5K01A

Crystal structure of comt in complex with 2,7-dimethyl-3-(1h-pyrazol-3-yl)imidazo[1,2-a]pyridine
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
214
structure length
214
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of COMT
rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Catechol O-methyltransferase
total genus 75
structure length 214
sequence length 214
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5k01A00
2QM3A 4RSRA 2NP7A 3EEOA 2PXAA 1VQ1A 4KIFA 3KR2A 3TMAA 2ONZA 2ZWVA 3HCCA 1KYWA 4Y2HA 3TOSA 1XTPA 3LBYA 3EVAA 3GRVA 1NKVA 1NV8A 5LQRA 3P9KA 2WA2A 3KPWA 3MTEA 5DPMA 4AZWA 1I1NA 1Y8CA 5EMJA 2ORED 3Q87B 3KQMA 4P7KA 2ZBPA 2IBSA 1JG2A 3AXSA 3KR9A 4LECA 2N47A 4RVFA 2Q41A 5HIJA 2NXNA 4LG1A 3FYCA 5GM1A 2UYOA 4RTNA 2O06A 4FT2A 3G2QA 5EIFA 1N7JA 2JHAA 1R18A 5DSXA 5EPEA 3FRIA 4IKPA 3SM3A 1RJFA 1SVUA 2ZIFA 5DTMA 3Q7EA 5E2AA 5FQNA 2ZBRA 1I9GA 1TW3A 3GRUA 4CKCA 4YUYA 5LQNA 1SUSA 2IPXA 4X61A 5E8RA 3RIEA 5HILA 2EJUA 3SMQA 2UYCA 2G1PA 3DH0A 1YZ3A 4KW7A 1VPTA 1ZHFA 2O07A 4GQBA 5FHQA 2JH9A 1RJGA 3BWMA 5E1MA 1DUSA 4DCGA 2C7RA 4CXMA 4ER7A 4BLVA 1QAMA 2ERCA 3IYLW 3FYDA 1V39A 3HNRA 2CWWA 1IXKA 3BGIA 2F8LA 2PV0A 5E9QA 2PKWA 4M38A 3EGVA 2GH1A 2FYTA 3OPNA 4PONA 5EGSA 3GRRA 1X1AA 3BGVA 3G2OA 4O29A 1N7IA 1QZZA 1R6AA 1NT2A 3OZSA 3AWIA 3C6MA 3T7RA 2DULA 3A25A 1D2CA 5DT2A 2OPBA 5FWAA 3G2MA 2OY0A 3UJ9A 3UFBA 5CD1A 2BZGA 4FSXA 3UWPA 1G8SA 1H1DA 1JR4A 5EZSA 2VDWA 3VC2A 3SX0A 1BC5A 1HMYA 3A26A 3DLCA 4DMGA 4PWYA 3G88A 4FGZA 1EIZA 2PWPA 2O0LA 4GOND 3CJRA 3JWGA 4MTLA 3PS9A 3HTXA 4GUAA 1Q0TA 4HC4A 5EHGA 4ER3A 2E5WA 2QRVB 4B17A 3BKWA 4RTPA 3V97A 5KQSA 3O7WA 5DLYA 1XJ5A 2OB2A 4X60A 4YUVA 3P2EA 4AZSA 3BT7A 4LWPA 2BR5A 2O05A 1P91A 2Y1WA 4QTUB 3EGEA 2AN3A 3OFJA 2YX1A 4CKBA 2ONYA 3LPMA 4PCLA 4RVGA 5ERGB 3P8ZA 1EQAA 2YXEA 2YR0A 1FP1D 3BUSA 1KXZA 1XDUA 3KPJA 4PYQA 9MHTA 4L7VA 4X63A 3G8AA 1KPIA 4P58A 2VZ9A 4DCMA 3FUXA 3ELWA 3LKZA 1BOOA 4OA5A 3GCZA 2UZ4A 1VE3A 5G02A 3UJAA 3O4FA 1JQDA 5E9WA 3MCZA 5E1OA 3GWZA 2PLWA 5DRTA 2IH5A 4BP1A 3RW9A 3EGIA 3DMHA 1R8XA 5CVJA 2A14A 4PYNA 2ZTHA 2BR4A 3FUWA 5JUWA 4U7TB 1X1DA 3GJYA 5DM1A 1YFLA 3CC8A 5GWXA 3MHTA 1VL5A 1X1BA 3T7TA 1ZG3A 2AVNA 2PGXA 2K4MA 4C03A 3KR0A 2NXCA 4PNEA 2QYOA 4GC9A 3IHTA 4OQEA 1BHJA 3BWCA 5CIYA 3B5IA 1VP3A 2ZW9A 1PJZA 3OU7A 3BWYA 3L8DA 5HIKA 1RI4A 3R3HA 1D2GA 2WA1A 1IM8A 2VDVE 4IV0A 2G71A 2H11A 1M6YA 3HM2A 5HFJA 5HOQA 2PWYA 5DM2A 3ANXA 2Y1XA 4ER6A 5EEGA 4MHTA 2I62A 3LL7A 2QRVA 4RTKA 4YV1A 4DF3A 3OU2A 3SVZA 3B89A 1EG2A 5DX8A 4OX9Y 2ZWAA 1FPQA 1ZKDA 3I5UA 4E2ZA 3PB3A 4Z2YA 3DTNA 2PX4A 5FQOA 1DCTA 1NV9A 1KHHA 2YQZA 3H2BA 4GF5A 4HH4A 2EG5A 1G8AA 3HVIA 3X0DA 3DLIA 3HA3A 3B3FA 3M6WA 1R8YA 2JHCA 2P3QA 3P97A 2PY6A 4QPPA 5DX1A 5HZMA 1JQEA 2WK1A 5ICEA 2ZZKA 3M6XA 5FTWA 1TPYA 2HWKA 1RJEA 2ESRA 1NBIA 2AOXA 3MQ2A 5F2KA 2VS1A 5FHRA 2OO3A 2ZIGA 5T67A 3ELYA 3UA3A 4GOLD 3ERCA 5ICFA 3G7UA 2FK7A 3QOXA 2ZBQA 5FCDA 3I53A 4AX8A 4CKEA 4DZRA 3NDJA 3OZTA 3OE4A 2AN5A 2GB4A 3FUTA 2JG3A 5CCXA 4QDKA 4IV8A 4QVGA 3SXJA 1L3CA 3KQSA 3LSTA 3WSTA 4EQZA 5M5BA 3OFKA 3LHDA 3M6UA 3P9NA 5U4XA 1D2HA 3D2LA 4GOOD 2B2CA 5H02A 3U81A 1JG1A 3UA4A 2GPYA 1JTEA 3ELUA 4HSGA 5EC8A 5K0GA 4C4AA 2P7IA 4GEKA 2C7QA 1RI3A 1XXLA 3EVBA 4ER5A 5FUBA 3DUWA 4GOMD 3TRKA 1NW8A 5CM2Z 1VP9A 2PX5A 3BGDA 4GC5A 2PX2A 5CVEA 4F85A 4UOEA 2EJTA 3V8VA 2CKDA 3KPUA 2P35A 4FSDA 1T43A 5FWDA 3TM5A 5KVAA 5EQJB 5ICGA 3FTDA 4LWOA 3VYWA 3HP7A 3AXTA 2CL5A 3KQYA 2AOVA 3HA5A 3O31A 4FP9A 4HG2A 3M33A 4PYOA 3UJ8A 5K03A 1YUBA 2HR1A 5K0LA 3GRZA 4C07A 3EVZA 5CCBA 5BW4A 3E7PA 3I58A 4YMGA 5LQJA 3NWBA 4FS8A 2VDUE 5FA8A 1UIRA 3KQVA 3FUUA 5C1IA 5E2BA 3C0KA 5KS2A 3KQPA 1WY7A 2H1RA 2ZZNA 2ADMA 2P7HA 3CKKA 3SSOA 3PX2A 2BH2A 5T6BA 3FTCA 1M6EX 2NNWB 3LECA 5EKUA 4R8SA 2YUIA 3EMBA 2P3OA 2OBFA 3PT9A 1L3IA 3UJ7A 4DA4A 1U2ZA 2ZZMA 3NVKI 1AV6A 3AY0A 3HCDA 2IBTA 1IY9A 3A27A 3I9FA 3KHKA 4RTOA 5EVJA 3HVKA 2PXCA 1YB2A 3MTIA 5K8VA 3E05A 5LQKA 1O9GA 4DQ0A 4QTTB 5FADA 4MWZA 5GINE 2IIPA 5KYGA 2YTZA 4HGYA 8MHTA 1PRYA 4PIPA 3ER8A 3G8BA 3EVEA 5DM0A 4R8RA 2UYHA 3PLAE 1L3BA 3UJBA 5F2OA 4HTFA 3CGGA 5EG5A 1DL5A 4DKJA 2ZSUA 3FPEA 3OE5A 3LCUA 4X1OA 4PYKA 3SSMA 5K01A 3TKAA 5DTRA 1R00A 5BXYA 3THRA 4QQKA 4WVLA 1NE2A 5LQUA 2ZLBA 2YXLA 1NW7A 3JWJA 3PTAA 3P2IA 2IDJA 3UJCA 1ORHA 4R6XA 3MAGA 4F86A 4RTJA 2Z6QA 4AZTA 1JTFA 2BR3A 5DRYA 2NYUA 2AOTB 2HMYB 3FPHA 3P2KA 5DWQA 3MGGA 4YMHA 2XYQA 5LSAA 1XVAA 4QPNA 2YXDA 4QDJA 4V0RA 4KIGA 5DXAA 3BWBA 3R0QA 5LQCA 4EKIA 4E32A 1ZGAA 1WXXA 4R6WA 3HVJA 3LKDA 1RI1A 4RVDA 3M70A 5GOZA 2HNKA 2FK8A 3OU6A 2B3TA 3FPGA 2YVLA 3TLJA 5HIMA 4C06A 5EEHA 3MCTA 1KPHA 4E31A 1RI5A 4HTFB 2ZIEA 4RYLA 1O54A 2PBFA 3GO4A 4BP3A 1JG3A 2HTEA 3KPYA 2IP2A 3PFGA 4OQDA 3HCAA 4E2XA 3TQSA 1JG4A 1JSXA 3HEMA 5K09A 3C3YA 3FTFA 5GIPE 3S68A 1SQGA 2P8JA 3NW9A 3UZUA 1INLA 1TW2A 2PXXA 5HIIA 4PGGA 1KYZA 4POOA 5DX0A 5MHTA 3NVMB 3KQQA 4AUKA 5K05A 3UBTA 1WZNA 4OBXA 3DOUA 5IH3A 2I7CA 2GAFA 3ELDA 4H0NA 5E1DA 1SKMA 2CMHA 5FULA 2G70A 4YV0A 2QE6A 1SQFA 4PCAA 3TR6A 1HNNA 1F3LA 1FBNA 1SUIA 1NW5A 3CJQA 2Z6UA 1UWVA 4XUCA 3A7EA 2C7PA 4EMSA 4RV9A 3DP7A 2IFTA 3VC1A 3HCBA 3HCEA 2IH4A 4YUXA 1MHTA 1YZHA 2FHPA 3MERA 5DM4A 2AR0A 1G38A 1KR5A 2AOUB 3NDIA 2BM9A 4X41A 3GGDA 3REOA 1JSZA 2PT9A 2OXTA 3NTVA 2AOTA 4RTQA 1MJFA 3PVCA 4OA8A 3NMUF 4QQNA 1ZQ9A 3TFWA 2R3SA 3B7PA 4MIKA 3LDFA 4ZTBA 4HGZA 1G60A 2OB1A 4RX1A 4FZVA 4XUEA 3CCFA 3EVCA 4AZVA 3KPVA 1P1BA 3DULA 4YUZA 2EFJA 3LDGA 2Z6AA 1Z3CA 1XCJA 1OR8A 2FCAA 2G72A 4P7FA 1F38A 2PT6A 3DR5A 3M6VA 4EVIA 2B78A 4DM3A 4RTRA 3R6TA 3FPJA 5EZQA 1YFJA 2JHPA 4HRAA 3A7DA 2FRXA 3EVDA 2P40A 3IV6A 1QAQA 2O57A 5EIWA 3CJTA 4RWZA 4XCXA 2LD4A 5B1SA 7MHTA 1KIAA 3GXOA 5EMLA 3PX3A 2AS0A 4M37A 2JH8A 4YUWA 5D1NA 5CVVA 1Q0SA 2B25A 1YF3A 1X19A 4A6EA 2AN4A 2EX4A 1NBHA 1QYRA 4M7RA 4A6DA 4F84A 3K6RA 3KQTA 3EEYA 1VLMA 3GIWA 3GNLA 3HA7A 3P71T 1O9HA 1NW3A 4Y30A 2I6GA 2OKCA 1UFKA 3KQWA 5E9JA 4XUDA 3P9IA 1N2XA 2AOWA 4PGHA 2XVMA 1XDSA 5C0OE 5P8WA 5HEKA 4FT4A 3RODA 3HCFA 4BLUA 5DTQA 4WXHA 4YV2A 2GLUA 5DXJA 1AQJA 2GA9A 4KDRA 4OBWA 2XYRA 3TKYA 4CWAA 4U7PB 4PINA 1VIDA 2JJQA 5E1BA 5BW5A 5K0EA 3ID6C 3EPPA 3ME5A 3R9XB 3UJ6A 2V74B 2PVCA 3ORHA 2ZULA 1AF7A 4KRGA 1P1CA 1EAMA 3B3JA 4BLWA 1L9KA 5CVDA 4ER0A 1WG8A 4EK9A 5LR6A 5F2NA 3ER9A 2P3LA 2UYQA 5GP1A 5K0FA 3G2PA 1FJXA 2PJDA 4RTMA 3F4KA 4ATNA 3G5LA 5EMMA 4RTLA 4E2YA 2PX8A 3B3GA 2VP3A 3LGAA 2DPMA 3LCCA 3K0BA 1WXWA 1SG9A 3EVGA 4E33A 1WS6A 5K0JA 3T0IA 4E30A 1QANA 3VSEA 2BM8A 1M0EA 1KP9A 3JWHA 3EVFA 4G56A 2NXJA 3KU1A 3I64A 5CUQA 2PSSA 3NJRA 4FR0A 4M36A 5EMKA 2ZFUA 2CMGA 3DXXA 3KQOA 3M4XA 3GU3A 3KR1A 3QV2A 3CBGA 2FPOA 2P1DA 2KW5A 4GBED 5GM2A 2AVDA 5BP7A 1JQ3A 4C05A 1G55A 1QAOA 2ZVJA 3PFHA 4QVKA 2NP6A 2B9EA 2XVAA 3BXOA 3OCJA 2IH2A 1KPGA 4C04A 1B42A 1FP2A 3MB5A 3BKXA 4MQ4A 1VBFA 4P7JA 2OZVA 1RI2A 5E8JA 2QY6A 3DXZA 3IEIA 3R24A 3DMGA 4E2WA 4JXJA 1NW6A 5DSTA 10MHA 2GS9A 4PYJA 1I4WA 3NWEA 4R05A 1G6Q1 3SR4A 4V0QA 1P39A 3P9CA 1EJ6A 3CVOA 3DMFA 4BY9E 3AJDA 1ORIA 2G8NA 3DXYA 3HVHA 5K0NA 2H00A 5EOVA 5FA5A 3FPFA 3JWIA 4EKGA 3LX6A 5K0BA 5T64A 2ZCJA 3KKZA 5EKXA 4PIMA 2V7EA 3BZBA 3TM4A 3LDUA 4P7GA 3G5TA 2OYRA 1XCLA 4PYMA 3SSNA 2NXEA 1EJ0A 1RJDA 1R74A 3LCVB 3C6KA 4PYLA 2HV9A 4KDCA 5CVUA 4IWNA 2P41A 3QOWA 5ICCA 3GDHA 4CTJA 1BKYA 4K6MA 4RTSA 4PYIA 3FUVA 4RVHA 4ISCA 5EHIA 5JR3A 4C08A 1XDZA 3OZRA 3UJDA 2C7OA 3GRYA 2IDKA 5C9ZA 4E70A 3FRHA 2AZTA 2XYVA 4KVZA 3E8SA 3FTEA 1ZGJA 2I9KA 2IGTA 4KWCA 1L1EA 4NECA 3FZGA 5IKMA 5LQAA 2XBMA 3A4TA 3G89A 3C3PA 3TPZA 4CTKA 5KQRA 3E23A 3T7SA 3SGLA 5GIOE 5D1HA 1X1CA 1AQIA 2AOUA 3THSA 5K0CA 3LBFA 2R6ZA 3EMDA
chains in the Genus database with same CATH superfamily
2NP7A 2H16A 2YJNA 4HXFB 3V32A 4D1YA 1J20A 2PSFA 3H99A 2RSLA 1I3KA 2RI1A 1WMBA 2ST1A 3N87A 4J49A 4TT8A 5T5QA 4ZIRA 3EHEA 1KFEB 2Q0QA 2PZEA 4QXOA 3RU3A 2OCGA 4GQAA 4CQMB 3N2ZB 1ZMRA 2YY5A 5HJ7A 5JXGA 4IZOA 2HL6A 1BDJA 2JL1A 3FFAA 3K1JA 3VMFA 4AZWA 3H19A 1KRXA 3K2BA 4FYPA 4QOEA 1NQUA 3O8QA 4P0PB 1I3NA 1CFJA 1Z33A 3PC7A 3V4OA 5L7WA 4R1PA 5AK6A 2CCJA 4ZVLA 4BO5A 2UYOA 2ONJA 1O9BA 4M9XA 2IZ5A 3G2QA 1R18A 3WB9A 1MVLA 3RV3A 4ESHA 3KSDO 3Q7EA 3BOSA 1OBFO 5LXTF 4CKCA 2O4CA 2IXDA 4YUYA 3Q40A 4WKCA 1Z2EA 8ATCA 1DIBA 3WLTA 3IR7A 5B37A 5I7UA 2XDQB 1OSNA 1Y3FE 2Q4DA 3TJZA 1HBJA 2QAGA 1PEDA 2G1PA 2OE2A 4R1LA 3ZPXA 4BQPA 1GL6A 2BEVB 2E55A 1BKSB 3RSFA 2HWUA 5E3JA 3OECA 3QI7A 4BLVA 1OJLA 2O50A 1GNLA 3NFRA 2OBXA 3WHPA 4HRXA 2YV4A 2ACKA 4A0QA 4M1SA 4ILKA 1LSSA 3PGVA 2QV7A 3GLHA 2HK7A 2OLKA 3I5XA 1RBMA 16PKA 2BMFA 1R8SA 2R7AA 4BQIA 3CB4A 4GP9A 1BXRB 2OESA 4JR2A 5HJ5A 4EM6A 4CLRB 1MOPA 2Q29A 1TVKB 1JVSA 5LA6B 3FDIA 4I7EA 2O0LA 3HWWA 4MTLA 1P45A 1Y7IA 1T8YA 3ASUA 1P7CA 4C7JA 5EHGA 4KAFA 4LDNA 4CV2A 4OLHA 3RTBA 1J0DA 1CBUA 1XJ5A 2PMDA 3BQMB 4BWVA 3CZRA 5FOQA 3UIEA 1YMUA 3FHCB 3OKPA 4LWPA 5CCDA 3T1YB 1I0ZA 3NBFA 2C2GA 1SRRA 5F3DA 4IGEA 4P98A 3OWOA 2QXYA 5KC9A 3T9FA 1ZHHA 3IQHX 3FRJA 1LPSA 3R76A 2CLHB 3NBYC 2GM9A 3ZIAA 3ONWA 3EODA 3DVRX 1G6HA 3FKSA 1TVEA 2P5TB 4MGZR 5A3JA 2FRDC 3ZXXA 1ATZA 4JBWA 3DMPA 3K7EA 1NVEA 1MGOA 3QVOA 3MMXA 3Q7TA 3O3NB 1QYVA 4B8ZA 1JR3E 3L0PA 4ZQCB 3UHOA 1G7SA 4DHEA 3TIIA 3EZ2A 5G1PA 5TVKA 1RMQA 1QGAA 5BURA 3DMHA 5IARA 1N6IA 1M7HA 1M72A 4HBZA 2A14A 4LXHA 1PQ4A 2BR4A 4OX9B 1JR2A 1HLPA 1Q3KA 3SS9X 2PVPA 3FNGA 5KNLA 1B8UA 2QMZA 1NUQA 4ZI7A 4HQ6A 4JUCA 3L46A 3U39A 1JDJA 3A70A 1ZMXA 2ZSBA 4E5YA 1H23A 1WCV1 1QOPB 3VO8A 4TTVA 1SY7A 1MEEA 2PLAA 2WVJA 4HHEA 1N6RA 4CF6A 4FYIA 2P75A 3IAUA 4RLSA 4REQA 4WUTA 1OV4A 3LX5A 2ZGVA 4WZ6A 3RJZA 1M6YA 5LZ2A 4BV2A 3PEVA 4OM7A 3MJVA 1RPJA 4TZKA 1EVQA 2Y1XA 4WOCA 4B3XA 4J0DA 1KBQA 4F3YA 3C5WP 2A7QA 5BSKA 3X1XA 1VPDA 3D64A 4X8LA 2F1IA 2EF0A 3V1KA 5CFNA 1N2CB 1TZJA 2C3MA 3OP1A 3T15A 3U7IA 5JO0A 4EYEA 3U4AA 2J0VA 1VOTA 2WBLC 4JB3A 3QUCA 3FROA 1NV9A 1FPMA 3U19A 5AUNB 4DCNA 2YW2A 3OQJA 2I33A 1ORVA 3AM3A 2SECE 2IJGX 1LSUA 3QF4B 5FLKA 4QFMA 4FYXA 2IHKA 3NJ4A 3PYXA 3W2IA 2VHVA 3GJZA 1YZVA 3CIFA 1H9AA 4MWDA 4OHWA 3MT0A 5A6VA 1VSVA 3DWGA 4UFNA 1NBIA 1XQVA 4CLDA 3QK7A 1Z6TA 1LLCA 3UTCA 3UV7A 3UAGA 1EQUA 4HGRA 4IH1A 1Z7YA 3F96A 1ABFA 3D6JA 2RHOA 3C5HA 2YHIA 4GP6A 4O4LA 4CM5A 3KT0A 4JC4A 3I53A 4CKEA 3OZTA 4O6VA 5IHPA 1Q20A 4C20A 1T1EA 2PRIA 4ZEMA 1E8DA 1W9MA 3S4YA 4IMJB 4PN3A 2K2QB 2BTOA 1FS4A 3T4EA 5M5BA 3D4PA 1H66A 3PG5A 2A6PA 2KB0A 1C4WA 5MFZA 4Q7EA 4FHZA 3CZMA 3NIDB 5FL3A 1P2GA 4N0EA 3WBKA 4CGZA 3IPCA 3QX9A 4MVXA 4MJLA 1MO3A 3ZWOA 1P1HA 1SKYB 2G25A 4IIVA 1LDGA 3EVBA 4R1UA 5HKBA 2VWGA 4W1SA 1A9XA 4UARA 1J0BA 1Z6GA 4OMUA 1FQKA 1V9LA 4Q9IA 1F6WA 4MDYA 2V65A 3NBKA 3BGDA 3M9XA 4OHOA 4EKDA 2WF6A 2R1UA 2IUSA 2I03A 4G5XA 5IAKA 3FHJA 2BM1A 1A7AA 1GIAA 1XG5A 1ZITA 4QOIA 2D00A 1WY5A 1ZC4A 3GMIA 4LXTA 4N8EA 4Q9LA 3ZW8A 3AR9A 1C9MA 1DCFA 4DLBA 2HA2A 3C4QA 4U2CA 1WDMA 2W2VA 1LBHA 1HDIA 2VP0A 2IYWA 2FFRA 3O1IC 4HG2A 1I7DA 3TTSA 3UJ8A 4L95C 3C7CB 3GRZA 5I9TA 3EVZA 2CUNA 2OD2A 4U2FA 5D8DA 3L79A 3I58A 1Z4MA 4KE7A 5CT8A 1TKAA 2OHHA 2UUPA 3DE5X 2VDUE 3E70C 1DEKA 1C0IA 3GFBA 2NPFA 3FUUA 3WYBA 1QVWA 3RJ9A 2UXDB 4Q66C 1EFUA 1BQ3A 2A35A 1U0NA 3E81A 3TZLA 2VAPA 3R3VA 3HO6A 3NPMA 5JNVA 1RP1A 4BE9A 2FWRA 4KU4A 1U63A 2N0SA 1Q84A 3I1JA 5DMHA 5KVVA 1ODLA 4P2GA 5JZ9A 1G5QA 1YR2A 5A0TA 1F20A 3NAQA 2X8JA 1JAYA 1VBKA 4B2LA 1QNFA 3STTA 3NVKI 4F2DA 1BJRE 1GCOA 5CYOA 5EE5B 1QRDA 2YVKA 2OBBA 1SM4A 4IDQA 3F7NA 1JDBC 4ZOLA 3KZCA 1UWCA 2PBRA 4JP5A 4AMBA 4YCDA 4MWZA 4D8WA 4LHWA 1WSAA 2ZXUA 3MOSA 1V3UA 4FIZA 2H59A 5IF9A 2JEZA 5T8KC 1SAYA 4MYRA 4GZ5A 4QXAA 3PQEA 1PUIA 2NU7B 5CH3A 3GRKA 1U0GA 1DINA 1IG3A 1KZ1A 2POCA 2VN8A 5L3ZA 4KR6A 3FKJA 3GRCA 3M2TA 3PNOA 1KMCA 5LZ7A 3DV2A 3IKMB 2EFHB 3TR5A 1X1EA 2NT3A 4WKBA 2QXTA 4IG4A 4JBLA 4ZYXA 3DDNA 3MLAA 1U0HC 3EA0A 4WVLA 1QZXA 5ALSA 1OFUA 4R40A 2Z1NA 3I04M 6CHYA 4J1SA 1LH0A 1R5NA 5ENZA 1DP4A 4LE0A 4ZGBA 1WW8A 3CX6A 1YASA 5CURA 1UJ4A 4Z8YA 4CG0A 2VDRB 1VA5A 3E27A 5LLDA 1WHSA 4C7XA 1JEQA 3LW8A 5COBA 1ZN9A 4ZU1X 1QF9A 4U63A 3IILA 1YGYA 2J33A 4AKSA 1JB1A 2WP0A 1Y9AA 3L5OA 3PQ5A 3SY8A 3NWJA 1SURA 1OUMA 4LNAA 3IP1A 1CZUA 2CNOA 4ND5A 4ZCLA 5JS2A 3ZVLA 5JAOA 1JE0A 4RY8A 1HPLA 4ZXFA 1KRHA 3QY0A 1U02A 3QE3A 4Q9AA 3AOEC 2YDYA 3OU6A 3A3NA 1PZEA 1CUCA 4ZO8A 3S2YA 2IEIA 4NQZA 2BY4A 1SVMA 3SE7A 2HTEA 3PTZA 1LBTA 2VHXA 4KP7A 4RENA 4EIWA 2O5CA 4NE7A 2RH4A 4Z4HA 2OSBA 4DC1A 4B3SB 1E7SA 1KJJA 3V8RA 3AL0C 3QWIA 3L8EA 4XRRA 3LTNC 2RI0A 2XODA 2A5FA 4LPKA 3FCCA 4X45A 3GT4A 4FFPA 4O2BA 4MZXA 2XA1A 1WKBA 4KJXA 5JCZA 1PKEA 4WDRA 2WJJA 3BX1A 4TT3A 2WM2A 2QM7A 4M7WA 3TR6A 4S35A 2QRKA 3OQVA 1BGXT 4YP9A 3TFQA 3O3MB 5AJWA 1NJSA 5J2TF 4RV9A 3M34A 3HCEA 3NNDA 4H7PA 1MHTA 3GCGA 4TXHA 3G13A 3S1AB 1IBLB 2QRUA 4ZAVA 4UTNA 2JCBA 3DVSX 3REOA 8LDHA 1R4NB 3L3BA 3BCHA 2QEQA 2CZQA 3DFZA 1P2FA 2AOTA 4U2BA 2JI6A 3WIDA 5A4IS 1QS0B 1KDRA 2PUBA 1X9HA 2VK1A 4TMWA 1M2JA 4E51A 3GJQA 3HDGA 4KBGA 2WJPA 3GBVA 4MV9A 3BGOS 5EXTA 3V7WA 4E6PA 4QODA 1P1BA 1K06A 3QGMA 1T2VA 1TT5A 1QGED 2ZOSA 1QGZA 1H4SA 1U90A 2P9BA 4L27A 1MX1A 1ZUNB 4N9WA 5GGYA 3ZQKA 3TW8A 1R6TA 2H52A 4GSYA 2SKEA 4IFTA 4O63O 5FJIA 3RYHA 3ZCTA 1MOSA 5A0VA 2PSHA 2GEUA 2ZWIA 5IAEA 3VSCA 3P5SA 1KDTA 3UY4A 3PHGA 1Z4IA 1QAQA 2WYWA 3L0ZA 4MZDA 3BBPA 1AUVA 3RADC 1JJBA 1B93A 1K27A 1N6NA 1RQPA 2JA1A 3C41J 4OAOA 4H1WA 1A8UA 4PLVA 2DVMA 1I0IA 1WQ3A 3VSDA 1RCUA 3HADA 4GECA 4J2OA 1NX6A 1LDNA 2C8VA 4UQOA 4CQLB 1CQPA 2J9GA 1VLMA 1BJKA 3QUSA 4LRQA 1A50B 3VR6H 4V38A 1T0BA 3AHGA 3FCAA 5DLEA 1JQKA 4TMTA 3S8EA 3OBBA 1KTIA 4ANFA 4MW1A 3H4TA 4BHTA 3OAAA 2GLUA 3OX3A 1FUKA 2P78A 5LP6B 2RG7A 1QIHA 5EJ8A 2CL7X 1AQJA 2WFLB 1F51E 3OTOB 2PU5A 2SCUA 4LRYA 4E7OA 2RI6A 4CM9D 5IM4A 4YS6A 3RVRA 4NS4A 1UZLA 1K75A 1KQNA 1EZZA 4FFVA 2QJWA 4RLHA 1DTWA 4J75A 2ZB8A 2YKGA 1UWLA 3DDHA 4BMOB 1K6JA 2RB4A 1J1UA 3BB1A 1HDEA 1L7MA 2Q2NA 3FGPA 4JDPA 5D2CA 3VAAA 1BHQ1 3WLIA 4DWOA 4KK4A 4AKIA 3EBOA 3RBVA 4BTEA 4FU0A 3LGAA 4FQ8A 2W6OA 4ES6A 1NM5C 3BE8A 3SOZA 2JKZA 3RC9A 3T0IA 4MV5A 3B6IA 4B7CA 5IDQA 1BSVA 1BGWA 3K9FC 2V7XA 1OXSC 2ARKA 3N0XA 5JJ5A 5C7OO 3LWNA 2WINI 1RHJA 1BX3A 2O2HA 3WYCA 2M32A 3VJMA 1GQRA 1P75A 1WNTA 4I9UA 2DUWA 1JBQA 1RHMA 5GM2A 5KWJA 1GRCA 2R1TB 2FSVA 3G5AA 3M6LA 3ONDA 4K81B 4LBVA 5EFOA 1EGAA 1UJ6A 2AQHA 3AESA 3SHQA 3ZWAA 3PXUA 1TTTA 1Y7TA 2CXUA 1OI2A 3VNVA 1O0SA 3O8QB 2DE0X 3I52A 1UFRA 2W5UA 1TAUA 3Q7QA 1PWXA 4UASA 2J0SA 5AJHA 3TBKA 2NTYC 1LFAA 4BPBA 2XJ4A 1NDUA 3N5KA 4P4TA 2G8NA 3F3MA 5K8IA 1JEDA 3TTUA 1YOVB 1LK5A 2X5JO 1DKMA 2MHCA 1UR5A 3EXG2 5K0BA 5T64A 3DT9A 4LK2A 5K20A 1FMCA 1U80A 1W5EA 4CN8A 2VYCA 4H1HA 4LY9A 5G1OA 4RDIA 3FDZA 1QM5A 2BBOA 3FTQA 4E5KA 3U09A 2AZXA 3LCVB 1RJDA 2G28A 1JXMA 3TNDA 2AXQA 2LDXA 1ULBA 1E6WA 2WAOA 2YBEA 5T4HA 4ASUA 4Q9DA 3QKWA 2I4LA 3L41A 1VE6A 3QX3A 1LJUA 2E4ZA 1OWPA 2F7SA 3DR3A 3SC2A 5EQDA 2O2XA 4RANA 1QU3A 3BILA 3IC5A 3QYFA 1SUWA 3AUFA 3HDVA 3C3PA 4Z53A 5GIOE 2EKLA 1BFUA 1MENA 2AOUA 1OKKD 1OAAA 3LCRA 1GPMA 1KYVA 3P52A 5ULLA 1PZNA 1XA3A 3KAQA 1U5BB 4RSRA 1VQ1A 1I51A 1RYEA 2W6CX 2H4WA 4AUEA 1GNRA 2GBCA 3NKFA 3I3SR 4GFDA 1U0JA 4XSGA 4CQMA 3INRA 3BBLA 1DE0A 2V96A 2FR1A 4V0NA 3TO5A 1H3FA 4D9EA 4ZO7A 4E88A 1PT5A 2XF2A 2OD9A 5D5PA 5ALYA 5HRAA 3MWGA 1I1NA 5EMJA 1L4HA 1P6UA 4LECA 1OZFA 4EA8A 3L7NA 2WTEA 3SBOA 1P1FA 4Q82A 3ENQA 4OQ4A 4JBNA 2XSZD 1G63A 1U7DA 4BJ1A 2ZI9A 5BOSA 3M4NA 2W2MA 1RRFA 1E1KA 1U4SA 3IAS6 4I5DA 4QD3A 3VV2A 3WYGA 5CDUA 4ESVA 4UM7A 1I1QB 1XLVA 3K8ZA 4F8YA 3ANYB 4AO8A 1JVNA 4I9FA 4K9KA 4PX5A 3NNNA 1CQIB 5CPFA 3GRAA 1CNEA 4X61A 4C14A 2OSVA 2EJUA 4LC1A 2VJAA 4WXMA 4YT8A 4A15A 1C3VA 3DSRA 1QTQA 4KW7A 3TRHA 3WDMA 5BSRA 1Z0SA 5EJ2A 1DUSA 3GEBA 3BEOA 4EDHA 4ROSA 1MFPA 3U7QB 1YS1X 1PD1A 2R84A 2NV2B 3QUQA 1XTRA 1RVDA 3IYLW 2ZREA 4B6SA 2H06A 2J3HA 3INYA 2PEYA 2H51A 1HDOA 4IHJA 3MMNA 3ODGA 4RVNA 1VHQA 2BGWA 2O48X 1L6IA 1U3UA 2CBGA 5BNFA 5KYUB 1HE5A 5FI3A 4OYRA 4N82A 2G5GX 4FI3F 4NX2A 4ACBA 4CEHA 3P5BA 4Y2RA 3BFJA 4O2RA 1LK0A 3WP1B 4HX2A 4BVBA 1FS5A 2WR8A 1G2PA 2BFCA 2R5WA 3A26A 4J3FA 2EGHA 2G1KA 1NW9B 3JYQA 1MQ9A 1JKJB 2IDZA 3LQ1A 3OKFA 4QSHA 1Z63A 4P4LA 2PPVA 4ER3A 1JX6A 2FG7C 2VHEA 3L0SA 4ESOA 1Y1KE 3HH8A 4B31A 4HQLA 4IWYA 1EM6A 1R2QA 3LWBA 5CYGA 1GPYA 4MEAA 4EW6A 2PK3A 1SKBA 2O05A 3U3MA 5BN4A 4XVHA 3FG9A 4EPXA 4PCLA 1ULUA 3PLRA 4RDHA 2YXEA 1D3AA 2RHBA 3Q5EA 2OA0A 3VX3A 5IXSA 5L3QA 5AI4A 3OPVA 1TMYA 4LGYA 1J99A 1Q57A 2FRVA 2PSDA 4L2IA 4R54A 4EFKA 3VNSA 1CUAA 3R5XA 3SFVA 5KQPA 3VAYA 3LYAA 2YN4A 4A03A 1IBKB 4X7PA 1BVUA 3N39C 3MCZA 3LT0A 4GW3A 8ADHA 1GM5A 4URZR 2XWSA 3HDTA 3RW9A 2ODBA 3P4YA 2G06A 2HMAA 4RULA 1I4OA 2RK6A 3IKJA 4ZT7A 2PGOA 3IRUA 4LISA 5DM1A 3MBKA 5IVPA 5KDOA 1C80A 3DOHA 5GWXA 2V3WA 1X7XB 5FLYA 4C03A 3MGKA 1CR4A 4NVRA 3A6PC 4C78A 5J23A 1R66A 4XX1A 3LHFA 4RKFA 4DV0B 1XMJA 5EJ6A 4ZT2A 2FW9A 1EFTA 3A9TA 1DPGA 2AR9A 2VHWA 5JOQA 1EYZA 3RS9A 4RL6A 4DLSA 1X7HA 2OWEA 1G17A 3PDHA 5H4HA 5TIIA 3ZVNA 3R0VA 4QATA 3J80A 3AFMA 1DC7A 4G63A 1NMYA 3L82B 1K6MA 3EPKA 2DBYA 3DE6X 4R51A 1PL8A 3AVWA 5SY6A 1I2AA 3LL7A 1XCGB 4LSZA 3LDHA 3EFOB 3LF1A 3HGMA 3LOUA 1KO1A 4DTIA 3C3XA 1WB5A 1KI6B 4JR0A 4L9WA 1PV4A 1T2NA 1YU9A 3D8NA 1MHPA 3FFWA 5TDHA 1LNZA 1D0VA 3BA1A 3MJFA 4BNJA 1DAGA 2FCRA 1OLXB 4XPIB 4UFPA 3H16A 1Y9ZA 3I6ZA 4QJ5A 2PIDA 1FW6A 3FWZA 3ORSA 2CK3D 3I8SA 1AKEA 3L06A 1HXHA 4UAUA 2QAGC 4Q19A 3GYGA 2HSZA 5KJ1A 4NCBA 4Y98A 5EIEA 1Q1BA 4TS4A 2WHYA 4FYHA 1M8GA 4DL9A 3RE1A 1NDQA 4KR0A 4GMGA 1RJEA 3QSGA 1ZFNA 4JIGA 2CUZA 1AUPA 4S1OA 3HR8A 3QFHA 4YJDA 4KGZA 4LJ7A 4W99A 3ND6A 3RNLA 3HV0A 4X65B 3SZRA 4LF5B 2TMYA 5LWHA 4I8IA 4HH3C 4HNSA 5T6MA 4L6AA 2A78A 4TTPA 4QM6A 4JLUA 3WNVA 4KQJA 1T15A 3CSDA 1GCUA 3RT9A 4E09A 1AO3A 4QVGA 2YJ6A 5JJKA 2IV3A 1I2MA 2ZB3A 4U0KA 4Q1DA 2H5JA 2XQVA 2BE9A 4KSBA 5DT2A 2B1IA 3A6GA 2QTAA 4ZT3A 1BMDA 2WP8J 4RFSB 4BE4A 4XIGS 4GEKA 3RRBA 2NAPA 1QMGA 1RI3A 3C74A 3CIOA 3L7MA 5HTOA 5A5DA 4MWGA 1U2SA 3ETLA 2IOHA 2YNMC 3GROA 5L9AA 4MLDA 3ZYCA 2O8EA 2C1EA 3E8XA 1C2TA 4MV6A 4IGAA 5AKJA 3MOIA 1CJMA 4G36A 1VP9A 3SF8B 1GFWA 1GVNB 4TRJA 4WVFA 2JFWA 3GG2A 4EECA 2G40A 4BDTA 4ZANA 3VZBA 2LE0A 2VC2B 3KPUA 2HNAA 1HG0A 3RYFB 4FBLA 1EUCA 3L1UA 3U0VA 1PT6A 3N8HA 4FLEA 4CCYA 1L7EA 4ZYVA 4DSTA 3PVZA 1R0YA 3KQYA 3T4UA 2P4HX 2QTCA 1P3Y1 3JQ7A 4J9UE 1WD7A 2P4EA 1EH5A 3WRVA 4BKQA 4BO0A 2I4RA 3TLKA 4C06A 1ULSA 4CEIA 3BJRA 3MPOA 5A06A 4NH4A 3ZN2A 4XH9B 3H1PA 2Z9DA 1MFZA 3MGBA 1DI0A 1SHZA 4P53A 5AK3A 1C9NA 4L02A 1BH6A 2P1RA 2I6FA 3OQIA 5K3FA 5C1IA 1DV1A 3UOAB 5KU1A 2GD1O 2QZ9A 2ZAGA 3EUFA 2YUTA 2RHHA 3QU4A 4JDUA 4RIGA 4EZBA 3CKKA 5FOWA 4KR2A 3WB2A 4YK7A 2C0PA 5ALWA 2ZYSA 3IAAA 1QE3A 2IHBA 2PKQP 4YRPA 4R9NA 3UJ7A 4RA9B 1DEOA 1KAHA 4U3JA 2VUTA 1PJTA 4UW9A 4DDWA 2OM2A 1JPVA 2M6RA 3TLGA 1L7OA 4IGKA 4KFCA 1EDDA 4BVLA 2PGAA 5EMHA 5A7FA 5BN3B 2GXQA 1DMRA 4EOGA 5TR9A 2VP2A 4W63A 4DMRA 1IOZA 4HNHA 3QYAA 4L8GA 5DOVA 4NOMA 2CEKA 4HGYA 1NL3A 1V37A 3IAXA 3SQNA 3V4PB 3SEFA 4B6OA 5JSQA 2I8LA 2R5FA 2X42A 3ZE7A 4EJSB 5HZHA 4WL0A 2D5AA 1H8EA 3K1TA 1XP5A 4Z9AA 3RS7A 4XX0B 4B44A 3V1TC 4HTFA 1X1RA 4AJ4A 1GQOA 1BS2A 1FF9A 3LGSA 1FTSA 4HDCA 3AONB 1TAQA 3W9YA 2L69A 3I9V1 2CUTA 3V4SA 5FL7D 4EF6A 3R9WA 4JJ6A 4I4CA 5F1KA 4PZYA 3DDSA 3GVCA 4N7RA 4PYKA 2E85A 5BXYA 3WNQA 4AU1A 2FQQA 4QQKA 2D3TA 1TNDA 3ETEA 1JILA 3IDAA 3LTEA 2CDCA 1Z0ZA 5KNDD 5JXHA 3W3AA 5L95A 4KPYA 3ONFA 5B3JC 1AOXA 3KXIA 3R5TA 3QQ5A 1Z0JA 1K5DA 3C3BA 3ECSA 1R0CA 1H2WA 1Y6JA 3Q0IA 1RCFA 3I2JA 1QFXA 4ZVOA 3E9YA 2HMYB 3NHLA 4OG2A 121PA 4BO3A 4PLCA 1I6MA 3B38A 5ESDA 3C4JA 3KB8A 4NZYA 5AW5A 1F3OA 4HAZA 2FDRA 4J1TC 3G85A 4W5OA 2ZBGA 3HP1A 4RVDA 3C6YA 4I55B 5JVDF 1E1NA 4RA6B 2IE8A 4OJNA 1PHPA 4YRGA 2PBFA 4DBZA 3GO4A 2GOYA 4KGXA 3ZBTA 6YASA 4RY9A 3D3WA 4UHBA 2QBYA 4E4YA 1AHIA 1HEUA 2JH3A 3NHKA 5BSEA 4FW9A 3C3YA 3NHPA 4EL5A 4K9NA 3O1JC 2JGRA 2QNRA 2LKCA 8MHTA 3M9LA 4DV3B 1W1WA 3D6NB 4WPGA 4KIUA 5LJIA 1Y1SA 4FPXA 4II3A 4RJTA 3DUFA 1IN6A 3GGGA 1X87A 2QRNA 1F60A 1CY4A 1DXHA 3AGPA 3FSGD 3K4PA 1DBSA 4X1KB 3ZLVA 1XN1A 3PQ6A 1TAGA 1GDTA 4I6GA 1SKMA 4Q9KA 5E1DA 1O6BA 4UTZA 3SM9A 5A62A 5ISMA 4TKUA 3E8MA 1T3ZA 4PCVA 3MRVA 1W2WB 3CR8A 4WIAA 1BDMA 3YASA 4YV0A 4PG8A 1MZVA 4GXRA 4QU5A 2GVNA 3HBLA 1ZJ6A 3FMPB 3KL4A 2R8YA 3L6BA 3VH2A 2WE8A 2EJBA 3ZU3A 5AKXA 5FUYA 1Z5NA 2FMXA 2IHZA 3ZKWA 4NPAA 4GMFA 4E5VA 3ZLBA 1YZHA 2OL4A 1WJGA 1TEVA 3TOXA 3TNJA 2O8BB 1N36B 3U7EB 2NVUA 1SHJA 3AUYA 4GUDA 5A7HA 4HAYA 3C87A 2XE6A 2DMRA 3DHWC 3K9CA 3LXUX 3PR3A 5AMXA 3RROA 4A0FA 3AVPA 2GJAA 4HWSA 4ZV4A 1JEYB 4ZZ1A 3E22B 2EC5A 4BCDA 4QNNA 4F3CA 1W19A 3RB8A 3CO5A 5HDQA 2Y05A 3T38A 4CG1A 1RWVA 4HLUC 1YL6A 2BM0A 3PUXA 4J29A 1DLJA 2JJMA 4IZHA 3VR4H 5K9ZA 2PRKA 1JT2A 1OE0A 2AZDA 1S3IA 4G1UC 3GUYA 4AJLA 1Z6ZA 2F8MA 3RFXA 1TIKA 3QE0A 4EZIA 1K7FB 3OOHA 4R2KA 5TSDA 3ETGA 3A7DA 4MOWA 1M0SA 2JFPA 4D8XA 2DFLA 3GOHA 3RH0A 4MGHA 4JT8A 1AKVA 3RYHB 1CUWA 2EBFX 3D59A 5BVGA 5EWLA 4IQ4A 3OE7D 5EP4A 4UREA 2OC9A 3M83A 4X3CA 1PDVA 2DUUA 3D6TB 2H1WA 3KQTA 4FE4A 5CB8A 1UBEA 3H5NA 5DGTA 3P71T 1Y80A 4M9UA 2W6JD 1C9YA 1C1DB 4MUJA 3KQWA 5EQTA 5ALZA 1V26A 2NVWA 4ZEXA 2J3KA 4K6OA 1IZ8A 2H9AA 3SZGA 4BLUA 3IVRA 3F4BA 3WI7A 2GX6A 4YV2A 1DVRA 3K9WA 1TXGA 1JTVA 1OZGA 4R1TA 4Y0VA 1IEQA 3L84A 3B7GA 3I09A 5BW5A 3TAHA 4MV8A 2WYVA 8ABPA 3DLBA 3R9XB 2O8VA 3GJ0A 1BQ4A 3DQZA 3NPAA 2RDMA 5AQ1A 3D31A 5ARDA 4B6RA 4PC2A 1QIJA 3MELA 4TKVA 2EEZA 2HUPA 3T3HA 1L5HA 3GRFA 5J2UB 3V33A 4QLBA 1IY2A 4DM4A 5TGDA 2OXIA 2VP3A 4PNZA 2HZ7A 1HE4A 1T6ZA 3MUFA 5TEWA 3K0BA 3AF5A 3CQ9A 1UBTS 2XRFA 1ISGA 4L8YA 3QWHA 1QANA 4X1KA 5CLQA 4Q4JB 3CW2A 5GOTA 3VSEA 1PBNA 3TE6A 5KOIA 3AIIA 1RKBA 2I4OA 3WDSA 2CNWD 1MPTA 3A6ZA 2HRRA 3JCZA 3KU1A 3OIWA 3EFBA 1FRVA 4RACA 3UPDA 5KTTA 1UC4B 2FPIB 5EJ4A 2ZJ0A 1WU8A 1GQYA 3W6NA 4LWQA 1A8HA 2A1IA 3D4NA 1UCFA 3EFHA 4UTVA 1W36B 2DAPA 3AIMA 1FXSA 1GR1A 3JZIA 1GAWA 5AP9A 4JYMA 3PL5A 2JBHA 3QEKA 3PDWA 5AVZA 1Q83A 1ZUIA 1X14A 2O5VA 5HJ2A 5B58T 4PFKA 3Q0TA 4DIKA 4AM8A 2ZJ7A 4NC9A 1HOTA 3IE1A 2I65A 3WGYA 1NW6A 4CCYB 2XB2A 2JZCA 1BX1A 2WJ6A 2FPGA 3NWEA 2WF8A 3H1EA 5ARBA 1EU1A 4O4HF 4LBWA 4XWOA 4PZEA 4BY9E 3ZTTA 2SNIE 2RHLA 1QIFA 2BDEA 2H00A 5I6DA 1UH5A 5HXAA 2ZSIA 3OEED 1Y6QA 5JMPA 1SH7A 1NMEA 3UWOA 5FOUA 5BSMA 5CAEA 5A3VA 2WSMA 4JQZA 1HZZC 3QV1A 4MWSA 1SA0A 3ESBA 2R7LA 2JHGA 3RVLA 4KYIB 1XRPA 3I9V6 1V25A 4OP3A 4R0NA 3RNOA 2C2KA 1E9EA 4GEGA 2D13A 3IUYA 3PQDA 4CTJA 4K6MA 3HGTA 1XJWA 4W1RA 3FUVA 2PH7A 3N8GA 2ZT7A 4EG7A 4Z7OB 3GLIB 1XKXA 3VVMA 1F9EA 3KT6A 1U28A 4GKVA 4MW4A 3WYAA 2BFEA 4YGYA 1RLMA 3E8SA 5L4NA 5DBGA 1EE2A 4R84A 1EWKA 5KOJB 3K2EA 2EATA 3AJEA 4LZZA 1POWA 2NO4A 3KYDB 1KVTA 2QT0A 4COOA 5IKMA 2XBMA 1GVHA 3DBIA 1E5TA 4B73A 4XDYA 5KQRA 2QZ4A 4LYEA 2X4GA 3RS8A 3THSA 5ALPA 5FO0A 5DTMA 1CLUA 1CFZA 2BFPA 4L78A 3DZGA 2C7VA 4BQRA 4TXJA 3RK0A 4W9NA 4JLNA 2PL3A 2RGNA 2RHWA 3TMAA 5K4AA 1AGNA 2VT7A 2V7QA 4B1FA 4M86A 2OORA 1XTPA 3CVJA 1NKVA 2D4AA 1JIUA 5BN5B 1UBCA 2J85A 3ESYA 3MTEA 3R3UA 4MS3A 3C8MA 1JIVA 1JYFA 2TMGA 3OQPA 5IZCA 2ZBPA 1H3EA 5FPSA 2AHRA 2OYCA 5CXUA 1QWSA 1Y3CE 2FEWB 2FFHA 4UCFA 4LI3X 4J7XA 2I80A 5C53B 1C50A 4O8ZA 5DSXA 3PRYA 3SM3A 1ZNYA 1G6KA 4AXBA 1FVXA 1XIVA 2X4LA 1T8SA 1GG5A 3KKLA 3MCVA 2FPMA 4HPJB 4X6UA 2I2CA 2LDBA 5ESWA 5E8RA 2FDXA 1J25A 4BNZA 1XUOA 3NEYA 4JLPA 2XRZA 1D0SA 1JQAA 1VL0A 2OZEA 2Q1UA 2UUOA 4F56A 5ALOA 1NVVR 2AJDA 3WKBA 3SVTA 2QP4A 4NZMA 1ISSA 4OI4A 2POQX 3MUNA 3C3AA 5LJLA 1E3EA 1Y6ZA 2FOLA 2BF4A 2HQ1A 5HK9A 1TEHA 3PNSA 3OOYA 1SZJG 3EN0A 4C4OA 1PTJC 3K6SA 5BN5A 3E18A 2AFVA 4NCHA 1QH9A 1M2OA 3ZLTA 3NU1A 2P5YA 3AZQA 1BG6A 3BGWA 1T3GA 1JR4A 2VDWA 3S7TA 3AFOA 3HY4A 1PJ4A 2BZSA 1ZAYA 4C4RA 3Q5DA 1S9DA 4EA6A 3KJNA 5BUCA 3O9VA 1JAHA 3CINA 3NKVA 3MRTA 5TS2A 2C4WA 3WBBA 2ZRHA 4O0MA 3RT7A 3FH0A 2YFHA 4IXMA 4CLEA 5LVAA 4Z7NB 2XUAA 4PZCA 1M1XB 5CT6A 1RNLA 3SJUA 1CRWG 4Y9TA 3FX2A 2ZITA 5JSHA 1HM5A 2FMUA 2VJDA 4IZ6A 1E2JA 2H4ZA 2IUFA 1JQLB 1R0RE 3WWPA 2OZPA 4RQUA 1XDUA 3IT2A 3Q7IA 4X63A 2GZDA 2JW5A 5F1OA 4UZEA 3QPUA 4MIYA 2R1TA 4EY6A 1U3WA 1WVMA 2RJ3A 3BJEA 5ALIA 4F06A 3AF6A 2QYTA 3D3KA 1MDBA 2X3YA 1W4BA 3UJAA 3EVTA 3WO0A 3H8SA 1Q5PA 5E9WA 1RAAA 3F7OA 2JLSA 4HAXA 3O38A 1JWLA 1T5BA 2BDUA 2QX8A 5J47A 3D1JA 5E7IA 2BCGY 1YQXA 2CNWA 3NBQA 3T5MA 3DEAA 1B23P 1X1DA 3EGXB 1VMIA 3CMCO 4II7A 3LRXA 4KQMA 4DMUB 4MUFA 4QG3A 5I9IA 1U7XA 1KS9A 1X1BA 2EW1A 3H2SA 1YTLA 2PGXA 3HYNA 3TBFA 2XA2A 1BGVA 3KR0A 1M2GA 1IK6A 2VRCD 1N75A 2GSWA 2XOEA 4MW2A 3SC4A 4CCAA 5CFLA 4HH1A 1DC8A 1PR5A 5TB5A 2YC2C 5CIYA 3B5IA 2A4MA 1F8XA 1V5IA 3FSEA 1BO6A 1GZ4A 1E6EA 2B3DA 2ID7A 4MPRA 1EI9A 4JITA 2C03A 3HACA 5IC6A 4OV6B 3R7BA 4BOYA 3VBCA 2BGIA 3AHIA 5DF1A 1AKQA 2DWUA 3FZQA 1DBQA 4GR9A 1YZGA 3G2KA 3UJHA 3AF2A 4MICA 4AY4A 2GRJA 5BVGB 1ZI6A 1N5RA 1XZGA 3R41A 5DX8A 3ICWA 4YMVA 3K09C 2DLDA 1F0NA 2BFCB 4HN2A 4I6EA 3NASA 5HCIA 2AC2A 1KHHA 1EA5A 4B3FX 3HVIA 3R6GA 4FNGA 1PFKA 4WOPA 3X0DA 2C2BA 4JBXA 1ECCA 2A5LA 4JSYA 2C5LA 5AVSA 2UUCB 1R8YA 1VC2A 4IR7A 1Q1NA 1U5CA 2QJOA 5C8YB 3N28A 4PO1A 2B4AA 1E1YA 1AC5A 3C98A 5KHAA 3RKRA 3EFEA 4TMZA 1IUNA 1WDKA 4E12A 2ZIGA 2B7BA 2CHVA 3ERCA 5LUBA 3BIXA 3ASYA 4YMWA 1DEXA 3QOXA 3DJYA 3L6OO 4KCGA 4RA6A 1P9RA 3QU2A 2FZCA 5IANA 5A71A 2AI3A 3QP9A 2XV1A 5CCXA 3KDSE 1FYVA 4DC0A 3NDPA 3WSTA 4X8HA 2NZYA 2ZWMA 3MRXA 4HT3B 1OBOA 3WQSB 2LTAA 4JOCA 3BMOB 2C96A 2FUNB 4AN4A 4QGSA 1NFRA 2OENG 4IGIA 4XARA 1ADYA 3HXTA 1NG9A 4B6EA 1TYAE 5JAMA 1WHSB 4AJPA 3RPEA 5L7TA 3GLIE 1Z2NX 4EF5A 2Q5LA 1BEUB 3K72B 2X1HA 3JWPA 4GOMD 5E7MA 4PZLA 5HBRA 3WK9A 1Q6ZA 3SU8A 2AMYA 4CMCA 1YRWA 1MTOA 3SICE 4EGCB 5C46F 1FBTA 4F46A 3R7WB 1UKYA 4YASA 4NARA 4PXYA 4DOMA 1N0WA 2JEOA 3TM5A 5F3WB 3O2NA 2V6GA 2YXNA 5KTPA 1N78A 3LW7A 1SU8A 3ZKWB 1VCIA 1XMXA 5HTKA 4O5AA 2QRGA 2AKEA 4DR4B 2KI5A 2CVHA 3CRVA 3UT5A 2YVQA 1YUBA 1T4MA 3OPMA 3C24A 3U3XA 4YCLA 5BW4A 3KTDA 5C8XA 3HLTA 3R7LA 1OHHA 1ZR2A 2FMIA 3NWBA 4A1FA 1EFHA 4ZAGA 2GDZA 3KQVA 4WZBA 4MMZB 2VATA 3CURA 3ER6A 4BGEA 2JJ8A 4AG5A 4BNTA 1WKCA 1JI3A 1YE3A 2X9QA 5KTRA 1IN5A 4W7IA 3QLUA 1G21E 2XCRB 1ISMA 4QWWA 1GN8A 1ZOPA 1C9KA 4RZSA 4ZI2A 3OZBA 1YZYA 4MIOA 1FDUA 4IDCA 4M6WA 5AK4A 2GETA 2J9YB 2GEFA 2PAFA 3F6RA 2WE7A 4UHFA 4EQ6A 4G37A 3ZWKA 4CU2A 1FA9A 3GDFA 3F6EX 1USKA 2WIFA 3VU8A 3GCDA 4LJAA 3LRPA 5THQA 4AICA 1XCBA 1HDRA 2HJVA 3OLWA 5FBLB 1ZD8A 5JXIA 1RWNA 4IS3A 1DFHA 521PA 2C59A 1A69A 1R4ZA 5ITVA 4R8RA 1AS2A 5KBYA 3U60B 2NNLD 1YB6A 1ATIA 4IHAA 1V3TA 1TPZA 3TCNA 3ETCA 3KDAA 1T36B 4Y7DA 1UBMS 2AE2A 2JD1A 3PICA 4ZAXA 2Z56A 4CKCB 4RL4A 2CXNA 2WICA 4DKJA 4ND6A 3QVJA 1ZGGA 4CI0B 1HT1E 3NOOA 5A3QA 3KTOA 4QDTA 5CXSA 3TINA 3O73A 4MKXA 1QC5B 1IPHA 3IE2A 3C85A 1R00A 2Y1KA 4FDLA 1U6JA 4IQ8A 4JAVC 5ICSA 4TTIA 3AC0A 3RYFA 1FJGB 4YBRA 5H68A 2FUEA 5HHTA 5AI6A 2PT7A 4NE9A 3T7JA 4JXXA 1P2SA 3H8WA 4MQEB 5TGTA 5BQFA 5IW8A 1EP1B 1PG5A 2PM8A 2ANCA 1BRMA 4KXXA 2PR2A 4QRIA 4UCWA 4RS4A 2GAOA 1FLDA 1PQYA 1X3SA 3CCBA 2IHVA 3THOA 2HRZA 2CZGA 2XUKA 2QIOA 1CR6A 4G0MA 3MTDA 3OTIA 4XJTA 1JHPA 1O8BA 2XQFA 4V0RA 3SBXA 1N2OA 2C9MA 1TRHA 4GNKA 1W4RA 2BGGA 3IOYA 1VPWA 4L5CA 1J6UA 1PK8A 2O1SA 3M70A 3DQPA 1Z15A 5THXA 2FK8A 5AJZA 5FBVB 1U6IA 1HOXA 4REMA 4E31A 3DZFA 5EEHA 3UC5A 2BGKA 3ZE9A 1B14A 1NLZA 5HF5A 3ZXIA 3C5CA 4U9HS 3ZNOA 5J5AA 3D4IA 1L4LA 3RVPA 3RYTC 3W34A 1OU4A 3R2JA 1RT9A 3IP3A 2DFNA 4REQB 1UEJA 4IWXA 3QPAA 3U16A 3NYIA 1I7PA 3Q9UA 2VKTA 4HR7A 4Y1RB 3BZUA 4CHGA 4POOA 4J03A 5ITSA 5BY2A 1Q1AA 1DFIA 1Z08A 4NJEB 3NTUA 1CDZA 4DBLC 1K2WA 2E18A 2OZLB 3E35A 3SP1A 1GOTA 4LXXA 3SYNA 4NE2A 4W5QA 1K86A 3UGJA 3E0QA 3WSWA 2Q5QA 4TL6A 4NWIA 4G84A 1P6XA 4UBIA 5DJ5A 4YUAA 3N8IA 2CYCA 4IDPA 1A0OA 2XRMA 1QORA 2O5RA 5B30A 3DL0A 4KPUB 4M53A 1V3VA 2JFXA 1PGOA 2JVJA 3PE6A 4Y2TA 2C9CA 2G4CA 2OP0A 3N2EA 4JVSB 5DM4A 3TVTA 3WWZA 1CJTC 1PD0A 2QPLA 1DG3A 1NP3A 3NGLA 1VJDA 1G38A 2P3SA 5CHEA 2ZT5A 1I5RA 5H1YA 3S1LA 3UMSA 1MJFA 3ABZA 3FDJA 3VPAA 4CEIB 4PANA 2PQ0A 1XZPA 5JPIA 2IXGA 1HETA 3QVUA 5LBUA 4AFNA 1FU7A 4ZVPA 1DQRA 3BF8A 3RVQA 3MWFA 1GEGA 1Z0FA 3RRNA 1PTKA 3LDGA 2ZJOA 2WYOA 3QBJA 4WEQA 3KBBA 1XAIA 3ZTYA 4PGFA 1HORA 1XX6A 4ZMRA 2HXSA 3OT1B 3JRNA 2O2EA 3M6VA 4IGFA 2Z8YA 1XVVA 1DHRA 1KDOA 3BXFA 3SI7A 3VH4A 4BDSA 3Q2IA 3LZ6A 5ALRA 5CNKA 1LUAA 1QC5A 4F1JA 3ESDA 4L3OA 4X1IB 5BV2P 4OGWA 2LD4A 1OH7A 1Q1GA 3IBGA 4AC9A 2NO0A 1MPXA 2AS0A 4N48A 1FRQA 3PEYA 3EUWA 1GA1A 4JEUA 2IYRA 4F84A 1MTZA 3E58A 1RC0A 2R11A 1JF8A 3MRSA 3MAAC 3VDXA 3W6PA 5F9FA 1NHGA 1OHHD 4JL6A 3K9GA 1PYOA 3JPYA 1PZXA 1ZJ4A 1ZN7A 3AX6A 1OGYA 3EG9A 3SHOA 1N2CA 4PAOA 4XYEA 4JROA 1QHEA 4IIJF 1O7JA 2CFOA 2R00A 2VQSA 5KYNA 2H07A 2GEVA 4MQMA 4PNHA 4KDRA 3VHXA 3BSFA 1YAHA 3LV8A 1J5EB 1YJXA 3N6VA 2F6RA 3PQ3A 2HYDA 4PTYA 5FBZA 4NEQA 5I4CA 3ISVA 3ME5A 4TYWA 2PRJA 3UJ6A 2GVDC 3GGCA 4KRGA 1B8NA 1WP4A 4ZQEA 2J4DA 3BFKA 3AEZA 1M2FA 2HJRA 5EI5A 4KQFA 2GD2A 1DJNA 1FJXA 2BKLA 3F4KA 5DGXA 1PJQA 2RGUA 3MQ4A 4BO6A 4ZHQB 1MN6A 3OSZA 3RS3A 2WIBA 3R8FA 1BCSB 1QIEA 4NJMA 1YE8A 2JRCA 2QTZA 3S2IA 1DG9A 3MT8A 2IOYA 5AOBA 5BPHA 3EFOA 3T5PA 1LBSA 1ZWKA 2B1RA 3JWHA 4RXUA 2G4VA 2W2OA 5D01A 4U8GA 3VVLA 4EP1A 3IKVA 3IV9A 2HLNA 3UB4A 1ACJA 2NYVA 1E2FA 4BMPB 4LGVA 4JGIA 2CMGA 4QYMA 4JYBA 2DPYA 4B8WA 5FO1A 5IMSA 1Y0BA 2JFVA 3I37X 3OP4A 3RUIA 2JJYA 4Y3UA 4BO7A 1CZKA 2ZVJA 1QK5A 3FBGA 2ATCA 1H8HD 2Z95A 3FDZB 1I5OA 3ASVA 4M55A 2WQ6A 4Z51A 3CH4B 3K4QA 3W2FA 5CG2A 1IEXA 4ZGGA 2HJGA 3AVXA 3IQXA 1CE8B 1V16A 1YACA 3H4IA 3OICA 1FTGA 4Q01A 2VAVA 1G6Q1 4FSHA 1DKRA 2CFIA 2QRZA 4K40A 1D1QA 3FBTA 1CZOA 4V0QA 1TZ2A 3VR0A 4G0XA 4RBNA 4B76A 5AW4A 5K3OA 4R71A 2HEIA 1DO0A 5JNSA 4J3JA 3LK6A 1HMPA 1IDOA 3FCOA 4PIMA 4S0ZA 3ZV3A 3TM4A 1IZ7A 1PUXA 1TI7A 3DZCA 3ND7A 1Y1RA 4HFNA 3HCOA 2XZTA 2UVDA 1WIWA 2Q5HA 1R74A 3EQ6A 5JSUA 1X7ZB 3BD8A 3MF4A 5IJ9B 1OB5A 1EJ2A 2WHPB 1UAYA 4IWNA 4L5AA 5DOZA 1M6VB 1ZZGA 4R9VA 4DA8A 3RYCB 1RZVA 4KPFC 4EHIA 3BRWD 1J56A 2IDKA 1E2NA 2W4MA 4G81A 2VTVA 1AKNA 2H3HA 3B8HA 2NU8B 2XYVA 4E70A 2VYND 2LZ0A 1RS0A 3LNCA 4R8LA 3Q88A 2XGOA 4EF4A 3U4CA 4P38A 3EBPA 1PQWA 2YS6A 4LRTB 1SULA 4Y2QA 1A4XA 2IF0A 3P20A 4INZA 2VLBA 1PS8A 2IKQA 3GFPA 4FKBA 4Q48A 2YYSA 1D1PA 5A3SA 5IZ4A 1CY2A 2J1LA 2NVOA 4YRAA 2C3UA 4H15A 3QEBZ 1QRSA 3GRVA 3WGTA 3COSA 5F51A 3LLMA 5LU8A 1AJEA 2NQ2C 4Z0NA 5KKNB 3TKLA 1J00A 4GI1A 5DPMA 5FV4A 1RQ2A 3QFFA 2SCUB 4FBGA 1P7ZA 2VNAA 2JAHA 4E5DA 4M1WA 4RFVA 2RHCA 3FAZA 3OZEA 3ZZTA 2HPAA 3UG7A 2EAUA 2FOIA 5EPEA 3ZGXA 3K09A 2CJXA 3VKHA 2EZ4A 1ZCZA 5IT9A 1SVUA 4IX1A 3MFQA 2JK0A 4NZ9A 4L1KA 1L8QA 4QEKA 1F5NA 2QW0X 3B2EA 1EX9A 3RIEA 4C7OB 3AHFA 3I2KA 2GNPA 2FH5B 1P5FA 2GD0A 3KU4A 4LWZA 4GQBA 5CT4A 2D5IA 3VZDA 3WV4A 3LYHA 3QWFA 2WZQA 1F1BA 4X0EA 5KNBH 3ZY6A 1A82A 1EXMA 4HDAA 2GYUA 4G1VA 2I6UA 5TPZA 3WMRA 1CEEA 2F1HA 1RQXA 2OXRA 1ZIPA 1F12A 1FK8A 2MYNA 2PV0A 2QOEA 1NXXA 2QGNA 3DL4A 5K8TA 3ADOA 5AHRA 3GRRA 1X1AA 3ZQUA 4RHYA 3KC2A 4FCTA 1NUSA 3FSRA 1E1CB 1G20B 2OV8A 2QVYX 2JI8A 3A25A 3CG0A 1R3DA 3DKRA 3SYTA 4BBAA 2MOKA 3GLGE 2AXEA 1JH8A 4B7AA 1ZRHA 3ZNPA 1A5AB 1PP4A 4BFWA 1M75A 9LDBA 2XECA 3RIMA 3ESAA 2FMFA 4R5MA 2PA3A 4XIFA 5FBQB 1A2OA 1C0KA 3RAPR 3KSBC 1Z6YA 3L04A 5EHQA 1UXOA 2VA8A 1RWBA 3OH8A 1LJ8A 2OB2A 4XTCS 1I24A 4X66B 1JR6A 2C9OA 4UPEA 3AO0B 1JDSA 1M1YB 3B9QA 1W29A 1SD1A 2QL6A 4QJ3A 4YQEA 3DPSA 1VXOA 3F46A 5TGZA 3TQRA 3LUGA 4TTTS 4KITB 2P2SA 3FB1A 1XV5A 3PJFA 5F78A 1SXJC 5ERYA 3L7KA 3CTPA 3G6KA 5EE3A 5M3BA 3MEQA 4W7HA 3PGXA 5AJUA 2GMWA 3L40A 1OLUA 2P2DA 3LKZA 3K0CA 1DXYA 3GCZA 1IM5A 1GTL1 3UT0A 4AN1A 3I4LA 3I01M 2Q9AA 3O8DA 4X84A 1TC2A 2DFTA 4DQKA 1HYQA 5A04A 4BN4A 1ISHA 1UKEA 1QH8A 3Q9LA 2RGWA 3RABA 4PYNA 5E0OA 3DOIA 1G0OA 5HNKA 3FOCA 3GZNA 1IL0A 4TLMB 4KHPB 3NOXA 2AVNA 2K4MA 1AQ6A 1JZSA 5HUHA 2F1KA 2DQYA 1VBMA 2HSWA 1ST2A 3GFVA 2N9UA 1WZ2A 3VC7A 4DCTA 1YHYA 2CW5A 2P0AA 4UUQA 4A10A 5BSWA 5IX8A 1KC3A 1WDWB 2P6UA 1E2KA 1PJZA 1XALA 3BWYA 3HLYA 1LPMA 4D4GA 1PR2A 3L8DA 3CH5A 5E3IA 4HDRB 1K6EA 1SU6A 3B5JA 1B0UA 3R3JA 2C04A 3WXBA 4BRUA 3GLTA 3E0XA 3KUCA 3NETA 3RF7A 1L4KA 3OCCA 4GX1A 1U2GC 4ITUA 1JBKA 1H5UA 1EEXB 2QROA 4N0QA 5ECWA 2V9ZA 1LI4A 3F7TA 1SMKA 4Z1MA 1R12A 1NURA 1GV0A 2QVCA 2ZWAA 3K9LA 1Y4SA 4H31A 1P61B 1LK7A 3U3OA 4GDFA 4MYHA 4R9UC 4OU4A 5FQOA 1DCTA 3FPLA 1IMOA 5EUMA 3TZBA 2BUBA 3MB8A 4DZZA 1YRLA 5FTKA 1I7QB 3R3ZA 5ENVA 2Q1WA 3H2YA 5KYVA 5JH7B 4G0ZA 4RD4A 4PEVA 4QUJA 3AILA 3DXFA 4FGLA 5CVCA 3W8FA 3LIPA 4HDOB 5E6UA 1NM5A 4TOIA 1JI0A 1T4BA 2X41A 2ZZKA 3F97A 3TW4A 4BQNA 4YAKA 5M04A 1UBUS 2OQIA 5FJJA 1U3DA 3A11A 3RASA 3GZ4A 4MARA 4LDAA 5B57C 2YIJA 2E5FA 1YXMA 3G7UA 4EDFA 3O2JA 2F3SA 2PGJA 4KMOA 3RREA 4DZRA 4WCVA 3P94A 2FX5A 1WXDA 3JS5A 2GZ1A 4G67A 4MYSA 3IEPA 1R4MA 1LBQA 1NBMA 1LI7A 1PV2A 4GL4A 4OFZA 3QVVA 4OD0A 4FFBB 3WK5A 5IBRA 4ONEA 4ACAA 2WJ4A 4OM8A 3OCZA 3BWXA 2C9DA 1HL3A 3J7TA 5EC8A 2WMDA 1U0OC 4LKRA 4YJHB 1RE1A 3ZWPA 5FOTA 1GNSA 1QJCA 3RHFA 4JLOA 3LBIA 4K9OA 4KMSA 3WL6A 3FNQA 1AS0A 4FW8A 3JWEA 4Y2YA 1KI6A 5IFLA 4LY6A 2P6OA 1RKQA 2CLEB 3DUWA 5DT9A 2IXFA 5B1HA 1KFJB 2W00A 4CQJA 4L6IA 3PKJA 1KDVA 1CQJA 1H6DA 5BWBA 2QPAA 4JC5A 3WX0A 4ZODA 2I3BA 2XGSA 3FWKA 3PKZA 1TVCA 2B1JA 1TKBA 3HABA 3I01A 4RPKA 2AD5A 3EA5A 2EKPA 3TB6A 3VYWA 1EAYA 3OZ7A 3GAZA 3PIIA 4GP7A 3CONA 2DKOA 3G6WA 3P2YA 4GIBA 3AHEA 3UHAA 2HCJB 4AJKA 4V24A 1YU6A 3MUOA 3M33A 2I0FA 4FEAA 4UEOA 2W9XA 2MINB 5CCBA 4C21A 5CLIA 3WIBA 3JAMA 5LQJA 2H8KA 5JALA 3HWRA 2X2FA 1L7VC 2ZI3A 3CH6A 4LYHA 3EIUA 3N2IA 5AI0A 3M3HA 1BXZA 5E2BA 1QK4A 4YRSA 2FWIA 4BNDA 5F23A 4K2AA 2LCQA 5FTLA 2W0SA 4C3ZA 1FMTA 4IJMA 1E5XA 2QA5A 2R0QC 3H1FA 2OV2A 4IDFA 3E4DA 1S3SA 2IP1A 4RH0A 2BKEA 3K8OE 4ZP1A 3PT9A 2MCFA 4YMLA 1EX6A 1IBRA 4NCIA 1N1GA 1XDGA 1N8KA 1Y3AA 3QXXA 4RO0A 3V7NA 3DMRA 5K8VA 1SIBE 5HKKD 2IVZA 1WXHA 1W5FA 2D7JA 2O14A 4DLUA 4DWWA 1JFTA 2I6SA 1QCDA 1ZY2A 1D5CA 2NTVA 2WABA 3CWZA 3L7AA 4BMVA 4D45A 4OO3A 1Q19A 4EAQA 1ESMA 4G1CA 1W4LA 1L4UA 1R0BA 4V0KA 5HS4A 2BCEA 2ZJFA 1E2DA 2ZU6A 1MNQA 1OQAA 1E6UA 1KOLA 2YW9A 2E4AA 3BMOA 1I7SB 3WQHA 2RG1A 4HL6A 2XCOA 1G19A 5CLFA 1NUPA 3BERA 4JCCA 3W5HA 5C3UA 2O3JA 2EQ5A 4BO4A 4AF8A 1ZM4A 4QT0A 2QTBA 4CIBA 5EJGA 1VMEA 2BISA 5C8VA 2CXPA 1T34A 3FCEA 3FR7A 4Z4FA 4FN4A 1P0FA 4WEOA 1NJ5A 4HN4B 4HZUB 1T35A 1WLSA 3CGWA 3K9QO 5AW6A 2W2TA 4RHCA 3Q3VA 3QIAA 4F4HA 1HSZA 1GRRA 3CMMA 1WVIA 4BN5A 4OXNA 2WU8A 4NBUA 4KLCA 3T6KA 3CZCA 4ZVRA 1C7FA 4PHTA 3M89A 4UM5A 3FN4A 4AKHA 4D43A 1YB4A 2OAGA 1ZSNA 2QYHA 1ZH0A 3PSAA 4P3PA 4OHRA 4G09A 1HT0A 3A14A 3IUJA 3R0QA 4MUAA 2WILA 4LRSB 3M5PA 1AIPA 4WZAB 3DOEA 2WY2D 5GV8A 3SJAA 5CBPA 3QE4A 3G17A 1LX7A 4RTPA 3B3QA 4F5EA 2A88A 2YWDA 3CWQA 5FV7A 2HU8A 2ZIEA 4R2IA 2VK2A 2DBRA 3LYLA 4L9AA 1IJFA 1L1QA 2XCUA 2XZOA 1HFJA 4KXYA 3FTFA 4UMFA 2NU6A 2FZGA 3AKEA 4X64B 4LTDA 1JFLA 3L4JA 1E2LA 2HD4A 4V39A 4D9CA 4X1YB 1XKLA 1KYZA 3M0EA 1SNYA 1DXOA 2ZUVA 3UUEA 5EHZA 3CRW1 3W5CA 4CV1A 1UQUA 3EY4A 1Q1ZA 3AINA 4KWEA 3SZOA 1G5TA 1NBME 1C7IA 2FWBA 9LDTA 2WHRA 3AERB 3AFIA 4DB4A 1JHUA 4K87A 1SUIA 5CFPA 3ZHVA 2JNWA 4ZICA 3BXXA 2AJ8A 2PUWA 4KYUA 2JFOA 3L77A 4N3NA 1QB7A 3T5DA 1FLNA 4E3ZA 3KAKA 4JVOA 2X13A 4WZAA 4HY3A 4PQYA 4GRAA 4YJ3F 2AR0A 3EISA 5A4AA 4CT5A 1IPEA 5H0IA 3R9IA 2VYNA 1J2EA 1CX9B 2DJIA 3CHYA 3I5MA 4TWAA 3CLTD 1BA3A 2AE1A 2BELA 4MP6A 1IY1A 3TCXB 3UT5B 1RAIA 2I87A 1OYYA 4B3GA 5GGXA 3VRHA 4CM9A 4AN0A 1Z5PA 2QG6A 5EZ6B 4CVNA 5C5EA 1QP0A 4CTNA 4CM4A 3STXA 1H2XA 1ZI8A 2FKAA 1VLZA 1VLJA 1ZM2A 4I08A 4KGVA 4NK5A 3BK7A 4OATA 1G4HA 3PQCA 2LCIA 2PT6A 4ZCTA 4W5TA 1L0BA 1S02A 1XU4A 4RSGA 1ZSVA 1H2HA 1A5TA 1RYNA 1XCOA 2N42A 4XWKA 5TQVA 3C1TA 4PSVA 1QF6A 2J48A 1BMFD 1EDEA 5K8UA 2FP4A 2O1WA 1Z6AA 2JBAB 3GZTB 1KP2A 1X7WB 2M6SA 4DJDC 2DP4E 4UBOA 2BEKA 1ARZA 3MINA 1X13A 3PUZA 5CVVA 3SG0A 3OZGA 3WNCA 5KHLB 4NBSA 2EX4A 1NBHA 2IEZA 4M7RA 4NBWA 2X77A 2IX3A 4EYKA 4UVEA 1CE8A 3ROFA 1GZ3A 1CRZA 1WD5A 4G6ZA 1GTZA 2Z5VA 5ALLA 2QXUA 3HG7A 1G4AE 3ILVA 5GZ6A 5A6SA 5IKEA 1Z37A 5KYTA 2D1FA 3ZIUA 1E6KA 2HY7A 1TAHA 2BVNA 2HWYA 5DXJA 4JI6B 5A3RA 4L22A 1KYYA 2CY0A 3RYIB 4LOJA 3TKYA 5T7BA 2FQXA 1VIDA 1CEQA 1CY1A 2JJQA 2Q1XA 1E98A 4J16A 5B7NA 1EXVA 2HA5A 1M73E 1BDBA 1Q7TA 4O1IA 5DIZA 1P1CA 3SMVA 3SXPA 3VGPA 2F8SA 1FVOA 1PR0A 13PKA 1PS0A 3I72A 3PU6A 3Q7SA 5KREA 4UXIA 2H0RA 4K2HA 3S0JA 3IQIX 3K1ZA 4JELA 4AMVA 2OGSA 1M2EA 3AEKB 3D0QA 2QJRA 5U4QA 3ROGA 3RVSA 5B1EA 2MSNA 2HMUA 5E0KB 2Z5GA 1ZD2P 3IPXA 3WLEA 2IEDA 2VPIA 3H86A 4MQEA 1SG9A 2W2LD 3TIVA 5LCXA 3F7MA 3W8EA 4NV1A 3DHEA 4P8RA 4G56A 1X0VA 2BV3A 2JD0A 4L16A 2PMCA 9ATCA 4HDNA 4H7HA 1GNPA 2CLKB 5JMOA 2C95A 3K5IA 5EZYB 4FKZA 5I48A 3EK2A 4FJ2A 3DVLA 1BVHA 2MSDB 3FCXA 4UM8B 2AB0A 5ES3A 4DIMA 5EPUA 5A4JA 4JUBA 5K8CA 1KQOA 3DDUA 1SCBA 3EIWA 2WD7A 3N05A 3FM9A 5C52B 5EKDA 3E7XA 4POAA 1U0FA 3RJTA 3QPVA 5G1NA 4JJIA 1DCMA 5GMOA 3PBKA 3TL2A 5K3AA 2BIFA 4PRYA 4RK1A 1QH0A 4ETNA 4KHZA 1MEJA 1SD5A 1DJMA 1AHHA 1IE3A 1SKQA 4NCXA 3PNYA 3R24A 4XVRA 1J2UA 4LZAA 3EZNA 5IEBA 5HF9A 3UGTA 3TJRA 1II8A 4M0PA 5DW0A 4UCXA 4ZGWA 2GAJA 2YS7A 1S2LA 5CFZA 1RC1A 3VNBA 3AJRA 4YHBA 3KWLA 3U3RA 4EJMA 2A9OA 5CNMA 1DJLA 4QJIA 4KR7A 2R47A 2W6QA 3H9EO 2RH5A 2X9VA 4GLOA 4IIHA 5EKTA 4RDCA 3TTVA 1IXRC 3VNAA 4JEMA 3VZPA 3WG9A 5EKXA 4CM1A 5KWVA 3OLCX 4M0LA 4Q15A 3I73A 3W79A 4G0QA 421PA 1I4DD 3HHPA 2YMPA 3SSNA 4DQVA 5CDSA 2P8SA 4JNKA 2YCLA 2OG2A 4PYLA 3COJA 3E3NA 1C4XA 4I0WB 5FFNA 3HYCA 3WMWA 3DDOA 2NO9A 2OAQ1 4PYIA 1IQRA 1QF7A 1SZPA 3IOMA 2QNBA 1L5VA 1IC6A 1PW7A 4KN8A 1W1UA 1FZTA 3HDJA 4H4CA 2BEWB 1M6VA 1WUHS 2WKWA 2XUOA 4OHFA 4ZAZA 4U0JA 3ISJA 4YJ2B 1NFFA 3ED5A 2RIPA 1YQ9A 2WDZA 3P4UA 2AIRA 1UK7A 1SUPA 2X7HA 3VTZA 3U4IA 5DYWA 3EXFB 4YP0A 1D2MA 2HA6A 3CS3A 3PFCA 5JV5A 1NJ8A 4NIMA 1AXRA 2PXAA 3T41A 5EE9A 4JN6B 2BZ1A 3AUSA 2ZWVA 4KWTA 5CNIA 4BO8A 3I6IA 1QG4A 2OYSA 5BMVF 2DB3A 1YB5A 4ZTUB 1RWQA 1OX5A 1PYDA 4ALNA 1FMFA 3L7DA 1COWA 2H4YA 4DFDA 2G9QA 2JLVA 4KIWA 2XGMA 5CDGA 3VKGA 5ICMA 3U17A 3ROKA 4RKEA 1GITA 3P2MA 5EIFA 3JZAA 5U4XA 4DNQA 3IAHA 4DR6B 1GYRA 1PNOA 2F9FA 3I76A 1UAAA 2EW8A 2BJVA 3N86A 3VO9A 1TW3A 1V7PC 2P6NA 4U7GA 4JY7A 1V11B 4IAOA 4I6JA 4MW9A 3KEFA 4PAGA 2O0JA 3JALA 3U7JA 1J24A 3DH0A 3UTDA 1SBIA 4J0EA 4F3NA 1XMQB 4EGFA 2UVPA 1G59A 1QH8B 4Z86A 4WTOA 5KUTA 2ZE8A 3EZ7A 3H9BA 5KOJA 1KEPA 2GEKA 1TM3E 1DRWA 2YN0A 4Q9JA 5AKLA 1PWZA 3P9PA 3VPBA 1FFCA 2ZXEA 1E4EB 5KMGB 1MO5A 3MA0A 2EBWA 2OGTA 3BK2A 3OPNA 4LF8B 3EXG1 3Q9NA 4KQHA 1NT2A 4MULA 4CMKA 3T7RA 4QQFA 3H2IA 3IBFA 3UYKA 2OPBA 2QRHA 1P33A 1M8PA 3QVSA 4FZRA 5FWAA 4EW3A 1DAHA 3MVEA 1PQUA 2Q5JA 2P9ZA 2ZDQA 3WZLA 2ZATA 2B0CA 3RLIA 3G1WA 3IMFA 3GUHA 1CF9A 1EIZA 1Y4DE 4EI8A 3RIHA 1QVZA 1WE2A 3CJRA 3Q8LA 4D0NA 2XT9A 2V5VA 1L5NA 3RD5A 4MWEA 2ZUDA 1UP7A 3V7YA 3WL4A 2C78A 3P0FA 1OLOA 4ADSG 4HB3A 5DLYA 3VPGA 2ZB2A 4ABYA 4P33A 2X2PA 3T3IA 4AKGA 4FJ0A 5JYEA 4IIXA 3K8YA 4G5RA 5SZJA 1RC8A 4P4UA 1GILA 2QLTA 2EW2A 2OMKA 1EQAA 4RJ2A 3SK0A 3OIUA 4LGCA 4DG9A 1HQYE 4D99A 1ODIA 1B0PA 1S2DA 1X38A 2X86A 3CZPA 3JQGA 3QX7A 3I2FA 1S96A 5BRNA 4HQ0A 1KPIA 4P58A 3AIOA 2VZ9A 3RTCA 3REGA 4WBNA 4XLLA 3ELWA 4OA5A 1BOOA 4PC6A 1SC9A 1SXIA 3EHDA 4EG6A 4UHDA 2TYSB 4EB6B 3NTXA 1V7ZA 4GXNA 5T4FA 3UCEA 2HRQA 4WERA 3WS7A 3HB9A 2CHGA 2I7XA 4D4IA 2IH5A 1B4DA 1UEXC 1T2FA 5AM5A 1MR3F 4DUGD 5CVJA 5FXMA 4K28A 4I1YA 1ZBDA 2DHRA 1L1FA 7MDHA 4RK7A 1RZRD 4MUKA 2VDJA 2MSEB 2YHAA 1WRBA 4KFTA 3VGJA 4DLPA 1SVLA 2FUCA 2F3UA 4PO8A 4H9GA 2HLPA 2NXCA 3G0GA 1F0KA 1IBCA 4IFEA 4PNEA 4M98A 3CUVA 5TARA 4UJ5A 5B3LA 3LWZA 5J2UA 3UF0A 4DLZA 3H6GA 3LWDA 3KJHA 2Y3IA 4LOKA 3R75A 2CMKA 1ML3A 3O74A 4HDMB 4UUPA 3RC8A 2GYWA 1X8JA 2ZYVX 3DZDA 3L02A 3OKAA 4KQWA 4AJIA 5B3KA 4TLAA 4NHOA 3ZD6A 1RI4A 4KRXA 2VDVE 4YR7A 3ZVMA 2WU0A 4M8SA 4RVOA 1QHGA 1EDBA 2ZRQA 2QI9C 3LVRE 2ZB4A 3WK6A 3IIKA 3FY4A 3NDRA 1DDIA 2EZTA 3G49A 3R7AA 3I92A 2XMSA 4E4TA 4F93B 1D4ZA 3SYRA 4C7VA 4F6RA 4CM8B 2P5SA 1SR8A 4GLLA 2ZJ6A 4YALA 2BRUA 3KOXA 4P3OA 1NF8A 3UO8B 4NFHA 2DTDA 5FNVF 1FFAA 4OBBA 1IB0A 2BMDA 3X2SA 2W37A 2A1TR 3OCUA 4NJMB 2WD8A 3V4RA 3C1UA 1OFIA 1PJSA 2OCBA 5IJAA 4Q6BA 3JX9A 4X44A 1L5SA 3RUEA 4UMDA 1XZBA 3HA3A 1NNUA 1UPFA 2GFIA 3G02A 4QPPA 4YA6A 2EV9A 1Z7BA 2Z09A 1GUBA 3CH7A 3NZEA 1A2QA 1XNJA 1Z36A 1U7UA 1XOIA 2OK8A 2WK1A 4M83A 5ICEA 3M6XA 5REQB 2QUZA 4U2KA 2JAOA 2XNKA 3P7MA 1SQSA 1XRMA 2C5EA 3ELYA 1P29A 1W30A 3TH5A 5ICFA 1ENYA 1K8XB 5JD6A 4BNMA 4JODA 2R85A 4DUYB 5FCDA 1FQWA 4G01B 1T91A 5AHWA 3KZ1E 5KVCA 3LA8A 4E5NA 3UPTA 1V8FA 3F5FA 3B1XA 4MUIA 1Z18A 5BV0A 3GLQA 5T4EA 1I30A 2JJ2D 4U6NA 5ELLA 3UA4A 2EVWX 5J2UF 3EEQA 4JX8A 3T35A 1JG1A 1H42A 2SICE 1TK3A 2VHYA 3LU1A 4Q39A 3TGWA 1JEAA 3BE4A 4LW8A 4URUR 4UXJA 4C4AA 3HN7A 2B1GA 3I04A 1XAHA 2F00A 2C7QA 1THGA 2FEOA 5JQWA 2JASA 1BDHA 3KEMA 5REQA 3ZBPA 3TOZA 4FCWA 1EXNA 2R4TA 4X3OA 4G5HA 1TLLA 1NWCA 4GGMX 1TB4A 3TFOA 1YZNA 1TQDA 1V8BA 2X15A 3DT6A 1CR1A 1RADA 1I1OA 4WBNF 4AY6A 2C3OA 5FWDA 1OFHA 4GZ6A 1J2JA 3KKNA 4H16A 1QXSA 3T94A 3BMQB 2FSPA 2VO1A 4GLBA 3P0RA 1Q1QA 2J5BA 1ZH8A 4N5NA 2IEGA 4OK6A 3WLHA 4U2DA 1F2TA 3LQ2A 3WLAA 3PZRA 2QTGA 2ZANA 4M54A 1T1SA 4PX3A 5NLLA 4BQFA 2VQDA 5BV1A 3STYA 3EVNA 3M49A 5K0LA 2HGZA 2O2DA 4GWLA 4D0LB 1E58A 2YJ4A 5TQJA 4TMKA 1PVDA 1JFFA 4LHSA 1LQTA 4U00A 2P27A 1YR7A 3FPSA 4CM7A 3DF7A 2IUTA 1YRAA 1VCNA 4O4HB 1RYMA 1ILEA 1BVRA 1P74A 1AMUA 1EUQA 1TTQB