1HQDA

Pseudomonas cepacia lipase complexed with transition state analogue of 1-phenoxy-2-acetoxy butane
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
320
structure length
320
Chain Sequence
b'ADNYAATRYPIILVHGLTGTDKYAGVLEYWYGIQEDLQQRGATVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGATKVNLVGHSQGGLTSRYVAAVAPDLVASVTTIGTPHRGSEFADFVQGVLAYDPTGLSSTVIAAFVNVFGILTSSSNNTNQDALAALKTLTTAQAATYNQNYPSAGLGAPGSCQTGAPTETVGGNTHLLYSWAGTAIQPTISVFGVTGATDTSTIPLVDPANALDPSTLALFGTGTVMVNRGSGQNDGVVSKCSALYGQVLSTSYKWNHLDEINQLLGVRGANAEDPVAVIRTHANRLKLAGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIPASE
molecule tags Hydrolase
publication title Complex of Burkholderia cepacia lipase with transition state analogue of 1-phenoxy-2-acetoxybutane: biocatalytic, structural and modelling study.
pubmed doi rcsb
total genus 128
structure length 320
sequence length 320
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2000-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1hqdA00
3Q0TA 4Q82A 1DWOA 4DNQA 4Y7DA 4H18A 2WIDA 4QA9A 4LYEA 4CI9A 1CFJA 2ONCA 5JAHA 4WFJA 1T2NA 2FUKA 1Q83A 3DD5A 2WFZA 2XT0A 2OAGA 5JANA 3H2KA 7YASA 3R41A 1AMNA 3QPAA 4P9NA 1K5PA 3DYIA 5HF6A 2VAXA 3QYJA 1QIIA 3W9UA 2EDAA 2Z8XA 4AN0A 2VSQA 2OCKA 2ZSHA 5JYCA 1MX5A 1XZBA 3WWEA 1JKMA 4BCCA 1SCKA 1ZIYA 1E5TA 3W04A 4MQLA 4PV7A 3QBJA 4JUIA 2YASA 1CPYA 2QS9A 5LZ7A 2WIFA 4B6GA 1A8UA 2DHDA 4Y2PA 3MVEA 5CT8A 2OQIA 1J2EA 2C5FA 5AIAA 4HRYA 4X71A 3ZWQA 1LPMA 2WG0A 3SK0A 3G0DA 5CTAA 5D6OA 5ALSA 5JD6A 5K5EA 3C8HA 2UZ0A 4Y2RA 4JYMA 3FBWA 5KREA 4F0JA 1CUFA 3O9MA 3M83A 3X3HA 3WWPA 2PSJA 2CZQA 4AB1A 3C5VA 5E4TA 4G4GA 3C6YA 2I3ZA 1YA8A 2WTMA 3UUEA 3WK9A 1VKHA 2GBGA 1F0NA 3DL4A 4H7IA 2WTNA 1XQXA 6YASA 3VKFA 1QIMA 3M81A 3ZV7A 4NZZA 5DTJA 4HZGA 5HKBA 4KACA 4MWSA 1R1DA 1FFBA 4C6HA 2XUDA 3DOHA 3W06A 1IUOA 1ZICA 1E3QA 4KYVA 1CUEA 1LPOA 2ZVDA 1ZJ4A 2XQFA 3D5EA 2Z8ZA 4EY4A 5DTIA 4FNMA 1K6EA 4CIBA 5YASA 5ALLA 2ZJFA 4OPMA 3VJMA 1FJ2A 2J3QA 2VATA 4B0OA 2QUAA 4BE9A 4X95A 3WYDA 3I6ZA 5EHZA 5EHXA 3O4GA 3WI7A 1P0MA 1ZI6A 4CCWA 4GLBA 1MPXA 4GHWA 3WL8A 4U2CA 4BZWA 1FFEA 5JD5A 5A6VA 3WWCA 4ZV9A 3BIXA 5KWIA 4DGQA 2QXTA 4TGLA 2JGJA 1BCSA 2ZYHA 2XLBA 5HCUA 4YK7A 1VZ2A 2X8BA 2XQGA 2VTVA 1G4HA 4WDRA 1F8UA 1XZCA 4KE8A 4BC0A 2XUQA 2H1IA 3C6XA 5JZSA 3N0TA 1NU8A 1TCCA 2VJCA 4Z49A 5E2IA 1JJBA 5HZGA 1CUVA 1SCIA 4EHBA 3JWEA 3TRDA 4UBJA 4KRYA 1W75A 2BFNA 4UHHA 4DNFA 2YH2A 4C4ZA 4ZWNA 1ZD4A 3E4DA 1KEZA 4EA6A 1VJ5A 3DLTA 4FBMA 3QITA 1GPLA 1QFMA 3A2LA 3DKKA 4MYSA 4X94A 1JJFA 1CUGA 5AKZA 3G9ZA 2WU4A 3EQ9A 3V1LA 4PQEA 3H2GA 3HI4A 1YAJA 3O9VA 1BEZA 1ZOIA 3VJKA 3FVTA 1ZD5A 2O7VA 3IUJA 1YR2A 1W6RA 3D2AA 3A6ZA 1JU3A 2XUFA 1GKKA 2HU7A 1BROA 3HACA 2J3DA 4G9EA 5H3HA 3F8SA 1CIJA 1ETHA 3ANTA 1LPNA 3FLEA 3PE6A 2DSNA 3VVLA 3STUA 4E14A 5D3ZA 3SX4A 5CBKA 4X91A 4X93A 3IUMA 1LZLA 1E8DA 2DQYA 3VXKA 3G7NA 5AM1A 4ZXFA 1EK1A 5ALXA 2GYWA 3D2BA 5AJHA 1CUSA 2BUCA 2PU5A 3WKAA 3C45A 1CUBA 3E3AA 2C58A 4RPCA 4UBLA 1DWPA 4YASA 5JASA 1VA5A 4X7BA 4FTWA 1Q0ZA 4QLOA 4GDMA 2WUFA 2WHPA 3VVMA 5FPQA 1F6WA 3WK8A 1THGA 1L7RA 1VXRA 3WLAA 3ZLVA 3A2NA 5DNWA 3W9BA 4HXFB 3I1YA 1YB6A 5IH7A 1AKNA 1UXOA 2XMQA 3I2JA 1JU4A 3KWJA 4P93A 2WQZA 1VE7A 2PSDA 3FLAA 5T4EA 4N5IX 3WKEA 2WIKA 1YSCA 1WOMA 4PSCA 1BRTA 1FFAA 3I2HA 5DYWA 2B20A 1QLWA 3AZPA 3WIOA 3STWA 4G1FA 3F97A 4Q1VA 3T52A 4L3WA 1Y7HA 3V1NA 2XUKA 1FSSA 4G8BA 2V96A 3AZOA 4Y9SA 4J0DA 4QNNA 1GPNA 5JAOA 1YS2X 3LIPA 2PL5A 2GYUA 3EBLA 5FOQA 1LLFA 1W76A 1XZHA 2VJBA 3F9CA 1AC5A 4QE3A 2BAGA 5KWJA 3OG9A 5AICA 4ITVA 1TK3A 5IVHA 3H2IA 2CMFA 3F96A 3DDUA 4CG1A 1MNQA 1B6GA 2WFLB 3CCBA 5EIHA 4NS4A 4OB8A 3U0VA 4KAFA 3W2TA 2O2GA 3QPDA 1DX4A 4RNCA 1QIFA 2Y2VA 2D0DA 1W52X 2V9ZA 1UZAA 3WK5A 4Q05A 1ZI9A 2EDCA 1GGVA 2QT9A 2OGSA 2ZYIA 3BXPA 1E89A 5CT5A 3R0VA 2QXUA 4AXBA 2JIDA 3GUUA 3K2IA 4BTVA 5ALQA 4BYMA 4FNGA 4MEBA 4LHEA 1ZD3A 4OCZA 3D0KA 1YB7A 1WM1A 4PW0A 1EDDA 1E66A 3GA7A 2VF2A 4OUKX 2QOEA 5C81A 4WJLA 1XZIA 3HJUA 4FOLA 1QIGA 3ESDA 1XRMA 4GI1A 2HA4A 1EDBA 2WUDA 2HA6A 2PUHA 1MX9A 2HA5A 1OCEA 3JYHA 1RWQA 3IVMA 4UHDA 4AO8A 1CUDA 3H2JA 3BF8A 1UKCA 4QWWA 5LKRA 4INZA 2C0QA 2HL6A 4CG2A 4FKBA 1M33A 2OGZA 1U2EA 5DLPA 1ODTC 3QMMA 1TIBA 5HQ3A 4FFWA 2C7BA 2QKYA 4E15A 3L1IA 1B41A 4UFNA 1QIHA 4B80A 3G0GA 4QDXA 1I6WA 1U65A 2D5LA 4H7FA 4BP9A 3C87A 4UUQA 4F60A 2PM8A 4G4IA 1MTZA 1XRNA 5ALUA 5AK4A 4EZIA 3R3VA 2VJAA 1QIEA 2HA2A 4FDMA 1EVQA 2P8SA 2JEZA 1NU6A 4C4XA 1LGYA 1HL7A 2JGEA 4PNZA 5LLSA 3R40A 4WY5A 5ALFA 4C01A 4AMZA 2BGNA 4K2AA 1UKBA 4GXNA 2XUJA 1P0IA 3WL7A 5IVIA 3B3QA 4H35A 5EI5A 4C87A 2WKWA 1O6FA 3IB3A 4I19A 1CUWA 1DT3A 2CKMA 2GZRA 5HKAA 1XZFA 2VT7A 1CUAA 2HFJA 2XI4A 5CH3A 5C8XA 1J1IA 5CXXA 2FX5A 5LIPA 5AHXA 1MX1A 4F21A 5SYNA 5C8VA 3H18A 2NW6A 1XZEA 2RI6A 1QIKA 2BUAA 3LLCA 3EIOA 3I6YA 4HS9A 1BE0A 3D59A 4H7JA 4K5QA 3IDAA 4N8DA 1CLEA 4AQDA 1F0PA 4DIUA 2PVSA 4EY7A 4G8DA 4U2FA 1VZ3A 4YPVA 3PUHA 3ICVA 1HPLA 4B84A 5ALZA 1PJAA 4EY6A 4A5SA 2ZYRA 5JZ9A 4J3JA 2WJ3A 5IKXA 3C6BA 3C70A 4BRZA 3I2FA 1DQZA 1OXMA 4HAIA 4OYYA 2XUIA 1LPSA 2V98A 2WHPB 2K2QB 3QZUA 2HRQA 1DTEA 2OCGA 1IZ7A 1TCAA 2DCMA 1X70A 3V1KA 4PSDA 1QFSA 4OU4A 5FUMA 1MAHA 3H17A 4O08A 2DQZA 4BAZA 2FJPA 3G9TA 5AM5A 1OILA 4UHCA 4XX1A 3GZJA 5KBYA 1H2WA 3KSRA 3FAKA 3OURA 1H23A 2QVBA 3G02A 1JMYA 1ODSA 4M0FA 1XRLA 5A7GA 5ISMA 1LPPA 3C43A 1W4LA 2AJCA 4ZI5A 1DX6A 2HU8A 4UFOA 3QMVA 5SYMA 2VQ6A 5JADA 1J06A 3BDIA 4UHEA 1TQHA 1XZMA 3RM3A 4RGYA 5LZ4A 1UK6A 2HU5A 3QM1A 1QIJA 5BWCA 1C7JA 5K3CA 2I78A 2HM7A 3DJYA 1QE3A 4C88A 5DNUA 5ALPA 5AI0A 1LNSA 2C0PA 2XUGA 5IVKA 1GPKA 2GZSA 4V2IA 5ALKA 2PUJA 1C4XA 2WJ6A 2Y1KA 1QOZA 4M0MA 3ZLUA 3LS2A 3WK6A 4BDSA 5EHNA 1GZ7A 3QPCA 4ARAA 1MU0A 3I6MA 4Y2XA 3KD2A 1LPBB 3F67A 4QLAA 1WHTA 4E11A 3CN9A 2WILA 3FSGA 3WMRA 1H2ZA 2J4CA 3M3DA 3RKSA 3WA6A 2DFPA 3DS8A 3OOSA 1AZWA 3ANSA 3H19A 3VJLA 3LIIA 3TGLA 2GBFA 1JT2A 2ZYSA 3E0XA 3G9XA 1XQVA 1R9NA 2QR5A 1X2BA 4U2GA 4UBNA 3KWFA 1X2EA 1EHYA 3RLIA 4N5HX 4K6KA 1YS1X 4JEIA 5T4HA 2WU3A 1BEEA 4BAGA 4MWTA 2OGTA 1AX9A 4MYDA 4Q3LA 4X92A 4WCVA 2XMDA 4ROTA 3BIWA 5C7YA 2XLCA 3HABA 5AM2A 1Y7IA 5JIBA 1AUOA 3WYNA 3HYSA 4B9AA 1WB4A 4AO6A 3BDVA 1WB6A 3C8DA 1G42A 2HIHA 4XIIA 2HHAA 2QJWA 5AKEA 4UBIA 1UFOA 1N5MA 3I1IA 2QMQA 2R8BA 4DNPA 3U1TA 3R3UA 2IITA 4J0IA 1HKHA 5ALNA 5ALRA 5FRDA 1JMKC 3FWHA 4BZZA 3ZLTA 1YAHA 5AOCA 1QO7A 4X3CA 3RARA 3HSSA 1LZKA 3V48A 1N5RA 4B83A 3S8YA 4IH4A 3UUFA 5HQ3B 5LZ2A 1LPAB 2ACKA 1R50A 2YYSA 5K3FB 4WY8A 1XROA 5T4FA 1WB5A 2G5TA 2PSEA 4FLEA 1ZI8A 4J7AA 3TEJA 2OCLA 5DNVA 1CRLA 5CW2A 3C6ZA 4LXGA 4LYDA 1XLVA 5ALYA 5JZBA 2QZPA 4PSUA 2VA9A 4K6GA 2RHWA 1HDEA 2XUHA 3O4HA 2PBLA 5EFZA 4Q3KA 3O4JA 1HLGA 4YX9A 2JGIA 1R3DA 3BL8A 2QTBA 4HRXA 4JNCA 5FV4A 4UBOA 1YA4A 3IULA 2HADA 3H1AA 5AP9A 3IUNA 1DQYA 3BWXA 3O4IA 3STTA 3K9BA 4Y2SA 2WFMA 5CT6A 2I3DA 5AK6A 5A7HA 3W05A 4BDTA 3I2GA 4J0GA 1CQZA 1XFDA 1ZJ5A 1WPRA 4X85A 1TKRA 4QWMA 1SCQA 1EI9A 4RE5A 2JEYA 3D4LA 2G63A 2OG1A 1YCDA 2X5XA 5FKJA 3RK4A 3HXKA 2XMSA 1Z68A 4QDZA 1BU8A 2VT6A 5AKGA 2XDWA 3ESAA 4Q3OA 3P2MA 5CH8A 5CMLA 3OTQA 5AH0A 1JFRA 1UT6A 3BE8A 3GELA 1TRHA 3G8YA 3H04A 5K3FA 3N2ZB 3L1HA 4G8CA 5HK8A 3DYVA 1E8MA 4CCYA 2PSHA 5E4YA 1CV2A 1EVEA 4FHZA 3WJ2A 3WL6A 1KU6A 3A70A 4Y2YA 4ZGBA 3NOXA 5I8PA 1QTRA 1ZGCA 3HLKA 2XMRA 2RAUA 4AO7A 1R88A 2E3JA 3PI6A 1QJ4A 1TCBA 4OSEA 2JGKA 2YXPX 4FLFA 4W1PA 5E4JA 2ZJ7A 1UWCA 4FWBA 3FYTA 5ALVA 4X00A 1D07A 1UKAA 2Z5GA 5AI6A 1LBSA 1IZ8A 2B9VA 3S2ZA 1NX9A 4WFKA 4B0PA 1IVYA 2VAVA 5CXUA 5CRIA 1GXSA 2QUBA 1CUHA 4J0JA 4QEKA 2C4HA 3G9UA 4L0CA 5ALTA 5FPPA 1ZD2P 3E1GA 4M0EA 1IUNA 3I2KA 2WHQA 3B12A 5AKJA 4GW3A 5CT4A 5I7UA 4P92A 4FLMA 2BKLA 4ARBA 5EIAA 1QIDA 5HF8A 5K3DA 2V97A 2BCEA 3WIBA 2BJHA 3FLBA 5FXMA 1XLWA 4H7HA 5J3JA 4OYLA 1PFQA 2HFKA 2PX6A 2RIPA 5EHQA 2JGFA 2FJ0A 4W1RA 4N8EA 3HZOA 4AN1A 5IVDA 3Q8WA 2OAEA 3IIIA 1CUCA 3MUOA 3DKRA 3K6KA 2XQJA 1IMJA 4J0CA 1UOQA 1XRRA 3T4UA 5A7FA 4BAUA 5AM0A 2WIGA 2B4KA 5LZ9A 2DHCA 1A88A 1O6GA 4X6UA 3DQZA 1CUZA 3CN7A 1Y37A 2WIJA 3VDXA 3EF3A 1JI3A 1WCYA 1ORVA 4KAJA 4W9RA 3GBSA 4GBGA 3PUIA 2Y2UA 3WK7A 2DHEA 2JGLA 1VLQA 3BF7A 2H7XA 5I9IA 3DL7A 4IO0A 1Q84A 2XMBA 4H7DA 1BS9A 2ES4A 4MXDA 1SOMA 3WK4A 2VJDA 2RHTA 3ED1A 4QDUA 1WPXA 1FFDA 3ILSA 1UOOA 1ISPA 3GFFA 4MQMA 3L1JA 1EXWA 1R4ZA 4IH1A 5FLKA 3IBTA 3WZLA 4C89A 4KR0A 3O0DA 1XZLA 1CUUA 3IUQA 4HXGA 3G0IA 3PDCA 1GKLA 4X6YA 5JARA 2OXEA 3CXUA 3B5EA 1A8QA 3HEAA 3FYUC 1ACJA 4Y2JA 4IH9A 2PPLA 5AI8A 1CUXA 1XRPA 2CUTA 1FFCA 1ZGBA 3OPMA 3JW8A 1G66A 3G0CA 3DOIA 1CUIA 5ALEA 4Y2VA 1MO2A 2WG1A 2B61A 1VE6A 1SC9A 2XMCA 3PF9A 5BV7A 2WM2A 4IQ4A 4BC1A 3OM8A 1UK8A 4E46A 1GT6A 5AO9A 5LZ8A 3DCNA 3V1MA 2Y6UA 1XZDA 4H77A 4KRXA 3FCYA 1VA4A 2O2HA 4ZV7A 1MJ5A 4DMHA 3AILA 2AXEA 5F4ZA 2HDWA 3KDAA 5HK9A 1K8QA 4DYHA 1XKLA 1HQDA 3WA7A 2W22A 3QVMA 5AKLA 4GECA 5JAPA 2Q0XA 2XUAA 5ESRA 3CCCA 5LZ5A 1S8OA 4HXEB 3UMJA 3SC2A 4BVLA 2ACEA 1BCRA 3I2IA 4S0XA 3PFBA 2WFLA 3FSGD 4AZ3A 1U8EA 1C7IA 4KEAA 4I3FA 1UOPA 4CCYB 2ROQA 1RYYA 2CBGA 2EEPA 1Q0RA 4Q34A 4X97A 2RGUA 3PF8A 4I4CA 4JYPA 4BVKA 4KJXA 4OU5A 1GQRA 4A16A 4AX4A 4EUSA 5DJ5A 4OD0A 1P0PA 4BRSA 5C8ZA 1GQSA 2WJ4A 3M82A 3LP5A 4AMYA 4RE6A 1CEXA 2GBIA 5JAUA 1ODCA 2XQKA 3AINA 3VISA 1AQLA 3STVA 3WWDA 3BJRA 3WQHA 4AZ0A 5AI4A 5T4BA 5JD4A 3KOOA 3FYUB 5HFAA 4ETWA 5LP1A 4GEGA 3ZPXA 2H9YA 5ALGA 2Z3ZA 2C5GA 1ZIXA 5ALIA 2ORYA 1A8SA 3R3ZA 4QZVA 4HTAA 5JALA 1EB8A 4UBKA 3WKDA 4ZRDA 5AOAA 4W1QA 2O2IA 2X76A 2Z3WA 3DEAA 3NUZA 1BN7A 4BCDA 3FOBA 1E8NA 2XMGA 3H2HA 1EH5A 4Y2TA 4PO3X 1XRQA 5AI5A 5A62A 4UFPA 3C5WP 1XZGA 4GWLA 3ESCA 1K63A 2GYVA 2ZSIA 3GROA 5EGNA 3DNMA 5A71A 2Y6VA 3V9AA 4DSAA 1R9MA 5A2GA 5AIBA 5JATA 5ALJA 5BWBA 4J0HA 1L7QA 1CVLA 1SFRA 5AKYA 2HA0A 1USWA 1EB9A 1XKTA 1P0QA 4CG3A 5AKHA 4C4YA 3IURA 1EA5A 4LKOA 4HVTA 4H0CA 2HA3A 4TVKA 3TJMA 4ZREA 5ALOA 2QRUA 3AIOA 2GBCA 4BCBA 4Y2UA 4BP8A 5CURA 1EK2A 4BATA 1N1MA 4KE6A 4UPDA 1T4MA 2LIPA 4KAAA 4BE4A 5AI9A 1H2YA 1XZKA 4LXIA 5K3EA 1UK7A 3AFIA 4B82A 3WL5A 4U2DA 2AJBA 2O7RA 1VXOA 3PFCA 5AKXA 4D9JA 4DLNA 3G0BA 3FNBA 1CUYA 4B7ZA 4CIAA 2WLSA 2WSLA 5AK3A 4EBBA 1KU0A 4B85A 2DR0A 3R3WA 4NVRA 5CH5A 2H7CA 3QH4A 1CQWA 4EY8A 2OCIA 3HRHA 4KE9A 1K4YA 1MT3A 4G5XA 3D2CA 4WFIA 2W6CX 2XMZA 4DSZA 2IX9A 1AGYA 2HRRA 4BTLA 1DINA 3ESBA 3SWWA 5FDFA 4P08A 1G5FA 3MGAA 3D7RA 4WDQA 1WHSA 5DYYA 2I03A 5LYYA 1U4NA 1VOTA 4UHBA 1TAHA 2WUGA 4FFVA 5D3KA 1EX9A 1XZJA 5ALWA 3NGMA 1QONA 5AKIA 4G9GA 5HFNA 4W63A 5ALDA 4LXHA 3D3NA 3R3XA 4NMWA 1YASA 1DWQA 4QDTA 1CUJA 4U2EA 2CJPA 4A23A 1A7UA 4KE7A 2WG2A 3WKCA 1EDEA 5K3BA 5AOBA 5HF9A 2XB6A 4B81A 1W1IA 1BN6A 5D7BA 4UHFA 1QTIA 3FCXA 1L7AA 1RP1A 2JGMA 1QO9A 2WHRA 3FVRA 3ICWA 5EIEA 1PV1A 4BVJA 2OQVA 1DU4A 4MJ3A 3YASA 4JH0A 1H22A 5ALMA 3O95A 4DNOA 2R11A 4IHAA 5AM4A 4BB0A 2PU7A 3KXPA 4PF1A 2IIVA 1CR6A 2WUEA 2BUBA 2OPHA 3A2MA 2CEKA 4FBLA 2G5PA 3AUKA 4L9AA 4Y2QA 4LIPD 2OLEA 4H7KA 1HBJA 3QMWA 4N8SA 3WZMA 2CB9A 2G4LA 2J4FA 4MEAA 1ORWA 4XJVA 4TPKA 3MUNA 3STYA 2JBWA 4OB7A 3H0CA 4CFSA 3AIKA 3H1BA 3LCRA 4DMFA 1N8SA 2QM0A 4W1SA 5ALHA 4EY5A 2HA7A 4F5ZA 4QDOA 4XWGA 3AIMA 5AK5A 1J07A 3STXA 1EINA 3WWOA 1DT5A 5CT9A 1QGED 1JJIA 2PSFA 2XUOA 1THTA 4DTCA 5LKAA 1XQWA 2AJLI 4X90A 4B9EA 4BBZA 1QZ3A 1MAAA 2JF0A 1MNAA 4FMPA 4OB6A 4DMCA 3EQ8A 2RONA 5HF5A 3FYUA 3AZQA 1H2XA 1XQYA 2VEOA 3F98A 4UBMA 4U2BA 4EB0A 2AJDA 3AJAA 2ECFA 4J0KA 4J03A 4G4JA 3ZI7A 3WKBA 4DM7A 4XVCA 5DYTA 3OC0A 4X6XA 5FP0A 4K6HA 2AJ8A 2XQIA 2H7YA 3HC7A 1MN6A 1UK9A 5AKKA 2XUPA 5K3AA 2XE4A 4DMKA 4L72A 3NWOA 2QJRA 3R3YA 5DWDA 1ACLA 1XLUA 3WJ1A 2ZJ6A 1IUPA 1AURA 3EQ7A 4H7EA 3I28A 5AM3A 2PKYX 3IA2A 2BGRA 3BJMA 3PICA 5BOVA 1LBTA 1XZAA
chains in the Genus database with same CATH superfamily
1HT3A 1JIVA 4H1VA 3FB1A 2M2IA 4FYWA 2LE0A 1DWOA 1GRVA 4NBNA 1C81A 1SCNE 4B79A 1XCPA 1P74A 2BGLA 1NIJA 5BSUA 3JQGB 4DLSA 5BWLA 5GIOE 3HXMA 3NDRA 1HDXA 2JB9A 821PA 1SHJA 2KB0A 2H7VA 4KYUA 4ZRNA 3BILA 1DEAA 4OXNA 4V0ME 2Z8YM 1KFJB 5B7NA 4XPIA 4X44A 4YEDA 4AURA 1B93A 2E37A 1SXJD 3OY7A 4MRMA 3RKUA 1W25A 5JAHA 1UF9A 5SICE 1T2NA 4CLDA 3VDRA 1G3IA 5FX2A 3EIHA 4QYWA 4DEVA 4LFCB 5ILQA 1IPHA 3TTSA 5BSGA 1QFXA 4P2GA 2ONYA 3U3ZA 2OB2A 3AHIA 5EVJA 1A4UA 4ZOAA 1L5WA 4RLHA 2TSYB 5E7MA 3DEKA 3L82B 5BV2P 5IBPA 1ML4A 1G2QA 2WFZA 1UDXA 1WL8A 4K81B 5LOVB 4LGCA 3AJDA 4KTVE 4RHUA 2V8BA 2OAGA 1L5SA 2LUOA 5TDHA 3LHSA 1I3LA 3RROA 1QVZA 1XNHA 2BKAA 4MQUA 4X8LA 5KSPA 1AMNA 1ZUHA 2NLOA 4RD1A 1I4TD 2ZIGA 2FP4B 2H2DA 2G4CA 4KI7A 4FGSA 1DG9A 1NVDA 2ZYWX 4HLDA 5SV2A 1Z45A 2PJDA 4EFDA 2GKGA 2GN6A 1O8BA 3IBFA 1CCWA 3AG6A 1WG8A 1EMDA 2ZGVA 2XCRB 1SUEA 3A1DA 1U0HC 2NYUA 1P60A 3BQ9A 3FKSA 4XWOA 3I37X 4INJA 1S01A 1RWOA 2VPTA 1QORA 1JN0A 3OX1A 1Q20A 3PC4A 4QRIA 4HHEA 2R00A 3NHSA 3GNQA 2HWXA 1A72A 3HI6A 2WT4A 4E5UA 1VMIA 1Z0FA 1XN1A 3H9CA 1QPGA 1BYUA 4Q47A 1R4AA 4TKUB 3W04A 3R1IA 1J24A 3D4IA 3K7EA 3CHYA 2W4MA 4ENVA 1O4WA 1PAUA 5BQXA 1FDSA 3ZTWA 2CLOB 1C5KA 4OJTA 4BIIA 1ONOA 4NFYA 4UZEA 4BB6A 4UVHA 4ND4A 3FN4A 4M1YA 1JZQA 1IZ9A 1PQ4A 3VRHA 2BONA 3OIUA 1QE0A 2VCYA 5JC1A 4BQPA 2FFRA 3SEZA 4EPXA 2QS9A 3IAXA 3QEMB 5FL3A 4GX2A 1NVVQ 3QE4A 2I87A 1A8UA 3FE2A 3VPBA 3TO5A 4Z0TA 5HOEA 2YWGA 2OE2A 1A5ZA 1J2EA 2Q6KA 4LKRA 4YJFB 3EXEA 5BSMA 5LJIA 4LJRA 2BC9A 2QMOA 1AF7A 3LYHA 4HRYA 2JBAB 2OBXA 1E0SA 4X71A 4F9FA 4P7BA 3IA7A 2EWVA 3ZKWA 2Z98A 4DG9A 2AFRA 1K7EB 1ZYUA 1D5CA 3B6IA 3PI7A 4IDQA 2GK4A 4CWAA 6ABPA 5EIXA 2YKGA 3KVYA 4PIMA 4QBGB 1V3UA 5C8YF 1SULA 4ARVA 5K5EA 1CK4A 1LNZA 3Q2OA 3L7CA 5CVDA 2I66A 2UZ0A 1AS2A 4HX2A 3HUEA 4DJJA 4M98A 3VZBA 1EXDA 1JEQA 4RK4A 5EQDA 4ZJYA 5J23A 2BEUA 4ECAA 3A3KA 4KUEA 3TW4A 2YJ5A 4IZ6A 1E7MA 3IDFA 4F5YA 3M83A 3K73O 2QQ5A 1C1YA 1SVNA 4EFMA 4IJ6A 3FPAA 2HYIC 4FE7A 2PXAA 4I9GA 5LBIA 3WWZA 1CZOA 2B21A 1XVTA 4CF7A 3WGGA 1US8A 1VSVA 2Z04A 5CFLA 3BFVA 2SKDA 1XQ9A 1J1ZA 2WTMA 1LK5A 3H87A 3ISJA 3LVQE 4I8IA 1VGRA 3UUEA 3IUSA 1CIVA 2GBGA 3DL4A 1F0NA 4G8JA 4H7IA 4AP5A 3OICA 2CE7A 2WP8J 4MGEA 5C1IA 3THYA 1JDPA 1FSZA 3TRJA 1TQ8A 1FQJA 2F9FA 4L6AA 3EF1A 4EKGA 3IELA 1QIMA 4DRYA 2QW8A 3CQ9A 3LWNA 4PICA 3FMIA 5NULA 5AQ1A 4YUYA 2MMGA 1FZQA 3PX3A 4CV1A 2AOTA 3T5BA 1W1WA 4ZJUA 2BGJA 3T7CA 3VA7A 1N36B 5LU9A 1OWLA 1BMFD 3GJ7A 5HKBA 3PWSA 4Z4FA 4JJ6A 1QP8A 1G59A 4KACA 4MWSA 1R1DA 5GONF 1L4GA 4YCSA 5BSVA 1B73A 2X15A 1HX7A 1VJTA 2PWYA 3P2OA 4GLLA 4NYJR 2FGKA 3RFTA 2GHRA 2HGSA 3GVXA 1W44A 4RH1A 1JWLA 4K9RA 4EVSA 1E3QA 1CY0A 3GVHA 4L1KA 5GZ3A 2PZJA 5A3QA 3GGDA 3W7BA 1XMOB 4LGYA 3L7OA 4Y1RB 2PUCA 2OHXA 4AY5A 1DIHA 3D0RA 2ZDHA 3UA3A 3G0OA 5CFOA 4ENSA 3L84A 3CT6A 4UXIA 3G85A 1BE6A 1HFEL 2Z8ZA 4ZAVA 1ORIA 3OZGA 2B6NA 1W59A 2BLNA 3O93A 4OATA 2NUAB 3SBOA 1YR3A 3AP3A 1ZXBA 4HQ6A 1ISGA 1Y3IA 5FL7A 4MQEA 2XWSA 2HJRA 3I9V1 4QXRA 5YASA 4KMSA 1NIPA 4NJEA 1I8TA 4GWGA 4YMIA 1SVWA 4HNVA 5DM0A 2ZJFA 2OZLB 4CPDA 5D5QA 4JLKA 3N86A 3AVWA 4I1VA 2LBPA 2VATA 2GAOA 2QUAA 1FP4B 2BE7A 3C15C 4M1MA 4XWYA 5A04A 2WF6A 4X95A 1ZK3A 1XXHE 4OH1A 3CJRA 4EO9A 1G5PA 2CD7A 3QEBZ 2PZBA 4DBLE 4DSTA 4QXQA 5EHXA 1HE8B 3F2IA 5HCIA 1XDDA 4N5DA 1P0MA 4NATA 5GV7A 1XAIA 1RAEA 2QUIA 4GLBA 4HBZA 3G2MA 2BFCB 3D54D 1YIOA 3WL8A 3HBFA 4C2UA 2I1VB 1TGVA 4U2CA 2GASA 1OXXK 1OXTA 2EFJA 2WMOB 1ZUNB 3DBIA 3UCEA 4A36A 4LPSA 1YULA 5JD5A 5A6VA 2HCBA 1TK9A 1OI3A 2CUZA 3MGCA 2HWKA 3LG2A 3HJHA 4I6GA 4NG5A 5IEJA 3FNFA 1L5YA 3GD7A 2ZUFA 3QTBA 3R76A 3HKEA 3QEJA 1KI6A 1LC0A 3GEGA 2QN7A 3TLGA 3UAYA 2QXTA 5EWMB 2QYHA 2C84A 2C03A 2HBRA 3L0BA 2G0AA 4KOAA 2VJMA 3TPCA 4BMCA 4IKEA 4QUEA 2XLBA 4QPNA 1USIA 3E2IA 4EMTA 1ODFA 1E1QA 4EUFA 3OPVA 1Z07A 4YRPA 2D4HA 4M3NA 1VZ2A 2QN9A 4PM4A 2DKNA 4U63A 3KFXA 3OKFA 2PVCA 1GA4A 4HLCA 4R01A 3U40A 4A27A 1OW3B 4AFNA 4F1JA 1FXSA 1SA0B 1G4HA 2QUHA 4WDRA 2WKQA 4ZVLA 5B6IA 1FDTA 2FPLA 4BV8A 4QEDA 1UMKA 3I5XA 1T3SA 2D1RA 5DM1A 1TVKA 2PJUA 4HVAA 4UCFA 5DVZA 2H8KA 5JZSA 3OTIA 2CLLB 1YQGA 1TCCA 2H65A 1FDIA 2VJCA 4FYHA 1VJRA 2EIXA 4NABA 1ZHHA 1U0RA 2FSPA 3OA2A 4K7JA 4L7VA 4AW9A 1PCXA 1XUOA 2OBNA 3UCXA 3AKZA 2XADA 1JJBA 3CV3A 3TQTA 5HZGA 1FTNA 4ZYTA 2Z4SA 1DPFA 1LRKA 2IZ1A 5K2MA 4L0QA 3TRDA 3ASYA 4ESEA 5IYZA 4P7JA 3K9QO 4DNFA 2YH2A 3RVLA 2NTEA 4C4ZA 1V1RA 2H4HA 1ZD4A 4D6XA 4RK0A 4BEJA 4MQ4A 4YCDA 4EJ6A 1IXSB 3Q9LA 2NVOA 5FWNA 2OD7A 2FN4A 3DLTA 3QX3A 1I4EB 1TQ6A 2CL0X 3C6QA 4WNAA 3UWPA 1L5RA 3D02A 3Q41A 3VZPA 1QFMA 2EYUA 4A91A 4CM9A 1PDOA 3AR8A 1T36B 5AT1A 1VJ0A 4UVEA 2EJVA 4WK6A 1CUGA 3RK0A 4HADA 1NXWA 1HNXB 2P6MA 3E18A 3IC5A 4PTYA 1E9BA 3C3JA 1U1EA 3H7AA 1CG6A 2MSNA 2YIVX 1T0UA 5JD3A 3MTJA 3S1AA 2BMWA 3OZDA 2QTWB 4QOIA 1F48A 4BNYA 2WIBA 3EC2A 4GUDA 3O9VA 1KBOA 1JXOA 1S2DA 2I5PO 4QQ8A 4JU8A 221PA 5T8KC 3FF1A 3UZUA 3WB0A 1U28C 3O2JA 3ZH9B 4LC0A 2JLXA 3I0NA 3IL2A 1KFKB 2OCBA 1Z6ZA 1DFIA 3EARA 1P5HA 1TPZA 3PXCX 4BFWA 5IZ4A 3QLTA 4MRRA 5JWOA 1GNPA 1BWPA 3GMIA 5EWJA 1EWQA 2OZPA 2LCQA 3DZBA 1C9MA 1JU3A 1DNPA 3AI3A 3RSSA 5FT9A 1UDRA 2E9SA 2IUFA 2XUFA 3E22A 1D2AA 2XCUA 2ZUEA 3OE4A 4GMFA 1HGXA 3MB8A 3I8XA 4Z9AA 5FJIA 5ABPA 2VSYA 1M2OB 1RHUA 3LX8A 5CDGA 1V3VA 2WD9A 1Z26A 5DULA 2Y0EA 4RTQA 2NZ2A 2V6FA 2UVQA 4IGAA 1QFYA 2I65A 3NEPX 4CMAA 3F8SA 4HTFB 1JIXA 4Q9KA 4OHVA 2QSUA 3GUZA 3OQNA 1R2QA 3GD5A 4LZLA 1GN9A 1I30A 1BGVA 4YO7A 3W8NA 3N2IA 3ZW9A 4CIXA 4DDWA 3VVLA 5D85A 1MDBA 2JAHA 3CNHA 3SX0A 3DBLB 1U8TA 3P19A 3AY7A 5IRCD 4ZVQA 1V41E 4G0PA 3SR0A 4Z0PA 4E14A 1T6ZA 1IBRA 1WXHA 1N0HA 4MW0A 3CLUC 1JJVA 4E2FA 4X91A 5E1BA 1Z36A 2V45A 1MC5A 4RPJA 5AJVB 1JAIA 1X7YA 1E8DA 2VJPA 4CM8B 1QXSA 4BLQA 5K3OA 1GR0A 3I5YA 2FEPA 3VXKA 3SMVA 3G7NA 3HZZA 4QASA 4QREA 2ID9A 4WESB 4BJHB 2F1RA 3H5OA 2C82A 1D9XA 3HWSA 3U3KA 5IK2D 2KHZA 1RBYA 4EG6A 1JVNA 1EHIA 2CXOA 5ALXA 2IU4A 5T6MA 4WOJA 1A1SA 3TDNA 1B26A 2A0UA 3U9TA 2DUJA 3PD0A 2LW7A 3D64A 4MW7A 3P0FA 5EOVA 4P5PA 3T5CA 3UJ7A 1FQOA 2OO7A 4GYJA 3WKAA 1YZGA 1UKVY 3L2OB 3N2GB 1HDGO 1CRQA 3DFIA 4UDYX 1KK0A 2G77B 4JSTA 5KMGA 3CLVA 3HDYA 1LEHA 5AVWA 1L8AA 5FNVB 1SKQA 3S40A 1U2GA 4UBLA 4MSUA 4RLSA 3B36A 1FIUA 2GN4A 2RGNA 3JY6A 4D80A 1T4CA 5H7XA 2R8OA 1QRRA 3IEIA 4LWOA 5JASA 2EWMA 1GAXA 4LV6A 2G07A 4MLDA 1W88B 4ETNA 1L4YA 2FRDA 3R09A 1Z0IA 2AZMA 4Z8XA 1RYDA 3EXHC 4DQUA 4FKZA 3VU9B 2E5LB 5H80A 4ISBA 1VI2A 2XBLA 4HUQB 1OZGA 3NTUA 4O1IA 4RVOA 3F7MA 5FPQA 4MVJM 1F6WA 1EJBA 1NYQA 1N8NA 1RCFA 2ZS8A 1Q22A 2QL5A 3QFCA 1M8JA 1E5XA 1UDAA 3NX4A 4RF5A 3ZHYA 3OT1A 4RF3A 4DREA 1ZAKA 4NOKA 2PS9A 4DB2A 2J46A 1B6TA 1E0DA 2XE7A 2EERA 4ID3A 4O2AB 4B3JA 1LK0A 2Z1NA 1M75A 1L7RA 4O4IF 1GG8A 1PL7A 4B3TB 3WLQA 2BTEA 2XTJA 1MO3A 1GITA 4HXFB 4EW1A 4NBUA 3T3DA 5IH7A 2IOHA 1V1JA 3EA4A 3T3GA 1U1GA 4HEA1 3T7AA 2PX0A 1I2ZA 2Z43A 1J0CA 5EZYB 4JLMA 4XFDA 4B4DA 1G2PA 1I32A 3WADA 3L0IB 4DBZA 2YOFA 3KWJA 3V5NA 3VNAA 1U8ZA 2F3SA 2WQZA 4QEZA 4LYAA 1JVBA 5T4EA 4ZYLA 1TZBA 3CW2A 3N7UA 1HFJA 1W5BA 2OV8A 2PZ8A 2WM8A 3MIIA 2WIKA 3NPAA 4UMEA 3X43A 1SZCA 1CZNA 3ZI4A 4C6TA 4F46A 4HDMA 4PSCA 5KEIA 1MRSA 2X6TA 1XZNA 2GWRA 1QHSA 2HHJA 2WIAA 5CPBA 3D7SA 3U1BA 2B20A 4I81A 3CWCA 4ZTZB 1N6KA 2C92A 2APJA 3BX1A 1CP3A 3WIDA 3CNBA 3WP0A 4P3KA 4AIRA 1XMSA 6AT1A 1YF3A 5DM2A 2PXHA 4HMOA 3KUXA 2B1GA 3M4XA 1MO6A 3PFNA 4P1ZA 3F73A 3ZVMA 1WVGA 3TLKA 2IYXA 4L3WA 3W4KA 4DHWA 2CF6A 4EX6A 2D5BA 3O8QA 4TYMA 1H1DA 3T34A 3V1NA 3LSTA 4G8BA 4MH0R 3PJRA 1PBNA 3WMGA 4CDNA 3DZ8A 3HWX1 4W6QA 2PUAA 2H0QA 1ZMTA 2O57A 3PEVA 3ZU5A 3HQ4O 5JAOA 4NOLA 2V3VA 2OPBA 3IV9A 3R8FA 4TT3A 3RC3A 5KNCA 3QY0A 1NMQA 2NIPA 3IPCA 4DIEA 1CZLA 5KZMB 2Z8YA 4L07A 2MSCB 1YS7A 1RQGA 2GYUA 3EBLA 3M6FA 1W76A 4NLLA 5KVQA 3UPDA 1BX0A 1DOHA 4CKBA 1X0XA 3F9CA 4FYIA 1ZEMA 4REMA 3ROTA 2I0FA 2HF7A 4TLAA 2J0QA 5EXSA 5D84A 3K4HA 4W9MC 2WVGA 3G3EA 1UAGA 4MWOA 4RZIA 5BSFA 1VL6A 4OHFA 3ZEIA 4H08A 5AICA 3DF7A 5JAMA 1PT6A 4YHBA 3EUFA 1L1QA 4EPYA 1MNQA 3ZQ4A 1M3SA 3DP7A 2BHLA 2DPYA 2VHYA 3WGLA 1VPEA 2X19A 5FI3A 5DHPA 3ZWCA 1F14A 1DCTA 1XJ0A 4KAFA 3W5HA 1X94A 4G25A 1YT5A 3UWDA 1Y8RB 4GKKB 4G41A 1JMVA 2M6RA 1BXZA 2YWBA 3F5SA 3F5FA 4G1BA 4E09A 2FR0A 4PQYA 2DUUA 4G0OA 1XWFA 5IJ0A 2JAPA 1UZAA 3LHKA 1G8HA 3E9YA 4Q05A 1VDMA 1K7CA 1X7ZB 4DZTA 2YWCA 3FIUA 1J0XO 3ZHCA 1M8GA 1JHUA 4LRWA 2L42A 2PMBA 3QTLA 5JR3A 3ZLJA 4ARIA 3AP1A 1GZ3A 1Q1QA 1UDBA 2P30A 2X1VA 1I7DA 1URPA 3CVUA 3E48A 3LK7A 1QDEA 1U0FA 3K6JA 4IJWA 4G84A 4A6XA 4BZXA 3IUEA 4W82A 3GP8A 3BFPA 1L5HB 5K45A 2II6A 5CT5A 3OKPA 4B1FA 3GRKA 3IQGX 3TW8B 3ZIAA 5FUWA 3R0VA 1QJCA 1TLFA 4B34A 1ZZEA 5KIAA 5BSWA 3H5TA 3QLJA 3IUPA 4MRPA 2GLUA 3FFAA 4G2NA 4QT4A 4Y6LA 4TMTA 4BYMA 2B25A 2VAWA 3NBUA 4FNGA 1U1CA 5I7HA 4LHEA 4YPOA 1OROA 1P45A 3RS7A 3TZQA 2A9PA 1GDTA 4ZVSA 1P7VA 1JKJB 3D0KA 3ENVA 3P5SA 4FFSA 2AR7A 4PW0A 3L6DA 1W8DA 1UPAA 1EDDA 6CHYA 3Q8MA 3JQBC 3PXEA 2RHRA 2R65A 3M5CA 2IEIA 2VF2A 1TAGA 5DK4A 3ZE1B 3R9IA 4PYIA 1YOBA 1ZRMA 3BK1A 1T8WA 2WHXA 2Y77A 1J5XA 2R1VB 1LS6A 3QPWA 1BIFA 1XZIA 4F4HA 4WJLA 4YNBA 4ZI3A 1QIGA 2FUG1 4MAFA 1K0FA 3BOSA 4LBVA 2FPXA 5THXA 4Q4HA 4RTJA 3GJ4A 2XGJA 2EFEB 4JUDX 1DC5A 1HQKA 4RSRA 4N48A 2ADFA 4IG4A 4DN6A 2WUDA 2X6QA 4BVEA 1ZU4A 2MSDB 2VWQA 1DWUA 3BK7A 3V2UA 1GM5A 1QGUA 2WE8A 1OC4A 3Q7IA 2BP7B 1OCEA 3WLHA 2C3YA 2YCBA 4KV9A 2G1UA 4AU1A 2XKAA 4LXXA 3NHBA 3OUTA 3RIEA 5ERXA 1GGMA 3EZ7A 2ZI6A 4LMPA 1UJMA 3WGJA 5KSWB 4ZCQA 3S70A 2F6RA 5JS6A 5TEVA 1UKCA 4YROA 1XK7A 1CYDA 5H4HA 5FL7D 2Z83A 4QWWA 1YTLA 2NYRA 3UKDA 4M9SA 4N03A 4A73A 1G291 1O6BA 4INZA 2BEWB 3M4NA 2X2FA 3KQVA 1OT5A 4Q4HB 4OLHA 3JALB 7REQB 1CJSA 3DVSX 3LQ4A 4CG2A 3AHJA 3VO1A 4RBNA 5FR1A 3HN2A 1N1DA 1M33A 1KAMA 3BD8A 1OT3A 4JJGA 4G26A 2OGZA 3IPRA 3MOSA 4EL0A 5DLPA 1ODTC 5BYAA 2JFHA 1VKNA 5CEEA 5HQ3A 4UOQA 3FPSA 1WDKA 5INTA 4FFWA 5HCNA 3K96A 5BMOA 3HCNA 1WZEA 3ZH2A 4BKQA 3PL5A 2RD2A 4BYGA 1JA0A 1B41A 1N8KA 1XKQA 3N39C 1P4AA 2FW1A 3BMXA 3JVIA 2GEFA 2XYPA 2PUTA 3AG5A 5HIMA 1UEXC 1ULSA 3G0GA 3RUPA 1T8RA 2D54A 5BN3A 2I6XA 4QDXA 4JI7B 1GEEA 1HE5A 1UJ2A 1P0FA 3ND9A 4OM7A 3PDHA 4ZCLA 4EK9A 1I6WA 1U65A 4H7FA 5BN1A 4PZUA 4BP9A 3ET4A 3JAMA 4IY1A 3B1KA 2HKIA 1RQPA 3KSMA 1MTZA 2EU8A 2TECE 1Q1NA 4FMDF 3VR2A 2XR1A 5C7IO 3WS7A 2PIAA 2PLWA 2VJAA 4Y98A 1NHWA 4D74A 4RHYA 2X6RA 2JJ8A 3DAPA 3W3AA 1SXHA 3AVTA 2HA2A 5H83A 1JEAA 4ZVPA 4JUAA 4TMKA 5E1MA 1EVQA 1KSJA 1U7HA 5KAMA 2JEZA 1MG5A 4IJ5A 3TVYA 3OE1A 1CR2A 5BP7A 4WKOA 2YJZA 1QV6A 4JCOA 4ZOEA 1KXJA 3VC1A 4PZYA 3AI7A 2WKRA 4NCKA 4P83A 5DTRA 1LGYA 4B4WA 5JSYA 4C4XA 5HYVA 5K0EA 3IVAA 5F7XA 1T3TA 1EZ4A 2JLCA 1WZIA 3R40A 5K2OA 1QH1A 2WBLC 1EBUA 1E6UA 4UMFA 5ALFA 1DTWB 4AMZA 2IBMA 4P3NA 5EKSA 4CKZA 4X62B 2H3HA 1AQ6A 1ELOA 3TR6A 3OHMA 1H0HA 1NR1A 4Q24A 4TLDA 4MHTA 2REOA 4KYIB 4ND8A 4P3YA 3C98A 4ZOBA 3B3QA 4R3UC 5G0VA 4KWTA 4Z99A 1A4IA 1PN3A 2WKWA 1VC2A 3EZ9A 4R1SA 5LBTA 3UANA 3FJ1A 1O6FA 2C5BA 3AEKB 5DN6A 3WGMA 1C0EA 2GCIA 1ZJZA 1PNVA 2Q3JA 4WZZA 5KYXB 3IB3A 1JZTA 4HWOA 4I19A 1CUWA 1V37A 2BJVA 1SCUA 3CUKA 5BQOA 1AK1A 4URUR 4UU8A 4C7KA 4EI7A 2GZRA 3RFFA 1JSRA 1TGYA 4MS1B 2P3OA 1HETA 2VT7A 4HDAA 5FPTA 4G86A 2OXIA 5CFMA 1O95D 3OZVA 3GFBA 1J1IA 1EFPB 3BFXA 3MLAA 5FEUA 1LW7A 1OYWA 1NW6A 2AR9A 2ID4A 2PGJA 4HFJA 5E6RB 1QCZA 1FU7A 4RWEA 4XPZA 5D5HA 5E7JA 1JHYA 4HYYA 3VUFA 3OU6A 5LIPA 5AHXA 2GCPA 3OH8A 3FJYA 3KT8A 2Q0SA 4R1QA 2Q5CA 3U60B 4OJNA 3ESYA 3H18A 1AF4A 2NW6A 3PJEA 3M6IA 4A4DA 1ENYA 2FN8A 3T38A 2BSQA 3X44A 4QQRA 2O8EA 1OIWA 1F9EA 3GAZA 4WADA 5FOUA 1JS1X 5T5QA 4DUGA 1P9OA 1Y1TA 3D59A 3X2SA 2WU0A 4LJLA 4DA7A 1ZKDA 1IHYA 2AG5A 4KN6A 1IHXA 5EJ6A 2NP7A 5AVSA 2ODPA 4AQDA 1F0PA 3FPFA 1YXMA 2OOSA 4M9RA 4OHPA 4UQOA 4CT0A 4DADA 4D99A 4TV8A 4MRSA 4C03A 5CD1A 3IESA 1M66A 4U2FA 1GXSB 3C3AA 3T06B 4YPVA 1FJGB 1ZR4A 4DV5B 2OVFA 3B78A 3PFWO 3JRNA 4CHTA 5IT4A 1W36B 1SNYA 3MJEA 2ODAA 4MINA 4B84A 3PHGA 2UZ3A 3L0OA 3IMCA 4EY6A 1SKBA 1PR1A 3IT1A 1XTPA 4G3XA 2R751 3SG0A 1Z18A 5KTKA 4CQMD 3ABRB 4JJ8A 1XG5A 2YHIA 2AUNA 4R9RA 4KPUA 5D5PA 3E27A 1ZOOA 3T1QA 3WRXA 5I48A 2BYTA 4URVR 2P65A 3DMRA 4DM3A 2FVYA 4J3JA 2WJ3A 3RSQA 3KO8A 3AVXA 4YP6A 5H8WA 2YL2A 3C8UA 4UE3S 1X7HA 3C6BA 1T8PA 2DQKA 3K6RA 1JE0A 1YRHA 2RSLA 4HZUA 1AMOA 2HF8A 4CFZA 2EL9A 1FLAA 2VFAA 4PBRA 1GCUA 2Q0QA 3CRVA 4I66A 1OXMA 4QATA 1CY7A 1D6MA 1I10A 4HAIA 1HDOA 3PR3A 2OQRA 2VYND 3O73A 4MWZA 3VPSA 2VHZA 1RI5A 2QVYX 4WERA 4E3WA 5I7EA 3QE9Y 3TZ6A 2V98A 3BB3A 3QZUA 4MV8A 4BEVA 3GDWA 4CYMA 1FW6A 1Y82A 2OCGA 2ODBA 3HCCA 1MQ9A 1U9JA 3ER6A 2G9NA 2OECA 3DQQA 4EW6A 4RABA 1KHTA 3LXRA 4PSDA 4N6OA 5CNIA 4AJHA 1DSSG 5A1JA 1QANA 3O47A 4KXWA 1SUDA 4V0NA 3S8MA 3WVNA 1NUPA 3H17A 4BKMA 1CU1A 1CLUA 1FYDA 2FJPA 3WRYA 5I7OA 4UHCA 1GYPA 1NM5A 4M8IA 2PX5A 1N7HA 3WB1A 4ZOQI 2DPMA 5AXCA 1YL7A 2IY9A 2XA2A 5JYDA 4FQ7A 2WFAA 4LE2A 3WK6A 3G02A 3KJEA 5JC8A 1D2MA 2AA3A 3I92A 5AHKA 3KSZO 4M0FA 1EIZA 3EMVA 1BU5A 2DC1A 1PJTA 3C43A 2QTVB 1R8SA 5L3QA 2AJCA 3RVJA 3T7EA 4ZI5A 2XXAA 1JAHA 3O4FA 3VR1A 1EFTA 4S2EA 3ZE0B 5HZHA 3MWLA 4FT4A 4D4GA 1SBHA 3RTEA 1UPXA 2OY0A 1EXVA 3PZBA 2QDXA 2C0CA 3PKIA 3QRWA 2VF7A 4M1ZA 4G36A 4EMUA 2XD4A 3LT1A 3PG5A 2ZYAA 4OO3A 4F2PA 6GPBA 5DBFA 3EYWA 4FYPA 2QBYB 2ZWOA 3A10A 1B00A 3CLHA 2N47A 3H1EA 3LC2O 3P45A 3GP3A 4WXEA 2D0IA 1GP2A 1KGSA 2A7XA 2HU5A 3QM1A 4TXHA 4FCTA 5BWCA 1P1JA 4ZD6A 1E1MA 3HCBA 2XD9A 4JAVC 3PE4A 1JLSA 1G8YA 4TT8A 3EWSA 4KR7A 3P0HA 1QFZA 2IYAA 4CUKA 2CWDA 3VMMA 4BBPA 1GGFA 4C88A 5FB3A 5E4FA 2A4MA 2X7XA 5KOYA 3P32A 5FULA 5AI0A 3W5AA 3GJRA 3IE2A 3B70A 5EERA 4JC5A 3L8FA 3UTCA 2Q45A 4O2LA 4TLEA 5CB0A 2YMLA 1H42A 2ZRJA 4OI2A 4N40A 5ALKA 2O5EA 3N5KA 1KP2A 2PUJA 2WJ6A 4DLPA 1JEEA 1K9SA 1IWPB 1W9MA 5KSOA 1J6UA 4M0MA 4MLPA 2P5TB 1C3OB 2YINC 1K27A 2D4AA 2FW6A 2BDEA 3QBEA 3SDSA 3P2YA 3ZLUA 4RH0A 3WTBA 4A8JB 1GFIA 1W36D 1R4MA 3L8ZA 2D1YA 4WKCA 2JD1A 2G83A 2KBEA 1AUVA 1E6WA 2EJBA 1GZ7A 4WZAA 1MU0A 3UV7A 1NT2A 1LPBB 3KD2A 1SKAA 3PVCA 5HBGA 6REQB 3KYCB 1RZUA 4G1VA 4UTPA 1J5PA 4LF4B 1GA6A 2IYWA 2RHCA 1BXGA 3DVQX 4G81A 2RG1A 3TZLA 4ZVRA 3G7SA 3HO6A 5F5NA 2IK8A 5IBCA 4KODA 4HNGA 4L4UA 5ULLA 2WZCA 3FGOA 3TECE 1BJRE 1NW7A 4WZBE 3UT5B 1H2ZA 4I9HA 2R8EA 4HNRA 1KI2A 3ZGYA 5KHLB 1BD3A 1XWWA 1PE0A 3I3OA 1ST2A 1OWNA 2FFQA 3QP9A 3OEEA 2QNIA 4BO8A 3NTOA 3I30X 1E79D 4FHEA 3ANSA 3P4YA 4ND1A 3VC3A 3ZQJA 4BB5A 3AOGA 4AJOA 2PYZA 5A3RA 3BC1A 3LIIA 3QFHA 2FG5A 1J0BA 4Y0AA 3V32A 3B7PA 6ADHA 2WJJA 4TWIA 4LA4A 5IYZB 5KDDA 1SY7A 4HNUA 1RAIA 4MP8A 4L2IA 4WASA 3W6NA 2PUBA 1VCIA 4NYMQ 1KMCA 2RARA 1TRKA 5I9NA 1NYTA 3BN3A 4MYRA 3B2QA 4NBVA 4B71A 1I7NA 5CJPA 1R9NA 4MKZA 3WYCA 1OKKA 2QR5A 3S3TA 3AUUA 4Q01A 1JBKA 5TMBA 1CY2A 2DWCA 5DT9A 2RHDA 3G5MA 3MGBA 2D06A 3RLIA 1TO2E 3Q3EA 3OBBA 1NZFA 5L45A 1YS1X 4WBXC 2ZI9A 1QWOA 1QF7A 3KEQA 3UT6A 4FX5A 4JCCA 3Q7RA 1JHXA 5B58C 2MINB 1R6DA 2A0WA 2BM9A 2GD0A 3JQAD 3S2EA 2A6PA 4JYAB 3IP9A 3BORA 4BQOA 1PUJA 1SELA 4D0GA 1UXIA 3M1IA 3ABOB 4MZDA 2GAIA 1YJ8A 5JWHA 5CD9A 4UXHA 2NZYA 1RJEA 3KSBC 1YE3A 2ZBFA 1W0KD 1MJGA 1Y0BA 2X8JA 4YRCA 3N8IA 1Y7IA 5JIBA 1E0JA 2B37A 3WYNA 3V80A 1SU4A 2Y76A 2ATCA 4Q9JA 1J56A 2IYQA 1N2XA 1YJCA 2FRVA 1Z28A 3BDVA 3KOUA 4X60A 2VDVE 1XA3A 1T2EA 1D7AA 3GJ3A 3ESRA 2GR9A 2R62A 5CCXA 1XEXB 2ZRLA 5K8LA 1ESMA 1ECLA 1PQYA 2C31A 4BP1A 4QKQA 4PAQA 2QYTA 2YJNA 1TUGA 4DZRA 2MSEB 2W6IA 3V7NA 2Z95A 4TTQA 4M4SA 1KDYA 2Q6LA 3UAOA 3VOAA 3H2ZA 3L8EA 1FP4A 1WCV1 2J48A 1QF6A 4DNPA 1YB2A 2O9JA 3KVRA 3EDYA 3LE8A 2ZE7A 1KE2A 2CN1A 1LX6A 4BMPB 2QF7A 2GRJA 4GT1A 1E6MA 4NCXA 1TFRA 1JMKC 2RGCA 2C88A 4GR9A 4MVJH 4PPNA 1YFJA 5C7OO 4IFTA 4XUEA 2IOFK 2P27A 2W9XA 4RJKA 4TMFA 4X3CA 5AJZA 2YZKA 2QXYA 3WBBA 2UAGA 1O6ZA 2G8NA 3DTVA 2ZYDA 3OOHA 4IH4A 2PUWA 4M55A 4LDJA 3VSBA 4B83A 4YCBA 4DCTA 3QELA 3OQVA 1O9GA 3ZHBA 5LMUB 2R4QA 4KW7A 4RCZA 5ILGA 4U4AA 1B6SA 4AKSA 4WY8A 1AN9A 4O2BB 1NNLA 1OGYA 3IQHX 3QU7A 4N76A 2JCSA 1WB5A 2PSEA 2QNRA 3BTUA 2A59A 4HFRA 4O6VA 3ADBA 1GL6A 3FB4A 4Q4DA 4J07A 4U6SA 3AVUA 3FYSA 1Y6ZA 1S2OA 3HE3A 3NH9A 5IUJC 1KEUA 4PAOA 3R9XB 2B4RO 5CW2A 1WLYA 2PUDA 3G6KA 5LIRA 5MFPA 4DA0A 4KXMA 1XDUA 3HRKA 3K3PA 4LYDA 1XLVA 3IAM1 4XEUA 5ENDA 1AKWA 1JYFA 1SGWA 3F4LA 1G0OA 2CHVA 2PH5A 3FXAA 3H84A 4LZZA 4PQRA 2QZPA 4F4CA 3QUBA 3WLKX 2FDCA 1UPBA 4EYSA 3EXAA 1ZWLA 1MGOA 3Q1KA 3WO1A 1B43A 1M5RA 4DS3A 2BR5A 4F92B 3JATB 1B0PA 3KLOA 1Z06A 4DPKA 1HLGA 2GA9A 1GDHA 2O2ZA 4OHBA 5A0FA 4CLEA 4D0SA 1N0WA 3KKMA 3IXLA 4LRUA 2I2BA 3C3WA 4XM1A 2NSDA 3SS7X 1WDWB 5DIFA 3HA2A 2ENWA 3DHYA 3PB3A 1WV1A 2JGIA 3WAKA 5HBRA 3QYPA 1HURA 1OXUA 1QC5A 1WAMA 1B3BA 1L5ZA 2DWPA 4WLUA 1FS4A 1RMTA 2C4VA 1K7SN 2JJ1D 3E03A 1QTNA 2FV8A 4DQDA 2H0AA 2Z9BA 1L3BA 3MLEA 2Z6VA 3FNIA 2RGGA 4JP1A 3W9YA 4IIYA 1UXJA 2WSIA 4EYKA 1G21E 1P61B 2GTPA 2QTBA 2ZTUA 1T5LA 1DAPA 1FL9A 4KIJA 1NF3A 4RQUA 1ADGA 3GJTA 5TV2A 1FLVA 1OVGA 1C4OA 1GTVA 1TOAA 4MUMA 4HVLA 5FV4A 1DJMA 4IMIB 2UYGA 2ICAA 1YQQA 2EC5A 4UBOA 5JO9A 1OPRA 1YB5A 3IHWA 4KIWA 1F5SA 1E4YA 2I4TA 3IULA 4XIJA 4IEFB 4DLKA 4EG0A 3KQNA 4HATA 2X0JA 4Z51A 4FJ0A 4KRGA 3MCZA 3IUNA 4LC9A 2IYLD 3BWXA 1CY8A 3PPWA 1Z5PA 4ABYA 1JQ3A 2P3SA 2CSUA 1Y3DE 5DYIA 1KK1A 4Y2SA 4U7JA 1REQB 3VM6A 3A1FA 1ADYA 1ID1A 3GA0A 2I3DA 1RIIA 2BFBA 4RENA 3B9PA 4CQNA 5AK6A 3W05A 1J00A 2VDKB 4EPWA 3KU4A 4MWDA 4KR9A 4BUJA 2GDZA 3VC7A 1BX1A 1ZCZA 3IGFA 1FNDA 3BXOA 2PUGA 4X85A 4D4LA 2O3RA 1GL9B 4G5SA 4BWVA 1XCGB 1UBTS 2NTVA 3G8CA 3MXTA 1E0KA 4I36A 4OIMA 4R9SA 3D4LA 2VBCA 5F9FA 5KOHA 3QBVA 2FETA 4JJZA 4OQNA 1HM5A 2I3GA 2OG1A 3PQ6A 3ZGLA 1UBUS 1VG0B 1YCDA 2LVBA 2W00A 4UU0A 1L5GB 1T2DA 2XMSA 2XYGA 4JUFA 3U4DA 4IS3A 5KYUA 3WX0A 4Y8VA 1W5SA 2FWJA 4LBYA 2GBLA 4EG7A 1SVSA 3SBDA 2DFLA 5JCXA 1A9OA 1I7SB 3WBJA 1K3FA 3HMQA 4M1OA 5TIIA 2WK1A 3I64A 3DR3A 2O4UX 4PG7A 4ZZ2A 4MPDA 3SKXA 4YCNA 4WOKA 3ABSB 3Q2IA 5IXJA 2R1TB 1IUKA 1NPYA 1KY2A 2LXNA 3THWB 1F7VA 2CY0A 3JSAA 3P2EA 5EEHA 1PG5A 4Z3DA 5CH8A 3ZHQA 2C98A 2R8RA 4ZO6A 3S99A 3NYRA 1CQIB 1UT6A 3BE8A 1PU2A 4Y6RA 3LWDA 1VPLA 3H1PA 4QTZA 1WF6A 1OC2A 4D44A 1E0AA 1Y48E 3MFYA 3JTMA 1N9KA 5L95A 3ZBQA 3AU8A 3PPXA 1M9NA 3EH1A 3CG4A 1JLLB 1UMCB 4Y2HA 3N2ZB 1C1XB 3L1HA 4QELA 2ZB4A 4URWR 1W2WB 3JD2A 1WR8A 3EGXB 3P7MA 4KMOA 3LH5A 4ZAYA 4DYDA 4WLFA 2XZDA 4BLVA 1MP0A 3I9V6 3D8UA 1RRPA 3WL6A 1WNTA 4CM4A 1KU6A 4Q4LA 3NMUF 2PN1A 2VDQB 3BH6A 4FR2A 3BGOS 2JGNA 4QFBA 4WZBA 3ZD9A 3T7RA 3ZKAA 4F1KA 1SG6A 4ZGBA 1JX6A 2WABA 1QTRA 2XCLA 3L0CA 3HLKA 3O82A 2XMPA 2XMRA 1JIJA 1HQCA 1F38A 2H1LA 2PKXA 3IMEA 3PI6A 4OSEA 1ZK0A 2YXPX 4FLFA 4AKHA 5AOVA 1XTKA 2PTHA 2IXDA 3M3HA 4JLBA 1AKMA 1X1SA 4MVJF 5E4JA 3CVYA 3O31A 3ND6A 1YFLA 3O2QB 3DE6X 2NOAA 3EVEA 1PD1A 2IYZA 4HEJA 4NNOA 4MLZA 2GJ8A 2P2CA 2R2GA 3NEYA 4Y9UA 3UCFA 4JUCA 4B2IA 1T2UA 5ALVA 4G0VA 4JGBA 4ZDJA 1UC9A 2CYBA 4G65A 4B4KA 1Z6GA 2O0LA 3K09C 5AI6A 5JXJA 2JFOA 4YHHB 1LBSA 3HP7A 5BQPA 3IR5A 2PXXA 1IZ8A 2HD4A 2PYDA 4AECA 5JXIA 3BVPA 2B9VA 4WFKA 3GLFE 2QAGA 5HIJA 5TQ0B 2HIAA 1IVYA 1SOUA 1SJ9A 2VAVA 3PRKE 3PFFA 3QNMA 3CTPA 3QKSA 2B35A 5CXUA 5LYJF 2E89A 4RA9A 5C8DA 3WLJA 2GGSA 3KVOA 3PIDA 5FFNA 3TLJA 3G9UA 5HUQA 1JXMA 5IFLA 3TEMA 3IOBA 4IPTA 1X74A 3HB9A 1U0TA 3NJ4A 3R0XA 1RVV1 2BKEA 4QFMA 3I2KA 5DNEA 5BRAA 4X1YA 3HHPA 1BA3A 4KX3A 1SKMA 1JSLA 1INLA 5HIAA 3ZU3A 1A0OA 1P19A 5CVJA 3EHDA 3VSDA 3RYCA 1ZUD1 2BHTA 2JZCA 3C6MA 4KLAA 4A10A 4MWGA 1YE5A 3FRIA 3MC1A 3QW2A 3AXSA 3AY3A 4NJMA 4WMLA 4ZU3A 3MS4A 3W77A 4FHDA 1C1XA 1KSFX 1V2GA 3WIBA 1KAOA 1KO4A 5IVPA 3U7GA 3FLBA 4E2YA 2G6TA 5FXMA 4LYHA 1HUQA 2EBFX 2QTNA 2ZQYA 3EVZA 4D0RA 4OYLA 3HEBA 4MLCA 1JAZA 2WQ6A 1QV7A 3JQ9A 2F3RA 4BVFA 1K5HA 3IEVA 4QUHA 2J87A 1OREA 3T5DA 1WCIB 4MS4A 3D1LA 3RC7A 2JGFA 4HMQA 1HLDA 2FJ0A 4S1OA 3ZU2A 1IXKA 1X42A 2XYVA 1UPCA 5JCJD 2QRMA 4KUGA 3AQ4A 1O0CA 1LC3A 1OQAA 1O5TA 2J9ZB 3EVTA 3L0ZA 5BN4B 3L8YA 1Y7TA 4MW1A 1GG9A 1MPTA 5DCUA 2J0EA 2AF4C 3MUOA 3NHAA 2VOEA 1FMTA 5JNTA 1BG6A 2HT6A 3DKRA 1FUYB 3F6PA 3L4BA 4J9VA 2ZIAA 4LRTB 2HO5A 1NVAA 4UUNA 4K0RA 1UOQA 4TVSA 1SIWA 3GK3A 1XRRA 4FB5A 1I6MA 1AS0A 1ZUIA 3VR6H 2XF2A 3SCZA 3NFRA 3P0JA 2RKWA 1QHHA 2AZDA 4WI1A 3VR2D 1Z47A 5JCOC 5H5JA 5LZ9A 5EIWA 1LJLA 2DHCA 2RB5A 1KJZA 3OE5A 5IANA 2XODA 1O6GA 1RAAA 3OLZA 5IKPA 2J9FA 1U8XX 1E9DA 1P44A 2O3UA 2OILA 4LSGA 5BYJA 5AW6A 3KYDB 1EWKA 1DEKA 2WIJA 4WEQA 5DGXA 2M98A 1F4VA 2QP4A 3H11A 3KT0A 4BZPA 4E03A 2BM1A 2OKCA 4C0XA 4PLTA 3HR4A 1MAUA 3LPMA 1GQFA 3IEUA 5JOQA 4BQQA 5LQMA 5I47A 3RIHA 5IM4A 1N7GA 3E3MA 3Q10A 4PX9A 4GBGA 4TKZA 2C2KA 5ITWA 3IVGA 1NPDA 1SKUA 3QKTA 5LP6A 2BH9A 2PGNA 2XB9A 3K0FB 4JLAA 1P9LA 4ZKEA 2CB0A 2ONJA 4IO0A 4KAXA 1NP7A 4H17A 4GAEA 3ML1A 4FSDA 2EYQA 3VR4H 3ODPA 4YC7A 1Z6PA 1E4OA 1WY5A 3C5HA 2NO7A 4G85A 2QJOA 3DNFA 1F4LA 1D0IA 1NM5C 4OA8A 1PO7A 1NSFA 1Z2EA 4C7JA 2C4TA 1DXQA 1W29A 5CUQA 3CRRA 1R6AA 4LTNA 1WPXA 1XAHA 3T61A 3ZYZA 1JP7A 1KVQA 1TMOA 2MR5A 3TXAA 2PA3A 1CULC 5DV9A 1QE5A 2C9MA 1FB5A 4R9VA 1FUIA 4WZ6A 1NUUA 3OPNA 4DIOA 4ZK2A 1D2EA 1ZW6A 3EFEA 3FSEA 3EFOA 3BMQB 3KUUA 2OBMA 3WIVA 4ESOA 2DBVO 2YV3A 3EBPA 4JP5A 1N78A 3BBPA 2HK9A 1YZNA 2YIJA 2VP4A 1OFGA 2OMEA 1DARA 3A1NA 3I34X 3QX7A 4IH1A 1MA3A 1SXJA 1XV5A 4IDOA 4DCVA 4C5BA 3MK31 1KOLA 3ONEA 2P62A 3PGLA 5KDLA 2COEA 5JMTA 3O0DA 3H8SA 1CUUA 2CHFA 1N5KA 3IUQA 4HXGA 4P7GA 3QG5A 4B5LA 4I5DA 4I50F 1P1BA 1GKLA 3SJBA 2OESA 3ZIDA 3NAZA 4I6JA 2QQFA 3FM9A 2GVNA 2LTAA 2QRJA 3NM4A 3Q4GA 5L3RA 2IPMA 3NOVA 4JC0A 4PHFA 1BSVA 1LX7A 2PPLA 1IJBA 4B2PA 1MEOA 4XCQA 4YAJA 1E2IA 2EW1A 3A9VA 2NZVG 3BWVA 3EVNA 5EINA 1EUQA 1FFCA 1TB4A 1F2UA 3X1WA 3JD4A 4BMOB 4K9PA 4BRWA 3U31A 3JW8A 1M67A 2C9OA 1MEJA 2GAJA 4DLRA 4D4IA 1O2DA 2FPPA 5E6UA 5CAEA 3V4SA 3FPLA 4TN1A 3MWKA 1ULHA 3DBRB 3IEMA 4BMSA 4XQ0A 3V55A 2Y9PB 3KZXA 4D5GA 1P4HA 2FZVA 4ZDKA 3MJSA 1SC9A 1RXVA 4B3SB 3P71T 5GJWC 4NCHA 4R51A 2BMAA 3PQ2A 3JQAA 3UK7A 1B7GO 4G01B 2X0NA 1T9ZA 1WMFA 4I5IA 1TMKA 4NR0A 1Y8AA 4PYOA 3SR4A 2RE8A 1TYZA 3LLSA 1TI7A 2H11A 2XCSB 1PZHA 1XZDA 2ZBVA 4KXLA 4H77A 2CSXA 1XPUA 3HSKA 1D3AA 3AJ9A 4KRXA 3A6PC 2Y1DA 2ILTA 2YOHA 4I4TA 4J6EA 5IK2A 2YW9A 2A94A 4KX5A 4MR9B 4ZV7A 2QHXA 1B76A 3AILA 3CUTA 3TIGA 5KVCA 1E59A 1PNOA 2AXEA 4U0KA 5F4ZA 2YQZA 3ZR4B 2VF4X 2CVQA 1FTSA 3FDZA 2AEFA 3HNOA 5B3LA 1Q1EA 2LCIA 4P3XA 4QGSA 4GU5A 1T9GR 3ICPA 3D6FA 4F6CA 1JFSA 3DWIA 1N6NA 3QVMA 4AUKA 2I4LA 1JGTA 4TL8A 2OHIA 4AMBA 2PS0A 2XUAA 3ESZA 3CCCA 3U56A 3QIAA 5CNKA 5LZ5A 4QO8A 1CEQA 3VZRA 3AB3A 4LRQA 1LH0A 1YVUA 2IP4A 3UMJA 4LCBA 2CYAA 2B4AA 1UJNA 1V5WA 1BRMA 2X8JB 2A86A 2ACEA 3A1VA 4IJMA 4S24A 4PR3A 4LOHA 4EQ6A 1NFFA 2XYHA 3WRVA 5CG1A 4FYJA 2PMFA 3EEBA 3EYAA 1YE8A 4F71A 1Z22A 5A9SA 3PXXA 2WFLA 3FSGD 1EUCB 4GP6A 4AMVA 1KRXA 1KYVA 3ZJVA 2X2PA 1U8EA 3NT4A 4CDMA 1C7IA 2H52A 1USUA 2VPPA 4I3FA 5ICGA 1UOPA 4U9HS 1VYTA 4PC6A 1BE8A 4R8RA 3HBJA 2IWHA 4CCYB 4DXHA 4OXYA 4YMVA 3B52X 3QUSA 3SSOA 3GLHB 2V6GA 3VBEA 1P3DA 1DO2A 1Q0RA 1Z62A 4Q34A 5LB2A 3B1FA 5K0TA 4WAUA 1QVRA 2YNMC 4PS0A 3FI9A 2I62A 2O52A 4KO8A 2CDCA 4OU5A 1GQRA 4PZLA 4OHZA 4B31A 5KTMA 3A7EA 3VUEA 5EPUA 3OZXA 1PR9A 2JD0A 1FU4A 3HNRA 4Q16A 5DJ5A 4EUSA 4OD0A 3T1YB 4IG9A 1WNFA 5E38A 4Y7CA 4UCXA 2ONKA 2EBWA 1KARA 2FW9A 3HCPA 1U5BA 3IPAA 3MGKA 1CEXA 2AN9A 4KBFA 4KFSA 5HRUA 1KOFA 2YQ4A 2B7BA 3HCWA 3AINA 2JW5A 3OSUA 3TX2A 3VISA 5IWCA 4QSMA 4GMGA 4NE2A 4YT5A 3WWDA 4JX8A 3JX9A 5A9RA 1OH6A 3KQKA 1C3JA 2PWBA 4ASUD 2NQ2C 1H4TA 5BY2A 1SWVA 4FPXA 3HJAA 5T4BA 3N2LA 5ADUS 5JNRA 4C5CA 1ZNZA 3NHLA 3ZDRA 2Y1CA 1N5LA 2ODTX 2WR8A 2X1LA 3ZPXA 3OD1A 2H9YA 1NMEA 3TWOA 1PVDA 2H6EA 1EG2A 3TAHA 3TR5A 1EFDN 3WGZA 1GZDA 2ZLBA 3CUWA 1N92A 1YDGA 1ISIA 3BHJA 5FBQB 3ZCQA 3ZZUA 3EZYA 1I3MA 4QZVA 3AL0C 1KHHA 1EFCA 5AW5A 2JLUA 3DPIA 4J16A 3DFUA 2Y3IA 1ULZA 1Z16A 2P4SA 3WKDA 4QGBA 4ZRDA 1GPH1 2J6IA 3KDSE 4DWJA 4A8JA 3NAMA 1VDZA 1Y3AA 3FPEA 2GPWA 2Q5OA 1QP4A 1JG1A 1IXRC 3A0UA 2VPWA 3F6YA 1II8A 5DW0A 2Q7OE 2ZWIA 2XRMA 4OYRA 5DBEX 4BCDA 2XGOA 2JHPA 3E15A 5M04A 7GPBA 1E8NA 2O5VA 1GPBA 5KQSA 2BMVA 2XMGA 3H2HA 1EH5A 3TSOA 5CEFA 3S1SA 1BFDA 2BBSA 1OA1A 4DAOA 2V54A 4GO1A 3REFA 1TUBB 3BRWD 3R20A 1XRQA 3DDWA 5AI5A 5A62A 2Y68A 4UFPA 3GCWA 4YRMA 5BN5A 3EFHA 1QYVA 1XZGA 2C96A 2ZWAA 3ESCA 3KQYA 1DELA 3MUEA 4GOOD 2HLDD 4RHFA 3DBRA 3GP5A 4BE7B 4DKXA 5EGNA 4DSAA 1LDEA 1L4BA 3FCEA 1R9MA 2WWYA 1TW2A 1H6CA 1RWMA 4XTCS 1I13A 1ZD9A 2EX1A 2FPPB 2QSZA 5E6UB 4E4TA 2PX3A 2D1SA 5LR6A 1IZ0A 1CVLA 2Q8QA 2YYAA 4IYRA 1OKKD 2SICE 2EQBA 2WUWE 4CODB 4DIBA 3NLLA 5DISB 2HDNB 2GF2A 5AKYA 4ZOCA 1Y6QA 3CKMA 3PC3A 3D1VA 4TKLA 4MWCA 3PWTA 1S6YA 3CZ5A 5HS4A 1ZSNA 1EUDA 3S44A 2J7KA 4DR7B 5AKHA 4BQSA 4C22A 1G5HA 4Q7LA 2E1RA 2VBIA 4KXNA 5E8JA 2RHBA 3GG2A 3OZRA 4YN3A 4C4YA 1SM4A 3IURA 3GU3A 5GJCA 1L4UA 2CD9A 3HS3A 4KKVA 3NKFA 1VCHA 1E3IA 2CLFB 3LBYA 2HMYB 4PAMA 3DMDA 1SHKA 4Q7QA 4NDZA 1NNEA 3R24A 1YKFA 2XT6A 2NTJA 4H0CA 3I72A 3ROGA 2QSJA 2GEUA 4PSKA 4V0RA 4CR8A 2FRXA 5TQ2A 5BRNA 3GCXA 3L4EA 4TVKA 1I24A 1U4OA 3E35A 5CK4A 4ZREA 3S68A 4CIVA 1P77A 5E2AA 3Q8XB 3C8ZA 5HG0A 3KPUA 2R6CA 3VAAA 4XQCA 2QRUA 3AIOA 3HH8A 1JHVA 3C14C 1RABA 1LD3A 3KKZA 3ZGVA 1NDHA 3NNDA 2W8ZA 2YZMA 3KJZA 1VBFA 1Q17A 4MMXB 3OFSA 1GVNB 2AN4A 1MUUA 2MSWA 3A4TA 4HPWA 4YFYA 4Z4IA 2BTQA 3UJ6A 3V8PA 3ZWWA 3BMCA 5P8WA 4ZEVA 1XXHA 1JSXA 2X4DA 3R4CA 4XEHA 3UJNA 5G0SA 1TPYA 16PKA 1Z3IX 1T91A 3O83A 1GNRA 3LUGA 3NASA 4IGIA 5EA2A 3T0FA 5FA8A 2BFMA 4GR4A 1FYXA 3KFLA 2WDPA 5C46F 2IUUA 1MB4A 4A6EA 1KXZA 3S8EA 1O4VA 4ZCMA 2CDAA 5K3EA 4HQRA 1NKSA 1S3FA 2BVNA 1II0A 2NACA 2EFDB 4EH1A 1UM8A 5U4XA 1YJXA 5JXGA 1B74A 4MYHA 3HUTA 3WL5A 1WX1A 3V2HA 3EEOA 3MPOA 5FTJA 2AJBA 3H11B 1P7ZA 2XGGA 2O7RA 2QTMA 1ZFNA 4MW2A 1P4RA 3SZMA 1VXOA 1U5AA 3PFCA 3Q98A 2V65A 5ER9A 1N0IA 1U2TA 2HV9A 1QFJA 1IHDA 1U5CA 3FNBA 4ACBA 5JMOA 5LQAA 1M2HA 3AF2A 3UT0A 5MN4A 2NU6B 3T4PA 4Q0MA 2JHAA 4CIAA 1E61A 2WSLA 2FGJA 1PDVA 1MOZA 1T4BA 3U19A 1RBMA 3K35A 3PUXA 3A4IA 4B85A 5AHOA 2O2SA 1TKAA 2PT7A 5JCJA 3RO7A 3U7JA 4R81A 1W1UA 1U04A 3EZ2A 2WU1A 2YIDA 4OI0A 2JCXA 1VB3A 3L1UA 4JKYA 3LCCA 4DPLA 2Q3LA 2LD4A 3LBAA 1SUPA 3FAZA 2NM0A 3SIXA 2VYFA 5DEOA 3GNTA 3OIWA 2H7CA 1WDLA 3HCOA 3PXBA 4JFRA 4RANA 4PIPA 1VG9B 4W9NC 4BPRA 1HZZA 1NJ2A 3DULA 2A0XA 3PNQA 4I55B 1FDVA 2Z2YA 4RUKA 4KE9A 4REQA 3R6TA 2EF0A 4X7PA 4J94A 4M9QA 4EHLA 4KWCA 1U2DA 1YZTA 1ZSYA 2O8EB 1U31A 4MB6A 3KUCA 4EYQA 3DA8A 4DHEA 1LQ2A 2W6CX 3LQFA 4WFIA 3SQNA 4HF7A 4YT4A 2I9PA 4HGNA 2XMZA 5LWQA 3CJQA 2HN9A 4QUJA 3KJNA 3N2KA 5BUCA 2QRZA 1E1CA 4FZ3A 3V2IA 3ZWOA 4D5EA 5K6AA 1E1QD 1N2OA 4UVIA 5JZVA 2H63A 1DIRA 1D6NA 3CBQA 3CM0A 2ZRQA 3ESBA 3LYAA 4GGPA 4WLVA 5IAGA 1MX3A 4P08A 3G79A 2BCGY 3MGAA 3D7RA 3Q1LA 3RVSA 4QU9A 3G8BA 1WHSA 3UMMA 4EHJA 2W6QA 3HJTA 2I03A 1EFPA 2V7PA 1F17A 1U4NA 3BH0A 2W2KB 3ME5A 3PJFA 3WGHA 5CJJA 3OWOA 3UO8B 1X1CA 2Y1WA 4ZYVA 2AUMA 1H4QA 1SOVA 3KKQA 4ZAGA 3SHVA 2QMHA 1NV9A 1TAHA 1U8CB 2D2XA 4BLRA 1RACA 4YRIA 5KYXA 3BWMA 3DW3X 4NK5A 1I7PA 2H1OA 1EX9A 1Y9JA 4X1YB 5WRFA 1FVHA 3OIDA 1A98A 2AG8A 3AWDA 3GUYA 3WV4A 4M8LA 2VDWB 1ILWA 2AQHA 4LWPA 2XY4A 4W63A 1B23P 4LXHA 2PRZA 3CNOA 1ZNXA 5A3JA 2QL9A 1TQ4A 4KQEA 4EABA 3M6LA 4TKVB 1BFUA 1GNTA 1TUEA 4JT8A 4JOQA 4QBIA 3P96A 3B5JA 4N6GA 4QDTA 5GVRA 2Z6QA 1DX9A 2JHFA 5DIZA 4Z9FA 4U2EA 3VR5A 1NZDA 2ZQZA 5KSYA 1GO2A 3ANMA 1A7UA 1PUXA 4MGKR 5CNMA 4N47A 5CA0B 1O9BA 4XJSA 2C7OA 4R5HA 5JDIA 2FZWA 3PWZA 4TTTS 5DHAA 2FSUA 4RWZA 5B4TA 2IUEA 3WKCA 1RHMA 4AY2A 3QOFA 4BUCA 4B80A 5K3BA 1UOEA 5COAA 3PE3A 2P77A 3RSGA 3QMPA 2AN5A 4JP8A 1T3LA 2XB6A 1BS1A 1W1IA 2NZXA 1AM4D 1UBJS 2FUCA 5H82A 5GV8A 4E22A 2HEIA 1LI4A 1L6IA 3D8RA 5B5SA 2GBPA 3WSWA 3AEQA 2LV8A 5T8KA 4K1LA 1U0OC 1F6BA 1EM8B 1NF9A 1ZIDA 3JQCA 4EMSA 4JUBA 2JGMA 3CNLA 2ID7A 3WIUA 2ZJYA 4M9XA 1AZSC 1MV5A 1RCUA 1RQRA 3ICWA 1GPWB 3E82A 3DFFA 2OQVA 1NN3A 5BMVA 2NPIA 4MJ3A 4KWHA 4XSGA 3YASA 1LBHA 4AKEA 2ECOA 4MV3A 1O97D 4PAGA 5FBRB 3J81A 4XA8A 3O95A 1CNEA 1ENOA 3GZNB 4LXUA 4IHAA 4CMIB 1GQQA 3W1WA 3INNA 2G72A 2ZI5A 1JXQA 3ZLBA 4K9OA 4EDHA 2PU7A 3ZEAA 1AHNA 4KQGA 1IQ0A 5JVDF 3KYBA 3Q7EA 1KZ7B 4PR0A 2H4XA 2V0NA 1SUCA 2QLNA 3QF4A 4PF1A 1L7OA 2IIVA 3HR7A 2R6JA 1RZVA 3FMPB 1GYQA 3LNTA 1Q7BA 3A2MA 2CEKA 1O94C 2PFKA 3INTA 3IS3A 2A14A 2WSSD 1T5BA 2ZPAA 3FPCA 3AUKA 3NJRA 3PV0A 4HUJA 4KK4A 5LB4A 4EPVA 5KWSA 3V3TA 4LSMA 2OLEA 3L6CA 5LU8A 3L4KA 1BXRA 3FZEA 1HBJA 3EE6A 2ZTMA 2IRWA 3QKWA 4LHVA 3U1VA 4M7WA 1Q0TA 4DV2B 1E3MA 1RWVA 2ZROA 4UOEA 4H3KB 4OJMX 3WWYA 1T2AA 1X1RA 3NUGA 1TJ5A 3CUYA 2EFGA 4OBXA 4UTOA 1YO6A 3FGPA 4XJVA 5J5CA 2O2DA 2D62A 4N41A 1FZTA 3RUAA 4E51A 1SQ5A 1E1NA 2Q2OA 5HS6A 4EB3A 2QDKA 5GADl 4OLBA 2GLXA 3K2BA 4CKCB 1GSHA 1YU9A 3AHCA 3ENWA 4O4HB 1AXRA 3K0BA 5ENZA 2OKGA 2XXJA 3UOGA 8ATCA 1E9EA 1U99A 2IZOA 2P9CA 2QM0A 1DAFA 3AF4A 4KO3S 5ALHA 1RI3A 4FEAA 1GRNA 2F4NA 3N58A 3RRJA 2ZTSA 3KVNA 1JDSA 3TQIA 3U39A 4GMXA 2M1XA 3EVGA 4NE7A 3BWDD 3ZXSA 4QDJA 1P4GA 4QDOA 4MRAA 4KXUA 4XWGA 5EZQA 5C32A 3V4RA 1MRNA 1YCHA 1J07A 1M8KA 1ZNWA 2VJLA 4NS1A 3STXA 3TJRA 5M2QA 5LYJB 2P2DA 4UM7A 4WBSA 4K87A 3DMTA 3RSCA 4PTZA 4L9RA 1Y42X 1QB7A 2VIIA 4RIEA 2NNLD 1Q21A 2I80A 1C50A 1UINA 4KVFA 5B1SA 4WN9A 5BMVB 5HZMA 1UBHS 3DAGA 1MXFA 4C2BA 2OENG 3OP4A 2AMLA 4LNUA 1Z5OA 5EJAA 1XI2A 2C5EA 4GRIA 4PFQA 4TL7A 1Z5WA 1T0HB 3A1EA 4JQCA 3TM4A 1EPUA 4BQNA 3FIJA 2A5YB 3ICCA 5H81A 1G0NA 2PZFA 1XWIA 4NECA 4PG4A 1G8FA 1B8PA 3NU1A 3CNEA 3G13A 1ES9A 3RJ9A 1COWD 4IGKA 3QOYA 3PQ7A 1B1AA 2P6PA 3L77A 3FFXA 1T1RA 5LBUA 1E1YA 1B1CA 1SXJC 5I4KA 5I7RA 4OJQA 5AW3A 3FH0A 4IRMA 4JJEA 4L8YA 1EAYA 1OLSB 4CW7A 4V3CA 4TS4A 4ADSG 5CFRA 1I7LA 3MNFA 4EG4A 1UPUA 1CS4C 3Q3CA 1XX6A 4IJQA 4XDZA 5LLDA 5A9TA 1ODKA 2SBTA 5FPHA 3O92A 5GJVC 1CBUA 4KGDA 4W6ZA 3DAYA 4NK4A 5E1DA 4L08A 2IOQA 3TQCA 3OZSA 1V3TA 4OB6A 2RONA 3KAQA 1J39A 3D7NA 4OL0A 1EP3B 3GT7A 3A9CA 3BMOA 5HQJA 4V38A 5B30A 2NO4A 3K72B 3N53A 3II6X 1RYEA 4L85A 5PNTA 1CYEA 4QD3A 2F59A 1LLDA 2BEVA 3L41A 1VRVA 4RZUA 4U2BA 3SLRA 4ZRMA 5HX7A 1QYWA 1RQ7A 4G24A 3R7BA 1ZRNA 3FWZA 3G2NA 4MCIA 2ECFA 2QTTA 1NVXQ 1ICIA 4J0KA 3CGGA 4NCBA 1I3CA 3LRPA 2V6IA 3EN0A 4V02A 4E5PA