3OZDA

Crystal structure of human 5'-deoxy-5'-methyladenosine phosphorylase in complex with pcl-phenylthiodadmeimma
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
273
structure length
273
Chain Sequence
AVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of human 5'-deoxy-5'-methyladenosine phosphorylase
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords S-methyl-5'-thioadenosine phosphorylase
total genus 95
structure length 273
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.4.2.28: S-methyl-5'-thioadenosine phosphorylase.
pdb deposition date 2010-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ozdA00
3E9RA 1V45E 1LVUA 1TGVA 1NW4A 1PR5A 2OXFA 1JE1A 3BSFA 4D9HA 4H1TA 1CG6A 3P0EA 1LV8A 1Z34A 1JDTA 4WKNA 1RXSA 2QPLA 1M73E 2A0WA 3GGSA 3OZCA 3LA8A 5F78A 4QEZA 1PR0A 1NC3A 1Q1GA 3DPSA 3DDOA 1V2HE 1OV6A 3PHCA 3O4VA 4NSNA 1CB0A 3F8WA 4LNHA 4JWTA 3BL6A 3OZDA 3EUFA 3MMSA 3DF9A 1K27A 3D1VA 4NY1A 3UAWA 4TS9A 1LX7A 4YMLA 4PNPA 2AI1A 1B8NA 4ECEA 3FOWA 1U1CA 4DANA 1A9OA 5F7OA 1G2OA 3FUCA 1PR2A 4MCIA 1ULAA 1Z36A 1JPVA 5K1ZA 5F73A 4TXJA 1Z39A 3K8QA 3ODGA 2H8GA 4K6OA 4D8XA 3UT6A 1JE0A 4U2KA 5I3CA 4KN5A 4WKPA 5F77A 1JDZA 5C80A 3OZEA 3PNSA 4GMHA 1SD2A 4L5CA 1JDVA 4BMXA 3KU4A 4BMZA 2HSWA 1PK7A 3OCCA 1TCVA 1RSZA 2I4TA 2RJ3A 3EMVA 1RR6A 4BMYA 4JOSA 3QPBA 4DARA 4OJTA 1ZL2A 3E0QA 4FFSA 4DAOA 4DA0A 3INYA 4DABA 1YR3A 4G8JA 1T8SA 4TYMA 4TXLA 2HN9A 1SQ6A 4OGKA 4YJKA 1Y6QA 3NM5A 1PK9A 4L0MA 1A9PA 5ETJA 3OOHA 2A0XA 2AC7A 4TXNA 1RYZA 2A0YA 1RFGE 5CCEA 1JP7A 3E9ZA 1T8WA 3UAZA 1JDSA 1Z35A 1YQQA 5B7GA 1V3QE 5B7QA 3T94A 3IEXA 4DA6A 1PBNA 2OECA 1PR4A 4M3NA 1RCTE 1U1DA 3PNPA 1RXUA 1ECPA 4DAEA 4MCHA 1T8RA 1Z5PA 1PF7E 3BJEA 4QASA 5KB3A 4OF4A 1T0UA 1ODJA 1A9SA 1V4NA 3FB1A 1U1GA 3P0FA 5CXSA 3NM4A 4MARA 2ON6A 5F76A 1RT9A 4R2XA 2ISCA 3MB8A 4DA8A 1OU4A 2A8YA 5CCDA 4GLFA 4F3CA 4GKAA 5EFOA 3LBAA 4WKCA 4TTJA 5IU6A 4F2PA 3KVVA 1VMKA 3DJFA 4QATA 1A9TA 2PGAA 3OZBA 3BGSA 2OC9A 4IP0A 4LDNA 4WKOA 2XRFA 4UC0A 1Y1QA 4OGLA 4L5YA 5F7JA 3U40A 1FXUA 5F7ZA 1TD1A 2AI3A 4G89A 1K3FA 2I8AA 5B7NA 5EUBA 1JYSA 1ODLA 4F3KA 5CYFA 1WTAA 4TS3A 4EARA 2GUWA 4I2VA 2QTTA 5DK6A 1ODIA 1ULBA 1A9QA 5IFKA 1PW7A 4WKBA 1Y1SA 3DP9A 4LNAA 2P4SA 1B8OA 1Z33A 1OVGA 3TL6A 1Y1TA 2OC4A 5B7PA 3KHSA 3OOEA 3UAYA 5CYGA 1Z5NA 1Y1RA 1SD1A 1VFNA 3UAXA 1VHJA 4GLJA 5CXQA 3UAVA 4PR3A 1RXCA 4R2WA 4D98A 1ODKA 4M1EA 2B94A 4X24A 3ONVA 1OTXA 3EEIA 4E1VA 1PWYE 4M7WA 4YNBA 1V48A 1ZOSA 3EUEA 1A9RA 4DA7A 1U1FA 4QAQA 1SJ9A 2QSUA 4R31A 1V41E 3KVYA 3NBQA 4YO8A 3SCZA 1Z38A 4TXMA 3C74A 1TGYA 3LGSA 4L5AA 2HWUA 3PHBE 5F7XA 1JDUA 4G41A 2AI2A 4TXHA 3OPVA 5FAKA 1T8YA 4RJ2A 3FAZA 1PR6A 2QTGA 4P54A 1NC1A 3KVRA 1TCUA 3OF3A 1VHWA 3GB9A 4LZWA 5JPCA 1N3IA 1OUMA 4QFBA 4F1WA 4OEHA 4LKRA 1XE3A 4F2WA 1PR1A 1C3XA 4D8YA 3KUKA 1QE5A 3O6VA 1YRYE 4TTAA 1Y6RA 1YQUA 2QDKA 1PKEA 2BSXA 5EPUA 2IQ5A 1K9SA 1YBFA 1Z37A 2Q7OE 3FNQA 3FWPA 4OY3A 4D8VA 1RXYA 2HRDA 3NM6B 4TTIA 1OTYA 3K8OE 3IOMA 4NS1A 4QARA 1U1EA 1I80A 1Z5OA 4L6IA 1A69A 3ENZA 4BN0A 4JP5A 4EB8A
chains in the Genus database with same CATH superfamily
1YJBA 3EK2A 3PFCA 4KLAA 3VFDA 3C8UA 2DM6A 2ISSD 3ZW7A 1W49A 3SU8A 1H2AS 4KR9A 1NVMB 1Z68A 3EIOA 3OZIA 3RVDA 4K9SA 3ONEA 1H2EA 4KUHA 4PQRA 1PVOA 4FGJA 1HDOA 3OTGA 4I1OA 3I3SR 4M2LA 4CQLB 2IYNA 4PGFA 1PYDA 4DR6B 1L8QA 5JDCC 3ZI0A 3ZGVA 2V7QA 1Z47A 1NV8A 4LV8B 2D2XA 2V65A 3TX6A 3TZCA 3U80A 3HLYA 4CG0A 4XB2A 3ZTYA 1JG6A 1ZCBA 1JW9B 1AZWA 3I9V1 2FP3A 4CWAA 4DRXB 3C1AA 4DS3A 4MR8A 4U0KA 1CR6A 2SNIE 4N5IX 4WWHA 4AWXA 1U9IA 1M6VA 1SK8A 3V2UA 9LDBA 2OQRA 4OU5A 4KO8A 5EZYB 5TMEA 4JD5A 1MB4A 2D7CA 2HD4A 3O8DA 4EMUA 5KYTA 1D03A 1LGYA 1VBKA 1VG1A 1W0KA 3N28A 1NONA 2R84A 4ZO6A 3ZIAD 1YZ3A 2EHDA 4C5CA 2G0TA 3R7NA 5CA1B 4J6EA 1I0LA 2J6BA 1TTHA 3PHJA 4RPIA 5SZHB 2WTXA 1N8SA 4ZHSA 3WNBA 6LDHA 4I3HA 1WXHA 3PTAA 1YI0A 1BVRA 3DLHA 1NYRA 1ESMA 1EIWA 3U44A 4JC4A 1P1JA 5HA5A 2RGUA 3Q6NA 4FHCA 4IV0A 1E2FA 1E6KA 5HF8A 2QRGA 1QK5A 4GGMX 2C4WA 1F5NA 2B20A 4KWEA 4W5JA 3WV5A 4BNNA 2R8OA 3BHIA 3WA7A 2X0NA 3F7TA 4ND5A 5CXXA 2R1UA 3ECSA 1MTOA 3FSEA 2IH2A 4Q1VA 4RZIA 3EZ6A 1BU8A 2PO7A 3ICEA 4GI1A 3O83A 1YAJA 2FOXA 4JP8A 4C30A 2RHTA 3TQHA 2PU5A 2V1XA 5LBIA 4I55F 4URHA 5DSZA 3N8HA 3L8ZA 3WLLA 2RG7A 2JZCA 1DJOA 4EB0A 4BNJA 4UBNA 1CJTC 3SSNA 3WBKA 5GADl 4Z4QA 3TIIA 2JGEA 4DBLC 2BHRA 1T3LA 3LUKA 1OFGA 2LCIA 4B80A 5AW0A 4GR5A 4B74A 4UHFA 3BGDA 1KMIY 3H97A 4WEQA 2CEKA 4WUTA 3EVGA 3TGLA 2QN2A 1P6UA 3DMGA 1RAIA 3QI2A 4IIHA 1VQ1A 2I54A 2J45A 5EJGA 4C0HA 1PR2A 1P45A 1QUEA 1Z36A 2VP3A 2PWYA 3A2NA 3MWJA 3R4VA 4S12A 1KVSA 4D8XA 1GZ4A 2O7RA 4LF5B 3AKDA 2FPLA 1JFRA 1P0CA 3UMSA 2WU1A 1C2YA 3KUDA 4JOQA 4OUDA 3UOWA 2F8MA 1LA2A 5KWEA 3FMVA 1TI7A 3OZEA 5EJMA 4MR7B 1Y9ZA 2DSNA 2EJWA 2BGGA 3LV8A 4LRUA 3FCAA 5BN5A 2PT6A 2JLYA 2AHOA 3PGXA 4YCMA 2GMWA 2A0KA 3VSEA 3ENQA 4MDEA 4IILA 3UGTA 1L4GA 1JLSA 3NNSA 3SJAA 2C20A 1UJ4A 4M86A 1JAIA 2OHOA 4ARCA 2M2IA 3HDGA 4OK6A 3UJHA 1NTRA 3N07A 4JBGA 1JHMA 3CNEA 1W4LA 4YRKA 1V6SA 2JAUA 4U8GA 2DGDA 1OLUA 3D64A 1OQAA 4W5RA 1UJMA 1JA1A 4O1IA 4BFUA 3CZCA 4V1CI 3OC0A 1NQ5A 4L50A 2ST1A 3ROFA 3UPTA 2FQWA 1ZUD1 2WQZA 1X0XA 1ZJZA 1WZEA 3AWIA 1WKVA 4YJ2F 3QWHA 4H08A 2HWYA 2IZOA 3CEAA 1CQJA 1OC2A 3FRIA 3HKCA 4GPZA 4X54A 3L4SO 3TAHA 2X22A 1PFGA 4NFYA 4P86A 4DABA 1FNDA 2NW6A 3CUEF 1WUKS 2IXEA 1UK7A 4I5FA 2F00A 4Z1OA 4R98A 3C3BA 4DSOA 1GAQA 3MTAA 2O9JA 5LZ4A 5LZ9A 3QXGA 2EJVA 2XVMA 4KE9A 2J5QA 2V7XA 1KA9H 2HFKA 2V4UA 4KI0A 1KYTA 1JAZA 2J3MA 3D8TA 5C51B 3VPSA 5K4GA 3TW0A 4TKVA 5JYBA 1GDDA 4AJPA 2FQQA 2IX9A 3G8CA 3SIXA 2P6RA 1SUCA 4PHFA 2J5RA 1A9PA 5E6SB 5B58T 2Z1DA 5U4QA 3C4JA 3WI7A 2EZ4A 4C0BA 3EPKA 2ALJA 1VMDA 2H52A 2JA2A 2XW6A 3L4BC 3G0OA 4NHEA 2QYSA 1XNQB 1RFGE 3WGKA 4UTZA 4RTOA 1JDSA 1Q95A 2WPDD 2J5XA 3H0CA 3I09A 3SEAA 1KXZA 2CD7A 1JAHA 4CU2A 5AM0A 1CEQA 1H69A 1RBQA 1VGQA 2PCLA 3H1TA 4XQ0A 5THXA 4AB1A 1OH6A 3EA4A 4KHPB 3IXMA 4NBTA 4DLNA 5JD3A 1PJBA 4JUFA 4AKEA 1L7PA 1BDMA 4CM8B 2HMVA 4QSMA 1F4PA 2DQKA 5FHRA 3RFFA 4D6YA 3BMOB 3P0HA 4MIKA 2YNMD 2BCEA 4YT5A 4E2YA 2BFEB 4UW9A 2ZB7A 4NBRA 1S5PA 4Q4AA 5EI5A 4M3NA 3RTEA 2O8FA 3VX3A 4V0NA 1J1UA 1CJMA 3FWNA 4ND3A 5DI3B 2E0IA 1XT6A 3N8IA 4QGAA 4YJ2B 2GCIA 4MIOA 3VOAA 5EEGA 2PL5A 3CLTC 4L8WB 3Q41A 4GP9A 4HPWA 5BW6B 1WSDA 2IXBA 2YBEA 3COVA 3HJUA 5HUJA 1SU4A 2ES4A 3DFKA 4HEA1 521PA 1ADFA 1C4KA 1W85A 4EUHA 1UMCA 3EW9A 3OZAA 4HL6A 1BIFA 4E94A 3NBAA 5AIBA 5KB3A 1DXQA 4DXDA 4FQ8A 4HWTA 1GQ2A 2K7ZA 1N5JA 2WVJA 1RI2A 3BE6A 1LPNA 4MH0R 3GLFB 1H6CA 1UK9A 1UZUA 2W58A 5CXSA 1OFUA 1Z56C 2OWDA 1XBTA 1DUIA 3IULA 4OG2A 4OIMA 3WIVA 3KSBC 1RXVA 2GDJA 2CNKA 2ON6A 4Q9AA 4D42A 4RYDA 2J87A 1TVKB 3L4EA 3P20A 4K6GA 1Y37A 2V0GA 1B6SA 1J06A 1L5OA 2ZVQX 2ZYRA 4ZV4A 4LWPA 2G8NA 3G2KA 3M49A 1DG9A 2YV4A 4Q4CA 3HZOA 3B2NA 3RT1A 1N5OX 3TM4A 1SOAA 3CM0A 4O4HA 4F3CA 2AJCA 3GVHA 3PLNA 3RT7A 1YB1A 1CP2A 1TUBB 1FXWF 1I14A 4RKQA 1L8LA 4BXOB 4EQZA 2NPIA 2HM7A 2GPNA 2Y1XA 4BX9A 4UHKA 4AYTA 3RREA 1TYZA 4QATA 1SBIA 2RH9B 2XNHA 4QDOA 3DSRA 2P3OA 2QN7A 3JWHA 3JYPA 5ECYA 1Y8RA 3GLRA 4CEHA 2X0RA 4LQLA 3W04A 3HM2A 3AG5A 1Z6PA 3MK31 3Q3VA 4FMCF 1VSQA 2HLNA 2EYUA 2IV7A 3BGIA 5F7JA 1FLAA 5KWJA 4WINA 2DU8A 3TL2A 1XF1A 5IABA 5KI6A 3A9UA 4M1ZA 3SZGA 3M5CA 4PPQA 4F4UA 3OF5A 1ECFA 1BO6A 1EFDN 4MQLA 5J1TB 4D9IA 2FPPB 4LXQA 3G17A 1OX4A 4KU4A 1KJQA 4JQSA 5G1OA 1NVVR 1F0KA 2AI3A 2Z8YA 4EVQA 5C1DA 4OHYA 4MDHA 4DDTA 1R8SA 2GFHA 2X58A 1CNFA 3DYBA 4TUYA 5H9VA 5I9LA 4C5AA 2IEAA 1VKRA 3O3MB 1CHNA 1KQ3A 2WFLA 2WJYA 3GJSA 4IICA 4D3ZA 4BFZA 3CWZA 3LVQE 4OXRA 1ORTA 3V4SA 3KVNA 1KAQA 1OWPA 2XMSA 2QV7A 2DFPA 2BISA 4JLNA 2CXNA 3DL0A 4K9PA 5L53A 5KO2A 1LS1A 2XOXA 3DBLA 4X6LA 5AI4A 5FOSA 2LIPA 3KJGA 2DP4E 2I6UA 4WCFB 3BTVA 3WRXA 1ISJA 1O9HA 1PSDA 3M4JA 4LOJA 4ZO9A 3S2YA 1TYCA 3QVJA 5CD1A 3VZQA 3IX7A 5J59A 3SSMA 5KTRA 3V2HA 3BEDA 3X2SA 2NVOA 2O8FB 4S1NA 3KOMA 3QEAZ 5DXAA 1IPFA 2HJGA 3DOOA 3TF5A 3U6BA 1HL7A 1TKAA 2OBBA 1GGMA 2IVFA 2X9LA 1KYZA 4U9HS 5IFKA 1R88A 3D2BA 2A94A 3H8JA 3WK7A 5CH3A 3C3EA 2B1RA 3UICA 3R6GA 4E3ZA 5HIAA 1Z4NA 2P4SA 5BN1A 5IBQA 1MA3A 1YB2A 2NVUA 1XRSB 3CR3C 2X4LA 3MLAA 4Z8YA 4ZJUA 3N2KB 4JEMA 2Z98A 2ZB4A 3OECA 2WWYA 2O48X 1RWWA 1JALA 1LC3A 2V3WA 4DJFC 4MW9A 5IT0A 2G9ZA 3LOQA 2ZJ8A 4XE5A 1XMJA 1Z5NA 2MYNA 4ID9A 4JB8A 1N5IA 1Z2EA 3IVCA 2O2SA 3O9MA 1J2UA 1W75A 3OJCA 4F85A 1O0CA 3K70B 2ATCA 3ZG6A 5JAQA 4E51A 3W90A 2D5CA 2XA9A 2YTZA 4IHJB 3W1EA 5IDVA 3W9YA 1ES9A 2WNSA 3MJEA 1V8PA 4KGDA 4YMWA 4EABA 4F7WA 4DCSA 1EAMA 4HN4B 2ZSFA 3K0AA 4FHZA 1MX3A 1ODKA 1A2KC 3EXHA 3KIPA 1RWKA 3OZSA 3QPVA 5GM1A 4CMCA 2OG2A 3HP1A 1GPWB 1Z29A 2YX1A 4WOCA 2BUAA 4KQ2A 3KS9A 4QD3A 4V03A 2QSYA 1E6LA 1UOEA 4OGFA 4GOOD 1OTXA 1ST2A 2CXXA 5AJXA 3WRYC 4BJ1A 4JJ7A 1HI9A 5C52B 3OEED 3F46A 5DYGA 5D3ZA 1JHPA 1RC1A 4OOFA 1U2TA 4IUCS 1Z4LA 5JC8A 1XZIA 1N3YA 5AJZA 3RVMA 4DMMA 3OPXA 4YRZA 2BMFA 3OPYA 1F5SA 4M55A 1P2TA 5T41A 2WF8A 3TQQA 2XIQA 2O4CA 4JT9A 4ND8A 4UBIA 2WKRA 3LWZA 2ZJFA 4QLAA 4UU8A 6PFKA 5HJ7A 2XXAA 5AWFC 1J2RA 2IFTA 4ZODA 5HTKA 5BR4A 4UNPA 4MI9A 3WKAA 1WKCA 4GPAA 4RL6A 1TEXA 4L57A 4CT5A 2RKWA 4D99A 5I45A 1SHTX 1WXDA 2QN1A 2VH1A 3TJZA 2IS1A 5HCUA 1YRHA 2FK7A 3DUWA 4N5LA 4X0EA 3JASA 3TN7A 1BD3A 1HYGA 1RI1A 2ILVA 4D3XA 1YZGA 2A84A 3IB6A 3ND5A 1P1IA 1NN5A 4WVLA 3KKQA 2ADFA 3CG0A 3KEOA 1XYYA 3DXXA 3VU3A 3H1AA 1Z5UA 3EE6A 4TMZA 4EG6A 2HMAA 1ZUNB 4AQYB 1ABFA 3ES9A 2I4OA 4KLRA 2F64A 5L8VA 2RJNA 4RX1A 1D2HA 4DWJA 3KT6A 4Y2PA 1QFSA 1QIJA 4CHGA 1EXDA 2NTYC 2A5GA 3HKBB 1CQJB 5BNWA 3GJ3A 3WHIA 5DM60 3PD7A 3T9AA 3E1GA 1XCBA 4BL5A 5EJIA 4O4LF 4HDSB 4GQAA 2XNKA 4LXXA 3VJMA 3F6EX 5JSZA 5CX4A 2B8NA 2RK6A 5AW7A 3FFTA 3RFCA 1S2NA 3NQ41 4ND2A 4M87A 4Q1BA 3ITEA 2P9HA 1DIRA 4F2WA 4I7EA 4FNOA 3PVSA 3ZU6A 2C84A 3R3HA 5SY9A 3U7FB 3BDVA 5JXIA 2Q9AA 2VP2A 1VE1A 1GR1A 1UXJA 1YRYE 3KB1A 1G5IA 3LHIA 4Y2UA 5EWJA 1R9GA 1A8SA 5K3SA 2R2GA 1M2OA 4REMA 3PI7A 5TQ2A 4DRYA 2G5GX 5U1PA 1ZLXA 2YZMA 3SSAA 1YQ9A 5AVSA 2KSQA 1IY8A 1FX1A 1AUQA 1GXSA 3CPSA 4GXTA 4H4DA 2F4NA 2QDKA 4HEQA 4JBIA 3DW1X 5LKAA 1K3TA 5DN6D 2EJUA 3HJHA 2ZUTA 2W7TA 4AZSA 2OM6A 4R2MA 3AW8A 4C78A 2BSAA 1TPYA 2AXEA 2O4UX 4G6ZA 4YUWA 1DXHA 5BN4A 1PGQA 3SQXA 1CIVA 2NPOA 2CXTA 4TWIA 3DHEA 4A0HA 5EWLB 2ZR7A 4D4HA 1XVVA 3J81k 3MT9A 1QO9A 1XQ9A 1PRYA 4I5DA 3FGOA 4YAFA 5C46F 3ZJVA 2HA0A 3OIFA 4QZVA 3K4PA 4FNGA 3DDSA 1MW8X 1S2IA 4P81A 1C9YA 1CUSA 4RORA 2A9VA 4TTIA 3RAEC 1G1MA 2OXCA 1QH1A 1F7VA 5H9WA 1IAVA 3QA3E 1BCSB 1YGYA 2W6IA 1ZH0A 3IBGA 3IOMA 5CLLA 2D2VA 5AYVA 4FEAA 1P17A 5BR7A 4EY6A 4YMGA 5AUNB 8GPBA 4A23A 3O91A 2Q5IA 4B3DA 4XOUA 1BGVA 2VSQA 3IT3A 3O8QB 4F93B 3TCNA 3EZGA 1DLJA 2O50A 1ISIA 5BOVA 5AVVA 1TAQA 1COZA 2HADA 2BBTA 3OLCX 4HDMB 1GA4A 2VL7A 3K1YA 4RD1A 3TQRA 2PHZA 1FP1D 1ONOA 2OVFA 2NUPB 3B89A 3DEKA 3H1FA 1ZM9A 5H16A 1ZM3A 2VHEA 3AUAA 4G5HA 4EG3A 1JL3A 4LF9B 3BL5A 1KOFA 4URYR 3WAJA 1UEIA 1Z2NX 5F5XA 2I33A 3E7DA 1Q6ZA 4EKYA 5JANA 3ADDA 4TN5A 2EP7A 2WAOA 3NEAA 4ENUA 4QXAA 2UYHA 4P4NA 1DIOB 3BSWA 3ZIDA 3SXPA 1JA0A 1CP3A 2OK7A 4G26A 4MCAA 4R9SA 5CMLA 1GL6A 4ZU1X 5L7TA 5EP4A 4ZA2A 5J5AA 4FKBA 3VU8A 1EKXA 5HJ5A 2R1TA 4MA5A 3RIGA 1VJGA 3FF4A 2YYYA 5J3JA 4EHAA 1TT5A 3IIKA 5I01A 2VSNA 3ORHA 3R4CA 4EJMA 4UU7A 1ZUNA 3IQXA 2QYHA 3NONA 4HB3A 2E4VA 2FFRA 2BV3A 1XVLA 3TAXA 3ZNQA 1UOOA 2H16A 2A59A 2WUVA 3AP3A 4A7PA 4JOBA 4D5EA 1F2UA 4DQUA 5HX7A 1A71A 1T9HA 1P1KA 4CLHA 3W5AA 4F38A 2W43A 4ENPA 3CLSD 3LX8A 1D2CA 3HZZA 3GPCA 3VU0A 5L3SB 2GA8A 1CUEA 4BU0A 5JNTA 1NYLA 5E95A 5J2UB 2FXVA 1JECA 1SGWA 4JU8A 4ZYYA 1BZYA 1L8AA 2QJFA 2QBYB 2CDAA 1K2WA 3L04A 3OOWA 5C9ZA 5LOVB 4HJXA 1US8B 3FZNA 3QTTA 4I1IA 1WUTA 3QHAA 5CHEA 3DAGA 4BKRA 1P3Y1 2BT4A 1J23A 1PQPA 1BW9A 3PV0A 4EGQA 3H3FA 8AT1A 2FQ1A 3ESQA 2QM8A 3I4LA 3U4IA 3QKWA 4X7RA 5HRCA 2I91A 2CHFA 2G72A 4UM5A 5FPKA 5BUCA 1REQB 4M0UA 2HXYA 3JQ7B 1NFFA 4G5FA 1BQ3A 3N7TA 3O4GA 4Y2SA 2CHEA 2AI1A 1R12A 3GU3A 4YJ3F 3UJ6A 5LQMA 1OIXA 1QG2A 3GFSA 1ZUHA 3LYHA 4JJZA 2XWPA 4RELA 4G1CA 4Q4JA 1DQRA 1F06A 2PGNA 3A7EA 3LPDA 4AECA 1N2GA 2YASA 2Q45A 2IUYA 3IUSA 2B98A 2QTCA 3UWPA 3WJ1A 4ZK6A 2PJRA 3C3CA 1U7TA 2I34A 1GGVA 2H8GA 3K8QA 4D81A 1WXIA 3D5TA 2WV7A 2NXWA 4JXJA 4A8JB 4U2KA 2IUUA 4QVGA 3RI3A 2FVXA 1I13A 3MEQA 2KI5A 3V4PB 2XEXA 4HEHA 3E7PA 1U7WA 3QVKA 4ZVQA 2VS1A 3BILA 1XZJA 3V80A 1ONBA 5EQDA 1UP7A 4PNHA 4AUEA 2B5OA 1JDVA 3C70A 4KKXB 4WFQA 2W2OA 4GI7A 3E8MA 4TWRA 3GO4A 1Z2CA 1XD2B 4CRWB 4KR2A 2ACEA 3OCUA 3G59A 3V9AA 2I2AA 4MV7A 1F0PA 5ICEA 4K9MA 1MZVA 5CH5A 2F55A 3LLSA 4E2ZA 5EJ9A 2WVGA 3GZTB 1TF5A 2E7ZA 2NQTA 2H2GA 3WK4A 2ZBRA 3JQ6A 3WL7A 4LHEA 4BMYA 4G0WA 2XX3A 4JOSA 4AU1A 4HI0E 2HA2A 2OXEA 2QTFA 4MV1A 4NJMA 5C7OO 1M1UA 4CLRB 1NQWA 4O1MA 1DCFA 1LBIA 1M1XB 1XL0A 1ZM2A 3I4CA 4OQPA 4EPVA 2QVBA 2FF7A 1XTBA 3UT5A 4WHMA 4E5NA 2O8BA 5BRAA 4R1PA 3INYA 1GTJ1 3TQIA 4BFYA 4N40A 2QRZA 1M8FA 3G2LA 3K9NA 4QDTA 3EXHB 1JTFA 3TSYA 4AZ0B 2BI8A 3HWRA 4G37A 1IN6A 3P2IA 4H7IA 1NLFA 1C9EA 1QHXA 1RQNA 2GEVA 2GK7A 2XBUA 3EARA 3IJPA 2Q2VA 1F2DA 1SKUA 2MSCB 4FI3F 3U09A 1DX4A 3TLCA 2CVPA 3EEQA 5BUZA 4U1RA 1NXSA 2F9FA 3FZQA 2EFYA 4LECA 4TVBA 1K6EA 1KTVA 1UMKA 4ZXPA 3I8SA 4KJXA 4ROTA 4RM2A 1NX6A 1M34B 3R8XA 2ZVJA 3HCEA 2NP7A 3RB8A 2L19A 5D3MB 4PYJA 5L3SA 2NG1A 2G82A 2GESA 1H2XA 2QGNA 1HQYE 1G2IA 1MX5A 3FUUA 2GBFA 3AEYA 1XPOA 1DELA 3TLGA 3WYAA 2XXAB 2C4NA 2X77A 3KKKA 4PXYA 4XRRA 3KQKA 2WJHA 1YFKA 3PCTA 1E4VA 1E99A 2EIHA 1Z35A 1BXRB 1O4VA 3KYBA 3ZHVA 1P4JA 1VHTA 4QUEA 4ETWA 1G21B 4ARZA 1QCDA 5KVVA 3E58A 4A15A 4E1BA 1M2WA 2XIJA 3TOXA 3L1UA 3C5WP 5FOTA 2XUHA 3KOYA 5EVJA 2QSZA 5CJ2A 1LLUA 2FSUA 3B1VA 3ZY5A 2PXCA 4ZT7A 5L6LB 2Z58A 4YRCA 2RH5A 4INAA 5E2BA 5JCZA 3ESZA 1PTKA 4M99A 4RANA 5FOWA 1VTKA 4F4FA 4D26A 2YC4C 4LZNA 2WQ6A 5AOBA 3ZWMA 3PQDA 1YK0A 1EG2A 2IL1A 3DEFA 4IIJB 4HAYA 3ROMA 4LK2A 4DAEA 1Z0IA 4MCHA 4PN3A 3BJRA 2QRLA 4NI5A 4CF3A 3MT0A 4MYTA 3PEUA 3SNHA 3WP0A 4B9EA 2P11A 4UOQA 2ENWA 1PR3A 3TH5A 3QMVA 4JXKA 2Q9CA 4IDOA 3SQOA 1UJCA 3QU2A 5FTMA 4HH3C 1P5ZB 4J43A 1I36A 4KLZA 3K70D 3T1VA 5ECGC 2KQUA 1ZRNA 4P31A 1GEGA 4WBNA 2CB0A 3KWMA 1NNEA 5THKA 4O4HF 5TGDA 1KDPA 5KSPA 1MC8A 2FR1A 3RAJA 1V9SA 1D7AA 5FLYA 4C7JA 4CODB 3RV3A 1EI9A 1PFKA 4UPEA 1D3AA 1KNXA 1AS0A 1T15A 2DHRA 4XQ9A 2P7IA 2RB5A 3BQNB 5D2CA 2HNKA 4UMVA 4I6EA 3PGLA 4M7OA 3EXG2 1BOOA 1NVFA 2UYGA 1G6HA 4TTQA 4ER5A 5DEOA 3CEJA 3IELA 5DDIP 1AF7A 1LVHA 4KXVA 2XKKA 5EFOA 4FCWA 1J42A 3LBAA 5B58C 1H6DA 1YC2A 4YT8A 4D0SA 5I7UA 3E9EA 3LTNC 2UZ1B 4HAOA 2GN2A 3RD5A 3UXYA 4QPZA 2CHUA 4DLZA 3LSYA 1DQZA 2EXXA 2JHFA 4D3YA 1VSTA 1FRVA 3N2IA 3TI7A 4EPXA 3U2QA 1WD5A 4WA8A 5IP5A 4KDCA 3ZWDA 3O8OB 5LXTF 1XDGA 4M76B 1YZYA 3VHXB 2TSYB 1QR2A 2E4AA 2GS9A 1FXUA 4ZPJA 1CQIA 4CN8A 5BW4A 5AI9A 4EECA 4PF1A 4PZPA 1KIMA 3TO5A 4A8TA 2EG9A 1W87A 4CNBA 1D09A 1IOLA 2CLSA 3FPLA 1PV4A 2V74B 3C43A 4LGVA 4D4GA 4XD2A 4MMXB 1AB6A 3T3NA 5I7OA 3GK3A 5HWSA 2CFCA 4PFQA 2OUKA 3R41A 4UTXA 1E69A 2QZ9A 2H9AA 2IV2X 1EZZA 1SQSA 4IIJF 4FW9A 1G7TA 2AJTA 3EVTA 4NBNA 3FTDA 4X65B 5C1PA 4FWIB 1H8EA 3IMEA 2CLDX 2G25A 1GG8A 2GF9A 1ISHA 2R7LA 2N3ZA 2YV1A 4JJ8A 4UHJA 2F3PA 3X1XA 1WUJS 2FOLA 1V1JA 3GLKA 3W2EA 2WWTA 4WFIA 1BXGB 1TMOA 3UK1A 1UFVA 2YOHA 2JJ2D 5IJAA 1E1RD 4TLEA 3ETCA 4MUNA 4P3PA 4B79A 1J5EB 5BSHA 4RFLA 4KO4S 5TNXA 2P77A 2WYVA 3JYNA 1GAEO 1IY9A 2W90A 4ENRA 5BW8A 4CLOB 4ARAA 1Q15A 4M7PA 2NZUG 3W3AD 1JAYA 1CJBA 1YTLA 3Q7SA 3D7RA 1NW8A 1ULBA 1RFLA 2WIAA 5G3ZA 3CCBA 1DAMA 4AIIA 1ZD9A 3EPHA 2P30A 4PAGA 1X1SA 3ZHXA 4LZZA 1GM5A 2LPMA 3MQ2A 4FOLA 5ALFA 3R0QA 4JI8B 1UJNA 4A6PA 7ABPA 2A5JA 3BAFA 3QXHA 1VLHA 3EBLA 2PUAA 2CXRA 1YR1A 1Q7TA 3DP9A 1UPTA 1Y3FE 3MPUA 4ZPXA 4YPVA 5BXYA 1RQPA 2XB2A 1T0BA 2IUFA 5IMBA 1WHSB 1I2CA 2JFNA 1Q0RA 3OTQA 1Z75A 4YJHB 1C1XA 1GZ3A 4HZUA 4BO2A 4TYQA 4JGBA 3L02A 3KLPX 3W6ZA 1M2OB 1WZUA 3KLBA 4P2GA 4L8VA 1A8IA 2FPKA 5T7BA 2B1IA 1N9GB 1Y1RA 1ZMOA 5BYJA 5BV7A 4RV5A 3IHTA 3KJFA 1LF5A 4N39A 4XWTA 3FKQA 4DYVA 4DWVA 1QR6A 4LRSB 4RVGA 1P1HA 2REXB 3IBYA 1VHJA 4EIWA 3R75A 3IFSA 1BS9A 5ENVA 3V6MA 4ZIRA 1MPXA 3KKZA 4HQKA 4JJ4A 1QTQA 4XUDA 4CN9A 1UM8A 4HR7A 3EGVA 5CDHA 1RMTA 2I22A 1NYTA 2I9PA 4B33A 1VGVA 4EYQA 3C45A 5EHNA 3ZHSA 2OCDA 1IPEA 1QMGA 1SG6A 1U2EA 2O8VA 1BHSA 3IPCA 4MS4A 3VPAA 3PRHA 2ZCUA 4KTVE 5JQGA 2VNAA 3I52A 2QMQA 1LJ8A 1J25A 3JWEA 2ZSEA 3SVLA 3ITDA 4QOHA 2JLWA 3H5LA 2C5FA 2E2WA 1RMYA 3LTEA 1KYXA 1EJBA 2RI1A 3RAFC 1I4LD 2JS7A 1MT3A 4A3SA 1T36A 2FWIA 3JZIA 3O21A 4AZTA 4DA7A 1X13A 4REQA 1R66A 2XPCA 4LJAA 3ZHRA 2C4UA 3IAM1 4DZRA 2YWDA 4PE5B 3G5UA 2GBCA 4PG6A 5JLJA 4N8DA 4YCLA 5FQOA 1E7MA 4R31A 3PE4A 1Y8RB 2I6FA 4V2UA 5E7QA 1NXPA 3DDUA 4W9NC 3JZAA 2QRJA 5F21A 1WIWA 3KJQA 2YQ5A 4HGNA 1UF9A 2RGAA 4HDSA 1BFDA 1RTKA 2I7CA 2BYTA 2GERA 5DCUA 3QYAA 2BDTA 3OIWA 2W0MA 1EHCA 4QGFA 4DJAA 4F5YA 1E9AA 1FFGA 3EGXA 4L5AA 4UOZA 4CM3A 2YFKA 3L77A 3DH0A 3OQNA 2FI1A 4Z1MA 5F7XA 3OESA 3NRBA 1RRGA 4P7FA 1RZUA 5CURA 4GX2A 4CM4A 1R3UA 1GGFA 3QG1A 2KM1A 2VTVA 1B3RA 4RDIA 1T5SA 1T8YA 1GPUA 3FAZA 1KDYA 4N48A 3CLRD 2IHZA 3HHPA 1N4AA 3OMWA 1WXQA 1YVDA 4KMSA 4UD6A 3ZQJA 5G40A 1WJGA 2DCMA 2IIBA 1E4EA 1FTGA 2WYWA 3A9SA 1SBQA 3R40A 4ZYUA 4KV7A 4TRJA 4IUYA 5FORA 4AUMA 5LIRA 2JHAA 1FU7A 3G79A 4FSDA 4F1WA 1P31A 2AQ8A 5ALYA 2V98A 1LI7A 3KBBA 1NF8A 3JQQA 4CKCA 3PQFA 5IVKA 1J21A 1FNCA 1M5UA 2FUNB 2ZI7A 3ZXYA 2V0CA 4OHZA 3VOTA 3TJRA 1FDVA 3O31A 3VZCA 3KUKA 1WB9A 1EHIA 1CLEA 1MGOA 2BBOA 2JJQA 1NVUQ 2HJWA 1J8VA 2VYND 3KQTA 3WICA 5BVHB 3AP2A 3DLCA 2FW9A 4FSHA 4G5XA 5A4DA 2O19A 2JJ2A 4OI1A 5K0BA 2JARA 5FUVA 3UK6A 1RPJA 1PFQA 3ZZTA 3P4XA 1YASA 3ZGZA 3TTTA 1I7SB 1FUIA 1NVDA 5B4TA 2IQ5A 1D6JA 2CXUA 2I2FA 5F3WB 5AW9A 2W2KB 1YRQA 1V8ZA 1FE8A 2RH8A 3GVPA 4CEJB 4WTOA 4DMFA 2P67A 1JSLA 4F2DA 1U3GA 1W6UA 4ZI7A 4QQFA 3I05A 3NWPA 3VR4D 3FFBA 1LZKA 5JY1A 4MPRA 2AT1A 1L3IA 2DQSA 4NDAA 4M36A 1UEJA 1G9XA 3ZZ1A 5ALEA 1YR9A 2FSVC 3KJEA 3CZ4A 4MAFA 4IIYA 3SYRA 2CV1A 5EMMA 1U2GC 3IA7A 3BGWA 1J0BA 5HKBA 1BAPA 4I0WB 2HR1A 4Y6OA 3WK5A 3PS9A 1JEJA 1OWOA 3C2QA 2F90A 2EKLA 5JTUA 1E1CA 1E1DA 1IHXA 2WYIA 2XUOA 4Y1EA 3S1LA 1RZRD 2QXUA 1YBVA 4Q9LA 1YBHA 2CD9A 3C24A 2PZJA 5DHPA 3UK0A 3LL7A 3ESDA 1Q3KA 4PU0A 4WDQA 3TTYA 3ZUPA 3BHJA 4Q4LA 2C1XA 1FJ2A 2VDNB 1QMPA 1EFPA 2AVNA 2VP0A 2YHIA 3L6BA 3OJFA 3OE1A 4RHEA 1U98A 2W6JA 4RPLA 5C8DA 5J9FA 2EFGA 1VHLA 1B74A 3VYSB 4RMIA 5LQCA 4DV3B 2LCFA 3FKJA 4KLNA 2HL6A 4R0NA 3LXRA 4EI8A 4Z5XA 3NTQA 1PJLA 1UKVY 2X0EA 3RJ5A 4YRRA 1U8ZA 4NIMA 5JH7F 5BSGA 1YTUA 3A6KA 1WVMA 1R16A 4B32A 5LMNB 4LXIA 4NZNA 3RUIA 3LX4A 1PDOA 5CDSA 4Y2JA 5ES4B 4TMYA 2O8NA 3UMJA 3N76A 3R7FA 2PWBA 2CBGA 4EFKA 3FA2A 4GECA 3MLBA 3BK2A 3TUJC 1X7WA 1PR0A 1QF9A 3EXG1 2DFDA 4KBGA 4ZOQI 1KQPA 1SOMA 1X7YA 4Y6RA 4LYDA 3KWLA 1UINA 2GN1A 4DWWA 4L9AA 1TAUA 2X40A 3E53A 4PCUA 4K88A 1ZR4A 3DTTA 3F8WA 1DC5A 3PPVA 3E18A 3HA7A 4MWSA 1U0RA 2BFNA 1AZTA 2NWQA 3ZS8A 4PSAA 1KY3A 4H1VA 3G2OA 1GG2A 2CE7A 2QAGB 5KTKA 2GN9A 3PXDA 2VAPA 4L8YA 1J5PA 2HDWA 3IP5A 3WWOA 1G17A 4RWEA 1GRRA 1B15A 3AVXA 1I9GA 1OILA 3OZDA 1MBZA 2P5YA 4R9UC 3UANA 3R0ZA 2IU3A 5EKTA 4CKCB 2HTEA 1AJEA 1ADBA 2Q1TA 3QOWA 4JLSA 2ZCJA 4BEVA 1EG7A 1W36C 4BP8A 5DM0A 1UC5B 3T12A 4UEQA 1FYVA 4TYWA 4PHCA 2HQ1A 4Q34A 4D57A 4DOMA 2QYTA 1ENYA 4JQCA 2IZ6A 1T5IA 4IRUB 4W82A 3VR0A 1U28A 3IDFA 2CFRA 2RGEA 3CS3A 2H4HA 4UFNA 4MA0A 3KQVA 4ZGGA 5H4GA 1O7JA 2QUKA 2XZPA 2VWQA 4OXYA 4QYIA 1I3OA 1C29B 2X1HA 1KR2A 4XQCA 4ZYLA 1TW2A 4RV9A 3J7AC 3ZVRA 2BM1A 1YOBA 4ECEA 5KNCD 1RAAA 2N47A 2YWBA 3L8FA 4JZYA 1D9ZA 4J8PA 4DW8A 1Z4KA 4F72A 4KGZA 1O9GA 1SHLA 3LG2A 2XCSB 2C7OA 4MCIA 4QQRA 2FMUA 5K3FB 5REQB 4DB2A 1L5HB 4MYUA 3THSA 3ODGA 1KU0A 5JARA 3COYA 1VPEA 1CUYA 4GHWA 5FLEX 1RPAA 5JQWA 2DWCA 3N5KA 2H48A 4O4LB 3WR5A 4AX4A 1QX4A 2W6JD 4MYSA 4LA4A 2I1WA 1SU8A 3TW6A 3O2JA 4FJ1A 3FOFC 2GO1A 2X6TA 4BWGA 1AUVA 4DLWA 2AW5A 4EENA 1JKXA 5KVSA 3QVSA 4MGKR 4WCVA 1KJYA 4DLYA 1N5KA 5BMVA 1C0EA 2IHKA 1DBVO 4NDZA 4CR6A 1K8YB 1CRLA 3A1TA 3N7UA 2QPTA 4Y1RB 3SVTA 1TIBA 4IHJA 3FHJA 3TIVA 2Q6KA 2VG8A 2QUZA 1R4ZA 3NC0C 3WL8A 2GN8A 1OWNA 2G36A 3N7AA 1LPBB 3DA8A 4H7KA 2ZJ7A 5JSHA 3LF1A 3UCEA 1E9RA 2B4RO 4EF5A 3F8SA 2HA4A 1QDLB 3M6IA 1VE9A 1C1YA 3V8QA 4BBPA 4WBNB 2V5AA 1DIHA 4DRZA 3O8RA 4ABTA 4Q05A 1HKHA 1YCDA 3GVXA 4HFJA 1SCBA 1RRMA 3EIXA 1YQDA 3G8YA 3L7CA 4XM1A 2O1WA 3T4UA 3SC2A 3FGPA 1YXMA 4YPOA 3L7LA 1RR6A 3MCUA 2DWUA 1XP5A 1IUNA 5F4BA 3GGPA 1E3LA 4ZQHA 1H3EA 1W8DA 5AVOA 4QWMA 5B53A 4Q9NA 1TQDA 1QLWA 1TZBA 5K8LA 1WE2A 2JJMA 1NNSA 3ANMA 3DDHA 3P1JA 4IQ4A 3O9ZA 2MHCA 4QAJA 1FFHA 4EO4A 1YFJA 1QFMA 2D2FA 2B69A 1RAEA 4F1JA 2I8LA 3BIJA 3HO6A 2PUVA 3VHXA 2NSLA 3NJRA 3M5DA 1C7QA 1PQ4A 4FFBB 2GM3A 4JUDX 1D4FA 2BKAA 1WCIA 4OYHA 3RAPR 1D1QA 3T7CA 3WG9A 1FIUA 1E5DA 1OX4B 4UU1A 1TM4E 2C9DA 2WTAA 1H8HD 2D3WA 4D8TA 2HJVA 1NHGA 2FG7C 3IHWA 1KQGA 3HI4A 4YUVA 3VO8A 2DHDA 3UTCA 3NIWA 4LRXA 4MP3A 5E0OA 2XUQA 4HDOB 5HR5A 1PK9A 5KNDD 1CS0A 1QU2A 4NECA 5G2OA 3FKSD 2XVAA 5HS4A 4OLBA 3PCRB 5D01A 1E1NA 2GHRA 2FY8A 3AHJA 1ZGCA 4G8BA 5GWXA 5KJEA 1RKUA 5K01A 1UPUA 3M81A 3OU6A 1KJZA 4ECAA 1UAYA 1ZH2A 3BERA 2HEGA 2J3HA 3QOYA 5JYCA 3CH6A 4C4PA 2GNPA 3T35A 2ZBVA 3GNTA 3LHKA 2YWCA 4KAAA 4D0LB 3AY7A 1AGYA 2B3DA 2QTAA 2XITA 3GNSA 3KUCA 2CLLB 2G0AA 3KV3O 3DBRB 1Z6GA 1L7EA 3A4IA 2VOEA 1O3YA 3VDXA 4BP3A 4FB4A 4YMTA 5L51A 2SKEA 4Y98A 1QQ6A 4XGQA 4ZOLF 4N9WA 2IYEA 2IX3A 3AF0A 5KQMA 1NW5A 4J0HA 3HV0A 4TKVB 4CL2A 1WEHA 3MSCA 1DEOA 5FL3A 1F8YA 3G82C 4HGOA 1KK0A 4I1RA 5A5FA 2C9YA 3FDZA 4FK8A 3AIIA 1NXQA 1E1QD 5GGXA 1T0IA 2MJLA 3KXKA 1ZINA 1GILA 1XMVA 3E23A 2YV2A 4DTIA 1KFEB 5GINE 2YQ4A 2V6GA 3CLTD 2XE4A 4GH5A 2OYCA 5A7GA 3EIQA 1Y6GA 1L7BA 1KORA 3AZOA 1U3FA 1ZUIA 3KR2A 1NRJB 1ESNA 4X41A 4JVSB 2QX9A 3QVWA 3SPXA 4RVHA 4Q3AA 2ZSKA 1UZNA 4M1MA 2ASEA 3BGVA 4NV0A 1A2QA 4OV6B 3WXMA 2WR8A 2JH8A 2VPYA 4BQNA 1THGA 4U63A 4KE8A 4B6GA 2O5EA 3JQEA 2PXAA 1QH8B 2WIGA 3LCRA 1QP0A 4DMHA 3W3ZB 4EKEA 4ZCPA 1RT9A 1IVNA 3PR1A 4J90A 2CJFA 4XASA 5LMZA 3NDPA 2CY0A 2DSTA 4HH1A 4NZMA 4RSGA 2IOHA 4TM7A 1XU4A 1SK9A 1ZG3A 3I1FA 1WB5A 2XCIA 2PCJA 5DGXA 2PXXA 3V97A 3IAAA 3IR6A 4C06A 1MHTA 4ZEOA 3U1TA 1I30A 1YZUA 4OBWA 2BGKA 3E9DA 3S81A 4YC7A 1QE0A 4GWKA 5AW1A 2V5UA 4RK0A 1HE1C 1M1ZA 3ZX5A 2HY7A 4DR5B 4J0EA 2JI9A 2M32A 2VJPA 3RDPA 2X2OA 3UXHA 2BR4A 4CLDA 1OGYA 3OFJA 4DQLA 4H18A 1I10A 2EWMA 2HKIA 5IM5A 1CRPA 2WFAA 3RVKA 3DEIA 5LP6F 2MYTA 2POCA 2YFQA 2DOKA 4UNQA 3SI7A 3VPFA 2AG8A 2Y1WA 2I4LA 2QNIA 2FE1A 2ZRPA 4K46A 4RY8A 4BJHB 2J33A 5A3RA 2I3ZA 2XQKA 3ASZA 3U40A 4GFDA 2G1UA 2O2IA 3NHRA 4YECA 4AAYA 1CCWA 1DZIA 3W5JA 1RS0A 4BEBA 1F6DA 1O0BA 1ND6A 1G4AE 4IIVA 1W2HA 1GRQA 3EIFA 2WUEA 3BRWD 5IN4A 5DNYB 2EV9A 1TD1A 1F3OA 1XZEA 4LRYA 3PQ6A 1MHPA 1DZ3A 2BL4A 4Z2YA 4M4SA 4H2DA 3C7AA 4KIGA 3RSLA 1K3FA 3S28A 4PAWA 1U11A 5AJWA 4FS3A 1IM5A 3OQBA 3V8EA 4B5LA 3R3ZA 3QTLA 1Y34E 4HWRA 4RK7A 1XK6A 4H0FA 3GR6A 2XKJE 3IAHA 1G1AA 1ODLA 1YIAA 2OQ2A 3OG9A 2IWRA 3IIJA 3GC6A 2BMAA 4DM3A 4OAPA 4LI3X 3H2JA 1DL5A 1KI9A 2H8KA 4N5MA 1AMOA 3SEFA 3BE8A 4KACA 3MT7A 4BO0A 2OHXA 1MO5A 3CINA 1HUQA 3ONNA 3SEQA 4KFUA 4FGSA 3I72A 5HRUA 1E7WA 1A77A 3JQDA 1FDIA 2Z6AA 1NPDA 2BMWA 5A9SB 1IZZA 5TMDA 3F7OA 2Z30A 4MW4A 5B6IA 2X13A 2O0HA 5GONA 1DAOA 2AEJA 2VT2A 2AF4C 1GL7A 4IQFA 4J7AA 4EB6A 5K0GA 3I2JA 5EOVA 1PT9A 1NGSA 1VJ5A 3C6BA 3FX2A 4GICA 3QXSA 4X8LA 4BKQA 2PKYX 2ERCA 3DLPX 4X3PA 3ZX4A 1J20A 2Q1SA 5MFPA 4U3JB 3BXOA 1XZLA 1A9QA 1GN8A 3LQRA 2YHAA 3ZGOA 2P0EA 1L7MA 1JAXA 2J5BA 3KLMX 2H1OA 1PW7A 3X2EA 2J3QA 1VLZA 1POWA 4L0DA 1Y1SA 4Q7LA 5EZ5A 2PWZA 3JD2A 2L42A 4J0GA 5LA6F 5KSWB 1G38A 3C1OA 1BDBA 1QM5A 1PG5A 2Z5GA 5GAJA 4DLLA 3O94A 2IDZA 3OKPA 1UBMS 1Z07A 2D5BA 1YVEI 3AJRA 3DO5A 4FP9A 3OM1A 4I6GA 1XF9A 5AK5A 2WKQA 1XK7A 3I42A 2D6FA 2MSEB 4GXNA 1CDEA 4C14A 1RWVA 5DYTA 4QGHA 1JHXA 1MDBA 4KQMA 4IHKA 3K9FC 2CNWD 1CX9B 4RJTA 1ZRHA 1EE1A 3G13A 4BEJA 1HA3A 1VFNA 3W9UA 2YXBA 4NZYA 3T7AA 4DDWA 2QR3A 5CXQA 2C2WA 3LFTA 1AUOA 1IN4A 1U8TA 2PUBA 1M66A 1OBOA 3M6UA 2Q8NA 4RL4A 4UDOA 5TF4A 3RVBA 3UN1A 4UKDA 4N01A 1DIBA 1OZAA 4OYYA 5JZMA 1WP4A 1C50A 3L05A 2B94A 4AYWA 4LGCA 1QIHA 1LWNA 1U5AA 2SKCA 2RBEA 1YQGA 4JKOA 1S4QA 3H9CA 1PL8A 3WB9A 1VPTA 5DMXA 2Z6UA 2NTVA 3ZZMA 2CLKB 5K3FA 4EPRA 1TOAA 4KYIB 1Z3IX 5C7IO 3GPDG 3NIBA 4ZCIA 4G1MB 4E13A 1KRHA 4WOPA 5KWVA 1WXXA 2X2EA 3ZD8A 1L8OA 3C8DA 3GELA 1T6BY 1CUCA 1P1RA 2CL6X 3F9CA 4X45A 3LUDA 1E2PA 3ZVLA 4AYXA 3GGCA 1A1VA 3SZ3A 4QRHA 4Z7NB 2WSLA 3OEEA 1RCUA 3PQ3A 3ST7A 1NY5A 2J9YB 4XTCS 3KT3A 2W22A 5I9BA 3OSUA 1CW2B 4XGIA 1IE3A 3KQHA 2D59A 1Y98A 3JQFA 1J00A 2E6UX 4PGHA 4M9SA 2V3CC 1HC7A 3FI9A 3OVMA 4YO8A 1M74A 4O33A 5H68A 3EW7A 1PNVA 3G89A 4DG8A 1X87A 1FTNA 1IVSA 5DBEX 3EVEA 3I6QA 2MR5A 2B99A 3F6YA 3C74A 4H6XA 2PR7A 3LI2A 3ZD7A 1ZHOA 2MOKA 1JSRA 2BJHA 4TZKA 1HT0A 1SUBA 4NK4A 4RK4A 4ZALA 4KXFB 4JB0A 1GAXA 3RUEA 1HK7A 4BX2A 3AF6A 1V8FA 4LZOA 5TSDA 2P2NA 1NMYA 3AKCA 1XRQA 4G9GA 2Z9CA 1GKIA 1UWVA 4XJVA 4TN1A 4B7AA 2C9MA 3FRJA 3BGOS 3G5MA 4RZQA 4A91A 3LPMA 5CB4A 1CF4A 1Z28A 3ZHYA 1K75A 1WNFA 3DFIA 1JDBC 5FFMA 5LQSA 4AXXA 3CIOA 1CFJA 3E1KA 4G1FA 3CE6A 5AIAA 1TEVA 2IXGA 4RK5A 3RIXA 2AOUB 5LP6C 1U3VA 3H2KA 2NIPA 2PU7A 5E9JA 2FPIA 3SIWA 3WGVA 3FXAA 2CV2A 3BMCA 3RU7A 1G8KA 4WCDA 3RS5A 4QFBA 5I7RA 5G41A 5EWMA 1W73A 1WO8A 3QV1A 4V0ME 3TBHA 5BWBA 2MYPA 4M8LA 3BORA 2PPLA 3GBPA 3OU7A 4FQ5A 1RVV1 5DBGA 1QHIA 1X7HA 2GXQA 2YXNA 2ZUUA 2G1PA 2IXTA 1SC1A 4L8GA 2V55B 5LB4A 3KT0A 1V4VA 5MHTA 5ECWA 1SBHA 3IE2A 3V4RA 2CNOA 1Q7BA 2BGUA 2IHYA 3TNJA 3B48A 4ZRDA 1MCZA 2ZJAA 1R0LA 2XNJA 5HZKA 4EHDA 1AIPA 2I99A 2OHJA 3L8EA 2JIOA 1ZX1A 4NMXB 1PG2A 3F78A 3PQ8A 5CA1F 2FDXA 4HQNA 4WV3A 3LY5A 1CRZA 4RF5A 3W7AA 5ARBA 2B21A 2IRWA 3IQGX 1PNTA 2ZRFA 4BMNA 4GPD1 3U26A 3W9BA 2F3QA 5I7HA 2XYHA 3GFQA 2OM2A 2C8KA 1USVA 4Q01A 3M3HA 3JATA 4JUAA 5HK8A 5TC4A 5DV9A 4W7IA 4UZEA 5PGMA 5IM4F 2MSKA 1RJEA 1RP1A 4IIDA 2NYVA 3L0BA 1XX6A 3FUTA 4MULA 4FYIA 2ZSBA 5JT1A 2IPLA 2Q4DA 4JS0A 2QRNA 5FEMA 1EJ2A 3N9IA 5ALOA 2PMCA 2VTEA 2BFFB 4EMSA 4FYVA 5AHOA 4GI5A 1MUUA 3CTMA 5E4FA 1H4VB 1MAUA 4HH4A 4LDPA 1Z7WA 3U17A 1JG2A 1CB7A 4BB9A 1OROA 3TDMA 1VC2A 3P9PA 4L6IA 1JR3D 1A4XA 1RYYA 4DUYB 3BFJA 2X6RA 1K86A 4IG9A 3NLLA 4RD6A 3E22A 4N3NA 3X1MA 2A5DA 1EP9A 2R86A 4AJ1A 1RYBA 4G0MA 3QEOA 1GKKA 2O2YA 4CMIB 4IIGA 2I6GA 3GWZA 2ORVA 4B4KA 2P91A 5DXJA 1GQRA 5I4IA 3QMWA 3S99A 4OB8A 2A9RA 3VKWA 2CK3A 3F0TA 5I7AA 4N8EA 4EI9A 1DRWA 5JYDA 4EX6A 2ECKA 2WHXA 4MQBA 3UMGA 2JFUA 1NG9A 4CCAA 2GF2A 3LPNA 5FBZA 1XCOA 3UAOA 3AUKA 3ZU4A 1BCSA 2GAIA 4J91A 4C05A 4LC0A 1KBOA 3LMKA 5LDGA 1ID1A 1O58A 2UZAA 3PDIA 4CQMD 2E49A 2JGLA 5SZIA 2H08A 3QP9A 2CJWB 2A0WA 3BZUA 3M6WA 4QOSA 3B1XA 5EL0A 3RR2A 3WOHA 4D44A 1M75A 2VFAA 3FG9A 4PX9A 3FW1A 3QF4A 1DKLA 3ER6A 4I3FA 1EQ2A 2COEA 4YREA 1ONNA 2VT3A 2PRKA 4Y9SA 1LQUA 1S8NA 2IKSA 2YWGA 1A27A 1QKIA 1TT7A 1EU1A 1OVMA 2NUTA 1NI4A 3QYFA 3T54A 2EZTA 2V97A 4BAZA 2B6HA 3RHTA 3ICPA 1ANKA 1PWHA 4MK4A 4WZBA 1N6IA 2Z09A 1XGKA 3DCYA 4L02A 3NHMA 4DMGA 3Q12A 9ABPA 3BL6A 1SNYA 2HYIC 2ZDQA 3DZGA 4MGHA 1XTZA 1UOPA 1WBBA 3BMCB 3MOSA 1JJIA 1WABA 1U5BA 3O2SB 3MTGA 3Q5EA 1YKSA 4QECA 5LU9A 4ACAA 4RDCA 5BUQA 4RY2A 2FPXA 2OGZA 3SEZA 4B3HA 2FDRA 3C15C 3HXPA 1TZKA 5KNLA 3ZH2A 3HS3A 2FJUA 2FGKA 1XI2A 3D1VA 4PZZA 1UXKA 3S2UA 3VAAA 1OXUA 1TTQB 2C5BA 2EQAA 5FNZA 5IKPA 3V1NA 4KBFA 2NZ2A 3HJAA 2PVSA 1XTTA 3LUAA 4D25A 4G86A 5A1JA 1F3LA 1T9GS 2QS9A 4Z3OA 4YJ3B 2Z6QA 1PZEA 1U4NA 1TZJA 1VECA 2AQHA 2CCGA 5MFZA 2GVDC 1HSZA 4O2AB 4P53A 1HTWA 3DC2A 2D1SA 3VUFA 5JY6A 2GYWA 2ZZKA 1YACA 3Q7TA 1ZQ9A 4BGIA 3T34A 3AF3A 2RGDA 2RK4A 1A1SA 3MWYW 3NO4A 4JIMA 3W9SA 5EWLA 4XCQA 4Z7JA 3S8MA 3N2NA 3PC8C 4JLBA 3LIIA 3IDQA 4BMSA 1KJ9A 4YIKA 3FSGA 2ZBEA 5IKMA 4EUNA 3CRW1 1DOHA 3PXBA 4KZPA 4FD3A 2ZSUA 3W5VA 4U02A 2WNHA 1FYDA 3MJDA 4YV0A 1EUYA 3ZXSA 3E1SA 5IAGA 3W06A 3I6IA 3HL4A 4DLSA 3IH5A 4RZSA 1OTHA 2JFGA 2FKNA 4US1R 4UUOA 1KK2A 3GDFA 3TLJA 4EEKA 4G0YA 1UOQA 1GU1A 1DFGA 2PO5A 5SV2A 4DDMA 1WZCA 3ZCTA 4ZTUB 3QBEA 1EDEA 1K8XB 1RSZA 4JKIA 2PBRA 4UZSA 4O0LA 3MJSA 1LNZA 3DW3X 3SG0A 1G6KA 2E4YA 4YLYA 4HMQA 1RJGA 1BWQA 1IM8A 3JVDA 3OQPA 2SKDA 4YJDA 4CG2A 3QKRA 3LZDA 4PRLA 1ZK4A 3T1OA 4DGQA 2IEYA 1W47A 3ETEA 4WLFA 1IRIA 4MS1B 5CLFA 5AVWA 1CC1S 3B9RA 3E48A 3A1CA 3FPCA 4FJ0A 3E3NA 2QZZA 3FE2A 3OIUA 3GRZA 4P4UA 4X3OA 1F2UB 4LWQA 4N8SA 4X60A 4CQNA 1EESA 4HX2A 3WISA 1AM4D 4DSAA 4POOA 1P0QA 4FDMA 4J1QA 4R1UA 5HKLA 3G23A 3CSDA 3G8DA 2A78A 5CNMA 5ILQA 2HN9A 1OB2A 5FUQA 1ZJJA 4ANFA 3LYUA 1O08A 2DBZA 2IU4A 5CA0F 4RWZA 1U2RA 2NMVA 2FWAA 2WD7B 3PD1A 1ZKDA 3ISVA 4L8FA 3B70A 3PG5A 4R4JA 3L01A 2XQIA 2ATIA 3W6NA 4MYHA 4QU8A 1EDZA 1ZMBA 2WJJA 4WW0A 4L0MA 2QZPA 4UUPA 1X7YB 5TE9A 3W79A 1TCBA 4WGGA 5HS6A 3C41J 4ED9A 2QW0X 5DX0A 4TV9F 2WWIA 3TRKA 4HGZA 1NVWQ 4MZXA 2OPHA 4UUQA 5KQRA 1MRNA 3L7JA 2GT1A 4EVIA 2HT6A 3KSDO 4P1ZA 3K9HA 1AU9A 1UDCA 1BWSA 3AG6A 4PYOA 5H0IA 3OKFA 3AOEC 3ZLJA 4IBOA 4Q7QA 3H3JA 2P69A 5B7GA 1QC5B 2IH4A 1GT91 1I94B 2W93A 4G81A 4IMIB 4U2DA 4X1KB 4QTXA 4YIHA 4QXMA 3P32A 3Q98A 4JUIA 1XHFA 1CR4A 2ZSDA 3CNNA 4XPIA 1ZI8A 3BXEA 3FHLA 2VJAA 3CMMA 3NBMA 4H17A 3FSGD 4DL9A 4KQWA 2RBGA 4XVUA 3D6FA 1IB6A 1RCTE 4BNVA 4J16C 4YUZA 3PUIA 1HBJA 3R0VA 4KPUA 4ZZ3A 4MUHA 4I19A 1UPCA 3H5NA 2X19A 2C9ZA 1S1MA 1RXUA 3PDUA 4TT3D 3KEQA 1DB3A 2R1VB 5KJCA 1GRVA 2A2ZA 2HQSA 4L4UA 4MVJM 2A4MA 2VJMB 4NCNA 2VRCD 3GCXA 1M0EA 2ZJZA 1J99A 2B37A 2EBWA 3F2VA 2EQBA 4Q4HB 3KQQA 1EX7A 2WWXA 3X1YA 2CDRA 4LWZA 3UHJA 2OBLA 3QFCA 4BMDA 5C8YB 1AMUA 4IZOA 2DLNA 3VC3A 3AL0C 1SCUB 4K9RA 3DKVA 1PJ8A 4O2BB 1UADA 4LC1A 1P19A 5ESDA 2NAFA 2J9GA 5F1PA 5TY0A 3P2YA 1WLSA 1XZDA 3OURA 2F4VB 3LY8A 4PZ0A 4JLAA 1N8KA 3MCWA 2HPAA 3E2IA 4MWBA 4NVRA 1A2BA 2MSWA 3ZI7A 3ICVA 1Q2XA 3A9TA 4YFVA 1RHJA 1GA1A 3C0KA 3JARB 2JFYA 2JIZA 3U37A 3M4YA 1SQFA 4EVSA 4V3CA 5ALPA 5IF9A 5DH9A 5KTSA 4MGEA 4WCFC 4C7XA 1VL5A 4L08A 5BV0A 3KSRA 1QXSA 3U7QB 5BURA 4L3WA 3DTVB 1TEHA 4BVHA 1EINA 3Q7IA 3BJMA 1K8ZB 4ZJPA 1PD1A 2UZ3A 4HT3B 1FU4A 3T5BA 2VK2A 1AF4A 3RYTC 3BRCA 3QPAA 4I4CA 1E8DA 5AVJA 3G85A 4DXAA 2MINA 5JEDA 1SB8A 1PQUA 2OSVA 2PD6A 2FZLA 1E79D 1JEAA 3PI6A 5EKXA 4O08A 2P2CA 1J2TA 3W2FA 1DMSA 2ZR0A 1DKPA 3I6BA 4DV6B 4LQCA 4ZO7A 3UB4A 1ZVJA 3RIHA 3DVAA 3X1KA 2OQVA 5A6SA 1GADO 4MUEA 2W0SA 1ECJA 1EXWA 2YC2C 1NOKA 3AFIA 3I9NA 5A9RA 2D62A 2WDPA 3E3LA 1R6VA 1FLNA 3ETHA 4JI2B 4Z0PA 3JQAB 1YHYA 3EWNA 3VR5D 5CFLA 3GCZA 2QORA 4FZJA 2C00A 2AZTA 2FWBA 3EWSA 4IVRA 5J40A 4YWHA 1K7CA 1X8LA 2O7QA 5FYDA 3ZNNA 1ODCA 1U2GA 2ZITA 3W6UA 1EXVA 1ORWA 1E4EB 2BRUC 4AZ3B 2GB4A 1GPJA 1LY1A 1Q1AA 2JIBA 1EQUA 2RHRA 3GAFA 4MVJH 2Q9UA 3WJAA 1QO0D 4PQGA 2GUWA 4TGLA 2NU6A 2ZBPA 3QUSA 5TR9A 3U4CA 1XEFA 2HIMA 1GQSA 1P9WA 2PZAA 4TX1A 4J03A 2X8JA 4NFHA 1K2VN 2VDWA 3ME5A 4URXR 2A9FA 4FR0A 4DVGA 2VCYA 2LGJA 2FU5C 1I2BA 2ZYIA 5BY2A 3I6MA 1LK5A 1NWHA 2NACA 2VAXA 2ZDHA 2EOAA 2C29D 3PQCA 1U4OA 1YFZA 3DT8A 2Q3BA 5ELLA 1TTTA 3H4MA 2QQFA 4RH0A 4CM7A 4AUNA 1DAEA 2QT1A 3IPLA 5E2AA 3G2MA 4MVJP 1MO2A 3NHLA 3GDHA 2XAUA 4HLDA 3TQCA 5ILOA 2H00A 1K97A 3I04A 3CNOA 1MRZA 3TJMA 3K73O 1ZIDA 5HKAA 5AJUA 3Q72A 1KKMA 4N0QA 2E37A 2O2CA 2YJTD 3TOZA 2PLRA 3MYRA 3W8DA 4QYSA 4ES6A 3ODPA 1UFRA 2NVUB 5EJ8A 2NO0A 1NP6A 2R8RA 4MJXA 5E0KB 4HNVA 5K3OA 4CLOA 5J47A 2DLDA 3QEJA 4K3VA 3INNA 4E15A 1E9DA 4AG6A 4P3NA 3A05A 3EZNA 3W7VA 2XZLA 1FFYA 4K1LA 2QG9A 4KXLA 4BZWA 5EIBD 1TUGA 1ZK3A 2WJZB 1SKQA 5AW4A 1XWFA 2BFDA 3RYFA 1HYEA 1DLIA 1QH8A 5TPZA 5JPIA 1PU2A 2I65A 2Q50A 4RSHA 2BFFA 4DY4A 4W9RA 4MXDA 3RJTA 1I2DA 3ZD6A 1XA4A 1E1LA 2ACKA 2GZ3A 2VLBA 3QY0A 3UENA 1MABA 4CM9A 1SBZA 2PNJA 4Z86A 5CB8A 2GKSA 4OHPA 4MGYR 4DPKA 3GFFA 3RT9A 4XYLA 1KE2A 1WCWA 2IITA 3NGMA 3OIGA 2ZBGA 3SHQA 3FTPA 3QXJA 2IZ7A 1HORA 2R0QC 3LCJA 3F4BA 5FOQA 2NSHA 2XGJA 3BVPA 4RS4A 1FW6A 1XZGA 4DJ5X 1NLYA 2O1SA 1G20E 2V96A 3B85A 2R1ZA 4TTSA 2VI5A 4EB3A 4UQLA 4L7VA 3THXA 3AH8A 3EXEB 1X2EA 2NNLD 3H5AA 2Y4NA 5KCMA 1O9BA 1LLDA 1NFQA 5CA0A 4AC9A 4CL3A 5CLIA 1EWVA 1UKYA 5LNK1 1RQLA 5CDYA 1SIBE 2CZCA 5DGTA 4J0JA 2O7NA 3IVRA 2WFLB 5F9MA 1DV1A 3DOFA 4RMNA 4AT1A 3FPEA 5L9AA 3DBIA 4F2HA 3D2CA 5KNBA 1KZYC 3ROPA 5IANA 4XXHA 2Q2OA 3EXFB 4MOWA 3A6ZA 3GT4A 4OL0A 2VAWA 3K6KA 2FEMA 5EUQB 4ISCA 1ZA2A 3U61B 2ODPA 3OT1B 1M3SA 3ADBA 3MJRA 2YRXA 1C9MA 1QV6A 1UL1X 4QREA 3M34A 1BA2A 3OPVA 1FTQA 1ONSA 3NHZA 1DCMA 1NNUA 4Q93A 4U9UA 5IEJA 5KYGA 4HSEA 2CFTA 4MWCA 2Y8EA 2B78A 3N3BC 4MRVA 2FN9A 5FIUA 1G0NA 1NWCA 3MWEB 3O4JA 4A27A 1CS0B 3C4QA 3UJ3X 5IJ9B 5CB0A 2BH9A 1NKVA 1YU9A 2WBLC 4DIDA 2QTRA 2FJPA 3KKPA 3BJZA 1PZFA 2C2BA 3D2AA 5CDUA 2ZLBA 5CG2A 1NG1A 5JQGF 3D6AA 3B5EA 1CDOA 1YZQA 3A1FA 3P45A 3LE8A 4C88A 4LKRA 4M60A 3IR5A 2XXBA 3KP1A 1YDMA 2IYFA 4M6WB 4BP1A 4LVUA 1QLHA 4TKLA 4IWXA 2GETA 4MQ6A 2WIJA 2JFXA 1HMPA 3GCDA 2EIXA 3A2LA 3NUQA 4G0OA 4TZ0A 4FMPA 5AHRA 1C8LA 4URWR 2BEJA 3H7AA 1IK4A 3ILHA 1U2SA 4LMPA 5CT6A 4BNGA 2P9ZA 3HKBA 1SXPA 2NM0A 3CLVA 4E09A 1OBCA 2EC5A 2IOFA 2Q6OA 3OZUA 5C8XA 2F2TA 1SELA 4RJLA 4UFPA 5KBYA 1CQPA 2HU5A 4FEGA 1SM4A 3SXUB 4NCKA 4HB0A 4IGEA 2DR3A 4FMBB 1RE0A 2A1IA 3PVZA 4PTZA 4DCMA 1GTSA 2QVLA 3DLTA 4R7ZA 3MXOA 1QZ3A 1ZCJA 3S2EA 3WGNA 1JZSA 2W4QA 3ZKWB 5HUHA 2ESRA 4QPJC 1SA0A 2ZE7A 4G0ZA 5C1IA 1WUIS 2HK8A 4KSCA 4XPIB 2XE7A 3N59A 3ZWQA 5BP7A 1FNNA 1N6OA 2OOSA 2YV5A 2H18A 4CV2A 2E5WA 1FVFA 5H81A 2GCOA 3AMVA 2QTZA 2QZ4A 2OZPA 4FGKA 4WT7A 1W44A 4YCDA 4DJTA 3KTFA 5JISA 4NQZA 1BN6A 3B60A 2EL7A 4YCCA 2J6HA 3ZWAA 4KLCA 4YQFA 3PNQA 5C3UA 3H8SA 3AVWA 4MV6A 2JK1A 2JVKA 4ZVUA 2R5WA 4Z4FA 3HA3A 1NVBA 2Q1XA 3SMQA 5A7FA 3W3AA 3A7DA 4WZAE 2J4FA 1DEAA 1P7ZA 1MR3F 1BMFD 4MRPA 5KTPA 2R6AA 4QPDA 1V45E 1U80A 5FBHA 4FC6A 1DT3A 1WKBA 5IC6A 1QYIA 4KN6A 1B8PA 3CTPA 3H8WA 3HBFA 1J2YA 1PUXA 2JFZA 4R16A 5C8YA 3TMYA 3ET5A 4P80A 3R7WA 4LCEA 4BTLA 5J43A 1GQFA 4ZT6A 5JD5A 3N6RA 3R6WA 5AVYA 1V5GA 2OD9A 2DH5A 2OLKA 2YIDA 3L41A 4IX9A 4D97A 4JMPA 2NP6A 5DNDA 1QNFA 2CV0A 3I01M 1E58A 4RFSB 4X84A 4MW5A 4RAQA 2QTBA 9MHTA 4OKSA 1NUUA 4LNUA 4ITRC 3CF0A 4ZEVA 3DV0A 3MCZA 4HC4A 1Q7EA 1AG9A 4MUXA 4X9XA 2P4HX 3HM9A 3K6SA 2LKDA 4HNAB 4PCAA 4DUPA 3EEOA 3HDJA 1JJFA 1UODA 5KU7A 3NP9A 5KPJA 1PJ2A 1E0DA 1PEYA 3DPSA 3OT1A 2PYZA 2FMXA 2XRZA 3F6RA 2BUCA 2YZKA 4UATA 2C61A 4XTRA 4PHTA 3A25A 3MF4A 1LEHA 4IM7A 4R8MA 2VCHA 3FJYA 3MWFA 4TRMA 4RCZA 4IDAA 3GIWA 3RBXA 4EK9A 1FNSA 3IQDB 4N5NA 4HAUA 1JHQA 3ZW9A 2A7QA 4AXBA 5EUMA 1LDEA 1UWLA 2QA5A 3DTYA 2BP7A 2FW6A 4L27A 4RPKA 2DFVA 3AVQA 1KSGA 4HVCA 2JGIA 4Q82A 2V54A 2XMPA 3EOBI 4BYMA 3K32A 4E7OA 5K0LA 1YS1X 2JKZA 1TC1A 1T5BA 3R6DA 4MRMA 3C3JA 4X90A 1LLFA 5KHLB 5FT9A 2WWVD 3EB9A 3SZRA 5BSMA 3VHQA 2WY2D 1MO4A 4YP9A 4L9RA 3W4KA 4D9JA 5ANRB 3V4VB 4UHBA 8ABPA 1Y7PA 3HDYA 4NBLA 1GAJA 1V5EA 3TINA 2V7UA 2VJMA 5A71A 2IPNA 2WAMA 4EPYA 4YI5A 2FAXA 1Z82A 2E3JA 1A3CA 1LX7A 2Q3EA 4KXXA 4W5QA 1I6LA 1LLQA 1CV2A 1QZTA 1W4RA 3E2PA 3RS4A 4JIGA 2QX8A 5IT5A 1OSNA 2GJ4A 2JHPA 4I4TF 4A82A 4ZP1A 4GOLD 5CB4F 5BN4B 3GFRA 2ZXEA 2J3JA 4HPXB 1GFWA 2QYOA 3K2IA 5DCYA 2DFNA 3N1UA 3HYSA 3VOBA 1A5SB 5FR2A 1HLPA 1DPGA 1T2EA 3OWXA 4I50A 4OJYA 1U9CA 3IV9A 2AQKA 4H1WA 4NFSA 5HJ2A 4NZZA 2ZUFA 2A92A 3UHFA 2RGCA 1ZGJA 3E9NA 1M7GA 3MBKA 4CW7A 1Z8DA 4GLOA 3UUFA 2ZIZA 1TX4B 2RGNC 1U2DC 1F12A 3G2JA 3LECA 4NJEB 3RJ9A 3GLFA 3PP8A 2Q2NA 1NAIA 1QH0A 5J4LA 5JWRA 4XI9A 3EG5A 4FGLA 1SBTA 3EHDA 3A6HA 4M0EA 4M46A 5F2EA 2WZDA 4J49A 3E9MA 3IT1A 3AYZB 4KDFA 4JP2A 5F2KA 3P9ZA 4FDUA 4C7BA 1P4GA 4DT1B 3UWSA 5T64A 1Z8NA 3P9IA 4YEDA 5AVUA 4YJ2A 1TA4A 3KX2A 1T4DA 2NX2A 1WCXA 5JALA 2WKSA 3DFUA 4WL0A 5BWNA 5D5QA 2BEKA 4LOIA 5EVCA 2P6PA 1PJRA 4GM4A 5DWVA 3DGFC 1R0BA 1JHRA 3EFOA 1R5JA 4NYIR 1NMZA 3WYCA 3BF8A 4FB5A 5AVXA 2BRUA 4Y2HA 4ZYWA 3SD7A 4QDXA 3ZQKA 4BFWA 3CX8A 3PC2A 3OC6A 2AJLI 4FFSA 3GLHA 3PA6A 2I6TA 4P34A 3IKJA 3RRXA 5JCJA 2CUTA 3RARA 3ZK8A 2QM3A 1T1IA 4NYMR 3CKKA 3DP7A 2XUJA 3NHSA 3TK1A 3O2NA 4GE3A 1L4KA 3WGZA 2HX1A 5D85A 1RRPA 1JFTA 1HQKA 1ZONA 5DMHA 3PUYA 5BRJA 4S24A 1XMXA 1KY4A 2DVMA 4TXLA 1YRAA 2G5PA 1SQ6A 3L0OA 4GM0A 1B14A 5FWYA 3C7CB 5IT9A 4KV9A 1QOZA 5KMGA 3W5SA 1Z6TA 3ZYCA 1W0JD 3CH5A 4RENA 4UREA 1A4UA 2XUDA 5I4CA 2AL7A 4DLAA 3T0GA 4B3MB 1FRZA 4BWVA 2VHUA 3SLKA 2BEVA 3N0RA 4RHFA 4E46A 5DM4A 5GTDA 3MAAC 5EEHA 4NQRA 3ZJ5A 3HB0A 5D86A 3G9UA 1QNLA 2XKAA 4N6NA 3RW9A 3UMYA 1C80A 1SVLA 3TW4A 1GV0A 3ZHOA 3LXXA 5LWHA 3UAZA 4B7CA 3NDJA 1DC7A 4UM9D 3S4YA 3OQJA 1JEQB 2E87A 2ZYHA 2CVHA 2CNNA 1IONA 2C5HA 5FI1B 3U7RA 4RHUA 3IQEA 4FFVA 4WBNF 2HHJA 3C7KA 3THWA 3C6KA 1X14A 2HWKA 1J0DA 3KZVA 3T94A 5K0SA 5I7FA 4MUBA 1E7YA 3L7YA 5CB6A 4AICA 1WZNA 2AN3A 5CDGA 5JZ9A 1GTMA 3W5CA 2UUAB 3HKDB 4QNMA 2YYZA 3VU9A 3THOA 2PKWA 2D74A 421PA 4R0VA 2DR2A 4OHFA 4HLUC 4OQFA 4RK1A 3S2FA 2VDKB 1Z6AA 4OXNA 3SAJA 1O6BA 2BD0A 3X3HA 1GNRA 1ZGZA 1FSZA 3I37X 4JAVC 3O84A 4HWOA 2VPQA 3CISA 5ERXA 3D3KA 1WDWB 1XEXA 2GAFA 2IU0A 1TC2A 3VVBA 2P41A 1PF7E 4GW3A 3BJEA 3K0HA 4K05A 4XD7A 5HIMA 4MEJA 2XDYA 5ELMA 1P3JA 1EB8A 1R0CA 2F1IA 4KR7A 3TVYA 2ILTA 1OYOA 3FLBA 5LPNA 4XAQA 2OK8A 1ND5A 2QT0A 2AH5A 2GX6A 2H5EA 1GSHA 1Z74A 1YQEA 3C3YA 3H9UA 3ZGLA 2L2QA 4C3ZA 1CKEA 2D4AA 2D13A 2WUWE 3QYPA 3E4DA 4M83A 5AK0A 2OFOA 1AHHA 4AN1A 3NYWA 3SR0A 1H8HA 3ETDA 4QVIA 2DECA 4NV3A 2R6HA 2ISCA 5HBGA 1I7NA 4C1NA 4G9BA 1XQYA 2M9MA 1IG3A 4W1QA 4D4LA 3UGQA 3FNEA 4AKSA 3VNUA 4Z0HO 4F4CA 3D4BA 4BKUA 3IRVA 4B76A 1QIFA 5C8YF 5I6DA 2LWIA 2FPGA 3HNPA 5IZ4A 1ITZA 3DWEX 1E9CA 2JBWA 1RYMA 2G6BA 3C6YA 4L78A 3Q7EA 4FBMA 3KE8A 1XEWX 1H5QA 1I51A 4DIOA 5KOIA 1VL0A 2YVLA 3K5WA 4TTJA 1EK1A 2HHHB 2VJCA 1BOFA 3HBMA 3V3KA 1SVUA 4F3TA 4TUYF 3K31A 4BFCA 1E2KA 1KY2A 1SXJD 2Z4SA 2PKXA 3KSUA 4TZ6A 4UE2A 5T3YA 4NEQA 3MUEA 4QU9A 3CR7A 4LDNA 4ZVLA 3FUVA 3EBOA 4ASUD 3R6TA 4Q21A 2I3DA 3E05A 1WDLA 4C4RA 3THXB 4LDQA 1EE9A 1FSGA 2ZATA 4NICA 1QIMA 3K9QO 4EKNB 1J97A 3O8OA 4F5WA 2UAGA 1Y3BE 3MWGA 4QDUA 3CVXA 1ECCA 3F6CA 1FFEA 1KI6B 4WH0A 1R64A 2Q3LA 3SF8B 1FP2A 4E32A 2JJ1A 2C96A 3GFBA 4YMSA 4BVJA 4BLWA 1VE6A 3MVEA 3GUZA 4CYMA 3RNLA 4ZAYA 4CR7A 3PQ5A 1SVKA 1VJCA 5F1OA 1NLUA 1U0HC 1U8YA 3D7SA 2VJLA 3C5EA 3K5HA 4MDYA 1DEHA 5K8CA 3FCEA 3TCKA 1D1PA 3OO0A 3TKLA 3M89A 5BWOA 3CUUA 3WBBA 5A2GA 4OB6A 1O6ZA 1OI3A 2VR1A 3WLJA 3IXQA 4A26A 4DQDA 4HDAA 4OHRA 4EARA 4WVFA 1H22A 1MJFA 4OBBA 4C87A 1ZRSA 2FZ5A 3HCNA 5E3IA 1GVHA 4AF7A 1V8OA 2BGRA 3M6LA 3LUHA 2IEBA 2X8WA 3I76A 1RYHA 4EKDA 2D1RA 3IDAA 4ER7A 3DF7A 3GT0A 2JIRA 3Q6IA 3VR6D 2GO7A 3BMNB 4UHHA 1N7IA 1QF7A 3J7TA 3S7TA 5M7EA 3V7FA 1N2ZA 4ZV7A 1I7LA 2WILA 2PY6A 4DIKA 1TJ4A 3FDJA 3OLQA 4GM1A 5K0ZA 3U44B 1P1BA 4ZDJA 4DNPA 3HB4X 3NTXA 3QU4A 6NULA 1EVZA 2PJDA 4ZZ2A 3THYB 1UJ6A 2I4MA 3DT6A 4RZ3A 5AOVA 3C3PA 1MX1A 3OUTA 1VPWA 3K0FB 3DDCA 3TL6A 4ND4A 3K9WA 4XWYA 2H4FA 1FMJA 2C3PA 4WZAB 4HFRA 2FF5A 4JX8A 2ADMA 5BSTA 5D5PA 5T67A 3K1TA 3OOEA 4R2LA 1PEDA 3AB7A 3OBIA 3SXJA 5I4BA 1Y7HA 4CL8A 4A36A 4IGIA 1E7QA 4O3FA 3WYDA 5BSWA 3PSAA 4EZBA 2ZVPX 3LSTA 3OPYI 4MMYB 4X92A 1ZIPA 2H1IA 2GKOA 1SD1A 3I9KA 4TTTS 1SCIA 3AHDA 4FOTA 4BLOA 2QRMA 4NH4A 3QX8A 4JSYA 4Q9HA 4F9EA 2BF4A 4E07A 3AFNA 2DLCX 2R6DA 5E9WA 3SOZA 3G9QA 3IUEA 2PH1A 1RQXA 3QQPA 4HYTA 4M1EA 1GPKA 1K7SN 3BQMB 2NZJA 5DHSA 3F49S 4YT4A 1K98A 3KJIA 4WUVA 4BLTA 3CR8A 4YQEA 3RRZA 3WHKA 5F2NA 5K8TA 4DA9A 1KH1A 3WGJA 1U8CB 4DCVA 3P9CA 2I9KA 4AY4A 3VUEA 1YFLA 3N2GB 4X91A 4ZVVA 5EMHA 1ULTA 4CIXA 2F67A 3EUEA 3BHNA 4DMUB 4KUEA 2ZJ6A 4F45A 5E4TA 1BYUA 2DMRA 2I2DA 1ZJYA 2YV3A 2P9FA 3ZZUA 3BQ9A 5I3ZA 1IQ0A 4O2AF 3QIVA 2C9CA 1FQOA 3TZEA 3HRHA 4ZARA 4IVNA 3JAKA 4Z1MD 2GPYA 4BFVA 1MV5A 1EK0A 2ZTLA 4PO3X 3LQYA 1WU7A 5EINA 1X80A 1NF2A 2QJWA 2IE8A 3FD8A 4OM7A 3T3PB 3CGGA 1OA1A 1GZ6A 1NL3A 1B42A 1Z38A 2OO5C 3HCOA 4H7FA 4ZOLA 1U6IA 1DSSG 3S2SA 3KV1A 4TXMA 5H59A 5IFLA 1HEUA 3DMNA 3QJ5A 4BE7B 1QFXA 8ADHA 1Z7YA 3TQFA 3QFHA 3T95A 1XLVA 3AI3A 1E98A 4INPA 4TVOA 4ZGBA 2AMJA 2JAPA 2Q3MA 2R6ZA 4HB4A 3MZ0A 4Q18A 1MP0A 5CP8A 4V02A 3OCWA 5MN6A 4RTSA 1UDWA 4DFDA 4UNIA 2WMYA 1RLOA 4MWDA 3U9SA 2ZIXA 2CNBA 4PZDA 3OE7A 5ITSA 3EBPA 1AC5A 1UXGA 2DBYA 4MUIA 4EFNA 1R0ZA 4G63A 2ZZMA 3D0QA 4PM4A 1QQAA 3OZVA 5C7LO 1Z5GA 1LBQA 4F1KA 1UJBA 3H86A 2SCUA 4WK0B 3DEJA 2PS3A 4ZCRA 2JH9A 4L4SA 2Z4RA 4FHEA 5HPYB 3CLUD 5EKDA 5FQNA 1OFUX 5KYUB 5IAEA 5KIAA 1G5PA 4PFSA 4EYGA 1T10A 4HHEA 2VPTA 5EQTA 4GZ6A 3WLKX 2PYIA 3KCQA 4O25A 3DHNA 2COKA 4BO4A 5EIFA 1UBCA 3NXSA 1SUIA 2QAIA 3PUVA 4KEAA 5CVVA 3D3EA 3OLYA 4WFKA 3E84A 3O2QB 3PCXA 3QM1A 1WUHS 2AEMA 3KOOA 1XWIA 4ETIA 4M89A 4JJKA 4NWIA 1MQSA 1M1YB 1C0PA 3NBKA 3S1AA 1Z3CA 3AESA 3ILVA 1Y6JA 4EJSC 4BN4A 4R05A 3KHKA 2FZCA 4GDMA 3GRKA 4QGSA 4DG9A 4U3JA 2BSXA 2FCRA 2ONYA 2CSUA 3NT2A 2HF7A 1OAKA 2HCFA 4DZTA 4GUAA 1K9SA 3D31A 1PJQA 2VUTA 3RVRA 3WFJA 3GRCA 2FPIB 2O57A 3RQIA 4X97A 3I32A 3G02A 4BE9A 2PQ6A 5GZ6A 4A0QA 1OI2A 2ZYGA 4HUTA 3THWB 1LB1B 4CTOA 2NZXA 2H9YA 4EH1A 3LX6A 2P3QA 3TD9A 2Y3IA 1AKMA 2XGGA 3IVAA 2C7QA 1DMRA 4DN6A 2XTZA 3LZCA 4JASB 4JCOA 4D8VA 2HRDA 3G6WA 1HE4A 1OWMA 2JFBA 4E22A 3U4HA 2RGBA 2P2GA 2VDLB 2WSMA 2Y0DA 5TDHA 3VYTB 4ETNA 1H2BA 5H8WA 3P2EA 3NKLA 1NATA 2XHEA 2YIVX 2ID9A 5EG5A 3KXPA 4AKIA 3SBEA 2H1HA 2VQ3A 1RQ7A 5EA2A 1O96B 5F51A 3SHVA 5FDFA 1GNTA 1M6EX 1Z22A 2YXEA 1NDUA 4L4ZA 2JBAB 4WJKB 5L3RA 1P6QA 3ZWXA 1T9AA 1KS2A 1V39A 1Z5OA 3O7WA 3ZU3A 4F4DA 3KAPA 5JI2E 1ILWA 4OYRA 3AVPA 2VUSA 5M2QA 1D2MA 3T7TA 4Q3OA 3ZHCA 2C2GA 1LPSA 4MS3A 4YCAA 3B53X 2G9QA