4CQMA

Crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
256
structure length
248
Chain Sequence
QNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTRADIOL 17-BETA-DEHYDROGENASE 8
publication title Insights Into Mitochondrial Fatty Acid Synthesis from the Structure of Heterotetrameric 3-Ketoacyl-Acp Reductase/3R-Hydroxyacyl-Coa Dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 87
structure length 248
sequence length 256
chains with identical sequence E, H, I, L, M, P
ec nomenclature ec 1.1.1.239: 3-alpha-(17-beta)-hydroxysteroid dehydrogenase (NAD(+)).
pdb deposition date 2014-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cqmA00
1VC2A 1IUKA 4ZQFA 5BNFA 5K0ZA 4PG6A 3GDFA 1O95A 3JD0A 3AFNA 3T7CA 4CJXA 2DBZA 1FMCA 1ZSNA 4M87A 3RC2A 5FWNA 4B4WA 4OXKA 3UUWA 1ADGA 2WYUA 4LVCA 1Z82A 3NDJA 4WPGA 4TRNA 4OYRA 3OJEA 4XKJA 1A27A 1OC2A 4NK5A 3QLJA 1C0PA 2CVOA 3QWHA 4B7UA 3OFSA 3P2YA 3ZWMA 1HSZA 2JFHA 4H15A 1U8FO 3JCZA 3WNVA 3PLNA 1VSUA 4NU5A 3B6ZA 4JQCA 4BNKA 5IXSA 1QLHA 1TLTA 3WNQA 2QZ9A 3NAQA 1E6WA 1NBOA 4AJ2A 1I3NA 4OJNA 4FSHA 2Y68A 3EC7A 3OQBA 2PKQP 4DPKA 3GRKA 2AE2A 4PVDA 3U4IA 4PGFA 4Z9XA 1P77A 2HMVA 5A06A 1XKQA 1YVEI 3GNTA 4U7WA 1O8CA 2P4QA 2FSSA 4YAJA 4DIFA 2VN8A 1Y8QA 5BNTA 1H6BA 2HMWA 1IB6A 2PY6A 1SO8A 4IPTA 2WD8A 3RUFA 4CV3A 5JC8A 5EL0A 1N1EA 4GLLA 1RYEA 2NWQA 1YONA 3OSUA 2HK9A 1LLDA 3OQ1A 3Q6IA 5F1OA 4YPOA 2BELA 2Q1WA 5AXDA 1I01A 3O03A 1E6EA 1EVYA 5KJEA 4C7KA 3A9WA 5I8WA 3PHHA 1XWFA 1Y81A 2NM0A 4ZRMA 2AEJA 4IZHA 3DZHA 2VRCA 4A10A 3BHMA 1R4NA 4AG3A 1AN9A 3D3WA 3PFFA 3WICA 4D79A 1SPXA 3SVTA 1JVSA 4GH5A 4E21A 1UP4A 1ZIDA 2IEBA 3QJ5A 1QXSA 1M75A 2ZQYA 2PV7A 3S2EA 3PQEA 4GPD1 4WLOA 2OP1A 1QV7A 1R16A 3F1KA 4ZQGA 4CMKA 3NT2A 2QYSA 2UAGA 3WS7A 4GX5A 4MDHA 3HFSA 1WMBA 3U9LA 1KVSA 3CKYA 2VHWA 4QO7A 1HDCA 1UJMA 4I1IA 2WM3A 4TWRA 2PK3A 1IPEA 2H1SA 1I36A 2O4UX 3PEFA 3V2HA 4K1LA 2W2KB 3W4IA 4MVJD 4RF3A 1FDSA 3F6YA 4O6VA 1YXMA 1EDOA 2J5KA 3KLMX 4GMGA 1H6AA 3GVCA 1DO8A 4JJIA 2NVUB 1JVBA 4KUGA 4U0KA 3KRTA 2EWMA 3KOUA 1T2AA 5IDYA 2Q2QA 3PWSA 1DAPA 2FN7A 1S7CA 3QVXA 3T4EA 4RF5A 1DFIA 2FRDA 1LRKA 1EMDA 3TN7A 5C3MA 5H83A 2H9IA 4YYZA 5A3JA 1GYRA 4DIOA 1CIVA 5I7EA 3ANMA 2RH8A 3ZGYA 1JKJA 1A5ZA 1D8AA 2VHYA 5JCJA 4CM1A 2WSBA 2R6JA 4TQGA 3OF2A 5KJ6A 1L7DA 4FGWA 4DLBA 3P2OA 2PR2A 4R01A 4XYLA 5B12A 2BFMA 5F1KA 2P5YA 3UCFA 1F8FA 2X4GA 3E82A 4RF2A 3TZKA 2PZMA 2O3UA 4J9VA 5JLAA 3G17A 5EMHA 2OFPA 1C3VA 5FF9A 2AW5A 4B7XA 1FXSA 3WYBA 1DRWA 4N18A 1TA4A 5KKAA 3DZBA 3UAGA 5L51A 3DFZA 1W8DA 3N7UA 1UXGA 4F45A 3BYZA 3WR5A 3W1VA 3B1KA 4BKRA 1YOVB 2EP5A 5ICMA 2RBEA 4W6ZA 5B4UA 1SEPA 1B8PA 2AE1A 3R0IA 1CETA 2J8ZA 3VPSA 2O3SA 3E03A 4II3A 4MVJM 4DIBA 5KVQA 3LYLA 5ER6A 3FPCA 4LSMA 4U8GA 4A5OA 4WLUA 4CQMA 5TSDA 2POQX 1CQIA 4J4TA 2C0CA 1HYEA 4INAA 4DLAA 2NTNA 1IHXA 4WOKA 2RIRA 1DFHA 5AXAA 3RUAA 1LU9A 1W6UA 3E48A 5CHEA 4CL3A 3K9QO 3WYEA 2X1HA 1ZJZA 2CVQA 2QG4A 4UULA 2J3KA 2B4TO 2ET6A 3S55A 3OP4A 3DMTC 1Z7BA 2OBYA 1PU2A 2QW8A 3TWOA 4PN3A 3AK4A 1W4ZA 2C5AA 3PJFA 4FDAA 4DMMA 1U5CA 1GYPA 5A5FA 1EVZA 2PH5A 3M1AA 2VUUA 1GUFA 3LLSA 4ONEA 4XJTA 1VRWA 1EFKA 2Z5LA 4J3FA 1U3UA 2X7HA 4D0RA 2YHIA 4LMRA 2CFCA 5GZ6A 2P5UA 4LRSB 1HWYA 2JHFA 3Q0EA 5CDUA 3AOGA 2Y0DA 5IDQA 1JQBA 3IUSA 3MZ0A 4XRGA 2PGLA 2O7QA 3FSRA 1E3LA 2VTDA 4CM6A 5EIOA 4PG4A 3HB5X 4DTIA 1NAIA 5KCZA 4CLRB 4AJKA 2Q4EA 4ALMA 4U0JA 1MV8A 4I8XA 3AOEC 1I3MA 4W7IA 4ND2A 2AMFA 1PJLA 4N5NA 5B1YA 1UDCA 4FD3A 4FFMA 1TB4A 5TQVA 3PDJA 2PA3A 4N7RA 1WMAA 1E3IA 1GL3A 2YV3A 3WTCA 3V1UA 2P91A 3QIVA 1O94A 2OL4A 3DFUA 5JC1A 4XCVA 1LJ8A 1V0JA 4RCVA 3C1AA 1NPTO 3CMCO 4Q3BA 4J6FA 3RKRA 3ENKA 4OL9A 1GCUA 4CMJA 3U09A 1LBEA 3COSA 1HE5A 4LK3A 3L4BA 1XHLA 3JQFA 1XR3A 1LSJA 5A3VA 1TEHA 2ILTA 3H65A 4CM5A 5G0WA 5COBA 1DHTA 3MOIA 3SJ7A 1MG5A 3VDRA 3BIOA 4HFMA 4R4JA 2PZLA 1A71A 3IIEA 4H3VA 2X23A 2GNAA 1GCOA 1ZNQO 2FPGA 2WJPA 3DBRB 1PR3A 4DYDA 4R1NA 4EUFA 5A1TA 1PS9A 3QWFA 4QQRA 1PJSA 3AY3A 5IJZA 3LC2O 5DP2A 3KSUA 3O8QB 1LLQA 5THKA 2I66A 1ZK2A 3HZZA 3IP1A 5CPBA 1X7DA 2OOSA 3PWZA 4JIGA 5A9SA 4R5HA 5JYEA 3C1OA 1E7YA 5DNAA 4YJDA 3BMQA 1D4FA 2HCTA 4P8RA 1P1HA 3PJGA 1LXCA 2C07A 1JAYA 3NRCA 4MVJA 1NFFA 3H5RA 4UVIA 4DYVA 4NZ9A 1P1JA 4BO8A 1E5LA 4OH1A 3NJ8A 3ST7A 2CDAA 1ISIA 3OM9A 1A9ZA 1ISHA 3UVEA 4CODB 3ZWVA 2EV9A 4XQ9A 4MP6A 4HFJA 4DXHA 1G0OA 1YL6A 3SXPA 1FDUA 1EQ2A 4D3SA 1HZJA 3INGA 3D7LA 1IL0A 1N9GA 5AXCA 4EW6A 4WLEA 4XIJA 1I8TA 4ALKA 3H3FA 3TL2A 4CM4A 4EUEA 2Y1GA 2Y93A 3O26A 5DCUA 3GPDG 1VL8A 1UR5A 4CM3A 9LDBA 2OORA 2EKPA 2DC1A 4Y67A 2YUTA 4WASA 4EJMA 2BRUA 2IDZA 3ICPA 1PGNA 3K92A 5DZSA 1LNQA 4HFRA 3DZIA 1NM5A 2HUNA 3CXRA 4C4OA 5BNIA 1J4AA 1ID1A 2OO5A 3HWRA 1LC0A 3E5MA 2P4HX 3FN4A 2IZZA 4II2A 1PEDA 2EGGA 2ZTVA 5FI5A 2JL1A 3PYMA 2AQHA 5ILGA 3FBTA 3DBVO 1ARZA 4NJMB 2ZCVA 4YRDA 1VE9A 4EEZA 1Z75A 3E5RA 4D7AA 3FNEA 3ON5A 3DTYA 5HWSA 2YW9A 1GQ2A 3C7CB 3WQQA 3RASA 4EYEA 2AHRA 3AI3A 4BO6A 2BMAA 4XDYA 3RD5A 1T26A 4HADA 4K6CA 3A4VA 7ADHA 2FSVA 3VOSA 5IZ4A 1XA0A 2B69A 2R00A 4CLOA 3ZWXA 4E0BA 4E33A 1R4MB 3GHYA 4ZQHA 2FPPA 3ETGA 3QWIA 1HE4A 1SZJG 3QQPA 3I9KA 1HF3A 3W6UA 2Z1NA 4YCAA 3ROKA 4RPJA 5DP1A 3I9NA 4HP8A 1DB3A 1GAEO 3ZHYA 4D3DA 1JA9A 1Y6JA 4RPKA 4D42A 3UXYA 3W4JA 1MUUA 4PFJA 2RH4A 4BGVA 4CM9D 2I6TA 1EZ4A 3ETEA 1DIHA 4Q3CA 4BS9A 3I52A 1BG6A 2IEDA 4A73A 2I9PA 1Q7BA 3K31A 3PTZA 2G17A 4BO0A 3IP3A 3L9WA 3PGXA 3TZQA 4J7UA 4MVJH 3A28A 1C1XA 4E5PA 1JKFA 2Y1OA 1RPNA 3JQFC 4YJHA 5JNLA 1GPJA 1NXQA 4MINA 2AQ8A 3WLFA 3FWNA 4BNGA 3CZRA 4GSLA 5CP8A 4JK3A 2G1UA 4CPDA 3UCEA 1VJTA 3DBLB 3UFXA 4CV2A 3OJFA 4YAKA 4F6LA 1MB4A 5ER9A 5JAIA 2VYVA 3CE6A 4E2WA 1U4SA 2WWRA 1I33A 2J3IA 4HBGA 4ITUA 1V3TA 2J5RA 3ZWNA 1UXJA 1YS4A 2P9GA 1G6KA 3OBBA 4XD2A 4AJEA 4ALIA 1AXEA 2D1YA 2E6UX 1P44A 3F3SA 1GD1O 5DBGA 5GZ3A 1PGOA 4B7CA 3RC7A 3OIGA 1XU9A 4R41A 3HUDA 5TJHA 3QP9A 2YDYA 3ITKA 1NQ5A 4NK4A 4AJLA 4BQPA 4A7PA 4IIUA 5L9AA 4Z0TA 3RIHA 4QECA 2TMGA 1GFSA 3IKVA 2GGSA 4PLWA 5EJ2A 5G2OA 1PWZA 2AA3A 1HDYA 5DN9A 4FR5A 5U9CA 2XAAA 3GMDA 3ZNOA 4YACA 3TZ6A 1E1NA 2Q1TA 2V7PA 1ENZA 4WCDA 3DR3A 3QVWA 2EP7A 2ZCUA 5JAZA 1CJCA 2DBRA 4RJTA 1EDZA 1EE9A 3ROQA 3WQSB 4A0SA 2JCXA 2GUGA 3GVPA 4RPHA 1PS8A 4RLSA 4YEDA 1HDZA 3K73O 5H81A 2I76A 3E6AA 4JBHA 4QXMA 3WQRA 1NX6A 5ICSA 2VRCD 3HFGA 4EEXA 2X86A 3BTUA 3O4RA 4Z3KA 1DIBA 1NFRA 2B4QA 4FJ1A 4NJOA 4OAQA 3W8DA 1P33A 2HK8A 2GZ2A 1HYHA 5G0VA 4WEOA 4ZA2A 3WSVA 3DL2A 5LDHA 3JTMA 3KM0A 4PLFA 4JXKA 2NVBA 3H5AA 3DBHA 3K5PA 1BW9B 2BFOA 3WJ7A 4NBTA 3MWEB 3P5SA 4ALNA 3GC6A 1Y8RA 3JD1A 4B8WA 3WJAA 4CMCA 1JDJA 1NWCA 3ZWAA 4G81A 4LISA 2SCUA 1V35A 3KV3O 3FRJA 3VPXA 1JAXA 4WOJA 3UHAA 2VZ8A 4FJ2A 3TZHA 3WGTA 2X9GA 4TZTA 5HM8A 3DOJA 3ZWPA 3DZGA 2B35A 2GN4A 4CUKA 2ZQZA 4L9RA 4A27A 3I9OA 4BNYA 5BSEA 1T2EA 4R3WA 1K5HA 1WXDA 3DHYA 3KYCA 2R00C 3NGLA 4A03A 4I5FA 1E7SA 4YT8A 1PZFA 5ITWA 3RVDA 4YWJA 3CUKA 2BGKA 3GZNB 2GR9A 2VUTA 3ZV4A 2YFQA 2WTBA 4R68A 3NDIA 2C20A 2V65A 3H3JA 5TLSA 3WSWA 3C3XA 3ZNQA 4ESOA 2NNLD 1ZCJA 1JWBB 3JQAB 2JD0A 3KSZO 1X7GA 5JSFA 1XYGA 4JN6B 1K0UA 1YDWA 4GGPA 1G1AA 1FDVA 3FD8A 1J6UA 1LDEA 3ZV6A 1KYQA 1E6UA 4ZN6A 1LTHR 2O3TA 2V6MA 3JD2A 5TT0A 2XF8A 1WNTA 5DDIP 4PLTA 1PJ4A 2DAPA 3UH1A 4R9SA 4WNIA 5C37A 4BOYA 2BFPA 2JCYA 2OUIA 3IJPA 4ZVVA 5BT9A 5TS3A 4LW8A 2D2IA 3GDOA 2GSDA 5BR7A 4L73A 3EAGA 3IL2A 3S8MA 5ITVA 4M1QA 4WUVA 4CQMD 1UDBA 1ZW1A 3ZV3A 5G0SA 1TXGA 2WYVA 1B8VA 4CM8B 2BKAA 1WWKA 3GEDA 3GVIA 1H5QA 4I5EA 1U7TA 1I5RA 2PGDA 2GRAA 4Q3EA 1CYDA 2NLOA 4CMAA 1DOHA 2I99A 1T24A 1ZBQA 3DZFA 1YRLA 1O89A 4JBGA 4ZGWA 1ONNA 2EF1A 5JAMA 2NVWA 3HNPA 4XYGA 4U5QA 5JBIA 1KC3A 4LRTB 4R51A 1QMGA 2GPTA 3GHHA 4MVJP 3L6DA 2DU8A 4GLOA 3PPIA 4RQUA 1JKIA 2PD6A 4GVXA 3Q9NA 4J0FA 4CQLB 4Z6KA 1H9AA 2IODA 2PZKA 1MLDA 3Q1LA 4OOEA 4BIIA 4KDEA 1KERA 1ZFNA 1QYDA 4XQCA 4LMPA 3MTGA 3LF1A 4W4TA 5FI3A 3JQ7A 3ZCXA 4XR4A 1CF2O 1E7RA 1YB4A 4EUHA 3OIDA 1LSSA 4L0QA 1E3SA 1E5QA 2X6TA 1XELA 3KO8A 4NFHA 5L3ZA 3RBZA 5I7VA 4B4OA 3DMTA 5A4DA 1NP3A 5G4KA 5GY7A 4BGUA 3JQBC 4WCFA 1MG0A 3VC7A 1E7MA 1X0XA 2Y0CA 2H63A 2UVDA 4B3IA 3E8XA 6LDHA 5IDXA 4M86A 4IXTA 4L74A 3ZDFA 2W2LA 1GV1A 4CLEA 3MJEA 3AY7A 3IAHA 1GY8A 1V3VA 4PZDA 1KEPA 4NHEA 3ZWOA 3LDHA 3HDHA 1NR1A 2PWZA 3GGGA 1VL0A 5L7TA 4ZQBA 4XDZA 2FY8A 1CEQA 1P3DA 1YJ8A 3RWBA 4GVLA 1V8BA 1XU7A 3Q2KA 3JQ6A 2HQ1A 1PL7A 4HUJA 1HE2A 3WDSA 1AUPA 1I3LA 2C59A 1BVRA 4E32A 1DAOA 2HDHA 2I67A 1GEEA 2DTDA 3WBFA 1P74A 4Y6SA 4WLFA 3GEMA 1ENOA 2NTVA 3EGOA 3MWDB 4LSWA 5JMPA 1H94A 3QVOA 1NQAO 1DC5A 3AOEA 3TL3A 2GF2A 1HYGA 3BTSA 3OEYA 1ULSA 1PQWA 2PD3A 5JFOA 3OA2A 4CUJA 1OC4A 2NV6A 5GZ1A 2VOJA 1O6ZA 4I9HA 1YQXA 1B16A 4E13A 2JFGA 2ZK7A 1P1RA 3VTFA 3IQDB 1R4NB 1QYVA 2BGLA 3D3WB 3NT5A 2E37A 3WX0A 5HBRA 4BNZA 2CY0A 1N5DA 3ADOA 3PJEA 4XB1A 2DVMA 4WGGA 3WB9A 4BVAA 4YRAA 4XGIA 1LA2A 4CLHA 2F00A 1FF9A 5MDHA 1HDOA 4MVJE 1BSVA 2YY7A 3ZWCA 1V6AA 2VHXA 2VTEA 1YBMA 5CAEA 3PIIA 4GAEA 4QX6A 4QFCA 1EQUA 3QVSA 4J2HA 2GD1O 1F14A 2WE7A 5JDIC 2A94A 2P2SA 2HRBA 1U3TA 3TPCA 2H5LA 2ZYGA 4MKRA 1MXHA 5DOZA 3ZNNA 4RVDA 3H4VA 1GZ6A 2DBQA 2OBNA 3JYPA 1Z45A 4B3JA 2XXJA 1BWSA 5F3RA 5MGBA 3OQ6A 1IY8A 4G5HA 3UGKA 1YBAA 2A35A 4R1TA 1MC4A 3W8EA 1VKNA 1X14A 2XXBA 2FZEA 4RV9A 4MVJF 5HRUA 3A1NA 2QIOA 1DFGA 3F4BA 1J49A 1LUAA 3FF4A 4UUNA 4JCOA 4CMEC 1A4IA 4Z0HO 5I7SA 1MX3A 1QSGA 1U7HA 3DOCA 4FFOA 4IJVA 5JE8A 2XOXA 3UICA 4IIVA 1X1EA 4HV4A 3L0DA 4O5OA 4CMGA 5BSGA 2DQ4A 4OOFA 1NAHA 2EG9A 3FCOA 1EK5A 1EUDA 4IMRA 4IINA 4ZHSA 4QFDA 4ZRNA 1YH3A 5JW6A 1MGOA 1YOVA 4JROA 1C0IA 1TVEA 1SOWA 4Q3DA 4F46A 4OM8A 4JX8A 1P1KA 4WECA 3GH3A 3HN2A 1A9YA 1UXKA 5I8ZA 4CR6A 5U4QA 4EJ6A 2B36A 1U1IA 3OICA 3PHLA 4E2XA 3JQDA 4TMFA 3WGGA 3OJOA 1OI7A 3ULKA 3HQ4O 4GWKA 2Q3EA 1PJ2A 2VWPA 3RAJA 3BMOB 5CEFA 3GVHA 3FWZA 4CQMB 4NFSA 3PYLA 2NACA 3RJ5A 1WLYA 3PGJA 4KDFA 1T2CA 3NV9A 5A9RA 5DCYA 1RM4A 2Y99A 3PWKA 3EW7A 2X5JO 1XSEA 3TF5A 1Z7EA 4GI2A 4WCFC 3RC9A 2EERA 4FPXA 3SX2A 3GA0A 3H8VA 3PRJA 1Z73A 1GADO 1Z6ZA 5TIIA 3GNSA 4PG8A 3F46A 3ONEA 5BSHA 3W4KA 2X0RA 4BO5A 2VNSA 3N58A 4XQEA 4X54A 1XGKA 3RC1A 3PI7A 3GN2A 3K6JA 2IYPA 3OIFA 1BDMA 1I2ZA 4Y6PA 4XGNA 3WYCA 4EITA 1T4BA 4EI2A 2DT5A 1P1FA 4XYEA 3KEOA 3PLRA 2O7SA 4BNMA 4MP8A 1U3VA 1X7HA 2YFHA 3NKLA 1UP7A 3PHGA 1ZSYA 2CSUA 2VZ0A 4YTEA 5DF1A 4YRBA 1RJWA 5LC1A 2JD2A 3EZLA 1LI4A 2VT2A 3OH8A 3GUYA 4TKLA 3OMLA 4XX0A 5I7FA 3G79A 5AQ1A 2AEFA 1KEWA 1UH5A 2EJWA 4EDFA 3NEPX 4CLRA 2NU6A 2C54A 2VYVD 4EGFA 1GV0A 2LDBA 4MPDA 4I5GA 1ZEJA 1K6IA 2D4AA 2DPGA 1K89A 4DPMA 4RQTA 1JN0A 2IYOA 3UW3A 4MKZA 1RYDA 5CPFA 3ANLA 1E1KA 2W8ZA 2XPCA 5TT1A 1M2WA 3GDGA 1U28A 4DRYA 2JD1A 5CDGA 4XB2A 1UXIA 3A14A 3ENNA 1DRVA 3IUPA 4XZ3A 4BMNA 3CMMA 2UUPA 4UVDA 4OMUA 3BMCA 5U1PA 4RVFA 1PZGA 3OHSX 5IN4A 3RBXA 4IXWA 4PG5A 2WD7A 3UKOA 1QR6A 4QUKA 4RDIA 5ENDA 4N5MA 2VCYA 4P38A 1HL3A 5COQA 2QRKA 1V3UA 3AM5A 3VKUA 2G76A 3P7MA 5K9ZA 4J16A 5TJ9A 3PK0A 1KVUA 3I5MA 2B5WA 3GMSA 2NU7A 4CUZA 1HRDA 2FZWA 3GRPA 4J9UE 5L4LA 3IMFA 4DC0A 1WDLA 3ZW9A 1O9BA 1TT7A 2JAHA 1C1DA 2FR8A 3DZJA 3F9IA 1NTOA 2Q46A 1ORRA 4KTVE 4M89A 1QYXA 5EINA 3TQHA 1OAAA 4IDFA 4N5LA 1KOLA 4BO1A 4IJKA 2D8AA 1ZH8A 5A9SB 4JP3A 3WFIA 4OHUA 4OKIA 1K2WA 1DIRA 1QKIA 3E9NA 1ZKMA 1D1SA 4CLDA 3DAFA 1IOLA 2QRLA 3RBVA 4IZIA 4MVJG 2IXAA 1R0SA 1LSUA 2CF5A 2BI8A 1C14A 2FP4A 3IJRA 5TF4A 4BNXA 2ZYAA 2LDXA 1T4DA 3FI9A 2Y05A 3QE3A 4D3FA 1VSVA 4YBZA 5DOVA 4RVGA 4GWGA 1YE3A 3F47A 2ZIZA 1E0DA 4JLWA 4CLXA 4BKOA 2HKIA 5F5LA 2AG5A 4Q3NA 1NASA 2NSDA 4DA9A 1P9LA 2X22A 3BHJA 1ZXLA 4CL8A 4PLYA 3WOHA 4RVUA 3U3XA 1UXHA 1I24A 2DKNA 1X0VA 3NGXA 3D4OA 3EUWA 4RGBA 4D0SA 2HU2A 2A9FA 4OIMA 1F17A 4PRKA 3GR6A 4YT2A 3FNGA 3IOYA 1MA0A 4YAEA 5IN5A 4XGKA 3WWYA 4YAGA 4J49A 2B37A 4RLHA 2D5AA 3I1JA 3C7AA 2VQ3A 3IS3A 5T67A 4F3YA 1R0KA 3AWDA 4UUMA 1CWUA 1ML3A 2Q2VA 4BO4A 4PG7A 4NIMA 2GZ3A 3GFGA 4XJSA 5H82A 5JMWA 2WMDA 3UF0A 5L7WA 4MIYA 2Y67A 2PZJA 1H9BA 1NFQA 3K8ZA 3V8BA 4TRJA 4YVFA 3KEQA 1T1RA 3NTQA 1XEAA 4IY1A 4TRRA 3AUAA 4YXFA 1ADBA 3LT1A 3PQDA 3QSGA 4R1UA 1I32A 2YQ5A 1MXFA 3WTBA 3VHRA 4R54A 2HJRA 2IZ1A 1VJ0A 4L4SA 3WMXA 1BDBA 1I30A 3ZI0A 3B1FA 3JSAA 3BMNA 3MJ4A 2ZB8A 5IFLA 4CLOB 1XCBA 2X58A 3V1TC 3KTDA 3MJCA 1ADCA 5KOIA 4FFRA 1PL6A 2C7VA 2DFDA 4UUOA 4NBUA 3GF4A 1LQUA 4DWVA 3GOHA 4YA6A 1WP4A 4NBRA 2NADA 2RAFA 2ZTMA 2VYNA 1XLTA 3AY6A 3D0OA 3WWZA 2Y0EA 3KLPX 2HO5A 5F5NA 2OP0A 4UEJA 1HTBA 4D44A 1R6DA 4BNJA 4NQZA 1SB9A 3I3OA 3O9ZA 3D1LA 5DBIA 3CPSA 2P9EA 2Q2WA 3KVOA 1F8GA 3S2FA 3TFOA 1C0LA 4J43A 2O3JA 3IDSA 3KYDA 2VT3A 3TOXA 4D41A 4RORA 1NWHA 4PIVA 5JDCA 3H9QA 3DZKA 1C1XB 1LSOA 2IE0A 3ZHXA 4CMIA 4YJHB 1TT5B 3JYLA 1YQGA 4JBIA 3RROA 4JJGA 1XG5A 2VWHA 4I5DA 4IM7A 4AJNA 2QRJA 3KHUA 1BXKA 3ZW8A 1DRUA 5L95A 2HSDA 3HDQA 3BZUA 3ASVA 4NU6A 3K2BA 3PIDA 2E4AA 4BMVA 8LDHA 4BNUA 2RHRA 2O2SA 2W2LD 3GEGA 2YQ4A 1YQDA 2Y1FA 4BV8A 5JXWA 2NTJA 2AEMA 4CMBA 1JU9A 2PFGA 1PZHA 4DUPA 5JS6A 3I23A 4QO8A 1PTJA 1F0YA 3M2TA 2Y1EA 5IG2A 1P0FA 4J90A 4KMSA 4YJFB 1N2SA 1Y1PA 3GUCA 3VH3A 2ZATA 5C7OO 1YO6A 4RPLA 3EK2A 1WDMA 4AJ1A 3JQBA 4ID9A 4WE3A 2O50A 1F06A 3RFTA 5KTKA 3D4NA 4J4BA 2FR1A 3JD3A 2VZ9A 2NQTA 4GMFA 1M6WA 4YJGB 1B26A 4ND1A 3BTVA 3FTPA 4Y6RA 4RVHA 5BQFA 3WGIA 1EUZA 4CR8A 3I9MA 4TROA 1AHHA 4J1QA 4PLPA 4UEKA 4WKGA 2GDZA 2ZJ0A 4E12A 2CDCA 4PCVA 1EEHA 5CDTA 4JP2A 4DC1A 1PX0A 1A4UA 1Y5MA 2W4QA 1X15A 3VZPA 4Z3DA 4BO3A 1GEGA 4HX5A 2HK7A 1LDNA 4E5KA 3FHLA 4Y8VA 1QP8A 4S3MA 1Q0QA 4UVGA 3F4LA 5CG2A 2PD4A 1ZVMA 5COAA 3VVCA 1Y9EA 1KVQA 1ULUA 1Y9AA 2B0JA 4KOAA 4HNGA 5EPOA 4MIEA 2P9CA 4L4XA 1PJBA 3ROMA 3RUIA 1Y8RB 4MVJI 4IUYA 1Q7CA 2NUAA 2PNFA 5TX7A 6ADHA 1KVRA 2EW8A 2G82A 1D1TA 1PWXA 4MIOA 4JJFA 1XQ1A 1I2BA 3JQ8B 2HAEA 4I9UA 1ZJYA 1QLJA 2EHDA 2ZYDA 1PS0A 1YB1A 4IQ8A 5F1PA 1ZXBA 2ZB3A 1LEHA 3ZU3A 4BQRA 1RM5A 3JQGA 4TVOA 3WGYA 5CEEA 1H2HA 2W90A 5KWEA 4JGBA 4DBVO 1PR9A 1IHYA 3ETDA 1WPQA 3K30A 3E18A 3Q11A 4IMPA 4NR0A 1X1TA 3KYCB 5LDGA 5K6AA 5JPIA 4KWHA 4IGFA 1OOEA 4G65A 1NYTA 1B3RA 2YJZA 1E1MA 5L45A 3LT2A 3OETA 4GGOA 2JHGA 3F5SA 2YYYA 2Q45A 5JDIA 2GLXA 1ZEMA 3S2IA 3I6QA 1BXGB 3JQAA 3RUDA 5EESA 1NVMB 1IE3A 3RU7A 2V6BA 1E3WB 1NPDA 3LT4A 3P19A 4H7PA 3EHEA 2DTEA 2H6EA 3WFJA 2BGMA 2AXQA 5TC4A 4FJ0A 1ENYA 3W6ZA 3DTTA 1PQPA 1Q2XA 3PYXA 3RUEA 1SB8A 4AJ4A 1C0KA 3K96A 4CMEA 2ZTLA 3VZQA 4EJ0A 1PGPA 1HSOA 3KBOA 3TJRA 1F12A 3QRWA 4DL9A 2CUKA 5JDCC 5JY6A 3BTOA 4NFYA 4MP3A 3MJVA 1HXHA 1DEHA 3ZHZA 2WE8A 1HLPA 4Z9FA 4NPCA 2C7GA 3TOZA 2YV1A 1M76A 1YBVA 4E4YA 1UP6A 3ZWYA 2CMDA 3KYBA 2PLAA 4TSKA 3MOGA 1SMKA 3AI1A 4W7HA 3H6KA 4GKVA 3WMWA 1VL6A 3AFMA 1LRJA 2GZ1A 3U49A 3DXFA 5JAQA 3E9QA 3PFWO 5G0TA 4H16A 1QV6A 3H9GA 4CV1A 4DLLA 4L76A 1B14A 2CF6A 2X0JA 4FW8A 4FQ8A 5BSFA 2YZ7A 3H9EO 1M6HA 2DBVO 3JV7A 3PXXA 4DQXA 4DQVA 2HMTA 3H5NA 1OBFO 3I9JA 3OJLA 5DT9A 2F1KA 4AL4A 9LDTA 4RDHA 3VH2A 4IBOA 3WIDA 2E48A 3CZMA 3G1TA 1DXYA 1B0AA 1EFLA 4K9DA 1HLDA 4TKMA 3WXBA 4KQWA 3N74A 4D45A 1I10A 3GLQA 1S6YA 1M66A 1P31A 1J0XO 2GERA 1QORA 5ENVA 2OHXA 5C7LO 1NPYA 3JQ7B 4RZHA 3C8MA 4GL4A 3DONA 4XYMA 2FWMX 3CEAA 4LGVA 1KEVA 4S1VA 5G4KB 3HDYA 4MOWA 3DAPA 4IDEA 5DULA 5CDYA 1HE3A 3LVFO 4R16A 4WCFB 3L9XA 1Q7GA 4Q9NA 4NBWA 3NX4A 1PGQA 5CG1A 2HRZA 1WZEA 3D64A 2PGJA 2O4CA 1RWBA 1J5PA 1A72A 1DBVO 3CIFA 4KQXA 3HN7A 2IXBA 4NDNE 3HE3A 1FDTA 3WBBA 4AJPA 3SEFA 5JO0A 4IJUA 4OSOA 3GFBA 1AHIA 1Z74A 1Y8QB 2X5OA 2RHCA 1NNUA 5T8KA 2NU9A 2YV2A 3PQFA 1AXGA 1GUYA 3FPLA 4E3ZA 1T1SA 1ISJA 2FHSA 4MKXA 3SLGA 1U5AA 4FB5A 1UUFA 4Y9DA 2CVZA 3ZH2A 3G49A 5LCXA 4L75A 3NYWA 5TNXA 5ILOA 4PLZA 3ZV5A 1CRWG 3LT0A 1BGVA 1M67A 2VHZA 3ZHBA 3RUCA 1MC5A 1G0NA 4NMHA 3ONFA 4D43A 1AE1A 5JY1A 1WZIA 2HMSA 4I08A 2R2GA 3VH4A 4LCEA 5K6AC 1DC4A 3MJTA 2X8LA 5CFZA 4KTTE 2X9VA 1JWAB 1VKOA 2FPIA 5GMOA 4KUHA 3PP8A 2W2KA 1KY5A 3ONDA 2J3JA 4TRMA 3TSCA 2WEKA 4K26A 1E3EA 4FOOA 3KSDO 2NVUA 2JAPA 4DGSA 4PLGA 2I3AA 2BI7A 3AU9A 3RFXA 1OMOA 2QZZA 4RO0A 5HS6A 1O5IA 2EIHA 3VDQA 1DC6A 3M6IA 3EVNA 4DREA 3DHNA 4A26A 4HKTA 5KVVA 2EEZA 4P4NA 3NTRA 3W8FA 5JO9A 3SBOA 3DOOA 4BGEA 2BHLA 3HHPA 3RKUA 5L53A 1IYZA 2JCVA 2VRBA 3VZSA 1R15A 3Q2IA 3D5TA 4WK6A 4UVEA 3TFQA 1H93A 2Y1DA 3INRA 5A04A 4ZD6A 8ADHA 3LC1O 5T64A 3EDMA 4GSKA 5AYVA 4EZBA 2DUWA 4R5MA 1BTOA 3ADPA 3V5NA 1UDAA 2VNAA 4E5NA 1U2GA 1U3WA 1FDWA 2GN6A 4UREA 4W9NC 3RCBA 1SBYA 1PGJA 3BA1A 3TZCA 1NVTA 1LDYA 4AJIA 3QA9A 5AXBA 1WDKA 4IDCA 2Z95A 4C7JA 3B1JA 2D3TA 3CH6A 4ND3A 1KEUA 5HS4A 1BHSA 3L4SO 3M1LA 4AFNA 2P68A 5B4VA 1NVGA 3ZNPA 3U62A 1ZUD1 2FMUA 4BNIA 1E3JA 5FEUA 3VPFA 2ZB7A 2CZCA 3WGHA 3H2ZA 3KZVA 4BKQA 1EBUA 2GN9A 3U5TA 1B2LA 3C1TA 4KUEA 4XYBA 3BMOA 1PIWA 3U4HA 1DLIA 4YB8A 5J23A 3NUGA 4BMSA 1PL8A 5EQFA 1GYQA 1GZ4A 4M55A 4BKPA 2Y66A 1E92A 2E82A 1B3BA 1SOVA 3DDNA 1N7GA 2OZPA 2ZTUA 1E7WA 2A92A 4ALJA 3IC5A 2J3HA 4E6PA 2VOEA 3VVBA 4M49A 1GZ3A 3KB6A 4ND5A 2VYND 4P22A 2V6FA 4BNWA 1ENPA 2OGUA 4CQLA 1L7EA 1H6CA 4MJLA 4RZIA 4YR9A 3AUUA 1D3AA 1EVJA 5L4NA 3SJUA 1V9LA 3DB2A 2O3QA 2YHIB 4QEDA 2GCGA 2V6GA 3JQCA 5T8KC 4FS3A 3VTZA 4AICA 4GQAA 5T57A 3AM4A 4UUPA 3KETA 4E5YA 4KZPA 4IDAA 2C29D 1E77A 4JNKA 5CEJA 4U6SA 2JFFA 2ZJ1A 5EQDA 3ZU4A 3ZU5A 3B70A 1HEUA 1EUCA 4MO2A 1YKFA 3OA0A 4NH4A 2DM6A 2FOIA 3TDKA 1EK6A 3EZYA 3QY9A 5CDSA 4I9NA 3DC2A 2BLLA 1T2DA 1R37A 4OQZA 3RQSA 1YGYA 3JQ9A 4IGEA 4UAGA 3X2EA 2HMUA 4WEQA 4M8SA 3GQVA 1W73A 1EBFA 1BXZA 1NHWA 2GASA 1CDOA 4BO2A 3S2GA 5L4SA 4Z0PA 4IQGA 2PTGA 3I9LA 1H6DA 1GU7A 4J91A 5I9MA 1LLCA 1U4OA 4NNJA 3RJ9A 3HDJA 2PH3A 3GNQA 1UZNA 4FIZA 1VM6A 4FCCA 4FC7A 2G0TA 2Y1CA 2ZKLA 1UAYA 3GY0A 4BNFA 2EXXA 4K6FA 3L77A 4OXNA 4UEOA 3EYWA 2NQ8A 4BO7A 4ALLA 4J1NA 3HADA 2OXIA 4ZICA 4OKNA 3GG2A 2BF7A 3BMCB 1OZAA 3NTOA 2A4KA 4FN4A 5EERA 4BUCA 2TMDA 2VWGA 3DBRA 4PRLA 1KETA 5KVSA 4KWIA 2C5EA 1Q1NA 2WD7B 1GTMA 4FOSA 5TGDA 3QWBA 5IAAA 3RUHA 1YB5A 1LLUA 1HDXA 3QVTA 2O3RA 1FK8A 1D7OA 3O8QA 3ZWBA 1LDBA 1IPFA 4FBGA 1P45A 1Y7TA 5A02A 1CQJA 4UVHA 5HTOA 1SNYA 1N92A 3WG9A 5KNLA 1Y5RA 4BB5A 3QHAA 1UAGA 4IQ0A 4E5MA 1ISMA 1EVIA 1I2CA 3BMQB 1BRMA 1C1DB 1E1LA 1NHGA 1FJHA 1ZK0A 4J4HA 4FGSA 5FFFA 2C2YA 4J1TA 2EW2A 2Q49A 1VPDA 3OECA 4XRRA 1KC1A 3OJ0A 5KJCA 3BXXA 3F5QA 4XEHA 1DSSG 2CD9A 4YAIA 4CM7A 3AM3A 3O38A 1W0CA 3E1KA 1GQQA 2X0NA 4PLCA 1DC3A 4GBJA 3RSHA 3S1LA 2X0IA 4RVSA 3GAZA 3TRIA 1U2DA 3L6EA 4B8ZA 5KIAA 3UCXA 3DHEA 3MTJA 3NJ4A 5IF3A 4ZQEA 1N9GB 2IZ0A 4BGIA 1YL7A 3LC7O 4AVYA 1K6XA 4PVCA 2I3GA 4WNCA 4RF4A 4DPLA 1VI2A 3I4CA 2VWQA 4CM4B 5KKCA 1O0SA 1QYCA 4CR7A 2Q50A 4IS3A 5DBFA 4BO9A 1P1IA 1JTVA 5A03A 2QQ5A 2J6IA 2Q4BA 1LX6A 1VLLA 1PZEA 1LQTA 3FNFA 4IDGA 1H0KA 3ICCA 3QWAA 5ES3A 3OEWA 5B4TA 1KY4A 1NQOA 1Q0HA 1YDEA 4TZKA 1GUZA 1HZZA 3I4FA 1KIFA 3PZRA 3GZ4A 2I5PO 2GN8A 3GVXA 1PJTA 2VUSA 4IS2A 4P4LA 1P0CA 3L07A 3NT4A 2DFVA 2O2YA 1DHRA 4NJMA 5G0UA 2B5VA 4HWKA 2JJYA 3JQAD 5TRTA 5ADHA 5JYDA 2EKLA 4A2CA 1ISFA 1NQTA 2CNBA 3DEYX 3JD4A 5AOVA 4HY3A 4OO3A 3D3EA 5THQA 1Q0LA 3FBGA 1HKUA 1HT0A 4XR9A 3T7EA 3VKVA 2GYYA 4AJJA 1R4MA 3SLKA 4ROSA 4YQYA 2UV8A 3DMYA 3EMKA 5IZCA 1K6JA 1U9JA 1IZ0A 1UZMA 1E7QA 1ZSVA 3ORFA 3ZU2A 4E31A 4TVBA 1BMDA 2YDXA 3WLEA 4AJOA 1N1GA 3BMNB 4J7CA 4BNLA 4F6CA 1H2BA 5KJ1A 4N54A 4YDRA 3A06A 1WAMA 2O23A 3K2EA 4K28A 2CDBA 1WW8A 3U0BA 1R66A 1ZK3A 5AVOA 3VPHA 4B4VA 4DQUA 1A7KA 3GGOA 3AUSA 3JQ9C 2GO1A 4GX2A 1XQ6A 3PHJA 4WLNA 4OXYA 3ROPA 3CSDA 4BKUA 2X5KO 4IDBA 3SC6A 2JKVA 4QSMA 1U8XX 4XQGA 5DCWA 3AU8A 5F21A 1SEVA 1ONPA 1N8KA 3F1LA 4BNVA 3NDRA 1ZMTA 4LN1A 1MP0A 2EGHA 4IDDA 4J1SA 1T2FA 5HA5A 1OFGA 1A7AA 1N7HA 1UZLA 1VJ1A 2BD0A 4ILKA 1RM3A 1DIAA 4O59O 3M2PA 2DTXA 4W82A 2DUUA 2HLPA 4YQZA 1YWGO 3STHA 3DBLA 3KYDB 4YT5A 3H7AA 3MJSA 3WGZA 3L4BC 1QRRA 2QHXA 1TT5A 4NI5A 4GX0A 4CMIB 1ZZEA 3AW9A 1WVGA 1PJ3A 4B3HA 1DIGA 3HJAA 3L6OO 4BL5A 3RFVA 3DO5A 2HJSA 1B7GO 3H9UA 1DJQA 4BV9A 1XIVA 3AI2A 3FR8A 3QW2A 5A9TA 2DLDA 1NR7A 3EY4A 3HSKA 2QX7A 3WGQA 2UYYA 3G3EA 4R3NA 4BNNA 1HDRA 5L7YA 2EJVA 2D0IA 1DLJA 4FFPA 2IRWA 3BHIA 3KXDA 3RU9A 3MEQA 3FTNA 2E49A 3R3SA 3LLVA 4URFA 1ZK4A 1ZO8A 1IZ9A 3H9JA 3R6DA 3U4CA 2UUOA 1PJQA 2YHUA 3H2SA 4ND4A 4XWYA 4ZU3A 3T4XA 4OGWA 4J7XA 3U4DA 1DDOA 3CTMA 3LQFA 2AQKA 4YJFA 3C24A 3ANNA 1RM0A 1KS9A 4DVJA 1GPDG 4HNHA 1RKXA 3EVTA 2WDZA 4RPGA 7MDHA 2G5CA 3CINA 2W98A 3GN1A 4YJGA 2UDPA 3DWFA 3D4PA 3KUXA 3LZ6A 1QG6A 4J2OA 3C85A 4KP7A 3VAZA 5L40A 4QTZA 1IULA 2BFAA 3G0OA 2D59A 3JYOA 1LDGA 3ABIA 4XIYA 3TNLA 1ADFA 3AUTA 1JW9B 3ITDA 4Y98A 1SAYA 3GAFA 3FNHA 4LCJA 5A5EA 3ZWWA 3IKTA 1JLLA 4GX1A 1BW9A 1X13A 3MCVA 1YJQA 4PZCA 3DBHB 5IDWA 4DMLA 2BH9A 1T25A 4J0EA 5I9LA 4O63O 1HETA 3DQPA 3JYNA 1B8UA 3GK3A 4B79A 3X2FA 3BAZA 3HG7A 1R12A 4L8VA 4CMHA 3SC4A 3DAGA 1KBZA 3HB4X 3PHIA 3LK7A 4Q3AA 3JQEA 3ZN2A 1ZK1A 4ZJUA 4E2ZA 4FC6A 3V2GA 3ZZNA 3GPIA 5EN4A 4XA8A 5KVCA 3JQ8A 1LDMA 3I6IA 2D5CA 4YT4A 3PZBA 3R3JA 1QYWA 1YL5A 3WIEA 1L1FA 3V2UA 3LU1A 4FFNA 4GKBA 3ASUA 3JQGB 2B83A 3LSYA 3GZNA 1MFPA 4LVUA 4WJZA 5IZCC 3VH1A 5JCXA 1EE2A 1GDHA 4O1MA 1I0ZA 1PQUA 1PJCA 4PZEA 4W99A 3UOGA 4PLVA 2X9NA 4IJWA 4Q39A 5JCJD 5B37A 1LC3A 3GG9A 3GGPA 1TI7A 2NU8A 1ISGA 1I3KA 4E2YA 4NG5A 3D5QA 3VPGA 3RI3A 5IXYA 1BXGA 1R0LA 4L4RA 2RCYA 1CERA 3I83A 1ZMOA 4R1SA 3G1UA 1HDGO 3WGOA 5I9NA 1AGNA 1E3WA 1GQYA 4QT0A 3V1YA 1KVTA 4OSPA 4CV0A 1LRLA 5KJFA 2WYWA 5A05A 2Q99A 4WLVA 4G2NA 2C2XA 4R69A 4Z9YA 4BNHA 4M54A 4OQYA 3B20A 2O48X 4AJHA 3Q3CA 4HXYA 1GR0A 4BHTA 4O0LA 4CM8A 3LF2A 3UN1A 2EKQA 3QV1A 3Q9UA 4R9RA 5T5QA 5C7IO 1DPGA 4BB6A 1K3TA 4PLHA 2PKRA 4NBVA 1XDWA 4RL6A 2Q1SA 3JYQA 3GT0A 3PDUA 5G4LA 3PVZA 1PSDA 1MFZA 2J5QA 2QYTA 4W9NA 4EBFA 4P4GA 5T6BA 4DBZA 5C5IA 2Z1MA 2ZB4A 2B4RO 1SC6A 2FR0A 3AJRA 2DPHA 2AQIA 1B15A 3VZRA 4U6QA 1DJNA 1ONOA 3R1IA 4B4UA 4CM9A 1BVUA 2AG8A 3INTA 3FR7A 4BNTA 3C7DB 2C82A 5FYDA 4FFLA 4HFNA 4D46A 4E30A 3E9MA 1SCUA 2PKQO 2Q1UA 2OMEA 2I65A 2VHVA 3PJDA
chains in the Genus database with same CATH superfamily
1NDUA 1YRBA 2PLFA 4D9FA 1O95A 2IOHA 1W4AA 3NVKI 3SX4A 3FDZA 2DBZA 1DADA 3FYUA 2NUTB 1IBCA 1MRSA 2XRZA 4K9RA 2FUEA 4C0QC 4KJXA 5D3MA 1TVKB 4B4WA 4BTVA 3JTEA 3KLNA 1XAGA 4LVCA 1D4OA 1L6RA 1KEKA 1CEYA 2AG1A 4OYRA 4XKJA 2AK2A 1A27A 3U4QA 4TMWA 2WKRA 3EQ2A 3VNUA 2PRSA 1YZHA 3QE9Y 4I55A 1YFLA 4BVFA 4DQKA 1BO6A 1A96A 4AYTA 3RHTA 2Z30A 4KI0A 5C5CA 4RUKA 1P5ZB 5EXEA 5DSZA 1JIQA 1U8FO 3JCZA 5ICFA 1OZ0A 1XRQA 3AFIA 3MJHA 1Y8CA 4JQCA 4BNKA 1QLHA 1DKMA 1PWYE 2VCEA 1L5LA 2QZ9A 3WNQA 4H7FA 3PFGA 4O4JF 5EZYA 4YUZA 1I3NA 4FSHA 3DL7A 3G5MA 1BGWA 1T8YA 1JRLA 1ORHA 2ID9A 4EKDA 4UARA 3RYFA 3WB0A 4OQEA 1GQOA 3NHYA 1EZZA 4RSGA 5A06A 2X3YA 1QHEA 3L18A 4YCJA 3N0WA 2QORA 4M4SA 2YINC 1EJ2A 1ZMXA 3OIYA 1J8YF 2VN8A 2VDUE 3C6BA 3KLBA 4KMMA 5E7JA 3WYDA 5M5BA 4MROA 5LOVF 3GLGA 5DHRA 4UTOA 4DDTA 5HKAA 1UC8A 3TLGA 1M0SA 4FFBA 3BHNA 2CJPA 1CUUA 3TR6A 2V5AA 2WD8A 1NBAA 2JFUA 3MCUA 2GFIA 4TLBA 5DHUA 3DV9A 5EL0A 5I5GA 3RUFA 4LJSA 1S2IA 5JC8A 1RYEA 2AD1A 3B78A 4MWDA 2DPMA 3MG9A 5H9VA 2RI6A 4CF6A 2HK9A 1LLDA 1TUGA 3Q6IA 4JBLA 1OB5A 3L8EA 2GWRA 3JVEA 4MQ6A 5CHYA 1XBTA 4KBFA 1AC5A 2WFLA 3HXLA 5AXDA 3ZJTA 2W42A 4C7KA 5EAIA 3NZEA 1QZUA 2YWEA 1RQ7A 3HUTA 4ND7A 3ZUPA 4F3TA 2PZFA 1RWQA 4BDSA 2VJMA 2QG9A 4TMTA 4DPKA 4IZHA 4A10A 1DUSA 3TVTA 1R4NA 4AG3A 3PFFA 2SICE 5AUOB 3C16C 4K86A 3WICA 4D79A 5LB2A 1SPXA 2AX4A 5JZBA 1JVSA 4GH5A 4E21A 5H16A 2IEBA 4HAXA 4F3CA 3D7RA 2XWQA 2OCGA 2DJ5A 1RD4A 3S2EA 1KSFX 4GPD1 3IQIX 4KNYA 4L7VA 4ZQGA 1FDOA 3NT2A 2UAGA 1ISRA 3A9TA 1P4JA 3BQ9A 3WKAA 4EO9A 1U0HC 3ANSA 4QO7A 3ZE7A 1EX6A 2ZI6A 3CU5A 3DNFA 1NI4A 4HI0E 3G0BA 4A23A 3QBVA 2IX3A 2PK3A 1UDWA 1QC5A 1RAFA 1LGYA 4QUEA 2JLQA 2CYAA 3K05A 3W4IA 4UHJA 4KV7A 3FOZA 4LYDA 5ALGA 1FMJA 5EA2A 4O6VA 2AMVA 1T36A 3VYRB 2QZJA 1ZUWA 3L7LA 3IHWA 5IAGA 2QD4A 2PSFA 3TIVA 4JAVC 1QGOA 1UBGA 2P6NA 1J25A 1V7PC 5AKIA 3K8OE 4Z7JA 1DFIA 2FRDA 3AF0A 1LRKA 1EMDA 3C4VA 1P9RA 3FPKA 3HKEA 1RABA 1K7FB 1T4GA 3JQQA 1TCVA 5A3JA 4Q1BA 4DIOA 1CIVA 2R6CA 2RH8A 3ZGYA 4I4TA 1A5ZA 1H2FA 2DUNA 2OK7A 1AZWA 1E2PA 4FEEA 2WSBA 1Y63A 2ZVDA 5F73A 1WDWB 4TX1A 4TQGA 1MPTA 4FGWA 4Q1FA 4F38A 1TTTA 2I7DA 4R01A 2ZUTA 1FXUA 1QHYA 2H1LA 2BFMA 5F1KA 3ZU6A 2P5YA 3IUEA 3S1SA 3IV6A 3BE8A 1UK9A 2NO0A 3IUJA 3OG9A 4LHWA 4FGJA 4WFQA 1H5NA 3OBIA 3TZKA 1XF9A 3A4LA 4O4IF 1N77A 4PM4A 5I4KA 1CUAA 2AW5A 2C2BA 1EFTA 1NP7A 2QMUA 2PQ6A 3NNDA 4MJ7A 1W36B 1T6NA 1N25A 4GOKA 5KKAA 5E6RB 2FRXA 4OXRA 3ESYA 4XWAA 4XCQA 4IIFA 3BYZA 2B0CA 3W1VA 3PS9A 1XKTA 4HT3B 3BJMA 1CUYA 3SDSA 5CTAA 3ANYB 2CFTA 1DPFA 1OVMA 3BGVA 3IAS1 2OQVA 2HEIA 3ZE0B 4ZIRB 2ZWPA 1TKCA 2C77A 4JYCA 5JD5A 4P3OA 1CETA 3IIMA 4BJ6A 4CGZA 1PE0A 2O3SA 3ILYA 4BMPB 4ZMBA 3TQQA 2WPDA 2CLKB 4GQIA 4Y2SA 1D0IA 1TJYA 2ZYRA 5KVQA 4PRYA 1LZLA 2CZGA 5EOVA 4CVNA 2I4RA 4O5AA 2YTZA 4WY2A 1YUBA 3TLAA 4MHSA 5JNVA 4HDKB 5TSDA 4UOEA 4J4TA 3PX7A 4A8TA 4MI3A 1TM5E 1VCMA 2RGNA 3WL4A 4ER0A 4M76B 4WOKA 1WLSA 2RIRA 4ZI7F 1DFHA 1QCCA 1ZD1A 3QBJA 4OHCA 4TM7A 2A9RA 5AP9A 3QUQA 5AXAA 1LU9A 2QN9A 4QQKA 5BP7A 2BV3A 1FSSA 1SBHA 4R8VA 5CHEA 3K9QO 4BQFA 2QPTA 4RGQA 4NY1A 3WYNA 1Z62A 1TADA 1ZVVA 2QG4A 1ST3A 1IOWA 2QTVB 3QXJA 4TV8A 4PCUA 2B4TO 4Y18A 5B3JA 2XYRA 2ET6A 2IL1A 1ZUIA 3DKRA 3S55A 2VK4A 3ZK7A 4PSKA 1SBQA 1Z7BA 2OBYA 2VHQA 1FJXA 3EGCA 2QW8A 5JYCA 2REBA 3QMWA 2QDKA 3RAGA 3TWOA 3RS2A 1U2TA 1Y3AA 2F3PA 3EOBI 3MAJA 1PK8A 4HYQA 5SZHB 3FVWA 4PN3A 4DMMA 4F56A 1UBJS 5EXDA 4JDPA 1W4RA 1GUFA 2VUUA 3C3CA 2IYZA 1ZH6A 2XADA 3THXA 1IN7A 1VRWA 1A1VA 2Z5LA 4J3FA 1S4QA 1UBUS 4ML3A 4Y9UA 3PL5A 4D0RA 3F97A 2K5UA 2CFCA 2ACKA 4KACA 5GZ6A 2FK8A 5HF6A 1HWYA 4ZZ0A 2OD7A 2QLTA 3NVAA 1L7QA 3AOGA 3V97A 4W5WA 5CDUA 5KOYA 2FQXA 2ACWA 4GXRA 1JQBA 3IUSA 1CZNA 2DWQA 4FWIB 4HMQA 4NZZA 5GV7A 4CNBA 4Z53A 3J7AC 1OILA 3KZCA 1MJFA 2P4SA 2ZSFA 2FMFA 2R6R1 4JL6A 4ZV7A 1DO2A 4GLBA 3FSRA 3BL6A 3IULA 2J3DA 3RLFA 3W1WA 5MF6A 3L7DA 1P2SA 3ZR4B 1S7GA 4XX0B 1YCGA 4DTIA 1YMVA 1Q0TA 4QSHA 5IJ9B 1LZKA 2V6JA 1TZJA 3MFYA 3PTLA 3R2JA 3OX4A 4MQUA 1XC7A 3PUKA 2Q4EA 1NG1A 3C97A 4YCCA 1MV8A 3CF0A 4ZTBA 4I8XA 1YU6A 5EC8A 1ZM9A 2XUDA 1U2RA 4Q9JA 4B3TB 4ND2A 3T0GA 1K63A 2ZRCA 4N5NA 5KU7A 2MYPA 1LPAB 1HT2E 5AHKA 4D8UA 2OCIA 4MUGA 4P08A 4DARA 1TIPA 2IYUA 3PDJA 1CKEA 1E3IA 1JEDA 2W8BB 2OL4A 4PTLA 3DFUA 3WLPA 3A2KA 1RJ9A 5FYQA 3A6JA 2NSLA 4RK4A 1X70A 3WK8A 1QVRA 5JAHA 3CMCO 3DF9A 3B8EA 1V8PA 3RKRA 3LQ1A 4CKZA 1L5OA 2BEWB 4OL9A 3WGUA 1GRNA 1TLLA 2JCBA 3ABSB 5DTQA 1LBEA 1LTKA 5AKKA 4CMJA 3U09A 2JVKA 2YCBA 4KQ6A 4Q47A 1XHLA 1XR3A 4H7EA 1XF1A 1L0BA 4CM5A 5CA1A 3DDSA 4MV9A 3UK0A 1JQ5A 2ZRAA 3MOIA 4KR7A 5A5DA 3LUBA 4JMLA 3RS7A 3VDRA 4EIWA 3BIOA 1Y98A 2QMYA 7AT1A 2PZLA 3L6UA 1R10A 2JVJA 1E2LA 1QBKC 4O1IA 3VR3A 4JB2A 3TQCA 3G2HA 1GZ5A 4BZQA 3G82C 1SULA 5KYGA 1IZZA 3ICWA 5GONA 2JLXA 1CJTC 1PUJA 2OCAA 1KJZA 5AWFC 4YJ3F 1N6IA 5A1TA 1PS9A 2CN1A 1ECPA 4D5EA 3UJPA 1P1CA 3LC2O 5DP2A 3QKSA 2X1MA 1TA9A 2NO7A 1J06A 5I4CA 3STYA 3A2NA 3HZZA 1EVQA 2IVFA 1GJRA 3OVMA 3TUIC 2CXOA 2Z2ZA 4B48A 2OOSA 1CQJB 1MD9A 1QIJA 3HY3A 1VYHA 5LQUA 2G1PA 4GRAA 5CBKA 2C3YA 1M6YA 3IMKA 4Y6QA 5FTWA 3L6RA 3P5BA 3KCNA 2BN4A 2C4WA 5BW6B 5KTTA 1I6LA 3NRCA 1CXZA 1L4UA 3H5RA 1QFZA 1P1JA 2XGGA 3NHSA 4BO8A 2XMCA 4OH1A 4BECA 4KVZA 3ZC3A 4NEGA 4YR7A 2W2OA 3EAFA 1A9ZA 3QBEA 4NV1A 1NE2A 2R87A 3Q12A 5AI8A 2EV9A 1NLFA 2HA4A 4MP6A 1EFPA 4PAMA 5D1HA 3LQKA 3I01M 2OMKA 5GIOE 3CGGA 3E2PA 1I3CA 2J1LA 5HZGA 1OY1A 1WBBA 3FSEA 5TARA 8AT1A 2G36A 4IGAA 4HDCA 1HZJA 2QZSA 3WIVA 1ETHA 5EZSA 3WRVA 2ZT6A 3COVA 3GGSA 2OBBA 3PKIA 4WLEA 1DIOB 1OJLA 1RAGA 3FVVA 4XIJA 1MHPA 2RK6A 4ZOCA 4N0QA 4WGFA 3HBAA 3SC2A 2YY5A 1MZPA 1VBKA 2A58A 4MZDA 1EA5A 1Z34A 3QU4A 3GPDG 1DTSA 4CM3A 1ZCFA 3HR4A 2DKOA 5JZSA 1I2AA 2HU8A 4WXMA 4AK9A 4XVHA 1OH6A 4J3NA 1B0ZA 1JDZA 4HAWA 2FTKE 3OOEA 2IDZA 4EJMA 3O93A 1NM5A 2QMOA 4L27A 1HORA 3TM4A 2Q0SA 1GPNA 4JLOA 3I05A 4C7BA 2BISA 2OO5A 3A4NA 4DLSA 3E5MA 2P4HX 1EFVA 1KL7A 4CGYA 1ZVQA 4TVSA 1PKXA 1SXGA 2XLCA 1VPEA 4JLJA 5ETJA 3R5TA 3HJFA 1TKRA 5CCXA 1CUCA 1VKZA 3EASA 5E3IA 2BP7B 2BEKA 3P4XA 3H1EA 5E2BA 3TLKA 3EXIA 3EXFB 1P0PA 3OLXA 2P9HA 3IDQA 1EWKA 1Z63A 3H1PA 4DDWA 1L4KA 2XE4A 1AUQA 3FNEA 3HCDA 4FIDA 4DMGA 1BHO1 4K05A 3BXOA 3TB4A 1IJEA 3DTYA 4Y1RA 4KR9A 5HWSA 3WQQA 2EFEB 4D6YA 1T6ZA 1S2MA 3BE5A 3R5KA 4BO6A 4TYWA 2XGMA 4US2R 2W37A 3Q87B 4HADA 3TH5A 3A4VA 4OAPA 3R5XA 3FDIA 4HUTA 3VOSA 2EQAA 4HWSA 2CMGA 1XA0A 1G9TA 2HA5A 4UM5A 2C3PA 3ZWXA 4E0BA 2X2FA 1VHWA 4UUBA 2GILA 4M8KA 5F7ZA 1YMUA 3QQPA 4WN9B 4US1R 4BN5A 3BERA 3I9KA 4EZIA 4L5BA 4TXJA 1QKKA 4H7DA 3W6UA 3B1VA 5EYPA 4AKEA 3KKQA 3ZCTA 4K40A 4K0KB 1CX9B 3LRTA 3AYZB 5DP1A 3AHFA 3S29A 5AVUA 3I9NA 4HP8A 1DB3A 3WBJA 5JJ5A 4MMXB 4D3DA 2DUMA 5T6MA 4BE7B 3I2JA 4YV1A 4AX8A 1MDBA 3W4JA 2WICA 2CFSA 4AMGA 4BGVA 1Q1ZA 2I6TA 3P2EA 1DIHA 5AHRA 5LB4A 1J8DA 5BXQC 1T6XA 4B4KA 3WHIA 1YUNA 4IO0A 3VHXA 1OE0A 1U8YA 2RHDA 3K31A 4GI1A 5DI3A 3OPVA 3LW7A 4BO0A 1OT3A 1SURA 2MR5A 3L9WA 3PGXA 1NUAA 1U2QA 4J7UA 4MVJH 5HKLA 2D74A 4GOOD 2Y1OA 3TRDA 1T4MA 3JQFC 2YXEA 4D3XA 3BWVA 5BN4B 2AQ8A 4HAIA 2IIQA 4TTSA 2RI1A 3WLFA 5KINB 3CZRA 3CH5A 3IBGA 5CP8A 3B6MA 3LC0A 2G1UA 4JK3A 3O1LA 1ZAKA 1ZW6A 1QIGA 4UM7A 4AY6A 4JYZA 1F4VA 2NYRA 2ZRJA 5K3FA 1NOIA 2FPKA 3OJCA 5ER9A 3ACCA 5AKZA 5JAIA 3CE6A 2A1UB 4E2WA 2HK6A 4YI5A 1I33A 3MT8A 4RA9B 4IXNA 1W88B 2IE8A 4ITUA 3VO9A 3K53A 4EA8A 3ZWNA 3QIAA 1EX1A 4JYMA 1G6KA 3AJAA 4B31A 1Z0SA 1N1MA 2NPIA 4DNXA 2D1YA 2VHTA 1GD1O 4MZXA 4O08A 3OTQA 5TGTA 3WKBA 1BVYF 1JYEA 3RC7A 3U7EB 2IPMA 3RRJA 4R41A 4TLLB 3HUDA 3FGZA 4JLPA 3SBXA 4GP9A 2P67A 3N8GA 4DJEC 4BQPA 5B3AA 1R6XA 1XZPA 3EFBA 1RWOA 3IODA 4IIUA 5J5VA 4HYEA 4Z0TA 1ZBDA 3RIHA 2TMGA 5LYJF 2B1GA 3V4VB 4N76A 1IY9A 1KK0A 1PWZA 1TMKA 2AA3A 3GLGE 4DLVA 1NXOA 3GMDA 4KXQA 1N9KA 1KMCA 2Q1TA 2V7PA 3TZ6A 4WCDA 4CE6A 2ZRMA 3H86A 1OKKA 3A3OA 3QVWA 3TBKA 1I4DD 1K6EA 1RYYA 2H92A 3FSGA 3LHDA 4YP6A 4N65A 5AI4A 1Z8DA 2QUKA 3JQPA 3ROQA 1PT6A 1I5OA 4JITA 4FHFA 4UBOA 1BOOA 2CLEB 3HRIA 2UXCB 1FLDA 4P5DA 5ED4A 4RPHA 2H0QA 3AKDA 1PS8A 4RLSA 4ETMA 4Q18A 3T3NA 2GT1A 5FHRA 2J0VA 3ADBA 2BFNA 2IITA 3K73O 1M1UA 2I76A 3E6AA 1KKLA 2HA0A 2R79A 3D6UA 3EIWA 3NU1A 2WQZA 4AWBA 1ZONA 1NX6A 1Z06A 2ZIEA 3HFGA 4N12A 3SXUB 2OPBA 2EKBA 5IH3A 3BTUA 2GXUA 4JJ8A 3QH4A 1TIKA 1C2TA 1NFRA 4FJ1A 4NJOA 1Y6FA 4CQJA 4IGKA 2A5YB 4JB3A 1JYFA 3UV6A 2XWBF 2CE7A 4O8CA 3K9HA 4D97A 2XQGA 5DGHA 2XZPA 2JFBA 3TW4A 5LDHA 3WSVA 4X91A 1P17A 3OPQA 3CH4B 4TTVA 1Y5IA 3DBHA 1G3QA 2FE4A 3I64A 1UEIA 3NNNA 3GRYA 4NBTA 3HSYA 4NMMA 2X0EA 1QIHA 3HJCA 4D4LA 3P5SA 2ES4A 1Y8RA 2ECOA 3RF7A 1E1RA 4Y2RA 5CR9A 1M1ZA 3OOJA 4DV1B 2SCUA 4KVAA 3ZKWA 4TTPA 5B1EA 3F6BX 3AW8A 1I13A 4QDKA 5SZKB 3CLUC 2ZE6A 3JATB 1PL0A 2H07A 4V1CB 4EHIA 4NPHA 4OXXA 5DHFA 3IUMA 4K9LA 3DZGA 5FTKA 3ZWPA 2NUPA 2B35A 1PW7A 3CN9A 2IOQA 2C98A 4JU8A 3BEOA 3IOCA 2YHSA 1YE5A 3HBJA 4LZNA 4R3UC 3O95A 4BNYA 4C7MA 1T2EA 3HLTA 4R3WA 2OXFA 3DHYA 3NGLA 3FZNA 4I5FA 3TLBA 5A2GA 4GL2A 3GT3A 4INPA 5FNVF 1K8YB 2OBMA 1O1YA 2ZBDA 3PNSA 3RVDA 5ITWA 3L7JA 4MRNA 2PXAA 4KNWA 3VPCA 1MBZA 1ORWA 5B30A 1FFXB 1MVLA 1XTUA 1Q95A 2EJBA 3QX7A 4O29A 3DGFC 2VUTA 3DP9A 3V1KA 1RLUA 1ZD5A 9MHTA 5DB4A 3U61B 4AZVA 1X77A 4D5GA 1SKUA 3AP3A 1YJBA 2D1SA 2NNLD 3PICA 4RE5A 3JQAB 3H5WA 3UK1A 2A9JA 2XYGA 4JN6B 1JU4A 4I1VA 1K0UA 3VHLB 1FDVA 1CP2A 2X77A 3C87A 4QTUB 3N5KA 2OC4A 4YDSA 1AGRA 5CYGA 1KYQA 5K01A 3S2UA 3DCIA 1D2AA 2V6MA 4KAJA 1Q3TA 4PX2A 5JG7A 4JCCA 4N7MA 3LK6A 2WIGA 5DN6A 1TLFA 1YK1A 4PLTA 1PJ4A 5IT5A 2WBLC 3IO5A 1E9AA 2O2DA 3G0CA 1QZXA 4PINA 1G1MA 2VTBA 4M99A 4RKQA 2OUIA 4UD2A 5F78A 2VQSA 3P26A 1ZCBA 5EHGA 5DLQC 1QUEA 3QPVA 2D2IA 3W3AA 1OJ7A 2VRWA 1KJWA 1WS6A 2G5TA 3KU1A 1H23A 3GRRA 1NQWA 4GM1A 4KNVA 2D54A 1JLMA 4M1QA 1FXWF 3N6XA 2HH9A 4R2IA 4CQMD 2P9QA 4U02A 2WABA 5JVDB 3SIRA 2BKAA 2LTAA 4JC4A 3ZQJA 4QXRA 5K7SA 1JIJA 3H8JA 3KJHA 1NF9A 3G1WA 3OJXA 4QYTA 5DEIA 5EIHA 1LW7A 1PN3A 1U7TA 2JGEA 3WAJA 1BVHA 1L7OA 2BUBA 2R85A 4I8IA 1HK7A 4D4MA 2CK3A 1CYDA 2VNIA 3TZLA 3O91A 3Q41A 4UPDA 4NZYA 3WLMA 4DBLC 4LZZA 1Q1EA 3DZFA 1ZBQA 2NSYA 1YRLA 4ZGWA 5HX7A 3NC1C 1H1LB 4LDZA 3HNPA 4HH0A 3RSQA 3WMRA 1KC3A 2RCNA 2OZKA 4LRTB 4MVJP 2AK3A 3GHHA 4RPCA 5ALNA 5AOBA 2XR1A 3EEQA 4GLOA 3DDCA 4D6XA 1JKIA 2PD6A 1L5WA 1F38A 1SCUB 2H9AA 1DBQA 1QJ4A 2FETA 2OZLA 2WILA 3GJZA 3KELA 4DCOA 4TV9B 3OHMA 4WESB 3IOMA 1UC5B 5FWXA 4Z6KA 5F23A 1H9AA 2FRVA 1EWQA 1MLDA 4XJXA 5C80A 3X1WA 1U7ZA 3B1XA 1W30A 2C04A 1R00A 1E0JA 1L7RA 3T7JA 4BB9A 1H5UA 4ZAGA 3WGMA 5FXMA 2NPOA 3FFAA 5AI0A 3MTGA 5J63A 3RVKA 5JCPA 2GX6A 2OO3A 3ZCXA 1GKKA 3BWEA 5FLEX 4P84A 3ETJA 1OH7A 1E3SA 2AI1A 2X6TA 5C9ZA 4PO8A 3UAXA 2Q29A 5I7VA 5HNKA 5CBPB 3LZCA 2B4YA 3JQBC 4BGUA 1O6FA 3LT5A 4ROTA 5ERGB 2WHXA 2HWYA 2PU5A 3T6KA 4B3IA 2E9SA 4OGGA 1E4EB 1B4DA 2KYRA 4YUXA 1XJQA 4IXTA 4YAOA 2C5GA 2W2LA 4NENA 3E3NA 1L5QA 1LLFA 1O0BA 1SUWA 4KQGA 2L19A 4H59A 4ASUA 1OAKA 2H31A 1NR1A 2OHVA 3DLPX 3GLIB 1X9HA 3OQVA 1M5TA 2NV2B 1X8XA 2FY8A 2WHPA 1Q7TA 4XDZA 3JWJA 4GVLA 1XU7A 3Q2KA 3RWBA 4DCUA 2HQ1A 4IEIA 3WDSA 3DLAA 4ZTZB 4K03A 1I3LA 4NZPA 2V7GA 5DO9A 2I67A 3P20A 1JQKA 2DTDA 3WBFA 3TMYA 2QM7A 2ZJ6A 1S2OA 1GITA 2XW6A 4QTTB 4WLFA 2WY2D 4RTOA 3E3MA 2CGEA 5CT6A 1Z0DA 1EHIA 1Y7HA 2XDAA 3E4DA 3TPZA 1I7LA 2VJDA 3B48A 3MWDB 1ABEA 1FNSA 4LSWA 4UASA 1ILEA 2RB4A 3MUFA 1F3OA 3WC4A 3BTSA 5JR3A 4P54A 4R8SA 3UMSA 4KDCA 1ULSA 1H4SA 4BFSA 5JFOA 4JLVA 2AOWA 5GZ1A 3WP0A 4PY2A 1O6ZA 3LKDA 1BHJA 3NEYA 4I9HA 4D4JA 4X93A 2Z3WA 5CFOA 3IQDB 3A4MA 3NT5A 3WX0A 3AGPA 1UMBA 1XI2A 2E37A 2VJLA 4IMIB 1N5DA 2XHZA 5LQMA 4FMBB 3KT3A 4XB1A 2DVMA 2UZ4A 1IUOA 3WB9A 1E9VA 2ZBUA 4BVAA 5E95A 5LWQA 5KVAA 3OT1A 5K0SA 2J3QA 4AECA 2NO6A 3H5OA 1XTZA 2F00A 4NABA 3RAPR 1GAQA 4AI6A 1AB5A 2OLEA 2D06A 4HRXA 2YY7A 2PUGA 1DTWB 3OQPA 3OJWA 5BQPA 2X2PA 1A8QA 2VTEA 4CI9A 1YBMA 5AR1A 5CAEA 2G4CA 3AKEA 3PHCA 5H3CA 5BRAA 2V55B 4QFCA 1GAWA 2GHQA 5CT5A 3R8CA 3QVSA 4CTOA 2MINB 1WQ3A 1BROA 5CCDA 4A6DA 3W2EA 1PT9A 1TPZA 1R9NA 1DKRA 2A94A 3LAWA 2H5LA 1UBFA 2BR4A 2H5EA 2ZYGA 3B9RA 1F5NA 2JI6A 1MXHA 3OI7A 1XNQB 3AVXA 1PEYA 1UMKA 4QATA 1VMIA 1XZCA 2CUNA 3VU8A 5ITZB 4B2IA 2OBNA 3R76A 4RAQA 5HM6A 1Z45A 4B3JA 4RWEA 1BWSA 1KBOA 5F3RA 3OQ6A 4OFZA 4HGOA 3D3QA 2B8JA 1IY8A 3NHPA 3HB9A 4F4HA 1FX0B 4G5HA 3TTVA 3CRMA 2VZLA 2A35A 1RMQA 2LKCA 2X2OA 1G7SA 4KW7A 4TMKA 4RV9A 4PAGA 2ZROA 4MVJF 4S2EA 4BVKA 4HVCA 5HRUA 1U0OC 4CFSA 1DFGA 1U2ZA 3D3JA 4BN4A 4C0XA 3FF4A 1EB8A 3F5MA 3WGJA 2ZRLA 1A4IA 1VJ5A 3E8SA 3WAKA 3VHQA 3ZCRA 4Z0HO 2WUWE 4BNDB 3DOCA 4IJVA 1K7SN 1CRQA 1VYVA 4V0NA 1IPHA 1JEYA 4IIVA 1WD7A 4BMYA 5BSGA 3QVGB 5G41A 1TQ6A 1ZUHA 2EG9A 1EESA 9GPBA 5KSWB 2GB4A 4IMRA 3HCAA 2OV1A 3PBKA 2IF2A 4AY3A 1EXVA 1IUPA 4UNIA 1YH3A 1QG4A 2Z5GA 1I4TD 3IAUA 3NIWA 4MYRA 2A5JA 2ONCA 3AP1A 3EA5A 1YOVA 4GWLA 4HN9A 4GBED 1NUQA 4MLZA 4GO1A 4GSYA 2I29A 1TVEA 4B83A 1SOWA 4Q3DA 1Y7IA 4OM8A 3JAMA 1E9SA 2ZE5A 2O1EA 3CLKA 3FLEA 4YJ2B 3KLOA 1D2HA 1MRNA 2B1IA 3FM9A 3NGMA 4H7KA 4HSEA 1IQPA 2ISCA 2P6OA 5I8ZA 1THZA 4EJ6A 4Z7OB 4CKWB 1HPLA 3KPUA 3PHLA 5HILA 3P96A 4CTJA 1AQLA 1VIVA 2NZVG 5EJEA 4GPTA 3I0NA 1J2TA 1U11A 2JIOA 4DLWA 2WIAA 3NPAA 3O5AA 3T9DA 3M89A 2QAIA 5FBKA 3FY4A 4ZGBA 1HDEA 4EX6A 2OGZA 1CW2B 4EF6A 3FWZA 2G1AA 1WO8A 4U3JA 4GMKA 1WLYA 5AJHA 1IUNA 4AZ3A 3FZGA 2HJ9A 3CW2A 1XJCA 1AO3A 1XNGA 3EY9A 1CJVC 3EW7A 3MTIA 2HJVA 3NDPA 4IRMA 4NJEA 5JQGB 2Q8NA 1PVOA 2JW5A 2ORYA 4J7AA 3RS3A 2EERA 4FPXA 4M38A 4NFLA 3HB0A 3VZDA 5C51B 2BHRA 1A88A 3ORSA 1V2GA 4PSDA 3FHJA 2YBEA 2QBYA 4PG8A 5FR1A 4U63A 3F46A 1VOTA 1O54A 1K2VN 1C9YA 1GNRA 2PS1A 4HWRA 3BAFA 3C45A 5BSHA 4K9QA 4ZC1A 4HZUB 2Y4NA 2X0RA 4JI4B 1GNTA 2VNSA 1X7ZA 2C3MA 4G56A 4ZEXA 1XGKA 3B38A 3GN2A 4ZT2A 3PNYA 3EZNA 4AY2A 2E7ZA 1RQGA 3AM1A 2IYPA 2FX3A 4X8OA 4DV7B 1BS9A 1BDMA 1AUVA 4NARA 4Y6PA 1LX7A 4XGNA 4ZV9A 1HT3A 4B5KA 3A1SA 1JI3A 1SXPA 1KEZA 2AFHB 4G89A 5IH7A 3O8BA 3LBNA 4MX8A 4ZJYA 1NP6A 3ZDXB 3NMUF 2ZYUX 3CVUA 3EQZA 2Q28A 4Z2YA 1U3VA 1X7HA 1Z6XA 2JJ8A 1PV4A 2ERCA 3I62A 1U1EA 3UO8B 1QHHA 4CKEB 3QEAZ 1RJWA 2XZTA 3U44A 2JD2A 4QGSA 2CT8A 3EZLA 2JFYA 2VT2A 2ZE7A 4IVPA 2EFYA 1JDBB 3X0DA 3ECSA 3OWXA 2JRCA 4I4LA 3NTUA 4KO8A 1FYFA 1TCBA 3RK1A 5FL7A 4B5LA 3IAM6 4QA9A 4L8LA 5AQ1A 1DAKA 4D98A 2EJWA 2GF0A 4CLRA 3NEPX 3WGNA 3ZY2A 3H83A 3SMVA 2PE5A 3AL0C 1G21B 4MPDA 4JJZA 4NCBA 5DCLA 2Q07A 2BDTA 4KO3S 1K89A 3PDCA 3VPBA 3EIHA 2BTQB 4RQTA 4ZXPA 1JN0A 3SJBA 4OP2A 5EP4A 4JYBA 2TSYB 3AR5A 3O8NA 1E1KA 1FP2A 1LD3A 2W8ZA 3Q8WA 4PBTA 3VTKA 3GDGA 1U28A 1ZD9A 4AF8A 1TAUA 2HBRA 2IEZA 3IIKA 1NVEA 3ML1A 4OGFA 1XVTA 3WK4A 4F1KA 4OVKA 4XB2A 1GKLA 5FOTA 4BJ3A 2A1TR 5MFPA 4LKRA 3LCJA 4BMNA 3IUPA 4DNQA 1ZMBA 3GEIA 1RFLA 1NUPA 2UUPA 4NMLA 1SFRA 1ESMA 1CU1A 3QF4A 2VNHA 1Y6ZA 3NP9A 2YNMC 1YF3A 3QE4A 4OHWA 1WKBA 1QR6A 1HYQA 3I8OA 1YHZA 5ENDA 2Z2IA 2JGMA 2PYDA 1D2RA 4N5MA 1NVVQ 4ITVA 4O3FA 4O2AF 1HL3A 4JXXA 1TEXA 2FUNB 2HF2A 3IAEA 1TOAA 1MIOB 2Q6IA 5EQJB 1W47A 4EECA 5LP1A 2BVNA 3FHTA 2Z8XA 3L6CA 2HCBA 3FCCA 3GMSA 5EHXA 1E4OA 1HRDA 2AF3C 4RMGA 1XTIA 3U7HB 4JQZA 5L4LA 1BD3A 4GKJB 1DAFA 1WDLA 1Y7LA 1SKMA 3HUEA 1B23P 1TT7A 2H2WA 2AVNA 2ABWA 3F9IA 3CF4A 3DZJA 4V0SA 5TV2A 2DHQA 1HYBA 1KJ8A 2Q46A 1QYXA 1B1CA 2RC5A 5K6TA 2G06A 2R751 2O2IA 3GPBA 4V24A 2D2XA 3X43A 1V39A 3EIXA 5EIFA 4JP3A 4RKEA 3WFIA 1DIRA 4PQYA 1SCIA 1PWHA 5EP1A 3E9NA 3NHKA 3UH0A 4AKSA 1T5IA 1PUXA 2E87A 1VJDA 4P7KA 2WT4A 4Q6WA 1LSUA 4AG6A 2CF5A 5P21A 3MMZA 2WW8A 2BI8A 3IJRA 3IHTA 4BNXA 3FI9A 4OB7A 4FYVA 3L0OA 3NOVA 2JCGA 3I12A 4KJZA 3T94A 1YE3A 1K5PA 1RI5A 2GM9A 3F47A 3Q3EA 3VAYA 4FU0A 4PNPA 1T1GA 4GQBA 3RO7A 1DRJA 1NASA 2VH1A 2Q4OA 5GINE 2QT1A 3HTXA 2K4MA 3AZOA 3A11A 2AJ8A 5E4JA 4JLAA 3WOHA 2ANBA 1V4VA 2G0NA 2IU4A 2J07A 1IMOA 3U3XA 1MNQA 4H1VA 1WEKA 4WTOA 1DKUA 1CJBA 8ATCA 3EUWA 2A59A 4HN4B 4D0SA 2NO5A 3D0QA 1DG9A 2A9FA 1LPPA 5DHSA 4ARCA 1UJCA 3PUIA 2XT9A 4A0GA 1NW8A 2KM1A 2Q3JA 4MA4A 1QR2A 4WMLA 1E1YA 1RSZA 1VYTA 4YAEA 1C4WA 5IN5A 2W6PA 3DE6X 3BCRA 4J49A 3LGAA 3TSOA 4LYHA 2HREA 5LQRA 1RCUA 4N8EA 3EZ7A 3GMIA 5ADUS 1A9OA 2ZVQX 3C7AA 2BGUA 1KAEA 3W78A 4F3YA 5D3KA 3AWDA 4HEJA 4UUMA 4ZMSA 1CWUA 1ML3A 4L8YA 5GVRA 5EJ8A 4ZEMA 2LCFA 3GFGA 2XEDA 2P77A 3KQMA 5H82A 2V9PA 2WSSA 4MIYA 5AHOA 1H9BA 2IS1A 5DBOA 2JI7A 3STUA 4YYEA 3VR6H 1EGVB 3AR8A 3RHSA 3LDAA 4YVFA 1T1RA 2QE7D 1JLHA 1BEUB 2D1TA 1J0EA 1XEAA 3IUYA 5ESXA 1KNQA 2I1LA 3IEKA 3AUAA 4XI9A 4MMZB 3L04A 1AS0A 2BAGA 2FMKA 3LT1A 4NX2A 4WZBA 4NCIA 1A8PA 5EKSA 5BO5A 5CYOA 1K88A 1NSFA 3FRIA 3KB2A 1IC6A 3PCXA 3UPUA 1BFDA 1VJ0A 1QX3A 4G1BA 1SVWA 1M8FA 4D9NA 1G3UA 1QGAA 4ER7A 4E6EA 2BR5A 4AF6A 5LP6B 4PZYA 3LOPA 1SVNA 2BKXA 4GYKA 4CEJA 3KKEA 3W5UA 3UT6A 3F49S 4AKHA 1XCBA 1JR6A 4EW2A 5DIZA 3KTDA 4JV5B 3MJCA 1ADCA 1YCDA 4MVWA 1WXIA 2CMFA 2WUVA 3V9PA 5ERXA 4NBUA 2HMYB 1LQUA 3GF4A 4TXHA 3THOA 3W7AA 2X15A 3A9RA 3LUJA 4ZOLA 2NADA 3C7TA 2R6HA 5IVPA 4UCWA 1D0VA 2BCEA 5DX8A 4QM6A 3EVZA 4D9JA 3T5AA 4C29A 1WXXA 5F5NA 3W5DA 1HTBA 4JSTA 3UJCA 5L3QB 4NQZA 3L0IB 4V0KA 1L4GA 1SB9A 2OFXA 2O0HA 3O9ZA 3MCTA 4OU5A 3L0CA 4FFDA 1GRQA 1F7UA 2BKUA 1SQ5A 3G6KA 4AY4A 4EGAA 2P9EA 2Q2WA 3P9YA 4ZAXA 1OLUB 1F8GA 2BKEA 1TZCA 1KXJA 3TFOA 1SG6A 2IKSA 5JXGA 4KAFA 3ZVNA 2X6QA 3GLRA 3H9BA 2AZMA 4OI0A 3CO0S 2VT3A 3Q6MA 4UHCA 4D41A 1GARA 10MHA 2R44A 4BFWA 1NWHA 2ALJA 2G08A 1R64A 3O94A 2FG7C 2P8JA 4PXYA 4PIVA 1LJUA 2IE0A 4NCJA 4ZVRA 5BUCA 3D6NB 3JYLA 5BRNA 2KHZA 4QDTA 4JBIA 4QU0A 4X1KB 3T9FA 1YR3A 3LI2A 3KUKA 1GNQA 3U7QB 2QQGA 3OQIA 3PX2A 3E0QA 4CEHA 3KHUA 2P6PA 3KZMA 4ZZ1A 2Z6AA 2PS9A 4A36A 5CM2Z 3D59A 1DRUA 3ZBUA 2ZYHA 5IT0A 3A9UA 3FYDA 3HDQA 5CU7A 3BZUA 1POXA 4NU6A 5AESA 5I9TA 4AROA 4QD3A 3RREA 4RETA 3HXQA 3K2BA 4DCCA 2I3ZA 2OGTA 2E4AA 1L1RA 1P5JA 2DFPA 4BNUA 1KMQA 2KS6A 1ZM4A 3HGQA 5DGCA 3OOHA 4DKJA 3QLTA 5JXWA 1GGKA 1VJRA 2QAGB 1TYEB 1JU9A 2PFGA 2JIZA 2WI8A 3MMNA 3GPLA 5CT9A 5ALTA 1XE3A 5PGMA 1PZHA 3I23A 1XXLA 3EBLA 4HC4A 5EIBD 3M2TA 1JF8A 1F0YA 4Y6LA 1RCTE 4NV3A 4WDQA 1E3TA 2YWHA 2COKA 4RSHA 3HXOA 3MMSA 4DF3A 3Q7QA 3HYLA 3VH3A 1TK9A 4Q93A 2EJTA 4Z8XA 2ZIVB 3M9XA 3KTOA 3CVVA 4RPLA 4IOMA 1IN1A 5DTJA 4Y6OA 1F06A 1MABB 2BW0A 1BJRE 4KRXA 2IZOA 1IQ0A 3QENA 3LUAA 4JI5B 3QUCA 4YJGB 3DPIA 1SHKA 3FTPA 2R6AA 3WK6A 4Y6RA 1VGVA 5INTA 3DWEX 3WGIA 4WSOA 3GROA 1KMHA 3WNDA 1JFFA 4TROA 2QTGA 1D5WA 4WI1A 3CZ5A 3GJ0A 2J31A 5EFOA 4UEKA 5IVDA 1XD2A 2XTAA 2WSYB 4PCVA 4DR5B 2EKZA 3CEPB 3T1OA 2P27A 2O8DA 2QTBA 3KT6A 2W4QA 1A4UA 1Y5MA 1LS1A 1U1DA 3P45A 3RANA 1HTWA 1GEGA 4BO3A 4DM7A 3F6SA 4K3UA 1LBHA 4JJKA 4LUCA 1ZY2A 3EC1A 4GLJA 1JWLA 4GBMA 3F4LA 5H3HA 3E61A 3PVSA 5DM70 2NP7A 3AHCA 4RLQA 1NXWA 1VHDA 1B42A 2C2HA 1YZFA 2GCIA 2DHDA 1HZZC 2RHWA 3NR2A 4HNGA 3A1CA 5EPOA 3KXIA 1W8IA 4B9AA 3V8MA 4YRIA 1PJBA 5DV9A 3I6MA 3SVZA 4IUYA 2PNFA 1P5HA 5FEMA 6ADHA 4KLNA 1KVRA 2G82A 3GQBA 3KB8A 2G9NA 4F5ZA 1D1TA 3Q0TA 1XTTA 2Q9AA 4EKYA 5AVSA 4TKZA 5B5SA 2BZSA 5JD3A 3CNBA 3RU2A 2HAEA 4CTMA 2GPWA 3SM3A 1II0A 4B6GA 1N5LA 1EK2A 3PKJA 3ZU3A 1PEKE 3H6GA 1WKCA 2FJUA 3HY4A 3WGYA 2W90A 4DMUB 3VVLA 4DB4A 1COZA 4M0MA 4AQDA 2W00A 4KLZA 4PYIA 3E18A 1YFZA 5F5XA 5FHQA 4ZO9A 2DH6A 3ENZA 1Q44A 5KHOC 1HE8B 1IWBB 1RCFA 1H8HA 1ZGGA 2PXCA 3AJ8A 5DX1A 4E15A 3P2MA 2V0GA 1E1MA 1PKEA 3OETA 4DW8A 3MWYW 5ARCA 5DHQA 3V7NA 3PEUA 2ZRNA 3R0JA 1ZEMA 1BXGB 5IEJA 3QPBA 2SECE 1T0BA 4B34A 2VT7A 1NVMB 3SK0A 1DI0A 5BYJA 1IE3A 2WWIA 5B55A 4WBNA 4WKCA 4C76A 2NTEA 1ESCA 2R7KA 1NPDA 3VC3A 1SKYB 1F2TB 1H9CA 2PMWB 2QA5A 3AUKA 1EFDN 3EHEA 3PE3A 3WRYA 4ZO6A 1S2DA 2DTEA 2H6EA 1AKTA