3OZDA

Crystal structure of human 5'-deoxy-5'-methyladenosine phosphorylase in complex with pcl-phenylthiodadmeimma
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
273
structure length
273
Chain Sequence
AVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-methyl-5'-thioadenosine phosphorylase
publication title Crystal Structure of human 5'-deoxy-5'-methyladenosine phosphorylase
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 95
structure length 273
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.4.2.28: S-methyl-5'-thioadenosine phosphorylase.
pdb deposition date 2010-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ozdA00
3UAWA 5ETJA 4G89A 4E1VA 2OECA 1ODJA 3KU4A 1OTYA 3OOHA 1TGVA 1PK9A 1JP7A 1PK7A 2QDKA 1A9SA 4TTAA 4P54A 3DPSA 4JP5A 2PGAA 4DAEA 3BL6A 4D8XA 1T0UA 4QATA 1LX7A 4DANA 3BGSA 4WKPA 4GKAA 1PW7A 3KVVA 4QASA 4R2WA 3DJFA 3UAXA 1T8WA 4NY1A 1U1GA 4OGKA 1A69A 4DA6A 1TCUA 2GUWA 4OJTA 1CG6A 4JWTA 1N3IA 4YMLA 3ENZA 1TGYA 1PR4A 1Z37A 1RFGE 1A9PA 3F8WA 3MMSA 3NBQA 4D9HA 4D8VA 5EUBA 2BSXA 4WKBA 5CCEA 1VHJA 3UAVA 3OF3A 4OGLA 5B7GA 3GB9A 4ECEA 1JDTA 4MCIA 1PWYE 4LNAA 3FAZA 1NW4A 1LV8A 5I3CA 4JOSA 4LDNA 5B7PA 1RR6A 4PNPA 3BJEA 4GMHA 3FUCA 1U1DA 4QEZA 1Y1QA 5F76A 4R2XA 4OEHA 4QARA 1JDSA 3EMVA 1JE1A 5CCDA 4DABA 4L5YA 2XRFA 5F73A 3EUEA 1V45E 2OC9A 1A9QA 1Z34A 1M73E 1C3XA 1RXUA 3UAYA 1Z33A 2AI3A 4DA7A 3OOEA 4H1TA 1OTXA 4BMZA 3ONVA 1PKEA 1TCVA 3O4VA 1OUMA 3LBAA 1JPVA 3PNPA 2I4TA 4DA0A 1Z5OA 1CB0A 1WTAA 5IFKA 4QAQA 1VHWA 2A0WA 3NM6B 1RT9A 4YNBA 1B8NA 1T8YA 3K8OE 1PR0A 1SJ9A 3PHBE 4L5CA 1JE0A 5K1ZA 1ULBA 3GGSA 3DDOA 5CXQA 1Z35A 4L5AA 1ULAA 4G41A 3OCCA 4G8JA 3OZBA 4M3NA 1U1FA 3D1VA 5B7NA 3O6VA 4TXMA 4BN0A 1U1CA 1SD2A 2A0YA 3LA8A 2QSUA 3FWPA 4U2KA 1RXYA 4LZWA 2AI2A 4TXHA 3P0EA 1NC3A 1PF7E 4WKCA 1PR5A 3IEXA 2QPLA 3P0FA 3KVRA 4X24A 3EUFA 3FNQA 1T8RA 1G2OA 3E9RA 1YBFA 3KVYA 4TTJA 2HSWA 5EPUA 1Z5PA 4YJKA 1Y1TA 3OZDA 4WKOA 1K27A 2QTGA 5F7JA 4F3CA 3INYA 3U40A 4EB8A 1RXSA 4K6OA 1V41E 1V3QE 1ZOSA 1YR3A 3BSFA 4IP0A 4PR3A 1A9TA 4F1WA 4R31A 4UC0A 3K8QA 1VMKA 1V4NA 2A0XA 4OF4A 3IOMA 3UT6A 1OVGA 3TL6A 2B94A 1K9SA 1YQUA 2H8GA 3NM5A 3OZEA 2P4SA 3MB8A 1T8SA 4D98A 4DARA 2I8AA 4TYMA 4KN5A 4BMYA 4LKRA 1OV6A 4D8YA 4GLJA 4TS3A 4DA8A 1I80A 5DK6A 1RXCA 2A8YA 2OXFA 4EARA 5B7QA 1U1EA 1RCTE 5EFOA 1Y6QA 1ODKA 2HWUA 3E9ZA 4MARA 1A9RA 4TXNA 4QFBA 3EEIA 1FXUA 1Z38A 4MCHA 5F77A 1YRYE 1RSZA 3UAZA 1QE5A 1RYZA 4F2PA 3SCZA 1JYSA 2ON6A 5CXSA 5CYGA 3T94A 1LVUA 5F7OA 1ZL2A 4OY3A 1Y1RA 5F7ZA 5C80A 1ECPA 2HN9A 4RJ2A 1JDVA 4GLFA 2AI1A 1JDUA 2HRDA 3KUKA 1PR6A 4M1EA 4F3KA 3C74A 1VFNA 1NC1A 3NM4A 1Z36A 1Y1SA 2ISCA 5CYFA 2IQ5A 4NSNA 4L0MA 1ODLA 2Q7OE 5KB3A 3OPVA 1SD1A 2QTTA 3PHCA 4I2VA 4NS1A 2AC7A 5F7XA 4FFSA 3LGSA 1A9OA 5JPCA 4TXJA 3ODGA 1ODIA 4WKNA 1K3FA 5FAKA 4LNHA 4M7WA 4TTIA 4TXLA 1V48A 3OZCA 4L6IA 1YQQA 1Z5NA 1PR1A 1XE3A 3FOWA 1OU4A 4DAOA 3PNSA 1V2HE 3KHSA 3DP9A 1Y6RA 1PBNA 1Z39A 5IU6A 5F78A 3DF9A 1PR2A 4F2WA 3FB1A 2RJ3A 1B8OA 1SQ6A 2OC4A 3E0QA 1Q1GA 4BMXA 1JDZA 4TS9A 4YO8A 1TD1A 3QPBA
chains in the Genus database with same CATH superfamily
1N36B 5CNJA 4DN6A 4S24A 2QZSA 5EE9A 4H7FA 4FHZA 1NVGA 2G7ZA 5D7NA 5E7QA 3UJNA 1PUXA 2E4VA 2EEZA 2X7HA 5FL3A 4RULA 2OE2A 4F4HA 2HA3A 3BH7A 3NHBA 4L7QA 5P21A 3GLFA 1FRZA 1HDOA 1NUSA 1VOTA 4NV3A 4QBTA 3ICCA 5ECGC 4BV8A 2VS1A 2B4AA 2RE8A 1PK7A 3BK2A 4DR6B 2H2IA 1E94E 1NONA 5BSRA 4DMLA 1M1NB 2WW8A 3CH7A 4I6EA 1UKYA 4PG7A 4B3XA 1ZC4A 3AXSA 1SA0B 2BGTA 3MWFA 1ORIA 4Z0TA 5C3UA 3WYGA 4M2LA 4YI5A 1HDCA 1R8JA 1TVKB 1IEWA 1ISMA 3U7GA 3MJRA 2GOYA 2WSSA 4YUYA 3CMCO 4IGKA 4L7VA 1YA4A 4PHHA 2XLBA 3Q7PA 2GTHA 1U8YA 4R2KA 2AT1A 4TSFA 1DEXA 2A35A 2AG5A 3HGMA 2ANBA 4QGGA 4C4XA 2HHCA 3EC1A 2AD1A 4GMGA 4XR4A 2Q2QA 1T0BA 3SR4A 5F5NA 3ZK7A 1OZAA 1M0TA 2DB3A 4FQ5A 3DKKA 1V1RB 2HI0A 2ZITA 1OI2A 5L53A 3VR3A 2HDOA 1J5XA 3MLBA 3F3KA 1OWMA 1RPNA 1E4EA 1SXIA 1X1QA 4KXQA 4WLVA 5HRUA 3W8DA 1JQKA 2QZJA 1I3NA 2XDQB 4NY1A 5CFOA 4KYUA 4Q0MA 1OW3B 1TT5A 2G4LA 3SOPA 4WX2B 3NCTA 4ESHA 3ZCUA 3B1JA 3GELA 4ETMA 2Z6UA 2ODEA 1TEXA 2JAQA 3DFIA 5B58C 1K2VN 3CM0A 3KTFA 3OPQA 3BMOB 5JZSA 3VKWA 3C5CA 4P53A 1NYQA 1OE0A 1Q11A 1KSJA 4YMLA 5LSAA 2CHQA 1BMTA 3TMYA 1N9ZA 1YULA 1ZQ1A 1Z8DA 2ZRPA 1Y8RB 4EW3A 4C88A 4GEKA 1YUNA 3LDFA 1MQ9A 5HQJA 1WKBA 4KDFA 4KK3A 2OKCA 4ESEA 5AJWA 1Q0UA 2O8DB 3GLHB 4MYUA 4EB6A 4IQFA 2PX5A 5J9FA 4CCYA 3IEUA 4P1ZA 3H5VA 4C6TB 1AS0A 3PXCX 1NP3A 1BWQA 1DEKA 1T2VA 2YJ6A 4I14A 1HC7A 2WFLB 3NWBA 3AX6A 2GYUA 4I1RA 2W6ZA 4WNAB 4DPMA 5CCEA 2EL7A 2WVGA 4G65A 3L6UA 2QX8A 4W9NC 3KCQA 1FVXA 3TTXA 3C8ZA 5E2IA 3WVNA 4N39A 5FP0A 3TINA 4M6WA 4MHOA 1MJFA 4BKUA 2P6OA 2ZSHA 4K05A 5B7GA 3T3OA 4OX9Y 3VVLA 3HBLA 5A1TA 4B87A 4PZLA 5I4IA 4MCIA 4GKKB 4OHBA 2GN4A 5T4FA 5HS6A 2IV2X 2CLKB 3AI3A 3T5MA 4DS3A 1ZI8A 3NB0A 3CVVA 4MGZR 1NZFA 2WKPA 4NV0A 1DC7A 2WUVA 3VPAA 3DLCA 1U81A 1C7RA 4KL8S 1OAAA 2LRHA 2QRNA 2QL5A 3MJEA 3AR4A 1L5MA 4KGVA 4KXLA 3TZKA 1O9BA 1VTKA 1T8PA 3O38A 5G40A 4WA7A 4X00A 1JVBA 3H5WA 3RRJA 3LVBA 4IH9A 1SXJE 1UBHS 4NMLA 4G0ZA 4K6CA 4LZPA 3DVQX 1OAKA 3ZZ0A 5B3AA 1R4NB 1WMAA 4FSHA 3WL7A 1HTWA 3C85A 5KTYA 3LCVB 5E4TA 1GYPA 1KTIA 1B3RA 1QVWA 2NUAA 1H2ZA 3G0BA 4FSXA 5CHYA 2CCKA 1MAUA 3PI7A 5TT0A 1CUHA 1GGVA 2RJNA 1H85A 1ZNWA 4XSHA 3AEQB 4DABA 1QX4A 1M0WA 5BRNA 4F7WA 4Q9AA 2VCYA 4WJKB 3TNFA 1BO6A 2PUVA 4XPZA 3DBHB 1W30A 3TQTA 3ZW8A 4PWYA 4OD0A 2IH5A 2JJ1A 5IKOA 1E3DA 2IYEA 3SN6A 1M73E 1H9BA 5CJ2A 1GTVA 4PPQA 4WQMA 1EK1A 3TSCA 1YB7A 2GBGA 2HBZA 4EJSC 3WGHA 3O92A 2W2OA 1NQUA 4KR0A 3M81A 4PNHA 3HEAA 5IDYA 4HHEA 3CW8X 4DUYB 3O9VA 1SVUA 2C78A 3EE6A 3A10A 1AUQA 2VAMA 3O4VA 3T7KA 3LPCA 4R0NA 4EYKA 1U6JA 5KO2A 1JPVA 3RS0A 1Z9BA 5JSZB 1Z5OA 3NONA 4ZT3A 1V9LA 2ILVA 1HFJA 1NYTA 1YA8A 1NVWQ 3ECCA 1Y81A 1RE0A 4GRIA 3RLIA 1FW8A 1TM1E 5KTTA 1TO1E 2AQHA 4TUYF 3VYRB 1YQEA 1DEOA 2IEDA 4JYZA 5C3MA 1U2GA 1UJ5A 2O7NA 1R50A 2A0WA 4RPLA 3PI6A 3VU1A 2JLCA 2BF7A 4RD2A 4TQGA 1P2TA 4CKCA 3V2IA 1XOIA 2C77A 1ISIA 2OK7A 2SCUA 1K6JA 4NG4A 1NV9A 4YMVA 4BS9A 1V43A 4I4IA 1MC1A 5TPZD 1KI1A 2NU8A 2QYTA 2GEDA 4YYZA 3WLNA 1WP9A 3E9EA 1E6CA 1HFWA 1PR0A 4IDBA 5DTMA 3UFXB 4PYNA 2MSDB 5KSYA 3UMVA 1BQ4A 3O8DA 3SJ7A 4ND7A 1EWTA 2C57A 3DW1X 4KQHA 1XROA 2WJZB 1L5GB 4F6LA 4ZCTA 5U1PA 2X2EA 4NK4A 2WTEA 3GH3A 1N1GA 1RMQA 4WK4B 5TMBA 3U16A 2PVSA 3NBYC 4Z2AA 2DECA 1QQBA 2CGEA 2Q3FA 3D1VA 3QENA 3VHRA 2OHVA 1O9HA 3QHAA 1N7GA 3TOSA 1BD4A 1NVMB 2G3YA 1ZEMA 2VHYA 1QG4A 5JYCA 3UICA 5EQTA 4TMZA 4D9CA 1OI3A 3DMTC 1LS6A 3PGMA 4W5QA 1X14A 2RGAA 4LTNA 4LYHA 4IM7A 1RP1A 2C8JA 3NOVA 4Q9DA 4YBZA 2W70A 5KC9A 4BNGA 1PFQA 2CHVA 1P5JA 4LYAA 3C7DB 1Z06A 1YB6A 3OZAA 2E5FA 4DSTA 1E98A 3ROEA 2FP4A 1T6NA 3E0XA 4PS1A 1C41A 2EKDA 2OWEA 4MVJP 5KKAA 3VC7A 3PPWA 4CL8A 1WOMA 2O0HA 1DL5A 3SZUA 5E6UA 1CYEA 3HVIA 4P4LA 4RV4A 5DBEX 1PNRA 2I1LA 3U6BA 3WG9A 3I9NA 1X1DA 2C96A 4M46A 3PNYA 2P2DA 4CLXA 4IQ8A 1ULSA 4KSCA 2Q5FA 1P6UA 2GLXA 2HSWA 1NI5A 5D51S 2F3QA 2VDUE 5IZCC 3KYIB 3R20A 2HA0A 4LE1A 1G4UR 4ZAWA 4CUZA 2IS4A 4EKDA 1BH2A 3ZV5A 3KJNA 1V16A 1EUCA 3ESAA 3LO8A 4KWTA 4YQEA 3ZDFA 1XTTA 1J07A 1KC1A 2V6MA 2XYGA 4F0JA 1UXIA 3G2HA 1MJNA 3I2IA 4IG4A 1IG3A 3JY6A 3SC3A 4MUJA 1ADFA 1FLDA 4BIIA 1RMTA 4NEQA 3IV9A 1VBMA 2YCBA 1ODSA 3IQEA 5FD8A 3BTOA 3VGJA 3L7IA 4DMHA 3HJFA 1D03A 3WE7A 2LKCA 1U6IA 4UC0A 3GUYA 5DLEA 3NAMA 4Q4AA 5C8DA 4U8HA 1SBZA 3QVLA 5DHRA 3IEPA 1KE1A 3UJAA 4FDMA 4WLFA 3UMCA 4FNGA 4YEDA 5L8VA 4X8HA 4JFAA 4N54A 4XUEA 3Q8MA 1NASA 3O2SB 5JXWA 4OF4A 1P2VA 3WNCA 3R4CA 1PYGA 1T1JA 2PEYA 2X8BA 4A82A 4X64B 2CHUA 1NVUQ 1HOTA 1VC2A 2DJIA 3H1TA 3I2JA 4RU1A 2ID8A 3H1AA 5E1MA 1PUIA 1KY3A 2ENUA 4JP1A 5AYVA 3T1OA 3VKFA 5H0IA 1UZLA 2B94A 1R6TA 4QDZA 3TOXA 3PQ5A 5ERGB 1YQUA 3A6ZA 3T5DA 3AVXA 2XR1A 3EOZA 4MRSA 4JI0B 3M49A 3BHMA 1G18A 3S4YA 5L6MB 1LH0A 3AGPA 3M1AA 4CUJA 2KYRA 1UKBA 2Q8QA 2VSFA 3B85A 3KR0A 4RHFA 4EJ0A 5KYVA 2AR7A 3PFBA 4JJEA 1WWKA 1KORA 2Q1XA 1X2EA 5HKKA 3UGKA 4KN5A 5E95A 4D8YA 4LNUB 4TS3A 1C7JA 5JYDA 5JI2E 4TYPA 2X2FA 2E49A 1X7ZA 2W22A 5EKSA 2NO4A 4YAIA 1P45A 2A8YA 1PFUA 3B3AA 4UUMA 2O4UX 4I08A 4PG4A 2WWYA 3JV7A 3QVVA 4X95A 4QHTA 5A3QA 2NTNA 4OU5A 1XVIA 2A1UA 1K06A 3D6HA 4WE3A 4MARA 3R9XB 5TXGA 4MKHA 2E85A 2HWWA 1UBCA 5IKPA 1U6KA 1FXUA 4HX5A 3QU7A 1E9SA 1Z38A 1RJGA 4ZZ3A 4OLBA 1NJ8A 1JWAB 4MW7A 1KYTA 1HYQA 4PTYA 1FQJA 2Q3BA 2DKNA 2FR8C 3SYTA 4ZMBA 3I37X 4YUZA 1YS9A 5T3YA 3HXPA 4CG0A 3FIUA 4RORA 2UXBB 1EFVA 1RKQA 1X39A 1P2UA 2DM6A 2QLFA 4HDRA 2ZBDA 5A5GA 5LUAA 3VDNB 2J9FB 4A27A 3HM9A 2VPZA 3LHKA 1VI2A 3ZHOA 5LD2B 1UIRA 3A06A 2A0UA 2XE8A 3IR5A 2VZ8A 4RH1A 3AVTA 3IAHA 3R7AA 2G09A 2OFWA 1GPYA 4YQZA 3K5PA 5F7ZA 3OZTA 2VTKA 1FP2A 1HRKA 5B2ZA 1K6XA 1NUHA 3HFRA 3SICE 2GJAA 4F3RA 1XTVA 3H6HA 1HRDA 4UEQA 4CM5A 2BGKA 3QTBA 4JMLA 2VXCA 3HKCB 2JLZA 4X45A 1JQ3A 3HJGA 1U02A 4D4IA 3RVLA 4N3BA 5G2OA 2XQIA 1TZCA 5BT8A 5JANA 1NZJA 1R0LA 2HRDA 2IIPA 3QY9A 5D3MA 1B0PA 3RAJA 3WHKA 2R0QC 4V39A 1OA0A 4W7IA 2Q6IA 4M1EA 4F3YA 1DC6A 1NQTA 1VIVA 3ORSA 4KE6A 4HQRA 3IBYA 3KAQA 3L02A 4WI1A 3G0IA 3TBFA 1OH5A 1YFZA 3EXHA 1JHDA 5TF4A 4BJ1A 4U00A 4BLUA 3HY6A 4ZPJA 4ZK2A 3P9NA 4HDAA 1RI5A 3M6UA 4HPWA 4B4VA 3KD3A 5K0JA 5KNCD 1M2JA 1NBOA 1AQIA 1GU0A 2BTOA 2PU7A 1V8ZA 4QGSA 3WYFA 1G291 1V8BA 3HO1A 4C76A 1B73A 1FQOA 4EKNB 3GXBA 3U7IA 3M5PA 3P2MA 3SBOA 3L8CA 2XQKA 2Q4EA 4C5AA 3U9TA 3LT1A 1Q0ZA 1QGED 3OE1A 3OPVA 1F8XA 2IOFK 1IM2A 2OD7A 4D74A 2HF2A 4JJFA 3B2EA 2PVPA 2X9NA 2AC7A 4HAZA 1I0IA 1PD0A 1TZKA 2C5SA 1RZUA 1ESNA 2HU8A 1SCDA 1PFGA 5CM9C 1SZCA 3WZMA 2VI5A 4DIUA 2QTAA 5BN4B 2B9VA 1WF6A 1M76A 3DCNA 4MMYB 2W8ZA 2P27A 4IJMA 4YRZA 2JIZD 2KHZA 1G7TA 3ISJA 2Q8PA 4KWCA 1I01A 3AUYA 2G77B 5SYMA 3CU5A 3GDOA 4ZOBA 3UB3A 1VJTA 3MTAA 4P33A 3NJ8A 5CB6A 5EJ6A 3COVA 1L4FA 5SY9A 2CVFA 1VIAA 2RGXA 1HR0B 1WB9A 2YZGA 3OZCA 1JKJA 3LOUA 1PO7A 4D41A 1JI0A 3LKZA 2HLPA 5L3SB 3HXMA 4P7BA 3PXXA 2I7XA 3DP7A 4LIPD 5H83A 4CFZA 1Y7PA 1PR1A 9LDBA 1RS0A 5A62A 2IZZA 2R8RA 4X85A 2PHZA 2EFEB 5AKGA 3WYAA 4BMCA 1W5BA 2H0AA 3D8TA 2PNFA 3TRDA 5EC8A 5J2UA 5KJ1A 1K92A 1V2HE 3DM5A 1IK4A 1IY1A 2X0IA 4H08A 4U3JA 3UH1A 3IEVA 4X0EA 3TM4A 4HBZA 4ASUA 4J6FA 3WB1A 3JATA 1ZGGA 3UMSA 2B69A 3O8LA 2QJOA 4X60A 3A6EA 1PV1A 3P26A 1ZM7A 1AUXA 2D2FA 4EKIA 5IYZA 2WIDA 4KIGA 4RHTA 4MI3A 4EEXA 4OGWA 4EG5A 1TLLA 4Z5XA 7MHTA 4NI5A 1M1ZA 3JVVA 2WAOA 3F8TA 4PX5A 4JDPA 5CP8A 4GZ5A 4WPGA 4K3VA 3KOMA 4J16C 2C0PA 4NYIR 2I3BA 4KFCA 1YDFA 1OIXA 3K2EA 3EMKA 5JJ5A 3GZNA 3HCWA 3RLFA 1P72A 4BNKA 2ZWAA 1Z75A 3QVOA 4HMPA 4R8VA 1IZYA 2HJVA 1WCYA 5F52A 3ROFA 2FPPA 2W2PA 1X1TA 1ZRMA 4G89A 3RW9A 5GIPE 1CEEA 4Z51A 4CFYA 1P4RA 1T5SA 1O96B 2N1BA 3H1PA 4ZVRA 2ZVQX 3KYDB 5LJIA 1SEPA 1XKXA 3BE5A 3KQMA 2V59A 4ZTUB 1G7SA 5ALQA 1CHDA 4DCUA 3TLJA 5F7XA 3CTMA 4BXOA 2Z1MA 1E6UA 4G6ZA 5JCOC 2FK8A 1JP7A 2YN4A 3LXRA 1XMXA 3Q7SA 4AVYA 4JT8A 5BXQC 2H63A 3NRJA 4B76A 4MVJA 1G20B 2GCGA 1SUEA 1IULA 1EUQA 1DIGA 4D9EA 3HXKA 2X5NA 2I3ZA 2ZQ5A 1GU7A 1O57A 5IVPA 2XGMA 4D8XA 3WHIA 4I99A 3UT5B 4JFRA 5EINA 1W88B 2WVHA 2L19A 3MLEA 4PAOA 3WOVA 5KMGA 2ARKA 3L6BA 2WSYB 2HT1A 1W49A 3PC2A 2EW8A 2JCGA 1FSGA 4EH1A 1GR1A 1KU6A 2NT4A 3D81A 3WLTA 2ACEA 3MF4A 3ZZTA 3ZWXA 2I4NA 4PO8A 4MIKA 2REQB 2P8SA 5IWAB 2Q41A 4HR7A 4N5LA 3NKLA 2Z8YM 3HG7A 4D3SA 1CJCA 1EFPB 4ENTA 2HW8A 3EG9B 3G02A 4LK2A 1QC5B 4E5UA 1AS2A 3JQQA 3RU3A 1ACMA 1T4GA 1UOPA 5C7LO 1LBSA 3GVIA 5JAIA 3CJQA 3JRXA 3RBAA 1WXIA 4KQWA 4FJ0A 1BRMA 2XUIA 2FG5A 1KPHA 1GEEA 2FUG1 2R48A 5L3RA 1GOTA 5DYYA 2MINA 1AN9A 1QANA 1RRGA 2F8LA 3HDGA 5C7IO 1CG6A 3FWHA 3U44A 2DUWA 4Y6LA 3DFZA 2BPOA 1U8CB 2BEVA 5GONA 4BQOA 2Y77A 4AN4A 3LXUX 4OBWA 2UAGA 5AOVA 3JSXA 5EQJB 2PSSA 2PT5A 2O8EB 3IPRA 3MBKA 4NBTA 3UXEA 4UREA 2EFHB 2R97A 4HS9A 3I3SR 1C8VB 2XYPA 4QODA 5IM5A 4YAKA 1ORRA 1HYHA 1KETA 1CD5A 2BEWA 3B9PA 1NVAA 1YT5A 2OCGA 4IEIA 4RKWA 4WSOA 2EEPA 4OMFG 4AZ0B 4UOEA 4R8RA 5I8WA 5DYTA 2ZDGA 2YQ5A 5F2KA 3K71B 4P0PB 4QRHA 1K1EA 1OOEA 3MTDA 1KY2A 3KPWA 4J0KA 4KKXB 2N46A 3MYYA 4UAVA 1SVNA 2E89A 3COYA 1RRPA 2YINC 1Y9DA 4WKBA 3FLEA 2IRWA 5EUBA 5KTMA 4CNQA 1Z74A 2N3ZA 3VOBA 4C0JA 2IPAB 1VHJA 3R6WA 2HIHA 4BNJA 4G0VA 5HKAA 5FOUA 4EHFA 3KYCB 5HWSA 3CW9A 3DMGA 3IE0A 1IOZA 5K0LA 2H1VA 4AS2A 5IK2D 2ID9A 3CLSD 2RJOA 1PJSA 3G0GA 4GL4A 4Z7QB 1L4EA 1K8QA 4OGLA 2BMDA 1V11B 2RHTA 4BGVA 3TG2A 4WFJA 5C0OE 1J0EA 1N6LA 2AJBA 3I9FA 1QZUA 3L8GA 1H2XA 2BUBA 1RWNA 2PH3A 1ZZEA 3P4XA 4GECA 3JAWB 4MWOA 3TWOA 5A06A 2P9EA 2E4ZA 1LY1A 1HKUA 3C16C 1VCOA 3IHTA 1Y42X 3E58A 1X87A 1M34A 4N3CA 5M3BA 1AZLA 4NYMQ 1B6GA 1XMJA 1PT8A 1ESDA 1HZZA 4YC7A 3OQMA 4PV7A 4XGKA 2NSYA 4YRQA 3VR6H 4CL2A 1KRXA 5AI5A 2E4UA 2L42A 4YN3A 5CAEB 1W0KA 1K4YA 4DBLC 4BKPA 1VE7A 2YOGA 2R66A 3T4PA 1E18A 4HP8A 2Y1OA 1SUCA 1QO0A 3F49S 1V3TA 3OZ7A 1ZGZA 4KLCA 4XX0A 4R8KA 2GF0A 1E3JA 4YQFA 1ZUNA 1QFXA 1U7TA 2E82A 4WNYA 4PZDA 4YRCA 2D59A 3ZBQA 5L7WA 1QP4A 1YBHA 3USES 4NQZA 3QJ5A 4R2XA 4AZ3A 2VEOA 3EUWA 4QARA 4QFMA 5A04A 1UZMA 3FETA 3OZIA 1C50A 4TMWA 1KJWA 1V25A 2DHQA 2BBOA 3AH8A 3S68A 3VU9B 4L5YA 4L75A 1P91A 5C2JB 5FADA 5JY6A 5TMPA 2HHAA 1U4OA 4RENA 4U2BA 3URMA 2HMTA 3GO4A 4IJWA 4OQXA 3EDMA 3C3KA 4JBXA 1N2SA 3ANTA 4Q3DA 1GL9B 2V3CC 2CK3D 3OQPA 2CNOA 3UAYA 1CY7A 1V4BA 1R27A 4FCCA 1KY4A 3NDRA 5BWCA 2O8CA 4PZEA 1UXGA 1OLSA 4TLLB 5T6MA 3IT1A 3QKTA 1JNYA 1PKEA 2ZAMA 3MQ4A 1PRYA 3OETA 3PX7A 1C3JA 4IIYA 4KRGA 4D97A 1FU8A 3MJFA 1MV5A 2WPDA 4BZQA 3WK5A 4D4MA 3W5HA 1ZI6A 2R2AA 1MABA 1PL8A 1PWHA 1R0RE 3H2ZA 3DE5X 3EWIA 1M2OB 1UDRA 1E64A 1GT91 2ZROA 3JQFA 3KPYA 3A26A 2Q9UA 3O3MB 2P5SA 3UV3A 3W3AH 1JBQA 1M66A 3DHYA 3L0OA 2PUAA 2GHRA 2NX2A 4NBRA 5F2OA 1PEAA 1JZQA 4YACA 5BYKA 2IGTA 3EQ2A 3W78A 5GZ1A 1YMUA 3VYSB 4M1WA 1YI0A 4CT4B 4ZCLA 4TKVA 2VJYA 3W5JA 2RH5A 3TRJA 1OASA 2WUDA 2GAIA 3V4FA 4MDYA 3GRPA 1FRNA 1CP2A 1MAHA 3GLRA 4J0GA 1Y33E 2X6QA 3VR6A 4BDTA 3RC2A 1OHHA 2HTFA 3RIMA 3L0IB 2VC2B 4FSDA 1HDYA 3QPVA 3D0OA 4BNXA 3WLIA 4JQSA 2GLUA 4XPIB 4KN9S 5AICA 3HI4A 1QFZA 3TIGA 4KX3A 3GROA 2XXAB 4FILA 3L0BA 2BGRA 4LYEA 3UHAA 2VP2A 3M83A 2ZYDA 3JQRA 1R0XA 2FFAA 2VOEA 4F9TA 3L1JA 2J0QA 4KWIA 2VQFB 3ED1A 1OFGA 4Q1BA 2F3PA 3FDIA 4Q15A 3KKQA 1TZBA 2F4NA 4XD2A 3KXLA 4FT2A 4CMHA 1P0PA 4G4GA 1U7HA 2I4OA 2F7SA 2A0YA 1ADBA 3JARB 2PA0A 2QSUA 3BL8A 4CIVA 4FEAA 5CFZA 4UBIA 2DZDA 1XK7A 1X7XA 3I23A 3F46A 3LBYA 2YJGA 4Z2YA 3HE3A 5HKLA 1LDGA 3IBFA 3L6EA 3GT0A 5JJBA 1FFXB 1Q19A 2C9CA 5F1KA 3UFBA 4ENRA 5J2UF 2GARA 2FJUA 2XAUA 1AU9A 1N8KA 3M70A 5AW2A 2WJJA 3RFUA 1J33A 4WDRA 2WYUA 3LQYA 3PSHA 2HIMA 4BCCA 2XIQA 2JLYA 1MAWA 3LW7A 3N53A 1G59A 1OQAA 2YIDA 4KOEC 4C0SA 5HJ7A 3GN2A 2ZTLA 3AIIA 4AZTA 2PUHA 1DWQA 3OX1A 3I8OA 5IYZF 1PT9A 2EDCA 3VSEA 4M0UA 2GPSA 2WHPB 2J9ZB 2ZYHA 5I9BA 2EYUA 3KVYA 1U3VA 2GBFA 3AJEA 3CE9A 5EPUA 4LV5B 1XRLA 2QP4A 4Z3KA 4MHTA 2BFDA 1T4CA 4WH0A 1FSSA 2R44A 1PJCA 3KSDO 1VE5A 2J48A 4UJ3A 3RQIA 4BVKA 5KNLA 3W3AA 1Z5WA 4I1SA 1YRAA 5DB4A 2B5WA 3DBLA 3S70A 3JQAB 4C0QC 5DV9A 4E2YA 4QG7A 4E3WA 1N78A 3QNUA 1H3NA 1H1LB 2Q21A 4M1ZA 1O08A 2NV0A 2I78A 2HPZA 2QOEA 1JIKA 3HB1A 3DYVA 2GZHA 4QYWA 2HYDA 4LOJA 3W8EA 4YRNA 1ZBQA 4M0MA 3UTDA 3UCXA 4Q7QA 4JP8A 4ZMRA 1S2OA 4BC0A 3KB8A 2PUTA 5EESA 1J42A 2YVUA 4F1WA 1P4AA 2FR0A 4WOPA 4HDSB 1LI4A 4GXTA 4NV1A 4R31A 3FHOA 4AYWA 4JELA 2HXGA 1NW9B 4E51A 4MVJF 2PT6A 5DNWA 1XDSA 1RHKA 2QORA 3EVBA 5A3VA 4DJ5X 5JC1A 4DUZB 3I30X 4B8ZA 5BNIA 3TVTA 1L1EA 1X8KA 5LC1A 1GCIA 1CJMA 1V96A 3H18A 3P9RA 3P0JA 3R3SA 2R6DA 4B80A 5B64A 3P2KA 1XMIA 4CMKA 2CXPA 1YRQA 3CF0A 3AT1A 3M34A 1L5KA 5KTSA 4CG1A 4KRYA 4UNNA 5FJJA 1UPCA 4I9GA 4E3ZA 4L3OA 3ZHTA 3G5AA 4JJZA 5FTWA 3AF3A 4LQDA 2GVDC 1Z15A 2VBCA 3ACBA 2AA3A 1OX5A 2Y9MB 1Y1PA 5KTNA 1ZO8A 4AQDA 1N5JA 2ZTUA 3HB5X 4HWOA 1FX0B 2IOFA 4DTCA 2A88A 1WA5A 2E6UX 2I8AA 3CISA 3N8DA 4O3MA 1QF9A 5CNIA 4Q7JB 3UTCA 2JHPA 3L5OA 3UWSA 2XB4A 3AFNA 1PD1A 5LMZA 2OB2A 2Y3IA 1DUIA 3A8TA 3PBKA 4EGFA 2EQ5A 2VP9A 2UZ4A 1F14A 3IQWA 4DSZA 2JBHA 2PZGA 2Y1DA 1U7ZA 3FRJA 4CN9A 1D4FA 3WFJA 3C98A 5KPJA 2VYQA 3HB0A 3BWDD 2Q62A 1Y6QA 4GBGA 3T6KA 3VO2A 4DG9A 5E9WA 1K0FA 5CPBA 5ECDA 1QHGA 5GONF 5FDFA 3RVRA 3FBTA 1HNXB 1XWIA 2HADA 3NHUA 3L4BC 1QB8A 621PA 1Y4AE 4IJVA 2P41A 3CR8A 2BDEA 2VH5R 3K53A 2E9SA 3MC1A 4EY3A 1T5BA 5AJTA 4C7OA 2EX0A 4PG5A 1AJEA 2QY9A 1DDGA 5FBHA 3IGFA 3HUUA 2VJDA 3NWJA 4MYRA 2G6TA 3WWCA 1QE5A 5DGDA 3FCAA 3G7NA 2IU4A 2NQTA 4XW2A 3K0CA 3PGKA 2CNNA 3T1HB 5JJIA 5LP6C 4IICA 1V6SA 2G9UA 1L9XA 3CHYA 5LDGA 4U5XA 2WTNA 2IDMA 4ARVA 3ZD6A 3Q9NA 4BQSA 5K03A 1M8JA 3I39X 3GEHA 5IF9A 1ZAKA 1RWOA 1JSZA 1V7QA 4BEBA 4DJJA 5ADUS 1EXDA 3FIJA 3C15C 3OM9A 1R4MB 4LGVA 3VMFA 4KR2A 2OSVA 3ZHZA 2BBSA 2FFBA 3NVDA 5I9IA 2EFCB 1RWQA 1N2EA 2VYCA 4IIGA 1I6MA 1IEQA 3QX3A 1FE8A 1FXWA 3ZWNA 3TLMA 2PYZA 2QGNA 2F3RA 3LDUA 3ZW7A 1FMTA 1ZG3A 3SEQA 5FQOA 3ES9A 3BD9A 3O2QB 4RD4A 5T4HA 2CFRA 1IN8A 2VT2A 5K0NA 3I2YX 3ORYA 3KM0A 1GTRA 4LRXA 3KHKA 2NUTA 1CSEE 1F20A 3Q9LA 1XJ0A 5BN3B 2CXHA 2FW6A 3AUTA 3AR8A 3KOWA 3UPDA 1M1NA 3ZU3A 5IANA 5KVCA 1U65A 2H7YA 4FOTA 2EATA 4GWGA 1PQYA 2MJLA 5EE0A 5EEHA 1AHHA 1TVKA 2ABWA 3AQIA 3K9HA 3L07A 2PLNA 4JU9A 5JQGB 3DPUA 1Q12A 4B73A 2FEOA 4ZU1X 4XVRA 2NZYA 2ZRCA 4UM7A 4AJJA 4ZO9A 2MTBA 3D3NA 3GGPA 4ZD6A 2PR2A 2VATA 1UPUA 2XTMA 4GVXA 2QGFA 1KMCA 1NN1A 2UZAA 2BCJQ 4N5IX 3CF2A 3HFGA 4CLEA 2BZ0A 3ZVRA 1WBJB 3GI1A 2O3QA 2GJKA 2QP9X 3C6MA 1V1RA 1Y6FA 5KSPA 1GQFA 2IHVA 4J0QA 1DHRA 5EZSA 4S1VA 5B1EA 2K7ZA 3D0KA 2XDQA 4IH1A 5EQDA 2OYCA 1PBTA 2VPTA 4LVUA 1ZVJA 1Y3CE 2H59A 4NCHA 1T2DA 2CUKA 3F2IA 1UANA 2C0CA 3MPOA 3K5IA 5U4XA 4B31A 5LLDA 5K6TA 1FVHA 3BIFA 4K2HA 5WRFA 4BOYA 1ZM9A 5JO9A 2C9OA 5JQWA 3C2QA 2ZJ7A 2C8KA 2V3VA 2BKLA 5IDVA 1JUDA 1T5LA 5D84A 1N9GA 1Y9JA 3DMPA 4MR7B 1BXRA 1LPNA 3ILSA 2ZRIA 1Y8RA 2JEZA 2ZW9A 3PDJA 3ZDBA 3AERB 2O19A 2GERA 1UBRS 1DDOA 5JDCA 1AKQA 3COWA 4J8PA 5EHZA 1XGKA 2Q49A 5IPFA 2AFIB 3G1WA 4XX1A 4ZVOA 1Y6RA 4LA4A 2O8DA 3GLHA 2NSDA 3BYZA 5AW5A 4HDOB 2GK3A 5F78A 4RXMA 3DOOA 4M4SA 1PR2A 3UO8B 2UXDB 3JPWA 5CLJA 5MHTA 3KJHA 3LUDA 5GADl 3ESQA 3IBCA 4L2IA 2Q1YA 4IOJA 2K2WA 4TRMA 5K3FB 2XZOA 4TS4A 5EJGA 1WNFA 3D2LA 3H6GA 4MW0A 2WFLA 4WNAA 2HCBA 4P2BA 4EY6A 1RWPA 1WZEA 3AHGA 1T2NA 1TVCA 1FP4B 2CVHA 4JP3A 2IS2A 3L6DA 3QXJA 5ETJA 1NXVA 3U9SA 3KZCA 1B3BA 1GPH1 3HJBA 3DVAA 3LPMA 4B4KA 2F67A 1I4EB 1N2JA 1OI7A 3N70A 4IZHA 5DM2A 2NWQA 3A0RB 3JU3A 2GILA 5C1IA 4IDHA 1IPFA 4X6YA 4P7FA 3PR2B 4UHDA 4BZWA 5JW6A 1FW6A 1U9ZA 5D6OA 4KPFC 4KIUA 1IM5A 1KHTA 1VLVA 3RYHB 5A4JA 3DV0B 3SF8B 1GXSB 2X1VA 2A5YB 1YGYA 4S1OA 2EYQA 2I34A 3JZDA 3HVKA 3FOFC 4DUGD 1D6SA 3I9OA 1PJRA 5LR6A 1N7HA 1SXJC 3REFA 1A9SA 2VQ3A 3DXZA 2MSNA 1EHIA 1N1DA 2RDMA 5A02A 3K9GA 1S0UA 1V4VA 5B5SA 4HVCA 4KQEA 1IZ0A 1OH6A 2BM0A 1UMCB 4OHFA 3TSWA 1QMPA 4EJSB 1DBIA 1O94C 1M7HA 1XEXB 2E5WA 2HJ9A 3OU6A 4HT3B 5AKYA 1R4NA 4XLTA 2BMVA 2A84A 1KR5A 1SOVA 2DHDA 1L5ZA 4U2GA 5JZBA 1OWLA 3DYBA 2LW7A 3P0HA 3UJ9A 3VM6A 2ATVA 3B8HA 3KJEA 5FLXA 2G82A 4Q93A 1TTTA 3LFUA 1YONA 4RKEA 3AEQA 4DVGA 4TYWA 3QITA 1ZK4A 3TCXB 4UKDA 4L85A 3WYDA 3DBHA 2I4MA 3TUIC 5T3UA 1FQWA 4P7KA 4RETA 4ZVQA 4XDZA 4YR7A 4ZJYA 4RK0A 1KI4A 3NKVA 3TLXA 4J91A 4LXQA 1JMYA 1N0UA 1YE3A 3EASA 5CDSA 2WWRA 3UJDA 2IH4A 4QOHA 4BX9A 2D7JA 4REQA 4LF9B 1ZCJA 1KAHA 3F8SA 4F3NA 3SLGA 4BN0A 2J33A 4W1PA 4A6XA 3U31A 3T1YB 1PZGA 1P9RA 3UK1A 5IJ0A 3L41A 2CNWA 1P9NA 3DBVO 1GTG1 3WRXA 4P6VF 2XJ9A 2G5CA 5K0FA 2EJBA 1OYVA 1PJTA 1MKYA 3QVGA 1YVPA 3ZX4A 3W77A 3MXOA 2CVQA 3PCRB 4MA5A 1AGRA 2ZS9A 1E60A 2ZVDA 4YRBA 1KI2A 4KXXA 5FF9A 3T3MB 1VYUA 2EGUA 1SY7A 2OO3A 2QT0A 3V1TC 4DGSA 4J07A 2RI0A 1I1OA 2VT6A 2NM0A 2ZAIA 4ARAA 1A2BA 2YWHA 2I91A 3E5RA 3MHPA 1E5TA 5LBTA 5I51A 1L8AA 3HY3A 4U0JA 3UFXA 1JPUA 1GL7A 3RRZA 1QMGA 1KS2A 4ZT6A 3EDQA 4IIVA 4A10A 1KWGA 5AHWA 3SVLA 1A72A 3GEMA 2R4TA 3L1VA 2AE2A 5G0TA 1LGYA 3O9MA 4UM9B 2HMUA 2QI9C 2C3YA 2NN3C 1G8YA 1V2GA 2DQZA 1SR8A 3QVUA 4TMVA 3OU7A 3WMEA 5JAUA 4U63A 3FSGA 3HVUA 4WK0B 5SV2A 6REQA 1BFUA 1H8EA 1KYQA 4GR9A 2DWQA 1YD7A 1KSHA 1OX4B 4LCEA 3KETA 4S05A 1ZHOA 4LG1A 1I4WA 4UUBA 1JI3A 3JD3A 3WL5A 4ZDKA 1XRRA 2AHOA 4CU2A 3IKJA 1X7GA 1XC7A 4OV6B 4QT0A 3AHFA 3NTRA 4WCDA 2QYHA 4EG8A 1SCNE 1Z6XA 2W6QA 3AL2A 2PNJA 4KGDA 4H4DA 2BYTA 3B7WA 3N3AC 1TFRA 1UT5A 2ZTMA 4E22A 1SU8A 1G19A 1KWKA 2WD9A 4G86A 4OQ4A 1GADO 3OFVA 2C3PA 4RTNA 4OBEA 5BW4A 3S28A 2PMWB 3ILHA 4EVRA 3PIDA 4BLOA 3EZFA 3OOJA 4AUEA 2VTVA 4BQNA 1UOEA 3FPJA 1U8UA 4FOOA 4R41A 4Y6OA 1QM5A 2F17A 3TQFA 5LIPA 1ZI9A 3L0PA 3QEMB 3UKDA 2PO5A 3DUFB 1N6OA 1H1DA 1UDAA 4FU0A 4MS4B 5JFTA 4QPPA 1CIPA 4ZAYA 1D2MA 1E1DA 2C7OA 1DJOA 5JTUA 3WV4A 3CZ5A 3KXKA 5K05A 1K86A 1RWWA 2ZFUA 2F1KA 3KOZA 2V03A 3D2CA 3WX0A 4TWIA 3ZI0A 4HLNA 2RH9B 4ZKDA 4X6LA 2WAXA 4C9BA 2O8NA 1RJDA 1X0XA 2JVIA 3BREA 1XPJA 3EDYA 4WXRA 3WS7A 3DNMA 4PXSA 2GQ0A 1RP7A 2C58A 3ABSB 3H2GA 2G25A 1HEUA 5FKJA 5IVHA 4DTIA 5DULA 5HM6A 2I29A 4RTOA 1FXWF 3HN6A 4ZIRB 4JX9A 4DJFC 1N2ZA 1YH3A 1Z6QA 2Q99A 1OUMA 3QE0A 4MGHA 3TIFA 3ZXUB 2EW1A 1WCV1 4ND6A 2Q3CA 2ZVPX 3SMVA 5JXHA 1KMMA 2PX2A 4PLGA 2IV7A 4TZ6A 4D46A 3WGIA 3ZY5A 1H65A 4H1UA 4EQZA 2PUDA 2HHJA 2BM1A 1VDMA 1F1JA 3LW8A 3NM6B 2LGJA 1P74A 3E5HA 1BIFA 1ZMRA 2PKQO 3HCFA 3I34X 4U7JA 4D3ZA 3O3NB 4YCAA 5EIWA 4FBLA 4RK4A 2V55B 3Q5GA 4B85A 2N42A 1E2UA 2A1TS 1OJLA 1G8GA 2C9MA 2FG6C 3LXXA 3AEXA 4WINA 4JOCA 4ZQCB 3THXB 2F55A 1GT6A 1MH1A 3I8XA 1CU1A 2XNHA 2XMCA 1TYEB 1DZIA 3DUWA 2XXBA 3FF1A 5AR1A 5DNUA 2VSOA 3Q6MA 2ZYUX 4P82A 3WK7A 2UUPA 5AD1A 4BY9E 1ULAA 1JU4A 2G5GX 3GMDA 3I73A 2JIPA 4UHCA 4YP5A 4BMPB 4BDSA 1J39A 2CLOB 4M3NA 4R5MA 4UDOA 2P67A 1V47A 1E3TA 5ALUA 1D2EA 3Q8LA 3B1KA 4LNUA 2JGNA 2RHRA 4GLBA 1UKZA 1HWYA 3GCXA 3NXSA 3R2JA 3QMPA 4MVJE 1PJ2A 3GBVA 3H19A 3TCKA 2CL0X 4WZ6A 2XQGA 1UJMA 2BFPA 1KZ6A 3VJMA 3DQQA 1ZGHA 4HL6A 1SWWA 1U1CA 3FTPA 5EP3A 2JLBA 4JLNA 2O8VA 5E2AA 4XM2A 3O75A 5F23A 4MPDA 2RGNC 2DBZA 3JD1A 1Y8ZA 3OO0A 5J5AA 3SIWA 2BY4A 2CCJA 1QO7A 1RM5A 4N6OA 1CDOA 2AYYA 4QTUB 1YGPA 2G4VA 4Q02A 3VTZA 3ZWPA 1RU3A 4XCQA 5IXJA 1EDDA 1MDFA 2H0RA 3K94A 1PFVA 1ZVKA 3MFQA 1PS8A 3CUYA 4LZLA 4RESA 2OXIA 2D1SA 1IWPB 1CUEA 1VKRA 2V7UA 3CT6A 1Z7BA 1I6WA 3DLIA 3IAS1 3JAKB 3OE7A 1W59A 3FNQA 4NCJA 4OA5A 1F7VA 1N4DA 3CLHA 1BFDA 3Q1LA 1QIKA 3FJOA 1L5RA 3IVGA 1INLA 3AYXB 4MQBA 3S2SA 3BB4A 3OE4A 3NT5A 3BCSA 4PPGA 5CFNA 1YJ5A 4ZT4A 2IP2A 4FYIA 1E5QA 1P33A 1HA3A 3G5TA 3WK9A 3OICA 2IHBA 4U0KA 3HBMA 4EYSA 1K27A 3T9DA 1XJQA 5AP9A 4KR3A 2JIBA 4PE5B 3SXJA 4D6YA 2Q3HA 1U7XA 2CMHA 2ZP1A 1QF7A 3NNNA 4LX0A 4UD2A 4A8JA 4F6RB 3WLJA 3V9PA 4EQ6B 2G08A 1JLLA 1RZ3A 2NQ8A 4R1OA 4D3FA 3LLVA 2TRSB 2YNMA 5HF9A 9MHTA 2CJPA 4N41A 1YR3A 3EC2A 2PS9A 2V74B 2R6R1 3O1JC 4HXFB 3B3GA 1PSDA 3ZCPA 4DZTA 2CW5A 1N8SA 3KZVA 3CXUA 1YKGA 1GTJ1 3HYRA 2YXLA 3KTDA 4ISCA 1HBJA 3WZLA 3DLHA 1CUXA 1NXSA 3FCXA 1U5CA 2XVXA 3KYJB 3U7EB 1DJMA 3QI2A 1I2AA 4RF2A 1LEHA 1IU9A 1HE8B 2AQ8A 4P31A 2WF7A 1DAFA 4DC1A 4EZBA 1BE6A 1GP2A 4GOJA 2HBYA 1NHGA 1ONPA 3DOJA 4W7HA 1G7RA 1BOOA 3U9LA 2A78A 1EBUA 4L4XA 2BDTA 2DHRA 3B51X 1N2IA 4UHBA 1Y1KE 4NJOA 1TVMA 1JQLB 3TTTA 1BYUA 2IZ0A 5EAIA 3HCPA 1YJAA 4UCWA 2FLKA 4XH9B 1YF3A 2X41A 5ER9A 3AB3A 3OZEA 4OQDA 5F4BA 4HAIA 2V96A 3IUPA 1QYXA 1H69A 3DDWA 4DARA 4P7JA 1U2DC 1ODCA 4DKJA 1M34E 1L4GA 3IDAA 4G0OA 2PM8A 1L4HA 1RXCA 1M8GA 3FNGA 4RTMA 4GZMA 2B25A 2I2BA 4MS3A 1UBJS 2Q1WA 3DA8A 4XD7D 2Z6VA 3KOUA 4IMIB 3TR0A 1QZTA 3VR4H 5L3SA 3W5CA 1WF3A 1YB2A 4AI6A 1L4BA 4J90A 3ONDA 4C1BA 4FFWA 2ZSKA 1L5LA 1V3VA 3AP1A 2HWKA 3QPWA 1QTIA 2FX2A 2W6IA 4TWJA 5CX4A 1AA6A 2FOLA 1IFXA 4ENSA 1WSWA 3W2FA 4JEUA 1AUOA 3B82A 4U9HS 4U7PB 5C51B 4TT8A 2E48A 1UBGA 3F9CA 4BGUA 3MRVA 2WZQA 3GL9A 4MGIR 2H16A 3A04A 4TLEA 4C5CA 1OC4A 5EZQA 5IC6A 4ZVSA 2OCDA 3T34A 1GQSA 3HLYA 2PL1A 1A96A 2Y67A 3A28A 1WRBA 3KTAB 5A3SA 2PRIA 4DJDC 3RC8A 4BWYA 1CQIB 1SURA 5G0UA 2XW6A 1DKOA 1ID1A 1NJ1A 5JH7B 1FFWA 3IRUA 3LWDA 1NM5C 5DHQA 5K0BA 1XDUA 2BLNA 3LYAA 1L4UA 2TMDA 4XA8A 4DIOA 4EYOA 2ZYSA 2HOQA 4ZA2A 3QLUC 1BWSA 2CF6A 1TF2A 1JG1A 4Z54A 4YV7A 1Z82A 1K75A 2V54A 3HABA 3T38A 1GYQA 1KH1A 2G9ZA 5TX7A 5FLYA 4P0QB 2VR1A 2H1HA 1O96A 1U2EA 1GPDG 3OIGA 3PWTA 2VP5A 4BUJA 3KYDA 1DTWA 2H54A 2JGKA 2AXNA 1M2FA 2M98A 2OD9A 2Z2YA 4FIDA 4JASB 4ZC8A 4HYTA 3PGLA 1OKKA 4LJ6A 5HFAA 1F51E 4Q1AA 3Q2IA 3G2QA 4M9QA 1R5JA 4CVNA 4RTLA 4ERNA 2ZYGA 4Y9UA 2R2GA 1ZESA 4CNBA 1X8JA 3WL6A 1H05A 3BRSA 4J03A 2FG7C 1ZSYA 3HRIA 4WDQA 3ZJYA 2O07A 1F9EA 3E1SA 3BMNB 2FEMA 2WE7A 1LU9A 4G24A 4IO1A 2LIVA 3ZKWB 4EVIA 2IOHA 1JF8A 5UKDA 2W6OA 2JKVA 4RVFA 1DKUA 1YZYA 3ZTYA 3NP7A 2ZWMA 2GRJA 2WYWA 3H3FA 4MGKR 2Z08A 4OJYA 4D99A 1W88A 5KB3A 2CV2A 1R8XA 1L5YA 2XWSA 4F4JA 1D2NA 2VZEA 4PNEA 1U0TA 5I7OA 1CF4A 2JFPA 2HJWA 4RCZA 3PHCA 2J5QA 3GAMA 3VR4A 4CU5A 1J20A 1J9EA 2REQA 4IMPA 4OVKA 3R40A 1U2TA 5CR9A 5KOJB 4QU0A 2KMLA 1EFPA 3LGSA 4DLVA 1JNXX 3EG9A 1DC3A 4HYEA 4M0KA 4N01A 2D7CA 4NARA 5EUCA 5EJAA 2B7BA 4QELA 4AMVA 1QC5A 1XPUA 5H68A 3HU3A 3SWWA 1ODIA 2IXEA 1ZOPA 1OZ0A 1CUIA 4KKVA 1W19A 1JH8A 2JK1A 4WECA 1EUYA 4B5KA 3DAGA 3L1HA 3G2PA 1VZ2A 1XT6A 4RL6A 4ZT7A 4FGJA 4NZOA 3MCUA 2FDCA 4LFBB 5JDIC 1W75A 4BFVA 2Y92A 5A4KA 1Z56C 1NW6A 2EKLA 2PR7A 1M2HA 1QB7A 2BCEA 2Q2VA 2QVYX 2X13A 2OAGA 2VDVE 1Y9EA 1GL3A 1I3KA 2AG0A 2X7JA 4I8DA 2D1YA 3B9BA 1OMOA 4JC5A 2X1LA 4Q48A 4MMZB 1YE5A 1XCGB 3ZCVA 5BQFA 2IEZA 5IZ4A 2EWWA 2UUBB 1IIBA 2RHJA 3IUBA 1NUUA 2HWYA 4NZ9A 4X7BA 2RGCA 4DNPA 4X1YB 3MJ4A 3OC0A 2JGAA 3WRWA 1ZFNA 4JLWA 5FPPA 2BJVA 3U09A 3H86A 3OPNA 1CR2A 3KOYA 4G3XA 4AZ0A 1PV4A 1O6ZA 2OP0A 2WJWA 3QF7A 1S9DA 4FBMA 3H1EA 2YBEA 1P7CA 2DBQA 3EFOB 4H60A 3SR0A 4GLOA 3TLCA 2OCAA 1BQ3A 1CVIA 3QU2A 2RHCA 4A5SA 2V6FA 4CDMA 1CJVC 2VLIA 1I24A 1ZD4A 2OLEA 3OM0A 1L1FA 4OHZA 3V34A 3IEMA 1GN8A 2ZOSA 4P3PA 3E0QA 3H65A 3HDYA 3FRHA 3G23A 1ECBA 3NT2A 4MXDA 2RGRA 4LF5B 1XV5A 2DTDA 1DAKA 2FDRA 3BHIA 1MV8A 1QIMA 2I1VB 4JVSB 2IH2A 4RJKA 1I7QB 3KYCA 4HGZA 4H7JA 4MV8A 3G9QA 2G5TA 2FJPA 4XTCS 1CLUA 1Q3HA 3I4FA 1NJ6A 5CBKA 4E5SA 2A0FA 5E3HA 3U3XA 2FSUA 3OHSX 1S2NA 1WHSB 1SKYB 2DPGA 1GFIA 3QTTA 5HPYB 4BZZA 5EIBC 4OHKA 4XIGS 1E9DA 1K7CA 1SB8A 1KMHB 2WP0A 4C6RA 4D80A 3JD4A 1OXSC 3PX2A 3WLLA 2YV1A 2FGKA 3FF4A 2ZU0C 2OILA 2WHRA 1AKTA 1NXTA 5E4FA 1UXKA 2EV9A 3L04A 3X0DA 1IN1A 2DFPA 2VL7A 5ED0A 1KQNA 5CAEA 2FW9A 1P2GA 1YR7A 3NBAA 1Y82A 1M5RA 4XOIA 5SZIA 2QE7A 4LRSB 1H2HA 1X77A 4ZOEA 1AX9A 2COEA 2AXEA 2HLDA 3AL0C 4EX6A 2B21A 5FBLB 3I5XA 1AIPA 3IB6A 2DU8A 3ST7A 5B1HA 1NX9A 3UMJA 4BFXA 4XAQA 3G7UA 1S01A 2HEGA 2C9BA 2VA9A 2ZWIA 3PSAA 1N6HA 1AKUA 3QZUA 4JX8A 2EP7A 4Y9SA 1PUJA 1UBLS 4UJ5A 3L4KA 4Z3OA 4WY2A 3TKYA 3VU9A 4ALNA 3IJEB 2QG9A 2C2XA 3C1TA 1SZPA 1JYEA 4LDRA 2JIOA 3ZS8A 1XRJA 3RS9A 3VV2A 3ZWDA 3WMXA 2GPBA 1U1GA 2O20A 3E9YA 3ZHYA 2NO9A 4OGKA 5ENVA 4NK5A 3IDOA 4UHEA 3DR3A 3LE8A 4LHXA 3DO8A 1GQYA 4RHCA 4G67A 1Y5RA 2XCLA 4N8SA 4PLVA 2QMUA 3KUDA 4PXAA 4U7HA 5I7VA 3RUPA 3PQFA 4HGPA 2PMKA 2Z3ZA 2ZJ3A 3N5CA 4C2BA 4AKHA 1MQ8B 3PDIB 1E2QA 1Z18A 1EDEA 4NMXB 5C1BA 1N3IA 2SICE 4DLAA 2XVZA 2WMYA 2NP6A 4WVFA 3ZUPA 2BFBB 3DAYA 2C9YA 5IDQA 1E2MA 2JASA 2JHGA 3IA2A 2IHJA 1OGJA 1JHVA 3EAQA 3TIVA 4BQEA 4RK6A 4J49A 3MXTA 3CO5A 4FYXA 5HFJA 1DRJA 2PGJA 2G17A 2VHXA 5H8WA 1TM5E 2YIJA 4W8OA 1PLLA 1CK4A 1RYBA 2FPKA 1NUAA 1M2OA 4WRRA 3BCUA 4WZAB 3EIEA 5JPDA 1WB4A 3U39A 1Q2UA 4DXHA 1SCUB 2QUIA 3TSAA 3QFHA 3J7TA 2I3GA 4XEHA 3W9BA 3II6X 1FNNA 3MTBA 1WDTA 4KVGA 1YJBA 3KPUA 2JHFA 3CLVA 1QWSA 1KOGA 2BFEB 2QUZA 3KR2A 3OFNA 5CEEA 5HM8A 4DR2B 4GPBA 3T7EA 5KYYB 4N48A 5I4BA 1L4NA 3KR9A 4M98A 1NDQA 2FR1A 1UKAA 3QKSB 4PLPA 4QRDA 4X9XA 2I55A 2RKWA 4E07A 4DDWA 1Z6TA 3TJMA 2WTUA 5KNBA 4HX9A 2WJ6A 4AWBA 1XZNA 2Z6QA 1LLCA 1R8QA 5D00A 1HNZB 3AP3A 4KYTA 2ORIA 4KLRA 3RVBA 4CT0A 1P9OA 3U4IA 1YQXA 1DG1G 2EARA 2YS7A 5CH5A 4RYLA 3C3CA 2D1TA 2YVAA 2XXAA 1SUPA 2V4ZA 4LNAA 4NWIA 4BUZA 1UMKA 1Y3BE 2HCTA 1J21A 2PZMA 3Q41A 1OFIA 3PUJA 4NDAA 4DDTA 5HKOA 4OREX 1ISJA 2AMVA 3ZU5A 4YMTA 4C7JA 4RGVA 3S7ZA 4A16A 2OCXA 4D9JA 3R0JA 2ZVJA 2KWIA 1GNPA 3RUHA 3ZD9A 4KVZA 5C35A 3H3JA 3JARA 1EHCA 3D3WB 3MS2A 2GCOB 2PGNA 1EVEA 4NS4A 4OLHA 1Q1ZA 3ZV6A 4GI2A 2CVZA 5THQA 3SF0A 4BJ5A 4WERA 2QJWA 3WNBA 1U98A 2QZ4A 3BB3A 4EJMA 3VO1A 4KP7A 1M2VA 2EC5A 4IJKA 1FTYA 1NIJA 3E23A 4US2R 2VHEA 3NIGB 4HVAA 3H2KA 3ZDEA 1LBQA 1R0SA 3OCUA 4WJZA 1NQAO 2I2WA 2H4JA 1TZ2A 2KW5A 3R3XA 4UHJA 1VECA 1SG6A 2I3AA 3WMWA 3VDRA 5BY2A 3FTCA 4QPCA 2ZWVA 1YFJA 3ZR4B 1K5GA 3Q8XB 4Q1DA 1S6YA 3HDVA 5HF8A 2WHPA 3TIXB 2C4VA 1C81A 1PWXA 1NVDA 1D04A 1TJ4A 3ONEA 3ZQ6A 2BR3A 5H4GA 5LM3A 1E0AA 1SKMA 4YCMA 1UFOA 1MRNA 2R5FA 4AROA 1PGNA 2C2BA 3U4MA 2PH5A 1RXUA 4R1MA 1MEOA 4KE8A 3BFXA 1USUA 3A1UA 3TD6A 2ASVA 4J1NA 1XDZA 2W00A 4U02A 3ONVA 1E1CB 2IWRA 1H1LA 1A71A 2QRMA 4BO5A 1COWA 1UM8A 4IILA 4IVPA 4KBYA 3G0OA 2BHTA 2SKEA 3M4NA 2YIVX 2HU2A 1PLKA 5HEKA 5MFZA 3A6PC 4MCAA 3GUHA 3HL4A 3GLHE 4JH0A 3TEJA 5ADHA 2FEXA 3PLNA 1QLJA 3WGQA 4HDSA 1EFTA 1XPRA 3WNDA 2I4IA 4A36A 4ZU6X 5IFKA 4GP6A 3AG6A 5ELLA 4FFNA 2R1VB 3THWB 1ONOA 2QYSA 3GFPA 1Y4DE 1NLZA 3ZOKA 3A32A 2VXOA 1E0KA 4DEYA 4CEIA 4KLNA 4MICA 2VA8A 1P6QA 1JG3A 4NHOA 4BTLA 4D9NA 2FQYA 2RG1A 2IYAA 2Z4RA 2OK8A 5EMJA 2AR9A 1S02A 1T6BY 1WKVA 2IP1A 4BLPA 2HNAA 2I6FA 4YIHA 4CEJB 4D3XA 1KZ1A 4BO0A 2IYWA 2QL9A 4LF8B 4B2LA 1CUZA 1FS4A 3DTTA 3LECA 4HQ6A 3QUCA 4TYQA 2VJAA 4RHXA 5FFNA 1FX0A 1YOBA 2GD1O 2ZT7A 4X94A 5KTPA 4F21A 1MNQA 4ZGGA 2FFHA 3LG2A 4LDPA 3SXUA 7ADHA 2F1HA 2GWHA 2JEOA 3L4EA 1IZ8A 4MLCA 4RV5A 3ZDRA 3O6VA 3ZJ5A 1KEEB 1XK6A 4IXNA 1QH1A 5LZ4A 3MT0A 5AW9A 2IEAA 3SQNA 3ODPA 5D1NA 3M82A 5CVCA 4EHIA 3U6KA 1SHJA 3TH5A 4EHAA 4G0UA 4YWJA 4NH0A 1P8JA 5KWVA 2OBLA 5DOZA 2NGRA 4CPDA 1CEYA 1OA1A 1ZCAA 2REOA 2XUKA 3AEYA 4OKIA 2XE6A 2MSCB 3LKDA 4RMJA 3W5AA 4RGYA 1V0JA 1W34A 2AN4A 3O3OB 3H8JA 1PSWA 1AXEA 3AUKA 3ICOA 4G26A 4W1SA 3WJ2A 4DSUA 3X44A 2CV1A 1FXSA 3FCCA 1TU0A 4PY2A 5ICCA 2Q0HA 5HCUA 1PZXA 3RGWS 5JZMA 1P1HA 5HS4A 4C01A 4Q4HB 1NAIA 3BN3A 3EUFA 4L8LA 1Q0TA 2VT3A 5C5EA 5L4SA 2R79A 5IJZA 1YBFA 1FK8A 4G2NA 5DCYA 4D8UA 5M2QA 4A73A 1NY6A 3P2IA 3TG8A 3KL2A 1C1XB 2G88A 1BN6A 2XRMA 1F9AA 1R4MA 3ZWBA 1CUVA 3KXPA 3TZHA 5HVNA 3GPDG 4IGEA 5L40A 5C18A 3GGJA 4OB8A 1NVEA 4EB8A 2NSJA 4KVAA 4YMHA 1GILA 5E0KB 4AMBA 4K6OA 1I33A 2AYXA 4MKGA 2WF6A 2WJVA 3RHFA 1XIVA 5EMMA 2NZWA 1U2GC 1MOSA 2VCEA 4FFMA 4OK5A 1TYDE 4QUEA 3K4QA 3NOQA 3KQOA 2GEKA 5KWEA 1OXKB 2IYQA 4LJLA 1FY2A 1L5SA 2VBFA 1W4RA 2B34A 5E1DA 5JAMA 1G38A 2VQ6A 2H85A 4TRJA 3VZRA 4LGCA 4EI7A 4MW2A 2JGJA 5BN3A 1TZMA 3J80A 2YC4C 1EEHA 1T6XA 3IDFA 5DW3A 5CT5A 4XJXA 2J67A 1Y3HA 3WWEA 4YCNA 4MVYA 3ZJ4A 4L3VA 1E3QA 5JQGA 1NLMA 3KHTA 1RAEA 1JSCA 3FSEA 1QZ3A 1Z4LA 2Q9AA 1ACLA 1HYEA 2ZS7A 1JIUA 3TXAA 5BNWA 1MO6A 3IOMA 3N58A 2O3RA 5BNZA 3T7TA 3D3QA 1XO1A 1QJCA 3GMSA 3ZXIA 4ZEVA 5JEDA 4M1KA 3VAAA 4FCTA 3W5UA 4WBNB 5MGNA 2QN7A 4O1MA 2Q7DA 5C5DA 1JS1X 1O89A 2I22A 3NHZA 4RTRA 5C9ZA 4LBZA 1SK8A 4WFKA 2GZAA 4Z1MD 2IUUA 2A2ZA 3PIRA 1RQRA 4JD5A 2HZBA 1HO3A 2ZRKA 5B53A 4J4BA 1QIDA 2NXJA 3PC8A 4LRUA 3UJ3X 4OQNA 4FMPA 1YKFA 2EJWA 4LHZA 4JC0A 1V8DA 2QW8A 2Z5GA 1ZINA 4BMYA 3K70D 1FCJA 2JFXA 3GJ0A 3T9EA 3IX7A 5IM4A 3KG2A 1MW9X 2EBUA 2WQZA 1THZA 2HU7A 3EZ6A 4JJ7A 4TLMB 1J2TA 3I3OA 2AJTA 3VHLB 3ZLVA 1VA4A 4N7JA 2PZEA 5HFNA 4F3TA 1SHKA 3AQ4A 4V0QA 2F1IA 4FDTA 3RK1A 3FHJA 1L6IA 4D0SA 4W9NA 3TS1A 1NQXA 2RGWA 3BWXA 1P0FA 3I5MA 5I7AA 4MR7A 1WCWA 4DDHA 2R60A 3MGBA 3NIBA 1YS1X 4YUVA 1CX9B 1K98A 3AERA 3OZGA 5IUKC 4D43A 2NXEA 4ZRMA 4NICA 1SPXA 3FNIA 1ZN7A 4GNRA 4R1UA 3NHPA 2WABA 1NW8A 3K2BA 3KZOA 4GI1A 4GGOA 4KJZA 4Y3UA 5ALWA 1KA9H 1QSGA 2ZJ4A 2BRUA 1NJGA 1RNLA 3PD7A 4HWRA 1RIFA 2P4UA 1ZKDA 1S3GA 3M6AA 3OCVA 3SCZA 3OLWA 4EO7A 2P9CA 3I58A 4YMGA 4YP1A 5I7RA 2F8SA 5BV0A 3VR5D 2I9KA 3RIGA 4TN5A 1SXJB 1JQAA 5K3FA 2DTXA 3I6IA 3PRYA 4HDCA 4URFA 2WJGA 1XHLA 1ZUD1 4JUFA 1AF4A 5C31A 5EWLB 4LRQA 1RABA 5KIAA 4Q7MB 4CTJA 3B6EA 5HZHA 2ZZKA 2FFJA 3F6PA 1UAGA 4ZI2A 3I6YA 3B53X 2CYBA 1IHOA 4LXYA 2ZRLA 2HN9A 2ZIEA 3FH0A 3S8MA 5IC4A 1RJ9B 4M87A 4K8RB 4XGRA 4XWOA 3RYHA 3H8WA 1B6RA 2H5JA 2JJYA 3DV0A 3SF8A 1GXSA 2DPXA 3OLXA 4JUDX 2F3SA 5KTOA 3R5XA 3C4JA 5EHNA 4MYSA 1N2GA 5KDOA 2F3TA 3X1XA 4QUKA 1Z0IA 5TE9A 3M5CA 4FFPA 4W6ZA 3NM4A 5ENZA 1Z36A 4Q00A 1VCIA 2YFKA 1LW7A 2Q4DA 3EVZA 4GQBA 3IUEA 1KDVA 1WD5A 2Q7OE 4G0PA 3IIIA 2QW1A 3TSYA 4YXFA 1SQ5A 4IFIA 1XZDA 4RW0A 5H5JA 3W1EA 1L8QA 2YZ2A 1A5TA 1M72A 1FMFA 1NXPA 3PR1A 1SBHA 1KJ8A 3T1NA 5THKA 3E81A 1WW8A 4BO6A 2FI1A 4BBJA 1JBKA 1E2JA 4DE5A 5KEIA 3RSHA 1DX6A 4DNQA 1SUAA 5CFMA 4FFSA 2IDKA 4QE3A 1F2UB 2CHEA 1V26A 2IHYA 2P69A 4TXJA 3ZOZA 5AVZA 1ZVVA 2IHKA 3H5RA 4Q6BA 5JAPA 2P5UA 1EJ6A 3O8NA 1QR2A 4WKNA 2HX1A 5DI3A 1MOZA 3X1KA 1J70A 5JSKA 4ACBA 4N76A 1Z7YA 3V32A 2ECKA 4X44A 4F1JA 3E15A 4FNMA 1T1IA 4D3DA 1HE1C 1KI9A 4JYCA 3U49A 1IBCA 4ZOAA 2RAUA 5TB5A 1MO5A 3H75A 4BRWA 4FS3A 2E1RA 2YVQA 3HCOA 3NWEA 3G49A 4JSRA 1BE0A 3OKCA 4OM8A 3Q3EA 4Z9FA 4L6IA 1QE3A 2KLHA 5AKHA 2EJVA 4LJAA 4BFTA 4RPIA 4G0YA 1F3LA 5F9MA 1TQ2A 4LV8B 4B47A 2JLXA 3GEIA 3NV9A 4R51A 1OV4A 1Q22A 2YCLA 4HYQA 2XZTA 2ZWOA 3F5DA 1JG2A 1Z6GA 4IHKA 1KBQA 3EVEA 4XWTA 3O31A 2I7TA 4NPAA 1E79A 3UC9A 5CVJA 1K7EB 3KHUA 4F46A 5A4MS 2J09A 1Z0DA 2X3YA 3VOTA 4AJ4A 3K20A 3MAJA 4WXEA 1AKEA 3DWEX 3ANNA 3TTWA 4B34A 5FB3A 4OMDA 3OLCX 3WSVA 5CXUA 2F62A 3HVHA 4YDQA 4JQYA 4LI3X 1EVQA 5EP4A 4HEA6 1Q1GA 4N0DA 5EKDA 3OQOA 1QIFA 4GLLA 4TS9A 5FI0B 4HPJB 3EGDB 2ADFA 2D5LA 2YHUA 2QTRA 2VPPA 4H3KB 1V8PA 3UAWA 4JUBA 2BFMA 2VWGA 1GPWB 3UV6A 4TSFD 2ORYA 4M0PA 4M9SA 3EXG1 3ZGOA 2XTAA 3HCDA 3O47A 2ZUVA 1F8UA 3ACCA 1EX7A 3I5UA 4RYDA 3V3KA 5K0SA 2RAPA 3JQ8B 2B20A 4OI0A 3CVXA 4K6GA 2J5BA 1OGIA 1OTYA 1SOMA 1YL5A 4AXBA 2H51A 4TVOA 4GF5A 4EKEA 5LNK6 3NYQA 1OX4A 2C1XA 2HJSA 3DFMA 4QXRA 2EU8A 3I1JA 1AQJA 4EG7A 4IIDA 1II8A 3R5KA 1DBVO 4QKQA 1RAFA 2VK8A 3A4LA 3AF2A 3MYRA 4BP3A 1TKRA 2CFOA 4KUGA 4F9FA 1QG0A 4MR9B 1O5OA 2RFLA 1VQ1A 2FPRA 2HQOA 1LQTA 4V2IA 2BEJA 1FF9A 4QJBA 1T0UA 2JD2A 2QRLA 5CH3A 4H9GA 4QTZA 5KQLA 2OV2A 1QRSA 5TQ0A 2NPOA 4HQKA 1OF1A 2PAAA 4BLRA 1E8NA 1PJBA 2XUZA 2Z2JA 2NPFA 3WP0A 4CQNA 1I9GA 3DQZA 5K3OA 3AFGA 2CXXA 1N5IA 1MMFB 4HYYA 3UWOA 1F0PA 5DN6A 2YV2A 2PXHA 3JZFA 2P1RA 3AKCA 4KPGA 4TTTS 4EYGA 1P4GA 3QEMA 4HS4A 3DUFA 4BKMA 1GTL1 3I52A 2ZIUB 2V7PA 3TNJA 1UK6A 4HMOA 3CTPA 3CZPA 2ECPA 2BGIA 3CGWA 1DAIA 1EFHA 3KLBA 3R8CA 4BC1A 2K6GA 1LF5A 1NMZA 3CBGA 3WFIA 3ER8A 1FBTA 1UADA 4HDNA 1ZIYA 2WVAA 3FVRA 2A9RA 5THXA 4A91A 1F0YA 3CEJA 3WQQA 5BQ3A 3UJBA 1RZVA 5JOQA 3DAFA 2V5AA 6ABPA 1I2CA 2ZUUA 3CLKA 3QU9A 2R7LA 3FKSA 3O4HA 5SZJA 5HOQA 4FGWA 1QZZA 4PLTA 1NP7A 1YHZA 4DV6B 3CQ9A 4IV8A 2PBLA 4ZIRA 5L4NA 2IEIA 3WLMA 2XDAA 3ESDA 1R4AA 1UFVA 3OCZA 1SN7A 4O2BB 1DU4A 4R9SA 3EBLA 1DXYA 4ER0A 2R5NA 4URWR 2Y27A 2WAMA 3F4BA 1D4AA 1UDWA 4AJ1A 2OTCA 2YC2C 5JG7A 5LB2A 2DPYA 5FBZA 4P4SB 3R6DA 2RK4A 3QFTA 2QN1A 3WLOA 1F4PA 3I1YA 4PBTA 5EZ5A 4X1OA 1U8FO 3FLAA 3QFSA 1EWQA 1XZGA 2HF8A 3STWA 3DS8A 1BA3A 1SU7A 3MJSA 5JQGF 3D02A 1NU6A 2Q2NA 3PT9A 3VYUB 4G9GA 4D4HA 1I36A 4UBOA 4D8VA 4EUFA 5BNTA 1C0KA 1M1UA 2BSXA 4ESOA 4LBYA 2ZIXB 1QJ4A 5CVTA 1HXHA 5JO0A 3THXA 1KVQA 1MJ5A 1ZOIA 2GFHA 4HNRA 1IZZA 4P4GA 3MM4A 5LZ7A 5BWNA 1XN4A 4B4OA 5KDLA 1L8XA 3MK31 3E5MA 3G3EA 4INPA 3OF3A 4ECEA 1V1JA 4PC3A 4MUFA 2WQ7A 1ZR2A 2WWTA 1FYVA 4KACA 3QX8A 4IAOA 4KUEA 4JIGA 3UOAB 5B2FA 3LHSA 1G20E 4HTFB 3EB9A 2XBUA 4HH1A 4JT9A 2DY1A 4UTPA 1X7DA 5J58A 5LOVB 2F9LA 1SRQA 2JK0A 1GN9A 1QVRA 1H2RS 2X8JB 1MVLA 3V8VA 4HEJA 2NSHA 1OBVA 5A3RA 3T8YA 2P78A 2I6QA 4FFLA 4MTLA 4DG5A 4Y98A 1CZRA 2JC3A 4AUMA 3EEBA 4MEAA 3CUVA 3PD0A 3T5CA 2POCA 3M4JA 3QLJA 3RG2A 4DXAA 1FU4A 3WLQA 4X7RA 3E05A 2G71A 2YFYA 4DA9A 1CRQA 1UUFA 1ZA2A 2Y1CA 1T5HX 2M1XA 3GJZA 3NYIA 3O4FA 3T5AA 1IXZA 2GNPA 2ZCJA 4QHYA 1D8TA 3K9WA 1KI3A 1LPAB 2ES4A 3C3BA 4FFBB 5EHQA 1VFPA 4M1QA 5F76A 5K3DA 3W8RA 3W90A 1JEYB 3GVPA 1G9XA 2BMAA 5C4GB 3PUYA 5DT2A 2QSYA 1KKUA 3SDSA 1YACA 1GPJA 3EMVA 3S27A 5BSEA 5EZ6B 1A2QA 2I99A 1P1KA 3HR7A 4WA8A 4Y6RA 1LSUA 3QMMA 1L7PA 1TKAA 2KBFA 2RGEA 4ROSA 3QVMA 2BHSA 4DQ0A 4MP8A 5ALJA 5ERXA 3TR5A 2PGXA 2M9MA 4JQZA 2XMDA 3I2GA 1AA9A 3RT7A 2R25B 5JLAA 1NJ2A 2W6NA 4K9MA 5J5VA 3KKMA 4IOKA 1MAVA 5F35A 4F6RA 5K7SA 3D6JA 3ILYA 1O54A 5TGZA 4FONA 5B2EA 3FMOB 1RYMA 4IL5A 2JH3A 1QGUB 3N7TA 5ES3A 4LE0A 1MENA 3L2OB 4PWZA 2VXBA 3GCGA 3W3ZB 4MR8B 1E2IA 2VHCA 3UG7A 3KB1A 1DAOA 3VZBA 3GFFA 4M1YA 5HZMA 1AD2A 1THGA 5JXIA 2ZJ1A 5EQFA 1NZDA 2ZIZA 4IVQA 4LWZA 4D0RA 4DR5B 1M0SA 5EOVA 2O59A 5A6VA 3CRQA 3F3MA 4QSMA 5AESA 1CR6A 4IX1A 4G8BA 4QAQA 3THRA 4C0HA 2IYXA 4V1CB 1WNTA 1AHPA 4OYLA 3M3HA 3F0TA 3MN1A 4FXOA 4V0NA 3GFOA 3I9MA 4Y9TA 1A9XB 3IUMA 1BGVA 4JI1B 3V8MA 1WQ3A 3JVUA 4MDEA 4M76B 3U7JA 4YREA 3X3HA 3P71T 2Z8XA 3I64A 5FHRA 4ENUA 5ALVA 3NHFA 3FFWA 1EBBA 1NE2A 1HDRA 1NWHA 5GV8A 4EGAA 5IEBA 5A9SB 5J4VA 1U99A 2QUKA 3L05A 5EPEA 1ZZGA 5EEGA 3DDOA 1MU0A 1P1BA 3G2MA 3PUVA 3IOCA 1E3LA 2B2XA 4RY2A 1IVNA 4L5AA 3COZA 1WUHS 4KI7A 4TM8A 5JXJA 2XMBA 4MWEA 4G8JA 4NCNA 4BUCA 3JWPA 3AUXA 3UNXA 1R6XA 3KFXA 2DLNA 4RKYA 1YFKA 1HZZC 3WL4A 3EPLA 1NBWB 4B2IA 1NVVR 3EMBA 3IRVA 4ECAA 4MJXA 4FDAA 3IT0A 1VL1A 2J4CA 3N8NA 5B1DA 4HB2A 3AFIA 1M2WA 1YAJA 2JJ2D 4F2GA 4TXMA 3HDJA 3GF4A 3NKFA 4OCZA 4EABA 3RS4A 1Q0LA 3CYFA 1IXSB 1P77A 2DBVO 1Z2AA 3MUOA 5DWDA 4MUMA 1TW3A 1N7IA 1PTKA 3TX2A 4EP1A 2O5CA 3U3KA 5L3VA 2GM5A 4FQ7A 4GAEA 3B2NA 2VH1A 4DLKA 2AYZA 1G41A 4KO2S 2QMZA 4YIKA 1LLQA 3EDCA 3SHOA 1JAZA 3LY7A 2C3MA 3LS2A 2A1TR 2BH9A 1Q95A 5C5CA 1NRWA 3NS7A 5JECA 4TXHA 4GKJB 2RGGA 4K40A 3G2IA 4HZUA 1X1SA 4B6JA 4H6VA 1CF2O 2CFTA 2FSSA 2Q45A 4I5GA 5DYIA 1SHZA 3V8QA 3BFVA 5CDHA 3GHYA 5A2GA 2VPWA 3KTAA 2OCIA 1XNQB 1H9CA 4YRSA 4N40A 5A6SB 5LWHA 1CQIA 1JEOA 3JQDA 3NOOA 5MFPA 3EGVA 4L07A 2EZ4A 5JH7A 1DNPA 5FR2A 4X8MA 3H4IA 4TTJA 3BZUA 3EXIB 1N2XA 3KUXA 3PUHA 5F3WB 2QPTA 2V7GA 3H4MA 1L0BA 4IDDA 3EVCA 4JODA 4RMNA 4YRPA 3Q3CA 2X9LA 3ZVKA 1MAAA 1G4AE 2D5BA 3CBQA 4GPEA 1FLAA 4QUAA 4ZARA 1CFJA 1FDSA 2XECA 2X0DA 3PFIA 3FCEA 2JGRA 521PA 3C6YA 1LBEA 2W0MA 1ITZA 1C29B 2PX6A 3JQFC 3OURA 4F11A 1RKBA 1ZOSA 4GU5A 4G5GA 3MEQA 2YXNA 3FTEA 3MVEA 4MDHA 3GJ3A 1X1CA 4FXPA 3LBFA 4KTVE 4A1FA 3FVQA 3TFWA 5KVVA 1AE1A 1YL7A 2XI4A 1JIXA 4CKXA 3MWKA 1HT3A 2QLMA 3BMNA 3QVTA 1ICIA 4GO1A 1H2BA 4ZREA 3U3RA 3LK6A 4L8WB 5CIWA 4CQMD 1U0LA 3ZKWA 3DH0A 3ZIAD 2O0KA 2JBAA 1Z08A 4FHCA 2VPQA 3FMGA 2Y9PB 3L8FA 3FPGA 1R2QA 1EWVA 3I42A 3PF9A 3PUWA 3Q7RA 1A1VA 4HZIA 1BG6A 4WHMA 2RB4A 3OD5A 3PDCA 4RKRA 3SBDA 4CYMA 3MNFA 2C4NA 2Q5EA 1G64A 1ETUA 1QVZA 2PIAA 1MN6A 3CNHA 2YUIA 3H5IA 2FZ4A 2IYNA 4JGGA 4NABA 4TQAA 3OC6A 2OORA 2X58A 2EWVA 2DQ4A 2XJ4A 3KLOA 3SD7A 5JNUA 1EZ4A 4TLDA 3G2OA 4ZI7A 4XB6B 2A86A 5ES4B 2C7PA 3I04M 1J8FA 4B6PA 4ZVVA 3E2MA 2DFNA 2WA2A 2XOXA 4RPKA 1BJTA 4OGFA 1G55A 3BORA 4N7RA 3GP5A 2QMEA 5HMLA 4AL4A 5LXTB 1BC5A 1CY6A 1H22A 1GZHB 5DDIP 5BN5B 3OCYA 1YA6A 2BFFB 4NXMB 4C30A 4GSYA 3I05A 5TEVA 1YU6A 4NC9A 4KQJA 4JKYA 4GBED 2AK3A 1JEQA 4D4KA 3EVAA 1MGPA 4HG2A 5I8ZA 1J8QA 5EFOA 1UFQA 2AHRA 1R6UA 1X42A 3IHWA 1FUKA 1XQVA 1XU7A 5CLHA 2DPHA 5AJZA 1KNXA 3HYNA 4YH1A 2WF9A 3ND9A 1XZBA 3V5NA 4DQUA 4UBKA 2H4XA 3A6DA 2MWMA 3NEYA 2NG1A 4X1YA 4TUYB 4XQ0A 1VB5A 4L08A 4ERXA 3WI7A 1GUFA 4AF7A 3D0QA 3ZN2A 3AY7A 4DJEC 4RVDA 2DEUA 5IBCA 3QP9A 4PSCA 3RFTA 2BAGA 2VYFA 2X1HA 3RJ9A 1X13A 5AJXA 3VR2D 4BVFA 4JQOA 2P0YA 3AR2A 2ZUCA 1HLDA 3EFOA 3QV1A 4BB5A 3ZTWA 1QIIA 2PLFA 4LSWA 4WCFC 1X7WB 1V5GA 1XYGA 5KJCA 3VU3A 3PNVA 3SFTA 1R0YA 2NP7A 1CXZA 1KEVA 2V7BA 1Y1RA 3DMRA 5EJ8A 5JWOA 4OG2A 3HUEA 2DMRA 1BAPA 2FMXA 2CXNA 3A1FA 3R09A 5D3QA 1R3UA 3ZWMA 1TNDA 1JHAA 1W2GA 2A5LA 1N6NA 1UXJA 2JGLA 3ZXSA 5LIRA 3GJ4A 3OPYB 3AC0A 1ZRSA 2QG4A 3C5EA 1JIIA 3D8UA 3IQHX 1WHSA 1N57A 2D62A 2GK6A 5A2QA 1ZK1A 1ZNZA 1R0KA 1RPTA 2FWJA 2ZRNA 1IPHA 721PA 1JHZA 1KMHA 1LX6A 4G1VA 4CCAA 5JEEA 1MQAA 4KX5A 3GLGA 1N5KA 1U3CA 1OBCA 1IUNA 1JXOA 1N8NA 1XJWA 3DE1X 3G59A 3JWGA 1Z62A 1IRIA 3NOXA 1XVAA 4RA9A 1TEVA 3S2GA 3L0YA 1FSPA 3OECA 3DEAA 3A2LA 3A9WA 2YRXA 4DW8A 1P17A 4NSNA 2BZ1A 4MV1A 2AMFA 2PZKA 4R2IA 2NYRA 1ODLA 1ISRA 3OU2A 1MORA 4G0MA 4HN9A 5ADVA 3U5ZB 2TMKA 2GXUA 2BFCB 4JVNA 4PQEA 2GJ4A 2BMJA 3N59A 4MO9A 4I6JA 4OFWA 2QR2A 1PT5A 4OHCA 5JJKA 2AUNA 2OO5A 1GG5A 2R6FA 3DE0X 4KH0A 3K35A 4MB2A 4K9RA 4C89A 3TGLA 2YYYA 1B0UA 1GCGA 2IZOA 2QU8A 1A88A 3H9CA 3DXFA 1F4LA 3TGWA 2OCYC 3PKIA 1JQBA 3B9QA 4HAOA 4OIMA 3TZCA 5L3QA 1VB3A 1Z7WA 4D9GA 5JPCA 4H4CA 3NHSA 2GN9A 3S1SA 2UU9B 5LA6B 1XHFA 3ZHQA 3AF1A 5HRAA 3A2MA 1YU9A 4PGAA 1M74A 5JWHA 4KSBA 3F6SA 4OQFA 3RVPA 3B13B 1G8MA 4M7WA 3F98A 1ZRHA 3PEWA 4TTIA 1KVUA 1MRZA 4RL4A 1TK2A 2GVZC 1P2SA 3W9YA 4P4UA 2FCAA 5KWJA 5HK9A 3VNAA 4RANA 3PFNA 3PDIA 1RRCA 3ZW9A 1YQQA 2QX6A 3DEJA 3DT8A 3F47A 4GHWA 5ESWA 3GLFB 2BH2A 3LHDA 2GXAA 2ERYA 1CJBA 1WV0A 2BFBA 1KDTA 3K0CC 3LFTA 4QJ5A 5BV8A 3EN0A 4ARCA 1KYWA 2P2CA 3NHRA 5F98A 2CD7A 3FPBA 1UDBA 2JCXA 3C8MA 2GN6A 3NAQA 4FJ2A 2C2ZA 2ID7A 2UV8A 4ZFNA 3OUTA 1N0VC 2YZNA 4AD8A 1E3SA 1VHLA 4OOEA 4QUDA 2YICA 2W2QA 4YAEA 5FTNA 2HMVA 3DMNA 3C7KA 4K9SA 1MLDA 1SCUA 4O29A 4MI6A 5KC8A 3FB1A 3EW9A 1XVTA 2FZKA 3GC6A 3KVOA 1KEZA 1VRVA 4KQ9A 4YCDA 2O1WA 2R1TA 1W52X 5DRYA 3F2VA 3RODA 2BFEA 4U1RA 1ZH6A 1SQ6A 5EE3A 4R2LA 4R2JA 5EIHA 5KYYA 2FH5B 2YJ4A 3A0UA 3JX9A 3QKSA 3T5TA 1NRJB 2QL7A 4R5HA 1UC4B 2XYRA 4D44A 1KIFA 2SKCA 4OIFA 2YR0A 4R9NA 3KNZA 2BHLA 2P5YA 2EF0A 2BBTA 1E4EB 1ZL0A 2HQSA 4KSYA 4K9DA 3ZY2A