4X90A

Crystal structure of lysosomal phospholipase a2
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
376
structure length
376
Chain Sequence
HPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of lysosomal phospholipase A2 and lecithin:cholesterol acyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Group XV phospholipase A2
total genus 139
structure length 376
sequence length 376
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02450 LCAT Lecithin:cholesterol acyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4x90A01
2XUKA 4JYPA 4WDQA 4X94A 5AKKA 4X90A 5AKHA 1ZI6A 4I19A 4Z49A 4WCVA 2BUBA 5AIBA 5ALHA 3GA7A 1H2ZA 3K6KA 1HL7A 4X3CA 4DTCA 4MYDA 5BWCA 4B82A 1JT2A 1CUJA 3WA6A 4DYHA 3N2ZB 5AM4A 2RAUA 3DKRA 1J1IA 3D0KA 3G9ZA 2Z8XA 1UZAA 3HSSA 1Q0RA 4HZGA 3UUFA 3R40A 1ZI8A 1CUUA 3WKCA 4V2IA 1EDDA 1WB4A 2VATA 1HBJA 1BEZA 3AINA 4DIUA 1XZBA 3G9UA 2XUDA 1AGYA 2G5PA 3F8SA 4WJLA 3T4UA 2WHPB 3E1GA 4Y2JA 4MXDA 3RLIA 5LKRA 1ZD2P 2GZSA 4W1SA 3QMMA 4LKOA 1AZWA 1DT5A 7YASA 1W1IA 3H1AA 1X70A 2XUIA 3BF8A 1XFDA 3H19A 2VEOA 4RPCA 3OM8A 2FX5A 4W1RA 3QITA 1R1DA 4BYMA 3WLAA 4CCWA 1L7QA 3HXKA 5SYNA 5K5EA 2QS9A 4L72A 2VSQA 1DX6A 4FHZA 4DNPA 1QIMA 1TIBA 2XUFA 3PUIA 1GXSA 2HU5A 5AOAA 5LZ8A 4GDMA 2O7RA 4ZGBA 3DEAA 3CCBA 4LXIA 4FOLA 3LIPA 2BGNA 4X91A 5JAHA 1R9NA 3WK6A 2DSNA 1HLGA 3P2MA 3WJ2A 2C4HA 3C6ZA 4BTVA 1IUNA 3EQ7A 2IIVA 3WWOA 4UBIA 4G8DA 1XZHA 3QMWA 1DU4A 2CJPA 2ZSHA 2WIGA 4PSDA 4ARAA 1QZ3A 1VOTA 1N8SA 3RKSA 3GUUA 4FLFA 4X00A 2LIPA 3IURA 3BL8A 3F67A 1EB9A 4C88A 1GPLA 4J0DA 2HDWA 1LZLA 4CG2A 2FJ0A 1CRLA 4AO8A 5CRIA 2XUGA 2QZPA 3ZPXA 3R3WA 5ESRA 2PSEA 4XVCA 3RK4A 4B6GA 1LPPA 3I28A 4JYMA 5AKIA 3A2NA 4U2DA 2OCGA 1XQWA 2XB6A 3KOOA 2OG1A 4G5XA 4J0JA 5LKAA 3MUOA 4E46A 2PSFA 2Z8ZA 5AK6A 2WKWA 2WFMA 1YR2A 2DHEA 2RHTA 3OPMA 1Y37A 1B41A 1TCBA 1LLFA 4ZRDA 3S2ZA 2CBGA 3PF9A 1AKNA 2WIJA 3FNBA 4H7JA 1QIJA 1AUOA 2PSHA 1CUDA 4UHHA 2WFLA 2WTMA 4N8DA 4BC0A 2BFNA 1XZEA 2C7BA 1BN6A 2BUAA 4L3WA 2OCLA 3E3AA 2QUAA 1ODTC 3FYTA 1E8MA 1G5FA 4UHDA 3VVLA 3WKEA 2G5TA 3FLEA 2R8BA 4QDXA 1MN6A 1U65A 5AKZA 2JGKA 3G9XA 5AKYA 4OU4A 2J3DA 1LGYA 5K3FB 5AI8A 4TGLA 4B7ZA 3D2CA 3DD5A 4MYSA 2J3QA 4UFPA 3YASA 1THTA 2G4LA 2ZJ7A 2AJDA 4B9EA 5AKLA 4Y2UA 2IX9A 4GW3A 1LPOA 3EBLA 1XQXA 1UK7A 4KR0A 5K3EA 3O95A 2DHCA 3L1IA 2CB9A 4BB0A 2B4KA 2XLCA 4OU5A 4KAAA 2UZ0A 1F0NA 2WU4A 3DLTA 2QM0A 1MX1A 2PUJA 1QO7A 4HXGA 3KD2A 1F6WA 3CXUA 4P9NA 4M0EA 1W52X 4N5IX 4K6KA 2VJBA 4JH0A 5K3DA 2XUHA 1CQWA 4MEAA 3VJMA 2JGMA 1IUOA 1OILA 1CQZA 3H18A 4Y2QA 5AP9A 3R0VA 5IKXA 5EHQA 4WY8A 3PUHA 3H2GA 4GI1A 3QMVA 3HC7A 5AKXA 4XJVA 3BDIA 5AK5A 1VZ2A 1UK9A 2QRUA 4Y2VA 5FV4A 4J03A 3JW8A 3C6BA 1YAJA 1W4LA 4W9RA 4OB8A 4EA6A 4K6HA 5JAPA 2HFKA 4XWGA 4U2BA 3A2LA 2WSLA 1DQYA 4C4ZA 3CCCA 1J06A 1XZGA 1GPKA 3B3QA 5JASA 3I6YA 5FLKA 2JIDA 5CTAA 3FOBA 4IHAA 3FVTA 4EUSA 1IZ7A 1YS2X 1J2EA 1WB6A 3L1HA 2XQGA 5DNVA 4KEAA 1OXMA 3G0GA 2QT9A 2WU3A 5DTIA 4AMYA 1BRTA 3WKBA 2OCIA 5FP0A 4QDZA 1K4YA 3BIXA 1HPLA 4FDMA 1XRNA 1CUHA 4Q3LA 2OGSA 3F97A 1BROA 3A2MA 4FNGA 4S0XA 2Y2UA 4BCDA 2XI4A 2D0DA 4CCYB 1EK2A 2PPLA 2OGTA 3O4HA 1XZIA 3G8YA 1W75A 4ZI5A 4W63A 1H22A 4HXFB 4W1QA 2AJLI 4X6UA 3DS8A 3W9UA 1EA5A 5BV7A 1XZKA 2HA4A 4QLOA 4F21A 4OPMA 3OC0A 4P08A 5AIAA 5AM3A 3EQ9A 3AIOA 3O0DA 4Y2XA 1CUYA 5JALA 2WG2A 4DMKA 4PV7A 3LLCA 1GKLA 1ZD5A 5ALLA 3C8DA 3AILA 2VAXA 3DYVA 3C5WP 3R3XA 3O4GA 1XZAA 3GZJA 4FNMA 5I9IA 2C0PA 5EHXA 1CLEA 4ZXFA 1XRLA 4HAIA 3WWDA 3WL7A 1VKHA 3R3YA 2WIFA 3QVMA 3FLAA 4EY6A 4PF1A 4Y2PA 4Y9SA 4XX1A 1SC9A 1CVLA 4PW0A 3C6XA 4LYDA 1QTRA 3V48A 4I3FA 2YYSA 4DNFA 1XZLA 4L0CA 4AZ0A 3WL8A 4X6XA 4W1PA 5FOQA 2YH2A 1CR6A 4G1FA 1CUZA 3A6ZA 2WIDA 2ORYA 3EQ8A 4E11A 5CH5A 4IO0A 3V1LA 2C58A 4NZZA 3PI6A 4HVTA 3HEAA 4AB1A 2PM8A 2PBLA 3DL4A 2P8SA 2WLSA 4BE9A 4G4IA 3H04A 5BOVA 3U1TA 2AJ8A 4J3JA 2PX6A 4KRXA 1ETHA 4QWMA 4K5QA 3WK5A 5AJHA 3BWXA 3FLBA 4NS4A 3AIKA 5LZ9A 2PSDA 2JGIA 2XMRA 5DYYA 4H7EA 2XUQA 3M3DA 2HM7A 1P0MA 1SFRA 5ALRA 4G8CA 2QKYA 5A6VA 5ALVA 1AURA 3WK9A 3G0IA 4BP9A 3MVEA 1LPMA 3IULA 3M82A 3V1KA 1EI9A 2H9YA 3HLKA 5BWBA 5KREA 5DYTA 4BAZA 2WG0A 1MPXA 3D2BA 1CV2A 3V1MA 2OGZA 4P93A 5AOCA 2HA6A 4B9AA 4ZV7A 1YA8A 4OYYA 1AC5A 4AN1A 3WI7A 4EY7A 4DSAA 3RM3A 5FRDA 5SYMA 2BJHA 2WJ6A 4QDTA 3V1NA 1LPAB 3NWOA 1WB5A 5IVIA 4PSCA 5ALUA 1JJFA 3GELA 3IUNA 2XT0A 3LS2A 1EB8A 1LNSA 1Q83A 2XQFA 1VLQA 2JEYA 2WHRA 2B61A 3C70A 2GYUA 3VJKA 4UHCA 4B0OA 5AM2A 3SC2A 1CUBA 1CUSA 4N5HX 2OXEA 1SCQA 2QXUA 3OTQA 1U8EA 2PKYX 2WUDA 2PL5A 3I1IA 1LPNA 3R3UA 2I3DA 4GWLA 1A8SA 1XQVA 3STYA 4G4JA 1VZ3A 1VE7A 4P92A 3FCXA 3B12A 3KXPA 1ZJ4A 1DWPA 1CUIA 1BU8A 5K3CA 3R3VA 1FFAA 4FTWA 2YXPX 3DDUA 1FSSA 2XLBA 4CI9A 1QE3A 2WJ4A 5HF5A 3NGMA 1UKCA 2HIHA 1JU3A 3STWA 1ZI9A 4C01A 1IMJA 4L9AA 4BCCA 1EVQA 1ZGBA 1E66A 4IQ4A 4YASA 1ISPA 1SCKA 1QJ4A 3IUJA 3WMRA 2O2HA 3B5EA 1BN7A 2GBFA 4EBBA 5DYWA 4K6GA 1LZKA 5ALGA 2HRQA 2GYVA 1JMYA 2HFJA 2C5FA 1W76A 2WIKA 2G63A 5KWIA 2CZQA 2OQIA 2V96A 5E4TA 3S8YA 1UOQA 5LZ7A 3H2JA 4H77A 5HKBA 4OB7A 1JJIA 5E2IA 1XRMA 2VTVA 1PV1A 3H2KA 2GBIA 5ALFA 3H2HA 4MWTA 4U2CA 5K3FA 5C7YA 3ZLTA 1ODCA 1LPBB 3ESAA 2Z3WA 5DNUA 5EHNA 3TRDA 3LCRA 2OAGA 5AI5A 4E14A 4OUKX 2HU8A 1X2EA 4C4YA 3QPAA 3N0TA 4KE9A 2XDWA 1L7RA 4AX4A 4CIAA 2YASA 5ALWA 4KE6A 5HCUA 5T4EA 5J3JA 2DQYA 3DQZA 1GT6A 4BE4A 3R3ZA 1F8UA 2X5XA 4FLMA 1UXOA 2HA0A 5AHXA 1CUFA 5KBYA 2HRRA 2K2QB 3VDXA 4DMFA 4DNOA 3IB3A 1SCIA 1E8NA 2WUFA 4Y2YA 4QA9A 3QZUA 2VF2A 2XE4A 3I2HA 2GBCA 4TVKA 2WFLB 3WZLA 2RHWA 2H7YA 3TGLA 4Q1VA 4N8SA 5CW2A 1EDBA 1IUPA 1IVYA 1WPXA 1G66A 4U2FA 3HRHA 1CEXA 3HABA 5AM5A 1MU0A 1R3DA 1ZIXA 1M33A 1Z68A 2XMBA 1D07A 1NU8A 1N5MA 1USWA 1XZJA 1BS9A 2NW6A 1ACLA 1ZD4A 1KU6A 2XMZA 5HFAA 3D5EA 3WK4A 1QIHA 4QZVA 2CMFA 3I2IA 3VXKA 4ARBA 1UK8A 4F60A 4EY8A 1VXOA 4QNNA 2GBGA 4OCZA 4Q3KA 3CN7A 4HRXA 5CT8A 5LP1A 5E4YA 1DWQA 1Y7IA 2V98A 2ZVDA 4O08A 1UOPA 5CBKA 3K2IA 4AMZA 4HXEB 4ZREA 3ANTA 1XZDA 3FVRA 5HK8A 4BZZA 4J0HA 2O2IA 3WK7A 4F0JA 4KE8A 3W05A 1QLWA 5C8XA 2RI6A 1X2BA 1ACJA 5AOBA 2JEZA 2DCMA 1JFRA 3WL6A 1E3QA 2WM2A 5AI9A 4M0MA 4Y2RA 4X7BA 5ALKA 5A7GA 3HZOA 3WWCA 4UBLA 1DWOA 4C4XA 1N5RA 5K3BA 2QUBA 3ED1A 4KAJA 1UT6A 3QPDA 4H7DA 4PNZA 1CIJA 1DX4A 4CFSA 5DJ5A 1YB7A 3TEJA 4FFWA 1HQDA 3QH4A 4OSEA 2QJWA 2WUGA 3ILSA 3Q0TA 3FYUC 3SWWA 2ES4A 1A7UA 4HTAA 1GQRA 2I03A 1QOZA 4BBZA 4QDOA 2EEPA 1HDEA 4OD0A 1ZIYA 3I1YA 2VT7A 1R9MA 4B80A 1QIEA 2J4FA 1Y7HA 1L7AA 3NUZA 2ZJFA 2DHDA 1G4HA 3C45A 4Y2TA 3STUA 4CIBA 2XMQA 4U2EA 1CUWA 1ORVA 4J7AA 2EDCA 5CXXA 5JD6A 5JZBA 2Y1KA 5DNWA 4ZV9A 2VQ6A 1VA4A 1VJ5A 4ZWNA 3STXA 3G02A 3ZLVA 2RIPA 3AZOA 5LLSA 4WFJA 1XLWA 1F0PA 3UMJA 1YASA 4G8BA 3G0BA 3FCYA 3C6YA 1E5TA 4Q3OA 5AK3A 3JYHA 1O6FA 4QEKA 4G9EA 1H23A 2DQZA 5ALQA 1TCCA 3DL7A 1P0IA 4AXBA 5AKGA 1HKHA 1R4ZA 1WM1A 2QXTA 5LYYA 2EDAA 4JUIA 1VXRA 5AM1A 4AQDA 5ALPA 5D6OA 4J0IA 1T2NA 1TCAA 4CCYA 3AFIA 4RE5A 1CUXA 1TRHA 3MUNA 1YAHA 4B81A 2H1IA 1EX9A 2HA2A 2E3JA 4RNCA 4WFIA 4UHFA 3E4DA 3VISA 2HADA 5DTJA 4KJXA 1VA5A 1PJAA 2ZYIA 5HK9A 3DYIA 2BCEA 2WUEA 2Y6VA 3W06A 2OPHA 1K8QA 1JMKC 2JGLA 5ALIA 4I4CA 4H35A 4GHWA 1TK3A 1QIGA 5LZ2A 2HA3A 5AICA 1DT3A 5T4FA 2OAEA 1E8DA 4MQMA 5A7HA 1R88A 3WWEA 1MNQA 2JGJA 2C5GA 2PUHA 3VJLA 4CG3A 1YB6A 1OCEA 5EIEA 1GPNA 4B85A 4X92A 3EIOA 1IZ8A 3TJMA 2Z3ZA 3IBTA 4FMPA 1JU4A 4MJ3A 5D3ZA 2XMDA 1LPSA 1XQYA 3AJAA 5K3AA 4UBJA 1WCYA 1NX9A 2PU7A 3WK8A 4HS9A 5JATA 1U2EA 1XRPA 4YPVA 4H7IA 4RE6A 5AI0A 4MQLA 3I6ZA 5HKAA 1SOMA 1K6EA 4LXHA 1XZCA 2ECFA 3IA2A 3KSRA 5LIPA 1MTZA 4UUQA 1UKAA 1KEZA 4H7KA 4HRYA 5JADA 3FYUA 2ZSIA 1EHYA 4FBLA 3QYJA 1MT3A 4QWWA 1JKMA 1MX5A 4J0GA 1E89A 4DLNA 2Q0XA 2W6CX 2GZRA 1MO2A 4KYVA 5AK4A 4BVLA 4UHEA 2PSJA 5C81A 1FFDA 3H0CA 4RGYA 4JNCA 5JAUA 2JF0A 4UPDA 4KACA 3KWFA 5CH8A 4UFNA 1Q0ZA 2WHQA 3ESDA 5JZ9A 3BXPA 3ZWQA 3F96A 1H2XA 4YX9A 1DINA 2FJPA 4H7FA 1GQSA 1U4NA 3W2TA 5EIHA 2O2GA 3ZV7A 4BATA 2BKLA 4IH1A 5CT6A 2Z5GA 5CT5A 5ALYA 5EI5A 4BVJA 1BCSA 2ZYRA 3G0CA 2XUAA 4H18A 4UFOA 4Q05A 1UFOA 3I2KA 1XROA 3FYUB 2B20A 1KU0A 4K2AA 1DQZA 1H2WA 2ZYHA 5ALTA 4ITVA 5IVDA 5HZGA 1YS1X 3ICWA 5HF9A 2Y6UA 4C89A 1LBTA 3IVMA 3W04A 2JGEA 4U2GA 3C43A 3F98A 3IIIA 1XRRA 2AJCA 5I8PA 5CXUA 3DJYA 4BTLA 2WILA 3IUMA 4EY4A 3BJMA 3I2FA 2V97A 5DLPA 4BVKA 1BE0A 3WA7A 2XMGA 1T4MA 2XUJA 3D7RA 4FKBA 2HA7A 3PE6A 2QOEA 1K63A 3MGAA 3K9BA 3FWHA 4KAFA 4UBNA 4AZ3A 5D7BA 1QONA 2VA9A 3FAKA 2BAGA 1QIKA 4DMCA 4B83A 1H2YA 5T4BA 1MJ5A 5CURA 3D3NA 2VAVA 1EK1A 2X8BA 3WJ1A 4DSZA 4LXGA 3AUKA 2QVBA 1BCRA 2X76A 2RONA 1CPYA 4WFKA 2V9ZA 3STTA 1ZGCA 2QJRA 3DOIA 2VJDA 4KRYA 4PO3X 3DNMA 3WYNA 5AO9A 2OLEA 1A8QA 2AJBA 4AO6A 1MAAA 5ALSA 1CUGA 3LIIA 5IH7A 2CUTA 5JD4A 4QLAA 3T52A 2VJCA 1XLVA 3V9AA 1GGVA 4INZA 1TQHA 5EGNA 5A62A 2I3ZA 1S8OA 1CUAA 5I7UA 4BRSA 2H7XA 1A88A 1FJ2A 3FBWA 4BDTA 2XMCA 2RGUA 3H17A 3M83A 1I6WA 4FWBA 1BEEA 3Q8WA 4BP8A 3E0XA 4IH9A 4Q34A 4QE3A 5A7FA 4Y7DA 1DTEA 4PQEA 4G4GA 3AZPA 3PDCA 4UHBA 5EFZA 4A23A 4J0CA 3HJUA 1THGA 1EH5A 1B6GA 4BAGA 2ACKA 4H0CA 4NMWA 3R41A 2CEKA 4UBKA 1P0QA 2VT6A 1QFMA 3BIWA 1P0PA 3D4LA 1MNAA 1JI3A 5F4ZA 2H7CA 4EZIA 3STVA 1ODSA 4Y2SA 1RYYA 3PF8A 5AI6A 3C8HA 3UUEA 3M81A 1XKLA 2CKMA 3L1JA 5ALXA 4EY5A 4FBMA 4GXNA 2WQZA 2JGFA 4EHBA 1ZD3A 5CH3A 5CMLA 5E4JA 4GECA 3KDAA 1O6GA 3VKFA 3ICVA 1YA4A 1R50A 2HU7A 4ETWA 4AO7A 2R11A 4B0PA 5EIAA 3O4IA 1AMNA 3GBSA 2DR0A 4IH4A 4H7HA 3ESBA 5C8VA 1XRQA 2VJAA 1UWCA 1JJBA 1N1MA 4X93A 5YASA 1NU6A 3A70A 2BUCA 3WYDA 3O9MA 4A5SA 2WFZA 1QIIA 1ZJ5A 1UOOA 5HQ3B 5KWJA 3QPCA 1AX9A 1MX9A 4FLEA 2O7VA 2ROQA 3KWJA 4BAUA 1UKBA 3VVMA 5LZ5A 1Q84A 1A8UA 4ROTA 3I6MA 3SX4A 4GEGA 1ORWA 4UBMA 1QO9A 5AM0A 1ZICA 5FXMA 3QM1A 5AI4A 5ALZA 3ZLUA 5ALEA 5JIBA 2DFPA 4XIIA 3LP5A 4C6HA 4AN0A 4D9JA 2XQKA 3D59A 3O4JA 5HFNA 4DM7A 4BC1A 3C5VA 4X97A 5JAOA 2XQIA 3WKDA 2ZJ6A 4TPKA 2WTNA 5ALDA 3RARA 1LBSA 5EHZA 2D5LA 2OCKA 3WZMA 4X71A 4FFVA 3OOSA 3X3HA 4DNQA 3I2JA 4G9GA 3U0VA 1G42A 4WDRA 5JARA 5IVKA 1C7IA 4C87A 5FKJA 1EXWA 4EB0A 5A71A 3WIBA 1W6RA 5ALNA 3OURA 4BDSA 1GZ7A 3C87A 3I2GA 3HI4A 5AH0A 5AKJA 5AKEA 1GKKA 3JWEA 4JEIA 3HYSA 3PFCA 1VE6A 4E15A 1J07A 3GFFA 5LZ4A 5FPPA 4GLBA 3BE8A 2J4CA 3OG9A 1PFQA 2WJ3A 2IITA 5JANA 3IUQA 1CFJA 5HQ3A 4Q82A 3F9CA 2FUKA 1XZFA 5FDFA 4WY5A 4MWSA 4X95A 1XZMA 1QFSA 2B9VA 2XUOA 2ZYSA 2I78A 1QIDA 1XLUA 3FSGA 4BZWA 5JZSA 3WQHA 4CG1A 1FFBA 4X6YA 4DMHA 2C0QA 3G7NA 1WHSA 2Y2VA 3QBJA 3IDAA 1TAHA 1CUVA 4LHEA 3GROA 2WHPA 3BF7A 4N8EA 1EINA 4BCBA 3NOXA 5DWDA 5CT4A 4KE7A 2ACEA 2WG1A 3D2AA 5JYCA 1K5PA 2QTBA 3G0DA 1WHTA 5FPQA 1C4XA 1RP1A 4NVRA 4MEBA 1MAHA 1ZOIA 1CUCA 3ESCA 1FFCA 5H3HA 3AZQA 4X85A 3AIMA 1QIFA 4LIPD 4UBOA 2JBWA 5A2GA 2HL6A 2QMQA 2BGRA 1YSCA 3FSGD 2W22A 4OYLA 1QTIA 3WKAA 3BDVA 1WPRA 3H1BA 2PU5A 4F5ZA 4QDUA 3ZI7A 5ISMA 4J0KA 4A16A 1EDEA 3O9VA 2GYWA 4GBGA 3PFBA 4YK7A 3W9BA 3BJRA 3DCNA 3WIOA 1AQLA 3WL5A 2XQJA 3CN9A 2XUPA 5FUMA 5HF6A 5T4HA 1QGED 4BRZA 2PVSA 3DKKA 5C8ZA 2AXEA 3G9TA 5HF8A 3ANSA 5JD5A 2OQVA 5IVHA 4M0FA 2XMSA 3SK0A 1TKRA 4OB6A 3HACA 3PICA 5ALOA 2HA5A 6YASA 2HHAA 1C7JA 5ALMA 1UK6A 3DOHA 3WWPA 5D3KA 1YCDA 2QR5A 4PSUA 5CT9A 2ONCA 4DGQA 4B84A 5ALJA 3H2IA 1RWQA 1WOMA 1EVEA 4LYEA 1CUEA 1XKTA 3EF3A 1FFEA
chains in the Genus database with same CATH superfamily
4HRVA 1L5MA 3WNDA 4C76A 1PL6A 1KO5A 5TR9A 4FZJA 1T13A 3OOHA 4QRIA 2QGNA 5D5PA 5PGMA 4DMMA 4OBWA 3WWYA 3T0FA 2A7XA 5AKHA 1ZI6A 4Z49A 1OB5A 2AZ4A 2GTHA 4IUCS 1W93A 4WCVA 4A1OA 3EZXA 5ECDA 2Y1WA 3FDZA 1H6BA 1NXOA 1R6UA 3RT7A 3WLRA 5IYZA 4OJKA 5AIBA 4FE4A 1UJNA 1AKYA 3COVA 4BNNA 1UM8A 5A9SA 2BR3A 4CMBA 1MFZA 1HL7A 2W43A 2P2SA 5IX8A 2PBRA 1VIMA 2B69A 3WGUA 4KWHA 4F8YA 2HQRA 2X22A 2I2XB 1J99A 3MJSA 3BA6A 3QOFA 5BWCA 2SECE 2W0MA 4IMRA 5CP8A 3RIHA 4DYHA 2DT8A 4LN1A 3RUCA 3TQCA 4ETNA 1SURA 5F7JA 3W2IA 1VP9A 5IFLA 5MGBA 1K4KA 1GGHA 3VR0A 1NTRA 1Z29A 1SUCA 4KGXA 1QUFA 4ZJUA 3JATA 4O4LA 2HOQA 2Z8XA 1JR4A 1UZAA 2XNJA 5EWLA 2VYVA 3TEFA 1Q0RA 3ZW8A 3E48A 1OTXA 3AJ8A 1DFHA 5BMVF 3UUFA 1DCTA 4UD2A 3ZDDA 3FYSA 4PSVA 3Q6NA 2DY1A 4ZYXA 5TIIA 4V2IA 1LK5A 2ZPTX 1WXIA 2IZZA 4G89A 4BV8A 1EXVA 1N7JA 1JHQA 1VL0A 2ZDQA 4RQUA 4DA6A 4URXR 5I7OA 1JA9A 5ES4B 2O2DA 2UXDB 2FKNA 2YFYA 4UDXX 3LY8A 4TKLA 4CVNA 4N39A 1I9GA 4KZPA 5FYQA 1D2CA 1E2JA 3U4DA 5CXSA 2XYGA 3R6GA 3ADBA 1A9SA 1T35A 1QVAA 3G2MA 4FEYA 1UBOS 3P9SA 2IY8A 3GLHA 1EEHA 4IHJB 2QNIA 5AVTA 3IMKA 4GBJA 1FXSA 2GB4A 2A0UA 2XBLA 3F8SA 3QXSA 8AT1A 2FPMA 3T4UA 1E7WA 1HDGO 3LKDA 4Y2JA 5AXBA 5IKPA 5LKRA 1VPWA 1E9BA 1ZD2P 2GEJA 2RC6A 5C46F 4EJSA 3CLHA 1DT5A 3AI3A 2QRPA 2QRKA 4GKJB 1PUIA 2I8CA 2YQ5A 2VDKB 4QPNA 1D04A 1ZU4A 5GVSA 1ZK0A 2VPXA 2XCQA 4ZCTA 2IUEA 5IM5A 2DQ4A 5JSUA 3H4IA 5JVDA 1RZRD 1DUSA 1E2IA 4BMCA 4KO4S 4X1KB 1R1DA 1JHPA 2CW5A 3WLAA 4CCWA 3HE3A 2GN8A 3AWIA 3HXKA 3HO6A 2P5YA 2QS9A 2PQ6A 2VSQA 1DX6A 3HKEB 4RK0A 2BTEA 1PDVA 3OTHA 3TW0A 4QRDA 4MCAA 2WYVA 1VHDA 2M6RA 4N5DA 4RMHA 1TIBA 4YJFA 1TKAA 5JROA 4LA4A 1VFPA 4FZVA 1P77A 4R9RA 2HU5A 3UAYA 4MPDA 1KJ8A 2A9QA 3OWOA 1RQNA 4FX5A 2HXSA 1PLJA 3K70C 3KKMA 1PFWA 4MUMA 2V9PA 1H3FA 2FFRA 2ERCA 2G4VA 2QYTA 3KHTA 4HUQB 1ICIA 4M9CA 3TLGB 3H84A 3H1FA 5E6SB 1PNOA 3JQQA 2WKQA 4FDUA 4NMHA 3RASA 5L40A 3PUWA 1WF3A 2AI1A 3CVYA 1Z0KA 4FYHA 3UFXA 2G8NA 3IVCA 4XTCS 1JJVA 1QPBA 4GNKA 5CVEA 3VSEA 3WK6A 4DR5B 3ESZA 2N1MA 3DXFA 4MMYB 4YDRA 1OA0A 2JC3A 2IA5A 2PQ0A 3QU4A 1CERA 3UH1A 4C14A 5GJBA 1FRQA 5TPZD 3ORHA 2P75A 2UVPA 3EQ7A 2IIVA 4LISA 3GCXA 3X1WA 2QM7A 1M5UA 3VO8A 3ABIA 3K0AB 4E03A 1QYIA 3DF7A 1KQFA 4Q3EA 3WWOA 4U00A 2OILA 3BH6A 1KP3A 5JH7A 1GA1A 2RHJA 1NT4A 3F3KA 4G8DA 2PV0A 4O2RA 4PYMA 4F38A 1A95A 4NK4A 1K1EA 2R5NA 3QWBA 1NHWA 2QV0A 3VH1A 1AKTA 1TVKB 4UMEA 2C7GA 1MX3A 2X9GA 3FTNA 3H5LA 2C95A 4LJ9A 5EQDA 3JASA 4ZQIA 4ARAA 1SBHA 1W96A 1I1HA 1ULTA 5EE9A 3RI3A 4P53A 1P2FA 1BFUA 3GUUA 2IZ6A 3KVVA 4FLFA 5EG5A 3KKQA 4ZD6A 4MPPA 1IAVA 4MROA 5T67A 5J5VA 3TR5A 2R2GA 5H9VA 3W6OA 3LYHA 1Y3FE 2FLWA 5FNZA 4M2LA 1Z8DA 1PJLA 3BL8A 3FNHA 3U62A 2AZXA 5CBPA 5I4CA 1UZNA 1X0VA 2Q4TA 1GPLA 3RJMA 5LP6B 2P9YA 1QTNA 3EIQA 3AM3A 3GEPA 5KVSA 2AUMA 3ND7A 4QTXA 2IS6A 1CRLA 1Q74A 3Q4GA 2ZS9A 1W5AA 4P81A 1NI4A 2FETA 4JLPA 3MG9A 1YH3A 2L42A 3OKPA 1W1UA 4D92A 3THXA 4JBGA 4KUEA 3PG5A 4YBZA 4RKRA 5DHRA 1XNQB 4CT5A 3UWMA 1CY0A 4QYIA 2VCEA 4B4DA 1U2DA 4B6GA 3VR1A 5KU7A 3I28A 2JVJA 1NXPA 2YX1A 3GAFA 5L3SB 2JJ1A 3A2NA 1JBEA 5F73A 4EL0A 4JBLA 4UZEA 1J90A 2W2QA 5EXPA 4C3OB 1M6EX 2GESA 1ORIA 2QE7D 1Q57A 4ZT6A 4DRYA 5KNBD 1G55A 5EJMA 3E58A 4YMHA 5AVSA 3KOOA 3IT2A 4GS5A 3N2NA 4LGVA 2JA1A 5LKAA 4G1UC 1G17A 3IODA 4JQZA 2ZTUA 3QHPA 1P7WA 3TSOA 3QBDA 1VG8A 2WMYA 4Z1MD 3KOZA 2KS6A 1X9GA 5EOVA 2MSWA 4MW0A 3CPHA 2NYVA 2DOKA 3BGOS 1GCAA 2P35A 2UUBB 3ZTWA 5CIYA 1Y4DE 4URVR 1AQUA 3VPCA 1KYQA 2IPMA 4IUBS 1DV2A 4GRAA 2PUAA 2VAMA 2QRZA 2ZWIA 5JW6A 3O47A 1LDNA 2AFIE 1T1JA 2PS1A 2FRDA 2Q6VA 4XUDA 1FDVA 3WGZA 5F2NA 3IJPA 3HUEA 3EVGA 2X42A 1RYFA 2HMVA 1W5SA 2R97A 5DVZA 1Q3KA 1AKNA 1H3NA 3P20A 3PF9A 4IZ6A 4HJRA 1U9YA 3FNBA 4HDAA 1XD2A 3BFPA 4P7GA 1N6KA 1RKUA 2OR3A 2YWXA 3F5DA 3O5AA 1YULA 1ZU5A 3GFSA 3GJ3A 2EP7A 4UHHA 4QXRA 3LHIA 4LPKA 3AVUA 2BFWA 3UJAA 1FRNA 5DHQA 3OX1A 3F0TA 3P9NA 4IIYA 1PJTA 4XSHA 3WB9A 2FR8C 5CK5A 2HMUA 2OCAA 5DLYA 2QUAA 5DV9A 3DBOB 4Y18A 2PZAA 4WX2B 1G5FA 1KEWA 1LH0A 2A6PA 2W6JD 2WP0A 5CGQB 2FSHA 2IBMA 3DCYA 1I2ZA 1U9JA 2J3HA 1E79A 4D46A 1IL0A 2RB5A 1GCIA 5K0FA 2I54A 5CJ2A 1F2TA 3ROXA 1JDZA 1B23P 2YBEA 5TXGA 5AKYA 4LCEA 1F0KA 3VTZA 1ZUNB 1FLAA 2GBLA 1M1XB 2J3DA 4GBMA 2NUTB 4EUHA 1PZFA 1M75A 4OKNA 4CWAA 3A9SA 3AR8A 3SQWA 5FBZA 4JASB 4TGLA 3I53A 3PQ3A 4B7ZA 3D2CA 3G17A 4HTFB 2O8BB 2I76A 1QZXA 3DD5A 3KWLA 1P3DA 2ZBPA 2OC4A 3MT7A 1NR7A 1EGMB 3T12A 2DPHA 4ARSA 3HFSA 2AX4A 3U7EB 2XSZD 1J0EA 3OHPA 4B3FX 1B0AA 4YGYA 4UFPA 7ABPA 5J4VA 4PYIA 5TQ0A 5EWLB 1WY5A 4G2TA 2G4LA 4XIYA 4EMUA 1P7PA 1ZOSA 3KJXA 4B9EA 1NBMA 4L51A 4NNPA 4R3WA 3VR4H 3X1XA 3WSTA 3QSYA 1CHDA 4ZT3A 1KO4A 4RIFA 5CNKA 4AP9A 5IPFA 3U4MA 4YFVA 1KZYC 1XQXA 3ST7A 3T7IA 3NI2A 2BKXA 3O95A 4RYLA 1QCZA 4RV4A 4CUZA 3PUKA 5BQOA 4BB0A 3L4BA 4MS1A 2RGGA 2Y99A 3CUYA 4RGQA 3UAGA 5TQVA 3OZRA 2WY2D 4W99A 4KO8A 2BHRA 4KAAA 1U0LA 5DKFA 1CR2A 1BC5A 1M2OB 3H65A 2I2FA 4BGDA 2BVNA 3ZXUB 3BXOA 5K0EA 3GJ6A 5ELXA 2H17A 4JOCA 1E61A 1MX1A 4PG5A 3QE2A 1JQAA 1NYTA 3KQVA 4Q0MA 3VZCA 1DRKA 4NE7A 2HQOA 2DFVA 5EZYF 3WGKA 5JCZA 4A8PA 5DYGA 1QP0A 2HBQA 3U3RA 4IOMA 4P5EA 4XYLA 1FQOA 5JQWA 1N2CB 1X8LA 3E81A 1I4TD 1W52X 1IHXA 2C92A 2XNDD 3A4NA 3BMXA 4GYKA 5JV5A 1U1DA 2JA2A 4JH0A 5K3DA 5IYZB 1RBQA 3GJSA 4QQ8A 3DG9A 4IIVA 1R18A 4Z4FA 3OCJA 2C57A 3LWZA 3MILA 3TXAA 4FM9A 4K9RA 4Y2QA 3AOGA 5AP9A 2I34A 3RUHA 4LE0A 5IKXA 2XGGA 2PUDA 4WY8A 1FDSA 3TGPA 1WZEA 1AK9A 3OZUA 5AMXA 4AZVA 3NNNA 2JZCA 2YZNA 3H2GA 4MWOA 2VF4X 2AHRA 1F3OA 1B6TA 4MYHA 2IV7A 3TH5A 1OYVA 2ZFUA 2C9ZA 3HC7A 4UM8B 4M3NA 1Y1SA 1RFGE 5AK5A 1WSWA 1OHHD 2Q4RA 2QVGA 2HMAA 2PZFA 1N57A 5FV4A 1DIRA 1W0JA 2D62A 4J03A 3IXLA 2FN7A 3BEDA 3F3SA 2B4YA 1L4BA 3O1HB 4ZOLA 1YAJA 1PSDA 4L07A 1YWGO 3E3NA 1CS0A 3PK0A 4W9RA 1NYQA 5BW6B 2C3PA 3WICA 4F93B 4GXTA 1U6JA 4EA6A 2OO7A 2WTUA 3DBHB 3IAFA 4QUBA 1NVFA 4NAHA 3HLYA 3TWOA 4RVFA 1OAKA 4KQWA 2HEIA 2QXYA 4JLMA 4ON9A 3USZA 2WSLA 4HQFA 4U2KA 4U7DA 3AHHA 2YVUA 3TM4A 2VTEA 4H31A 3RUEA 4OLHA 4DV3B 4DDUA 1OC2A 1V1MB 2VQSA 3IIJA 4FHGA 1GPKA 3OBIA 4PO8A 3TKAA 5JXHA 3UATA 4AAYA 1M66A 3BWCA 1IJFA 2QAIA 5CTAA 3R2JA 1H1TA 2Z3VA 5FPSA 1E63A 1VG0B 4MCHA 1YB5A 2VZ0A 4EUKA 2YV3A 4I6EA 2HTFA 1AQNA 4EAQA 4G0NA 2NXNA 1L5NA 2QIPA 3II6X 3RGWS 1Y8ZA 2FB9A 3ORRA 3EGVA 2R1ZA 3MMXA 4RIGA 4UVDA 3ND9A 1WB6A 3BEOA 2HSEA 3MJEA 4XEHA 1G0NA 1DKOA 1VL1A 4MPTA 1W44A 1W87A 1XMJA 1OXMA 3VC2A 4D9FA 1GEGA 5DULA 2PKQP 3EY4A 4BMXA 2F48A 3HNRA 1COWA 1OKKA 2E1RA 3IQIX 3AWDA 2WU3A 2YQZA 1ABFA 2X41A 4TYPA 3JQ6A 4KWTA 3R7LA 4YRPA 5LZ9A 1KOFA 3Q3CA 3U4QA 3O1IC 2ZJ8A 2ZUFA 4QDZA 4MS1B 2XHZA 1EBUA 1K4YA 3G7UA 3BIXA 5ICCA 2ZSBA 2R4UA 2GD2A 2Z95A 1YONA 3I0MA 3Q3GE 4QYTA 4Q3LA 1WETA 1YJCA 1X86B 3G2NA 5J47A 3S81A 2OGSA 4DDVA 3KZOA 1BDBA 1BROA 1UWLA 4K8OA 4GRIA 4NH0A 4EARA 3BT7A 2F9LA 2ZRCA 3AG6A 2VDPB 4ZVLA 4FUQA 4OX9Y 2HQBA 3OCWA 1B6SA 2ZSKA 1T6YA 5CDGA 4JI5B 2DETA 2IEZA 2NPOA 3CPEA 2X58A 2WNHA 5AUPB 3D3JA 4V1CB 5HSGA 3I42A 3QXJA 1EK2A 2H3HA 2CHEA 4QUGA 2F9MA 4JP2A 2OGTA 4WA8A 3C7CB 5KJCA 3ET5A 1G2IA 3FNQA 3M6IA 3OLYA 4N0DA 3WFIA 4F72A 3G8YA 5LP6F 1H22A 2P4UA 4FINA 4W1QA 3QEMA 1Z5VA 3MWJA 4Z0HO 2PE5A 1P4AA 2VO1A 2UZAA 4NQRA 2YCLA 3DS8A 1QR2A 4WI1A 4IIJA 5BSTA 5C9ZA 2QL7A 5H81A 1EA5A 5A4MS 3O74A 3ETJA 1WP4A 5D3MB 3W77A 4FK8A 3IIMA 1ZXXA 3KE9A 3L6UA 1RZRA 3LLSA 1SU8A 1Z6GA 3COYA 5F9MA 4AMBA 4BVGA 2Q6OA 4DQ0A 4M1EA 3MINB 5HIAA 3OLXA 1UC4B 2IU0A 4GMGA 1QHIA 4JGIA 5E6UA 3NBFA 1KY3A 3NHPA 3NV9A 3NWJA 4R54A 1GRVA 1AD2A 2JKVA 4NE9A 4C5AA 1VRCA 3ZH2A 1U81A 4KODA 4U3JB 2IDZA 3G9QA 3HGMA 3ZVRA 4D3SA 1IULA 4LW8A 4ME6A 3RANA 1N2HA 2EL7A 4H1VA 1P5FA 2LDXA 5EP1A 2H57A 1ADCA 1TTHA 2VAXA 5B4VA 4LNHA 3C5WP 3DKPA 3OY2A 1XZAA 4JBXA 5EA2A 5HYVA 4R8MA 2F3TA 1K06A 4P3KA 3AYZB 1O8CA 2X4LA 2IEAA 4W8HA 2PANA 5I9IA 3W5DA 2NTEA 2C0PA 5DW0A 5JRJA 3K3PA 5EHXA 2PZJA 3QX3A 4EUFA 4U63A 1RCTE 5BYJA 1RWMA 3FTEA 4IIJB 4O2LA 3VVBA 1DAKA 4HAIA 4DV0B 4M0KA 3CV3A 3WWDA 1ZGAA 2NQ8A 4F2PA 3LFUA 2DFLA 1X77A 3VKWA 1PFVA 3M2PA 1PVVA 4OATA 1QE0A 4ATNA 1UXJA 3H5TA 2A5DA 1G3MA 2WABA 4FYKA 4HAVA 4N18A 3WFZA 1JJ7A 3I4CA 4S04A 4XX1A 4IFEA 4LE2A 3LCMA 4K87A 1CVLA 3TM5A 3KQKA 1SMKA 3C6XA 4DLYA 1TM5E 1SG6A 4DIMA 3VV3A 3VDNB 2XECA 1Z47A 1OASA 4LZZA 1XZLA 1T2EA 4E1BA 4E5YA 4FFRA 2IXEA 2WDZA 3PR3A 3ZE2B 2YQ4A 4IILA 4X6XA 4W1PA 4XRGA 1YOVA 1HDRA 3T3NA 2ZI4A 1T10A 3NVKI 1Z22A 4TS4A 4YJ2B 2YH2A 3FMOB 4UEOA 1T6ZA 2O7QA 3BORA 4CF6A 2CWDA 4ZYLA 3DL0A 3DTVD 3VTKA 1Z4JA 3OEYA 3EQ8A 4ILKA 4ZHQF 3CZAA 5AW1A 3SYLA 1M1ZA 1GO2A 3ZGNA 2ZSFA 5D5HA 2V0CA 4IO0A 3SF8A 4UU8A 1Y0BA 1J25A 1ZIDA 3ZVLA 1O4VA 5HCIA 1JLSA 1X9HA 3LHSA 4HLUC 5B58T 1GDTA 4TVBA 2XCOA 5E1MA 1KI9A 1NIPA 2HCRA 3GXOA 1YK0A 4RPJA 3X1JA 1T8TA 3KJHA 2PL1A 3OE5A 1YZGA 3RTBA 3SCZA 1SVOA 2PBLA 3EX7C 2P2CA 1S2DA 2PX0A 2D1SA 4A4DA 4FGSA 4MWEA 1DJQA 1Y5LA 3KZ1E 3Q7RA 5DM1A 2WHEA 4G4IA 3V1UA 2Y77A 2PGIA 3GW8A 3QP9A 1GG5A 2H1FA 1B43A 3PE3A 2DFDA 3EN0A 4QPCA 4KRXA 4NOLA 4IF4A 3H5RA 2O4UX 3O1LA 2A33A 5CA1F 4RXTA 4L15A 4WJKB 2R6GA 1NUSA 3AIKA 2EFHB 1CVIA 1XO1A 4O5OA 4DBLE 4H3HB 4GP6A 4WN3A 2JGIA 5T6MA 1T0HB 1ZGHA 4MKXA 4B48A 2VHVA 2I33A 4CUJA 3EDYA 2RHGB 5DYYA 1MABA 1HYGA 3IOCA 3PUVA 4H7EA 1NPYA 1SHJA 5EXTA 4DCPA 4I9HA 5SZHB 1NRXA 5KVQA 2YZ7A 3KB6A 2Q8PA 1F0YA 2AN4A 3PX7A 2IIPA 1CDZA 4LYJA 4FC6A 1T1EA 2XWBF 1FEZA 3AEYA 2GK7A 1RIFA 3IDOA 4Q9AA 2QKYA 2V55B 1CFZA 2YOHA 3HCPA 2JLAA 1ZKMA 3AK4A 3N2YA 5ER9A 5DTMA 2ZYAA 3WC4A 5CVVA 3FHOA 3QWFA 4G1BA 4DZZA 1NP7A 3LPNA 4GU5A 4IFTA 4S1NA 2C20A 3WNZA 3G6KA 1KBQA 1PWEA 3MGGA 2WPNA 2HQSA 3IULA 3GZTB 3RODA 3TNJA 3V1KA 4AYWA 4U4AA 2VPPA 3G8DA 1TUGA 2C83A 2QLJA 5I9MA 1GITA 2VK2A 1HNZB 5C5IA 2D59A 3CZMA 3GGSA 5B64A 5CDHA 3PIIA 2ECOA 2OHVA 1MPTA 5P8WA 3PDIA 4BAZA 1FS4A 2R8OA 3D2BA 3FAZA 4FYIA 3FDIA 1M83A 1TMYA 2AG5A 2KJQA 4QPZA 5FHRA 4RTPA 3NFYA 1HNWB 1TYCA 2LRHA 3NALA 3EXG2 4P93A 4HLDA 1CJVC 1ZLXA 3I9OA 5C80A 2AKEA 3N05A 2O2XA 4RFVA 4YDQA 1SKQA 1LJUA 3GFTA 1EJ0A 4GMDA 4IXNA 3PXGA 3GLGB 1M76A 1AC5A 3IOEA 1DO2A 3I6QA 4YPOA 3PRYA 2P91A 3V2IA 3G2QA 1NXVA 3KOWA 3RFUA 5BOSA 3W7BA 4EG0A 2AIRA 4ID3A 2QZSA 3RM3A 3SHWA 5CGZA 4GR4A 1J33A 4QAQA 4U6SA 2GD6A 2BJHA 5EFOA 2F59A 5BW8A 2WJ6A 2BM1A 2WYUA 2X8WA 3UMGA 1LPAB 1F3LA 1ZLYA 1WB5A 1KXJA 1T2AA 2HTEA 3JZDA 4GYWA 5DFAA 1D1SA 3SXUA 3ADPA 3TK1A 3V6MA 3KZXA 1VI6A 2E21A 3IEPA 1CZNA 1UMCB 2XT0A 3MCVA 2IYFA 1NRJB 3AESB 3W8DA 2E37A 1V5FA 4IRMA 4D8UA 3QPVA 4XGIA 2BD0A 3N2GB 1EB8A 2QM8A 2YTZA 4G56A 4LVNA 4V1CA 2CJXA 1DXHA 3SXPA 1XE3A 4TTTS 5JWRA 3SEQA 4XR4A 2JEYA 3WMGA 1Y4ZA 2P90A 3CT6A 1SCAA 1UANA 4D9BA 4FYMA 4QX6A 1DJOA 1KVQA 1RWOA 1YMQA 3MB8A 2ZAYA 4N7MA 2ONZA 3T54A 4NR0A 4DHEA 4LOAA 2ZIXB 1CS4C 4G0XA 2DH5A 5ADVA 1CW2B 1CUSA 3AM4A 3AV0B 2RB4A 3FKJA 4JC0A 2QJFA 3RSQA 2VR1A 3BBLA 3TQOA 3AU9A 5KS2A 2GJ9A 1NQOA 1EUQA 1Z2DA 2DFNA 4BPBA 1O89A 1TUBA 3SVLA 3UEOA 4WNCA 1H4VB 4Y6GB 2J7PA 2PYDA 2WUDA 4NJEA 2JAPA 3EIHA 3WTBA 4MW9A 2VAWA 1SWVA 1KTVA 4B09A 4PLWA 1A8SA 4P83A 4YUZA 5TT0A 1MOZA 1L6RA 4DEYA 4KNYA 4KVZA 5B1EA 4L7QA 1E1QA 3BRQA 3MERA 4O4HB 3D2LA 1R6TA 4KOEC 5ED4A 4V0OA 1LSSA 3FPBA 3L9WA 3TNYA 1G21E 3T7KA 3VR6H 5K99A 4YRBA 2BE9A 1T0UA 3JR7A 3OFKA 4FGKA 2X7HA 3W3ZB 1PV2A 4R1PA 1B73A 1T9GS 3B12A 5JSHA 3QEBZ 4TLEA 1ZJ4A 1T25A 1KY5A 2G07A 2K4MA 5TNXA 5U4QA 4RU1A 4LMBA 1O3YA 1FYVA 2JHGA 1CUIA 3V7YA 2E4XA 5DMHA 4A7PA 3LT4A 3BB1A 1KVSA 5T64A 2B21A 5AJYA 1G3RA 5K3CA 1YU9A 3R3VA 4D0GA 3BTVA 5LMUB 4PNPA 4E6PA 4Y3UA 3FUCA 3T1TA 1QRSA 4FTWA 2YXPX 3D7NA 2I4IA 1LTQA 5DGHA 4BNXA 2ON6A 1KEVA 3FI9A 2CXHA 1IN4A 2CK3D 1MIOA 3U3MA 1XVUA 3L06A 5HF5A 1IG0A 3NGMA 3L1KA 2CD7A 5DI9A 2G76A 1ZI9A 2PRZA 3VH4A 3UUGA 4EPWA 4PVDA 3MAAC 5EJ6A 1RPZA 2VWGA 4L5YA 3WNBA 4CQJA 1LD3A 3CRQA 3LOQA 2BY4A 4RJKA 2VNIA 4Q48A 1VECA 1XHEA 2VNJA 3ZQUA 4IQ4A 4DCGA 6REQB 2BR4A 5IJ0A 5LJLA 1SCKA 2BT4A 5JVDF 1PV4A 4DLVA 4ENPA 4TV8A 3G2KA 2W6OA 4MI3A 1KO7A 3EXHC 3R23A 3ZG6A 3EZ9A 5DYWA 4EW6A 4AM8A 5K6RA 1PZHA 5D1NA 3GOQA 1V45E 1AUQA 1N5IA 1WTCA 4EHIA 2O3UA 5HTKA 4PVCA 3BSYA 3S7TA 2VJOA 1FP7A 1LSOA 1JMYA 1XYVA 2PRYA 5FBHA 3RUIA 2B37A 3CX8A 2FW9A 1VSQA 3VH3A 1MXFA 1CJKC 5B55A 3U09A 5DN6D 3IAEA 2WIKA 2G63A 3T9AA 4YUWA 2O1SA 3GYGA 3K1YA 1P3Y1 3SX0A 2FHSA 5F35A 1ULSA 4M1KA 1W36C 3N3AC 3VNBA 4L3VA 2V96A 4YP6A 2RGWA 2BEUA 1QP4A 3GFBA 2X0FA 2RKOA 4URFA 3Q88A 3KDPA 3AHDA 4IXMA 4OB7A 4H6XA 1DTWB 3AHFA 1JJIA 3KV3O 5E2IA 4Y2GA 4P34A 2JCGA 2VTVA 3LPAA 2HMTA 3TBFA 3QGMA 4RCYA 4LX0A 1E96A 4DA7A 1J21A 2BTQB 1JSXA 2OMKA 4FFDA 4A8JC 2UUOA 3H2KA 4RVUA 3NV7A 2FLKA 1WXEA 1SC1A 1MIHA 3B3AA 3KSMA 3O1JC 2FQXA 5BSUA 4MWTA 4YAUA 1ZN9A 2FW8A 3ZNQA 3RHFA 4C2AA 1OLSB 2NUTA 3VOAA 2P1ZA 3UH0A 5KTTA 3VPBA 5KWSA 1GZ3A 3C3MA 1NMQA 3TQRA 4XQEA 4P54A 2Z3WA 2ZE8A 5EHNA 1QNLA 3J81k 3TRDA 1QFXA 1G7TA 3IPRA 4D8XA 4DJFC 2FUG1 4HPWA 4JYCA 4E14A 2JFGA 2KYRA 1ZWKA 4TQAA 3L0ZA 2XX3A 2JEOA 4LXQA 3QJYA 3IMFA 1QQBA 1RJ9A 421PA 1KEEB 4JI0B 5J4HA 3P2EA 2N47A 1E6UA 1Q20A 1TQ4A 2XDWA 3ENVA 4YAGA 3VTFA 1U2PA 1I4WA 2J3JA 2DKNA 1O8BA 3K9GA 3KYIB 4O63O 1AO3A 4OI0A 4S1WA 3KLPX 4PBSA 4QUDA 1U0OC 1QCYA 3L46A 4M8SA 1E4EB 1MA0A 4TRNA 2J48A 4WY2A 1DZ3A 3N8HA 1E4VA 5F12A 2BHSA 5T4EA 2DQYA 3FOAA 4O59O 1F5SA 3TOZA 5BYAA 1N5DA 1NDHA 2DCUA 2VPIA 3DTNA 4L8GA 4YLGA 5CNJA 4U7HA 2M2IA 3R3SA 3SS7X 1PU2A 1UXOA 2HA0A 1OFGA 1VL5A 1MUUA 1LLUA 4FFLA 4TTRA 3IEVA 4D3FA 5B2ZA 4ZTUB 4RTKA 5K01A 2IEIA 3R0ZA 5IF3A 2O2YA 3DGEC 2YV5A 1EFVA 4KQ6A 2ORVA 3GIDA 3WYCA 3EYAA 3GLRA 3NDPA 2FX2A 4ZQHA 3VSCA 1U31A 2P6PA 4G5YA 2R47A 2XNKA 1O58A 1MW8X 4NEQA 3ESRA 1ADBA 1Y6RA 2EJTA 3P2KA 1P74A 2WUFA 3DBVO 3EWNA 4IV0A 4MKIA 4IIGA 2W48A 3QZUA 2Y4OA 2VF2A 5AXCA 4YREA 3UMSA 4EF6A 1H93A 1XMIA 3R1IA 4M1QA 4RZHA 5DHUA 2UZ4A 2J9YB 1I7QB 3P7MA 4O4JF 5C1BA 1HX7A 1Z7YA 2Z2YA 2GZHA 1EVLA 3AHJA 3HA7A 1W30A 5CDTA 4Z4IA 1Z4PX 2YWDA 1E3WA 3LXRA 4KPFC 4PY2A 4E5SA 4CEJB 2Q0QA 1C30A 2WFLB 3WZLA 3IP5A 5T3UA 4FMCB 2PVCA 3K0KA 3V46A 3GBPA 1QBKC 2M6LA 2H7YA 5B7QA 5IJ0B 1JYFA 4I1PA 3WDLA 4Q1VA 5CW2A 4YVFA 1MVLA 1RM4A 3AERA 4WQMA 3TTXA 1FDUA 2R4TA 1D0VA 4FHFA 3DMPA 5F76A 1S9HA 4BQQA 5DTRA 2IWRA 1V8FA 2CZGA 2O3SA 4M7PA 4Y6SA 5JNUA 1G9TA 4HB4A 2YINC 3HABA 3OIYA 2H7VA 4X44A 1MU0A 2ZYWX 4KAXA 1TMGE 1WIWA 2WD7B 2GCOA 1Q1GA 1O0SA 3AJDA 5L3VA 3NAZA 2ZT5A 3DXYA 3LQYA 1V43A 4MS3B 5DXJA 1I7SB 1Z88A 2W98A 1B6RA 1XZJA 4BMOB 2QAGB 1M7HA 3AKYA 2HJWA 1AVTA 2IOHA 5LXTB 1FYDA 1B74A 3KVOA 5GOTA 2GPYA 4IDOA 3WGLA 2OCBA 3CU5A 4DG9A 1I0LA 2XMZA 5FR1A 1QB7A 2CV2A 4G0OA 4Z3KA 4LHWA 3UJBA 1OU4A 2OHXA 1QIHA 1U3DA 3CX3A 3ISTA 2RHBA 1E20A 4N4AA 1QRAA 3I2IA 1TO1E 2J9RA 4ZI3A 2I99A 2YZMA 3H3FA 4YBRA 2EX1A 4YROA 2I1WA 4B31A 4D8YA 3DOOA 3QKSA 4D42A 3A32A 4F2HA 5IARA 3Q7EA 4Z9FA 4EY8A 1VXOA 1V95A 1XTKA 3LNTA 4HWOA 1MV8A 2AI3A 2GBGA 4PAGA 5C4IA 2O8FB 1ECJA 1EK5A 4IWXA 5HA5A 5L3SA 1SHZA 3RC2A 1UMKA 1HYQA 5CT8A 3UHJA 1CG6A 4Z2AA 3HN7A 1VG1A 5JSFA 1DWQA 3ER6A 2O1EA 1TE2A 4HAYA 1H94A 3HVUA 2DTDA 1ZRNA 2ZVDA 4RSHA 4O08A 3DW1X 2YVQA 4EOGA 3UWOA 4EYSA 2H1WA 5CBKA 2PDAA 4NFLA 1A71A 1UJBA 1FIUA 1R0RE 2Q50A 4MVXA 1PJQA 3R74A 4KXWA 4F1JA 2D2IA 1HA3A 2FSVC 3ANTA 3DD1A 1IY9A 3IT1A 4WXEA 3FVRA 2CDCA 4ZOCA 5DTEA 4BZZA 4PZLA 3RWMB 4MWZA 4CR7A 4EMSA 1SAYA 1UC5B 2VHEA 3P0RA 4U8HA 5AT1A 3MWLA 2O2IA 2GD0A 3EZ6A 3KQTA 4WNYA 4AZSA 2P1RA 3O21A 2P0AA 2CXQA 5I48A 2QVZX 3W05A 5IZCA 2FY8A 2ZKIA 5TVKA 3NOOA 5KTRA 1PJZA 1AHHA 1ACJA 1E5VA 3AW9A 5AOBA 2FMKA 2JEZA 5BN4B 1ITZA 4AICA 4EA7A 4WV3A 3INNA 3S8MA 3HFGA 2ZZNA 3KIPA 3EMKA 3GJ5A 4KZKA 3WWZA 3WL6A 3F6SA 3TTSA 4PXYA 4FW9A 1X7WB 5AYVA 2GK4A 4QFBA 4TWIA 1YJAA 3D6UA 4Y2RA 1XTJA 5F2OA 4X7BA 5A7GA 5T5QA 3TPCA 4AJ1A 2CHQA 3QTLA 2K6GA 5K3BA 3UJ6A 1CT9A 1FVFA 2C9MA 5DSZA 4FR5A 2M1ZA 5KOYA 1Y81A 5EUMA 4CPDA 1SKUA 4KAJA 1NXTA 5FWXB 1IHPA 3GUCA 4NS1A 3GLIB 1W46A 3B3JA 3PEVA 1IBSA 3NBYC 3QHAA 4CFSA 4CKEA 4OH7A 4Q4DA 2O8EB 2MOKA 4D6XA 3UWPA 3TQSA 2WZQA 1JKIA 3KRTA 1E60A 2QJWA 3L7AA 3E1SA 3Q0TA 5KYKA 3SWWA 3LQKA 4BXOB 2AYZA 4LTDA 1JQDA 4F3NA 2Y66A 4M1ZA 4LQDA 2I03A 3KTDA 4B32A 3RIGA 3A4TA 4RAQA 5ARBA 4KITB 1NLZA 5CVCA 5EGSA 3HB0A 1C7RA 4DNXA 3BQNB 4QDOA 1AKRA 2XHEA 2F43A 1N25A 2XNHA 5E7MA 3LKZA 2VHZA 3ICPA 3PNPA 5FEUA 1W4RA 1PFGA 4F21A 2IGBA 1QIEA 2YWEA 2GN4A 1L7AA 1DP4A 4XM2A 1VHTA 1JIQA 4KQJA 1DAFA 5K8TA 2YR0A 3SNHA 3C45A 4Y2TA 5BMOA 4GM1A 3PFNA 3ONNA 5CTJA 2A94A 4DR4B 5ILGA 1CDOA 2Y67A 3GJ7A 1EBFA 3A8TA 4J7AA 1D7OA 3OSUA 1HG0A 1KS9A 1OIVA 5CXXA 5JZBA 4MV9A 5JR3A 3F5MA 4JZYA 2VQ6A 2Z6UA 1VJ5A 1GD1O 3BWMA 1MQAA 3STXA 2ZAOA 3RRNA 2FXVA 4BX3A 1HE8B 3F6EX 1VRWA 3H2ZA 1D4FA 2GPAA 4RENA 3AZOA 4XD7D 5DLEA 1E1LA 1X6VA 1XLWA 2HQ1A 5H4GA 1PD0A 3PGXA 1HMYA 2MWMA 2YVKA 1YASA 3UMJA 5AVZA 4QJ4A 2NO6A 4MWDA 4G8BA 3G0BA 1GL3A 5G1NA 3ZWDA 4B7CA 1BVYF 5HW0A 3X2FA 1N3IA 1WZNA 2PH5A 3BVPA 1N6PA 2HUPA 3HCCA 3JYHA 2QMYA 3TSAA 3H75A 5LOVF 1O6FA 2QP3A 3CSSA 3LVQE 2QTHA 4PC1A 3N53A 4PYKA 1H23A 1VBMA 4I9UA 1ZH4A 4BMPB 5JXGA 1QHYA 2DQZA 1GPYA 1VJDA 3NBZC 3AP3A 1D2EA 1G1AA 1L8AA 2F62A 2KHZA 3I37X 3CONA 1EQUA 2FPIA 1QYWA 1V11B 1ZOOA 1XP5A 2AN5A 2Y68A 3D8BA 2OXTA 1PX2A 2DERA 5CG1A 2D6FA 1OV4A 5AKGA 4RD6A 3W4IA 2BZGA 2AXPA 3PDIB 1MJGM 4KP7A 3MLEA 3QY0A 1U8AA 3C39A 3DVSX 1RJDA 3OCVA 4PU0A 1Z39A 4K9PA 2OLKA 2RGYA 2YJTD 1YZ3A 3UA4A 4ECAA 2CNBA 1LQUA 1JUDA 4QBFA 4RK6A 3P2OA 4V24A 3AL2A 4M37A 4OXYA 4P82A 2F55A 5KNDH 5ALPA 3NPAA 4QHTA 2AFRA 2O14A 1KI7A 1RABA 4K1XA 4LFCB 1NI3A 4C4SA 3ZQKA 2H2HA 3OT1B 3MJVA 4TKMA 4J3FA 1M34A 1RLTA 1KHTA 2ZIWB 4JUCA 4Y9DA 4ZOQI 4RE5A 1ZXBA 4YQZA 1NN0A 2FUNB 1EZZA 5TC4A 3Q7SA 4ZOAA 3MUNA 3IQWA 3SC3A 4PZ9A 4B81A 3FOFC 2H1IA 2CLFB 2MSNA 3M9LA 1TD1A 1EX9A 1ONBA 2WJJA 5IUKC 2YN4A 2HMSA 1P9LA 1KC3A 5T7BA 4U02A 4WBSA 5IKEA 1YZTA 3V3TA 1T9HA 1XJCA 4C4RA 1CZRA 2FQYA 3FDZB 4L8VA 4WNAB 1SQ6A 1NN3A 5IFKA 2VZ9A 1SKAA 1HNXB 1GQFA 1N3YA 1QLJA 3ZLBA 2HADA 4C7BA 2IYAA 1DHRA 5DTJA 3SIPA 4G0PA 4MS3A 4OHYA 3GRZA 4AIRA 1E18A 2IYYA 2WD7A 2DBRA 3DYIA 3NHWA 3PXXA 5CDSA 2D2VA 2Q27A 2VEDA 1UEXC 1XA4A 1WULS 5TDHA 4ZYYA 2HO5A 5J2UA 5EAIA 4J3NA 3UC5A 3ZQ6A 3LUGA 4MGZR 1MO5A 4MS4B 2Y6VA 3E0QA 3R7DA 4A8JA 1L7XA 4WVLA 2PYZA 1CR0A 4M1OA 4MARA 2WF5A 5CHYA 3SEAA 4AWBA 5JXJA 3HDJA 4S2EA 3QUAA 2G67A 1K8QA 2G80A 2GZ1A 4H3SA 4Z54A 5LWQA 4CEJA 5B12A 3GMDA 3CNQS 1JMKC 1SUAA 4G5SA 4KGVA 2A58A 3ZWAA 4ZAZA 5ALIA 5LUAA 5LPNA 1XKQA 2W90A 1Y33E 2V0GA 1PSZA 3TZLA 1YDWA 5C8YB 5KIAA 3E7FA 2BMVA 4KYTA 4D3ZA 1UDCA 1IPHA 1WXGA 2WJPA 3MS4A 3WISA 2UYCA 3A4LA 1JQ5A 4KR9A 2I1QA 3C1OA 4ZVTA 4CLDA 1E3SA 2EW8A 3HCEA 4EABA 3I3SR 4M99A 3SJ7A 2VZLA 4EQZA 3E35A 3JQEA 4CIWA 1A8HA 5HMMA 3UT5B 1EFLA 1YOVB 2ZE7A 3V7UA 1OX4B 2A14A 2H92A 4IXWA 2WUWE 4X7PA 4B17A 3M4ZA 3HR4A 1EP3B 6ADHA 4C3UA 1E9CA 1F38A 2V9CA 3H5OA 3IP9A 4JGGA 4F04A 3TW4A 4IX9A 5JSYA 3B82A 5JAMA 1NSTA 4GH5A 1VE3A 4M1SA 1ECLA 1PR6A 2R6FA 1GAWA 1PR2A 1YJXA 1VKRA 3FSJX 4YRIA 2ZUEA 1JKFA 1MH9A 2J07A 4OJMX 3ZDQA 2IZ1A 3BFKA 2G3YA 2ZYUX 3VC1A 3IUEA 2JBHA 1XZ8A 3U3ZA 1YFLA 1M1NA 4QSMA 4LDZA 4R2MA 1HY3A 1UKZA 4GOKA 5FTKA 5A0FA 4FS8A 2WT4A 2PZLA 4FEAA 4KYUA 4R1LA 6CHYA 1QHEA 1TJ3A 3NM5A 4I7EA 3ODPA 1MBZA 3PQ2A 4MQBA 1Y63A 1BYIA 1TU4A 2FUEA 3I83A 1ZK3A 5AJZA 3VJLA 3WADA 4MRPA 4LJLA 3ZWWA 1ONSA 4BFTA 4D96A 3PEYA 4URHA 3DVLA 2ZBQA 2W70A 1T8PA 5TT1A 1FFHA 4BUCA 3HB9A 9LDBA 3BPSA 1Y7PA 2CXSA 3H97A 5C8YF 1PJCA 3EIOA 1IZ8A 1Z4MA 2H5EA 3ORQA 4EKNB 4FHDA 4OM8A 121PA 5COQA 3JD4A 3IBTA 1IG3A 2DJ5A 3OESA 1XGKA 1OIXA 1JU4A 2CDRA 4WZ6A 2V6MA 3IE0A 3QG1A 4BNKA 4JENA 5HG0A 2JRCA 5D3ZA 4ZQFA 2LVBA 2XT9A 5AFSA 1LPSA 4IICA 4ML3A 4TV9F 3OZEA 2BFDA 1F60A 2G40A 3B38A 1G6KA 3N8GA 4HNQA 5AW9A 3SVZA 4EHFA 1WCYA 2QPAA 2XWPA 2ZTVA 1HT1E 2J6CA 4HSEA 1E1RD 4GR9A 1NZDA 3LA6A 3IKLA 1UMDA 1NYLA 1X1DA 4EELA 1BNCA 1G21A 2GN1A 3BGWA 4BJHB 2QRVB 1D09A 2V6FA 4AY3A 3ZCQA 5CLJA 4KRGA 4RLHA 4OJYA 1CY1A 4H7IA 3ISJA 5AI0A 3QWHA 2ZUTA 3TZHA 1WVMA 1W0KD 1IBMB 1SOMA 5A4KA 1U8UA 2D8MA 2IHKA 4RV5A 1XTRA 1K6EA 3FUTA 4L4SA 1K66A 4JLAA 3V5NA 1WCV1 4IFBA 3VPFA 1PT8A 4WCDA 3V4OA 1UJMA 3T7TA 1FE8A 5GGXA 3T9EA 4MDHA 2GKSA 3AFOA 1VJTA 5KZMB 1NF2A 1WMSA 1Z28A 2Q6KA 4PICA 4YI5A 2AMJA 5HDQA 5LQMA 3TFOA 4XIFA 4Z4HA 3ELDA 4QVKA 5LIPA 3ZU6A 2E87A 1AS2A 2KBEA 3EWSA 4HDQB 4UUQA 3B5JA 3ZV4A 2CNLA 5EE0A 2IYLD 3P9IA 5FL3A 2R7MA 3GWZA 1SIOA 4HFRA 1ZJ6A 5JADA 4XWYA 2VJMA 2HWKA 1P4JA 3R5FA 1RVV1 4JQOA 4ALMA 3QYJA 4NCNA 4MVWA 3ROKA 1EGQA 2K2WA 3GEBA 1DSSG 3Q41A 4C7XA 2DBVO 2BMAA 4J0GA 4TTJA 1XDWA 1GL7A 4ZU3A 5FORA 1FW8A 4DLNA 1WDMA 1PQPA 2GZ3A 1OFHA 5A04A 2I5PO 1EWQA 2FSSA 4G3XA 4BV9A 1JEJA 1KGSA 2QEQA 1PR3A 2ID8A 5AK4A 5HGJA 4UC0A 1NVMB 1GDDA 3U17A 1G9SA 4Q1DA 4BVLA 4QQKA 2IE8A 2AW3A 3TD2A 5BV0A 1Z75A 4UHEA 4YH1A 3RSFA 2QY9A 3C5EA 5I7VA 1OA1A 1IQ0A 1QCDA 1X7ZB 2WF7A 3DM5A 5C81A 1A3CA 4TOIA 3S2SA 4TUYB 2XZLA 1SD5A 5LQAA 8ATCA 1X1EA 3ZBQA 4RGYA 1YIAA 4BEWA 3MMNA 2D7JA 3T4PA 1VE1A 2OFOA 3AKCA 2J9XB 3JRXA 4J07A 3AEZA 5CXQA 3JVIA 2CV0A 4YXWD 1ZNWA 4V0NA 5A4FS 1B1AA 3HWX1 3TECE 3HB1A 3M5PA 3N58A 3D1VA 1FU7A 2QBYA 2WHQA 5CB8A 3WGIA 1J8DA 1SGWA 4LWPA 1ISHA 4TKUB 1YRHA 2IEYA 4BU0A 2I66A 4MA4A 5TQ2B 1QMPA 1R6BX 1QS0A 2G9UA 1SXQA 1EZ1A 2HNBA 3BJZA 2O8FA 1R5OA 3BBPA 3TOSA 3LY7A 5KNCH 5DHSA 2PUBA 2DY0A 4FJ2A 3NOVA 2AXNA 4BX9A 1YL6A 4XDGA 4AMVA 4Q1CA 4TM8A 2ZUSA 1E6MA 1I6MA 3FDFA 3EOAI 3LSYA 1KZ7B 1TA9A 2O2GA 3JQAA 1JEDA 4X64B 4K9MA 3MA0A 1KKLA 1SQ0A 3ZIAD 3HJBA 1Y8RB 1ZRHA 3E27A 3DHYA 4HATA 3SZLA 3EPLA 2Q9CA 3A28A 3BCRA 2H5LA 3GI1A 5CT6A 1ULHA 1APBA 5EESA 3OJXA 2GBPA 3JWIA 5CT5A 4GO1A 2XOEA 3F1LA 2VZEA 2W6PA 1BCSA 2ZYRA 3EF0A 4JSTA 4L74A 2XR1A 3VI3B 1JSLA 1FFGA 2ANBA 3OM1A 1KDVA 1W0JD 1YVRA 4HB2A 4HGYA 4BO6A 3JAMA 1RE1A 5G2OA 3V80A 1UH5A 3M5CA 3L8HA 2XA1A 3Q3JB 4Q7EA 4Q7MB 1KU0A 1CQJA 4K2AA 1JP7A 2B2NA 3OY7A 3A26A 1OBFO 2IW1A 3MWDA 4DCSA 5DI3B 4ITVA 1OYYA 5IVDA 3GFRA 3GIWA 3P1JA 1WJGA 4Y0VA 1KEEA 5EMJA 4B6RA 2Y6UA 3K31A 1LBTA 1DPFA 1ZJZA 1NW4A 1XTZA 3IVMA 4GQBA 1K27A 4FFMA 4NDNE 4YALA 2EQAA 1KKMA 4KVFA 4UHJA 3N28A 2NO9A 1E0JA 3JX9A 4P3OA 3V8NA 4CKBB 4PZUA 5TPWA 1HK7A 2BGKA 2H52A 2X19A 4FZRA 5F7XA 1UIRA 1D2MA 3GDHA 3H8VA 2KSQA 5I8PA 2AK3A 4UEQA 4YDHB 3PWTA 1T2CA 2IF0A 1NQVA 2JATA 5IULC 3V6LA 3O0TA 2CZCA 2FZ4A 4MVJD 3OFSA 1K3UB 4ZYWA 3EFOA 4FNAA 4WKCA 3OWHA 3I2FA 3MLBA 1O6BA 3NNDA 4MW5A 4TRMA 3WOVA 5JSKA 1KMMA 2XE6A 4JEMA 1QB8A 4F3YA 5BSEA 3MK31 1MHTA 5BSWA 1MVNA 4TWJA 1T0JB 5FO0A 1G20E 3TI7A 3D6TB 4BVKA 2IP4A 3GT0A 3RGGA 4ZKDA 1DBQA 2WWGA 3EZ2A 2XNCA 1ECCA 2XUJA 3D6HA 5E38A 4YV7A 5ABPA 3FCCA 4FKBA 1F8YA 2HA7A 1GV1A 2RGBA 3CISA 3H11A 3H5IA 1FTSA 4REQB 3VC7A 2MIIA 3SPXA 4QL3A 5TV2A 1SJ9A 5EL0A 4GLOA 3K9BA 1KBZA 1KPGA 1M2NA 5D7BA 4HZIA 3FAKA 1I3OA 4C5BA 4ZEMA 1GRCA 2JRLA 1RI3A 2YYZA 2FDRA 3RSZA 2CFCA 2GWHA 3W2GA 4ASUD 3U56A 1KAEA 1QIKA 1RWWA 4M9SA 4RSGA 1P2TA 5FI3A 1H2YA 4RX1A 3N1UA 1JAYA 721PA 2A0KA 1QV6A 4O5AA 1U8FO 2SHKA 1UR5A 4GNRA 4RM3A 3U40A 1F1JA 4IDFA 3F6RA 2O8DB 2X8BA 1R4AA 2Z2XA 3WJ1A 5LQSA 1C7EA 2CMGA 4LXGA 4OL0A 5FT9A 2I9PA 3KEOA 4HEJA 4MW1A 5JSZA 2EFYA 2A67A 3GFOA 5JOQA 5KJ1A 1NXXA 2AG6A 3MOIA 3TTWA 2RONA 3DH0A 3GHHA 3WIVA 4Z5XA 3CH6A 4PFKA 1HYHA 16PKA 1HNNA 2AQ8A 1SC3A 3RHTA 4ZHQB 1J8YF 1R6AA 3DOIA 3PITA 3I9KA 4TXJA 1X1SA 4KO2S 2DAPA 4FE7A 2D3WA 4TKUA 5EIFA 4PO3X 1GG9A 4JLSA 5EPUA 1CE8B 3DNMA 4NI5A 4F5WA 2HB6A 2ILVA 2X3UA 3NM4A 1OXUA 3A27A 2GEKA 3TIGA 1NV8A 2GZ2A 2GXQA 5FV7A 4HH1A 4AZ3B 4DUGA 4PEVA 3TB6A 9LDTA 3PNVA 4DUPA 3EUWA 1GT91 2DPMA 3OPNA 1DIAA 1CUGA 3C1UA 3EISA 1VRVA 3F8TA 1RBMA 3M3HA 3LIIA 4HZUA 3VNVA 2CUTA 4TWBA 1SOWA 1W8DA 1ZMRA 2RKWA 4IP0A 4ZGGA 2V7UA 4RHTA 5KC8A 2B6HA 1P7VA 4RORA 2FPXA 4EPYA 1KMNA 3A6FA 2NX2A 3I1FA 4P4LA 4H6VA 1TK2A 3RIEA 3I05A 3ISVA 1TQHA 3CNBA 3FRJA 1NKSA 5JFGA 2O1WA 3KUDA 5AJWA 4E31A 3AUTA 2NTJA 3AL3A 5A62A 1E5DA 2I3ZA 1KYWA 1VLJA 5KOJA 4ASUA 5I47A 1S8OA 3Q6IA 4QBKA 2B3DA 1BG6A 4BRSA 4K81B 2VPQA 3FG9A 4DC0A 3CJQA 1FJ2A 3KT6A 3LGXA 3FBWA 4BDTA 4XEUA 4IIXA 4FW8A 3EVTA 3LVRE 5B1DA 1Q7GA 4L85A 1HDIA 1C3LA 3EPKA 3JR3A 4G6ZA 4NJEB 1NI5A 2RGUA 1RADA 1FNNA 1KAOA 3CVJA 3H17A 3HGQA 3IIEA 4UZSA 2B1IA 4UD6A 1I6WA 2NM0A 3RT1A 1PG0A 3Q8WA 4WKGA 1P6UA 2O2ZA 3NS7A 4NYIR 4G09A 5CLLA 1RT9A 4BP8A 2B82A 2W6ID 1QHNA 1XEXA 1DADA 3AEKA 1A9PA 1SHTX 3FMPB 4L08A 4V0KA 4ZEOA 2REOA 4NULA 1O9BA 3LUBA 3OU2A 3STHA 2V4UA 1ESNA 1X7YB 5BWOA 3Q0EA 2JAUA 2G1UA 4PM4A 3H6GA 4GMXA 1QR6A 2GAFA 4G4GA 4PQEA 4DS3A 1HH4A 1ZN2A 1GWNA 3PDCA 4UHBA 3ZY2A 3DULA 5LM3A 2IP1A 4RH3A 1JQJC 2P9FA 3KQYA 2FCRA 3LLMA 4J0CA 5EJ2A 3ZOZA 2ZK7A 1THGA 4HEQA 5CU7A 1OD6A 1UXHA 1JSRA 2WOJA 4TSFA 4FB5A 4KN9S 3GARA 4RBNA 4JV5B 4GPEA 2QROA 3QFRA 4I5EA 2VUSA 3D1JA 2QTVA 1U9IA 1G2OA 2Q5CA 3AP2A 2AKYA 1SQGA 2QYOA 2ACKA 2WV7A 2XYHA 3FOWA 5EPOA 4NMWA 5FBRB 3SSNA 1MEJA 4F91B 2GNAA 1U2GA 3CJTA 1X1QA 1AKMA 2P68A 1RZ3A 1P0QA 1SVNA 2WD9A 2VXCA 3G0OA 4P6VF 1OHHA 5KTSA 2CBZA 4AX8A 3H9CA 5IYZF 4FGWA 1C0IA 1NN1A 4YY3B 3IBYA 1DAPA 4GOOD 1WL8A 1PGQA 1SVIA 2NUPA 3IP8A 1UJ2A 4OM7A 2JFFA 3AL0C 3L7BA 2I7XA 1UWKA 3G8CA 5EIOA 2WF9A 1UDAA 1RWNA 2ZWMA 3K7EA 4JT9A 1LDYA 3KC2A 3LA8A 4PZCA 3UHOA 1A2OA 3IB6A 4LMAA 2XXAB 3ZX4A 2XVYA 4BP3A 3OIWA 2ODBA 3H2YA 1W6UA 3EVAA 4XB2A 1UPAA 3PF8A 5AI6A 4M7OA 4LRYA 3M81A 4G37A 1L4HA 1X13A 2JHPA 1UBLS 2PJDA 2QLNA 3KVNA 1XK7A 5HMLA 4YP0A 3HGTA 1OYOA 5IRCD 4EHBA 3QG5A 1FNMA 4ZOEA 1OY1A 5CH3A 5CMLA 4DDHA 2JAXA 5K2MA 3IAHA 1N8NA 3OTGA 4CF7A 1NUHA 3RADC 4J8PA 5CAEB 1O6GA 4L9WA 4UMDA 3VKFA 1N2BA 3A7EA 3ICVA 3FPKA 3LFTA 4RHCA 4CM1A 1WDKA 3P0IA 2HU7A 2VPWA 4PIMA 2R11A 2BDUA 3E3OA 4NBLA 3LP6A 3WSWA 1NVVR 5EIAA 3O4IA 2NSLA 1GPJA 1NMYA 1TPZA 4URYR 1AMNA 2KMLA 1I4LD 2ZRBA 1WSAA 1REQB 4MH0R 2GCPA 4EG5A 2UVQA 4IH4A 4L5IA 2B2CA 1A7AA 2FUCA 3NOQA 3U4IA 4RPLA 4N03A 3HY3A 4C0AC 3SC6A 4NWIA 4KLZA 5CPFA 1G8AA 1UPXA 3KR0A 4FCCA 3V3KA 4D6PA 1XRQA 1S2LA 2FPWA 2D2FA 4OK5A 3UGKA 1Z36A 1N1MA 2AFIB 1OLXB 3O8NA 4UAVA 4FFOA 2E5WA 3DVAA 2BUCA 1GPUA 3QMPA 3HXTA 4OFWA 1JWAB 1KJQA 1ZHFA 3L0DA 2FW6A 3O9MA 4RZIA 2WFZA 3SGLA 4BO2A 4BGEA 3CUVA 2DWOA 2H2FA 2VP6A 1ZJ5A 3D9QX 4ZT4A 4DRXA 1UOOA 2ZXFA 1S3SA 5HQ3B 5DCYA 3UXHA 4BLWA 3WNCA 3KKKA 1YS4A 1PJ4A 4EO9A 4GPBA 4P84A 4PLHA 3TO5A 2BMWA 3UJPA 4BLVA 1IBLB 2VSNA 2W6NA 1JKJB 2HPVA 5JS8A 5T6BA 3CRMA 1U5CA 3IQXA 5DGDA 4ESVA 1V5EA 2GA8A 3R5XA 2OORC 1WXXA 1UKBA 3ZHOA 5D51S 3HCOA 4ZDIA 4KUGA 3TOVA 3SQNA 1A8UA 2HGZA 4ROTA 3HP4A 1V37A 2Y1XA 3LDFA 2IE0A 3CRNA 3P9PA 4JLWA 3SX4A 4B43A 1Z37A 5LFAA 4GEGA 3T1NA 4EPTA 2PXHA 4EI8A 1T5IA 4TV9A 2DT5A 3IDQA 2CBXA 3OO0A 3U4CA 2GKOA 4HF7A 4D0SA 4LFBB 3CINA 5I7RA 3AVVA 3HJGA 2X1HA 4LBVA 5IJWA 3R7AA 4TYNA 1EM8B 1BOFA 2D0PB 2IOFK 3ONWA 4YRJA 3K0FB 3LWBA 2DGDA 4MV8A 4NBVA 4DMRA 4IFIA 4HFMA 3HY4A 1C9EA 4DFDA 2XEXA 1EKXA 2DFPA 1DKLA 3LHKA 3QPBA 1NFFA 4I5FA 4ZOBA 3W4KA 2OECA 3LP5A 5LBIA 4C6HA 4CI0B 1TCVA 4AN0A 4NBKA 2YJZA 1L5HB 1RRMA 3LLUA 5BMVB 3IAM6 4Q37A 4WAUA 2C61A 5CA1A 4X7MA 1WD7A 2FN9A 3C14C 1Z0IA 1DCMA 2G9ZA 4IDAA 1LFAA 1G20B 1U3TA 2G83A 1SOVA 1VPEA 5DXAA 1N32B 2QTFA 4CKWA 3R9XA 3I8XA 4HBZA 3C5VA 3OPYB 3H2BA 2O2EA 3UJ3X 1VJGA 1Y8CA 2QV7A 4WZBA 3WKDA 2ZJ6A 3PR1A 4QNRA 4TPKA 3M6FA 2WSSA 4V2UA 3WGOA 4E4YA 1Y1TA 4LKRA 5EHIA 4CEIA 1NF9A 2QUKA 1I2DA 4P33A 1K68A 1QZTA 5FBWB 4CIXA 2KQUA 3ZBUA 2GF2A 3VR5A 3EIUA 1NDQA 4FQ7A 3ZZMA 2VDMB 5ITVA 1DEKA 1ZNZA 2J67A 3M8KA 1GA6A 4Z7NB 5AW8A 5KNBH 1IHOA 4FFVA 3AR3A 3A0RB 3DCJA 2EIXA 2PT5A 1Z08A 3X43A 4BEJA 3P97A 4JUDX 1GU1A 1E9EA 4IG9A 3EQ2A 5MN4A 4ENTA 2G71A 2OHOA 1COZA 3KZKA 3KYDA 4OQNA 4G9GA 5HS6A 2GH1A 4WCFA 3X1ZA 2Z09A 5JYBA 5K8LA 3U0VA 1BHSA 2TRSB 2I2WA 2O0JA 2REBA 1C7IA 1P5RA 2GHRA 3DMDA 5J4YA 4A8TA 3KL2A 1UBRS 4FSXA 1NASA 1JTFA 3U3KA 4EB0A 2YNMD 3LPMA 1AKVA 2VFAA 4R1OA 3RC9A 1ZJYA 5ALNA 3HBMA 2FMHA 3H0KA 2VPTA 1PGPA 3GO4A 4TXLA 4AY2A 1JQLB 1V4NA 4NFYA 1NZJA 1EFTA 3AB3A 1S2OA 1Q50A 1E7YA 3AB8A 3M33A 3OLQA 2FF7A 3W5UA 5A4IS 5AH0A 1P75A 2B5WA 1PFYA 2JGDA 5AKEA 3HBNA 2NVWA 1GKKA 2Q2OA 3T35A 3SLKA 1AS0A 1VE6A 3DC7A 2ZT7A 3PXUA 4JP3A 4ZRMA 1J07A 3GFFA 2JIQA 3AHIA 4E15A 5LZ4A 1VLVA 4GLBA 3SM9A 4I8IA 4GP7A 2XTNA 2J4CA 4HYYA 4IJ6A 4HNRA 2CK3A 2XH8A 3BMNA 2FOLA 5SZIA 4OQLA 5CVDA 3TCKA 1G5TA 5LQDA 1P80A 2RH8A 3AI2A 5KSZA 2G9NA 5CFQA 1DX9A 4IDHA 1BMFA 3R0JA 3R7WA 4O4IA 2Z58A 4Q82A 1A5TA 1GRQA 3KQOA 3F9CA 4L5BA 4O1MA 4CM6A 1XZFA 5J2TB 4WY5A 4MWSA 3MTAA 2ZR9A 3QF4A 2I0FA 3HN6A 5D87A 2WMOB 4X95A 4US1R 1U99A 1IM8A 3PCTA 4JP8A 1Q1AA 1QFSA 3R9KA 1BGWA 3NBQA 3L0OA 4MX8A 1NJGA 3EXG1 5AUQA 5JMPA 2NPFA 3ZLJA 1NUUA 4HNUA 3RSGA 2I78A 1XVIA 4RWZA 4NJOA 4AS3A 3K71B 3TSCA 1KVUA 1OFIA 1BXGA 1VIAA 1TF7A 1QIDA 1VJ1A 2HIMA 2J87A 2R7NA 3JQAB 3MRTA 4RIEA 1TT5B 3LQRA 3RVKA 3H05A 5JZSA 1N6OA 2PGJA 3EEBA 1FSFA 4GE3A 4O2AF 4CG1A 1K3TA 2AL7A 4X6YA 1YRWA 1X19A 2QPTA 4DMHA 3BRSA 3G7NA 1YCFA 5KNCD 1H05A 2Y2VA 2NQTA 2EZTA 4ILEA 3X44A 1MB2A 3HWRA 1GU0A 4BNUA 4B4VA 2V3CC 3D7LA 2P2DA 5G3ZA 1TW3A 1TAHA 2ZRFA 1OYWA 4ZO6A 3BN3A 3MGBA 3QVJA 4WK4B 3IUSA 1PZMA 2JNWA 2I87A 3LBHA 2DULA 4LHEA 1H8EA 2DSTA 4MJ7A 3T3IA 1TQDA 2O3QA 2IYEA 5FNVA 1EA7A 4BCBA 4FMDF 3V00A 3NOXA 4F71A 2NV6A 1KAQA 4CIDA 1ZESA 2EFCB 3PT5A 2WJVA 3W5CA 1F4LA 3D2AA 2WIBA 2B8JA 3FFXA 3FJYA 5JYCA 5JNWA 2GOYA 4D6YA 2Q4DA 1V9LA 2B4AA 4JHLA 2I2BA 2QTBA 4RZ2A 3WHLA 1UXIA 2Q0SA 3QU5A 3NXKA 3RVBA 2G88A 4V0RA 2ZULA 3FIUA 1C4XA 4IXDA 1RIIA 4NVRA 3GRPA 1CUCA 3ITEA 4NV0A 2ZB2A 5GPBA 3VR5D 4GOJA 3NH9A 1NDUA 3AZQA 5FTNA 2QMEA 2R751 2A1TR 1JALA 3TVDA 3U4QB 3WLNA 1SXJA 2VSFA 4K2HA 5A2GA 4DCOA 4PSAA 2QNRA 3P71T 4GVXA 4NZPA 5KKCA 4U1RA 4AI6A 1YBVA 1TAGA 1Z33A 2C4VA 2EC5A 2GYYA 4FQ5A 1FSZA 1LRKA 4XQ9A 4FX2A 2EERA 2J9ZB 2RARA 4E1VA 5KSOA 2BFBA 3TLCA 4N6OA 2CLMB 2J9FB 1YDMA 5AQ1A 5ULLA 2V8OA 3GAZA 3FVWA 4HDKA 2PFGA 4OMDA 2G25A 4WZAB 4CKCB 3DFZA 3PWSA 2DMRA 3FPAA 3G2JA 3REQA 3JAWA 3O2QB 1RWKA 2PBZA 1QV9A 4MQUA 1Q92A 4WASA 4RFSB 3FZNA 4YT5A 4D0LB 3ADDA 1XKXA 2AT1A 4HPXB 3MBIA 4DE5A 4GI5A 4YT8A 4ARCA 3MQ2A 3DEKA 3P9QA 2PUEA 1Q19A 3KQMA 1AXEA 1JECA 1NX6A<