3OZDA

Crystal structure of human 5'-deoxy-5'-methyladenosine phosphorylase in complex with pcl-phenylthiodadmeimma
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
273
structure length
273
Chain Sequence
AVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of human 5'-deoxy-5'-methyladenosine phosphorylase
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords S-methyl-5'-thioadenosine phosphorylase
total genus 95
structure length 273
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.4.2.28: S-methyl-5'-thioadenosine phosphorylase.
pdb deposition date 2010-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ozdA00
5F76A 3OZBA 1ECPA 2HN9A 2QSUA 4MARA 5FAKA 3P0EA 4K6OA 4DANA 3NM6B 1LVUA 4M7WA 1VHWA 4YNBA 2OC9A 3PHBE 1Y1TA 1A9PA 2XRFA 4WKOA 2QTGA 3T94A 3C74A 4LDNA 5F78A 3EEIA 4QASA 3GB9A 3EUEA 1RT9A 2HRDA 3PNSA 2AC7A 1A69A 3NM4A 1M73E 4BN0A 2B94A 4E1VA 1JDSA 2RJ3A 1PR6A 3LBAA 4OGLA 3DJFA 4U2KA 5C80A 3ODGA 1K3FA 3TL6A 3F8WA 3NBQA 1PWYE 3U40A 1Z36A 4OEHA 4R2WA 4ECEA 1PR5A 4L5YA 2A0YA 4F3CA 4M1EA 4TTIA 2P4SA 5B7QA 3LGSA 4TXLA 4NSNA 1RSZA 3EUFA 4NS1A 4YMLA 1T8SA 1K9SA 5I3CA 1NC3A 3P0FA 1FXUA 4TXMA 1JP7A 1A9SA 2ON6A 3DPSA 3UAVA 4MCIA 1PBNA 3KVYA 1RXUA 4QFBA 4LNAA 1TCUA 1JPVA 1K27A 4PNPA 4DA7A 1Y1RA 4BMYA 3OF3A 3E9RA 1PR0A 3OZDA 4TYMA 1V41E 1PK9A 1U1GA 3DP9A 2ISCA 1A9OA 1LV8A 1RFGE 3K8OE 1OUMA 1OTXA 4DAOA 4WKNA 1ULBA 4WKBA 2OC4A 1SD2A 2A0WA 1SJ9A 1JDZA 2OECA 4DAEA 2I8AA 1SD1A 3OOHA 1JE1A 3PHCA 3MMSA 5JPCA 1G2OA 4GMHA 4BMZA 1YRYE 1U1DA 4LNHA 4QARA 1TD1A 4UC0A 2HSWA 1ODKA 1U1CA 3UAXA 1CG6A 1CB0A 2H8GA 3E0QA 4TXHA 4LZWA 1B8OA 3KHSA 3LA8A 1Y1QA 3KVRA 1PK7A 4JWTA 2A8YA 1QE5A 4QAQA 5F73A 1V48A 5B7NA 1T8YA 3OOEA 2BSXA 1A9QA 4L0MA 2Q7OE 4GKAA 4I2VA 1PKEA 1YR3A 4WKPA 5ETJA 5F7XA 3SCZA 4F2PA 3UAWA 1ODLA 4F1WA 1RXYA 4G41A 4F3KA 5EUBA 4IP0A 4EB8A 5F7ZA 4DARA 1Z33A 4QATA 4LKRA 1T8RA 2HWUA 5CXQA 3D1VA 1Z5NA 1RCTE 5F7OA 1ZL2A 4JP5A 4TTAA 5EFOA 1ZOSA 5CCEA 5DK6A 1JYSA 5CCDA 1Y6RA 4GLFA 4D98A 3BGSA 1NW4A 1VHJA 1JDTA 4P54A 3KVVA 4TTJA 1NC1A 2QTTA 3OZCA 3KU4A 2PGAA 1U1FA 3UT6A 3FUCA 4TXNA 1OVGA 3DF9A 4TS3A 1PF7E 3PNPA 1Z35A 1OU4A 3FNQA 1PW7A 3NM5A 1Z39A 4R2XA 3E9ZA 4WKCA 4OY3A 1PR1A 1RYZA 5F77A 3FB1A 4DA8A 5B7PA 3EMVA 1JDUA 4L5CA 2A0XA 2AI1A 5F7JA 1ODIA 4PR3A 4OGKA 3FWPA 1ODJA 4KN5A 5K1ZA 2I4TA 1V45E 5KB3A 1OV6A 2QDKA 5CXSA 3GGSA 3O6VA 4M3NA 1V3QE 3UAZA 4TS9A 5CYFA 3BJEA 1N3IA 5IU6A 1PR4A 1YQQA 4EARA 1Z5OA 4FFSA 4DA6A 1C3XA 3QPBA 2OXFA 4F2WA 1Z37A 2AI2A 1I80A 2GUWA 4JOSA 3ONVA 2AI3A 1Z38A 1A9TA 2IQ5A 3INYA 3OZEA 4DA0A 1WTAA 1YBFA 1JE0A 3IOMA 4D8XA 1Z34A 3FOWA 1TGVA 5B7GA 1TCVA 1U1EA 1Y1SA 1YQUA 4G8JA 1RXCA 3BSFA 1V4NA 1VFNA 4GLJA 4OF4A 4TXJA 4H1TA 4G89A 4D8YA 1V2HE 1Q1GA 1TGYA 1VMKA 4D9HA 1T0UA 3BL6A 1XE3A 1PR2A 1Y6QA 4D8VA 4OJTA 3DDOA 1SQ6A 4YO8A 1Z5PA 4L5AA 1OTYA 5IFKA 1RR6A 2QPLA 3MB8A 4RJ2A 1A9RA 3K8QA 4DABA 5CYGA 3OPVA 4X24A 1T8WA 1RXSA 3OCCA 3FAZA 1LX7A 3ENZA 4L6IA 4MCHA 1B8NA 4BMXA 3KUKA 4QEZA 1ULAA 4YJKA 3UAYA 3IEXA 4NY1A 5EPUA 1JDVA 3O4VA 4R31A
chains in the Genus database with same CATH superfamily
5F76A 2PU5A 2J7KA 4QDKA 1V43A 3CT6A 3O4HA 1FYVA 1SWWA 1YZUA 4PSKA 4YA6A 2OBMA 3HDTA 5IJ9B 1KRWA 1XEFA 3GDOA 2IYZA 3BFPA 1MQAA 1CY4A 5EE3A 2HT6A 2FQ1A 1YT5A 4GBJA 1EM6A 4P4LA 5FNVA 1TC2A 1W6RA 2Y0PA 3NC1C 2XWQA 3QJYA 2QE7A 3V7YA 3JYHA 3LBFA 1LVGA 1GM5A 1L7PA 2R1UA 2IE0A 3NWPA 3VR4D 5LKRA 1Z3IX 4HLCA 4EW2A 1P1IA 1ISHA 2BFEB 2FP4B 3FPHA 1AXGA 5DEOA 2XOKD 1HEYA 4OI2A 1QH1B 1ZWKA 4L8YA 1MG5A 1P73A 3S4YA 2WWYA 1TEZA 4N7BA 5BRJA 5HJ2A 2OR3A 1K68A 2BTEA 3E48A 3DLIA 1O54A 1TCBA 4C1BA 2W4QA 4GX0A 1XU7A 2EX1A 4KXUA 5DGCA 3WMWA 5IPFA 1OGIA 3PFIA 1QQ6A 3HWX1 3JTEA 1A69A 3I0ZA 1W5BA 3LUGA 2VTBA 5P8WA 1E7QA 2VSQA 2XAUA 4B5LA 3EH1A 1K8ZB 3CZ4A 1XTKA 1YJAA 1DMSA 2CK3D 5TRTA 2H0QA 2CNWD 2YWDA 2NYVA 2C2GA 1W9MA 2W6IA 3BZUA 1DKOA 4HAZA 4OL0A 4PHFA 5CU7A 2ODAA 3V8EA 1A9XB 3LPLA 2NAPA 5B3KA 1GQRA 1Z6XA 1RFLA 3S29A 4ZK2A 2PUWA 5FV4A 1AA6A 5L3RA 4G1BA 4BMOB 1MIOB 1R0ZA 1E8DA 1NMXA 4KFTA 2ACEA 4QOSA 5FJIA 1M5RA 1KVRA 1UJ4A 3JWIA 1FFHA 1VLQA 3IVGA 3RFXA 5L6MB 1EFPA 2C3OA 2X1MA 5CXUA 3B3JA 1ZD1A 2B8TA 1W0KD 1NLFA 2A9FA 2GLUA 3QITA 4K1XA 4L3OA 1BDIA 1W6UA 1GTSA 1GDTA 4KKXB 3AG6A 3A6KA 3EZLA 5LA6F 3U13A 1K0FA 2QV0A 4R40A 2IITA 1EIZA 4LFCB 2H5LA 1HZZA 1KHTA 2IDJA 4BJ1A 5FLXA 4KE6A 2CL0X 4NV0A 5ITWA 5JUWA 3Q12A 3SZMA 4JITA 2PCLA 2HIGA 3PJEA 2ID8A 3I1YA 1PR5A 4QC2A 2GMWA 1G7TA 4L4SA 5T4HA 1R15A 3E61A 4ALMA 1RWNA 1RCFA 4H2DA 3AJAA 2ZB4A 3TOCA 4LHXA 1GPMA 4NF2A 4E5PA 2C2OA 3W5BA 4ND2A 5DBFA 5CLGA 1L7RA 2P2DA 5JQGF 3ZKAA 5IK2A 4EI9A 2DECA 2FZCA 5CM8B 5GJWC 1B26A 3IQEA 2HI0A 5DIZA 4EYEA 5HM8A 1KVUA 3SF0A 1HDIA 4GZ6A 5D6NA 3U3OA 3B52X 4X1OA 3GFGA 2HO5A 4JJ8A 4KPUB 2DBYA 5FULA 4N1AA 4PPGA 1KE1A 3BERA 1AGPA 4J49A 5B6IA 3PJRA 2QUZA 2GEVA 4DVGA 1DV1A 2YVQA 2H2FA 1C1HA 3NEPX 2UVPA 1XDUA 2HMSA 3LWZA 2Q9CA 1Z4IA 3K9LA 4GICA 1Z8FA 3WZLA 3WMEA 4JASB 3WJ7A 4RTJA 1JKMA 1GFIA 1S2DA 1PG0A 5EJMA 3RC7A 4WV3A 4WWHA 2PT6A 2PSFA 3GFOA 4YV0A 4QDUA 2XUDA 5HF9A 1A2KC 4MPPA 4MUXA 4HX9A 5A4IS 1PFYA 3ZDYB 1XMOB 2AT1A 2I6QA 4QNNA 1CW2B 1QYXA 3R3HA 3M4XA 2UUCB 4RFVA 1IOVA 4YRGA 4R1TA 3RYFB 1JEJA 1QP7A 2ZIWB 2Q6IA 1NBHA 1DUVG 4KNWA 2RDMA 1Q19A 2H52A 4NU6A 4OYYA 2DHDA 1LBHA 1RMYA 3OZDA 4BN5A 2EU8A 1U1GA 2AB0A 2D7CA 3ZDXB 1GL3A 2DSNA 4O4JF 4R7TA 2MWMA 1J21A 2C96A 1N2OA 1A8HA 2YOFA 3Q0EA 2AJTA 3A32A 3QPAA 4N40A 3W3ZB 1N9KA 2AWNA 2GCOB 3H8VA 4QREA 5B2ZA 3T7SA 1LJLA 1RI4A 4BECA 2CBZA 5DN9A 5BVHB 3OG9A 2EVWX 2ZYRA 4Q47A 4RVSA 4LF6B 3SJUA 3V1MA 1DKRA 1U1IA 2W2PA 2V98A 4DAOA 1TTPB 3T1VA 4EDHA 3FSGD 4K6HA 1R6AA 1SIWA 4RS3A 3T3NA 1S1MA 2WIDA 3U3XA 1JQJC 1ULBA 1MQ8B 3I4FA 2XT6A 3JX9A 1Q7GA 2WIFA 4MRMA 2JBAA 1SD2A 2HCFA 2A0WA 4HR7A 4UFPA 5IYZB 4JQCA 3UCXA 1KHHA 3LPMA 3ER6A 5DI9A 3U9TA 2WPDA 4AUEA 3VU9A 1QZTA 4E4YA 3K05A 4KXXA 1UM9B 2EYQA 2WAXA 3USCS 1E64A 1R10A 3DR3A 4Z8YA 3WK7A 2GZDA 5JDCC 2DLCX 1QQBA 3M5WA 3WC4A 4X90A 3QKIA 1AKUA 2TMYA 2FX3A 2NAFA 3LQ2A 3QEMA 3BKWA 1EJBA 1SD5A 1GXSA 2FPOA 2HB6A 5U1PA 3TGWA 2REBA 4MPDA 2Z8YM 1K8QA 1KVTA 4C4ZA 5KVVA 2H9YA 1TD1A 1W96A 2BGGA 1OKKD 3CJQA 3CW2A 4JZKA 3OM9A 4XYMA 5FUVA 2DQKA 1XQXA 8MHTA 2QV7A 5DGIA 3L8EA 3BJIC 2FPLA 3UK0A 3FM9A 4B7ZA 3LCMA 2VXBA 4XDZA 4OPMA 1RYHA 4QSMA 2BHRA 4NWIA 3B5JA 4FMCB 3L8DA 5TS2A 3ZGNA 1NP7A 3S2YA 4TLAA 1P33A 4ZVSA 2Y4NA 2HLNA 1R50A 3V42A 1GY8A 4M6WB 4O2BA 1T13A 4MVJI 4URYR 1ONSA 1SU7A 1UC5B 3DM5A 3RYHA 1B93A 3CVWA 3WJ1A 4EBBA 1VQ1A 2Q4DA 4EJ2A 2ALJA 3DMYA 1C9NA 5H3HA 1A3CA 1T8YA 4ROTA 4Y0NA 1A0OA 2FFAA 2J1LA 2ODQA 2QENA 3IP6A 3G6WA 4ND7A 4PZCA 3LY5A 4KWTA 2EBHX 4QYSA 4X1KB 4ALLA 4EF5A 4F86A 3V6MA 4LYGA 3FGPA 4DFDA 3HH8A 1FDIA 1YAJA 1Y5MA 2G07A 1HL3A 4I5GA 3ZQUA 4CHGA 1M2GA 2Q9UA 4BXOA 4P84A 5UKDA 3CPEA 1Q3HA 2NZJA 2VJOA 5CVVA 2DULA 4GZLA 3I73A 4ED9A 3H2JA 2CLEB 2WMNB 1EB9A 1Q5PA 1JA1A 5DGDA 4F2PA 1NUTA 3K0HA 4DM3A 1ADGA 4ISBA 1Q2UA 1QNLA 4J0JA 1G18A 1I14A 3H7IA 2PIAA 1SFRA 1I2MA 4R8SA 3WKCA 4F4FA 3ESRA 5FWYB 2I34A 3KHUA 1G8JA 3QKTA 3ZCTA 3FH0A 1L5YA 1QQAA 1N32B 4C0WA 3MWDB 3PLRA 1JBKA 2BI4A 2N3ZA 1ACLA 4MPJA 3OQBA 2PWAA 4G36A 2GVNA 4H27A 4KW7A 4PVCA 2JIDA 1KI1A 2VQ3A 4MUEA 1M1YB 2VDWB 4XR9A 3TSAA 3V8NA 5EJIA 1EJ0A 5JPDA 1KOJA 3OA0A 1JIJA 3Q1KA 3MINA 1RCTE 3PGVA 4PLVA 5EHIA 3O92A 1USVA 5CVTA 2EL7A 4JLUA 3ZV3A 2ONCA 2FPMA 4RWEA 2G0TA 2H2HA 2QE7D 4KWHA 3C3BA 1ZK2A 4J8PA 1DC8A 1KDOA 1UP6A 3RNOA 1NDUA 2B0JA 5KDDA 4CV1A 4LXTA 2FFRA 4YPOA 2WU4A 1VRVA 1D6JA 2BCEA 3PWTA 4WN3A 2NO0A 1KSJA 4OLAA 1G7SA 4I5EA 1CF9A 1NVFA 2QLBA 4HPWA 3WP0A 5HGXA 3D3QA 5CTJA 2GKGA 4I6GA 3NLLA 4PFSA 3EF3A 5IBQA 2FNAA 4IH9A 4P54A 3TCXB 3ISJA 2X5XA 2C29D 4D3SA 2C61A 4PBRA 2HA7A 3OFNA 3CNLA 4XJXA 1XNHA 1Y33E 3W2EA 1DJOA 3ZN2A 4Q3NA 4Q7EA 5KX5A 4I0WB 4ZKDA 2E5WA 1EZZA 5KYWA 2G0NA 5PGMA 1NZJA 5FBKA 4H9GA 1U0EA 2P11A 2XGSA 1ST2A 1OLXA 3PT9A 1V0JA 4MVJD 4YYZA 3L0IB 1ZCBA 2ATEA 4PU0A 5JCPA 4MIOA 2XADA 1E3WA 1VPEA 2C5GA 3KK0A 3NHJA 4QTUB 1AT1A 3ACBA 2P7HA 1WUTA 2EZ9A 4PX2A 2PO7A 4E2XA 1R37A 4I4LA 4KR3A 4BVKA 1J07A 1MB9A 1M2HA 5B1SA 3SC3A 5B6PA 4RYDA 1FX1A 2DC1A 5L8VA 4URHA 1PT8A 1WDWB 4MGHA 3DZDA 1L7MA 2RH5A 3I30X 4UJ5A 2BELA 5IAJA 3FI0A 1SQFA 4I5DA 2XRMA 3AEKB 5DX1A 1X8KA 1JKJA 4G63A 5H16A 3KJZA 4H3VA 2F2TA 3AEUA 3CZAA 3K1AA 4BUJA 3OJFA 1E96A 3G5UA 2ZB3A 3RU9A 3NGXA 1IY0A 3ED1A 4WLVA 3DD1A 3E7WA 4ASUA 3THXB 5I4BA 1L5WA 1QZXA 3NDPA 3GGDA 1KEEB 4E15A 4BB5A 5AUQA 4CIXA 5CDGA 1KI6B 2QUHA 4REQA 4KSYA 3I9KA 3DQPA 2X3YA 3FWYA 5B1DA 4H4DA 3JQEA 4TYQA 4OHPA 4YRMA 4PRLA 3H9CA 4FSHA 1L4MA 1VYUA 4YP1A 2C4HA 2WJVA 4GOJA 4NK4A 4ZKEA 3ZEIA 9GPBA 2XZPA 2D2FA 4I1YA 2IW1A 4N0DA 2P41A 1DWUA 3ZK8A 4C01A 5HTOA 2XXAB 1W30A 4IHJA 3RK1A 1EE9A 4N41A 5HQ3B 3SVLA 1EFVB 1N9GA 3M1IA 4LMRA 4ZI3A 3CE9A 3N3AC 4E6EA 1Q7EA 3V1NA 3KKNA 3FWNA 1CB7A 2G9NA 4NYIR 3LFUA 1GV0A 3U4HA 1CDDA 3WLKX 1WCV1 3R3UA 4JQSA 1EI9A 3OKAA 4E1AA 3O3CA 1C0LA 1KO8A 4YGYA 2QQFA 1U7XA 3PUHA 4NL4H 4KRFA 3KEMA 2DUNA 5IBRA 2C31A 2XWSA 2BTOA 1O97D 2CXSA 3UN1A 1I1NA 3ABQB 4RAOA 5E1MA 2X9LA 5KS2A 5KSYA 2ILVA 3CE6A 1TCCA 2V6MA 1E1QD 3L8HA 5HCNA 2RJOA 3B38A 5IAAA 2E3JA 1JWLA 4RK7A 4EHNA 4B3TB 3I5AA 3OFSA 1PFKA 2Z9CA 4LRUA 2XMCA 3HB9A 3KTAB 4PHCA 3LPAA 3TFOA 1UPFA 1X7HA 1U94A 2JH3A 1T8TA 1VJ0A 4ZEOA 3T3MB 2X77A 3BDVA 1KQNA 4B34A 2PUDA 4QM6A 5KMGB 1GN8A 4U63A 4ZGGA 2MSDB 4NNOA 4X60A 5E0KB 2OXFA 1E2PA 3FDXA 4MR9A 1U9YA 4UVDA 1WY5A 1Z37A 3PEYA 1Z6TA 3VV2A 2AYXA 1AGNA 4JGGA 4OXQA 2XA9A 3OZEA 4LDJA 1T0JB 4K9KA 3M70A 4TWRA 1SUDA 3ZE9A 3GJ0A 2GZ2A 1TM5E 3FKSA 4FTWA 4LZOA 1NF9A 1QB8A 2BI8A 4YVFA 5H9VA 1N3BA 3KQMA 5FI0B 4EB0A 3UK1A 5K01A 1RI2A 1GTZA 2CL7X 1VKOA 4R2IA 3THYA 3N7TA 3AQIA 4ZI5A 4ZJZA 1FVOA 3VR4A 3LHFA 3AR3A 1RYBA 3ZHQA 2HF7A 5MF6A 5IVHA 1PFUA 1TGVA 1Z25A 4HDMA 1SHTX 4AIRA 4UPDA 4M7RA 7REQA 2EKQA 3DE6X 3ADCA 4AKGA 4FBGA 4HX5A 5LUAA 3KWFA 1Y9JA 4KLNA 1QJCA 4F7WA 1VHTA 4ZRMA 4Q9HA 4FWBA 5C2JB 4I3GA 3DC7A 3BMNB 4F85A 1Y9DA 1OXUA 2YY7A 1XDDA 3KXPA 4IINA 5LYYA 1DKLA 2FWBA 3CV3A 1QK3A 2AD5A 4KQ6A 1ZK4A 3T1OA 1L5QA 4YJ3B 1C9YA 2C9OA 2H8KA 2GHQA 2ZWPA 4ESOA 3VHRA 1FYEA 4Q4HB 1TZBA 4HI0E 3D8SA 3VNSA 1O6CA 1H0RA 1CQZA 1PIWA 1ZISA 1ESMA 1GPDG 1Z28A 2P5UA 3BRWA 3KT3A 1T5TA 5B2FA 3O8DA 1QTIA 3QJ5A 2W11A 4ITUA 5BWMA 4XX1A 1Y3CE 5HF6A 2YXBA 3COZA 1QQ7A 3OLXA 3GG9A 5COBA 4YO8A 1P0PA 1ZGGA 1M34B 4NPHA 5FOQA 1WX1A 3TB4A 5DM60 1RR6A 3HR7A 3NW9A 5K20A 1C8KA 1A9RA 3PUXA 1TRHA 2WE8A 1BEEA 3HKDB 2X6QA 4YMIA 4BGVA 4ISCA 5DNAA 4YUXA 5JSZB 5KQLA 3EULA 5LFAA 2O8BB 4L4RA 2YVLA 3EZ6A 1B43A 1R0YA 3RS8A 1KAHA 1XRQA 3M5PA 3Q3GE 2HY7A 3HDQA 4FOSA 3O3NB 4IF6A 3KEOA 4M53A 2X2PA 4KQKA 2YHIA 2PEYA 5J59A 3RE1A 5LDDC 3V4PB 4I9GA 3WGTA 4KHZA 2NVWA 3JASB 3KC2A 5AKLA 3HI6A 3N6RA 5KAPA 4AKHA 3N39C 3QWIA 1OSNA 3ZDFA 1ZBDA 3IEXA 2OQ2A 3JSAA 4LDAA 3N05A 1UXIA 4V0NA 5H0IA 2BKLA 2HU7A 4MWTA 2JEYA 2I8CA 3FYDA 1AUOA 4CV2A 4NXNB 5K3EA 1ACJA 3T3IA 4XWWA 4BNYA 3FTDA 3P2YA 4YCJA 3UVEA 1YGYA 5TQ2A 2IUEA 1JQ3A 2W0SA 1CNFA 2CNNA 2IHBA 4PYOA 1MO2A 1UADA 2ZJ2A 3DCJA 4JXKA 4P86A 1C50A 1ZHFA 2QVGA 4GSYA 4X3OA 2ZRJA 1HE2A 3D7KA 1XPJA 1J5EB 5IDXA 1KO7A 3A3NA 3MG9A 3QVLA 4PFJA 3DFKA 1VL0A 2C77A 2Z1DA 4WKOA 2R44A 4MA4A 3CR7A 4JLWA 4CODB 2P6OA 5CYOA 3S2UA 1K7SN 3CRVA 4FYMA 3NXKA 5CJ2A 2YH2A 4YQZA 4KN9S 1B3BA 2V8BA 1T36A 4QLBA 1KMMA 1E2IA 1HE5A 4TWAA 1T43A 4I6EA 2HRDA 4JGBA 1E3LA 1OZ0A 1B0UA 4WSOA 1K92A 4X6LA 3W7VA 3J7AC 1RPAA 4YK7A 3P2OA 2JGRA 3JQPA 4N4AA 4KPYA 1B8PA 2QJTA 2PIDA 1BU8A 3U4QA 2R751 1EVKA 1LNZA 4G5YA 1EFVA 1O8CA 4FGKA 3HJCA 1GUAA 2GZ1A 1O0BA 4B46A 2VA8A 2HUPA 4I4CA 3VM6A 1ZWLA 2WMYA 2XMRA 3PC2A 1RZRA 3CXRA 3Q8XB 1UFOA 2F6RA 2V4MA 4V39A 4Q3CA 1ZK1A 2NIPA 4JXZA 1OHHA 2RBKA 4ENTA 1X38A 3Q3IA 4PG5A 4RKQA 3D6MA 2O19A 5FHRA 3TUJC 1H9CA 3IO5A 1DDGA 2DKOA 2WIBA 4K9RA 2W6NA 4A0RA 1W5SA 5LP6A 2FMUA 4OP1A 2O23A 2CV1A 2Y27A 4B35A 3QW2A 1X13A 2C4KA 3EEYA 2OO3A 3F3YA 3ZE1B 3KUXA 4AKTA 7MDHA 1GR1A 2ZE5A 3RHTA 1EXNA 3Q0TA 1IOLA 1P60A 1RHUA 4OMFG 4FFDA 2FJPA 3ZNNA 1KGSA 1SC1A 2HDNB 1QM5A 4CM9A 3MTGA 4E2YA 3BZWA 3DB1A 3S28A 3WLTA 3SFTA 4FHFA 4FM9A 2IBMA 1SN7A 4P7GA 3NC4A 1DJNA 4PC7A 4YB8A 2D2XA 5M34A 1UPCA 3JYOA 3RW9A 3ZV5A 3H9GA 3KWJA 4HWRA 2F67A 4JBLA 4Y18A 4B7AA 2V9PA 2IYTA 4U2EA 3G89A 1SBCA 2NVUB 2E4WA 2HYDA 1GTJ1 1GNSA 1AHIA 1X1AA 2Y67A 3OSZA 1J8QA 2OMKA 3DLAA 4R2WA 3E9QA 2BE9A 4L5YA 2FZ5A 5D1HA 3ZS8A 4EQ6B 4BCBA 4YCSA 2BKVA 1WLYA 4UBIA 2FX2A 2EEPA 4X95A 3TLJA 2C4WA 3HDHA 1DTWA 1HNNA 5IT9A 1V5FA 1NRWA 1QRRA 1JG6A 3OJXA 4GX2A 4S24A 5C1OA 2GXUA 3IIJA 2FN3A 3JVVA 3JSXA 3RYCB 5E3HA 5L3SA 3IMFA 3SZOA 1A97A 1YONA 4IRUB 4JEIA 1KYVA 5FDFA 2HMTA 5B7QA 2DEUA 3QV1A 2V5AA 5JH7B 1SVNA 2QTMA 2A7XA 5TX7A 5KNCA 4LA4A 2WHQA 4B80A 4R41A 4DF3A 1UJ6A 1GL9B 3AOGA 4HX2A 3RC1A 3GPIA 2OM2A 4JYCA 1G63A 4IIXA 3FMIA 1XQWA 4NDAA 4RD4A 4DBLE 1M2EA 4JL6A 1HMYA 2CFTA 3HJRA 3P9SA 5K0ZA 1UKVY 2E6UX 2HJHA 5JWHA 4HMOA 3WBFA 3B6EA 2R87A 3A9WA 4BMNA 4M1TA 1DJMA 4B7UA 1XTQA 5F23A 3RARA 5CDHA 5E6UA 3I05A 5AUPB 1F4VA 1RZ3A 3JALB 4S0XA 2G80A 4Z1MA 4PS1A 5CVUA 2QIOA 5AHRA 4CQMB 1HH4A 2B92A 1EQUA 2J3JA 3AR5A 4V03A 1W19A 1K98A 1K27A 2V55B 3ADOA 3R9WA 3AHHA 3KQPA 1YQEA 1BHQ1 1BXRB 2M6KA 1T15A 3GFTA 2P69A 3I64A 4Z4CA 1JTFA 3FRIA 3U4GA 1U4SA 3OHMA 4WNCA 2WD8A 1WZIA 1GPWB 2X4LA 3CZRA 5HKBA 4B76A 5AHOA 3ZD7A 1W44A 2I2CA 3W5SA 3KE9A 3I2IA 1PZGA 5EXSA 4B6JA 3ER9A 3P9KA 1QIGA 4OHZA 5IH7A 5JNLA 4IDNA 4C4XA 4Q3EA 3PDIA 2YHIB 1GUBA 1QHHA 1TUEA 2Q3MA 2Q3DA 1S89A 2O2IA 3IIEA 4H35A 4U5XA 1XFAA 2CC2A 2YOGA 2PZAA 3CLTD 2CXNA 4JHLA 4LUCA 3TM4A 1Z3CA 3PI7A 2YICA 1CQJB 2J07A 3O8QB 3V8BA 3C3XA 5IBPA 3H13A 5CT5A 5I7HA 3BIJA 4P7JA 4H08A 1YVDA 4PNHA 5GGYA 5KHLB 4KQJA 4QFMA 5EEHA 4FDAA 4QEKA 4WKBA 1JIXA 3TNFA 3FTFA 1BMFD 2BFBB 2EIHA 4E11A 1JB1A 1U5CA 1LK5A 4EPYA 3DYVA 4XPIA 2BMEA 2CSUA 1T6YA 4N39A 4C7OA 2X19A 3BIXA 3F4KA 1CT9A 3K53A 4IAOA 1U0BB 3PEFA 3ICCA 4YWJA 4FBLA 3T0IA 5KYXA 1F51E 1NQWA 1XXHB 2NU7A 1C0EA 1T9GR 1CEYA 1H5QA 2B8NA 1P7ZA 4HL6A 4J9VA 3RGGA 1XAHA 4G4SO 4GMKA 4HWKA 3BXHA 1QU2A 1Y1PA 4RTNA 1IM5A 2EGHA 3KQHA 1P4JA 4ARBA 4IIUA 4W82A 1ZH4A 5HE9A 4ANFA 4IXTA 3KHKA 5DO9A 2JHAA 5C5DA 3RBXA 3CRMA 1F2UB 2IPAB 3A6LA 4MEAA 2I3ZA 2DSTA 3GGOA 3QXXA 5IHXA 2EBFX 1F0PA 1ZIYA 3LBHA 4DCJA 1B8OA 1ZRSA 2PTHA 4B0PA 1EINA 1U3WA 2RFLA 4I55F 2Q3BA 3RU3A 5K0GA 1KIAA 2R6JA 2W2TA 3EBPA 3HKBB 3R0VA 4CN8A 3LCCA 2B7CA 4WZBA 3KVRA 1RLJA 1ZMRA 4D8UA 5HR5A 2V4UA 3SPXA 5EP2A 3ZBUA 4D43A 5JY1A 6NULA 2WABA 4UFNA 3WXBA 3NVKI 4RY8A 4FZ5A 3ZUPA 5ANRB 3RSOA 5IZ4A 4DB4A 1PVVA 3BUSA 3HPRA 4HDNB 4ZAVA 3PDIB 4JCCA 2YNMA 3KPVA 3PENA 4L5BA 2OUIA 1KQ3A 2HHAA 3SS7X 5CDTA 1BX0A 1DBIA 4XM0A 3M89A 4YAGA 3LDAA 5ESDA 4BZWA 1C3OB 5GWXA 5C1IA 2OYSA 3LTEA 4KUHA 2H1VA 2WBLC 3P9XA 5IYZA 1Y6FA 5GMOA 5TJHA 4OKNA 2J9FB 1G1AA 4EATA 1VBFA 3OTQA 3GLQA 4FYHA 4MICA 4TRRA 4U7GA 5B57C 3JQAA 3VZPA 4QVIA 2VZLA 1I9CA 4NDZA 4TUYB 1PEDA 5CX1A 3W9BA 1EFDN 2NLOA 1CFJA 5JSKA 7YASA 1ND6A 1G5TA 2Z83A 3LPDA 3DHVA 1PT5A 3JAWB 3K9QO 1L7EA 4C87A 2CVFA 3BDIA 4BVJA 3M5CA 3MXOA 4B3BA 2AKYA 1L5HB 1P81A 1YA4A 3E1KA 4YLEA 1Z33A 5I9TA 4B82A 1KR2A 3HEMA 4J4BA 4EUFA 4RF2A 1L4EA 1KY3A 2P4QA 3LXMA 4HQLA 4WNAA 4QATA 3EDMA 1X39A 1NLUA 4KFCA 3NBZC 3NHFA 3KJIA 4W8OA 1GGMA 4TV9B 4WNAB 4D79A 3JZFA 3EEBA 3EGWA 1HEUA 2CMHA 3D1VA 3NBUA 5BWBA 2C57A 4AG5A 3SLRA 3U6BA 4PAOA 2A0UA 1E9DA 4IDDA 5HM6A 3E9DA 3ONNA 4E1BA 2QTVB 1XA4A 3GBSA 1JH8A 2QF7A 3BA6A 4MQ4A 3WO0A 1IUPA 1L5VA 1JKIA 1LDNA 1O95D 1P6QA 2GI4A 2V7WA 3G8AA 3L0CA 4QELA 3ETJA 4BO6A 2PGXA 4TUYA 5IBCA 3DZGA 1G5RA 3PKZA 4B6GA 2UZ1A 5CCEA 2NO5A 3ROQA 1EQAA 1ODSA 4BVEA 5HIAA 3GGCA 3OWHA 4QHTA 1D5CA 5F52A 3MJEA 1AKMA 3E70C 3KS9A 1E0KA 4CCYA 1G8MA 3DSRA 3ROEA 4GQIA 4HS4A 1WVMA 4KQFA 4OFWA 4P4UA 1ZYUA 4AYTA 5CHEA 4IVNA 2O48X 1K8YB 2A9VA 4WCFB 2ZWAA 1QVAA 2DM6A 4HH1A 3SQLA 3V4FA 2VXOA 3TRJA 4BJHB 5ITZB 4KU4A 3OZCA 1EWTA 2GETA 4UM9B 3VJKA 4LZJA 1EK1A 1YFKA 2QZZA 4G2TA 3RJMA 5TNXA 1CX9B 4AZ3B 1QRTA 5EFZA 4NPAA 4MR8B 5TQ0A 1LLCA 3ASYA 2WM2A 3R74A 6AT1A 3I92A 5JEDA 5JCXA 5EJGA 3ZE7A 4CMCA 5AOBA 1S8OA 2A1TR 3PYLA 3KR1A 1H1LA 2PVSA 2Q6KA 4IXWA 3T9BA 3DF9A 3OE5A 4I14A 4QQRA 3FPLA 3C1OA 1J5XA 1ZVKA 4DY4A 1PF7E 5ULLA 1MCZA 2JIPA 5E7IA 5BR8B 1JHOA 3L7MA 3A0RB 3ZDRA 3KR9A 1DQRA 2A92A 4M9SA 4R9RA 3NM5A 4Y2QA 3JQFC 1CQXA 2GN9A 2C2KA 3ANXA 1JQ5A 1GNTA 1PD0A 2XZDA 2O7RA 4LVCA 3SSNA 4ZYLA 4GI2A 2C00A 5EINA 2JW5A 5EJ9A 4A03A 3K09C 4D3XA 3LTNC 2WWXA 3NWJA 1EESA 5EE9A 4QBHA 4HDMB 1DBQA 3QZUA 4BV2A 1SEPA 3CBGA 3C16C 1QYCA 1RWQA 4GXNA 2C7BA 3CKKA 3NIDB 4I55A 2LUOA 3BFKA 1FFWA 4Y2UA 2JKZA 3RBAA 4TQAA 3ESBA 2RBGA 4L7VA 4XEHA 2HV8A 1J5PA 1L9KA 4YAKA 2YX1A 4YTEA 1VKRA 4YAWA 1MO5A 3IMCA 5A62A 3F0TA 3O8NA 5BWLA 2O8DB 4TVOA 2FUG6 1F4PA 1A77A 3G9UA 5D2CA 2G88A 3LO5A 4YCNA 1PRYA 3HBFA 2I0FA 1DNPA 2XQIA 3DEAA 3KKZA 2BOVA 1JHPA 3A1VA 4LE0A 2JGJA 4PGAA 4PX3A 2XNKA 5EP3A 3VNUA 5BP7A 2GD6A 1N8SA 4B3CA 3TLZA 4EHFA 1Y9EA 1KVQA 2O14A 3AR6A 3O6VA 3ENQA 3GUZA 2O2GA 3CW9A 5CB8A 3K8YA 4ZO6A 2HA6A 5EWJB 3B1KA 3BE8A 3P2EA 2J33A 3JAKB 1P44A 2P9JA 3QFCA 3VNBA 1QHSA 3PJDA 4Z4HA 1Y8RA 1X1EA 2MYPA 2YFHA 3D2LA 2ZLBA 3PFFA 3ZV4A 2NMVA 3ZD8A 1I2ZA 2GOYA 2W83A 3BH0A 3FPAA 4TM8A 1MHPA 3E15A 2FU5C 4AUKA 1EX6A 5HNKA 2YYAA 1AF4A 1JAYA 3RIMA 4RLHA 1YQQA 2WPNA 5JANA 2D8MA 4KFRA 3DZKA 1ISPA 1MB4A 1AIPA 1T6BY 5FNVB 3LLVA 1Q92A 2XX3A 1Z0ZA 2HGSA 3HVKA 3E18A 2EW1A 3TQRA 1ZVQA 3HL4A 3OX2A 2E6KA 4L28A 5ALLA 1JILA 1ZGZA 2C9MA 3FSJX 3NH6A 4XJVA 5EJAA 4KOEC 2D62A 1HDGO 2GVZC 3AESB 4UTRA 1C3XA 3L8CA 3OZTA 3RV3A 4F06A 3CH5A 1R5NA 2JZOA 3FJYA 1ENYA 1P2UA 1MB0A 2VEOA 2CFOA 2W2LA 4HGPA 2G7ZA 1P4GA 4DXDA 5I9IA 1N2IA 1E0AA 1N5KA 3M81A 2H1SA 4DCTA 5ALWA 2KX7A 2WV9A 4Q7JB 4GL2A 1HO3A 1PWZA 1VE5A 4BO4A 2Q5LA 3E7XA 1Z63A 1CLEA 2NP7A 3DNPA 5B58C 2ZJ0A 3ZZUA 3AFIA 1CUGA 1NUPA 4H6WA 3DD5A 4TMZA 1ONOA 2BHTA 5C8ZA 2EKLA 2ZR9A 1N2HA 3IOMA 2AOXA 3SXJA 4BBPA 3NJRA 3UMFA 1C29B 4U8HA 3RBVA 2CLMB 2H1HA 3MCWA 2XMSA 3HBLA 3WFJA 10MHA 1XA3A 5ALHA 4ZO8A 1RABA 1YS4A 4W5WA 1E62A 2DHRA 1TA4A 2IY7A 4UE2A 1ZJJA 3TLMA 1NJFA 3UPDA 4C2TA 2JGIA 5B36A 4DV6B 3DDCA 4WESA 2A3NA 3QSGA 2LIPA 5T6MA 4DV0B 4Z86A 3QEMB 4NXMB 3HCCA 1ZM9A 4UNIA 1KDYA 3HFGA 1F2TA 2CXHA 2X7HA 1UIMA 4XIGS 5AI5A 3VH4A 2EW8A 1FX0B 2F9FA 4IKEA 1XNJA 3OQJA 3REOA 1Q1GA 5A02A 4E5UA 2DFTA 2O05A 1CFZA 2RK4A 2YC2C 1XRPA 5J2TB 3UOWA 4I3FA 4N8DA 5I5EA 1RBZA 1BA2A 2CXTA 1QGED 1KI2A 1GPKA 1VPWA 2WFAA 3A4VA 3B82A 3OZAA 4KXVA 1GZUA 1BQ4A 1EEHA 1G8SA 1VLJA 3GDWA 1IG0A 1II8A 1PL6A 2FH5B 2QX9A 3O8OB 1SQ6A 3FCCA 3GLTA 1U8XX 1NA5A 4IHKA 5AM2A 5AP9A 3AR8A 4E94A 2ZUEA 5DHSA 2G40A 4FDTA 5ARBA 1TLLA 1H8HD 2QRPA 2JA2A 3GWGA 3OMLA 4GIBA 3T52A 1M8GA 4P4TA 5B4VA 2C3MA 2FW6A 4QDXA 4NCXA 2IKQA 1A7UA 1H3FA 1N0UA 2ADFA 2BDTA 2PH7A 5GONA 1OFUX 2GBLA 1N4AA 1VKHA 3VNAA 5EQFA 3KQNA 3TGPA 4RQAA 4CT0A 2VP0A 2PMKA 1RYMA 2REQB 4IG9A 5LBTA 3RS0A 3MQ4A 3R4CA 3IDSA 3B9PA 3PHGA 2OPHA 1RRVA 5ICCA 1K1EA 1N78A 2BONA 2GQ0A 3E22B 4GKVA 1ZNXA 3C6BA 5LZ8A 3W2GA 5KSZA 3GLHB 2OBYA 4BJ5A 3B3FA 3KNZA 1B1AA 5BQOA 2NXWA 3IJRA 3M4JA 2ZUSA 3KJEA 3RF6A 5A5DA 1W59A 4Z4QA 1U9IA 2NO7A 2E55A 4ZO9A 1O94D 2P62A 2HN9A 5EY5B 4CL0A 6YASA 4MARA 1QP4A 2I6XA 2CFRA 1NX6A 1CULC 2BKEA 3FTNA 3LQFA 3DONA 2CXXA 5CX1B 4J16C 1SK8A 4ZQHA 1MQSA 2FWNA 1AUVA 3WLQA 3ESZA 4AUNA 4PV7A 3COSA 4ZVUA 2NO1A 1X1BA 1O89A 2X8BA 1PEAA 1YI1A 5DI3B 3R5JA 5GIPE 4C0QC 1IN6A 1K4KA 3DBLB 3NFYA 4K6CA 4N3GA 4P3PA 1XMXA 1REQB 4NJEA 2PD6A 3VO1A 1YIAA 1JR6A 4L8FA 5CT4A 4JLMA 5ENVA 1T3SA 4B45A 1CS0B 2MYUA 2P9EA 3BJZA 2Y77A 3VNVA 4YJFA 1QOQB 3PRYA 1XXHE 1NVXQ 1CTQA 2V0CA 3A14A 1GG8A 5FV7A 3SEQA 4FGWA 4LJ4A 3ACDA 5E1DA 3AEZA 1WPQA 1DG3A 4GW3A 3IMGA 4ZARA 3ZJYA 3QWFA 4V2UA 5EJ5A 2FRDC 2ZRFA 1NYLA 2VSNA 1SU8A 4NI5A 2C42A 5E2IA 1M0SA 4CE6A 4CUJA 3TQFA 3W04A 4KIJA 5B5SA 1K06A 2F3PA 1LKZA 2JAQA 3GEDA 4EJSC 4CF7A 1SR8A 1M34A 2NQTA 4KO3S 5M5BA 1UKZA 4FLEA 4K7JA 1GKLA 1RKVA 3EXAA 1JI0A 3KL2A 3H5VA 4FFVA 4OH1A 1MH9A 2WSLA 4II3A 4LHZA 2P8JA 2WF7A 4K3VA 4HZUB 4RHCA 4GUDA 3NBQA 1H94A 5IJXA 2WLSA 4DWJA 1P2FA 4RAQA 1CHDA 2JVJA 2YXPX 4U8GA 5JHGB 2E4UA 3LGXA 4CM8A 3VKGA 3LF1A 4OUKX 4MR7A 5CA1A 1OAOA 3EAQA 2A1TS 4PAWA 2LP4Y 1UXOA 2VDMB 3HJGA 3GA7A 1I3KA 2ZS9A 1Z0UA 2WW8A 3I04M 1E3IA 2EBUA 2GZAA 3ZCRA 1HNXB 1NNSA 1Q0UA 2AEFA 1CUUA 2A0YA 3DZCA 3FRJA 3D5EA 4XUEA 5EIOA 4UAUA 3ZQJA 4KGZA 3RFFA 4DC1A 1RI1A 2V6FA 1JPJA 2P2YA 3BF7A 3I4LA 4M1YA 5KQGA 3RS7A 1QRAA 5HS4A 4EH1A 4ZEMA 1F0NA 2V7VA 3WMGA 1DELA 2JJ1D 2Z0MA 3SSAA 2XF2A 3JQDA 4B84A 1IZ0A 2A9KA 4R8VA 4MEJA 4US2R 1UM9A 3PQ6A 3CRRA 1RZUA 2CZCA 2ZAMA 3HDGA 3ZDCA 4K9OA 4YIHA 5C4MA 1G8KA 2PNFA 2X0RA 4IJKA 2IWHA 1RRFA 3SAJA 5AI0A 4QU5A 2NUAB 4CMIA 5BOSA 5JAMA 4LK2A 3MWDA 2BEKA 2ZR7A 2FP4A 2GJAA 3R5XA 4KV9A 4NBSA 3W78A 4CV3A 1NVAA 3P0IA 2OXIA 1YRWA 3UPUA 4RJJA 1JP7A 4E51A 3C5WP 2WVGA 3AFGA 4A2WA 4OYLA 1YR8A 1TT5A 1R4ZA 3VOSA 1KERA 3DEFA 3K1ZA 2XKAA 3HWSA 1T1SA 3TFWA 1O4VA 4I08A 3MLEA 5G3YA 5EE1A 2PFKA 2XMDA 2H2DA 4GLOA 2LDXA 4RU1A 4CDMA 1AVTA 1X3LA 2ZITA 3LP8A 1I5EA 1VMIA 3SR0A 4R0VA 5E7JA 5BYKA 2EQ5A 4BMYA 3B6JA 3U61B 4MO9A 2X8LA 1XA0A 2QNIA 1Z74A 2FG7C 3S2IA 1QAOA 4X1KA 5AWFC 4XFDA 4JSRA 4R83A 2BZGA 4O4JA 3HVRA 2I87A 3M0EA 1H85A 3G1UA 5BQXA 4KQGA 1OB5A 1XJCA 2XA1A 1EVYA 3BILA 4HWOA 1V8DA 4NCIA 1B15A 1RI3A 2XXAA 3A1DA 1X7WA 1Q0RA 4U9UA 5L3SB 5YASA 1I1QB 3O1LA 3SM3A 2Y76A 2O8FB 2PZJA 1T0IA 1WMFA 3AJ8A 1N7GA 1NJGA 1T24A 3D8NA 2E1RA 3K0KA 3AERB 4UKDA 2ERXA 2ECFA 1JW9B 3QXSA 4FDUA 4HJXA 1UH5A 4JLKA 1L5RA 4EQ6A 3CLRC 3LBNA 4BBZA 2R1ZA 1W4ZA 2E5FA 1JZSA 2PL1A 2F9MA 4IJUA 4DR3B 1JEYA 4MRRA 2OOKA 3K3PA 3WGJA 1CUVA 1DHTA 3FJ1A 3Q9UA 5B1IA 1CYDA 1SJ9A 4CPDA 1CJUC 1RRGA 1MC1A 2OSBA 3K5WA 4L8VA 3IIMA 4A8TA 1ZD4A 1MAVA 4Q82A 1VA5A 3E3LA 3NDRA 3OIYA 4V0RA 5I47A 1T10A 3LUJA 5KHAA 5LOVA 4YRZA 4G24A 3HADA 4HUTA 3STXA 1SXJB 3KZ1E 1FRFS 4DIEA 3STVA 1N2JA 1J9GA 2PMFA 5KNCD 5JBQA 4YO7A 4KE8A 4KTTE 4MQBA 3I45A 5E1BA 1O6GA 1CVIA 1HL7A 1SQ0A 3OU6A 2PA0A 4X66B 2OZLA 3DCNA 4J1NA 3GH3A 3DOOA 1F4LA 4R1OA 5TR9A 1O58A 4Z0NA 3R6TA 4X54A 2P68A 2ISQA 2R3SA 2Q2WA 2XT0A 1ODKA 4MV8A 2FTKE 4UMFA 1UDBA 2C3UA 1GO2A 1DX9A 2IYAA 4UATA 1IUOA 3F6EX 4E4TA 3F6BX 3MJFA 1U8TA 4HQOA 4PLZA 3E9YA 2WJ4A 2ZYTX 4JB2A 4GI1A 5FL3A 3UYLA 3LX6A 3DE2X 3UA3A 3C97A 4WN9A 2GN4A 1KZGB 1S1CA 2RGUA 1ZMTA 2YIJA 7AT1A 1TK9A 2HU8A 2O1SA 4IS3A 4FWIB 1ZCJA 2J09A 3O1HB 2DR0A 4DIFA 2BZ1A 4C07A 3UQYS 1G7RA 1KKLA 2GSDA 2CZGA 2PK3A 4IZIA 4FDVA 1KU6A 1DJQA 3FPBA 4IJQA 3KYCB 5ICFA 3VTAA 1OBCA 5AO9A 1ZJZA 1CJCA 5FJJA 2OLEA 1NIPA 1BE8A 2JHFA 3NC0C 4FYIA 3TPZA 3UGJA 3B2QA 2C9YA 2GPJA 1X0XA 5KVCA 5D00A 5K2OA 3GLFB 3S2ZA 5L4SA 1DEKA 1Z45A 2VPWA 1JJIA 2ST1A 3B6IA 4AO7A 3T3DA 3QYJA 5JXHA 4CMAA 3W3AH 3S8MA 3ETEA 4HDAA 3U5TA 3FY4A 4TLCA 4TUYF 3G2JA 2VHXA 1NV8A 4ZVTA 4GI5A 4ZJYA 4G41A 5EAIA 4BLWA 3ILVA 1BOFA 1MGOA 1Y5IA 4IP0A 3QFHA 4KIUA 5A9RA 1R5OA 1XDSA 4PZUA 2REOA 5IKMA 2E85A 3ZLTA 4KXWA 3QI2A 4Z3OA 4M54A 5JT1A 1YR7A 4GMGA 2YWRA 4DLBA 1QH1A 5DSTA 1MB3A 4PPQA 3A1TA 2CXPA 1H2XA 2ZTUA 3ASVA 3WJ2A 3SEFA 3B2NA 3BVPA 1PDVA 5K3OA 1BSVA 1BU5A 2JLVA 4W9NC 3DAPA 5GONF 2C1ZA 4WFIA 2ZWOA 2FXIA 1U7UA 4GP9A 4LWZA 5KNBA 4YRDA 4RVOA 4H17A 3PXAA 2QNRA 4XSVA 4BWGA 5F7OA 4UAGA 3NHUA 4MMXB 3ZHTA 2GA8A 5EFOA 4GQBA 2R8RA 4O4HA 5CNIA 4B48A 2D0OB 4LYHA 1AKEA 4ALKA 1N6KA 4FX5A 5IKPA 3PE3A 1QIDA 5BQ5A 4LOIA 3I34X 4XTRA 3SEAA 5JD6A 1T5BA 4JBGA 1K6MA 1N92A 2HO4A 2ZVJA 3OM1A 5JI2E 4W9MC 5DNCA 2R1TB 4ZU3A 5LU9A 4FGUA 2I03A 2O7NA 2QT9A 2D6FA 4L07A 3T1HB 1ULZA 3F98A 2HPAA 4HRVA 3J80A 4BNFA 2PL3A 1YL7A 2IFTA 2YJ3A 4WCVA 4C0BA 4IJMA 5ILOA 4N7MA 2EAUA 2QYSA 3FHOA 4M0UA 3Q7RA 1I6WA 1Z62A 3EW9A 1BKYA 5C4GB 4OHBA 3U09A 4EHAA 4GOND 4FP9A 1C9KA 4JI7B 1NX9A 2PQ6A 2ZK7A 3NUZA 3TVTA 3MOIA 4RA6B 3PR1A 2RGAA 2VKQA 3VTFA 3WKEA 3EPRA 2FE4A 1VJGA 1I5RA 1VSBA 4LTNA 4Q4AB 2JGFA 4XDGA 1YL6A 4ZMRA 3EMBA 4Z7QB 2Y6VA 1TEHA 1DBVO 2HZ7A 3DO6A 4JP8A 2JC3A 2TSYB 4LPKA 3R7WB 2CD7A 2E1PA 3BXEA 3UKJA 3FTEA 1G5PA 5C8XA 4CJXA 3RC8A 5K3CA 2AJBA 3L0BA 4KI0A 3SC2B 1YHYA 1SB9A 4RTSA 1TF5A 3EPPA 3VR5A 5JSFA 3I83A 4WKCA 3ELBA 4LWPA 4B2PA 2YOHA 1RYZA 1E20A 2CF5A 2EG9A 3L79A 1LV7A 3NT2A 5GVSA 4HEJA 3L4JA 2IVFA 1WCYA 3HJAA 1IVSA 4WBNA 1JDUA 3HMQA 2OKGA 4XVRA 3PS9A 2FZVA 1OT5A 3A9TA 3CB2A 2D1FA 4HDCA 4U9IS 2ZQZA 4ND5A 4MPTA 5TF0A 5EJEA 3KXIA 2QTFA 3WRXC 1DAIA 3DXFA 4L5JA 3HCWA 4B7CA 3DWEX 4XD2A 1WVGA 3RFCA 4K2AA 3PE4A 2IK8A 2FEAA 1DX4A 3WNDA 2CT8A 4MRAA 1F6WA 5CYPA 1PJ4A 2OHVA 3EQ6A 1Q17A 3E27A 3L8MA 1RYFA 3NWEA 4URZR 1UQRA 2WJGA 4RTRA 1CY8A 4AS1A 3UHOA 1OV6A 4Z9XA 4EHBA 4RHEA 3HRKA 3SIWA 3DO5A 3IAM6 1E9BA 5CXSA 2H6EA 4HQFA 4IUDS 1NMEA 3GGSA 3PX3A 5JEEA 3CW8X 3OZGA 2CJFA 2ZBQA 3MT9A 2PUBA 4R3NA 1TK2A 1YRAA 1VYHA 5H59A 3CLVA 4B4UA 3HWRA 3OM8A 3ZU3A 3SZGA 3TW0A 5I7OA 1K7EB 3JARA 3O2JA 3WY9A 3DMRA 1QH0A 3CO0S 2R60A 3C98A 4BEVA 4U7DA 4B7XA 3JWPA 4DR2B 4DLRA 1FS5A 2KHZA 3D8HA 1H3NA 3GY0A 3UBMA 3LKZA 2BGUA 3E9EA 3G5TA 4QUAA 3V2IA 1PP4A 2NUBA 3IPAA 3AOEA 1TYEB 3G0DA 3R3VA 4FJ2A 5DXAA 1CWUA 1M1ZA 2PX3A 4BB9A 3AY0A 1J0EA 2FPPB 1B73A 3B51X 3WQRA 3IUPA 4EK9A 3H1EA 4IDHA 1IEVA 1QTQA 3A58B 3WQBA 4CLHA 1Z82A 4DWWA 4ZYYA 2M1ZA 4BO0A 1ZINA 1C0IA 3JASA 4LMAA 3AF1A 3I8OA 4I46A 2YXLA 1DKUA 3WWZA 3ICPA 1DC7A 5C8YB 3W7BA 1I80A 3K92A 2J7PD 4H7PA 2XUJA 4FR5A 4XYEA 2W6OA 3T1YB 5CDFA 3T61A 3WWPA 2B5OA 1SOUA 2D0PB 4QNRA 1JDPA 1P4RA 5IRCD 1EMDA 1WTAA 1T6XA 2XD9A 4HDSB 4R3UC 4ZPJA 2WWWA 3OWXA 4BEJA 3E03A 3FYUC 4IUYA 2QN8A 2X23A 1IC6A 3G8CA 1YBFA 2R2AA 4N0EA 5BRNA 1QF7A 3WKDA 4BQOA 4X5OA 3PDUA 4ZYZA 2LXNA 4OXYA 1TEXA 4MB2A 3KJNA 5J2UA 3DVRX 2QR3A 3R7NA 1I10A 1LLQA 4S1PA 1XZ8A 4FPXA 4IQFA 4F71A 1SURA 1LEHA 1AKTA 2GEDA 4RIIA 1AN9A 4YMUA 4PZEA 4DADA 3H8JA 4TQUS 1J97A 1MPXA 4GGPA 4HDOB 2W37A 3AKCA 4JYMA 4MYSA 4D8YA 2WWIA 1HE1C 4AJIA 3V97A 2WRZA 3I9NA 1KORA 1YK1A 3KV1A 1S6YA 1QMPA 4HFRA 7REQB 2HT1A 1O9HA 3OMWA 1RYDA 5AHWA 3U4CA 4D6YA 5J2TF 1CD5A 2HDHA 3AUJB 4OQFA 1M3SA 1PR2A 1PTKA 1Y6QA 2VUIB 3K4HA 5AJXA 3L4EA 2ZRPA 4I9UA 1AG9A 2JRLA 2XTAA 3MBKA 3Q5DA 4BNXA 3RT9A 1L8XA 1VL6A 1ZVJA 4KMOA 4FGSA 5DTMA 3VVBA 4DIUA 3K0SA 2RD2A 1FJGB 2O59A 2FSFA 1JFFB 2GILA 3G5AA 3QWBA 3ZDBA 2UZ0A 3O47A 4RHYA 3OOWA 3WL7A 1Q12A 2VSYA 3RSCA 2FUNB 1UDRA 1LLUA 2D3TA 4MCHA 3RIXA 3BRQA 3KAPA 4WGGA 4F8YA 5IX8A 2PX8A 1KI8A 4RQUA 1FFSA 4WXHA 1AKRA 4X63A 3ZCQA 4CQMD 2KW5A 3E5MA 1NBME 1P5HA 4JZYA 2HF8A 2VRWA 2Z4SA 3ONWA 4MCAA 2PPVA 5K4AA 1WXIA 3D1LA 2IX9A 5TS3A 1JDVA 4QOEA 3VU1A 2VEDA 5SV2A 4DEXA 3S7ZA 2OUKA 4LVUA 4LRWA 1XPRA 3NTQA 1ZUNA 2BEUA 2W8BB 1EIWA 4DKXA 4CIYA 2YY6A 3MOGA 3CG4A 2PFGA 4PSDA 2IYYA 1K63A 2ILTA 4ESVA 2PQ0A 1CQIA 1NXTA 2R7LA 2AR7A 5JVDF 1CYEA 4MUNA 2UYQA 1C7RA 3NHWA 3OLCX 3STWA 2OE2A 5ALZA 1H8EA 5FB3A 5MHTA 2AG1A 3W1WA 4NHEA 1EBUA 5BN1A 3F9RA 3SY8A 4N3CA 5BNWA 1L4UA 3ZDDA 3LS2A 1P9OA 3OT5A 3WLHA 3GC6A 1C4WA 5J40A 3JAMA 1GZ4A 1VC2A 2MDTA 2WWRA 1ZOPA 5EIWA 2QQEA 4YCLA 1W25A 4F46A 2V9CA 2QD1A 4H60A 4QASA 5ES3A 1YDWA 2Z43A 2PKQP 1SCQA 3ANTA 4IHJB 5CMLA 3P9IA 4OHXA 2JAOA 1Z0IA 3AHDA 3WB9A 5A2QA 5BUQA 2Q3FA 2AC7A 1VE3A 2AN1A 2UYOA 1X94A 4B4WA 1BYIA 1KQOA 4MXDA 3CIOA 1DAEA 3N2EA 3WYCA 3IPYA 4DV5B 3H0EA 1ZM4A 4LISA 1JDSA 3QVGB 1D4FA 1RXWA 2OPBA 2QYTA 3DL2A 3T34A 3ADDA 5TEWA 3IAAA 1OR8A 2VHCA 4DA4A 1HURA 2O3JA 2WV7A 1IEXA 3BCUA 1YXMA 1OH6A 4KAJA 3VPHA 1SHLA 3VPCA 1P9RA 3W2TA 1GVNB 3U7GA 5CA0A 4P2BA 1JDNA 5FUQA 1IAQA 1HFWA 1Y7LA 4DQVA 1XKXA 2GS9A 2YV4A 4H1UA 1ORDA 4MYDA 3H9BA 4OKSA 1HLDA 1RJFA 2FGKA 4US0R 1TIKA 3EIFA 3ETNA 1DIGA 3U1VA 5HFNA 2GTHA 3RH0A 2J0UB 1PWYE 1ZG3A 2GKOA 4G0WA 4R1NA 3PWZA 3DDUA 1FFEA 4PLWA 2PNJA 3TZHA 1VCMA 2C83A 4RM2A 1N7IA 4RXMA 3UHAA 4RK0A 3TINA 4ENQA 3JWGA 1GGVA 1DCKA 1ZXXA 2B1IA 2ZRQA 4FXOA 4RFSB 5E6SA 2QPOA 2F90A 2J9XB 3LRPA 4MWDA 1AX9A 4DCPA 1GPJA 1UWVA 2XDYA 3WZ2A 1VSUA 2G82A 4F45A 5DM70 2XV1A 3FDJA 3QH4A 4DMLA 4MRPA 1C1XB 5A9SA 4KPFC 2B4YA 4PO8A 2QBYA 4RIEA 4HNAA 2OHXA 3PGJA 2L69A 4RD0A 2Z6QA 2O8DA 1S0UA 4XLTA 2C4MA 4JT4A 3RVMA 1LC3A 5AVZA 2Q49A 3ZLBA 3FUTA 3G5MA 4FINA 2B30A 2G7MC 4QULA 3CWZA 1Q0HA 2RC6A 3RK0A 3A6ZA 3T54A 1UWCA 3VJMA 5B3JC 4LMPA 2YQ4A 5COAA 1GZ6A 3ITDA 1HZJA 1IUNA 1JEQB 3BB1A 4FMPA 1HKUA 2YWHA 1KP9A 1YQWA 1O0CA 2OZVA 1J6UA 2EX0A 2D54A 2IU6A 4P5EA 4CYMA 3KQSA 5LD2B 1N0WA 1XMVA 1UBKS 3TLAA 2COKA 2EW2A 4GKJB 2VPZA 3LUAA 4MLCA 3SG0A 2P1DA 4BUZA 3ABOB 3L1IA 1RJWA 3WE7A 4HNRA 3K0FA 4WY2A 2AMLA 3BD6A 5JCOA 3P1JA 4LQ4A 2BHSA 2C84A 4UEKA 4L75A 3E82A 1I7PA 1XEXA 1YS7A 2R8OA 2OHOA 1ZGAA 4QXOA 1DXYA 3P26A 3SWWA 1IHPA 3QXGA 5BN3B 3FGOA 1ABFA 3BIOA 3E4DA 1HG1A 2JLBA 5HFJA 3OPYA 3TUIC 4EX6A 1J0AA 1NUUA 5GZ6A 3IEUA 1QF9A 3K30A 2W42A 1MG0A 2OCAA 1DKNA 4J2OA 1MH1A 3T5PA 2P9FA 3WGQA 4LF7B 4IIBA 1JBEA 4J1QA 3LQRA 1NW3A 1DHRA 4N6GA 1DKMA 3OCXA 3UXYA 3NCHA 4ZZ2A 1I24A 2FAXA 2Z08A 7ABPA 3LFHA 4B3GA 1UJ2A 4GPEA 1GADO 3PNBA 3RAEC 1RMQA 2PWZA 2VRCA 4EECA 4WMLA 3TJRA 1MJ5A 5MGNA 4MP8A 3QE3A 4DLUA 1AK9A 2P6UA 2I29A 3KQKA 3R7LA 1A71A 3W8RA 2JFZA 3QVXA 1XTRA 4ID3A 4BX8A 4INAA 3QUQA 2X1VA 2D0DA 1SUSA 4KAFA 4JDPA 4N01A 1C1YA 1T2AA 3FCUB 1U0FA 5TPWA 3FYSA 2PS3A 4OHRA 4X1IA 3C3KA 1OZFA 5CVEA 3QEOA 1OOEA 1X8JA 2OC4A 1C1DA 2VAXA 3T4XA 1TVKA 2ZI5A 1CS4C 3MTEA 4DAEA 1X1DA 2I8AA 2IZ0A 5LQAA 1ULUA 3DVAA 3DKPA 5E4FA 1TECE 1I51A 2FZ4A 2OD2A 1KY5A 2JFHA 1JB9A 2PPLA 4BO3A 5HJ5A 3UWSA 1XLTC 4CLOB 2ONJA 1EE1A 2BHLA 1JFVA 2FK8A 1UBHS 2MSNA 3CPSA 5JNTA 4IQ8A 1ABBA 3AT1A 3EY4A 3P0HA 2XGJA 4P2GA 2EZTA 2GVDC 4W7HA 3TEJA 1QP0A 3LVBA 2PUEA 1YC2A 3F97A 1XQYA 3GMDA 3DLHA 2BFCA 1OV4A 3WL4A 3IXQA 5LNK6 5HEKA 3INRA 2JKVA 1BFKA 1UOOA 4TKZA 1CG6A 1P39A 2JS7A 1PR3A 3E0QA 4HMPA 2G08A 1KGDA 3KHTA 1NLMA 1XQ6A 1QIJA 4LOAA 3LA8A 3KX2A 4TKLA 2XWPA 4R51A 4QG3A 3LHKA 3FUVA 5DXFA 4YUVA 3TKLA 4I1SA 2JEOA 4YGXB 2H11A 2Q4RA 4NEHB 3CEMA 1NVVQ 1L1RA 2J4FA 5FBQB 4WLFA 4ZDKA 2P6PA 4ZXPA 3A4TA 1BE6A 1QVWA 2PXXA 2QAJA 2UKDA 3Q1LA 2ODWA 4NZYA 4RY0A 4Y6LA 3W1EA 3IP8A 1WF6A 5B3LA 2MHCA 1Z8NA 3IB6A 5HUHA 3HUEA 4L8GA 4D9BA 3NX4A 3HP1A 3KZKA 1GSOA 3PC8A 4FW9A 5FYQA 3H5LA 1KKUA 1UP4A 3KZCA 4YJ2F 3DKIA 4TYYA 3EW7A 1NBMA 2ZIUB 4WTOA 4HAOA 4PYMA 2A1UB 4IY1A 1TVCA 3FPEA 4RACA 4X8OA 4IMRA 2PR2A 4XDYA 1VPTA 3D8RA 3QEJA 4YRAA 3EAFA 1Y7TA 4L8LA 4CKWB 2NSHA 5JYEA 1QPZA 4JT2A 1EUCA 2ZIVB 4KRGA 3W90A 2JFOA 3QPVA 3ZOKA 4EKGA 2CJXA 3UMBA 1W9HA 2PUFA 3WIDA 1Z6PA 2WJYA 1ZQ1A 3T35A 2QP4A 3CMMA 2QD5A 3TNDA 4KOAA 4AZ0A 3IIIA 4Y6GB 3ZI0A 1KA9H 5HS6A 1JG7A 1XCGB 2V7QD 4MQFA 5DBOA 4AB1A 4EMBA 5FPPA 1E79A 2QVYX 4GPZA 2ZRAA 2GB4A 4Z9FA 3I8SA 3SNHA 5CITA 3GV0A 3GLIB 4FYVA 4MGYR 2ZZNA 1V4BA 3PQ8A 3NORA 2QT1A 2W58A 5JXGA 1J22A 1NE7A 2RH4A 2ZYGA 3KTDA 4R16A 1VYTA 5G53C 1QDEA 2N75A 3HVJA 5FWDA 4D3FA 5KVSA 1OWNA 3DTVB 4OMUA 1HETA 2V7PA 4X45A 2FWPA 1NN0A 4RM3A 1O96B 1DEXA 2JCYA 1D0IA 2WU1A 1WMDA 4PLFA 2QY6A 2YVAA 4PGHA 1QFSA 3T0GA 3BHJA 1RKUA 4R1MA 5CT6A 5CIQA 4YWHA 3TRIA 4ZP1A 1QYIA 2ZANA 1LJUA 3HMKA 1FS4A 3WK4A 3NHYA 1SC4A 5K0TA 3OTIA 5FTWA 2H0RA 5JZBA 4AJ2A 3THOA 1DTSA 3GWZA 3X44A 3ICQB 1PJ8A 5D01A 2FR8C 2ZIXB 3QKSB 5PNTA 3BWBA 5JO0A 4BRSA 1QHHB 1EP2B 5EZSA 4BFLA 3ZOZA 4RPCA 2QXUA 3C48A 1UMKA 4HRAA 2G6BA 1CP3A 2FOLA 2PWBA 3ZIUA 3JYLA 4MINA 5JNSA 4LG1A 3FOCA 4QQ8A 3KU4A 4KSBA 2YV5A 3PCRB 4K0RA 4BC1A 2BBWA 4W5HA 1E7WA 3DTVA 2WB2A 1IXZA 3SJZA 2HPHA 1XELA 1M76A 2J0QA 1TMGE 5LB4A 4BWFB 2XUKA 3W9SA 3BWEA 3EEQA 4LI0A 4P0QB 1CF4A 4ER5A 1OH5A 5DRYA 4K6GA 1T35A 4B87A 4E4RA 5IWCA 5ISMA 5FPQA 3VOAA 4UHEA 3DTTA 3WYGA 1IY2A 2BM0A 3VX4A 3PNPA 3P9PA 2Z6UA 1LX6A 2QMZA 3FNQA 1CY7A 1EFPB 1FEZA 4I8IA 2J6IA 1NLYA 2ZS8A 3D4LA 4IHAA 4JLAA 3TIIA 2OFXA 4XD7D 2JLZA 2OCXA 1GNPA 5F9MA 3WAKA 3KQTA 1JSZA 2CKMA 2QRVB 1IE3A 1LI5A 2Y6UA 3AKDA 5CH5A 3RRZA 3WQHA 4B6OA 4OI0A 2FB9A 1UPUA 4U4AA 3FB4A 3UT0A 3I32A 3ZY5A 4JSYA 3OPNA 4NCAA 4B0OA 1DGQA 2BFPA 1ATIA 4WEOA 2O1XA 4RCVA 4WE3A 5J1SB 1L5KA 3ZBQA 1T25A 1XHLA 3BD7A 3PNLA 1X87A 3EG9B 1JPUA 2C0PA 1P7WA 4J3NA 3W06A 3E5HA 1U5AA 4L1KA 5JH7A 1X9IA 5K7SA 3CG0A 2BMAA 2QJOA 3R9IA 4EYSA 4KN5A 4XIYA 1B2RA 1ZO8A 3ANLA 2ZU0C 4QOHA 2QGZA 1RTKA 3UWDA 1NNUA 5AKJA 3WDLA 2G1UA 1CUIA 2RJNA 1TM1E 2BM1A 1R9MA 2CMGA 4P1ZA 2CCJA 3WLPA 2BFEA 5CG2A 3WYBA 3H3XA 5HKKD 1EK6A 1OH8A 3VSAA 4YMSA 4ZCMA 1CUJA 2E49A 1OLSB 3BM5A 3F6PA 3NBFA 4UVEA 3R75A 1ESCA 3BSYA 1EK5A 2O2DA 3C8HA 3H5OA 4RORA 3QX3A 2OLKA 1U0OC 3LOUA 1XL1A 4WESB 2WWHA 2WUDA 3ZH2A 3W2FA 3GX1A 2JFUA 3ND6A 4EA9A 1MVLA 4TL9A 2VAPA 4OM8A 3CVYA 2R6CA 2B98A 4P7FA 2CE7A 3M9XA 2G5TA 1G9SA 1Y6JA 2QSYA 2VPPA 3INNA 2GCGA 5JS6A 1BX3A 2AG0A 4IFTA 4JKIA 4QIHA 1N5MA 4JOCA 1C2YA 4DQUA 4NLLA 5EKUA 2ACVA 3X1JA 1SKYE 2VLIA 4B3HA 5JIBA 1BROA 3F49S 4IQ4A 2ODNA 1YCFA 1C9EA 2J9RA 2I62A 4IYJA 3NDBB 4JLBA 3TQTA 3T3OA 4QGAA 3A10A 3C7TA 4P3OA 5HRCA 3WWCA 2DMRA 1S2OA 5CFQA 4N0QA 1Q14A 4QT0A 2AYZA 1E2JA 4X20A 1ZVMA 3HKCA 4EITA 3DE4X 4JLVA 3G2NA 2XITA 1Q74A 4MQEA 5EHNA 3PNQA 1V2GA 2H16A 4D9NA 3C4VA 4OX9Y 1YB6A 5C8DA 1ECGA 2VUHB 5A6VA 2HBZA 3N75A 3CVXA 1Q95A 1Z2PX 2XQJA 4RMJA 2DFNA 3EDRA 1FNBA 3ICWA 1I1OA 5B7GA 3ZGOA 2GFHA 3WNCA 3NAGA 2QU7A 2AUNA 1I9GA 4FMCF 3BMOA 3PD1A 4GR4A 3TAUA 3C6QA 2ZB8A 4RGBA 3FUWA 3C7CB 2JHGA 1VFNA 3IBSA 4MW1A 5LIPA 1GN9A 4WT7A 3U2QA 1MOZA 2WUFA 4DJFC 1V2HE 1V47A 4EG0A 4H7FA 1VIVA 2Q9BA 4M88A 2HWWA 5HRAA 1UFKA 1W47A 3UJ3X 3RJ9A 5CB0A 1EFRD 5IVKA 2NUAA 3WGKA 4CMIB 2IXEA 4OJQA 1WA5A 2F64A 3QEKA 3PJGA 4G1EB 4YEDA 3C1AA 2DQSA 3QOWA 1XEXB 1ZKMA 2OYRA 1T3HA 2HQRA 4C0LA 2WD7B 5B12A 1M2FA 2WU8A 4LRYA 5EJ4A 3R40A 2VYVA 1DIHA 4MRSA 4GZ3A 4H7JA 3ICVA 1WCIA 4MS3B 5IFKA 2QN7A 3SICE 2F17A 1A82A 2NUPB 4HSEA 2BJHA 2P75A 4HY3A 4Z9YA 5JAOA 4CRWB 2IPMA 3F71A 3OJOA 3OPVA 1JEDA 1RLMA 2JB9A 5JJKA 3ROMA 1RXSA 3L5OA 4X3CA 5I9BA 1AUQA 3RHFA 3CH7A 5C53B 3ZJVA 3RSGA 2PKQO 5AK4A 3MJSA 4HNUA 5L3VA 1ZI6A 1SCUB 2KI5A 1ILWA 1VTKA 5EUMA 3REFA 5TV2A 3NNNA 3OKCA 3B89A 4RTPA 4X64B 4JB8A 3DW1X 2FEWB 3NTVA 3VYWA 3DEHA 1DP4A 2G5GX 1YJ5A 3NOQA 1KJ8A 3L7YA 3LKBA 4O4LB 1LPAB 1KS2A 5ECWA 3WGNA 4Q4CA 5EPUA 5G4KB 5LR6A 1XNQB 3AY7A 2I71A 3BF8A 1I4EB 2IXFA 1YZTA 5CLIA 3TD9A 1SQSA 3GP8A 3UWKA 1ECPA 3GUHA 5MN6A 5C81A 1L7NA 1PT7A 3DPIA 4XVHA 1KIFA 1Y8ZA 3HCFA 3Q3JB 3KQUA 4RULA 3UH1A 1WE2A 5FAKA 1JHAA 3QVVA 2PKEA 3JZMA 4LJ5A 5JVDB 2VSXA 4ACAA 1NONA 3QIVA 1PT9A 4YX9A 2OC9A 3S27A 3C3YA 4AJ1A 4TT3D 2C7RA 3EGXB 1QU3A 2PDAA 5AI8A 3ZH9B 4PSCA 1WSWA 4NARA 2IV2X 1K7CA 2FY8A 3B5EA 3ZVLA 2H5IA 4WI1A 4DLYA 4AKIA 1O95A 5AJWA 3M6AA 3NAQA 1A7AA 3G8YA 2VJKA 4R69A 5LNK1 5LMNB 1P7CA 2ES4A 3HN6A 2HSJA 4JVOA 4QAJA 2GASA 1P8AA 2RHHA 4OU5A 1FP1D 3KJGA 3ZTYA 4LOHA 4AIIA 3I2KA 4QDZA 4I50B 2A14A 3D6UA 1WLSA 2WWTA 4KXFB 3IOYA 4QJ5A 5J4LA 2DBZA 3GZJA 5B1YA 2EFYA 1C5KA 3STHA 3GT7A 3FOBA 3HB1A 1JKXA 3GVHA 5HVNA 1IVNA 3G1WA 1N1DA 2G28A 3BPSA 5T8KA 5TMDA 4Z7JA 5TY0A 1CLUA 2HCJB 4DLVA 3VPAA 3UK6A 4A4DA 1Z2EA 1FP4B 1N2CB 1W75A 3UMCA 2P0EA 3S1LA 5IF9A 1OXMA 1QANA 5HQTA 4M9QA 5CD9A 2JH9A 4BLTA 3LY9A 1Z5WA 1YDHA 2RGBA 2G06A 3LX8A 5LQKA 1N3LA 1IY8A 2MYTA 4NR0A 3CFYA 1JHDA 1K3FA 4N5HX 2OENG 3N2NA 1CY1A 4M38A 7MHTA 3AF4A 2MT9A 4BO2A 3CUTA 4X6UA 1B41A 3QU9A 1XRRA 3KUDA 2QM3A 3FIUA 4O4JB 1XLVA 4D42A 3W5DA 3U60B 2QRNA 4MVJE 1ZUHA 4W4TA 5DNVA 1ZL0A 2XGMA 2NSLA 1LI4A 1GOTA 1ZLYA 3CUUA 3DYBA 3LUHA 3M6MD 2K4MA 5FTMA 3U3JA 3ETHA 5TJ9A 2A9RA 4KQEA 2PEZA 4OOFA 4OQDA 5LYJA 4TMXA 4O2LA 2R66A 3SM9A 1XV5A 1MO3A 4FHGA 1CUEA 1C7QA 1JEAA 3OJCA 3RS3A 4M1EA 5SY4A 1IRXA 3G0CA 4WXMA 4BWVA 4ZEWA 1Z15A 1SUWA 3T1QA 1JJVA 4BB6A 1VJ1A 2BCGY 1Z47A 2JVKA 3DVQX 5DNWA 3VKVA 2FKAA 5JSYA 1QGAA 1L6IA 1JPNA 1EAMA 4LJAA 4D9IA 4HLUC 3P5SA 4JJEA 2DP4E 1SOMA 1I4DD 3ILHA 4ZAWA 1ZH0A 3D31A 3GQBA 4X8MA 3PB3A 4HXGA 4LBYA 3IQWA 3URMA 1BH6A 1Y42X 2OG1A 1CF2O 3DEZA 3K1AB 5G0UA 3VH2A 1K8RA 4A9AA 2CDNA 3GBPA 2ANCA 4FMDB 1I0LA 4WZBB 3N6VA 1EVEA 1L4BA 3QVOA 1P1BA 4M86A 3ZD9A 1CZOA 1NSFA 1QP8A 3ZHOA 3KTFA 4PS0A 3MCVA 4WZAA 2VSOA 1RHKA 4EVSA 4OUDA 5FP0A 2A5YB 4KWIA 2HNBA 1R8JA 1H1TA 2M6RA 3JR3A 4WZAE 3I9V1 2VNHA 5AW5A 4EJFA 4BEBA 1Q91A 5BV8A 5BWNA 1RZRD 1PW5A 2Q1TA 1C7FA 1TCUA 1W49A 3NO4A 1YZVA 1AS2A 3I42A 2GBPA 1X1CA 3TD2A 1E0SA 5EJ6A 1AQIA 3U7EB 4LOLA 3ELYA 3LCRA 5HQJA 5JRZA 3GMIA 4UD2A 1V11B 3BC1A 2AC4A 3EOBI 1UFQA 1V25A 4HAIA 5DU2A 3WIUA 1EUYA 2JD1A 3MZ0A 1RYNA 1R5BA 3WZMA 3WRYA 4HT3B 1I1HA 1K6JA 1WXDA 3TOVA 1C1DB 1R27A 3NIWA 1Q6ZA 2B36A 1QV6A 2FPKA 2N46A 1XZPA 1Z6AA 3EC1A 3EFHA 2Z5LA 2GN6A 1JQBA 2VWHA 1NVEA 3HV0A 4D9GA 1SKMA 3FPGA 4WKNA 4M89A 2FG5A 1E4EB 1O03A 3OH8A 4HDSA 3Q6NA 3DUFB 2YWBA 1D9ZA 3A05A 1TUGA 3AUYA 1E0DA 3H2ZA 1FJ2A 1ZUIA 3B85A 4LVNA 5G41A 3H3JA 1UT5A 4Y0AA 5DRTA 3FZQA 4BQRA 4OJMX 5CIYA 1F7VA 1UZMA 3I58A 1GWNA 2CXUA 2OECA 4KH1A 2NXNA 5HCUA 4YLGA 4LSWA 2OLJA 4YJFB 4G4IA 2J0EA 4FLMA 4BNZA 3MXTA 1F06A 3AGQA 3QVWA 1TLFA 5BT8A 1QHYA 1Y89A 3C3MA 2A9JA 3GJYA 3C0KA 4M46A 4PG8A 2H2AA 1N5DA 4U7WA 3ZWBA 4POOA 4Z7NB 1VG0B 3EGXA 5LZ5A 2ATXA 2ZTSA 4MHOA 3OUTA 3OVMA 4XWYA 2PUHA 1Z6YA 1RLTA 2D74A 4HLUA 4DRXB 4EB3A 2PGDA 2QAGB 1LWOA 5GOZA 3WGVA 3F1KA 2O7QA 2Z2XA 3L7DA 2IHNA 2XA2A 4ZCIA 9ATCA 1WDTA 3GJRA 4Q1FA 3CX8A 4MUKA 3SBXA 3E4CA 4YASA 1FIUA 1DOAA 1WWKA 2BFWA 3MGCA 1G3UA 3LDGA 4UUNA 1EA5A 5CFOA 1G3QA 3KHSA 1YZKA 1Q77A 1LDEA 3KKMA 4D46A 4R84A 3A9UA 3IV6A 4JC0A 2ZDHA 4UCFA 5EIBD 4DLSA 3GN2A 2EQAA 3QBTA 4RMGA 3MIIA 5IULC 3RVDA 3QE0A 1E3JA 5JBIA 3IDAA 3WR5A 3TJZA 1Z0DA 2AFHA 2G6TA 2RK6A 4NMWA 5CT8A 5EPOA 3H1PA 3T7CA 1E9RA 2FWJA 1EDEA 3KOXA 2FSGA 3VKUA 1SBQA 2ID9A 2NG1A 3L41A 3TM5A 2AJLI 3DA8A 1KI4A 3SZRA 3UBTA 1U8UA 2W6JD 3A70A 1G6KA 3UA4A 3HABA 4GKAA 1NVWQ 2HZBA 2Q1YA 4ZVVA 4YJ2B 1GRRA 3GDGA 4GRAA 3GPLA 1Y5RA 2I9PA 4DQDA 1MMFB 1R66A 4K6KA 4RVHA 2ORIA 3W6OA 2PZMA 2BSQA 3RNLA 4NE7A 4DDWA 1DC3A 2ZRKA 4CT5A 3CX6A 4EKDA 2Y0BA 4KE7A 4FUTA 4C3UA 3RVQA 2OD9A 3OCYA 5IM5A 4MDFA 4XFKA 2O6HA 4G0XA 4ZEXA 1Y80A 2WB4A 5HA5A 2ZI6A 2JAUA 5EMHA 4D3ZA 5IUKC 4ALJA 5AKIA 2J3HA 1PS8A 4X7RA 2C92A 3BWDD 1L0BA 3Q10A 1KYQA 3QVMA 2ZSUA 5TDHA 4MWEA 4ND3A 2GPAA 5FL7D 3BQMB 5BSRA 5INTA 4DQLA 4X6YA 1I4WA 1ARZA 3LL7A 4ZI7B 4X6XA 4OK5A 1VPDA 5DYYA 2A86A 5CUQA 4L73A 3G02A 4XIFA 1XKTA 2G1JA 4TTSA 4ABYA 3LQYA 5EUQB 3PU6A 1UBSB 3CM0A 1GG5A 2A58A 1QG0A 2CLFB 3MMNA 1HE3A 4XSGA 2CDRA 3ZUGA 3HACA 4MUJA 1E66A 2QD4A 2RH9B 4TMKA 1MUUA 1BDMA 3CTPA 4PSAA 3QYAA 5BW8A 2IEGA 3SXUB 2V03A 4O63O 2VDJA 5LQRA 3L4BA 4EG6A 3PA8A 4OFZA 5JAIA 2QI9C 2WU0A 2OO7A 2YXNA 4HADA 3JV7A 4TL6A 5K0EA 1B8UA 1HNZB 2E9SA 2IYSA 2WSMA 2ZXEA 3EF0A 1OQAA 1NHGA 2PA3A 2BFFA 4LJ7A 1S2LA 5JNUA 3VDRA 4X62B 3TIVA 1YS2X 4GPD1 4C76A 2O5RA 3R9XA 1NC1A 4ND1A 2B6HA 4QL3A 3VYUB 3L93A 2E48A 3ZIAD 2RC5A 1NQ5A 2QRUA 2Q29A 2XYPA 3JD3A 2HJVA 4UQOA 2P9YA 5GM2A 2YS7A 4KR9A 5JQGA 4R0MA 4G9BA 4E2ZA 1KAQA 1E1RD 1QG4A 3QMVA 4N8EA 2VF2A 4HNSA 3GNSA 1TKAA 1NW5A 5E7QA 2PRIA 3V8MA 2W6ID 1CY0A 2OTCA 4C88A 4TSRA 4ZT4A 3FPKA 4MTLA 3MT0A 4QOGA 4BY9E 4RPJA 4CL2A 3ZWYA 3I9OA 1A8UA 1KC1A 1KO1A 4H7HA 3A1FA 3MT7A 3W2HA 2C4UA 3ENKA 4NAVA 5CVDA 3IODA 2XLBA 4NJMA 4BU0A 1FMJA 2I6GA 2HBQA 2Z58A 5T4BA 2FW0A 2X1LA 2H9IA 5FOUA 4EYKA 5H3LA 1OBOA 1CUYA 1MAUA 2Z3WA 2WM9B 3KSAC 4WCFC 3U5ZB 5L95A 3VPFA 5ADUS 4FDMA 5FHQA 5KPJA 5JMPA 2BFOA 1CRLA 4XLLA 5I48A 4LZLA 1KK1A 1UOEA 3VQTA 5ITSA 4XCVA 2HXYA 4QOIA 4GAEA 4CQLA 4LW8A 2HK9A 2AOWA 2GF0A 3BH6A 1FF9A 2FF5A 3DZJA 3NOOA 5AKZA 4GE0A 3LZ6A 4BNMA 1OTHA 4H15A 4WH0A 2RARA 4TX1A 1R4NA 2BKXA 2CB9A 5LKAA 3A4LA 1FMCA 3GJXC 4RVDA 4IJWA 4WADA 2X9VA 4P08A 4XKJA 3REQA 4I55B 1UMCB 4WDQA 3AEYA 4V02A 4YJDA 1NUAA 1WUYA 4TRJA 1UEJA 4N5LA 4UHHA 3JR7A 1GZ5A 1PU2A 4DYDA 4P7BA 2OOSA 4KZKA 4E07A 5C8VA 4IIGA 2NVBA 2XNSA 4XUGB 3V4ZA 4D8TA 3BCSA 5L4LA 2ZSJA 4F4HA 3K0AB 3O8LA 2CMFA 3ZXUB 5B53A 1AOXA 5BOVA 1JVNA 4KUEA 1U0SY 2JIRA 2BVNA 2O52A 3DJYA 3HDVA 1X77A 4ONEA 4ZWNA 1EGMB 4Z3KA 2QWXA 1HI9A 1BKDR 3UMYA 1TZJA 2P5SA 5G40A 3ETCA 1BMQA 3HBAA 4BTLA 1JDJA 2F4VB 2EGUA 1KNXA 1S3IA 3ORFA 2Q8QA 4MVCA 3USES 1VKJA 4XQEA 5JZSA 3B1VA 5FWAA 1A5AB 1NZFA 3NZEA 4MV9A 2PFSA 3RRNA 1HSZA 1SXJC 3NHZA 3KLNA 1Q44A 1IHUA 4S2EA 4MWOA 3HJNA 3AVVA 4HAXA 1LY1A 1ZCAA 1ST3A 2V7QA 4TYWA 1KAMA 2V1XA 2XE7A 5KZMB 4YUYA 1OU0A 2PT9A 3KO8A 3HFJA 3F6RA 1EGVB 4JODA 4XOUA 1ZI9A 3H2SA 2IXGA 3QNMA 3GEMA 1DQYA 3QYPA 4JP2A 5DULA 4ARUA 1D8TA 6CHYA 1HOXA 1GCUA 2BEVA 3WYEA 5KOJA 1E6LA 2Y2UA 2FCRA 5C51B 1HQDA 2AJ8A 4RD2A 3FMOB 1XD2A 2CLSA 3VZCA 1RHQA 1RS0A 2WOJA 1XCMA 1DBWA 1D4ZA 1GEGA 1YB1A 3GLIA 3GL9A 4H1HA 4HWGA 4YN3A 4QXPA 4MV0A 3B9QA 3NB0A 3I01M 3FGNA 3L49A 2QTVA 1T2VA 2ZJ7A 4WK4B 5FF9A 2RB5A 2WZQA 4CHTA 3UMGA 4WVFA 3ZWQA 3D4OA 3NANA 1ML3A 2BYTA 2NU9B 1ZLXA 1E5TA 1V4NA 4QWMA 1VG1A 5FOSA 1BCRA 2IYNA 2JGAA 1S4MA 4LK3A 3SMVA 4PG4A 3QU4A 1D2GA 4G89A 4PC3A 3OECA 1WZUA 2FWRA 1OI7A 1DBRA 1XZNA 3N6XA 1ID1A 1C3LA 4HN9A 4IDCA 5DEIA 1C80A 3ZU4A 1HZZC 2RGRA 5K0FA 4C3ZA 1H0KA 1NDHA 3JRWA 4ND6A 3W9UA 4IGKA 1ORIA 3LCUA 3EIXA 3KQLA 2DT8A 2BFFB 3C24A 4Q4DA 3RC2A 1CQPA 3D4PA 3R3YA 1JLSA 4KO8A 4EB6A 3H83A 3W1VA 3Q7TA 4DLAA 3K8ZA 4RZHA 4YFYA 1E3DA 5F12A 4CTKA 1OB2A 1AH2A 1ZD5A 3RRMA 2PYZA 4QBIA 1SULA 5CCBA 2O2SA 4MS1A 1MN6A 3V1UA 2XEXA 2ACKA 3E6AA 5C5IA 4NBTA 3TQHA 4TMVA 2V65A 3LH5A 4KXNA 1TM3E 1T9CA 3F90A 1SNYA 2SCUA 3O0TA 4FJ0A 4A2QA 2QLJA 1LWNA 1GUDA 3PXUA 5THKA 3W8EA 4DLLA 4FKZA 3INGA 1PZXA 1B8NA 4UXHA 1HYEA 1TTHA