2HXSA

Crystal structure of rab28a gtpase in the inactive (gdp-3'p-bound) form
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
178
structure length
178
Chain Sequence
GSHMRQLKIVVLGDGASGKTSLTTCFAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQIWDIGGQTIGGKMLDKYIYGAQGVLLVYDITNYQSFENLEDWYTVVKKVSEESETQPLVALVGNKIDLEHMRTIKPEKHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGIKLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-28
publication title The Crystal Structure of Rab28 GTPase in Active and Inactive Forms
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 62
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2006-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2hxsA00
2ZSBA 4B32A 2GESA 2ZPTX 3VR5A 3BAFA 2Q3HA 1W36C 2C5LA 1NBMA 2QP9X 1N6KA 3WHKA 4G5SA 3B82A 1RJ9B 4Q1FA 3THWA 1XF9A 5UKDA 4EJSA 3P20A 1NLYA 1CR0A 1E9FA 2JCSA 3P27A 4AYWA 4A9AA 1AGRA 1QHNA 2J0QA 2YVUA 2B7CA 4LJ7A 3REGA 1UEIA 2ATXA 3B1XA 2CBZA 4G5GA 5EE9A 4V0OA 5BXQC 4JLOA 1R0WA 5H1YA 3L8YA 1TMKA 3GFTA 2ZRIA 3A1VA 4NU0A 1TF7A 5EXPA 2IWHA 3RNLA 4M1MA 5JZVA 3IEVA 4W5WA 2CMKA 1II0A 5AWFC 4JMPA 4N3NA 4QL3A 2IUUA 4NDZA 2J46A 4NH0A 1R5BA 3TW4A 2P6RA 1T5IA 3B13B 1XD2A 2D4HA 4RKEA 3ZZUA 4EDHA 4QM6A 2OO7A 5F98A 1DS6A 1DTSA 3EZFA 3U7FB 2B6HA 1SHKA 3RSOA 1I4DD 1M74A 1OW3B 4JSYA 2ZU6A 1AKEA 2JJ1D 5L3SA 2AKYA 2P67A 2CLCX 3PENA 1A1VA 1M8PA 4GFDA 5DLQC 5EP2A 3VHLB 2WZQA 2HUPA 2RGNA 1Z06A 4K46A 4EQ6A 1JJVA 4MGKR 1Z6AA 2FU5C 3VHXA 3LQRA 3QKUA 4N0DA 1P75A 1XEWX 3T35A 1G8GA 1XXHB 4NMMA 1BMFA 3P26A 3WBJA 2QI9C 3O8CA 1CP2A 2QTHA 1QHHA 2ZEJA 1EXMA 2FEMA 4UNSA 1CJKC 4DLYA 1N3BA 4TYWA 3B78A 2OLKA 2ZE7A 2PH1A 4TL8A 3U3MA 4R98A 4WZBE 4GMXA 2ZRBA 5JS8A 3SQWA 1E9EA 2GEDA 5B30A 1Z0JA 3C4JA 5HTKA 5K8TA 4DLXA 3C16C 2VP6A 5AJXA 1PZNA 3U2QA 2CCJA 3U6KA 1ODFA 4D4MA 3AVOA 3KJEA 5CDFA 2GDJA 4MGIR 4HDCA 2YYZA 1J70A 4DC9A 1NN0A 5FPKA 2V54A 1F60A 1AS3A 4MYTA 1AM4D 2UZ3A 3L0OA 5DE3A 1GKUB 2ODNA 2VSOA 4GP7A 1JALA 3TUIC 2VIIA 4ZI2A 2J0VA 2IW3A 5M04A 1EFRD 4AYTA 1KK3A 1G3QA 2B8TA 4RVCA 5FTLA 1HEIA 4F7WA 1NG1A 3FHTA 1P62B 1OFTA 1G7SA 1QHIA 1A2KC 3LH5A 3K0EA 1E0SA 1YQTA 3KL4A 3QSYA 5KSYA 2BHRA 4OK3A 4ILEA 5GJWC 1E2LA 1OFHA 4Y0AA 1VECA 5JI2E 1IBRA 2V1UA 1G7RA 5JEEA 4LI0A 4BFZA 4GOKA 3K9HA 2DWPA 3RRYA 4PPQA 2XOKD 1WQ1R 4DIEA 3R8FA 3FYHA 1C1YA 4AC9A 3Q7PA 4Q48A 4GZLA 1I2MA 1E2EA 4R2HA 1RZ3A 4KFRA 1A7JA 2QY9A 1DAMA 2RGBA 3Q8XB 3THXB 5J47A 5DHFA 1KTVA 3FWYA 2ZRGA 3K0AA 4U5XA 3EWAA 1XBTA 3AV0B 2YHSA 3CNLA 1KHTA 4QGHA 1H8HD 3H84A 1N6LA 2WOOA 1VCNA 2J7PA 2YWGA 4DUGD 2A5JA 1DAIA 1EFHA 4GOJA 3RLFA 4M8NE 2R2AA 3B7GA 1G8YA 3T06B 3D8BA 3SOPA 4LZZA 3HDTA 2REBA 5TDHA 5FTMA 3KQLA 4POAA 1G64A 4FW9A 3H4MA 1AK2A 1DADA 3UMSA 4NYMR 1YZUA 1W7AA 4M9XA 2R9VA 3KDSE 3UKDA 3TUJC 4DB2A 4US2R 1GTVA 1P9RA 4PPNA 5FFMA 3GFOA 2GHIA 2N1BA 4Q1AA 3EC1A 3ZLJA 2A2ZA 3VNVA 4MKIA 2ZJOA 2HT6A 1E9BA 2IYSA 4TN1A 5EE3A 1EX7A 2GK6A 3FFAA 3PIRA 4LYAA 4RZ2A 2GVZC 2ZAMA 3QENA 1ZU4A 3Q3JB 2ZRMA 3VR2A 4W9MC 4BUJA 1G4UR 1KZ7B 4Q9JA 4Z1MA 1KI6B 4PPGA 4CT5A 2BCGY 4X8MA 1YRBA 4NE2A 4ZKEA 4HAYA 1DG1G 3FB4A 1DVRA 2BDTA 4DCSA 2VP4A 4D0GA 3VFDA 2ZRHA 1BO6A 4I99A 4CEJA 4XH9B 3EAQA 5JHHB 2QMEA 2YOFA 2ZRDA 1JR6A 4H1VA 1IXRC 2OFOA 3QY0A 1E98A 2DR3A 3TQFA 3FKQA 3B9PA 4QJ3A 1GSIA 3DEFA 4V0NA 2XNDA 2PJRA 3KKNA 1Z2CA 4Q00A 1W49A 3VX4A 5CK5A 2D2FA 1UBGA 3AVVA 3CPJB 5DNYB 2WPDA 1COWA 4JKYA 4CEIB 4NCNA 4Q9IA 1MR3F 4D4KA 3TGPA 4TMTA 2FX3A 3QKSA 2HXYA 4AY2A 2KJQA 1CU1A 1XMJA 2IF2A 1G19A 2KI5A 2V3CC 3K70D 5L3QB 2F1JA 5CYOA 5TVKA 1E1QA 4D81A 2HF9A 4WOPA 1T0JB 1ZIOA 2R6CA 2ZE5A 4ITRC 4A36A 1E79D 4GP6A 1XMVA 3KUDA 1VCMA 3ZZTA 1PVOA 3C5CA 3Q5EA 3VKWA 1QHSA 5JSZB 4D4LA 3FKSA 1ZP6A 3A36A 1JXOA 1CLUA 2D74A 4W5JA 4NL4H 5AUNB 4UQOA 3KB2A 2IS4A 2G1JA 1RFLA 4GPTA 1VKJA 4GZMA 4KLNA 2PZGA 1E2NA 4GDFA 1W44A 1QF9A 2ZSAA 3I1FA 1WXQA 3TAUA 2PJZA 3BC1A 3D7MA 1P3JA 4GRAA 2CLDX 1F6BA 1O87A 4AYXA 4QHYA 2YV5A 4MUBA 1WA5A 2ZRJA 1ZM2A 2EFCB 4NKRA 2IS2A 4B2PA 2JJ2A 3FHCB 1OH5A 1XPUA 1T3HA 1Z6YA 3GJ7A 1JBKA 3L0SA 3OE7A 4BFXA 3A8TA 1VYTA 2OFWA 5JECA 4K8OA 3X1ZA 1G9XA 4XD7A 2W58A 5FPTA 3AVQA 4Z54A 3GCGA 4EPWA 3RABA 3L43A 4V0ME 5FTJA 1ZCBA 1R6BX 3DKVA 1XTKA 2WWFA 1W48A 2C2HA 3OAAD 2XSZD 1KK2A 3QBTA 3QE0A 1U8YA 4TTQA 5JBQA 1A2BA 2XNSA 4V0KA 4U7DA 4D0NA 1KO4A 3AF0A 1KKLA 3M0EA 2QM8A 3LQQA 4Q47A 4DCVA 4DCTA 4V0MA 3LVRE 4DDTA 2HJGA 4B34A 4ZKDA 4RD1A 1KMQA 2XZPA 4YXWA 1Z63A 1OH6A 3HU2A 2IBMA 3SJCA 1KAGA 4Q4AB 3D31A 2KWIA 1U0JA 3BFKA 1NBMD 4HUQA 5AR1A 1EX6A 5TB5A 2OFXA 3NDBB 3QXXA 3IPYA 3EPLA 1W36D 1FMLA 4KBGA 5HKKA 2D06A 2ZI6A 1E2IA 3LXXA 1UKEA 1KO7A 2V4ZA 1Z29A 2ZUDA 4Z8XA 3BXZA 2Y8EA 4ZO4A 5EXSA 1P73A 5HE9A 2QORA 2ZS7A 5CJPA 2W6IA 3LX5A 4C7OA 1W0KA 3DHWC 2JASA 4C0HA 1YZQA 3P1JA 4HZIA 3NHBA 5E3HA 5TMPA 2IL1A 3UIEA 1YZLA 3N2IA 2EFDB 3W6NA 1KDRA 3GLIB 3VNUA 4EFLA 2GCOB 2VTKA 3K09C 4CZ2A 1BIFA 3J81k 3CH5A 4FN5A 2QMUA 2VSXA 4X8LA 1IY1A 2GXQA 2AXNA 1FNMA 2OXRA 1PLKA 3EW9A 2O8BB 3G5UA 2RHDA 2FZ4A 1G6OA 1FNNA 1TNDA 3SR0A 1IN5A 2Z4RA 3LBHA 4RKFA 4P32A 3UWOA 4C0KA 3RS4A 3AB3A 2C78A 1R7RA 2J9RA 3N70A 1VIYA 1KMHA 2BBWA 1D2NA 2HEIA 4A6XA 3KTAA 5SZHB 2BEJA 2E1RA 3LA6A 3ICQB 4JYBA 4P4SA 5C4GB 2BMDA 3SYLA 1T91A 1TAGA 4AG5A 1FUUA 2RHMA 3TQCA 1NKTA 1US8B 3O8RA 2E9SA 4DT1A 5KDLA 3QUSA 3KKQA 4LDJA 2C8VA 3B60A 1WBDA 2ZYVX 4US0R 1N5KA 3H86A 4URYR 1XWIA 1KO5A 2VHTA 3NBXX 5KUTA 3CBQA 1GG2A 2CVHA 3RC3A 2Q21A 1HT2E 2O8FA 2CJWB 1M2OB 3ZYCA 1U0HC 4PQFA 1SVLA 2QAGB 1M7BA 1OLOA 4KVAA 3EPJA 3FMIA 1WDTA 1XD9A 2ZYWX 2CE7A 2R6DA 3ND9A 5KYKA 3GPLA 4V02A 1XD8A 3CLVA 1ZAKA 2MMCA 2V7QA 5CLQA 1KK0A 5BWMA 1VDZA 4WZ6A 5FL7D 4QBHA 3REFA 4LV5B 2PZEA 5IHPA 4MRNA 1NKSA 2F1IA 3LDAA 2VO1A 2ANBA 2GXAA 1C9KA 2IYYA 4ACAA 4C0BA 3WNDA 5L3VA 3PVSA 4WW0A 3NC1C 3QG5A 1L4YA 2Q9CA 4G5RA 1VCIA 2R44A 4PSAA 5CYPA 1NNEA 3L0IB 1BKDR 4M9SA 3HJNA 2ZJYA 5KHOC 2NGRA 3NBZC 1OHHA 3RRZA 4CDGA 3IBYA 4CEHB 3QOFA 1U2RA 4NP6A 2XX3A 2YC4C 4RZUA 4R71A 5FL3A 1OYYA 3PUYA 5E4FA 2W0SA 3GJ8A 4TLBA 2VHJA 4XWKA 4Q7LA 1ZUIA 4TT3D 2RGXA 5FOUA 1EFTA 4MRPA 1JEDA 4IDNA 3HYTA 3VU9B 4OI2A 5D3MB 2Q3FA 4MYCA 4DVGA 1TL7C 1XB2A 4A15A 5IK2D 2XJ9A 4RD4A 3T5DA 3LY5A 2LKCA 4JYCA 3KQNA 3MWYW 1L7VC 1R5OA 2IYQA 1AGPA 4URWR 4RFSB 4F4CA 3RSLA 5EE5B 4FCWA 1OIXA 1G3MA 1W2HA 2CNWD 4XJXA 2JLYA 2ORVA 5FOVA 3RAPR 3NDPA 3BFXA 2EYQA 1NMZA 2J41A 2WSMA 4QJ4A 3T1OA 2YZ2A 2BV3A 3G0HA 1HTWA 4P0TA 4QG7A 4URZR 4BQSA 2EQBA 1EFUA 2OHFA 5KO2A 4A2PA 4WA7A 1GL6A 3U44B 2ZUBA 2J59A 1NLZA 2BMFA 3QEJA 4II7A 4CT4B 1WRBA 1IM2A 3EASA 3I3SR 4NYJQ 5CM9C 4MDEA 2Q6TA 1JXMA 4OI1A 2F1RA 3RC8A 1T0HB 1PLJA 3B1ZA 4L15A 1N0UA 2QT1A 3IHLA 4KFTA 1R4AA 2BWJA 4DB4A 3PUZA 2ZTSA 2FSGA 3KJIA 2QN6A 2PT7A 4A8JC 5EZ6B 1IAQA 3ZS9A 4UXIA 4HB3A 5F9FA 4FCVA 4C2UA 2DB3A 4WXPA 3KKOA 2IYRA 3AKYA 4DBLC 4U00A 3C41J 3VX3A 3L0PA 4O0MA 5CK4A 4LBYA 2Z43A 2ZSEA 4Q9HA 1CS4C 1D9XA 1R8SA 5DH9A 5JWRA 1FOEB 1R0ZA 4IFBA 1QG2A 4QC2A 4F4JA 4EPVA 2GJAA 5J4YA 4Q4JA 3BJIC 2IHBA 5SZJA 1OXUA 1W4RA 5HPYB 2IXEA 1E9SA 2JLSA 3DPUA 121PA 4DCUA 1XPOA 2NO6A 3IEUA 4NTZA 4TZ0A 3A1UA 3KFXA 1IJFA 5ELXA 1GVNB 2EFHB 4UKDA 1YR8A 1RYFA 3PUWA 1J99A 1S3SA 4Q21A 4M1TA 4HI0E 1UAAA 5KTYA 3AUXA 3VKGA 2IUSA 4ESVA 4LGMA 2Q0HA 2W2TA 5CIWA 1IN6A 3ZVRA 1YU9A 3EA0A 1TEXA 2FV8A 3V00A 5E7MA 1NSTA 5ANRB 3R20A 1D6JA 2IHYA 4DXAA 4HLCA 1OB2A 2EFEB 2XNDD 4RD3A 3TSOA 3MCAA 1OIVA 4DSOA 1QHGA 2C99A 1GM5A 1DO0A 2XTMA 1RJ9A 1ZVQA 2WPDD 3RS0A 5B58C 2OT3B 2G83A 4E03A 1KDOA 1KSFX 2JLRA 2QSZA 4OQXA 2D2EA 2ZYTX 2IYXA 1N5JA 4BASA 3ZS8A 1LV7A 2OCAA 4NBSA 4XOIA 2HCBA 4KSCA 4TLEA 1NVWQ 3RS5A 1E1QD 3QQ5A 4F92B 4ZIRA 2O5VA 3U60B 2OM2A 4LJ6A 1SXJB 2PMKA 3LO5A 2J1LA 1Q22A 2KB0A 4FMBB 3UPUA 1AZSC 3FKSD 1CJUC 1XTSA 1EK0A 5CIQA 3UG6A 3GMTA 4LJAA 3ZIAD 1E96A 2QAJA 3KXIA 2D7DA 4IXMA 2OZEA 4OHZA 2VBCA 4IOJA 2XB4A 3AP1A 3OEHA 3EC2A 2QEQA 2P5SA 4FMCF 5F2EA 2AWNA 2QP4A 5FPYA 1L8QA 1TX4B 1GNPA 5G3YA 3CIOA 4LJ5A 4A8JB 2H1LA 2QENA 2OESA 2JJ2D 4BWYA 1CBUA 3GEEA 1J8YF 3QXJA 1EWQA 1E2PA 4MQBA 2JLVA 1X8JA 4RSGA 5C18A 5J40A 3C14C 3GJXC 2RMKA 4AIIA 3MFYA 4JLBA 1XZPA 4HB2A 2GRJA 4TLDA 1UDWA 2BJWA 2QU8A 1P2UA 3DKPA 2AXPA 3AUYA 3UWKA 4Q18A 4UNQA 4KLZA 3SS8A 2KBEA 5JI3E 4CIDA 2ZXUA 1GNRA 4GBMA 4EJSC 3S1AA 2FFAA 3NTUA 2RGCA 2F7SA 4Q7JB 3FFBA 1GL7A 1SHZA 4KFSA 4D82A 2VHCA 2ZRAA 4OL0A 5KU1A 5FBLB 2J0SA 1SKYB 2WBLC 4QFMA 2P5TB 3F0TA 4KHZA 1W5SA 2CK3D 2VQSA 2YKGA 2XTNA 4BLTA 4ZCIA 2ERYA 2QTFA 1HQCA 5HKKD 1F5NA 4JVSB 5FOTA 1KSHA 4M21A 2AD5A 2JEOA 4PSKA 1Q0UA 4BECA 5C4MA 4PHTA 4C0AC 2OAP1 3K70B 3KQUA 3QF7A 3HYRA 4LPSA 4UXJA 4EPTA 4IDQA 5KSZA 1VG1A 2D3WA 4S35A 1IXSB 1SKQA 3OIUA 2CXXA 3PUVA 3CZQA 1G8PA 3KKMA 4MYHA 5BYJA 3TK1A 2WMNB 5FOXA 2GZHA 2JATA 2NO0A 2OEPA 4JLJA 3B85A 2WJVA 2JLZA 2QL6A 3K0FA 3OIYA 2FMXA 3OEEA 4LHXA 4PQYA 3BH6A 4DRZA 4RJLA 3RWMB 2AFHE 2B8WA 2RGNC 2X2EA 5L8VA 5LDDC 3I61A 2CCGA 4GL2A 3LNCA 3ICEA 3QXSA 2ZROA 1E69A 2DFTA 1N5LA 4B2LA 4X8HA 5AK0A 2ZJ2A 4P4UA 3CZPA 5EP3A 4ASUA 3K1JA 4R2IA 4PC2A 4PPFA 2A3RA 1F2UB 4UJ5A 2XXAB 1Q3HA 2ZITA 2HT1A 4MDFA 4XVUA 1DELA 1ESNA 1D9ZA 1Y3AA 2O8CA 4RCZA 1EESA 2FEOA 5CDFE 1TADA 3W5IA 3IKJA 3W8NA 2YWFA 3BORA 2QBYB 3EPHA 4LJ4A 1TEVA 1YRAA 3CWQA 4PZYA 2X8AA 4B73A 1CIPA 1HH4A 1FTNA 1P7CA 2ODWA 4XTRA 3W8RA 4TYNA 1FQKA 3QVUA 2IWRA 4DDWA 3A37A 5IT5A 5DHAA 2QE7A 1WE2A 2IXFA 1E2JA 2IA5A 2X77A 1TUIA 3NVAA 1T9HA 3EZ7A 3MAAC 3QF4A 5EZ5A 5JMTA 5J4LA 4G5OA 4JLAA 3WNCA 4C3ZA 1QG4A 6Q21A 3VR4A 4QJ5A 1ANKA 4PANA 1XCPA 3SFVA 4L9SA 4TYQA 4XSHA 2ZRLA 3WY9A 2O8DB 4Q4HA 1CF4A 1NJFA 2XEXA 4LV6A 4QOSA 3LLUA 4NCJA 3UK6A 5LB2A 4DEXA 4JZKA 4C2TA 3EA5A 3GFPA 1W36B 3R9WA 2ZSDA 4KO8A 1DOAA 4IOMA 5BN4A 2VP0A 2QRZA 3A4NA 3CPHA 1GUAA 2VYFA 4B3BA 3BERA 2WICA 4HZUB 1G20E 2OBNA 3HPRA 2ORWA 1HYQA 3FGNA 4DKXA 3A1SA 1OHHD 4A2WA 3AVUA 4BE7B 1NMYA 2JLUA 2GTPA 1KI6A 2WWIA 2F3RA 4IDOA 3GJ6A 2WIBA 2OSBA 3WMFA 1OV4A 2I4IA 4PR0A 4C0JA 1WBBA 1C4OA 3IIJA 1IY0A 1Z6GA 1KDTA 2WTUA 1XD2B 4C4PA 3W90A 4JLDA 1U9IA 2WKRA 3GQBA 1JQJC 3UANA 3GLFB 2CL7X 2R8RA 2OBLA 1M34E 3GJ0A 2RKOA 5FBQB 3CRVA 4AKHA 4JLMA 3NHAA 2OXCA 3MLEA 2GBLA 2VSFA 4H9GA 5FOWA 5A4JA 1JPJA 3U3JA 5TY0A 1S3GA 4EQ6B 2NOAA 4D2IA 1ZD8A 2YJTD 4R9UC 3BRWD 1IQPA 1E9CA 3SC3A 4XVQA 1SXJD 1MT0A 3AVWA 1AQYA 2W6JA 5CB6A 1OE0A 3IIMA 1Z22A 2ZM5A 1L2TA 4IRUB 3KB1A 2AX4A 1FTSA 4M1SA 2GEUA 5L3QA 1OF1A 5KOYA 2C77A 3QPUA 1KO8A 2WJIA 3W9YA 1HQYE 5JS7A 2PLRA 2ODEA 3IO3A 4RY2A 3R7WB 5A0FA 4NONA 2B21A 2ZQ5A 1XU4A 3UATA 2RH5A 3F8TA 3MUFA 1PUIA 3F5FA 1ZD1A 1LTQA 2YNMA 2HYIC 2UVQA 3ADDA 3BWDD 2JLQA 3NBFA 3H2YA 1MOZA 3AGQA 4P3YA 1K6MA 3CRRA 3GLHB 1QDEA 1CR2A 3WYAA 5GJVC 3K0CA 3IPXA 1BS1A 3ASZA 3I4LA 3EIEA 5GVRA 4D6PA 3CPEA 4DLSA 3U7HB 1F2TA 3UMFA 2FGJA 2XTZA 4M4SA 4IFEA 3HP1A 4GOXA 5SZKB 3TH5A 3QKRA 2KSQA 1N6HA 3SHFA 4OHVA 1UKVY 3QG1A 1JJ7A 1EGAA 1BYIA 1S1CA 3QI2A 5AUQA 5EXXA 1N2CE 2DHRA 5IF9A 1Q44A 4NYJR 3RANA 4IEIA 2IEYA 2Z83A 621PA 1KYIA 4I4LA 3A6PC 1CJVC 3K9GA 2WWXA 1ZM7A 2HLDA 1IXZA 2OAQ1 1G17A 3IIKA 5JRJA 4D25A 1VHTA 5J5CA 4YMWA 1XTRA 1UBFA 2CVFA 1JECA 2I3BA 3HU3A 4LBZA 5DN6A 4FWTA 3JVUA 1U98A 2HJVA 4URUR 4UXHA 3OFND 4HDQB 3U4QB 3ZVNA 2GJ9A 1MV5A 5G40A 1DAEA 3AKEA 3DO6A 4NCIA 2DFKB 5AJYA 4C0LA 1E2KA 3RS7A 4KJZA 1HY3A 1GNQA 1E0JA 4LYHA 4DIDA 1AIPA 1NN1A 2PBRA 3I73A 3K0AB 1NMXA 4HAZA 1W0JA 1BH2A 2R65A 4L9WA 1JQLB 521PA 3CNNA 2NMVA 4IVQA 2KE5A 1KY2A 2EYUA 1KI8A 4KV9A 2IK8A 4ERNA 2FNAA 2H16A 1J8MF 5CJ2A 1MABB 3CRQA 5BN5A 3C8UA 1ZCAA 2C95A 1DE0A 2TMKA 2FPKA 3BS4A 4LC1A 1NSFA 3AH8A 5FPHA 3VAAA 1XEXA 4A4DA 2IYTA 2ZSFA 4BZQA 4QKQA 5D3QA 1EFCA 3C7KA 4DLWA 1XCGB 1B0UA 3CM0A 1DG3A 1NI3A 2WSSA 1T8UA 3CH4B 2EWWA 3QKTA 4M1KA 4TLCA 4PTLA 1LB1B 2XB2A 5DISB 4IKEA 4DSUA 1A5TA 5GVSA 1KNQA 8OHMA 1G8FA 4NCHA 5B64A 3RWOA 3EARA 2HDNB 4Q02A 2OBMA 2ZJAA 4KODA 4AG6A 4FMDF 5GJBA 3PQCA 4M22A 3LLMA 2Z4SA 5DIFA 5B2ZA 3I8XA 3V9PA 4BFWA 3CR7A 2DYKA 2ZRFA 4MKHA 2WM9B 1KIMA 5EQTA 3VR6A 4DLZA 4L4UA 5BW8A 4IW3B 1P4SA 3AVTA 3WYFA 1VIAA 2WMOB 3VTKA 3T1TA 4HB0A 4RD6A 1KI2A 1P5ZB 2BEKA 3T12A 1KAOA 1NVUQ 3QPVA 2PEYA 5KNDA 3RDPA 5EXTA 4Q1BA 4LSGA 5BN3A 4FXPA 1V43A 2C9CA 4V0LA 1HE1C 4EKDA 4PC7A 1JPNA 4PSVA 1OXVA 1ZM9A 4B35A 2IYZA 3FPAA 2FN4A 1YZTA 4E09A 2IYLD 4PAQA 1JR3E 1M1YE 3CRW1 1OFUX 4TYPA 2QPOA 3JZMA 2PLFA 3E70C 2YWEA 1YJ5A 2IF0A 1JAHA 3AKCA 1U81A 2IS1A 3QXCA 4QGAA 4QBGB 4JT4A 3IDQA 4OQNA 1E2QA 1G6HA 4PC1A 3QKSB 1XZQA 3EIQA 3AVPA 3TBKA 821PA 1DAHA 1JR3A 2JA1A 3CRMA 2BMJA 2P6NA 1LNZA 4TL9A 3SE0A 4PZZA 4MKGA 1XCMA 2ZR7A 2A5DA 3SJZA 4QXAA 3WBKA 4E22A 5K8LA 4OQLA 1FX0A 3VR1A 2NPFA 2OILA 5JJLA 2EW1A 4PHHA 1E9RA 3WRYC 3LVQE 2D62A 3B1YA 1E4VA 3NKVA 3ZGXA 2VF7A 4ARZA 5LD2C 5EE0A 3GEIA 2ZVQX 2A9KA 5DYGA 5DI3A 1H8EA 2ZI4A 4G01B 1ONBA 4MRRA 1NF3A 2BC9A 1TUEA 2V1XA 1ZW6A 3OF5A 3CUEF 3EZ2A 2YOHA 4DEYA 4HLQB 1BMFD 1ZBDA 1IONA 4B2IA 3B1WA 1K5DA 3THYA 4DLUA 3ADKA 5H68A 4UJ3A 4CF7A 1E4YA 4E5UA 2O52A 3QBVA 1ZNYA 2N46A 2R6FA 3KX2A 1LS1A 2F6RA 4K81B 1T4GA 3B2EA 4GNKA 4BLOA 1Z08A 4OK5A 2MSEB 2GA8A 1LY1A 1CJTC 3O8DA 3PCRB 2NO7A 2HF8A 2QE7D 4QRHA 5J4VA 1XP8A 4YMSA 1TPZA 1G7TA 4TTRA 4BFVA 1VG0B 1N6IA 1NG9A 221PA 1NLFA 1XPRA 2CE2X 3I72A 3TKLA 3O8BA 2CDNA 5JCPA 4DSTA 1J7KA 1OT3A 3WXMA 3R9IA 4OBEA 4A2QA 3ETLA 4P4TA 4WIAA 2GZDA 2J45A 4BRUA 2NZJA 4HUQB 3TMKA 1YZNA 2G0TA 4ACBA 1G5PA 3P4XA 4TQUS 4CGZA 1HE8B 2I1QA 2RB4A 5HR5A 5FBRB 3C15C 1EFRA 2BJVA 3B6EA 4PAOA 3WP0A 2NQ2C 3FMPB 3EX7C 4JL5A 5C1BA 3SN6A 4TLAA 4DCNA 2P6UA 2FF7A 4FI3C 4IDPA 2QPAA 3GLGE 4BPBA 1G18A 5FUWA 4C7OB 4O2LA 4YLGA 3NC0C 4E07A 4A0GA 1ZNXA 2O8EB 2RCNA 3UXMA 1LS6A 4M9QA 1GWNA 1KNXA 1M7HA 3M1IA 1NIPA 2G0NA 3KXKA 4JT2A 1MO6A 3TRFA 4AWXA 1FW6A 2ERXA 2NTYC 3GLGA 2VPPA 1ZIPA 3BE4A 1KI7A 1G5RA 4C9BA 1IOZA 2GZAA 4JL6A 2H5EA 1Z8FA 3WMEA 1KDPA 1FFHA 1II8A 1L4UA 3SZRA 1OFIA 4MA4A 4KVGA 2GNOA 4OHYA 2W0MA 2J0UB 2J7PD 3I32A 1OPXA 1KSGA 3KTAB 4ABYA 4LX0A 5GADl 1UJ2A 2QTVB 4P4SB 3BB1A 2W2VA 1XJCA 2G3YA 2ZS8A 1RYHA 3O47A 1H8HA 1R10A 3U3OA 4YMTA 1ZU5A 4OJQA 4DUGA 4ZDKA 1CRPA 4TL7A 2H18A 3IQXA 4DT1B 2W6JD 3GJ3A 4LC0A 2ASEA 2FFHA 4B3CA 1XX6A 1KJZA 1M6NA 1S0UA 2HCJB 3CF6R 3Q7QA 4IOKA 1RRCA 2O0JA 1P2TA 2GXUA 3HR7A 1M7GA 3MWLA 4B71A 2ZUCA 4HAXA 5JHGB 1NP6A 1YZGA 3SI7A 3GJ4A 4B6EA 2O8FB 1N5IA 5DSZA 4MKFA 1AN0A 1Z47A 3CF0A 1CR1A 5DO9A 1G41A 4TSFA 1LFDB 3DM9B 2WWHA 5H8WA 3CO5A 1G7CA 1N6PA 4TWZA 1PJRA 4PFSA 3C5HA 3JVVA 1XTJA 1J90A 4AK9A 3X1WA 1JAIA 5FTKA 4QGGA 4DWJA 3FVQA 1S1MA 2Q9AA 2ZR0A 3VMFA 4D0LB 4OI0A 2QZ4A 2GCNA 5BQ5A 1JEEA 3BOSA 4Z1MD 2WWYA 2MSDB 4KBFA 5FBVB 1TU3A 4M53A 5FUVA 3ZD6A 3E5HA 4F4IA 4HLUA 2GCPA 3K9LA 2GWHA 4B76A 2ZJ5A 2K5UA 1F3OA 3U7GA 1E9DA 2BMEA 4WZAE 3D6TB 2HLDD 2OV2A 2AKAB 1ZJ6A 1LF0A 5G53C 3RHFA 3U6BA 3DVLA 2AK2A 1E2HA 4MITA 3KUCA 3B5JA 5EE1A 4JL8A 1HT1E 2W00A 3BIFA 4JVLA 2PCLA 1RRGA 2O0KA 3KJGA 4QM7A 1PUJA 1COWD 2R62A 3GP8A 1GOTA 1Z6TA 2JIZA 1Z0AA 2G1KA 4OQMA 5TV2A 4B33A 3PV0A 1NVVQ 3I92A 3Q85A 2Z5FA 5KNBA 4PXAA 3SDZA 1VHLA 4KITB 4I1UA 4KI0A 3DOEA 2GEVA 2ZR9A 3FE2A 2LKDA 3QXHA 4RZXA 4BGDA 1E79A 3SJAA 5LPNA 1ZC3A 1Y63A 4I81A 1IN4A 3I5XA 1U8ZA 1Z6XA 4GT1A 2VEDA 3FDIA 1NL3A 2B7BA 3RS3A 3U61B 3BB4A 2J3EA 4YMUA 2EU8A 4A0RA 4JBXA 1IJEA 2IYUA 2ZI7A 3GD7A 3ASYA 1XXHE 2NZ8A 3L2OB 4IXNA 2NO1A 2Q9BA 3Q5DA 2FE4A 1TU4A 1Q1ZA 1UADA 5FI0B 2IS6A 1X1RA 4W5HA 1E1RA 2VLIA 2ZRPA 4B74A 2QQ0A 2REXB 5HCNA 721PA 1HURA 1Z5ZA 3OE7D 1KJYA 3Q9LA 4IHQA 1F2UA 4JLKA 4XIGS 2VA8A 4BLRA 2J87A 2XXAA 1CEEA 421PA 1U99A 2QQEA 5TXGA 1XXHA 4LK2A 1FP6A 4XD7D 2A5FA 5KSPA 3W3AA 3SQXA 2P2LA 4Q4JB 4EFNA 1T6NA 1DO2A 2N42A 3HWSA 3LBNA 4J0QA 5TARA 3AKDA 1VPLA 2R6GA 1N0WA 2BIFA 2QBYA 2IX3A 2VP9A 4MH0R 2VL7A 5P21A 2GJSA 2GJ8A 4DJTA 3FOZA 3AF2A 1E9AA 3OAAA 4KCGA 2L0XA 2XSZA 4BLQA 4EAQA 2BOVA 4IOLA 2JLXA 1NN3A 4YXWD 1W4AA 3BGWA 2ZE8A 1W4CA 2QROA 2QP3A 1J2JA 3LWNA 1X8KA 1YVDA 3PEUA 4EPYA 3RRMA 4BFTA 1X3SA 2IC5A 3Q72A 3PUXA 1I4LD 2O8DA 1G3RA 1E94E 3PITA 3OIWA 1KGDA 4B3GA 4AD8A 3K53A 1NVXQ 1UKYA 3ECCA 3T61A 2IYVA 2W6ID 3DMNA 4PO1A 4QNRA 1CTQA 4HAWA 1W0KD 3IBGA 1FP7A 2G88A 1DARA 1FPMA 2WJHA 1U8AA 1JR3D 3DM5A 2RGAA 5L3RA 1OH7A 4HZUA 3KXLA 4D4JA 2ZETA 3U3RA 4ZIRB 4ZPXA 4JJZA 3W6PA 2PL3A 5KDOA 3T5GA 3M4YA 4LY6A 4DLVA 4HATA 1SVKA 4OHWA 5JRZA 2NO9A 4AKEA 3QIAA 1VYVA 2OG2A 2FH5B 2ZI5A 4HYYA 4LHYA 1LVGA 1W2GA 5E7JA 3SNHA 3GLFE 4LPKA 1Z28A 4N0EA 1PV4A 3QVVA 1Z0IA 1UFQA 1KJWA 4BFYA 2F43B 3U3KA 3MD0A 1IHUA 2EWVA 5JWHA 4D26A 1KI9A 4KSBA 1E99A 1RC8A 1H8ED 3THXA 2BBOA 1ZD9A 4TMKA 2AL7A 4QHTA 3PEYA 3GLFA 1EWRA 1RIFA 5IRCD 2DWQA 3ADBA 3DOFA 2W83A 4FWIB 3IQWA 3MWKA 1II9A 4HB4A 4Q9KA 1E6CA 4BEBA 1ZM4A 3NEJA 1U90A 4LWZA 4Q19A 3QPWA 3SBDA 4XTCS 4LRWA 2G77B 4V03A 2VP5A 4ZI3A 3SYNA 1OYWA 1ETUA 1YKSA 3WRXC 2RAPA 3TVTA 1Z07A 2FSHA 1G5TA 1SQ5A 3BK7A 2XZOA 4M1OA 1TQDA 3MGCA 5EUMA 3R7WA 1DEKA 5LB4A 2PX0A 3TR0A 3GLHE 5JCZA 3MJRA 3PG5A 2V7QD 1KZGB 3H1TA 3S1AB 2NG1A 2LWIA 2CLSA 3DZ8A 2HYDA 1I2DA 1Z0KA 3LW8A 1RE0A 3THWB 5JJKA 5F9HA 4EJSB 2WIAA 1AJEA 4KYIB 1OXTA 4AURA 3NBYC 2JDIA 2A78A 2WWGA 3GLHA 5FL7A 4RD0A 1MO5A 3W5JA 1G8HA 1OXSC 1EG7A 1G3IA 3W34A 3IO5A 4KAXA 3AVXA 5CM8B 5K8UA 1QBKC 1V5WA 3JZAA 4PAMA 4TTPA 2F1HA 4BFUA 5SZIA 3TSZA 2CHQA 2ONKA 5FBWB 4A1FA 3KQHA 1MKYA 2DWOA 2F9MA 4TL6A 1OXXK 1X6VA 4DSNA 3PEVA 4H1UA 2H92A 2Q3MA 5AUPB 3AVYA 1U9IC 4TQ9A 4MGYR 3T15A 4TMWA 2FJUA 2FFBA 1QVRA 3K0FB 5AUOB 2PCJA 3X1YA 4FIDA 1S8FA 5E95A 1FZQA 2YINC 2GBLC 2ZU0C 4GSYA 5DI9A 2GKSA 5L3SB 5FOSA 3R9XA 1AQUA 3KQKA 2ZYUX 4LBVA 4TT3A 3U4QA 5C46F 1D2EA 5EP1A 3CX7A 1S96A 4ZCMA 2B92A 5IK2A 4CEIA 1OJLA 2ANCA 2F3TA 4KFUA 5JJIA 2FPLA 4CYMA 2H8KA 1UKZA 1P6XA 2DY1A 3BBPA 1KK1A 1QHHB 2X2FA 2O8CB 4FD2A 3R8CA 2HV8A 2CNWA 3ZQJA 3EPKA 2GETA 1TTTA 3ADCA 5FTNA 1WP9A 5CITA 4PHFA 1S4QA 4OKSA 2QGNA 1N25A 1XFAA 4GI7A 2DFLA 1QZXA 5JSZA 2BVNA 3WHLA 1TQ2A 1E2MA 3ONWA 1F48A 2CHVA 4Z8YA 4ZDWA 1RPZA 4JVNA 1MABA 1XRJA 4QBIA 3TNFA 2W2XA 3K0CC 1T3LA 1YR7A 2VH5R 3QF4B 4M1WA 4YDSA 3UG7A 2XAUA 1G4AE 4FCTA 4WBSA 2XJ4A 4MGZR 4Q9LA 3CX8A 2FOLA 2J5XA 1K5GA 2PEZA 1GKIA 1N6OA 1MH1A 4Z51A 1SZPA 2YWHA 4TSFD 1VTKA 3I5YA 2VRWA 4Q4HB 3AF3A 4S2EA 2A7QA 5H70A 2J7KA 4NHOA 2VP2A 1R5NA 5K8IA 3B1VA 1OKKA 5G41A 2C9OA 3AM1A 2DFNA 2O0HA 4PHGA 3TW8B 4DDUA 3N2EA 4NPHA 3NH9A 5KNCA 5KPDA 3NG1A 4F93B 1YE8A 1ZNZA 1Q1EA 4MUAA 3L82B 2JGNA 4BZPA 1LW7A 1UBEA 2AN9A 2ECKA 4IVPA 5DYIA 3FHOA 1CRQA 5B57C 1XEFA 4ZDIA 4Q4LA 2ZJZA 4AKGA 1DAKA 5CLLA 5HZKA 5LBIA 4JIMA 1ESMA 1GRNA 2IEZA 4LHWA 2FSFA 2Z0MA 1TF2A 3ND8A 2C98A 1LF5A 1SGWA 2V6IA 3P4YA 1ZUHA 3HPQA 4NYIQ 4A92A 2Z6VA 1NY5A 1YZKA 2XITA 3LBIA 3LD9A 4JLVA 4Q4AA 2BM0A 2P3SA 3ZDQA 3MRSA 1O3YA 4W7SA 5A5GA 2SHKA 4YDHB 1XMSA 2JIZD 2QNRA 2UKDA 3GLIE 1RRFA 1FMJA 2C03A 4LUCA 1ZINA 1N6RA 3MWJA 3U7EB 4URVR 2GF0A 4D80A 4ESHA 1NJGA 2VHQA 3QEOA 4KYUA 1Q1BA 1E3MA 3A4MA 4P33A 4NCKA 2NPIA 4TYYA 4HLDA 2FSIA 4PZLA 4XSGA 4LHVA 3BH0A 2WAYA 3GLIA 4OYHA 1U94A 2GCOA 2V55B 1P61B 3TVDA 2FWRA 1CJMA 2BBTA 4B44A 1XNJA 1SVSA 4DZZA 4HSEA 4KXFB 3SU8A 2O8BA 4NZYA 3X1XA 4RFVA 1IN7A 1GRRA 2KBFA 4HDOB 5AJVB 3PXGA 3SFZA 4UNPA 1CXZA 3ZIAA 1GAJA 4YC7A 3OEHD 2AHOA 1Z3IX 1KI4A 4OHXA 4BFSA 4Q1DA 4OQFA 4MRSA 1NVVR 5FI1B 1U0LA 2FG5A 2D7CA 2PT5A 4Q03A 3BFVA 1E1RD 2MMGA 1F2TB 1RRPA 1GKYA 2X19A 1E2FA 1MO3A 1KO1A 4A82A 3QKRB 3H0KA 1Z0FA 4FMDB 2G6BA 1US8A 2E87A 3LV8A 4Q01A 3TLXA 2JAQA 4A0HA 4G0NA 1ZMXA 1E2DA 2CEAA 2ZE6A 2RGDA 3E1SA 2XGJA 2WKQA 4B47A 4OI4A 4B6FA 2PZFA 5JWOA 2WJJA 2ZS9A 4L5BA 1X8LA 2P0EA 4Y0VA 1SVWA 2QAGC 3DMDA 5GJCA 4LBWA 4CEJB 1G1MA 1Q12A 4FINA 4PO8A 5FPSA 1S9HA 1YR6A 2CJWA 3RRNA 2QAGA 3NXSA 2WJYA 3CW2A 1WCV1 4Q7MB 4F91B 2IYWA 5EJEA 1NRJB 4LJ9A 2WVJA 4DHEA 4GMDA 1Q1QA 5G3ZA 4G5QA 2H7VA 1OB5A 2ZRKA 3FMOB 1W46A 1FL9A 4L16A 1N6NA 5EP4A 4LJ8A 4AI6A 3L8ZA 1I4TD 3TSWA 3W3ZB 1KI3A 2QUZA 2UZIR 5AJZA 1VCOA 3VKHA 2CK3A 4KU4A 2RGGA 2GXSA 3B8HA 4DLTA 1GIAA 2C04A 3D3QA 2IT1A 4O2RA 4A0FA 4CEHA 1E0AA 1WF3A 1MRSA 1DBSA 3NIBA 4B3XA 1G3UA 4JSTA 4G1UC 3OEED 1S2MA 4LHZA 2ZANA 5IDVA 3SEAA 3TE6A 5JLJA 3X2SA 2O8EA 4TMVA 1K8RA 1XEXB 4YONB 3TAHA 2JLWA 1B23P 2G9NA 1ZM3A 3VU9A 1S9DA 4ASUD 4JLNA 3SBEA 2QM7A 4O25A 5D3MA 4QHSA 5FUYA 1ZYUA 3ZVMA 2XZLA 1UBCA 2JJ1A 1VYUA 3RVBA 3T1QA 4UNNA 3K09A 3HU1A 3LW7A 4RFSA 4DLRA 1D2MA 1OSNA 2AD1A 3M6AA 1R2QA 2GVDC 4UNRA 4HAVA 2QMHA 2OLJA 4WXRA 4WVFA 5DGXA 2BKUA 3PFIA 2AWOA 2J0UA 2VHUA 1TQ4A 2V9PA 3MJHA 1GDDA 2ZI3A 1RKBA 1XTQA 1OIWA 4QNMA 2REOA 4BZXA 2FDCA 4MRVA 5FUXA 3ZJYA 4B3FX 5HE8A 1AZTA 3U44A 1G16A 3P32A 3V4FA 2F55A 3RYTC 4RZ3A 1VG8A 3CB4A 2WV9A 2IXGA 1PLLA 3TJZA 1QVAA 4JKIA 1SULA 1G291 2IUTA 2AK3A 5EUQB 1Q3TA 3LXRA 1AS0A 4L8GA 2WAXA 3T1VA 4QBFA 4BLPA 2CHGA 2QA5A 1GZSA 5E7IA 1ZNWA 2A5YB 4Q5IA 1XJQA 2JDID 1QHXA 4X8OA 3IILA 3FTQA 1AA9A 2WKPA 1ZRHA 2ORIA 3CF2A 1UF9A 2FZLA 4LYFA 3UMRA 1HUQA 1Q21A 2H17A 2QMOA 2QGZA 4XVRA 3ZH9B 1T5LA 2I1VB 4LYJA 1Z2AA 1P2SA 1R8QA 3E2IA 3WMGA 5BYKA 3K0SA 2BCJQ 3NEYA 2ZRCA 4MYUA 1GITA 2A30A 1GL9B 3AP3A 3T34A 4CRWB 4DDVA 1W1WA 2C9YA 3OIVA 1QHYA 4Q7KA 2XOKA 1FX0B 4IJMA 2ZI9A 4M2LA 1E32A 2BBSA 2P65A 4N1AA 1MO4A 4U02A 1UPTA 2X1VA 4NYMQ 4BLSA 2OCBA 2ZVPX 4LCBA 1A82A 1KSJA 1T8TA 1Z83A 4EUNA 2H57A 4B3DA 1XMIA 3BD9A 4ARZB 1XDBA 1KMHB 4TQAA 2R6AA 1CKEA 1NN5A 1JNYA 5DI3B 2WHXA 3MMPA 4ON9A 3OESA 3I8SA 5LD2B 1IY2A 3NWJA 4EPXA 2FFQA 3HR8A 2HXSA 1Q57A 1NY6A 2WJGA 3LFUA 3ZD7A 1SXJE 3AEZA 3AP2A 2GAAA 1WMSA 2LCFA 4PQRA 5FR1A 4BRWA 4JBYA 4R7ZA 1KKMA 2ONJA 1DAFA 3QNUA 4IVRA 3KKPA 3PEWA 1E0KA 5FH9A 2ZJ8A 5KDDA 3THYB 4XWAA 1SXJC 1ZUNB 1X86B 4PO9A 3A4LA 1SVOA 1D5CA 1JB1A 2ODBA 2ZAOA 3IGFA 3SJBA 4PX9A 1X1SA 1SXJA 1W4BA 3EG5A 2YOGA 3TR5A 2RGEA 1R0XA 4ZDJA 2PMDA 2FPMA 3ZVLA 1DAGA 2V8OA 4B48A 4Q1EA 1XEWY 1R0YA 3LRPA 4WAUA 3PJRA 3AQ4A 1YHNA 2FA9A 4C30A 2WWWA 1GRQA 2AFIE 4EPRA 2WOJA 5FR2A 1MRNA 4PC6A 4JS0A 1JI0A 3B9QA 1XTIA 4URXR 1RW4A 3CKLA 1BYUA 1UEJA 3IUYA 1ZC4A 2NIPA 1GILA 4AKIA 5JEDA 1A4RA 2JJ8A 3DL0A 5HCIA 1Z0DA 2F9LA 2QSYA 2QRNA 4HLUC 4A8JA 3THOA 2VF8A 2GJKA 1OKKD 1YR9A 1XJ0A 3WP1B 2FGKA 4CW7A 3WNBA 3AF4A 4B75A 1D8TA 3MG9A 2ZRNA 4I1OA 3X1DA 2DBYA 2AR7A 4EIWA 3W6OA 4P31A 4LJYA 2DPXA 1KY3A 1TF5A 2CL6X 3A1TA 4XWOA 4ZCLA 1UDXA 3BH7A 3IHWA 1AKYA 4Q1CA 1SVMA 1UM8A 4RCYA 5KSOA 4US1R 4B43A 4HAUA 4IEEA 5AJWA 3CWZA 2BKEA 3KFVA 1SKYE 4EFMA 3OHMA 5DN6D 5J4HA 3KJHA 3AGPA 4A6PA 2OCYC 3EWSA 1DPFA 1G21E 3EZ6A 1CULC 2OE2A 3NH6A 3GLGB 4IDHA 4JBWA 4Q66C 2DCUA 3LX8A 2OUKA 3OFNA 3EXAA 4OK6A 3ZZ0A 2ZIAA 1II8B 1W0JD 3K70C 3OZXA 1P60A 1P9NA 1KOFA 2C96A 3K8YA 1SVIA 3TUZC 4C0SA 2OCPA 2BM1A 4JJKA 1H65A 2QT0A 1OH8A 1AS2A 5F3WB 1VG9B 3FMFA 2GK7A 2GF9A 1FQJA 3EZ9A 2GAOA 3RS2A 4C0QC 3ZQ6A 2CL0X 3I62A 5KPJA 1BOFA 1KI1A 1P2VA 1FUKA 4I1SA 4TZ6A 3CONA 1P72A 3DDCA 5J4KA 5C2JB 4NYIR 3AF1A 1VMAA 2GILA 1CR4A 1GP2A 4PC3A 1T3SA 4QGFA 2WSSD 4YMVA 5CB8A 1P9WA 4TMXA 3DZDA 2EVWX 3CX6A 4BEJA 2A5GA 3F3YA 2ZJBA 1HA3A 4HUTA 3QJYA 2V6JA 3VR3A 1HV8A 1NIJA 1TQ6A 2MSCB 4FMCB 3TIFA 4M0LA 3CNOA 4F38A 2F43A 3LAWA 3U5ZB 2EFGA 4JVMA 4LV8B 1IN8A 3EIHA 3K9NA 4O3MA 2YC2C 1E2GA 2QPTA 3KZ1E 4OJKA 2ATVA 3MSXA 3A58B 1WB9A 3GEHA 3V4RA 1N0VC 4YQFA 3G82C 4G3XA 2CCKA 4RD2A 4M1YA 3BB3A 4LOAA 1RVDA 2PX3A 1Q20A 3N5CA 4CVNA 3VQTA 1GFIA 4HEJA 3SHWA 2QG6A 4I1VA 4JLPA 4TMZA 1W5TA 4M9ZA 1QRAA 3PR1A 1NBME 5JFGA 4ZV4A 3GJ5A 5HZHA 3WYGA 1ELOA 3A1WA 2ZREA 3CR8A 1W47A 3SYKA
chains in the Genus database with same CATH superfamily
2ZSBA 2ZPTX 3K6RA 2HSWA 3NJRA 2PS1A 1P0MA 4AX4A 1TM1E 1VPVA 3PCXA 4HPJB 3H2BA 1BDMA 1MO2A 1NBMA 2C5LA 2J3HA 1KJ8A 4RXUA 3WHKA 5K4GA 3IEXA 4M8IA 5CP8A 1YVUA 3THWA 1ZKDA 3L9XA 1PHPA 5DHTA 4EJSA 2XDAA 3RTAA 3P20A 2FJPA 5TF0A 3UMBA 4YT8A 4P86A 1E9FA 1O89A 4A9AA 1GU0A 1QHNA 2YVUA 4U7PB 2B7CA 4EI9A 2IDJA 3WSTA 3ZYZA 5BXQC 4V0OA 4KIWA 9GPBA 1KVRA 4JLOA 2WR8A 2D1RA 1LRKA 4W9RA 3WWZA 1G2PA 4G24A 2ZT5A 2MYNA 3L8MA 2ZRIA 4L3OA 3H9QA 3N0RA 4NU0A 3OZCA 1TF7A 5EXPA 4AF7A 1BVRA 4DLLA 4M1MA 5J1TB 4TRMA 5JZVA 4M49A 2CMKA 1UZNA 4TKUA 5FFFA 1II0A 4LRUA 3VR6H 3VZRA 5DW3A 2ZR8A 3R0QA 4L4RA 3R5JA 1X7XB 4N3NA 2IUUA 3LCVB 5FWXB 1Q0PA 2VDLB 4NH0A 3O9ZA 2NZYA 3KVOA 1LQ2A 3DBHA 3TW4A 1QQTA 9LDBA 3HCNA 4OQ4A 3G5TA 5KREA 1XD2A 4KGDA 1J56A 2NTNA 3SKVA 3V1YA 5AW2A 3HKEB 4QM6A 2OO7A 5C7OO 3EZFA 3TOXA 5BNIA 4CLRB 1EFVB 1UAGA 3C6QA 4H18A 4JSYA 4YRFA 1MB9A 2AKYA 5HM6A 4FEGA 2CLCX 3PZRA 1M8PA 4E6EA 4C03A 2C7GA 3MJVA 5FA6A 1H42A 2WZQA 2FETA 3WQHA 1T35A 4C05A 4HWGA 2HA2A 4QZVA 4EQ6A 4ND7A 1JJVA 3SD7A 2BISA 4WCFC 1X0XA 5IAEA 3LQRA 3QKUA 1K7CA 3OOHA 5A6SB 3O8LA 4NMMA 3PNOA 1EP2B 1N34B 2AMYA 1TYDE 3HVRA 1FF9A 3I52A 4RGBA 3PNLA 2QTHA 3H19A 4JC4A 2YQZA 4RANA 5KQGA 1NP7A 1CJKC 3V8PA 4DLYA 4FBMA 4DV0B 1N3BA 2XUHA 1DLIA 4FK8A 4TL8A 2Z6AA 5LMUB 4R98A 4TXNA 1IOLA 3TRHA 4ABTA 1RYEA 1L5RA 3NQ41 4PLFA 3T9BA 2VP6A 2W6OA 1PZNA 1UT8A 3FXAA 1CEQA 1PNRA 1KETA 4KGXA 1XF1A 4AJJA 3JU3A 4CM4B 3KJEA 2FKNA 2GDJA 4XQGA 1N2BA 1NN0A 1QR6A 5KWEA 1F60A 1DSSG 1MJ5A 3RO7A 2JHCA 4KVFA 5SYAA 3DMTC 4IIUA 4X6YA 4UD6A 4JZYA 2VSOA 4GP7A 5H59A 2VIIA 4DA0A 3FWNA 1I6LA 1E3WA 1U2GA 1WDMA 4MIOA 4RZIA 1HRKA 1F7VA 2B8TA 2LUOA 3N05A 2HPHA 4HYEA 1E3TA 4KNWA 1HEIA 1ORDA 3CUVA 3HL0A 1ULZA 1GZVA 4KAAA 4ENUA 5DNUA 1QHIA 2PQ0A 1TE2A 3H3JA 3L1HA 3LH5A 4U7TB 3MRVA 5HM8A 1A9QA 2H00A 4B4KA 1QGOA 1W94A 1K98A 3GVPA 3SSOA 1CZHA 1KJNA 2NT4A 3DWIA 1J8VA 3HBNA 5JI2E 5JZSA 5FHQA 2XUFA 3PX2A 3O92A 2O3JA 3WXBA 3B89A 4PPQA 2XOKD 5JV5A 1L6RA 3R8FA 1ZJWA 3AEYA 1V5FA 2P30A 1O54A 1USUA 5G0UA 3FOWA 4ZJUA 4H3VA 1TJ3A 1BNCA 3OZDA 3PJGA 4IIXA 5DX8A 2COUA 4Q48A 4GZLA 4DR1B 4QAJA 5H4HA 1IB0A 1WDLA 4R2HA 3W8EA 4D9JA 2GPSA 3UWMA 3L7MA 1TLFA 3BHIA 3EGCA 1A7JA 1ABFA 1DAMA 2QY9A 3WK9A 1CFJA 1G1AA 2A14A 4I55F 4IIJF 5DHFA 2NO4A 4PGMA 5DP2A 4B87A 1AKRA 4QGHA 3CNLA 4TV9F 2FRDC 1N6LA 2QD2A 1O6GA 4S1WA 1PFYA 4CLDA 3GIDA 1S89A 3ZY6A 1NBAA 2PUFA 3HLYA 5L40A 4Q9AA 2DX7A 4AO7A 1O95A 1UFKA 2FMFA 4RSMA 1VXRA 4TSKA 1SK8A 4GI1A 5AJHA 4YRNA 3KQLA 1AB6A 1KJ9A 1HSOA 1CVRA 1AK2A 1BX3A 3IVCA 3WLMA 5A9SB 1CEYA 3EEOA 3RTGA 3WYDA 1YZUA 2FHSA 3ANXA 4K2HA 4M9XA 5HDQA 4M9RA 4EB0A 5KTTA 1JU4A 1VE5A 3KDSE 3B6MA 2VT3A 1ILEA 2R7KA 5CA1B 3PR3A 3MILA 3Q3CA 4US2R 3FDZA 2IGBA 1AVTA 3V4VB 4RK5A 1U8CB 2NN3C 4BNKA 3LP8A 1DC4A 4HH3C 4UPEA 3X43A 1SPBS 1FFDA 3RYHB 5KYYA 4PPNA 2P4UA 3PQ7A 4PYQA 4ZK2A 4GYJA 3QFHA 5AXDA 1OZGA 3P9KA 2X5XA 3HXPA 1JTEA 4KWEA 4MJXA 4Y67A 4PG7A 1VZ3A 3AWIA 1RJGA 1XNRB 1JI3A 4F3RA 1XSEA 1D4ZA 4MKIA 4B17A 2VNHA 4XLTA 1MJGA 4CCWA 5L7TA 1I6WA 1ZISA 3ANTA 3T1YB 1NUQA 2HT6A 2IX9A 3NYIA 2QTWB 3ANNA 4I4CA 1YO6A 1CUIA 2GK6A 2LGJA 3FFAA 3LGXA 4OFXA 4Q3BA 1FYFA 2ZAMA 4L2IB 1ZU4A 1C80A 5KC8A 1NW3A 2ZXUA 1NXWA 1Q0SA 3VR2A 4L08A 2GN4A 3ZV7A 2IYAA 5HS6A 4PPGA 1RT9A 1KOJA 1YRBA 1U8UA 3UENA 4QYWA 3V1NA 3ZGVA 1ZGZA 2NLOA 3BXOA 3JQ9C 3OKCA 3QUCA 1FFXA 2BI8A 2AMFA 3E81A 2G40A 4YX9A 4BVAA 4I99A 4L02A 2C2MA 1QZUA 3LOUA 2XDQA 3EAQA 2QRPA 2YOFA 4M0EA 3H4IA 4XYBA 2G7MC 4MLDA 5LLTA 4F72A 4RTMA 2OHVA 2DHEA 3C0KA 4B81A 4KQXA 5T8KC 2DR3A 2UZ0A 3P71T 4NABA 4ZN6A 4NATA 1W85B 2Y9MB 1JPUA 2R5NA 3C8ZA 4V0NA 2PJRA 4DZRA 1M0EA 3RKRA 1Z2CA 4Q00A 1I2BA 4MPRA 4DY6A 4KR3A 2QMZA 2X8BA 5A5EA 5KNBD 4MVYA 3V6MA 4V1CA 2WPDA 2GEKA 3BKXA 3DA8A 4JC5A 2AZDA 4K9SA 2BEVB 1SY7A 4IHKA 5D00A 3TGPA 3MQ2A 1OLXA 4TMTA 4CI9A 5K9ZA 3CXUA 3CINA 2KJQA 4IQ0A 4AY2A 4PPYA 3LCUA 1Y3CE 1ZVJA 1XRRA 1ZL0A 3K1YA 3M6LA 4I14A 2WEKA 5CYOA 5IF3A 5L3QB 3SX0A 2WUVA 3VUFA 4I1PA 1E5QA 4WOPA 4HNVA 1V9CA 2E4UA 4G37A 3OLVA 4WI1A 5K0ZA 4GP6A 1NVGA 3N7AA 3UT6A 2VUUA 3GEPA 1XQ1A 3Q5EA 4DIBA 1DXHA 1G4HA 5AI9A 4G4SP 5K7SA 3CZCA 4K2AA 1ZP6A 4RHFA 4PRKA 1JXOA 1EG2A 2D74A 1TO1E 4NCXA 4NL4H 4DRXB 5MDHA 1QDLB 2QRVA 1RADA 3KB2A 1F8XA 1LJUA 4EJ0A 4AN1A 1RFLA 4KLNA 3NTVA 5T4EA 1E2NA 4FS8A 1C7FA 1W44A 3HACA 2A1TS 4LCJA 2I6UA 3I1FA 4Y2SA 2FDRA 2O7VA 1K4MA 5KOHB 2ETXA 1P3JA 3TSAA 4K6KA 4GRAA 3SQDA 4FKZA 2G09A 4HN2A 1JJFA 2HPZA 4QHYA 4CKYA 1TZMA 2EZ4A 2FPXA 4XE5A 2XCRB 4NKRA 2DRIA 2IS2A 2XUOA 1U7DA 3AQIA 1OH5A 1Z6YA 3GJ7A 3OF3A 1TB4A 3OE7A 1TAUA 3TDKA 1VYTA 2OFWA 1V8DA 3DDNA 4RSHA 3X1ZA 1G9XA 3R6LA 2Z8XA 1KJJA 1SC9A 2W58A 1YBHA 4WJKB 5LZ9A 2AKEA 1QU2A 2JFFA 1NVKA 3AVQA 3KIPA 2WJAA 2V98A 3D3KA 3GCGA 3E0XA 3VC1A 5HJ5A 3HA2A 4L5IA 5DU2A 4KBYA 1RAGA 4FKMA 3JQDA 1L5YA 2HIMA 1F9EA 1DUIA 3AXTA 3B51X 1W48A 3DKVA 5EMHA 2XSZD 1KK2A 1OA1A 5IVKA 5KINB 2JJQA 3I5AA 1FJGB 1WCWA 3WWDA 3D7RA 4Y7DA 5HCUA 3A9TA 4D0NA 1KO4A 1ZUD1 4DVJA 5KOIA 3T3NA 2IITA 1HT0A 2QX8A 4DCVA 3K5PA 5COAA 4ZV7A 3OZUA 2AH5A 1RXSA 2CHEA 4YRQA 3WI7A 1KMQA 5JAQA 1E5DA 4B34A 5KQPA 1XZHA 3C5EA 3SJCA 1Z63A 3GVHA 3F5DA 5EYPB 3UOGA 1HKHA 1WEKA 2KWIA 1X15A 4D42A 1CUJA 3HV2A 3BFKA 1R27A 2HKIA 2FHPA 1VLJA 4M7WA 5LQNA 1YDMA 1ULAA 2ON6A 4BMVA 1JEYA 4K8RB 3NDBB 5TNXA 1NSYA 4NEQA 3QXXA 3O84A 2AA3A 4QEDA 2BTOA 2Y1DA 3ETJA 2ZI6A 3I04A 3LXXA 4L3WA 1OFVA 4MV7A 1KO7A 4UUBA 1Z29A 1P73A 1S7GA 1IM8A 1BXRA 3K92A 5T7BA 4X3CA 3V1UA 5B3LA 4O2AB 1T4DA 4Q4DA 2W6IA 4RLQA 3ZBUA 4C7OA 5DKFA 5JRDS 4DJEC 4O2BB 3V1TC 4Z3OA 1X3LA 4C0HA 5ECGC 3AIOA 1P9LA 3KQOA 1C3LA 2AG1A 1FYEA 2QRKA 3I01M 3R3WA 1M0WA 2IL1A 3SY8A 1JRLA 1NZJA 2VJCA 3N2IA 4HWTA 3LPMA 1J09A 4I5GA 2JIPA 2SECE 3VNUA 2GCOB 2VTKA 3EGDA 3CE6A 2HBQA 3AUFA 3AZQA 4YFVA 1KVUA 3URKA 3J81k 2B1QA 3UW3A 5DMXA 2R8PA 2RJOA 1IY1A 2AXNA 2OXRA 3NAGA 1PLKA 4FQ5A 4IG9A 4RHUA 2B7LA 4PNZA 3JZIA 1RYBA 2J3QA 4HDMB 2WFMA 1TNDA 1DKQA 2WSIA 1IN5A 5A3QA 5JFTA 1XMPA 2C31A 4TKZA 2PBFA 3H9JA 5JTUA 3RS4A 1ORVA 4UCXA 1FSFA 2FQWA 1VIYA 1C9DB 2BMVA 2FZVA 4V0RA 1CZLA 3JQ8B 3TTTA 3K4QA 4A6XA 3KTAA 5B1EA 1QDUA 2GKGA 2PUVA 5SZHB 3WQBA 1ENOA 2E1RA 1G5HA 4P4SA 3EIFA 4HWKA 1MUUA 1PVDA 1ADBA 3W05A 3RUFA 1JDUA 2XADA 3D43A 3FD8A 2I9PA 2RONA 5TQ2A 3T0IA 4OATA 1ZGCA 3OIGA 5TMBA 4C6RA 3DC2A 3PNVA 5L45A 1Z4PX 3HNOA 3A2KA 1TLTA 3ZXSA 1DCMA 4Z4FA 4FYYA 2QZPA 4J7XA 3B60A 1P1FA 5F4BA 1WBDA 1J06A 1M54A 2ZYVX 3OHSX 3U1BA 3SE7A 1T2FA 1N5KA 1OQAA 4URYR 2DPHA 4JC0A 3WX0A 5KUTA 3LC2O 1A9SA 3NBXX 3CBQA 4FE3A 1PZGA 4K9LA 3ZK8A 2Q21A 1HT2E 5HKAA 4CJXA 1M2OB 4RELA 1SVLA 1N2OA 2QAGB 1WLYA 2Z95A 1VKOA 3O21A 1I2AA 4B2YA 1Z4IA 3EPJA 4YR9A 4Z53A 2CE7A 2R6DA 5AVTA 3TTYA 3GPLA 2YR0A 1XD8A 2YMPA 3CLVA 2FZCA 2J4CA 3EVGA 1JJBA 1JFLA 2MMCA 1REQA 4IJWA 6ADHA 4NNOA 2X4IA 3O1IC 3HCBA 2JFGA 3HXLA 1DG9A 3H83A 5FDFA 4RJJA 1NKSA 2F1IA 3DBLB 3FUUA 5GAJA 3U81A 1D6NA 5BUZA 1SVNA 3SC2A 2GXAA 3QVTA 1GRCA 4GLFA 4F3KA 1M1YB 4LK3A 3TF5A 2XUJA 3DVRX 1NONA 4G5RA 2IPMA 2Q9CA 4XUEA 2I76A 5CYPA 4CLHA 1XDDA 4OLFA 1USIA 1ZIDA 2IOHA 1PHRA 1SUBA 1XO1A 4DWWA 2VZ0A 1D8AA 1EGQA 1UJCA 3NBZC 1M6EX 3RRZA 1QKKA 5KHOC 3LTNC 3CNQS 4CEHB 3M6UA 2Q5LA 4Y1RB 4JP3A 1ACJA 1U2RA 2VNKA 2Q6VA 4NP6A 2YC4C 4EDFA 1O08A 1WD5A 1K92A 1N1GA 3C3EA 4FLMA 1MF7A 4E21A 4KQ1A 3ETHA 4R9VA 2FPWA 3G9XA 5E4FA 5E4YA 4PNPA 5K20A 2VHJA 1N33B 4AMBA 2C3YA 3MBIA 4Q7LA 4CKBA 2UXBB 1MVLA 4ZQHA 1Z18A 5FOUA 3R44A 1JEDA 5A5FA 3DEHA 2XRFA 3UAZA 3GGDA 4RHYA 5I7VA 2XWPA 2LKCA 2Q6LA 4G9GA 4JYCA 4XFJA 4L95C 3Q1KA 5JARA 2IYQA 1AGPA 2H3HA 1VHJA 1G0NA 1OA0A 2P75A 1X1AA 1UC9A 5C5DA 1J8DA 4MW0A 5CLHA 1MFPA 5TQVA 4H0NA 3G68A 1OIXA 4DCOA 1W2HA 1RACA 2CNWD 1BFUA 1NUAA 4IQ8A 4AWBA 4FFBA 4K6MA 3RAPR 3NDPA 1GQOA 3SS7X 1ZJ4A 3NVKI 1PK8A 1CRWG 3ETDA 4QJ4A 2E37A 3HNRA 3INGA 3A9VA 2YZ2A 1EP9A 3GLKA 2YDXA 3DV0A 3HMQA 4M0CA 2I66A 4QG7A 2WABA 4BQSA 4EY7A 1SC3A 3SSMA 3ZQUA 4WA7A 4TXHA 5CAEA 1MAVA 2ZUBA 4K05A 4CT4B 3ESDA 1WSWA 2HNKA 2XLCA 2P9JA 2D4AA 2EKPA 1Z16A 2R00A 3I3SR 4OMUA 1I6KA 2EP5A 3C70A 4ZVPA 4OI1A 5BRAA 2X9GA 1PLJA 3FPHA 4KXNA 4L15A 2QT1A 2VT2A 5LBTA 1JVBA 4M9UA 5IUKC 1R4AA 2BWJA 2ZFUA 3PUZA 1PEKE 4PS0A 4YB8A 4EKEA 4A8JC 4GM0A 3R41A 1GPAA 3L06A 3N2KA 2D3TA 3EW7A 2C7PA 2DB3A 2IZZA 1YJCA 3R7LA 1A77A 3BM5A 2QVLA 4EJMA 3NC4A 2ZYIA 2H3EA 4U2EA 5AD1A 4GC5A 1FFEA 4GPEA 4J91A 4U00A 4X94A 5CK4A 3HJGA 1PR2A 3KT6A 1EPUA 1BDJA 3LA8A 1BWSA 4G5HA 4NU6A 1FOEB 5NULA 1D2AA 1R0ZA 3IV7A 4LWPA 1MAUA 1GRVA 1QG2A 1SUWA 3INTA 3L5KA 4IFBA 3EG9B 4C2BA 5J4YA 3WGIA 3FWZA 4DIMA 3K9CA 3HO6A 1JYEA 2HJRA 3OPQA 4FW8A 1E4EA 1GXSA 1X1CA 2Q5OA 2IHBA 4PVDA 1OXUA 3AYZB 2PRIA 2Q7OE 1Z25A 2JLSA 1E9SA 3B3QA 7YASA 5HPYB 2ZCJA 3IEUA 5ALDA 3BL5A 1KARA 1THTA 2C92A 5AW5A 3DE3X 5ELXA 1GVNB 5DX0A 4KKXB 1T1EA 4OFZA 4N8EA 1L9KA 5JTTA 5IH7A 3DAGA 2O2JA 1GNTA 3CVVA 5KTYA 3S8MA 1OOEA 2P5YA 4HX9A 2VCHA 4PM4A 1IHDA 3PJEA 2VJKA 3VKGA 1FP1D 2V0NA 3OOJA 4EA6A 1GFZA 2VRNA 1QYWA 3GFQA 3EA0A 4HMPA 4C07A 1TEXA 2XCQA 1IQ0A 1R00A 4AULA 4C43A 2FV8A 1R8JA 1GN9A 3ZQKA 1TA9A 1NSTA 1O0BA 4REQB 5ENVA 1B74A 1FRVA 4MROA 2XNDD 4PLHA 1KR5A 5BSWA 5K3EA 3OQOA 4G56A 3DD1A 1PGPA 3LWDA 3IE0A 3P97A 3EBPA 2C99A 1NBOA 3MWDB 2Z3ZA 6AT1A 4E7OA 4QT4A 3ZWQA 2CXQA 2WP0A 4NICA 1WDKA 2D5IA 4E03A 1C3OB 1KSFX 4HZGA 3U4HA 2P9QA 3O1JC 1QOQB 1WTAA 3A9WA 4X1IA 1KRWA 3L0CA 3NHFA 3H2GA 3JSAA 4NBSA 2HCBA 4XOIA 2XW6A 1U2ZA 3H9BA 3WLRA 4JI4B 1FJ2A 3DCIA 5KTNA 2O5VA 4C4RA 3U60B 4PSUA 1ZAYA 4KO2S 2MSKA 3H4VA 4W8GA 1A9ZA 2LRHA 2PVSA 4TT8A 4L0CA 5BV1A 4KR6A 2XIQA 4O4JF 2IH2A 3ZWOA 1AZSC 3FKSD 2XMDA 4HFRA 5KVSA 1CJUC 4QDUA 4X41A 4EB8A 5C1PA 3UG6A 1N5MA 1X7XA 2HMAA 5FWXA 1E96A 4FT2A 5KYUB 2AOUA 3NOXA 2HA0A 2K2QB 3SZLA 2C59A 3RE1A 1TIKA 2IY9A 2WT9A 5D3KA 1JDPA 4ZGBA 3FUVA 1L4MA 1Y48E 2IUYA 1N9ZA 2GYVA 4ME6A 4V3CA 3G8AA 2WAOA 3D5TA 4M0UA 5H9VA 4O1IA 2RIPA 2VQDA 1EXDA 2D7DA 3HKEA 4B09A 3N0VA 4OHZA 5HKBA 4IOJA 3OEHA 1UP4A 3FYCA 3IJ5A 4KGZA 3DDZX 4ALIA 2P5SA 3PFNA 5F2EA 3G5AA 5FPYA 1FNCA 4ZCQA 4ECAA 2X3FA 5K05A 1L8QA 4J1TA 5ADHA 3P0HA 4D9GA 4RLHA 3OE5A 2WJ3A 4A8JB 2H1LA 4RSRA 2JIOA 4P5EA 5L4LA 3X1MA 4DQDA 3LHFA 4K9KA 4RSGA 2C8JA 1OLUA 4O33A 4UBLA 4BTEA 1M8FA 3PNKA 4P7FA 3EQ2A 1VE7A 3U5TA 2A33A 1N1DA 2H54A 1JLSA 5H9WA 5ILGA 1LK5A 1XZPA 3DQZA 2B35A 2BJWA 4JASB 1IBLB 3UWKA 2I3DA 1EXVA 1P0IA 4Q18A 2VHVA 4KLZA 5TMPA 2J6CA 3L7YA 3AJEA 4HQRA 3OQMA 1GT6A 1Y9AA 4BDSA 4HGQA 1D7AA 1ZA2A 4Y2RA 2AW3A 2P1ZA 4AZTA 2Y3IA 1QV9A 2F7SA 3OJXA 3L6CA 1U2DC 4MV3A 1GL7A 2PFSA 1BMDA 1SHZA 1HETA 5A4AA 4MVJH 5KJEA 4CM4A 5IN4A 4D82A 3C3CA 2EDAA 4OL0A 3BWBA 5FJIA 4E4YA 4ZT3A 3D1VA 4XOUA 3UUGA 4EK9A 1G9SA 1NVBA 3ZWBA 2CK3D 5ELLA 2FAXA 2VQSA 2YKGA 4RA6B 1MZPA 2KMLA 3V42A 1I1HA 1D6MA 1V7QA 4C04A 3T3OA 1F5NA 2VJMA 5TC4A 4EG7A 4KRXA 2P2GA 1P6QA 2ZIZA 1Q0UA 2Z4TA 3K5IA 4OB8A 5C4MA 3KQUA 2EG5A 3C3PA 1I3LA 1MQSA 3GI1A 4JEUA 4LPSA 1X80B 4IDQA 4UXJA 4Z2YA 1C3XA 3OIUA 4OA8A 1XLUA 3DNPA 4H6WA 2OKCA 3CZQA 3O74A 3DZHA 5FOXA 4BBZA 3IQEA 3LUFA 2GZHA 1GZUA 2RBGA 4ZC8A 5IM4A 4JLJA 3B85A 1NOJA 2JLZA 1WAMA 3OIYA 4QUGA 3KD2A 5BV0A 5E6UA 2AMVA 3NEPX 2XUPA 1PF7E 2VC2B 3WLEA 1A9PA 1TEHA 1K5HA 3KUUA 5FF9A 2K87A 2RGNC 2X2EA 3T95A 1B0AA 2EBWA 4KE7A 5JZOA 5LDDC 4OHPA 5FLEX 1C81A 1JLHA 3WLSA 1EHCA 2WP8J 4QEKA 4E5VA 4X8HA 4QG3A 3GN1A 4E15A 2RAUA 5F7XA 1FMFA 4L5JA 4ASUA 3K1JA 3C1UA 2GZ3A 4HGPA 4M7RA 1GU7A 4M83A 1EQAA 3RR2A 4CN8A 4R9SA 2XXAB 1Q3HA 1T9CA 2ZDQA 3G7NA 4XVUA 5LUBA 1PDWA 3X0DA 1ESNA 1D9ZA 1V95A 2KLBA 1FU4A 1SD5A 5CFMA 1SOWA 1TUGA 1Y3AA 1QZZA 4D0SA 3USES 4O1HA 2FR8A 3DQQA 3KHTA 2FOXA 3CVWA 3SC6A 3IKJA 2FRVA 2QBYB 3IR6A 4BY9E 1TEVA 2LE0A 2ASVA 2NU7A 2BF4A 1QGED 4PZYA 4MKXA 4ND1A 1V25A 3W8RA 3QUBA 3GX1A 4GPZA 4KMOA 2UXDB 4TYNA 4F12A 4YXFA 3A37A 3N74A 1JHRA 1Y6RA 5JCOA 5AKXA 2ZBPA 2QY6A 2X77A 1E2JA 3JYOA 4F06A 2LBPA 1NATA 5IYZB 3U3XA 4JLAA 3WLPA 4C3ZA 1QG4A 3QITA 4IH4A 6Q21A 2AQHA 3I6ZA 3M1YA 3VR4A 5J58A 3TYXA 2QZ9A 1T9GS 1ANKA 1XCPA 2OPBA 1D6SA 1Y3FE 1QJ4A 3R24A 4JQYA 4L9SA 4MXDA 4X7BA 1BJKA 1RKQA 1UBNA 1M0SA 4XSHA 4ZARA 3LE8A 1KDZA 2I1WA 2GAJA 4Q4HA 4WKOA 3OQHA 4LV6A 4DM3A 5BNZA 5BQPA 1CF4A 4XIFA 4NBKA 3RYHA 1SBZA 3ZHTA 4NC9A 1UBJS 3MF4A 1DJLA 1PYDA 1FDUA 1UZLA 2JAWA 5J2UA 4C2TA 1W36B 4CODB 1QRDA 2P9GA 2ZSDA 3TW0A 3N2ZB 2PT6A 4IDAA 1DOAA 2OD9A 3A4NA 2NVOA 2POQX 2VYFA 5LP6F 2XMRA 1J2EA 1H2HA 1P4HA 5B4TA 3E22B 2OBNA 4D0RA 4CETA 1KH1A 3MBKA 5C9ZA 2UZ1A 4QWWA 4X65B 4UHDA 1YA8A 1VMEA 4TZTA 1E3QA 4YAFA 4A2WA 2AEFA 3G85A 4HBZA 2WWIA 4RXTA 4XZ3A 5K99A 5EFOA 3GJ6A 3W06A 4E2YA 3Q3HA 4K6HA 4MVJG 1N5RA 1G20A 3ZKWB 2R6HA 4DDHA 2FSSA 1FP2A 3CLSD 3CW8X 3PLAE 1Z4JA 3MC1A 4C4PA 5IKEA 4YRPA 4Z0PA 1WCIB 2WKRA 5J1SB 2I8CA 3WV5A 2Z5LA 5DTEA 2BUCA 5LWHA 3L04A 1JQJC 1H6AA 2I2XB 3GLFB 3D4LA 2V4MA 1U6KA 4LVUA 2RKOA 4PV7A 3CRVA 4PYMA 3RUEA 4CTJA 4JLMA 5KBYA 3U09A 3ZDCA 1NP3A 4H35A 3A1DA 3MLEA 3RFUA 3SKYA 1GTJ1 4S12A 2ZSIA 4B6SA 1QLWA 3U3JA 2R5FA 4I9HA 4PLGA 1QYRA 1E7WA 1KEWA 2NOAA 2QM3A 2UYGA 2YWXA 3H65A 4IINA 4R9UC 4HWRA 3LLVA 4KQJA 4ZVVA 3VHXB 1HEUA 2QD1A 1E9CA 3T7RA 2BEVA 1T0IA 1Q91A 1VJGA 5ILQA 1AHPA 1OE0A 2Z9BA 3IIMA 3H1PA 1FZTA 2H7YA 3TJRA 3LBYA 1LPNA 4IRUB 3TL6A 2AX4A 1FTSA 5IX8A 5L3QA 1TT5A 2P2CA 2MTBA 1OF1A 2BSQA 3KYJB 2C77A 2WJIA 4QBTA 2RHLA 3MOIA 1O97D 4YAOA 3IO3A 4RY2A 3AR6A 5DSXA 4J7UA 1HBJA 5E3IA 2X5JO 1P80A 2ZQ5A 1EJBA 1XU4A 1SCIA 1QGZA 2RH5A 3MUFA 1QORA 2HMYB 1YIOA 4G1MB 4M8LA 3RYCA 1ZD1A 1ISGA 5CFNA 2RGUA 5G1PA 3QMWA 2JCBA 2ZVJA 2ZJ4A 1GGFA 3DFZA 1H6DA 3Q2OA 4MS1B 2G1UA 4CDRA 3UJBA 1IY8A 2GN9A 2O54A 4NARA 4P3YA 2C0QA 1Y5NA 2YZKA 3CRRA 4DHWA 3GLHB 4Q37A 1CR2A 2R86A 2OA0A 5GJVC 1G2IA 3IPXA 3I4LA 2JBWA 4WX2B 1I3NA 1ISHA 1DC8A 2PKWA 4JYMA 3RVSA 3K6SB 3U7HB 3ESZA 3UMFA 3HP1A 4GOXA 2VK4A 4R3WA 3FOBA 4A73A 3HEBA 4KMSA 5KAMA 1WPQA 5F23A 1XVAA 3OO0A 5I7OA 2BH2A 2SCUB 4GI5A 5AUQA 3CG0A 3SVTA 3S8YA 5GINE 3GZ4A 3UJPA 4C76A 1N2CE 2DHRA 1UBRS 1JA0A 2C4MA 3LT4A 4IMIB 4MJ3A 1N8SA 3N2YA 5IT4A 3P0IA 1KYIA 1O94C 1CUFA 2IJGX 1RHUA 3R5SA 2FP3A 1KJQA 2JFXA 2YXBA 5JRJA 2JI6A 5J5CA 3QEMB 2XYRA 1EXNA 4RJKA 5EXDA 2XQFA 4DPLA 2VTBB 1Q7GA 2YYAA 5KTSA 2I3BA 5D01A 2HRRA 1R16A 4ROSA 1UDCA 4HNHA 4FWTA 3ZVNA 2C4UA 4MS3B 4OG2A 2WTBA 3G89A 4MUGA 4UDOA 5G40A 4L73A 2Q99A 4MQEB 3AKEA 3DO6A 4YAKA 4OF4A 4RYLA 4UHKA 3KETA 1XKQA 2QDXA 5D2CA 1E2KA 2EATA 4EJFA 2LW7A 2RK4A 3T41A 3U7QA 1HY3A 3F7TA 1E0JA 4LYHA 2JCYA 3AZPA 3KYCB 5MGBA 6REQB 5FB3A 3OZTA 4M0DA 1GPJA 5FPPA 3L8GA 1CUDA 2Q5IA 3HWRA 1CUZA 3QMPA 1C7ZA 4TWRA 1JQLB 521PA 1PJ8A 1R88A 3ZX5A 2NMVA 3HXKA 1KI8A 3EXIB 2O7SA 2H16A 4M38A 3R2JA 2P1DA 3EYWA 1YI0A 5CJ2A 3WL5A 2G06A 2R8ZA 3CRQA 5BN5A 1ESEA 4JH0A 3C7DB 5DASA 1ZCAA 2C95A 1JR4A 2E0IA 2TMKA 4LC1A 5FPHA 4LFBB 2X0FA 4LOKA 1MC1A 1XEXA 5EJ2A 3VAAA 3DD5A 4QXRA 3RGWS 1SXPA 2Q07A 4DG5A 3EEQA 3I76A 5D3QA 2QM0A 1PE0A 3CVXA 2HX1A 1TCUA 1ID8A 1EFCA 3C7KA 1XCGB 1R8YA 2WSBA 3CHYA 3ESXA 3MRTA 5F1PA 4MCHA 3E7DA 1OU4A 1E7QA 2WSSA 1T8UA 5EVCA 1LTHR 4WGFA 4FNGA 3QKTA 4M1KA 4TLCA 4BMCA 1VM6A 3A4TA 4Z4GA 5DISB 4E46A 5GVSA 3QX8A 5B64A 2VDPB 2HDNB 2V7GA 2RB5A 3JAKA 2NUAB 2FN8A 2Z04A 4J1SA 4KODA 2G5TA 4AG6A 2XV1A 1NE7A 4FMDF 1WY7A 3JQ8A 5GJBA 4M22A 2Z4SA 2KS6A 5B2ZA 3I8XA 2ZUVA 4OV6B 3AJ9A 2O8VA 2ZIFA 1FUYB 3ICOA 3PEEA 1L5HB 4MKHA 2WB2A 3U16A 1FCJA 4DLZA 1ZGAA 4L4UA 4R2MA 1P4SA 3D02A 5DNEA 5K1ZA 2HJSA 2WMOB 3VTKA 1E5TA 1VL6A 2PYDA 1TCAA 2HUNA 3IAEA 4PBRA 3JR3A 3P2YA 3ZHQA 1N57A 5ESWA 1MB4A 2HRZA 3QVOA 4HNAA 1KAOA 4JUFA 2OGSA 1FFGA 2QRLA 4FFLA 3CLUD 3RDPA 2NU9A 4WCDA 5EXTA 3ED5A 4DRYA 4LSGA 1FVFA 4IEFB 3ESBA 4E0BA 5CD9A 2JVIA 4V0LA 1YL7A 2J48A 3C6MA 3RK4A 1Q15A 2D6FA 1HE1C 4BAUA 3ZGZA 1F8FA 1N8KA 1QLHA 2G28A 4PC7A 3TQSA 4EA9A 4YCBA 2X0DA 2BZGA 3BGVA 4MCJA 2VS1A 2FN4A 3FPAA 4NMLA 1YZTA 3FF1A 3ODGA 4L9RA 5LZ7A 5INTA 4G9BA 1BHSA 4NFSA 1N2ZA 4BYMA 5EZYA 3BMOA 4WFIA 1QS0A 3EPPA 4R69A 2JGDB 2BMWA 1CRZA 4UNIA 1PBNA 1ARZA 1T36B 5J5VA 1WXFA 2YICA 4C5CA 1ADJA 2H0AA 2FCAA 1K8YB 1R37A 3GL9A 3MPUA 4IDFA 1U81A 3W9BA 3QXCA 5KOJA 3HP4A 3IQGX 1V9SA 3IDQA 4OQNA 1G6HA 3Q8MA 1W4ZA 2PX4A 4M3NA 1M6YA 3AVPA 4PC1A 3TBKA 3O2NA 1BKSB 2C3OA 1M1YA 3GCDA 2VWHA 3QWFA 2JA1A 3WIVA 4EFKA 4TL9A 4MIYA 3SNKA 4LGCA 2XTAA 4PZZA 1XCMA 4W6ZA 1JG4A 1MORA 4WXEA 3R9KA 2F62A 3WBKA 2VDMB 5ALRA 4E22A 1EDBA 4AZ3A 4OOEA 1PU2A 4OQLA 4ZI5A 3TZLA 1FX0A 1JBQA 4GKAA 3ZLVA 4L50A 2NPFA 1JLMA 1BE8A 3B6ZA 3K32A 4UBNA 4LY3A 4H31A 5CHEA 1Q6YA 1AE1A 3LVQE 5GV7A 3K73O 1E4VA 3NKVA 2V7EA 3OCZA 3ZGXA 4BDTA 5FLXA 2JFUA 2CFCA 2VJPA 3P2IA 5LD2C 5BUCA 1PS8A 3SS9X 1U6JA 5ESRA 5DI3A 4FJ1A 1SMKA 4F9TA 3OZFA 1H8EA 4CTKA 5EZQA 1I32A 3SDBA 1CY1A 4FYMA 5E2IA 4F3CA 3O93A 1LFAA 1ONBA 3GDFA 2Q5QA 4MUNA 1YFZA 5J59A 3WSVA 4BMYA 1HDIA 1X7YA 3PRKE 3L1VA 4NY1A 3VH3A 4DNQA 3Q9SA 1ZBDA 3GJQA 2E4YA 3RS8A 1J8QA 2VFAA 3CUUA 5EIWA 3N8NA 3I0ZA 1E4YA 4IUCS 1E7RA 4KL8S 4CF7A 1IXYA 3DXFA 3OIDA 3QBVA 4QVGA 2NVUB 3E8MA 1SIWA 3U0BA 5EJ5A 1WMFA 2R6FA 2X3UA 3KX2A 5JNRA 1PZEA 3AR4A 3ZE8A 4H2DA 3DFFA 4PRZA 4XI9A 4K81B 1SHUX 1T4GA 3AJAA 3NBMA 5IAOA 5KTPA 3EFHA 5B1DA 4DWOA 1MBZA 3DOOA 2PGLA 2VDKB 3IVMA 2IIVA 3PUJA 5CA0F 5GGYA 3TZKA 5AICA 5HSGA 1GTRA 3L6RA 3DO5A 4QRHA 5J4VA 2JEYA 4YMSA 1Y89A 2CFSA 3M81A 1BQ3A 3EVAA 3KDAA 4WN9B 4EGCB 2V5AA 4MV4A 4ZOQI 3TKLA 5JCPA 2CDNA 4F84A 1NI4A 3WXMA 1DXQA 1LDBA 4WJZA 3ZE7A 4OBEA 3QJGA 1HZZC 4NCBA 2NZWA 5IWCA 1DQPA 1RLTA 4YQYA 4CM5A 4CIYA 5LR6A 1WNTA 3BMNB 1RHJA 5TPZA 2NZJA 1QH0A 1MW9X 3L92A 3WKEA 3K15A 4HUQB 1L5LA 4CPDA 3PDUA 1Q3KA 4Z9FA 4FGZA 3V7WA 2HSDA 1HE8B 2B25A 2I1QA 1TK3A 2XVMA 1GZ5A 1NVTA 3KR2A 4XFDA 4QLBA 5HR5A 1RS0A 3C15C 2O5CA 3WK8A 3AFHA 2PX8A 5JNWA 1ZG3A 4PAOA 3RUHA 2NQ2C 1GV0A 5TLSA 2WFLB 5HW0A 3EX7C 4A26A 4K28A 4OQYA 4JL5A 2FPRA 1X39A 2X14A 4TLAA 4OHUA 2PSEA 1P3Y1 4OREX 4FI3C 5CX4A 3GLGE 1RI1A 2YCLA 5EIBC 4L8WB 4XWWA 2J33A 4YLGA 3CUTA 4PZ9A 5IDWA 1M2VB 4JA2A 1ZNXA 2HRCA 4FX2A 2AJTA 5FNVF 2RCNA 4YRBA 4M9QA 2O8EB 3KP1A 1GWNA 2Z5GA 2QX6A 2L42A 3VPGA 3HVUA 4JT2A 2UYOA 3DLIA 3MTBA 3WGYA 4DR2B 3N75A 1W30A 2WE7A 1WY5A 2W4IA 1ZIPA