A 1X7HA 1NPTO 4WOJA 3Q2KA 3DB2A 3SC4A 1NTOA 4OOFA 4HUJA 4M8SA 4JJFA 1J0XO 5MDHA 3QRWA 3V1YA 4AJ2A 4B7XA 2B69A 4CV1A 1DIGA 2ILTA 5AYVA 4R51A 1R0LA 2P9GA 5KJEA 2PGJA 3KBOA 3OICA 4RPKA 1GUFA 1E1NA 3T7CA 4JLWA 3GPDG 2J3JA 3AJRA 2EKLA 4XDYA 4Z9YA 4IY1A 2YUTA 4ZQBA 1ISJA 2Y05A 1LRJA 2NVUA 1FDWA 5TSDA 4CM7A 1Q7BA 1BXZA 4NBRA 1QV6A 5B4UA 1I3KA 3EVTA 4CUZA 3BAZA 4WGGA 1E1LA 1BDMA 3IJPA 4DQUA 2ZTUA 4NU5A 5CFZA 5DZSA 3F4LA 3D64A 1ADFA 4YTEA 1K6JA 4ZQGA 4YJGA 4ZQEA 1UDAA 5L4NA 2NLOA 4OAQA 1LX6A 2AG5A 1YRLA 4Y67A 5A1TA 4GMGA 5BNTA 1RWBA 3A4VA 2LDXA 4J1QA 2CDAA 4ZQHA 2FRDA 3ZWBA 4XDZA 2P91A 3ZV6A 5DBGA 2PNFA 5CG1A 3WGOA 3JQAB 1E7YA 2VWPA 3ON5A 4KTTE 4BB5A 1GUYA 5CEFA 4J7CA 1A4IA 1I2ZA 2NU7A 4YT2A 4YJFB 2BFPA 2FOIA 4DL9A 1LTHR 2EXXA 1JLLA 2YFQA 4RORA 4YDRA 1K3TA 4CMEA 4NBWA 3LC7O 1FDUA 3U3XA 3F5SA 3HFGA 1IHYA 3DZJA 5LC1A 5C7OO 3OMLA 1D1TA 3E03A 5JC8A 3DBHB 1SEPA 1O89A 4XGKA 3QWAA 1C0KA 3H4VA 3KYBA 1NVTA 1ZKMA 1ZO8A 4NPCA 3F5QA 4P8RA 2IODA 3HHPA 5L9AA 1HZJA 2CY0A 5EN4A 1U3UA 3NUGA 3RFVA 4AJOA 3UXYA 2C5AA 3JTMA 1J4AA 1HE2A 2VRCA 1XLTA 1PJQA 3V1TC 5CP8A 3H5RA 4BNYA 2PKQP 1PZFA 3GRKA 4YPOA 1BWSA 3SC6A 4GSLA 1Z45A 2OZPA 4EGFA 5A9SA 2CVZA 4AJEA 2VZ0A 2GF2A 3C85A 4IQ0A 3VOSA 1L1FA 3O38A 4TQGA 3WS7A 2B35A 1EK6A 1YB4A 3E8XA 2OXIA 1X7GA 3K8ZA 4XYEA 3V2HA 4YT4A 3PP8A 2JJYA 3HB4X 2IE0A 5LDHA 1XSEA 3OHSX 5DCUA 3JD4A 3TZCA 1LRKA 1SZJG 5G4LA 1M2WA 1NVGA 5IJZA 2UUPA 2OHXA 1UDBA 3ITDA 4DMLA 1W73A 3C3XA 3CTMA 4L9RA 1Y9AA 3OJ0A 4J0FA 1JVSA 4TRMA 4CMBA 4ZA2A 1LEHA 2DBZA 3R6DA 3T7EA 2QRKA 3D1LA 1I5RA 3KXDA 4WASA 3UFXA 3PPIA 4AJNA 4FFRA 4IIVA 1XU7A 4NHEA 2OGUA 1R6DA 1M76A 4BIIA 2VCYA 2Y67A 3N7UA 1HDOA 4OJNA 2WYVA 1WP4A 4WEOA 5T57A 4KMSA 1PJTA 5EL0A 3RUEA 2A9FA 4TMFA 5CEEA 2C82A 2PKQO 3UN1A 2PK3A 1A7AA 1NVMB 2AQKA 5JDCC 2VN8A 2EGGA 2NTVA 1EDOA 5KIAA 2VWQA 2Y1FA 4Y6SA 3DZFA 1GQQA 2Y1OA 2ZQYA 3ZWPA 3I9NA 1H2BA 2JCYA 4KWIA 4BNTA 3DMTC 4JX8A 3EK2A 3KSDO 4Q39A 3WGGA 4UUPA 2W98A 4GVLA 1T4BA 3BYZA 3OBBA 4L76A 4NH4A 4WNIA 2OMEA 1ZEMA 3GZNA 3KOUA 5A5EA 5JAQA 4CM8A 1KYQA 2IZ1A 4FCCA 4MOWA 1PR9A 1I30A 2SCUA 3FCOA 3M2TA 3R3SA 3L77A 3PIDA 3ENKA 4L0QA 3W4JA 2O2SA 1HKUA 5A3JA 3PYMA 2XPCA 2P9CA 2UUOA 3ZV5A 4K1LA 4DLAA 2J5KA 4WK6A 2DBRA 4O5OA 1Y5RA 2QQ5A 1SOVA 3GNSA 4JN6B 4OQZA 3JQ9A 1IULA 1BXKA 3WQRA 2V6GA 3PJEA 3PLNA 1CETA 3V8BA 1UP6A 4CL3A 1K5HA 3E18A 1D8AA 5CDSA 4YQYA 2B83A 4PCVA 3KETA 5KKAA 1VJ0A 3ZNOA 1QP8A 4FGSA 4CM4A 2NU6A 3DMTA 5TC4A 4A03A 3FNEA 4IM7A 3NV9A 1UR5A 2QYSA 3HG7A 5DBIA 3HNPA 5B12A 1GYPA 1AHIA 3DQPA 2QZZA 2AHRA 5KJCA 1DFGA 1OOEA 1YE3A 2J5RA 3WGHA 3EY4A 1HTBA 2IRWA 2Y66A 4IDCA 4UAGA 1HSZA 1Y8QA 2WD8A 4FPXA 3ZNNA 4NFHA 1FDVA 1VRWA 3N58A 2HUNA 1AHHA 4ZU3A 1QYXA 3C8MA 1A7KA 5TRTA 3RD5A 5KKCA 1PGPA 3ZWVA 1BGVA 2CUKA 3H9EO 3PJFA 1P1RA 3JQFC 1F17A 2NADA 4ALLA 1R15A 1AXGA 3SJUA 5GZ6A 3QY9A 1PQWA 2PZJA 3JQ8A 1E92A 1I0ZA 4DIFA 3GHHA 1DRUA 3RFTA 4BNMA 4PZCA 2I3AA 4WLOA 3KV3O 5A04A 2V6FA 2J3KA 5G0TA 1PWZA 2CSUA 4MIYA 2VYVA 2XAAA 1A9YA 3QWBA 3K92A 5L7TA 4PLVA 4IS3A 1T2CA 1Y8RA 3VPFA 3JV7A 2NTJA 4B4VA 3JD3A 4KUHA 1TB4A 2QRLA 4DXHA 1SBYA 3OSUA 4IUYA 3IS3A 5IF3A 1PZHA 4WLNA 2RAFA 2D8AA 3WDSA 4E2YA 1R0KA 2CFCA 4NJMA 2VTEA 2ZCUA 1PTJA 4ALJA 2NU9A 1MC4A 2O3JA 1G6KA 2PY6A 4KDFA 4IJUA 1QXSA 2W2LD 4E32A 1MFPA 1ISGA 3CMMA 5LDGA 1N5DA 3GT0A 3NJ8A 3ANMA 1V8BA 3NDJA 5G0WA 2HMVA 3LYLA 4JGBA 4R9SA 2PTGA 4MVJI 4JNKA 4Y8VA 2G82A 4YACA 1UZNA 2HK9A 2X86A 4G81A 3E6AA 1KY4A 3LDHA 3VHRA 1UUFA 3JYNA 4EUHA 4BO2A 3Q9NA 5DCYA 3JSAA 1MXHA 1RYDA 4Z9FA 3AU8A 4E3ZA 1ULUA 1B8UA 1KS9A 4E5KA 4NBVA 5MGBA 3HUDA 3D3WA 4AJHA 5JAMA 1XCBA 1SEVA 3EZLA 3I1JA 4A7PA 2C20A 1U7HA 2P4HX 4EBFA 3ZH2A 1Q7GA 4ONEA 4OQYA 3E9QA 3VDRA 1LU9A 3GGOA 1GZ6A 3ROQA 5DBFA 4AJIA 4YEDA 3GC6A 4ZN6A 1UH5A 1ZSYA 1ADBA 4E5YA 4DPMA 5AXBA 3WGZA 2DQ4A 1NFRA 2Y1DA 3P19A 4NIMA 1EBUA 2W2KB 3ETGA 2R00A 4MIEA 3MJVA 1SO8A 2X1HA 1C1XA 1U5AA 2EP7A 4BQPA 3JQCA 1NFFA 3GEGA 3ROPA 3DHNA 2HJSA 4D3FA 4H3VA 1ZFNA 3BMQA 1NHGA 5JO9A 2Z1NA 1U5CA 1DPGA 5AOVA 1JAYA 4BNFA 1R12A 3RUDA 4PG8A 4XYLA 5F1PA 1H2HA 2B4TO 5IZCA 3IP3A 1N9GA 2F00A 2IXAA 3BMNA 5BSEA 1GQ2A 4TZKA 1H5QA 3LT0A 4RGBA 5ER6A 1EQUA 3BMOA 5C5IA 1HDZA 1E3IA 4R41A 1CJCA 3DXFA 5IG2A 5I7SA 4GQAA 4CMAA 3K31A 5JBIA 1GDHA 3I9LA 1I32A 1LJ8A 3DBVO 2AMFA 1KOLA 2VHVA 4E30A 3ASVA 3I83A 4LSMA 5L51A 1HSOA 5JMPA 3TN7A 4BKQA 2EGHA 4MVJD 3C7AA 4BNUA 3LU1A 4UEKA 2ZJ0A 4UUNA 2W8ZA 1D3AA 3Q6IA 3EMKA 4S1VA 3EC7A 1LLQA 3WIDA 4ESOA 1U9JA 1MUUA 3NTOA 1C14A 4L4RA 2NVUB 3BHMA 4UVGA 3IAHA 3FHLA 3L9XA 1JU9A 2H5LA 1RM5A 4MKRA 3OJFA 1NYTA 2O3SA 1LA2A 3LC2O 1IOLA 4AJKA 4GLLA 2B36A 4OYRA 4WOKA 4BKOA 3M1LA 3D4PA 1I2BA 3GEDA 4R69A 3ZWWA 3F1KA 1U8XX 3GZ4A 4DREA 4BNNA 2X6TA 2PA3A 1LDGA 4CLRA 1E3JA 5A3VA 2GYYA 4PLCA 1YBMA 3WICA 4B4WA 2Z5LA 8LDHA 3DTYA 2Q4BA 4MJLA 4IQ8A 4TRJA 1HDRA 3EW7A 3ADOA 3LSYA 2VZ9A 4GSKA 2O3UA 2X0JA 2HJRA 3CINA 1CIVA 3OIGA 3G17A 3ZZNA 3INGA 4L73A 3WQQA 4AICA 4OXKA 4IINA 9LDBA 3AFMA 4XJSA 3FF4A 3PHIA 3F1LA 4FC7A 2UDPA 4PLZA 2Q1TA 3GPIA 3LLVA 4BO6A 4WPGA 1E7MA 3LT4A 2D5CA 3GG9A 1PL6A 5HM8A 2OFPA 1ZK3A 2RH4A 4OXNA 4FB5A 2OP1A 3OECA 4J7XA 4Q3NA 3PZRA 1WPQA 2FPIA 4Y6PA 1VL0A 1KVRA 4G2NA 4BS9A 5F5NA 1R0SA 2Q45A 4JQCA 1Q0HA 1WLYA 1RM0A 4QECA 1VL6A 3ZU5A 5JW6A 2D1YA 1WW8A 2HSDA 3QE3A 1KEUA 4RZIA 5I7FA 1WWKA 1KVQA 5ITVA 3QJ5A 3Q2IA 1PR3A 1XKQA 2YZ7A 1PQPA 3B70A 1LLCA 3Q3CA 1E77A 3X2EA 4IDEA 4DPKA 2C7VA 1BRMA 3WX0A 1XQ1A 2BI7A 3AI3A 3LC1O 3PGXA 3S2GA 4RJTA 1YDEA 2IXBA 4DQXA 2FMUA 4U6SA 4RDHA 5DOZA 1LSSA 1X1TA 3I23A 5A9SB 1UXKA 5JNLA 3H8VA 4CMIA 2Q4EA 1J6UA 3FI9A 4YAIA 4YXFA 2OORA 4DVJA 3INTA 1A9ZA 2VYND 1XYGA 4QX6A 3K73O 5AQ1A 5HS4A 2XF8A 4DWVA 1HETA 4AJ4A 5TT1A 5COQA 3S8MA 4CODB 3ZWCA 1I3NA 4BV9A 1HYGA 1P45A 3GY0A 3DZHA 3INRA 4JBIA 4UVHA 5KJFA 1PEDA 5TGDA 4YJHA 3IKVA 2XXJA 4EITA 1SMKA 3QIVA 1PGNA 3IP1A 1P44A 5THQA 9LDTA 1UAGA 2HO5A 2I65A 4J2HA 5GZ3A 3FPCA 4BMNA 1EUDA 1UAYA 4BMVA 2FSSA 4WLFA 2X9GA 3H5AA 4GPD1 3FBGA 3GN2A 3V2GA 3DZKA 2DLDA 3ETEA 5U9CA 1UXIA 4FS3A 4RVDA 1T24A 1ZH8A 1K6XA 3Q9UA 1DSSG 1QYCA 2HK8A 3O8QA 4MVJP 4MVJM 5BSFA 3BTOA 1TI7A 1YJQA 4LMRA 4Z0TA 4PFJA 3H3FA 3GRPA 3ZHXA 3KHUA 1YXMA 3M2PA 5A9TA 2A94A 2GCGA 4P4NA 4BO7A 2CF5A 2Y93A 3ZHZA 4GH5A 1PSDA 2Y0DA 4EJ0A 2QRJA 2Y68A 1NX6A 3JQBA 3MWEB 1BDBA 3EZYA 1E6EA 3D4OA 1NR1A 2JFHA 3H5NA 4XR4A 5C37A 3AWDA 2QX7A 4BUCA 1R16A 4D0SA 2CD9A 3ST7A 1IZ0A 4GGPA 5KJ1A 2JAHA 3JD0A 1ISMA 2DFDA 2R2GA 2Z95A 3AUAA 3GZNB 3GDOA 4AVYA 3ZWAA 2R6JA 4MIOA 3JQEA 4OGWA 4YT5A 4CM8B 2VUTA 1P77A 2QG4A 3JYOA 5JAIA 1GCUA 3I6IA 3I9KA 2EKPA 3HDJA 5IAAA 2Y0CA 4YRDA 3PI7A 4IDFA 2V6BA 5EIOA 5FF9A 2EV9A 2FPGA 1EVIA 1NHWA 3L07A 4E4YA 1QR6A 4CPDA 6ADHA 1HZZA 1YBAA 2I5PO 4OIMA 5FI3A 1W4ZA 4AJ1A 1N2SA 1P1JA 4RVHA 1NWCA 2EKQA 4Z0HO 4I5FA 2Q1SA 3RUFA 4DTIA 2ZB4A 4C4OA 1NR7A 2B37A 1MXFA 4E5MA 3BA1A 3PHJA 3IIEA 5T6BA 3GVXA 4CM4B 2X5KO 4JROA 4D7AA 1G0OA 1XU9A 4DBZA 1ZUD1 4J9UE 2G17A 4RLHA 4E12A 3NAQA 1EVJA 4L4XA 5I9LA 1Z82A 4IPTA 4CUKA 1Y8QB 2OOSA 3GFBA 1OFGA 4KQWA 4CQMD 1NPYA 4YA6A 3QVOA 3JQGA 3UUWA 4XB1A 4C7KA 2FR8A 4XR9A 1KIFA 2Q49A 4CMEC 1PS8A 1T26A 1WXDA 3B1KA 4ILKA 4J1NA 3OJLA 4XIYA 4BQRA 1DXYA 2HU2A 2VTDA 1ENZA 3JQ8B 3AM5A 4GX5A 4TRNA 1DBVO 3IJRA 3UAGA 4XRRA 1KVTA 1O94A 2CF6A 1Z73A 3FWNA 5DP1A 3VPHA 4CLDA 4BNGA 3I9OA 3GLQA 4IMPA 4MPDA 2V65A 1Y8RB 4L8VA 3IC5A 3GK3A 4Y6RA 4WKGA 3ZI0A 1CF2O 2GN4A 3WLEA 4PRKA 3EHEA 3LF1A 4FFNA 1SAYA 5ITWA 1QLJA 4I5EA 1JDJA 1ZSVA 4NJMB 3HFSA 1LC0A 5G4KA 5BT9A 4CQLB 2E37A 1F8FA 1DDOA 2VOJA 4HFRA 3U49A 1V6AA 3A9WA 4Z9XA 4WECA 2O23A 4IDGA 3VAZA 4IDAA 1P31A 2A35A 3OIFA 5H82A 1M66A 1LDEA 4WEQA 1W0CA 1R4NA 4A0SA 3HB5X 3GVHA 3B6ZA 4DYDA 1EMDA 1P1FA 3TJRA 1OBFO 4L74A 4CM9A 1BXGA 3OA0A 1PJCA 2P5UA 5FFFA 1PGOA 1XA0A 3DONA 3NTRA 1H6BA 3KLMX 3NT2A 3ONDA 1LUAA 4BNWA 5A05A 1HLDA 2YDXA 3ASUA 4RF3A 3PQDA 3MJCA 3ZU2A 1C0LA 4IGEA 2X0NA 4CUJA 3PJDA 2JFFA 3ZWMA 1VM6A 3GOHA 3D3WB 2BLLA 1O8CA 3IKTA 1U2GA 1P1HA 3SLGA 4FSHA 1EK5A 1OC2A 4PGFA 3TL2A 4DGSA 2C5EA 2GZ2A 4LN1A 1F06A 3FWZA 4QUKA 4XRGA 5CDTA 1DC3A 1B3RA 3B20A 1VJTA 4ZRMA 4BO8A 2DTXA 3WGYA 1VL8A 4CM1A 2VT2A 5TJHA 1P1KA 4W7IA 2H9IA 4DQVA 5KVVA 4E5PA 2HKIA 5KCZA 1B15A 1U2DA 2GDZA 4Q9NA 2DAPA 1Z6ZA 4QXMA 5CEJA 1DIRA 5I9NA 5L7WA 5EPOA 3TPCA 3WTBA 3GHYA 4AJPA 2PD3A 2Z1MA 3G1UA 4JXKA 4FIZA 4HBGA 1C1XB 1P9LA 3AY7A 1D4FA 4YQZA 5JCXA 3OA2A 4JIGA 3GDFA 4O0LA 4J7UA 2XXBA 2PZMA 4FFPA 4MP6A 1YB1A 3VPXA 2IDZA 4FOOA 1B14A 4Q3DA 3RU7A 3BMQB 3B1JA 1NQ5A 4E2XA 4RPLA 3CPSA 1YGYA 4ROSA 2ZQZA 4WCFC 2BFAA 2Q99A 2ZB3A 3KYDA 1N9GB 4BO5A 1LDYA 1B2LA 1E3SA 3H65A 2GASA 3F4BA 1MV8A 1O0SA 3BMNB 4PLFA 2VZ8A 1ENYA 2Y0EA 4ZRNA 1D7OA 3W4KA 4XQCA 3V5NA 4GKVA 3BMOB 1EUCA 1XHLA 2QYTA 1E6UA 3HADA 1MGOA 4E13A 3JQ9C 2PR2A 2NU8A 3JQAD 2YW9A 5DCWA 2GZ1A 3G3EA 4ALKA 3AOEA 4H7PA 3DOCA 4U5QA 4I5DA 2AG8A 3NTQA 4CV0A 4NQZA 1UXGA 5L45A 2IYPA 3KEOA 1FDTA 1LDBA 3CZMA 5KVSA 1QLHA 4PLHA 3W8DA 4I9UA 5IDWA 3RCBA 1KVUA 4S3MA 3Q11A 1PWXA 1PZGA 3FBTA 5L95A 5FEUA 4X54A 3GVIA 2GZ3A 3W8FA 1BHSA 5JPIA 1M6HA 1Z7EA 3GDGA 3GVPA 2NQTA 2O2YA 4B3IA 4D0RA 1IL0A 4MP8A 5HRUA 4WCFA 4A5OA 3MOIA 3PJGA 4KWHA 2Q2VA 1IUKA 3H9JA 4QFDA 2D4AA 1T2FA 1LDNA 5DN9A 3HSKA 1BG6A 2C54A 4RPJA 1U3TA 2DTDA 1JN0A 3KTDA 4RZHA 1FJHA 3WJ7A 4BO0A 5C7LO 1U7TA 3I52A 4PG5A 3GGPA 3FPLA 4CLRB 4CM6A 3WMXA 2YY7A 3I5MA 5DP2A 3VZRA 4PIVA 4BO3A 3DEYX 4XKJA 3AUTA 3FRJA 3O4RA 4C7JA 2YJZA 1ZNQO 1ZBQA 3PQFA 3AM4A 2ZB7A 3VKUA 3KYCA 3NDRA 5HA5A 2FPPA 3I4FA 3NGXA 4BKPA 1NASA 4YRAA 4CV2A 5CHEA 1GFSA 4WNCA 4MKXA 4BGVA 4MVJH 1VSVA 4P22A 3CZRA 1LDMA 1HF3A 2ZCVA 1A5ZA 1PJ4A 1VE9A 5CPBA 4YWJA 2HMUA 3U0BA 1J49A 4CR6A 2I67A 1R4MA 3HDQA 1B3BA 1XGKA 4AG3A 2EP5A 1I3MA 1Z7BA 3OQBA 4ND1A 3TOXA 3MCVA 4IBOA 2ZKLA 2RH8A 1PX0A 1GPDG 4BNLA 1GD1O 2I3GA 1Y6JA 3MTGA 4HFJA 3RIHA 1I01A 5EESA 5IFLA 4HKTA 3ADPA 1AN9A 2BD0A 3W6ZA 1DC5A 1FMCA 3UCFA 1X7DA 4YAJA 1ZCJA 3WBFA 4WUVA 3RC9A 1YVEI 4Q3CA 4M55A 2HMTA 1CQJA 3NX4A 1N92A 4J91A 5TS3A 5KJ6A 4FW8A 1H9AA 4EDFA 2HDHA 4P4GA 3OQ6A 2DUWA 4GX0A 2WYUA 5TJ9A 4BNXA 3PRJA 1DRWA 2FZWA 2X0RA 3FN4A 4N5NA 3PVZA 4CMIB 1BMDA 1XDWA 3HQ4O 4Z6KA 4U7WA 2P4QA 2D5AA 2VWHA 3HDYA 3S1LA 4BL5A 4M54A 5JCJD 5FI5A 3UW3A 2B5WA 2V7PA 3PFFA 4RCVA 1Y1PA 5DT9A 3NJ4A 4NK5A 2AE2A 2GN6A 4YT8A 5JC1A 3WBBA 4J4BA 1E3WA 1DFIA 4GWGA 2OO5A 2R00C 3BZUA 1UJMA 4B7UA 1GPJA 1E3EA 3STHA 2YV2A 3ZHBA 4RVFA 1B16A 4LGVA 2FHSA 4KTVE 2QIOA 3RC7A 4PVCA 2BI8A 4YJDA 1E1KA 2PV7A 4MVJF 3ROMA 4P4LA 3RBZA 4PLYA 1YO6A 1PGQA 3G49A 4J2OA 3EAGA 1DFHA 1MX3A 4BNKA 2HAEA 2O50A 2VOEA 3S2FA 5B37A 4BNHA 3WQSB 1U1IA 2PH3A 5F1OA 1TT5A 3PZBA 4DRYA 1ISIA 4KUEA 1M75A 1HT0A 5IZCC 2PLAA 1KC1A 4RV9A 3UOGA 1T1RA 2IZ0A 2X58A 4ND3A 2G5CA 3D0OA 4IJKA 5I7EA 1JTVA 4N5MA 2DKNA 1JWBB 3UF0A 1EFKA 2G0TA 4CLEA 3WGIA 1EE2A 2EIHA 4XCVA 1GUZA 3TL3A 3CKYA 3DL2A 1GAEO 1XG5A 4P38A 4CLOA 1X0XA 2AXQA 2A4KA 3L4SO 4I5GA 3ZWNA 3TOZA 5EQDA 1SNYA 2WJPA 4II2A 3UICA 4IQGA 1CEQA 2JFGA 1DLIA 1NQAO 1ADCA 1FXSA 4ND5A 3ZNQA 1ZMTA 1H0KA 5ILGA 5JMWA 2J8ZA 1BW9A 1Z74A 1Z75A 4NBTA 3OQ1A 4OSPA 2FR0A 5KVCA 4QEDA 4OM8A 4UUOA 5K9ZA 1N1GA 1N7HA 1IY8A 5C7IO 1KY5A 5BSGA 3QW2A 4Z3DA 3ZHYA 3DFZA 2EWMA 2DPHA 1DO8A 1KETA 1LRLA 3IUPA 3L6OO 2EHDA 2NNLD 2ZYGA 4UULA 3LLSA 4R3WA 5ADHA 3MZ0A 4UVDA 4XA8A 4QO7A 3RUCA 1NPDA 1DAPA 3L6DA 1GV0A 3A1NA 3TZQA 4CMHA 2CVOA 4QT0A 3BXXA 5L4SA 1ZJZA 3SX2A 3R1IA 1T1SA 2JKVA 3BTSA 3VPSA 2GRAA 8ADHA 4TKLA 4PZEA 5F3RA 3RUAA 3H2ZA 1LLDA 3S55A 2I66A 3ZWXA 3ZWYA 3RQSA 2PZLA 3K96A 1N7GA 5K6AC 2JCXA 5AXDA 1L7DA 4D44A 3VVCA 4DC0A 4IDBA 3QSGA 3JQGB 4FFLA 4MVJG 3VZSA 1LQUA 3RC1A 5IDXA 1O9BA 4XZ3A 4NMHA 4D79A 4YR9A 4LVUA 3W4IA 1YONA 3C1OA 2WM3A 1FK8A 2Q50A 2BGMA 4ID9A 1NM5A 4TVBA 1OC4A 5CAEA 1WDKA 1AUPA 1N1EA 4RF2A 4WE3A 3L4BC 4IJVA 4GX2A 1F0YA 1YBVA 3MJSA 2NVBA 3ZDFA 2C59A 2X4GA 3DBRA 4N18A 2JCVA 2PD4A 4UVIA 4CR8A 3L9WA 1IHXA 3EDMA 3JYPA 1YL7A 5F5LA 5CDGA 4ND2A 4CM3A 1LC3A 4YJGB 2BHLA 4HADA 3PLRA 1PL8A 3CMCO 3OJEA 2AQ8A 5TF4A 4FR5A 3C1AA 5ES3A 2W2LA 4FOSA 2GGSA 1HDCA 2GD1O 3K2EA 3QWFA 2VQ3A 5JE8A 4RLSA 4EEXA 2TMGA 1PIWA 1HYHA 2DTEA 1WZIA 1BVUA 3WTCA 2NVWA 5EJ2A 3H6KA 5G4KB 3TQHA 2X7HA 3NT4A 1DJNA 5K6AA 3L6EA 1ISFA 1ZK2A 1QG6A 1W6UA 3PDUA 3RROA 5AXAA 4YB8A 4CLHA 2DFVA 2VHZA 4D43A 3UCXA 3H7AA 1R4NB 4K6FA 4FDAA 2O7QA 3W1VA 4F46A 2FP4A 1JAXA 5A02A 4MDHA 2DBVO 3L4BA 4PLWA 3ZV4A 4FFOA 1BXGB 3TZHA 1T2DA 3F47A 4WLVA 1CQIA 2B0JA 5DDIP 3GG2A 1EBFA 4AL4A 5JXWA 3IL2A 1P0FA 3TFOA 1B0AA 5A5FA 1DHRA 3JYQA 1F8GA 4OO3A 4W4TA 4L4SA 3JQDA 1X13A 1DHTA 1GYRA 3E48A 4CMGA 1ID1A 5TQVA 4ITUA 4EJ6A 1UXJA 4GBJA 3GNTA 3PWSA 1NQTA 1IB6A 4LMPA 3WJAA 1P33A 5K0ZA 3U5TA 3CH6A 1DIBA 4O6VA 3AI2A 4OL9A 1IPEA 3U09A 3PWKA 3QWHA 3FSRA 2UV8A 3OEYA 5COAA 3QVSA 5ER9A 1U8FO 5TIIA 4EI2A 1I3LA 3WB9A 3MEQA 3F3SA 3WNVA 2I9PA 3U62A 1W8DA 4ZHSA 1X0VA 4XEHA 3JQBC 4IZIA 1WDLA 4B8ZA 4ND4A 4MO2A 3K6JA 3H9QA 4B79A 3N74A 4INAA 4KOAA 2AQIA 2GPTA 3SEFA 3ZW9A 1QYWA 5B4VA 2D3TA 1Y9EA 3AUUA 3PWZA 2YQ4A 4E2ZA 2HRZA 3VVBA 5A4DA 3BMCA 1VPDA 2D59A 3BIOA 2AEJA 1EEHA 4RVGA 3KYDB 4PN3A 3F46A 1M67A 2CDBA 4RQTA 5IXYA 2VUUA 1Y7TA 3BTVA 5DULA 4J1TA 2CDCA 1ZXBA 2DM6A 1JA9A 5JLAA 1YH3A 3P2OA 3QA9A 1GL3A 1MP0A 1YQDA 2E6UX 2JHGA 4E31A 3PIIA 1VKOA 4MVJA 3P7MA 5IN5A 1VSUA 3GR6A 3D7LA 4W9NA 1DC4A 2E48A 5BNIA 2ZYAA 1K6IA 4NK4A 4KUGA 3GGGA 3AW9A 4OH1A 1NBOA 3RI3A 4FJ2A 1Y5MA 1LXCA 2W90A 3I9JA 1JWAB 3WMWA 4R1NA 4CMJA 3GA0A 5DF1A 4J0EA 4JJIA 4EYEA 4XX0A 4CV3A 4FJ1A 4GLOA 2P68A 1ZMOA 4A10A 2C2XA 4EUFA 1ARZA 1E0DA 2AEFA 3K30A 4WCFB 1AGNA 3RJ9A 2O3RA 3QV1A 4D45A 1G1AA 2EJWA 3AI1A 2HK7A 1UP7A 3E1KA 4NJOA 3ETDA 3QP9A 2DUUA 4ZVVA 3LT1A 4G5HA 3I9MA 1I2CA 2Q2WA 4KP7A 3ROKA 3GF4A 3C7DB 1B26A 4FD3A 5HBRA 2I99A 5ILOA 1JVBA 3ABIA 3ZN2A 1XELA 3JQ7A 5IXSA 3FR7A 4ZGWA 1RM3A 4XB2A 2A92A 1S6YA 2POQX 3KYCB 1E3LA 3PHGA 1C3VA 5COBA 2Y1CA 4NU6A 1TEHA 4FQ8A 2VWGA 1GEGA 1MC5A 1KBZA 1GTMA 1ONOA 2WTBA 4O1MA 2NV6A 1GY8A 2OBYA 3KVOA 4GKBA 4DLBA 3RBXA 3WYBA 2QZ9A 1IYZA 3KEQA 1R4MB 2ZTVA 2TMDA 1DJQA 2EEZA 2NWQA 2UYYA 3O9ZA 1VI2A 4F6LA 2GN9A 5G0SA 2JD0A 4GL4A 4HFNA 2RHCA 2YHUA 5H83A 1K0UA 1GR0A 3O26A 2WDZA 2AEMA 4R3NA 1NQOA 2RIRA 4GI2A 5ENDA 3UHAA 5EINA 3GUCA 1GV1A 3GMDA 2B4QA 3RUIA 4PLTA 1XIVA 3HE3A 1K89A 4FN4A 1SB9A 3CSDA 1X14A 4OKNA 4BO1A 3DC2A 3R0IA 3GAFA 4F3YA 5JY6A 1DC6A 1U3VA 1PJLA 3KO8A 4A2CA 2E49A 3RAJA 2VYNA 3V1UA 4BB6A 4DBVO 1SOWA 4R1TA 4LVCA 4J16A 4JBGA 5EERA 1GADO 2YHIA 1U4SA 3ONEA 3WFJA 5JS6A 4I8XA 4MINA 3JYLA 4BNIA 2D0IA 3GEMA 4HNGA 3BHJA 3GNQA 4IGFA 5FYDA 1ZW1A 1C1DA 1UXHA 1H94A 3RVDA 3SXPA 5FWNA 5TLSA 1T2AA 4BHTA 4TKMA 3LF2A 5EMHA 1MG5A 4OKIA 4D46A 2WYWA 4M86A 5JDIC 4B4OA 4JP3A 4LRTB 3U4DA 1HEUA 1ONPA 2P9EA 4WLEA 1LQTA 4LW8A 1E3WB 3TZKA 3DAPA 1ZZEA 1YL6A 1YOVA 2AA3A 4I9HA 4XWYA 4W82A 3H9GA 2CZCA 3IUSA 5KOIA 3TDKA 2RHRA 4HWKA 2YV3A 3FNGA 4ZQFA 5F21A 5GY7A 4FJ0A 3SBOA 1I33A 1PU2A 4D3SA 1C0IA 3LK7A 4R01A 3OP4A 3VH4A 1BVRA 1Q7CA 2I76A 1PS9A 3WXBA 1E7RA 3U9LA 4JBHA 2ZYDA 3QWIA 4J43A 4F6CA 1TT5B 1CWUA 2GSDA 2EW2A 4WJZA 4EW6A 4U8GA 4DMMA 5L3ZA 4GGOA 4UEJA 7ADHA 3HZZA 3NYWA 3TWOA 2HMWA 1RPNA 1GQYA 2PGDA 4UUMA 1NXQA 3WGQA 1ZEJA 1Q0LA 1LNQA 1LSUA 4W7HA 1I36A 4B3JA 1Q0QA 4NI5A 3V2UA 4CLXA 2ZK7A 2ZTMA 3S2EA 4JK3A 5JDIA 1IE3A 3AOEC 5BSHA 2E4AA 3GVCA 3PHHA 1U3WA 3TF5A 4NFYA 3I3OA 2BH9A 3M6IA 4XD2A 4CLOB 3DFUA 1J5PA 1P0CA 3E9MA 3PDJA 4MKZA 3M1AA 2F1KA 1CRWG 1NWHA 3GUYA 4D3DA 1JKJA 1EVZA 4NG5A 4UREA 3VKVA 4YRBA 3SJ7A 3E5MA 4HFMA 3GFGA 2BGLA 3LVFO 1CYDA 4XQGA 4D41A 1WNTA 3UKOA 4FC6A 1A27A 1BW9B 2IZZA 1LI4A 3F6YA 3H3JA 2P2SA 2VYVD 4M49A 5ENVA 1ORRA 1ZSNA 3ULKA 3CEAA 1HDXA 3C24A 4NR0A 1AE1A 1LBEA 4FGWA 4J6FA 5CDUA 2HRBA 3CE6A 3L0DA 1I24A 2QHXA 3IOYA 4U0KA 1U28A 1GCOA 3TRIA 2D2IA 4XYGA 3DO5A 3WLFA 4OHUA 3OEWA 2PZKA 3E5RA 3WSWA 4OOEA 5AVOA 4LRSB 1PQUA 3DTTA 1ZIDA 3FNFA 5L4LA 4F45A 3WGTA 3VZPA 3EYWA 3GQVA 3RKRA 3TFQA 4EZBA 1HLPA 4BV8A 5KVQA 4IXTA 2NM0A 3H9UA 4CQMA 1YWGO 3DBLA 4YAEA 4II3A 5CDYA 2PFGA 2Q46A 4J1SA 1N8KA 4PLPA 3TNLA 1TXGA 3ITKA 4XGIA 3WG9A 2QW8A 2JD2A 2JAPA 5T67A 2H6EA 4TWRA 3IMFA 3WSVA 5L53A 4Q3BA 3FTNA 1PZEA 3TSCA 3QLJA 5CPFA 4AJLA 4ALNA 1E5QA 2BFOA 3HWRA 1VKNA 3CIFA 4XQ9A 1SCUA 4IXWA 2YQ5A 5JO0A 1MFZA 3IQDB 5BQFA 2RCYA 5B1YA 3FD8A 3ZU4A 1K2WA 1DIHA 3DBRB 2CNBA 3KUXA 4K28A 1YQGA 1VJ1A 1XEAA 4J4TA 3AY6A 2FZEA 3EGOA 4R4JA 2X9NA 3HN7A 5THKA 4D42A 1Q2XA 3RC2A 2P5YA 1HRDA 1DLJA 2J6IA 3AUSA 3NT5A 4N5LA 3G0OA 4RF4A 2VUSA 5JY1A 1E1MA 2HLPA 3FR8A 3O03A 5I9MA 4ZICA 1EVYA 3QVTA 5F1KA 4MVJE 1WMBA 3A06A 5IDYA 1V35A 1XQ6A 2NSDA 2DT5A 4R9RA 3BHIA 3RFXA 5C3MA 2G1UA 3OF2A 2WD7A 3K2BA 4R5HA 1UP4A 1TA4A 4CJXA 5I8ZA 3K9QO 4M89A 3VTFA 3WR5A 4DIOA 5L40A 3WIEA 4YAGA 4YVFA 3GAZA 1TVEA 2X5JO 5AXCA 5U4QA 1B8PA 2W4QA 3NGLA 2EG9A 2IEDA 4DIBA 5ICSA 3KSUA 2DBQA 5JDCA 3DAGA 3ORFA 3DDNA 4MP3A 4KZPA 4M87A 4NNJA 4CR7A 4Q3AA 2X9VA 2Y1GA 5BNFA 1HDGO 2VNAA 1MB4A 4TZTA 1YJ8A 1WAMA 2C07A 1KEPA 4DPLA 4LISA 2GO1A 4BVAA 1UZMA 1V3TA 4BNJA 3QVXA 4XYBA 1MLDA 5T64A 4BGUA 4NZ9A 6LDHA 1IPFA 3ICPA 4H15A 3VH3A 2YFHA 5H81A 4Z3KA 5TT0A 3HN2A 4RDIA 4I9NA 5T8KC 1HYEA 3VZQA 1WDMA 3ANNA 4Y98A 4W99A 1ADGA 3Q0EA 2JHFA 2GNAA 5GZ1A 3LZ6A 1EQ2A 3GMSA 3AY3A 1OZAA 2ZIZA 1QRRA 3KLPX 3JCZA 2E82A 1YQXA 4DC1A 3A28A 5A9RA 1QYDA 1VC2A 2WMDA 3RJ5A 1KEWA 3DZGA 3AFNA 4R54A 4HNHA 4DUPA 1DIAA 3DHYA 4JP2A 4NDNE 2B5VA 2HCTA 4EUEA 4YJHB 3PFWO 1PL7A 1X1EA 4J3FA 4RVUA 1F12A 2GN8A 5EQFA 1YDWA 4LCJA 3MOGA 1QV7A 3BMCB 5JYEA 1E5LA 2Q1WA 2WE7A 3AK4A 2NACA 3UCEA 3JQAA 5IN4A 4BNZA 4CQLA 1DB3A 1OMOA 1RYEA 1SB8A 3PEFA 2YYYA 5JSFA 1VLLA 1PJ2A 4J90A 1UDCA 1V3VA 1LLUA 4JJGA 1GZ4A 3RU9A 4W6ZA 3DHEA 4HX5A 3RASA 4GMFA 4YJFA 3DOOA 4E33A 4E0BA 4ZD6A 3O8QB 1P3DA 5T8KA 1Q1NA 2X22A 3JQFA 3NEPX 3ZGYA 1B8VA 2PKRA 4OMUA 1T4DA 3DBHA 4K9DA 3HDHA 4IZHA 3A14A 3QHAA 3GH3A 2VHWA 1F14A 3OH8A 1O95A 1HDYA 4B3HA 4DYVA 2FWMX 2O4UX 4R1SA 5J23A 3I6QA 1QORA 1HE3A 2IEBA 4I08A 4TRRA 5JYDA 4OXYA 4OSOA 2C29D 2VHYA 5B4TA 4XYMA 1P1IA 3WYEA 3P2YA 1NAIA 4RVSA 4E21A 3W6UA 4BGEA 4XIJA 3D5TA 1KVSA 2BKAA 1O5IA 3Q1LA 4R5MA 4XQEA 4J4HA 2UVDA 2VRBA 3R3JA 4B4UA 3DZIA 1H6AA 2ZB8A 3G1TA 2Y1EA 3WWYA 1D1SA 2C0CA 1NAHA 1HE5A 1P74A 4E2WA 2FY8A 2WEKA 1DEHA 1QYVA 3OM9A 3DMYA 2VNSA 1ZK0A 2FN7A 4EJMA 3WNQA 2AQHA 2IYOA 5G0VA 1JKFA 2DU8A 3JQ7B 5HS6A 5U1PA 1V3UA 3EVNA 3AU9A 1U4OA 1A4UA 3S2IA 5HTOA 4AJJA 1UZLA 2PD6A 1WZEA 1XWFA 2Q2QA 2J5QA 4KQXA 4QTZA 5G0UA 5GMOA 5TNXA 1H6CA 4PRLA 4RQUA 1MG0A 1RKXA 2X5OA 3COSA 3AM3A 3RSHA 2I6TA 1H6DA 5KWEA 3NRCA 3ANLA 4PZDA 3KM0A 3LQFA 4QSMA 2C2YA 2EW8A 4Z0PA 3PXXA 2WSBA 1QMGA 3K5PA 4TSKA 3MJEA 4QFCA 4WLUA 5DOVA 2BRUA 5CG2A 1RJWA 3T4XA 3JD2A 4HXYA 3WFIA 4DLLA 3QVWA 5IZ4A 2GR9A 4UVEA 4R1UA 4HV4A 1HL3A 3EUWA 1T25A 2ZTLA 4B8WA 1C0PA 4L75A 1E7SA 1JQBA 3F9IA 2BELA 3KB6A 3BTUA 5I8WA 3SLKA 2V6MA 4BO9A 3DAFA 3D4NA 3FNHA 2HMSA 2YHIB 5JCJA 4PG6A 5IDQA 2AW5A 3QQPA 3MWDB 4PVDA 2GUGA 3B1FA 1HE4A 1EE9A 4R16A 3E9NA 3DWFA 1E7WA 1C1DB 2X8LA 3VTZA 1JW9B 2PGLA 1FF9A 1S7CA 4IDDA 3MJ4A 2OP0A 4BGIA 3X2FA 3ZWOA 4JCOA 3VH1A 1EZ4A 4G65A 3MJTA 4GVXA 4EEZA 3C7CB 4QO8A 4XJTA 1YOVB 2NUAA 4ZJUA 4DA9A 5KTKA 3UVEA 1O6ZA 4LCEA 4NBUA 1M6WA 4YAKA 4YYZA 1WMAA 1JKIA 2J3HA 3P5SA 3UGKA 1G0NA 5A03A 3C1TA 2Q1UA 3OFSA 3PYLA 1NFQA 4Y9DA 1GU7A 4O59O 1ZXLA 1BSVA 3I4CA 4TVOA 5DNAA 3VH2A 2RBEA 2X0IA 1FDSA 4IMRA 4RO0A 5G2OA 4BO4A 1CERA 5BR7A 3U4HA 4HP8A 1YKFA 2NTNA 3U4CA 1ONNA 2BMAA 1PJBA 2X23A 3H2SA 1B7GO 3D3EA 2O7SA 4HY3A 4BMSA 2B4RO 1KC3A 4E5NA 5L7YA 2Q3EA 2ZJ1A 1MA0A 3ONFA 3PK0A 1IZ9A 4W9NC 4A73A 3WWZA 4M1QA 3KSZO 3W8EA 1OAAA 4CMKA 1I8TA 4GAEA 2ET6A 1HXHA 1QKIA 2DPGA 2H63A 2YV1A 4K26A 3IDSA 4CMCA 4LK3A 1V9LA 4CL8A 1GYQA 4R68A 3PHLA 1A72A 1OI7A 4O63O 1TLTA 2EF1A 3WOHA 2H1SA 1LSOA 4YBZA 2OBNA 1BTOA 2HQ1A 3ZV3A 1EUZA 2PWZA 3ZU3A 1CDOA 2UAGA 1Y81A 2WWRA 1ZK1A 1TT7A 3HJAA 1WVGA 4RL6A 2Y99A 3KZVA 1EFLA 1L7EA 3RKUA 5TX7A 4A27A 4BNVA 2CVQA 4FBGA 5JFOA 2VT3A 1DAOA 1GZ3A 4IS2A 4BKUA 4IJWA 4B7CA 2EJVA 4N54A 3OIDA 5A06A 3WYCA 4J49A 1XR3A 4NFSA 2EERA 3PTZA 4QQRA 2O4CA 2GLXA 3E82A 4J9VA 3DOJA 4TROA 4XGNA 2DC1A 3MTJA 1GEEA 5HWSA 4PG4A 3PYXA 4ALMA 2DVMA 1PGJA 4I1IA 1E7QA 1PS0A 1X15A 2GERA 3CUKA 4RF5A 4CQMB 1LSJA 2FSVA 5KNLA 3UH1A 5T5QA 3DBLB 1YL5A 4GWKA 4Q3EA 1A71A 2ZATA 1YB5A 7MDHA 1SC6A 3ENNA 1HWYA 4BOYA 2AE1A 2O3TA 1NNUA 4PG7A
chains in the Genus database with same CATH superfamily
4MJ7A 4NENA 1ZVMA 3CW8X 2CD7A 1OWPA 2PSSA 3OZTA 4W9MC 1ZJJA 4J03A 2YWBA 3B2QA 1A04A 2XOXA 3PIRA 2DQYA 3FTPA 2QN3A 4P33A 3LT2A 5E3JA 3DLBA 2KM1A 3ND7A 3O7WA 3RUHA 4Q6BA 3NXSA 4R81A 1X80B 2ZRMA 1SHKA 3WP0A 4EUKA 3PUJA 3R5XA 2BGKA 3O4IA 2VPXA 4HB4A 2DQSA 1ZK4A 2OQ2A 4O4JF 3ZGVA 3FCCA 3ZKWA 4GMXA 1Q15A 1SCUB 4F04A 2VRCD 3SM9A 3DZBA 4EMBA 1I14A 2EZUA 1WS6A 1CR1A 2AXEA 3CRVA 4A26A 3K5IA 1T2EA 4ALIA 3CHYA 3AOGA 4KMOA 2C9ZA 3AO0B 4RIFA 3S8YA 1P8JA 1NG1A 4YCCA 2WE8A 1SPXA 3OFKA 4RPHA 3NHKA 3RBVA 4ZXPA 3PLAE 2HB6A 3LRTA 1H9BA 5B7PA 1U3DA 2JI6A 1ZJYA 4NMWA 5ALIA 1KP3A 2H06A 2G7MC 2QG6A 3OZIA 4N7RA 1EXVA 4FFMA 5BY2A 1Q1BA 1AF4A 3IILA 3RAFC 3BDAA 3OFVA 2P11A 3C5VA 4KO3S 1ODJA 1C1YA 4BWVA 2JL1A 3KQYA 4IO1A 2ZIEA 5AJVB 2HEIA 3G13A 3T12A 1WRBA 1BYUA 5TQJA 2G9RA 3ZTWA 3VU3A 2H0AA 4A8TA 2WD7B 4XJVA 2IXTA 3VR5H 2C7GA 1JU3A 3AVYA 1PBNA 2J41A 2JKYA 4KSCA 2BTEA 2J4CA 4L0DA 3ZCXA 3PPYA 1J8DA 3U4IA 2GRUA 2QTRA 3KQMA 3ZW8A 1ZICA 2XCIA 3M34A 4N3AA 3SVTA 1L3IA 2ODBA 5JNVA 5ICMA 1IG0A 3VC7A 1AKWA 4IEFB 4JLJA 3ZE6A 4OGGA 4Q3OA 1WHTA 4PTZA 2QXYA 1DRVA 1GT6A 3ZYZA 4CQNA 2P3OA 4JSRA 4JU8A 1NPTO 5H80A 3ZV7A 5K8TA 5EJ7A 4FYMA 4G86A 5HKOA 5LSAA 1U65A 4K86A 2ZVDA 2XUJA 1JHPA 1WTCA 4FD2A 4I8DA 4HAYA 4AJ2A 5I5GA 1Z2EA 5B1HA 4CV1A 5HTKA 2ORWA 2GZDA 2P9GA 4ZYUA 1OROA 4Q05A 4Z7QB 1RE1A 3QX3A 1E1NA 3RTDA 1QMPA 4ZYYA 2PKYX 4JLWA 3ESCA 5FTWA 4R7GA 4GICA 3GUZA 1R50A 3V8NA 2YWFA 2FFRA 4WBSA 3G7NA 3MCUA 1ITZA 5I3CA 3QVVA 4TV8B 3TLCA 1AC5A 3NTVA 1DBSA 1DX6A 1Q7BA 3U7QB 3TJMA 1PNRA 4QDXA 1BXZA 1OH5A 1LPOA 1MABB 1SKYB 2IL1A 3K0HA 1N8TA 1Z35A 2N75A 5DYYA 2WU0A 3H2HA 1KKUA 2FX5A 2IYAA 4KYIB 4L8FA 4WGGA 3FYHA 2WJIA 3B3AA 4MUJA 4MQUA 1BDHA 1IZ7A 1JT9A 4PV7A 2BGTA 2V6JA 4HAXA 4ZJPA 3MWGA 3V4FA 2ESRA 2ZTUA 4BQOA 4MI9A 3W7AA 2LVBA 4NU5A 1MO5A 2RB4A 2YYAA 1DQRA 4NABA 1OVMA 4KFUA 1ZN7A 4HN9A 1A1SA 2Q3JA 2GM3A 4K6OA 1J06A 1U8UA 2CJYA 3A7DA 3IAM1 1KF0A 3SQDA 2NLOA 2NXCA 3GPLA 3QPAA 3P4UA 5AVJA 3QU9A 3AHHA 2CDAA 2WAOA 3SF0A 3EUAA 2FRDA 2FCAA 3MWJA 1CULC 3WKBA 3ZV6A 5DBGA 3EIOA 1YACA 3JVUA 4C2TA 5FOTA 3WGOA 4NCBA 4EUNA 1TF7A 2O1XA 2Q9UA 4QEZA 2C8JA 4I81A 6REQA 1A4IA 3QKIA 1I2ZA 2FOIA 1H1LB 4G4SP 4DL9A 1NQUA 2EXXA 1J1ZA 1NKTA 4LY9A 4YQEA 4BWFB 5IWAB 5C0OE 1K2VN 2VO1A 3G59A 4YDRA 2Z6UA 4CMEA 2YMPA 4ENVA 1PT7A 5JECA 5EJFA 3U3XA 1U8TA 4D5GA 5DMXA 3VR4A 4RLFA 5K0GA 2CV1A 1A82A 1UJ5A 3BGOS 5LC1A 1TD9A 3OMLA 1D1TA 3E03A 3VKWA 1P7YA 4ARSA 3THSA 3FYTA 3U26A 3X3HA 5JC8A 5ELXA 1C0KA 1NVTA 2NO1A 1ZKMA 4DNOA 2ZI7A 4NPCA 3B1XA 4P8RA 2IODA 3HHPA 1E94E 1ZAKA 4IFIA 1EPUA 5L9AA 2CY0A 3BERA 4QPDA 2BEUB 4TLAA 6GPBA 2P9BA 5JADA 1RADA 1G4HA 1U3UA 1VCOA 3NUGA 5KYUA 4AJOA 5KMGA 4DDHA 2HF8A 5AKYA 1E2NA 4C0BA 4EVQA 4HRVA 3V1TC 3IQFA 3H5RA 4BNYA 2AX3A 2WNHA 2EZTA 1MZPA 3SC6A 2HM7A 2OZPA 2PBFA 4U7PB 3CVOA 5A9SA 1U0RA 2PL3A 3BFXA 1D1QA 4AJEA 3NYIA 1KPGA 1Q0SA 1ULBA 2P2DA 5T41A 1L1FA 2Z58A 2C2OA 4IILA 3PF8A 3MSXA 2JFYA 1HT1E 3E8XA 4KVFA 1JFTA 4AY2A 3FPAA 3MRSA 2WOJA 4XYEA 4J75A 2P69A 3Q1KA 1PEAA 1Z6GA 2BEWB 1AGPA 3L0ZA 4JD5A 3RVKA 2VXCA 4XARA 2BM1A 3PWTA 2O2IA 1TVKA 3L01A 3JD4A 3TZCA 4CXMA 1LRKA 2BAGA 2HH9A 3T38A 1QF9A 4JBLA 1A2QA 2JIDA 4FCTA 3GJXC 4Q1EA 1A97A 2UUPA 1RPTA 3CR7A 1UDBA 1GQOA 1XZFA 5D01A 3C3XA 2D0PB 1IVSA 4TL6A 4J0FA 1NJSA 1KI6A 5KOHA 2DBZA 3R6DA 3RRMA 3G9QA 4AKEA 1I5RA 4AJNA 2Q1XA 1Q6YA 3PPIA 3QFSA 5AI0A 1K9VF 5JFGA 1UPCA 2CLFB 1M7GA 3DBIA 1MB3A 3B8EA 1G3RA 3ISTA 4LQLA 3JASB 4WADA 1U0SY 1DV1A 2QX8A 2YMQA 1JLSA 2YJ6A 1YZFA 2HA0A 3ESXA 4KMSA 4C7OB 2A9FA 2A1IA 2PLWA 2ZBQA 4K9PA 4QBGB 2REOA 4TMFA 5CEEA 4DV4B 3LCJA 2AFIA 1OLUB 1WW2A 2PKQO 1Z29A 1Z0UA 2PK3A 3J7TA 4Z1OA 2AQKA 2E18A 2Y3IA 4I1SA 5JDCC 2OOKA 2V8OA 2WF5A 3MLAA 4Y6SA 2FYTA 4ZHQF 5KNBH 1RQGA 1XK7A 3MWEA 3C3BA 1LBQA 4RY2A 2JCYA 1M2KA 4DV0B 4YLGA 4U7FA 2BTQB 2CWWA 3FXAA 1DVRA 1QFSA 3AY0A 4Q39A 3X1DA 2F6RA 2IPOA 2W98A 4GVLA 1AX9A 3BYZA 3OBBA 3OX3A 3FTQA 4JQSA 4PYOA 5I8PA 1ECGA 1M2HA 1KK0A 5A5EA 1IXZA 3MK31 3PEUA 3LG2A 3SYMA 1CFJA 4BUZA 1PR9A 1N78A 3EPKA 4NOKA 1P1BA 3R3SA 1JXMA 1HFJA 4E6EA 2SNIE 4CGZA 1U0OC 3WXMA 1JMVA 5ECYA 3W4JA 5BUQA 3S68A 2J7PA 1Z4JA 5A3JA 1T5SA 2WTAA 4J3NA 2UUOA 2XKJE 3NOXA 4L7QA 1U0FA 3FYSA 4ZTBA 3R3WA 1E32A 4O1IA 1Y5RA 2V97A 4O5OA 4OQZA 1U7OA 1BXKA 1QB8A 4JY7A 2V6GA 3BGIA 3O83A 1NNLA 4EK9A 2PUGA 4Q1CA 1CETA 3V8BA 4CL3A 1M1ZA 4JDUA 5F1YA 1E2JA 1K5HA 2DH6A 3V4OA 1NN5A 3B9PA 4QGAA 10MHA 1Z6PA 4G56A 5D3KA 3J81k 1KJIA 1XALA 1L8QA 4PS1A 2QEQA 5KKAA 1T9DA 1I0IA 3MWYW 4Y0VA 1QP8A 3PCRB 3Q98A 4QRIA 4AN4A 3H5TA 3SS8A 5F9FA 1WSDA 1XAHA 4IM7A 4JZYA 4UOZA 3W7VA 1VFNA 5DBIA 4G2TA 4IIGA 1GYPA 2W6IA 4NMMA 3DQPA 3WO0A 3L0PA 1DFGA 1KZ4A 4LJ5A 4Z49A 3WGHA 2CHQA 1RNLA 2IK8A 3M89A 1HSZA 1Y8QA 1WEKA 2GJ9A 1DMSA 2XQFA 3B12A 4NFHA 2ZBGA 1QVZA 3N58A 4DBLC 4DJDC 3C8MA 3TKAA 2WG2A 3HB9A 5JR3A 4NU8X 1A7KA 2OXRA 5TMEA 2ZIXB 3FOAA 3MRTA 5E8RA 1FPQA 4ZYVA 4IFBA 2Q5QA 3H9EO 3PJFA 3KD3A 3P52A 2XEXA 1SA0A 2NADA 2QTBA 4GWLA 4KE9A 4ZANA 1R15A 3FSJX 3K8QA 5H59A 4ALLA 4DNXA 2XNHA 2CNWA 3BN3A 4QYMA 2GCNA 3UKDA 3JQ8A 4BY9E 1OAKA 3N2ZB 2FPWA 4PZCA 4WLOA 3W34A 2AJDA 1X9IA 3KV3O 4QUHA 8GPBA 1IOVA 2C5FA 4Y6QA 1O95C 3CONA 4GOND 1L4HA 2CSUA 4MIYA 5G0TA 4ZVRA 3AJ9A 2VYVA 4TTPA 3UO8B 1C30A 3G8AA 4KVGA 3ZDQA 4GR5A 2WQ6A 2H4HA 1T2CA 3VPFA 4OX9Y 3JV7A 2NTJA 2CXSA 2ZG6A 3MINB 2F3SA 3R76A 4LJ6A 3NDPA 4I1UA 1J9ZA 2V03A 4IF4A 1T0BA 2YN4A 5KYNA 1SBYA 1H1DA 1RBYA 3OSUA 5HQTA 1RZRD 3GT4A 3ER8A 4WLNA 2BJHA 1TQHA 2RAFA 5K8LA 5CW2A 2RARA 2JLAA 3OM0A 1R0KA 2CFCA 4N39A 1E2IA 4GBMA 3F5MA 1YS1X 1SUEA 1PHRA 4S2UA 2ZREA 1PZXA 2NU9A 1VIAA 3R7LA 4F8EA 3NMUF 4OIFA 1F20A 1G6KA 1HFWA 3DZDA 2C57A 5CCDA 1XZHA 4MV5A 3QFTA 4R8VA 4DKXA 3AW8A 3L82B 5JWOA 1MFPA 3KQNA 4FYWA 1RWQA 1VECA 4Z3OA 1DTWA 1V8BA 3GLHE 2GVDC 4KFSA 3V4VB 5IXJA 1SXJA 4QBTA 3O8RA 3AEQA 4MVJI 2QTLA 4V03A 1JAZA 4BMYA 1UZNA 1GTL1 3LDHA 4RABA 1UZAA 3TI9A 5K8IA 3M6WA 4PCAA 4RZUA 4BO2A 5DCYA 3JSAA 3SEAA 1HI9A 1UPUA 2NO7A 3DVRX 3U48A 1B8UA 1KS9A 1P3JA 3NHAA 4NBVA 3T7DA 2A3NA 3OT4A 3OOYA 3N87A 4NY1A 5JQGB 1P5FA 2CGEA 5MGBA 4W63A 4AJHA 1XCBA 2JI9A 3VYWA 4FYIA 3K71B 2DJ5A 3I1JA 5HX7A 3H8WA 3B6EA 1K5DA 3ZH2A 1VBKA 4OQYA 4V3BA 5DWVA 3UHPA 1FNDA 4DCMA 1AMOA 1KQGA 3VZCA 1T0JB 2YWEA 2QM8A 1P7WA 1LU9A 3VDRA 3EVCA 4HRYA 5DBFA 1EGMB 3ZE8A 2WFAA 2FEMA 5LPNA 3GC6A 1ADBA 5KEIA 3L46A 3FOEC 4QGGA 4DPMA 4YMLA 1ECPA 2A9PA 5JYBA 4EABA 4RTMA 2Y1DA 5G3ZA 1EBUA 3UM9A 4BECA 2F1HA 3ETGA 1U7UA 2RK3A 4X95A 2WJ4A 5TXGA 2CN1A 5REQB 2JBWA 1CS0A 2F90A 1IUPA 2KI5A 1C1XA 2EP7A 2Z3ZA 1D0SA 1E79A 3LOUA 2OC4A 3ER6A 2XNKA 4BQPA 1N0IA 1J2UA 3K1AB 1LV7A 3GEGA 3ROPA 1SKBA 5EJIA 1A9OA 2IYEA 3ILYA 2HJSA 2Y92A 4F12A 4OJKA 3CXUA 4RZSA 1NHGA 1H8HD 2Z1NA 5JMOA 2OPBA 4KCGA 2A2ZA 5AOVA 1K4KA 1JAYA 2F67A 1YJ5A 4JU9A 4JVSB 3MB8A 4EJSC 4FMDF 4LRQA 4XYLA 3N8NA 3N3AC 3PG5A 4YMTA 4DLWA 1N9GA 1E5TA 1ZC3A 4INPA 5E9AA 1BX1A 1QM5A 1GQ2A 2BE9A 2ZUDA 4M2LA 4H1TA 5FB3A 3IBSA 3LT0A 3OZFA 5HIMA 2Y9PB 4YRLA 1ECLA 4NCJA 3U9TA 1QH9A 4QXAA 4JYBA 3EY9A 2QK4A 2A0KA 3AV0B 4ZAYA 5GP1A 3SHTA 2JGEA 4MLDA 1FZQA 4PAQA 3WB2A 2JBHA 3I9LA 3VPAA 4GYYA 4LF5B 3RNLA 3K6KA 4E30A 1JHUA 4IR7A 5JAPA 4F4UA 1HSOA 5GQSA 3RS2A 1ZL2A 3RVOA 3TN7A 4BRZA 2WIJA 1WULS 2WPNA 3NLLA 3DHWC 3NWEA 4MV3A 3ESQA 3PQ6A 4MVJD 1MW9X 4UM9D 3MAAC 2GESA 5J5AA 2UZ3A 2CXQA 1CRPA 5KINB 1NXTA 3GLHB 2KMLA 4EO9A 2Q6LA 1ECBA 1XTBA 2JJQA 5FOUA 1I1QB 1X1QA 1Y37A 4G9GA 4JGIA 4ZALA 3VQTA 5HJEA 3A6ZA 2PT6A 2Y9MB 1RRKA 3EC2A 3EMKA 3MTIA 3HHEA 1VMDA 4YWHA 1Q1GA 1MUUA 1R6BX 3NTOA 3RWMB 1KAEA 4ZHQA 4L4RA 3EEYA 4UVGA 1W52X 2RI1A 3A6KA 2NVUB 5DSZA 3AJAA 4EJSA 2V4ZA 2HWUA 3DEZA 3IUMA 3L9XA 1JR4A 1U9IC 3D8UA 3LQ2A 4QNRA 3A3OA 2Z4TA 1S3FA 3KFLA 3QTLA 4E3WA 3BWXA 2WZQA 4WL0A 4DV3B 3GEDA 3A3KA 1PK8A 4MW5A 4OUDA 4PYMA 5EZYB 4XUEA 3VU1A 4KV7A 3HY4A 4KE7A 2GYYA 5A3VA 4YLYA 3G2HA 1YBMA 2HIHA 5DX1A 3WICA 3VNAA 3HYNA 3L7JA 4FS8A 4ZOEA 3VHLB 5F2NA 2B8JA 4GPZA 4XH9B 4B4WA 2Z5LA 4CF4A 5GJBA 4MJLA 3PX2A 3SIWA 3ESZA 2QJRA 4Y2XA 1ZVJA 2VZ9A 3LSYA 1JJIA 4R0VA 2VI5A 5BXYA 4AWXA 3QOWA 4FW9A 2PX3A 4MV1A 4JLDA 1WJGA 3BAFA 3T3NA 2C3YA 5B64A 1GITA 1N2CA 1U2ZA 1SQ6A 1EFAA 4ZEMA 5PGMA 2ZYWX 3EXAA 1YTUA 4BLQA 2QUHA 4QJ5A 4BKMA 1XTIA 2QIPA 3V2IA 2Q1TA 1JXQA 3GPIA 1T3SA 4PO3X 1M2OA 4I36A 1E7MA 4WPGA 4IX1A 4A5SA 3DVLA 2NU7B 1PO7A 1BGWA 2C3PA 1R8SA 3C3JA 1LPNA 3LPAA 2Z98A 3LDUA 3BUSA 5F9HA 1ZK3A 1D6JA 1JLLB 2CL0X 4B74A 2OB1A 1A9PA 1H3NA 3OECA 1P8AA 4FB5A 3ZDBA 4J7XA 3T1OA 3LBHA 4F96A 2XT0A 4HS4A 4FLMA 2FPIA 4RNDB 1S2IA 1YA8A 1E96A 1P2UA 4H59A 4OFXA 3IHKA 5MHTA 1GG2A 2PWPA 1R0SA 2YIMA 4JL5A 5TF0A 4P82A 4JQCA 2YBEA 2OXEA 3FNIA 1QF6A 5CA0F 1Q0HA 3SNKA 1ZHOA 2PQMA 2Q6VA 2WZDA 4G24A 5WRFA 2AG1A 2XIJA 1WW8A 3KKPA 3QE3A 4PPQA 4NH0A 3W5IA 4RKRA 5I7FA 2QAGB 1Y4AE 4KV9A 1YUNA 3GJTA 5THXA 2EQAA 2FZCA 4HAUA 1Q83A 1Z2DA 3SFZA 5DNCA 1U0EA 2I78A 3X0DA 4IIFA 1QIMA 1BD3A 3JY6A 5FBHA 5C4MA 1LLCA 4F91B 1E77A 3N7AA 3X2EA 4DPKA 4HNVA 3OCJA 2YCBA 3TRKA 3WX0A 4RJTA 2AG0A 1WMFA 1DJOA 3R5FA 3QLVA 2TSYB 4D8TA 1DWUA 2W0MA 5KYGA 5LMNB 3AVVA 5C3UA 2QGNA 2P4EA 2CFIA 1XMJA 2FMUA 3UAVA 1YA4A 1RXUA 3ILXA 1LSSA 1X1TA 4RDHA 3WLIA 2F55A 3DDOA 2G4LA 1PAUA 1UXKA 3AR6A 2QE7D 3IESA 3W3AH 3ZBTA 4P36A 4X7BA 5E1OA 1D6MA 3ZGOA 4F2HA 3E61A 1MMFB 3D0KA 3DKVA 2GPBA 2ODAA 1O54A 3HCFA 4RSRA 3BG5A 1A9ZA 2C94A 1PG0A 3K73O 5EE5B 3T94A 1UMKA 4CF6A 2D5BA 4DWVA 3KQVA 4M21A 3VBCA 5TT1A 1IUNA 2OWDA 3OSZA 1VG0B 1XD2B 2R6GA 3QJGA 1JHQA 1H3FA 2GXUA 5EXXA 1HYGA 1P45A 3SJAA 4RHYA 2FZLA 2R1UA 4LXYA 4UVHA 3WDMA 3MUFA 5EA2A 1ZNXA 3PSAA 2C00A 5KJFA 3IV6A 3OZXA 4LC9A 3NBQA 4URZR 1XMQB 1WDTA 4JXXA 2P3LA 1EH5A 3QIVA 1PGNA 1ZCZA 2E87A 2WFZA 3IP1A 4HGOA 3T5AA 2IHKA 1UAGA 1R27A 2R66A 3FLMA 2HMAA 1OIVA 5EOVA 5G1OA 3J7AC 5EKDA 3Q15C 4Y1FA 4BMNA 1EUDA 4BMVA 2FSSA 4QGFA 4WLFA 1QRSA 4I1YA 4UCWA 2X9GA 1G7SA 3WNDA 3S29A 4DC9A 2XUKA 3UFXB 3FBGA 4RQBA 5E2AA 4F4DA 5JBQA 1USVA 4HUTA 1VP9A 1SBQA 2JI8A 3BGSA 5KTOA 5U9CA 5JS7A 1ZH8A 3AEYA 1HFKA 2HK8A 4MVJP 3U7FB 1YJQA 2WIKA 1UZUA 2A1TR 2SHKA 3R5HA 4DLTA 5KOYA 4Z0TA 3GRPA 3ZHXA 3Q2OA 1JR6A 3M2PA 1DOAA 2WJGA 1E9BA 5DBHX 1CJKC 3B2EA 2A94A 5A9TA 3DYVA 4RFVA 1W87A 5JS2A 2XUIA 1NVAA 3WGLA 2CF5A 5KWVA 3BEDA 1SXHA 1JLMA 5GTDA 4KACA 3R6TA 2QAIA 2Y0DA 3IUNA 2QRJA 4H77A 2WPDA 2RGYA 3IIMA 3K1JA 4RFSB 3D8TA 3H5NA 4XR4A 3WV5A 5C37A 3F7OA 1RE0A 3AWDA 3SHOA 4BUCA 2CD9A 2AOWA 4GGPA 1I7NA 1QH8A 1ZZGA 2R86A 3L06A 1Q0PA 1HKHA 1ISMA 2H2WA 4NE2A 3GZNB 3GDOA 3AYZB 3FKJA 3G9UA 3AB7A 3ML1A 1FFGA 5CB0A 1PQYA 3H4TA 1D0IA 3ITEA 3JQEA 4LJYA 4JL8A 4PNZA 4YT5A 5IVDA 3UJHA 1P77A 3JYOA 1KJZA 4F8JA 5JAIA 1GCUA 1Z7GA 3L8DA 2ZXFA 5AI9A 1QUEA 1RYYA 1UMDA 3AP1A 3SEQA 3DDSA 1M74A 2B3DA 2X41A 1UJ6A 2EKPA 3OQHA 1K97A 1REQA 4JITA 2APJA 1IY9A 2VKTA 3LS2A 3HDJA 2WABA 5IAAA 2FR8C 2IW3A 1LJUA 3L1UA 1Z28A 2FPGA 1EVIA 1NHWA 1NXXA 1THMA 2WB4A 4RHCA 3W5SA 4AF7A 2YWGA 3PUHA 1OXSC 1ISRA 4JUDX 6ADHA 1A8IA 1FFYA 2ZT8A 1YBAA 2I5PO 4HH3C 3TSAA 4HWGA 5JNUA 1UPAA 2V4UA 1GAJA 1P1JA 1RI3A 2EKQA 4BB9A 4NPHA 3AIOA 3VR3A 4PM4A 3SDZA 1IWBB 4E7PA 2DR2A 4FMCF 1YB6A 1NR7A 5CVJA 4YMVA 2W2PA 4E5MA 1IQRA 2QNBA 3R0ZA 2WWYA 4P7GA 2CL5A 2PGXA 2HA4A 4YP5A 5DGTA 1J8QA 3TX2A 2YXNA 2ZR8A 4RZ3A 1Y80A 2H00A 2NU6B 4BYMA 1HG0A 1T0HB 1ZD3A 2I6FA 3IIIA 3ROZA 4AUEA 3TSZA 4DBZA 3O9MA 5C8VA 1Y4DE 5MGNA 1NY5A 1HTWA 5LU9A 4AF6A 4A8JC 2VPWA 4LNUB 4IPTA 4CUKA 4PR3A 1JQ5A 2ZJ8A 1OFGA 2EJBA 4IJQA 4X65B 2N1MA 3B6KA 2ZYSA 3EXHB 2EJCA 3JQGA 4MR8B 4ZCSA 1QNLA 1KMHA 1XZAA 2VP9A 3TSOA 4KR0A 1QUFA 1NMSA 4WXMA 3LWZA 4B3CA 2EZ9A 4C7KA 2FR8A 1WZUA 4XR9A 3TXXA 3T1YB 3KAKA 2QL5A 3G5UA 1WXDA 4NYIR 4X1OA 4J1NA 3SDBA 3OJLA 4BQRA 2AXPA 1C1HA 1DXYA 1TM5E 3O3OB 4H7IA 2QVLA 3IXLA 3NEYA 4JJZA 1PR2A 4LF6B 2D1TA 1TEZA 3B53X 4HC4A 2WFMA 3U40A 1JDUA 1G8FA 2ZIAA 4GX5A 3EMVA 3ZCQA 5I48A 5FH9A 3HA3A 5HF5A 1FUUA 3UQZA 4DSNA 5C5EA 3REFA 3OKPA 1Z73A 3ETHA 3FWNA 2JBAB 1C5KA 2QW1A 1XZNA 2A0WA 4KDRA 3I9OA 4RXMA 2MIIA 4IMPA 4MPDA 4UTXA 3W2HA 2V65A 4DMUB 2KWIA 4L8VA 3IC5A 2YZNA 2HOQA 5LLSA 3RLFA 2I8CA 4DLNA 2GN4A 5CT5A 1JH8A 3T9AA 1XLTC 2KQUA 5FHQA 5CLFA 3FY4A 5ES4B 4D92A 1V9CA 4DDVA 3A58B 2IP1A 3H3XA 3RB8A 5C18A 4L7VA 1KBQA 5EZSA 4ZARA 1YRQA 3W9UA 4BZQA 4A8JA 1L7MA 5G4KA 2J0SA 4I9GA 2B34A 3DJYA 3LBNA 4WECA 2V59A 2Q5OA 2ZS8A 1G5QA 2I7DA 3E7PA 4L57A 3TQQA 4PO8A 3MTQA 2A35A 1N0HA 4Q15A 3FMGA 2XTMA 1KPIA 3OVMA 1ATZA 5DTIA 1L7XA 2G63A 1XMOB 2YMMA 3GVHA 3P0FA 5CNMA 3RSFA 2GWHA 1P1FA 3IBTA 4OHXA 3TJRA 4L74A 5H5JA 1BXGA 4GOKA 1LX7A 3RF7A 5CVUA 4DZTA 5IF9A 5JSYA 3ZVMA 3JARA 3K0FA 4GMKA 3SDSA 3NTRA 4QQ8A 3WK7A 5BN3B 3NT2A 1JLHA 1U2QA 4FFBA 3OBIA 4X93A 1HLDA 2YDXA 3ASUA 4QJBA 4KL8S 1I7DA 4IGEA 1QZ3A 2YOFA 4TWIA 4PPGA 3HM9A 1VGRA 1VM6A 3ME5A 1TU3A 1U2PA 2NSHA 3WWEA 1E2UA 5CA0A 1E4YA 1ONBA 1JG2A 3SLGA 4RXTA 1KK1A 4TLMB 4AUNA 4PGFA 1PV4A 1BEUB 1R8QA 3WLMA 2WWWA 4HMPA 3UA3A 2QKYA 1QX4A 1V1RB 4G3XA 4LZOA 1QQAA 4DMHA 4QUKA 1M9NA 4N0PA 2OG2A 5CDTA 1EBBA 2BJWA 7ABPA 4FYJA 3DEKA 4BO8A 3WGYA 1VL8A 5BW4A 4G89A 2BR5A 1QK4A 1HT3A 2VT2A 1MC8A 1TF2A 3HBFA 4JIMA 3SZGA 4YPFA 5HZKA 2JFXA 2GDZA 1QIFA 2Q21A 4JBXA 4RHFA 4UJ5A 5CEJA 1EAMA 5L7WA 3IVMA 1U81A 5IUKC 4FGUA 3ZDAA 1RAEA 4HAWA 4TT3D 1ZVQA 2ID9A 4DIEA 3ZDDA 5M34A 4KPGA 2H2AA 4KSYA 3SOZA 4BRSA 1P9LA 4KN5A 4CDMA 1PR6A 1H85A 5AICA 5JCXA 3OA2A 4XDGA 2DERA 4U6NA 2XXBA 3UKJA 4FFPA 3LQ1A 1B14A 4Q3DA 2DKFA 3BMQB 1TIPA 8ABPA 1SC4A 4RPLA 3CPSA 4BVEA 5KTPA 4PTLA 1T2NA 1UWLA 1QVVA 2KPOA 4WCFC 2BFAA 4CG1A 1LB1B 2ES4A 4HN4B 1QE0A 4Q82A 2ZB3A 2J9GA 2ZSIA 3E5NA 4BO5A 1E3SA 3H65A 1JQLB 3F4BA 5EQJB 1MV8A 1KH2A 1O0SA 3BMNB 1KDYA 1E60A 3Q41A 5T7BA 1ESCA 1SXQA 1WMSA 5FEMA 4L27A 3LUDA 3H9CA 3BMOB 3HYTA 3V8MA 4MEBA 1QO9A 5SY9A 1XHLA 2QYTA 3O4VA 3FMFA 1T9BA 4ZT5A 4E13A 3EDOA 4ZVSA 3TLBA 3G3EA 1DAMA 3IV9A 3FWHA 5DNVA 1UODA 3HFJA 4U5QA 4C7VA 1JHZA 1XTUA 4I5DA 3NTQA 4ROTA 5E2BA 4EGJA 3S40A 2H5IA 5L45A 2XRMA 2IYPA 3KEOA 3T5GA 3BS4A 4DY6A 4XW2A 5KVSA 3DDHA 4I9UA 2QU7A 4DCSA 3MCAA 4DF3A 3RCBA 4S3MA 3Q11A 4EG0A 1YNOA 2ODEA 5AM4A 1S5PA 5LFAA 2GF9A 5CLQA 2VQEB 1RD4A 3B5IA 4NF2A 1RXVA 3W8FA 1YIAA 3PC8A 4QPCA 1Z7EA 2ETXA 5IMBA 4KITB 5TMPA 2JGRA 2BMVA 2GBLA 3IP7A 3HLKA 1SKAA 2ENUA 3WHPA 5LIRA 4MR7A 2QBYB 4NONA 4EM6A 3PFGA 1IL0A 3DGEC 3AERA 3B52X 4O4HA 4REQA 1YMQA 4WCFA 1KU6A 4A5OA 3GH1A 4YUAA 1S4QA 4QFDA 1II9A 2D4AA 4L3OA 3FRIA 4YK7A 4ER7A 1YGPA 2GO7A 1M1NA 5IKOA 4GRAA 5DN9A 1NNEA 3HSKA 1W59A 3UYKA 3KPJA 4RZHA 5B2FA 3C3KA 5K45A 1AQLA 1RYHA 3C3AA 1SU6A 4H0NA 4ASUD 1BD4A 4CHGA 4PG5A 5BSKA 2XZPA 1EK2A 3C7TA 3CLUC 2YY7A 2F64A 1IAQA 3ICEA 3FDJA 1DAEA 1N25A 3AUTA 3BRQA 5IAEA 2EF0A 4C7JA 2NUTB 1ZA2A 3PNVA 4E5DA 3G9XA 3AM4A 1TYEB 5JH7B 1HOXA 2B94A 3KYCA 4HEA6 5HA5A 5HQ3A 2H5JA 4CT0A 3I4FA 2X7JA 3KT6A 4RJJA 4YRAA 2ABWA 5CHEA 4CV2A 4EF5A 3TBFA 4C21A 4BGVA 4XSGA 1JG7A 3KSBC 4P22A 1BJTA 2ASEA 3DE3X 4NE7A 5HCUA 2X14A 1PJZA 1QO0D 3QVGB 4MV8A 4YWJA 4Q24A 5BQ3A 2ZT6A 4TVKA 2HADA 3KQQA 5DLYA 3NASA 4ETMA 4F6RB 3HI4A 5EIFA 5A4AA 1MVOA 2I67A 2M1ZA 2V0CA 3HU5A 4R1OA 4AG3A 3U3RA 2C9MA 2KJQA 4ND1A 2ZKLA 2CWDA 5E9WA 1DE0A 2BI4A 3AEKA 4DQDA 2BF4A 2X9QA 1Y4ZA 5CXXA 1A9XB 2YVUA 3LUCA 1Y6JA 3EBPA 1IB0A 1V1JA 3DOIA 3M8KA 2IEIA 2GK3A 1X8KA 3JWGA 2Q9AA 3C3EA 1C4KA 3E9CA 1W2HA 4O33A 4HUQA 4U2CA 1EJ6A 3V8EA 5B1IA 1JPUA 2D1FA 3UCFA 1W2WB 2ONKA 1ZCJA 2X4DA 5KU7A 1IN6A 4LOHA 4QYXA 2D54A 1QAQA 3NVMB 5H4GA 1YVEI 4Q3CA 4NXNB 1T1JA 1UBKS 4UHEA 2W0SA 4HYTA 3VPBA 3IAEA 4OQQA 4CCYB 1SIWA 3CSSA 3OTWA 1X77A 2I8AA 5B2EA 3F96A 4J91A 3WL8A 2PVCA 2ODWA 4HXFB 5TS3A 4RTQA 2NSLA 4FW8A 3LT5A 2PSDA 2HDHA 1MO6A 2NO0A 4EB0A 4MR9B 5NULA 1XZIA 4LVOA 4X1IB 4BNXA 5EEHA 4TLDA 3HXKA 2IOFK 3WGMA 4X64B 1HX7A 3CZCA 1UBFA 4JT4A 3HV2A 1XDWA 3IQHX 2ADOA 3ZX4A 2P4QA 3GGJA 3OOHA 2D5AA 2VWHA 3ANXA 2Q3LA 2YS6A 2RONA 4O29A 4BL5A 3GP5A 4C6TB 1NRIA 3UW3A 2B5WA 2V7PA 4JDPA 5DT9A 1HMPA 4NK5A 2GN6A 4QICA 4YT8A 1FQWA 1NNSA 1W0KA 1PI3A 2QUIA 4J4BA 1NR5A 3A1CA 1VHDA 1Z08A 3VKGA 2E6KA 4GWGA 4MQ5A 3MQFA 4K8RB 2R00C 2BFEB 5HF8A 5J40A 1SVUA 3EGXA 4QVGA 4ZVQA 3M6UA 3SZLA 4D9JA 4LIPD 4MQ4A 3LNTA 2D8MA 4LGVA 3DOHA 2J7KA 1SXIA 2X0DA 3RARA 3TR0A 3UMCA 2LTAA 2TS1A 2IEAA 3AX6A 3DV9A 4IH1A 3RC7A 4LUCA 5D85A 2RGXA 2PV7A 3TQFA 4MVJF 4N4AA 3RSOA 1MW8X 6NULA 1MAAA 3FYCA 5F33A 4X6XA 4ON9A 7YASA 2I7TA 1MX3A 2IITA 2P35A 1XWIA 4BNKA 2O50A 2PPLA 2XQIA 1RWXA 4LAFA 3TNYA 5B37A 4BNHA 2ZRBA 3LFHA 5EIHA 4UAVA 2X0KA 4EX6A 1QHIA 1ZD5A 4AN0A 4DRYA 1ISIA 5FTLA 2O5CA 1O2DA 3C39A 1NI4B 5G3YA 3KZMA 3TI7A 1T1RA 4YRNA 3CN7A 1F2VA 1HR0B 4YXWA 3DLAA 4UAJA 1ZWKA 4BN5A 4N5MA 3N0RA 1BCRA 4M0CA 3OEED 3VR2D 3OEHD 5B7QA 2G0TA 4RUKA 1HE1C 4CLEA 3WGIA 3G2KA 1V8DA 5GV7A 4UUBA 3EE6A 4XCVA 1L7AA 3C7KA 3GAAA 5HRAA 5I4KA 2QD4A 3PUXA 3KSRA 2PNJA 2AMLA 4HNTA 4CTOA 1M2VB 1OTXA 1F8UA 4C05A 3WP1B 2NPIA 3CKYA 1GAEO 2OK8A 4BVFA 1R2QA 4RQAA 1QZTA 4I5GA 3KT0A 2I1VB 4MUXA 2PX2A 1U1CA 4DG8A 1E1YA 2VAXA 1EWVA 5EQDA 3ZG6A 5CCEA 4MAAA 3KQUA 1UBNA 2CLEB 5C1DA 1LY1A 3LZCA 4R8RA 1O6GA 1IRXA 1MPTA 2V5VA 3A3PA 4J94A 5KNDH 3IEIA 3BD7A 1DLIA 1WG8A 2C99A 2HSZA 3DDCA 1UBHS 5GIOE 2CUZA 5JMWA 2R8OA 1Y48E 4EBBA 1FJ2A 2NPOA 1Z74A 4M60A 3V4RA 2ZJZA 3OQ1A 4OSPA 4PGMA 1T4GA 3RYTC 4OM8A 4BX9A 4FXPA 2OHIA 5LMUB 5K9ZA 1N7HA 3W5VA 1IY8A 4QA9A 4N47A 5C7IO 1OLSB 1KY5A 1JXOA 2I4MA 2XQJA 3V6MA 4U7GA 3ZHYA 3DFZA 1ZI9A 2GB4A 4OGKA 1DO8A 1PTKA 2VF5X 2NNLD 3CLKA 1QGZA 5ADHA 3MZ0A 4PHTA 4XA8A 4LHVA 3DPIA 2FWAA 1CUDA 3U39A 3L6DA 1OI3A 4BVKA 1W1IA 3A1NA 1MO2A 1YZUA 1C2TA 5EIBD 5ECDA 1XWWA 3FYUB 1RKUA 1JDVA 4RW0A 2SKCA 3R1IA 1ORWA 2CFRA 4OJQA 2EAUA 4UZEA 5KYYA 2SBTA 3M0EA 3TL6A 3L0YA 2JKVA 1IRIA 3DWGA 4N9QA 4V0ME 5FWXA 3HR4A 5ITZB 1DQPA 4TKLA 2O7RA 2IGTA 2QXTA 1X7YB 4GXQA 1KO1A 1JR3D 4PC3A 3ETCA 3STTA 3ZNNA 4R71A 2YHBA 3HJFA 2RGDA 3BE6A 1KDPA 1TTPB 3JVVA 1L7DA 4D44A 1QWSA 4A6EA 1SR8A 4DC0A 4MVJG 3KYIB 6CHYA 5HW0A 1QHSA 3GGDA 4UMFA 2KE5A 3ZHTA 1LQUA 2PQ0A 3CUEF 4XZ3A 3TK1A 3DPSA 4M0LA 2GA9A 3JAMA 2ZBVA 4M38A 3N2KA 2OGTA 3C1OA 2LPMA 4HLDA 5C34B 4D26A 3G8BA 3VTAA 2BGMA 1YB2A 2C97A 2L19A 4ID9A 4JJAA 1OC4A 1EFCA 1LK7A 2WTEA 4A6XA 4TLLB 3NWOA 3KWLA 1E2KA 4RF2A 4WE3A 3TCXB 4IJVA 5BRAA 4KLRA 5EJEA 4NXMB 5BWBA 2F3TA 3ZDFA 4GBGA 3QLTA 3O8CA 1PR5A 3WNBA 1KP2A 1QG2A 3MS4A 4H1WA 1ACLA 1GKYA 1C9EA 4QOFA 1RZRA 1G4UR 1IHXA 4MAFA 1GFWA 4OV6B 5GGYA 3CF4G 1Z2CA 4CM3A 4YJGB 4Q1VA 1A2OA 2QRPA 3CMCO 2ZDHA 1AD2A 3GLGA 2Q07A 3E5HA 1Y7IA 4M1ZA 4FP9A 3QEOA 4F7WA 3QWFA 3K2EA 3PFCA 2QRUA 3DOFA 2XT9A 2IX3A 1QK5A 4RLSA 3TB6A 1ZYUA 3E27A 1PIWA 1HYHA 2DTEA 4J8PA 1L8AA 3DSRA 2J46A 5K5EA 3H6KA 3H5WA 3ESAA 3TQHA 1DJNA 1QIIA 3H04A 3OU2A 4F9EA 4AWBA 1JSZA 5GM1A 3S2ZA 2FEPA 3OPYB 1QG6A 3PDUA 2VPPA 2ICAA 3H5IA 2FJPA 5FAXA 4X24A 3RROA 5LKAA 4YB8A 4JJKA 2E1PA 2DFVA 5C31A 2VNKA 4LZAA 1SC9A 3SBXA 4ZAXA 2WIDA 2GTPA 1ADYA 3OJCA 5E38A 3DTVD 3N2EA 1PFYA 1R6VA 1SUPA 3EVFA 2DBVO 4Y1RB 3QTTA 4BLPA 5FPHA 1L7NA 4V0QA 3ZK9A 3F47A 1B6GA 1JG3A 5GOTA 2YMLA 3RT1A 2JC3A 3M3DA 1P0FA 1B0AA 1BS9A 3M9LA 4US0R 5CGQB 1DHRA 4F4JA 1H4SA 1YK0A 2V7WA 2P79A 1Z7WA 3VYVA 2H07A 3THYB 3LRXA 3LKBA 4L4SA 4NBSA 1X13A 1GYRA 2G8LA 3HY6A 1UEJA 1ID1A 1SHUX 3UB2A 3QELA 5TQVA 5EIEA 4ITUA 1T6XA 1CR6A 1OFIA 2C1ZA 3GBSA 2ZBEA 1RTTA 2IHYA 1ZUIA 2ZETA 3GNTA 1ZESA 4F92B 2PCLA 3ZDRA 2ERXA 4ND7A 2D13A 3MG9A 4AY3A 2ZCJA 1NBWB 4EYKA 5K0ZA 5E9QA 3PL1A 1DIBA 4RSGA 3NBUA 5BMVB 2GK7A 1QS0A 1ICEA 1IPEA 5ENZA 3PWKA 1M0EA 4MS3B 2OWEA 4UHDA 3D6MA 5ALFA 4G67A 4MRAA 4L8GA 4ND8B 1NF9A