5K01A

Crystal structure of comt in complex with 2,7-dimethyl-3-(1h-pyrazol-3-yl)imidazo[1,2-a]pyridine
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
214
structure length
214
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of COMT
rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Catechol O-methyltransferase
total genus 75
structure length 214
sequence length 214
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5k01A00
3LGAA 4RVFA 4CTKA 5K0EA 2IH4A 3GU3A 4F85A 1KP9A 2F8LA 5DRYA 5DT2A 3VYWA 1D2HA 3G5LA 1WXXA 2H11A 5ICGA 2N47A 2PGXA 3FTFA 4DF3A 2ZLBA 3Q7EA 5EGSA 4V0QA 4QPNA 5U4XA 4ER6A 3HA5A 4PCLA 2Q41A 4PWYA 5DSTA 2EG5A 2JG3A 3NDJA 4BP3A 5LR6A 5DXAA 4QQKA 5GINE 3HVIA 4PINA 3ELYA 4ISCA 4R6XA 5DTMA 5E1OA 2HTEA 5T64A 3I9FA 3SX0A 1R8YA 5DM0A 2Z6QA 1G60A 2ZIGA 5KQRA 3EGIA 4P58A 5E2AA 1NW5A 3BKWA 2C7QA 9MHTA 2B9EA 1F3LA 2P8JA 3B3GA 2FYTA 3EPPA 3P9NA 2IDJA 2OB2A 3HCDA 2BH2A 1T43A 1N7JA 3OPNA 4PYOA 4EVIA 4DKJA 4PYJA 1DCTA 3V97A 4P7FA 3HCBA 2I7CA 3CGGA 4MTLA 5E2BA 1JQEA 3A25A 2B3TA 4C05A 3IYLW 4M36A 3U81A 2AOXA 2GAFA 3DMGA 1O9HA 5LQRA 2DULA 4FGZA 5K03A 5HFJA 3G88A 2EJTA 3G2MA 3EVFA 3AY0A 4AZSA 4YUWA 1D2CA 1X1BA 5F2KA 1WXWA 4GOLD 4RWZA 4C07A 1RI3A 2O57A 4C04A 2BR5A 3GXOA 3HA7A 4X60A 3A7DA 1TW3A 3PFGA 4HG2A 5FHRA 4OQEA 1YZHA 3MAGA 2IDKA 3GNLA 4OQDA 2B2CA 2PVCA 5DLYA 2EX4A 5C0OE 3UFBA 4YUYA 2ZSUA 1M0EA 3HNRA 1M6EX 3OZRA 4AUKA 2ZBQA 2NNWB 3FRHA 2FK7A 1P91A 2P41A 3FPFA 2PT6A 2PXXA 3WSTA 3A4TA 5GM2A 5EMJA 3HM2A 4CTJA 3MGGA 1QAQA 3DLCA 5FCDA 3EVCA 2EFJA 3BWYA 5IKMA 2G1PA 3FUTA 2ZIEA 2R6ZA 3R24A 3TM5A 4DM3A 1G8SA 4E30A 2O07A 4FS8A 3C3PA 5FUBA 1SKMA 3JWJA 3G8AA 2IBSA 1KXZA 3TPZA 1IXKA 1YFLA 2ESRA 2P35A 3FZGA 4XCXA 3DULA 5E1MA 5BW4A 1KPIA 4BLUA 3SMQA 3HEMA 4C08A 2XYQA 3EVGA 2YXEA 4QVKA 3PT9A 2NXJA 2OZVA 4CWAA 4GC5A 5T6BA 1F38A 3DH0A 2AOVA 1VQ1A 3PLAE 2BR4A 2BZGA 1BC5A 1UFKA 3HVJA 4KDRA 5E1DA 4WXHA 3PB3A 3UWPA 2C7OA 1VP3A 4PGGA 4A6EA 3A7EA 4EKIA 2VDWA 3I58A 1WS6A 3REOA 2GB4A 2WA2A 4RTRA 1Y8CA 3LKDA 2H1RA 2QRVA 1EG2A 3HVKA 4O29A 2HR1A 5K0NA 4MQ4A 2HV9A 4QTUB 2AVNA 1VP9A 3VC1A 1EJ6A 3ELUA 2YVLA 4PNEA 5GP1A 3KPVA 4F84A 3KKZA 3C6KA 4Z2YA 3GJYA 2UYHA 1ZKDA 2NXCA 4Y2HA 3M4XA 5E9JA 4BLWA 5JUWA 2E5WA 2JH8A 5LQAA 3EEOA 2ZVJA 4RSRA 3G7UA 1JG3A 1JSZA 2AN4A 1I9GA 5EVJA 5CCBA 1EJ0A 2ONYA 1AQJA 5HIKA 3X0DA 2PX4A 3DR5A 1YUBA 5FA5A 3M6XA 5C9ZA 5K0CA 4QVGA 4LG1A 1XTPA 4PONA 1KIAA 4YMGA 2ZBPA 5KS2A 2AOTA 1YB2A 4XUDA 4V0RA 3G5TA 3BWBA 3EVEA 3HCFA 3LL7A 3PVCA 4IWNA 5EQJB 4ATNA 5ICEA 1MHTA 4GOOD 4FT2A 5CVUA 1I4WA 5EKUA 2ERCA 3BXOA 4HC4A 2ZWVA 4H0NA 4PGHA 4IKPA 1NBHA 3KQYA 2VZ9A 5DTQA 1FP2A 1YZ3A 5LQCA 4DA4A 4OBWA 3VC2A 3F4KA 3ID6C 3GDHA 4FSDA 3UA3A 1EQAA 3M6VA 1JR4A 5EZSA 4E32A 4RTQA 3B5IA 1NT2A 3SVZA 4DZRA 2AOUA 2HWKA 5EHIA 3EGEA 3M70A 1WG8A 3GIWA 3THRA 2XVMA 3TOSA 2QYOA 5FULA 1H1DA 1ZQ9A 5FQOA 3PS9A 3THSA 1WZNA 4KIFA 3BGDA 3BUSA 5E8RA 1O9GA 5CVVA 5P8WA 3TRKA 3O4FA 1L3BA 1UIRA 1KYZA 2ZZKA 3E7PA 3LBYA 2AOUB 3FTDA 3HVHA 3Q87B 5EOVA 2JH9A 4QDJA 2AN3A 5EC8A 1G55A 1RJDA 5EMMA 2GA9A 2O06A 3LDFA 1SG9A 4HSGA 2OY0A 4P7GA 5HIJA 3ELWA 1ZGAA 3ER8A 5DRTA 1NW3A 1SQFA 4X1OA 1ORHA 4GEKA 3TKYA 4YV0A 4MHTA 1VLMA 1XJ5A 5CUQA 2NYUA 2OB1A 2PX2A 1FP1D 3MQ2A 4K6MA 3OFKA 2NP6A 2NXNA 2PY6A 2CL5A 4YV1A 1R8XA 3DTNA 3KQVA 1QAMA 2FRXA 4DQ0A 1Q0TA 4PYIA 1L1EA 4RTNA 3G89A 5FTWA 2OKCA 2VS1A 1NV9A 1OR8A 2K4MA 3H2BA 3DMFA 3EVZA 3A26A 2BM9A 3CC8A 3LECA 3BKXA 4E33A 2G8NA 3KHKA 4FZVA 4RYLA 3JWGA 3O7WA 3EVBA 4M7RA 2PWYA 2OPBA 3E8SA 5K0JA 3FPGA 5JR3A 8MHTA 2PLWA 1HNNA 1RJEA 3E23A 3RIEA 5CCXA 2IGTA 4A6DA 1QZZA 1VL5A 2Y1XA 5HZMA 2ZULA 3M33A 5EZQA 3KQMA 2WK1A 3P2IA 4CXMA 4QQNA 1BHJA 3OU7A 1R00A 2JHCA 2PV0A 2CMHA 1JQ3A 3FTCA 3R9XB 3FUXA 1L9KA 4PIPA 5FHQA 4PIMA 3G2OA 3P9IA 1XXLA 4NECA 3BGIA 3T7TA 5ICCA 2ZW9A 3B3JA 3QOWA 3FUVA 5K8VA 1L3IA 3CKKA 4LWPA 5BP7A 5HILA 3IV6A 4X63A 3G2PA 4X41A 3TR6A 1X1AA 5EHGA 4E2WA 3SSOA 4ER7A 1DUSA 1AF7A 1PJZA 2P3OA 3FYCA 3LBFA 2IH5A 5CM2Z 3NDIA 1RI1A 1VE3A 3IHTA 4KDCA 2FK8A 4GF5A 2P40A 4HTFA 1QANA 5GOZA 2O05A 2Z6AA 3R3HA 2P3LA 5CVJA 2AR0A 5B1SA 1RI4A 2PX5A 5CVDA 3HCEA 2CKDA 3CJTA 3DXYA 3NVKI 3MCTA 2ZZMA 3IEIA 5FQNA 1NW6A 3JWHA 3T7SA 1AQIA 5K0GA 4CKCA 4FP9A 4RX1A 4EK9A 2GPYA 2JHPA 3KR2A 5BXYA 3E05A 1B42A 1KHHA 5DM2A 1QYRA 3FYDA 1BOOA 1JG1A 2Y1WA 2UYQA 3GCZA 4HGZA 1Q0SA 2O0LA 5GIOE 4RTJA 3P2EA 4CKBA 2R3SA 3FPEA 4B17A 3CVOA 2UYOA 3NWEA 5E9QA 2AN5A 3OU2A 4OA5A 2I6GA 4FSXA 4GUAA 4IV0A 3CJRA 4Y30A 3KPJA 4CKEA 1JTEA 4KWCA 4AX8A 1EIZA 2ONZA 3C3YA 4X61A 4MIKA 4PYQA 1ORIA 1FPQA 4KRGA 5T67A 3UA4A 4DCMA 4YUZA 3BT7A 2ZIFA 1NBIA 1XDZA 5HIIA 5K09A 3LX6A 4OX9Y 2AOWA 3EVDA 1P39A 3ELDA 1JTFA 1RI5A 1Z3CA 4R05A 3GO4A 2GH1A 1IM8A 3K0BA 5EKXA 5LQKA 3DLIA 1SUIA 4ER3A 4RVHA 2B25A 1XDUA 3LCCA 4LWOA 3FPHA 4GC9A 4R8SA 3M6UA 4BLVA 3KQWA 1XVAA 3FUWA 1P1BA 4WVLA 5DM1A 4U7TB 1U2ZA 4QPPA 3KQOA 1ZHFA 3ERCA 3GRZA 3R0QA 3FTEA 3OE4A 5DX0A 4C03A 1JG4A 1G38A 3LKZA 4E2ZA 1YF3A 5D1HA 3A27A 3BZBA 5DX8A 5C1IA 2Z6UA 1D2GA 4AZVA 3C6MA 5F2OA 3DP7A 3GGDA 5FADA 2IPXA 2PXAA 1AV6A 3M6WA 5GWXA 2LD4A 2AS0A 4EMSA 3SR4A 2KW5A 4YMHA 4L7VA 2ORED 3T7RA 4E70A 4C4AA 4BP1A 1BKYA 1VBFA 3KU1A 3O31A 1RI2A 3R6TA 5D1NA 1YFJA 1NW8A 4PYMA 4F86A 3EMDA 4KIGA 2FPOA 1SVUA 3G8BA 5EMKA 5E9WA 3GRRA 4HRAA 2ADMA 4RTKA 3B89A 5CIYA 2PX8A 1RJFA 2BR3A 5K0LA 2C7RA 2PKWA 1SQGA 3GWZA 3KQTA 2VP3A 2YXLA 3UBTA 2B78A 3K6RA 4YUVA 2IIPA 1MJFA 2FCAA 3P9KA 5HIMA 5HEKA 4YV2A 3OFJA 3UJ9A 3SM3A 1FJXA 2C7PA 3P2KA 1VPTA 1KR5A 2IP2A 4FT4A 4E2XA 3KQPA 4UOEA 1UWVA 2PXCA 3OCJA 3LHDA 2AZTA 5H02A 2IFTA 3KR9A 3SGLA 5K01A 3OE5A 3LPMA 5DPMA 3TFWA 4C06A 4QDKA 3DMHA 10MHA 4E31A 1M6YA 3ANXA 3CCFA 5DSXA 4RTMA 4JXJA 3TLJA 5HOQA 4RV9A 1NW7A 3LCVB 4RTSA 2BM8A 2V7EA 1FBNA 2XYVA 2GS9A 5DM4A 5LQJA 3G2QA 2JHAA 5FWDA 3AXTA 3UZUA 3SSNA 3DXZA 2EJUA 1INLA 5EG5A 1ZGJA 3NVMB 3SXJA 2XBMA 3AJDA 2ZWAA 4ZTBA 4RTOA 5E1BA 3KR0A 4ER5A 1DL5A 3CBGA 3LSTA 1TW2A 5DWQA 4XUEA 3UJAA 2UYCA 1RJGA 2HMYB 3AXSA 3UJ8A 2PWPA 5M5BA 1X19A 4R6WA 2YR0A 3P97A 4P7KA 4RTPA 3TM4A 1L3CA 1XCJA 3OZTA 5FWAA 3UJ6A 4PYLA 3MTIA 1N7IA 2CWWA 4AZWA 2G71A 3PX2A 5E8JA 3EEYA 1G8AA 3FPJA 2PBFA 4PCAA 4YUXA 1P1CA 5GIPE 2IBTA 2YTZA 3P8ZA 5MHTA 3PX3A 5GM1A 3P9CA 3BWCA 4U7PB 3DXXA 2PSSA 3S68A 2I62A 5ERGB 4GBED 1JSXA 3KR1A 4OA8A 1EAMA 5BW5A 1R6AA 2H00A 3OU6A 4G56A 5IH3A 2OYRA 2OBFA 1NKVA 3JWIA 3KQQA 4R8RA 4LECA 3PTAA 3NW9A 2UZ4A 1NE2A 2JJQA 3HA3A 3NTVA 4HGYA 5DX1A 3ME5A 1TPYA 1X1DA 3DUWA 4DCGA 2QY6A 3KQSA 3P71T 3PFHA 1XDSA 3MTEA 5LQNA 2A14A 3D2LA 3HTXA 2VDVE 5EPEA 5LSAA 1R18A 3KPWA 4IV8A 3HP7A 5F2NA 5KVAA 3CJQA 4BY9E 3B7PA 3QV2A 4KVZA 3ORHA 3AWIA 1O54A 3OZSA 2I9KA 1JQDA 3EVAA 3MHTA 3TMAA 3UJ7A 4EKGA 2PT9A 4P7JA 3KPUA 3LDUA 3RODA 2P7HA 2YUIA 2GLUA 1IY9A 1NV8A 3TKAA 3FUUA 3UJBA 2P1DA 3UJCA 2ZFUA 7MHTA 4HTFB 4RTLA 4PYKA 2G70A 4M37A 5EIFA 5EIWA 3NMUF 2QE6A 3I5UA 2VDUE 3I64A 5EEGA 1KPGA 3MB5A 4HH4A 4KW7A 1N2XA 5G02A 5DTRA 5FA8A 5K05A 4FR0A 2NP7A 5EMLA 4MWZA 2HNKA 2NXEA 2ZBRA 2QM3A 3B3FA 3FRIA 3I53A 1I1NA 1KPHA 3GRUA 3KPYA 3NJRA 4GQBA 1R74A 2YXDA 3MCZA 5KQSA 4GOMD 3EGVA 5K0BA 1WY7A 3DOUA 4QTTB 4ER0A 2G72A 3LDGA 5ICFA 2OO3A 2OXTA 2ZZNA 2YQZA 4AZTA 1VIDA 3NWBA 3TQSA 2CMGA 4M38A 1KYWA 4DMGA 1X1CA 3BGVA 4RVGA 3RW9A 1PRYA 1QAOA 3MERA 2ZTHA 3SSMA 3V8VA 4POOA 2IH2A 5KYGA 2QRVB 2XVAA 3GRYA 3BWMA 1HMYA 3LCUA 3T0IA 5CD1A 5EEHA 3EMBA 2P3QA 1SUSA 2DPMA 4GOND 4XUCA 1V39A 2ZCJA 2P7IA 2FHPA 1JG2A 3HCCA 1ZG3A 3UJDA 2AVDA 2PJDA 3C0KA 1G6Q1 2WA1A 2XYRA 5CVEA 5K0FA 4E2YA 2AOTB 4PYNA 1XCLA 4OBXA 4EQZA 5LQUA 3QOXA 2YX1A 3GRVA 5DXJA 4RVDA 3ER9A 3HCAA 3VSEA 3L8DA 2V74B
chains in the Genus database with same CATH superfamily
1J6UA 3A9TA 1ZVJA 1XE3A 1LPOA 1GA6A 2W83A 4W7IA 2OBBA 4MUKA 1C9EA 3QKSB 1V16A 3DUFB 5F3RA 5AQ1A 2BI4A 4TXMA 4H1HA 4XGQA 2IW3A 2PHZA 1VE9A 2NSHA 3NNSA 3P2MA 3H3XA 2QP4A 3O84A 4YJ3A 4EUNA 3Q7EA 5BWCA 1IZYA 2H1SA 2Q07A 1GCUA 2HH9A 4K1XA 5U4XA 1JWBB 3KEFA 3N6XA 5BSKA 2FPIB 2XHZA 3C6ZA 5E9AA 3DKKA 2VQ6A 3I9NA 3PQ2A 1YR6A 4JK3A 3RJTA 4B3MB 1DQRA 3PVSA 1TCAA 4JEIA 2IHNA 1X92A 3GWGA 3L8FA 3WSWA 3WYGA 1S3GA 3CPHA 2FZGA 2RB5A 3ZJ5A 3CPEA 3WDLA 5FBVB 2HNBA 1OYWA 3NHUA 3E1SA 4ZAVA 4PM4A 4EZBA 3BQMB 1ABEA 3WXMA 4Q4LA 3MILA 4HWTA 4CLOA 5JPDA 1G21E 1PL6A 4AKTA 1D6MA 2E89A 4GIBA 4OFBA 2OC4A 4EVIA 1RBMA 1A8UA 3ROMA 4WLNA 6Q21A 2P2SA 3VH3A 1M83A 4QNMA 5COQA 3SKXA 1N1DA 3U48A 4F5ZA 4RC9A 4TXHA 1PR1A 3RS2A 3HB7A 5T3YA 1Z7GA 2R86A 3DNPA 3TVTA 2VPIA 5CITA 4HEQA 1TZKA 4Q34A 2OGWA 3G2MA 1E1QA 1GXSB 2GPSA 4MCJA 1QYXA 5JCOA 2BI7A 3A0UA 5K2OA 1OB2A 4AY2A 1AA9A 1GEGA 1GKKA 1QE0A 2Z2IA 2ZYWX 3OO0A 3V4PB 3L05A 2FWJA 4BIMA 1YUMA 3HC7A 1K97A 4DLSA 3KNZA 3BFXA 3OLVA 4G0ZA 4PICA 1ZR2A 4HG2A 1JNXX 1T1RA 1T5BA 1NLMA 1A82A 1MOQA 4OQDA 2B2CA 2FFRA 5F78A 4ZOQI 3A2LA 1E6WA 3RAEC 2ZSUA 3ZCTA 1G6OA 4YMTA 5I5EA 2A3RA 4MVJD 3SG0A 2OBLA 3L92A 4JGIA 3TG8A 2DKFA 4M83A 1XRPA 3KWJA 3ONNA 4JXZA 1QVVA 2J32A 1J2EA 3D2BA 2ZIEA 4FGWA 4QBGB 4Q82A 3AZOA 5FIUA 3WB1A 3NZEA 2IEYA 4MPRA 2X3FA 4HNRA 3U4QA 1GXSA 4BKQA 3JWJA 4DC0A 1WCXA 3C97A 2L0XA 3TSWA 3WXBA 1HRKA 2GEUA 3GJXC 1Y5LA 4BNDB 1FFGA 4A92A 2AE1A 3EAGA 1OYYA 5BNTA 3PT9A 1ZIPA 3ZXIA 3HKCA 4C2TA 2MWMA 2HIAA 3EXFB 3ZY3A 4LZZA 1CPYA 3N6RA 2B4KA 1E9VA 2WDZA 3AUSA 3W2EA 1H9BA 2QPTA 2BM0A 2Z1NA 1UFKA 2ATEA 3QU7A 1LV8A 4GVXA 1WKVA 3CF4G 4PGGA 1GUBA 1XQYA 2JLVA 3Q12A 5KNBH 2FPGB 3AI1A 4BRWA 1AU9A 1DUIA 3M1LA 3IA7A 3N74A 4R1QA 3UMGA 2JGIA 5AK6A 2CFIA 4S1TA 4KH1A 2C2YA 4OL9A 1RU3A 4WXYB 1ZS9A 4G5OA 4XRGA 1T2UA 4FNMA 1VZ3A 4K28A 1TJNA 3I2GA 1Z0UA 1VP9A 2GA8A 1YAJA 2D1FA 2QHXA 1T1GA 2UVPB 3L0ZA 3MCVA 3NCTA 3UXYA 2D06A 4HYQA 1TNDA 2HZ7A 1M66A 1KO8A 4MJ7A 4CLDA 1IG3A 5KNBA 1EK6A 2QTFA 4URYR 2GJ9A 2WJYA 2X76A 2YOGA 1W2HA 2C8KA 4HAVA 2CLMB 2DJIA 1EYZA 4J76A 4S1WA 2D00A 2RJNA 2I4IA 2YNMD 2D1QA 4CM7A 2VHCA 4DMKA 1H1LB 4G1EB 1Y37A 4N49A 1JTVA 5C9ZA 1YUBA 2CYBA 1IHUA 1TUGA 4MYUA 1HPLA 5FD8A 4ENUA 1XTPA 1U28A 3HY3A 4PR0A 3COVA 5CRIA 4NS1A 3PDHA 4WOJA 4OJYA 2V4UA 4DLAA 1WSDA 3DD1A 3MRXA 1YS1X 1LFAA 5JS6A 1SZCA 3BS4A 4W4TA 3NHAA 4WVFA 3GN2A 4ZAWA 2ERCA 3RHTA 3N0WA 1G6KA 4ME6A 1QMGA 4YJDA 1LTQA 3RI3A 2ODAA 1K9SA 2VHZA 5FPYA 4GOXA 3ER6A 4RK5A 5CPBA 4O8ZA 4DA4A 4OBWA 2PZFA 1A96A 2EBWA 4EO9A 1NUAA 1PJBA 4KITB 1UMBA 5IWCA 3H05A 3B5IA 4WUTA 3L7OA 4G5SA 3WKEA 3R6LA 1T5HX 5JMOA 1KZGB 5D3MA 5BRNA 5KMGB 5CT5A 2VXBA 5K3FA 1SRQA 3DMRA 3TOSA 2QYOA 1H1DA 1RDFA 1SUCA 1U04A 3IERA 2QXYA 5CA0B 5AW2A 1CRLA 1GA4A 2CNNA 3L0CA 4PZUA 1YBAA 3WNCA 5CB4A 4LXXA 1BWPA 1A98A 2RHLA 2E21A 2NAFA 3PQFA 5CJ2A 4KNWA 4DWJA 2AN3A 2UUCB 1RAHA 1RJDA 2AG0A 1Q1GA 2Q3FA 4AMGA 1Y9JA 3VNQA 2BMFA 2X42A 3ZD7A 3QLUC 1SUAA 3PFBA 3UT6A 4H7DA 3ZTWA 1IAVA 2BOVA 4IEIA 3UG7A 3R8FA 4KACA 4NOMA 4HI0E 2QVLA 3HJNA 3JQ8B 2XADA 4Z9FA 3WGGA 4EMBA 1QJ4A 1XJ5A 2F48A 2WVAA 3KKKA 5AT1A 1RLMA 5LBIA 1P4RA 3EOAI 4K6MA 5TRTA 3DZFA 1VLJA 1UMDA 1GPUA 1Y48E 1K92A 4NDAA 3WQQA 3CNEA 4K9QA 2Q2WA 4WKNA 1J8YF 5M04A 4JVLA 5ALKA 1RADA 2GBLC 2QTZA 3NRJA 2WOOA 4ZQHA 2Z9CA 5CLQA 4A03A 1SFRA 5BXQC 2NZYA 3FLEA 3FAKA 1ZK2A 4L74A 3F46A 2BP7B 2VPWA 3RVOA 2VS1A 2G36A 3OTHA 3WGOA 2GCNA 4OGWA 4I4IA 2B5WA 2OHVA 3BEOA 2B4QA 3EVZA 3H86A 2QE7A 2V6IA 2HUPA 2GBFA 3BN3A 4M8KA 3I23A 4MDHA 1FSFA 4ON9A 2FDCA 3H18A 2BFNA 3ET4A 2FMHA 1RQRA 2CV1A 2MDTA 4M7RA 2WYIA 3QF4B 3DF9A 4FYXA 5KYXB 3A1SA 3LL4A 4MHSA 3I12A 2VK8A 2OK7A 4G63A 2K87A 4OO3A 1MH9A 4HPWA 4RZIA 3OA2A 4X64B 2ZDHA 3AWDA 1YA8A 2ZR8A 3M33A 2QD4A 4QHSA 4P2BA 3W6NA 4KJXA 4LBZA 1N7GA 4ZI7F 1MX9A 1XQVA 3PD1A 2VF4X 2XVXA 3FUXA 5CHEA 4U7JA 4HZGA 1E1YA 1M73E 1DV1A 2QR2A 4Q7EA 5ICCA 5JS8A 4CEJB 3EQ2A 1TKCA 5JQWA 1TT7A 1PKXA 1XMSA 2OAP1 4YRPA 3BWXA 3SOPA 4DVJA 3WK6A 4X63A 4RA6A 2GZHA 4XIJA 1TM4E 3G3EA 2B34A 3O38A 3UWSA 4EWLA 3LUDA 5FR1A 2GBPA 2VRWA 2GJAA 1N4AA 1GTMA 2DETA 4BMNA 1GGFA 4WBSA 3RF7A 2Z6AA 1HGXA 4TMFA 1PTJC 4N82A 3PUVA 5DHAA 4OIFA 4HDSB 3AY6A 3KD2A 3KJXA 3FJYA 3WLJA 4CYMA 1NMXA 5DGIA 1NT4A 4P81A 2GZMA 3S1AA 2XT9A 1QH8A 4FUQA 6REQA 1ZGHA 3RGGA 4DKXA 2I0FA 1NXXA 1XTTA 2OD2A 5JZSA 1E79D 4CRWB 3AV0B 2YJZA 4F7DA 3DL0A 4WLOA 1HQKA 2MSDB 2WFMA 3E05A 3CKYA 3FCAA 5F23A 2E87A 1D7OA 1T9ZA 2VAXA 1FRQA 2B37A 3LVRE 3WKBA 4CF3A 4EF4A 5JDIA 3R5SA 1R0ZA 4CM9D 4M8NE 5EPOA 2O0LA 4INOA 5BMOA 3RWOA 4YPVA 4KXWA 4XQEA 3FPEA 1BYIA 3FROA 2AN5A 3D0QA 1GR1A 3HBJA 2PMFA 1P19A 1UZNA 1G5IA 3H2ZA 2K2QB 1A4IA 3ECAA 3WB0A 2GRAA 1A7KA 3U56A 2FQ1A 1JJAA 4Y30A 3D59A 1T34A 5F3DA 3OCZA 4CMAA 4PGMA 4F6CA 1U7XA 2X9GA 1MB2A 3E53A 4LQCA 3K4HA 2Q1TA 2DM6A 1OBHA 2A33A 4Y2JA 1E77A 1K5DA 1U3WA 3EVDA 1A4XA 4Z3OA 2PN1A 2ZRGA 3AHGA 3AVVA 1EBBA 3HG7A 4KFUA 1E6EA 2V58A 5LP6C 4K9NA 3TQCA 5LQKA 4URXR 2VZLA 2R6AA 5LQSA 3CLUD 5T57A 3PCXA 3PPVA 1PEAA 1SXJE 4X62B 2QMEA 3IQGX 1CZHA 1E89A 4H7EA 4RF2A 4D9HA 2QB5A 4Z49A 4KMMA 3TG2A 2R6GA 2ZB8A 5CT8A 3SKVA 2JJMA 5KHOC 1A2BA 5J63A 4C03A 1FA9A 5J9FA 3K7EA 2QS9A 3RFXA 5JDCA 1ZD9A 5DX8A 3BZBA 5C1IA 1KJ9A 1VIVA 4G5GA 2HOQA 3DEAA 4YRLA 2J5QA 3N75A 4IUBS 3NTUA 3FSEA 4MQEA 1CK4A 1ZSNA 5KB3A 5K8JB 1DHRA 2XOEA 1VJ1A 4AO8A 1CIVA 1JBEA 2ZU6A 3A6EA 3B7GA 4MZDA 4C4AA 1XVUA 2ZPUA 5I7EA 4DCSA 1KDTA 1NU6A 3G0OA 2XUJA 2P4EA 5B7NA 2OXEA 3Q0TA 4L50A 4R0MA 1IZ7A 1LFDB 1ZCZA 4NU6A 4ESEA 1CNMA 2VP2A 3KC2A 1G8FA 1ISMA 1MO5A 1TIKA 2MSWA 2ZJ4A 3OD5A 4Q1AA 4X3CA 4JFAA 5JSZB 3EPLA 3HSSA 5FEUA 4BQOA 4J3JA 5IBCA 3K6RA 2D1TA 2BEKA 1K4MA 1UK9A 4GP9A 1E6UA 2PO7A 4M8SA 4Q9DA 3ROTA 1VTKA 1E1RD 1MTZA 2HRQA 4ZRDA 3ZHUA 1KY4A 1FJXA 1Z75A 1HYEA 1MIOB 1R37A 1J1UA 4Z8XA 1FVXA 1UWVA 3LHDA 1TZ2A 2FQXA 3EDCA 5FWYA 1Q0PA 4X1YA 4D3YA 1M5TA 3AINA 1PR0A 4E31A 5LLTA 4HX9A 1KA9H 4MPJA 4BZZA 3V4VB 1OA0A 1RWMA 4Y2GA 3DL4A 2HEGA 3D3JA 1K6EA 5EE5B 3TLKA 5JSQA 1NJ1A 3W79A 4RJIA 2XMGA 4TMZA 3U4DA 5T4BA 3SY8A 1L4GA 1V48A 3QQ5A 1DMRA 1V25A 3AXTA 4Y1RA 2PH7A 1QIGA 4GYYA 3RK1A 4AY3A 2Q0QA 3WMFA 3SBDA 2PFGA 3ED1A 3A10A 4M8IA 2FTKE 3SI7A 4AXBA 3W2TA 1IVNA 2F17A 5JEEA 3FZNA 3NDRA 5JCJA 3NHPA 1ODLA 3L18A 1EVLA 4UEWA 5DJ5A 4Z0NA 2BMDA 3UJAA 1K75A 2F59A 1EH5A 3BWVA 5IP5A 3R7SA 4BU1A 3EXHC 1QE5A 4L15A 2P9FA 3DE3X 4ABYA 4BB9A 1FXWA 2GTHA 2JRCA 3DAOA 3I2KA 2YNMC 4TL9A 5KYTA 1ADJA 1NVVR 2FPRA 1OFUA 4PYLA 2GKOA 3MTIA 5HPYB 5KU1A 5FEMA 4S05A 5E8JA 1JI3A 1J7KA 3OF2A 4MYTA 5J1TB 2H31A 1P1CA 3T34A 4H6XA 3WHLA 4KXVA 4I9NA 5FUYA 4ZHQF 5IUNC 5I7FA 1AXRA 5TQVA 4BJ3A 4JB3A 4OXIA 2PMWB 4IDAA 1OAOA 2JI9A 1QONA 2IS2A 2FR8A 4OA8A 1EX1A 4OHOA 3K6SB 2GN9A 3P52A 5IH3A 1HKUA 3CZQA 1V1JA 3JWIA 2TYSB 1GAQA 3KQQA 5HJ7A 3L4BC 1P0PA 3EARA 1ADCA 1ARZA 1TA9A 2OK8A 2JJQA 4QUHA 1R0SA 1KI8A 4JVMA 5I7HA 2HHHB 5AK5A 2ODWA 1K08A 4YR7A 1JMVA 3OBIA 2CXNA 3I2JA 4NG4A 1ZO8A 3EISA 3KKNA 4TV8B 1L5GB 4TWAA 4DCGA 5A6VA 3HYSA 1G64A 5CB4B 4HATA 4FC7A 1R18A 3KPWA 3M6MD 1DZ3A 3SC4A 3OETA 4X5OA 4XJXA 4DWWA 2SNIE 3GEIA 1VE5A 4EVSA 4B75A 1B6SA 3ZLVA 2IYNA 2JASA 4KLZA 3PJEA 4JL5A 1IY9A 1UDXA 3SYNA 5LNK1 2BEUA 4EECA 1GL7A 1EUDA 4M1SA 5GONB 1PJCA 4PYKA 5A4JA 1LQ2A 4RK1A 1MA3A 2JGJA 4U0KA 1V3QE 1DAHA 1M7GA 2GFHA 4AKGA 5EZYB 1MT3A 1DQSA 4QUKA 3EF1A 1I24A 5FA8A 4M9CA 2ONJA 4H2DA 1FVHA 3NWJA 2GYYA 1XMXA 1E1RA 4B40A 5KSPA 4CKCB 1A9QA 2A5GA 3CO0S 1KPHA 3GRUA 1QYWA 1ZLYA 3H8SA 4IGFA 5G2OA 1TYAE 2G80A 3D4PA 5K0ZA 5ALPA 1IOWA 1I2CA 4M1KA 5H81A 2V0GA 5KNDD 4LJ7A 1WXEA 3WLSA 3ZDDA 4P4SB 4RAQA 1UT6A 2D62A 4BCCA 2ADFA 1QAOA 1VHWA 4DADA 2BFBA 4DGQA 3E9MA 4G8CA 5AVSA 1C1XB 4TQAA 2P3QA 1EP1B 4NKRA 3KOZA 3L4EA 4ZVTA 4O4HF 1ZG3A 5C3MA 4JXXA 1SU8A 2IPOA 3O94A 4V3CA 3ZQ4A 4QAJA 1AMUA 4XM2A 3GLFA 3KKEA 1PBTA 1XCLA 3EHEA 3V1KA 4FDAA 1BW9B 2I2AA 2NO1A 3BTUA 3BK7A 3OT1A 2EZTA 2J6HA 2R65A 2WJ4A 4UUAA 4ZVQA 4LJ9A 4DRZA 4D0SA 1JF8A 1U7OA 5F4ZA 2VHVA 2QW1A 3R7LA 2P6PA 4MB6A 1NI4A 4CTOA 2BY4A 3RRNA 1KP9A 5JSFA 2EFEB 5M3BA 4HZUB 1XL1A 3HB5X 3B2EA 4TWIA 3OC6A 1G7TA 3EC2A 5CFNA 4JYZA 5ICGA 1RKUA 1UDCA 2W2OA 4UCFA 1MB0A 4DTIA 3HKDA 2BFFA 1JDTA 1UFRA 2BCGY 3HA5A 2J3QA 2CNKA 4DCJA 2VPZA 4OAOA 3IP5A 4LSGA 3UATA 2HTEA 4ZOEA 4X93A 3KJZA 1ZOIA 1OBCA 2XWSA 2JD1A 5JVDA 4DV1B 3U44B 3K9WA 1NMQA 3C70A 1KMHB 3C8MA 1NJGA 3EPPA 4GI1A 4D82A 2RGBA 1Q1BA 3AHDA 5CIWA 2QQEA 3SFTA 2N1BA 2V3VA 1IQRA 3KG2A 5TQJA 4H6VA 4EB3A 2IKQA 3GDGA 1S02A 4BMVA 1X7XA 2COUA 4QDUA 4R8MA 2FP4B 5A4IS 2ZQZA 3UMBA 4Y6GB 3W9UA 4YONB 4A8TA 2PLNA 4QHYA 4IZHA 4YUWA 3LUHA 1Z29A 3IR7A 4JJ4A 2JJYA 3HRKA 1N5LA 4O1IA 4NL4H 2E6UX 2WWGA 1Z5NA 5A5GA 4KWTA 3BE4A 3GP5A 5EIAA 3RE1A 1AKRA 2BMVA 3M3PA 4B4UA 4AROA 4ZMRA 3GVXA 4FR2A 2YC4C 3FA2A 3FFTA 3GNLA 4Y8VA 2PVCA 3EDRA 2YVQA 3HNRA 1CZNA 3F78A 1FU4A 3HLTA 3ICPA 2NPOA 4NENB 4COKA 2HNAA 5BVHA 1H4SA 1ZD2P 1ZUD1 2OV6A 2QL5A 3TSOA 3M4YA 2ARKA 4QPZA 2EFJA 2AFHB 2F3QA 2O7SA 4PHCA 3CRMA 3BGOS 1BNCA 1JVSA 2R1VA 2V03A 3R24A 4UNRA 1RAEA 2O07A 3UOWA 4ZHQA 5KOJA 3QJ5A 2WHYA 2OHXA 4IX1A 3PFCA 4X3PA 4FR5A 1VHTA 3TTXA 4ARBA 2JAXA 2WY2D 4HB2A 2FUKA 5ALGA 5FP0A 1U5CA 2K6GA 3A4MA 2QZ9A 3ZU6A 2ZPTX 2IU3A 4B09A 2YXEA 4URWR 4M22A 4JI3B 1H23A 2P6RA 1E7WA 2IHVA 1TEHA 1K3FA 3SFVA 3OCUA 3WLAA 2DB3A 1VCMA 3AP1A 4JZYA 4KO3S 4OGGA 1NBWB 1VQ1A 3MAAC 1N6NA 2XQVA 4DR7B 1XXHB 3T94A 2XRZA 3U80A 1F48A 3EIEA 5AUNB 1H2HA 4WSOA 1N2EA 1Z9BA 4IMJB 3U1BA 2QD5A 1B7GO 4CIDA 4TVSA 1MNAA 2QUJA 2VQDA 4FFVA 4M0UA 4JGGA 3A06A 3CFYA 4MULA 1SUBA 4IDHA 5JG7A 4BKMA 3CF4A 1RRCA 2E5LB 2RIPA 3NEAA 3HYLA 5ESDA 4OPMA 4D79A 4KQGA 2VJAA 3ZHTA 2LXNA 3QPAA 4WFQA 5DYNA 2I76A 2YVLA 4HQOA 1BVRA 1XVTA 4II7A 4KMRA 4B87A 2HEIA 4P0TA 2Z8ZA 4JDUA 2JK0A 3BGWA 2D5AA 3IV9A 1ZKDA 5KYXA 1PG2A 1I0LA 4HWOA 5BPHA 1L5HB 4Y2HA 4MYDA 3WDMA 1C8VB 4IHQA 4XXHA 2B1QA 4CKBB 5J47A 4AW9A 5BWMA 1Z47A 1I9GA 1XZAA 4KN8A 1Z5PA 3BB4A 4WUVA 3CEHA 5BQPA 1MC5A 3ENWA 2LZ0A 1TECE 3P0HA 4OJNA 4R01A 3BYZA 4PRLA 1NTOA 1T8YA 2FF5A 5CM8B 3R3YA 4KPEC 3DP9A 3KAPA 4NU5A 2Q8PA 5KC8A 2J3JA 3B6MA 4H7FA 4D9GA 521PA 2WJAA 5HS4A 1TMYA 3VPHA 1U9IC 2PE5A 3O8CA 4AYXA 1XB2A 3MWDA 4DPLA 2JB9A 2H1OA 5DTQA 4MMYB 2DZDA 3ZE8A 1DBRA 4FSHA 3B85A 1L5HA 2B5OA 2FI1A 3RYHB 3GFSA 2WVJA 1P9RA 1PS0A 2ODNA 2C2MA 2DH6A 2QMHA 1PD0A 4MW6A 1VB5A 4OL0A 4UUNA 3WMXA 4ZYXA 1VXOA 3GIWA 1GZHB 3L7AA 4GR5A 3V33A 1A9SA 2F3TA 3V7FA 1HTTA 1A1VA 1EK2A 2D4AA 3CNLA 4DDHA 1JDSA 4KIFA 2WZDA 3RVQA 4B7ZA 3WJ1A 1H5QA 3LPNA 1NMYA 4UPDA 2WHXA 3KSRA 4N03A 2PYIA 4J6EA 2PMKA 3T1OA 3CX3A 4RJKA 4Q9JA 3V2HA 5K6AC 2BJVA 5JDCC 1SM4A 3G1TA 3WFIA 1PZEA 2J7PA 3USES 3HUEA 3T1TA 4CDRA 1TFUA 1UDWA 3WS7A 3P9YA 5EHZA 3RBZA 4HGQA 4P1ZA 2H8GA 1M72A 1U3FA 1O8BA 5GONF 4MKZA 4UEOA 3SIXA 4OK6A 2JW5A 1J1ZA 4IIBA 4MW5A 2PK3A 3FFWA 5ICSA 1U5AA 4RBNA 1ZL0A 2OSVA 1ECPA 5KU7A 5LYYA 2EQBA 1ID1A 3ACCA 4EKNB 1M0TA 2AT1A 1OU4A 2EW1A 4NU8X 1FTYA 1ZN8A 1GRNA 2ZYRA 4CODB 5IAJA 4ZFNA 2GJ4A 4RQUA 4JI7B 1A9PA 2FOLA 1U7UA 4LRUA 1L7PA 4AZ0A 4C2BA 3CC8A 2XTJA 3FHLA 2YWCA 2WP8J 2EYUA 2WF9A 3KHKA 3OMXA 3JWGA 4JROA 4L7QA 1TZCA 3L0SA 4B6EA 4CF5A 4MQLA 5CYGA 4RPKA 2QSYA 1GU1A 3L4JA 2GXSA 4JKIA 2BONA 2LGJA 3DNFA 5KZMB 4M86A 3KQMA 2QX4A 4CXMA 3MBKA 2Q9BA 3QYAA 5EWJB 2QUIA 1KAOA 3FOBA 3FSGD 2C5AA 2NO7A 2OFPA 3KSUA 4UTZA 4XDGA 2ATCA 1MIHA 1LZLA 2C59A 1PR6A 4U7GA 2ZRHA 5GONA 1RRKA 4LYAA 4PIMA 3W6PA 5B37A 1NWCA 3G0BA 3MAJA 2QQ0A 3CPSA 4NEHB 3DLBA 3IJRA 1YJ8A 4IKEA 2H1VA 3TZ6A 1TB4A 4LWPA 1FDOA 2ZATA 3UKJA 1TC2A 3OQIA 2YV2A 5EP4A 1U2PA 4MRPA 3SSOA 4RY2A 1PJZA 2P3OA 4XPZA 1EP9A 5K3DA 3E81A 3L4SO 4HPXB 3DT8A 2DRIA 5EXDA 1G59A 3MMXA 4F4IA 3EA0A 2DLDA 1K7CA 2IZ7A 1G20B 3THOA 3FR7A 3N2ZB 2IK8A 1IZ9A 1PFUA 4OHFA 1PDWA 1J56A 5IEJA 3MCTA 3RG8A 2QLTA 5FQNA 3HJGA 3C5EA 2MMCA 3QVSA 3PEWA 4DPKA 5CXQA 2EEPA 3FVRA 2RHHA 3HXKA 5DTJA 3UEOA 1Z0FA 1J0DA 4OQFA 2D0PB 3UB4A 2HA3A 2ZVPX 3SIWA 4CUKA 4J1NA 1CKEA 3OG9A 3Q9SA 2H2AA 1Q0SA 1X8JA 4TM8A 3WB9A 3IIMA 1P4GA 2HADA 5JZ9A 1N2IA 1DDGA 1W0KD 2VSYA 3HYCA 1A4RA 1E98A 1COZA 4PEVA 1DRVA 1T2VA 2PSEA 4QJ5A 1NI4B 4QU9A 3BD7A 2FP3A 1ONNA 2A88A 3CU5A 2A0KA 1V5IA 3I3OA 3IC5A 5C8YA 2G06A 1O97C 4PSVA 2QDXA 1SOUA 2C99A 3AFIA 3H6KA 4RY0A 4X85A 2IEIA 1JDPA 1U0OC 3BSWA 4JSRA 5T67A 3VDQA 1QB7A 4BVJA 5HIIA 2C92A 4CV0A 1QFMA 3LHKA 4J4TA 4R1SA 1VI6A 1JTFA 1GVNB 2RK6A 4MQUA 5IVPA 3QNWA 4M87A 4B47A 4H0FA 1SUIA 2XXAB 3BOSA 5AHOA 4GMXA 1EFUA 1SZJG 2R6DA 3P19A 5DISB 2GQ0A 3WQHA 3GLIA 2ZT7A 4UVEA 1CRQA 4FMBB 4QPDA 4WZAB 1GRRA 1UKYA 3T7JA 3MLEA 3FTEA 5C5DA 5HVNA 3WGLA 3UICA 2VATA 1RMQA 1DO0A 4R9SA 3FBGA 1G38A 5T7BA 2AX4A 3O3CA 3G5MA 2CMFA 1W47A 3TNJA 5KSWB 2A58A 2B1JA 1BGVA 3ISVA 4F8YA 3TQFA 3WX0A 2ID8A 3M6WA 1KFBB 5GWXA 4V0SA 4Q05A 1RWXA 3LSYA 5D8DA 3W6ZA 3ZV5A 3ZY4A 3DE0X 2IYZA 1ZEMA 4PN7A 1JHZA 2HWYA 1KEEB 4UJ3A 1PZNA 3EIOA 1XALA 5DGHA 4KREA 2WIBA 4F86A 4TS3A 5JE8A 1SNYA 5IT0A 4KQCA 2RKWA 5IPFA 3N8NA 3PL5A 4BFSA 2XQJA 5JXWA 1DOHA 2C94A 4FN5A 2X15A 4R0NA 1L4UA 3GEBA 4P5PA 2H3EA 2CF6A 4R7ZA 4Z4IA 1GQSA 4YUVA 1GPAA 1YE8A 3HDQA 4BNWA 4F3NA 2O3SA 3C1AA 4RADA 1AHIA 4FT4A 1X38A 3AUAA 2ZXUA 3L1IA 3DJYA 4C7JA 4YT8A 1WBDA 2P27A 4AD8A 5C5IA 5EIHA 2NU7A 4QDKA 1MJHA 1GCAA 1B8VA 2DWQA 2J3KA 2CLFB 3V1NA 5LXTA 3GLQA 1COWD 4FXOA 2JF0A 4P3OA 4QBHA 2FMIA 2VJLA 5E6SA 1RMYA 4C7BA 5HOQA 3KELA 1AGRA 2WAAA 3ECSA 3AO0B 3UM9A 4EY8A 1KC1A 3BL5A 4P7BA 4BMOB 4OLBA 1V96A 3A70A 3SS7X 3K4PA 2Y1FA 3DXZA 2A9JA 2NSDA 5EG5A 3BTSA 4F91B 1MH1A 2G83A 3SXJA 3WMWA 4RTOA 3DQZA 1LI5A 2H54A 1WDWB 3CCBA 1HETA 2J4CA 1YRLA 3GUYA 1ENPA 3PKIA 1Z5GA 3ANSA 4CIBA 4D25A 1EK5A 4DHEA 5M5BA 1XNQB 3NYRA 3OIFA 4IZOA 1DJOA 4WACA 5A5EA 1LW6E 1DLIA 2PUVA 1ULAA 4YHBA 3G1WA 2QWXA 2TMGA 1XCJA 4Q93A 3QE2A 3I61A 5JH7B 3UJ6A 4AK9A 1KVTA 4WBNB 1Z33A 3T41A 1R66A 2XCTB 1REQB 2Y9MB 1XRMA 2J5XA 3L6OO 3QH4A 2PBFA 3WL6A 4B5KA 4UC0A 3B1WA 2Y93A 4GE3A 4PV7A 4R1LA 3LT0A 1P1KA 4YJGA 1JSLA 1OUMA 1F06A 3NV7A 1GPDG 1HT3A 1MW9X 1ZMXA 2CVZA 1VPLA 2VRCD 3LUCA 1LQTA 4HDCA 1JX6A 5C1DA 3PD0A 5LPNA 4BGUA 3PTLA 3ETGA 3IEPA 1N6RA 3IDOA 1Z12A 4JJFA 3PEFA 2GCPA 2BL4A 5G1NA 3X44A 1U8FO 2PMEA 2ZREA 3PTAA 1S1CA 2WSYB 1LEHA 3EFHA 2Y1OA 5EJ7A 1BJKA 2WTNA 3PFHA 1K8RA 3C39A 3D2LA 1N2SA 2OORC 3M6FA 4YQFA 2FHSA 2M9MA 4ZYZA 1RBZA 5C4MA 1RM0A 2BZ0A 2BTEA 3IOMA 3VR6D 2A0WA 3CJQA 2QTHA 3ICVA 2FOXA 1L0BA 1XZDA 1HV8A 1BCSB 2QYHA 2VHQA 4B6GA 5DLPA 1Q3TA 4QIHA 4CL3A 4G86A 2ZQYA 4WZAE 3S8YA 1NV8A 2WQ6A 1J8DA 1PG5A 3U7QA 3AGQA 3VOBA 3W5HA 3GCXA 1MJNA 3EGDB 3F47A 3I64A 5ILQA 4DJTA 2D54A 3MB5A 3D3KA 2M6RA 4DSNA 3THYB 1E5XA 1SELA 1Y7LA 2B4YA 4PHFA 5JATA 3LM8A 1PWEA 3PHBE 1JS1X 1QFYA 2W8ZA 3GJ5A 4D44A 1X8XA 4URUR 2R66A 4DXDA 1L4NA 4UM9B 2YDYA 1F4PA 1I4EB 2PUJA 3ZVRA 3CEJA 3GZNB 3MCZA 5KQSA 3UJNA 2G1UA 2PU7A 3VX4A 4IJWA 5K51A 3DVAB 3TIVA 3ZWNA 3U3OA 4LYFA 1R16A 3ZPXA 4Y2VA 5HBGA 1YTUA 1FRFS 2A9OA 2ODQA 2J6IA 3RW9A 4JLDA 3MWDB 3LXUX 1G7SA 1HE3A 2AZ4A 4PAWA 1K0UA 2VO1A 3C3MA 4M0CA 3RM3A 1EVQA 1K7SN 5EINA 1Y82A 5IDXA 3ZY5A 1OKKA 3OCCA 1SUSA 4ES6A 2ZCJA 1F5NA 1HG1A 2P7IA 2W0SA 2B35A 3T1HB 3GYBA 4RH1A 1T91A 1WD5A 3UK1A 5AUPB 3C3KA 3KAJA 1TVMA 5CVEA 4BGVA 1QP7A 2OFOA 3Q72A 2ZAIA 1P7WA 2XQGA 5LQUA 4TS4A 2H57A 3NJ8A 1MAHA 4X92A 4ZT7A 3KDSE 5KEIA 4NHOA 3BSYA 2NSJA 4HHEA 1DP4A 2VSOA 3DDSA 3AONB 2YDXA 3HDTA 1N34B 2GN2A 1VSTA 2XDQB 2G4LA 2ZWPA 4TWZA 2IHYA 4XLZA 1EFDN 1KNXA 4YJ3B 1GO2A 5FL7A 3RS5A 1CJBA 5LR6A 4REOA 2FPXA 4ZZ2A 2OZLA 2PANA 1J9GA 4KNYA 1WXXA 1JE0A 5D5PA 4TTTS 2YY7A 3VO2A 4D4IA 3G85A 1SQ5A 1OAAA 3KAQA 2VN8A 3PYXA 4PWYA 1SXHA 4JI4B 1WUHS 1NZDA 4X3OA 1JZQA 2C5SA 4MVJP 3K73O 3N8HA 4ISCA 1A69A 4R6XA 5JAQA 3ZDXB 3Q7PA 1R0YA 2IEGA 3I9FA 3A05A 3LYAA 4QWMA 5KOYA 3JQEA 3THXA 4X45A 2Z6QA 3KXKA 4BQPA 1YRAA 2J4DA 3TLXA 1E18A 2AMLA 4H3KB 4K1LA 3W1VA 5B3KA 4O1MA 3K1AB 1SUFA 1E62A 4HNAB 5B1IA 1H6BA 3V97A 4DANA 3VOAA 3IOEA 4K9DA 2C88A 1GZVA 2XUIA 4ZOLF 5AKGA 2NSLA 3DBIA 4L4UA 2IV3A 3BM5A 4G0OA 1SQSA 4M36A 1J9EA 2GILA 5JZMA 1VYTA 3IVRA 2BSXA 1D8TA 3FDZB 3DOFA 5HFJA 2HREA 2PKQP 5JNUA 2GEKA 1F60A 1U9ZA 3L6EA 5BSUA 1VYVA 3DW1X 4E12A 4H08A 4UDXX 4B85A 1PL8A 1GNTA 1ZUNB 2J1LA 3DWGA 3TGWA 2A9RA 1VXRA 3HA7A 4MMZB 3FPBA 1NYRA 1EUZA 2DGDA 4S1OA 3PR3A 3PFGA 1QK3A 1VLQA 3G2IA 3SHFA 4D99A 1PWHA 1XOIA 4KXUA 3X1JA 1JI0A 3VU0A 3CH7A 5DNDA 4FHEA 1CP3A 3BULA 5KBYA 2JH3A 4B3GA 3LO5A 5BN3B 1Y4UA 2JRLA 4J1TA 4OXRA 4KDFA 4Y2QA 2FJ0A 4Q7QA 2B8JA 4DYDA 5A3RA 3OTOB 3DLCA 2HF7A 1XEWX 1AJEA 4RF5A 4RHXA 1Y3HA 4DBLC 4E11A 1UEIA 1U7WA 3ND7A 4PTZA 3EZ9A 2JIZD 3OSUA 1QIDA 4HNHA 2PEYA 4L8WB 3GY0A 3SEZA 1YBFA 4ZVOA 2IBSA 1I3CA 2NZ2A 1JVNA 3TZHA 1CNEA 1MP0A 2H4WA 2IYOA 5LNK6 4OMFG 1M7BA 5AKXA 4L2IB 1IULA 3U3JA 3TSCA 1XHEA 3ETJA 2BUBA 3RS9A 3RARA 1YJ5A 1NAIA 4CWAA 5C2JB 5I4BA 1L1QA 1XFAA 1WJGA 3KIPA 5T5QA 4Z8YA 1AMOA 4LJRA 5I45A 3LOUA 4AMZA 4JYPA 4Z5XA 1VCNA 3PB3A 4G8DA 2EU8A 4MOWA 1KEEA 3K31A 2NZWA 4I5FA 4B2YA 4H7JA 1MB9A 2WB2A 4GXQA 2VXCA 1CUWA 5JVDB 3NUQA 1CS4C 1Y8CA 3CGWA 4G9GA 3PE3A 1V11A 4UTXA 4WESB 1OTYA 4C4YA 3AL0C 2ETVA 3QTBA 3EFOA 3VPXA 1B3BA 2V4MA 5EMHA 1XZGA 4EY7A 1CY1A 2PRZA 1J2JA 2C03A 2XOKA 2WPDD 1E1CA 1ULSA 1NJ6A 1WLYA 2XF2A 4EB8A 2NV2B 2RGYA 1YHYA 3WO0A 3H13A 4AUEA 1TKRA 2HSWA 2WKQA 4GM0A 1I5EA 1ZESA 2Y6UA 4BLWA 3CVVA 4GKKB 1HTBA 4IQ8A 2HYIC 4CM8B 1CEQA 2AN4A 1W73A 3HWWA 4FQ8A 1S8OA 1ZJ6A 3IPLA 4G5HA 5EXSA 1K8ZB 2OT3B 3TBFA 2LV8A 1JQLB 1NFFA 1ONSA 3ABZA 4C0HA 3CISA 4YMGA 3SF8B 4CEHA 1KO4A 5FPHA 4XUDA 2JFZA 2IS1A 2P2LA 3AFOA 1ZWKA 4GI7A 1C3OA 5CA1F 4H7IA 3QXCA 1RAGA 1D03A 1KR2A 1AGYA 1OFGA 4GI2A 4UXJA 1X7XB 4U8HA 2A6PA 1ZZEA 2HMAA 1AX9A 2EKDA 2ZCUA 4QUEA 4UCXA 3ZOZA 4FGJA 3I9OA 4JVOA 2WKPA 4CMIB 4I1UA 1J39A 4HGNA 2XUKA 2EXXA 2V8OA 5A02A 4JC4A 1NUPA 4DZZA 4U6SA 3D5TA 3UA3A 3ITKA 3T9AA 3VYSB 4DDMA 2QM0A 1NT2A 1XC7A 1A77A 1CHDA 2GUWA 3H2SA 4D3FA 4FYHA 4LVOA 1QM5A 2IYQA 2VA8A 3M70A 1LA2A 3SHVA 1SY7A 2RFLA 1H6AA 4Y2TA 4N0EA 1DBVO 3R3JA 3EX7C 2WF8A 3CWCA 3LBIA 3U09A 2SHKA 1G3MA 1RBYA 4FMDB 1O9GA 1I4TD 5CVVA 3CXRA 3EIWA 3IELA 3IODA 1EVEA 3O4FA 4F3KA 1LLDA 4CCYA 3Q87B 1BQ3A 3LBYA 3M6IA 1KEWA 2PBLA 4UFOA 2JH9A 4QDJA 4LCBA 1SEVA 4F46A 1NOJA 1J42A 2GKGA 3E5MA 1P73A 2Y92A 4HZUA 4PZYA 1WW2A 1ONBA 1UBTS 2O06A 4EG8A 1SG9A 4FQ5A 2CFSA 5FBQB 3GXBA 4MGEA 1RKBA 3OQOA 3B1YA 4J29A 1ORHA 1BX1A 2C3UA 3L5KA 3ZDYB 4ZD6A 1ZJ4A 1EDEA 4XI9A 1XEXA 5T4EA 1C3JA 4A8JA 3BMOB 2OHOA 2I7DA 3RH0A 3HM9A 2XA9A 2Z8XA 3P9SA 2GN4A 1AN9A 2XIJA 3JAWB 1UPBA 3L82B 4LRWA 4GOKA 2CYCA 1BX3A 5HS6A 3N58A 2FVXA 2BFMA 1PDOA 2O50A 4FFSA 4NATA 4TYPA 5ER9A 3SDZA 4EHLA 1Z0DA 4Y9TA 1OFHA 4RVUA 5TQ0A 3HZZA 2Q3DA 4TLEA 4WZZA 2Q5CA 5K3SA 2OA0A 2OKCA 3C4JA 2FF7A 1GIAA 4JKYA 4ZXPA 1UK6A 2DUMA 3WYEA 5KINB 1JYFA 3L8ZA 3A9SA 1ZGZA 5JARA 1FDWA 2LCIA 2EOAA 3GF4A 4REMA 4EW1A 5DBOA 4YLYA 3GGGA 3RBXA 2VAWA 2C3PA 2EFHB 1JR2A 4DS3A 3FPGA 1CZOA 1SCUA 1IEQA 1OOEA 1WZUA 2ZQ5A 3ORRA 1SKAA 1F2TB 1E2UA 1ZXXA 2D5CA 1FF9A 1ORDA 2WE8A 3EZXA 2XMRA 1H3FA 3EFEA 3IBCA 1H2ZA 1QOZA 3U7EB 1IIRA 3CEMA 4E3WA 3ZQ6A 1IN1A 1UFVA 1ZX1A 2VDQB 3CM0A 5JAZA 3ZGXA 3GD7A 1R00A 2Z83A 3HR8A 3HB9A 4BWGA 2OFWA 2W00A 2ZYVX 3NM6B 2HJWA 1JFFB 2ZUUA 1IN6A 5EERA 5GY7A 3TTUA 4NMXB 2E82A 1H2WA 2WHPA 3IRUA 4LISA 4NECA 4UDYX 2QRZA 2XNDA 3ETDA 3G9TA 4LTDA 3IE1A 4ZRMA 3GAFA 2VAVA 1YBVA 4J16A 2O5CA 4W8GA 3RYFB 5GGYA 4BN4A 2IL1A 3GVPA 1ST2A 3NDIA 1KH1A 4MWGA 1GSIA 1U90A 2OORA 3I6YA 4P53A 3SC2B 5AYVA 3IMGA 2OV2A 1U8CB 1J07A 2R751 3OSZA 4C2UA 2FZCA 3TZEA 4YDSA 4O63O 1E7SA 3ZWOA 4EG3A 1YRWA 3VA7A 1EFPB 1C1YA 3JWHA 1QNFA 2YNMA 2XODA 1E32A 3OEED 1Y9EA 4FHCA 4AM8A 3EGOA 3CZ9A 3BL8A 1UXJA 2JIQA 3JD0A 3WV4A 1B42A 4LZPA 5CFQA 2I55A 3NPMA 2QAGC 4XWYA 3FYDA 1BOOA 1JXQA 3K0SA 2ZETA 4ZARA 2QAGB 4LMRA 2CDBA 1P77A 4B3XA 1PQPA 2LP4Y 3V9AA 3JQBA 5TC4A 2CEAA 2YMMA 3HP1A 1E0JA 1EX9A 4HAOA 4O4JA 4DIMA 4WRRA 3KXPA 4Y9DA 1HBJA 1MVNA 5ETJA 1RKVA 1YQ9A 2I6GA 3JX9A 1N2CB 2AHRA 2R6CA 4LOJA 3A9UA 4UAVA 4YT5A 1AQUA 1Q7TA 3C5VA 1WDKA 2JGLA 3E3OA 3KPJA 3DDNA 4ZV7A 5GAJA 1EIZA 2AZDA 4EABA 1WCYA 3LZDA 2UU9B 2HCFA 2BD0A 4RJJA 3ESRA 3JWEA 4B31A 1XQXA 3OZBA 1Y1KE 4P31A 2R5WA 4Q3BA 1AUXA 1UKEA 4UBLA 4F6RA 1PW7A 2PZ8A 2OOKA 2YIMA 1RI5A 4MV6A 3W5IA 2R85A 1FFSA 2UKDA 2Z5LA 4LRSB 3RSOA 5JNRA 5JZVA 2OBXA 3IT1A 1KJWA 1U9CA 2EHDA 2A86A 4XD7D 1T6ZA 3ZJTA 2HA0A 3H9GA 4JBWA 3MT8A 4MJXA 2POCA 1DKLA 3Q3HA 4TQUS 2G9RA 3BE6A 5L3SA 3EIQA 3F0TA 3I01M 4PBTA 3R41A 3TDNA 3ZE9A 2XI4A 5DX0A 3TD9A 2LCQA 3LLMA 5D84A 4N48A 5F5NA 3SJ7A 1MIOA 2IYEA 4D02A 1T6BY 3EXAA 4KQ9A 2XDQA 2DHQA 2BAGA 5FADA 3FZEA 1RC1A 5LUBA 3CLTD 3TYXA 2LD4A 3BRWD 4R2KA 2OAQ1 3NHKA 4CHGA 5I4IA 4FK8A 2ZRAA 4QDXA 4HDAA 1V1MB 2Y4OA 5K7SA 1H3EA 3HI6A 1IC6A 4PYMA 5A2QA 2AFRA 3EMDA 4FI3F 4BAUA 3R76A 2PWBA 1IQPA 3DLTA 1DKNA 4TV9A 5I47A 1KJYA 2QL6A 2PX8A 4HUQA 3S1SA 4TTSA 4Y6LA 2FUNB 1R88A 3CE6A 4M1OA 3RQSA 3CUUA 4YAGA 5G53C 4LWZA 3MA0A 1KOLA 2FMTA 4OP2A 2IIPA 3OPQA 1UBLS 1CUUA 2F1KA 2QMUA 4YV2A 2QLBA 2Q1SA 5AVWA 4JN6B 2VXOA 1WXHA 1XZJA 4X6UA 3ADPA 2IIBA 2GHRA 1U6JA 4DGSA 4ZCIA 1BMQA 2Q6VA 3DW3X 3UV3A 3PEVA 5HMMA 2WAOA 3ODPA 3FW1A 5P21A 3TLZA 4WCFC 4PR3A 4EG1A 2DP4E 3SQDA 4DQKA 3E6AA 4UTPA 5C8YB 3J81k 3MTDA 2QT9A 2V7EA 1U11A 2VPQA 4RDIA 3WGYA 4IXNA 1JPVA 3ZN2A 1R4NB 2O8FA 4KI7A 4L3VA 3T9DA 3QMVA 1U63A 4UULA 2OEPA 1AXGA 1GN8A 2FWPA 5KNLA 3IILA 3OJCA 4MINA 3JU3A 2QA5A 1YJAA 1BIFA 3G49A 4QYIA 4EJSA 5K4AA 3R5FA 5FTNA 3WV5A 4ER5A 1E9SA 3IDZA 4ZCMA 1ZM4A 3HYRA 4IWXA 4W99A 5H0IA 1TAUA 1W0JD 1OVGA 2JZOA 2WSMA 3OZCA 1CJTC 5CTJA 4MKGA 1LBTA 3ZS8A 4ZMSA 3AG6A 4P7KA 3PUZA 1FNMA 2VF8A 1UBOS 4HH0A 3FWNA 4J9VA 4LRXA 3K05A 5HF5A 5CEJA 3HXQA 1BHSA 4MRRA 2P0EA 3DWEX 2C4MA 1N7IA 2AJ8A 2JDIA 3K09A 4NPCA 3BDAA 1LV7A 5A3JA 3GLGE 4NESA 2JAPA 1OA1A 3P8ZA 2MT9A 4RENA 1AQLA 5D3ZA 1UDRA 4QRHA 5BQ5A 3H4VA 4CHTA 4Z7OB 1U2GC 3FNBA 2CZGA 3MJSA 4V39A 3MJFA 1GNVA 2IUTA 3GEPA 2I33A 3O26A 1BE6A 5IFKA 1DIGA 1VMKA 2W9XA 4NABA 2QRUA 4ZPJA 1X1QA 1DEKA 2Y0PA 5ESWA 2WTBA 2HL6A 4ZI3A 1OMOA 1ZVQA 1SPXA 3IB3A 3I42A 2FFAA 2HYDA 3PQ8A 4G84A 4RHEA 3K5WA 4C43A 4Y9RA 4OB8A 4Q24A 1W85A 3QGMA 1X1DA 3DUWA 5LQNA 2YWRA 1XDSA 3GV0A 5DE3A 4YCAA 3TSYA 3HSKA 3VUEA 5AIBA 4NZOA 4L5JA 1CFJA 1L5VA 3HP7A 1GLGA 5EE3A 4IIJA 3ZBQA 2ZE6A 4FFOA 5ECWA 1BFDA 2CXTA 4MVWA 1VGRA 2PKEA 4GU5A 4H27A 5ADUS 1RXYA 2PT9A 2JBHA 3LDUA 3GRPA 3QXHA 4TKUB 5JS7A 4PC2A 3EB9A 3ZWCA 3R5TA 4TRRA 4YN3A 1SXJB 2GOYA 2QRNA 3TRIA 2P9GA 5HE8A 2Q4DA 4XVUA 2XYGA 4HWPA 1XMPA 4YAJA 2VDNB 3O8LA 5G40A 3TQQA 3VKFA 4QGSA 5HSGA 1SXJA 4BGEA 5CA0A 4R51A 3L43A 4QYMA 2CVOA 2EW8A 5EMLA 3NASA 4YJ3F 2ZBRA 1ZOOA 3WIDA 2R6JA 3LY9A 3L4KA 4A9AA 4Q7KA 2YHIB 1Q5PA 4C3OB 3PJFA 3M4JA 1ATIA 2G72A 4LI3X 1JLHA 2A0FA 3JD1A 4XASA 5SZIA 3TQSA 4MS3B 5LXTB 2Z5VA 4QWWA 3PG5A 2ILTA 3H3FA 1E5DA 2F43A 4GVPA 4CQLA 4RACA 4KO8A 1JDBC 2DWPA 1WTCA 2ZTLA 3C5HA 3FG9A 3H2KA 4JLNA 3T0IA 4DLTA 5IW8A 4RXTA 4RCYA 3UC5A 1POXA 1WXQA 3VYRB 4H16A 1UPFA 1C30B 2EARA 5IN4A 5SYAA 1NHWA 1CDDA 2CUKA 3I39X 2PUWA 4FW9A 6ABPA 4WKOA 4FX5A 3RS8A 4Q1BA 3VDRA 1WDMA 4D74A 4I2VA 1NULA 5HG0A 1ZH0A 1C0EA 1DT3A 4X8OA 1IUOA 5A4AA 4YIHA 4MV5A 4HN2A 2IEBA 4MS1B 5A04A 4P22A 3TZCA 3AJ8A 4UQPA 4NPHA 3DDZX 2MINB 1TM1E 3FMOB 4KVGA 4CF7A 3N9IA 5FWNA 5DT2A 3VTZA 1RXWA 3N76A 1NBOA 3QFRA 4XD7A 3RT1A 1NNI1 2VPYA 3JY6A 4IZIA 5EJ9A 5FUMA 4DF3A 5JMTA 2JLRA 1IZZA 1JLLB 5CFZA 1UQRA 5ENZA 1QO0D 1YS2X 2OD7A 2Z1DA 3MG9A 1C30A 1RP1A 2J3EA 3JQAB 3UOGA 1NMSA 2BMWA 3LBAA 4PPGA 3E4CA 1R8YA 5BVGA 1GUZA 3MQFA 1WE2A 2QN8A 4JI6B 3WY9A 1S96A 1FNBA 1NA5A 2JJ1A 1R5NA 1Z5WA 2NO4A 3VNBA 5A4DA 1M3SA 1N75A 1LS1A 1WNFA 4IDDA 2QTVB 3UCEA 3TUIC 1M76A 4BBJA 3IMKA 1OLOA 1G3IA 3SQOA 1RJ9B 4RZHA 1YE3A 4FGSA 4MTLA 4PVCA 1A3CA 3OQ6A 3VPGA 4MUHA 2AOXA 4F21A 1O9HA 4QLBA 4R84A 1DC8A 3L1JA 3IJ5A 3FNIA 4OG2A 1Z36A 4Q12A 1KEKA 2W48A 3BRSA 3G88A 4ZDWA 2FWRA 3NWOA 3C3JA 4PSCA 3E9CA 5LA6A 3QU4A 2GBCA 4Q66C 4P32A 3W2FA 3TLCA 4DCVA 3BJRA 4K6HA 3AU8A 3NKFA 4JUDX 4WLEA 4C07A 4HQFA 4MROA 3BG5A 3UOAB 1LDBA 3BH6A 2QT1A 4RGYA 2VJMB 1E7QA 1DBQA 1NWHA 1Q91A 3DQPA 3RC2A 4C88A 1ND5A 3MMPA 4P35A 4IUDS 4PPFA 5AW6A 3JVUA 1F0PA 3GNTA 3H75A 3GG9A 3PA6A 1PJRA 1DC5A 1MC4A 3EOBI 3EXEA 3FRHA 4IOKA 4JIMA 4P3PA 3RS7A 4EFMA 2J07A 1NASA 2H63A 1RRMA 3QVVA 2BGTA 1NRJB 5J23A 4TYYA 1W35A 1K88A 4IEEA 2ZSDA 1C7ZA 1R6DA 1UBEA 3LLCA 3JSAA 3KOWA 5EQFA 1I5OA 2VRBA 3NC0C 4FYPA 1CUCA 3AEUA 4Q6WA 4M1YA 3U37A 3TGLA 2X0RA 2IC5A 1NP3A 4QXQA 3TPZA 2BGWA 1U1GA 4I50A 2ESRA 1PVVA 2I22A 4X97A 1EFRD 3D4LA 3I0ZA 4CM4B 5DT9A 1XA4A 1W6RA 4L78A 4L4SA 1D2RA 3T38A 1I3LA 3OZWA 2YYSA 4N3BA 3ZXXA 1PT9A 2G9ZA 3I1FA 2FEPA 4ZREA 3OE7A 2FZVA 1VL6A 1VGQA 4EJSC 1F38A 1NPYA 2II6A 2AOVA 3EF0A 3NHLA 3X1XA 5KTPA 1F14A 5E1DA 3VPFA 5CFPA 4WTOA 1ND6A 1G17A 1K6XA 3VAAA 1QZUA 2JPDA 3MBIA 3ZE6A 4BNDA 3GR6A 4FGLA 2ZYUX 1WS6A 3UB2A 5T8KC 3Q85A 2QAIA 1LJ8A 3A2MA 2QRVA 1G4AE 3E7DA 3KXDA 1N6PA 4HEHA 2W4IA 4ID9A 4B8WA 5C5EA 5LP6F 3R9KA 5TLSA 4OLFA 1BFUA 3LCRA 2C9DA 4N4AA 1RIIA 3EIFA 4DV6B 2X8BA 2RGUA 1KS2A 2OCBA 1Y5RA 4ML3A 1YJBA 1Y8QB 1W76A 4DCTA 1YDMA 4F2PA 4F84A 3PA8A 2JFVA 1AN0A 3OJ0A 4B7AA 3C7KA 3RRYA 3WWEA 5IJ0B 2AQHA 2NXCA 3RPEA 2TS1A 2NYVA 2R7KA 4BNFA 3G7UA 3IS3A 1ENYA 421PA 4I5IA 2HXSA 2VPPA 3UO8B 2RHRA 5KYUA 3FGOA 1KWKA 3M6XA 2IOQA 4DW8A 5FBKA 1R4NA 1W87A 3RG2A 2DR0A 3BVPA 4UHDA 2CNOA 3L8HA 4UVGA 3NGMA 2DPXA 1QE3A 4V3BA 2PJUA 5PNTA 1C29B 4CLEA 4D7AA 2VDMB 1BE8A 1KGSA 3LQFA 4LYEA 4W1SA 3QENA 4HVCA 1I4WA 4OHWA 5EIEA 1E3LA 2Y8EA 3PGMA 4C87A 4Y6OA 1OGJA 1V7PC 2NU9A 3RC8A 4AURA 3WA6A 1AMNA 1U2DA 3BXZA 4CLXA 1DTWA 3BD8A 3SM9A 5HXAA 2X9NA 2XUQA 4J0KA 1Z5OA 3S44A 2RD2A 4ECEA 3ID6C 5C7LO 5IG2A 1WMFA 1JR4A 3ED5A 5EZSA 2DFPA 2R7LA 3CSUA 3HBMA 1UBGA 6CHYA 1E8DA 5IAEA 1KFKB 3A6KA 3T1NA 2X9QA 1NL3A 2AQKA 3EGEA 2HIMA 1GQOA 3LY5A 3PC8A 2FWAA 4HQLA 3B2QA 4MVYA 5AJHA 1GTL1 3CZMA 1X13A 3DPUA 3HH8A 1J49A 2YIDA 2FSFA 3EXFA 1B0PA 2I34A 3ZLBA 4CV1A 4EB6B 5P8WA 4DRXB 1Y1QA 4AJ2A 1USGA 3M7IA 3BTOA 3E7PA 2BTQA 2QV0A 5SZHB 4HMOA 2K7FA 1DBIA 5E2IA 4C4XA 4KZKA 3ZW9A 2GA9A 5IBQA 4QOHA 2XV1A 2BTQB 4E2FA 2QRGA 3ELWA 1M54A 1NF2A 4Q3NA 3B13B 3PXUA 2B0JA 3OQIB 2F1HA 3K1TA 1P7PA 1E1LA 1CR2A 3FDZA 3VKUA 4FHGA 3LUKA 4KH0A 4O2RA 3UG6A 3HV2A 5G3YA 5JI2E 2HMWA 1WU7A 2FDRA 4K6GA 3CVUA 3MOGA 4DNFA 5ALYA 1O08A 1EM8B 2RGNA 1SKYE 2OV4A 3G7NA 3IPYA 5B2EA 2FRXA 3SVLA 1WF6A 3TW6A 2NAPA 5DN9A 1YVDA 3AOEC 2H2HA 2OP0A 3OMLA 4E1VA 1ZD1A 3IV7A 3COWA 5CVCA 1SVSA 5EY5B 2E4VA 4X20A 1NUHA 4GHWA 3PGLA 2O8BA 3PQDA 1A76A 1R64A 1ZCBA 1L4MA 1RM5A 5CX1A 2EFYA 3SQMA 3G5UA 3I1IA 5FFFA 4EBBA 3F1KA 3KETA 1W5EA 3INNA 2IY7A 3RSHA 4KLNA 3DBHA 3W0LB 1XHFA 1UC9A 3EGXA 2ORWA 5IASA 4ZODA 3PR1A 3L7YA 4G1UC 5CCXA 3U7RA 5J2TA 3N70A 2ZWIA 2ZULA 1QK4A 2GN0A 3ZTTA 1MRZA 2AV6A 3RKUA 4D9EA 4UFPA 5I5GA 1ZXBA 1YZVA 2IXTA 3RTCA 5DNAA 1P2UA 2J31A 5JCXA 2XTMA 1ULHA 3ICCA 1CDZA 3RAFC 1L9KA 1Z2EA 4PC3A 5JYCA 5FHQA 2ZYTX 4IH4A 1Z37A 1KTVA 2RI1A 1YZKA 4IVRA 4KN9S 3RSGA 3PHIA 3MSXA 1A5TA 5TJ9A 3B3JA 1ZYUA 3FUVA 4Q0MA 4UARA 3W8EA 2BBTA 4J0HA 3IEUA 2JA1A 5TPWA 2AG8A 4BFZA 4DSTA 2VDLB 3PNQA 1QU3A 3BH0A 1M2JA 4K81B 3WISA 1ZN2A 4K6OA 3IAM6 5FBZA 3STXA 4CQJA 2W7TA 2GBGA 3PUHA 1P4HA 2ONCA 1JHQA 4QA9A 3GLSA 2FRVA 3HPQA 4OF4A 1U31A 2FE4A 5B1SA 3W7VA 1RI4A 1NNSA 4I2NA 4K7JA 4XPIB 4GYKA 4KTTE 4EHKA 3N28A 1NN5A 4M1ZA 3O8OB 4B3TB 1N9KA 3PNMA 2KE5A 2QM7A 4B46A 1T2FA 5EKDA 3ZHSA 1VSVA 4LZNA 2IVFA 4N3CA 3H8WA 5BNIA 1AGPA 5KO2A 4C3UA 4JI0B 3SZUA 3MUEA 1CEYA 1L7XA 4M9ZA 1W4ZA 3SJZA 3PPWA 1ZVMA 4BVGA 4RTJA 4EOGA 1FB5A 1WPQA 2ZIWB 4G0PA 4REQB 4EDHA 5DYYA 3REOA 2VSQA 5E9QA 2TRSB 2X5KO 4Q18A 5AESA 1AD2A 1MG0A 3U0BA 5AXBA 2YN0A 4U2FA 1R0LA 2VJKA 4RZSA 2V5AA 1KTIA 4WBXC 5FLXA 4R40A 1L5SA 1ABBA 2NQ8A 5BNZA 1EUCB 1FYXA 1NBIA 4OX9Y 2KLBA 3EAQA 1PBNA 3KM0A 3N5KA 3VPSA 2DPLA 3WJ2A 3BMCA 2P9TA 3LVBA 1AQ6A 1KYXA 1OXTA 3KDPA 3QOYA 1JHPA 2CLIB 2G25A 4MP6A 1I7QB 3FXAA 4LWOA 1NUQA 4GC9A 1EFRA 1VHLA 4U4AA 1VRVA 1N0IA 3IAM1 3MQ4A 4WVLA 1OZHA 4JAVC 4E4TA 1SXJD 5MFZA 3DMDA 2GWHA 1B2RA 3NBMA 3NTRA 4JLJA 4K9SA 2VTBA 4GS5A 2I3DA 2YBDA 3DVQX 3R6DA 5CD9A 3T52A 2IH2A 4ND8B 4NYJR 5HF8A 3T7AA 3D3WB 4N5LA 1YF3A 5DK4A 1RHUA 2X1LA 3D81A 4XX0A 1ZRMA 4KXNA 4Q4HA 4KXQA 1JEYB 1HLDA 2EG9A 3C3DA 5TMDA 3GVIA 3PRYA 4TL7A 5H3LA 2AMJA 3R7BA 2PUBA 4KI0A 4A82A 5J4YA 4IFIA 1KVSA 1C4XA 1E7YA 1U3TA 4HLUA 1DEHA 4GXRA 1H2YA 5BSTA 4E5SA 2YIJA 4E14A 5BUQA 4O4HB 4D6PA 4GDMA 2ZK7A 1DPFA 1P0FA 4B4DA 1C9YA 4FB4A 2YASA 1PQ4A 3KSMA 3VQTA 4D4MA 1V95A 1N4DA 4MQ5A 1JLKA 5C7YA 4HO1X 4AG3A 5ITSA 3MMZA 1T13A 4FIDA 4OHRA 3EJWA 1TQHA 2Z8YM 4XQGA 1WUTA 2X3UA 5AHKA 5HCUA 4ZCRA 5B1YA 3CIFA 1SQGA 5KWIA 5BR8B 4YPOA 1C2YA 3CW9A 4JP2A 4BUZA 8GPBA 5AHXA 1A9XB 1VKOA 3SCZA 3X43A 1SHZA 1Z5VA 4DQUA 4KG7A 5GGXA 4BMCA 3FKQA 3P2KA 2P6OA 3RB8A 1EE9A 2NVUB 3KVVA 2C0CA 3H4TA 1R6XA 1O7JA 4O2AB 1MQ8B 3CX8A 2AL7A 1MDFA 3VDMA 1SBYA 3ZKWB 4GWKA 3O8NA 1O03A 1UP6A 4KOAA 4JXKA 2JDID 1MO4A 1WCV1 1Z88A 3DVAA 3M2PA 3QJGA 4BV8A 2XNHA 4ZKDA 3NVDA 3FLAA 4RV9A 4RV4A 5TE9A 1O1YA 3VVMA 4EPTA 1JKXA 1DB3A 2XYVA 3N7TA 2QBYA 2IZ0A 3AGPA 1C7RA 3FMPB 1D1TA 1VG0B 2W2MA 4Y1FA 4MWBA 2X5JO 3MMSA 4C29A 1INLA 1NZJA 1W0JA 2AXEA 2PVPA 2W6PA 1MRSA 3C3AA 1A9TA 4JJAA 5FJIA 3O9VA 4F2HA 4MX8A 3M6AA 3NVAA 4NCAA 3IE0A 2BPOA 2R5FA 3PC6A 5SZKB 1HURA 3OFND 1NC1A 2HK9A 5F2EA 2PKQO 3VKWA 2ZRJA 1S3SA 3E03A 3TXXA 3ZCUA 1E9DA 1UQUA 4IWYA 5DZSA 4BJ1A 4RTPA 1L5MA 1I6LA 2IHZA 1QQAA 5BYJA 2CVFA 4GH5A 4LFCB 1X7ZA 3QHQA 4PGFA 1P9WA 1T0BA 1XBTA 3NHFA 5KVQA 1LW7A 1VSQA 4NJEB 1RLIA 3Q3VA 3CURA 2GRJA 1ZMOA 4YUXA 2YS6A 3E9QA 3FPJA 4FMDF 4L5CA 2R8PA 2OZLB 2Z58A 4F4UA 2B20A 3RSCA 3IXMA 2JAQA 3A8TA 3UAOA 2XPCA 1NGSA 4D0LB 4WFJA 1V6AA 1IZ8A 3G82C 4IY1A 1M1ZA 3WNZA 4J6FA 2AGVA 2ZE8A 4ZCPA 3T12A 1WCIB 2MSCB 2TMDA 2PSFA 2XT6A 4XWTA 3TOZA 1H0KA 1HY3A 1T0IA 2E37A 2GGSA 3W3AD 3AVWA 1W36C 2A30A 5FNZA 2I2XB 4P8RA 1VMDA 1RJWA 1T6XA 3KQSA 8ABPA 3AR6A 4FYYA 3KJIA 3KYDA 2P91A 1US8B 3LZ6A 3FWHA 3GAZA 4QU5A 5K5EA 3WQSB 1SJ9A 1RACA 1ZJYA 5ER6A 3DM5A 5EXPA 1YCHA 4RMHA 4MI3A 1HEIA 2XYPA 3E2MA 2IY9A 1NMEA 4G24A 2P7HA 3AF1A 1GGHA 2H1IA 3FUUA 4UVIA 4JGBA 2QI9C 3HU3A 3UXHA 4C0KA 2AG6A 1FFBA 1GG5A 2F9FA 4MLDA 1BN7A 3NHSA 1A2KC 2A8YA 1IPEA 3Q9UA 3JQ7A 4G81A 5EYPA 3AB8A 3BH7A 4FR0A 3HO1A 4IHJA 1FQKA 2NXEA 4U63A 2WKSA 3ZZ1A 4OBBA 5CGQB 1AA6A 1N2CA 5KX5A 5JEDA 1SOAA 3LF1A 1AQNA 1NQTA 1R74A 1XU9A 1KORA 3QBTA 4BFXA 2A92A 1CD5A 5G4KA 3ZDQA 4AF6A 4OHBA 2V0CA 3HBFA 1QKIA 1ULTA 3HP4A 3IBTA 1XPRA 3BA1A 5K45A 3STUA 4KV7A 2VHUA 3AYZB 1E4OA 1E58A 1L7VC 3NHZA 3QIVA 3VU3A 4Q9AA 2HO4A 3LCUA 3BWMA 2O8FB 1ZINA 1NP6A 1IBSA 3H9BA 1OIWA 4Y98A 2A5DA 1SBZA 2J0UB 1EE1A 4KPUA 3ZVLA 2PSHA 4WXMA 2ADOA 2GO1A 1OI4A 3IXQA 2E55A 3HYNA 4CNQA 5E6UA 1SH7A 4DT1B 4Z53A 2AC2A 1JYSA 2Z6VA 3GEHA 3KHUA 1V0JA 4KQ1A 4LTMA 5EXEA 3ROEA 4BIIA 4CMGA 1EFHA 5K3FB 4ZI5A 5NULA 4PNPA 4Y0AA 4CG2A 4M0FA 4A91A 4FEEA 1IN8A 1NQWA 1OH8A 1N1GA 4MI9A 2IPNA 4QPNA 1T6YA 1RM3A 5GV8A 1ISPA 1E59A 3SE7A 5TPZD 1QVAA 3EXG1 3RUHA 4Q1CA 1N8NA 5F73A 3KFLA 2F3PA 4JV5B 1A9OA 3VKGA 3ADDA 3MTJA 1M2VB 2A0XA 3O74A 2CXPA 5EJ6A 4C7OA 3AOEA 2E6KA 2H08A 4P4SA 1FTSA 2A1TS 3B3GA 3NBKA 3R9IA 2IDJA 2VNJA 1GOTA 2IYWA 1P7VA 2WJPA 4Q3EA 3TBKA 2XXAA 4DC1A 1ZJJA 2X22A 1HT1E 4RGBA 2ZYIA 4PSKA 5E6SB 3AEKB 3HCBA 5D6OA 4E6EA 2QVXX 4K05A 1XCPA 5EP2A 4IRXA 4Y3UA 1ES9A 1JMYA 2ZANA 4MVJI 1IRIA 2P5YA 5EKTA 4OTZA 5J43A 4XOIA 3RU3A 4A2QA 2Q6TA 4MDEA 2L69A 5IXJA 1QQ6A 1SC4A 4DZTA 2OILA 3LC7O 2X0IA 4EENA 2FW7A 2HQOA 4TLLB 1SCKA 2OP1A 4CV3A 1JU9A 1QHHA 1T4MA 3AJRA 1L7AA 3QKUA 2OLEA 1SWVA 3M0EA 4PQYA 4D9KA 5LL6P 3V5NA 4QGHA 2IDKA 5CB6A 3T1QA 1PK8A 2QTAA 3BRWA 1XEXB 3MWKA 4PC7A 2ZAMA 2NNWB 3K4QA 4J8PA 3FPFA 4QJ4A 1XEFA 2V3CC 1UMDB 4DIOA 5G0UA 4J4HA 3QVGB 2EW2A 1ZMRA 1NFQA 3SC3A 3V1YA 3HM2A 2JLUA 2HB6A 2H5IA 2C4NA 2RHWA 2XZLA 4IX9A 2JFOA 4YMVA 3MINA 4MMXB 1NXSA 2JKZA 1VKZA 4QYTA 2VYND 4C20A 2HO5A 1SQ6A 1VPEA 5CFOA 1BMFD 5L4NA 1HM5A 4G6ZA 1FJ2A 1NW9B 1SA0B 2AEMA 3E1GA 4FWBA 4NEGA 1DVRA 1NI3A 1TKAA 3FYHA 3KT0A 1EUCA 2AEJA 2QAJA 3CZCA 3EVGA 1C7IA 3NFRA 2GI4A 4EYEA 1R8SA 3WQRA 1ICIA 4E21A 1IH8A 4YK7A 5AI9A 3GELA 2G4VA 4KDRA 1EXMA 4BBAA 3FCYA 1NLUA 3RSFA 2X9VA 3A6LA 4Q1FA 4MPDA 4C4ZA 2WA2A 1Y33E 1RYMA 2B8NA 2WNIA 5TT1A 5IRCD 4B9EA 1H93A 4CDNA 4HDRA 3D3WA 2HV9A 3GNQA 3D0KA 3QLVC 3ENZA 1J0XO 1FTQA 3P20A 3PDCA 4HCJA 4Q4JA 2C82A 5SZJA 1U9YA 4EATA 5KOIA 4V38A 1OIXA 3ZQUA 3WGUA 5AKJA 3DFUA 4BNTA 5A9RA 1EBFA 4HX5A 4Q4JB 3Q11A 2HRZA 5AJWA 1GTG1 3W4IA 1DKMA 1NQOA 1IJFA 1IPHA 2W8BA 5D51S 1RW4A 2E5WA 4XTRA 5E9JA 3AR7A 2ZYSA 1SBCA 5J58A 1SVNA 3GNSA 5F4BA 4JJ8A 3AFGA 1UP4A 3EULA 5FA5A 1UAYA 4JA0A 3AEZA 3HJTA 4QVGA 3M1AA 4PONA 2ZBPA 3TLGB 1P9NA 1YBHA 4OMUA 1O58A 1ZPDA 4X1IA 3ZD8A 2QTBA 1TJ4A 5CB8A 3SHOA 3KLPX 3PCRB 1T9KA 1P80A 2WG1A 2IXEA 1Y80A 1S8AA 1Z56C 3RK4A 2IXGA 4MZXA 4N39A 4WK2B 4X1KA 4ZOAA 1E2LA 4CKWA 3AL3A 2MSEB 2G9UA 2I4RA 2IW1A 1WU8A 2BMJA 3OCXA 4I66A 4CL0A 4ERXA 2R1VB 5HR5A 3VI3B 2JLCA 2FUCA 2IQ5A 1X3LA 2H7XA 1CTQA 3AF0A 3F90A 3V1LA 2FX3A 3ZE2B 4DZRA 4B2LA 2QN7A 5LCXA 3HXLA 2ZI6A 5CCDA 5ALFA 1IEXA 2XVMA 1PS9A 3GLIE 2YMPA 3ML1A 3OC0A 1OJLA 4GGPA 5ALMA 1AUVA 3NWPA 3BGDA 4PCVA 3M5DA 1L6IA 3I4FA 1YQGA 4IF4A 5J2UB 1L3BA 4DA7A 5C8DA 2F1RA 4HUTA 5EOVA 3TI9A 2QU8A 1Z4JA 3LT5A 3NHBA 4K6FA 1F8FA 1G55A 3R6WA 1JU4A 2REBA 5JCOC 1MO3A 1Z6AA 1HDCA 2YBEA 2BKVA 1I80A 1TK3A 1YZQA 2C5FA 2CJPA 3I9KA