1HQDA

Pseudomonas cepacia lipase complexed with transition state analogue of 1-phenoxy-2-acetoxy butane
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
320
structure length
320
Chain Sequence
ADNYAATRYPIILVHGLTGTDKYAGVLEYWYGIQEDLQQRGATVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGATKVNLVGHSQGGLTSRYVAAVAPDLVASVTTIGTPHRGSEFADFVQGVLAYDPTGLSSTVIAAFVNVFGILTSSSNNTNQDALAALKTLTTAQAATYNQNYPSAGLGAPGSCQTGAPTETVGGNTHLLYSWAGTAIQPTISVFGVTGATDTSTIPLVDPANALDPSTLALFGTGTVMVNRGSGQNDGVVSKCSALYGQVLSTSYKWNHLDEINQLLGVRGANAEDPVAVIRTHANRLKLAGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complex of Burkholderia cepacia lipase with transition state analogue of 1-phenoxy-2-acetoxybutane: biocatalytic, structural and modelling study.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords LIPASE
total genus 128
structure length 320
sequence length 320
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2000-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1hqdA00
4J0JA 5D7BA 2HU8A 2PL5A 2XUKA 5AIAA 2I03A 1SCQA 4BCDA 1C7IA 4N5IX 4EY6A 1WHTA 2PSDA 1EDEA 5AKJA 5JZ9A 5K3CA 1XFDA 4N5HX 5ISMA 4AQDA 4X93A 1IZ7A 5CTAA 4X6XA 1G66A 4OB8A 4XX1A 4PSCA 3KSRA 3ZLTA 3G02A 2XUQA 4JNCA 4MQLA 2HU7A 2HM7A 3H0CA 4XIIA 1E8NA 3BL8A 1LPAB 3FWHA 2JGFA 1GT6A 3CXUA 5ALPA 2JGLA 3AIOA 3R3ZA 3FSGD 1J06A 1NX9A 2PSFA 3R3WA 5CT6A 3TEJA 3I28A 1UWCA 2V9ZA 1HDEA 1VXOA 2WTNA 5AM2A 4J0IA 1GPKA 3VVMA 1XZCA 4JUIA 1CUJA 1EINA 1QIFA 1TCBA 1HKHA 1WB6A 3FYUB 4H7DA 1JMYA 1QIIA 4Y2VA 4A5SA 1BS9A 2O2GA 3BE8A 4Y7DA 4KACA 2H7CA 3CCBA 4EHBA 1XZLA 1H2XA 4DMCA 2PBLA 3AILA 4DGQA 5HKAA 2HA4A 4OU5A 2QZPA 5YASA 3E4DA 2RGUA 3O4HA 3PICA 2WUGA 1CUXA 4G8BA 4J3JA 3HYSA 3HSSA 1FFCA 5D3KA 3VKFA 4X6UA 1CUUA 3H2GA 2O7RA 4PSDA 1UK6A 3W2TA 2OCKA 5K3BA 3ANSA 4UHHA 4ZWNA 2QT9A 2OCIA 1TCAA 2C5FA 2JEYA 3MGAA 2B4KA 5E4YA 3N2ZB 4MEBA 2B61A 2HA5A 4Q34A 4GLBA 3MVEA 3FCYA 4OB7A 4PNZA 3IBTA 1T4MA 4BDTA 1AC5A 4BTLA 5EIHA 5IVIA 4MWTA 4IH1A 1R3DA 5K3FA 2E3JA 4H77A 1IUOA 4BC0A 2XUFA 4J0HA 2Y2UA 3F97A 3HI4A 1LZLA 4DMKA 5T4HA 3ILSA 4KAJA 2PSJA 5EHQA 2HA6A 2VATA 1GPNA 3AIKA 1MO2A 2HRQA 4NS4A 3RM3A 5HFNA 4U2CA 1CUIA 4DYHA 4AB1A 4Y2RA 5HK9A 2O2HA 3SK0A 2BCEA 3WJ2A 4UFNA 5ALZA 4BCCA 5AI4A 5CT4A 3G0BA 3RLIA 3K9BA 3C70A 1VE6A 5CMLA 5C8XA 1THTA 5AKEA 4H7JA 3QMMA 4Q1VA 1I6WA 4LYEA 2JGIA 5DTJA 4AMZA 4PF1A 2WIKA 1W52X 4LIPD 2XUAA 3ZPXA 3EQ9A 4BRSA 3NGMA 2RHTA 4V2IA 4JYPA 4DIUA 2WKWA 3FAKA 3IUNA 3WWCA 3R40A 1CFJA 2RHWA 3BF7A 4HXGA 4DNPA 4KAFA 5HK8A 4IHAA 2PVSA 5E4JA 5ALFA 1XZHA 1JJFA 3QITA 1QIJA 6YASA 1J1IA 1USWA 3RARA 4UBIA 2D0DA 1QJ4A 5HQ3A 1K8QA 5JARA 1JU3A 3DL4A 1ZIXA 3U1TA 2J3QA 5T4BA 1R9NA 5ALNA 4QDUA 4A16A 3C45A 3C5WP 3O0DA 4BZZA 4LHEA 5DWDA 1XLVA 1SOMA 3FYUC 3LCRA 1DWPA 4S0XA 2ZVDA 2DHEA 4MQMA 3KD2A 3LS2A 4Q3KA 3LIPA 4PQEA 2BGRA 1CUSA 3F9CA 1A8UA 2PUHA 4Y2QA 5KWIA 3ZI7A 1ODSA 5FPPA 3BJMA 3G9TA 1QIDA 5LZ2A 4EY5A 5J3JA 1A8QA 3VJMA 5F4ZA 2VSQA 1AQLA 2WIDA 5H3HA 3B12A 2IX9A 2EDAA 5K3FB 3LLCA 5ALIA 4IQ4A 3C5VA 1MJ5A 4AO7A 1W75A 3DDUA 4QWMA 2DR0A 3WLAA 5ALJA 4BVKA 2C58A 1TKRA 1E3QA 3WKEA 1QIGA 1CR6A 4OU4A 1LPNA 3H19A 1WOMA 3WK5A 1E66A 3IB3A 3WZMA 2OGZA 1K5PA 1DWOA 2H1IA 5LKRA 1IUNA 1XZEA 3R3YA 4FLMA 4CG1A 2WJ6A 5ALHA 5CH3A 2I3DA 3D3NA 1C7JA 3WK9A 1QGED 1TQHA 4X90A 4UBMA 2PSHA 3D2CA 4JEIA 1UOQA 2YYSA 5IH7A 1QE3A 5IVDA 3E0XA 4UPDA 5I8PA 1CUYA 2HL6A 3S2ZA 3D2BA 5HKBA 1HL7A 4X95A 1ZJ4A 4FFVA 1ODTC 2AJLI 3H1BA 1SFRA 3KWJA 1FFBA 3A2LA 4GECA 1WCYA 1JI3A 2BKLA 3QZUA 2JEZA 4DMFA 3WMRA 1AUOA 1JU4A 1L7RA 2QXTA 4ZI5A 4FNMA 4AO6A 4UUQA 1E5TA 3W05A 4B84A 4OYLA 1GQRA 4UFPA 3WZLA 1K4YA 5K3AA 3EIOA 4ITVA 4QWWA 2HFJA 4TGLA 4KAAA 2XMSA 1ZD4A 4N8EA 1EB9A 5JAPA 3DQZA 2XUOA 3HC7A 2DCMA 3DLTA 1YS2X 3HRHA 1W76A 2FX5A 4K2AA 2WTMA 5HF9A 4BE9A 1YB6A 4HXFB 3STVA 3WK4A 2C0QA 1KU6A 1AZWA 2EEPA 3C87A 1UXOA 3ICWA 5I9IA 1XZKA 2G4LA 3FCXA 4G4GA 7YASA 4QLAA 3T4UA 1UZAA 2VT7A 1OCEA 1ZICA 2G63A 4FHZA 4H18A 1LPBB 2ORYA 2QJWA 1Y37A 2XMRA 4AX4A 3MUOA 4WFJA 2CJPA 1ACLA 1DQYA 5AM0A 1U8EA 4WJLA 1BRTA 1R4ZA 2BGNA 1LZKA 3I2IA 5IKXA 1Q0RA 5AM4A 1QIHA 5JZSA 3B5EA 1LPSA 2ACEA 1MNQA 3ZWQA 3O95A 4U2BA 5ALOA 4KE9A 1ODCA 3D59A 5HCUA 1AKNA 4QA9A 1CUWA 3D2AA 1SCKA 1H2WA 1AX9A 4DMHA 1MN6A 4LYDA 4NMWA 1DT5A 2PPLA 5JANA 5AI9A 1XZGA 1F6WA 5FV4A 4EB0A 4GDMA 4AN1A 3FYTA 2WIJA 3G9UA 4GI1A 3DS8A 4G4IA 4W1SA 4UHEA 5CW2A 5HF6A 3G7NA 4B82A 2RAUA 5AOAA 3H17A 4C4XA 1LPPA 4WDRA 2J3DA 1U65A 2CKMA 4Y2YA 5DTIA 1CUGA 2XMGA 5K5EA 1ZI9A 3WK8A 3QVMA 5ESRA 1WPXA 2C5GA 4L72A 4B83A 2V96A 2OG1A 4FKBA 4BBZA 5DLPA 5DYYA 5KWJA 3C6ZA 3D0KA 1QFMA 5FXMA 3H2IA 5BOVA 2XLBA 2WFLA 2OCGA 1VLQA 1MX5A 2XDWA 4X7BA 1YA4A 3QPAA 3WKAA 4I4CA 4X71A 1CQZA 4OYYA 3A2NA 3R3VA 3QPCA 1YS1X 3WYDA 1FJ2A 3G9ZA 2WSLA 3CCCA 2JBWA 2BAGA 1UK8A 2X8BA 1UKBA 1E8DA 2WHQA 1CUHA 4INZA 2VEOA 1ISPA 4M0FA 2EDCA 3G9XA 1BEZA 3G0DA 2WUDA 4F21A 1VXRA 3HLKA 5LP1A 5EGNA 2DQYA 5DYTA 1PV1A 4X6YA 4YASA 3EQ8A 1HLGA 1ZIYA 3T52A 3WK7A 1BCRA 1H22A 1XKTA 4J0CA 4B80A 4IO0A 2XUJA 1ZOIA 3ESCA 2XQFA 1M33A 5ALUA 2YH2A 2CB9A 3Q8WA 3F8SA 2PU5A 5JAHA 1XZAA 4F5ZA 3CN7A 2QR5A 4Q3LA 2ROQA 2XUIA 4UBJA 4GXNA 2Z3WA 1FFDA 4ROTA 4BCBA 3HEAA 4QDTA 1EHYA 2QVBA 4IH9A 5FLKA 5ALQA 5C7YA 2JGKA 1Z68A 2ZJ6A 1Y7IA 1EDBA 3I2HA 1LBSA 5HZGA 3H04A 3P2MA 5EHXA 4ARBA 2RI6A 2B20A 2JGEA 4KRXA 1Q0ZA 1YAHA 1EI9A 2O7VA 4AZ3A 3FNBA 2DHCA 3DYIA 4C4ZA 1NU8A 4JYMA 1XRLA 5JIBA 2DFPA 1VE7A 2GBFA 3IDAA 2V97A 3U0VA 1WHSA 3C8DA 2AJDA 3AJAA 4LXIA 4LXGA 2C0PA 3PFBA 3ESDA 3C6BA 4YK7A 5EHNA 1QTIA 2BUCA 2QOEA 1TK3A 2HHAA 2R11A 1CUBA 3DKRA 3IUJA 1VA4A 2HFKA 2ZYHA 2VAXA 3WIOA 4MYDA 3STUA 4XWGA 2WG2A 2DQZA 4QE3A 4L9AA 1DQZA 4L3WA 5AI0A 4X97A 5LZ8A 5C81A 4C87A 2G5TA 1G4HA 3PUHA 2XUPA 4UBLA 4QDOA 3SC2A 1IMJA 5ALGA 2Z8XA 3D5EA 2HU5A 3PF8A 3QH4A 3IA2A 2JIDA 5CT8A 1EK2A 4EBBA 1BCSA 5LIPA 2QXUA 1UT6A 3WJ1A 4X85A 1VKHA 2OLEA 4Y2TA 1LNSA 4FFWA 3VXKA 1CRLA 4BB0A 5DYWA 1UK9A 3TGLA 1GPLA 2Q0XA 5K3DA 1WPRA 3ED1A 4G4JA 1XROA 1X2EA 2AJBA 5JYCA 2I3ZA 3I6YA 3ZV7A 5DNUA 1F8UA 1A88A 4AN0A 5HFAA 4B0PA 1IZ8A 4W1QA 1FSSA 5D3ZA 3YASA 2WFMA 3OC0A 2OAGA 4J0DA 3AUKA 3HXKA 5SYMA 2QKYA 1TAHA 1XLUA 3I2JA 1QONA 2I78A 4U2FA 5EIAA 4FTWA 3RK4A 3M3DA 5ALVA 4DTCA 3LIIA 2XMZA 3I2GA 4CCYA 3M81A 3KOOA 5JALA 3IULA 3C8HA 4J0KA 4BDSA 1YA8A 3FOBA 5FPQA 2WFZA 2HA3A 3WWOA 5K3EA 3W9BA 4K6HA 3C6YA 5A7FA 2ONCA 2HDWA 2WHPB 3VJLA 4TPKA 2WM2A 2H7YA 5JZBA 3QMVA 4K6KA 3ESAA 4BVLA 5AHXA 5IVKA 5JAUA 2ACKA 4BAGA 4QNNA 4HRXA 3EQ7A 4W9RA 5AI6A 1Q84A 2PM8A 3IIIA 2WU4A 2FJPA 1G5FA 1R9MA 2AJCA 4Z49A 4WCVA 3L1IA 4Y2XA 3PI6A 4M0MA 1XRPA 5AKLA 1C4XA 3V48A 5KBYA 1MT3A 4NVRA 1MPXA 3QPDA 4J7AA 1R88A 3K2IA 1UOPA 2BFNA 1ZD2P 3BIXA 2Y6VA 2XLCA 4DLNA 3DD5A 4H7FA 1U4NA 3W9UA 3F67A 4P92A 1DU4A 4UHFA 3AIMA 2XMCA 2OPHA 3FBWA 5ALMA 3DKKA 3TJMA 2X5XA 3DYVA 3R0VA 4G9EA 2VTVA 1EDDA 3DJYA 4BZWA 1AMNA 4G8DA 5DNWA 2GZSA 2OQIA 2HA7A 1MTZA 4B81A 2K2QB 5AH0A 5AKYA 3D4LA 3WA7A 4N8SA 1LPOA 4DM7A 4B0OA 5LZ5A 4KE6A 1H2ZA 1MX9A 2JF0A 4RGYA 2JGJA 2B9VA 1QLWA 4FWBA 2QS9A 2C7BA 5A71A 4ZRDA 4DNFA 5ALWA 1KEZA 4GWLA 3H1AA 2Y2VA 1N1MA 1JJIA 2ECFA 1YR2A 3QBJA 5A62A 1AURA 1R50A 2BUBA 3L1HA 4QLOA 1E89A 1WB5A 1F0PA 1B41A 1BU8A 2P8SA 2QTBA 2QUAA 5HF8A 1P0QA 4BRZA 3QYJA 4AXBA 4EUSA 1VZ3A 4H0CA 3QMWA 1W1IA 1ZGBA 3WYNA 4BE4A 5AKKA 4CFSA 3DEAA 2GBIA 3A2MA 4QDXA 3OM8A 1CIJA 4FBLA 1CQWA 5EHZA 1H23A 3AZOA 2ZSIA 4EY8A 1VA5A 3O9MA 3ESBA 4W1RA 1XQYA 4CI9A 2ZSHA 4KRYA 1ETHA 3K6KA 3IVMA 4KEAA 2VAVA 1F0NA 2XUDA 3VISA 1DWQA 4MEAA 4B9EA 1GXSA 2ZJ7A 1L7AA 4B85A 2WIGA 5LZ7A 4B7ZA 1UKAA 3BXPA 3JWEA 1EK1A 3I1IA 2QM0A 5EI5A 5E4TA 5FDFA 1H2YA 4GHWA 4LXHA 5JADA 1JJBA 3KWFA 2HA2A 3DCNA 5AKHA 3WKDA 5BV7A 4Y2UA 4C6HA 1EX9A 1EVEA 1TCCA 2XQKA 3L1JA 4U2EA 1E8MA 4OB6A 5AOBA 3H2KA 5JASA 1A8SA 3JW8A 3AINA 3IUMA 5EFZA 4JH0A 2OCLA 3OPMA 3OTQA 1RYYA 4J0GA 3I2FA 3OG9A 4IH4A 4CCYB 1EB8A 4ZXFA 4FBMA 1G42A 5CH5A 1XRRA 2WJ4A 3WL7A 2ZYIA 5I7UA 2V98A 5CT9A 1KU0A 1CUDA 3GA7A 3FSGA 4CIBA 3DOHA 1HBJA 2RIPA 2XMQA 3BDVA 4KE7A 3WA6A 2WLSA 5A2GA 1YB7A 3W04A 5D6OA 4AO8A 1RP1A 3B3QA 2XUGA 1GGVA 2WG0A 4Q05A 5EIEA 1FFEA 1XZFA 2AJ8A 2RONA 4BP8A 5FKJA 1GZ7A 1O6FA 5AK4A 4A23A 4K6GA 1D07A 5AM3A 1MAAA 5C8VA 3G0GA 3BJRA 2WUEA 4ETWA 1SCIA 5HQ3B 4OCZA 4WFKA 1UK7A 3HABA 3N0TA 5T4EA 5JD5A 3VJKA 3GFFA 5A7GA 1IVYA 2CZQA 3HJUA 1LGYA 3A70A 5ALRA 1XZJA 4HVTA 2DSNA 3IUQA 5DJ5A 4ZREA 4G8CA 1IUPA 4H7IA 1T2NA 1CLEA 4I19A 2VA9A 3RKSA 3AFIA 1EH5A 2UZ0A 3I6ZA 3I1YA 4F60A 1QIKA 4Y2JA 4EY7A 1CEXA 3DNMA 4MWSA 1BN6A 1XRQA 2OQVA 3C6XA 3O4IA 1QO7A 5JAOA 1QZ3A 1P0MA 2OAEA 5AM1A 3DOIA 2XUHA 4P93A 5LZ4A 4C89A 4H7HA 1DT3A 2XMBA 2C4HA 2W22A 4OPMA 5CXUA 4D9JA 1XKLA 1ORVA 2QUBA 3GUUA 4RPCA 4EZIA 1R1DA 3SX4A 4J03A 3G0CA 1JT2A 4KR0A 4EY4A 1YSCA 2OXEA 5AKXA 3W06A 4Q3OA 4UBOA 2VQ6A 1BN7A 5AK5A 5IVHA 5KREA 1U2EA 4MYSA 5ALSA 1ZI6A 4CIAA 4HAIA 1PJAA 3PE6A 2PSEA 4FNGA 2VJBA 4FDMA 4G1FA 4RNCA 2J4FA 3WKCA 4XJVA 2YXPX 2WIFA 4FOLA 1AGYA 1J07A 2QRUA 3O4JA 5FUMA 3KXPA 2XMDA 3WKBA 1QFSA 5FOQA 1ZJ5A 1YCDA 1FFAA 3WL8A 3WL6A 2HA0A 3NUZA 3ICVA 3GELA 3FLEA 2H7XA 5JD6A 2H9YA 3OOSA 2QJRA 1QIEA 2CBGA 4N8DA 4G5XA 2CUTA 5AIBA 1A7UA 1XRMA 1L7QA 3V1NA 3BWXA 3CN9A 5BWBA 4FLEA 4OSEA 4E15A 3PFCA 1B6GA 1NU6A 4H7KA 4WDQA 4HXEB 2WHPA 2ZJFA 4PW0A 1QO9A 4UHCA 4TVKA 3FLBA 2PUJA 2Z8ZA 3PDCA 4DSAA 3STXA 3IURA 5AM5A 4PO3X 4HRYA 1JFRA 2GZRA 5JD4A 2OGSA 1RWQA 1ACJA 2VJDA 2X76A 1ORWA 5T4FA 2VJAA 2WU3A 1WB4A 4P08A 3STTA 2Y1KA 3V1KA 1YASA 3GBSA 5LKAA 1QOZA 5CXXA 5CT5A 4L0CA 1ZGCA 2G5PA 5CH8A 4MXDA 2Z3ZA 4OD0A 4BYMA 3EBLA 1OXMA 1W6RA 1ZD3A 2BJHA 3KDAA 5A6VA 3SWWA 3H2HA 1JMKC 3BIWA 1ZI8A 1MNAA 1XQVA 2HRRA 4X91A 5ALDA 2QMQA 1XLWA 3BDIA 2PU7A 2WHRA 5C8ZA 1CUZA 5AICA 4BAZA 2W6CX 1YAJA 5ALXA 4BAUA 2Y6UA 5AKGA 1DX4A 4OUKX 5ALEA 5AKZA 4X92A 2ES4A 1LPMA 3ZLVA 1CV2A 3V1LA 4PSUA 1XZMA 1QTRA 3FVTA 3FVRA 1THGA 4B9AA 4O08A 2HIHA 4Y2SA 3AZPA 4C88A 5ALYA 1UFOA 3WIBA 1K6EA 3HACA 2GYUA 4LKOA 1EA5A 1EXWA 5FRDA 1P0PA 5LYYA 4Y2PA 2GYVA 3V9AA 3DL7A 2FJ0A 1XQWA 4FMPA 3E3AA 1OILA 1ZD5A 4BVJA 2OGTA 4UBNA 1J2EA 1UKCA 3M82A 5JATA 1CUVA 5AI5A 5DNVA 2GBCA 1TRHA 2BUAA 4WY5A 2WQZA 2GYWA 3TRDA 5BWCA 1CUAA 1MAHA 4E11A 3OURA 2PX6A 5ALKA 2GBGA 2XB6A 2WILA 1VJ5A 1MX1A 2XT0A 3UUEA 2VJCA 4G9GA 3A6ZA 5CRIA 4DNOA 4E14A 1BEEA 3JYHA 3QM1A 4E46A 4B6GA 4W1PA 3H18A 2FUKA 2J4CA 3M83A 3R3UA 1VOTA 1CPYA 2VT6A 3H2JA 3E1GA 4GW3A 3X3HA 2PKYX 3O9VA 1XRNA 4Q82A 4GBGA 3UUFA 1K63A 4P9NA 4AMYA 4PV7A 3WWPA 3WK6A 5ALLA 3O4GA 4ZV9A 5AO9A 4KYVA 1DTEA 4YX9A 2JGMA 3FLAA 5AKIA 1O6GA 3MUNA 3WL5A 4QZVA 3R41A 4H7EA 3VDXA 3AZQA 5HF5A 5AOCA 1XQXA 1XZIA 2CEKA 4CCWA 2O2IA 1CVLA 4X94A 3ZLUA 5ALTA 1GKLA 3I6MA 3R3XA 4X3CA 2VF2A 5AK6A 3G0IA 5LZ9A 1X2BA 3G8YA 4KE8A 1LLFA 4ARAA 1GKKA 4BP9A 3UMJA 3WI7A 3NWOA 4HZGA 1HPLA 1QIMA 3Q0TA 3C43A 4CG3A 4QEKA 4WY8A 5LLSA 2ZYSA 4FLFA 4WFIA 4YPVA 3STWA 5AK3A 2WFLB 4HTAA 4UHBA 4UFOA 3STYA 3V1MA 4BC1A 4CG2A 4BTVA 1UOOA 4F0JA 3S8YA 1Y7HA 3GZJA 1N8SA 3WWDA 4RE6A 3F98A 5CBKA 4MJ3A 3ANTA 4M0EA 2AXEA 2XQJA 2IITA 4XVCA 2NW6A 1BE0A 3BF8A 1CUFA 1X70A 1XZBA 2XQIA 5AJHA 5E2IA 1DX6A 1MU0A 4I3FA 1VZ2A 2IIVA 1SC9A 3WQHA 3WWEA 2Z5GA 3LP5A 1CUCA 3I2KA 2XI4A 4X00A 4K5QA 4AZ0A 4U2GA 3D7RA 4BATA 2D5LA 1W4LA 1EVQA 3PF9A 1N5RA 1XZDA 2ZYRA 4DSZA 1N5MA 4Y9SA 1GQSA 1Q83A 1JKMA 5AP9A 4GEGA 2WUFA 4EA6A 1WM1A 1PFQA 5AI8A 2WG1A 4KJXA 4NZZA 2LIPA 3NOXA 5CURA 2DHDA 3HZOA 1TIBA 1S8OA 3EF3A 5FP0A 1P0IA 4ZV7A 1LBTA 2R8BA 3PUIA 4HS9A 2WJ3A 4UHDA 2HADA 2XE4A 1HQDA 4C01A 5A7HA 4UBKA 1CUEA 4RE5A 1DINA 4DNQA 4H35A 4ZGBA 5SYNA 3F96A 3FYUA 1BROA 2YASA 4W63A 3VVLA 2XQGA 4QDZA 4U2DA 4C4YA 2CMFA 3GROA
chains in the Genus database with same CATH superfamily
3OMWA 1K6JA 3OTIA 1JQAA 4EPVA 2IW1A 1MRSA 1EJ0A 1SCQA 2ZANA 4NPAA 5DNDA 3ER9A 4G3XA 2HRDA 2DVMA 4JVMA 4PLYA 3RRXA 3VGJA 2TS1A 4PS0A 5HA5A 4I6GA 1WHTA 4I1IA 4DREA 1EDEA 1E2FA 1U1GA 1SAYA 5DX1A 4D4GA 4XWWA 3HJTA 1COWD 3ZS9A 2PA3A 3IV9A 1EVKA 1Q20A 3ENKA 3LOUA 2CWWA 1IZ7A 2GZ1A 5CTAA 3GJTA 3ENVA 4NU6A 3KSMA 4X6XA 4OB8A 1Y1RA 1H1DA 3AX6A 4CF6A 2XCTB 1L3CA 3AHCA 4IMIB 2ON6A 5G1OA 3SHWA 3AO0B 3CH4B 4C29A 4L6AA 1JEOA 2V8OA 2ZAMA 3G02A 4JNCA 4ZT7A 3TOVA 4ZJPA 2IS2A 2FZCA 1JSLA 5GV7A 4TKLA 2MOKA 2HM7A 2ZIFA 2ZITA 3H0CA 3OPQA 4XIIA 4H1HA 3JY6A 1LPAB 1P33A 4FFOA 5BQPA 4KK3A 1NT4A 4I3HA 2GAIA 2VPYA 4WZAE 4AKTA 4F3NA 1JLMA 3ZWXA 2F1OA 3JARB 4QGAA 3FSGD 1CE8B 3QU2A 1GJRA 4L4UA 1NX9A 1NI5A 5IYZA 3R3WA 4X62B 1KR2A 1B3BA 2FDCA 1MOZA 4G0OA 3DE2X 4YXWA 1L1FA 1DOAA 1TLLA 3VO1A 1UWVA 1RWVA 4BMZA 3JATB 4OK5A 1R15A 4XDYA 1CY4A 3WS7A 5JS6A 1TPYA 1IHDA 3EGEA 3OFND 1HDEA 5AUPB 4RHYA 2P6PA 3DBLA 1SEVA 2IE0A 3LHKA 5FJJA 5KQMA 1W0JD 1PFYA 3NHWA 3M3HA 4N12A 4EKYA 3HXLA 1NUTA 3A58B 1DFIA 3DLCA 4OQNA 2DXIA 2E1PA 1ADFA 5DV9A 4L5JA 2EJWA 3UF0A 1Y5LA 1SY7A 4YRCA 5B12A 5E9QA 1NRIA 2ZSBA 3ZX4A 3A36A 2BTOA 1UMBA 1EINA 2YS7A 3KJFA 3LUJA 4KX5A 1LC3A 2VCEA 3JZDA 5DMXA 3TEFA 4B6PA 3PEYA 3GNSA 2FJUA 3AM4A 1M10A 3TNYA 2F67A 1W4ZA 2V45A 4JL8A 2QW8A 5FHQA 4B4OA 3KLOA 5CJPA 3WP0A 1TO1E 3RB8A 4BNNA 1TEXA 4HQ6A 1PNRA 1N1DA 1YNSA 1JMYA 4XFKA 2NXCA 4CODB 5LDDC 2UZIR 3DV2A 4A5SA 2LCQA 1QXSA 3OT4A 1HNWB 3MAJA 5B4VA 1QNLA 1EAMA 1W46A 2ASVA 2NM0A 3BE8A 3G13A 3KPJA 3MINA 4GE0A 2WI8A 3HVKA 4ZVNA 4CKEB 1RWKA 1PG0A 3C2QA 2E82A 3GT4A 4C4RA 3DDHA 4KACA 5DM0A 1D09A 4X3OA 1EUQA 2QMEA 4F04A 1MC4A 1MJGA 2EVWX 2ZJ3A 4B6EA 4EHBA 5CM8B 4D7AA 3TD9A 4Z1MD 3FIJA 5I9NA 3MILA 2ZB4A 1TGVA 3RTDA 2I9PA 3KFXA 1TAQA 1LQUA 1XTKA 1E1NA 2P69A 1PW7A 3PPVA 1R0CA 3R2JA 2VXYA 4GPD1 4RM3A 1W5TA 5HKAA 2FQYA 1SOAA 2HA4A 3L0SA 5EMNA 1T8SA 3RF6A 1YJ8A 1XVUA 2EV9A 2Z1DA 3AQIA 4RIFA 5GWXA 3H9QA 4MA5A 1LV7A 4KN9S 4BKPA 1IJEA 3HR7A 3LUFA 2XH8A 5EIBD 1SVLA 5AHOA 5B58C 3ETEA 3KC2A 1Z9BA 2AD5A 1JEQA 3NHKA 5JD3A 4Y9UA 4DA4A 3R8FA 3HYSA 1P7YA 1T2VA 2OV1A 3GOQA 3UXMA 2OEPA 3PQ4A 3HSSA 3FW1A 3PFHA 2O1SA 1U9IA 1JEYA 1PHRA 1SBHA 2FG5A 3ZHQA 4D9GA 2R6FA 4JFRA 4RMHA 4ZVTA 1DJPA 3VKFA 3PGMA 4BWVA 2ZYWX 4F3CA 3HXOA 1U3WA 4GYWA 4XYMA 3HYLA 5B6JA 4A2PA 2RGCA 3UMBA 3HWSA 2QV7A 4DY6A 1XELA 4JEUA 1SVWA 2ILVA 2Q1WA 2CHUA 1MG5A 3ANYB 4DV0B 1VRCA 4UHHA 3IJRA 3V4PB 3BXOA 3WISA 1TYAE 2H4WA 4M0UA 1QRRA 3TKLA 2M6RA 1GT91 2ZVPX 2WHXA 1GFSA 2XA1A 3DL2A 1D6NA 1NQOA 2AG6A 2QF7A 2C92A 4MI6A 1Y1QA 4Q1DA 4F2GA 4Y1FA 2RD2A 3MBIA 3MGAA 2Q5JA 2WWVD 3TL6A 2PO7A 5M7EA 1B74A 2IELA 4MYRA 4KXWA 3OJXA 3M6WA 2IZ7A 2ZQZA 2B3TA 1MH9A 4RGVA 4K86A 3T1QA 1ATIA 3V4VB 4QYIB 3PVCA 4F38A 4UEWA 2HA5A 3BD6A 3GFRA 5FPYA 2EU8A 3RFCA 4B2PA 4YRNA 2C1XA 4GLBA 4QGGA 1PGNA 5JH7B 3FCYA 1G38A 2EW8A 5EUMA 1MABA 1B1CA 1KKMA 1RJFA 2UYQA 1CLUA 1I3LA 2LVBA 2P1ZA 1T4MA 1UAGA 3JQBC 3T7KA 1KETA 4MO2A 2JK0A 1Z0AA 4C01A 4KP7A 3CUWA 4TSFA 4JBNA 4XASA 4B75A 1AC5A 1NSFA 2CCKA 3ANNA 3I9NA 3QUSA 1BD4A 4IJWA 4MWTA 2FE4A 3QIVA 1C1YA 5I7VA 5K3FA 3AB7A 4NULA 1HZZA 1RZ3A 2P4HX 3TIFA 3HLYA 1HFEL 2J31A 3ND9A 4B2LA 3U26A 3K0FA 2QB5A 4IFIA 2BEUB 4N5DA 4Q9IA 2H85A 1IUOA 4KQIA 3JXEA 4A8TA 4DILA 1I14A 2ZSDA 4J0HA 4B3XA 1JNYA 1HE4A 3UJBA 2BMAA 3I53A 1HDOA 2OD9A 1R8JA 3G8AA 4JOCA 3W4JA 3KOWA 3F97A 4YMHA 4EJ0A 4JT2A 1U9YA 1I1OA 1OZGA 1T2CA 3ITKA 3RGGA 3QVKA 3T1TA 1YK0A 1U31A 3R0JA 4WA7A 1EFUA 1Z25A 1XAGA 3V6LA 3GNQA 3O0TA 1GPDG 5DYNA 6PFKA 5EHQA 1EFRA 2F9LA 3MRSA 4WINA 1PX0A 3RBAA 1OWLA 2Y0DA 3F2VA 1EYZA 5D01A 3VPSA 1GPNA 1MV5A 1NV8A 3AIKA 4S05A 5JHHB 4F4JA 4EHDA 4CL2A 1KMHA 2ZJ4A 3PENA 4OFXA 3TBKA 4F96A 5DW0A 3KKPA 1Z7GA 4BQFA 4AJ9A 3I9LA 4MRMA 1NJ5A 2X0KA 1WU7A 3HRKA 3O6VA 1X94A 1E2LA 4P33A 1LVUA 2DKNA 1IB6A 1DC4A 2OECA 3OCJA 3NW9A 1ZY2A 1Z0ZA 4MGHA 4ZPJA 2YZKA 4EHKA 1EWTA 2BCEA 4ITUA 5DEIA 2PFKA 3QVVA 2YDXA 4L9SA 1JG1A 1KO7A 3AEUB 4X1IA 4Q01A 3WJ2A 4F45A 5F23A 5DHFA 5HW0A 5TMBA 1IIRA 3S1AA 1KAEA 1SCNE 1Z34A 1DPGA 1KVUA 2J85A 3D6JA 3IVCA 5J1SB 3C70A 3W2IA 4AIRA 4EFMA 1ICIA 4NJEB 1HDZA 3CZ4A 5C8XA 1THTA 4A91A 3QMMA 4O2BF 3K1YA 3LXMA 3OFVA 3H6GA 5JMWA 3B2QA 4G84A 4Q12A 4LZPA 2CLLB 4LYEA 4P3NA 3A4VA 2INGX 2OILA 3MOIA 3I6IA 3RIEA 1S2NA 3OMXA 1JVSA 1PEDA 4HATA 4PF1A 1W52X 1R18A 2QP3A 1W4AA 1A2QA 2FFAA 3EJ6A 3KLPX 4BVBA 1E4OA 2QMHA 5IAAA 1O6ZA 4X24A 4EOGA 2GLUA 1KDOA 2GPAA 1J6UA 3DM9B 4KWTA 3VC3A 3VO8A 2AS0A 4FOPA 1RXEA 2VDWB 1FDOA 1U1CA 1V37A 3RJ9A 2JGDB 4DNPA 4A8JB 1KQPA 4H3KB 1ZGHA 3E9RA 5HK8A 4BN5A 3IUEA 3L8DA 3STHA 4IX9A 4Q0MA 5A4IS 2JIBA 3QE4A 1R8QA 3AETA 5ALFA 4II7A 1WIWA 1FJHA 1P2VA 1KO4A 4BX2A 3NTLA 1CR0A 2XD4A 4U1RA 3TQHA 3ICQB 3SEQA 1AT1A 4I5FA 4JP3A 2AN9A 4C0BA 1BHJA 5H59A 2CT8A 3VHRA 1OLSB 3RARA 1AXGA 3CF6R 5JBIA 3UHJA 1TL7C 2VJNA 3JQCA 2QTAA 1DEXA 3DEIA 1LTKA 2BISA 5JARA 3PWSA 4OAQA 3QFHA 3LYAA 1QWOA 2ASEA 3PK0A 3PG5A 1WR8A 5DM1A 3GL9A 4ESVA 2X9NA 4ALJA 5HKLA 3ND7A 4UU8A 3FFXA 3K05A 2QVYX 3L84A 4GGPA 4GG1A 1V8FA 2I8CA 1XQ9A 2B9EA 4PGGA 2O5RA 4QBFA 5K3SA 3Q2OA 4RQBA 2FETA 3DOEA 3KQPA 5ER9A 2CY0A 1K7YA 3EPLA 1GZHB 3C5WP 4BNTA 4LHEA 1SXQA 2O3QA 2REOA 4BMCA 4EGAA 5CIYA 4YJFB 4PLPA 1GFIA 3FYUC 3VPCA 1M6YA 4UHJA 1ZOLA 4MRMB 1WNFA 4HUQB 5JLJA 1MW9X 1N2IA 3BA1A 4MQMA 4X5OA 3UUGA 1RLTA 3FRIA 4ZYXA 3W5AA 5CLIA 4Q3KA 3D1VA 4BMYA 1F2VA 1FBTA 1U0JA 3T7CA 1KI9A 2QY6A 1ODLA 4W8OA 3BREA 3GPLA 1XP8A 1XVAA 2DBYA 3MIIA 3RC3A 4P3PA 1VGQA 2DC1A 1OZFA 5B30A 3CWCA 3FI9A 1ZJYA 5MN5A 4FE3A 3ILYA 4KYIB 5CLLA 1QZTA 3VZCA 1T36B 4BB6A 4ZVSA 2YXBA 3EOAI 3VO2A 7MHTA 1SXIA 3ZI7A 1ODSA 3VM6A 3QUCA 2BEWB 2QLTA 3TL3A 1I3OA 3EC7A 1VBMA 3MWFA 1QIDA 5LZ2A 4MHOA 4XB6B 5J3JA 2BMVA 4FGLA 1A8QA 3VJMA 2IPMA 3QV1A 1EVYA 2EFEB 3HB1A 5EL0A 4ZQGA 3IQZA 4KXLA 4GXRA 2FR8C 4OLBA 2WKPA 2N1MA 2X9GA 1VGVA 3LNTA 1GSIA 2N75A 4HWOA 1U1FA 1WY5A 3L7KA 5H3HA 3V2GA 1YVPA 3L6OO 2H0QA 2QRLA 3LXRA 3QFRA 3QLUA 5FADA 2JLZA 3PGLA 4R71A 3KJHA 4PZLA 2IZ6A 5FR1A 3RS5A 4AZTA 3BILA 4NF2A 4RESA 3E5RA 1K3TA 4UW9A 4AT1A 2BLNA 3JZIA 3RAEC 3RS8A 1EXDA 3DTVA 2PS9A 3LT2A 2WJYA 2VEDA 4PZZA 5HJ2A 3T1YB 4NXMB 4LMRA 1HEIA 3GJYA 4BQIA 4UM9B 1OH7A 5ALJA 4DE5A 1H1TA 1RI1A 4YWHA 1UC8A 2C58A 4R5MA 4JBWA 3W9YA 4A0SA 4YCMA 2CL6X 4QYIA 3GJ3A 4WK6A 1EFRD 1E3QA 3CUUA 3SYRA 2HSGA 2OV4A 1JZQA 5FQNA 1QIGA 1DCFA 3PPWA 3QUTA 3WLQA 4E07A 1C3LA 4ZGWA 2J5BA 4ECEA 2HR1A 3AXTA 1JLKA 3REGA 1VSTA 3WK5A 2LZ0A 3A04A 3WZMA 4ADSG 4FB4A 3NVKI 3AVYA 5I7WA 3IE2A 3M6LA 2H1IA 5C4IA 3QX3A 1XZEA 5FTJA 4CG1A 1TZ2A 5ALHA 1P7ZA 4IYRA 3MWYW 3OCZA 4MROA 4Y0AA 3WLFA 1B6TA 2X2EA 3HM2A 2II6A 1CJVC 3EA4A 1HH4A 3NO4A 3EF1A 4O2AF 1ZHOA 1YS4A 1E1CA 3HYNA 4ZD6A 1IIBA 1OHHD 5BSRA 3RK1A 1DAMA 4EA9A 4E5PA 2PSHA 3KOYA 3LVQE 2VHJA 1F2TB 3EPRA 5KQPA 2DU8A 3LLSA 2ZGVA 5FI1B 1JIJA 5IG2A 4H15A 3AOGA 3U4CA 3RCBA 2OKCA 1ATZA 1Q6ZA 4Z54A 3VJRA 1M8JA 3A4NA 5JAIA 1ZAYA 1QV9A 5J59A 4HQFA 2IS6A 1EESA 3WLMA 4LSWA 2O6HA 2DBVO 1I5EA 4LE0A 4OUDA 5CVUA 1FCJA 2HL6A 1JHYA 1N7HA 1ZH4A 3K0CC 5ICEA 4N41A 3BC1A 4CNQA 1N0IA 1QCYA 2FEWB 4L51A 1FX0A 4M0PA 1P1FA 1GPMA 2J6BA 1WF6A 4MB6A 5EZQA 1UIRA 3HCWA 2VTEA 3EODA 2XT9A 4E2WA 5KS2A 1N8TA 1OUMA 3NUGA 4FN4A 1A9ZA 1DGQA 1MDFA 2MINA 1Y8QA 3HB4X 4FSDA 3UICA 1EEXB 1XMJA 3U4AA 4EGFA 2JLUA 4ANFA 5HG0A 1Z28A 2ICAA 3IAS1 2H59A 1FFBA 3EGOA 1UR5A 1WCYA 2BKLA 4WL0A 1V48A 1JFVA 1NBMA 4IJVA 1P9OA 2YX1A 2FP4A 2AEMA 5DLEA 5DYGA 4D9HA 1P62B 2QTHA 1RC0A 1FU7A 4KK4A 2SBTA 3R3SA 5DP1A 3WMRA 4DMFA 1JU4A 2BTQA 4E5UA 3IRUA 1WXQA 4WNIA 4F5WA 1T9HA 3FFTA 2XZTA 1G6Q1 1X7XA 4MRVA 4LRUA 2X0EA 1ZA1A 4I4LA 4D6PA 1RQNA 2A9OA 1AUQA 1IPFA 4JENA 4B84A 3ZHUA 1GQRA 1PD1A 2F43B 3K9WA 2AIRA 2HMWA 4RJ2A 5KYXA 5K3AA 1JMVA 4ITVA 4HMPA 2HFJA 5DVZA 1W4CA 1NKVA 2MHCA 4KAAA 4N6OA 4XIFA 1M3SA 2CNWD 5EPOA 5TPWB 3DVSX 3PUVA 2ZYGA 3BGWA 4M0KA 1VRWA 5AJVB 4PWYA 1C9KA 4TUYF 1J5XA 1EB9A 4Q3CA 3X1ZA 2BSQA 3DQZA 1BKDR 1F7VA 2O7QA 3IUSA 3R44A 2AG8A 2UVDA 3PNQA 3F8TA 2FR0A 4HGOA 3ABQB 4F3YA 3AT1A 5LP6C 2VRCA 4JYAB 3LQFA 3WB1A 1TUIA 1JECA 1MQ9A 3OQ6A 3WGTA 4COKA 4AJEA 4K2AA 1UM8A 2WTMA 2GHRA 5HF9A 4K2HA 2I7CA 3JQ7B 5K0TA 2EATA 1JQJC 3VU0A 5KYWB 5CGQB 3I58A 1W581 1Y1KE 1XZ8A 2VDKB 1IM2A 4GRIA 4OQDA 5JDCA 1QGZA 3STVA 3L1KA 2GZ2A 3THWB 3HFJA 4U7FA 4JGIA 2CMKA 2LCIA 5A9RA 5JBQA 1AZWA 1II0A 4ND3A 1UXOA 2WWRA 3BDAA 4EX6A 2JCVA 1R6TA 1QMGA 3CGGA 3GLHA 4NFHA 3TG2A 5F4BA 3GLRA 2P9TA 2WP0A 1NVVQ 2P4EA 1DL5A 2HDHA 2DQ4A 2VT7A 1XEXB 1OCEA 2W4MA 3IP5A 2F1IA 3BEDA 4FHZA 3EFOA 3P20A 4Q24A 2QVXX 1FTGA 4LOHA 3SMQA 5MN4A 3N2KB 5H8WA 1JQ3A 4ZVKA 2E89A 3GFQA 2HQOA 3PSAA 1NATA 4F11A 1I7SB 1F60A 1W73A 5BQFA 3WRXC 4ZI2A 1CY7A 3C3DA 4TRNA 3UMMA 5DN6D 2AUTA 3ABSB 2W6MA 1XKXA 3USZA 5IXJA 1TTQB 1XFAA 2CJPA 5SZIA 3NJRA 4DR6B 2CZCA 4G8JA 3J81k 2H6EA 2DPGA 1FRZA 5AM0A 4US2R 2B4TO 3DV0B 3V7FA 4K26A 1N3IA 5DI3A 4RHXA 1SO8A 5BURA 2H1OA 2FMHA 4JI4B 2YYAA 3LHDA 3T1VA 2VP5A 1RXVA 1T15A 4IGIA 2ZIEA 3E84A 4PGAA 1JPNA 2VPIA 3O38A 2A3RA 2X6RA 2EFGA 4FNOA 5EJ9A 5ELLA 1LDGA 3EFOB 2DM6A 2QN1A 2YN4A 3FE2A 3LT1A 1L7MA 1XDBA 3QKTA 3TTYA 4EI9A 1Z73A 4YV0A 5KYVA 2GZAA 1MFZA 1UZNA 2YICA 1FU8A 2ONJA 1AMUA 3IKMB 4UCWA 2CHQA 1GIAA 3NEJA 5IFKA 1VE1A 4Z53A 3ASZA 2HT1A 4K8RB 3OZSA 1EE1A 1E9BA 2IIPA 2ZDHA 3W5UA 2K7FA 2PZBA 4RQTA 3KKEA 3KKNA 4TS3A 2L18A 5DTRA 4ON9A 2CBXA 2Q3CA 2LR0A 4QA9A 2QLJA 1RRGA 3QNMA 1Z74A 4Q4JB 3AVXA 4PYIA 3B5IA 4BLRA 1U8UA 2R7AA 3RUEA 3ZX5A 4ER5A 5FHRA 5IW8A 4LZWA 3D7LA 2JH3A 1MN6A 3C39A 2IYQA 1AZTA 4IDBA 5G0UA 4DMHA 5KX5A 4W5RA 1E2IA 5DW3A 3MJRA 5H3LA 4DLLA 4GF5A 4BNXA 1XZGA 4O5OA 1F6WA 2NO4A 1JEAA 1LX7A 4GDMA 3B70A 2GCOB 2IZOA 2IVFA 5DCLA 3UAZA 4LJ5A 1Z2EA 4FCVA 2C2XA 3TQIA 2B30A 3R6WA 4U4AA 5FUQA 2WIJA 4A8JA 4PZYA 4QQRA 4TWRA 3B6MA 1DG1G 1GPYA 1QDLB 3DS8A 4W1SA 2NU8B 2FRDC 4D97A 3CBQA 2PUWA 3G7NA 2VYCA 4JFAA 1X87A 1F14A 3FPBA 3P9IA 1FYXA 1R5NA 1MRNA 2C2GA 3WBKA 2ZBPA 1E1LA 1ZG3A 3JD3A 4LZLA 2BD0A 3HY4A 4O8CA 3UMGA 3H0EA 4DNXA 5AOAA 3K6JA 2L82A 1FLAA 2R79A 5T3UA 1UAYA 3SCZA 5JSZB 1LPPA 2GEVA 5J9FA 2X42A 1F3OA 2QX9A 4U7JA 1TUEA 3MOGA 4MCIA 2A7XA 1RE0A 1C80A 1CUGA 4QNRA 3IAFA 3REQB 4LVNA 4A2QA 2Z57A 3PLNA 1ZI9A 4I6JA 4P35A 5GQSA 1XEAA 5CFZA 2JG3A 4NHEA 1TQ2A 2OWEA 1P4AA 4FUTA 4UDNA 1J9GA 3VR5A 1T8UA 3HKEA 5ESRA 5KU1A 1LNZA 1WPXA 5JCJA 1WPGA 4QUDA 5HIMA 1NKSA 2V96A 5CFMA 3M5PA 2W00A 2OG1A 1ZIOA 1JSXA 2PGLA 5JNRA 5DLPA 3M6IA 1QFMA 4I0WB 1QQ7A 2FN9A 1GXSB 2Z6VA 5JU6A 1O5TA 2P9HA 1O5IA 2AI3A 2XLBA 3C1AA 4M21A 5D87A 3GMIA 2E6UX 5C3MA 3ETLA 3K0AB 1Q1AA 3OF2A 4AM8A 1RCUA 1CVIA 1PWHA 4MYTA 4XI9A 2C5EA 2V0NA 1V2GA 3EIUA 1ACMA 4EVIA 1A69A 3INGA 4IIXA 4PRLA 2C2WA 1QF7A 4MUYA 3WKAA 1S01A 4YCNA 3H99A 4EHFA 2ZXUA 1MZVA 2OE2A 3A2NA 5J4HA 2JFHA 1ZDMA 3C1TA 3ZCQA 4S1TA 3K70B 3G5AA 1ITZA 2BP7A 3NOOA 3NHLA 3CY6A 3RS9A 1MMFB 1JXMA 4MMXB 3IP3A 1P9RA 3WYDA 2YOGA 1FJ2A 3G9ZA 4N3NA 4E08A 2EXXA 2COUA 3KB2A 1HMYA 3L8HA 5EG5A 1I7QB 3AKCA 4U8HA 1RCTE 4YYEA 4CLXA 4EGQA 5LM3A 4QEZA 3SNHA 4K9NA 2FAXA 3A9UA 2I3GA 3IAM6 3A26A 1CZOA 4QFMA 1T25A 1IU9A 1VPVA 2WHQA 4WHMA 5BSEA 1NF3A 3DEFA 4INZA 3FPHA 4ZQEA 2NUTA 3MCUA 5C5DA 5J23A 4GKVA 2FKNA 2G0AA 3NOQA 5F98A 4NBLA 2PR2A 2FDRA 4RH3A 1NXWA 3D4IA 2KHZA 4RXUA 1KI7A 2O0HA 2A0WA 3IQIX 2EZ4A 1NP7A 3JD0A 2ZE7A 3AHDA 1XDZA 3OPNA 3A1EA 1WUJS 4HFMA 2E21A 2JLSA 1H85A 1DBIA 2YVAA 4IFTA 5BXYA 2XNCA 1PV1A 3LK7A 4QAQA 2DCUA 3QVLA 3ZE8A 1YU9A 1DDIA 1FUKA 1P73A 1S9DA 1RKXA 2IOFA 4ISCA 2CB0A 3MIZA 4HEJA 1T6NA 1KSJA 1YI1A 2YY7A 3HO8A 4YCAA 2P6RA 2XIQA 1SK8A 1SUBA 4YDRA 5E38A 3T52A 3K5HA 4HFNA 4UXJA 4HJRA 3RW9A 4LFCB 3SU8A 1BCRA 3OQMA 1XKTA 3HS3A 1WD7A 1U2QA 3BWEA 2GJ8A 2HRBA 4RCZA 1JDNA 4ABTA 1E3JA 3E9DA 3TR6A 3RTEA 3R0ZA 4RJTA 2XUJA 3GP3A 3MT9A 3K9LA 2V7XA 4L8WB 4ZCRA 3ZVKA 3PI7A 2HYIC 3DJFA 3K70C 2UZ3A 3MTDA 4URZR 5DBOA 4AMVA 4DHEA 2A0KA 4I1UA 2YRFA 4E7PA 5HRCA 1QM5A 5I01A 3M1LA 3RIMA 3QEJA 4TT3A 3GRRA 3Q8WA 1USGA 3GYGA 3RG2A 1GPAA 3RUCA 1TZJA 2QORA 2QTFA 1XZAA 1P7PA 3BS4A 3QPWA 4M89A 4QJ5A 3R74A 4RD3A 4ZO7A 1NYRA 2WAOA 1MV8A 2APJA 2E6KA 1U2GA 2BSAA 4NE9A 2CXOA 2IRWA 1ODFA 3ZKWB 3ESZA 2FUEA 1QFXA 1Q21A 1HWYA 2O57A 1USKA 5ITZA 1CRWG 4PZEA 5DPMA 2FTKE 2VSXA 3LBNA 4UBJA 1KY3A 4OXYA 1W5BA 2JEOA 4UUAA 5C7IO 1FFDA 3D3EA 3OOEA 1NLZA 5AESA 6GPBA 1U0BB 3KK0A 1BHO1 3G68A 1NXTA 4EG7A 4XLZA 4WLNA 2PS3A 3GUVA 4ZQBA 1C9YA 1TCUA 2QVBA 5HKKD 1W0CA 1Q91A 3U6BA 3WFIA 4MGIR 5F35A 4OV6B 3WHIA 1CY8A 3D6TB 3RIGA 4D4LA 4L76A 4OHWA 5AQEA 3I9KA 4Z2AA 2IOYA 4TKVB 1BXZA 4CT5A 1KXZA 3CR8A 4AULA 2XB9A 2YCLA 5EHXA 3L0DA 1PK8A 1JHZA 2POQX 4U7PB 5EP2A 4ARBA 1YUMA 1G6HA 3K09A 4JLBA 1HYQA 3U7JA 2NOAA 1GL7A 2JFXA 2ODBA 1K68A 2ORED 3DHWC 5F77A 3PXEA 4WK0B 2J9XB 1XVLA 3WOVA 2HWYA 3GLIB 1C4WA 3P5BA 4NZOA 2WSYB 2IYZA 4H3HB 5BUQA 1I51A 2L42A 3V8MA 1Z22A 3TTTA 4EFDA 1GTSA 2D7CA 3M5DA 4KN8A 3PKJA 5EP3A 3KUUA 4JEMA 3ZY3A 2XCOA 3FCEA 3TSWA 1XRLA 3GFTA 2HW8A 1DMSA 2BFDB 5EXXA 1XMPA 4Z0PA 2EJCA 2CDBA 2G1AA 2ZUCA 5F33A 2QG6A 1D4FA 4NS1A 4X1IB 4A8JC 4GM1A 2B8WA 2EWWA 3AL2A 1SOWA 1RRCA 1NW4A 5IJAA 1DELA 3M34A 1JE0A 4LXIA 4RANA 3CH5A 3MW8A 3Q11A 1E92A 3OECA 1Y89A 3H75A 4JELA 1ECBA 4NCBA 1EK6A 2G1UA 1L5MA 3FYCA 1QQAA 4QXPA 3ZJTA 3ZIAD 1NRXA 2GRAA 4JI3B 1UL1X 4NJMA 1Q2UA 4CI0B 3OZGA 4IRMA 2W6OA 1Y7TA 1NY6A 3TDKA 4MW1A 2FSUA 3TSAA 1CUBA 2P9BA 3DKRA 2I67A 2RMKA 2WHYA 3NDJA 5JRJA 3DC7A 5GZ1A 2C3OA 5J4YA 4YCBA 1FP6A 3IRVA 3K16A 1X19A 1VA4A 3FX2A 3V9PA 4PQRA 5JOQA 3DFFA 4X20A 3R7WA 3F7TA 3OOYA 4J2OA 1R9GA 3AHEA 3K0AA 4RSRA 2WG2A 3DFMA 3OUUA 4QE3A 5JJCA 2ZJOA 3DF9A 1TDJA 2BMEA 1KEPA 4KCGA 4LYJA 4IXNA 3DDZX 4NBSA 5G1PA 3NM4A 1NPTO 5AUQA 3SLKA 3PJFA 3T99A 1GAEO 3GWZA 5UKDA 3FHLA 2QPAA 5E9AA 3SSNA 2WE8A 3KL4A 4XRGA 1VB3A 4MGZR 1N7JA 3IEPA 4ML3A 3EWIA 3HA2A 3PUHA 1W5SA 2ZK7A 3DCYA 4WWHA 4J1QA 2XUPA 2X23A 4JQZA 1P74A 2GD0A 3GLKA 1P29A 4QDOA 4QVGA 4MDHA 2Z8XA 5ALGA 3KWLA 1WEKA 1GHTA 3GDFA 1U28A 3S2SA 1DAFA 4TRMA 4KGXA 3IA2A 4AJKA 1VKNA 2JIDA 5CT8A 4E30A 1S8FA 4F4HA 3JQDA 2CVQA 4Q7JB 3QE0A 1DAOA 3CM0A 5K0NA 4G65A 4CKZA 1BQ3A 2I6QA 2BI4A 3PHGA 5EWMA 2IBMA 4QKQA 1C29B 4X85A 1VKHA 2H1RA 3U7HB 4DIFA 1H9BA 1ZR4A 3VXKA 4J0FA 4WN3A 4BB0A 1C0KA 3PHCA 5DYWA 1FFSA 4GP7A 1FRVA 1W0KD 1UK9A 3QJ5A 3TXYA 4KQHA 2E4YA 1BW9A 4QODA 4XQ9A 1IH8A 3VNUA 2XWSA 1JT9A 3NDRA 3AI7A 1CHNA 4ZOAA 1P19A 2C9OA 5ICMA 3AV0B 3T3OA 4FILA 3CEHA 5CK4A 4MMZB 4EYSA 4KVGA 2BCJQ 1Y6GA 3PHBE 2ZBRA 1WL8A 4WKCA 5I4IA 2AJBA 5JYCA 5H9VA 3ZV7A 4NDNE 2UDPA 1O96A 2VLBA 3RVLA 1P80A 4JI8B 3SOZA 1D2EA 1NDHA 4ROSA 2J8ZA 4WUTA 3H1PA 5HEKA 1NLUA 4BJ1A 1H0SA 4FEGA 3ZDYB 4CF4A 1QH1B 3V32A 2Z1NA 3TL2A 4RTSA 3O4FA 1GKYA 3H2BA 5BNFA 4UEOA 3UC9A 4LBVA 2Y92A 1CT9A 2I2CA 2UYYA 3KVVA 4ZODA 5FX2A 2Y71A 3UK1A 4C7OA 5E0KB 1FSSA 1L4MA 1ARZA 4KPEC 1BXGB 1VRVA 4MUMA 1Y9DA 5FULA 3OC0A 4CV2A 5EE1A 2WQ7A 1OXTA 2N46A 4R84A 3HXKA 3RBZA 4OM7A 1XLUA 2OKGA 2YW9A 4HX9A 1Q0QA 3OEYA 3V8QA 1KA9H 3O8QA 3OM1A 4N7MA 1J0XO 5SY9A 2F9FA 2I78A 3QVGB 4DV2B 2X7XA 3G7SA 4PIPA 1RFLA 4Z4FA 1RWPA 1YZKA 1M6EX 4ZYWA 4UUNA 3GAFA 3NORA 3WO0A 1IEQA 3NT5A 4R2WA 4PZUA 4UTOA 1XK6A 2BDEA 1RWMA 4LA4A 3VTKA 2XD9A 5EIAA 5I7HA 4CIDA 2JVKA 3V97A 2PMKA 2DFLA 1G3IA 2D0OB 2J0EA 3LUCA 4GI3A 4M86A 3GLUA 5IBQA 3ZQ6A 4TVBA 1A95A 1JTEA 1K0FA 1NNLA 2J08A 3IKJA 3JQ7A 2Q49A 3L7AA 2A9FA 2X2OA 3BJEA 3L6BA 1W48A 4ZU1X 1EKXA 4DA6A 3H13A 3DPUA 5AVUA 2C5LA 2IS1A 4S3MA 1HT3A 1RBYA 4EMTA 1UM9B 3M81A 3WIVA 1TAGA 2I6FA 2GTHA 5GOTA 2Q3JA 1YS7A 5DDIP 2IWHA 3VH2A 4NU5A 1WSWA 3HP1A 3DFIA 3OJ0A 2VSOA 2Z58A 2JBAB 2QQEA 1A76A 1FMJA 1T5HX 3B60A 1J4AA 1JJAA 1WBJB 1UDRA 2VSYA 2PWPA 4GH5A 1XTQA 2WFZA 4GU5A 3RRYA 3ZEAA 2A9VA 3JYOA 1AK2A 4JYCA 1D6SA 4XTRA 1V16A 2RI1A 3LKBA 4BFLA 2ZB2A 3NHYA 2M9MA 4K6HA 3SJCA 3C6YA 1BJTA 2HDWA 4G1EB 2GFQA 2O3RA 2WHPB 3ITNA 4ZC1A 2PRIA 4LOKA 4D46A 2W0MA 2BE7A 1Z6GA 1GAWA 1ZGAA 2WTBA 3EBOA 2GHTA 1JEYB 3MNFA 1PZGA 1RAEA 4GI7A 5ICGA 3HJNA 1SG9A 2I2WA 4EJ2A 2BGWA 2ZRPA 3NB0A 3RLFA 4Q9AA 1WQ4A 4E13A 1LDEA 4P83A 1E20A 1QC5B 2AFHB 2HLHA 2H7YA 1QRUA 2D74A 2KBFA 1Z8DA 4K6KA 2CL7X 3EXHC 4LXYA 4P80A 4BVLA 1E1CB 1N6IA 5K2OA 2VKTA 5FO1A 2JBAA 4PAOA 2G70A 2Z4RA 5IVKA 3N2GB 4AK9A 2VWQA 4QD3A 3EPJA 1D8TA 1M74A 2FPWA 5JAUA 4LZJA 4FDUA 2ACKA 3RRMA 1YWGO 4ZMBA 4PZCA 2VPPA 5LMNB 3TNJA 4FGWA 5AK0A 3EA0A 1E7QA 1EEHA 2HMYB 1VJRA 4Q03A 2CUNA 2O0MA 1B3RA 3F1LA 3IL2A 2KB0A 4EW3A 3CW8X 1TGYA 4HZUB 4P4GA 4W9RA 2GEDA 3JSXA 1O9GA 2AOVA 2PCLA 3EC2A 1KPHA 1VBFA 3BJZA 4U2KA 4IS3A 3E27A 4X8LA 1SD1A 3S8MA 1SR8A 1FX0B 2I4MA 5AJXA 2BI7A 4BNJA 2QPOA 3DMPA 5KOJB 5JMPA 3JQFC 1I0LA 1P1HA 2FHPA 1OX6A 4WCVA 4EVQA 3NYRA 4MR8B 3CKKA 1Q7RA 4Y2XA 3VNAA 3PI6A 1NQXA 2D1TA 2QI9C 2VHCA 2AOTA 4UCXA 3U37A 3ZHZA 1P8AA 1JIQA 2XXBA 3RROA 1PGPA 2WYOA 3MTGA 5BR1A 5KX5B 1GRRA 4LMBA 1UBUS 1JDJA 4HDKA 1WBDA 2C2YA 3C8ZA 1N2OA 5GIPE 3NKFA 1SVKA 4UM7A 5B3JA 1Q7EA 1W88A 5FBWB 3AEYA 4G1BA 1UPAA 3R5JA 3FCOA 4HZUA 4E5SA 1QGAA 5E6SA 3U5ZB 4ZCTA 2XNKA 1O6CA 4HB0A 4TYMA 4RPHA 3LU1A 4KSBA 2Y6VA 3T95A 5KVQA 4O8ZA 3L0CA 2WJZB 2XLCA 2JA2A 3G5LA 3GRFA 3DD5A 5TC4A 3T94A 5HUQA 3W9UA 1TVEA 1YOVB 3RYCB 2WD8A 4LPSA 2IF0A 8GPBA 1M67A 5KX5F 1DU4A 4DRZA 2DUUA 3EY9A 1XXHE 3IP7A 4RSMA 5AOVA 5AVJA 4JU9A 1P2TA 4ZAVA 2BFCA 4NBTA 3THSA 1APBA 3Q7RA 2HJGA 2PKQO 2ZI7A 3FBGA 4OG2A 4G9EA 4B45A 2ATXA 3KBBA 3A9VA 1DG9A 1OF1A 2MMCA 3DJYA 1W29A 5GZ3A 3IIKA 3FUVA 2GZSA 1Z35A 3GVIA 3W3AA 2XSZA 5EXEA 4ZV4A 5CXUA 3FI0A 2V3WA 1J20A 3PDHA 3SE0A 3SS9X 3SZLA 1NI4A 5JH7A 3T1NA 4N1AA 1QH8A 5E7QA 4B48A 3WJ7A 2GJ9A 1WXWA 1YFKA 3AJ8A 4PTLA 2XCRB 1XD2B 5AKYA 3LRXA 1C9EA 3WA7A 4WBNB 1LPOA 4XVUA 1M2NA 5F7JA 5LYJF 4MRAA 3IQGX 1NLMA 3FR8A 5GPBA 4MULA 1HDGO 1WY7A 4AKIA 1NGSA 3AY7A 1URPA 3NHBA 4AUKA 2HBZA 1U6KA 2O0KA 4B4VA 1QGUA 4UOQA 2B9VA 3TW0A 4QPDA 2B1QA 4C04A 1YC5A 3BA6A 1ZISA 3RJTA 2MYPA 2CLCX 1ZW6A 1E2KA 3AXSA 1AG9A 4EATA 3IBGA 1XA0A 3FUWA 3CF2A 3WSVA 4EJSB 1ECLA 2C7BA 1J00A 3QBEA 3ZJ4A 3JQ9C 5JWOA 1II8B 3D7NA 4MVJG 3I2YX 1CIPA 1WDMA 2WKQA 1U0GA 3PJDA 1U94A 3KQKA 3HCPA 2YZ2A 1KEZA 4WOBA 3DWEX 4GWLA 4HS4A 2E37A 3MFYA 1AK9A 1V9LA 4YIHA 1JJVA 2D1QA 3OKFA 3OX1A 3MSXA 4CMIA 2FR8A 1N1MA 2HN9A 4P84A 2ECFA 1Y6JA 3AY0A 2O1EA 3LHIA 1W44A 3QBJA 4PX5A 1XJ0A 1JFTA 5NLLA 2F3QA 4OHFA 3ZE7A 2V5UA 2A1TS 4JASB 4FWIB 5H3CA 5CEJA 2WWIA 4EYOA 4ARVA 2FP3A 1E89A 1LJUA 1QYDA 2G1JA 1L8OA 3OQBA 1F0PA 2BLLA 2H1VA 3QKIA 3ZCRA 1EGQA 1V1JA 2EFCB 2VDWA 1XD2A 4DDVA 4V0OA 2DMRA 1AB6A 2LPMA 2WJWA 3LFTA 3QLEA 2ZYUX 1BX3A 3N8HA 1ZCAA 4KN6A 3IPRA 2AKEA 3AJEA 4ZO8A 4YROA 3KSAC 3CINA 2OCAA 4Y1EA 1UZMA 4JB0A 1MAUA 5K6TA 4D98A 3LC7O 4QEDA 4LRWA 4CR7A 4LG1A 2GN4A 1PLJA 1O96B 5ITVA 3TW8A 2PZKA 5KOHA 3OH8A 3QMWA 2XAUA 4OHOA 1W1IA 2CD9A 4PFQA 4XR4A 4U3JB 1BTOA 4CM5A 1H8EA 4YY3B 4AY5A 4IIUA 3AUSA 1O4VA 3ETCA 3LRTA 4WKBA 2PGNA 5C1IA 3DEAA 5J4VA 2NTJA 3A2MA 2BDUA 1X1BA 3E81A 5KNBD 3ISTA 3ONDA 3QRWA 3KYBA 2ODNA 3DL0A 3OM8A 2FEMA 1CQWA 4FBLA 5AHKA 3ROTA 3E9YA 4K81B 3RIHA 4IV5A 4NCNA 1W25A 2ZSIA 3D8RA 3O3MB 4I3GA 4QUBA 4GDFA 1PVOA 1SPXA 3LUGA 1SXJC 1VA5A 3M9XA 5T67A 3O9MA 3PWKA 1M1XB 2WWFA 3KUXA 4MK4A 4W1RA 4O4IB 1W2HA 2J09A 2X2PA 2F9MA 4YFYA 1DAHA 4A8HA 2X0RA 3O26A 4ZC8A 2ZSHA 2PMBA 1ETHA 4KRYA 3KLNA 4P38A 2NP6A 4D80A 1NR1A 3CB2A 4YJFA 3R0XA 2PTHA 3FOWA 4KEAA 2C9YA 1XHEA 2VJOA 2XUDA 2FEPA 4IIDA 3DZGA 3GRAA 3O2NA 5G53C 4RTOA 3TCKA 4F7WA 3VBCA 1J8MF 4JX9A 1ES9A 2WIGA 5HQTA 1T1EA 2DUNA 3FWYA 4OP1A 4BX8A 4ER0A 1KI4A 4QELA 4HAWA 4DRXA 1MO6A 3BXPA 4L6IA 2J3LA 3DUFB 1EK1A 4KQ9A 4CM9D 3PQ5A 4DMRA 2GCEA 4NZ9A 5FPTA 1GG5A 3E05A 5CB8A 1WZUA 1VJDA 3K73O 5K3OA 2DH6A 2QM0A 1N9KA 3ND6A 4NU0A 1HL3A 1XZNA 1NLYA 1DCKA 5EI5A 1CK4A 1G41A 3L0IB 3DVQX 3SR4A 2WWTA 1POXA 3OE5A 1CNFA 3CR7A 3H9EO 4HAXA 1EP1B 4OGLA 5F5LA 3T34A 3IT1A 1O95D 2DHQA 4REOA 4POOA 5IBRA 1LI4A 1Z6AA 3CCFA 4I4IA 5JADA 3TZEA 4UTXA 5AKHA 5JE8A 4G5RA 1J8FA 3DQPA 2IYYA 5BV7A 1J1ZA 3JQAA 1XF1A 4D2IA 5JJLA 1EVEA 2QRKA 2XQKA 5AHWA 2AF4C 1TTPB 2OORC 4PRKA 3ZHXA 5K6AC 4PC2A 3N0WA 4MW4A 3ACDA 3K71B 5AOBA 2O4UX 3JD2A 3H2KA 3PXCX 4LHVA 4XCXA 5JBNA 1EJBA 3IDOA 1BMQA 2AFHA 2KM1A 2Q28A 3JW8A 4LRSB 4NONA 3IUMA 5D1HA 4JH0A 1YU6A 2H4FA 4JVSB 3OPMA 3K0HA 4TWZA 4WE3A 4PN3A 5K4HA 1J2TA 5ARBA 4J0GA 1KH1A 1QO0A 4OI4A 5KTSA 4OQYA 3IAXA 4F91B 2DERA 4ASUA 4KIJA 1EB8A 3EIWA 4B3JA 4DVGA 4MUGA 3OJWA 1O5OA 1G42A 2VQSA 3HM9A 2RHCA 3FMIA 3ZCSA 4O33A 2X3FA 1C30B 3SY8A 2R6HA 3RC9A 5EC8A 2A58A 4XEUA 4BQRA 3ADCA 2CSXA 1XWFA 1I10A 2Z04A 3EOZA 2ZATA 3M4JA 4JP2A 4ZHQF 2ZAYA 1H3NA 4FYMA 1B76A 3GA7A 1E61A 1VLZA 2PGXA 1G1AA 2EGHA 4W7IA 2CDNA 3P9PA 1OYVA 1M34E 3U3RA 2RIPA 3GDHA 3K96A 1P5RA 1SVSA 2QRHA 3SXUB 3AM5A 4MV4A 3PGJA 3BD8A 1WKCA 5A4JA 1YB7A 4ZVVA 1MAWA 4JUFA 5J2TA 4HH1A 2V74B 3F8WA 4R9VA 3ZGVA 3ZNPA 1HT0A 3NTXA 4HDRB 3ZQJA 2Q2QA 4ACBA 1JWLA 4PFSA 4R68A 1K89A 4AO8A 3TKAA 1GGVA 3M6UA 3LCCA 1GEGA 4NJOA 5HE8A 2QM8A 4JDUA 1GNVA 4LVCA 4YO7A 1U7DA 1X0XA 3VDRA 5I51A 3QOYA 2J33A 1I7PA 4D02A 4EJSC 1D9XA 4F8JA 2NVUB 5C51B 1EUYA 4XGNA 4L9RA 1OXSC 4A23A 4BKRA 3K8ZA 4K6GA 1JEJA 4G0XA 2FYTA 2IUUA 5A0TA 3N9IA 3UMRA 2EP7A 3B48A 2X5JO 3MRVA 4R1OA 3HGMA 2ZIVB 1RWBA 5EXTA 3KTFA 4PG6A 2VRCD 3KIPA 3G0GA 1KIMA 1XALA 1OIVA 1Z7YA 2IU3A 3NIBA 3O1IC 1SCIA 4L8LA 4NG4A 4EA8A 4G67A 4O02B 5JROA 1Z4KA 1SJ9A 3GARA 3L7BA 3O92A 1I7LA 4BMDA 2C88A 1EFHA 3HABA 4ZCIA 3TAHA 1PLLA 3U62A 1ZUIA 4V0SA 4EH1A 3PNSA 3GAAA 4X7RA 1RXYA 4EHIA 5JD5A 3MELA 4ISBA 1HYEA 1YZFA 1J0AA 1MJGM 2H65A 3HJUA 4GP6A 5FL3A 4GBMA 3I0NA 5BWNA 1E98A 3A70A 1J5PA 1KVRA 1N2CE 2VDRB 5DNCA 3VKHA 5MFPA 1FDIA 3RS3A 3S68A 2EP5A 2Y4OA 1XZJA 3DVLA 4LHXA 4C0XA 1ZUNA 2BVNA 2DSNA 4ZREA 4DY4A 2WAAA 2ZUEA 3B9PA 4Q1EA 4HPXB 1IAVA 5C5CA 3JPYA 3K92A 3ZY4A 4C22A 1DV2A 3NIWA 1ZOPA 5ADWA 5D6NA 4EKEA 3GRYA 1HR0B 5CEEA 4AG5A 4FYIA 4LXTA 1T9KA 2VK1A 5AW8A 3IIJA 1EFLA 3DW3X 2YMPA 3PRKE 1R8SA 4F2PA 4EZEA 4REQA 1UBSB 4FCWA 3ZK8A 3GCGA 3SBEA 2I4NA 2B78A 4LXXA 1BGWA 5KYXB 3RKSA 2OBNA 1Z39A 5LQAA 3B8HA 1S3GA 4B76A 1UFKA 1NXVA 3PQ6A 3EG9A 1RHJA 2YMMA 5EJGA 1E58A 1JQLB 1JL3A 1QIKA 4LJYA 4O1HA 2GGSA 3OQOA 3W5HA 1WUHS 2FI1A 2PGJA 2WM9B 3GFOA 2IV7A 1V39A 4S1WA 2QTCA 5WRFA 5JFGA 3AHHA 5ILGA 4MWSA 1BN6A 2W2XA 1J1UA 3FSRA 2AFRA 2Y3IA 1QHFA 1QO7A 2X1MA 1GCGA 3PFFA 1TC2A 5BVGB 5L3VA 1NQUA 5IANA 3R8CA 3OJCA 4QTUB 2XV1A 3RC2A 4P93A 3SQLA 5LZ4A 4H7HA 4MVXA 2ZSKA 1KIAA 1Q7CA 4MUBA 4OX9B 3WGJA 3P9RA 4M88A 1BGVA 1Q1ZA 3ZG6A 3FZGA 4I1RA 2NQTA 3DBRA 4CQMB 1DTSA 2WINI 1XPJA 3GUUA 3ROGA 4EZIA 2Q2VA 3CX6A 1D3AA 1NNUA 1ZD8A 3MINB 1CE8A 1R1DA 2Y67A 2PQ6A 1PYOA 3LRPA 4MW5A 5KYNA 4B6JA 1GZ4A 1NAIA 2XIJA 4J03A 4DV7B 3C3CA 2QZSA 4KR0A 3AW9A 3MMSA 5CPBA 5BSMA 4EY4A 1IE3A 2PXXA 1TQ8A 1WXDA 2CE7A 4AF7A 1J2YA 3CPHA 4BNUA 4Z4IA 2PV0A 1ZL0A 2A5DA 4Q3OA 3T06B 4QTZA 4JI5B 2C8JA 3TOSA 4BUZA 1SEPA 2VQ6A 4LI0A 3HKCB 3W5DA 4S1NA 2D5AA 4RA9B 1W47A 3V7WA 2NO0A 2GBLC 1CZKA 1IATA 1K8ZB 2VSNA 4I66A 1SUEA 3EAGA 2I65A 5EA2A 4ZAWA 3OZCA 2Q2WA 1XWIA 3CUKA 2FQQA 1M8GA 2IXDA 3F5SA 3LQ2A 1T43A 4FZ5A 4MYSA 4OKIA 3KNZA 4ZU6X 6AT1A 3WGLA 2YXDA 1NJ6A 4HAIA 1R74A 1YVUA 2HH9A 4TL8A 4WLFA 4XARA 5BSGA 2H1SA 3A9TA 1CY2A 1L3BA 3ECAA 3Q0EA 3IVGA 2IYAA 2VT3A 3QWBA 4GVPA 1Z75A 4M98A 4WNCA 5HM6A 3DPSA 3UO8B 4NEHB 3H5TA 3WKCA 1Y34E 5C32A 5CFQA 1RYBA 4HPWA 4IZHA 1E79D 3IT3A 2VWPA 4DLTA 2HDOA 2Y0BA 4FOLA 3MMPA 2AL7A 1FSFA 2A0XA 3AMVA 3HDQA 4XW2A 4YAUA 2QRUA 5FEMA 5BVHB 3EWNA 5H02A 3KXPA 4I5EA 1GADO 2VHZA 2FZLA 4FR5A 4ENVA 2ZZKA 3UPUA 1RQXA 3IT0A 5DK4A 1U7OA 3VNQA 2G9RA 5K03A 4ZT5A 4GX1A 4E12A 3W34A 1W94A 5THXA 2GJKA 3R75A 1XTPA 3ZDZB 4CKWB 4GRDA 5FWAA 1RJDA 2HA0A 3N7TA 2QUIA 3AG5A 4K87A 5AJZA 3CISA 4B6OA 3AV3A 1XTTA 1LW7A 2CFOA 1CZHA 1ENYA 6ADHA 4OIMA 3KM0A 1VFNA 3GELA 2XDAA 3D6UA 3JTMA 3CPSA 3KOUA 4TSFD 2WTEA 2XGOA 3FLEA 1ISHA 1ZH2A 2OAQ1 2ZXFA 3BQNB 3DBOB 4S1OA 4Y6SA 2BRUC 4MB2A 2H7XA 2IU6A 2WSSA 1JHOA 1M2HA 4HAZA 4WX2B 1IHUA 3OOSA 4XE5A 2CGEA 4YUAA 3Q1LA 1DBWA 3Q5EA 2C61A 1E9AA 4WD3A 1I3CA 1QIEA 5BN3A 1EXVA 4P5DA 3SZ3A 1JX6A 4URXR 4N8DA 2BV3A 2CV2A 1HXHA 5TE9A 3CNEA 2ODEA 4IHJB 2H18A 4RUKA 2CUTA 5DIFA 4MQUA 2RC5A 4D6YA 5EQDA 4LHSA 5KYYA 3N8KA 5BWBA 5IT0A 1Y5MA 1O9HA 1QBGA 3H8SA 4Q9DA 1D8AA 4ZJYA 3VZRA 2RHJA 1SUDA 1JB1A 4MIOA 4NE2A 4NY1A 3HCBA 5DBGA 3T35A 1F8YA 4XWOA 1K06A 3W1EA 1IFXA 4IF6A 1T26A 3NYQA 4TS4A 2B0CA 5B5SA 4H17A 5IULC 3DMNA 5BSWA 4DV4B 1YF3A 3NWJA 1QO9A 2DLDA 2F3SA 3B1KA 3FLBA 2PUJA 4PW0A 2Z8ZA 2XXJA 5B7PA 2DETA 4J4BA 1IJBA 1SC6A 3IP8A 3PDCA 4DSAA 3EVCA 2B3DA 3DCIA 4EEKA 3EZ6A 4GOLD 4NOKA 3AP2A 1VL8A 3N2NA 2ZUBA 5AM5A 1UXGA 2IJGX 5AVYA 3C6QA 4KPUA 1T91A 4YJ3F 3TQOA 4BVFA 1WUTA 3E58A 1YR8A 3VU9B 2X19A 4LQ4A 2QQ5A 2J87A 3TLBA 2WYIA 4KGDA 2XHEA 3VZSA 3K0EA 2G71A 4CVNA 3N8DA 5JD4A 2I33A 5ESWA 3IEVA 4ZT6A 4B3GA 5AR1A 1H2BA 3T9AA 4Q1CA 1TM2A 2ZSEA 1ORWA 3HZRA 2CEAA 5C8YB 5K51A 1OAAA 2JARA 2QM3A 5CVEA 5CB6A 1A2OA 4MUFA 2BKXA 2C4VA 1TD9A 4OSOA 1JV2B 3PXGA 4UAVA 1KPIA 2Y1KA 3G2LA 4H4DA 1YASA 4KO3S 4N3GA 4NK5A 5DHTA 4ZOBA 5AUNB 3R5HA 5CDUA 3BOSA 1EA7A 3S2YA 3CG4A 221PA 1GZSA 2EF1A 5CXXA 4JYBA 3RVOA 3UIEA 4HVLA 5JNLA 4KFRA 3UB4A 1PG2A 4L0CA 4TTPA 1HQCA 4DHWA 1A9QA 3R24A 3WYCA 4AU1A 1BOFA 4BNYA 4G0NA 1RHKA 4BFCA 4DLXA 4YLGA 2EG9A 1JA0A 1JBQA 4C3OB 1P1JA 2XCLA 5AVZA 2AQ8A 1GZ6A 2A2ZA 1CD5A 3CVOA 1J49A 5C5IA 2HHHB 4WKPA 1RAAA 1FX1A 5I9BA 5A6VA 2IP2A 3EXFB 1PE0A 4HQOA 1RADA 3ANLA 4GFDA 5CLHA 2WKSA 3SZGA 1AHNA 3A1VA 1U8XX 2HBYA 3CLSD 3UQYS 5JYDA 4BMVA 2CDAA 1CEYA 3RSLA 5HZHA 3IXLA 5K8TA 1IC6A 4W5HA 1TU3A 4DQDA 3AGPA 3QG5A 4KXUA 2RI0A 2DSTA 3BDIA 2J46A 2PU7A 4DR7B 2YFQA 2IU4A 4RO0A 3GVPA 4QX6A 4JJKA 5AICA 2CYAA 3MT7A 4BU1A 2BFBA 4DAOA 3UGJA 2N1BA 2I4RA 2Y0EA 2ZQ5A 3CEMA 4OYHA 1A96A 2H9IA 4KQEA 2FZKA 3GGOA 4ARZB 3RNLA 5C52B 2FSVA 5LD2B 5JXWA 4M99A 4H0CA 4IMRA 5AKGA 2OHFA 5DM4A 2C4KA 1U2DC 3K2BA 3FTDA 1E7RA 2PPVA 3TVYA 3O5AA 2O50A 3V4SA 1FY2A 4GOMD 2FB9A 3U19A 3AVUA 1LPMA 1T3TA 1T8WA 1X8JA 4N76A 4O5AA 1IOLA 1G7CA 2HO5A 1GTL1 1PU2A 1CV2A 2R1ZA 2R7NA 2WYVA 3V1LA 1RYHA 5AVOA 1L8XA 2OZLB 1NX6A 2EIHA 1FNCA 5G0TA 3WLHA 3QLUC 1ECFA 5B4TA 2O19A 3A1CA 1THGA 1QQ6A 2A9RA 2QX4A 1T6ZA 2HIHA 1OZ0A 4MRPA 1K0UA 4R41A 2RAPA 4ENTA 1IQRA 4Q1BA 2GWRA 3P5SA 3ERCA 1FTNA 2R9VA 2W2PA 3GP8A 3WIBA 4DWVA 2KQUA 2BFEA 2ANCA 5IBCA 1LS1A 2GYUA 1QG4A 1U1IA 3FKJA 3LZ6A 4KXMA 1EA5A 4ND1A 2J0SA 2FPOA 4YMGA 2JFVA 3U61B 1M2FA 3ADDA 4O25A 1PR6A 5KSOA 4RAQA 2P6UA 2GYVA 2NU8A 4QJ4A 4K40A 2P2LA 3ZBTA 3DMHA 4G0VA 2F8TA 2GZDA 3DL7A 2FJ0A 1KR5A 4PVDA 1S89A 4NV0A 3ZOKA 4PYRA 3ZXYA 1XAHA 3HMKA 3KALA 1H1LB 1RM5A 2X8WA 3C24A 2FWBA 3A9CA 1XBTA 2WMDA 3Q4GA 1WHTB 1FS4A 3A0UA 3CHYA 4H4EA 1QDUA 2R00C 3INYA 3GT3A 3D81A 3PC7A 2JGAA 2BHLA 2D2XA 1R6VA 4UEQA 3DFUA 4E2XA 3C4QA 4WY5A 1ZK4A 2FW6A 3BORA 2P62A 4DCUA 2ZR7A 2RJOA 4MI3A 1QYWA 1OZHA 1X9IA 2FWAA 1YIOA 1FB5A 1BD3A 2BM9A 1IN5A 1CQPA 1LSUA 2G6TA 2Q1TA 3L7JA 3MS4A 2N3ZA 4QJIA 1LSOA 3LO5A 4RJIA 4X6LA 1OKKD 3JVVA 1U0SY 2PMEA 4QTTB 4H1VA 4J1TA 2VJLA 1RQ7A 3ZY2A 5CD9A 2IYSA 2PUGA 5ESDA 1VJ5A 3UUEA 2VJCA 3DTVD 1ZH8A 2I66A 4FZRA 4DNOA 1TKBA 2I29A 2NAFA 1BEEA 3MXTA 3RYTC 2JJ8A 2QN7A 4CMIB 3OKAA 4F3TA 1T1JA 1U8CB 5BOSB 3ZVMA 3IJEB 2PVPA 3VOAA 4AKEA 1U9ZA 3QHPA 3GVCA 3F78A 2Q1UA 3LJKA 1RC8A 3QJGA 4YRMA 3TI9A 5CHEA 2XRZA 2FUKA 3H11B 3KYDB 2I55A 1D1QA 1KYIA 2X9LA 2Z8YA 3QNWA 1K7SN 3HR4A 3H86A 3EZYA 3K7EA 4EW2A 1QGUB 3U3MA 4C2AA 2PJUA 5KTNA 3BFXA 4IHJF 5FBZA 2FPXA 3KPWA 2R68A 2YQZA 3O9VA 3UUWA 4GBGA 5K09A 4M1WA 2GUGA 4BGVA 1PR9A 2W71A 2QNBA 3H6KA 3PD0A 3T6KA 3FYHA 3NAZA 4CT4B 3SDBA 3E9CA 3MJVA 5ALLA 3GR6A 1B0PA 2QUKA 3ACBA 4KYVA 1FUUA 3IBFA 2R6R1 3H5VA 3UAXA 5J58A 1E4VA 4HAVA 4X84A 2P6OA 3NUQA 3GQVA 5F9MA 2EBHX 2A86A 4AJLA 5A6SA 1KFKB 1KRHA 1ZQ1A 2B92A 3D0OA 1AGRA 5SV2A 1N9GA 1KI6A 2GO1A 4JC0A 5KVAA 2CBZA 2WSSD 1F8FA 3AK4A 3AHJA 3C41J 3D3WB 3KL2A 5PNTA 1G291 1NAHA 4YAKA 4G4SO 1FUYB 3FSEA 1Z7WA 1I9CA 1GCAA 1MC1A 1NN1A 1P1BA 5CDFE 1I2AA 2V7GA 3SP1A 4MDFA 5H82A 2IV3A 2O2IA 3OZBA 4KHPB 8MHTA 1HZZC 1RMTA 4KH0A 4WESB 1PFUA 3FDZB 3WXMA 3E23A 4XLTA 2I62A 1OTXA 5AK6A 2GRUA 5E6UA 2P5SA 4C7MA 2J9YB 3QFTA 1PFVA 1XE3A 2EYQA 4G9BA 1A9RA 4TMWA 3OBIA 3TAXA 1ORIA 5I4CA 4ARAA 5JTUA 1KK3A 3P2JA 3HN7A 4E22A 5FNZA 3KKMA 1A82A 3L6RA 1IQPA 2VZ9A 2WICA 1FA9A 1WTCA 4H9GA 1OH8A 1RJEA 3R7BA 3WRYC 4A9AA 1B6RA 2CJYA 1YZVA 3UMJA 1J8QA 1W4RA 3K5WA 2ZYAA 2BMWA 3V7YA 4F6LA 2VHTA 1RACA 4EQ6A 3A1TA 3CKYA 3PXUA 3GLHE 3Q0TA 4QUHA 4XRRA 5KJEA 1G5HA 2FEXA 1E3IA 4CG3A 4OK3A 1KMQA 2Q8QA 2FE1A 1WQ3A 2A4KA 2R6AA 2Z4TA 2ZYSA 1E3WA 3GNLA 3H7AA 3LLMA 4BKOA 5KVCA 2C20A 4YPVA 5LXTF 1JG6A 3ZJVA 3LF1A 4MCHA 3EG5A 1H3EA 2HMSA 3TRIA 1QYIA 4XSVA 5LQNA 1SXPA 4GT1A 4Y9RA 2VQFB 1GVNB 3ESYA 4N6GA 3LDFA 2J0QA 4NWIA 1J2JA 1OFUX 1U3CA 2I4OA 3HRIA 1JPJA 1NOIA 3LK6A 2D00A 3L7CA 4LXQA 3GC6A 2XCUA 3IELA 5D86A 5BMVA 5FR2A 1KI8A 5ECYA 4HN9A 4YP9A 4V0ME 4RHEA 1CQIA 3E8SA 4U5XA 1P39A 4UHBA 4WZAA 1YK1A 2NV0A 2FPIB 5TIIA 5I7FA 3EDQA 4Q3DA 4HDSA 3V1MA 3EAQA 4BC1A 1TI7A 3K4QA 2PMDA 1UOOA 3AFNA 3S8YA 1Y7HA 3DZ8A 3U7EB 1QRSA 4KQWA 1N8SA 1NVEA 1RXUA 1SC4A 3CSSA 1RQPA 5G1NA 3VKUA 2UUBB 1NN5A 4C0WA 1SC1A 1NF8A 3KXLA 4UOEA 1OVGA 5CBKA 4MJ3A 3REQA 4US1R 4JUCA 5JTTA 1C8LA 1DP4A 4GZ6A 3ANTA 4RFSA 2GJAA 4DL9A 1LKZA 3DEZA 1OBOA 1FYEA 2AVDA 2R5NA 1ZJ6A 3KPYA 4XVCA 3AR3A 5JS2A 5KC9A 2OXIA 1CJCA 3U4IA 2O2CA 3U44A 1QHHA 3KEMA 3IKVA 5EWLA 2XQIA 4UCFA 1OX5A 2MWMA 5ECWA 3RUDA 4WKGA 4BS9A 1YL6A 1IYZA 1GFWA 1I2ZA 2J7PD 5TXGA 1D2CA 5IZ4A 1N2GA 3GBVA 2VAWA 3Q3VA 4I3FA 4BNWA 4B3SB 5HCNA 4MVJD 2VDLB 3OKCA 4E1BA 4NLLA 1KZ9A 5T57A 3F49S 2DRIA 2NWQA 3O47A 4QBKA 2W42A 1IWPB 2VI5A 3V42A 3WQHA 1JR4A 4GVXA 1EWQA 2VCYA 4EDFA 5JS7A 2DT8A 2X22A 4MKGA 2GBPA 4X44A 4C0SA 1H66A 3A25A 1Y8CA 2XJ9A 3ZHCA 2XI4A 5C53B 2XRFA 3QW2A 2B69A 3O8OA 2M6KA 1QK4A 1NTRA 4PX9A 2C94A 1S02A 1WOYA 3DZBA 1H2HA 2QZJA 1OKKA 1ZW1A 3D7RA 4Y1GA 1AQIA 2BHTA 2CMDA 2J7PA 3V4RA 1MJNA 4DR4B 1RS0A 2XPCA 3HU3A 2ZUUA 3K9QO 3KSDO 4OJMX 1UQRA 3HNPA 4QVIA 3PF9A 2V65A 3BG5A 3LYLA