3OZDA

Crystal structure of human 5'-deoxy-5'-methyladenosine phosphorylase in complex with pcl-phenylthiodadmeimma
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
273
structure length
273
Chain Sequence
AVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords S-methyl-5'-thioadenosine phosphorylase
publication title Crystal Structure of human 5'-deoxy-5'-methyladenosine phosphorylase
rcsb
source organism Homo sapiens
total genus 95
structure length 273
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.4.2.28: S-methyl-5'-thioadenosine phosphorylase.
pdb deposition date 2010-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ozdA00
2HSWA 3LGSA 1SJ9A 4G89A 5F7ZA 2A0WA 1Y1RA 3INYA 1JE0A 2AI3A 3KVYA 4TS9A 4MARA 4F2PA 3FAZA 4G8JA 3ENZA 3NM5A 1ZL2A 4EB8A 1CB0A 3DF9A 1Y6RA 2BSXA 1N3IA 4BN0A 1VFNA 4TTAA 4FFSA 1TGYA 4D98A 1V4NA 1PWYE 3IOMA 3O4VA 4MCHA 1PF7E 1WTAA 5F7JA 1YQQA 3FNQA 3OZEA 2QPLA 4D9HA 3NM4A 1NC3A 3KU4A 2Q7OE 1ODJA 2I4TA 3UAVA 3EUEA 4R31A 4U2KA 4I2VA 1ULAA 5C80A 1B8NA 4OEHA 1NC1A 1OVGA 1RXUA 1A9TA 5KB3A 3ODGA 1PR6A 1Z5OA 2A8YA 5F73A 1Z5NA 4K6OA 1A9OA 1U1FA 1VMKA 1RFGE 4OJTA 3DJFA 4M3NA 3FB1A 3E0QA 4QARA 5CCEA 3DP9A 4DA6A 4PNPA 5F7XA 1B8OA 4L6IA 1T8RA 3LBAA 4TXMA 1RR6A 4P54A 3UAXA 1A9PA 1A9QA 4JWTA 4YO8A 5DK6A 3BL6A 1PR5A 2B94A 1RT9A 2P4SA 4DARA 4ECEA 3GGSA 1ODKA 2OC4A 4X24A 1Z35A 4DAEA 1YR3A 1RXYA 3DDOA 1JP7A 4F2WA 5CCDA 3FUCA 5CXQA 3KHSA 3BSFA 1PK7A 1PKEA 5B7NA 2OECA 1K3FA 4JOSA 3T94A 3FWPA 3PNSA 4H1TA 1Z33A 1PR2A 1OV6A 4DANA 4OGLA 4LZWA 4OF4A 1PR1A 4L0MA 1OTYA 5CYFA 4YJKA 1JDTA 4DAOA 1A69A 3DPSA 1T8SA 1JPVA 3SCZA 1RXCA 4BMYA 3KVVA 4GKAA 1JDZA 3OCCA 2QDKA 1CG6A 1M73E 1Z34A 3EEIA 4L5YA 5JPCA 4WKOA 4QAQA 3U40A 2XRFA 4D8YA 2ISCA 3MMSA 3ONVA 4NSNA 4IP0A 5F77A 4DA8A 1PR4A 3UAYA 4WKPA 1JE1A 4LNHA 4L5AA 4MCIA 4QFBA 5F7OA 1T0UA 1Q1GA 1C3XA 1T8YA 3NM6B 1Z37A 5ETJA 4R2WA 1SD1A 1QE5A 5B7QA 4UC0A 1OU4A 1PBNA 1G2OA 3C74A 3KVRA 5B7GA 1ZOSA 4LNAA 1Z5PA 3KUKA 1OUMA 1TD1A 1Y6QA 1SD2A 4RJ2A 4M7WA 2QTTA 3TL6A 5EFOA 1TCUA 1ECPA 4L5CA 3UAWA 2H8GA 1RYZA 1YBFA 1ODIA 4TTIA 3OOHA 2QTGA 1V3QE 3P0FA 1FXUA 2A0XA 4G41A 2I8AA 3NBQA 1TCVA 2RJ3A 4YNBA 2QSUA 4OY3A 1Z36A 2HN9A 1U1EA 4NY1A 3LA8A 1YRYE 4GLJA 3MB8A 1Y1TA 1JDSA 1JDVA 4GLFA 4DABA 1TGVA 4BMXA 1JDUA 3K8QA 5CYGA 1Y1SA 2OXFA 2PGAA 1VHJA 3GB9A 5IU6A 3P0EA 4WKNA 1Z39A 3E9RA 1Y1QA 4M1EA 4QATA 3OZBA 1U1CA 3OZCA 1RCTE 4D8VA 4TXNA 5IFKA 4BMZA 1K27A 1V48A 4LKRA 4QASA 4R2XA 5CXSA 1YQUA 3O6VA 3PHCA 4DA7A 1RXSA 4OGKA 1VHWA 4TYMA 1LVUA 1SQ6A 1K9SA 4WKBA 3F8WA 5EUBA 3OZDA 3OF3A 3QPBA 5I3CA 3EUFA 1ODLA 4F3CA 3K8OE 1XE3A 4F3KA 3UT6A 1I80A 4QEZA 2AI2A 4E1VA 5K1ZA 3IEXA 3PHBE 4EARA 4TXLA 1A9SA 2ON6A 1V45E 1A9RA 4WKCA 2GUWA 1RSZA 3BJEA 5F76A 1ULBA 3EMVA 2AC7A 1Z38A 1U1DA 2A0YA 3OPVA 1T8WA 4TXJA 4DA0A 1JYSA 1PW7A 1LV8A 4NS1A 3PNPA 4YMLA 5B7PA 1V41E 3D1VA 5FAKA 2HWUA 2OC9A 4TTJA 1V2HE 4JP5A 3OOEA 3E9ZA 2IQ5A 4KN5A 1LX7A 4TXHA 1PK9A 1U1GA 3UAZA 3FOWA 1OTXA 5F78A 2AI1A 5EPUA 1NW4A 4F1WA 4TS3A 4D8XA 1PR0A 3BGSA 2HRDA 4GMHA 4LDNA 4PR3A
chains in the Genus database with same CATH superfamily
2YNMA 4R83A 1WKBA 2ORVA 4G5YA 3PX2A 4R5HA 3MHTA 3LGSA 4WLEA 1P60A 3KOOA 5KSZA 2Q4BA 5TEWA 2XHZA 5DCLA 3PL5A 1TT5A 1UMCB 1EUDA 5YASA 1O8CA 3KP1A 4J6FA 4R8RA 4US1R 4EYKA 3OOJA 3ZTYA 3R5SA 4M89A 1JDJA 5LQDA 4C6TB 3ZCSA 1TO2E 2BFNA 3VVBA 3FPFA 4DQUA 2PK3A 4AVYA 1ZCBA 1A7AA 1TFRA 3RBAA 4W4TA 3KQTA 3TW4A 3RRXA 4HXYA 2IH2A 1GTL1 3BMOB 2PT9A 3RUIA 5HCNA 2EFCB 4HSEA 1KH1A 4MJXA 5L3VA 1A76A 3KEMA 3GBVA 2DWCA 1KVTA 2WKQA 2ZJAA 4JA2A 3UMMA 1QZ3A 2EKPA 2KHZA 2GLXA 4LMAA 1CY1A 1BS1A 1JEQB 3BAZA 4OJYA 5TF0A 4J3NA 3TK1A 3ZIAA 5CAEA 1D1SA 4MQLA 4AF8A 3QUQA 1US8A 2C2HA 5CIYA 1OZHA 1JEJA 1JA0A 3KWLA 4JEUA 2QPLA 5DEOA 5EJ9A 2F2TA 5EP1A 5U4QA 4OHRA 2A1IA 2WWFA 2FK7A 2QD2A 1X7DA 2FPXA 2VAPA 3UJ6A 4EG6A 2O2XA 2FSVC 3AHCA 4KYIB 1VSBA 3SIWA 4PYMA 1VXOA 2I4TA 4NKRA 5GONA 1P3DA 3QW4B 3RD5A 4YJKA 1CUSA 2Q3CA 1RVDA 5GZ1A 2BD0A 2Z98A 1MFPA 1BQEA 2VNAA 3DOFA 5KYWB 4C6RA 4G4SP 2OZPA 3W77A 5HRUA 5BQFA 3S8EA 2BZGA 1OVGA 2QX8A 5A3VA 4L15A 4Z54A 2EQBA 5DEIA 4L8WB 2JVIA 5LYYA 2ETVA 1K3UB 4O1HA 4BYGA 1UMDB 2CZGA 1YMVA 4RD4A 4ZQBA 4TM7A 5DW3A 4GVXA 4DBVO 2X86A 4WEQA 4RH0A 1Z22A 1QMGA 2H2DA 3F9RA 4PVCA 4DA9A 4JT9A 2PX6A 2Z8ZA 1KFCB 2FPIB 3G6WA 4R2KA 3ZJYA 2O3QA 4OFZA 4WBNB 4J0KA 1WDLA 3EFBA 1Z5WA 3NOQA 4ZV7A 4J91A 2CV1A 4MDFA 3D4IA 2W93A 1ADJA 1LFAA 2GN8A 1BU8A 1BC5A 3KZKA 5KHLB 1EJ6A 1RFGE 1W7AA 3BXEA 3S2EA 3V2GA 1QRDA 4M3NA 4B4KA 1A8UA 3JXEA 2BSQA 2QVBA 1PJCA 5IARA 1EBBA 2GVNA 2VUHB 4UEKA 5T4BA 3RVDA 3SBEA 3WV4A 1G98A 1TVKA 5IT5A 2RGAA 4W6QA 1SRRA 1T9AA 1WB5A 2R5NA 4M37A 2WQ6A 1ZHOA 4QREA 1GU0A 1WF6A 2BP7B 1TAHA 4JDPA 4L5IA 4MUXA 4TXMA 3V33A 1ETHA 1RR6A 1EFVB 3L05A 4CKEA 1J07A 2GM9A 3MEQA 1CKEA 3V46A 3TRJA 3ZZUA 2H59A 1WKVA 1XVTA 2FFBA 2G70A 2I99A 3EVTA 5DLDA 3TUZC 4YCNA 4IUYA 4ZCLA 1IDN1 3IESA 3ZH9B 4DILA 3FYHA 3HSYA 4IVPA 2V8OA 3ZE9A 1V5FA 3BOSA 3N39C 1USUA 3O3NB 4Z53A 1P0IA 3ADCA 1AO3A 2RHWA 4K3VA 4CG0A 2G5GX 1OA0A 1XDUA 4E5DA 3MIIA 1QH1A 3ZCPA 3H04A 4DDKA 3ABZA 3DM9B 1X13A 3OM8A 1DIOB 2HK8A 3FCOA 3HFGA 3E9YA 3EVZA 2MSWA 4B32A 3ZBUA 1JG2A 1FJ2A 2I80A 5T8KC 3QY9A 3KHSA 4KDRA 2PKRA 2VHVA 4LZJA 3IOCA 1PK7A 2P7HA 2VNHA 4PYLA 2F43B 2OV8A 3Q9NA 3AZPA 2H4WA 5FH9A 2OECA 3O75A 2IBMA 4JP3A 2H5JA 2EERA 4JEHA 1Z2AA 1U0EA 1XPUA 2AA3A 4IPTA 1ILWA 3GROA 4BFUA 4TN5A 4MPRA 2TMGA 4B6FA 5EJIA 4B74A 3I2FA 3WWOA 4AX8A 4F4JA 2JAXA 1Z0UA 2XUJA 3FZEA 1USVA 4MV8A 3HPRA 2FWIA 4J7CA 3TXYA 3IEMA 1XROA 4GLBA 4HI0E 4REQB 3GNQA 2EF0A 4Y1GA 2XADA 1JNXX 2OEPA 1LRKA 5JQGF 4AUKA 5JALA 3I4FA 3QXGA 3B51X 2V0NA 1PR1A 4O3FA 1J0DA 1OTYA 1YHZA 3UT5B 2D2IA 1UJMA 2MJLA 2Q8NA 2OBLA 2QU7A 5KJFA 1UM8A 4H6WA 1BXKA 1CUVA 3DPSA 2DUJA 1VMEA 3WLKX 5BT8A 3UGJA 5FQNA 1GGJA 1ZCZA 4J6EA 4Z49A 2CLLB 3C6YA 3LW7A 5G1PA 4B6SA 1BH2A 3B13B 4EGAA 2H4XA 2ZUSA 4IDEA 4WNCA 3W7AA 4AECA 5CVTA 2IEIA 3HVIA 3I2YX 2ID9A 3QXHA 4G9GA 3PFWO 1FDWA 1QHXA 3NMUF 5JAUA 1HYQA 1YRLA 2XUAA 4E5YA 6Q21A 4CIYA 3R6LA 2P4UA 2FRVA 4URXR 3AG5A 5EFZA 4AN1A 2AEJA 2A9FA 2JLBA 3HBMA 3L8FA 3QPDA 4M86A 1P1FA 3H3FA 2W6CX 4WERA 4LFBB 3U7RA 4P1ZA 2B82A 3ZDYB 2JFVA 1W0JD 4IIDA 1THMA 5JPDA 4C2TA 2W9XA 3GRUA 3RK0A 3ZVLA 4MVYA 3HL4A 3ITNA 4D8YA 2PZLA 4MV5A 3PK0A 2HMTA 3UFXB 5FUQA 2IYRA 4UNIA 1XZAA 3T4XA 3O95A 2DLCX 1GP2A 3MTEA 3UB4A 4BNVA 1A5BB 3KFLA 1VFPA 2RKWA 2V6IA 1ZGZA 4GICA 2XWPA 3C8MA 2QYHA 2CEKA 1ES9A 2PZJA 1GUBA 1VG8A 1KPIA 1TJYA 5TRTA 3OZGA 1SEVA 4WEOA 5HKKD 4TZ0A 1YE8A 4F3RA 1WD5A 3JY6A 4FDTA 3VOTA 4YBRA 5ESDA 2H1WA 4X61A 3HI4A 2DOKA 4C6TA 3B3GA 2ZZKA 4LRSB 1P2SA 2VZLA 3DMTC 1EQAA 4LYFA 4MZXA 2OAP1 4BRSA 1YOBA 5TC4A 1KSFX 4IRXA 3WLSA 5ER9A 3NOOA 4RIIA 3T1HB 1QGDA 1H3EA 3KKKA 1KJNA 2VDWA 4D9EA 2HR1A 2O07A 3ELDA 1P9RA 2ZREA 3L5KA 3T6KA 1ZVJA 2D5CA 2XGGA 4ND2A 1C7IA 3WWCA 1JG6A 5E4FA 1S1CA 4C22A 5TS2A 3J81A 1QQ6A 2P9YA 3O9MA 1NONA 2DT8A 3BAFA 2TRSB 4CLOB 1O3YA 1HOXA 2G0NA 3MB5A 5B4UA 4S1OA 5FOSA 4P4TA 4LFCB 3AESB 2DR2A 3FLEA 1B26A 5AESA 2RH4A 4EJMA 1J5XA 1L5RA 5K3AA 3K2IA 3HKCB 3GPDG 3ZX4A 4PAWA 2O59A 5CLFA 5TQ2A 1E59A 2OB1A 5K6TA 1MXHA 3A10A 1O5OA 2EZ9A 3CZ9A 3KC2A 4J2TA 1HDGO 3FRJA 5DNCA 3TL6A 5KYWA 4BXOB 2V3CC 2IHYA 4MITA 1UMBB 1LBHA 2WMOB 3COWA 3GJZA 4MV7A 4E94A 3AEQA 5JJLA 3FNBA 4B8ZA 2AQIA 5DHRA 3ZHXA 2XNDA 4C6SA 1I9CA 3OLVA 4CGYA 1MV5A 2RHGB 1GGVA 1X38A 3B36A 4L3OA 4PINA 4DIMA 1S8NA 2NXNA 4BPRA 2VZ8A 1SOUA 4KITB 3D2CA 3A6GA 4WBNA 1Z45A 1G55A 1ODIA 3LKDA 3MJVA 2R1UA 1A7KA 1N3BA 3EDMA 5FLKA 3AEZA 3TD6A 4NK4A 2W90A 2ODEA 2PH5A 3F2IA 3M1AA 3U4IA 2PS1A 1AXRA 1C9KA 5AI0A 2Z83A 2D1FA 5JYEA 4FFBB 3L2OB 3MN1A 1DEHA 2FWPA 1YS6A 3OZUA 4RK6A 4DDWA 1G5HA 5LWHA 3GPBA 3ORSA 2XTAA 2LGJA 2AQKA 1HLPA 3KYCB 3U3DA 3L7KA 4JX9A 2ZB4A 3D7LA 3QKSB 2IYTA 2XE6A 3E0XA 3KS9A 3QTLA 4AQDA 5JIBA 2Y1LA 1NT4A 3OEWA 1HFEL 2R5FA 2WE7A 4G1CA 5KOYA 4MZDA 2CYCA 2BP7A 3BXFA 1Z4PX 1LI5A 2XGSA 2ZP1A 2L18A 5E2BA 1JDSA 2NADA 3OE7A 1EFVA 2KE5A 1P1RA 2PGXA 2CB0A 4X6XA 4ESHA 5BSVA 1FOEB 3ET4A 3QM1A 3WGHA 2FR0A 3OWHA 1Q7GA 2AV6A 2R7KA 4PX9A 1XJ5A 4GM1A 1DCTA 4NJOA 3QKUA 4Q0MA 4BNNA 2H5LA 4D97A 3GYGA 1WM1A 1MOPA 3QPWA 1SHJA 1LXCA 5JBQA 5TPZD 4JYBA 2GERA 2I2XB 2KJQA 3SHOA 5FADA 3SAJA 2ZCJA 1I1HA 3EG5A 4D44A 3C85A 2RC5A 3QYJA 3H97A 4H1WA 1V37A 1YBHA 1W1UA 3O73A 3TLAA 4NYMQ 1ZD1A 2GEFA 1MC8A 5HS4A 4QATA 2E4UA 1ABFA 2PO5A 4QXAA 1ACMA 4TLBA 3WYDA 2ZBVA 4OM7A 4BLRA 4MSUA 4IJ5A 1K86A 4D4LA 5WRFA 2AFHB 3SXUB 4H08A 2F43A 3CX7A 1IEXA 2EFJA 1DZIA 3AW9A 4NBNA 3K2QA 2XXBA 1GNVA 4DEYA 2FZLA 1GTG1 2XODA 3BHNA 3U0VA 3TL3A 1YFJA 4BJ5A 3M9XA 4YGXB 4AS1A 2ZE5A 3BA6A 1IVYA 2QMUA 3AJ9A 1NBEA 5EXPA 3FOEC 3HWWA 5BMOA 1JMVA 2CFSA 5KJCA 4LKRA 4U6NA 2Y05A 3MJTA 3NT4A 2O2DA 2WHRA 2ZUUA 1VCIA 1DX4A 3HCEA 3KNZA 3O2JA 4REQA 5BYBA 2GFQA 2H54A 4Z3KA 1MABB 2NVOA 1QFXA 4WGGA 4DA7A 5JDCA 1CLUA 5KCMA 1PS8A 1OASA 2YMPA 1GGKA 4JR2A 5DHFA 3DZHA 4JEMA 5ALIA 3WNZA 3UT5A 4EA9A 5LOVF 5K3OA 4IJQA 4UHFA 4HEQA 3KXDA 2IRWA 5H16A 1QHGA 1WCIA 3A2MA 2GWRA 3V8MA 4HDSA 5DHSA 2OHOA 3PWSA 1PEAA 5F3RA 1BE6A 1N1EA 3TXAA 5LCXA 3OZDA 5H3CA 4KPEC 1VKZA 1LDNA 2ZI5A 4I7EA 1GPMA 3OBBA 4ZCRA 3DE6X 2PANA 2HPVA 3NHFA 4U1RA 2WFLB 1RACA 4QO8A 4I1SA 1BKDR 2C2ZA 2AZ4A 3DLBA 3HJUA 2WJVA 2HK9A 4NXMB 5CB6A 2XCLA 1Q20A 4XA8A 4UM9D 5L53A 1GFIA 3SVZA 2ACEA 4R7TA 1VP9A 3EODA 3NJ4A 1KYYA 3A37A 1HT3A 4RAQA 4XQ9A 4EARA 5AHXA 3JCZA 1TU0A 1JHRA 4H6VA 4H27A 1EWKA 1AKRA 2HEGA 1DO2A 2Q5IA 2BC9A 4QGHA 3L7JA 2Z43A 3K92A 5H70A 5TQ0B 4LV8B 3EMBA 1SWWA 5C81A 1F8FA 1PJ4A 2FSFA 3BJEA 4LV6A 4WV3A 1ULBA 1TJ4A 5DIFA 2OY0A 1Z38A 1Z3CA 1RWKA 2CFRA 3E1SA 2I3GA 3S99A 5COAA 4C3OB 1E7SA 1GADO 4TMKA 1BAPA 1Z2DA 1V9LA 5TGDA 5MF6A 2W37A 1FRFS 2AEMA 1S8FA 4Q9IA 5K6AC 3KYJB 2Q5EA 3DZGA 5KEIA 2FMXA 1RJ9B 1Y6ZA 5EY5B 3W8DA 3S3TA 3I28A 5ALMA 3U39A 3HWX1 2O0JA 4G0XA 1HQCA 1X74A 3CVOA 3MSXA 4MUMA 4WOCA 3L0PA 5JDIA 1SKYB 5AMXA 4CLOA 5IN5A 4UJ5A 3GUYA 3I3SR 3R9XB 2HK6A 1NI3A 1UOOA 1PGOA 1VDZA 3AESA 3AFHA 1F0PA 3A4VA 3BE8A 3LH5A 4X1YB 5JXWA 1OI3A 1MVNA 1FW8A 3H84A 1PZEA 3IKTA 3HKCA 1CZLA 3MFYA 3OQJA 4L5JA 4MYHA 1QX4A 3EARA 4UDYX 1HA3A 3ROMA 7REQB 1CNMA 1P2UA 2FMUA 1A5AB 2YW9A 3G8BA 4KN5A 4IXTA 3HY6A 1QNLA 3STYA 1EDEA 2N46A 5EMLA 1WEKA 2EWWA 3EB9A 4LGCA 3A9TA 4CVNA 4GU5A 3CCBA 4BXOA 1MFZA 4FM9A 2GILA 4RSHA 5K0NA 3A32A 1UMBA 3NTLA 4ZOQI 1EJ2A 1ZITA 4M8NE 1U2ZA 2JK0A 5ALGA 4MIYA 1E9BA 1CVRA 1NYRA 4DJEC 1PBTA 3BDAA 1L1FA 5EKDA 4XARA 1LDEA 1M2GA 2O0HA 1K8ZB 3QVTA 5HF6A 3EW7A 1RRFA 10MHA 3DZDA 3ORQA 1ZD9A 3C6MA 1Z5UA 2GR9A 2WSIA 2P6PA 3JD0A 3EWAA 4TTPA 4HAVA 2REBA 5E8JA 1VHTA 1F4PA 4TS3A 4F1WA 1XRQA 1YNOA 3ER6A 4X97A 4BTLA 3IBFA 1GSIA 2C9DA 1G8GA 1Q83A 4WCDA 4YY3B 1HE8B 4DV2B 4IXMA 3IUPA 4LOHA 5HYVA 1HE5A 1E99A 2CLHB 1NLMA 1N9GA 2OWEA 2LV8A 2WJJA 4MVCA 4ZOLB 5T67A 1MBZA 1NNSA 2GF9A 1SUIA 3CXUA 1II8B 4LY0A 1Q6ZA 4MKIA 4Y6LA 3KYCA 2O7SA 4BJ3A 4C4XA 2NU7A 3QKSA 1LSUA 5A4JA 1S2NA 1JU4A 1JLLB 2Q6KA 3S2FA 1RPAA 1KWKA 4CCSA 3IHWA 4HXFB 1D5WA 3FZGA 3TE6A 1FF9A 4MGYR 2WM3A 2A0WA 1TTQB 4WLOA 3C5HA 4PSVA 1E7YA 1FRVA 1XVLA 4A1OA 5G53C 1OT3A 2GM3A 1DOZA 3QG1A 4IS3A 1ABEA 1XTJA 2WWXA 1XCLA 2FH5B 2OPBA 2I54A 3F6RA 4JWKA 1CX9B 2D2XA 2WFZA 3AV0B 1P1CA 1P4GA 4KXWA 4EPXA 3HBFA 1ZSNA 1DPGA 2X2PA 3WMXA 4QGFA 4TZ6A 1QK5A 2JLCA 3SQLA 1SXPA 5C7YA 3GELA 3DHYA 2OM2A 1ZUWA 2JLQA 4INJA 1UKZA 2O5RA 4JLUA 2SKDA 4YRDA 2B8JA 4BMNA 5KPJA 2AB0A 1CB0A 4MUGA 4XUEA 3DF9A 2R85A 4GEKA 1QQBA 1INLA 1YS1X 3SN6A 3NO4A 2O2JA 3NTRA 2VHEA 4TT3D 1H65A 2ZVDA 4K9PA 2PUTA 3U5ZB 2X0JA 3SBDA 3VUEA 4E1AA 3WB2A 3K9QO 4EOGA 1TUBB 3I6ZA 2E85A 3G8DA 3PWTA 1YS4A 2O23A 4RZUA 5HUJA 1MENA 3DMFA 1NVUQ 2Q62A 2AFHA 4Z9YA 3SXUA 3GQBA 5JXIA 2I2AA 5KHOC 3FWNA 1DI0A 1W36C 3G02A 3R0XA 3ZX5A 1WULS 2WOJA 3FGOA 5AM1A 2V96A 3R5JA 4N3CA 5K0CA 2OHIA 1BA3A 3DXYA 3MRSA 5I9MA 4KGZA 2PH7A 4QUGA 4GYJA 1NURA 2AN5A 2WJZB 1J0XO 1MB4A 2HCJB 3QKRB 2OQRA 5F9HA 3BZWA 4ARIA 1UPTA 3HLYA 4YQYA 1XMSA 3ETNA 5GOZA 1L1RA 1SWVA 2W4MA 3AHGA 1ZA1A 2I0FA 1G3IA 3JWEA 3ON5A 4JLJA 4X1IB 1N9ZA 4X3PA 1GAEO 2HU5A 3F9CA 2O7RA 3M1IA 4D92A 1T2UA 2A8YA 1PTJA 3QU9A 1DQYA 2BLLA 4G5SA 5B6JA 3T3GA 4X64B 3IR5A 4DG5A 1U9CA 3S0JA 4RTRA 4FP9A 1IHOA 5LIRA 1DC8A 2LIPA 4NQZA 1G8KA 3W7BA 4EUNA 1CJBA 4PC2A 1M8KA 2V7WA 2DJIA 2CE2X 2NV0A 2IYOA 2YFHA 3OTWA 1SQSA 2WFLA 4MR7B 1KFEB 5FI1B 4BBJA 5ICEA 5KTRA 1ZR2A 4UU7A 3W78A 4ZGGA 4X0EA 2GF2A 1D04A 4UARA 1EGQA 5E7MA 4R16A 5BR1A 5EHZA 4YJHB 2PL3A 5K51A 1TZBA 1KI7A 2VL7A 1KIMA 1SVWA 2A5LA 1FQOA 3N75A 4LXQA 4U2DA 4V38A 4DNFA 1P81A 3FTDA 1H5UA 1LK0A 1XSEA 5SZKB 1ND5A 2YVAA 4PPQA 3TOXA 4F46A 5D87A 5J4YA 4N5HX 1OBHA 4NZYA 4RFSB 2KLHA 4RSMA 2PM8A 4FUQA 2NYAA 2XKBA 2G8LA 4IS2A 4AWXA 3VR5H 4BNWA 3X1KA 1JQAA 4XGIA 3IP5A 3AYXB 4NCAA 2BE7A 5DK6A 4O6VA 1IG3A 1N1GA 1KBOA 1Y9JA 1PR5A 1E2NA 2CXPA 1XZMA 5F64A 3JWHA 2XWJI 5CVJA 1S5PA 2BH9A 4UDNA 1HMPA 4YI3A 4N18A 4YUWA 5FWXA 4C20A 1MA3A 4Y9UA 3RS3A 4RV9A 1NKTA 1XWIA 2RHMA 4MW7A 1Z35A 3WB1A 1W36D 1T4CB 4DBLE 4CIXA 4PHCA 1DWOA 3GOQA 5C5IA 1XXHA 4TQ9A 4RO0A 2QMHA 2ATCA 4W5OA 4AZ3B 1XZNA 3QQPA 4GKJB 1GV0A 4F1JA 1E7WA 4TMZA 2HLHA 3TLJA 3V80A 4NEGA 2ZYDA 1OX5A 2P35A 5B7NA 2QMQA 4CQMD 5L8VA 3T94A 4LXYA 3J7AC 1UWCA 3PNSA 3F6CA 3TL2A 4BCBA 3A2KA 3PDIA 1Z74A 4S2EA 1LQ2A 5JCJA 3WRXC 3CCCA 4JI1B 2FPOA 4YUZA 2GDZA 1KO1A 3DVSX 3QYAA 3KT6A 5IM4F 4RHTA 1CRPA 1OV6A 1W4RA 2HV8A 3H17A 2PMKA 3BIOA 7REQA 1GFZA 3WYGA 3HA5A 5KTSA 4NENA 4PG5A 5E1MA 4E5MA 3IKVA 1DB3A 5IC6A 4MEBA 4DLAA 1TMYA 4CM6A 2Q0XA 3DD1A 2NQ2C 1YMUA 2IXAA 4FDLA 4FU0A 1AC5A 1ZJ5A 4LTMA 5CYFA 3U81A 5CG2A 1RPTA 1L7EA 1T0JB 1U3WA 1PL0A 1JIUA 3TD2A 2OKGA 4ACAA 5IMSA 4E3WA 4LQ4A 3GLQA 1NN0A 1XJCA 2E18A 4UUPA 5EJGA 8ABPA 3CUYA 1RE1A 1BMFD 1VL6A 5K7SA 1ADYA 4O25A 5LQRA 1JPVA 2BHTA 4HV4A 2WAAA 1B23P 3QEOA 2O2IA 2XLCA 4YUVA 4CG1A 1NL3A 4PSUA 4NNOA 4W5HA 3KT0A 3M1LA 2B30A 1M76A 2H7CA 1M73E 3ESZA 1N6IA 4PQYA 4AO8A 4IFBA 1GAWA 2PT7A 3JQPA 4PZUA 3KZNA 4FEAA 3FNFA 4PGMA 3D81A 3NYRA 4ZOLA 4V3BA 2GI4A 4F2DA 1DHRA 2J5QA 2BBWA 5EERA 4WXEA 1SBYA 4KXQA 4B4UA 5FBZA 1CUDA 2EG5A 2QTHA 5AM3A 2PAAA 1FPMA 5CLJA 1O5IA 3CNNA 3U19A 3RVRA 4HN9A 1LQUA 1JLLA 1ZCFA 4Z4FA 2WU1A 2G4CA 2Q27A 3TNYA 4IGEA 4YBZA 3NEJA 4LQLA 4AG5A 2Y1KA 3GVXA 2G04A 1U65A 1Z2PX 1AUXA 1I3MA 1UP7A 1Z2OX 1GUYA 4KQWA 4GZMA 4PYIA 5AJYA 3D3WB 3H1GA 4K1LA 4LPKA 4MLZA 1U3TA 5B1SA 2ZANA 1JILA 2PLFA 1BFKA 3EY9A 3U13A 4BAZA 4F4IA 4CR8A 2JAWA 4GO1A 4BWYA 3RIGA 1CULC 1Z37A 4R6XA 1GKYA 2HJWA 1E7QA 4UQOA 3O4GA 3Q7EA 4I3GA 1L7RA 1U0LA 4Y2RA 1CQWA 4ZHSA 1J25A 5U9CA 1X1AA 4Q1BA 3U7EB 2QN3A 2VF8A 3TTYA 3RIYA 3CH7A 2A2ZA 4EHBA 2XAUA 4BIMA 3TM4A 4A2WA 3MTIA 1R8QA 1TUBA 3GFSA 2WKWA 1DJQA 5CPBA 3BB1A 3PX7A 1SG6A 2I4IA 3P27A 1JEYB 3NYIA 4QBIA 4LNAA 3LW8A 1GSAA 2I6SA 2P5TB 4B84A 1VL2A 1I6MA 3BB4A 1NW7A 3UJAA 3ZE7A 1ZY2A 2V0GA 1OE0A 1ZMXA 2O9JA 5FA5A 1ZSYA 1VECA 5ALNA 5KQGA 4HTFA 3DQZA 1FUUA 2BVNA 3RANA 2HHHB 2PJDA 4DIDA 1Z17A 2PZEA 1XI2A 3V1KA 4EMSA 2FSGA 2CJFA 5CYOA 3TCXB 2JAQA 1KU0A 4QU5A 3SQMA 4B9EA 3RK4A 1BMDA 2DTDA 2FX5A 4AY4A 2IX3A 1OXKB 2XBLA 2FPLA 3MAAC 3EZ7A 2QX4A 2IY9A 4P83A 4H17A 1BE0A 3MCWA 4JJ8A 1NDHA 1TK9A 4R1UA 3NC0C 4R2LA 1EDDA 3DEKA 1ZIDA 4QG7A 5BNIA 3Q7QA 3JRWA 2JI6A 3O4IA 4G26A 4IILA 4MDEA 1NDUA 2HWXA 3I52A 1NXOA 2FVXA 2ES4A 2XB4A 3AB8A 2B20A 4H7HA 4PQGA 5KWEA 4JB3A 3IO5A 2XWQA 2O8VA 3ZK7A 2D4HA 2JIQA 1RWBA 4DC1A 1FIUA 1AKQA 2WHPA 2Y4OA 4YHBA 1KJYA 1QMPA 3SZOA 1XVAA 1KKMA 2H2FA 3IGFA 3ME5A 4GI5A 5FV7A 2OWDA 2HN9A 3OEYA 4EPRA 5JSHA 2RKOA 1Z0SA 2O4UX 2QD4A 3FHCB 4YRTA 3I2GA 5P8WA 4C4OA 1Z4JA 3QPAA 4O59O 4D4HA 1WUHS 2CHEA 2IHBA 5G0TA 1OGYA 1T3SA 3EF0A 1XC7A 4BMXA 4EO7A 3DKKA 3JRXA 2XZTA 2GMWA 3H13A 2RHOA 2XSZA 5A7GA 4C6HA 4BV3A 3NETA 1DC5A 3MTDA 5IUJC 5ALDA 4ZN6A 4CMEC 1N2GA 1PIWA 2QE7A 2W2NA 3DR3A 4ND3A 1B6TA 2FLVA 2TMDA 4NBRA 2PQMA 1TYDE 2CCKA 1J2EA 4FYIA 1EE9A 4OUKX 4RMNA 1T4CA 1VLJA 2Q1XA 3QBTA 4D0LB 2WWIA 4NMHA 2QI9C 4FXPA 4RF3A 4BWVA 4RF5A 4YV2A 1WBBA 4WRRA 2FQ1A 3R6WA 4YMHA 4C0AC 3LLVA 2JVKA 2YZNA 4AZ3A 4FMDF 3ZKAA 1B1AA 1TVMA 4KO8A 4MICA 1CBUA 3ST7A 4CZ2A 1C3LA 4O2AB 1HG1A 2XRYA 2XUIA 3AJ8A 4CMCA 4AI6A 4KFSA 3HUDA 3TE7A 4BE4A 3ONNA 3SQDA 3THOA 3V97A 3ZTWA 3HM2A 2H85A 3PXAA 4J8PA 3SLRA 4YV7A 2L19A 5JSUA 3AI2A 3EH2A 2P3LA 3I9MA 3KCNA 2IVFA 3ZXSA 3E7PA 1KEKA 1ODSA 2G9VA 5LP6C 1DBRA 3F97A 5F3DA 2CLFB 1IWBB 3QVGA 2I71A 3GLIB 5INTA 1MW8X 2JJYA 5DGTA 3L3BA 4JBHA 2RHCA 4QDOA 2YYYA 1NX9A 4MUNA 2QGNA 3FDFA 3OJOA 3W6ZA 4EG1A 3THXB 1ELOA 3A6JA 3O6VA 4KQCA 5EI5A 1DTWB 1HE2A 2HRRA 2JGIA 4JUDX 4CF3A 5JJBA 1WB9A 2QVXX 3FTNA 4KNVA 3D2LA 3I2HA 1WXIA 4GPBA 4JSYA 5EE9A 4H7EA 4I4NA 2RJNA 1LVUA 1M7GA 3FWYA 3P9KA 1K5DA 1YCFA 3TPFA 3QG5A 4LYYA 1NSTA 1NYLA 2OBYA 1EBFA 1V0JA 1V6CA 2X5XA 2Z8XA 1GCAA 3N2KB 3W5SA 5JNSA 3VNVA 4I5IA 1RYYA 4OAOA 1TCCA 1ECBA 4DG8A 4F93B 2XB2A 1ZAKA 1YR7A 4RK4A 1E8NA 4ZO9A 3KJIA 4YRZA 4E4TA 4NBUA 1V9SA 4EFDA 3EUFA 1ODLA 1D4AA 2DHEA 3PFCA 2BDTA 1CUAA 1LU9A 4RNCA 3JQ8B 1JZQA 1AZSC 1HGXA 1E8DA 2RGNA 3C5EA 3HXOA 3ZWWA 1G38A 1J0AA 3E1KA 3CLUC 4V2IA 1T0IA 3PKZA 1T5HX 4RJTA 1XPOA 1H23A 2F9FA 3PUYA 5TSDA 1EM8A 5L45A 3P96A 2R2AA 1VSQA 3L93A 4M53A 4IUCS 1J97A 4ZEMA 4QEZA 3UC9A 4X66B 3KL4A 1JUDA 4XRGA 1XNRB 1WP4A 1GG9A 2ONYA 1F0KA 1KFJB 1VKNA 3NATA 1YZUA 1UKVY 3PHBE 4FDVA 2GHRA 3T7AA 1CFZA 1V1RA 1LC3A 2PWBA 1QOQB 2IF2A 2XEDA 3DO8A 3EFHA 3F6EX 2ORIA 3OP1A 1DC3A 5JJ5A 4XCXA 1Z6PA 1SOVA 2ZYUX 2C3MA 1T3HA 3SSNA 4A10A 2EIXA 5ERYA 2GUWA 2IYAA 3P2EA 4MJLA 5F76A 4PTYA 2V6BA 5B2EA 3B6ZA 4TT8A 2DY0A 1QRRA 1W93A 1Y8AA 3MYYA 4RD2A 1SU4A 2JJ1A 2IEDA 3SPXA 4Y6QA 1Z0JA 3F7MA 3IILA 5ILQA 2NUTB 2EF1A 2PX4A 1G5IA 3B6IA 4ZPJA 4MAMA 1N25A 1DWQA 4YEDA 2F55A 3U7GA 4HLDA 1G21B 1QHFA 3AHEA 3AZOA 3M89A 4NFYA 1Z8DA 3HJGA 4Q3LA 4V1CI 1LV8A 3MRVA 3R6TA 2AN1A 3DC7A 5CA0B 5HM6A 1RYBA 4KODA 2O0LA 1ZKMA 4AC9A 2YKGA 5CX1B 4C06A 4BQNA 1C41A 5GONF 5HDBB 1KI6A 1G3QA 1QFZA 2Z4RA 3G49A 1RXIA 4P3XA 4E70A 5CEFA 1J8MF 1I5EA 3MTQA 5FYQA 1NLFA 5JZBA 4CLHA 2BISA 2XCUA 5T6BA 2B8WA 3REGA 3CLUD 4RJKA 3TTWA 2EHJA 4RL4A 1TLFA 4WXRA 3VNAA 1VKOA 4Q3NA 5JRZA 1M6NA 1PVDA 5AUQA 2N1MA 3LBIA 3NBZC 3K9BA 3MT8A 4KRYA 3CZQA 4ND8B 3TNDA 5LDHA 4OXKA 1RQGA 3A6KA 3GCDA 2EW1A 4PAQA 1RAFA 4W7HA 4ZRDA 4Q01A 3BD8A 4H0NA 4KIUA 1U81A 5C3UA 3V6LA 2TECE 1L4UA 3W9YA 3TF5A 1NUQA 5KJ1A 1OXBB 2IH4A 1K63A 2R60A 2WBLC 3DBOB 3ROKA 1GEGA 3CPEA 4AJLA 5B1YA 5JNUA 2PGJA 4MA5A 4G81A 3MJRA 1YS9A 1U02A 1CP2A 5GM1A 5A0TA 1E69A 3GT7A 1YGPA 1EFTA 2WFMA 3M34A 3HR8A 1QTRA 2VK2A 4LTDA 3RSFA 3MTBA 3T38A 1B8UA 1O94D 4HDOB 4HXGA 4Q4JA 2Q2QA 4GH5A 3T52A 2EP7A 3DHWC 5JAOA 3UMYA 1Z0KA 3CBGA 1SBQA 2I1VB 3R44A 3RRJA 5JI2E 1FUKA 2QUJA 4Z0NA 2PIDA 1UBNA 3W6UA 2ZTMA 1R5JA 2O06A 4E2WA 4EH1A 3G5UA 5LLDA 2JBAA 1KMHA 4TS9A 3E5HA 4XM1A 1TKCA 3GLSA 3OECA 1II0A 3E7XA 4JXJA 1SVKA 2O57A 3LX6A 3K71B 1P7CA 4E09A 4EYSA 4R71A 1Q74A 1YE3A 4KK3A 1L9KA 5FL7D 4ZHQB 3GBSA 3C1AA 4OI0A 4Q39A 1QQAA 3GPLA 3EQZA 3O4FA 2IP4A 1PQ4A 1NFQA 3NHLA 2GBFA 4PIVA 3CCFA 5KJ6A 3DDSA 1NMYA 1F6WA 2NYVA 3PNVA 2JJ2A 1TI7A 4EEZA 3HNPA 3AJRA 1F48A 3KM0A 4F06A 3OWOA 1T9HA 4LSZA 4O2AA 3IUMA 4IV8A 5LMNB 3UW3A 2P79A 4XWKA 3IEVA 2C7QA 5KDDA 2P6NA 3LYAA 2VAVA 5KX5B 3AOEA 3PFNA 2GA9A 4X63A 4DR2B 4MS3B 1ECJA 3RUPA 4BJ1A 1JFLA 2AFVA 4ZI5A 3X2SA 1GDTA 5JTUA 1QG4A 3C97A 2F3TA 3TBKA 3GLIA 2NTVA 2CW5A 4UE6A 3H75A 5KI6A 1B6RA 1MQ9A 2ZYAA 5AVYA 3L8MA 3FTEA 3D6FA 1J39A 1GLGA 1LLDA 1FU8A 3KPJA 3MUFA 4WAUA 4X95A 3JAMA 4ARCA 2IV2X 2QRNA 5AJZA 4IIVA 3FPLA 4IIEA 1W2WB 3RRYA 4OV6B 2DR3A 4BFVA 1RP1A 1WCV1 2W42A 2FW0A 1JU3A 3EPJA 4ENUA 1LPPA 3AP1A 3N2KA 1JR3D 5IM5A 4MW5A 4GS5A 5TMBA 3ZXYA 3RAEC 1WETA 3FYTA 4KAFA 4IDGA 2LKCA 3E03A 3V4OA 1AQNA 2ASVA 2OGSA 3NVMB 1NQWA 1ZQ9A 3RTEA 2DQKA 2OHVA 1FVOA 3IPCA 1F6BA 1U04A 1IMJA 2XTNA 3M8KA 3N3AC 1YU9A 1K89A 1GUAA 3JQ8A 5IAKA 3O84A 4HEA6 4MVJA 1QYWA 5C34B 3DL0A 3LCUA 2ZJ8A 1DC7A 1R8SA 2G1KA 3DC2A 4BWGA 2RSLA 2IQIA 3BIFA 1B14A 1JSLA 1ZNQO 4I1UA 3UJ7A 2X2OA 3FKQA 3LT2A 1SXJD 1B0UA 3WYCA 2WZCA 3W6OA 2VQSA 4DDVA 1EXMA 4S1VA 5I3ZA 4Z9FA 3LGXA 1Z6AA 3V32A 4YX9A 5DH9A 3PICA 5JD4A 4TV9B 2C95A 1Q84A 3ETGA 1A9QA 1DARA 3TZLA 1GPDG 3ANTA 1G6HA 3SX4A 2QLBA 5AI6A 4B4DA 4CIVA 1A2QA 1ZGAA 2IPNA 1OB5A 3CZ5A 1JA9A 3ZJ5A 1OXVA 1N8KA 3ETLA 4QU9A 4OX9Y 4RELA 4FQ5A 2OXIA 3KZOA 5C37A 1V7CA 5AKJA 2AF3C 3QI2A 3AF3A 3C3EA 1I1NA 1UBRS 4X24A 2QVGA 3GX1A 4DAEA 2FAXA 1JLHA 3E18A 5JROA 1J9EA 2ECPA 2P3SA 1RXYA 2PFKA 3CRVA 4E6PA 3I34X 1OU0A 4XYGA 4EG8A 4MIEA 2J3EA 3DE4X 4WXHA 5AW4A 5TMPA 4ND4A 1IVSA 5CT8A 3NZEA 4BO6A 1J90A 1O97C 3UIEA 3ZGLA 4ZVSA 5KAPA 1K0FA 2NUTA 3FCCA 4XYMA 2A1TR 2QWXA 4G4SO 1G21A 2ZVPX 3BQMB 3FWPA 3RYIA 4EPTA 5KVVA 2FSSA 2CD7A 3RJZA 3MFQA 4RSRA 5CDFA 2H1CA 3DTVD 1Y4AE 3NXSA 4HVAA 1OHHA 3EVCA 1OPXA 1PDVA 4M1SA 2YXDA 2Q0SA 4BO3A 3H5TA 3HB1A 1CY0A 4KIWA 3DDUA 4NZOA 5SYAA 5FOXA 4DBLC 5LDDC 1AQYA 3LWNA 5JECA 2VSNA 2ODQA 1CHDA 4KN9S 1XJWA 4UPVA 2CV2A 3NGXA 2P0EA 4MUJA 3PC7A 2IP2A 4NJEB 6AT1A 5KOIA 4Y2YA 4UEQA 2HA6A 3CTPA 2NN3C 3LM8A 4JB8A 1SR8A 3UVEA 3VNRA 4F4CA 3CR7A 5L4NA 1YHNA 3GGCA 4ZXFA 4QOHA 1R37A 3ANLA 4ND8A 3WLOA 2Y1OA 1BGWA 2XYVA 4OXNA 1OXUA 1XTZA 2A6PA 1LS6A 3DULA 4CUKA 5BNZA 3DWFA 2HZ7A 3A4MA 4J4TA 5AW5A 4FSDA 3N53A 3JQQA 1PGJA 5J2TF 3E3AA 3GUCA 3CLTC 3F96A 4GKAA 4BVEA 2YXNA 4WZAE 1CG6A 4BV8A 3RTAA 4C1NA 1T4MA 3GDFA 4KTVE 4G5XA 4WKOA 1A9ZA 2DWOA 5D8DA 4ZO6A 2DVMA 1F2TB 3QVMA 3EH1A 2Z5VA 3EIFA 4IJVA 2ISCA 4C7XA 4OL9A 4QPDA 2FE4A 4Q9LA 4LJLA 1C4KA 3HHPA 1X39A 2G7MC 3LLCA 3CA8A 4G0OA 2Q6VA 4ETNA 3Q0EA 3SIPA 1IY9A 1R64A 3HNOA 1JIQA 4LY9A 4DYHA 1DIBA 3DTTA 5KYTA 2C03A 1O97D 1R4AA 3BWBA 3OJLA 3OJWA 1J2JA 1VYHA 2V6FA 3AYZB 4IZHA 2EVWX 3T7KA 3T95A 2VTBA 3QEJA 3PLAE 1WD7A 3AUSA 5FUMA 2V6GA 2N47A 4KR3A 3B1YA 3A1DA 4I4IA 3W4KA 5IYZB 1K68A 3CKMA 3EZNA 3H8SA 3I01A 2CMDA 3QPUA 4E2ZA 4N9QA 2B34A 1YR1A 4FYPA 4J90A 4JVSB 3VR4D 2F1RA 1POWA 3NHZA 4MCIA 4X8MA 4BGEA 1G9SA 5BWLA 4R51A 3WK9A 1U8TA 2V45A 5ETJA 1O6FA 2WF6A 4G1UC 3VKGA 4UEOA 2JGNA 1E9SA 2IFTA 3S1AB 5KDLA 4MQFB 4TRNA 1FLVA 2CUKA 2FEOA 4I36A 3WMFA 4S05A 1EWVA 1DXQA 1OU4A 1QHYA 2CK3A 3NRJA 3DAHA 1KARA 4JU9A 4TLDA 3GLRA 3Q7IA 3IUBA 1FYXA 3FF4A 4QICA 2W6IA 4AY5A 5DXJA 5EJAA 1ZIOA 5DSXA 3DDCA 1DMRA 1G8SA 3FSGD 4I08A 3FVVA 1WZNA 1H0RA 3LIIA 1FNBA 3GC6A 1G6KA 3DMDA 1ZCAA 2WK1A 1H3FA 2VEOA 3CV3A 4MS3A 1R4ZA 1SC3A 2CL6X 4HWSA 1AD2A 4I1PA 1QVAA 2OHXA 2KX7A 1C9DB 4YCSA 1QTQA 2NM0A 3IE2A 4NFLA 4EKIA 1KMMA 1XTRA 3CLTD 2YCLA 1SKBA 1OJLA 5EFOA 4D74A 1UK7A 4XXHA 1Z7EA 4IDCA 2A5GA 4LEIA 2WTNA 1D9ZA 1GOTA 1M6VA 3KB6A 3OX1A 1KFBB 2J5RA 1GZHB 1JI0A 5LU9A 3MWJA 4BVBA 4UREA 3PBKA 1NR1A 4GGOA 1BDIA 4F9TA 5BQ5A 5A7FA 1QRSA 1QYXA 1WVIA 1SUCA 3OCZA 3UK0A 2PX8A 3L4SO 4D6YA 3DAPA 3QWHA 5E8RA 1N33B 4YC7A 3IAHA 5HJ5A 2BFPA 1FVHA 4XYBA 5SY9A 1DRJA 2VHZA 4JOQA 4UTZA 1IY2A 3WRYC 2PKCA 1NUPA 3ORYA 2HNAA 1E5TA 2ZRGA 3ZK9A 2ZXUA 3A11A 4AY2A 4F5ZA 1NA5A 3ONFA 3SK0A 2PL1A 1JYEA 4YNBA 3K72B 3Q98A 4F6LA 2FGKA 2QTNA 5BR7A 1G17A 2C8LA 3UA4A 3G0CA 4M8IA 2NACA 2J08A 2EC5A 2O1SA 4FT4A 3T7IA 3VJMA 2EZ8A 3FMVA 2YJTD 3DOIA 1G8YA 2QJRA 3H9UA 3LA8A 4JLWA 1Z9BA 4MV9A 1P2DA 1SUWA 1QR6A 4FFMA 1TCBA 1HDEA 3IX7A 4O1MA 4PY2A 1SOMA 2DUNA 3LK6A 4FFDA 5KTYA 4AS2A 3B89A 4TV9A 2OQ2A 1FDSA 1WP9A 3B70A 3B1VA 4WPGA 3WYFA 4JUAA 1AHIA 4ZKEA 3CMMA 3HJBA 3HRIA 4H7IA 5DFAA 1AGNA 3ZGVA 4RDXA 4YFVA 3SWWA 1WB4A 4K9SA 2IH5A 2FPWA 4AYWA 3D4NA 1S4MA 1E8MA 2PZ8A 2ZYVX 1HYBA 2XOKA 2QM0A 2W6PA 2AUMA 3ICPA 3MLAA 1FEZA 1XMXA 2ZWOA 4LE2A 2XOEA 3R7WA 5H3HA 2GAIA 3R7DA 1TLTA 3WOVA 3ZU5A 5LJLA 2E2WA 3IXMA 3EXEB 4DBZA 4TTQA 2C3PA 1A95A 3NASA 5EIFA 3W3AD 2Q4TA 2O5CA 1PNVA 2H17A 1WDTA 1M83A 2GJ9A 3FCUB 3FPGA 1C8BA 3IEPA 1B6SA 3O92A 2EFYA 5ANRB 3T3HA 2SCUA 4D82A 4QBTA 4ZIRB 1KY4A 4EI9A 5JFGA 1Y8QB 1RM4A 2WWGA 4XPIB 1XLWA 2IT1A 4UPEA 3VXKA 3AM3A 2JIMA 2OBXA 3UV6A 2N9UA 2DERA 1YDWA 3B1JA 3PSAA 4J9VA 1RKBA 2HSZA 3NCHA 5FQOA 4HZIA 4JLPA 4J2HA 1I6LA 4J94A 3V7UA 4BUJA 5A05A 4CKBB 1OBOA 3SOPA 4GGMX 2YC2C 1DG1G 5DYYA 2DQSA 2OHHA 1TEHA 2ODBA 2OXEA 2WLSA 3KYDB 3ESDA 3LUDA 2D8MA 2WF9A 3BIJA 2VJPA 3EPRA 3HR7A 3NEAA 4BQQA 1G8JA 2WB4A 4DV4B 4HDKB 2YMQA 3PHCA 1U63A 5G0SA 1Y3HA 2JGLA 3G5MA 4JLAA 1ZYUA 4I1OA 3AHIA 3G7SA 4E30A 5CFQA 5IK2D 4MMYB 2YWBA 4RZIA 3O3OB 4WDQA 5D3KA 5J47A 4EPWA 5KNDD 3W5BA 3TLGB 4UULA 2P67A 4UTPA 3ROXA 3LHSA 3ND9A 3NEYA 1EZ4A 1U8FO 3SDBA 2LRHA 3TMAA 5JSZB 3NFYA 1T5TA 2DWQA 2HCBA 2ZWAA 5F1KA 1W1IA 2HA4A 5EUBA 3IAM1 3P4XA 5DULA 4AO6A 5ITSA 5LJIA 3OF3A 3RROA 4NVRA 3GT3A 1NF2A 3SHFA 4KVZA 5DBEX 1WHTB 4CF4A 2H1RA 1DC6A 1U9JA 4HPJB 5DTEA 3R3YA 5DSTA 3WOHA 3HYNA 4EP1A 2X9LA 3GJ3A 3O4RA 3SSAA 2XBMA 4WK4B 4F96A 2R66A 1A0OA 1JHYA 3ZN2A 3ZXIA 2ZI7A 3AL3A 3MWYW 2ZS7A 5CA1B 1EGVB 3HNRA 1Y37A 5CLQA 4EKDA 1M2VB 2GNPA 2HQ1A 1LKZA 3STHA 4COKA 2CDRA 3TX2A 5GJCA 4TXLA 4JI5B 3T3EA 1OB2A 1E58A 3T3NA 2I34A 2ZDGA 2ZFUA 2O2HA 4LJ7A 5E1OA 5BP7A 3H5RA 2PZBA 5FI3A 5G4LA 2C4HA 5AW2A 1BCSB 1KZGB 3V4RA 2G71A 1RSZA 3AUXA 1G4HA 4KB5A 2NUAA 5HSGA 3PPXA 1Z18A 3FW1A 5IYZA 4I9UA 3ZBTA 3B3AA 3GA5A 3R4VA 4QDXA 4M8SA 1WW8A 3MTJA 1A2KC 4X84A 1VZ3A 2A0YA 2IGTA 3NIBA 1SKMA 2PUCA 2GCOB 4P22A 3OPVA 2E7ZA 2C2XA 4OOEA 4MGKR 4LFAB 1KC3A 3G5LA 4KAXA 4ZU1X 4MWDA 4H1VA 3CRW1 1QVRA 3HJTA 4XLZA 1U0SY 4QXQA 5FB3A 2BMAA 3ECCA 3FN4A 4LOJA 3ADOA 1J9ZA 2FJ0A 2PAFA 3Q87B 4JOCA 4OXXA 2PUBA 4BNLA 3TZEA 2VG8A 3Q1LA 4L5BA 1ODCA 1ORWA 2JA1A 1EVIA 2OM6A 3OUUA 4V0MA 4BZXA 3PJFA 4IDNA 4K3UA 1HWYA 4BATA 1NP6A 3W9BA 4B3CA 4DJTA 1MQSA 1KH3A 5IKMA 1V5WA 2XUQA 4ZQFA 3VPHA 3OA0A 2ZXEA 1KEWA 4CM4B 1BWQA 3KL2A 3ZNOA 4Z0PA 2VK1A 5LNK6 1BCRB 3FNHA 3ML1A 1K08A 2AXNA 1NWHA 4MUIA 3D02A 2ZAIA 2QW8A 3PYLA 1NIPA 4R8KA 4D4GA 4MUAA 3UAZA 5IZCA 3FOWA 5FV4A 3KQHA 4GZ6A 5DNAA 1E4YA 5DM1A 1AZTA 3ROFA 2YX1A 1IUPA 2OCLA 2ZJOA 5AW1A 5BSMA 3IAUA 1DEKA 1E20A 1U0BB 5G1NA 1PQUA 3CW9A 2ZXFA 4EEKA 1ZIXA 2HO5A 3OQMA 1FNDA 5DN6D 2PUAA 3DSRA 4DMRA 4BEJA 2J4CA 5HFAA 4UHKA 4M9UA 4OAQA 5FNVB 2QY9A 5A9TA 3VO8A 1WZUA 3EEOA 4UKDA 4MRSA 4M2LA 1T4BA 1GQOA 1VGRA 2VOJA 1L8XA 3O83A 4Y7CA 2J5XA 2YN4A 3TRKA 3GVHA 1RQRA 2E4XA 4CLXA 4HGPA 1VPDA 5HW0A 1XCGB 1A7JA 2NAFA 2QN9A 5BSHA 5B58T 3LY5A 2Z1DA 4U63A 3DZIA 5DNWA 5FPSA 2VA9A 1XRPA 5LM3A 3E82A 2WM9B 5MFPA 3H5OA 3WVNA 2JPDA 3NNDA 1GQYA 2C4UA 4MUEA 5B3AA 4GR9A 4PSCA 5LZ5A 5IMBA 3MS7A 4TVOA 2JFNA 1U31A 2XTMA 3KBBA 3QWFA 4WZBB 4ZDJA 4RS3A 4AWBA 2XT0A 4F8EA 5B1HA 3ZU4A 2R8PA 4KR6A 1Z5GA 2DRIA 3MCAA 5J2UB 3JQAD 4WK0B 1N5RA 4LRQA 4X7MA 5AYVA 3DT8A 3FFBA 1ZM7A 2AK2A 5TV2A 1RDFA 2DMRA 2BT4A 3NAGA 1A88A 1YOVB 1NI5A 4KBYA 2ECOA 1R4MB 3LVBA 4II3A 4XRRA 1YJ5A 5GGYA 4DCNA 3KBOA 4BFLA 1L5SA 3ZH2A 4FFSA 3N0TA 4QTYA 1Y98A 2QLJA 1M10A 4DRZA 1AB5A 3BFKA 1V4NA 4RIHA 2FR8C 3M3DA 2VUUA 2VTKA 4BE9A 3VBEA 3H1TA 1GGMA 2CHVA 2FPPB 2JBHA 3MMZA 4NOMA 4KPYA 4ZIRA 3REFA 4R4JA 2QL9A 3OZEA 1WUTA 3ZEAA 4B44A 2WSBA 1Y8QA 2BKEA 4D9HA 4LJ9A 4R1PA 4XPIA 5I51A 3THYA 2Q41A 2FMTA 1EQUA 1R18A 3N6RA 1GHTA 4OQFA 3JASA 1J0EA 3PFKA 1DQRA 5D1HA 3RFUA 3CZRA 3DWEX 3TJMA 4W1SA 2NSLA 3C1OA 4CKBA 4Z99A 1T2VA 1LW7A 4Q7JB 3MK31 2D8AA 3BRWA 5D3QA 3P0JA 3CBQA 4KU4A 4OEHA 2J33A 3LQFA 2PBRA 2B61A 1WXFA 3ZS8A 3CF2A 2HT1A 3DXFA 2FUG1 4C0BA 1M0SA 4GGPA 1E6KA 1KEZA 2J6HA 2ZUVA 4M8KA 3OM0A 3KKNA 3PWKA 1GVNB 2CVPA 4LNUA 5FBRB 2O20A 5CDHA 3ABQB 3SFVA 2VRNA 3LPNA 4LF6B 1AGYA 1QCCA 3QBDA 3GH3A 4OP3A 4HTAA 5DCUA 2A0FA 3PCXA 3DVQX 3QFTA 4LX0A 1YC2A 4Z3DA 4RORA 1MOZA 4N4AA 1WHTA 2DX7A 4OHWA 1QYIA 5HIKA 4DA4A 2ZI3A 4XI9A 3PNLA 1OIVA 1NKVA 4RJLA 4ZOLF 5JCPA 2A4MA 4HEHA 2A5FA 3D3KA 3LHDA 4HF7A 4DIUA 3PC2A 3T5CA 1AKYA 4U0KA 2NSDA 3FJYA 4TRJA 1KK0A 2REXB 3OX2A 5IASA 2R751 1GG8A 5CA1A 4I3FA 1J24A 2HBQA 4Q1EA 4DC0A 2VO1A 3EN0A 3N0XA 3C4JA 2DZDA 4JWTA 1C1XA 1NUUA 4FYJA 4QUIA 3GFGA 4UM9B 1JG7A 3PQ2A 3SIXA 1CQZA 1W0JA 2JNWA 2ZIVB 2OUKA 2PSDA 4IEFB 2FXIA 3WL8A 4R9UC 4G3XA 1OA1A 1RT9A 2P4SA 3IDQA 2JIRA 5T4FA 1QR2A 3ILSA 4DM4A 4BMDA 4Q3BA 3UK2A 3D6UA 1Z2EA 5U1PA 1RHUA 4P4NA 4CMGA 4W7SA 5K20A 2HYIC 1U28A 4JBLA 1PFVA 5JATA 5JNTA 5HKKA 1FS6A 4J0QA 3U3JA 2JIOA 3Q0IA 1E4OA 2C5EA 5CT5A 3C43A 4BU1A 4B7AA 1DKRA 4GMKA 6ADHA 1OW3B 1UKAA 5L3RA 4Y2XA 2IV7A 3VR6H 3ZDQA 1QRUA 4YJGB 1MDBA 1ZD2P 4KO1S 2ZSIA 3ZJUA 1YONA 1CZKA 4D9JA 4ISCA 3CSSA 2ST1A 3O3MB 4UJ3A 3LUPA 5KVSA 1DJMA 4P7JA 4R84A 2YWGA 2JDID 2RI1A 2JJMA 4RCYA 3RHFA 1PR2A 5I9BA 3PEYA 3KQUA 4U7JA 3DEZA 1RM3A 1BJRE 4ZJPA 2GZDA 3EAGA 1LPOA 3R09A 4JK3A 2H1OA 4Y6RA 1G0NA 4CM4A 4FYKA 2ERYA 1BE8A 3X43A 1OY1A 1X7XB 4OF4A 4R68A 1GPBA 1HO3A 5DNYB 3S1SA 3K09A 1UDBA 4GDMA 4UCXA 3W1EA 4NYIQ 1K2VN 2KSQA 5C5EA 4P4GA 4PSDA 1XZCA 1FMCA 2Q07A 4PBTA 5EJ5A 4ID9A 1NW5A 4LXGA 4N40A 4JAVC 2VAMA 1T8SA 4AB1A 4EB6B 5C8DA 2BGLA 4KR0A 5FPQA 3ZQJA 2WAYA 1QWOA 3W8EA 3AFMA 4P08A 2DT5A 5HBRA 5FWNA 5FEUA 3C6KA 1SKUA 1M1ZA 3UJHA 5K3CA 1P1IA 2YC4C 3L82B 1Z34A 4LV5B 3TLMA 3E7WA 3GFVA 3M33A 5FNVA 5FPTA 3SXJA 1QHHB 1XWWA 2AZMA 1OXTA 2C9MA 2HF8A 3SC3A 2QRKA 3D0QA 1E2GA 1G7SA 1YASA 2XRFA 4YDRA 3W2EA 1T5IA 1WMBA 4HN4B 3RUHA 3ZHTA 4UBNA 4DTIA 4KQHA 4AZTA 1YB2A 4PO1A 1FSGA 1VKHA 4WNAB 2CJPA 4HDNB 3TB6A 1AZLA 1Y80A 2V03A 2R65A 3H8JA 2MHCA 5EIBC 1VYUA 1SU8A 4HGYA 4J16C 3K15A 2G77B 2HIAA 3GFOA 3RVBA 4GYWA 3E3MA 1JB1A 1NQTA 2HBRA 3MMXA 1SQ5A 4YK7A 1R4NA 5DHUA 1BGXT 1SOWA 3DWGA 3G2JA 4WZBA 1XP8A 5AHWA 3V1TC 4EMUA 1U0HC 4MR9B 1OZAA 4W5JA 2IUEA 5F1PA 3VNSA 1WZEA 4CNBA 5J2UA 2WV9A 3L0CA 2ODTX 3AUUA 4BNIA 1HQYE 3GLHB 1XLVA 2YJGA 4OHMA 4OREX 3VPCA 4NZPA 1BQ3A 2ZQZA 1R4MA 5L40A 5LIPA 4A8JA 1AUVA 3GFQA 4YRIA 2MU1A 2K5UA 3L1UA 5BORA 3EASA 2NNWB 4QL3A 3AG6A 3OIWA 3PNQA 4MH0R 3FXAA 3M6LA 5A5EA 5LZ8A 3RU7A 4HQNA 1QK3A 5F2OA 3F49S 2DCUA 5KYXA 3T3DA 2FPPA 2ZIXB 2WEKA 1R3UA 5FI5A 3PNKA 2ZE7A 1JIIA 4M99A 1FTNA 1KVSA 1QONA 2PH3A 3G17A 1Q21A 3PHGA 2VUTA 5B30A 3CLRC 4MIOA 1QVZA 3ZDDA 2R62A 3KD2A 3M0EA 3L0YA 4V2UA 2WVAA 1N7HA 2G9RA 5DYWA 1ZXLA 3U26A 4DLWA 4H60A 4RM3A 4RL6A 4L0DA 5BV7A 4MUFA 3AUJB 1XVVA 3C3KA 4RKQA 1RXWA 4AMZA 5TVGA 4L5CA 1PWHA 3ZGYA 1ZI9A 4JR1A 3O9ZA 4CT4B 5JY6A 2O8EB 1KETA 3G0GA 3H2KA 3ED1A 3HCDA 2PUDA 1UC4B 1UF9A 3EOBI 2QQFA 3GEDA 3OX3A 3ASZA 4QLAA 4DCGA 1IJFA 2QG6A 1O89A 3MAJA 1I3KA 2O05A 3QFFA 2NLOA 1MJGM 2GTPA 5EIBD 2QVZX 4M21A 4U02A 4AF6A 5JISA 4AZWA 3QOFA 1J8DA 4Z7JA 1EAMA 4FYXA 3R8CA 1RD4A 3EZXA 2CF5A 1NG1A 2H48A 3PRKE 2YZKA 1SA0B 1UZAA 1RHJA 1Z82A 1IZYA 2GZHA 1J2TA 3IALA 4FT2A 1HDYA 4HLUA 4TMWA 1Z36A 2C42A 2JKVA 2NO1A 3OPYI 5HF8A 4WFQA 1MF7A 5BV1A 3FMFA 1Q1NA 3ITEA 4IFTA 4CT5A 1JDVA 2JCGA 4PLPA 3SFZA 4V0QA 3ZC3A 3FPBA 1E98A 5J40A 1TGVA 5CVDA 4Z8YA 4QNMA 4D4JA 3T15A 1YBAA 3TEMA 3QU7A 2R8RA 1OFIA 3K9NA 4KVGA 1OROA 5BXYA 4JJGA 1COWA 1XF9A 1P2BA 2DQ4A 2Z30A 4M9ZA 3LBHA 5DM2A 3RGGA 3V55A 5KU7A 3HKBB 3MINA 5DTJA 1BX1A 2RKBA 5L7WA 1O9GA 4CTNA 1H0HA 1PP4A 2F1HA 5EEGA 1IY1A 1SD5A 1FXSA 4PYKA 3LF2A 1VBFA 4HYEA 3HCFA 2HQRA 2VR1A 4G0PA 4XD7A 1M5TA 1T9CA 3CLRD 2UZ0A 4KMSA 1Q7BA 4IHJB 2NT3A 2JI7A 3IR6A 2R1ZA 4JDUA 1JWBB 3K1YA 2WVGA 4JITA 5SV2A 5EJ2A 2E6KA 3D6NB 2VXYA 1SCNE 2WPDD 3DLTA 4AROA 5B3JC 5K0FA 3HACA 3JR3A 1I5OA 2QP3A 3OPNA 4LWPA 5SICE 4REOA 1GG2A 1RCTE 5D1NA 4YJGA 3WLAA 1HV8A 2VDJA 4MAFA 2J48A 1NRXA 1GQFA 2C04A 5IAEA 5A4KA 4HNGA 1AMNA 2Y6VA 4XB6B 4CHTA 1PG0A 3RVQA 4S04A 4KWTA 3WZLA 3EGIA 1C1YA 3LX8A 4D9BA 1V48A 2HMVA 2XRZA 2PS3A 5LDGA 4QASA 4RHFA 3RC3A 1GTZA 1YO6A 4CQMB 2Y68A 2O54A 1P0QA 1IC6A 1S01A 3E9QA 5LQJA 1RXSA 1C30B 1R0LA 4DN6A 2AOUB 3KIPA 1UKYA 2JFXA 3EVNA 1GTVA 1IEQA 1WJGA 2VF7A 4NTZA 4QE3A 4DJAA 1YB1A 1PGPA 1KTIA 1NVDA 3C3CA 2R8OA 5A06A 5CW1A 3DEIA 2D1QA 1UBOS 2Y71A 4PRZA 4UUAA 1Z7BA 4EB6A 2VJOA 4YR7A 5BN5A 4KLNA 1PFKA 2AVNA 4CM3A 4NBKA 4DOMA 3K35A 4Q21A 1MTOA 3L02A 3JQ7B 3PV0A 3INRA 5AI4A 1T2CA 3GLGB 5CVVA 3CWZA 2O50A 1L7QA 2ZVQX 2XUDA 5TT1A 3B9QA 1DBQA 4LCEA 1A04A 1L5LA 4TWRA 4F3KA 3HADA 1U80A 2GH1A 1QHHA 5HG0A 4RVFA 2D54A 4QBHA 4CL2A 4W99A 3OSZA 5DTIA 2EIHA 4PQRA 5FFNA 4C0WA 1F6DA 3FYUC 4G5OA 1F8GA 4UE3S 4BLUA 4LSWA 2KBFA 4R54A 5KS2A 3HEAA 1DZ3A 3JYLA 4H2DA 1AXEA 4DR7B 1V5IA 4DCCA 4X20B 4WNAA 1SUEA 4L4UA 3SFTA 2ICAA 3T5AA 5IC4A 3R0VA 1A9RA 1V8BA 2FZGA 3AI1A 3BFVA 4TROA 1XPJA 3DR5A 2ECKA 2W6JD 2RIPA 1KO8A 5LFAA 1E0SA 3DKRA 4RHXA 3HZZA 4QUAA 4RPJA 4QSMA 2ZRCA 5K0GA 4IMJB 1DLIA 4HDAA 2ZRFA 3QTTA 3ROGA 1Y7LA 3GG2A 3HXTA 2VPWA 3ZZTA 1B7GO 1P2TA 3NV7A 1P5JA 2BAGA 4QQFA 1CLEA 2EFEB 3BE4A 1OPRA 3MRXA 2B7LA 2ACKA 3IHTA 1USGA 3IDSA 4FCCA 3DL4A 1XMJA 5AXCA 3OQVA 4TXJA 2COEA 3FUVA 5JWOA 2FFJA 2YQ5A 1JYSA 1CEQA 2FG6C 2R47A 3P9CA 4D02A 4TWJA 3CY6A 3VV2A 3L6EA 5SYMA 4TUYF 2D7DA 4OXIA 4KO4S 4O2AF 1ZH8A 2CDCA 4ZQCB 2HSDA 3DVAA 3IVCA 1NG9A 2ZIXA 1H1LB 3UQZA 2ZSBA 4JGGA 2W2LD 2OC9A 1WDMA 3RFTA 2AKEA 3N8IA 1CEXA 3NKVA 3HCNA 2FRDA 4TT3A 5KKCA 3COVA 3HN7A 2PUFA 4YJ3A 1RLJA 4MJ3A 3CVWA 2BFBA 1EFRA 3N7UA 4U5XA 4WN9B 2NW6A 4QHYA 4PC6A 3X2EA 1N2JA 4FQ8A 5JMWA 1PSZA 3DNFA 1DBIA 1U0TA 3ASUA 3EVFA 4G8CA 4R41A 2AQ8A 3WG9A 3AX6A 1X1SA 4QWWA 1E9AA 4RVUA 3UW1A 2C88A 3UJDA 1Y9DA 1DXHA 1B8VA 2H6EA 1VJ5A 2VRCD 2XQJA 3HYTA 3IPRA 1U5AA 4XE5A 5CHEA 3HU5A 5F78A 2YWEA 2OLKA 4RA9B 2O8EA 4ITVA 5JD3A 1UJ5A 2G40A 2YMMA 3K6KA 3A4TA 1Z2NX 2NWQA 4U4AA 5K0SA 3QUBA 5AW0A 4LWQA 1KAGA 1RHMA 1W4ZA 1CVLA 3SC6A 3PXXA 2XIJA 4UMFA 4JSTA 2R8BA 3BGSA 4CV3A 1UXJA 1C50A 3PQ3A 1IUKA 1GIAA 2BFEB 1GL7A 2NV2B 2WSMA 3D7SA 2Z2IA 4OG2A 4XJTA 4XTCS 1U7DA 4ZEWA 3I32A 5CLIA 4ZVTA 3AF1A 3UV3A 4QM6A 5I6DA 1SA0A 2I76A 4LSMA 4KYVA 3TJZA 1IUNA 1OX6A 5E2IA 3M83A 1H6DA 3M5CA 3O8DA 5JCOA 2VBIA 1CVIA 1TK2A 2VK8A 3F6YA 3QE0A 3UTCA 3GFFA 3BD6A 1FDVA 2HADA 3PE6A 4PCUA 4NECA 4PRLA 3WY9A 4W7IA 4CKXA 2IYYA 4RC9A 4CEHA 4DR4B 3OKCA 1BNCA 1N7GA 1E2KA 1D2CA 1ENOA 2X0NA 3HR4A 3G0IA 1KR5A 2PRIA 2ZJBA 3KJXA 4IIUA 1GO2A 3BT7A 4JNKA 4Q9HA 2B9EA 1W96A 4S24A 5B3JA 5IVHA 1HX7A 1Z4MA 3OLXA 1KJJA 1KIFA 1Y82A 3HKBA 4TKVB 4DLZA 4KQFA 4IF6A 3VKVA 4ESEA 1RCFA 3PGA1 2AR0A 2P6OA 4GRAA 1VCNA 3E2MA 4HYTA 1YQGA 1YZGA 1MO4A 3U2QA 3UWOA 2FZVA 1B76A 5TQVA 4CFSA 1KFKB 1N57A 3DONA 4BZQA 5BRJA 4J0HA 3DYVA 3GVCA 4TV8B 4RVSA 3GGPA 1RRVA 4Z9XA 4PZAA 2CHFA 4UATA 3RHTA 4A5SA 4DTCA 2E4WA 5DV9A 1EFHA 4L8LA 1TYCA 3DOOA 1XHFA 2XVYA 3DOUA 1WTAA 4CGZA 4KKXB 1HC7A 2D5LA 5CA0F 4QTXA 4Y6OA 2O8NA 1H6CA 1JEEA 1T91A 3ZZNA 1U2GA 4PC7A 4U0JA 5AI9A 3WGGA 4BO2A 5M29A 2GJSA 4N7MA 5I4BA 4KACA 3VU3A 3LSYA 1O9BA 4BPBA 2LNDA 2WJHA 1V5EA 4R31A 3K6JA 5JLAA 1TYZA 3HJNA 3SD7A 3VKFA 3AR7A 4NC9A 1QTIA 1SQ0A 1M3SA 4CQMA 1HMYA 2IYQA 4O4LB 5BNTA 3G2IA 5AVWA 2V9CA 4JKIA 3UKOA 4IXDA 3L43A 3H65A 1EK6A 4TVBA 1CR1A 3B2QA 4ZC1A 4IH1A 2AOUA 1NT2A 5EESA 5JNRA 4OBEA 3PT9A 1SIBE 3O5AA 5F9MA 1BHSA 1PO7A 3VZDA 1Y8ZA 2MOKA 3RYFB 3T7EA 5HUQA 2Y1GA 3I6MA 1RAGA 5CLHA 3U7FB 5FHRA 1ISIA 4Y67A 2FMHA 1QG0A 3PDHA 4EBFA 3VA7A 2FZCA 2WUWE 1N3YA 4J4BA 3ZLTA 4B17A 2WHYA 2AW5A 3GAMA 3RBZA 1AM4D 1LC0A 2HB6A 2I7VA 4PZDA 3LLMA 3VO1A 3C8UA 3JQ7A 1BRTA 2GT1A 2Z5LA 1MA0A 3GA0A 3PC8A 3GLGA 1DKQA 2I22A 4MVJP 4H7FA 3TLZA 4FGUA 3KPWA 4LCBA 5LWQA 4DWOA 2XDAA 1BMFA 1WKCA 4YREA 4CM8B 3WIDA 2BHNA 2GD2A 3RO7A 4DSZA 1MX5A 1UR5A 5C8ZA 2BYTA 3GP5A 1I51A 1NJ8A 1P2VA 3A1CA 3IOBA 1CYEA 4JQYA 4R1NA 1X7YB 1EUZA 4PFQA 1SU6A 3TOCA 2ZJZA 3AO0B 3GRKA 1BEEA 1O95D 1E2LA 2NTNA 4X20A 8AT1A 3OQOA 2Q7XA 4B3TB 4Y2QA 4MGHA 2WIJA 5HK9A 4HRAA 4X5OA 3UQYS 4J1QA 2AWNA 4O2BB 2UXCB 1FX1A 4IH4A 2NTEA 1IN7A 3T35A 4MRMB 2AKYA 4PS1A 2XJ4A 4TMVA 5JZMA 3ESAA 3NCTA 5JYBA 2AJ8A 4HB2A 3V4PB 4M1KA 3LQQA 1WLSA 3NTQA 3PDUA 4F2WA 4ZHQF 1UBTS 4YP7A 1XCJA 2O2CA 2GKOA 5TR9A 1OGJA 2C20A 4G23A 2JGKA 4L51A 5AW3A 3BSFA 2AG6A 3DUFA 4NI5A 3AY7A 3PC4A 1OFVA 1OYWA 3RTGA 2RGUA 4ENSA 2BI4A 1OIWA 3HJHA 5I7FA 1BHQ1 1CY8A 1CJSA 5AW6A 3NEPX 4GPIB 4LXHA 5KOJB 1X1QA 5DT9A 3LPLA 5LC1A 4MUKA 3EZ6A 2HZBA 1RMYA 2YV1A 4XYEA 4JV5B 1YZHA 3PT5A 4CXMA 3Q9SA 3VI4B 5KX5F 1X1TA 1LTHR 5TNXA 4CMKA 1KVRA 3GUZA 1UPBA 2GPJA 3VPFA 2C59A 2J3IA 3EVAA 3ZOKA 2RHRA 1GNQA 4WN9A 2MR6A 4PONA 3RTCA 4L0MA 2R25B 2QAJA 4TPKA 5EYPB 3RM3A 1QB7A 2ZTHA 4ALIA 1ZVVA 3NVAA 4KUEA 4MQEB 2IIQA 5CPFA 1U8ZA 1CUCA 2EBHX 4EJSA 2CFTA 3DFIA 1U2TA 2FW9A 1H0SA 1T1GA 1WL8A 1FTWA 2EJTA 3JQDA 4P3OA 3TSCA 3ZGXA 2R9VA 4KDCA 1Z8NA 4GBJA 4V0SA 5IC5A 5BV0A 3JQEA 2GZSA 1VE5A 2OAEA 1XKQA 1T43A 1CRZA 3PQ6A 1QYRA 3LC2O 1AKNA 3ZD9A 4Q4HA 4HO1X 3CINA 1OFHA 1NJ2A 3C6ZA 4LYGA 3BL8A 5BMVA 3OQPA 2VSQA 3HO6A 4L7QA 3JD1A 3U0BA 5B4TA 1W52X 1JAYA 3TSZA 4ZRMA 1H8EA 3IUYA 1IZ0A 4LVOA 5EWJA 4EB3A 1YCHA 4IXNA 5DLYA 2BFCB 1YT5A 2AN4A 2C5BA 2E1PA 1EP2B 2CFOA 4G0UA 1TMKA 2PGIA 2C4WA 2R68A 2VBGA 4GXTA 4K03A 4YVFA 4E2FA 1TQDA 3CNLA 3U4QB 2WSSD 1EG7A 2VXBA 5HK8A 5FRDA 3GLFB 4PXSA 4PLTA 2XMDA 2V74B 3RV3A 5JWHA 3WGZA 4F04A 4B3RB 3WJ1A 5PGMA 4TV9F 3RT1A 5AJTA 4KV7A 1YRHA 2OYRA 3WR5A 1LF0A 2CUZA 2GHQA 1NXVA 2Q46A 1RM5A 1MV8A 3HHEA 2FPGB 2FV8A 4LVCA 4BCDA 1BX3A 5KTMA 5FL3A 3A0UA 1TFUA 4XVCA 2PXCA 3VDMA 1W48A 1TQ2A 4P33A 2W6NA 1Q15A 4TKVA 3TPCA 4QFBA 5CURA 2QNIA 3B9RA 4YAUA 3NDBB 3LVFO 3PCRB 2PGOA 1F60A 4ZOAA 3M49A 3T5TA 4JYZA 1A98A 3C3BA 4DXAA 4F56A 4DUGA 2AOVA 1HYHA 3L79A 3K9GA 3NWJA 4GSYA 4LJ8A 1QP4A 4TM8A 2PQ0A 3RRZA 2ZYHA 1RXEA 3ZNQA 4BKPA 3QBJA 4II7A 3EX7C 3FA2A 5HKOA 2J0VA 1MO2A 3DE7X 3A4YA 3KVRA 1N32B 5GTDA 4Y3UA 1FP4B 2OHJA 1GRVA 4Q02A 4ZT6A 3UGQA 3IRVA 3AEYA 2GZ2A 1X1DA 1K4YA 2IZ5A 1VIDA 1U8YA 2NGRA 3O8OB 4IX1A 4CDRA 1HTTA 1PYOA 4A15A 2AUTA 3AHDA 1E0DA 1HLGA 1UJ2A 3L7NA 4MDYA 2JVJA 4OQEA 1X42A 3KDPA 3V4SA 1PT9A 1L8AA 1PZFA 1PKXA 3LPDA 1VSVA 2VFAA 1U4OA 3FROA 5ALSA 4OLFA 1BYUA 4IZ6A 4Q16A 3UAWA 1IBCA 1FUYB 5CDSA 2QN2A 3SS8A 4BNJA 4DUPA 3QRWA 1E7MA 2PX5A 1SCUB 4LYJA 4M8LA 1H4TA 3TSWA 4DADA 3ICEA 1EESA 2HAEA 4Q7QA 1O0BA 5AP9A 3RYFA 3U3ZA 5K0LA 2J7KA 1QK4A 2CMFA 3C14C 5CM9C 2A84A 4LCJA 5T57A 5MFZA 1JR6A 5LMZA 4KQKA 5I8PA 3HN6A 1GQRA 1MOQA 3R5KA 2DWUA 4H0CA 5BSKA 1W30A 2WDPA 2NU8B 1BFDA 2RJ3A 3H11B 5DI3A 5IUNC 4C4RA 4FE4A 3NHBA 1UDAA 4AJNA 3VGJA 1ZH2A 4UU8A 1U1EA 2ZUDA 1N9KA 4CM8A 1PD1A 2QRMA 4HWPA 4HVLA 1ZONA 1PG5A 2A9QA 2FP4A 2HA7A 3F5QA 4L76A 5IF9A 5HR5A 1PG2A 5H82A 1JJFA 2JI4A 4KQGA 5ELXA 4KIJA 1LDGA 1FU4A 2C4MA 2OVBA 1OZFA 4U9HS 1SXJB 4QNNA 4I1IA 1AKVA 1N78A 4B80A 5IYZF 5KINB 1XV5A 2G9ZA 3FOFC 1SVUA 3E1GA 3KKPA 16PKA 4JQCA 4F21A 4D80A 1YIAA 2PGAA 2WP0A 3PNMA 4KR9A 4AP9A 4LOAA 5DF1A 2WJAA 2QRPA 3A7DA 2JH8A 4MRMA 3CM0A 3CONA 4R9RA 4V03A 2FEXA 5DI9A 5IBPA 2P2GA 3UO8B 3UPDA 1P74A 5LQMA 4N0EA 4KFCA 3OJFA 3CUSA 4XVUA 5K4AA 3DOEA 1CUZA 3CFYA 1FP1D 3QLUC 2XZOA 1EQ2A 2JKYA 1L4FA 3OZBA 3QF4B 1N5DA 3FDJA 4HLCA 2Q0QA 5TX7A 3IBYA 2OLEA 1G20E 1U1CA 3YASA 2DBRA 2WUEA 1H4SA 1PNRA 1E2DA 2O5EA 3RVJA 1B8PA 2WTMA 4BEWA 2ZKIA 2QJOA 1Y5RA 3ZK8A 3FY4A 1OVMA 4QECA 1RLMA 4YACA 3RLIA 1E3WA 4DREA 1CF2O 3C7CB 3IS3A 2AKAB 5ALVA 1YWGO 2PR7A 2VNKA 4BKOA 3O8RA 3OT5A 1PHPA 2LBPA 4H0FA 3AUYA 4EABA 1WMEA 1OLOA 3KOYA 4A2PA 3ZOZA 4C4SA 4E7PA 4MPTA 1ZW1A 4ISBA 1L8OA 4NFSA 4WCFC 4MUHA 4J2OA 5JTTA 3EEFA 4AICA 5B12A 2H4ZA 2AUNA 3DTVB 4R7GA 3TNFA 1AV6A 2HLDA 2BF7A 4JI4B 4EK9A 5JUWA 1E3SA 3NVDA 4HUQB 3TLCA 1SO8A 3QZUA 5EYPA 5KYGA 2CMKA 2FNAA 2WU8A 5LSAA 3F2VA 2G1JA 4MQEA 3ZXXA 1T0BA 3GA7A 3K0FB 2ZKLA 4V39A 2VYVD 2W2TA 5T5QA 5C2JB 4BNZA 2P1ZA 4YXWD 3HVHA 2HU2A 1XTSA 1Z12A 1G291 3NIFB 2EOAA 4QOJA 4XQCA 3A7EA 4PCVA 2BRUA 3LCMA 3K8OE 1H9CA 4WLVA 2YHAA 2BKAA 1I1QB 1XE3A 2DGDA 5AHRA 2WTUA 1YGYA 1O6BA 4BLQA 2QQ0A 4QBFA 4TYNA 1T8TA 1XKTA 5ENZA 1FRZA 3WL4A 1CUBA 2XI4A 4CMBA 2FWMX 1X0VA 3R74A 5HGJA 3SYKA 5K1ZA 3WLIA 2BBOA 4G01B 2QN7A 2IL1A 4RW0A 4AQ7A 3RVNA 4WBSA 1ADCA 1RRCA 1HTWA 3GLFA 1HE1C 1NHWA 3K5HA 2LDXA 2J4FA 4RZHA 2YZMA 5CB4B 1KMIY 3PX3A 1DDOA 5EMMA 5A6SB 3PQFA 1XB2A 3B1FA 4RKYA 3H3JA 1CB7A 4G2NA 1LNQA 4IIXA 4C88A 3EGXA 2FPGA 4FN4A 5IDYA 4IIJB 5MHTA 4OQLA 1O94A 4PC3A 5UKDA 2GHIA 3EGVA 4ERXA 1KHTA 3FKSD 3LDAA 1F51E 1LRJA 5L9AA 3UJNA 1CUUA 3UENA 4MVXA 2W2KA 4K86A 2F67A 4PGAA 3D6MA 3JQFA 5C1DA 3UTDA 1FMTA 3AL2A 1DEXA 3HE3A 1U9IA 4UNSA 1SELA 4URUR 3UHFA 3DCYA 4EGQA 3H5IA 3LWBA 4B35A 5EE5B 3TI7A 1GM5A 2FWNA 2AEFA 2RDMA 3PNPA 3D5QA 5KAMA 3ZEIA 3L5OA 4M0KA 3M4YA 1RJDA 2CNBA 4KVFA 1ZNXA 4S1PA 1KHHA 3KAPA 5FL7A 3LRXA 4H3SA 4RANA 3BK7A 4DSNA 2X8WA 4EG3A 2Y9MB 4HWOA 2HWUA 3CS3A 1MPTA 2EATA 1UBLS 3DKVA 3A6EA 2R4TA 3CJRA 4BO4A 1DP4A 3S70A 3QEMA 1FFCA 1GJRA 4TQAA 4CKYA 4DPKA 2X13A 1RKUA 2EEPA 3O8OA 2PKWA 2P9QA 4D42A 5MN4A 1SUFA 4MV4A 3PC3A 2GJAA 4ARZB 1XTKA 3NKLA 3N3BC 3B2EA 4L8VA 1J6UA 3IEKA 4Q03A 5L3SB 2OT3B 4D81A 1A8HA 2V58A 5G02A 5KTPA 5KSWB 4QFDA 4B4VA 4B3HA 4AKHA 3O2QB 3ZQ4A 5C4MA 6LDHA 1WXGA 1GGNA 2QF7A 3KQVA 3LJKA 1XLUA 2AI1A 4AMYA 2ABWA 3KEGA 3MUEA 3NYQA 4RLSA 2DQYA 2B4TO 4Q4AB 5EHXA 1SCUA 2J7PD 3G89A 2C2WA 2DB3A 3VR5D 1KXZA 3NC4A 4YIKA 4FSXA 1U2DA 2GB4A 5EJMA 5CBPB 1V26A 1S9DA 4OHFA 1M0WA 2V55B 2VP4A 4U7DA 5HJ2A 4OHYA 4R5MA 1VIMA 3B7PA 4XKJA 3KWMA 3I53A 2I5PO 3TJRA 4IV0A 4KQJA 5DTQA 1TM2A 2HLNA 2CC2A 3RKUA 3SDZA 1JR3A 2QYTA 3O2NA 1PL8A 3H11A 4FR2A 2NU8A 4ZU6X 2BGKA 1QJ4A 3AHFA 1HG0A 2LDBA 3OU7A 3PHHA 2E89A 2ZS9A 4RHCA 1TEVA 4EUKA 1YZ3A 4CEIB 3U4HA 5CA1F 1RPNA 4UCWA 5F7ZA 3URMA 1ILEA 5JAZA 1CUEA 3JVUA 3C4QA 4OP2A 3ORRA 1IK4A 1PT5A 3E61A 1KDRA 5ALUA 1BS2A 1JE0A 3VGPA 2X4DA 1FL9A 3O8QB 1BMTA 3RSGA 4L2IA 1PNQA 1XRNA 4YTEA 1HTBA 1EVQA 1ZH0A 1JHOA 1MT0A 1OXSC 3MG9A 3BULA 4R40A 4F4FA 3KVYA 1VJTA 4CQJA 1SVSA 1VTKA 2W0MA