5K01A

Crystal structure of comt in complex with 2,7-dimethyl-3-(1h-pyrazol-3-yl)imidazo[1,2-a]pyridine
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
214
structure length
214
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Crystal Structure of COMT
rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 75
structure length 214
sequence length 214
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5k01A00
2ORED 4V0RA 4GC9A 1KYWA 4PYIA 3G2PA 3FYDA 2ZFUA 1X1AA 4E32A 1XDUA 1ZGAA 3AWIA 3G8BA 5FULA 4PYKA 3SSNA 4ER5A 3G89A 5E2BA 5ICGA 5E8RA 4YV1A 4LWOA 3VYWA 2Y1WA 2IBTA 3HVHA 4XCXA 3LBFA 1JR4A 3R6TA 4AZVA 3G8AA 4KW7A 3E7PA 3SGLA 3TPZA 1EG2A 4QPNA 2I9KA 4GQBA 4BP1A 4ER3A 1TW3A 3PX2A 5HIJA 4M37A 3MERA 4CTJA 1NV9A 4CKCA 1VQ1A 5EMMA 4X41A 2PX8A 4DMGA 5DPMA 1QANA 2P7IA 1KPGA 4Z2YA 1JG3A 1M6EX 1P91A 2EJUA 3CBGA 4MWZA 2GLUA 1BKYA 5LQNA 1VIDA 5T64A 3EEYA 1RJFA 2GH1A 3DTNA 4C06A 2H00A 5B1SA 2EJTA 3LKZA 3S68A 2F8LA 1SG9A 4M7RA 4HGYA 2LD4A 3EVAA 5K03A 3M6VA 5EHGA 3KQOA 5GIOE 3T7RA 4PYQA 3B89A 3HVJA 2B9EA 3MGGA 3TQSA 1G60A 5EHIA 3SR4A 3EPPA 3TOSA 2BM9A 3FTFA 3A7EA 4F86A 4A6DA 2BZGA 1RJEA 4O29A 1INLA 3I58A 1U2ZA 4GOMD 2HR1A 1ZG3A 2YVLA 3HA5A 1WG8A 3EEOA 5EPEA 1L1EA 2OPBA 2EFJA 3EMDA 4QDJA 3UFBA 1FJXA 1V39A 4PYNA 3PFGA 1VPTA 3JWIA 5K09A 3ER8A 3ME5A 1NKVA 4CTKA 4M38A 3KKZA 2XYQA 3EGVA 3MAGA 4EMSA 1RI2A 4HG2A 3G7UA 5DT2A 4RX1A 1X1BA 5DSTA 5DTMA 3PX3A 5K0BA 5LQCA 5GP1A 3FRHA 2YX1A 5FHQA 2VS1A 1SUIA 2FHPA 3H2BA 4OQDA 1AQJA 3LL7A 8MHTA 4ISCA 4IV0A 1IY9A 2FK7A 2YUIA 4IWNA 2Q41A 3SSMA 2ADMA 2ZWVA 3CVOA 2P3LA 3X0DA 3EGEA 3ELDA 3OZRA 1AQIA 3TM5A 4PONA 3KPWA 4F84A 4RYLA 3PLAE 3FRIA 2PXXA 5DXJA 5EMJA 1SQFA 4AUKA 3NTVA 1NW6A 3KHKA 3UJ7A 2PLWA 1OR8A 4MIKA 2XVMA 3TFWA 4OA8A 5LQKA 5DWQA 1PJZA 2GS9A 1WY7A 3HCBA 2GB4A 1EJ0A 3G5LA 4RTRA 5IH3A 2PSSA 4HRAA 3NWEA 5EEGA 4CKEA 1N2XA 4WVLA 4E2XA 3EGIA 2VDWA 2Y1XA 2JHCA 2PBFA 4CXMA 5DX8A 5EGSA 2UZ4A 5EZSA 2PVCA 1G6Q1 2P3QA 3DR5A 3EVBA 2PWYA 1M6YA 3E23A 5FWDA 1QZZA 3GU3A 1VP3A 3Q7EA 4BP3A 5H02A 4C4AA 3FUXA 3BKXA 5D1NA 1HMYA 1XCLA 3DP7A 3HNRA 1XTPA 3HCAA 3SSOA 3V97A 2XYVA 4EVIA 1P1BA 4DKJA 3P2KA 4GEKA 1EJ6A 3SVZA 3UJAA 2OB2A 3G2OA 1L3IA 5C1IA 5CM2Z 5EKXA 2O07A 1YF3A 2FPOA 5KQRA 5CIYA 1RJDA 1I9GA 1IXKA 1SVUA 2YXDA 3ID6C 4R8RA 4NECA 3MTIA 1JTEA 1NBHA 4PYMA 5EIWA 1XJ5A 2ESRA 2YR0A 1R8YA 3V8VA 4RV9A 2NP7A 1BHJA 3CKKA 3G5TA 3TKYA 5BXYA 3HTXA 1KYZA 2I6GA 2UYQA 3CJRA 4H0NA 5CVDA 5GM2A 2IH2A 2CWWA 1JG1A 1NE2A 4P58A 5FWAA 2VDVE 1WXXA 2PX4A 4MQ4A 5K0LA 3TRKA 4DCGA 1R18A 2AOWA 2G72A 4XUEA 3FTEA 2BR4A 1XDSA 2AN3A 4GOND 1DL5A 2AN4A 3LDUA 4R05A 3HVKA 3BT7A 5CVEA 5HZMA 5EZQA 1FP2A 5K8VA 5GINE 9MHTA 1G8AA 1WS6A 2IH4A 2I7CA 3TKAA 5FTWA 5LSAA 3FPFA 1RI3A 3HA7A 5E9JA 3M4XA 5T6BA 4PGHA 2GAFA 4QTUB 3M70A 3GXOA 5FA8A 2ZBRA 5CVUA 3FUUA 3KQMA 1WXWA 4OA5A 5KQSA 2BH2A 1XVAA 2YTZA 3HCDA 5DM2A 1JTFA 3UA4A 2WA2A 1B42A 3DMHA 4DCMA 1YZHA 5DM0A 3SXJA 5FCDA 1YB2A 10MHA 5M5BA 3FUTA 2HWKA 4ER6A 1HNNA 5K05A 2ERCA 5E1BA 1F38A 2DPMA 4R6XA 4LG1A 1O9HA 2AN5A 4X61A 2IDJA 4LECA 3GRYA 5CVVA 5GOZA 4EKIA 5GM1A 2ZTHA 2G1PA 2OZVA 2YQZA 3KPJA 1KPIA 3NDJA 2ZULA 2EG5A 2PJDA 2UYCA 5HFJA 2WK1A 3KQVA 4DQ0A 5ICCA 3ELYA 2H11A 5EIFA 3KQPA 3DLCA 4X1OA 2FCAA 3CC8A 3IHTA 3SX0A 2PV0A 2ZBPA 5EG5A 1F3LA 4KIFA 4PWYA 5T67A 4DM3A 4RTKA 1EQAA 3GCZA 4F85A 5GIPE 2P41A 4IV8A 3HP7A 1SUSA 1L3CA 3M6WA 3UJ6A 1ZHFA 2PGXA 3WSTA 5HOQA 2K4MA 1Y8CA 1Q0SA 1WZNA 3AY0A 5HEKA 1R6AA 3EVZA 3LBYA 3HCFA 3RODA 5F2NA 5EQJB 4X60A 4DF3A 2R6ZA 1QAQA 1NW5A 1M0EA 2IH5A 2NNWB 3BWCA 2P35A 3LCCA 4ER0A 1MJFA 2GPYA 1YZ3A 4IKPA 2YXEA 3LDFA 3B3FA 3NWBA 3OZSA 3M6UA 3G2MA 3DXYA 4P7JA 5K01A 5K0CA 4RTOA 4AZWA 3E8SA 2JH9A 1EAMA 1H1DA 3REOA 4PYOA 3HCCA 4OX9Y 4Y30A 1D2CA 3MB5A 4RTPA 1JG2A 5K0JA 4DZRA 3OU2A 2P1DA 3FTDA 3FUVA 4GOOD 4PINA 5EMKA 5K0GA 3UBTA 2AS0A 3QV2A 4OBWA 3KR1A 2FYTA 3DH0A 4HH4A 4HTFB 5EC8A 5DSXA 4C07A 3GJYA 5E8JA 2QYOA 2EX4A 3R3HA 5LQJA 2VDUE 4PIPA 3ER9A 1UFKA 2FK8A 4QVKA 5LQAA 4GF5A 4R6WA 4YUWA 3MTEA 3P71T 4M36A 4PGGA 3NMUF 3FTCA 3UJ8A 1UWVA 3PVCA 4POOA 2OY0A 1L9KA 1JSZA 2NXJA 5HIMA 3C0KA 5FUBA 3EVFA 3DXXA 4V0QA 1R00A 4U7TB 3CCFA 2V7EA 2PX2A 1NW3A 3CJQA 2E5WA 2ZZNA 3LPMA 2OO3A 3BKWA 3A25A 5FQNA 2IGTA 1I4WA 3A4TA 3FYCA 2AVDA 4GOLD 2ZVJA 4EK9A 3K0BA 4CKBA 2XVAA 3DUWA 3SM3A 4AZSA 3KPUA 5D1HA 1ORHA 2Z6QA 2Z6AA 3OFJA 4FR0A 3I53A 3PS9A 1G38A 1IM8A 2O0LA 5LQRA 1VP9A 5ICEA 3FPHA 4CWAA 2JJQA 2FRXA 2N47A 3NJRA 4U7PB 2HMYB 3M6XA 2BR3A 3P9IA 3BXOA 1N7IA 4HTFA 4WXHA 3C3PA 5FA5A 1XCJA 2QRVB 3GDHA 4AX8A 5DTQA 5CUQA 5HIIA 1VLMA 4FSDA 2HNKA 1FBNA 4E31A 4HGZA 5LR6A 3I9FA 3ORHA 1NBIA 3FPGA 5F2OA 2PXAA 4BLUA 1DCTA 3Q87B 4FGZA 1FP1D 3KQQA 5EEHA 3BGIA 4RVFA 2AR0A 5E1MA 3F4KA 3BGDA 4FP9A 2KW5A 2O57A 3KR9A 2ZCJA 4RVHA 1G55A 3L8DA 3PT9A 1ZKDA 2OYRA 2C7PA 4GBED 1JQEA 4P7KA 3B5IA 2O05A 3JWGA 3THRA 1ORIA 4RSRA 2B2CA 2B3TA 3QOWA 4XUDA 3BZBA 4QVGA 2GA9A 3HCEA 3JWHA 3GNLA 2AOVA 4E2YA 1BC5A 2QY6A 4EKGA 4KDRA 5DRTA 5HILA 3FPEA 2G70A 4ATNA 5BW5A 4XUCA 5CD1A 2XBMA 4P7GA 1KIAA 3LCVB 1QAMA 1SQGA 3BWMA 4QQNA 1NW7A 5E9WA 2AOUB 4RTNA 5C9ZA 1O54A 2R3SA 5BW4A 2QRVA 4Y2HA 4RVGA 2PXCA 4E2ZA 2UYHA 4QTTB 3NVMB 1VE3A 3GO4A 5JUWA 5EVJA 3P2EA 4FZVA 3O7WA 2CMGA 5E2AA 5KYGA 3G88A 4RWZA 2AOTB 3BUSA 2JHPA 5JR3A 2CMHA 2OB1A 3LKDA 2P7HA 4ZTBA 2NP6A 2Z6UA 4YV0A 3E05A 2PX5A 4KVZA 4GC5A 1XXLA 2PY6A 1AV6A 4KIGA 3TMAA 2IPXA 3P9CA 3GIWA 4PNEA 1JQ3A 4YUYA 1TW2A 4C03A 1KHHA 2P8JA 2B78A 3KQWA 1G8SA 3QOXA 3LECA 3HVIA 3VC1A 5K0FA 1KR5A 1UIRA 5G02A 5IKMA 5FQOA 3LX6A 3VC2A 3RIEA 1QYRA 2HTEA 3IEIA 3FPJA 4UOEA 5KS2A 3NVKI 2ONZA 4L7VA 3B3JA 3OCJA 2UYOA 2C7RA 3MCTA 5DTRA 4YUXA 2P3OA 3AXTA 3UJDA 5DRYA 3EVGA 4YUZA 3HEMA 3KR0A 1FPQA 5EMLA 3TM4A 4YMHA 1R74A 2OKCA 3AXSA 1NW8A 3R24A 4MHTA 3DMGA 1I1NA 3GRUA 2ZWAA 3I5UA 5C0OE 2ZSUA 5CCXA 3THSA 2AOUA 3OE5A 5E1OA 3PFHA 4RTMA 3GGDA 3GRZA 5GWXA 3T7SA 1YFLA 3EVCA 4QDKA 1P39A 1PRYA 2IP2A 4E30A 3ELWA 3C6KA 3OU6A 5HIKA 4E70A 2WA1A 1Q0TA 1ZGJA 2NYUA 2AOTA 1QAOA 4ER7A 4PCLA 3K6RA 2OXTA 2PWPA 5LQUA 1ZQ9A 2ZLBA 4GUAA 3I64A 1R8XA 2BM8A 2OBFA 5DX1A 5F2KA 3UA3A 2AVNA 3EMBA 5EKUA 4FS8A 4HC4A 3LGAA 1JG4A 1P1CA 3C3YA 3MQ2A 5K0NA 3VSEA 4E33A 4YMGA 5DM4A 4C05A 2C7OA 3KQYA 3MHTA 3OPNA 2IFTA 2VZ9A 1D2HA 2JHAA 2CKDA 1KP9A 2PT9A 5DX0A 4BY9E 3KPVA 4KRGA 2ZIGA 2V74B 2AOXA 4K6MA 4MTLA 2JH8A 1BOOA 3DULA 2NXCA 3HM2A 1NV8A 3KU1A 3R0QA 5ICFA 1VBFA 3OE4A 4YV2A 1RJGA 4BLVA 3P9NA 1RI1A 3UJBA 3PB3A 4JXJA 5E9QA 3UJ9A 3R9XB 3TR6A 2CL5A 2PT6A 3EVEA 3LSTA 4C04A 4EQZA 4YUVA 2YXLA 3O31A 1VL5A 4QQKA 3B7PA 3DLIA 3ERCA 7MHTA 1MHTA 3P9KA 4AZTA 5FHRA 3LHDA 4R8SA 4RVDA 2QM3A 1X1CA 2ZIFA 3ANXA 4OBXA 2ZIEA 1AF7A 4X63A 1Z3CA 3JWJA 3UWPA 3KR2A 3M33A 4B17A 2ZBQA 3G2QA 2QE6A 3OU7A 2DULA 5DLYA 2AZTA 1JSXA 3NW9A 5K0EA 1D2GA 1O9GA 1X19A 1KPHA 5P8WA 4KWCA 3T0IA 5DXAA 3GWZA 1L3BA 2XYRA 3P97A 2VP3A 1KXZA 2HV9A 3DMFA 4G56A 3CGGA 5DM1A 1XDZA 5U4XA 5KVAA 4FT2A 3GRRA 3BGVA 3EVDA 5EOVA 2P40A 1NT2A 3LCUA 3KQTA 2H1RA 4P7FA 2ZZMA 3BWYA 3HA3A 3FZGA 4OQEA 2A14A 4DA4A 3RW9A 1YFJA 3D2LA 1RI4A 3B3GA 1YUBA 3C6MA 2NXEA 4FT4A 2G8NA 2PKWA 3A27A 4PCAA 5FADA 4A6EA 4PYJA 2B25A 4E2WA 1N7JA 3A26A 4KDCA 3KPYA 4RTJA 3IV6A 4LWPA 4BLWA 4FSXA 3PTAA 3BWBA 2BR5A 2O06A 4QPPA 4RTLA 1JQDA 1T43A 3IYLW 3OZTA 3P2IA 5MHTA 3DOUA 3P8ZA 3O4FA 2ZW9A 3TLJA 3CJTA 1X1DA 3GRVA 3A7DA 3LDGA 3OFKA 1EIZA 4PIMA 2I62A 1TPYA 3MCZA 2ONYA 3FUWA 5E1DA 3UJCA 3T7TA 5CCBA 1SKMA 2IBSA 3UZUA 4RTQA 4RTSA 2JG3A 5BP7A 1RI5A 2IDKA 3KQSA 2NXNA 3AJDA 4HSGA 3U81A 1DUSA 2IIPA 2C7QA 4PYLA 3SMQA 5CVJA 5ERGB 3DXZA 2G71A 4C08A 3ELUA 3NDIA 2ZZKA
chains in the Genus database with same CATH superfamily
1YZKA 1HLFA 3PQCA 5CX1B 4MDFA 2JGLA 5IF9A 1JEYB 1GPNA 2NZ8A 1EGMB 3G2PA 1HNWB 1Q14A 4QUGA 4Y2GA 2J6BA 2V97A 1GKYA 3ONEA 1IG0A 3WA7A 4I8IA 1AKQA 4BX2A 1BW9A 3O9ZA 1X94A 1J8MF 4PLTA 3ZE9A 2PWAA 3R6TA 5FTKA 3BD9A 1DAEA 3KJGA 6Q21A 1EH5A 3PXXA 4EZIA 2B6HA 4KYUA 4ER3A 3VMMA 1QFJA 2DLDA 2QD4A 3T5BA 2HCBA 3CEMA 4XVCA 3ICOA 1R9NA 5EMMA 1LNSA 2PX8A 1V8ZA 1CHDA 5EUQB 3SC4A 1DRKA 3UT5B 2X0KA 4UASA 1A98A 3JQAD 3D8TA 1D5CA 2BP7A 3K2QA 3QPAA 3JQDA 1H5NA 2HDNB 4RHFA 3DOEA 3T5MA 2O2EA 3UMMA 4QO7A 4KWEA 1L5FA 4Q9JA 1KP3A 1K1EA 3KKEA 5JCJA 1WD5A 3SCZA 4AG6A 4DLZA 4X24A 2A9JA 2WABA 3DEFA 5F12A 4DQDA 2YKGA 2OECA 1RXCA 4LJ5A 3Q7TA 4MRNA 4WLNA 4MA5A 1AXEA 4E4TA 1C7EA 2PZMA 2BZGA 3PXGA 2GZ1A 3EBOA 4AU1A 1JEYA 3VOTA 1C8VB 3ACCA 4BX0A 4X9XA 3PA6A 1EVQA 1PJ3A 1BEZA 2VRNA 3V1KA 1G2QA 5A3QA 4ZXPA 1QRTA 2YNMD 4FGWA 5BOSB 3ET5A 1CB7A 2X76A 1SUBA 4KOAA 4ZP1A 3S2EA 3U17A 1WPGA 3V7UA 4D9IA 1CFJA 4EMSA 4RJIA 3KFVA 1PJCA 4RZ3A 1ZJ4A 1T2DA 4WMLA 1CU1A 5DZSA 2BI8A 3RU9A 1A7AA 2DPXA 2O8VA 3FRHA 4HQ0A 3R1IA 2FHPA 1G7TA 4BFXA 4F93B 3P0EA 4IV0A 5L3VA 3CVJA 1UZMA 3FBWA 3UT5A 3ILHA 3JASB 3Q12A 3IBFA 1NU8A 1YDGA 2C3PA 3VNUA 5ALJA 4GPAA 4NYMR 2ZAIA 3G68A 2G4LA 5F1YA 5DXJA 2PXXA 1BQ4A 3WQQA 1A7KA 1DDOA 1UAYA 2GBCA 3DHYA 1NW6A 5C8VA 2TRSB 2EDCA 3VNBA 5KQGA 5TVKA 3X1DA 3KYJB 2XVMA 3EF0A 4UAVA 4C2AA 2VCHA 3HM9A 3QPWA 1PJZA 1ZVKA 1P5JA 1JMVA 2H4HA 4I50F 2IYXA 3IO5A 3MILA 1WCIB 1D0IA 1PNVA 4IXDA 1B0UA 4KYIB 3TB4A 5C46F 1TYAE 4RTRA 3BG5A 4ZYTA 3TS1A 4AKIA 2Y1EA 3EGIA 4Y9UA 1SVIA 3PT5A 2JHCA 2PBFA 1QFMA 2IS2A 1MQ8B 3WP1B 1BA3A 2GJSA 2Q2WA 3G59A 4I08A 4LOJA 4JLAA 2NZUG 4QBIA 5EZ6B 4IOLA 3STUA 3ZCTA 2UZ4A 5JBQA 1YB1A 4G0PA 2XW6A 5TXGA 1QZUA 1ORWA 1CUBA 4H3HB 4N12A 5CEFA 1MU0A 3CX4A 3CUSA 2VPIA 3KSZO 2ORVA 4WACA 1SC3A 1PGNA 3PEVA 4QTYA 1C9NA 1HLDA 1V6SA 2JKYA 1EJ6A 1XQ1A 3C1AA 1G9XA 3O3MB 4JBIA 1U9JA 5C1IA 1O95C 4PF1A 4QD3A 2A5JA 4ZIRB 2W6MA 1GNPA 1QMPA 1JW9B 3S8MA 4AF8A 1Q95A 1N5IA 2FEMA 3IELA 2P62A 1J6UA 1JTEA 1RAHA 1SELA 3ND5A 4OI4A 4ZI7F 1XNRB 3VR6H 2XQGA 2ESRA 4TN5A 1OIVA 2Q3MA 2X2OA 1COZA 2X5KO 3UXHA 1QRAA 2V7XA 4P58A 3STXA 2KB0A 5A62A 5AVYA 4HNTA 1D6SA 4EATA 2IIVA 3CNHA 2GTIA 4P82A 3CZMA 3E61A 5FBZA 4E13A 1YKFA 1PFKA 1QUEA 2HN9A 2RHLA 1Y6QA 4GR4A 5AOVA 4EB6B 5THXA 3BT7A 4F8EA 1I5EA 3B2NA 4BFLA 4XVRA 1V5GA 3L8EA 4AVYA 4C1NA 1JJAA 1NNLA 4P3NA 1E59A 2HXGA 3ROZA 2V1UA 1RI3A 4YPVA 1E1NA 3MUOA 1YZYA 4WWHA 3G0OA 3FPLA 2G09A 1U8YA 4NV3A 5CU7A 5FA8A 2P9BA 2PANA 3AKZA 2J6HA 2C9BA 2EWVA 5DCYA 4ZQBA 2YJ6A 3DBOB 1OWNA 3IPCA 4F45A 5KYNA 4DCMA 1D03A 3HRHA 2VCYA 3T3DA 3FUTA 4ZIRA 2WOOA 4ERNA 2VQSA 1N6KA 2JB9A 4X61A 5FFFA 1VGQA 4YREA 1K3FA 3S1LA 4Q01A 4Y98A 3UAOA 2WTXA 3HVUA 4LNAA 4PS0A 5JJ5A 4TMFA 2NU8A 2WK1A 1DTSA 4ESHA 3QVLA 4NOLA 1O89A 1ZXXA 3V7FA 1Z4JA 3AHFA 3KQPA 2J85A 2CV2A 2IE0A 4P0QB 1W4ZA 2C9CA 3AP1A 3F5MA 3HDYA 4OJMX 2WUVA 4J4HA 4N3GA 3VX4A 5JNWA 2FQ1A 1GZUA 2FWIA 3E6AA 3I6BA 3E81A 2KM1A 4I55F 4AKSA 2HBYA 2VCEA 4EF4A 1YBHA 4EB6A 1G3UA 2RGNC 5DULA 1Z0DA 5AHKA 1WZNA 3DA8A 2AYZA 3KUXA 4JGIA 4AJHA 5CG1A 1FFAA 4TMZA 3TD2A 3PJGA 3UWMA 1VBMA 3IVAA 2YWFA 1Z33A 2B8NA 4MRPA 2E37A 4S35A 3E9CA 4NBTA 4PXAA 3HUTA 1UT6A 3CMCO 1KEKA 4NWIA 2OHXA 2IHYA 1V1JA 3KHTA 4FN5A 3QM1A 3BH0A 3HL4A 3LW7A 4P6VF 5FUQA 1BIFA 1ULUA 3MB5A 1Z4OA 1EVEA 1JG2A 3I92A 1Z0SA 3G2IA 3KJFA 5FNVB 3TMKA 4BB6A 2QVZX 4Y18A 4PINA 1DQSA 2ADOA 3CLSD 3TR0A 1KFJB 2C4MA 2JLZA 4DUYB 1VE5A 2FTKE 4DUPA 3DH0A 2RFLA 3M6LA 5EC8A 1FF9A 1A9PA 1ZZEA 1RKXA 5EJ4A 1BRMA 2AF3C 2AFRA 1N3BA 5KTOA 3ETHA 3O6VA 3GRPA 5EQTA 4ZAGA 1QU2A 2X2EA 1U4OA 4G1BA 3SYRA 1J22A 2ZXEA 4HB3A 2OG1A 4IZOA 4YI5A 7GPBA 5I8PA 1ZOLA 1U7DA 4FDAA 1PR6A 4G0NA 4MDYA 2W2KB 4NS1A 3WGHA 2AJ8A 1T9DA 1L7AA 4AWBA 2APJA 5ALDA 1Q1QA 3QI2A 3BSYA 3E1GA 3ULKA 7MDHA 4F4IA 2AUTA 1U4SA 4YO8A 5JS2A 3QLVA 1ZD3A 4RL6A 2HF7A 1TRKA 4MV4A 4QBGB 1NP3A 3Q3GE 3A25A 3QV1A 4G5XA 4U0JA 3RWOA 3U4AA 4ERXA 1D1PA 3RUAA 3LPLA 4PG7A 3IAS6 5AI8A 3SM3A 6NULA 1H8HD 2QPTA 2VWPA 3C3MA 1QVRA 1OXTA 3CIFA 2I4MA 3LA6A 4LXHA 2IZ0A 5AK5A 3UUEA 2VKTA 2REQB 1JXMA 2GTHA 5FNVA 1A69A 3W1VA 1VP9A 1NJ8A 4MQUA 1AKWA 4Z7JA 1C8BA 1EWVA 4B31A 3LLUA 1JPNA 4ZI7A 1XE3A 2FDXA 2R8PA 1J8QA 1LGYA 1XCJA 1VC2A 2OAGA 1OAKA 2UDPA 4KN5A 4M9ZA 4URHA 4JOCA 2YJ3A 2QPOA 4G8CA 2RCYA 2ZB7A 1ITZA 2HNKA 3FYSA 3I6IA 3JPYA 1O87A 3PUIA 4HGQA 4HGZA 5F7ZA 3SBOA 5K2OA 5F2OA 2Q1XA 1DEKA 2PXAA 4JZKA 4KB5A 3R7SA 4JL6A 2JZCA 2CK3D 2Z57A 4A4DA 4NHOA 4YH1A 3WGMA 5JNTA 2W2KA 3PEUA 2WKSA 4NAVA 5JV5A 2OHHA 4U7FA 1M8PA 4JI5B 1P5FA 4HNHA 3QWFA 3TRJA 3QJ5A 3T0IA 4OLAA 3PYLA 1NVTA 1AB6A 2ZP1A 4JD5A 5J59A 1GU1A 2FPWA 4PLYA 4UEKA 2ZM5A 2O5RA 2Q2OA 1F3OA 4I8XA 1J4AA 1H1LB 5TT0A 2WSMA 3D6JA 3GJXC 1CZKA 2OAEA 2ZTVA 5IDWA 2JGKA 2W83A 3K96A 3WDMA 3UJHA 4EMUA 1XHEA 3IP6A 2B2CA 7AT1A 2D5AA 2QMOA 3A9WA 1JKJB 2Q8QA 3GQBA 5C0OE 2REQA 1N6LA 3LZCA 3ND7A 2VP4A 5K8IA 1N7GA 1JU3A 1AE1A 2ORIA 4MGZR 1NUHA 4ZTUB 4HI0E 4MVXA 4LJ7A 3CH7A 3JQ7B 4GI1A 2VXBA 2HLDD 2V5VA 3HGQA 4H6PA 4RE6A 1Q12A 3KQLA 1A71A 2L82A 3N2YA 5C9ZA 5E7IA 3AUKA 2G40A 3M6AA 2R8EA 2YIJA 4L5AA 4IFIA 4E2ZA 3IMEA 3EZLA 5LNK6 3PK0A 2EFEB 1IFXA 3P9QA 5ALTA 3GFVA 3V1LA 3AV3A 2COUA 3G88A 1YJ8A 1U7XA 1E92A 5SY4A 1JFFB 2ACKA 2P7HA 1FZTA 5IC5A 2O5EA 3IPLA 1EB9A 3E05A 4J0QA 5FOXA 5CVTA 4U6NA 4YUYA 1JQ3A 3L6CA 1L6IA 5AI5A 4D79A 5CFQA 2Y4NA 5IKPA 1AX9A 4PNHA 2PX3A 1P4RA 2M1ZA 4L0QA 4Y8VA 4YLGA 1JUDA 2VC2B 3M5PA 1VECA 4L15A 1PAUA 3EGOA 1DDIA 3HS3A 1XTZA 3OQVA 1GTZA 3FDFA 3N7AA 4ON9A 3FGZA 3KAPA 1SEVA 5FUXA 3VISA 1LPOA 4ZV4A 2HTEA 1E8NA 2FOIA 4FMCF 4ZPXA 3M4JA 3G0GA 1II9A 2OZPA 4YAKA 5HM8A 1OYOA 1L5MA 1Y3AA 2PFSA 4L7VA 2JHGA 1K5DA 2P2LA 2RAPA 3FTNA 1JKJA 3MCTA 4LWQA 3K1AB 2B5WA 2CDRA 2ZYHA 4RFVA 3AZOA 4DNQA 1M1ZA 3EVGA 5DRYA 2GN1A 2RK4A 4Q6BA 4RGVA 1XJ0A 4V2IA 1RQ2A 3JQ7A 4GICA 4IF6A 3HJHA 1Y1TA 4R9RA 3F3MA 1V5WA 4Z3DA 1QWOA 3H4TA 3RC8A 4V24A 4EG4A 1GZHB 3IUQA 3NAGA 4ICIA 3GCXA 4WDRA 5KDOA 3WK8A 4RD2A 1E2NA 2Q5CA 4L50A 3JYOA 2RBKA 3AONB 1M1NB 5EP1A 2BEWB 2G5PA 2VDWB 5E4YA 3UW1A 3WYDA 4CVNA 1JFFA 4GOKA 2PWPA 5JC8A 4WH0A 3EARA 4H6XA 1VIVA 2PHZA 2IDZA 1AO3A 2OBFA 3BC1A 3IAHA 3L01A 1HI9A 5EKUA 3WV4A 4A9AA 5HKKD 4CDGA 3FSGA 1VJ5A 4G5FA 4UFPA 4K6KA 2FEOA 3RM3A 3BCSA 5JASA 3TJMA 1F2VA 1ILWA 1C0KA 3V1YA 1E3JA 5KWVA 3OLQA 2P0AA 1JZQA 1FYFA 4ZAXA 1RLJA 3I01M 5DX0A 4QQ8A 1C81A 2PR2A 2NO1A 3HJUA 2HA0A 2DAPA 3KTAA 2YQ5A 4WI1A 2EBHX 3IOYA 1EU1A 3HM2A 4NYIQ 4U2EA 1DNPA 1SUPA 2DKOA 1QBGA 1G5TA 1QH1A 3DT6A 3OE4A 3PICA 2DYKA 5COBA 3MSXA 3JQ8A 2P3SA 4NMXB 3AJRA 3C41J 4J2TA 1ONNA 3FOZA 1TJ4A 1L8OA 4DJEC 5EJEA 5AVXA 3KSRA 1U7TA 3D0OA 3UMCA 2GYVA 2E4WA 4Q1AA 1X1TA 3WJ7A 3NHFA 3UN1A 4YY3B 4U3JB 4HVAA 1E63A 3HBNA 1M6VB 3WRXC 4BO7A 3IXMA 1BCRB 3GT3A 3O1LA 1P7PA 1WBJB 2ID4A 4MITA 2Z08A 4C7OB 1ODIA 2ZI7A 1SC6A 2FZGA 4X85A 1M1NA 4JBGA 4XYGA 1ESEA 2BEWA 3WYEA 3RO7A 2WSLA 3PNQA 3M7IA 1TMYA 4KVFA 4ND5A 3PFKA 3WJAA 1Y4UA 2QLLA 3JXEA 2NWQA 3ND6A 4RETA 4W7HA 2HV9A 4TYWA 4POAA 1XTVA 4RAOA 2X9NA 4M55A 4GECA 3WKAA 3NBZC 3GVXA 3NRCA 3LGXA 2L2QA 1WEKA 2B7CA 2D0OB 3NTQA 4TVKA 1MFZA 5HDBB 3RE1A 1XVTA 2V58A 5A1TA 3RW9A 2E55A 3LXMA 3X2EA 5JT1A 1XWWA 4IUCS 5ALOA 3A27A 2ZE6A 2HLPA 4DCSA 3W9SA 4JGGA 5JAPA 1GN8A 1L0BA 4J7AA 3BBLA 4PHFA 4NH4A 2ZE8A 3A26A 3OX2A 3I5XA 3J81A 4DLRA 4FFNA 3L0BA 2C3YA 1XT6A 4LN1A 4GZ5A 3OTQA 4NP6A 3OZTA 2F3PA 1X2BA 4L9AA 3MEQA 2YHUA 5JARA 3RSCA 2QX9A 4U3JA 5COQA 4PE5B 1SHKA 1M6VA 5DJ5A 1BCRA 3DTYA 2JW5A 2PX6A 4C7OA 4GKKB 3KUCA 3T4EA 1WNTA 5DVZA 2GEDA 1CJVC 4KEAA 5GZ3A 1SUEA 2LCFA 3D1LA 3U31A 1W4CA 1QRRA 3H5OA 4I9HA 4V38A 1UK6A 2RIRA 3URKA 1S5PA 4TRMA 4X97A 3EVNA 3NASA 4F91B 3I28A 3I61A 3PGMA 3D1VA 3BCUA 3H8WA 1V5FA 4ZDWA 3AM1A 4D6YA 4D9HA 1CP2A 3DXZA 3KZ1E 1K06A 4JI0B 3K0BA 1WUTA 1UMCB 2ORED 4RMNA 5A5DA 3TTTA 1U7OA 1XRLA 2CWDA 4G24A 5AK6A 1NUUA 1RPNA 5KTPA 3D6FA 5IMSA 1J99A 4FDMA 2PPLA 4K88A 3ZOKA 2Z8XA 3KSDO 3GBSA 3HC7A 2F17A 2GLTA 4KGZA 3V8RA 5A9RA 4LSZA 3G02A 4TS1A 5CNIA 1CY2A 2IEDA 3QUAA 3WS7A 5JQGF 4F2HA 1W0JD 2EATA 3PQ5A 4IMIB 3OM0A 1YU6A 5J43A 1JLKA 1PUIA 3VZSA 4HP8A 4D45A 3WLNA 2HDWA 3PX2A 2VA9A 4GP6A 4BVGA 4E07A 1NYQA 1SBIA 2NUTB 4EEKA 4UU1A 1GQFA 2E5FA 3AUYA 4HDRB 1KPGA 3GJ6A 1BX0A 5B36A 1IJEA 1P91A 2DPLA 1X74A 3NHWA 4Q9NA 1J70A 4LXGA 1W36D 1CIVA 2GXAA 4B3BA 3PDJA 4A5OA 1J0EA 1I3NA 2HF8A 3FAKA 3IRUA 1QCZA 4OIMA 3IEMA 4W7SA 4LF4B 3RK4A 2E4UA 1Y4ZA 3C8MA 1KBZA 5BN4B 3KQOA 3Q40A 1KE1A 3SS7X 1LBSA 1KEUA 2AQIA 2BJVA 5B57C 1SVSA 4CU2A 1R10A 3LX4A 5EHIA 3RB8A 4RY8A 5HRCA 5ILOA 2Y2VA 3OEED 1KH1A 1X80B 2ZBFA 2G04A 1YWGO 1Y5RA 3G5UA 4TQ9A 1UMCA 1R5OA 2J45A 1KJJA 1WKBA 5C53B 4Z8YA 2JIRA 1FSGA 1HQCA 3A2NA 1YE3A 5ALPA 5BSFA 3T35A 1R66A 1UFQA 1HYBA 2HK7A 2PRSA 3DVLA 3K9CA 3C4JA 3KEMA 1VJ0A 2K2QB 5L6MB 1TIPA 4FI3C 4B7CA 3N6RA 1IEQA 2DQKA 4R2LA 5JZ9A 3U7JA 2MYNA 1YQWA 3WGZA 3PX3A 1AY0A 1VZ3A 1TJYA 1AQJA 2NUTA 3AEQB 1FSSA 1E89A 1QVZA 1ZNQO 2DU8A 3KELA 2UV8A 4HDRA 1A4IA 1E94E 2PO7A 4IWNA 2GFQA 3ZV6A 2ADMA 3UK6A 4FIDA 4KAFA 2FGJA 5IU6A 3GCGA 4PONA 2FSSA 2C2ZA 4F84A 1YS9A 4N40A 2QN1A 4LPKA 2CXNA 5ALIA 1P29A 5D5QA 4U9HS 1SU7A 2UZIR 3QU9A 3WGTA 4D43A 5BN4A 2D3TA 5ICSA 3KZXA 4YCDA 3R7DA 3PEYA 1NYTA 1YQQA 2HRBA 3QPCA 4OMUA 3T7CA 4WPGA 2OXIA 4FM9A 1T35A 2AG6A 1KRHA 1TE2A 1D1QA 1X80A 1AGYA 3BGWA 4ZDIA 5E4TA 3SE7A 2X7JA 2O2IA 5LMUB 4HDMB 4A0SA 3P2JA 4PPFA 5JD5A 3GLGB 2EU8A 2D0DA 5BN3B 1XD9A 2C42A 4BNWA 3VDRA 3SYNA 1EP9A 2JI4A 4F12A 2BBOA 5F7XA 2X3FA 5L40A 1OFTA 3CNLA 4G84A 3G0HA 4LWZA 3HNRA 1IZ7A 5D3KA 3FUCA 5KVQA 3GLFE 4B79A 1PDWA 3TAXA 2J8ZA 4HZIA 2BFEB 3EDRA 2C9MA 4H0CA 5P21A 3MIZA 4OXRA 1H2FA 3R3ZA 2BUCA 5C5IA 5I3CA 5KOHB 3K70C 4O4IB 3AEQA 3SWWA 3CX7A 3ZWXA 2JGMA 3DZIA 4LSGA 1Y1LA 4OYRA 6LDHA 3U4MA 5TQVA 4PYMA 5EIWA 1S7CA 4D3SA 2AA3A 3W6PA 2OGUA 2P1RA 1OZ0A 3CKKA 2XAAA 3G5TA 2NZJA 2IRWA 4YJKA 1BTOA 3VKVA 3D3EA 4ALIA 4D4HA 5BXYA 621PA 3BL8A 1QF9A 2CEKA 1KY2A 2Z30A 3WQSB 4C78A 3TECE 1Z25A 3SC2B 5AUOB 1C2YA 2P6OA 1NVBA 1YCHA 4U7WA 1Z7EA 4N48A 1NVVQ 3DOIA 1H2WA 2W4MA 4PSUA 3V4VB 5K8VA 1FP2A 1XZGA 4PX5A 1BAPA 4HDMA 3RUEA 3O0TA 3WR5A 1FMCA 3ZHZA 3GLGA 2ECPA 1U1EA 3UQYS 1OAOA 4B6EA 3II6X 1NQTA 2DQYA 5BN3A 3LWNA 2CVFA 1XDGA 2H7YA 3BWDD 4G0ZA 5AOCA 2GPAA 4XR9A 4BJ3A 1PGOA 3N86A 4DN6A 4AY4A 2YTZA 2BFEA 1ZBDA 3C8ZA 3GN1A 1JHDA 4RZSA 2MOKA 3QG5A 1OJ7A 1UKAA 3UA4A 5EJ7A 2LGJA 2YFYA 1DB3A 3TUJC 1FMFA 3EZXA 2QI9C 4O4IA 1ZR4A 5TPZD 1CDZA 2I91A 1K88A 4GMHA 4N6GA 3G5AA 2GCOB 5K05A 1N2EA 4CNBA 1S9HA 4I5EA 1QOPB 4QFCA 4QGHA 2H08A 4ENQA 5IP5A 2XA2A 2VP6A 1J0AA 1TZ2A 5LYYA 4UE3S 4U2FA 3W5DA 1WHTB 2DECA 1N2ZA 4PG4A 4DQ0A 4LPSA 3PHCA 4OXXA 3K9WA 1BKSB 3DEKA 1H0RA 3W2IA 1WOYA 5BWBA 1A27A 1TCBA 2R7KA 3D6NB 4TWBA 1LNZA 2BFBB 3SC2A 2ZS7A 3UMBA 3UK7A 1DRVA 2BDTA 1YRWA 2VJQA 1P2GA 3MWFA 2ZWPA 4Y2YA 3VR5H 5CLJA 3OO0A 5M3BA 1MT0A 2B5OA 5IAJA 5JRJA 2OLJA 4K6FA 2LDBA 5PNTA 3EB9A 1IZZA 3HWSA 4ZZIA 3TQFA 2BMVA 1DZIA 1EXWA 4H77A 4ZALA 5ILQA 4A6XA 5A0TA 4C7BA 3HCPA 1XU7A 3NNDA 4UBIA 1QH8B 3K72B 9ATCA 3IVXA 1Z9BA 2ZTMA 3CXUA 2UU9B 1BDHA 1EBFA 1JKXA 1OZFA 3KDSE 1TTQB 3ZZ1A 5IVHA 3O74A 6YASA 4LHVA 5A0VA 4DFDA 4YRAA 5KHLB 2IF0A 3AFGA 3VQTA 5KMGA 4ES6A 2OAQ1 3RKUA 2RJ3A 4QZVA 1DEOA 1ZXBA 1BFUA 1XQ6A 2R00C 2GCOA 1MIHA 4HDKB 4XR4A 5JSHA 1IMOA 4OV6B 2XYPA 2FX5A 3UUWA 1CB0A 3ELBA 3OD1A 3U3ZA 3H6HA 3KTOA 2H8KA 4Q93A 4C2BA 3D43A 1WHTA 1PTJA 1PUJA 2XHZA 4IMPA 4QRHA 4QBKA 5HRAA 3EIEA 3JRNA 3WWYA 1TLTA 1GZ3A 2IQ5A 5D6NA 5EIHA 2QXTA 3ZGZA 2B1QA 3ZJUA 1Z82A 1TAQA 2BFBA 2YXPX 5BR7A 3MTEA 4F2DA 1E98A 2G06A 1K27A 4UDYX 2D3WA 2GVZC 4PYRA 2X9LA 5SY9A 5KVSA 2CL6X 4N9WA 1R0RE 3RANA 1XHLA 3I8OA 1ODFA 5JZVA 4NZPA 5L8VA 1Y3CE 3U0BA 3KWMA 4Z4QA 1OB2A 3S2YA 2PT5A 4FLFA 5DTEA 3ZDBA 2JJ1D 2E5WA 1QH8A 3A6FA 4HAYA 3VOBA 3B2EA 1YZGA 4JJGA 1BE0A 1XRPA 4HDNB 3F7TA 3WNZA 4CJXA 4OGGA 1G21B 4B7XA 4CKBA 3EWAA 1N8KA 2BM0A 3PP8A 3H2JA 2BGMA 1LQUA 2VZEA 4WXRA 1LWNA 2PZFA 2VSXA 1MP0A 1J56A 3M0EA 4ZOBA 3GLIB 3H3JA 5DMHA 2EX1A 1GUZA 1W0KD 2Y99A 5JMTA 1UJCA 3GJ3A 3WRWA 3D3NA 1XKXA 1H0HA 4ZMBA 4HEJA 1QB7A 3MK31 3TRHA 5CK4A 2HMYB 3ZE7A 4EYGA 4MZXA 3CX8A 3HXKA 3M6FA 1L7DA 3G9TA 5IF3A 1MT3A 4RZHA 2Z8YA 1VCNA 5IT9A 3HK2A 1Q15A 3DDZX 2XTNA 4WFKA 5J4YA 1G2IA 1Q83A 4M1ZA 4TLBA 3V7WA 2P69A 3X2FA 3ZCSA 2PUHA 4F9GA 3CVXA 2X2PA 3BX1A 3K92A 3MJ4A 4X8MA 5BNZA 2E4VA 3CRZA 4B75A 3SHVA 2WTBA 3E9QA 1ZZGA 4LMPA 1IL0A 2LP4Y 1E9SA 2W2PA 3M34A 3AF3A 2VJYA 4HGRA 4L4XA 4UC0A 5ED0A 3ROPA 2O50A 4F71A 5BN5B 1XYGA 5E1MA 4MPDA 2EAUA 3I2HA 3OCZA 3U1VA 4LBWA 4RIEA 1GUFA 1Z12A 2C5LA 4BTVA 1TZMA 2WUFA 4G2TA 2GZ2A 2V3VA 4N3NA 4B3JA 1G55A 2P5SA 1ZKDA 2JF0A 2AT1A 3NANA 4YK7A 4I6JA 2D00A 1O97C 3N8HA 1G21A 4QOJA 2R96A 8ADHA 3FFTA 5L45A 5CXSA 2J3MA 4IQ4A 4L07A 3W3ZB 3GLIA 1N3LA 2JLUA 1GQSA 1U7PA 3RADC 3OFVA 2WF6A 4BB9A 2QYHA 1UAGA 1T8UA 1H9BA 1Q1ZA 1SULA 4FU0A 2QY6A 4FHGA 1GTJ1 4NQRA 4JXXA 4UVDA 1Z8DA 1NUQA 1MX9A 3HKDB 4PZ9A 2GYYA 3E03A 5IX8A 5I9IA 1XRMA 2WD9A 1CP3A 4A0QA 4KQ1A 4AJ2A 1B8UA 5E9WA 4Q4CA 2FSFA 4MVJH 4COOA 1P4HA 1UIMA 2ZG6A 3H99A 2VJOA 1UJNA 3RFXA 3RAPR 4FB4A 1F8GA 2F1OA 4RVGA 4CV0A 3VU3A 1R0KA 3RAJA 2PYZA 1MAWA 5IULC 3E9ZA 6AT1A 2G63A 2W9XA 3NBXX 4J94A 4XQ0A 4Y7DA 1EZ1A 2VLBA 4O4LB 5AKEA 5TF4A 4DG5A 4F6RB 3ZGXA 5IVKA 2OAP1 1V7QA 1F4LA 4CIBA 3BGOS 4PW0A 1N5DA 2GEFA 3CO5A 1X14A 1JA1A 4P84A 2BBTA 1G63A 2QENA 3BA6A 4FYIA 5ELLA 4M21A 4OQMA 5JE8A 4D8YA 1Z37A 1CZUA 2KJQA 5BN5A 4M1SA 2P8JA 5KYYB 4ZANA 4WZBB 2RAUA 1QHXA 2QOEA 3W9UA 2BPOA 3EXEA 5G02A 1JVNA 4TYYA 2O19A 1ZVJA 2K2WA 3QBEA 4P3PA 3IEIA 1BX1A 4EHFA 4L73A 2CF6A 1X0XA 2Y67A 4KNYA 4GG1A 4Q66C 3T06B 3TBKA 3VUFA 3MS4A 1E1MA 1QX3A 3NNNA 4NCNA 4PU0A 5FPTA 4CKXA 5JCXA 4B3RB 3MLAA 4G1UC 2CLFB 2OYCA 5LUAA 1B41A 4E3WA 1I1NA 3HKDA 4LKRA 3RYCA 4HQ6A 4OP3A 4YMWA 5CCXA 2FE4A 2ECQA 2XQIA 3H9QA 4DWWA 4N3AA 2Y1LA 5BV8A 1UFOA 2V7WA 1FS4A 3EIUA 3MSCA 1FDSA 4ML3A 5KTMA 2IY9A 1ZI9A 3RS2A 1HC7A 4EPTA 2OCAA 4O4LA 5HIKA 2PZ8A 2B20A 2FWNA 4GP9A 4F6RA 1VPWA 2B69A 3JTEA 4EA6A 3E2IA 4MYDA 3OE7A 4N5DA 1ENPA 2QWXA 1AUXA 3HEAA 4DXHA 3O03A 3SZ3A 2FCRA 4HWKA 2I0FA 2MIIA 2FGKA 4KQFA 3SJZA 4EUNA 4YMGA 5KYYA 5MDHA 4WZBA 3CZPA 2RHCA 2VUTA 3EXFB 3WQBA 1TD1A 2FRVA 1JZTA 2PT9A 4L75A 2QL7A 3OFND 3N5KA 4ZEWA 1GGNA 4IVQA 3K1TA 3N0VA 1BOOA 2BGUA 4Q3KA 1VRVA 4Y9TA 1YTUA 4ZGGA 4YCCA 3E1KA 3QPDA 4KACA 3WRYC 4BLVA 3T5AA 4HYTA 1SD1A 1YHNA 4JXJA 5LMZA 3AGPA 4E46A 3AOEC 3R9XB 4ND3A 4A10A 3L7LA 4KDEA 1PR5A 3L1VA 4QYSA 1KI9A 3ROQA 1R9JA 5EJ6A 4OL0A 1ZIPA 4PTYA 1PT6A 3JRXA 4LMBA 3ADCA 2INGX 4EAQA 1T29A 1SVMA 3UHFA 2ARKA 1GGVA 1S02A 4FDVA 2V7GA 2Q7XA 3HLKA 4MO2A 4X6XA 5J1SB 3ROXA 5KTKA 3S8EA 4UD6A 1YR6A 3RC2A 1U9IC 3NW9A 2CLKB 3DYVA 4H18A 4KSCA 3MCAA 4EENA 3HUUA 1PVVA 4AF7A 3A4YA 1XVIA 2ZRCA 1CEYA 2H59A 3JVVA 4DDUA 3A36A 3CGGA 1O1YA 1KYVA 4B3CA 1Z7BA 1IOLA 3SHOA 3EXFA 2VH1A 5FKJA 2VTBB 1EFTA 1USVA 4IL5A 1W35A 3EJWA 1NLYA 4PNZA 3WIOA 1BRTA 3BF8A 4IGFA 2GN4A 4NV0A 2Q2NA 3ZQ6A 4DARA 4UHFA 1PWHA 2QV0A 3CWCA 1E2IA 2E4XA 1RXIA 4RVSA 2OZKA 4ALNA 2Z83A 4IDDA 2GHQA 3C3DA 4OCZA 1O6CA 3F90A 3R9XA 1JDNA 1RMYA 4FSXA 4OHUA 2X8AA 1FXWF 4JLBA 1WPXA 4NDAA 4MV5A 1WETA 2GILA 5KSYA 2DR2A 4GHWA 4FHDA 5DCLA 4GZ3A 4XX0B 2HC9A 4YO7A 3IKMB 2D1YA 4WY2A 2W93A 1SCQA 4LQ4A 4K26A 5H4GA 2HCFA 2C4HA 3ZZTA 2ZXUA 3MCZA 1SKYB 1MAHA 1T5IA 2QP3A 3Q2OA 1PLLA 5MN4A 4LC9A 5AHWA 1P3DA 4M1TA 3VYRB 1GFZA 2VDKB 4S24A 1RBZA 3GEMA 5LYJB 3LSYA 4IOMA 3BIXA 1CWUA 4UVGA 4BRZA 4B4DA 3ZVNA 4DSOA 1O0SA 1TI7A 3SMQA 1M8FA 2O2GA 3E9RA 5DASA 5TB5A 3V2IA 4REQB 4MVJI 1VDMA 3IFSA 3P5BA 2BJHA 1N2JA 2A4KA 4BLOA 2VTBA 3Q8KA 3ABSB 1XDUA 1M9NA 1ZGAA 2HPVA 3I04M 2FX3A 4UNIA 2YNMC 4ZRMA 4BKMA 3IJEB 1DKRA 2Y1WA 3DSRA 3R5TA 2IBTA 4TYQA 5GVSA 2DFPA 4P35A 5TARA 4FOLA 4MUNA 1W75A 4W99A 4AZVA 1NONA 3KVRA 1Z0KA 2B4RO 1SC9A 4A7PA 5DNWA 3MERA 4FC7A 1GILA 1ORRA 4ITUA 1FSZA 3QFHA 4EL0A 1SHZA 2ZI9A 4XX0A 1TTHA 1T0PA 3W2EA 1JLMA 3WYBA 1Y8RB 3VZCA 4XWKA 2HNAA 3JR7A 1L4YA 2I03A 2J1LA 1PEYA 3A1NA 2HGSA 2ZUDA 3EUAA 3NV7A 2FH5B 4PQYA 5IAGA 3D7MA 5LYJA 5DLQC 3R8CA 3PWSA 3GRKA 3ROKA 1SXJD 3NUGA 4LCJA 3T7RA 1IUOA 4JI8B 4Z9BA 1N8SA 4NARA 2J5XA 2QT9A 2R1TB 3HXMA 5K0FA 1ADGA 2X8JB 2FMIA 4ME6A 5GV8A 2H2IA 4REQA 3SM9A 4TVSA 3DVAB 4RJTA 4PZEA 4EZBA 3I58A 3AH8A 1WXDA 2C4WA 3PPIA 3CB2A 3PEFA 2YVLA 4NNPA 4AC9A 1K3TA 3CPSA 5BT8A 1XK7A 2OPBA 1K5GA 3DONA 4MUKA 3PFGA 1EE9A 2HXYA 1WUHS 2PGLA 2Z9DA 3D8RA 3MOGA 1CV2A 4UVEA 1T6XA 4CTKA 3MAGA 4XKJA 2ZB3A 3BXPA 2PLNA 4H16A 4F5ZA 5FTNA 4MROA 3DCJA 3HYSA 5GP1A 2I6UA 2YX1A 1B6SA 2O1XA 1SUIA 2QP9X 1T9GR 3P1JA 4MPPA 5DH9A 5H0IA 5BSRA 4TKUB 3UYLA 1OA1A 1ZK0A 3QEAZ 4LYHA 1NUPA 4EGFA 1NVEA 2JLWA 1Y8RA 3OD5A 5LKRA 2IXBA 1XGKA 4JSYA 5E0KB 2HFKA 4ZRDA 1GYPA 2FN8A 2AJCA 1ZN7A 2QZ9A 2WFAA 4ACAA 4HDOB 4CT4B 1A8UA 3QBVA 2DWOA 1OR8A 3B1YA 4MUFA 3KVYA 5EZYB 1L5HA 4C0JA 2PSDA 4F3TA 5J3JA 2JGEA 3IUNA 3ND8A 2C5SA 1YIAA 3UKDA 3UUFA 5HJEA 4IHJF 6GPBA 4S1TA 5EEGA 4BDSA 2R1TA 1N2XA 1C50A 1TUGA 1ZNWA 3IOEA 4E2XA 2X8JA 5ABPA 3HXQA 4YIKA 5BWOA 1RZRA 2Z4TA 3HI4A 3JYLA 2X0JA 4U9UA 1TKRA 4EQ6B 2X40A 3CPHA 1QXSA 4BP3A 2EGUA 1A1SA 1NC3A 1CS0B 1LJ8A 3A1SA 1RWNA 3AF2A 3BD8A 2YUTA 3T7DA 1CZRA 5FPQA 1DUVG 4NE9A 2PX0A 4F5YA 4K0RA 5FPKA 3VSDA 5JEEA 4DKJA 1RC8A 4FGLA 4AMUA 2R5FA 1AUVA 4L72A 3V6LA 1ECBA 1WXFA 1XTSA 3DB1A 3HY6A 5CX4A 3SIPA 3QVXA 4CMJA 3VHQA 4HLQB 4P4LA 4PQFA 4FQ7A 3UOAB 4CV1A 4TKUA 3I2YX 2GZ3A 4E5UA 5GTDA 2VUSA 13PKA 3HPQA 1ZDMA 3ID6C 1GPDG 1W29A 3LCRA 3RK0A 1URPA 4DTIA 3ETGA 3ES9A 4DANA 4R84A 1EYZA 2PK3A 4IGKA 1Z75A 3OTHA 3LNTA 5HKLA 2VDJA 4XW2A 2HJHA 4DCJA 5CVDA 1U02A 4CFYA 1NE2A 1TCUA 4MQ4A 3BJMA 1Y1KE 3PR1A 2G17A 2JCXA 2HSDA 1Q11A 1DHRA 2AN3A 1AA9A 2Q21A 2YDXA 1DL5A 4GOND 4P83A 4Q7KA 4R05A 2L0XA 5JMPA 4BMNA 4DTCA 4Z7QB 1ECFA 1SGWA 4F4CA 5JRDS 3GUCA 4O3FA 5BRAA 1T8SA 2G9ZA 1UKZA 1KO5A 4F9FA 2V9ZA 1L7RA 4LQLA 5I7OA 2ZETA 2QRMA 4B2LA 4YRZA 4EQ6A 1HETA 2H2AA 1VLZA 1B8NA 5TT1A 2QAGC 2XCOA 1CS0A 3FW1A 4UPVA 1RLTA 4X00A 5DW0A 5GJCA 3ZS8A 1EM8B 1XPUA 4NPHA 1A7JA 5B55A 3TFOA 1WXWA 3B1KA 3M1YA 3LVRE 3RHSA 4B76A 4Q3DA 1GD1O 2OL4A 2WJHA 1CERA 5DK6A 4MV0A 1I3OA 3AKYA 3OF5A 2JGRA 4IS2A 3EZFA 3REFA 3SX4A 3ZIDA 1D5WA 3A9RA 4D8WA 1N2CB 1JU9A 3JYHA 4MI6A 3CLSC 5HS6A 4M1WA 5I7EA 4R2MA 1SXGA 1YI0A 3GB9A 4IGIA 1DBRA 1JHAA 2QAJA 2F43B 1VSVA 5J5AA 1WDWB 4UBMA 2GXQA 1X1RA 1NLFA 3CC8A 4I8DA 3Q8WA 1KEWA 1E3EA 3TEJA 1Y3FE 3JX9A 1OBFO 4ZVVA 4FEGA 3O8QA 1SUSA 3COVA 5KOYA 3DPSA 3RDPA 3OURA 1K0UA 3VTFA 1YKGA 3R20A 4HDAA 5DP1A 1Y8CA 1GIAA 2HNBA 1E1RA 2CXPA 2WJVA 4X60A 1Q6YA 5I5GA 5IW8A 4U7HA 3V8BA 3ESZA 2QM7A 1SZJG 2GAIA 4QO8A 4NCXA 2XWBF 4NU5A 3HJFA 3QLUA 4B83A 2Y27A 1YASA 3FTPA 1EM8A 4DDKA 4EA8A 3B3FA 3WBKA 3AVOA 4M99A 5I9BA 2BKLA 3RFVA 1DP4A 2OQIA 3FKSA 2IPMA 3QY0A 4HEHA 1KAHA 4JLNA 1QIJA 1M83A 2TMKA 2W2LA 3R5SA 4UAUA 2OENG 4PYOA 4YB8A 3S2SA 4CR7A 2PL1A 4WJZA 4RTPA 4CEJA 1N2CA 4MIYA 1XQVA 1UQUA 5BXQC 2VF4X 3FSJX 2BAGA 4KI7A 4HMQA 2X58A 4OBWA 2OCYC 3DO5A 3C6YA 2C78A 2F43A 4C07A 1OHHA 4MYTA 4XQEA 4MSUA 4F4HA 4MW7A 1UOEA 2VDUE 2ZREA 4GLBA 2YXNA 1Y5IA 2ZUUA 3HR8A 3B2QA 5KNDH 3D7NA 3PWTA 1RP1A 2GK4A 4KWTA 3B1FA 3NFRA 1ICIA 3LHKA 1NMSA 3USCS 3CS3A 4Q1FA 4LFAB 1AHHA 1K97A 1ZW6A 3HYRA 4OK5A 4B71A 1H5UA 3FMOB 5NLLA 2M6RA 4PHCA 1Z63A 1TU0A 4Y2UA 4EHLA 1NW3A 1C3JA 2JAHA 1P61B 1T5DX 2FPGA 3HZZA 3FOBA 3JWPA 4HWPA 4R9UC 5ALLA 5JADA 1W2GA 2WPNA 1EFHA 1TGYA 2YOHA 4WXEA 3VC7A 4MOWA 4EVRA 1BROA 1JDBC 2NG1A 2ZVJA 3FZNA 2K7ZA 3ZWAA 4Z7NB 4AKEA 1K63A 4J29A 2PUVA 1U7WA 2FG6C 3P20A 3PS9A 5SYMA 1T2AA 5JCOA 2QS9A 4Y1EA 3SQOA 5IT4A 4OQZA 5JSZA 3IS3A 3FNIA 3CN9A 2NPFA 2J6IA 1JH8A 3PRJA 4OVKA 4HMPA 2VJAA 2JAXA 3PDCA 3H9JA 4GI5A 5TJHA 3DHWC 4R41A 3SHQA 3K2IA 3O1HB 2QE7A 4JA0A 1EP3B 1NBOA 4US2R 1EGVB 5HS4A 1KOGA 2PMBA 4JYAB 1CEQA 4G26A 4DXDA 3F1LA 3EE6A 1FBNA 1NI3A 2ATCA 4JQYA 4LJSA 5KNBA 3T3OA 2QL6A 3VOSA 1J7JA 2ZDQA 4MUBA 3S0JA 1GQRA 2YJGA 1Y3DE 3O4GA 3PLRA 4BJ5A 3RTAA 2HO4A 2BHNA 4FNOA 5JAMA 1FS6A 4HPJB 3RFCA 2GJAA 3R3SA 5CXXA 4E08A 1Y7LA 5IN5A 3MNFA 1O6GA 1LSUA 3B51X 3ZXXA 1XB2A 1V8DA 1E0KA 3H1EA 4CHGA 2IX3A 3KHSA 2RIPA 3PT9A 5CA1B 2PUBA 4KR3A 1N78A 3C5CA 1SXPA 1N3IA 3MJCA 1Y89A 4ZEXA 2OKGA 4OHKA 1CNMA 2X15A 1MW8X 2UXBB 5AFSA 3D8UA 4XUDA 2DT5A 2J9RA 4F96A 2WZBA 1ZUWA 3BXZA 2KMLA 4B47A 1W1UA 2IQIA 4HX2A 5HILA 1EB8A 1Y7HA 4L85A 4AQYB 3IKVA 2XBMA 4P7GA 4C0SA 2FX2A 4G0UA 2DRIA 4GNKA 3WB9A 1FDTA 5JPCA 1VG9B 1TRHA 3UXMA 1ESNA 1C1XB 2VRCD 3K71B 2J32A 5L4SA 4C2UA 2PXCA 4XYEA 3A2MA 2B8TA 1P74A 1XKTA 2BE9A 4Y0AA 3UTCA 2RKOA 2IUFA 5T3YA 3O7WA 4HOYA 4R1SA 2QR2A 1WCXA 1YK0A 3EPLA 4NOKA 1E7QA 3HJNA 1Z0AA 2GM3A 1NMXA 1L7QA 4J0KA 3I0MA 4ZTBA 4CLRB 1HFWA 1HK7A 2PY6A 3TMAA 3E2PA 4WLEA 3P0FA 4LTDA 4HDSB 3U9LA 1VYHA 3W5JA 3L7JA 1ZK4A 4JJKA 2J7PD 2AV6A 1GQOA 4EB0A 2OBBA 4NMHA 1AH2A 3VC1A 4Y1RA 4IIJB 4PQEA 2OBNA 3FPBA 4Z54A 5IKMA 4O8ZA 3T1HB 5AJWA 3WB0A 4WBNB 1G9SA 4KO8A 3NEJA 3PKZA 4PBTA 4H4CA 3I30X 3WADA 3T12A 1UJ5A 4CM9A 5DTRA 3ECSA 4NZZA 4WY5A 5CIQA 5JATA 4KOEC 5IYZF 5I4CA 1W1IA 1NW8A 2QW1A 4Y2PA 1EXNA 3ZJVA 5KYUB 2ZANA 2PSFA 3GRUA 2ZWAA 4BFWA 2FMHA 5C8YF 1RRPA 3QA9A 3ILSA 4JXKA 2PD4A 4L4YA 1T9HA 4LHZA 1C1XA 3SXUB 1UJ4A 5GWXA 4FYMA 1YFLA 1PZXA 3W8DA 1AGXA 2FSVA 1SIWA 1ZGHA 3O94A 3OLWA 4YROA 1CJSA 5DHFA 1X9IA 5A06A 1XQWA 2LRHA 2WOJA 1FFHA 5HG0A 1X1EA 3G2LA 2J4CA 4GPD1 4CLRA 1UBNA 1I51A 2WTNA 3T9AA 4NBLA 5HUQA 1USWA 5H7XA 1E4VA 1DKOA 4PEVA 2CLLB 4P38A 2GZMA 1IPFA 4E33A 2YDYA 1H93A 1IOVA 1TADA 3AR6A 3TSCA 3MHTA 3SN6A 4BZXA 3QX3A 2VZ9A 4ZOAA 2YJ4A 1QIFA 2EJCA 2I55A 3RS5A 3F73A 4IIJA 1RWPA 3BAFA 3O91A 4X62B 1Q5PA 2C5FA 1THZA 3FZEA 3KZNA 3OI7A 1ZAYA 4K6MA 4WBNA 4KAAA 2DUUA 3UIEA 2D2FA 1SU8A 2C2HA 4ARBA 1HDYA 4GQAA 2G5TA 1WQ4A 2IITA 1WPRA 3S5UA 3TR6A 4V1CB 1D2EA 4DDTA 5FXMA 2IELA 5KYUA 2CD9A 2R4UA 1GT6A 2VHQA 4EJ6A 1K7XB 2ORYA 3FETA 1OXSC 3P9KA 3NHUA 4KLCA 3RSLA 3SXUA 4WOJA 4F3NA 1X1CA 1XEXB 1ID8A 2VBCA 1B1CA 1AF7A 3NT5A 3IILA 3JWJA 3VKUA 3F97A 4E03A 3W06A 4MTCA 2XF8A 3PCRB 1PD0A 2FFHA 3R8XA 5K0EA 1T5BA 1U0LA 4K28A 1IPEA 3AFIA 3F9IA 4IDBA 4KWCA 1VMIA 2E9SA 1NG1A 5P8WA 1MJGA 2P6MA 3ZZNA 1OFHA 4R8MA 5K8JB 1FIUA 1ZJ5A 4C0XA 4QA9A 3WL8A 4DR2B 5DM1A 3I9NA 1M6WA 4QPJC 1LDYA 1IULA 2I80A 4KPFC 1KZGB 1NVXQ 5JO0A 2JFOA 1PFVA 4OQEA 2A9QA 4N7JA 4DEXA 5J5VA 2W71A 1N75A 3NVDA 2ZJ8A 4KO3S 4BAGA 2ZRKA 1SBTA 3H2IA 3OZDA 1P81A 3GMDA 3RGGA 5BUQA 5EIEA 2VQEB 4QFMA 3RG8A 5JVDF 1DKMA 1MOSA 4U5XA 1Q7BA 2FP4B 2BSQA 4K86A 5HXAA 2WR8A 2JZOA 4V1CA 4BNNA 1V7PC 3VVCA 1GA6A 2HM7A 1CR6A 1AUOA 2HD4A 1OV6A 2WPDA 4H35A 4IUDS 3W9BA 2VBIA 4QUEA 3MPUA 3FWZA 2VJDA 1H2RS 4FYVA 3ODPA 4PFKA 4QOFA 4IYJA 4CF5A 3EXG2 1W36C 4NMLA 1XEXA 5E1DA 5FO0A 5I7FA 4KRFA 3NH6A 3MJVA 3RC3A 4LXQA 1P0IA 4JJAA 3UC5A 1MABB 2LPMA 1Q2UA 2YWDA 3GUUA 5LBTA 4IH9A 4EYQA 5CJPA 3IL2A 4X3CA 3V80A 1CRWG 2JA2A 2QRQA 3N2IA 3TIXB 1KVRA 2C7QA 2ZJ0A 4NU6A 1VYTA 2KX7A 1M2HA 3PC6A 1FRQA 1HKHA 2D5BA 1SUCA 3SD7A 1QV7A 2XUPA 5TRTA 4F06A 2BGIA 3QIVA 1K7FB 3L1UA 3AJAA 3S29A 2C4NA 2BFAA 3JQ9C 1XR3A 3QW4B 3AWIA 3HUDA 1MTZA 5F9MA 1XTQA 3I23A 5HK9A 4D57A 3G82C 3WK4A 2ODEA 1ULBA 4EECA 4YJ3F 3EMKA 1ZMXA 1R27A 4HEA1 1B6TA 1NNUA 1R37A 2FP4A 3OZ7A 3R3XA 3V9PA 1IN8A 1TW3A 4M8LA 4WKOA 3ZXIA 4I7EA 2LZ0A 2YWHA 5CFRA 1UBTS 1W2WB 3A05A 2ZK7A 2AD1A 2XB4A 3DKRA 1ZSVA 4ABTA 2IEAA 3N6XA 5DI3A 1VHTA 4BP9A 1JG3A 3BMQB 1M6EX 5JY1A 3OT5A 2JRCA 2LKCA 1ONOA 3KYDB 4G8BA 2K6GA 1SBNE 2Q6LA 4Q37A 3WHPA 4B6FA 3DTNA 2PUWA 2LUOA 5B1SA 4G4JA 2XB2A 5ES4B 1MABA 1SK9A 3AY3A 3I2IA 3RS3A 1PEDA 1X8JA 2GVNA 4M87A 5AW2A 1IN7A 5EIBD 5GIOE 1V45E 1GPYA 4IJ6A 2WZDA 2Y0BA 1E66A 1CEXA 3R0JA 2BM9A 4QRIA 4JNKA 3BMXA 3D7SA 4K5QA 3EPJA 5G1NA 1THMA 4FCWA 2NQ8A 5JANA 1G5IA 4W5JA 1LJUA 1WG8A 5LZ2A 3F96A 4QDJA 5ERXA 1EGHA 2ZDGA 3FN4A 1CF2O 1ZUHA 3SDBA 1MZVA 2DT8A 5F73A 3HMQA 1HYHA 4IIDA 5G2OA 1JRLA 3FJYA 5JVDB 2GXSA 1Z2CA 2QN6A 3LWDA 1COWD 2HYDA 1TK3A 4FMBB 1NX6A 2J33A 5F23A 1TJPB 3DKIA 3ICEA 4QU5A 5I8WA 1HQYE 2I6SA 1BS2A 2XCIA 3MJHA 4LUCA 3DZGA 3FCEA 3MJRA 3I45A 1BVUA 1TC1A 4PR0A 4DJAA 2VHEA 4P80A 3KYDA 3THWB 4ZZ1A 4TUYB 3GEDA 5F1OA 4DMFA 1X70A 4AO7A 1J9EA 1ZD5A 5K0SA 3V2HA 1QHGA 3N3BC 3MMZA 2HH9A 1JIUA 2PQ2A 3MGAA 1PZMA 4OA8A 4S1WA 4CLEA 2GB4A 3BRWD 4YJDA 3AC0A 3CLRD 2NUAB 4DDMA 2WI8A 3NWEA 3ONDA 4QDZA 3QX8A 5HCUA 1E8MA 2VOJA 4B3DA 4B74A 3D0RA 5F98A 3LVFO 3B70A 3ZDZB 1B26A 2O2ZA 4JUDX 3WLMA 1G6Q1 2R6GA 5IDVA 5C34B 4A36A 5FWDA 3P32A 1GCAA 1N2IA 1R64A 1GQ2A 2GCIA 4KRXA 5J1TB 3PJEA 3BKXA 4V0SA 1EM6A 4I5GA 1HMYA 3S5JA 1Z35A 3DL7A 3E7XA 1EVIA 3KJNA 1M2JA 4LDNA 4QDXA 3JPWA 5LCXA 5A5EA 3M5CA 5JVDA 4M89A 5HGJA 3DGEC 1JXQA 1QPGA 3T52A 1CUAA 5FAKA 2GEBA 4HUQA 1UXKA 1IM2A 3GJ0A 4GR5A 3UICA 4DV0B 1T8TA 1K6EA 3PHLA 1JB1A 2F9MA 2R6DA 3QBTA 2HA5A 2R79A 4L22A 1IXKA 3I05A 3BFKA 3CLUD 5K3FB 5BV0A 4UTRA 1T34A 4OJKA 2CB9A 1RDFA 5BQXA 4YCLA 2IOFK 3WLTA 4QVIA 4AMGA 2GZSA 3TZKA 2D13A 4KRYA 4TUYA 1W46A 5TSDA 2Y8EA 4DC9A 1OVGA 3M3DA 4O25A 1B73A 3ESBA 2J5QA 1AURA 2A9KA 1R18A 2F1RA 2C0CA 1R9MA 1OX4A 2NUAA 5GONF 4CMKA 3AR7A 3D6HA 4C3UA 5L4LA 2HJWA 1TVKB 2WVHA 5F2EA 2RGBA 4YMVA 5HZMA 4OLJA 1X8LA 4ISBA 2H4WA 3FXAA 2JVJA 1QO0D 2I1QA 3HUFA 2JDID 2CVQA 4MKFA 1O58A 2PIDA 1NWHA 4E88A 4TKVB 4ZEOA 4J6FA 3E4CA 2DF8A 2Z1MA 2VZ8A 1JHMA 4TSFD 4TLLB 5CJ2A 1OJLA 2BUAA 4YJFB 4BNTA 5LLSA 4L4SA 1N6HA 5TS2A 4RTSA 1MPXA 3W77A 4EY3A 1JIIA 1IWPB 1OY1A 3S1SA 3F6EX 2FW9A 2XA1A 2ZU0C 3ESRA 1NVFA 3LBNA 3PF8A 2J31A 4LQDA 3OWXA 5K0TA 4OQPA 4YJ3A 1ZH0A 1CUHA 3VZRA 4IQ8A 3QTLA 3PV0A 2HCJB 3KXKA 1U0OC 3QA3E 1QIHA 3PDIB 4JQZA 1PT7A 5CLIA 2HWKA 1IB6A 1YONA 1FL9A 2DPMA 1RYNA 5K3FA 1SU6A 2F55A 1GPAA 2I7TA 2WM2A 1JJ7A 2Z43A 1I4EB 2WU1A 2ZULA 2Q49A 3MTJA 2VJBA 1DKPA 3OQPA 3TLAA 4LF7B 4XWWA 2P91A 2X42A 1ZC3A 1YR1A 3KU4A 2XCSB 1ULSA 2OLEA 4WUVA 2IPNA 4X1OA 1MGOA 3SX0A 1ZLXA 5K0GA 1WB5A 1J25A 4I99A 1E7RA 2HJRA 3AVPA 3U4IA 1YQDA 3GAAA 5H80A 3VJMA 3GL9A 3HP7A 4IIXA 3A4NA 1L3CA 3M6WA 1TVKA 4OQNA 1EWQA 4R8KA 1QU3A 2DUWA 4DMLA 2K4MA 1AKNA 3NATA 3UMRA 2JHFA 3GH1A 3MJSA 3CNEA 4OAPA 2VG8A 4Y2XA 4F2PA 4W5RA 2V0GA 1M34E 1NXWA 3K1YA 2WWGA 3IUSA 1OFGA 1U0JA 4UCXA 5F5NA 1QWSA 4U4AA 3CMMA 2YMMA 4YJFA 3JQFA 5CT9A 2V7QD 3QXHA 4YR7A 5AKJA 3M1AA 2V0CA 4BHTA 1JEDA 1CE8B 2CVPA 2I2WA 3BJEA 4PWZA 4CN9A 4PBRA 1XELA 2QXYA 1ORDA 2NO0A 4PG5A 4ZO6A 1SKBA 2Y9MB 4A73A 2BKUA 1UPBA 2VA8A 1GAQA 2RAVA 3Q3EA 1X38A 5JH7B 2CUTA 4LVCA 3PDIA 3ND9A 1H6DA 2ZB8A 3KKKA 4ZEMA 3ASZA 1SVNA 2IPLA 3KVNA 4Q47A 4JB8A 3ORSA 4EBBA 1P4GA 2O2SA 3C98A 4YDRA 1GKLA 4W1PA 5DN6A 3TFQA 1G20B 4MMYB 4DA0A 1YR9A 1Z29A 3GOQA 1BX3A 4OSOA 4GU5A 3UEOA 3MQ4A 4QFBA 2A59A 1RW4A 3AZQA 1WSAA 3HXPA 1I01A 3U39A 3MUEA 4B5LA 4F92B 4DLWA 3R23A 4LXUA 3FYTA 2GO1A 3OVMA 4JU9A 2A0WA 4XGNA 5E3IA 2XOEA 1BHQ1 3M83A 4KUGA 3PVCA 2AFHB 1LKZA 4TLDA 1RKUA 3IXLA 4J7UA 2OM6A 2QZJA 4HH3C 1AUPA 4F9TA 1L5QA 1X42A 4QPCA 4C4YA 1RPAA 4P3OA 5K0ZA 2CHVA 1H9AA 2H1OA 3LIPA 3ORFA 1DQZA 3DLTA 3VR3A 1D7AA 1PTKA 2PSJA 2MHCA 3AUUA 3G6KA 3HJGA 3KEGA 4N49A 5G4KB 5EFOA 5GV7A 5JSYA 2VXCA 1YAJA 2QORA 4MVJE 1U11A 3OLYA 1CE8A 1YS6A 2J3QA 3AINA 1TM7E 1GV0A 1ODSA 4QODA 1I2AA 1RM3A 4QSHA 1T4DA 1QYIA 4PICA 3W2HA 4ARZB 4D8XA 3P52A 1LVHA 3LUKA 4MW9A 3USES 5JH7A 4BBZA 1P4JA 3NBUA 4US1R 2G9NA 1E64A 1LH0A 3IR7A 4HXYA 1JSCA 2G28A 4NYJQ 4CWAA 4DSTA 1UEIA 2CJFA 5ICEA 1RNLA 5DWVA 2BBSA 4LY3A 4R40A 2XZPA 3BXOA 1FFSA 4LQCA 4EUKA 2QM0A 4Q9AA 2PRYA 1GZ4A 1FA9A 1Z83A 4GX2A 5CGZA 3IC5A 3OQHA 5ALGA 3NM5A 2ZRFA 2VF7A 1CXZA 4J7CA 1C1HA 3HB9A 4BIIA 5GONA 1I1OA 2VUHB 2XDQB 1KZYC 1JPJA 2AK3A 1H5QA 4BEWA 3H11B 5D01A 2J09A 2ID8A 2Y77A 4DCOA 2Q1TA 1CZNA 2AR0A 2P2CA 4GI2A 1JXOA 1KHTA 1TD9A 4PAQA 5CEEA 3BGDA 2Q45A 5C5CA 1CUUA 4M1KA 1XPOA 3N2KA 4BN0A 2YY5A 5JJIA 1XTJA 1DC5A 5EXSA 4IIFA 4DUGA 5DXFA 5F76A 1UJ6A 2XKKA 1IN5A 2BOVA 4UU7A 3R7NA 3ZD8A 3LH5A 4HS4A 3HZOA 4ARZA 1E6CA 3HJCA 2CBXA 2WE7A 3EZ7A 2ZBGA 1OXVA 5EIAA 4TZTA 3L7MA 3N8GA 5HZKA 3IAM6 3OESA 3SIRA 3PQDA 4OSEA 3T4PA 4KVAA 3F78A 3DW3X 3MJFA 4UCWA 4K9LA 2B1JA 3B9QA 5AHXA 3VYUB 3ZCQA 1ISPA 3NT4A 3ZZMA 1R0CA 3CZRA 3JQBC 1Z5ZA 3CWZA 3INGA 4FI3F 4HX5A 5BSEA 1G8GA 4ZJYA 1VE1A 1EGQA 1FDRA 3Q4GA 4TXJA 4EG7A 4YP1A 1VG1A 4B3HA 1SIBE 3OY2A 3GLFB 4PSKA 1M8KA 3PFNA 1FQWA 2UZ1B 3LT1A 4IFTA 4L9WA 4UNQA 4Q9IA 2Q5HA 2DHCA 5J47A 3NAZA 2XDQA 2XUAA 5CYFA 1DBPA 1FDWA 1KC1A 1RWBA 3PUWA 4ZMRA 5JTUA 3H11A 3Q3CA 4FWIB 2E5LB 4RKWA 3SEQA 1QRSA 1VSUA 1CUXA 3FNFA 4JYBA 3OMXA 1LDGA 2MYPA 5AUQA 2JLSA 4YDHB 2JJ2A 4DLKA 3UW3A 2B36A 4Y6RA 4JUFA 1SXHA 2J9ZB 3RVBA 4H7IA 3ZU2A 3S40A 3BICA 4PXSA 3O9MA 3J81k 4MQMA 1QHYA 2TYSB 3DD5A 1F1BA 2ISSD 4EI2A 5K45A 3CVUA 2AUMA 5E95A 3L0YA 4E3ZA 5E4FA 3X1XA 3AERB 4YYEA 2D1FA 1VLVA 2I3AA 1T0JB 3EGXB 3BK1A 2A4MA 1UP6A 2D5LA 3I9JA 3BA1A 3JS5A 3KR0A 4CM6A 4LF6B 4MHTA 3ITKA 4BFYA 5HTOA 1PO7A 2XNJA 5AW9A 3D59A 4XJVA 4DYVA 4MR8B 2V6GA 1E4YA 3DBIA 3KLMX 4LJ8A 3IP7A 2I33A 2X77A 5ALQA 3VZBA 5AIBA 3NHZA 5EJMA 3GGDA 4PPNA 1N2HA 4E15A 3CF0A 2WDZA 3LUHA 3E9YA 5CNJA 3RG2A 3RSZA 2Q5EA 1VA5A 2A9FA 1G7CA 3GLFA 1OC2A 1XEWX 1MFPA 3UPDA 2NYUA 1MDFA 4FONA 1QGUB 2E48A 2UZ1A 4OI1A 4QUKA 3T7KA 4ACBA 1Z8FA 4ER7A 2ZSDA 4QYIB 3F3YA 3M1LA 4JQCA 1N1EA 1Y3BE 5GZ6A 1RWWA 5C8ZA 4EFDA 4IJQA 1QF6A 3SAJA 5TEWA 2HBQA 5H4HA 1G1AA 3MQ2A 2Z0MA 3EA4A 1AO0A 3ANSA 3JQ6A 4BNKA 5INTA 2WWYA 3K09C 2JFPA 3T3HA 2H4ZA 3HU2A 4I4TF 2XNKA 3KP1A 3IQWA 4MW6A 3TRIA 4RK4A 1BHSA 4OAOA 3TQIA 1NQUA 3DULA 1I2MA 4QYXA 3O9VA 5KPDA 1PBTA 1D4AA 1PWZA 2I7VA 4K2HA 1Q84A 5B3JA 1RHUA 1ZVMA 1RI1A 2BV3A 3AERA 3EGXA 1AK9A 5C1DA 4Q3EA 3OICA 3IUMA 3HZHA 1OF1A 3LI2A 2QTTA 5IJZA 4DQVA 4MUYA 3WQRA 4NXNB 2AUNA 3K6JA 4C5CA 3H3XA 4V0KA 4MR8A 5AVTA 1MQ9A 2GZHA 3OTWA 4M0PA 1ST3A 1N8TA 1XWFA 1NJ2A 2QX8A 1ZUD1 3F47A 3L4BC 3F1KA 2BCJQ 4KTTE 3VO1A 2C8LA 1DX9A 4PC7A 3W8NA 4Q9HA 4D1YA 3VU9B 3DDWA 2ZBQA 4EHHA 2G0NA 2QI9F 3HRIA 1Y6RA 3H4IA 1QGUA 5EP3A 4EUFA 2HJGA 1Z18A 2AEJA 1IM5A 3IJRA 5FR1A 2ILTA 2RB4A 1V1MA 4PBSA 4QYIA 5DXAA 2CFCA 4D81A 4DLLA 5HQTA 4CF4A 2NAFA 2PT7A 5FV7A 1XYYA 3KE8A 3GJSA 2IYZA 4QBTA 4R9SA 3V1NA 4OUKX 2QRLA 2IYPA 1GR0A 4OFZA 4RF5A 2BSAA 3B5EA 3H5WA 4M9UA 3IQXA 1QPBA 3FSRA 4OM7A 3T7IA 6ADHA 4A82A 4MI1A 4KXFB 4HBZA 4MA0A 1JR3D 3HO1A 2NT4A 3Q8MA 5AESA 2WZCA 2IYFA 1GFSA 1N1MA 5HBRA 1WABA 2R47A 4RKEA 3ZU4A 4B0OA 5HE9A 2GD1O 2MMGA 2C0PA 1L4LA 2HXSA 3AHHA 4L8FA 5EJ8A 3B1ZA 1AT1A 4WKBA 2GOYA 5FF9A 1I6KA 1Y8AA 2M32A 2GO7A 3LZ6A 3OUUA 3EOZA 4IYRA 5MHTA 3K9NA 4B4WA 1NDHA 4U2CA 1U1IA 1OLXB 1N1DA 1QVWA 3CF4A 3QJGA 4XSVA 2AJLI 3LT2A 4AIIA 1ZU4A 3L8GA 4JP5A 4H1HA 2QRHA 4BQSA 4Q4LA 3N8IA 4JLSA 3UZUA 5T41A 1A8QA 1R5NA 1V71A 2IDKA 3GPLA 5DNYB 5KKCA 1PNOA 2IHZA 4L5IA 1O3YA 5EN4A 1MX5A 4RH3A 4BV3A 1NF2A 1WP9A 2CJWB 4Z1MA 4RDXA 2CZQA 5B1DA 1OVMA 4ZKDA 3SDSA 3TEMA 3WGVA 5KNDA 3EHEA 3BPSA 2Q8NA 3H65A 3QFSA 1NOIA 3OEHA 1AZWA 3L6UA 2OFWA 1VFPA 2ZFUA 2YV5A 2JLCA 3GPIA 4LZWA 4L8LA 1E6KA 4HQFA 3MF4A 3SSNA 4DR5B 3C74A 5E2BA 1ZICA 5ARCA 3CR7A 3PXEA 4PCVA 2QTMA 4UBKA 3R4CA 2CHEA 3HVHA 3AI7A 4DBZA 1VBNA 2WRZA 1P9OA 4AP5A 4DZZA 4FX5A 5AW5A 1CDEA 4H15A 5T4FA 4BV2A 3MUFA 4BOYA 1EQ2A 3K5WA 1P7ZA 4E09A 3GP3A 1PHRA 4BO9A 2GN6A 3TRFA 4BLSA 4NFSA 3GDGA 4F3YA 5DPMA 2IL1A 2Q4OA 3K9BA 5B37A 4UM9B 4BKOA 5KPJA 2EJUA 1OLXA 4W9NC 1VKRA 1XJCA 1YAHA 2JARA 2J3IA 2NV6A 1XXHB 3HFGA 5JRZA 3ZDAA 5KNCH 4MUJA 4IV5A 3FR7A 3A9SA 2H7XA 3REGA 5DP2A 1PL8A 1BZYA 1MC8A 3G0CA 4OGWA 2E85A 3RJ9A 4JUBA 3GD7A 3RT9A 3LLSA 3UYKA 1G6KA 2XSZD 1QP7A 1HL7A 4ZYWA 3D4OA 1IXZA 1HT3A 2C2GA 3MGGA 3PHBE 2CVHA 4M0KA 4XCQA 4BC0A 3U60B 2QTVB 2XUDA 3OJOA 1OXKB 1E79D 2XTMA 4OK6A 5TS3A 3C8DA 3TZEA 3UTDA 3IPAA 3GFGA 1INLA 3KFXA 2ID7A 2JFHA 3U0VA 1PYDA 5C7LO 2I4NA 3ZNQA 5IDXA 3KCQA 2PUFA 4PZPA 1L1EA 1YSCA 2ILVA 4INOA 3D2AA 4Q7JB 3L4JA 3RAFC 3FHTA 1S3IA 3B82A 1S3FA 1C3OA 3ER8A 1GKUB 3FNBA 1GAJA 3I9KA 1WQ1R 3GMTA 1XQ9A 4M3NA 1QS0B 3IB3A 3LPAA 4LOIA 4MKHA 4RHEA 3EG5A 3PCXA 3G7UA 4PGMA 1ECGA 1PLKA 5AH0A 5DT2A 4E51A 3GUZA 5LQCA 4ODIA 1GNRA 2AR7A 3EUEA 4YN3A 3OMWA 3QEMB 3SR0A 4DB4A 2R97A 2LVBA 2RSLA 3GVCA 4WASA 2YUIA 1EG7A 5IS2A 4X1IB 1KOJA 3SSMA 2HMWA 4N0PA 4LTMA 4B6SA 4BRSA 3GJ7A 3VNQA 2Z3VA 1TKBA 4ID9A 3I09A 4KKXB 3TM5A 2VR1A 1M54A 4DQXA 4BVHA 1KO8A 5A7HA 3LBHA 5EMJA 3WBJA 5TDHA 2Y1GA 4ENPA 2XXAA 4M7PA 4TT3A 5JC1A 4IM7A 1WDLA 2PLWA 2IZ1A 2EP8A 1CUSA 2W2OA 2XMRA 5LQKA 4BCCA 3QWAA 1N7HA 4IIEA 3KQHA 4AQDA 1QNLA 3O21A 1LK0A 1TMKA 2YWCA 4J9VA 2QTVA 5K2MA 5BO5A 3TDKA 1TCAA 1DAIA 2A86A 1XPRA 3ZG6A 1YRQA 1WX1A 2YYAA 1W8IA 1T2VA 3L07A 4BX9A 3FFBA 2G5GX 2IYLD 3C14C 1DRWA 2NIPA 2A33A 4AJKA 5LP6A 5FLXA 3E5NA 1QS0A 4JT4A 2PKQO 3O8DA 4J2HA 1VKOA 2Z6VA 2JKZA 2TECE 3NZEA 4BQFA 3VU0A 3CUUA 2ZYDA 4OQ4A 2WU4A 5DBIA 4EGAA 1E20A 4X1IA 1PL7A 1SVUA 2H1FA 3WYAA 1Z36A 4A2CA 5K9ZA 3MTIA 1NBHA 2DKFA 5EESA 3I9MA 1AM4D 1RPJA 1EHCA 1JG7A 3KYBA 1C8LA 4TLAA 5EL0A 3V8VA 1WD7A 3ZDQA 5LIPA 1NI4B 2Q5JA 1JQKA 1ZMOA 3COYA 5AD1A 3LTEA 4GGOA 1IWOA 3AK4A 5D3QA 4KUHA 1SXJE 3TRKA 2VDVE 5UKDA 2NUPB 2CDCA 4ANFA 3S6JA 3RGWS 3O3OB 2AN4A 5K8CA 4D46A 1T0IA 1U6JA 3INRA 4HUTA 1AXGA 3GGOA 5TGDA 1CDOA 4C3OB 1T5HX 4B3MB 1P4SA 2VVTA 1Z39A 3O90A 3HA7A 2GSDA 4H1TA 4K87A 3MW8A 4M8KA 4MUMA 4NAUA 4RZ2A 1KA9H 4Q39A 4AJPA 1LK7A 2GAFA 2ISQA 1N6PA 3K53A 4QTUB 4E1VA 2WT4A 3GXOA 3CM0A 2WUDA 1H2HA 2QTGA 2WJ4A 2YFQA 4DBLC 2QMUA 5CB8A 5JAIA 2QLMA 2A9VA 4PLPA 1JEJA 4B46A 2CVZA 4HFRA 1MQSA 2OR3A 1RLUA 1UODA 2BHTA 5FX2A 1T4GA 2Q1YA 4FUTA 1JVBA