2HXSA

Crystal structure of rab28a gtpase in the inactive (gdp-3'p-bound) form
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
178
structure length
178
Chain Sequence
GSHMRQLKIVVLGDGASGKTSLTTCFAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQIWDIGGQTIGGKMLDKYIYGAQGVLLVYDITNYQSFENLEDWYTVVKKVSEESETQPLVALVGNKIDLEHMRTIKPEKHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGIKLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Ras-related protein Rab-28
publication title The Crystal Structure of Rab28 GTPase in Active and Inactive Forms
rcsb
source organism Homo sapiens
total genus 62
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2006-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2hxsA00
2IXFA 1DE0A 2OHFA 1KMHB 4RD1A 3WHKA 1BIFA 3W6OA 5AUQA 3KB1A 3EPJA 2WIAA 5SZHB 2JA1A 4K46A 1IJFA 3QXJA 5E7IA 1Q20A 4FMBB 4CDGA 4G1UC 4OQNA 2H92A 4NDZA 1AZTA 3OIYA 2WWIA 3EPKA 2YOFA 4R98A 3OEHD 2J45A 3CNLA 1Z6GA 2A3RA 2AD1A 2VP2A 3PEVA 5JEEA 3ADCA 2P67A 1EFTA 2N1BA 3AVXA 1II9A 2C99A 3U3RA 1RYHA 3DL0A 1Q3TA 2VEDA 3U44A 2FGJA 2JJ8A 1S0UA 1GKUB 3UPUA 1YRAA 3EARA 3MUFA 4Z8XA 2C03A 4DT1A 1Q1BA 1SZPA 1ZAKA 4TMKA 1T9HA 4GL2A 2WOOA 1II8A 5C18A 1KDOA 4M4SA 3I72A 4EFLA 1E2GA 1ETUA 2WVJA 2I1QA 1RJ9A 2XNDA 3EPLA 3U4QA 1NG9A 2D4HA 2DFKB 4A92A 1ZD8A 4DLUA 2ERYA 4URZR 5JS8A 4ITRC 2DHRA 1OIXA 3TQFA 1E96A 2QP9X 4YXWD 1NIPA 2X2EA 3AVPA 1PLLA 4M1KA 3V4RA 1YU9A 4UJ3A 4PSVA 4HZIA 2ZRPA 2WWYA 2ZVPX 5KDOA 1YHNA 4Q47A 4URWR 4NYJQ 4DEYA 5L3QA 4LYAA 2ONJA 5AUOB 3TIFA 5KU1A 2HCJB 3ZVRA 3GJ0A 2ZI6A 1HY3A 4PFSA 2R2AA 4I4LA 4D2IA 4UNNA 1ELOA 3DZ8A 4Q00A 1EFRA 2VHUA 3B2EA 1XEWX 3FFAA 1AQYA 3X1YA 1UDWA 4KJZA 1CIPA 1G8PA 4YONB 4EPWA 1P9NA 4F7WA 2ZITA 3WMFA 2WAXA 3HDTA 4JLNA 3AP1A 4OL0A 3V4FA 3B9PA 1E1QD 3KL4A 4ZDKA 3P4YA 1XXHA 2AD5A 2BBWA 2IYSA 4JYBA 2G0TA 4IFEA 1G1MA 5CDFA 1RC8A 2ZRIA 4CW7A 2XTZA 1NSTA 4HATA 3DZDA 1BO6A 4Q7MB 3R7WA 4A9AA 1QG4A 3I5YA 4IOJA 1E98A 2OE2A 1DO2A 4V0MA 2EFGA 5DHFA 5C4GB 2QNRA 5FTKA 4HZUA 3RRZA 1M2OB 1J70A 4KSCA 3WNCA 1IONA 4DIEA 1F2TB 4MA4A 1U90A 1WDTA 1JAIA 2OCAA 4JVMA 3MLEA 1EXMA 1SVLA 2I1VB 5JJLA 2IXGA 4GI7A 2YHSA 3ZGXA 3K0CC 3TSOA 3BB1A 4C0KA 1M7BA 1ZM3A 1G4AE 1KGDA 3B9QA 2VRWA 4PQRA 5LPNA 4LV5B 2YC2C 5FBQB 5JECA 1KSHA 2AR7A 2RGXA 1XXHE 3QPUA 1XTRA 2XTNA 3KUCA 4XSHA 2E87A 3FMPB 3I4LA 5CDFE 3PUYA 1OHHD 4TQAA 4TMTA 1IY1A 1E2LA 5C4MA 4OQMA 1KI6B 1NJFA 4N1AA 4B6EA 2GZDA 2NTYC 2FFQA 3ZD7A 4MGIR 5KNBA 2AKYA 4V0ME 2GETA 3QIAA 3TAHA 3P1JA 3CBQA 4PZZA 5IF9A 4TLAA 3RS7A 1G8GA 1DEKA 4OK5A 2BMDA 2Q21A 5IK2D 2JDIA 3WYAA 4TZ6A 1P73A 2J0UA 1N6OA 4XVUA 4GFDA 5FOTA 3A4LA 1QHIA 2F43A 1VYTA 4JT2A 2FV8A 4KCGA 5BXQC 1E0KA 2WJJA 4LBVA 2W2TA 4MQBA 1JR6A 2WWFA 1E1RD 4Z1MA 2A5YB 3PUZA 1SHZA 2B6HA 3LY5A 1JR3A 1V5WA 5B57C 1NKSA 1XTKA 5A5GA 1E9SA 1EFHA 2ZI9A 2OSBA 4FIDA 1HYQA 2OBMA 1EG7A 3QI2A 5G53C 3SFVA 4D0NA 1DAKA 4ZI3A 3QUSA 1KHTA 1QZXA 3CH4B 2OZEA 2VA8A 4G5SA 4C7OB 4V0NA 1HE1C 1YZLA 4URXR 1I2DA 1JJ7A 4RSGA 4A6XA 2R9VA 3BJIC 4N3NA 2HJVA 1OB5A 4G5OA 1FUKA 1S3SA 1H8EA 2GF9A 4RY2A 4CVNA 3W5IA 4B75A 1N0UA 3U3MA 2QMUA 4PC3A 4EAQA 1W36C 1L4UA 2JATA 2ZRGA 1GL9B 3KB2A 3SZRA 2ZRNA 3R9XA 4ARZB 1IBRA 1T3SA 2JCSA 2BKUA 2O8EB 2IYLD 3MWJA 2JGNA 5DN6A 2E9SA 2GAOA 4DIDA 4GP7A 4NCNA 3QNUA 3PCRB 3MFYA 1ZUNB 1NBME 2GCNA 3L2OB 3T5DA 1FQKA 2HYDA 4IKEA 5DE3A 3T15A 4I1UA 3DOFA 4ERNA 1C9KA 2G0NA 2Q3FA 3NEYA 1TF2A 1XTIA 4MYHA 2QRZA 2VF8A 3CM0A 3KJIA 4C0HA 3BD9A 4NYIQ 5FTJA 5BYKA 2JLVA 4KFTA 4E03A 1E2DA 1Q1EA 2IS6A 2CHQA 4LJ7A 1XP8A 2ODEA 2FDCA 5HE8A 1OJLA 2QL6A 1ZUHA 1DAIA 2CLDX 2QMHA 4JLDA 3K8YA 4LYJA 5E7JA 3BFKA 4LJYA 1VIYA 2ZRJA 3EAQA 1GUAA 3L0OA 3SJAA 3THYA 2G88A 2QGNA 1JNYA 4KO8A 2ZJ8A 4JS0A 2R6CA 1KK2A 2GWHA 2VQSA 2GESA 4GT1A 1R7RA 4RZUA 1GNRA 4EQ6B 3EASA 1QHHB 2EYQA 4BPBA 3QPVA 2OUKA 1TF5A 3FB4A 2OLKA 1IY2A 3FHCB 3DMDA 3RHFA 1SKQA 2V6IA 3WYFA 4YC7A 4TYWA 2CL0X 1XJ0A 4DDUA 3QY0A 1DAFA 2GA8A 3LVQE 1R4AA 2QT0A 3AF3A 3LXXA 3VU9A 4MKIA 2C04A 1UJ2A 3K70B 2Z43A 1RRGA 1S4QA 4G3XA 3CUEF 4F92B 2QGZA 2NO1A 3WNBA 3QOFA 2HJGA 4ACBA 1GNPA 4JMPA 2R62A 1Q0UA 1MO5A 3OEEA 4Q1EA 2GAAA 1XPRA 3T06B 3ZH9B 3ADBA 2O8DB 3U3OA 1T4GA 2NPFA 2ZRLA 1XTQA 1P2TA 3X1ZA 2QT1A 1Z6YA 1NI3A 4KU4A 5E95A 2R44A 1H8HD 4BFSA 2NPIA 1M7HA 3O47A 2ZYVX 3U3KA 4ZV4A 1NLZA 2YKGA 2H8KA 5CLLA 2P3SA 5CLQA 5UKDA 5AJVB 1PV4A 3KX2A 4FINA 1KOFA 3B1YA 4NPHA 1PLKA 2HCBA 2ZJBA 1W1WA 2ZJOA 4KAXA 1XX6A 3VQTA 4KFSA 3AUXA 1JXMA 3MGCA 4Q1CA 3GPLA 3AVTA 1UBCA 4M9ZA 5DI3A 4TLCA 2JIZD 3Q5DA 3MRSA 4L9WA 1RYFA 4PHFA 4URVR 1S3GA 2IYTA 3OEHA 3OIVA 3AGPA 4C9BA 2A5JA 3FKQA 4Q9KA 4P4UA 1KI4A 4YQFA 4NTZA 3SYLA 1XCGB 3FFBA 4QNRA 2ZE7A 3AVYA 4ZKDA 2MSEB 2ZSEA 3KDSE 1XFAA 4IXMA 3C16C 1KTVA 1RRFA 4M1YA 3WNDA 3DPUA 3IQXA 4BEBA 2VBCA 2EFHB 4XJXA 4AC9A 4B33A 4BASA 2FFAA 2WMNB 3FWYA 3GFTA 2YNMA 3K0EA 2KJQA 2BOVA 1MABA 2CVHA 3NVAA 4FCWA 4FMCB 1SVKA 3VMFA 2ZJZA 2AL7A 2IYQA 4FW9A 1LTQA 1R6BX 1U94A 4YXWA 3VHLB 1WBDA 3EW9A 1XJQA 4UNQA 2XX3A 2J0SA 4XD7D 5KYKA 3I8XA 5H68A 3MJRA 3RSLA 3REGA 1FL9A 3CNNA 4HAYA 3ZVLA 4BFWA 4BRUA 5BW8A 1G6HA 4DLRA 3IPYA 1P72A 4WZ6A 4B3FX 1XEXA 1G17A 1G21E 3K1JA 5FOWA 4TSFD 3CF0A 4HAVA 4KHZA 3U7GA 2YWFA 3KQKA 3T1TA 2X19A 1NVXQ 1TU3A 4LC0A 2XTMA 2WWWA 2R65A 3FHOA 1VCMA 1E9BA 1KK0A 4Q9JA 4OHXA 3RVBA 4JBXA 2AKAB 5JEDA 4F4IA 1G3QA 3TUZC 1AS2A 2QA5A 3PUVA 5J4VA 1IAQA 1F60A 2W00A 1N5IA 5TXGA 1JXOA 2HLDA 2BBOA 3A8TA 4I1VA 4IDOA 3I73A 3EPHA 2WSSD 4M0LA 4BLOA 5L3VA 2J3EA 1B23P 3RWOA 1LF0A 3KTAB 4QGFA 4A0RA 2V6JA 1E1QA 1YKSA 3W90A 2BM0A 4X8HA 2FNAA 3FMFA 1KKMA 3V9PA 2IA5A 2IT1A 3DHWC 3IIJA 4B6FA 4M1TA 3Q7QA 5CYPA 4JLOA 5JRZA 3GMTA 4M8NE 3TUIC 1E2FA 2W6JA 2QSYA 3WMGA 3BRWD 1EWRA 1D2NA 1G9XA 2QSZA 4HLQB 4X8OA 4URUR 4E09A 4IVQA 4F38A 3B8HA 1CU1A 1X6VA 2RGDA 4KLZA 1N6LA 821PA 1J8YF 4F4CA 4Q4JA 1A1VA 1AA9A 1E2PA 4LWZA 5TVKA 2G3YA 4B47A 1CRQA 5GJWC 3KXIA 2RAPA 1JI0A 4JLPA 4W5WA 5GVRA 3HPQA 3RAPR 1OB2A 1S1CA 3GLHA 4ZKEA 1TQ6A 2ORVA 5EE3A 3B85A 3OIUA 2FJUA 1Z06A 4NP6A 3TMKA 2JLQA 2OCYC 2GBLA 2ZQ5A 2I3BA 3LRPA 2CBZA 4ABYA 4HUQB 3VTKA 5EE1A 4EIWA 2ZI3A 1BMFD 1EX7A 3GFOA 3TW8B 3RYTC 2F3TA 4QM6A 3FE2A 2PBRA 1GZSA 5KHOC 3D7MA 1R0WA 1TU4A 1LF5A 3GJXC 3OE7D 1KO4A 4A36A 2C98A 1R0YA 2D7DA 1CRPA 2B8WA 4KXFB 1I4LD 2GK7A 2B92A 2QM8A 2ZEJA 2ZYUX 5IK2A 4AK9A 1FFHA 4ZIRA 3FHTA 5JHGB 2AFIE 1TMKA 4M1MA 5J4YA 2GTPA 3DVLA 1WBBA 2XSZD 4TL6A 5EE0A 3U6BA 4QBHA 5SZIA 3GLGB 1ZUIA 2AK3A 1E1RA 2J87A 4E07A 3VNUA 2NMVA 4PC1A 3ZQ6A 4DLYA 2C9OA 3QPWA 4B3CA 3CPJB 3IBGA 4K8OA 1TTTA 1IY0A 3C14C 1S9HA 3U7EB 2ODNA 5EUQB 4NH0A 3AF2A 3THOA 2QPOA 1G5PA 3PITA 4F93B 1UADA 3LDAA 4JBYA 1G6OA 5FTNA 1C1YA 3CWZA 4TT3A 4DCUA 2QQ0A 2YOGA 3T61A 2GXSA 3GJ7A 1Z2AA 3CF2A 4V02A 4ZDWA 1VMAA 2GEUA 1Z0KA 3FMIA 3W6NA 4AD8A 1CR4A 2QRNA 4JL6A 4JYCA 1IJEA 1Z07A 2A5FA 2YC4C 3UK6A 1MV5A 3EA0A 1HT1E 5AWFC 1L2TA 2CJWA 3ZZTA 4DLVA 4V0KA 5KSOA 1YE8A 1XRJA 1GKYA 3ASZA 2EFDB 2R6AA 3R9WA 1ZM2A 4MRPA 2IYUA 3KKOA 2Z6VA 3K9NA 4A2WA 3U5ZB 3CRMA 1Q44A 2ZI5A 1VYUA 1F2UA 1FUUA 2DFTA 1LW7A 2AXPA 1NVUQ 2GBLC 3QBTA 5HCNA 6Q21A 1AIPA 3GLIB 1JALA 2OXCA 2HV8A 3VFDA 2WKRA 1NSFA 1W48A 1G7TA 1Z0AA 2GXUA 5P21A 1UEJA 5KDDA 3N70A 1XCPA 4QL3A 3CONA 2AFHE 1HQYE 1NRJB 3A6PC 4YMTA 5CB6A 1W44A 2QMOA 1AS0A 4RFSB 3H2YA 1W0JD 3E2IA 1ZYUA 4GBMA 1N5KA 3B1WA 4GMXA 4C0LA 3S1AA 3NTUA 4BZPA 1CJUC 2VHJA 3SU8A 5K8IA 2VSXA 3W8NA 4LUCA 2C9YA 4LI0A 4DEXA 1YZKA 1G7RA 1PVOA 1MKYA 4DCTA 4JLKA 3WY9A 4B43A 1FMLA 4KBGA 3VKGA 2Q9CA 1Z6AA 4B73A 2FH5B 4O25A 2K5UA 3GJ3A 1KY2A 1WP9A 4TYNA 2W0SA 1KKLA 2OT3B 1T0HB 2RHDA 3MD0A 4JLJA 1TAGA 1DG3A 4JVNA 4QKQA 4AI6A 1E2MA 2FFHA 4US0R 1E2IA 2CMKA 2FEMA 4MYTA 4UQOA 2GCOB 1OXSC 4IOKA 4XOIA 1H8HA 1P9RA 5JSZA 2GJ9A 3AVUA 1R5OA 2YWHA 3LO5A 4M1OA 1E2HA 2PEZA 2BKEA 4LBYA 2REBA 5DIFA 5FTLA 1SKYE 2V1XA 1LY1A 5LDDC 1SGWA 1FP6A 4RD4A 3AEZA 2JIZA 1YR9A 2O8CA 3KKNA 2UKDA 3MG9A 3K70D 1K6MA 1OLOA 2ORWA 3RS3A 1FNMA 2QTFA 5AUPB 1CXZA 1YZTA 5FUYA 5HE9A 2ZR0A 4OI1A 3GLFB 4ASUD 1SQ5A 1DVRA 4G01B 5AJWA 3TSZA 1Z3IX 3QKSB 1RVDA 1W0KA 3IPXA 4GP6A 4BFZA 1MR3F 3JZMA 3O8DA 4RCYA 3SJBA 2ZYWX 3AF4A 4RZ3A 4MRSA 4OHYA 4O0MA 4BZQA 1US8B 2WIBA 4PC2A 1N5LA 4Q4HB 1OH7A 1P7CA 5K8TA 3EZ6A 4TTPA 4DDVA 1NN3A 1WE2A 3ONWA 5HKKD 2H7VA 1AGRA 2O8BB 2CHVA 5FOVA 2WM9B 4JT4A 1M7GA 3RC3A 2IUUA 3V00A 3GEEA 1KI9A 3WBKA 3BERA 5FL7D 5L8VA 4MDEA 1T5LA 4Q4AA 1GITA 2OV2A 2W2VA 4TSFA 2ZJ2A 3KFVA 4X8MA 1XPUA 2O5VA 2WWHA 3B1VA 4PPQA 2ANBA 1GILA 1XBTA 3CKLA 2ZE5A 3C7KA 3QF4A 3CH5A 4G0NA 4TWZA 2IXEA 1GSIA 3TW4A 2C78A 2JAQA 2IEYA 2WAYA 1Z22A 4BLRA 5BN5A 1VPLA 4RD0A 2PMKA 1CR0A 4NYMR 4CZ2A 3VNVA 2NO9A 3KXLA 3L8YA 1CEEA 5HCIA 5DSZA 3SNHA 3M6AA 2A5DA 2F1HA 3K0AA 4CGZA 3X1WA 3PG5A 4QGHA 1VHTA 2H18A 2VF7A 3P32A 2VP0A 3EWSA 4B32A 4D0GA 1XCMA 4S2EA 2ZRAA 1G16A 1W46A 4MUBA 3QJYA 1JJVA 3NBXX 2P65A 3K0SA 5HR5A 1VHLA 2XGJA 4C0AC 3LX5A 4PPGA 1KO8A 2RGNA 1F48A 3VKHA 4Q9LA 4KODA 1D8TA 1TQ2A 1KSGA 1SVOA 5JZVA 3U61B 3AH8A 1ZMXA 2KSQA 2CE7A 2OAP1 1QVRA 1IN7A 3K09A 5E3HA 3R20A 4DDWA 2DR3A 1WXQA 4D4KA 1JEDA 1XD2A 4M1WA 2W6IA 1D9XA 3C5HA 4RD2A 1X86B 3AB3A 2C2HA 3BBPA 1S9DA 3SYKA 1NVVR 3O8RA 4N0DA 1OW3B 2P5SA 1ZU4A 3H84A 3W8RA 3ZVMA 2QORA 4Q9HA 1T5IA 4Q48A 5DYGA 3PFIA 1U0JA 2J7PA 1FPMA 1J2JA 1BMFA 4RZ2A 3LLUA 3THWA 5FTMA 1TPZA 2DWPA 3B13B 2AXNA 4ESVA 5JJIA 3NBYC 4PSAA 3QE0A 4LJ9A 3UG6A 2R6FA 3NG1A 3SJZA 3ZYCA 1VG9B 3U44B 5GVSA 2FSHA 1OIWA 2PL3A 3DKPA 3TQCA 2C77A 1IOZA 2VHTA 4BUJA 5B30A 1AZSC 4PHTA 1II8B 1UEIA 4LJ5A 4NCHA 4PHGA 4ACAA 4XTRA 2QBYA 3G5UA 3HPRA 3U4QB 2CL6X 1RJ9B 2IX3A 1ZNXA 3TUJC 2BMJA 2QTHA 4TMXA 1RE0A 1G3UA 5CIWA 3AVWA 1BOFA 5TDHA 2NG1A 4XSGA 4FMDF 4DWJA 3CRQA 3EZ2A 4HAZA 3PVSA 1AS3A 4IEIA 1E0AA 5EUMA 3BE4A 4IVRA 1FZQA 4C4PA 2OO7A 4UXHA 4QGGA 3SHFA 5J4KA 2CLSA 2FPLA 1M8PA 1XMVA 4ESHA 4LJ8A 3CRW1 1K5GA 4B2LA 4AKHA 3REFA 4F91B 2ZS9A 2GEVA 4OKSA 3UATA 3VHXA 5DHAA 2ZU6A 5TARA 4LDJA 2G77B 1OXTA 4L4UA 2QEQA 4DLZA 3EX7C 1Z0JA 4M9SA 2KI5A 4IRUB 3SBEA 1YZUA 2PZFA 3DM9B 4G5GA 2OBLA 4PAQA 3ZVNA 2PT5A 5J5CA 2ZUCA 3AM1A 4TYQA 3W34A 3CX7A 2EVWX 1ONBA 3N2EA 1BKDR 1Z0DA 1G19A 1MH1A 2RGBA 2JASA 3C8UA 3P20A 2B7CA 2BDTA 1D2EA 4QXAA 3R7WB 4MITA 2ODBA 3NH9A 1K5DA 2YJTD 4CEIA 1W36B 3T5GA 3IHLA 4KFRA 1HUQA 4HZUB 2ZRFA 4L9SA 3VR5A 2WV9A 1XTJA 4NYJR 1N6KA 1U9IA 1U2RA 3K0FA 4UNRA 3VR3A 1UKVY 2A2ZA 1NBMA 2WPDD 4ARZA 2V3CC 5LB4A 4DSUA 5KTYA 1P75A 4Z51A 1QRAA 2UVQA 1SULA 5L3RA 3SBDA 5BN4A 4JJZA 1KJWA 1MO6A 4P32A 1CJTC 1TL7C 1DELA 2WJGA 2ZRBA 4M22A 2EWVA 1E2NA 4CEJA 4LHYA 1E4YA 1GOTA 2GVZC 1IN4A 1M6NA 2IYYA 2WKPA 4HB0A 4PHHA 4Q4LA 3WRXC 1VDZA 3R9IA 1L8QA 2GCPA 4US2R 3WRYC 5C2JB 1FTNA 2A7QA 2ZYTX 3GJ6A 3EZFA 2L0XA 2HUPA 1KI1A 2GJSA 4O2LA 2G9NA 2OM2A 1UDXA 2H17A 5CM9C 1U81A 4V0LA 1OFIA 1Z6XA 3D3QA 3VAAA 2WHXA 2ZS7A 4MGZR 2H16A 2PJZA 1U98A 1G20E 1OFUX 1KDRA 1WCV1 1XB2A 2ZSFA 5FUXA 5CJ2A 4HSEA 4WXPA 2ECKA 2RB4A 4Q7LA 1GVNB 4IXNA 3RS2A 5JLJA 4OI0A 2OAQ1 2F43B 3IGFA 1SXJD 2YINC 2VO1A 2IYZA 3TLXA 1P4SA 1ZC4A 2F1RA 3E1SA 3ZS8A 4BE7B 1N0VC 2AK2A 3BGWA 4M21A 1ZCBA 3W3AA 4NCKA 4AYXA 1RW4A 2AWNA 1COWD 1KY3A 2ZVQX 5GJVC 2ZJYA 4WBSA 5AK0A 1NMXA 4AKEA 1GG2A 1G7SA 3Q72A 4ZO4A 1NLFA 2VHQA 4A0GA 4ASUA 2AWOA 1NP6A 4W9MC 1UAAA 5LB2A 4TQUS 4HLDA 4MGKR 2HXYA 2H57A 2CK3D 3VX3A 1MOZA 1P60A 4FN5A 2ZSDA 1FX0A 5F3WB 3DO6A 1CJKC 3MWYW 4WVFA 2CL7X 2ZU0C 2BC9A 3LNCA 3EC2A 4C2TA 1NF3A 4TLDA 1QHNA 3T35A 1BH2A 4C0SA 4OQFA 3K9GA 4KYIB 4RD3A 3O8BA 2BMFA 4EFNA 4H1UA 3K9LA 1HE8B 4DCNA 2D2EA 5FL7A 4LCBA 1EWQA 5KSZA 2N46A 5IDVA 4QBIA 1ANKA 3MMPA 3L82B 3I8SA 1QBKC 4DSTA 3THYB 3WHLA 2BHRA 2F1IA 3FOZA 4TTQA 2P5TB 2QAJA 3DKVA 4IW3B 4POAA 1ZINA 4WIAA 1RPZA 5BYJA 2ZUBA 1WMSA 4MRVA 5FUVA 2HT1A 3TGPA 2RGEA 5IRCD 5TV2A 3F8TA 2RCNA 5AJYA 4P4SA 5FL3A 3LQRA 4P3YA 2VIIA 5EXSA 4LOAA 1UBFA 4TZ0A 3R8FA 3WBJA 3LW7A 4PSKA 3I92A 2D2FA 4L5BA 4LRWA 4W5JA 1E9DA 4GZMA 2FSGA 4Q18A 3QENA 3LFUA 2GDJA 1B0UA 2OFOA 3VU9B 4PO1A 2ZE8A 3SS8A 1QHXA 3GJ5A 1JQLB 2IS2A 1ZNYA 2PMDA 1ZM9A 3KKMA 4A0HA 3PUWA 1DOAA 4MYUA 1S8FA 1NMZA 4XTCS 3LBIA 4A1FA 1PJRA 2XXAA 1QF9A 1UKYA 1XJCA 4NYIR 1Z0FA 2J59A 4D0LB 1W4AA 4C30A 3SEAA 4LHZA 1EFCA 3AVQA 1KZ7B 1W4BA 3DDCA 5EP4A 1XEFA 5L3SA 2PCJA 3SE0A 4PAOA 4DKXA 2XAUA 2DWQA 1G18A 4U7DA 4BLSA 5EP1A 3A36A 3GQBA 3QEJA 1KJZA 2ZRDA 3U60B 1C4OA 2GHIA 5HZKA 1UBGA 3W6PA 1AGPA 1ESNA 3TAUA 4GOKA 2VPPA 5EQTA 1YR7A 3VX4A 1FP7A 2YOHA 4B34A 5DI3B 3E5HA 2ZE6A 3CR8A 3CF6R 1VKJA 3PXGA 4GOJA 1R0XA 3SC3A 3WMEA 2MSCB 2N42A 4XWAA 1GKIA 3QKTA 3THXA 1AK2A 2A30A 4HDOB 1JB1A 2GJ8A 2ZRCA 3FKSD 3KKQA 4LHXA 4LSGA 5FH9A 4US1R 4A0FA 4DDTA 1S1MA 2BV3A 2FOLA 3DM5A 2NO7A 1BYUA 1ZD9A 4C3ZA 5FOUA 1G3IA 2OLJA 4ILEA 4OJKA 3KJHA 4MDFA 2NIPA 2RHMA 1QG2A 4LJ4A 4TYYA 4OI4A 1UKEA 2NZ8A 4QBFA 5AR1A 4XH9B 3NBZC 1MABB 1QHSA 1SVMA 4DB4A 2FZLA 1PUIA 3P26A 3NHAA 2BCJQ 4UNSA 1DAMA 2ZJAA 4AYWA 4OBEA 2FA9A 3C15C 3BS4A 2F55A 1AN0A 2GJKA 4EFMA 3BH6A 1DO0A 5JMTA 2BBTA 2ZPTX 4U00A 1J99A 3CNOA 5B2ZA 2DYKA 3T1OA 2Q3HA 3FMOB 3HJNA 1A4RA 2Q9BA 3RS4A 4JZKA 2IUTA 2C8VA 2OG2A 3AF1A 1Q21A 1PLJA 3WYGA 1P6XA 1XEXB 1E99A 4R2IA 1E69A 3I32A 1UF9A 1AKEA 4OK6A 4R9UC 1XD8A 2JLZA 3SFZA 1W2HA 1NN1A 2HT6A 3IILA 521PA 3AVVA 5JJKA 2DFNA 5AJZA 3IO3A 3ZD6A 4HEJA 1LB1B 1X1RA 2RGCA 3DOEA 4RFVA 2X2FA 2YWGA 1FW6A 1GNQA 1DAEA 2CNWD 1GDDA 3M4YA 4HB3A 1G4UR 4W5HA 3A1WA 4BLPA 4C0JA 2BJWA 4O3MA 1OHHA 2RMKA 2Z0MA 1KSFX 4AG6A 4IJMA 4LHWA 1KIMA 1GAJA 1UBEA 3HU1A 5G3ZA 4DJTA 2ODWA 4OHZA 4OK3A 3TVDA 3VR6A 3I3SR 4AIIA 1SVSA 4FI3C 2Z4RA 5KSPA 2O8FB 1XNJA 1DS6A 2JJ2D 3GEIA 2ZETA 4C2UA 2J9RA 4IDQA 3R8CA 3ADKA 4NE2A 2BMEA 3ICEA 3ADDA 3X1XA 4P0TA 3U7FB 4MGYR 1Y63A 3RANA 1H65A 1NY6A 4B76A 2ZR7A 4A6PA 1E6CA 2CCJA 4PANA 1R10A 3OFND 3GLGE 1EK0A 2F6RA 2ZRMA 221PA 1EFRD 1VECA 3KQHA 4CEHA 5LD2B 1I2MA 2KBFA 4D26A 1Z6TA 5C1BA 3AKCA 3LLMA 4D4MA 1GRNA 1UM8A 3A1UA 3GLHB 3QXHA 4DCVA 2C96A 1E2EA 2G83A 1IM2A 2FZ4A 4GNKA 5JRJA 5KPDA 2AHOA 3CB4A 2BWJA 4YDSA 2GNOA 4PPNA 5TB5A 4Q1AA 4QHSA 3X2SA 1XDBA 3KJGA 3PQCA 2WSMA 2ASEA 4C0QC 2IWHA 2D74A 2JLYA 3K9HA 1EX6A 2PEYA 3L43A 4PX9A 1G5TA 5FPKA 4KFUA 1WA5A 4JKIA 3ZS9A 2FF7A 1W36D 4ZIRB 3CWQA 4JJKA 2G6BA 2J41A 2ZREA 5LD2C 3NEJA 1OKKD 3EIHA 3BFXA 2XNSA 4KYUA 2Z4SA 3ZQJA 1SXJA 5DGXA 1GWNA 1TUEA 3SI7A 3HU2A 4I81A 3BOSA 3LH5A 4NL4H 4KSBA 5D3MA 4Q19A 3LQQA 4JBWA 5JCPA 2W0MA 1IXRC 3D8BA 5FPSA 4HLCA 3OHMA 4HB4A 4RD6A 1COWA 5CYOA 3RRYA 1D2MA 2BIFA 2REOA 4TMVA 3PIRA 2ZIAA 4G5RA 5KSYA 3N5CA 1JEEA 1KK1A 4NHOA 2QAGA 5GJCA 3GLIE 4BWYA 1BYIA 2WBLC 3UKDA 5BWMA 1RRCA 1FOEB 4DLXA 4XIGS 4EJSA 4R71A 2UZ3A 2IL1A 4IHQA 1AM4D 1VCOA 1CS4C 2QU8A 4B3BA 3B1ZA 4CYMA 4Q7KA 1OF1A 4CT5A 3Q7PA 2V9PA 2REXB 1Q1ZA 1SXJE 2CK3A 3TVTA 5CM8B 3CX8A 5EE9A 1ZW6A 3VR4A 3G82C 3MJHA 4Z1MD 4AY2A 3L0PA 3I62A 2J7KA 4PPFA 1KDTA 1JR3D 4H9GA 1Z0IA 4P31A 4QHTA 5FI0B 5TY0A 4ZDJA 4B3GA 1V43A 1F2UB 4HB2A 3NDPA 2ZJ5A 4WA7A 1ZBDA 1W2GA 4C0BA 4MKHA 1KO7A 1GIAA 3A1SA 2OXRA 1E9AA 3TJZA 4B2PA 5JFGA 5KOYA 2DY1A 3RWMB 5KO2A 4OI2A 2NGRA 4A8JA 5GJBA 4PC6A 3PV0A 3QVUA 4LPKA 1H8ED 1W5TA 3HWSA 5HZHA 3ZZUA 3RC8A 1UPTA 2EFCB 2EYUA 5D3QA 5DYIA 2R6DA 4OQLA 3G0HA 3B82A 3B78A 3H0KA 3AUYA 1Z29A 4DLSA 3IBYA 2GXQA 4PQYA 4YMVA 4IFBA 2LWIA 4LV6A 4Q4HA 3BAFA 4HYYA 4Q1FA 2P0EA 1ZM7A 5CK5A 3QXXA 3QKRA 4EPRA 3LD9A 2QPAA 3N2IA 2PT7A 3EIQA 4BQSA 4NKRA 3I5XA 1RZ3A 3RNLA 2IEZA 1KYIA 5HPYB 4LHVA 1A5TA 4BEJA 5F2EA 2JLWA 2GK6A 2WJVA 4HI0E 3LV8A 1KMHA 5FFMA 4XWKA 3NHBA 4H1VA 3OZXA 1NLYA 3LAWA 1JPJA 2LKDA 2IW3A 1VG0B 3GCGA 4Q9IA 4ZPXA 4FXPA 4DB2A 4XD7A 3IHWA 4IDHA 5DO9A 3RRNA 4U5XA 1NNEA 4D81A 2RH5A 2E1RA 2ZS8A 3CPEA 5FBRB 3LWNA 1VG8A 2IYXA 2O0KA 3HYRA 4G5QA 3L0SA 2UZIR 2F3RA 2QROA 2WWGA 3A4MA 2O8CB 2HYIC 1E79D 5JBQA 4GDFA 4DBLC 5J47A 2J46A 1NL3A 2Q0HA 3KFXA 3F3YA 2EU8A 4MRNA 1DAHA 1KNXA 3FKSA 4WOPA 3GFPA 4EKDA 1AKYA 3IUYA 1G8FA 4A8JC 1YZNA 3T34A 1J8MF 3CZQA 3AV0B 4JVSB 2OFWA 1YQTA 4P33A 1O3YA 3WXMA 2WSSA 4DUGD 1K8RA 1JPNA 1OT3A 1N6PA 5FR1A 4QC2A 3UXMA 2GZAA 3HYTA 4B2IA 1PZNA 3HP1A 1OFHA 5E4FA 1E9FA 3CX6A 4JLMA 4LGMA 2QTVB 4QJ4A 1XTSA 3ECCA 2XITA 4PZYA 2MMGA 1UFQA 1IQPA 1CP2A 3FGNA 4I1OA 2VP6A 3CO5A 2IBMA 1ESMA 4TN1A 1KMQA 1R5NA 2EFEB 1KI3A 2FSIA 3EG5A 4QG7A 4Q4AB 1WF3A 4ON9A 1HT2E 4PZLA 4Z8YA 2QI9C 3IQWA 3KUDA 4CT4B 1E2JA 1VIAA 3KZ1E 3LW8A 4RKFA 1VCIA 4TQ9A 1N2CE 1WB9A 2A5GA 3B1XA 4CIDA 1CTQA 3QF4B 2PJRA 2CNWA 1M34E 1U8YA 4B74A 4D82A 1T6NA 1R8SA 2KBEA 1FQJA 3K0CA 2ZAOA 2ZAMA 3KXKA 3JZAA 4A82A 1FMJA 1D6JA 3QVVA 3UANA 2OEPA 2VP5A 3K0AB 4NBSA 3RSOA 2ZRKA 3KKPA 1ZU5A 2MMCA 2WKQA 3LBNA 5JI2E 1YR8A 3OE7A 1Z63A 2Z83A 4FCVA 2W2XA 4MH0R 1X1SA 3RLFA 2JJ2A 5F98A 2F9MA 2QY9A 3BB3A 5CB8A 1VYVA 8OHMA 4KVAA 3U6KA 3C41J 1TUIA 5EXTA 5EZ6B 4DT1B 2XSZA 3UWOA 2VP9A 1F2TA 2V54A 3MAAC 1MRSA 1XU4A 2JLXA 4Q5IA 5FI1B 1R8QA 1ZM4A 5DISB 2CEAA 4JL5A 1E32A 1MT0A 1N5JA 2V8OA 5KUTA 3FPAA 3BIFA 4BRWA 5FPYA 1IN6A 3OFNA 1X8LA 5G3YA 2IC5A 5AUNB 1Q3HA 1XD2B 1T0JB 2B8TA 2RGGA 3EC1A 4Q21A 5FOSA 1E3MA 2FPMA 4TL8A 4JVLA 1RFLA 2F7SA 2HLDD 3UWKA 1KSJA 3ASYA 1KI6A 1DADA 1P5ZB 5LBIA 5BN3A 2O0HA 4AYTA 3CR7A 1GP2A 1W5SA 3C5CA 3IIMA 4S35A 5L3QB 2RGNC 3THWB 1R2QA 1S96A 4UXIA 3M1IA 2BCGY 3KJEA 1NKTA 1ZD1A 1PUJA 2W6JD 3IKJA 1KJYA 2W58A 2FN4A 2RKOA 3JVUA 1SVIA 2PX0A 4BLTA 1NIJA 3NIBA 3NKVA 2IHBA 2QM7A 3K09C 5FPHA 2CLCX 4D80A 1YJ5A 4IDNA 4EPVA 4WXRA 2JEOA 3AP2A 4DXAA 1OKKA 4BLQA 3H4MA 2C95A 2CE2X 3FDIA 5EXPA 1A2BA 4AKIA 4LYFA 3SJCA 2QBYB 1KI2A 1QDEA 1X8KA 1ZNZA 1XXHB 3UMFA 5KNDA 4LY6A 3BWDD 4X8LA 721PA 1HEIA 1QHYA 5A4JA 3U3JA 4IOLA 4PC7A 1G41A 2QMEA 2P6UA 4PR0A 3W9YA 4C7OA 1XWIA 1E2KA 4PXAA 1ZIPA 2WZQA 3ND9A 1DBSA 1LS1A 1XF9A 1KK3A 3KQUA 2DB3A 1Y3AA 4NCIA 1ZP6A 2CCGA 3SQXA 3WP1B 4JIMA 4RKEA 4FMCF 2IYVA 4J0QA 1TNDA 5G41A 5A0FA 1JBKA 3PEUA 121PA 2JLUA 1D5CA 4BFYA 3BH0A 2O8EA 1KO5A 2C5LA 3Q8XB 3U7HB 1Q57A 2B21A 2XZOA 4Z54A 1W0JA 4AKGA 4WZAE 4JLVA 3UIEA 1OIVA 4R2HA 4YMSA 2X77A 4KITB 5JS7A 1ZC3A 3VR1A 2GJAA 4BECA 3SOPA 3EWAA 2QE7D 3QBVA 4HDQB 2PCLA 2Z5FA 4GSYA 5ELXA 5F9HA 4Q7JB 4IDPA 5B64A 4D6PA 2BEKA 1OV4A 1LVGA 4LK2A 4QJ5A 2FMXA 3BC1A 421PA 5JCZA 4TT3D 4IVPA 1NY5A 2OESA 1OXXK 2J0UB 4N0EA 4CEIB 3B6EA 3GP8A 3OF5A 4EQ6A 1N3BA 1X3SA 2P6RA 1QHHA 2X1VA 2FSFA 2V7QD 1OE0A 2PZEA 2QUZA 2HF9A 1E0JA 4IOMA 5GADl 3K0FB 5K8UA 1Z8FA 1LFDB 4GPTA 3DEFA 3IEUA 4QBGB 1I4DD 4Q1BA 3B60A 3W3ZB 1VTKA 1Z5ZA 2C9CA 1E2QA 3UG7A 4CF7A 1JR3E 2NZJA 4HAXA 3AKYA 1G3RA 1YR6A 4Y0VA 3RS5A 3VKWA 1GRQA 4CEJB 1U8AA 2G1JA 4BFUA 3A37A 4OHVA 3TSWA 2D06A 1NG1A 5FUWA 4DCSA 1CLUA 4EDHA 1U8ZA 3OAAD 1GL7A 2AX4A 1OXVA 2O8DA 1KZGB 1QHGA 5CITA 3ZIAD 4EPTA 3IEVA 4TMWA 5EJEA 1E9RA 2XOKD 2QQEA 1P2UA 3Q3JB 1U9IC 4A2PA 1W4RA 3BXZA 1TEVA 4MKFA 2WJIA 2ZSBA 1N6RA 4HAWA 4ZI2A 1P2SA 3SR0A 4OQXA 2JJ1D 3T1VA 2V4ZA 1AJEA 4HUTA 1XD9A 2DPXA 4FCTA 4A2QA 4JSYA 3E70C 4M2LA 3BB4A 5DH9A 1U0LA 1L4YA 3LX8A 4NU0A 5HKKA 3T12A 4QNMA 2FX3A 3TNFA 5EXXA 4K81B 2KB0A 2PLRA 1Q22A 1VCNA 2F9LA 3ZDQA 1ZNWA 2MSDB 3PUXA 3HR7A 1CR2A 1DAGA 2ANCA 4NZYA 2WWXA 1E79A 5K8LA 1O87A 5B58C 4BZXA 4MKGA 4A4DA 3LA6A 1A7JA 1ZRHA 1T8UA 3CPHA 3RS0A 1M1YE 4WAUA 1U99A 1ZCAA 3NC0C 2VTKA 2GEDA 3L0IB 4R7ZA 3SQWA 4D25A 2O0JA 3NH6A 1N25A 1UKZA 2HEIA 2LKCA 3FTQA 4FMDB 2VH5R 3VR2A 1CF4A 3HU3A 3P27A 2ZI7A 1F3OA 4DUGA 3A4NA 4B71A 2OCBA 5AJXA 1FX0B 1GM5A 2KWIA 1E9EA 2BM1A 5M04A 2HDNB 1OSNA 2XJ9A 4LYHA 5FBLB 2ERXA 1W49A 3AQ4A 4LV8B 3K70C 1JAHA 5SZJA 5EP2A 2DBYA 2WJYA 4L8GA 4M53A 5CK4A 2FU5C 2GRJA 4F4JA 5TMPA 3Q85A 1F5NA 1J7KA 3MSXA 2CVFA 4AG5A 1DTSA 3Q9LA 2OBNA 4TL7A 5CJPA 1LV7A 3SYNA 1SHKA 4OHWA 1T8TA 2WOJA 2WICA 2ZR9A 1E0SA 1W0KD 4Y0AA 1P2VA 3H86A 1TF7A 1J90A 3BORA 3EA5A 3TRFA 1TQ4A 2D3WA 2DCUA 4YLGA 4NCJA 1N6IA 2EW1A 1YRBA 3KTAA 4P4SB 1HA3A 4NMMA 1CULC 5FBVB 2SHKA 4YMUA 5KDLA 4ZCMA 2RGAA 3AGQA 3CIOA 2ZI4A 4UXJA 2IUSA 5BQ5A 2IWRA 2XB4A 3TK1A 2YZ2A 3TBKA 3QXCA 4OYHA 4XVRA 1XMSA 4XVQA 5IHPA 3TKLA 4II7A 1TADA 2EWWA 2AN9A 4JLBA 4QRHA 2ZUDA 1R5BA 1CJVC 1KO1A 2XXAB 4Q66C 2Q9AA 4U02A 2ONKA 621PA 1S2MA 1ZJ6A 3H1TA 2H5EA 3TH5A 5CIQA 1TEXA 1FNNA 2P6NA 1OPXA 3WP0A 4B3XA 1G8YA 4B3DA 4LPSA 2G1KA 4LC1A 4RCZA 4EPXA 3QEOA 1BS1A 3B7GA 4KVGA 5L3SB 2WTUA 1KDPA 5F9FA 4LBZA 1VG1A 1XEWY 3ZJYA 1ZIOA 2XB2A 1AQUA 1II0A 4HUQA 4DZZA 2H1LA 3MWLA 4GZLA 2O52A 1YZGA 5FR2A 2Q6TA 3AKDA 3NXSA 4ZDIA 3QQ5A 3TR5A 4DC9A 3PJRA 1M74A 2D62A 5FPTA 3BK7A 2ZM5A 1T3LA 2O8FA 1YZQA 2R6GA 1N0WA 2GF0A 1TQDA 3THXB 2YYZA 3BFVA 4P4TA 1NJGA 4I99A 3NBFA 3I61A 2DWOA 2A78A 1CKEA 2ZTSA 3GLGA 2BJVA 2XNDD 5JWRA 1ODFA 1XZQA 4ZCIA 1Q1QA 4W7SA 5IT5A 1RIFA 1IXZA 3PR1A 3C4JA 2IHYA 3UMRA 4B44A 1IHUA 4NONA 1P62B 4BFTA 3GJ8A 2W6ID 4O2RA 3J81k 1P9WA 1F6BA 1OYWA 2BBSA 5JI3E 1A2KC 2YVUA 1OH8A 1CBUA 1Z47A 3AVOA 2BEJA 2F1JA 4MUAA 2GZHA 2YWEA 3EXAA 4KV9A 3FVQA 2ORIA 1DPFA 2IF0A 1L7VC 1Z2CA 2J7PD 2VP4A 2FFBA 3I1FA 4Q01A 4V03A 4YMWA 1P3JA 2GVDC 2QP3A 1IXSB 1KAGA 1T3HA 3QXSA 1EGAA 4Q4JB 3GD7A 3NDBB 1SVWA 1CR1A 1MRNA 1IN8A 2D7CA 2FE4A 2WPDA 4KLNA 3PEWA 3AF0A 4JKYA 2FGKA 3ETLA 5H8WA 2QN6A 2IYWA 3GJ4A 1GRRA 1HURA 1D9ZA 3QG5A 1OYYA 1KAOA 2PZGA 3QF7A 4BFXA 2OILA 3D31A 4DLTA 3GLHE 2TMKA 5E7MA 5JHHB 4I1SA 2V55B 3QKUA 5J4HA 2QE7A 2XZPA 4A15A 3CRRA 2QZ4A 2CCKA 5H70A 2J0QA 2HXSA 2FEOA 3EZ9A 1GTVA 3OIWA 4L15A 3SHWA 3M0EA 1XZPA 3GLIA 4TYPA 2FWRA 3KQLA 2EQBA 2J1LA 2V1UA 1FTSA 2BVNA 5EE5B 4Q1DA 1LNZA 1G7CA 2OFXA 2HF8A 2I4IA 4Q02A 2ATXA 1G291 2IF2A 4RVCA 4CRWB 2PX3A 5H1YA 3CRVA 1T91A 2GILA 3L8ZA 4FD2A 5KPJA 3ZLJA 4BGDA 1N6HA 3SDZA 2R8RA 2V7QA 4PO9A 1IN5A 4RFSA 3K53A 3A58B 3D6TB 2OCPA 2JLSA 1XMJA 3P4XA 4M9XA 4HDCA 3RRMA 1RRPA 4QOSA 4QJ3A 3ND8A 2WMOB 1G64A 1JQJC 3RDPA 4AURA 4RJLA 4CEHB 2PH1A 5JWHA 1HV8A 1MO4A 4LJ6A 1R0ZA 3A1VA 1OXUA 2IYRA 4PAMA 1E94E 2XZLA 5HTKA 3AP3A 1DG1G 4FWIB 5EZ5A 4AWXA 4DLWA 2CXXA 2Y8EA 2NO6A 3LVRE 5DI9A 3TR0A 5JWOA 3OAAA 2KE5A 1XMIA 5SZKB 1ZVQA 3ZIAA 2NOAA 2XOKA 3IO5A 3T1QA 4TLBA 3KQNA 1EESA 2ZSAA 3MWKA 4KI0A 2JDID 2CJWB 3F5FA 4PQFA 4EPYA 2GCOA 1GL6A 4L16A 1Q12A 2JJ1A 2CDNA 2Q3MA 1E9CA 4TL9A 4TMZA 4FWTA 3LXRA 4LJAA 4OJQA 1SXJB 3UMSA 4B48A 4HLUA 1NBMD 1EFUA 5DLQC 2ZRHA 2XJ4A 5D3MB 4DSOA 4M9QA 4LX0A 2WJHA 2J5XA 4E5UA 1MO3A 2VHCA 1X8JA 4B35A 1LS6A 2NQ2C 3ICQB 2W83A 3B5JA 3BH7A 3QSYA 3GLFA 4UKDA 3W5JA 1G3MA 1U0HC 3EIEA 2ZANA 2A9KA 3QKSA 1NN5A 1JECA 2QAGB 2GKSA 5DNYB 1P61B 4NYMQ 4DSNA 1E4VA 1NVWQ 4TTRA 4EJSB 4DHEA 5FOXA 2QP4A 4QHYA 2B7BA 1SXJC 3NC1C 5G40A 5DN6D 1WRBA 3U2QA 1G8HA 1US8A 1G5RA 4RZXA 3S1AB 4KBFA 2GXAA 4MRRA 4QFMA 4LBWA 1SKYB 1CJMA 3CZPA 2XEXA 4HAUA 3PENA 3SN6A 2O8BA 2J0VA 2QENA 4EUNA 3OESA 4M1SA 3CLVA 2QAGC 3GLFE 4XWOA 4JL8A 4TLEA 2VL7A 3X1DA 1KI7A 4EJSC 4V0OA 4BFVA 1N6NA 2VSFA 4PTLA 2LCFA 4GOXA 5C46F 4DRZA 4GRAA 1OH5A 4A8JB 1I4TD 5JSZB 3TE6A 1NN0A 3IIKA 1HTWA 1W4CA 1TX4B 2JLRA 4QGAA 1NVVQ 2FPKA 4WZBE 5FBWB 3FYHA 1YVDA 2CHGA 2QPTA 2VSOA 2ZROA 4D4JA 2NO0A 1HQCA 1Z08A 3IDQA 4PO8A 2VYFA 1HH4A 5J4LA 2P2LA 4JSTA 4HLUC 1QVAA 4JLAA 4UNPA 2X8AA 4MYCA 5ANRB 2DFLA 5J40A 1OH6A 1WQ1R 3GEHA 1A82A 2FG5A 3F0TA 3MCAA 1OFTA 3PEYA 5KNCA 3O8CA 3EZ7A 3NWJA 1KI8A 3Q5EA 4WW0A 5EP3A 4DVGA 3QKRB 4URYR 2QG6A 1W47A 4QM7A 2IS4A 3CW2A 4Q03A 2ATVA 3OEED 3LBHA 1RKBA 3ZZ0A 2YV5A 3AKEA 3A1TA 3HR8A 1KNQA 4LZZA 3DMNA 2IS1A 1GFIA 2VLIA 4UJ5A 1NMYA 4YDHB 4E22A 2IK8A 2PLFA 4GMDA 1W7AA 4D4LA 3JVVA 1Z28A 3QG1A 4ZCLA 3RABA 1DARA 1Z83A 4IEEA 1XPOA 2ZXUA
chains in the Genus database with same CATH superfamily
1KMHB 4MW9A 4EGSA 4ZT7A 5AUQA 1U0GA 2C61A 3EPJA 3IMEA 2WIAA 5SZHB 2JA1A 4K46A 1J33A 5FA8A 2O9JA 3AR3A 3TOSA 2Q50A 4OAPA 3HB5X 2I8AA 1HF3A 3OY2A 1UJCA 3H8JA 1YZHA 4G1UC 4Z0HO 4ZVNA 2BL4A 4QLBA 5LM3A 1YA6A 2P40A 4N40A 2IOHA 2CJXA 1YH3A 4D3FA 2P30A 2WWIA 4YK7A 4R98A 3CNBA 3OEHD 4YAOA 5CB0A 1U3WA 1LBIA 5KKCA 4DJ5X 1F0KA 4GW3A 1LNQA 2VP2A 1Y42X 4MWCA 3R09A 3GF4A 5KI6A 3BCRA 1G5HA 3N8IA 3AVXA 1II9A 3ND7A 2C99A 4QEZA 3INRA 3OFKA 1Z73A 3TMYA 3C3EA 3IAUA 3DLPX 4J0JA 1RQXA 5GV7A 3T99A 3I9LA 3EARA 1CVLA 3VUFA 3Q8MA 5HUJA 1NUSA 3SQOA 3MB8A 4MQEB 1YFKA 5CU7A 3ZBQA 3EPLA 1ETUA 1NXQA 2XNDA 3NIGB 4K6KA 2D4HA 2H2IA 4BNNA 4QRIA 3EG9B 3W06A 3OEYA 1OIXA 1LPMA 3WOHA 1FJHA 4H7DA 1ML4A 4XOUA 5EJ9A 4DG9A 2BJHA 2PAAA 3SXUA 3PHCA 3E2PA 2C84A 5KTOA 4KIGA 1VLHA 4A16A 3L8EA 4KGZA 1TQHA 3AFGA 2BRUA 4QQNA 4WN9B 4UZSA 2ZRPA 3OLZA 1OA0A 2HA7A 3PVZA 4UCQA 1OGIA 2I78A 5D3KA 5KDOA 5BQPA 1JIIA 3A28A 4RA9B 4TQGA 3EXIA 4NYJQ 3S28A 1JHXA 1LCIA 2JAWA 3BL6A 1MMFB 3QX9A 2NUAB 5AUOB 2A6PA 2HCJB 2EBUA 2PLNA 2XYGA 3BD6A 4JR2A 5BV8A 1IOLA 4FFRA 4FOPA 3NZEA 2R2AA 1SHJA 2AMVA 2VUSA 2CNBA 2VT2A 3C39A 3DZ8A 3PGLA 2QUBA 3M83A 1BMTA 2VHUA 4I7EA 5BUSA 2WTXA 3E61A 3FFAA 1UDWA 3RD5A 3KWLA 4QRDA 3T0FA 3VPFA 3HY6A 1K75A 1SBIA 1AX9A 1J7JA 1UAYA 1E3LA 3LA8A 4V38A 4YONB 4G1VA 5B2FA 2FR0A 4HVAA 1PYGA 5CGQB 1IH8A 2ZITA 3BA1A 4CF5A 4FFLA 3WMFA 1OZHA 2WAXA 3HDTA 4CUJA 2ZTVA 3HDVA 4NQZA 3BREA 4FJ2A 5EGSA 1NUHA 3B9PA 1E1QD 2H31A 2HBRA 2GTHA 4DC0A 2AD5A 5JQGF 2F8SA 5I9SA 4F6CA 2G0TA 2EJWA 4JI7B 1K6JA 2QD2A 5BY2A 1QTQA 2XTZA 3FVVA 2IHJA 3CB2A 3QYJA 3A6LA 3R7WA 1DAPA 3T9BA 3KSAC 4IOJA 3I5YA 2HPZA 3T5BA 2HPHA 3TWOA 1E7SA 5AW6A 5C34B 4BU0A 3PRYA 3S2SA 1DO2A 2G17A 4V0MA 2EFGA 3LPMA 1J0DA 1JEOA 3PHIA 4KQIA 1M2OB 4WNAA 1XNQB 4OBBA 4MQ5A 5DYTA 3WNCA 1A8IA 4LZWA 1P5FA 1WDTA 1CUYA 1JAIA 2OCAA 2P4EA 2R1TB 2VWQA 1SVLA 3QY9A 3AF6A 2QJRA 5U4QA 1DI0A 2IXGA 3KQOA 4E33A 1IIBA 1XZLA 1QWSA 3IOEA 1ZM3A 1G4AE 1KGDA 3N0TA 3C0KA 4PQRA 3JQCA 3G5TA 3D5TA 2YC2C 3KWMA 5DK4A 3WAKA 3ZCVA 2GMWA 2HKIA 1V8OA 2OVBA 1I6WA 4HDRB 2RGXA 4URHA 2YJ4A 3IP8A 3KUCA 4N76A 1VGVA 2E87A 3I4LA 4CTOA 5CDFE 1WQ4A 3PT9A 3EGXB 3LT2A 3GDWA 4LECA 4B6GA 2DQKA 1GFZA 3HVIA 1NBWB 4K86A 4CFSA 1LJUA 2GWRA 5I8WA 1M33A 4MV0A 4U7GA 4OQMA 4N1AA 1NJFA 4DS3A 4WNIA 4B6EA 3MELA 4Y6PA 5BN3B 4I5GA 4UD2A 2P35A 5KNBA 2XMGA 3KQPA 2ZVDA 2GETA 1NXVA 1R6TA 3TTVA 4Q4DA 1TQ8A 3P1JA 2XMZA 2HNKA 3CBQA 4G0QA 4RJTA 2ID8A 5HMLA 4BNDA 4F4UA 4MW2A 1DEKA 2DQ4A 2HF2A 5C8YB 3KQYA 4P36A 2JDIA 3LT0A 3H1GA 2GCIA 2J0UA 1EB9A 1I14A 3CJTA 3CN7A 5ALUA 1JH9A 5D3ZA 1YWGO 2F43A 3ELYA 1Q16A 4RW0A 4JU8A 1JR6A 2CDAA 2E4YA 2WWFA 1E1RD 2A5YB 4Z4GA 4NJMA 1QU3A 4E1VA 3HK2A 2R8PA 4NR0A 3RFXA 4G0WA 2RHLA 1V5WA 1ONNA 1NKSA 1VMKA 2PY6A 4HNSA 5DXFA 1IQUA 1EFHA 1OWPA 3L7IA 4FIDA 2OBMA 4MGHA 3NBMA 3QI2A 4I5EA 3RHZA 3DYVA 5KQMA 4XCXA 4KQCA 4JUBA 2AE1A 2ZKLA 3NBKA 2WK1A 2OZEA 1EEHA 4UVHA 2ZWAA 4V0NA 3EFOB 4G1CA 4HWOA 5KQPA 4B79A 1Z26A 1WF6A 3ZJ4A 3HBMA 3JD4A 2CXQA 2GJ4A 1UPFA 1DX6A 2RKBA 2YYYA 3G8YA 2Y2VA 4GAEA 4MWTA 4NNPA 4LMAA 4TVBA 4E7PA 4F3RA 1H8EA 1E3WB 1WSDA 4L2IB 2C4UA 1NW3A 2HU2A 4GYKA 1MVLA 3W5IA 1W36C 3U3MA 2FHSA 2N3ZA 2QMUA 4EAQA 2ZAIA 5K6AA 2JATA 1Q7GA 1GL9B 4U9UA 4UDOA 4EX7A 2ZRNA 4AS2A 3R9XA 1TTHA 5EWLB 3CNQS 4OOEA 2JCSA 3SSMA 2BKUA 4E3WA 4MB6A 3MWJA 2WG2A 3M6IA 4IKOA 2CB0A 4NCNA 3QNUA 4UTZA 3PCRB 1NBME 2G1AA 1AB5A 1YONA 4JCCA 1YS4A 1L5NA 3ROEA 5DE3A 3T15A 4XX0A 4NV3A 5HOQA 1PTKA 1C9KA 2FEWB 2Q3FA 4FI3F 1XTIA 2W4MA 3NDJA 1EVYA 4G25A 4ZZ1A 5IT4A 4C4SA 2XKAA 4HL6A 3ZLBA 1SQGA 3D8UA 1E2DA 4LZNA 4XQ0A 5CT8A 3RVMA 5DT9A 4E03A 1J4AA 4BJHB 2O5EA 3GBPA 2GFQA 1HK7A 3L77A 1CUVA 1QVVA 4E7OA 2VNKA 3ITKA 5HE8A 3G5MA 5KAPA 4EA9A 1OROA 1DAIA 4F96A 3QEAZ 2QMHA 3CVOA 1MVOA 2PQ6A 3BFKA 4RV9A 1I7PA 2ZRJA 5GMOA 2XCTB 3L0OA 3DW1X 1W96A 2G88A 3THYA 1JNYA 4KO8A 3RUDA 5AVZA 3VOAA 1A5BB 3IEXA 5LN1A 2GWHA 3DUFB 2UUAB 2GESA 2H2GA 4BS9A 1C1DB 2Y9MB 2WJ3A 2HIGA 3MRTA 3EASA 4RXUA 2PUHA 4A23A 4EMTA 4RPIA 1D6NA 2J6CA 5JBNA 4MYDA 2DY0A 1ZIDA 2OUKA 1KVQA 1JWAB 1XQXA 2A0YA 3FHCB 3G2LA 2VNIA 5LBTA 1HKUA 5C3UA 3TI9A 5TPZD 3OOSA 1SKQA 5ELMA 5G4KA 5CT5A 4B4OA 4CKEB 2CL0X 4K87A 4UAGA 4BB0A 1VE3A 2GA8A 4WKOA 3NHWA 4R8KA 3C48A 4KXUA 4PRKA 3LPCA 1J24A 3OX3A 1RI5A 1TW2A 1YB5A 2DC1A 2OCDA 3UJ3X 3O95A 1Q0SA 1L7RA 1RRGA 1XMPA 2B7LA 2RH9B 3TQHA 1WDKA 5JXJA 4F92B 4KRGA 3C45A 5JNRA 2NO1A 2QZZA 4RS3A 3A2MA 4R9VA 1Y4DE 4Z4CA 2CXRA 3TLYA 3PR2B 3W4IA 3DHNA 2GAAA 5L53A 3ADBA 3V1UA 3U3OA 4LQLA 3ZHUA 1MC4A 4HN9A 5LQUA 4DQVA 1DSSG 3CQ9A 1XTQA 3UC5A 2QT1A 1NU6A 1XQWA 1Z6YA 2I2AA 1WPGA 4BO6A 3WICA 1YCGA 1NI3A 2C2GA 1T1SA 4KIJA 1J9EA 3F6EX 2YXDA 3MILA 2R44A 2H51A 1JLKA 2NPIA 4ZV4A 4XM1A 4WD3A 4WOKA 3DZCA 2P3SA 5CLQA 4BV8A 2VVTA 5AJVB 1WXHA 3O2QB 1CQPA 1QFJA 2WWRA 3AG5A 3C7TA 3LO8A 4UTXA 4HK4A 3Q40A 1QDUA 2C42A 3L8CA 2VLBA 1XNHA 1FFDA 3FPSA 3KZMA 1Z5PA 1X0XA 1TCBA 3Q5DA 3G9QA 1TO2E 2OXFA 3MRSA 1XYYA 1N7GA 2DFDA 1V7ZA 3GMIA 2C97A 3H2GA 5T41A 2DUWA 4YAKA 3FKQA 1R6VA 2ZPAA 4MWDA 5DGCA 4ZCQA 2F90A 3N8GA 3FAZA 3ROKA 3UHJA 2WUWE 5LYJF 2QV7A 1TT5B 1PGPA 3SYLA 4G8BA 4LEIA 1QC5B 2Y66A 3FZEA 3LUBA 4Z0TA 4PS1A 2WF8A 4WERA 3E3MA 3UQZA 2ZSEA 4CL3A 2FY8A 4I3HA 4ENRA 4CTKA 2PIAA 3C3CA 1ZGJA 2EFHB 2GGSA 4B46A 2OZKA 2Q8PA 4IIUA 3WK9A 3OZWA 3MCZA 4RENA 5DYWA 4FCWA 1CS0B 1ZBQA 4FMCB 2K6GA 1SVKA 4FDAA 1XZJA 3DXZA 1LPPA 2QVYX 3QTLA 1SK8A 2EF1A 1LTQA 4ZYUA 3E9RA 2F9FA 5DHRA 5WRFA 4B31A 3PGXA 3TL3A 4G4SO 3T4EA 3TD2A 4AZ0B 2G1UA 3I8XA 3GOHA 5AVWA 3I37X 3CNNA 1A5ZA 1SUBA 2IEAA 1VBKA 2OV3A 5H3CA 5BW8A 5BNFA 4KFCA 2X0NA 2PUGA 1SWWA 2B37A 3R40A 4WZ6A 3PC7A 4X9XA 2CMFA 1G17A 3W2GA 2ZIEA 4B3FX 4BMYA 5C4IA 1G21E 1XROA 3L7DA 3DDSA 4PX2A 3UHFA 4EY5A 4CIBA 3KYCB 5IPFA 4KXXA 4DQUA 1QNFA 2B2CA 5C31A 3COVA 3AT1A 1YI1A 3TZLA 2X19A 1NVXQ 1TU3A 4EL5A 1XFDA 1ISMA 2XTMA 1WWKA 2WWWA 2R65A 3KTOA 1V3QE 3C85A 4Y0NA 1E9BA 1KK0A 4Q9JA 3NOQA 1S2GA 1M1ZA 4UU7A 4DRYA 5IXSA 1GYRA 1V3TA 3H9CA 1CDEA 1RC1A 4F4IA 1ZIXA 3TUZC 1AS2A 2QA5A 3ESQA 3PUVA 4YCMA 3A2LA 1IAQA 2EZUA 3LXMA 2OBXA 2BBOA 5EMNA 3BRQA 4WBNB 2ZM6B 3EPHA 2R79A 1QX4A 3JATA 5H7XA 3SWWA 4OMFG 1L5YA 4BLOA 4FQ5A 1QOQB 4BQOA 4YRGA 2CFTA 4QGFA 3JWIA 4G81A 4P7FA 2V6JA 3FUWA 2IZOA 2FNAA 3WBFA 3QPAA 3RLIA 5F1KA 3DHWC 4HH4A 1GTJ1 3AETA 1BHO1 3V3KA 4JYAB 4X95A 2GERA 4YJ2B 3GMTA 1E2FA 2W6JA 5K20A 1IHPA 1KZ9A 4KKVA 3HEMA 3BRWD 3KUUA 3JALA 4UFNA 5ITZA 1P2DA 4EYGA 3CIFA 2HJHA 3IOMA 3IV7A 1G9XA 1UP4A 4DNXA 3HCFA 3VGJA 5IU6A 3IL2A 4X8OA 2PFSA 4URUR 2M6LA 2G9QA 4M8SA 1UT8A 1WV1A 5JANA 1V4NA 1K89A 1X6VA 3K35A 2V98A 1K4KA 4CLDA 3EBLA 4ZVSA 4EW2A 5JY6A 4BKMA 4JXJA 5GONA 4K03A 1BROA 4HDKB 4IBOA 1LJ8A 4YP5A 5FWDA 5CVTA 2VCYA 2QTCA 3Q10A 2CHEA 2ZAYA 1GNLA 2JGDA 1OB2A 1U3TA 1SXHA 1T9BA 2OHHA 4FYPA 2A92A 3I0NA 3H9BA 3NAQA 1WMEA 2CFIA 3H5IA 3JD3A 1JTFA 4EB0A 1K2VN 1Z38A 5HILA 3TMKA 4KLAA 4CLRA 3BHJA 1RI1A 2VHXA 4JN6B 1Q95A 2P62A 4QU9A 4ABYA 2DCMA 2FZGA 5A9RA 5EG5A 4QTYA 4F72A 2PBRA 2NU9A 3IT3A 3PJFA 4JEIA 4C1BA 4PZ9A 4DOMA 5LP6B 3GJXC 3PX3A 2JBAB 1OLSA 5LR6A 2XXBA 5LNK6 4L6CA 3MT7A 4UATA 5HJ2A 4PX3A 5IXJA 1Y6FA 5ENDA 1I4LD 2J3MA 1WXEA 2B92A 2QM8A 1YT5A 2WDZA 2ZEJA 2RI6A 4WZZA 5LA6A 4AK9A 2XLBA 5EQFA 4F2PA 2WG0A 2C82A 1AE1A 1PNVA 3FCXA 2VAXA 3DVLA 3KELA 2XSZD 4KRYA 2AG0A 3V3TA 1NX6A 3WWOA 3U6BA 5C32A 1RWNA 4QWWA 3U7JA 4PY2A 4CQJA 3P9CA 2JHPA 1VBNA 2K87A 4CFYA 3VNUA 2FSUA 2FZEA 2J9FA 4QTZA 1UC4B 1QH8B 2I4TA 3QKRB 4WVLA 4IVNA 1XNGA 5ESXA 3QPWA 1O0SA 3CPJB 3PC8C 2IHVA 3D6NB 1U7UA 4MV6A 2EJBA 3NUGA 4XDHA 3THOA 1G5PA 5AK4A 4F93B 1UADA 3LDAA 4LZAA 4QUHA 1G6OA 4CM4A 3VTAA 1C1YA 4TT3A 3SK0A 2QI9F 1K7EB 1IZ8A 2YIDA 4BUCA 5BNTA 2ETVA 1UWVA 1RBMA 2UVPB 1CUIA 3OPYI 4BQPA 3FR8A 4UD6A 2JRCA 1F6DA 1S3FA 1ZQ9A 1J5XA 1W2WB 1KH1A 2YX1A 2V9CA 5KSWB 1IBLB 2QRNA 3VKFA 4XFDA 2ZJFA 1Q50A 4R8SA 4C3UA 1NHWA 3QWAA 2Z3VA 3GT3A 3UA3A 5JTTA 4X1KB 5AW0A 1L2TA 3ZZTA 4DLVA 2G70A 3RFCA 1QK3A 1I3MA 3T5CA 3I58A 4MRPA 2VJMB 4UW9A 4FHFA 3KKOA 4EZBA 2ICAA 2PXCA 2XDAA 1VI6A 4UM7A 2HRBA 2P77A 3HNPA 3SCZA 3U5ZB 1YB1A 2ZI5A 4PZ0A 1S6YA 4C89A 3BZWA 3K1AB 1FUUA 1CQIB 4BLVA 1J20A 1ZA2A 2IPOA 1VE9A 1C14A 1KYWA 3LDUA 2FRXA 3I9NA 2GR9A 4BNKA 2RBGA 2HSGA 4L9AA 2NVOA 2EGUA 2HV8A 2IOYA 4LK3A 4NMHA 2Q5CA 4YECA 4KPFC 4MLDA 4RMNA 5FCDA 1Z33A 3T7CA 4CMBA 1W48A 3JU3A 4XXHA 5HEKA 2PMEA 1DX4A 4IUYA 1POXA 4NU8X 2Y0EA 4TKUB 1CZHA 3TEMA 2WQ6A 4AMBA 4I1RA 5DWVA 4BL5A 1E20A 1XCPA 4IJWA 4MMZB 4YCJA 5AKYA 5FI5A 3CONA 1U8FO 5IULC 3GP3A 5IASA 1Z35A 1DBIA 4D6XA 2WJWA 2IGTA 4N6GA 3AC0A 3H2YA 1W0JD 1ZYUA 4E5YA 2HMAA 1N5KA 4OXKA 4EF6A 3M6VA 2H4YA 4TOIA 3S1AA 1VLVA 3NTUA 1ZQ1A 4BZPA 5I47A 5K8IA 3GWGA 3R3HA 5D5PA 1CRLA 4LI0A 1JQAA 1G7RA 1MKYA 4DCTA 2H1CA 2HHJA 2EBWA 4L7QA 1GXSB 3KWFA 4IIVA 4D99A 2LCIA 1QJCA 3DKIA 4O25A 4B4WA 1QIFA 2AOUA 2JEYA 2K5UA 3T7DA 3VO1A 1X94A 3KQKA 4XUGB 2WYUA 5L4NA 4ZU6X 2RHDA 2V6MA 3MD0A 4MIKA 1WDWB 1TAGA 3M89A 4UBJA 1NMSA 5TNXA 4ZHQA 1SC1A 3TZHA 1M72A 1UWLA 4WZBA 5F5XA 2EZ4A 4EHFA 2E4WA 1L8LA 4IDBA 4IOKA 4XOIA 4AJNA 1PR2A 5JSZA 2GJ9A 2PJDA 2ZDGA 3L8FA 5ADWA 1CUHA 4KV7A 1VE5A 3T52A 3Q9NA 1V4VA 4M1OA 1JW9B 1YD7A 2B4TO 3GLVA 4IHJA 1E2HA 1Q0RA 1T9GR 1YDGA 5K4AA 3ZGLA 2H1HA 4NV1A 5DDIP 5CM2Z 3AG6A 5CIYA 3KCQA 1JHMA 1BRTA 5AESA 4ZK6A 4RD4A 1NNLA 1FMFA 2AEFA 2FCRA 2Q6IA 1IQ0A 1RC0A 1YR9A 2VUIB 2ZTLA 3BXPA 3LF2A 1YBMA 2UKDA 3MG9A 3IA2A 1ORRA 1SU8A 5ECDA 1GNSA 3K70D 1XTBA 1TC1A 4YUAA 1EK1A 5AUPB 5HG0A 1PD1A 4ND5A 2PKYX 1UMDB 5B4UA 1T3TA 1SQ5A 3KC2A 4G01B 5AJWA 2G9RA 4W8GA 3RSCA 2NLOA 1EZ1A 1JLRA 1RVDA 2H2HA 1NQVA 1H5QA 4GP6A 3TLBA 4D8VA 1GTL1 2MYTA 5FULA 2EDAA 5SICE 3FHJA 4FR2A 4BFZA 3UBTA 3PJGA 1Y8ZA 1JKMA 4U9HS 4N3BA 3RT1A 3ZH2A 3ZTTA 5JS1A 3FWZA 4OYYA 2B4QA 2ZYWX 2DSNA 2JIQA 4YI5A 4BKQA 4MRSA 3WLOA 1PR1A 2BSAA 4BZQA 1TJNA 1DLJA 2NYRA 2BGLA 2NT3A 1KS9A 1NQ5A 2KPOA 3DDWA 3KTFA 2ODTX 4I4IA 1DEXA 1IL0A 1NDUA 3M2PA 3QP9A 2WIFA 4HNAA 2QL7A 4C43A 1QP0A 4U7PB 3GP5A 5EY5B 2ZW9A 4L95C 1NN3A 1SBYA 3SBXA 5HKKD 7AT1A 2JBWA 2GFIA 3R1IA 4JT4A 1JG4A 3RBXA 3UEOA 3I9JA 2YHBA 1TM5E 2X0FA 3LSYA 3BERA 3O4GA 3PXAA 3PYXA 1V1MB 2OV2A 3MF4A 1L5WA 1BJTA 1PV1A 3E3AA 2W5UA 4JP1A 1PWYE 1CG6A 3G2KA 2JFXA 4G4JA 4MUGA 4X8MA 5F3DA 1E7YA 1U5BA 3WGNA 4PPQA 1GILA 4TKMA 1XBTA 2GZMA 3CKLA 5CBKA 1E89A 1M2JA 4TWZA 5DBFA 1XMOB 1JHAA 4BP3A 2GZ1A 2HFJA 3EIUA 3TW4A 2NXJA 4KJXA 3T4PA 2ZIVB 1OBHA 3MGBA 5AXDA 1YMQA 1Z22A 5BN5A 2VTBA 4TZ0A 2VXCA 3PXEA 1D6SA 1FB5A 1WW8A 4BN5A 4CZ2A 2NO9A 3E1GA 3QA3E 5JQWA 5HCIA 1KZYC 5DSZA 3SR4A 3VZSA 1CEEA 4MV7A 1MXHA 3SNHA 3M6AA 4OFBA 3RRBA 5A4FS 3E8MA 2I6GA 3H1AA 1ARZA 2JI4A 1TOAA 2HMSA 3CMMA 1WTAA 3PG5A 4QGHA 5CVEA 3ABOB 2VF7A 1KWGA 4ZANA 2VP0A 2BI8A 3BM5A 2JFPA 4B32A 4D0GA 4HVLA 4S2EA 3IE2A 1E7MA 2Z57A 4FQ8A 4CG0A 1QH1B 4DG8A 4MUBA 3QJYA 1JJVA 4C1NA 1DJMA 1Z4IA 1KDZA 3KEQA 2AOTA 1VHLA 3FI0A 1TECE 4DMUB 1R00A 2GBGA 3LX5A 1LPAB 4P53A 3U5TA 4LYYA 4DEVA 1GGFA 1TQ2A 1TUBA 3A0UA 1B6TA 5E4YA 1UMCB 3OA0A 2UZ1B 4CT0A 2QM3A 1ZMXA 3AH8A 4JJAA 4R1PA 5FA5A 2BFDA 3TTYA 5E3HA 1VGRA 2I91A 4CLHA 2DR3A 3ESAA 4JYPA 1JEDA 3GYGA 3K4QA 4UCXA 2W6IA 3DAOA 2YBDA 1E2UA 4PGGA 3AB3A 2DHEA 2SKCA 3ZQ4A 4YUWA 1UOEA 3S4YA 3VH3A 2BDUA 1S9DA 3OTHA 3SYKA 4WK6A 1JJAA 3N0WA 4TS1A 1QGYA 1ODJA 1H0KA 4MVCA 4N0DA 2P5SA 3SBOA 1ZU4A 2Q2NA 2RAUA 3GAZA 3H84A 3L8DA 4F9GA 5A2GA 3ZVMA 2QORA 1VGQA 4Q48A 4WE3A 5DYGA 3PFIA 1NOJA 3P2YA 2J7PA 2O2XA 3V7YA 1BMFA 1RQGA 5LZ7A 1O9BA 2LIPA 2DWPA 2AXNA 4ESVA 2QE6A 3ANNA 3A6ZA 2BGGA 3RYIA 2X3YA 3K2BA 3AUJB 4FFWA 2R8XA 1TD9A 1I3CA 3ECSA 4PTYA 3SJZA 4AS3A 3U44B 5GVSA 3OJXA 2FK7A 1H9BA 1OIWA 2IZ6A 1B6SA 3D6MA 3DKPA 4L27A 3OQ1A 3TQCA 3X43A 4E1AA 3K73O 2QLBA 3O1HB 3I2GA 1EVJA 4ACAA 1JV2B 3QFFA 4DR2B 1ZNXA 1K6XA 4W6ZA 5DOZA 1RE0A 3JYPA 2D2IA 3UWPA 1M2EA 1JEQA 1H2EA 4GXQA 1E3TA 3RSZA 3G79A 4YJ3A 3AVWA 2DJ5A 2GEFA 2XY4A 3NOVA 1OPRA 3WRYA 1HGXA 1LBTA 1Z25A 3A06A 2GHTA 1WHSA 3PVSA 1JFFB 4MROA 4OAQA 5EUMA 3BE4A 4IVRA 1SJ9A 2F8LA 5JDIA 1MW8X 4WJZA 1X7XB 3FCEA 3WLQA 4AJ9A 3FCSB 4QGGA 4KHPB 3BMOA 4BKRA 2GVNA 1AZWA 2FPLA 4IAOA 5J4KA 1KH3A 1ZHHA 5DNAA 3O38A 2C5GA 4ESHA 4ETMA 1NONA 4LJ8A 3RU7A 2PG3A 1E1KA 2GPBA 3OI7A 2OCKA 1RQNA 2I9PA 4B2LA 2Q5HA 4AKHA 2GD1O 3HE3A 4LZJA 3BJRA 4J0FA 4D8UA 3SC2B 3A2NA 3JQPA 1NRIA 2E18A 3E0XA 1CF9A 3R74A 1YNOA 2ZS9A 3RASA 1JDBC 1H6AA 1CZRA 3LGSA 3IX7A 1FDVA 2BMVA 4RXTA 4DE5A 4LDJA 4O4JF 3C2QA 2IXBA 4M9SA 3V2GA 1QR6A 3C3WA 3VYVA 1W34A 3KT0A 4OHCA 3KOUA 2ESRA 1C41A 1YZUA 2PZFA 3DM9B 3OZEA 2I3DA 2OBLA 4G5GA 4NBVA 3WGTA 5J5CA 4Y67A 5TQVA 5FUMA 2CLOB 3AM1A 5CH5A 3RB8A 1KR2A 3W34A 3C3JA 3NPMA 1JAZA 2EARA 4FE7A 2JFYA 3FTNA 1ORDA 1MH1A 4X44A 2HZ7A 4D41A 4QXAA 2JASA 2YYSA 3C8UA 1U2GA 2BDTA 4WXMA 4OHRA 4ZP1A 1KDVA 4MITA 3SEFA 1TZCA 2P6MA 3UTDA 2ODBA 1C7ZA 1B00A 1LI4A 3H6HA 4Q3DA 2ARKA 3KHSA 1KS2A 5ALLA 1EQAA 2FMHA 2LPMA 3A9UA 3HFGA 3IHLA 1GFWA 3R41A 4LCJA 2BI4A 3BF7A 2ZRFA 3VR5A 4W7HA 2LNDA 1AO0A 5E0KB 1FRVA 3KAJA 4DY6A 1U2RA 3VU1A 1QCZA 4WZAB 1SKBA 3VR3A 4B6PA 4ES6A 1NBMA 5HBRA 2IDJA 2W2LD 2W22A 4ME6A 1EWTA 3ULKA 3SZUA 1P75A 3T5MA 5KTYA 1QRAA 2UVQA 2WF5A 3SBDA 4K1LA 1PFUA 5BN4A 1KJWA 1JEYA 1VYHA 5CG1A 1TZJA 1EK2A 1V5EA 2HSJA 1DELA 1ZUNA 2R8BA 2ZRBA 4KX3A 4AJLA 4M22A 4AXXA 3DZBA 1KTIA 1KJ8A 3CLRD 4LHYA 4P35A 4YCBA 1LTKA 4RGVA 2WKPA 4YEDA 5AW5A 2Q4RA 3TZBA 1VDZA 2P4QA 2GCPA 4UE3S 1Z7YA 5GWXA 3Q7TA 5J5VA 4US2R 5IDWA 5C2JB 3DEAA 2Q5OA 1DX9A 1ECLA 3GJ6A 2A7QA 4O2AB 4QU0A 1Y1TA 3EZFA 3HKDA 4NEHB 2HUPA 5DMHA 2GJSA 3PE3A 2G9NA 3V8PA 1Y9JA 2OM2A 5TSDA 3RIHA 4B3HA 2WU1A 4LE0A 3V8VA 3MWEB 2C20A 3JR7A 2GYUA 4MV1A 5B7GA 5DNEA 1RYMA 3A6DA 1XB2A 4E5KA 1JU9A 2CXTA 3MUOA 4QAQA 1N5DA 1NE7A 2ZGVA 5A6SA 2ECKA 1JRLA 1CY6A 1XOIA 3CEMA 3AEUA 4GPEA 2E2WA 2G9VA 4OI0A 2DR2A 2YINC 4C29A 3ZLUA 3VNAA 4D4GA 1Y5NA 1QS0B 4B3RB 1ENYA 1Q7EA 3E1SA 7ADHA 1N0VC 4MTCA 2OSVA 3JAKB 5DFAA 1M8GA 1BWRA 2C3PA 1TEZA 1VFNA 2AWNA 2QN3A 5ALTA 4DNPA 2WD8A 4FFNA 4EY3A 1GUZA 4CN8A 1AKNA 2RFLA 3VBCA 1O7JA 4WBSA 5AK0A 4IF6A 2GEBA 2ZYSA 5ETJA 1NT4A 4AKEA 3N0RA 3C98A 1GAXA 1I30A 2VT6A 3MK31 4WOBA 1PSZA 2AWOA 5DMXA 4NU6A 5AI6A 3T3DA 4W9MC 4XPZA 2BEUB 1UAAA 4B5LA 2PGLA 2YHAA 3E9ZA 5A04A 3ESBA 1K3UB 2HXYA 2BEWA 4I2VA 1GA1A 1ZJ5A 1PWXA 4M0DA 3OC6A 1MOZA 1P60A 2H7YA 4MW4A 3ELWA 4BCDA 5LXTA 5CLFA 2VEOA 2XE8A 2KW5A 5IAEA 4O3FA 4R5HA 5KJEA 4Z53A 3BIWA 3ZCUA 4HMPA 2NX2A 5F5LA 1VL5A 3BIXA 5DCUA 5KOHA 1L7PA 2FMUA 2P9GA 3K9FC 4X90A 2XUDA 5D01A 3T35A 1EDDA 3WLKX 5DXAA 1UPBA 2C3MA 4RD3A 4TWRA 4BGVA 2I54A 1I1NA 3DTTA 2OGWA 3O8BA 4OUDB 5ALMA 1FVOA 3K9LA 4KIWA 4Z0PA 3SXPA 3OLYA 3EQZA 4CM6A 3HNRA 5FB3A 1O0CA 4DQLA 2TSYB 2BFBB 5K1ZA 1ZJZA 3TI7A 1DMRA 1ANKA 2XVMA 3HS3A 3L82B 4FOLA 4DSTA 2DPYA 2VCEA 4GVPA 1B2RA 8AT1A 3TTUA 1ZWKA 2F1IA 3GNQA 5A05A 4TTQA 1UIMA 2P5TB 1RPZA 4A8HA 3E8SA 4RTKA 5M29A 1USUA 4HTFA 1WMSA 2Z2YA 4PAGA 5BYJA 3V8EA 5CLGA 3OCUA 2P3LA 1T36A 2OZPA 3A1CA 3WWCA 1BAPA 2PVSA 2RCNA 5B1DA 3A9TA 4ETIA 1QQ6A 4YI3A 4P4SA 5FL3A 5CA0B 5EXSA 3ZY6A 2UXDB 4MUNA 4UPEA 3ESZA 3LW7A 2WF6A 3KD2A 4LRWA 5G0TA 1ZJ4A 3LC2O 1E9DA 2F67A 4CQLB 4Q18A 1BE8A 1ZVJA 2EX4A 1JE0A 3RVLA 2OFOA 4AKTA 2ZE8A 4E51A 4KMOA 1U0FA 3ZHOA 2IS2A 1ZNYA 1AN9A 4DZRA 2ECFA 1ABEA 4EGJA 1G21A 2IELA 1V9SA 4FFSA 2B25A 2K2QB 4HKTA 4MYUA 3ZXUB 5H3HA 1I3LA 4XTCS 4YALA 3QHAA 4O8CA 3W2EA 4A1FA 3ZDAA 2XRMA 4HGQA 3C4QA 1DJNA 4B0PA 2ADFA 1UKYA 1FFXB 1ISIA 4NYIR 3SGLA 2J59A 5DLYA 1C3OB 1GPH1 2C8JA 2XNKA 5HM8A 5K0CA 3ZYZA 5BR4A 1D2HA 2XIJA 2ZB8A 4L4ZA 4RHEA 3ZG6A 1QVZA 2JFVA 3QE4A 4RHYA 5EPUA 2HHAA 3JQAD 3IVGA 4MQUA 3ZCPA 1NMEA 2Q7OE 3QVSA 2OBYA 1G18A 3C8MA 1ZW1A 3L8GA 3GNLA 2BCEA 5EP1A 1QKKA 1JXQA 3JQ9C 4ADSG 3ICVA 4V0SA 3EHDA 3SHVA 2GHIA 1UBGA 3W6PA 1FTWA 3O94A 4OEHA 1ODLA 1CY1A 1HLGA 4AJ4A 5FADA 2VPPA 3IJEB 2PXAA 4FGSA 1NJ6A 1KOLA 3B52X 4KI7A 1AMUA 4JD5A 3PPVA 2K7FA 5JU6A 4X64B 4H31A 5BV2P 2YJ6A 1RAAA 2GN6A 1R0XA 3DDHA 4GOJA 4NQRA 1D2RA 1CZNA 4Y2QA 3SC3A 5BQFA 1VRCA 2N42A 3FWKA 3KOYA 3PICA 2Q2OA 4QYTA 2W2OA 1CJCA 3NP9A 3A6JA 4NRDA 3CTPA 4PYRA 3RVJA 2Q5IA 3ZNPA 5KQRA 4O4LB 1DBWA 3FKSD 3KKQA 2QLLA 3DHYA 4LSGA 5ADHA 1ONOA 4US1R 4A0FA 4GKAA 2DX7A 2PSSA 2ZPUA 1DTWB 1SUFA 2D5AA 2NO7A 1BYUA 4MA0A 4MUHA 5FOUA 5EJFA 1RWKA 2OLJA 3JQRA 4NMWA 3KJHA 1PX2A 2ZZMA 3JSXA 1IG0A 3DZHA 5GY7A 1OGJA 2W6ZA 3HABA 4OI4A 1UKEA 2NZ8A 1S2IA 7YASA 1X77A 2XBUA 4ZYYA 3OMWA 2H0QA 1E3EA 5CFQA 2FTKE 2QQFA 1SUWA 2PBFA 3R6GA 3CXRA 3R3WA 4AYWA 3AV3A 3IXQA 1DO0A 2XUFA 4O1IA 5BUZA 3Q8KA 4QT4A 3E9QA 1YV9A 3CNOA 3HEBA 5AW9A 5F23A 2HX1A 4IO1A 1U0SY 3HJNA 3W5CA 1QOZA 4HQ0A 2PRIA 4JZKA 2IUTA 2C8VA 2OG2A 4BMPB 1EVLA 3RIMA 2GBFA 1QOPB 1E99A 4RGQA 1C50A 3ABQB 1AKEA 3DBRB 1XD8A 1ZKMA 2CNDA 2Y1EA 1VI2A 1NN1A 1OV6A 2HT6A 3IILA 3MTEA 4KRFA 1ESCA 1HNXB 4O2BB 3LUGA 4HEJA 4NNOA 4FBMA 1KVTA 2YNMC 4MO9A 2P9QA 2RGCA 4J7UA 1VLJA 5KJ6A 2YWGA 3HKCA 1IBCA 3K4HA 4HB3A 4BLPA 4W5HA 1G4UR 1H23A 1ETHA 1DZIA 4W7IA 5ALSA 2B82A 4HC4A 5DV9A 4EI9A 2WVHA 1PTJC 1B16A 5F7ZA 1MX5A 1KSFX 3IT2A 4G84A 3BMCA 1MB2A 1UBEA 2Q49A 3H13A 5T6MA 3UGQA 4B6SA 4MW7A 4C6SA 2ODWA 4R2XA 3TLJA 2FPGB 4ZGBA 1JDZA 3I3SR 3WLAA 4AY5A 1M6HA 3BHMA 4X00A 5E9AA 2FMFA 4FI3C 3ZX5A 5BSGA 1O58A 1XNJA 1DS6A 3GEIA 3DVRX 2QLNA 2ZETA 4ND8B 3R8CA 2CFCA 4LQDA 3DT8A 1FEZA 1L3CA 2BMEA 4ITVA 3OY7A 1YBAA 4F2HA 5ITWA 3U3XA 3UPTA 2H9AA 3OPXA 1NR5A 1FJGB 1EVKA 3BVPA 2HXGA 4DMHA 2P2DA 2ET6A 1BDBA 2J3KA 5ALIA 4KGDA 1KBQA 2ZJ0A 1WKVA 5A4KA 3AHHA 1XJWA 2FX2A 1R10A 4AMYA 2HJRA 3ENZA 3OFND 2H6EA 2ZRMA 1IK4A 3L7BA 1N77A 4GXNA 2ZCJA 4MWGA 2MINA 4WEQA 2KBFA 5JALA 1Z6TA 5C1BA 4K0KB 1XDZA 4RS4A 1UM8A 1NVDA 3QXHA 2XUJA 4ZAGA 3UHPA 3MWDA 4S1VA 3F7TA 2YFKA 2G83A 5HDBB 3N86A 3GN2A 1SC6A 1VE7A 1MDBA 3U4GA 2AHOA 3AI3A 1V1RB 2W71A 4TS4A 1ESEA 3NJ4A 5SY9A 3MNFA 4N3AA 2VATA 4QHSA 3KJGA 3GFBA 3P9PA 4W63A 1XZHA 4JI8B 2D74A 3IV9A 4OH7A 3K9HA 1EX6A 2PEYA 1TCUA 2FR1A 2I6XA 4PX9A 4WSOA 5GAJA 4KFUA 4CCYB 1W75A 1W36D 2FF7A 1B73A 4J7CA 4EG4A 3CWQA 3VDMA 4N0MA 2QRVB 3PWKA 1QQ5A 1WPXA 5EIBC 5LD2C 4B6FA 1YK0A 2AEMA 2ZTMA 1XKTA