4CQMA

Crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
256
structure length
248
Chain Sequence
b'QNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTRADIOL 17-BETA-DEHYDROGENASE 8
publication title Insights Into Mitochondrial Fatty Acid Synthesis from the Structure of Heterotetrameric 3-Ketoacyl-Acp Reductase/3R-Hydroxyacyl-Coa Dehydrogenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 87
structure length 248
sequence length 256
chains with identical sequence E, H, I, L, M, P
ec nomenclature ec 1.1.1.239: 3-alpha-(17-beta)-hydroxysteroid dehydrogenase (NAD(+)).
pdb deposition date 2014-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cqmA00
4Z0HO 1FDSA 3OJFA 1KY5A 1DRWA 1WDLA 1GUFA 5L7YA 2JD0A 3C1TA 2WD7A 1J4AA 2Y0EA 1HYEA 4DXHA 4ZN6A 1DJQA 3JQDA 6LDHA 1UP4A 3INRA 3GVPA 1EQUA 2GN6A 3AW9A 3O8QA 5TLSA 3KM0A 1UXKA 1PJCA 4FFLA 2X9GA 4JCOA 4GI2A 4FW8A 4PIVA 4QT0A 2PD6A 1NPDA 2B83A 3NJ4A 4I5EA 1SAYA 4BL5A 4CMEC 1PL8A 5B37A 4PZEA 2RH8A 3G49A 4RVDA 2G76A 1AE1A 3D3WB 2Q1TA 2PV7A 1A72A 4IJKA 2BGLA 4M86A 4WASA 1W6UA 1HEUA 1BMDA 4I5FA 2CFCA 1IYZA 2RHRA 4IGEA 5TNXA 3UKOA 1WXDA 1JAYA 2W90A 4HKTA 4F45A 3PWKA 2A4KA 5KKAA 1DRUA 2AHRA 2B37A 4M55A 2IE0A 5BSHA 1KC1A 3X2EA 1UAYA 4KWIA 1B16A 1EK6A 2DFVA 2ZJ1A 4TSKA 1C1XB 4TQGA 4YAGA 1PJTA 1B26A 1F12A 1YRLA 2BMAA 3OEYA 2NACA 2FPGA 5BNTA 1H9AA 3JQGA 3IOYA 5KTKA 2P91A 4NI5A 1CF2O 3IKTA 4ZD6A 1DO8A 2Q1UA 1C1DB 1V0JA 4L4RA 1ZNQO 5HM8A 1A7KA 5U4QA 4KP7A 2D59A 5C3MA 3G17A 2DVMA 3GHYA 4CQMA 4NBVA 3I4CA 5DCYA 1I3MA 4Z6KA 5GZ1A 3K2BA 1U3WA 4IZIA 3MJEA 2JKVA 3GNTA 3HB5X 1U5AA 1LSJA 2JCYA 2V6FA 3EAGA 3EZLA 5CG1A 1R37A 3OIGA 3JYNA 5IZ4A 3ANNA 3DO5A 2YV1A 2HK8A 1FK8A 4WOJA 5B4UA 1HKUA 2Q3EA 3ZGYA 2FRDA 2VTEA 1Y81A 4FSHA 5ER9A 1BG6A 4NFSA 3NAQA 5I9NA 1HL3A 4ZQFA 2O3UA 1EBFA 2J5KA 4BGIA 4YT8A 1F8GA 3V1TC 1ZEMA 5JY1A 1K3TA 1IPFA 1YS4A 4RL6A 3KETA 3F5QA 1A4UA 2IDZA 1E92A 3I4FA 1HETA 4BNKA 4J91A 4AJ4A 5DN9A 1JWAB 4CMKA 3TZQA 4BKPA 4HY3A 4DPKA 4UAGA 4TMFA 1S7CA 4XR4A 3ZNOA 4DYVA 2XOXA 4WLOA 5A02A 2I3AA 1I2CA 4MKRA 1SOWA 2Q49A 1GTMA 4MVJP 4RJTA 5JY6A 3RAJA 3BMOA 5DCWA 1PJQA 1T25A 2JCVA 5EL0A 4BO9A 3NV9A 4WLFA 3S55A 2JFHA 4R9SA 3GEDA 3EYWA 1GUYA 1HYGA 1XA0A 3E82A 3S1LA 1HF3A 4EI2A 3B1KA 5KWEA 2Y1CA 2Q50A 3O03A 2EEZA 2PTGA 1J5PA 4IS3A 3JQEA 1ZK1A 4XIJA 3OBBA 1E7YA 2BH9A 1K89A 2GO1A 4FJ2A 4BNIA 1H9BA 5L95A 3L9WA 1Y6JA 5CDGA 4NBUA 3M1LA 1ZXBA 5IJZA 4CMEA 1R0SA 3ADPA 1VL6A 4O63O 2E4AA 3B6ZA 4PLHA 4G65A 4RVFA 1YQDA 4DPMA 4JX8A 3UFXA 3DAFA 2H5LA 3MWDB 4PZCA 3ZN2A 3CEAA 5A3VA 1P1RA 4Z9YA 2C20A 3HQ4O 4A27A 4KDEA 5F3RA 2NVUB 1LDEA 1H6AA 1K6IA 4E5KA 3PFFA 5L7TA 8LDHA 2BFOA 2W2KB 1GCUA 4I08A 5EN4A 1B8PA 3U9LA 4XYBA 1D1SA 2GR9A 1N2SA 3P5SA 1E7WA 1LTHR 4YRBA 3GVCA 1F17A 2UDPA 1ULSA 2VWGA 5L4LA 2VOEA 4UUOA 2CSUA 1BW9B 2HK7A 5CDYA 3GC6A 1NR1A 4IDEA 1I2BA 1R0KA 4PGFA 3DFZA 1IPEA 4GQAA 2VHZA 3SXPA 3ETDA 3JQCA 4IDCA 4I9UA 4XB2A 2O4UX 2PGLA 5DCUA 5ICMA 4MO2A 1E3SA 1GYPA 3AY3A 5AOVA 1HE5A 5DDIP 5AYVA 4B4UA 4PLGA 2IZ0A 1A27A 3EMKA 2G5CA 1P31A 3FR7A 4P8RA 4Q9NA 4XQEA 4IBOA 2DT5A 4MVJA 3HNPA 5B1YA 3DOJA 2FPIA 1KIFA 3H9JA 1LDMA 2VUTA 3EUWA 4HFMA 2Q2WA 2AQHA 1I36A 1X14A 2PA3A 2PKQO 2WE7A 4PVCA 2QZZA 1WP4A 3WOHA 1L7EA 5F5LA 3DBRA 2IZZA 5L4NA 1QYVA 5L45A 4LCJA 1MG5A 3GHHA 4WNIA 4GSKA 4XEHA 4LRSB 3LC7O 3JQ8A 4ND1A 5JAIA 3QIVA 1AHIA 2UAGA 4BB6A 3KOUA 4Z9XA 2FN7A 3RUCA 3WMWA 4AJIA 2Y05A 2B5VA 2AG8A 5DOVA 1Z7EA 3ZNQA 4NU6A 1VRWA 3LZ6A 4MIOA 4MIEA 4KOAA 1K6XA 4YJGA 1GQ2A 5MDHA 1E77A 3PJFA 1WNTA 2VYND 1U8XX 2X4GA 2VRCD 4D43A 4JBHA 4NMHA 4E3ZA 1P1JA 3NT4A 4UVIA 3PQEA 1XGKA 1LC0A 1XSEA 1EEHA 3NUGA 4LVUA 2X5KO 3L4BA 4EZBA 1ZJZA 5KJ6A 4XDYA 2Y0CA 1JN0A 3NX4A 4HWKA 3ST7A 5KVCA 2GNAA 3RUEA 1SOVA 5BQFA 5JBIA 3IJPA 2X5OA 4CL8A 1HXHA 4I5GA 3DC2A 3I5MA 4GL4A 4J6FA 2G0TA 1KVQA 3QVOA 1JW9B 3GG2A 1SMKA 2DBRA 4DLBA 3GVXA 1TB4A 3KYBA 3KEOA 3S2IA 4YAIA 3LLVA 3SJ7A 4BNVA 3CXRA 1SPXA 1PX0A 1BRMA 5ER6A 4B7CA 1NVGA 3IQDB 2YUTA 3OFSA 4ID9A 4ND3A 3ETGA 4UUPA 3MJCA 4RVSA 3GN1A 4LRTB 1CJCA 1X7HA 3OJEA 4BO4A 1Y8RA 1KS9A 3JTMA 3TNLA 3MOGA 2I67A 1HSOA 3QLJA 3JYOA 1R4MA 2CY0A 3FTPA 5F5NA 4RVHA 5HBRA 5TGDA 3ZHBA 4U0JA 3PHLA 2X58A 1ZFNA 5TC4A 3UN1A 1U4OA 4R3WA 5CDSA 4LSMA 2V6BA 1A9ZA 2W98A 1PQUA 3AFNA 3PEFA 4R1TA 4J1NA 4QO8A 1OOEA 2LDXA 2G82A 4A73A 1VKNA 3WGHA 5T5QA 3WIEA 4CM4B 2JFGA 3EK2A 4CQLA 3ONEA 1BHSA 1DC5A 1F0YA 2NUAA 5THQA 1WWKA 4INAA 2PH3A 1ZMOA 3QQPA 2O3TA 3HFSA 2I6TA 1PGNA 1V35A 3FPCA 3QWFA 4D3DA 4TROA 3ASVA 4XX0A 1SCUA 1NVTA 4CQMD 1LQTA 3PIDA 3QW2A 2XXJA 4TRNA 1N7HA 1ADFA 2R2GA 4I8XA 2WSBA 4D44A 2PZMA 5JMPA 3TPCA 3V2UA 1JVSA 1FMCA 2WYUA 3DZJA 3KZVA 4G5HA 2Y0DA 2YV3A 3DAPA 3GEGA 4FC7A 3ZWAA 3TOZA 1GCOA 1VL0A 3GH3A 2VUUA 1IZ0A 1P0FA 3JD0A 4YACA 1O0SA 4NQZA 3WJAA 4EJ6A 4YT4A 1BDMA 2FZWA 3LF2A 4A2CA 1VKOA 2V7PA 4CLOA 2I65A 4CLRB 1H2HA 1Z82A 1I01A 1G6KA 2BD0A 3HG7A 4Y67A 3I9JA 4AVYA 2VNSA 4S3MA 2LDBA 3F9IA 3FWZA 3VZPA 2XAAA 4DVJA 4MVJF 3KYDA 3BZUA 5CPFA 3GDFA 3ASUA 5HTOA 4RZHA 3KSZO 3W4KA 2PZLA 3MCVA 3QVTA 2PR2A 5TQVA 3WWZA 5TRTA 5A03A 1AXEA 1MX3A 5A9TA 2QX7A 1ADCA 2YYYA 4MPDA 4EGFA 1TEHA 4B8WA 1R66A 1IOLA 4AJLA 3Q0EA 5C5IA 4E12A 4AJOA 2OHXA 5IFLA 1PIWA 3I3OA 1Z6ZA 5KNLA 3BTVA 3JSAA 4D46A 2D3TA 1EE9A 2A9FA 3F3SA 2NVBA 1IHXA 1QRRA 3GF4A 3PYMA 1EVJA 5B12A 1LDYA 1E3WA 4YT5A 2NADA 9LDBA 4HFNA 1DIGA 1P9LA 4CLDA 1CETA 3LYLA 1DEHA 4FFRA 1TT5A 4NBTA 1FDTA 4BIIA 2VRBA 5FYDA 4TKMA 2D5CA 4MVJM 4ZQEA 1YBVA 1SBYA 1YB4A 3MWEB 4MVJI 3UVEA 4FD3A 4GMGA 3ENNA 3IDSA 4U7WA 1PEDA 3H4VA 2GERA 2ZQZA 1VE9A 4CR6A 2VWPA 4ALLA 4PFJA 4XR9A 1BXZA 4ZA2A 3PZBA 5AVOA 3ADOA 4IDAA 1XR3A 2OL4A 3Q2KA 3GN2A 4UVGA 3VZSA 5L4SA 1N9GB 1NAHA 3WBBA 4ZQHA 1HE2A 3PZRA 4XGNA 2B5WA 4DQVA 2NTVA 1NPTO 2YZ7A 3QWHA 4WOKA 1Z73A 3PPIA 4YBZA 1LJ8A 2IODA 5ENVA 3U09A 2CF6A 3ZU3A 1Q0LA 1I2ZA 1M76A 4BNZA 5L7WA 3D5QA 5KOIA 1UAGA 2NLOA 3H5RA 1BDBA 3ZI0A 1PGPA 3G1UA 1H0KA 2B35A 4EEXA 2OBYA 3QWAA 3T7EA 1VJTA 2CVOA 1XQ1A 1H6DA 2GZ2A 4BNXA 3VVCA 4GGPA 4ZGWA 2QRLA 1CYDA 1QLHA 2YW9A 3ZV4A 4DPLA 3H9EO 1GV1A 4GGOA 4CM8A 4DREA 4F6LA 5ILOA 1XQ6A 3KBOA 2NU7A 1YDWA 1DHTA 4MVJD 4U0KA 4YDRA 3VDRA 1EVZA 1I32A 3AU8A 4J7UA 1MP0A 1T1SA 4EUFA 4P4GA 4HX5A 4PLFA 3LC2O 1YL6A 1BXGB 4J90A 2AEJA 2P68A 3VZQA 1T4BA 3KB6A 3V1YA 3E48A 4FJ1A 2ZKLA 4AJ2A 4CMGA 1OZAA 3HDQA 4K26A 2E6UX 3U49A 1E1NA 3H6KA 4HUJA 4E2WA 2VNAA 3W4IA 2ZTUA 3I6IA 4HP8A 1LXCA 3QVWA 1V3TA 2FR8A 3RUAA 2H9IA 1TVEA 1TI7A 3LT4A 3L9XA 4OHUA 2D2IA 4R5HA 2BLLA 2JAHA 3RKRA 4JJGA 1U28A 4H3VA 5LDHA 1Q7GA 1EDOA 4ND2A 2NNLD 2C07A 4YQZA 2OBNA 3JQ7A 4Y6PA 3WFIA 3RROA 4E33A 4OJNA 4OYRA 4NJMA 3N58A 1H5QA 5F1KA 4AL4A 4TKLA 3W6UA 1ZO8A 3UCEA 5L40A 1BTOA 2E82A 2EP5A 4NJOA 4ONEA 3VH4A 1PTJA 4FGWA 3U0BA 4TWRA 5JCXA 4DC1A 3ZH2A 4YJFA 5AXDA 1VJ0A 2HO5A 4DMLA 1ML3A 3WYBA 4CLXA 4UEKA 3RSHA 1O94A 1AN9A 2YV2A 1H6CA 2GZ1A 1YJ8A 3VH2A 1EUZA 3NJ8A 1QP8A 7MDHA 5DBGA 4BGEA 4M89A 1NXQA 3ZNPA 4WLEA 3P19A 3D4OA 4KUHA 5EPOA 3CTMA 3ROKA 1M75A 3F46A 1WDMA 4PLYA 2RHCA 1JKFA 4YAKA 4ALMA 5ITWA 1DAOA 2BFPA 1KVSA 1XWFA 2HRZA 2X0JA 4ALNA 3D64A 2GRAA 2O3QA 4PG4A 4K1LA 3RC2A 3CE6A 3GT0A 1LDGA 2O7SA 2PGJA 3GLQA 3B20A 3MJTA 1Y8QA 2DAPA 4P22A 3BHIA 3PGJA 3IP3A 2VHYA 4IS2A 4II2A 1N1GA 1A71A 3FRJA 4XD2A 5C37A 3PYXA 4KWHA 3MEQA 1MUUA 4E5YA 4E6PA 4IY1A 4UVDA 3BIOA 2DQ4A 4BKQA 4H15A 4J0FA 5KJEA 4AICA 1HLDA 1Q7BA 1JAXA 1LX6A 4O0LA 5I8WA 4CV0A 4RLHA 4ESOA 2X9VA 1H6BA 4HFRA 5U1PA 1YBMA 1C1XA 1E7RA 2X0NA 4Z3KA 4JP2A 4E30A 5CEJA 4BO0A 3LQFA 4GX2A 1C1DA 2AMFA 1KETA 3KLMX 2EKPA 2ZB8A 3B1FA 3CZMA 4J4BA 2POQX 4L0QA 5ICSA 1RYDA 1WVGA 1K2WA 1JVBA 3IUPA 2I3GA 2Y67A 2NU9A 5JO9A 3INTA 3UCXA 2CNBA 3KYCB 1T2AA 1RWBA 3DBHB 3UUWA 3NGXA 3ZU4A 1F06A 2C54A 1E1MA 4R68A 3A14A 1P74A 3T4EA 1C0LA 1T2FA 3E9QA 3PIIA 5DF1A 5IXSA 3TZHA 3PHIA 1K5HA 4J1SA 3HZZA 1L1FA 3VVBA 4IMPA 4EUHA 2QHXA 2ZYDA 4L4XA 4LK3A 1EFKA 4WLVA 5G0UA 5AXCA 2FWMX 4BGVA 2J3IA 4U5QA 4OAQA 3K8ZA 4GSLA 3DZHA 3DWFA 4FFNA 2GGSA 4RPJA 3RBVA 3P2YA 1R16A 3JD4A 4CM5A 1Q2XA 1LLDA 1Z74A 5A1TA 2Q4BA 3ZV3A 3OJ0A 3PJEA 2EV9A 2PKRA 2OUIA 2EKLA 2HMUA 2BELA 1IE3A 1XG5A 4RPLA 4J16A 2AEFA 3PYLA 3OA2A 3D5TA 3LU1A 5JPIA 3TQHA 2C5AA 4FGSA 1O5IA 3IJRA 3DZBA 1LSUA 1OFGA 3GZ4A 4OXNA 4RV9A 2OOSA 1PSDA 1GY8A 1XU7A 3KVOA 3OIFA 5HS4A 1UZMA 5JE8A 3RUFA 1NTOA 1D7OA 3GQVA 3JQFA 4O5OA 4W99A 5L3ZA 5L51A 4BNTA 4E13A 3Q2IA 3PHHA 2FOIA 4WEQA 4ALKA 2AW5A 3WGTA 3GUYA 1ZCJA 4JBIA 3JYQA 4C7KA 3CKYA 2DTXA 3C7CB 4AJEA 1GQYA 1WMAA 5F1PA 1Q0QA 5CEFA 2A92A 4XGIA 3K5PA 2W4QA 5T64A 3WSWA 3P7MA 4ROSA 4BO3A 1XLTA 2Q4EA 2Y1GA 5L53A 1G1AA 3RKUA 3OICA 3FPLA 1GU7A 3FNHA 4HADA 1KEWA 3C8MA 2O23A 3RBZA 3ITKA 4IUYA 3NT2A 4FN4A 3Q11A 1ULUA 2JJYA 4Z9FA 2AQ8A 4HNGA 2PD4A 2ZIZA 3VH3A 4WNCA 5I7SA 1P1FA 3F5SA 2Z1MA 3U4DA 3A4VA 3VPHA 1Y5MA 2W2KA 1ZK2A 4YJHB 3AJRA 3PJGA 5BSFA 3E03A 3GR6A 2RCYA 2ZYAA 1YOVB 3BHJA 3GAZA 3GPDG 4YAEA 2GZ3A 1HLPA 4OH1A 5CDUA 2FMUA 4DA9A 1G0NA 3WX0A 1FDVA 3AM4A 1HTBA 3PP8A 3L4BC 2DTEA 2JHFA 3D4NA 3NT5A 1BW9A 1EVYA 1E6UA 3JQGB 2ZB7A 2TMGA 4RPHA 4XJSA 2Q45A 1KC3A 1ZZEA 3MTJA 4W7IA 4MOWA 4RF3A 3VZRA 4AJPA 4Z3DA 4RF4A 3DOOA 3VPFA 3KV3O 3JYLA 4Q3NA 5DULA 4J3FA 1I10A 3O26A 4IDBA 2ZTLA 4TZKA 3UOGA 2E37A 3WIDA 3D3EA 5C7OO 1EFLA 2X7HA 2NQTA 3JQBA 4XWYA 1U2GA 3G3EA 3A1NA 1V9LA 1X0VA 4XZ3A 1Q7CA 3ZWNA 5I7VA 4D7AA 3EVTA 4HV4A 3H9GA 1LA2A 3OIDA 4NFYA 2Y68A 1U4SA 2WD8A 3HUDA 3O9ZA 4WE3A 1WMBA 3K31A 2O4CA 3R0IA 4AJJA 4YT2A 1ZK3A 1YQGA 2VZ8A 3H3FA 3T7CA 1JU9A 4PLCA 5I8ZA 2E48A 3RIHA 3V2GA 5DBIA 2R00C 3I9MA 3E18A 5EERA 5TF4A 2DUUA 4J1QA 2Y1EA 4J9UE 3LLSA 3LT1A 3PDJA 3U5TA 3ZWBA 3QJ5A 4XCVA 1X7DA 3GNSA 2CD9A 2UUOA 4L73A 1SB8A 1ID1A 3DZGA 1T1RA 1S6YA 1T24A 4GKBA 1GL3A 2B4QA 2VZ9A 4BNNA 1YBAA 4ND5A 4FQ8A 1KVRA 5FI3A 3L6OO 3C7AA 3U4HA 4NK5A 2WJPA 4GAEA 1Y9EA 4EJ0A 5JW6A 1UXIA 3BMOB 3HHPA 4E2ZA 4ZRMA 3I1JA 1E3IA 4OKIA 3ROQA 3RI3A 4GX5A 3FR8A 4OOEA 5EJ2A 3CMMA 5AQ1A 3W6ZA 4N18A 3RCBA 4J7XA 5CPBA 4ND4A 4WCFB 1T2DA 2DKNA 4JBGA 3P2OA 5J23A 2OO5A 1C0PA 4GPD1 4NH4A 1J49A 1Z75A 3WGIA 2P9CA 1L7DA 3S2FA 1RM4A 4R5MA 1XEAA 3BAZA 3AI2A 4LSWA 4BQPA 1DIAA 1YB5A 5JO0A 2BI8A 3CUKA 1SB9A 1P1IA 5G0WA 3QHAA 2GD1O 1QV6A 5IDXA 4PRKA 3FWNA 3DMTC 1U7TA 3O38A 1NM5A 1PS8A 1Y1PA 2ZYGA 1ZSVA 2IXAA 5MGBA 5COQA 3M6IA 4L4SA 2Q1SA 4JN6B 4QFCA 4DWVA 4MINA 2PGDA 2YHIA 4CM7A 2EHDA 1R4NB 5GZ6A 1DC4A 1PJLA 2ZB4A 3ZW8A 3STHA 1XELA 2QYSA 1YO6A 3DDNA 1G0OA 3RC7A 4UEJA 1MLDA 1ENPA 2D0IA 1YDEA 5KKCA 1ZXLA 4BUCA 4ZICA 4KMSA 1E3LA 1PL7A 1GPDG 3ZV5A 1ZIDA 2JHGA 4OM8A 3QP9A 4Q3CA 3HE3A 4QEDA 4CODB 4BQRA 1D3AA 3CPSA 1HDOA 3QVXA 1Z45A 2AE2A 3FHLA 3TF5A 4UREA 1B8VA 4PVDA 1OI7A 1DRVA 2DUWA 5ITVA 3U62A 2V6MA 2UUPA 3LDHA 3AM5A 3JQAA 3RJ5A 2B36A 2C82A 1MC4A 4R01A 4YEDA 3I9KA 3TL2A 2VT3A 4WGGA 3KTDA 5IF3A 1BVUA 1E3JA 1VSVA 3R6DA 5GMOA 4J1TA 4GWKA 1SO8A 2Y1DA 3E9MA 2O7QA 3LSYA 4R9RA 4A0SA 3QSGA 2CDCA 4II3A 1DIBA 4YVFA 2YFHA 3MJVA 1KEUA 4CMIB 1E0DA 4BMVA 1NBOA 1X1EA 2G17A 3WDSA 2R00A 4H7PA 2NV6A 3NKLA 4YJDA 4U6SA 1XKQA 1GFSA 4XKJA 3NDJA 1DAPA 3GZNB 4CLRA 3WLFA 1DFHA 2J3HA 5TSDA 4BO7A 2C29D 2F00A 5IAAA 1B7GO 1NX6A 4XA8A 1UDBA 2JL1A 3G79A 3HSKA 1E7QA 5THKA 1ISHA 2QW8A 1YGYA 1DC3A 1LNQA 2DFDA 5KVSA 1O89A 5JDCC 3WQQA 4W9NA 5KIAA 5FF9A 2I76A 1ZW1A 4YRDA 3EGOA 1FDWA 2GPTA 3AUAA 3WNQA 4L76A 4OSOA 3H7AA 1NQOA 4BNFA 1P77A 1W8DA 1O6ZA 3H3JA 4RO0A 3IAHA 5KJFA 1C14A 3VAZA 2QRKA 4R4JA 4MIYA 1H94A 1NHWA 2X1HA 5KVQA 2J5RA 2CMDA 4TVOA 2HKIA 2BF7A 4RQTA 2DU8A 3BMNB 3TFQA 5JSFA 3TFOA 2VHVA 4L74A 1VSUA 3VKVA 5JLAA 3HJAA 2HDHA 3DZKA 5COAA 1U3VA 4DTIA 4CMAA 3ZHXA 1GZ4A 2EGHA 4CMJA 2B69A 3DMTA 2O2SA 5TJ9A 4YWJA 3DZFA 1MFPA 3F1KA 5JFOA 2EKQA 3R1IA 2WEKA 1Y8RB 4PG8A 2JFFA 3KSDO 4NIMA 4FOSA 2FZEA 4YB8A 4BNGA 1P1HA 1MGOA 4EJMA 3FBGA 4R1SA 2G1UA 3ITDA 1EVIA 1RYEA 3AOEA 2YFQA 5T8KC 1R15A 1T4DA 1UJMA 5A05A 5A9RA 1BXKA 1JTVA 2SCUA 2QQ5A 1Y9AA 1EK5A 5JCJA 3HADA 1N9GA 3LT0A 4LW8A 3R3SA 2YJZA 1BWSA 1RM3A 4YCAA 1XYGA 3I23A 5JS6A 2WWRA 2YQ5A 5JAZA 5TX7A 2ZATA 3UGKA 1P1KA 1PWZA 1X13A 3C3XA 4QX6A 3C1AA 3QWBA 3WG9A 4CL3A 1NWCA 3BMCB 3GNQA 4BNYA 4FFPA 3ROPA 3ZZNA 3BMQB 2X8LA 1AXGA 3AI3A 1JDJA 3SJUA 3ZWOA 1PR3A 3ROMA 1GR0A 1LC3A 4OXKA 4PG5A 4RPGA 4W82A 4ZQGA 1M6HA 1ENYA 2A35A 2BI7A 1E6WA 2ZCUA 4AJNA 3H8VA 3NTRA 1JKIA 4J2OA 2NVWA 5H81A 4HBGA 5CDTA 3DHNA 1NYTA 3DTTA 2FR0A 3RUDA 1HDCA 4QFDA 1JLLA 1PL6A 3AY7A 3NYWA 5BT9A 3GY0A 5A3JA 2GUGA 1YVEI 4EYEA 1DJNA 4JNKA 3DBLB 4ZHSA 2ZJ0A 5H82A 3LK7A 2EJWA 2VOJA 2VWHA 1BXGA 4OO3A 1P0CA 3IC5A 4BO2A 4CV2A 5CHEA 1NASA 4XQCA 4OQZA 4NBWA 1V6AA 5IG2A 1NHGA 1U3TA 1NP3A 4BNJA 1GYRA 3ZWVA 1KERA 3Q9NA 4NG5A 4UULA 4C4OA 2BRUA 3E6AA 1PZHA 2DTDA 3DOCA 3EY4A 3ONDA 3K30A 1PGJA 1WW8A 3CMCO 2BHLA 2PWZA 5JDCA 3BHMA 4MVJG 2XF8A 2D8AA 2O50A 3PQFA 3L6DA 4MKZA 3FN4A 3JQ6A 4GLOA 4ZRNA 3KSUA 5JYEA 3G0OA 4QECA 2BFMA 2Y99A 1HT0A 2HMVA 4LGVA 4OKNA 3ZHYA 2O3SA 2JCXA 3RJ9A 3TWOA 4JP3A 1ISFA 3HDYA 1O8CA 4W6ZA 1NFRA 4UVHA 1DFIA 1X0XA 4R1UA 2PZJA 3ABIA 3I83A 1LEHA 4LN1A 4DL9A 4NPCA 5JC1A 1N1EA 3TOXA 5IXYA 5G4KA 5K6AA 2QYTA 4CM9A 2WE8A 3CSDA 5I7FA 1UXHA 3WGGA 2QIOA 1UDAA 3LF1A 1QR6A 3GK3A 1UZNA 4MP3A 5T57A 1JQBA 3KRTA 4PN3A 1LUAA 3L6EA 3AI1A 4Y9DA 1WZIA 5A4DA 4ZJUA 1LLCA 4Q3AA 3QV1A 1TT5B 3T4XA 4E31A 2VCYA 4FR5A 4FJ0A 1M67A 4PLPA 1MV8A 7ADHA 3VPXA 1ZKMA 5JAMA 1GEGA 3DHYA 5DP1A 3RASA 3DXFA 3GRPA 3ZCXA 3ZV6A 5T8KA 4AG3A 1CERA 4HNHA 4WUVA 1Q0HA 2W8ZA 5JC8A 1OC4A 4NHEA 3JV7A 3RU9A 5TT0A 4JQCA 1LLUA 2P4HX 3RFVA 4BNLA 3V8BA 1ADBA 1JKJA 1CQIA 2VHXA 5LCXA 4AJ1A 2CDAA 1EZ4A 3L77A 4L9RA 1LDNA 3GGGA 4J2HA 2YDYA 1ONPA 2I9PA 4RQUA 4FDAA 5CG2A 3ZWYA 5I7EA 4YPOA 2DBZA 4DIOA 1NNUA 2VTDA 4HFJA 4Y6SA 3PLNA 4LVCA 2IXBA 1NWHA 3RQSA 1OAAA 1TLTA 3JQAD 4PLWA 3V2HA 4YR9A 1LSOA 3W1VA 1XHLA 4FCCA 4WLUA 4CM8B 3JQFC 5DNAA 1ZEJA 4BO8A 1U1IA 3QY9A 4CM1A 2HK9A 3WNVA 1E1LA 1HYHA 1XIVA 5T67A 3SX2A 4TZTA 3WQSB 4IDFA 5BSEA 1N7GA 3JD2A 1QV7A 3WSVA 4WLNA 1PZFA 3KYCA 3DONA 1UP7A 2DC1A 3DBHA 4IPTA 3BTUA 3PJDA 3WGQA 3F1LA 5ADHA 4R16A 1M6WA 2J5QA 4MP6A 4R1NA 3JD3A 3H5AA 4IZHA 1IULA 3RUHA 2IYOA 1K0UA 3U4IA 5EINA 4XJTA 4E5MA 2Q2VA 3D3WA 1FDUA 4ILKA 1YE3A 5GY7A 3O4RA 1ISJA 4D42A 2RBEA 3GDOA 2AE1A 4PRLA 1I3LA 1ONNA 4I5DA 2OZPA 2ZCVA 1SEPA 3PVZA 1LI4A 3DL2A 3I9NA 4GMFA 1PGQA 3VDQA 3FTNA 4OSPA 3PFWO 3VPSA 5JDIA 2Y1FA 3WGOA 1I8TA 3AUTA 2OORA 2GF2A 2B0JA 1ENOA 3I9OA 4E2XA 4PLVA 8ADHA 1U5CA 3KLPX 1N5DA 5C7LO 4KZPA 1GV0A 3WICA 5G4LA 1SEVA 2GCGA 3DMYA 2IRWA 2OP1A 4KQXA 3AK4A 3TL3A 1EBUA 3AUSA 5CAEA 4CMCA 1QLJA 4CUKA 3F4BA 4Q39A 5CP8A 3ICCA 1PU2A 1HDRA 1A7AA 4QUKA 4I1IA 1B3RA 5A9SB 5EMHA 2HAEA 3JQBC 1NR7A 4MDHA 3PWSA 4Z0TA 3IKVA 5KJ1A 3GUCA 3L07A 1ZUD1 3DEYX 3EHEA 1N92A 2Q99A 3BXXA 4WCFC 2P4QA 4ITUA 1PR9A 4E21A 4YA6A 2A94A 4WK6A 3SEFA 3PK0A 2H6EA 3E9NA 4I9NA 3PDUA 2XPCA 4MVJH 4FB5A 3ZHZA 1DIHA 3DBVO 5EQFA 2FPPA 2QZ9A 1LRLA 4JK3A 1NPYA 4Y6RA 6ADHA 4NDNE 1AHHA 3GAFA 1Y8QB 3OF2A 5JCJD 4B7UA 3W8DA 4CV1A 4NZ9A 2EWMA 1VM6A 4OGWA 3DFUA 4EEZA 3OETA 4ZU3A 4IJVA 3WR5A 3OQ1A 3D1LA 4O59O 3UF0A 3PQDA 2VT2A 5DP2A 5L9AA 1LU9A 4N5NA 4IMRA 4YJHA 3WFJA 4F3YA 3TZ6A 1LRKA 1M2WA 1QYWA 4U6QA 4M1QA 3OH8A 5FEUA 1PWXA 1YOVA 1KYQA 3S2EA 3A9WA 5IN5A 1ISMA 3GDGA 1D1TA 1HZZA 5B4TA 9LDTA 3GG9A 3ZDFA 1UXGA 1WAMA 4D0SA 1HE4A 1ISGA 2X22A 3ICPA 2P5YA 3QRWA 5LDGA 1MG0A 4TRJA 2WD7B 4WECA 1O95A 3A06A 4K9DA 4RLSA 5JNLA 3IUSA 3HFGA 5KJCA 3HN2A 1FF9A 1PJ3A 3O8QB 1U7HA 2HMSA 2RAFA 3OM9A 1NVMB 4GX0A 1MFZA 3Q3CA 4R41A 1KBZA 2CDBA 2X23A 2EJVA 3JYPA 4GKVA 1UDCA 3ON5A 5JAQA 3WQRA 5U9CA 3WS7A 2ZQYA 3ENKA 4B4WA 4BO5A 3FD8A 3ZWPA 1ZH8A 4A7PA 4D79A 1ZVMA 5DBFA 1AGNA 1BVRA 4FC6A 1I24A 3TSCA 4BO1A 3LC1O 1ZK4A 2P9GA 2ILTA 2NVUA 1A9YA 1X7GA 3ZNNA 3RFXA 1YONA 4EITA 2DBQA 3IP1A 3CINA 2IZ1A 1RM5A 2WDZA 2V65A 4CR7A 5HRUA 1O9BA 1IY8A 1YL7A 3R3JA 2GLXA 3C85A 3N74A 1EE2A 5HA5A 1NQ5A 2O3JA 1WZEA 3DTYA 1QSGA 1Q1NA 2HJSA 2NU6A 3KUXA 1YKFA 2I5PO 4BHTA 1UZLA 1MA0A 4PCVA 5A04A 4R54A 1GD1O 1CRWG 2BGKA 4B4OA 4RVUA 4URFA 3JQ9A 4CMHA 1I3NA 1VL8A 3FBTA 4UUMA 4CM9D 4CQMB 3SC4A 2HUNA 1B14A 5G0SA 4DBZA 5BSGA 4GVXA 2B4TO 4KTTE 4FS3A 2OFPA 2J6IA 4LISA 1I5RA 3D7LA 4XQ9A 4E5PA 4P4NA 1R12A 4IXTA 4WCFA 2AA3A 1KOLA 1EUCA 3K73O 4MVJE 3EZYA 5ENDA 1TXGA 4XYLA 5G0TA 2E49A 3MJSA 1U8FO 4BOYA 3EC7A 5COBA 2FSSA 2QRJA 2WMDA 4DQXA 2HSDA 3H9UA 4IIVA 4XYEA 3RD5A 3NTQA 1XU9A 2EP7A 5C7IO 5BNIA 1ZBQA 5G0VA 1HRDA 1YB1A 2EW2A 3ONFA 5IZCC 4MJLA 1DHRA 3GGOA 2CF5A 3TZKA 3L0DA 1PQPA 4W7HA 4DC0A 4I9HA 5DZSA 1CWUA 4NR0A 4PZDA 4JLWA 4CM3A 5IDQA 3BYZA 1ZJYA 1LDBA 1E7SA 4RF2A 1R4NA 2VUSA 4A5OA 1ZSNA 4JJIA 2O3RA 3G1TA 3N7UA 3GPIA 4IQ8A 3UW3A 2HQ1A 3PHJA 4DYDA 3SVTA 5IN4A 3BTSA 4YRAA 4W9NC 1JA9A 2FSVA 3HN7A 4RORA 2CUKA 2DLDA 3I9LA 3WTBA 3WXBA 4CR8A 4GBJA 4D41A 3F47A 1OMOA 1IUKA 1HSZA 3RC9A 3WGZA 1A4IA 2EIHA 3UXYA 4GH5A 3S8MA 1B3BA 1C0IA 3HWRA 4DIBA 4CJXA 2NM0A 1R0LA 4KUGA 1E3EA 4BNUA 2PKQP 1GADO 2FHSA 4BGUA 2HMWA 3WYEA 4MP8A 4JGBA 1N8KA 1QORA 1NAIA 4NNJA 2AQIA 2Q2QA 3KXDA 3NDRA 4XQGA 4KTVE 4Z0PA 3NGLA 4A10A 3QVSA 4YYZA 2IEBA 1NQTA 4L75A 4QXMA 4CLHA 3ETEA 3K96A 3LVFO 2IEDA 2PK3A 2R6JA 1V3VA 4E5NA 1V8BA 3COSA 2C7VA 4CMIA 1MXHA 3VHRA 2RH4A 1ZK0A 1ISIA 4R3NA 4UUNA 2EXXA 3AM3A 1XCBA 4DIFA 3HDHA 3TZCA 1H2BA 3AOEC 3DQPA 3S2GA 3WGYA 1I33A 2NWQA 3GZNA 2Q1WA 4JROA 2HJRA 5H83A 3OMLA 5JXWA 3GOHA 5TT1A 3JD1A 5I9MA 1GUZA 3IMFA 3UH1A 4PLZA 2PFGA 1UH5A 4QTZA 1DLIA 4CM4A 4NK4A 1E1KA 3HDJA 5TS3A 2YDXA 1ENZA 4XIYA 2UYYA 2HCTA 4XYGA 3FI9A 4N7RA 2X86A 4GVLA 3B70A 3I52A 4XB1A 3UICA 2PD3A 4B3HA 2P9EA 4GX1A 4O1MA 1SC6A 2Z5LA 4ALJA 3H65A 4CM6A 4J9VA 1U3UA 2DPHA 4H16A 3PI7A 1CEQA 1PQWA 1DDOA 4IIUA 3W4JA 3GFBA 3KEQA 4NBRA 5KCZA 3BTOA 4FPXA 2H63A 2HLPA 3SLGA 1RJWA 4IGFA 4KDFA 4P38A 1JWBB 2W2LA 3OHSX 1W4ZA 2J3KA 4D3SA 4XRGA 1UUFA 2OGUA 3GRKA 5G2OA 2J3JA 3QWIA 2NTJA 3BMNA 2YY7A 3NDIA 1B15A 3V5NA 4D3FA 2DPGA 1P3DA 4J7CA 2Y66A 1DFGA 5HS6A 4PG7A 4XYMA 3TRIA 2NSDA 4EW6A 1PJSA 3DBRB 4IINA 4D0RA 3E5RA 2JAPA 3OP4A 4N5MA 3BA1A 4JXKA 5DOZA 5IZCA 5KVVA 4DLLA 3JQ8B 3DR3A 2HMTA 3MJ4A 3WBFA 3W8EA 3ANMA 3DHEA 3JCZA 1WPQA 2D5AA 3MOIA 4BO6A 3UCFA 3X2FA 3SLKA 2AXQA 4AJHA 4WJZA 4A03A 1DXYA 1VJ1A 3OJLA 1WDKA 2YHIB 1PJBA 2ZTMA 4YJGB 4BMSA 1GQQA 5AXAA 3C1OA 3WMXA 3WYCA 4EUEA 2O2YA 3VTFA 4E2YA 2OXIA 4J49A 1DSSG 1LRJA 1QYCA 4RZIA 2O48X 4YQYA 3H2ZA 4QSMA 3VPGA 2GASA 3I6QA 1TT7A 1QG6A 1QKIA 1E6EA 5ES3A 5FWNA 2TMDA 1T2CA 2VZ0A 3FF4A 4WPGA 1GZ3A 1RM0A 2GN8A 1DLJA 1VC2A 1ADGA 2VYVA 2X9NA 3BMCA 3FNFA 1IL0A 2PZKA 3GFGA 3BMQA 4K6CA 3B1JA 3LT2A 3VH1A 4IM7A 3ZWCA 2WTBA 4CUJA 2VN8A 5K6AC 1EQ2A 3KO8A 4BKUA 1T2EA 4IDDA 3JQAB 5A5EA 4QO7A 1DB3A 2UVDA 2I99A 1SZJG 4RF5A 1F8FA 4M49A 4RCVA 2ZK7A 2AEMA 2P5UA 1HDXA 1T26A 1J0XO 1I3KA 3GEMA 1QYXA 1E7MA 1GEEA 4XGKA 3RVDA 2VQ3A 4L8VA 1B2LA 1QXSA 1I0ZA 2Y93A 3QE3A 5BNFA 4OXYA 3DAGA 3IS3A 4BV8A 3RBXA 2YQ4A 3DBLA 2UV8A 4DBVO 2FR1A 3U3XA 1R4MB 1YXMA 5FI5A 1CQJA 2CZCA 3EDMA 3DZIA 4Y98A 3TN7A 3AU9A 3PTZA 3H2SA 3F4LA 4ZVVA 3ZU5A 3PXXA 3GMSA 4XDZA 4OMUA 1SNYA 2BKAA 3D0OA 3QA9A 3C7DB 4RDIA 1H93A 2VHWA 4DLAA 2C59A 2OMEA 4BNMA 4IQGA 4IQ0A 1KVTA 4J43A 3W8FA 3PHGA 4BNWA 4CQLB 5CFZA 1YWGO 2GDZA 1HDGO 3EW7A 1W0CA 4WCDA 4PLTA 4S1VA 4B4VA 1Y5RA 1YJQA 3E5MA 4KUEA 5K0ZA 3OA0A 1EDZA 5A5FA 3WTCA 1I30A 2ZB3A 2EERA 2JD1A 1UXJA 3OQBA 1K6JA 1PS0A 2DM6A 1B0AA 3ORFA 4J4TA 3GA0A 4MKXA 3OJOA 4DRYA 3GVHA 4LMPA 3H5NA 1LSSA 1YL5A 3MTGA 4AFNA 4K6FA 1VLLA 1C0KA 1GDHA 4D45A 3FNGA 5EIOA 2J8ZA 1E5QA 1UP6A 1GAEO 2EW8A 3K92A 3WB9A 3INGA 1ZSYA 2PH5A 3HB4X 1HDYA 3Q1LA 4P4LA 4RGBA 5CEEA 4ZQBA 4K28A 4CLOB 1GZ6A 3ZWWA 3VTZA 1DIRA 4WEOA 2DBVO 2AG5A 3ZW9A 3NEPX 3M2TA 4F6CA 3TDKA 2Y1OA 3ANLA 4FOOA 1ORRA 4NFHA 3ZWXA 4E32A 4DQUA 3TJRA 3WJ7A 3KYDB 4BVAA 4QQRA 4O6VA 2GN9A 1KVUA 1LQUA 4YTEA 1D4FA 1P33A 2B4RO 2IYPA 3FCOA 4Q3BA 2AQKA 2NQ8A 3SBOA 2CVQA 4Q3EA 3GMDA 4IXWA 1KY4A 1FJHA 2PY6A 2X0IA 3NTOA 4Y8VA 1NQAO 2C2YA 4JJFA 1HE3A 2FP4A 3OQ6A 3Q9UA 5JDIC 4UEOA 1ONOA 4OL9A 1P45A 3IIEA 3Q6IA 4KQWA 1KEPA 2WM3A 3PRJA 4DMMA 4M8SA 4JIGA 5EESA 3AFMA 4AJKA 4DUPA 5BR7A 4N5LA 4IJUA 1VI2A 1E5LA 4BV9A 1W73A 5JMWA 1P44A 5F21A 1BGVA 3EVNA 3RFTA 4B79A 1LBEA 1CDOA 4Q3DA 1E3WB 4R69A 5JYDA 2JD2A 4GLLA 3SC6A 3D4PA 4EDFA 4B8ZA 3IL2A 2Q46A 4M87A 1DPGA 3RU7A 4TRRA 5IDWA 3RUIA 4EBFA 3ZU2A 4YAJA 3F6YA 1FXSA 1IZ9A 1DC6A 5T6BA 3AY6A 2WYVA 3FSRA 2PLAA 1GPJA 1X1TA 1WLYA 4N54A 1PGOA 4BMNA 3VOSA 4A26A 1GYQA 2ET6A 3GGPA 1YH3A 4BKOA 1MC5A 2P2SA 5AXBA 4TRMA 4W4TA 3UHAA 4BKRA 4CPDA 3VKUA 1PZGA 2I66A 4B7XA 4B3JA 1OC2A 3VC7A 3PWZA 3ZWMA 2C5EA 4NU5A 2EG9A 1U9JA 1Z7BA 4TVBA 1C3VA 2C7GA 2CVZA 1QMGA 4RVGA 3AUUA 3L4SO 4LMRA 4J0EA 3AWDA 3MZ0A 5EQDA 4B3IA 4CV3A 4RPKA 4FFMA 4DGSA 1RPNA 1YQXA 1PJ4A 4CUZA 4OIMA 3FNEA 4U8GA 1EUDA 5FFFA 3OECA 2NTNA 3NRCA 3CIFA 3WLEA 1DBVO 1IB6A 3CZRA 2Z95A 1U2DA 2X6TA 4CLEA 3C24A 4HXYA 3PLRA 4XRRA 2FY8A 5G4KB 2W2LD 3OEWA 2GYYA 2GN4A 2D1YA 4BS9A 1TA4A 2YHUA 1F14A 1AUPA 1EMDA 1Y7TA 2GSDA 2XXBA 5I9LA 5LC1A 2PNFA 3M1AA 1HDZA 4GWGA 4RDHA 3K9QO 4OQYA 2RIRA 2Z1NA 1R6DA 5A9SA 5B4VA 5F1OA 2BGMA 1OBFO 2EF1A 4FIZA 2HRBA 5ILGA 2HU2A 1BSVA 1VPDA 1ZMTA 2ZTVA 2H1SA 1QYDA 1IHYA 3K2EA 4FFOA 2VWQA 1HZJA 4BNHA 4PG6A 5HWSA 4IDGA 1D8AA 1PJ2A 2X5JO 4G2NA 1MB4A 1RKXA 3KHUA 3DB2A 5TIIA 1PZEA 1PS9A 2F1KA 1CIVA 4IJWA 3WWYA 4WKGA 5TJHA 1J6UA 4M54A 3A28A 3RC1A 2BFAA 2EGGA 3H9QA 2OP0A 1B8UA 3JQ7B 2C0CA 2QG4A 1NFFA 4YXFA 1KEVA 3OSUA 4NJMB 4G81A 1MXFA 3UAGA 2V6GA 1LLQA 2C2XA 4ALIA 1X15A 2VYNA 2WYWA 2VRCA 5K9ZA 4YJFB 3E1KA 5DT9A 5IDYA 1A5ZA 1DOHA 4UVEA 2NU8A 4F46A 1HWYA 2VYVD 3E8XA 2D4AA 3JQ9C 1NFQA 1XDWA 4E4YA 3K6JA 1ARZA 3CH6A 4FBGA 3GVIA 4J4HA 3M2PA 3ULKA 3V1UA 4R51A 5A06A 3AOGA 4OOFA 3U4CA 4C7JA 4CMBA 4E0BA 3PGXA 4X54A 4LCEA 3RWBA 4BB5A 1UR5A 5GZ3A 1V3UA 1M66A 2X0RA
chains in the Genus database with same CATH superfamily
4Z0HO 1C4KA 1OFTA 1KY5A 1DRWA 4KMOA 2AOUA 1FTYA 3C1TA 2YMMA 1FPMA 4GP9A 5BRNA 4YRMA 1U0BB 4IFBA 2B2CA 4U8HA 4ZN6A 2B8NA 3ETLA 3QU9A 4BBJA 1DJQA 4RZQA 1Q83A 3T0IA 4X7PA 5BPHA 2ZRPA 3NVKI 2GN6A 4QOJA 4U2FA 2C2GA 4OBXA 2PKEA 3QKRB 3KM0A 3VH1A 5JXHA 1CRPA 2X9GA 1Y5IA 1LF5A 3KTOA 4JCOA 4RELA 1C7QA 1PD1A 2BFCA 3DLIA 3UG6A 4PWZA 3OEEA 1PL8A 5B37A 1ZESA 3VO2A 3U3OA 5H80A 4RVDA 1I3OA 3FPFA 2WFLA 1MRNA 5KTRA 4TXLA 3MK31 1DO0A 4V1CA 1J09A 1VG0B 4FSDA 4M86A 1YQUA 4LYEA 4UUAA 1N34B 5H16A 2A9OA 3AH8A 3KHKA 1XZJA 4KXFB 1CZUA 2V4ZA 2RHRA 2Y1XA 4FGUA 4HLCA 4NZZA 4M36A 5TNXA 2ATEA 2N9UA 3G23A 5JUWA 1CJKC 2IDMA 3RC8A 3B13B 3WRXC 2A4KA 4M9RA 3H4TA 3W6NA 2CHUA 2AHRA 2RIPA 4EW3A 1MO3A 2E6KA 1KAHA 2VH5R 1JYEA 4G1BA 3BFKA 2L17A 3P2EA 5ILQA 3SZOA 3TDMA 1KC1A 5BSHA 1EB8A 1BE0A 1UAYA 1TA0A 1N0VC 2DFVA 1T1JA 4E4RA 2G07A 5JS8A 1GZUA 4YAGA 5LXTA 1B26A 1OTYA 5BNTA 3TE6A 1Z16A 4WDQA 1U8YA 3DZ8A 1S89A 2E9SA 2YJ3A 1CF2O 2X8WA 5JH7B 2D6FA 1DO8A 2G9UA 4E51A 4OB7A 4UBIA 3KJXA 1ZNQO 3BL6A 1B42A 1JPJA 3OP1A 5FJIA 4G07A 3OPVA 4KP7A 2D59A 1L5OA 3A4IA 3AHDA 3SBDA 5CNJA 3TKLA 4CEHA 1RDFA 3IE1A 2J45A 4Z6KA 3K2BA 5DLEA 4J0IA 4TT3A 5EKDA 1Z5VA 3GNTA 2B25A 2NTEA 5EC8A 4BWFB 4TXJA 4DC9A 2CXUA 3UWSA 2VBFA 2GEJA 2V6FA 1C9MA 2YXLA 2ZJ7A 3OIGA 4RACA 3DE6X 5I5GA 2F8TA 3IOEA 4OB6A 4O4IB 4R8VA 4ER0A 1L9KA 4JXZA 1XTPA 2I4IA 1SCQA 3B2NA 2Q3EA 4OYHA 2IEIA 3A70A 3MWYW 2R1ZA 2GF0A 4G1MB 2FRDA 3VYWA 4AKSA 2VTEA 5HZKA 4B40A 3CXUA 2GARA 4NFSA 4QHTA 3TG2A 4AQDA 5JBQA 5I9NA 1RRFA 4ZQFA 3CRVA 2Z2IA 3ZEAA 1EBFA 2J5KA 5AW8A 3JATA 3CG0A 1K3TA 2R7AA 4XQ0A 3LBIA 4XJVA 4EPVA 5E1MA 4YRKA 1PP4A 4CKBB 3UB2A 2LZ0A 1FSPA 4MDYA 1SKUA 1LTQA 3F5QA 2IDZA 3AVXA 1GN8A 1HETA 2TMKA 3LQKA 1JB1A 3VR6A 2PUEA 4NULA 2HIMA 1YDFA 3OZFA 5HMMA 4I1VA 3RSSA 4QICA 3RYHB 5IUNC 3GDWA 2XSZD 3NORA 1KFJB 4B6PA 4CKWA 4WLOA 4BCDA 4CI0B 1I2CA 1N3YA 1NUHA 1QYRA 4MKRA 2YTZA 4MVJP 3P0FA 3RAJA 5DCWA 5AKIA 2JCVA 1TZMA 1V45E 1OZFA 1W75A 4FR2A 4KMRA 1BA2A 4KMMA 5EL0A 4EATA 1QB7A 1GPWB 2JFHA 4R9SA 3WL7A 1E1RA 1FP1D 3T5DA 5I7HA 1EXVA 3FPKA 1VDZA 2DECA 3VR4A 3ENWA 3S1LA 5CLLA 1HF3A 3AXSA 4EA7A 5CA0B 1TQ8A 2HB6A 4A8JA 2PJRA 4OLAA 2BM8A 2PTGA 3OQIB 4ENVA 3IQEA 5CB4A 2ODQA 3UGJA 1SVNA 3UIEA 1V7ZA 3HLTA 2B2NA 2ICAA 3EIEA 1AQ6A 2BH9A 3CISA 3MPUA 3OBBA 4FJ2A 5AFSA 1H9BA 3IVCA 4P82A 1GDTA 1QQBA 3EODA 1KJZA 1JJIA 1PQYA 5CURA 2NPFA 2HIHA 3C70A 3TTWA 3DVAB 3K70D 5JSYA 1JPUA 1H2EA 4K9MA 3B3FA 2W9XA 3BX1A 3N6RA 4FWBA 4PS1A 1QE5A 5AIBA 5IJZA 4GXRA 5JANA 2J0SA 4O63O 1K88A 1L5ZA 2JJ1D 3IE0A 3CVXA 2PE5A 4DPMA 1X8KA 3CW9A 1E2NA 3WHIA 5BW6B 2IYXA 3MWDB 5IMBA 2DRIA 2WTAA 4N6NA 2BE9A 5KNCD 2V55B 2B8WA 3TZLA 3ZGNA 5A3VA 1K7CA 4KJXA 3FNIA 1DX4A 1Y1QA 4PBRA 5CX4A 1ZQ9A 2CDRA 5F3RA 1VG9B 5I8PA 1LDEA 2QNRA 3CG4A 1H6AA 3L4EA 2YRFA 4X66B 3WWEA 5BMOA 2QENA 4DR2B 3F5FA 2W2KB 1O6CA 2J7PA 3WRVA 2BF4A 1GCUA 2GCNA 3OPYI 2E5FA 4XYBA 1D1SA 2GR9A 1MIHA 2GZDA 4BVJA 1IU9A 5K0LA 2JW5A 3GVCA 1E0KA 2UDPA 3NEJA 4B17A 5L4LA 3G2LA 4TS3A 4B44A 5ETJA 2Z8ZA 3RQIA 2ZWMA 1NXTA 2WUEA 4F84A 1V8ZA 1TYBE 2PRSA 3GC6A 4IDEA 1TZCA 4N0QA 1KZ9A 2NAPA 2FUEA 1FDIA 1XEFA 2V7XA 4H7IA 4L27A 5DMHA 4B2PA 2VHZA 4XWTA 2G72A 4MS3A 2WP8J 2B3TA 1V5GA 4PXYA 4NV0A 3FUUA 2PGLA 1NLUA 1GLGA 5DCUA 1EXWA 5FNVA 4MO2A 3TJMA 4HTAA 3MINA 4WY2A 5AYVA 4AS1A 2IZ0A 2OM6A 3IUQA 2G5CA 4P8RA 3SHQA 4LNUA 5E7MA 5EJMA 3G8YA 2BSAA 5K3FA 3KZCA 3CNNA 2J46A 3LA6A 3U7FB 4MV4A 5T6MA 2GHRA 2QTMA 3NWPA 5LXTF 2CXTA 1JBKA 1LDMA 3F9RA 4HFMA 1Z5PA 2WHEA 3C8DA 2IYFA 4P2BA 3VO1A 3HBAA 4PVCA 4X6XA 2QZZA 2F9FA 4FEYA 4B8YA 3WOHA 2QUIA 1L7EA 5F5LA 4ISBA 3DWGA 1JHVA 3IVMA 4KW7A 1HQKA 1ULZA 3O2JA 1YMUA 3GHHA 4WNIA 2G0NA 1YR9A 2O2JA 2G77B 1FYFA 3KT8A 2WZBA 3F8SA 4UBMA 1T43A 2AD5A 4BB6A 1GXSA 4QELA 4BVBA 1ZU5A 4QQ8A 2RARA 1BE6A 2B5VA 4BMXA 1AMOA 1FP7A 1CY7A 3IAXA 1NU8A 3ZNQA 1VRWA 2IU0A 1EJ0A 4JLAA 4F3CA 4KOAA 4LXYA 4PYLA 2B1GA 1GZHB 2FB9A 4TL6A 3OQMA 5D7NA 1GQ2A 5K0EA 4LOJA 3KE9A 4QGBA 4RULA 3U4QA 4BJHB 4V0LA 1WUTA 2VYND 3MT9A 2PBRA 4LJ7A 5IAEA 4BMOB 3BWMA 4EHAA 1LKZA 4BP9A 1P1JA 1T0UA 2V7GA 1XT6A 3OKAA 4GR4A 2C2KA 4Z86A 3HB9A 3PS9A 1LW6E 5CM8B 3U3ZA 4XDYA 2CT8A 2HJ9A 2I3BA 2CFSA 3WKCA 5KVCA 1PZXA 1Y37A 2GNAA 2IYEA 2VDWB 2W6QA 3NRBA 3OHPA 4L9SA 4MQFB 1OT5A 2RHWA 4Q1FA 5AVKA 3C3PA 3WL5A 1RC8A 1HXHA 1HM5A 1NVEA 2W2OA 1OIWA 2C95A 2WDPA 4OI1A 3I5MA 4C87A 4J6FA 1II8A 2JAQA 2D5LA 1QHFA 1SMKA 2VQDA 2HPZA 4QVKA 2IDJA 3ZOKA 1TB4A 4JLBA 4DDUA 1O6GA 1BC5A 3GUHA 3LLVA 3SJ7A 4BNVA 5ER6A 4LDZA 1PX0A 1BRMA 1DELA 4XWWA 2PMKA 3PC3A 2H1OA 1XNJA 1G63A 1TCVA 1UM8A 4R7ZA 4UUPA 5FX2A 2BH2A 1QFMA 4G97A 2XLCA 1W29A 3GN1A 1JFSA 5CBPB 4PZPA 1CJCA 1OROA 1U3DA 2VJBA 4BO4A 1KMCA 1KS9A 3QE2A 2QORA 3JTMA 4OK6A 5JS2A 1QHGA 3RSFA 1YB6A 1IY9A 4QDOA 5BVGA 1J99A 1AZWA 1ZX1A 2JBAA 3QLJA 4ZOLA 3JYOA 6YASA 3IEMA 1S8AA 1R8QA 5CT4A 4NJEA 2CY0A 4IFIA 4QARA 4W9MC 1TM4E 5CB4F 2QMOA 3D3NA 3I2FA 4MV7A 4U0JA 3PHLA 1ZH2A 2X58A 4X95A 3UN1A 4L78A 4HVCA 2Z30A 3B7WA 1WCIA 4BE7B 1IY1A 1GL7A 5JSUA 3QI2A 4LSMA 1A9ZA 3IMCA 3MMSA 5CUQA 1P2UA 1JAIA 4HZGA 3ER6A 4Z2YA 1F2UB 4EG3A 4IWNA 1JJAA 4ENSA 2LDXA 2QTGA 3SHWA 3RODA 2R7KA 3QG5A 3WGHA 5T5QA 2UUAB 4PC6A 4JU8A 4CQLA 2QN6A 1Q7RA 2ADOA 1L4KA 3NBYC 4CT5A 1XZDA 4D9IA 2V3CC 2X15A 1BHSA 1TZJA 3VOTA 4DMCA 1DC5A 3UUFA 3VR2D 3VA7A 3HVJA 2BFFA 2IYZA 4UXHA 3OOYA 2O3TA 1CRQA 1XAJA 5GONB 1KK3A 1RLIA 5GJVC 3O7WA 1GTJ1 3ASVA 1M6VB 2IXGA 1CLEA 3DNMA 1UK9A 2WQZA 3SGLA 3ZE8A 3HZHA 3SS7X 2RI1A 2DY0A 3VPCA 1NVVR 4TRNA 4P7KA 2XNJA 4EYOA 1N7HA 2AFHB 1L4MA 4D44A 3RFFA 1QFSA 1P6UA 2QX6A 4JX9A 1GA1A 1FL9A 2WYUA 3DZJA 4WZBE 3HK2A 3MNFA 2VAXA 4G5HA 2Y0DA 3QOXA 3VXKA 4Z8YA 3ZQ6A 3GEGA 1ANKA 1CP3A 5BXYA 1NF8A 2ZS8A 1GCOA 3TOZA 4ITRC 1TDJA 2VUUA 3OBIA 3C8HA 4ZU1X 1VB3A 3I92A 4KN5A 3WJAA 1RHJA 2JH9A 3GUZA 4EJSC 1TF2A 5LBIA 4CF4A 4I46A 2FZWA 3LF2A 4JBXA 4YO8A 4W5NA 1VKOA 1L5VA 5FNVF 2WR8A 3M5PA 1S2DA 3U7RA 4CLRB 2IUFA 3KSAC 3DLHA 5FEMA 5HFNA 2OZLA 2QVGA 3KJZA 1G6KA 2BD0A 2NW6A 5K0CA 4WFQA 2OSBA 3D2CA 1LBTA 2WWTA 3FGNA 4AVYA 4HN2A 2A6PA 1K9VF 2B7LA 2LDBA 4MUFA 4D8YA 3VZPA 2XAAA 2FQ1A 4YHBA 5B30A 1JFVA 5BQ5A 1GDDA 1UPCA 1C8LA 1SIBE 5K03A 3DOHA 2IPAB 3KSZO 2FYTA 3QVTA 4P3KA 2BGTA 1VIYA 2JHPA 1RRKA 4LGYA 1QPBA 4P0PB 1XF1A 1RHRA 3LQ4A 1U28C 5TRTA 4NU0A 3C16C 5DI3A 5E6UB 4NPAA 1R66A 4LF7B 3CHYA 4AJLA 4FMPA 2HSWA 2YW2A 1KXJA 3LCVB 2OXRA 3MD9A 3CLUD 2BEVB 1JG7A 1TUBA 5FL7D 3FDJA 5ERXA 1H42A 4LS3A 5D8DA 5WRFA 3B8HA 4DDMA 2FMIA 4WWHA 4TMZA 1PIWA 5IULC 1YS6A 3EC2A 4TTAA 2YS6A 3AHEA 2I2FA 3AEQB 1JG6A 3EFBA 1GNRA 2QQ0A 1QHHB 5KNLA 3H1FA 3EEIA 2XLBA 2PVCA 3EGXA 1E6KA 3OZGA 3H4MA 3ZS8A 1EVJA 4OPMA 3GLFA 4MDFA 3IP7A 2NADA 3OM0A 2B1IA 1DIGA 2H54A 3MVEA 3P0HA 2A9PA 4HFNA 4HLNA 5D5PA 1LVUA 4BV2A 3LIPA 1CETA 1DEHA 2JRLA 1Z4KA 3HEBA 1Y63A 2VRBA 1ZN8A 3DD1A 3F71A 4DARA 4E88A 5K8CA 5JJLA 4LZPA 4MVJM 1QPGA 1YB4A 2W2TA 2WYHA 2L19A 2XIJA 1KMMA 3T3DA 1M54A 3A58B 1DDIA 3G2HA 3NBKA 4BNDB 5ISMA 5JCPA 4U7WA 1JNYA 4C4SA 1F0PA 4DS3A 1VE9A 1N6RA 3G5UA 4DLWA 5DTRA 4PICA 2ZDHA 1NQWA 4TN1A 3REQA 1BXZA 4ZA2A 4PC3A 3C6KA 5AVOA 2O8VA 5HUJA 5H8WA 1NNEA 4DNOA 5CIQA 5LLSA 1F8XA 1Y1LA 1XR3A 2KJQA 3A4TA 4DSZA 4X45A 4UVGA 3A6HA 1TPZA 3FTDA 1HE2A 4KAAA 3PZRA 1UBJS 721PA 2YZ7A 1DRJA 1TFUA 1Z73A 3PPIA 2G80A 1A9OA 3VO9A 2AG6A 4YUXA 4RA6A 2EIXA 1DBWA 1P8AA 1JT9A 2P6MA 1DXOA 1JEQA 1Q0LA 1GLVA 1QX3A 1TYCA 3H5IA 2YVLA 1I2ZA 1Y1SA 3R7LA 5L7WA 3V3TA 1IBKB 3I01A 3P9ZA 1XA3A 3RG8A 3O6VA 3H5RA 1BDBA 1JSRA 3FLAA 3ZI0A 4ZOLF 2NSJA 4EEXA 2ZYHA 4KK4A 1J2RA 3RS2A 4YMTA 1YJBA 1S7GA 1VJTA 2QJOA 3HDGA 1GAQA 2FAXA 1TAHA 1OXBB 4Y2PA 3DXYA 4YHHB 3IP8A 4KQEA 4TWIA 3CM0A 3QELA 4K9KA 4NEGA 3G9TA 1CYDA 3N0RA 3LCMA 5JG7A 2DPMA 3ZV4A 4HAIA 2DUJA 1NXSA 4GGOA 4Q21A 1PYGA 2BBWA 2JVKA 2Z2XA 3I1YA 3L82B 4DREA 5EIXA 5ILOA 3L1UA 4ER5A 2OY0A 4BMZA 4BVEA 1YDWA 4MUIA 4GHWA 1DHTA 2ATIA 3FA2A 4HGNA 2Z43A 1EVZA 2VEDA 1SUDA 1OVMA 2XJ9A 3Q12A 4J7UA 5DSZA 3TNDA 3S1SA 4EUFA 5KSOA 1TGVA 1XV5A 3F96A 4PX9A 4JSTA 1ORVA 1BXGB 3H84A 5D84A 3VZQA 1KMNA 2XB4A 4XCQA 5LQUA 2XTZA 3AESA 1XNGA 2UVPB 1PV2A 3K09C 7REQB 2ZITA 3E48A 3GRAA 2ZKLA 3G0GA 2QTLA 3A25A 3O4FA 1CX9B 2G71A 3ORHA 4LI3X 2E6UX 4S1NA 3AERA 3QLEA 5FI1B 5B1IA 4F4HA 5BMVF 4YMLA 1Y7LA 1QLWA 2V7QA 1JAHA 1T3HA 2ZTUA 4HC4A 2WKRA 4WOPA 3W4IA 2R79A 1V3TA 3HJRA 1KPGA 2E5WA 2GJ9A 4FZVA 1TI7A 3LT4A 2J9RA 4C01A 5KNBD 2JGIA 3WZ2A 3HFRA 1M9NA 4OHUA 4R5HA 4LBZA 1JYSA 2MSEB 1HI9A 2JAHA 4HYEA 5LDHA 5FOTA 3KD3A 4X8MA 1T8TA 2I1WA 4WH0A 1ECLA 2WWWA 3K1TA 3U7IA 4KKXB 3AFGA 5CFOA 5I7AA 5ALRA 4BFVA 4OYRA 1H5QA 4MKHA 5IYZF 1AA6A 5FUYA 1VXRA 3PR1A 2WA2A 1BTOA 1FP2A 1U7OA 3DA8A 3Q8KA 2XOKA 1G8MA 4IKEA 2FNAA 5E6SA 1QOZA 1KARA 1KDYA 3ZKWA 3AETB 1FQWA 4IRUB 3U0BA 1ODCA 1YR1A 1MTZA 2J9YB 2PCLA 4YYEA 4Z7JA 4DR1B 4YJFA 5CM9C 1VJ0A 3O82A 2JGDA 3TBFA 2PGXA 1TLFA 4CLXA 2NVOA 1VL5A 4TVSA 1NJSA 3G85A 1M0EA 2YV2A 3K05A 4H2DA 5GQSA 3UMFA 5IVPA 1H6CA 4RTSA 2OHIA 4YAFA 3SM3A 1YJ8A 4E1BA 1EUZA 4F1WA 4ZAWA 5IF9A 2XQJA 1U7WA 3NJ8A 5H4GA 2C5GA 4JAVC 4FOTA 4ZRDA 5A6SA 1MU0A 1ZA1A 5DBGA 4JV5B 3Q7SA 2JLVA 4WY8A 4Y7CA 5CDFE 1KGSA 4R1MA 5EHIA 5EPOA 1OX4A 3Q8LA 1E9FA 1NATA 1KQNA 3RLFA 4DM7A 3FKJA 3GLGB 4PLYA 1RZRD 2EBUA 4NE7A 4KLZA 4RY2A 1JKFA 5K3BA 4BVFA 2BEUB 1IFXA 3E9YA 1GOTA 1GFWA 2X14A 1W5EA 1KVSA 1J0BA 2BFPA 3NXKA 4FYYA 2Z6QA 3D64A 4M8IA 2HDWA 3O91A 3IDOA 2X8AA 3IKMB 1FPQA 4LJYA 3RC2A 3CE6A 1GRVA 2JDIA 1RJDA 2VXOA 3GLQA 2L0XA 4FI3F 4RD6A 3RR2A 4O2BA 3TAHA 2OCKA 1W2WB 2QX4A 3EGDA 2ZT5A 3OLVA 4MWZA 1JWLA 4JLVA 3V4RA 4FNAA 3RTDA 1GGKA 3IP3A 1WEHA 3I64A 2SKEA 2YXNA 3I1IA 3TSOA 1XZCA 3ZUGA 2CHQA 3KB8A 1N7IA 3N1UA 4QWMA 4LF5B 1TMOA 4KWHA 1V1RA 1MAHA 1ZR4A 3ADDA 1JDBB 2EJBA 4A15A 3F6SA 2DQ4A 1EVQA 4QNMA 1VYVA 2JI8A 1P4RA 4MUHA 2FJUA 5KJEA 4I66A 3R74A 4AICA 1HLDA 2G6BA 2QAIA 1Z29A 1JAXA 1LX6A 1Q0ZA 2R1VB 4O0LA 4A1FA 2XDAA 3RW9A 2JIOA 2EYUA 2OLEA 3O31A 1IN7A 4HXGA 3AHHA 1YBMA 1FW6A 1C1XA 3AKDA 2X0NA 4DCNA 5JYBA 5BSRA 1JHXA 1JLSA 4UFOA 5E95A 4NATA 1F5SA 1A8QA 4CF7A 1LVHA 2P9BA 4GX2A 5KS2A 1BYUA 2IS1A 2OOKA 1Z6GA 1I5OA 1U0FA 3WB0A 1Y8AA 5KC8A 3D31A 3L02A 5JTUA 2EKPA 3B1FA 3CZMA 5IRCD 4DJFC 3H99A 4MXDA 5ICSA 1RYDA 1K2WA 1JVBA 1AV7A 1SK8A 1UFKA 1VB5A 3D6JA 2FFAA 3PHCA 2VP3A 1ZM2A 1RKUA 1T3GA 4MS4B 3UCXA 4NXNB 1RPAA 1RWBA 2YFYA 3BZBA 1OXMA 4KOEC 3Q8XB 1J2EA 2H2DA 4Y2RA 3IRUA 1YVPA 3ZU4A 4UTZA 3GA5A 2IPNA 5LQKA 4GZ3A 2C54A 4KGZA 1DWPA 2BFBA 4KPUB 1P74A 3T3OA 5H3HA 3PIIA 1VMKA 4I6JA 3TZHA 3PHIA 1XPOA 3H0CA 3V34A 4C2TA 3UGTA 2XI4A 3KD2A 1GPLA 4QXRA 1BYIA 2C58A 3HBJA 4BMYA 2IHNA 1JEAA 4IMPA 2QHXA 1R0WA 3SY8A 1MO5A 2CCKA 4LK3A 4DSNA 2VDLB 5IJ9B 1YOBA 3SJAA 1CNFA 1BU8A 2R6HA 1NE7A 2HBQA 4IW3B 3HSYA 4JS0A 1JIIA 3DM5A 4U5QA 4E1AA 5HQTA 2I22A 3LQ1A 2XCOA 3DZHA 3DWFA 4DGQA 5IKXA 4RPJA 4LFCB 1OFHA 3P2YA 1Q1QA 1TGYA 2AOTB 3JD4A 2GLTA 5DMXA 4F3NA 2AFVA 1VI5A 1Z74A 2FSGA 3K4QA 3CZCA 2GK3A 3A1UA 4F46A 1PJAA 4ENUA 2EV9A 5BWLA 2X2FA 5KTOA 1F8UA 2BELA 4P3PA 2IZ5A 2AEFA 3F73A 4HDSB 3PYLA 3OA2A 2VTKA 2H4HA 4FUTA 3TQHA 2R8BA 2WVJA 3GAMA 4Y1FA 3T0FA 2Q8QA 1NNI1 3DZBA 2A7XA 3T3GA 1OFGA 5AT1A 4C03A 4M9ZA 4MS1B 1X7XB 2YWXA 3L0OA 3L43A 3NBFA 1SELA 3OZVA 2ZYWX 3OIFA 5HS4A 2PSEA 1X38A 4BYMA 2PAAA 4ARUA 2V0NA 3DDHA 3JWGA 4TXHA 2X6QA 4UNIA 2ZXEA 1CJMA 1J8YF 2PFSA 2FOIA 3PHHA 5AVJA 5C3UA 2AW5A 5E4JA 3FGOA 1K5PA 3RRXA 3O21A 3CWCA 3LUJA 5KNDD 5D7BA 5C5DA 3CKYA 2HFKA 4N0DA 2QE7D 4L8WB 1OBHA 4DCSA 4I6GA 3O2SB 3D7MA 2BDTA 1X1DA 4ND8B 3QFRA 4EQ6A 3NHPA 4K03A 3K1YA 3ICQB 2ZFUA 3GFSA 4ZCQA 1I0IA 2A92A 3LA8A 2W4QA 1IK4A 1P2BA 3DNFA 3P7MA 4XGIA 5T3YA 5T64A 3GLHA 3KK0A 4FNOA 3MLAA 5F35A 3CH5A 4HADA 3FNHA 3U48A 1M5RA 1ECJA 1OIXA 1R0CA 4KE7A 5HJ2A 2HADA 3SIPA 2AI2A 3VJRA 2C0PA 4Q4AA 1Q1AA 5F2EA 3QKIA 5ALYA 1YTUA 2Q0SA 2WABA 4BZXA 3Q11A 4CHTA 1CPYA 1ULUA 1GCAA 2BTQB 2RGWA 4M76B 2CUTA 1L4HA 3KB1A 3R3UA 1EHYA 2XODA 4G09A 1QOPB 2PD4A 1UDRA 5AKEA 5LMUB 4MCAA 3VHXB 1I9GA 2OXEA 1GSIA 4WNCA 4MICA 2G5GX 1YNSA 1P1FA 1W6RA 1T34A 2H8GA 2VHEA 3BD9A 5ELXA 5DYNA 2IOQA 1ATZA 1HYBA 4BFZA 1G41A 2K6GA 2HQSA 1RI5A 4X00A 4YJHB 1QP4A 3PJGA 2N46A 3ZJTA 4EA6A 3E03A 2J4FA 2BV3A 3CO0S 3FWKA 3GAZA 3GPDG 6AT1A 1O54A 3ROFA 5CDUA 3A1TA 2FMUA 4PAMA 3AM4A 1VCMA 3PP8A 1SUPA 1A9XA 1CTQA 3K2IA 4O2BF 1Q84A 1BW9A 2J0EA 4ZI2A 3JQGB 5ESRA 1CUYA 2ZB7A 3SOPA 3RARA 3ZWQA 4BU1A 2Q45A 4RXMA 3FW1A 3QNWA 2V7TA 4W7IA 1NVUQ 2C8KA 1R4ZA 3RDPA 3W5CA 1E2PA 4HF7A 2WM2A 4IO1A 4P93A 1U8TA 2QJFA 3KV3O 3PE4A 2PKYX 4FSXA 3VPFA 4D92A 2XYGA 1IHPA 1HT3A 3KJIA 5C4MA 1TKBA 2ERCA 3ZK7A 4G25A 3BWVA 2QLJA 1SQ0A 4QQKA 2Z04A 3D3EA 1EFLA 2XGGA 1C3JA 3ZE7A 1UOQA 4XWYA 2Q4DA 3RVJA 3TI9A 2XXAA 1D6NA 4OU5A 1U2GA 2PWYA 3KOYA 3PFGA 3A1NA 3MXOA 1YZ3A 3UKJA 4MX8A 3PDHA 5J1TB 2BISA 4N0EA 1Q7CA 1SK9A 1Y9JA 2O7VA 3ZWNA 5I7VA 3Q7QA 3AJAA 3PWTA 3R9XB 4DV0B 4EFLA 3BJRA 3GP8A 2BFEA 5FD8A 3HRKA 3OIDA 2Y68A 3IXQA 4LTDA 4HDKB 3TMYA 4KN8A 2FKAA 3R0IA 3IUJA 2O4CA 3M6VA 4KH1A 4AJJA 1VKHA 1YQGA 1ZK3A 3CC8A 4YT2A 3L0SA 3QX3A 1JJVA 3T7CA 4DG8A 4HDQB 4JUIA 3C8ZA 1CEYA 1QWOA 2R00C 2A5GA 3CVUA 1R9GA 4QAJA 1CFJA 3V8VA 1D04A 1N3BA 4LXUA 5FWXA 3VKGA 3V6LA 4KVZA 1RPZA 3R7AA 2QY6A 1JQDA 3FTCA 3IEPA 1XOIA 3OWOA 4MGYR 5AJWA 3QJ5A 5LN1A 2WJGA 4C07A 1OY1A 3GNSA 4YCSA 5HYVA 5KSWB 2ZJ5A 4CCYA 1VBMA 5JNWA 2YUIA 4L73A 5C32A 1RIFA 4I4NA 3GEBA 3RG2A 2PMBA 3TTUA 1T8PA 1MQ9A 1UBUS 5CT9A 4B71A 1USWA 3JVDA 3OPNA 4ND5A 3FSJX 1KVRA 5FI3A 2XB9A 2PT6A 5IJXA 1V1MA 2FZGA 3QPWA 1Y9EA 2H18A 2JIZA 4UD6A 4M1SA 1C3OB 3BMOB 1DX9A 4OMFG 3AKZA 1ZM9A 1Z9BA 4DNFA 4FHFA 5LUBA 2LD4A 3ROQA 3QYJA 4IVRA 4KV7A 4OOEA 3DW1X 5EJ2A 2WNIA 3ES9A 3FKSD 3JVUA 4C88A 5C1DA 2AFHE 3VV3A 4DDKA 1TVCA 1T2DA 2DKNA 4B48A 5BVHA 3NIDB 4JC5A 4ENTA 2J3EA 4LJ9A 5J23A 1UWCA 4IVNA 3NWJA 3OIVA 5E3IA 2FXIA 1W5AA 3A4LA 3TUJC 3ZWKA 3HJFA 3EDQA 3N6XA 2JA1A 4H7KA 3LY9A 5AM1A 5E6RB 5FHRA 3LUAA 4DUGD 5BN1A 2PU5A 2OHVA 4O2AA 4B6FA 3U44A 1O9GA 1XEAA 3A11A 4R7GA 5BWMA 2EQBA 3AI2A 2YY6A 3BWCA 1G3MA 5DTIA 1DTEA 4A2WA 4AO8A 1AKTA 2WJIA 4QBGB 3IBTA 4YP1A 4MUMA 3D8RA 1CYEA 1QV6A 5HQ3B 4ODIA 3FWNA 3KKZA 3DMTC 3GBVA 1U7TA 3FUCA 4H9GA 1Y1PA 3BQNB 4K1XA 4KIWA 1CR6A 2GEDA 1C9YA 1AS0A 1EA5A 3CJTA 3PQ8A 4C2BA 2J0QA 5COQA 2JJ8A 4JVSB 5IBRA 4AYXA 1NZFA 1TM2A 2AMLA 2CK3D 3D3KA 2DR3A 3STHA 2GJ4A 1XELA 1NUUA 1YO6A 3GRZA 3KWMA 1G0OA 2X1LA 5EE5B 4Z7NB 2AI1A 4Q18A 1E6MA 5KSPA 3T5CA 1JTEA 1JRLA 3U60B 4NNOA 3ZWDA 5DHFA 1G5HA 5KKCA 1KR5A 2FN9A 2HHLA 4LRXA 5DYYA 4B46A 2HA5A 4PXAA 4DLSA 5B5SA 5CFNA 2L18A 3GCZA 3Q7TA 4C5CA 4Q3CA 5ALHA 4RD4A 4QEDA 1DAEA 1E9EA 3H1EA 1HFEL 4QU5A 4F8EA 2A5DA 3CPSA 2NSLA 1MGPA 3QVXA 4EP1A 3ESCA 4AK9A 4PAGA 1A97A 1Z45A 2FK8A 2P2LA 1JMKC 3RTCA 3WGJA 4KQ2A 1ICEA 5DYTA 5IBQA 3DMHA 4KQ9A 5HVNA 1Y89A 3VSDA 1AY0A 2VC2B 2WVHA 1T5TA 5HKOA 1KRXA 2OBBA 1SM4A 3GCDA 3TH5A 1QKKA 1KZHA 1B1AA 2UUPA 1UBLS 1FVXA 1F3OA 1KI6B 4UOQA 2MOKA 1J9EA 2A30A 1MC4A 4Y18A 1ZRNA 4GLFA 4TGLA 4WGGA 4LDQA 2IOFK 1K7SN 1FNCA 3TINA 5IF3A 1ZD8A 4ABYA 4D0GA 5DXJA 5EY5B 4BLRA 3H86A 4J1TA 3LK6A 4MQMA 4XJXA 1O6BA 5EUQB 3F3MA 4YJ2B 4QYSA 3S5UA 3LSYA 2GM3A 2I7TA 2CDCA 4G0UA 4ZDJA 4UJ3A 3CVJA 3JZDA 4NDZA 1KBQA 1GP2A 4QATA 3BJIC 3WDSA 4H7PA 3MA0A 2D1TA 2NV6A 1FNBA 3NKLA 4ZPJA 4F3RA 1E2KA 4FYJA 2F3QA 4CF6A 1XKQA 4G41A 4XKJA 3KB2A 4MWDA 2Q3CA 4BO7A 3CR3C 3PBKA 2P4UA 3ZHUA 1ZG3A 2WHXA 5M34A 1B7GO 2K7FA 5DNUA 5LA6F 2JL1A 4WZ6A 4B73A 3A3KA 5IEBA 1C3LA 3HSKA 3L8CA 1ISHA 5K45A 1FX0B 3T1HB 1EFRD 2IEGA 1VJ5A 3SFZA 3N87A 4GYYA 2DFDA 3F97A 4IWXA 3SDBA 1OKKD 4ZEVA 3IPLA 3QU4A 4TYYA 5BQPA 3L6RA 1UEXC 2W43A 4W9NA 1B0PA 4M8KA 5FF9A 3AVYA 4YRDA 3HXTA 4FIDA 2IGBA 3U31A 3N8IA 2UU9B 2Q0XA 4L76A 3H7AA 4IF6A 1JI0A 8OHMA 4R84A 4RABA 1NQOA 3SIRA 2CBZA 5BW4A 3PUWA 4HH3C 2YN4A 4RO0A 1T9GS 3CRRA 3LW7A 4D0LB 5AVSA 4L16A 4PCAA 4XUCA 1H94A 3JAKB 1NR5A 3JQQA 2DWCA 3BWXA 1OASA 3T3MB 3MQFA 2BDEA 3AHGA 2XHEA 1OF1A 4OXQA 1PQ4A 4BU0A 2ZAYA 4D02A 1HEIA 4DDTA 1W7AA 3FYDA 2IP1A 2QTNA 3Q9LA 2O2EA 2ROQA 2VHVA 4K81B 5LSAA 2JFWA 4HLUC 4LHYA 3VKVA 3DYBA 5BWOA 4OMCA 3DZKA 1JDSA 5COAA 5LOVB 3VNAA 2ZYUX 1RABA 3O1JC 2HXYA 5HPYB 2EGHA 2YZ2A 2YNMC 3JXEA 1BMFA 3LWBA 1ISSA 1BGXT 3NPAA 3QKTA 2O2SA 4S35A 3W7VA 4DR6B 4JFAA 4KV9A 3DLAA 1ZH0A 3CUUA 1CUUA 4YWJA 1MFPA 3F1KA 4FGJA 4LOAA 5JFOA 3GPLA 2HT6A 1FDOA 2WEKA 4B9EA 4JVMA 3KSDO 4UAJA 5REQA 5M5BA 4FOSA 3CZ4A 4MGEA 2JLYA 1S9HA 3MBOA 3FCYA 2LRHA 3FSGD 3C41J 2BMDA 2O07A 2A33A 1KH3A 2WK1A 4MRPA 2IF2A 3NVMB 3FBGA 4A6EA 3SSOA 4Y2SA 5TVKA 2FR8C 2VK2A 1RYEA 2YFQA 3BXFA 4E11A 4ZFNA 1GSOA 1SH7A 3R3YA 1R15A 2XNDD 1GTRA 2YJ6A 3KT6A 3TW0A 4MROA 1GPUA 2ZIAA 3FI0A 1VOTA 4MQEB 1P7PA 5JCJA 4G86A 3J81k 3HADA 2ZEJA 3PXDA 3R3SA 3E7DA 1C1HA 3UAXA 4PYJA 1D6SA 2XYPA 4A82A 3V4LA 2QLMA 3DKVA 2DPXA 4B47A 5K6TA 2FFRA 2GM9A 2CZQA 2ZATA 4NECA 4PYQA 4TTQA 3UGKA 1HFJA 2IDKA 1P1KA 3LVRE 3BDIA 4UU8A 4HPJB 2LUOA 4YRLA 2EJUA 4CL3A 5ITZA 3BMCB 3OZSA 3RV4A 1JQKA 1VHTA 2DPYA 2WHYA 3GNQA 3HJBA 3VFDA 3ROPA 1NY6A 5KVAA 3BMQB 2PVSA 1T0IA 1JHDA 2PKXA 2X8LA 1TEZA 1FVOA 1KI1A 1WDTA 1U1DA 3CFYA 1VCIA 2LWIA 1XQYA 4UM7A 5EWMB 1ZC3A 1GARA 1JG3A 1ZL2A 4OXKA 4YUYA 4LJ8A 4LA4A 5TS2A 1UJ5A 1W76A 3H8VA 3LFTA 5IKOA 3QUQA 4NXMB 5BSMA 4J2OA 4OHOA 1P9RA 4HBGA 2NMVA 4MVXA 2GK4A 2VK8A 2C98A 3DHNA 1UJBA 4YCJA 4DCGA 3AR6A 3KUKA 5AK5A 2FR0A 4WZBA 2JZOA 4ETMA 4OAOA 4ZHQB 2EGUA 4Z7OB 5K3DA 1AA9A 5JAUA 5A3JA 1JEEA 4GUAA 1PT6A 1GPH1 3TLCA 4GOMD 5L3QA 3GLGE 2GUGA 2O8BA 5KYWA 1MPTA 3SQLA 1U5BA 5H82A 1M8FA 3OLYA 1CVLA 5FORA 3LK7A 3CE9A 4PO8A 1OXVA 1ZCBA 1VECA 2EJWA 2VBCA 3PDIB 5DLYA 4H3KB 4B33A 1YDMA 3GEIA 2JEOA 2V5VA 4H7EA 2R1UA 4MA4A 4OQZA 2JFOA 2W58A 1UMBB 1NHGA 1I4LD 1U3TA 3GZTB 3NS7A 4G5GA 1QYIA 4ND7A 4QUGA 1KERA 3VX4A 1N5JA 1W5SA 4QGAA 5CK4A 4ARVA 4C4OA 1L5HB 4M0KA 2WUGA 1SHTX 3DOCA 3EG9A 2YMQA 1AG9A 2JGMA 1QANA 2FUG1 2L2QA 3LY7A 3EQ6A 2BHLA 1TADA 3WDKA 4MVJG 1KEEB 2D8AA 3A3YA 4EFMA 4URVR 3PQFA 1KU6A 3F0TA 4QYIA 4ZRNA 3KSUA 5TGZA 4QECA 4MA0A 4TXMA 3B48A 2GCOA 4UJ5A 2BZSA 1HT0A 2X40A 4AMYA 5JD6A 1U8CB 3AUFA 3PGKA 4LGVA 1Z4JA 5AKYA 2V59A 3RJ9A 3H2HA 1QWSA 3S4YA 3HDYA 2ZJYA 2XVXA 4W6ZA 5B3LA 1WVIA 1W1IA 3ZY6A 3MCWA 3QX8A 3LUBA 1MRSA 4EFDA 5H3CA 4EHHA 1LEHA 4ZMSA 5JC1A 1OH6A 1Z38A 3M6FA 4FOLA 5EAIA 1C3XA 1IRIA 3UWDA 2NPOA 5IXYA 1YE8A 4K2HA 4QTTB 3AGQA 5K6AA 5JZVA 1E2FA 1T6XA 3CSDA 5E3HA 5I7FA 1UXHA 1KMQA 1JXOA 4MPRA 1SUSA 4DQLA 2VDRB 5J4VA 3CNHA 4CKEA 3FVWA 3HCDA 1UZNA 1JQBA 2F4NA 1A2QA 4EB6B 1JHAA 1ZGZA 2EJTA 2XDYA 2R4TA 4Y9DA 4DBLE 1FYXA 3CF6R 4Q3AA 2FDCA 3QV1A 3K0EA 4Y1EA 4AJ2A 1L1EA 1I51A 4D74A 5JZ9A 3PQ3A 4C20A 4TTVA 2VRWA 4FR5A 1M67A 1TZBA 1XTSA 3B78A 3LQQA 3V4OA 3WDMA 4CMGA 2VSOA 2OD9A 4JT9A 5YASA 1JFRA 1QAOA 2IWRA 4K05A 4CIYA 5JAMA 3DHYA 4NZNA 4TL7A 3RASA 3DXFA 3GRPA 1YS1X 3RABA 3ZCXA 2QTZA 2R4UA 2JKYA 3MRTA 3E9EA 3EUFA 1IBRA 1CERA 3AF5A 5HKKA 2BEJA 5BN3B 5KSZA 4AJIA 5FLEX 3WNDA 2XAUA 3EAFA 4NE9A 3U0VA 1A9PA 2JJ1A 2NO9A 3KUCA 1BVYF 2W8ZA 4UHDA 5JC8A 3IV6A 1BXRA 1XCGB 4OP3A 1PF7E 1JXMA 4U3JB 4P32A 1GG8A 4WCVA 3OF5A 1BHQ1 2FP4B 2AX4A 4W8GA 2VHTA 2LR0A 4RUKA 3TLGA 4FKBA 2Q0QA 1P3JA 2VHXA 1LPPA 1T6YA 3LYUA 3NV7A 4X6UA 4DQKA 4F5EA 1JBEA 3MAAC 3HP4A 4D82A 5A3RA 1LDNA 1G20B 3KPVA 5JZBA 1RYHA 1OU4A 2I9PA 4RQUA 2QLTA 4CI9A 2RJOA 5C18A 1X9HA 3PA6A 5EUCA 3ZWYA 2DBZA 4DIOA 3IVXA 1NJGA 4MJ7A 1U2EA 4RA9A 4FCWA 3X2SA 4D81A 2OPHA 4EF6A 1PKXA 1NNUA 2GOYA 3QVKA 2EKBA 1NOKA 1AZTA 1FDRA 1LK7A 2Q41A 5EZYA 3EDCA 1KJQA 2F1JA 3AUYA 2Q62A 1U9ZA 4PLWA 4UM9D 2C9YA 1N2EA