1HQDA

Pseudomonas cepacia lipase complexed with transition state analogue of 1-phenoxy-2-acetoxy butane
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
320
structure length
320
Chain Sequence
ADNYAATRYPIILVHGLTGTDKYAGVLEYWYGIQEDLQQRGATVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGATKVNLVGHSQGGLTSRYVAAVAPDLVASVTTIGTPHRGSEFADFVQGVLAYDPTGLSSTVIAAFVNVFGILTSSSNNTNQDALAALKTLTTAQAATYNQNYPSAGLGAPGSCQTGAPTETVGGNTHLLYSWAGTAIQPTISVFGVTGATDTSTIPLVDPANALDPSTLALFGTGTVMVNRGSGQNDGVVSKCSALYGQVLSTSYKWNHLDEINQLLGVRGANAEDPVAVIRTHANRLKLAGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIPASE
publication title Complex of Burkholderia cepacia lipase with transition state analogue of 1-phenoxy-2-acetoxybutane: biocatalytic, structural and modelling study.
pubmed doi rcsb
molecule tags Hydrolase
total genus 128
structure length 320
sequence length 320
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2000-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1hqdA00
1YSCA 2XUPA 2OPHA 3C8DA 4B6GA 2GBFA 3WI7A 1MTZA 3U1TA 3AZQA 1B6GA 2X5XA 1X2BA 4OU4A 4PO3X 3AZOA 2BUBA 2HIHA 2J4FA 1J06A 1U8EA 4KE7A 2RHWA 2DSNA 1GGVA 3FWHA 4Y2RA 4OUKX 4FLEA 4BVKA 3ZI7A 3G9ZA 4NVRA 4GDMA 4J0GA 3V1LA 3F97A 4A16A 4BDSA 1XKTA 5FV4A 3G9TA 1XZLA 4J0JA 5I9IA 5C7YA 2B20A 2O2GA 3D59A 2GYWA 4FNMA 5FPPA 3QBJA 4F0JA 3AINA 1ZICA 2JF0A 4LIPD 3QITA 3GBSA 3RLIA 3WL5A 3EF3A 3H2IA 4QDXA 4CIBA 4U2FA 2HA4A 2O2HA 2LIPA 3D2BA 1R4ZA 5C8ZA 4YK7A 1F8UA 3M3DA 4FKBA 5HF6A 3ZLUA 2OQIA 2WIGA 4UHFA 4BAGA 2WIFA 5ALXA 4FFVA 2YASA 5AI9A 3QMVA 3HI4A 1S8OA 2ZSHA 4BAUA 3HRHA 4EBBA 5FPQA 4ZI5A 1WPXA 4FBMA 4H7HA 5FRDA 2QUAA 3DOHA 2C5GA 1UK9A 1ZD4A 1YCDA 4L9AA 5HQ3A 4BATA 1N1MA 2JBWA 2GZSA 4AN1A 4P9NA 2JGJA 4PW0A 4AQDA 2PSDA 3E4DA 4A5SA 3WZMA 5CURA 5KREA 3WK4A 2ES4A 5EHZA 5E2IA 4B82A 5JATA 1CUSA 4AO8A 5BWCA 5E4TA 4DSAA 4CCYB 2G4LA 1LPNA 4F5ZA 2G5PA 4QDUA 3STVA 1YAHA 3FBWA 5JAHA 2B61A 4W1PA 1DWPA 3IULA 4HS9A 5AIAA 1EXWA 1QIHA 1CUYA 1BRTA 1ACJA 5HFAA 4S0XA 1N8SA 3FYUA 3H1BA 3IUQA 5EGNA 5LP1A 3D0KA 5ALJA 4BRSA 1DWQA 2O2IA 3SWWA 5IKXA 4M0EA 4X6YA 5ALPA 5ALZA 4KACA 4UFOA 5A7FA 5ALSA 3KXPA 3W9BA 5CT4A 3IA2A 4U2EA 4O08A 2HA3A 3F67A 4PF1A 4OB6A 4X6XA 2QOEA 4X90A 4QDZA 4DNFA 5DNVA 1BS9A 4Q34A 2OG1A 4OD0A 1C7JA 1DX4A 3WL6A 1A8UA 1J2EA 3C6BA 4IH1A 2PVSA 5DYTA 1VXOA 5EFZA 5JZ9A 3A2NA 3CXUA 2HU5A 3WWCA 1QOZA 4GEGA 2WHQA 5CH8A 1SCKA 3P2MA 1VLQA 1B41A 1ZIXA 1YS1X 5AKZA 2Y2UA 3T4UA 4UBIA 1JU3A 2XMSA 4G8BA 3BF7A 2PSJA 4DYHA 2JGFA 3WK7A 2XMGA 4K6KA 2HFJA 3LIPA 2JEYA 4ARAA 4OB7A 3BWXA 4UBNA 1XQVA 5AK4A 3ESDA 1LPMA 1FFEA 5DTIA 3QZUA 3FYTA 3ANTA 3QPDA 3WQHA 1QIMA 5IVIA 3WA7A 1CR6A 5DYYA 4FLFA 4RE5A 5HZGA 3H17A 1TCCA 2OXEA 2HA7A 2WHRA 4X6UA 5AKGA 1G42A 2VEOA 2OCGA 2G63A 2CJPA 5K5EA 2H7XA 2QS9A 2DR0A 5ALNA 5JD5A 1VE7A 1MJ5A 1TAHA 1EHYA 5ALQA 2QTBA 4H7IA 1ZI8A 3G9UA 2C0QA 4GXNA 5CT8A 5ALMA 1PV1A 2ZYRA 1IZ7A 4QWMA 1GKKA 2OGTA 4K5QA 3WWPA 2JGKA 4LXHA 5ALTA 4DTCA 5CBKA 5JIBA 6YASA 1E8MA 3IVMA 3K6KA 5F4ZA 2OQVA 5DNWA 4AZ3A 1Q0RA 5CXXA 1HQDA 4PNZA 3QYJA 2QMQA 1WM1A 3I1IA 1XQWA 3DNMA 5ALLA 1CV2A 1XQXA 2FX5A 1MT3A 1DU4A 4BCBA 3I2KA 3VJMA 4ZGBA 2I78A 2PSEA 5A71A 3EIOA 5DYWA 2EDCA 1Y7HA 3A2LA 1FFBA 1YB7A 1QZ3A 4U2CA 4UHCA 1MAHA 4HRXA 5K3FB 3FLEA 2WILA 1XRMA 4FWBA 2X76A 2VATA 1VA5A 3ZPXA 2WLSA 4GW3A 5AOCA 4IH9A 3B12A 4RGYA 4UUQA 4PSDA 2QT9A 4QE3A 4X00A 4J3JA 3AUKA 3FOBA 1GXSA 1CFJA 4KAFA 3MUNA 7YASA 4AZ0A 1ZJ5A 5EHQA 5JYCA 3G0IA 3TEJA 2BAGA 5KWJA 3I28A 4ETWA 5AP9A 3BDVA 4Q05A 2VTVA 5LKAA 2P8SA 1CRLA 4KE6A 4B83A 4FMPA 1LPSA 2WJ3A 5AM5A 2WKWA 4Y2XA 5CTAA 2XMBA 1LGYA 2B9VA 3IIIA 5T4HA 1Z68A 2YH2A 3M81A 4M0FA 1SOMA 4E14A 1EDDA 4V2IA 4U2BA 1BCSA 4UBJA 1XLVA 2QM0A 3W9UA 1AGYA 5KBYA 3AIOA 4GBGA 1MO2A 1VZ2A 3C6YA 5A62A 1THGA 3ICVA 4P92A 1PJAA 2XB6A 1WB4A 4Q3KA 2I03A 5HKAA 5D6OA 2AJLI 5EIAA 2BCEA 4G8DA 2PUHA 4K6HA 3FVRA 5LZ8A 1MNAA 1CUDA 1AKNA 4WY5A 3H2JA 1H23A 3TGLA 4OSEA 2D0DA 5E4JA 1JT2A 1TCBA 3GFFA 4F60A 4HZGA 2ZSIA 1LBTA 4DMFA 3DQZA 2H7YA 3H18A 4BCCA 3WWEA 2OCIA 4H35A 3LS2A 5AI6A 3ZV7A 1W6RA 3FYUC 5HQ3B 1LNSA 3PUIA 3PUHA 4DMCA 4L0CA 4LXIA 2J3DA 3DKRA 4B84A 5FUMA 4ZV7A 3E0XA 3V48A 3BE8A 3O4JA 1CUWA 5LZ7A 3F8SA 1VZ3A 5CRIA 5K3DA 2XMDA 4Q82A 4AMYA 5LZ9A 4XIIA 1H2ZA 1Q83A 2C58A 2XMCA 1K8QA 5A7GA 1AQLA 1VE6A 4J0DA 5ALGA 5HCUA 1UXOA 4WFJA 4AX4A 2CEKA 3ILSA 1G4HA 1W75A 5AOAA 4W1QA 1JU4A 3FYUB 5ALHA 2WHPA 2JGEA 2HA5A 4LXGA 4DMHA 4XWGA 5T4BA 4CG1A 1DQZA 2AJDA 1F0PA 4UBLA 2WU3A 2HU8A 2PSFA 1GQSA 4JUIA 2Y1KA 5JASA 4AXBA 2PL5A 2Z3ZA 3DYVA 2HM7A 2XUQA 3WK9A 4X93A 1H2XA 1E8NA 1TRHA 3G0DA 2QJWA 4E11A 5D7BA 2FJ0A 1TIBA 3I1YA 3FNBA 2XMRA 1MX1A 4EB0A 2XQFA 2Y6UA 4EY8A 4FOLA 4QWWA 1HLGA 1IMJA 3IB3A 2XMZA 2I3DA 1DTEA 2Z5GA 3FVTA 3ICWA 5K3BA 1KU0A 3DLTA 4J7AA 4GLBA 2WFMA 1EB8A 2BGNA 1XQYA 5EHXA 1WHSA 3M83A 5IVKA 2DHCA 1OILA 5IVDA 4BVJA 1CUIA 4I4CA 4NMWA 2HA6A 4XX1A 3I6YA 4MJ3A 1ACLA 1HBJA 5EI5A 4X92A 2XQIA 3HACA 1RWQA 1ZJ4A 4QEKA 2ONCA 1GKLA 4NZZA 4BZWA 1JJIA 2DHEA 3HABA 5ALIA 3FLBA 4G4GA 2AXEA 2ACKA 4G4JA 3HSSA 4DNPA 2GZRA 3HC7A 3FSGD 3YASA 2HA0A 4GI1A 2JEZA 4ZXFA 3WL8A 3S2ZA 2AJCA 1XZBA 3K9BA 3EQ9A 3ZLTA 3H2GA 4MYSA 5CT9A 2H9YA 4ZREA 1NU6A 3VJLA 5AI5A 2PX6A 4YPVA 1YB6A 1EK2A 3TJMA 3V1MA 3A2MA 4C89A 3O0DA 4KAJA 4KEAA 1MPXA 4BP8A 3GUUA 5I7UA 5LZ4A 3O4IA 3V1KA 5T4FA 1EI9A 2WTNA 3CN7A 2Z3WA 2C5FA 1O6GA 2GYVA 5K3AA 4BAZA 3W2TA 4Y2PA 4KYVA 4JNCA 4MXDA 5FDFA 3DD5A 5HK9A 4J0HA 1N5RA 4H7EA 5AJHA 3R40A 4H0CA 4E46A 1MAAA 3ESCA 2BGRA 5LZ2A 4BE9A 1YS2X 1M33A 1EB9A 2VJAA 1SCIA 2HDWA 4B9AA 1L7AA 5I8PA 2OAEA 5AK6A 3OOSA 1C4XA 1W76A 4HXGA 5AM2A 2QVBA 3IDAA 5EHNA 2HRRA 3JYHA 1E8DA 2D5LA 1UWCA 3WZLA 2QUBA 1YA8A 3L1IA 4KR0A 5A6VA 3LIIA 2XUAA 1Q84A 3T52A 4E15A 3C8HA 4I19A 2Q0XA 1ZD3A 2HU7A 3NUZA 3K2IA 1LPOA 2Y6VA 2HHAA 1UOPA 3WJ1A 4EY5A 1QFMA 2OAGA 2XI4A 4J0CA 3VVMA 2B4KA 4OCZA 1LZKA 3WWDA 2RI6A 5ALYA 3H04A 3A70A 2WG2A 2XUHA 4WJLA 3NGMA 3PE6A 4IQ4A 4UBMA 1DT5A 1K5PA 3FCXA 4RE6A 4GWLA 1VA4A 5LYYA 1MNQA 3QM1A 2JGIA 5ALFA 3O4GA 2DFPA 1L7QA 1CQWA 4N8EA 4WDQA 1R3DA 1J07A 4BZZA 1BEEA 2K2QB 3WYNA 3D2CA 4BCDA 4ROTA 4CIAA 2XUIA 5ALEA 1U65A 4WY8A 3U0VA 4H7JA 5CT5A 4DLNA 2JIDA 5DJ5A 3ZLVA 3QMMA 2HL6A 3G0GA 1SCQA 5AIBA 3JW8A 3AZPA 1DQYA 3OURA 3N0TA 4BC1A 5K3EA 1KEZA 2XMQA 1P0IA 4OU5A 2RIPA 3EBLA 3ED1A 5H3HA 1IUOA 2W22A 4ARBA 4PV7A 4XVCA 3PICA 3VVLA 3O9VA 1XLWA 1X2EA 1VOTA 4HXFB 4IHAA 5C8XA 1CUUA 1G5FA 4MQLA 5IH7A 3O9MA 2AJ8A 4FNGA 4A23A 3IUMA 2QZPA 1CUGA 5AICA 3EQ8A 1XZEA 2HRQA 3X3HA 1CUBA 1Y37A 1WHTA 3D7RA 1W1IA 4LYDA 1LPPA 2HA2A 1XZMA 5SYMA 5JAUA 4J0KA 4TPKA 3WKDA 4UFPA 3IURA 5AI4A 2HFKA 3PFCA 3JWEA 5CMLA 5FP0A 5LZ5A 4UHBA 1YA4A 3DCNA 4X85A 5BV7A 3G0BA 1E66A 4N8DA 3QH4A 4GHWA 3BXPA 3PI6A 2WFLA 3PDCA 2WHPB 4UBKA 4BE4A 3SX4A 2WUFA 2JGLA 4QLAA 5HF8A 3Q0TA 4MYDA 2GBCA 5ALWA 1R88A 1T4MA 5ESRA 4M0MA 2V98A 1ZGBA 1QTRA 5JAPA 2BFNA 3WK5A 1BROA 4H18A 1OXMA 4H7FA 1NX9A 4BBZA 1LLFA 2CBGA 4YX9A 2XT0A 4H7KA 5AM1A 4N5IX 1RYYA 1VKHA 2C7BA 4G5XA 5HKBA 2CZQA 3HLKA 4Y2QA 3DS8A 3IUJA 1YR2A 2GBGA 3G7NA 2WUEA 2PU5A 4DNQA 2XUOA 3GELA 1IUNA 4EY7A 3STYA 4L3WA 4C88A 1XZDA 2XUKA 3DDUA 1W52X 4KJXA 2Z8ZA 1PFQA 5DWDA 1P0QA 4X97A 1QO9A 4MEAA 1A8QA 4W1RA 4W9RA 5ALOA 3LCRA 3I2FA 3OG9A 3I2IA 3RARA 3C5WP 4J0IA 1G66A 3G02A 1FJ2A 1H22A 3HYSA 3UUEA 2XUFA 3RM3A 5AKEA 4ZV9A 2PU7A 2J3QA 4G1FA 4IH4A 2G5TA 4JH0A 1TQHA 4PSUA 3NOXA 1IZ8A 4N5HX 1WB6A 3H0CA 5K3CA 1GPNA 4W1SA 4UFNA 3OM8A 5AI0A 5FKJA 4DM7A 4DGQA 4C87A 1BN7A 1EVEA 3VDXA 3BIXA 3STUA 3CCBA 2VJBA 1XLUA 3MVEA 4QZVA 4B7ZA 3Q8WA 3C6ZA 1CPYA 4C4ZA 5DNUA 2CUTA 4P08A 3G8YA 1GPLA 2IIVA 4B0OA 4QLOA 1UOQA 5ALDA 1BN6A 3OC0A 2HADA 2H1IA 1XZIA 1JFRA 1QONA 1LPBB 2XLBA 2GYUA 5E4YA 3AJAA 4WDRA 3KOOA 4HAIA 4CI9A 2WU4A 4EZIA 5LLSA 4UPDA 1J1IA 4RPCA 4KE9A 1P0PA 5FOQA 1XZKA 4TGLA 1QE3A 5JZSA 2QRUA 3R3YA 3L1HA 4OPMA 1TCAA 4G9EA 1IUPA 3PFBA 5JARA 2DCMA 3OPMA 4X91A 3FLAA 3W06A 3WJ2A 4ZRDA 3NWOA 1EX9A 1QIEA 3C70A 3ZWQA 1LZLA 3EQ7A 4B9EA 3D2AA 3W04A 2C0PA 5ALVA 4B81A 2PPLA 2NW6A 2OLEA 2VJCA 4FBLA 1NU8A 2CMFA 4LKOA 4BB0A 5KWIA 1HPLA 4DIUA 5EIHA 1QIIA 5AHXA 4HTAA 2ROQA 5J3JA 1BEZA 4UBOA 3FSGA 1EDBA 1GPKA 1XZGA 4QNNA 2ZYHA 1BE0A 3DYIA 3HXKA 5FLKA 5A2GA 3B3QA 4Y2VA 1E3QA 3QVMA 3WA6A 2VA9A 2IX9A 4QA9A 1XROA 4INZA 5AOBA 3G9XA 2DHDA 1MX5A 1H2YA 5CW2A 2WG0A 4MWSA 2O7VA 1AMNA 3FCYA 2E3JA 3UMJA 2ZJ6A 1AZWA 4H77A 2VSQA 1ORWA 1QIDA 4OYLA 4K2AA 1OCEA 4HVTA 4FFWA 5JZBA 4BP9A 4BDTA 2YXPX 5AM3A 2VJDA 1ODCA 1MX9A 1ORVA 1CUHA 4G9GA 3E1GA 4BVLA 2YYSA 1QLWA 2WJ4A 4FTWA 3WIBA 1VJ5A 3E3AA 1DWOA 4BYMA 1CUCA 3F9CA 3F98A 4HRYA 4FDMA 3PF8A 4Y2YA 3UUFA 2WJ6A 3AILA 3HEAA 1JMKC 2DQYA 3RK4A 5ALRA 3V1NA 4JEIA 1UKCA 1EVQA 2JGMA 3DOIA 1AX9A 2WUDA 2RAUA 2WM2A 1ETHA 4J03A 1TK3A 1CUJA 3GZJA 2OCLA 2CB9A 2Y2VA 3WKAA 5ALKA 4DMKA 1XZAA 4Q3OA 5DTJA 4CCWA 3DJYA 1ZI9A 3STXA 5T4EA 4C01A 3LLCA 2QJRA 3C43A 4ZWNA 4LHEA 3C45A 1K4YA 4QDTA 2QXTA 1U2EA 4WFKA 3FAKA 5CT6A 5AKXA 4X94A 3BJMA 1XRQA 3WYDA 1N5MA 1R9MA 4C4XA 3I6ZA 3C87A 3WMRA 5HF5A 5IVHA 1EA5A 2CKMA 2WFLB 1ZD2P 5CH3A 4C6HA 5A7HA 3WKBA 2VT7A 4OYYA 5AI8A 4EUSA 3QPAA 1UKAA 2V97A 4CG3A 1QTIA 1E5TA 2WIKA 4YASA 1UZAA 5DLPA 3I2JA 1RP1A 2RONA 2X8BA 1EH5A 1MU0A 4KE8A 3DL4A 5HF9A 5YASA 2OGSA 3AFIA 1K63A 3HZOA 1E89A 1CLEA 4Y2JA 1FSSA 1KU6A 2WG1A 1XRLA 1AURA 1A88A 2I3ZA 2Z8XA 3KD2A 4CFSA 1VXRA 3S8YA 1UOOA 3I2HA 3A6ZA 2XUJA 1CIJA 1BCRA 4JYPA 4BC0A 3GA7A 1FFAA 3WK6A 5D3KA 4X95A 1JJFA 2V96A 1ZGCA 4X71A 2QKYA 1F0NA 3H19A 2ZJ7A 4X7BA 1CUAA 3R3WA 2UZ0A 2EDAA 3STTA 2R8BA 4NS4A 2VAVA 3VXKA 5JD4A 1CQZA 3ANSA 1QIFA 4WCVA 5SYNA 3SK0A 4AB1A 1DX6A 4EA6A 3BIWA 1AUOA 1SC9A 1XZHA 4MWTA 3LP5A 1H2WA 3DKKA 1QIGA 1Y7IA 2VT6A 1WCYA 5AKHA 4AN0A 2WQZA 2WFZA 1DT3A 1QIJA 4D9JA 4U2DA 2O7RA 3PF9A 2WTMA 1HDEA 3VKFA 3AIMA 2IITA 5BWBA 5AK5A 3I2GA 3D4LA 4CG2A 5AKJA 4Y7DA 4I3FA 3L1JA 1ZD5A 1JMYA 5AKKA 4OB8A 1W4LA 4KRYA 1JJBA 1GZ7A 2ZJFA 4B0PA 2BUAA 3ESAA 5EIEA 5AM0A 1EDEA 5ALUA 3R41A 1XZFA 5AH0A 3HJUA 1O6FA 4AO6A 1QJ4A 4FLMA 4AMZA 5FXMA 1C7IA 1DINA 2OGZA 3C5VA 1QGED 2R11A 4BRZA 1R1DA 1CUXA 5C81A 1QFSA 2ORYA 4N8SA 3R3XA 5HK8A 4F21A 3WWOA 1X70A 1ODSA 4KAAA 3WLAA 1IVYA 1YASA 4UHEA 2OCKA 2QR5A 5JALA 3VJKA 2BKLA 1UK6A 1EK1A 4Y2UA 2H7CA 1FFCA 1AC5A 2RGUA 5AK3A 5LIPA 1QIKA 5JANA 2VQ6A 2WIJA 1WOMA 4UHDA 3IBTA 4Z49A 4HXEB 4Y2SA 2ZVDA 3BF8A 4EHBA 3OTQA 2W6CX 4CCYA 1A8SA 4G4IA 5AKLA 1CUZA 5JAOA 3G0CA 1WPRA 2PKYX 3O95A 4BTLA 3QPCA 1FFDA 1HL7A 3M82A 4KRXA 5CH5A 5C8VA 3WKCA 1SFRA 2XQJA 1P0MA 1QO7A 3GROA 1CVLA 3KWFA 1THTA 4W63A 1ZIYA 4UHHA 3TRDA 1U4NA 2RHTA 3STWA 4G8CA 1UFOA 1CUVA 4AO7A 1BU8A 1R50A 4P93A 3F96A 5AKYA 2ZYSA 1ZI6A 4L72A 1XRRA 3I6MA 5LKRA 4RNCA 1YAJA 1Q0ZA 3R0VA 1UK7A 2AJBA 3H2KA 4H7DA 1GQRA 4Q3LA 2VF2A 1GT6A 2PUJA 3KWJA 3WL7A 2ACEA 4U2GA 4IO0A 3BL8A 3D3NA 3DL7A 2FUKA 3MUOA 4MQMA 4DSZA 1WB5A 4PQEA 4C4YA 1HKHA 1LPAB 1K6EA 2FJPA 3AIKA 1XRNA 2EEPA 1MN6A 2XDWA 4X3CA 3WIOA 4B85A 3CCCA 1R9NA 1T2NA 2PBLA 1UK8A 4WFIA 5AM4A 5AKIA 4MEBA 3RKSA 2DQZA 3W05A 4LYEA 2ECFA 3WKEA 1L7RA 2J4CA 1F6WA 2XQKA 1XZCA 4BTVA 2VAXA 3H1AA 3H2HA 2PM8A 3KDAA 1USWA 3V9AA 2C4HA 5D3ZA 1XKLA 5AO9A 5JD6A 3ESBA 3SC2A 4EY6A 3CN9A 1UKBA 4Q1VA 3R3UA 2XLCA 2QXUA 4XJVA 5ISMA 4EY4A 1ZOIA 1CUEA 4TVKA 3IUNA 1A7UA 2WIDA 4JYMA 4Y2TA 2WUGA 2BUCA 1UT6A 3DEAA 5CXUA 2BJHA 3KSRA 1CUFA 1JI3A 3BDIA 2XUDA 2PSHA 2GBIA 2V9ZA 3C6XA 2XUGA 4Y9SA 1EINA 3B5EA 5JADA 1LBSA 5BOVA 2WSLA 3R3VA 3N2ZB 1CEXA 3BJRA 1ISPA 4FHZA 3R3ZA 1D07A 1TKRA 3VISA 4QDOA 4K6GA 2ZYIA 5HFNA 3QMWA 3D5EA 1XFDA 2XQGA 2XE4A 3O4HA 3WK8A 1JKMA 1I6WA 4GECA 1ODTC 1XZJA 3MGAA 1XRPA 4ITVA 4DNOA 4B80A 4PSCA 5K3FA
chains in the Genus database with same CATH superfamily
4C7OA 4B31A 1YSCA 2Q4EA 1NT4A 2I2BA 2Z5LA 5T8KC 4RHUA 3L0BA 4QUIA 4R2WA 2YIMA 3U9SA 3C8DA 3ROTA 2YOFA 3KYCA 2FW1A 1N78A 1IVNA 1J8YF 1QH8A 4L2IB 1WLYA 1QHXA 3LPLA 3WI7A 1MTZA 3EG9B 4B6GA 2WNSA 1GLVA 3EGOA 4LJLA 4NEGA 3JWJA 3ZK9A 4BECA 1PNOA 4F2DA 3K5IA 4MLPA 4PHTA 1X2BA 1E5QA 4OU4A 2Q45A 2I4NA 3AZOA 3FKSD 3GA5A 4G0MA 4RA6A 5DNYB 4I8XA 2BUBA 1W59A 1Z06A 2YXNA 3LKZA 4NPHA 5JS1A 2IYFA 2FUEA 3BFKA 1T8WA 4PZPA 1OB2A 4X62B 4YMWA 2G9QA 4Z54A 1U8EA 2X0KA 4KYTA 5BVHA 2HREA 1M76A 3RYFB 5CD9A 3K9HA 3OZRA 2I67A 5E1MA 1ISSA 4COKA 2QENA 1GGVA 4ZHQF 2HEIA 1CY1A 1RDFA 4Y2RA 5H4GA 2QYHA 4FLEA 4Y6RA 4B8ZA 4BVKA 2P4EA 5JISA 1DNPA 5L3SB 4GL2A 2GCOA 2FGJA 1XQ6A 3DEIA 1OZHA 2Y76A 2FN8A 2NV6A 3PQ2A 4B4DA 1AM4D 1ADCA 4G85A 4QPZA 4Q3CA 4J0GA 2R44A 3AY7A 3GRYA 1MCZA 3ILYA 3PYLA 4UQOA 3VZCA 2PMBA 4ZO8A 4QLBA 4W82A 1YDMA 2YTZA 1VIYA 2OLJA 1NVKA 4LVOA 1QUFA 1W4AA 3FYCA 1KL7A 2BE9A 1JEQB 1N6KA 3D4BA 4E51A 5FBKA 4CM6A 2YDYA 4F9FA 2ZM5A 1DC7A 1ZXLA 4JQZA 1JG6A 3I2YX 1L6RA 2ORVA 2ZQ5A 1XVVA 1WCIB 5MDHA 2WF7A 1I6MA 4F1KA 3CF4A 5B1SA 5DASA 1RRMA 2O2GA 2PBFA 3K0BA 4HH4A 1E4EA 2DWUA 4JA0A 3DBLA 5DM60 4B40A 2GYWA 5HGJA 2PKRA 1T0IA 1EDOA 4FNMA 1XZNA 5KYGA 3F6YA 1TVCA 2HIAA 4I6JA 3GRPA 1EVKA 3QIAA 2PJDA 5EOVA 1IZ0A 4HBGA 2PUBA 3CRRA 7MHTA 4HS4A 3PCTA 4TKVB 5LVAA 2C9DA 2Y67A 6ABPA 4OGWA 1HUQA 3Q8KA 1ADFA 1Y5LA 3M70A 1FPMA 1YZ3A 4HD8A 4B3BA 5HP4A 2I7VA 4DV3B 3DSRA 1OY1A 2QJFA 3JATB 3QNUA 1G21A 3UJBA 421PA 4DSOA 1LTQA 4FKZA 2DFVA 2FYTA 3KQVA 1Y33E 5HS6A 4E7OA 5L40A 3R20A 1E3JA 2GETA 1S3IA 3QXSA 3FPCA 2FCRA 2YHSA 2YJ3A 4LEIA 1GCUA 1OXSC 2Q3EA 4HUJA 4JB8A 2Q62A 3M3DA 4A03A 5WRFA 1AKEA 3C7TA 1L8QA 3GDFA 2PZJA 4JLNA 1WW3A 4ANFA 4U1RA 4BAGA 4UPEA 5KVSA 4FEAA 2NGRA 3ZQJA 4FFVA 4XQCA 1C9NA 2PQ6A 1P5HA 1XPUA 1EUDB 5KYKA 2FFRA 3U44A 4J91A 1Y82A 3GFVA 4FNAA 4TQGA 3PFNA 5CDTA 5C0OE 3QMVA 5AVRA 1TQ2A 1P19A 3KX2A 3H5VA 3I3OA 4K05A 2P41A 2JG3A 5EERA 5JNWA 3O4FA 4V1CA 4GGMX 2CZCA 5LL6P 1MGPA 1ENYA 3GVPA 3NRJA 4IEEA 3CLUC 3OMWA 4M60A 3VNQA 1IBRA 4UTPA 4JLKA 1ZS9A 4H7HA 5FRDA 2QUAA 3Q41A 4IVQA 5HPYB 1DJLA 4KFSA 2UVDA 3OU7A 1ESMA 3EXIB 2GZSA 2OM2A 4CKWB 3RI3A 2AZDA 3V7UA 4P9NA 5ICCA 1A7AA 1AUVA 1O97D 2HSZA 4P4GA 4Q4HB 2Q2NA 3UGTA 1B2LA 5BNTA 2PSDA 4TX1A 2EW2A 5BSGA 3WZMA 1T1GA 4C4OA 1MG5A 5KREA 3DAOA 4IDHA 4I8DA 4MAFA 2OC9A 4ALLA 2J3IA 2OHFA 3JQFA 2J5XA 1W19A 1E2EA 4KQEA 3WG9A 4RGBA 2DQ4A 3RSZA 4MR7B 5CNJA 1RCFA 3SBEA 1J2YA 1E2QA 1WKCA 2YV3A 1ULAA 4XDYA 2ZDHA 3U4DA 1A4XA 1DFGA 3RSLA 4HAXA 3ZCSA 2H1OA 3R24A 1GEGA 1ICIA 1TL7C 1SG6A 3NM6B 3QE9Y 3SHWA 5A04A 4JBHA 1KA9H 2FPIA 3EYWA 3TQHA 3G8CA 5T41A 1IH8A 4UTXA 3LCJA 3W79A 1UBMS 1OUMA 2B61A 3FFWA 4DPKA 2K6GA 3K73O 2WD7B 4ZDIA 1DWPA 3KOYA 4FSDA 4GNRA 4DMMA 4QUDA 2QY6A 2RJ3A 3MBKA 2H2HA 3OAAA 5LB2A 1J9ZA 2FWJA 5AIAA 1ZO8A 3WRWA 4EUHA 3GLHE 3G89A 2H07A 1GFZA 3FHCB 2PNJA 4ZIRB 1R8SA 3AEQB 2FPWA 3BBLA 4RCVA 5CM2Z 2HSJA 3LWBA 3NBQA 2QZSA 3IEMA 1VBNA 3LVBA 1IXYA 1QS0B 4YJ3B 3QWFA 1LDNA 3ACBA 1KE2A 4NZNA 4PLGA 4PSVA 1Z73A 3R5KA 1FXWA 1Y80A 3RODA 4EF6A 2VXBA 5B7NA 3R9WA 1GVHA 4GI7A 3TYXA 2H1FA 2A2ZA 3O7MA 2V9PA 3OPQA 1QH1B 2WMOB 3QBEA 3NCHA 3HB9A 3Q85A 4MQBA 3HCOA 1RABA 2PXXA 3SWWA 5IKXA 4HO1X 3ZS9A 2XD9A 3V1TC 3JD0A 1KOFA 3SE0A 3MHTA 3IIEA 4UMEA 4AKGA 2Y27A 3H8SA 1GPAA 3VKHA 1VHTA 2IPMA 2QRVB 2DPYA 3LX5A 3AG6A 2HXGA 4GWGA 4XEUA 3ZWOA 3PNLA 4RTRA 4U2EA 4AJ1A 1IVSA 2HLNA 4QC2A 4O08A 2HA3A 4TUYF 2YZ7A 4GLLA 2Y3IA 1XALA 3FUCA 4ME6A 4TTSA 4AC9A 4AJHA 3ZHTA 3K4PA 4P8RA 1JH9A 2Z4SA 4X6XA 2QAGA 3K2BA 3RABA 1RYHA 2J5BA 3GFBA 3WJAA 2COKA 2B3DA 5G53C 4DNFA 3B8HA 3CZ4A 1Z7BA 4Y18A 4D45A 2KBEA 2CJWB 5DZSA 2B92A 1BS9A 1KDZA 2FA9A 5LUAA 3ORQA 1PZXA 1GKUB 5CYFA 1DPFA 1A8UA 1GEEA 1LLQA 2JAOA 1JEOA 2V7BA 3BK7A 3G2IA 3LQ4A 3OJLA 4PLVA 5KVQA 2DLCX 3AG5A 3OAAD 4F92B 2B6HA 4I8IA 1CP2A 4L4XA 4HV4A 1FFXA 3EWNA 1RJFA 4IRMA 1J9GA 2WRZA 1KZ9A 5FAKA 1E5LA 1R0RE 1WL8A 3CXUA 5IXJA 2HU5A 4MQ5A 1KAGA 1QOZA 1M6NA 3P4XA 2YYZA 3LT1A 4O02B 4ZOEA 1QAMA 1SBHA 4UNNA 2R1UA 1SK9A 3U26A 5CH8A 1SCKA 3KE8A 1RWNA 3T5BA 1U4SA 3O83A 4FK8A 2FZ4A 2RJOA 2WOOA 3FDZB 2HTEA 4KMSA 1B2RA 3HGMA 3TZLA 2AKEA 1YHNA 4TL9A 1O2DA 2Q6KA 5IXSA 4XSGA 2VNAA 1Y8QB 4CPDA 1POXA 2XMSA 1N6PA 4DC9A 3L07A 3WK7A 1YWGO 2QD3A 1R18A 2FN4A 2HTFA 2AVDA 2INGX 3GFSA 1I3OA 5LQKA 3W34A 1U7WA 3UM9A 5ILOA 1Z16A 5B55A 1J25A 3WIEA 1BKYA 4ARAA 4H6WA 1BHQ1 1OC4A 2VF5X 4I9HA 3TQSA 3ZIDA 4D3SA 3BWXA 3I9FA 1ADYA 2Q3HA 4NG5A 5CDFE 4KXMA 3FDJA 3I9KA 2J1LA 3ESDA 1IU9A 1N8KA 2PIDA 1OWOA 2O3RA 2QZZA 3W1EA 3I0NA 3VTZA 3T9AA 1G5RA 2CD7A 5I7AA 1X9HA 1OFVA 4Q21A 1RS0A 4DB4A 2BL4A 4OYRA 2E18A 1QPZA 1LRJA 2GEUA 3GPIA 5EMLA 5M7EA 3QPDA 1WEKA 4HB4A 1ZNQO 1EXNA 2YYAA 2J6IA 3D02A 5HKOA 3OSUA 5L7TA 3ORRA 2PBRA 1BSVA 4FGWA 2ORWA 2ZXEA 4KUGA 4FR2A 3M4XA 2FWMX 3M89A 3T06B 5C1BA 3VA7A 1U8YA 2NO5A 5DYYA 1MEJA 4MUJA 3DAFA 3AR6A 4CM1A 1Q16A 1BX1A 1Z28A 4LSZA 5DULA 3LHSA 4RE5A 3H17A 3RS3A 3WMWA 1E2FA 3GJ5A 3ZDDA 4GNKA 3N07A 2G71A 4D99A 2YN0A 4X6UA 3UUWA 4YT8A 4RJ2A 5JZMA 2CYBA 2OCPA 2GNAA 4MGIR 1WSWA 4BMCA 3WLFA 2CVPA 2W0MA 4DQKA 1GN9A 1VLZA 3JRNA 3ZWBA 3FMOB 4O5AA 1RWPA 1WXGA 4UVGA 4Y6OA 3D4NA 2J6CA 1XNJA 4DFDA 1CEYA 4F71A 4OMCA 3ACCA 2OENG 2VYFA 1EHYA 3QSGA 4MKXA 3RR2A 1L4MA 1P91A 3QV2A 4NBWA 2ZIXA 1N1EA 1EVJA 3DEJA 3D3KA 4P2GA 1FMCA 4GXNA 3JSAA 3QEMA 4R3WA 3SYRA 2HK7A 3HDJA 5E9WA 1K8YB 1PV1A 2NSLA 4DQDA 1TT5A 4CU2A 5LR6A 7GPBA 5IVPA 4R9SA 1YC2A 2Z9DA 4MVWA 1OF1A 3AMVA 3UCFA 4UATA 4MWDA 1P2SA 1WZUA 1NQVA 2HHCA 2QTVA 4I1UA 1V8ZA 5ARDA 5KTRA 1CVRA 2BN4A 2A3NA 3K94A 5JECA 2YICA 2FLWA 2YHBA 3CW9A 5CBKA 2C8JA 2XVZA 3LP6A 1E8MA 4PBSA 3T41A 3Q4GA 2HUPA 4D9BA 4HUTA 1VHQA 3P4YA 1M1NB 5CEJA 3AUAA 3OQHA 2BGLA 1Q0RA 4YT2A 2G67A 1QDLB 1I4WA 2CCGA 3BC1A 1SKBA 1UZNA 4AY4A 2O7SA 3LY5A 1HQDA 4ZAGA 2BV3A 3VNRA 3F5DA 1UPFA 3AM5A 1GGEA 2V7WA 1XQWA 3WGQA 1NW4A 3A9VA 2W83A 3DNMA 3IEXA 3KT0A 4M3NA 3RTBA 4N39A 4G37A 1RJWA 2QM8A 4OQ4A 1CV2A 1IXZA 3E3LA 1SQ5A 2PRYA 1FP4A 1D1QA 3P2JA 5FBVB 4MICA 3I2KA 1M6VA 1O6BA 4C0SA 1PNQA 3VJMA 4KFCA 3CXRA 4DQXA 4EL0A 2YS6A 4JZYA 5NLLA 4MR8B 4PE5B 4YUAA 3MLAA 3MJTA 4JWKA 5HMLA 5IH3A 3KELA 3TMKA 1CERA 2PWPA 5EKUA 5HBGA 2IIPA 3F78A 3CJTA 1E69A 5DYWA 1SCBA 2P69A 2P4SA 3MYRA 4DSTA 2EJBA 1DLJA 3A2LA 3CLSC 1GPBA 2N1BA 3EIUA 4WXEA 3RC1A 1QB8A 1XZQA 1ULZA 2NU8A 1T2DA 3TECE 1RM3A 1W8DA 2DKOA 3KQLA 3KQPA 5F2NA 1JB9A 3F7NA 1BXRB 3FLEA 2WILA 4ZKEA 4OHBA 1XRMA 1UAAA 3MELA 4DB2A 1SRQA 3EZ7A 3WLTA 1VA5A 4D3ZA 4RK1A 2QK4A 2WLSA 1N5LA 5AOCA 2VIIA 3LUFA 5TF4A 3WAKA 4QU5A 1A69A 1CJTC 3EISA 1GTG1 2R4TA 3NRBA 3QLVC 4Z9AA 3OJXA 2QT9A 3UICA 1BJKA 1VRWA 3PI7A 3W9SA 1JFSA 4D6PA 4KQGA 2O2DA 3A1WA 3AUKA 1G291 1GXSA 1CFJA 2O20A 1QF6A 1CRQA 3LYHA 3G0OA 4QGSA 3IQGX 4R1MA 1P5ZB 4RTSA 2CSUA 1QX3A 1ID1A 2YN4A 1ZJ5A 2XTMA 3F3YA 3LM8A 1UWKA 5BSRA 2FG5A 4X3OA 3M5CA 2A7XA 4FFBB 1MW8X 4B75A 3EX7C 3BVPA 3KB1A 3RIYA 4Q16A 3RG8A 3TNYA 2CNWA 4L07A 1GTZA 4LNUA 2LVBA 3GGCA 2AK2A 4BN4A 1W88B 2IGTA 3ED5A 3ZHVA 2VWPA 5AP9A 2BH2A 2PZFA 3EC1A 3DFKA 2O2CA 2QTNA 3GDHA 3RANA 3RSFA 3BXZA 3KJFA 4Q9KA 3CLRD 4J0EA 2EF1A 2BFDA 2VTVA 4D25A 3Q3IA 5GJWC 2ODAA 4PHGA 1FNNA 1DKPA 4D6YA 4TMVA 2ZJYA 5LB4A 2XB2A 5KO2A 4RLQA 1C29B 2UVPB 4QULA 4WZBA 4YWJA 3SQMA 1V9SA 2EJWA 5KVAA 1AF4A 2AMVA 1UL1X 3UJCA 2APJA 2XMBA 1LGYA 1YZVA 3VRHA 2R96A 1HDZA 1WG8A 3H6KA 3ZD9A 4AKHA 3ZZUA 1ZEJA 2ZBEA 3KZOA 1PJ3A 5AVVA 2VUIB 4R3UC 2PX8A 1CX9B 4FFSA 2HPZA 2ANBA 5T4HA 1P1KA 2F1HA 3CUEF 4XQ9A 1IOLA 1YBVA 3I1FA 4FMBB 4WINA 1EDDA 3W9YA 4YMSA 3EVZA 3OUUA 2X0IA 2W4MA 3HADA 4N5LA 3TIIA 3A6GA 1JNXX 2HLPA 2OG2A 4Z4EA 4J9VA 2QM0A 3ENVA 3G2OA 1T9ZA 4RDHA 3S5UA 2PD4A 2QVZX 1E3WB 1P45A 2DBZA 3MD9A 5HA5A 4LOJA 3V4ZA 4ZOLF 3GJTA 5FOXA 4DRXB 5KBYA 4Z9BA 1UJMA 3C6YA 1YDFA 1SHTX 3H5IA 5BSKA 5A62A 2OHIA 1V9CA 2X8LA 3MTQA 2B99A 3DBOB 4P92A 2XB6A 3HY6A 3VU3A 1IK6A 1WB4A 2ZI6A 2CNWD 3DAPA 4Q3KA 2QLLA 1ZLXA 4OJMX 4B3FX 4PHHA 5HKAA 2AJLI 5EIAA 1R6AA 2FZEA 3PEWA 1NW3A 4DCMA 3ONWA 3ESYA 2JIZA 3AR9A 1K3TA 3OZIA 1R64A 4NZPA 1UT5A 2BY4A 3PUZA 3DE1X 3TZ6A 3QKUA 4PZLA 3IHKA 3GFRA 3HA3A 4ZALA 3U17A 1AKNA 2FSIA 2D0DA 5E4JA 1ILEA 4WECA 4HJRA 2GF9A 1JT2A 3GFFA 4RADA 4I2VA 2CVFA 3K15A 1F4VA 4HZGA 4XA8A 4J0QA 3U0BA 4JLOA 1KO7A 1V39A 1LBTA 4CIXA 2W2XA 1PJRA 1XSEA 4M21A 4FDUA 2H7YA 5DCWA 5C2JB 2UYGA 1YVUA 2YW2A 3EAGA 4EKGA 4KXYA 2QJOA 2YNMA 3JR7A 1GG8A 3IAFA 4KI7A 4BCCA 4DLLA 4LA4A 3T9DA 3W3AH 4GZ3A 2C00A 5DP2A 3WL3A 3RG2A 1YBMA 4FHDA 3GLVA 5ITWA 3U31A 1K27A 5B3KA 2DSTA 3A6DA 2HX1A 2UYYA 3CKLA 2GHRA 3IAS1 4JP8A 4N7JA 2PUCA 2BP7B 3UK1A 4FT4A 3LQKA 3ZV7A 3FYUC 3VOTA 1IFXA 1SELA 1YONA 2ARKA 4LV6A 1OYWA 1ZHFA 3GU3A 3QTBA 4NOJA 4ARIA 1ZVKA 1ZNZA 2P30A 1K7XB 3L0CA 1G17A 1XKQA 2NXJA 4L0CA 1Z82A 2YVLA 1M6WA 3IAHA 1ML4A 3RBVA 2FSPA 4MI1A 5AK0A 1K8ZB 3QXJA 4IJKA 3UAYA 4JQCA 1NTRA 2GCEA 3GOQA 3I8SA 1SY7A 1W4BA 3MCWA 3WMEA 2JIZD 5FUMA 2TMDA 2I2CA 3QPBA 2BM9A 3E0XA 3V48A 1NJSA 2WAYA 3RUAA 1SBIA 2FE1A 4KC0A 4CF6A 3T3IA 1J09A 2EFYA 4Z7OB 4DSUA 4QYWA 1TZCA 1XC7A 2CHEA 1V2GA 3GZNB 4JD5A 4N7MA 4FQ7A 3LP8A 4HFNA 1NI4A 2PTGA 3CNBA 3LC7O 2R8PA 4YJ2B 4RKFA 3B5JA 4Y9UA 2NSHA 4MHOA 4MKIA 1XGKA 4AT1A 4OATA 2NUAB 4OHRA 4G2NA 2P6OA 1O0CA 2RHBA 2RG7A 1KXZA 3FBTA 1P1FA 2NTNA 3FWPA 4H59A 3MSXA 1Z3CA 3TBKA 1W36B 2WVJA 2OBYA 2WDZA 1KI8A 1Q83A 2YNMD 5DI3B 1QRUA 1AU9A 1FTQA 1QVWA 4RIEA 4B2IA 2JI7A 4K6OA 3KOWA 4U0KA 1V9LA 1DBPA 2BKAA 1HSZA 4Q1FA 3AF2A 1WNTA 2JLXA 3TIFA 5ALGA 3ROPA 1LV7A 3V00A 1G8JA 2ZSUA 4WFJA 3ILSA 1G4HA 2FEOA 3IUEA 1W75A 4LN1A 3O8OA 1Y4AE 2CNBA 1JU4A 1YNSA 2UZ3A 1T9GR 2WHPA 3H3JA 4YDHB 4YAKA 3FXAA 3MNFA 5FR1A 2H31A 1RZUA 4RS3A 4LF8B 3ABZA 2QL9A 4OHYA 4LYHA 1G2QA 2OZLB 3P2KA 4YVFA 2I0FA 4WN9A 4LZLA 1UMDA 1P5RA 1VG8A 1GGNA 7AT1A 1DQZA 5K4HA 4I5GA 1U9JA 2C4KA 1BEUB 3CKMA 5J4YA 1LU9A 3VC3A 2AJDA 2P77A 4FC6A 3OI7A 5KYVA 3TM5A 2EAUA 2HU8A 3PWSA 8ATCA 3LYUA 5FLXA 3QLUA 3T3GA 2VDLB 3LXMA 4NICA 3U9LA 2G82A 1BCRB 2PL5A 1V4VA 5FR2A 5ICFA 3RQSA 1IEVA 4GP7A 3UMBA 2NG1A 1G8HA 2Z3ZA 3DW1X 3KU1A 3NYWA 4PIVA 1LVHA 5JQGB 2GDJA 1BWSA 3GVXA 3RHSA 5MFPA 1WPGA 1W85A 3HE3A 2Q21A 2ZWIA 3IA7A 1UPBA 1VP3A 4JR2A 3G0DA 3M34A 2NZVG 5C51B 1GM5A 4IDPA 3WGOA 2L82A 2O3TA 3EARA 4HLUA 4OHUA 3KSZO 3BYZA 2J46A 2JAPA 3R0XA 3S44A 1GUBA 1V71A 2G7MC 1VPDA 4R0NA 4HWRA 3JQ9A 4J4BA 1BA3A 2G04A 1U31A 4JSYA 1W5BA 4Z3DA 2VYQA 1E1CA 1U8TA 5KDLA 4AYWA 2Y6UA 4HKTA 4EEKA 3ITNA 4R9VA 2Q9BA 1IMJA 3ZHQA 2LDBA 3LTEA 1Q7EA 5THKA 5DGDA 3NJ8A 1PO7A 1GSIA 2PAFA 3SHTA 1DTEA 1SBNE 1VQ1A 3E9EA 4DT1A 3A04A 3PNQA 2H2WA 3WGZA 1M2WA 4YI5A 1A4IA 1C1DB 4CE6A 2QQGA 1NG1A 4BNYA 5K0EA 1O95A 1TVMA 5JYBA 2L19A 3ICWA 3U6BA 2WDPA 3HO6A 3GUHA 3KHTA 2JLUA 5EXEA 1YZUA 3HR8A 4IXMA 4LDZA 1J24A 1I8TA 2QSZA 1YO6A 3NHUA 3SR0A 3TM4A 1O8BA 3NTVA 1UMBA 3UJHA 1RAFA 1SBYA 4H6XA 5KYXB 3FVQA 5DOZA 1D04A 1XG5A 1NQAO 1S4MA 4LWQA 4RGQA 2OEPA 4BTEA 1Q7RA 4FYKA 3RFUA 2E21A 3ASUA 3VDQA 2I71A 5IFLA 3W5BA 4W5TA 2VJMA 4IOKA 1QB7A 2WEKA 4MJ3A 5LQJA 2Q2QA 2IWHA 3LLMA 3IV7A 4KIGA 4LCJA 4D0LB 5B64A 1LTKA 1VCMA 2FNAA 4EGAA 2GM4A 4WNYA 1LX6A 2Q6TA 2GERA 1ADGA 2QV7A 4I1PA 4LY0A 3RHZA 2IYVA 3OJOA 5KOYA 1I7QB 4PLHA 3EXEB 2NVUA 3UV3A 4XX0B 3ETLA 3K09C 1GZHB 4QHYA 3PUJA 2DHEA 4V3CA 2EBFX 4X7RA 3SR3A 1QBKC 3RUIA 4CMKA 3ZE6A 2W6NA 5ALIA 3HDYA 2WICA 1KXJA 3KJGA 4B8WA 1N6HA 5FBRB 4H7PA 2HMWA 1FDWA 1UBFA 3H1TA 4ER5A 2XCSB 1H8HA 5TQ2A 2BEWB 4GI1A 4KX5A 4WCFC 4ARZB 3DD1A 1L2TA 2JEZA 3CTPA 3IPLA 4U7JA 3WL8A 3S2ZA 1O95D 1XDDA 2P8JA 5KCZA 2QU8A 3AOEA 3ZLTA 3EQ9A 4GLJA 3LLSA 4EJSB 3MCZA 5T7BA 1BX3A 2WBLC 3H2GA 4BNIA 5ARBA 3CHYA 3LC1O 1FA9A 2YFHA 2IXEA 1YBHA 2OY0A 2W43A 5IULC 3FSEA 1DG9A 4ESVA 1TKBA 1WDKA 4LE2A 5AI5A 1KOLA 3BFVA 2FMIA 3ENKA 1EYZA 1E4OA 2FX2A 2G06A 2PX6A 4P4UA 5I48A 5IDVA 2I76A 3IP6A 2E4WA 3KQMA 1RLIA 3Q12A 4R4JA 4CIWA 1OI3A 2DLNA 5BOSA 3A25A 4UTVA 3QYFA 3IMKA 4PAQA 3A6KA 4JJEA 5GV8A 1L4BA 3LE8A 4PCAA 3N2KA 4WBXC 4GD3Q 4YCNA 1I7PA 4BP8A 3PC2A 3ZWKA 4KVZA 2P27A 5EPUA 3GUUA 4ZU3A 4WLNA 1KMMA 3UOAB 3O4IA 1RZ3A 3V1KA 1XU4A 5T4FA 2PX2A 4DQLA 1V6AA 3AVWA 3DMFA 2C5FA 1YKSA 2GYVA 5K3AA 2XF2A 4EPRA 1GU7A 4NH0A 2WT9A 4KYVA 1LUAA 4MQ4A 2R0QC 2ZSFA 4UUAA 4XRRA 1YZKA 3S1AA 1K86A 4B3IA 2HPAA 4L02A 3WRYC 5ADVA 1IHDA 2R66A 2PEYA 3O84A 3I5XA 2V6FA 4H1UA 4J0HA 1M54A 1DZIA 2QUZA 2QMEA 4O59O 4N6GA 1Z0DA 3AB7A 3G2HA 5KWSA 4DJDC 4LJ8A 3K72B 3ZJVA 1T3LA 5C1OA 4Z53A 1U7UA 5LZ2A 1T2AA 4WEQA 2OHJA 1V8OA 1NE2A 4KOEC 1B14A 1BWRA 1XL1A 1SCIA 1KEPA 1GT91 3C6KA 4OJNA 1NZJA 5CRIA 2YFQA 1TCUA 4J76A 2I7TA 5I8PA 4NJEA 3PLAE 3BULA 2OAEA 3MA0A 5KAPA 1XTJA 3ZK7A 1XF9A 2O5VA 2JCBA 1GHTA 2UAGA 3P27A 2OORA 3OOSA 1C4XA 4P5DA 4ZVQA 3VPAA 3WC4A 2V7GA 4DWJA 1YS6A 1RJDA 1W76A 2GSDA 2JBHA 2WHEA 4YQEA 3RVRA 1W49A 2J87A 3WMXA 2JIPA 1SNYA 4MP8A 1EFTA 4TWZA 3BTSA 2OD9A 2FWIA 1WP4A 4WK2B 2EFGA 5BVGA 1J99A 4C4TA 2JHFA 3DVQX 4OQFA 4AJ9A 5IT0A 1KQPA 1YA8A 4MGHA 3RF6A 4DZZA 2ZRIA 3L1IA 1TQDA 3T6KA 3HO8A 3RRFA 2ZJ3A 1X6VA 2CDRA 2ZI3A 1XCJA 1JI0A 1P7PA 1V6SA 2XUAA 3V1UA 3UG6A 4JKOA 2FWPA 5FFNA 1R8XA 1MJNA 3JARA 2WJAA 1Q84A 4OBEA 1ZQ1A 1G19A 3KVNA 1FX1A 1SVSA 4WA8A 5DM2A 1P1IA 1KFKB 1ZK3A 3C8HA 4KSYA 4IXDA 4P54A 4UUOA 4JI7B 1UXJA 4Y98A 1DKNA 4MGZR 5BY2A 4ZFNA 1H85A 1XMVA 2EWWA 2MT9A 3F8TA 3ASVA 3KHUA 2Q5FA 3L2OB 1MOSA 3LDHA 1M2FA 3ETDA 4NHEA 1P2UA 3TQQA 1LPOA 1TK2A 4M99A 3TLZA 4PZCA 4EHJA 13PKA 5CCDA 2FDXA 5DGXA 3WO1A 4LQLA 2IZ5A 2C3MA 1JIXA 1JE0A 3TFWA 5EMHA 4UXJA 1YQWA 3IP1A 2OAGA 5E8RA 1G2OA 1RAIA 4J0CA 4ZT6A 3VVMA 5J43A 3CM0A 4JN6B 4JIMA 4LS3A 4U00A 2B4KA 4DLZA 1EUYA 4QREA 1JDTA 3TLMA 4M53A 3WWDA 1WZIA 4Y9RA 4IICA 5IDQA 1IWBB 5EYPA 2BFCB 3LFUA 1SU6A 3L8EA 3NU1A 3LQYA 1JDSA 3N3AC 2CBXA 2HSWA 2OE2A 4A6EA 1C7EA 1TB4A 2XA9A 1X14A 2AW5A 2H4XA 4O1IA 4K9LA 4IHJF 1GNLA 1OX5A 3FCXA 3OA2A 4RE6A 1J42A 2HBYA 3RYFA 3T12A 5JYDA 4W9MC 5LYYA 1NG9A 1UBLS 2I4MA 1M83A 4MUHA 4PU0A 3O4GA 3NHWA 3CX8A 4EYQA 4F2PA 4Q48A 5CYPA 4BNFA 4UCWA 4B6QA 1NDHA 3L84A 3FTCA 3GDWA 1OLXA 2Y8EA 4TTQA 3RSCA 2IP4A 2R6FA 1BEEA 4TMXA 3WYNA 2Q5HA 3NT5A 4R6XA 4BVGA 1GPDG 3O8QB 2OFFA 3D2CA 2H00A 1IWOA 4A6XA 4BCDA 3VVBA 1UUFA 2ETVA 3H83A 2IHJA 3H9JA 4C3OB 6PFKA 5AVJA 3PLNA 1NFQA 3NPAA 1DXOA 2I3BA 1KVUA 4OSOA 3I5MA 5ALEA 1ZM7A 4HX9A 4V1CI 5LXTA 3ZCUA 1ZVVA 1A50B 4Y1RB 3KWLA 1MABA 4Z4CA 2CFSA 1PT7A 3OE7D 1SUIA 3Q88A 4Z4HA 2C3OA 3R9KA 5JSKA 3DZKA 1WVGA 3TE7A 1Q0UA 1S89A 2JIDA 3TW8B 2A67A 4KYUA 2PVPA 1JSCA 1GL7A 3ZLVA 5TQ0A 1Q7GA 2FFQA 1E2BA 2Q5OA 3K0CA 4E33A 4LW8A 4MCHA 3G0GA 2BMJA 1SCQA 1ZSNA 621PA 3OFND 5AIBA 3O8RA 4D80A 4HNQA 3JU3A 3RNLA 4Q18A 2IY7A 4KN9S 1DQYA 1BVRA 4G01B 1YS7A 3MUFA 3AOGA 4H6PA 4BC1A 1KEZA 1T2UA 1QQBA 4MA5A 4YMHA 4M6WB 2XNJA 4YECA 2UZ4A 2V0CA 5JO9A 4OU5A 2RIPA 4R3NA 3EBLA 1QNLA 2OB2A 1D6MA 4UXHA 1S1MA 2HGZA 3QE3A 1CR1A 2B3TA 2CV1A 1I0IA 4TV8F 3O9VA 4CT0A 4E03A 5DGIA 1VOTA 2A4KA 3OZGA 1Z12A 4DKXA 4MYUA 1G5FA 4ZTZB 1N2CA 1QYIA 3L1VA 4MULA 4MZDA 5A9TA 3RO7A 3USCS 5TPWB 4HVLA 3AL0C 1ZCBA 2BHRA 4WJKB 3B48A 3DEKA 2AJ8A 2B1QA 3AJEA 1CZUA 2HF7A 4JP1A 3SDZA 2X22A 2G1AA 3OQNA 3TB6A 3VYUB 1P18A 3PK0A 4GXRA 5AICA 4H1TA 1Y89A 3M2PA 4FGZA 3L0PA 1XZEA 1UC8A 1YBAA 3GIWA 1BMQA 1K4MA 1RHKA 4JLWA 3JZAA 1VLMA 3KJHA 4WKPA 1AO0A 3MCTA 1WHTA 5TVGA 2GN4A 4LYDA 2B9EA 4LDQA 1M6YA 4D4HA 5IUNC 1DFHA 1U6JA 3VNUA 1ZA1A 3PC6A 3O47A 5H83A 4C30A 4A82A 1TW2A 3NHMA 4J0KA 4R05A 1J20A 2X6TA 1WQ4A 3EXIA 3DDHA 3QUSA 4IRUB 3V1YA 1GL9B 3CZ9A 4I9GA 3X43A 5A05A 5K0FA 2HFKA 3PFCA 3RVSA 2VP3A 4R51A 5CMLA 2V6JA 5LZ5A 3EZYA 3AHDA 3AP3A 3GCXA 3K05A 4UHBA 3CLVA 1SXJB 3ZZNA 1AS0A 3DCNA 3UTCA 5GZ3A 3NIFB 4F9EA 2IS6A 2FWAA 4HX2A 4HWTA 3G0BA 2D0PB 2WJZB 5IAGA 2XKAA 3N75A 4A8JC 2J09A 5ADHA 5J40A 1Q1QA 3QH4A 3MAJA 4QTXA 4CTOA 1U8FO 3FHTA 4LHZA 1RQRA 3BTUA 1C8BA 8OHMA 4UBKA 3TL2A 2GWRA 2VUTA 3TBFA 1Z4JA 1XWWA 5K0LA 4AX8A 2WNHA 1XL0A 1E9VA 3KHKA 5HF8A 3SJ7A 2WPDA 2VBGA 4CVNA 5JRDS 4CMCA 1EEXB 4MYDA 3T4PA 3JQGB 2C20A 4D9MA 3V7FA 5HRAA 3OZWA 4BBAA 5DM4A 3IP3A 5KJ1A 1KKMA 1JMVA 4EG7A 1U1FA 4EVQA 1F3OA 3RRXA 2VPPA 2W2VA 3IE1A 1I1HA 3A6PC 4HZIA 4MUGA 2V7VA 2J6BA 1PS9A 4ZO9A 3V3TA 3S8EA 4EJ0A 5C4GB 4LJAA 3BIJA 3GO4A 4HNVA 2GPAA 1QS0A 4EGSA 1N77A 5TJ9A 3DW3X 4TVSA 3P32A 3AKDA 2JLAA 2YZKA 2ILTA 5KTNA 1EWKA 1LTHR 1AS3A 3K0FB 1XJCA 2OCDA 1HQCA 1M2JA 1M2VB 3JQ7A 4RM3A 4P38A 4B48A 2YWGA 3FCCA 1QH1A 2Y0EA 5AM1A 1RYYA 2B35A 3RLFA 3CE6A 4QICA 1B1AA 3D1JA 5KMGB 4DR1B 1IIBA 4MS1B 2CZQA 3HLKA 3Q3VA 5AJXA 1EP3B 2WTUA 3O90A 4AVYA 3DZJA 1V4BA 2Q4DA 2QRVA 3DB1A 4I4LA 5F73A 1M75A 4JEUA 2HU2A 2I7CA 3AUUA 3H16A 2GO7A 3GT7A 3HUFA 4DV7B 3NMUF 3Q11A 1EMDA 4HXYA 1CQPA 4AUEA 2EBHX 4DNQA 2VCEA 3RYCB 5CM8B 1NSFA 1JXQA 1XTQA 1P39A 3CRW1 1OA0A 2KLBA 1NNLA 4CLHA 4L3WA 3QMPA 1U9IA 1U02A 3RHFA 1SN7A 4KJXA 5H02A 4JL8A 4RJLA 2WPDD 1PFQA 4TTPA 1XDGA 1L8OA 2DTEA 3TLYA 4BLWA 3MM4A 2H1HA 1U3VA 1WHSB 2JIQA 2NQ8A 3DZCA 2WJGA 3FJYA 3LUGA 5C46F 4P53A 3OHPA 4L5IA 4DA4A 5EIWA 1A8QA 3GLUA 3V7NA 1UWLA 2WSSA 4TS4A 3FFAA 2DR2A 1YB1A 3TDKA 1NX6A 4ZT4A 3S2FA 3I2FA 3H97A 1UANA 4CUZA 3H2SA 3JR3A 4H60A 3RARA 4MVJE 3RAFC 3C5WP 3NJ4A 2KYRA 3GL9A 1QVAA 4WD3A 3E7PA 3ZJ5A 1CDEA 4J0IA 4QUKA 3W8RA 2QD5A 2IHUA 3C3DA 1YJAA 1RAGA 2B2NA 3QEKA 2DPGA 1FJ2A 2QTHA 1N5OX 1PQPA 1YZLA 4YONB 3UUEA 5KNCH 4ADSG 3LHDA 3ZCTA 3F6SA 2W00A 3KDSE 4GT1A 1TZMA 1PJLA 1XTVA 2MSEB 3ICPA 2IYAA 2PU7A 2J3QA 2JFQA 4LDAA 4CLEA 4DJEC 4ZDKA 5BMOA 1RZRD 4XGQA 1XLTA 1HFJA 3C3JA 1NN0A 3AX6A 1XJ0A 3ZW9A 3I61A 4PSUA 4PX9A 3VGJA 1U7OA 3GRKA 3NOXA 2IEDA 3ZKAA 4ACAA 4EGQA 1KETA 5BXYA 1CZLA 3E8SA 5G2OA 1ZBQA 4QM7A 3EAFA 2BJWA 3H0CA 4KLAA 4OX9Y 2ZWOA 3BZWA 2JAWA 4WIAA 1PZHA 4L95C 1YZYA 1M9NA 1PBNA 16PKA 3SS9X 2PKQO 4W1SA 2AOVA 4CEIB 4UFNA 5T3UA 1ZOPA 2HV8A 1C8LA 5LC1A 1GITA 1OR8A 1FX0B 5C53B 5ILQA 1KERA 1TK9A 3QVVA 2VDNB 4YPFA 1KBZA 5DHSA 5AW3A 2A33A 3QU5A 5DHRA 3V8EA 1G7TA 4C87A 2VUSA 5CDYA 2VF7A 1OIXA 3CB4A 5CLJA 4I50F 4X1YA 4XUDA 2P1DA 5CEFA 3U3JA 3HJFA 1ND5A 4HWGA 2Y9PB 2FDCA 4D4LA 4LCBA 3TPFA 3BIXA 3VKUA 4LQ4A 4D8WA 4B3SB 4G23A 1F3LA 1S2IA 1NDUA 2B5VA 2C83A 3V42A 3HJTA 4KQCA 4H1WA 4PLPA 3QX8A 5FTKA 3UBMA 5HNKA 2UZ1B 1S96A 4QZVA 3BX1A 3WRVA 4WN3A 4B7ZA 1N25A 2ZSEA 3JZFA 1R5OA 4RTMA 3RASA 1ST3A 2HF2A 4IDEA 4TYMA 3B6MA 1Y1RA 3PXDA 2HWYA 4OKIA 5JI3E 1XJ5A 1AZSC 2FPSA 4W5HA 5A1JA 3BWYA 2DBQA 2IXDA 4RSHA 2FPXA 3GMIA 5CHEA 1U28A 2ZQZA 2IIVA 4OGKA 3F9IA 3MOSA 4HFMA 4IXTA 1RKXA 4GG1A 4QLOA 4X1KB 3FNQA 1OVMA 2K2WA 4NENB 3FZYA 3L4KA 4U9UA 3QVXA 2H18A 2HADA 3ZCVA 4OMFG 1XT6A 3ZJTA 1RYNA 2GZ3A 4NU5A 1N2HA 3AESA 4CMBA 5JMOA 1WD7A 2UUOA 2WB4A 3A6HA 4KBYA 1T0HB 2Y0DA 1WZNA 3QWHA 5CA0B 3QXGA 1IZZA 2OO5C 1O7JA 3ADPA 4MO2A 2ZTMA 1XCOA 3HJRA 3T7IA 4F8YA 2O3JA 1UMCB 5JNUA 3A3KA 3EXG1 2AN1A 4RSRA 4YRDA 3DKPA 4ONEA 3SFVA 3UAWA 4WKNA 2FWNA 1E18A 1MIOA 1A5SB 2XDYA 3WLJA 1ECLA 2W4IA 4EZIA 3V3KA 4J2HA 1KK0A 2M1ZA 3OCYA 3L7OA 1J1IA 3HP7A 3LHFA 2QY9A 4INPA 5IMBA 4EW1A 2V5AA 5F9HA 7MDHA 3VNAA 4WK6A 4HUQA 4AZSA 4AROA 1ZJWA 5H9VA 2BF7A 1YS9A 1E7YA 1L4FA 2ZYDA 1Z2DA 3BJZA 1N9GB 4DIOA 1ZMTA 3NWPA 4BO7A 5JSZB 4TXHA 5DBHX 4PYLA 4LJ7A 2DEUA 4JJGA 1KVRA 3GT4A 2DCMA 3OCWA 5JO0A 3IQIX 5KJ6A 1MHPA 1IN8A 4WZ6A 2Q2WA 1O6ZA 3CV3A 2WMDA 3GGSA 1C9YA 1A8PA 2X9LA 4MPPA 3DM5A 2X8JB 1T29A 1UFKA 4IHKA 4WFQA 3T7DA 3DBVO 3FLAA 4CV2A 1Y48E 3THYB 2ZYTX 5E3HA 2KPOA 1H69A 4GUDA 3RS8A 3ZDFA 1G4UR 1LK5A 1XA3A 1GA6A 4FZJA 4DCCA 1LI5A 1L4GA 5IARA 1JLMA 1VYVA 2G8NA 1CR4A 3HJHA 1DADA 1Z6ZA 1LZLA 1PR2A 1AZLA 3H5OA 3PJGA 3TAUA 4R0VA 3EB9A 3EQ7A 3KQYA 1HNNA 3LHIA 4I5DA 3D2AA 9LDBA 3K70B 4RU1A 5ALVA 2RC5A 4I36A 1UXHA 4ICIA 4B81A 4JUFA 2NQTA 2X23A 4F6RB 2OLEA 1FXSA 3AU8A 1WMDA 1D2NA 3MMPA 5E3IA 3UA4A 1TVKB 4E3WA 3DOOA 4HC4A 1E5DA 4E5MA 3WDLA 4RC9A 1ORIA 1UBSB 1Z25A 4M4SA 4W4TA 4RO0A 3H11B 2ZFUA 3EWSA 4FWTA 5KCMA 3RGWS 2I6XA 3DUWA 3ZH9B 4BJ3A 821PA 3KT3A 5JWOA 2P0EA 4XUCA 4WGFA 3BL6A 3A4LA 4ENVA 4HMOA 4U8GA 4Z4GA 4BQQA 2GAAA 1M2EA 1WDMA 4HTAA 1YE8A 2ROQA 1KIAA 3QX7A 2XKBA 3IMGA 4HX5A 5FORA 3JCZA 5BR1A 1JQ3A 5HWSA 1CY7A 4NL4H 1EM8B 4UE2A 4UBOA 3FSGA 2OYSA 4TMKA 4YHBA 4HEA6 3C3EA 4G0NA 1XZGA 1OXTA 2LGJA 2XNCA 4BZQA 3D5TA 2XNHA 5BPFA 1BU5A 4OV6B 3D6VA 4WOKA 4IV0A 1KH2A 2PMKA 4Y3UA 3IE2A 1HI9A 4GI5A 1J22A 1SQGA 5HJ2A 3SAJA 2X5NA 3LVQE 4PZDA 1U5BA 3RREA 2IX9A 3LHKA 4QDJA 5IBQA 4GP9A 5I4KA 5CHYA 1T9GS 1BVUA 3L7CA 4MLCA 1IOZA 2OILA 4QA9A 1JZQA 1XROA 3D7KA 4INZA 4P7JA 1X0VA 2YZMA 3HBJA 3G9XA 5I7OA 1YK0A 2DHDA 5A9SB 3GFTA 3E58A 1E5VA 1Y6JA 4RCYA 2ZJ6A 1AZWA 5UKDA 3ZQKA 1P2TA 3CVOA 1ORWA 1QIDA 2PR2A 3ZVNA 2YHIA 4OYLA 4K2AA 3PSAA 2FWRA 3DE2X 4JLUA 3U13A 4X7PA 4CNQA 1KI6B 1JEDA 4FFWA 3SXUB 3HY4A 4BDTA 1HEUA 3ZNQA 2JFNA 5HUHA 5EE3A 4ZCSA 2FSVC 3GARA 1BHO1 2PLAA 3GZTB 1FFWA 1VMIA 1IN4A 1ODCA 5LIRA 1KHHA 3E7DA 4UCXA 3NUQA 1FP6A 3NNNA 5EKXA 1TDJA 1USIA 1RI4A 1TQ8A 2JFUA 2I1WA 1RBQA 4PLYA 5F52A 3PRJA 3C0KA 3QUTA 3IVAA 2ZB4A 2XE6A 3IXQA 4D1YA 2ZITA 3N8HA 1QLWA 4M54A 4JODA 3RU7A 3JWIA 3AUJB 3TVDA 2O05A 4AMUA 4GP6A 4CTNA 3L8YA 5EQDA 4DEVA 3VC7A 4R7GA 4EHNA 1E3WA 2WJ4A 3E8XA 3M4NA 2PQ0A 4UVHA 2ZI5A 4ZQEA 4BFLA 3NOOA 3SZMA 3K5WA 3E3AA 1B23P 3KSUA 4EGJA 1C7QA 4D9HA 3GP8A 1KYTA 2N47A 1OA1A 3E9NA 1NUAA 1K6IA 5KNDA 2YZ2A 4PYKA 1U2PA 5B57C 3HHPA 2L0XA 4MW7A 5E6SB 3RT7A 4C0KA 1PK9A 4Y2YA 5TQVA 1B8UA 3I72A 4J1QA 3IR7A 3AILA 4MV0A 3UUFA 5KTSA 4D5EA 2PWZA 5KU7A 4GVLA 2WINI 1CR0A 3RTCA 3REQB 3RK4A 3ROZA 1LFDB 4PFSA 4JEIA 1TUBB 4MDHA 2V9CA 3GP5A 3S8MA 1IZYA 2P1RA 3CLRC 3K8QA 2ZETA 4C6TB 1IY1A 1X7WB 2JGMA 4TWBA 4EFMA 5L6MB 4DR4B 1AX9A 4GMFA 4EA8A 3CMMA 3EGDB 4PZUA 4BYGA 1A04A 1VLJA 2AFRA 3GJ7A 1VIMA 2WM2A 4U3JA 4TXJA 1ETHA 3E05A 3H05A 5D3QA 1H1LB 5DU2A 2P9TA 3KLPX 2HJWA 4DDVA 2G08A 2XIQA 4C0LA 1MOZA 1REQB 5TE9A 4EG6A 1TK3A 3CSSA 3PXBA 5C4MA 1BZYA 4LJ4A 4ENTA 2Z5FA 2ZCUA 4MB0A 1FL9A 1PDWA 2YUTA 1B4DA 2FLVA 3NX4A 4N6OA 2YIVX 4XR9A 5FYDA 4AY5A 4DMKA 1ZU5A 4OQPA 2J3LA 1XZAA 2ODWA 4UOQA 1AS2A 3D6UA 5DTJA 3SOZA 4JVNA 4LBZA 4CCWA 1AG9A 3QQPA 3QXXA 2X4DA 121PA 4O0LA 4V0SA 3TIXB 1FMFA 4IW3B 4W8HA 5BR4A 1DKQA 2ISSD 4KN6A 3GQBB 3ZXYA 1UPCA 1X3SA 2BCJQ 3ASZA 2RHGB 3B3JA 2N1MA 3LLCA 1JBKA 4C3VA 4MROA 4ISBA 2GLUA 2VDQB 3EGIA 4JVMA 4EH1A 2EKZA 2OHGA 5A4AA 5IEBA 1K4YA 4HY3A 3ZEAA 1BH6A 3CNHA 5KNDD 3JX9A 2Q7XA 1OXUA 1M8PA 4QDTA 2A92A 5LYJA 2EG5A 4DJAA 3RW9A 4PLFA 3TZCA 2AYZA 2WWTA 2RGGA 4FN4A 1DAFA 4WJZA 3WLLA 4YCCA 1PUXA 3D1VA 4NR0A 1MQ9A 1XRQA 1E64A 4D4KA 2QIPA 1L7PA 4MKFA 2HRZA 4I55A 4O2BF 1Q7CA 1GL3A 1KARA 3H86A 4B2LA 4MA0A 1VHLA 3LECA 4FYJA 5E3JA 1FSPA 2BFPA 1OAAA 5HKLA 5K0TA 2H1VA 3C87A 5AJZA 3GP3A 1K7EB 1P4HA 3E9YA 4MUBA 7REQB 1KZYC 4CCSA 1YDGA 2QVLA 5CH3A 5L8VA 4WNAA 4P7FA 4P80A 4A4DA 2QW8A 1SD2A 2VT7A 5ED4A 2HDOA 5ECWA 3AC0A 3QPAA 1UKAA 1G55A 2NYRA 3ZIAD 1QOPB 4WZZA 4QBIA 1QTIA 3DVRX 1E5TA 4DDKA 1KYVA 3JQAA 2CKDA 4ZMRA 5K8UA 3LBNA 1KAOA 3FNRA 4O29A 3WHIA 1AJEA 1JQBA 1FXUA 2PFKA 2ZW9A 4IDGA 5EXPA 5BR8B 2NUPB 5CFQA 1EU1A 1KDYA 1MIHA 1UWVA 1QHNA 2RONA 3PNBA 3X1YA 1NM5A 5LMNB 1LA2A 1EH5A 1VJDA 1S02A 1X1QA 3E5HA 4NAHA 4N9QA 5YASA 2QV0A 1I0ZA 3DOFA 3GMSA 1ZM2A 2DOKA 2NU7A 1PDVA 3RQIA 3SJZA 5KPDA 1LVGA 1CBUA 3ZJUA 3KPYA 1KU6A 2VRNA 3RAPR 4PRKA 3H3FA 2V1UA 1X8JA 3MUEA 1PWYE 4INJA 4O4HA 2J9XB 4O4IB 3KSBC 1R0SA 5BQ3A 3T3OA 1FFSA 2OZEA 3FA2A 4R83A 2P2LA 2Q4RA 4F2WA 4I66A 4DMGA 3UMCA 3COPA 4ZU6X 5FHRA 5CPBA 1TMYA 3LUBA 1E7WA 3A6ZA 3NQ41 4G5RA 5J23A 2FZWA 1FMLA 1BCRA 3BREA 5AUPB 1T9BA 3U5ZB 3HBAA 5FPYA 1R5BA 1DE0A 1JDBC 2BSAA 2R2AA 3O31A 3KE9A 1WA5A 4Y9DA 3X2SA 3OP4A 1X77A 4OFWA 1UM9B 4R1NA 4C5CA 2P40A 1V3VA 4AD8A 4CZ2A 5FOUA 3PNKA 1JJFA 2Y05A 3LCMA 2VC2B 2ZEJA 4BIMA 5DV9A 4O2AA 4X71A 4IS3A 4QQ8A 4XQGA 1SQ6A 1X92A 2QX6A 4FXOA 1FJHA 2ZJ7A 5LA6A 3WLQA 1KQGA 5IHPA 4D57A 1K7SN 5BQFA 4KPEC 3BCSA 3C4VA 3B1YA 2FZKA 3SEQA 5CFRA 3NIBA 2AG6A 3BXFA 4HVAA 4OQXA 1R6DA 3IDFA 4US0R 2HJ9A 3RVPA 3R74A 5IAJA 1V16B 1VBKA 4R2KA 5KNLA 3VTFA 2DM6A 1W94A 1Y98A 2F3SA 3PR3A 4ZVTA 1U3FA 1CK4A 1U9YA 4IYRA 3GN1A 3E84A 1V5IA 3QA3E 2VAVA 5DHFA 1MFZA 3G88A 3TZBA 4MVJG 4MUEA 3TLGB 3AH8A 3NOQA 3K9CA 3WADA 4TZKA 4L8GA 4WCVA 3BCHA 4R84A 3ZWMA 1OB5A 1HH4A 4FWIB 1DX6A 1E92A 2P4UA 4QDKA 2BC9A 3WIUA 4GVPA 3LJKA 1PFKA 3AKCA 2MINB 1JR3A 3CUWA 1SC9A 3Q3GE 1Q12A 5EXXA 3UJ7A 5KYXA 2YJGA 1RHJA 3VR3A 1F2VA 3WGVA 1GUDA 4Y0NA 1ZZGA 4CFZA 2PIAA 4KOAA 3LP5A 5LQUA 2Y1EA 4BN0A 3UV6A 1O96B 2FZLA 4CXMA 2VXCA 5AKHA 4AN0A 3BMNB 4D9JA 3ZZ0A 1DT3A 1KDTA 4MRNA 4XH9B 1R15A 5F1OA 1LK7A 2PZKA 4FOOA 3TQCA 2A1UA 2GCGA 4G1EB 4MV9A 4CBVA 3CLTC 1OYYA 3TVYA 4KQFA 3AIMA 3THWA 2OV4A 2J85A 2NUTB 3AFHA 1DBVO 5LBIA 5AW4A 4DY4A 4YRRA 4AKIA 4JOQA 3WOVA 4KO2S 2ZZMA 3K32A 3NVAA 1XVAA 2HY7A 3L6OO 2F8LA 4Z2YA 4IDOA 3PUYA 3TPCA 3ZWNA 5K2OA 3SYKA 2C3YA 2XOKD 3QW2A 3IESA 4CKBA 4Y7DA 4N0MA 1GUZA 2MR5A 4WESB 1NXOA 3HDGA 1YOVB 3QLJA 4HNAA 2EKLA 5AKKA 2OAP1 4QNMA 2C5BA 4IFIA 4TS1A 4IDQA 3JTEA 2ONYA 5DK6A 3V2IA 4G63A 1W4LA 2ZAYA 5JD3A 1GZ7A 4U9IS 2ZJFA 4BHTA 2VAWA 1QP0A 3KU4A 3KYIB 4H17A 1MAWA 3F5SA 1BW9B 1R8JA 3GGPA 4TLMB 1EDEA 1YVPA 1XZFA 1JR4A 1S8AA 4CTKA 1O6FA 1RXIA 2NQ2C 4ATNA 5REQA 4ZVSA 1WB9A 2NTEA 3GGDA 4AO6A 3QHAA 3DLCA 3CRMA 4LK3A 5HILA 4E22A 5LNK1 2QRLA 1QJ4A 1U3WA 4L28A 4MS4B 1KMHB 4UCFA 3NWBA 3VMMA 3OHSX 4RY8A 2Q5IA 4X63A 2G4VA 3MXTA 1VJ0A 1CHDA 1JR3D 1RAEA 2C4UA 2I2AA 3CT6A 3EZNA 3NHRA 3Q1LA 1KQOA 4FMCF 4HDSA 5IDYA 3DYBA 2BM8A 4TMTA 1T5SA 1V3QE 3TI7A 4RM2A 4BVHA 5BYKA 4XD7A 5KB3A 2Q4TA 3R8XA 2M9MA 5JE8A 3EIXA 4ES6A 3W5DA 1EP1B 1T9KA 3EW7A 4QBTA 3K0HA 2XCLA 2IDMA 2ET6A 4L51A 2AVNA 3TNFA 4MPDA 4X44A 3F7MA 3WWOA 4GZ6A 1EAYA 1VIVA 4NY1A 4F21A 5BPHA 3BMQA 5AWFC 1CJKC 1EUCA 4JGBA 4KAAA 3W2IA 5JD4A 3ME5A 5K20A 2Q1UA 1OIWA 2P79A 1GGHA 4PX3A 1IY9A 1Z4LA 3AM3A 4UHEA 3RROA 4E5VA 1QDEA 1ESZA 2QR5A 2VHXA 2Z56A 3UT6A 2O1EA 4LYYA 3VJKA 4L4SA 4D0NA 3WO0A 5JS6A 4NYIR 6NULA 4Y2UA 1FFCA 1Z5NA 1I4DD 4JQYA 3I6IA 4OI4A 2NO0A 1AC5A 1S8FA 3TCKA 3BMCB 3MTDA 2GB4A 1KJZA 5LIPA 1ID8A 1DVRA 1LF0A 1E98A 2H2GA 5HE8A 4CL0A 3LDAA 3MJRA 4M9XA 2TMGA 2VQ6A 1N3LA 2BR4A 2YWRA 4BNUA 4UHDA 3P9XA 2CC2A 4IIYA 2JA2A 3IBTA 4MKZA 3BF8A 3HA7A 4GM1A 3VNVA 5HVNA 2OC4A 1L5RA 4G4IA 2FEPA 1O94A 4N41A 2CHVA 2P91A 3NCTA 5H3CA 3ZGYA 5M29A 1V45E 3G0CA 1XK6A 1HDCA 4HDOB 3P9YA 3R4VA 4HGPA 2XHEA 5BWLA 2AKAB 5JEEA 4Z4FA 1SWWA 1ZR2A 3O95A 4BTLA 5BYJA 1G3RA 4XD7D 3GLIA 3EULA 3PGXA 3ECSA 5JT1A 2DJIA 2K7FA 4RK0A 1JQAA 3DR5A 5CH5A 1ES9A 1P7YA 2FQ1A 3EMKA 3RTEA 4L50A 3C5EA 4RVHA 5JRJA 1JTEA 3EVAA 3WNBA 4M98A 2J9GA 4PR3A 1XUOA 1QO7A 3KBBA 4F86A 5JCZA 4ZMSA 4F5YA 2CL0X 4KQIA 4KDEA 4NEQA 4P4TA 3KWFA 4KSCA 3F6BX 1JLRA 2XTAA 4FYHA 4EVRA 4BV3A 4HNTA 3G2PA 1XO1A 5L3RA 1V11A 3D8HA 1Y5NA 1UIMA 5DWQA 4M36A 3DV2A 4LUCA 3HNPA 2VUUA 1MZPA 1U4NA 1XD8A 2RHTA 4KCGA 3STWA 3UWOA 4FYWA 3AM4A 4HAOA 5KQMA 4YRPA 3AT1A 4IGFA 1YZTA 4QOFA 3T5PA 3MN1A 1XX6A 4OHFA 1VMKA 2OESA 1BU8A 4R40A 3G5LA 3NHLA 2Q3MA 1WBDA 1QUEA 5EJFA 4QBGB 4CMIB 3WLNA 5BNIA 3GJ3A 3OZCA 1H9BA 3IJEB 4EK9A 3FNIA 4C43A 3L93A 1XRRA 3I6MA 3OIGA 1Z56C 3PX2A 4EKDA 4B43A 2ORIA 1UPTA 3PD1A 4MJLA 5FNVB 1IDOA 1Q0ZA 1YNOA 3DAGA 521PA 3OIDA 2RHHA 1RC8A 1KAMA 1O94D 3ND5A 5A5EA 3CINA 5D5QA 2HHHB 1KI1A 4YUWA 1DKUA 1UP7A 5LOVF 1JWLA 2GK6A 1U4OA 3G17A 1GQRA 5EINA 1KY3A 3UHAA 3IJRA 2QQEA 5AMXA 4DR7B 1T15A 4ITRC 1FNCA 5A4KA 2PCJA 3EGWA 5C52B 1WF3A 1BMTA 2C96A 2IZ1A 2D2FA 1P2FA 1PSZA 2QWXA 3HV0A 3S29A 5DT9A 2O8FB 3S7TA 2WVHA 1R74A 3E5RA 4RX1A 5CNIA 3B2NA 3IXLA 1PW7A 3DHEA 4IO0A 4ZU1X 3AHEA 1KORA 2XNKA 1E5XA 3AV3A 1U7XA 3BL8A 2HXSA 3DMTA 4MQMA 4YGXB 4ND2A 1Z34A 3UG7A 1M1YB 3EJWA 1QFXA 1ONNA 1BJTA 1JHAA 4HDRA 1T5IA 2XX3A 3AHCA 3BA6A 4REQA 1A5BB 3WV4A 3ZBPA 3OTIA 3T1NA 2Z1MA 4BNHA 2O14A 1ZJJA 1EPUA 3AIKA 4D82A 1GZ6A 2QP9X 1PT8A 1NW9B 4Z3KA 2OK7A 3MBOA 2ZRAA 4PTYA 4P2BA 3LY8A 1QG2A 3CVYA 4N49A 5H7XA 1X80A 2WSIA 3D5QA 1CQIB 2N75A 5ERGB 3WIOA 4K28A 3ZNPA 3M1AA 3CCCA 4B85A 3ER9A 1T13A 1R9NA 1MDBA 2CXPA 3W7AA 2PBLA 2ERCA 4QYIB 3FOAA 3DLBA 1Z0JA 2H65A 1NBME 1R4MB 1NE7A 2O1SA 4GAEA 5JTUA 2PZBA 2WW8A 4WFIA 2W6PA 1TXGA 1RWOA 2ZIUB 4QEDA 3BWDD 5F12A 2OLKA 2C9OA 3O1IC 3QOXA 3L7NA 4HQNA 4B3TB 5LQNA 1XI2A 1DBSA 3WKEA 4TT8A 2FPPA 2J4CA 5F3RA 5HQTA 1F6WA 3CEAA 3EMDA 5KYYA 1NJ5A 1L5WA 3IDOA 4KVFA 5HQJA 5CCBA 4LGVA 2GEJA 4YJGB 1CRWG 4IIJA 3R7BA 3QOFA 2QX8A 3AERB 4KQ9A 4CF5A 5LYJF 2PGLA 1WEHA 3M3HA 1FRZA 3P4UA 3H2HA 3GRAA 3HUTA 4FMDF 4S1NA 3RGGA 4C4SA 5J5AA 1B6RA 1T0JB 1WV0A 2AXNA 4RZ3A 4B45A 1USWA 3C3CA 1D4OA 2IZ7A 3V9AA 1EGAA 5D3ZA 4CIDA 1U3CA 1NUPA 2RI1A 2JVIA 1SM4A 2HO5A 3O9ZA 1ZNXA 1D5CA 4MITA 1Q0PA 3E53A 4ZEMA 4PINA 4FOPA 3SC2A 4XVUA 1FYWA 3CN9A 2RMKA 4F72A 2XLCA 1XNHA 2JANA 2QUIA 4NDZA 1ILWA 1X3LA 3WGYA 5ISMA 1BG6A 2I66A 2J0UB 1Q11A 2QYTA 1AGNA 1G7RA 4PFKA 3HB5X 4QL3A 4EY4A 5H82A 1YZHA 3WV5A 4F46A 1G8PA 3OKPA 4KZPA 4DN6A 4ND3A 1CUEA 1PLKA 3ZGVA 1EM6A 1ULTA 2B34A 3N6XA 5DMXA 2FEMA 1IPHA 2WIDA 1ZBDA 4MKGA 1P73A 2C61A 4GOOD 4J16C 4JYMA 2NU9B 3T5GA 2SECE 4YJFA 1HY3A 3MMZA 4AZVA 4YUXA 3GLFA 1ARZA 3KKQA 2IY8A 1NLFA 3RBAA 1LBQA 5TPWA 4DG8A 2BJHA 3KR2A 4IMPA 5JLJA 2CFOA 1PZMA 1P5FA 4DUGA 3VAZA 4EYGA 1KWGA 2FJUA 4EG0A 4M2LA 3UWMA 5FWYA 3JRWA 2XUDA 3EEIA 4LQDA 4ISCA 2GBIA 4NBVA 1S5PA 3C2QA 4WOPA 4BQPA 3DUFB 2XT9A 2PUDA 4CQJA 1N6NA 1N5JA 4M37A 2RGNC 5LP6B 3O8DA 1DCFA 2D1YA 8ABPA 5LWQA 4OK5A 3PGA1 5JADA 3DCIA 1DMSA 1LBSA 1EGVB 1UEIA 1VSBA 2OV3A 2WSLA 1E1QD 4URHA 3VYTB 4F8EA 2AN5A 2PGAA 1CEXA 3ODPA 3EXFA 4BNZA 1UQTA 5JQWA 1IXKA 3FWYA 4P34A 2WSYB 2H4YA 1ZAYA 4UJ3A 3EC7A 3DQPA 2ST1A 1ZR4A 3SVLA 2GFIA 3U4IA 1F2DA 1RVDA 2VHEA 1D07A 2GEBA 4BO1A 1ESEA 1S6YA 4Q9AA 5TNXA 5CBPA 2HYDA 4UKDA 1SXJA 2PL3A 3RSOA 2ZYIA 2D7DA 1NVEA 1OE0A 3BFPA 5K99A 1Q92A 2YWJA 3H99A 1NZFA 1P44A 4GM4A 2XODA 4BFXA 3IV9A 2R9VA 2VSNA 1MBZA 4JY7A 1Z5ZA 3OMXA 5BR7A 5AVYA 3IAM6 4YC7A 1P2BA 1A96A 3WK8A 4GECA 1YJBA 4XWKA 2P9CA 1Z5UA 3OT1A 4TN5A 3SZRA 5C3MA 3ZDCA 3PG5A 2ONZA 5KQSA 5KX5A 3ANXA 2AFHA 3TD9A 5KSWB 2E6UX 1T36B 1R3UA 2X8WA 3DBHB 1XZJA 4HNHA 5DMHA 4ZD6A 1QRD