4X90A

Crystal structure of lysosomal phospholipase a2
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
376
structure length
376
Chain Sequence
HPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of lysosomal phospholipase A2 and lecithin:cholesterol acyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Group XV phospholipase A2
total genus 139
structure length 376
sequence length 376
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02450 LCAT Lecithin:cholesterol acyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4x90A01
4H0CA 5ALPA 2WIDA 1XQWA 3PI6A 2CMFA 1MN6A 4N8SA 2RGUA 2HADA 2Y2VA 4Y2RA 2CZQA 4WFIA 1BU8A 1K6EA 1QIIA 1MX9A 5FOQA 2PBLA 3I28A 3QITA 5HKBA 3FNBA 3DDUA 4QLOA 1MAHA 4J7AA 1VE7A 4QDZA 4DSZA 3WJ1A 2DHEA 5AKYA 2ZYIA 4Y2YA 1CQWA 2PL5A 1R88A 5DTJA 3VISA 2O7VA 4WFKA 4TPKA 2WSLA 1I6WA 2J4FA 3G02A 3HEAA 2XMQA 3CN9A 4ZI5A 2XT0A 1YAHA 3D5EA 5ALQA 4GI1A 3QMWA 1B41A 4ROTA 5FKJA 1HBJA 1L7RA 3FSGA 3BXPA 1JFRA 2Q0XA 3RARA 1XZLA 1EDDA 4FMPA 2OGZA 2CEKA 3ZI7A 4MQMA 1MAAA 3R0VA 4L9AA 4J0JA 2C0PA 2HFKA 5FXMA 2XI4A 2WUGA 1J2EA 4P92A 1UWCA 4BCCA 5A2GA 4DMCA 4FDMA 1LLFA 2DSNA 4WY8A 5ALOA 4FKBA 1UOQA 4FWBA 4GBGA 3STYA 1DQZA 4UBKA 4F5ZA 4C01A 5AKKA 1U2EA 4M0EA 2VT7A 2WJ4A 3PFBA 4KAAA 2HM7A 2XMZA 5T4HA 4AQDA 1CUFA 3F9CA 4OPMA 5FV4A 3C70A 4L3WA 5A7HA 2WTMA 3GBSA 3KXPA 5HKAA 1YA8A 4F60A 1CLEA 1QIKA 3DD5A 3KDAA 5LZ2A 4BVLA 3ICWA 4LXIA 4K2AA 4I3FA 1GXSA 2VTVA 4INZA 1H2ZA 2BGRA 3Q8WA 1UKCA 5AM1A 3KOOA 4K6KA 4U2BA 4CIAA 2G5PA 5IKXA 2XUAA 4B9EA 1G4HA 5CW2A 5LLSA 4X00A 1GQRA 1R1DA 3G0IA 3H2KA 3I6MA 4EZIA 3DKKA 4KR0A 2G5TA 3A6ZA 3JYHA 4BVKA 4FNGA 3STXA 1F6WA 4QDOA 1WCYA 1Y7IA 3WKAA 1VJ5A 3FLEA 2AJ8A 1G5FA 3ILSA 1MTZA 4QDXA 2FJ0A 1UFOA 1LPPA 3FCYA 2BCEA 3RKSA 3E1GA 4UPDA 1ZJ4A 4U2CA 1PFQA 4H7JA 4CFSA 2X8BA 3VVMA 1GQSA 2FUKA 2HFJA 4MJ3A 3WWDA 2AJBA 2C7BA 3G7NA 1X70A 4X93A 3SWWA 4WCVA 3WIOA 4U2GA 5JAUA 3HC7A 4EA6A 3HACA 1W76A 4OYYA 5FPQA 5ALRA 1TAHA 2ZSHA 4N8DA 1E5TA 1YB7A 3FCXA 2QRUA 3FLBA 1Q83A 5IVDA 5AOCA 2XLCA 4DIUA 5CBKA 2HDWA 5C8ZA 3I2IA 1CVLA 1L7AA 3C45A 2GBIA 3D2CA 2B9VA 2WIKA 1J07A 2YH2A 1CUVA 5EHNA 2XUOA 1A8SA 2VQ6A 1AQLA 4P08A 2OG1A 4EY8A 1IUOA 3LS2A 2HU8A 4Y9SA 1N5MA 1QTRA 3S8YA 1HKHA 4AO8A 4NVRA 5AOBA 2XUJA 4KEAA 4KE7A 5K3FA 2K2QB 2XMSA 5ALVA 4N8EA 1IUPA 3RLIA 1ZGCA 2BFNA 2DFPA 1IVYA 5T4BA 1VZ3A 1XLUA 2UZ0A 4HZGA 2Z8ZA 4BE4A 4FFWA 2WLSA 1WHSA 2PU7A 1UK8A 4D9JA 5ALIA 1IZ7A 3M82A 4CG2A 3STVA 1TCAA 1QFSA 1E8NA 5BWBA 5EIAA 5LKRA 1P0MA 1A8UA 1IUNA 4ARAA 3ESCA 4BRSA 1CV2A 1VKHA 2XUQA 1MX5A 1QIMA 4BCDA 2QOEA 1XZAA 1E89A 1DTEA 2W6CX 4XWGA 1P0QA 2R8BA 1MU0A 2AXEA 5ALHA 1ZIYA 3C5WP 3H2HA 1R50A 4OB6A 4HAIA 1XZIA 4Y2SA 2OGTA 4UBOA 5FDFA 1CR6A 4KE8A 3C43A 1U8EA 2HA7A 1VE6A 4LXGA 2RONA 4PW0A 3QYJA 4F21A 3H2JA 1PJAA 4BAGA 1KU0A 3C6XA 5IVKA 2I03A 1EINA 3M83A 5LZ5A 4L72A 4H7FA 4HRYA 1K63A 3ZPXA 3F96A 3H17A 2WIFA 1CUSA 2GZRA 3WL7A 1GKLA 5IVIA 5AKLA 5CMLA 1HDEA 1EDBA 3FWHA 2AJLI 3FYUC 4C87A 1FFDA 2VF2A 1MX1A 1CQZA 2J3QA 3CN7A 4BTLA 2WJ6A 4KJXA 2WU3A 1YS1X 3DL4A 5JAHA 1UT6A 1W1IA 1QFMA 4G9GA 4DNPA 1BN7A 2V97A 4H7IA 4C4ZA 3D59A 1XZJA 1N8SA 4YASA 3UUFA 4DM7A 4OD0A 3GA7A 4GLBA 4WDQA 1XZMA 1LPAB 5E2IA 7YASA 3AILA 1IZ8A 2QR5A 3IDAA 3H18A 3B12A 3D0KA 5ISMA 1QONA 2PVSA 3CXUA 5JZBA 5FP0A 1UKBA 1U65A 1OXMA 2XLBA 5BOVA 4LYEA 5T4FA 3WK6A 3A2LA 3G0GA 1JMYA 3OURA 3GFFA 3HXKA 1TKRA 1LPMA 1GPNA 5CURA 4Y2XA 1ZD4A 4DNFA 4Y7DA 3EIOA 3MUOA 2JGLA 5CRIA 4BP8A 1YB6A 4WDRA 3UUEA 2GBFA 4RPCA 1XRRA 4HXFB 3FLAA 4X7BA 1K8QA 4IQ4A 5LKAA 2CBGA 5D3ZA 3HJUA 1H2YA 4EY6A 1DQYA 5J3JA 2WUDA 4FOLA 4OU5A 1TIBA 4CCWA 2O7RA 4AZ3A 4Q34A 1ZI9A 3DEAA 2QT9A 3U1TA 1HLGA 3AFIA 5KREA 4G8DA 5JASA 3ZLTA 1EA5A 3LIIA 1WB5A 4X90A 5DNVA 1GZ7A 2VSQA 1G66A 5E4YA 2WILA 4I4CA 2PU5A 1XFDA 2OLEA 5HZGA 5A71A 1Q0ZA 3VKFA 3GZJA 3BDIA 3NOXA 1Y37A 3IURA 3I6YA 1UK6A 3NGMA 4B83A 3W2TA 4X71A 2C5GA 1WHTA 3FYTA 3WA6A 5AK6A 2HA4A 3D2AA 3H1BA 4H77A 1D07A 3GELA 3O4HA 1QZ3A 1ACLA 5T4EA 3WL6A 5D6OA 5K3DA 3TEJA 5ALXA 3MUNA 3ANSA 3FVRA 4LYDA 3QPAA 3R3UA 4AX4A 4AN1A 5JARA 2QXUA 4FFVA 4B81A 1EHYA 2V96A 4FLMA 1XRLA 5K3BA 5EGNA 1QIDA 1WPXA 3WKCA 1JJBA 3WLAA 4G4IA 3L1HA 3WKDA 3F8SA 1VOTA 4CG3A 5LZ8A 5ALZA 4LHEA 5CH5A 2J4CA 3WWOA 1LBSA 2ACEA 2ZYRA 3PUIA 3JW8A 5FRDA 3WWPA 1JU3A 2VJAA 2BKLA 2PSJA 4A23A 1J1IA 5AH0A 4OUKX 1C4XA 3M81A 4AMYA 1SC9A 2WFLA 1K5PA 3WJ2A 4BZZA 3VXKA 1WM1A 2WHPA 5HK9A 3DNMA 1G42A 3R3XA 4XIIA 4KE6A 2Y6VA 1DWQA 4W1QA 2HA2A 3OM8A 2IITA 3EBLA 1RWQA 3G9UA 2WM2A 2BJHA 4JUIA 4UFPA 2XUIA 2ZJ6A 5AKHA 4LIPD 3B3QA 1P0IA 5ALMA 5LIPA 1XRPA 2JF0A 2ZYHA 1JMKC 4MWSA 4BRZA 1VA4A 5A7GA 3O4GA 5JD4A 5CT6A 5C8VA 1UK7A 2H9YA 4X95A 4A16A 2B20A 2H7YA 3RK4A 3DYVA 4K6HA 5I7UA 5DYWA 1LGYA 1NX9A 3L1IA 5CT8A 2JGEA 3I6ZA 4QDTA 5AKGA 1EK1A 3AZPA 1AC5A 4YPVA 3R41A 4JYPA 4G8BA 1EI9A 4OSEA 4OU4A 5I8PA 4BE9A 3KD2A 1TCBA 5IVHA 3VJKA 2XMCA 4QLAA 1W4LA 3K2IA 5ALDA 1CUWA 1XQYA 5AJHA 5JYCA 3OTQA 4W1PA 2I3DA 2ONCA 3D2BA 3I1IA 2ROQA 4BDTA 2ES4A 2HA6A 1ZD5A 2C0QA 4X6UA 3NUZA 2O2GA 2GBGA 3AIMA 5ALYA 4IH9A 2QJRA 1RP1A 5LYYA 3ZLVA 4KACA 1ORVA 3BF7A 1C7JA 4PNZA 2RHTA 2BGNA 3G0DA 2NW6A 3KSRA 4EUSA 4WJLA 4Q05A 5ALKA 4B7ZA 1LPBB 3G0CA 4RE5A 3R3YA 5ALGA 1F0NA 2XUGA 3G0BA 1B6GA 2HA5A 1O6GA 1Z68A 1ZI6A 3X3HA 4UBJA 2HA0A 5AKZA 2XQGA 3IA2A 2EDAA 1MT3A 1HL7A 4U2FA 4MWTA 4AB1A 3O0DA 1QIJA 1QOZA 1VA5A 2O2IA 2PX6A 1LZKA 3WQHA 1OCEA 1HQDA 5JZSA 3VJLA 3HLKA 4MXDA 2VJCA 3PF9A 3AZQA 1ZOIA 4ZREA 1CUXA 3V1NA 6YASA 3QPDA 4AXBA 3STWA 4H7DA 3WWCA 2PSEA 2VJDA 3S2ZA 4AO7A 1GT6A 3AJAA 1R3DA 5AO9A 2XUDA 1H2WA 4MYDA 3GROA 4K6GA 2E3JA 3U0VA 1VXOA 1AKNA 5JZ9A 3GUUA 5AM5A 3QBJA 4EHBA 1LZLA 5A62A 1XZKA 4CCYB 2W22A 3I2FA 1N1MA 3VJMA 5AK3A 2JGIA 3QM1A 5AKEA 2FJPA 4QDUA 3H19A 3H0CA 2WQZA 1XQVA 3PICA 1KU6A 4J0CA 4DGQA 4MEAA 2XMRA 4XJVA 3G8YA 5HFAA 1BCSA 4YX9A 2WU4A 3FYUA 5EI5A 3IUQA 1CUBA 5CT4A 4G1FA 3IBTA 3I2GA 1CRLA 1F0PA 1S8OA 4J0DA 4BBZA 5BV7A 5LZ4A 4PV7A 4K5QA 4X6XA 2OAEA 3ESDA 3FAKA 3H2IA 4C6HA 4GECA 2ZVDA 2BAGA 5BWCA 3BDVA 4PSCA 5C8XA 5JALA 4F0JA 1DWOA 4Y2QA 4C88A 4G4GA 4CI9A 2QTBA 4AO6A 4EY4A 4TVKA 3FBWA 2WFMA 2WFZA 2XQKA 3PFCA 4H18A 2RI6A 5E4JA 5EIEA 1ZI8A 3DS8A 1EH5A 1XRMA 2QZPA 4Q3KA 2P8SA 1NU6A 1ETHA 3W05A 2Y2UA 4FTWA 5DJ5A 1BE0A 2XUKA 2QVBA 1CUDA 1J06A 1P0PA 4UHFA 1XLVA 3D3NA 4KYVA 2D5LA 4B6GA 4J03A 3DOIA 5DTIA 2XQIA 1AX9A 2OCKA 1LPOA 3KWJA 3W9BA 2B61A 2DQYA 5AK4A 1ODTC 3DLTA 5AICA 2V9ZA 1BCRA 4AN0A 3WZMA 5CXUA 2WFLB 2ACKA 2IX9A 3VDXA 5CT9A 1ORWA 1TCCA 4RGYA 3V48A 4FLFA 3AIOA 4ZWNA 3HABA 1ZGBA 1DWPA 1DT3A 3I1YA 4ZV9A 5AKIA 2IIVA 4BDSA 5CH8A 3EQ7A 5CH3A 3DJYA 4PSDA 5KWIA 1UOPA 2XQFA 3O4JA 4LKOA 1XZFA 1JU4A 3AUKA 1L7QA 4J3JA 5ALUA 4EY5A 2WG0A 2G4LA 3O95A 3NWOA 5K3EA 3WI7A 2C58A 5FPPA 2D0DA 2PM8A 1BROA 4DYHA 4FBMA 5HFNA 1XZBA 2XDWA 4Y2JA 1EXWA 1TK3A 3P2MA 4MYSA 2H7CA 3R3ZA 2ZYSA 5AM0A 5LZ9A 1YR2A 4X94A 2VEOA 2XUFA 5JD5A 5CT5A 5DNUA 3AZOA 4PSUA 1DX4A 1YASA 5K3CA 3HYSA 5AM4A 4G8CA 1Q84A 3A2NA 1XROA 2Y1KA 1MNQA 3E3AA 3MVEA 2Z3ZA 1BS9A 3BL8A 5A6VA 3OOSA 2WG1A 1ZJ5A 3FOBA 4W1RA 1THTA 4FBLA 2QMQA 5FUMA 3DL7A 3WL8A 1T4MA 2Z3WA 4UBNA 3OPMA 3G9XA 4J0GA 4M0FA 4H7HA 4KE9A 4QEKA 3STTA 4XVCA 2JBWA 2HHAA 4UUQA 3DCNA 2BUCA 4H7EA 4W63A 5A7FA 2PKYX 3H04A 2WIJA 3OG9A 3ICVA 1MPXA 3C87A 3K9BA 4NS4A 2PUHA 4GEGA 4J0IA 5AI9A 2OQIA 4ZV7A 1LPSA 4JNCA 4X3CA 1UK9A 4DMHA 5IH7A 5KBYA 3FYUB 3WA7A 1A7UA 2H7XA 3KWFA 4PO3X 1LBTA 4G9EA 1CPYA 2Y6UA 3DOHA 5ALNA 1AURA 4UBLA 1CUEA 2DHCA 3W9UA 3QVMA 3MGAA 3QH4A 1C7IA 4BP9A 4JH0A 3PUHA 3F98A 2X76A 4EY7A 4HRXA 3O9VA 1UXOA 3D4LA 1X2BA 4CIBA 4ARBA 1GGVA 1SCKA 1UKAA 4Y2VA 4MEBA 3C5VA 3BWXA 2VAVA 3SX4A 4BATA 5HCUA 3WYDA 3WK8A 5AI4A 4B85A 1SCIA 2H1IA 2JGMA 1XQXA 2QS9A 3WZLA 4B0PA 3HZOA 1YA4A 3HI4A 4HS9A 1AZWA 5SYMA 5YASA 3CCCA 5HK8A 4QNNA 5K3AA 1XZHA 2FX5A 4N5IX 2VAXA 1MJ5A 4CG1A 2C4HA 1JJFA 3WKBA 4EB0A 4GXNA 3WMRA 4W9RA 5ESRA 5CXXA 4X6YA 3V9AA 4RNCA 2OQVA 1CEXA 1EVQA 1QGED 4C4YA 3G9ZA 4WFJA 3HSSA 5CTAA 4HVTA 1LPNA 2YXPX 4ZGBA 2HU5A 4DMFA 4NMWA 4IHAA 4EBBA 2DQZA 1QLWA 2VA9A 1DT5A 4QA9A 5DYTA 4DNOA 1CIJA 2WKWA 2XMDA 1FFBA 4X91A 3G9TA 2YASA 2I3ZA 3LP5A 5JIBA 2WHRA 1GPKA 1BEZA 1QJ4A 5K3FB 1XZGA 1CUHA 2QUBA 3H2GA 3L1JA 4Q3LA 5ALFA 4DLNA 1SCQA 2AJCA 1EX9A 4UBMA 2VJBA 1XRNA 4U2EA 5EHZA 2CKMA 3I2HA 2GYVA 3E4DA 3IUJA 4BTVA 4TGLA 4E46A 3SK0A 3QMMA 3C8HA 3FVTA 2PSHA 3SC2A 5HF9A 1USWA 1VXRA 2CJPA 4C4XA 3B5EA 5EHXA 2BUBA 4S0XA 4PF1A 1E8MA 3QZUA 4X97A 3WK4A 3PE6A 4UHBA 3C6ZA 2QM0A 3O9MA 3JWEA 5JAPA 2HA3A 4UHHA 4V2IA 4JEIA 5EFZA 2XE4A 2PUJA 3TJMA 3FSGD 1T2NA 3A70A 1CUJA 5DNWA 1AGYA 3C6BA 2LIPA 1FJ2A 5I9IA 1THGA 1TRHA 4Y2TA 1H22A 2OCGA 5JAOA 4C89A 4KRXA 3IUNA 4Q1VA 3ED1A 4P9NA 1FFCA 1AUOA 1UZAA 2YYSA 1XKLA 1UOOA 1WB6A 2JEYA 4FLEA 3M3DA 3YASA 3ZV7A 3LLCA 5C81A 1VZ2A 2DR0A 4UHDA 2ZSIA 4ZXFA 1W75A 1VLQA 2JGKA 4AZ0A 5ALSA 4HXEB 3ZLUA 1EDEA 2WG2A 1YS2X 4BYMA 3Q0TA 5D3KA 3IIIA 5JADA 1WB4A 1BEEA 2VT6A 5AI8A 2PPLA 1CUCA 3D7RA 2V98A 4B84A 3E0XA 5JD6A 3BF8A 5KWJA 1AMNA 2OCLA 2Z5GA 3WK9A 1CUAA 2WHPB 4QZVA 1Y7HA 4Y2PA 2HRQA 5JANA 5AHXA 1XZDA 2WUEA 2OCIA 3BIXA 3EF3A 5LP1A 2ZJFA 4BAZA 4B0OA 5C7YA 3PDCA 3AINA 4KRYA 4IH4A 1EK2A 5AI5A 1N5RA 3H1AA 1XRQA 4IH1A 5AK5A 3F67A 1CFJA 2QKYA 1FFAA 5AI0A 2ZJ7A 2XUPA 1DX6A 4UHCA 3EQ9A 3WK5A 2WIGA 4JYMA 1EVEA 4H7KA 2RAUA 1QO7A 3A2MA 3PF8A 4M0MA 4BB0A 4GWLA 4IO0A 1CUGA 4MQLA 4E14A 5ALTA 3OC0A 1YCDA 4X92A 2VATA 1GPLA 3ZWQA 4DTCA 4HTAA 5AIBA 3I2KA 1CUUA 1CUZA 5AKXA 3DKRA 1YAJA 4QE3A 1EB9A 4U2DA 5ALLA 1Q0RA 3LCRA 4FNMA 4ZRDA 2X5XA 2R11A 3O4IA 2XMBA 1MNAA 5AP9A 1E8DA 4BZWA 5ALJA 4CCYA 1K4YA 1R4ZA 4WY5A 3F97A 1TQHA 4UBIA 5DLPA 2AJDA 3ESBA 5D7BA 1A8QA 4OYLA 2DHDA 4Q3OA 4NZZA 2OAGA 3STUA 4GHWA 2QUAA 1PV1A 4DNQA 3IVMA 3BIWA 1YSCA 4GW3A 1M33A 3DYIA 4P93A 1QIHA 2HU7A 5HF6A 5AOAA 3QMVA 1SOMA 1HPLA 1H2XA 2HRRA 4I19A 2OXEA 2JEZA 5HF8A 4Y2UA 3WL5A 1BN6A 2PSDA 2XB6A 1MO2A 3WWEA 2RHWA 4Z49A 2B4KA 2QXTA 1CUYA 3T52A 4YK7A 2J3DA 5AKJA 3WK7A 1JKMA 1ZICA 1U4NA 1IMJA 2BUAA 1BRTA 2HL6A 4OCZA 5F4ZA 1XKTA 4FHZA 2ORYA 3IUMA 3EQ8A 2OPHA 4A5SA 5DWDA 1ODCA 4BC1A 2XQJA 3UMJA 3BE8A 4B80A 2G63A 2CB9A 4QWMA 1E66A 1W6RA 4BC0A 3V1LA 3W06A 3N0TA 4W1SA 2WHQA 3LIPA 1R9NA 4G5XA 4ETWA 1ZIXA 5K5EA 4ITVA 3K6KA 1LNSA 5JATA 3HRHA 5H3HA 4J0HA 1XLWA 2QJWA 5AM3A 2GYWA 3TRDA 4BCBA 2C5FA 2EDCA 4N5HX 2XUHA 3C8DA 4GDMA 2WJ3A 5E4TA 2Z8XA 4PQEA 3ANTA 5ALEA 3W04A 4RE6A 3WKEA 4QWWA 1SFRA 5SYNA 1R9MA 3AIKA 4H35A 2RIPA 3CCBA 3BJRA 3QPCA 4E15A 3IULA 1ISPA 5AI6A 1OILA 4AMZA 4J0KA 2O2HA 5HQ3B 1XZCA 2GBCA 1F8UA 2WUFA 5AM2A 4DMKA 1DU4A 5ALWA 1WPRA 1E3QA 3DQZA 1ZD2P 2JGFA 5LZ7A 2I78A 4UFOA 4BVJA 1FFEA 3WIBA 4OB7A 2OGSA 4XX1A 1CUIA 1ODSA 1RYYA 1ZD3A 3VVLA 2XMGA 2GYUA 4LXHA 4O08A 2JGJA 1QO9A 2HIHA 4BAUA 3TGLA 1GKKA 3I2JA 5DYYA 4HXGA 5EHQA 4KAFA 5FLKA 1A88A 3N2ZB 1JJIA 1QTIA 4B9AA 3IB3A 1H23A 1JI3A 1EB8A 4E11A 3V1MA 2DCMA 4OB8A 1QIFA 5HQ3A 2JIDA 1NU8A 3ESAA 3C6YA 5EIHA 1KEZA 1JT2A 4B82A 3R3VA 3T4UA 2WTNA 1DINA 2GZSA 1FSSA 2PSFA 1ACJA 4X85A 5HF5A 4L0CA 4Q82A 2ECFA 1W52X 1XZEA 3V1KA 1QIEA 3R40A 3WYNA 5AIAA 3R3WA 1O6FA 4KAJA 1QIGA 2EEPA 1X2EA 3RM3A 4UFNA 1WOMA 2CUTA 3BJMA 4UHEA 1QE3A 4G4JA 4DSAA
chains in the Genus database with same CATH superfamily
3BAFA 5EERA 3B5IA 3R74A 4YP7A 2ZANA 1RRFA 5CIWA 3C7KA 3KQLA 1T2VA 2DWUA 4HI0E 2Z4TA 5FADA 4WOPA 2WAOA 3PI6A 5JSUA 3BUSA 4E4RA 2YYZA 1T3ZA 4PRZA 1Z2OX 5PNTA 3GMTA 4WZ6A 2EYUA 1L3BA 2YL2A 1JTEA 5KVCA 1N5LA 5JS6A 2JRCA 3T1YB 1K97A 4WOCA 3I45A 1DZ3A 1VSUA 2O1EA 3Q3EA 3U4MA 4JXKA 4Q1EA 2QSJA 3QVGB 2XHEA 1MX9A 2D7DA 5FO1A 1BNCA 3H3XA 3K30A 4Z86A 3IEUA 4MSUA 3I28A 1GUYA 2R7LA 1VIDA 1QVZA 2JJ2A 4JDUA 1HLDA 1Q5PA 1R4MB 1MAHA 1D6JA 1U02A 2O20A 4J7AA 3M3HA 4MVJG 2P1RA 1G3IA 1UWKA 2FV8A 4OGWA 4DA7A 3U3KA 3HJFA 1SKYB 4BNNA 4H27A 4L6CA 2ZYIA 3NG1A 2PL5A 4C4TA 3N59A 1NN5A 2XY4A 1X77A 2GA9A 1RW4A 3L07A 1H4QA 2IUEA 2BELA 4YMHA 2FPUA 4GRIA 2JLBA 3OOJA 3BICA 3DXFA 3GFGA 4P32A 1U28A 3K6SB 4C3UA 4TPKA 1L0BA 2P7IA 3GEDA 1H0SA 1OKKA 3ACDA 1KI7A 1XP5A 3HEAA 2VZEA 1FYFA 4K9DA 3E2IA 1HE3A 4YJ3A 2F3RA 4KWHA 4QARA 1JI0A 2IZ1A 4HB4A 5B6PA 1NR7A 3N1UA 2XT0A 1J21A 2P1ZA 4NESA 3V1UA 3QV1A 4YAGA 4D26A 1KK2A 1JR3E 2HSWA 1NTOA 1O6ZA 3HV0A 4CKCA 1J39A 5J9FA 1N2HA 5BNFA 4NV0A 3T7KA 5IFKA 1VPWA 1L8LA 3DAYA 4HUQA 1B41A 2ZSUA 2NXWA 2R84A 2GM4A 1U04A 2HXSA 5FKJA 3BEDA 4UXJA 1TK2A 5DBGA 4ZU3A 3BXPA 2ZUTA 1JEDA 4MWGA 2LXNA 1NC3A 1JLKA 2V6MA 3LC0A 3PKJA 1OXBB 3HGTA 1WWKA 3SC6A 1SVWA 1U8XX 2R3SA 1CZLA 3D3EA 4CUJA 2A1TS 2VHQA 3M0EA 3O7WA 2JFQA 3HO8A 3OH8A 2WQ7A 3LUAA 4Z4GA 1OC2A 1T36B 3GLQA 3FUVA 5DHTA 4DRXA 5ECYA 3D0QA 1Z07A 3F3YA 4MQMA 1KQGA 2Q0SA 1LQTA 1ZFNA 2IEBA 1P7VA 2PDAA 3R0VA 2R0QC 4HH0A 1OLXA 3U7QA 1MT0A 2AI2A 1IATA 4QXAA 1N2XA 1MFPA 1IRIA 4TN5A 1LRJA 4P92A 1UWCA 4DQUA 4NMLA 3F9RA 3NDIA 2AXPA 1DIHA 1NVMB 1QYCA 1TF2A 1V2HE 2DSNA 4BQIA 3KELA 4DUGA 3NC1C 3UF0A 1AS2A 2FDXA 2ZB4A 3OFNA 1O5TA 4BUCA 2IPAB 4Q93A 4HWKA 2HMVA 5ALOA 4GBGA 1ZN9A 4NONA 5BT8A 1R66A 5EIWA 3QLVA 3JQPA 4D42A 3K8ZA 2HK9A 3L4SO 2FLWA 2BZSA 1EWRA 1PD1A 4UBKA 4JKYA 2R1TA 4KBYA 4AK9A 4BQFA 1YXMA 2P0YA 1V6CA 2ET6A 3I64A 4HG2A 3MWDB 4F5ZA 5KNDH 4MVWA 3KTFA 3NVMB 2QN8A 2E18A 5HOEA 5MN6A 3AESA 4IMIB 2D1SA 4HNUA 3BULA 4KO4S 4E2FA 2OUIA 2WJ4A 1AD2A 1WDKA 4PX3A 3GO4A 4KAAA 4KFTA 4HOYA 4MVYA 2EFCB 3MERA 3WXBA 4BEVA 1Q7EA 2JD0A 1JEYB 2ZB8A 3OEYA 1DI0A 1GAWA 1FFGA 1H05A 1SUSA 3F9CA 5E1OA 1CQIA 3ZS9A 5BR7A 2CXPA 4PX5A 4A36A 2FN4A 5K7SA 4EHIA 3C70A 4O8CA 1U0HC 3BD8A 4LYJA 1V9SA 3ASYA 5DM4A 2LNDA 1KE1A 3DMHA 4O4HB 3G23A 5K6TA 1DC4A 3KXPA 1A95A 1VLMA 3K0HA 1G2OA 1YA8A 4XTCS 2F9MA 16PKA 1MRSA 3G59A 3L0IB 3RTCA 3HKEA 2ZK7A 4LX8A 1VCMA 1OWOA 4A0SA 1QIKA 1EX1A 1V3TA 4H4DA 3E5NA 1KJNA 3KDAA 3KLBA 2AFHB 3ICWA 1T4DA 3QE9Y 1RMTA 3MELA 3UMRA 1O0CA 1GQ2A 4I3FA 1GXSA 2FFQA 2C42A 1PEDA 2HLDD 1SG9A 3K4HA 5EL0A 2OBMA 1UKCA 4LJ5A 2GHTA 4U9HS 3TQHA 3JAWA 1PSDA 1R0LA 3RRNA 4P0PB 1PUXA 4U2BA 3PD1A 3MJVA 2QL6A 3FR8A 3JQ8B 1PZMA 4MI1A 3FIUA 1JQKA 1FDIA 4KWIA 1P18A 4YRDA 4L9RA 5EXDA 4RS4A 3GRVA 5LLSA 1AQJA 4DV3B 2P6NA 2VSNA 1R1DA 3SPXA 4KAXA 2F1OA 1SHJA 5AUQA 4MNTA 1U2GC 3I6MA 4QGFA 1WSDA 4EZIA 5E7QA 1YJ5A 4PVCA 5FH9A 4MUNA 2ZTMA 4KR0A 4RK0A 4YCMA 3T3NA 1X1DA 2C2XA 1RYDA 4DCPA 1S96A 1Y0BA 3E7FA 3AY0A 4UUNA 5DTRA 4DR1B 3QKSB 4ON9A 1KBZA 4QDOA 4OGGA 2H1SA 3PL1A 1Y7IA 4RAQA 1YQTA 2A33A 5TGDA 1VJ5A 1L6IA 2B21A 5IXYA 1YS4A 2NV6A 2EP5A 4PE5B 4CF4A 1P17A 1YZGA 2VYNA 4MP6A 1ZPDA 3IE0A 4E2XA 2GPNA 3NNNA 3NBMA 1L3CA 1XQ6A 1UFOA 1ZXXA 2VTEA 4LHZA 3I23A 4L0DA 1DC7A 3H8WA 1MUUA 4H08A 2XRZA 1SXPA 3VAZA 4O33A 1O03A 3OKCA 4NEGA 4PFKA 3GGOA 2QRLA 3F5QA 3I42A 4ZVMA 1XHEA 3R0QA 4EUEA 3KS9A 3OZFA 2BFFB 2ZDHA 3DE2X 1CFZA 5BO5A 3RRMA 4DXHA 2HFJA 1Z5OA 2P9JA 3IP9A 2BGJA 3PSAA 4IHJB 3I05A 5TNXA 1UBJS 1SPBS 2X5JO 3U7RA 1DRWA 1K6XA 3TNJA 2VDKB 2AOUB 3MCTA 4BUZA 2YZ2A 2HEGA 4K3VA 4PLGA 4QTUB 4B3MB 4UAJA 3SWWA 1F51E 1KYWA 5KQPA 4O3MA 4GI5A 2O9JA 4WBNF 1S9DA 2SKDA 4LZAA 3ROFA 3KG2A 2QQEA 2QJTA 3HC7A 4EA6A 5K3SA 5C7IO 3HACA 1DHTA 2AN9A 1B0ZA 2PBFA 3FMPB 3N2IA 3PQ4A 2OENG 1ZVKA 1TAHA 4YECA 3BG5A 1V43A 4GOND 3A14A 5E1MA 4JELA 4C6RA 1P73A 1J2RA 5F78A 3TDMA 1JNXX 1UEIA 1T4CA 3FLBA 4ATNA 2W0MA 3IQDB 3ABRB 5BUCA 2DETA 1VMDA 1V1RB 5A5DA 5TJ9A 4MW0A 1AQIA 1K98A 4YJHB 4CHTA 4DIUA 1OYVA 4WZZA 1O4WA 1KO4A 2V6JA 4WBSA 1FBTA 2WNHA 1JKJA 2JHPA 1Z5ZA 3BKWA 3UFXB 1W85B 3S81A 4DZRA 1HO3A 3H4IA 3CRZA 1L7AA 5EHGA 4Y0VA 2ZTLA 2VS1A 3C45A 1A5TA 2CNLA 3D2CA 5KNBD 1RBMA 4UM9D 4ZVNA 1WKCA 1H9BA 2X0IA 2ATVA 3DZIA 3OPNA 2PIDA 4MV6A 1ZGZA 3TB6A 1L1RA 1GTSA 2HJRA 3JQQA 2IJGX 2OV2A 1DZIA 1A72A 3G2LA 3G85A 2VQ6A 4IIUA 5CFOA 3T5DA 1SBIA 3O2SB 5CGQB 5CTJA 3W8DA 3WO0A 3LY9A 4AU1A 2HXYA 3AUTA 2OG1A 3CUKA 4ARUA 1N0VC 1YIOA 3A6LA 2NUPA 1QAQA 3JV7A 4ESEA 5CX1A 4Y9SA 2P40A 5EIXA 4EHLA 3GJ3A 5ICCA 1Z2CA 3AY7A 3OE7D 4TT3D 1N5MA 1NP6A 1A9XA 2HJHA 2QGNA 3S8YA 3KXKA 4FFOA 1Z26A 4LC1A 4NU5A 5IKPA 4M36A 3G2PA 3G5TA 2VDMB 3BWDD 5AOBA 3SZRA 1WIWA 1XF1A 3HUUA 3IS3A 1TZJA 2WA2A 3BH0A 4FX2A 4RY2A 1SIUA 3MSXA 5ARDA 5TVGA 1SO8A 2C5EA 5B1EA 1N8NA 3QU7A 2BISA 2CEAA 3CBGA 3G1WA 3JQ8A 4WOBA 3FFTA 5ALVA 2UAGA 1Z8FA 4NDZA 4YQEA 1I7DA 2OL4A 1SIWA 2NUPB 4P3YA 1M6WA 1NATA 3DSRA 3O31A 3OQHA 4GYYA 1XXLA 3H05A 5E1BA 4RTLA 3GJZA 1ODJA 1ZK2A 3LLVA 1UPXA 1T0PA 1U80A 2CDAA 1GXSB 4GH5A 4RVFA 3AVVA 1W94A 3ZGXA 1VZ3A 1ML4A 2UZ0A 1BZYA 4IRXA 2IVFA 3HR8A 2UV8A 2IZ6A 1F8GA 3FZGA 1A3CA 1FXUA 1LJLA 4R3UC 1U63A 1FRQA 3CZMA 1G8AA 3IP3A 4OLBA 3G0HA 3FBGA 2WMOB 3C3XA 1E1CB 4LCJA 1NW9B 1EESA 3ENNA 5MHTA 1ANKA 2VAWA 2VYND 3OUUA 1MORA 2VH1A 1MTOA 3CKMA 2R62A 4XH9B 4BXOB 1G7CA 4XPZA 3FTEA 1S7CA 1VECA 3CVJA 5ED0A 3K5HA 4A0GA 3BVPA 2I55A 1UK8A 4W5OA 2AIRA 4KXFB 4NBRA 5ALIA 3NONA 5E8JA 3QKWA 2BFWA 4W9NA 4YJHA 4DCSA 4F3RA 3IAXA 3M82A 1R0RE 1PJQA 1Y9EA 4NX2A 3SEZA 3W7VA 4DQDA 2BTOA 1E8NA 1PZNA 1LRKA 3DPIA 1T10A 4Q4HA 3VDRA 2QAGC 4BMVA 4FGJA 5LKRA 1WP4A 2ZE6A 1M0WA 1P0MA 3UJPA 2OK8A 3CZ4A 2LKDA 2C88A 1NBIA 2F7SA 1QC5A 2I8CA 3N8KA 1IUNA 5JG7A 5TQVA 4PFSA 2QSUA 4EENA 4DC1A 1FQKA 5EOVA 1THMA 4O4JA 3HXTA 2QUJA 1PR1A 3CUWA 5ICMA 3EVBA 5GQSA 1QIMA 4HDSA 2JGAA 3PUVA 4BGUA 5BNWA 3RK1A 1MENA 1I94B 2NWQA 5CD9A 5DN9A 3WOHA 4MTCA 2P0AA 3DBIA 2I3BA 3MJCA 4ICIA 3HO6A 1AHNA 1JVSA 1PW7A 4HQLA 2IFTA 3WLRA 1DTEA 4IXMA 2VBCA 4BLTA 3EEYA 1W48A 3FF1A 3FHCB 4G1VA 4F6CA 4S35A 5ALHA 2V6FA 3G2QA 3ANXA 1KE2A 3SC3A 1R50A 4OB6A 2O2JA 3KTAA 3E48A 1CZNA 1UXHA 4LKRA 1WU7A 3HFJA 3QSGA 4UBOA 1L5YA 1K5DA 3ZNPA 1W88B 1XHLA 2X7HA 5KHOC 2GHIA 1JEAA 3C43A 4YO8A 2HA7A 4QG3A 2DBVO 2O3JA 4EOGA 2RONA 1I1NA 1IRXA 4XOUA 3QYJA 1JVNA 3A58B 4O2BB 3DEZA 4J7CA 5EKSA 1P1KA 1QGZA 2YXNA 2V9PA 1E2DA 3AEZA 9LDTA 3K9FC 2ZQZA 5LVAA 3OY7A 1KU0A 3C6XA 3P2IA 4KUGA 2A0UA 5EXEA 3O7MA 4C06A 4QT4A 3KAQA 5J2TA 1SBQA 2PYIA 2VDUE 4G5SA 5IJAA 3B2EA 3IO3A 4L2IB 4RENA 1RXYA 1YT5A 5LZ5A 5KJFA 1R9JA 1ESDA 1MB3A 1N7JA 5C5IA 1Z88A 4HRYA 3ORYA 4KGXA 2G0AA 2P77A 2E6UX 2I7XA 4U0JA 3ZPXA 5DNYB 5IAGA 5JAQA 1O94D 1KYYA 5TS3A 5KWVA 1AN0A 3TIGA 1IM2A 1XXHE 1TEHA 5BQPA 2E89A 3BH7A 4WLUA 5HUHA 1CY8A 3F73A 2QT0A 3OO0A 2JFFA 1PWZA 3ACCA 4V0LA 1ZQ9A 5IVPA 4U2KA 5FFMA 4BWFB 2PRSA 4C87A 2KE5A 3NJRA 4HGPA 4JI5B 1XX6A 5SV2A 3V4VB 3VR4A 3K70C 5K0ZA 5TV2A 1MX1A 4WN9B 3CSDA 4PHFA 1U2ZA 1XEAA 4DHEA 3U19A 1PNRA 3C7AA 2WU3A 3AV3A 4U9IS 3CW9A 1HDGO 3NOVA 4LZZA 5KI6A 4IWXA 3T4PA 1LSSA 1G7RA 3HA5A 3QFFA 4UU1A 4ZO4A 5D7NA 1DNPA 3KSMA 3HZRA 4D41A 4DIEA 1E2IA 1QFMA 1NJ8A 3DOCA 2VP2A 5EJ7A 4WIAA 2CHVA 4POOA 3QEAZ 1KSHA 2P5SA 4NRDA 1SC6A 2BSXA 3AJRA 3KKOA 4NATA 1C0LA 4Q7JB 1KRWA 4B4KA 4DNPA 5AYVA 1AGNA 1BN7A 2X1HA 3ONNA 5GJWC 4C4ZA 2QZJA 2X1VA 1NIPA 1GGHA 1I3OA 5IZ4A 1L6RA 4HPXB 5G2OA 3VU8A 2AH5A 5HEKA 2JK0A 2RG7A 1QQ5A 2W2TA 2J9GA 4TL6A 4CKBB 5L7TA 1XD2A 4YASA 2P9CA 3UUFA 5JI3E 3NHBA 3IP5A 4Q4LA 1S4MA 4JU8A 4Q4AA 1BH6A 1J24A 4Y1RB 3VX3A 4EJSC 2VRWA 4MGIR 1BGVA 3CXRA 4H31A 4TMVA 5IMBA 5JSFA 4BKOA 4HFNA 1O97D 4KNVA 4EFKA 1MG5A 4LC0A 4AZSA 1C8BA 1J42A 1JKFA 4KGVA 1C3VA 2VF7A 4L7QA 4LMAA 1GNLA 1BKSB 2KMLA 2ECQA 2QR5A 3BERA 2OP0A 4YAJA 3H8SA 1GZ5A 3MWDA 3DAGA 1TK9A 3H18A 3IDAA 4IGAA 4MV4A 3B12A 1Z0DA 5CNIA 3RFVA 1IULA 1B73A 4ZQFA 4IZOA 3BGIA 4OXNA 4AZWA 4R3NA 3D3QA 4TKVA 5JZOA 4JT4A 5DX8A 1UKBA 1NUSA 2WJGA 1T43A 4WADA 1ECFA 2A9KA 1OXMA 4MUKA 5KSOA 2DFNA 3CC8A 4LJ4A 3TUIC 2PEZA 3KUXA 2CNWA 2ZRPA 3TEFA 1T5BA 2FZEA 5ADUS 1U8UA 3SX0A 4BO0A 2C2GA 4B3BA 3AI7A 1DQRA 3IAS6 4PLWA 1JR3D 5I7FA 1LPMA 1TW3A 3HFSA 5IJ0B 2JCXA 4IVQA 2C57A 1ZNWA 2E4AA 5K0LA 1DDGA 2HF2A 1F2UA 3DT8A 4LBVA 4Y2XA 3A6JA 1NQOA 5DOZA 4M1OA 3DUFA 4HBGA 4DPKA 1XT6A 3EIOA 5JJCA 4UE3S 3ZZMA 3FPHA 2HBQA 2JGLA 3MWLA 5IZCC 1YK0A 4KNYA 4PHTA 5L95A 3FCOA 4BP8A 2HU2A 3QFRA 3TAUA 5AOVA 1KC1A 1SZJG 1U2SA 4YAKA 5EYPB 4XJSA 4HXFB 1Q77A 1RYZA 1U8FO 2GN1A 3CH5A 1RWOA 1U3UA 4X7BA 2VPZA 5EZ6B 5G1NA 4CEJB 5BSFA 5G0SA 2MSEB 4HQFA 1KQFA 1H2YA 2BI7A 2HX1A 3N74A 4EY6A 4D4GA 4JIGA 3SVTA 1L9KA 5EA2A 4X3PA 1NVXQ 1M6NA 1TIBA 3GLHB 3QUQA 4Q01A 4J8PA 4D9IA 4FFRA 3R7NA 3NBFA 3IKJA 1KAQA 4V0RA 3TE6A 4AZ3A 4AURA 2BRUC 1XAHA 2G4VA 5EEHA 3GLIA 2EEZA 2Q7XA 3DEAA 4WJKB 2YVUA 4MV5A 4M7OA 3OI7A 4XX0A 3U1TA 3WICA 1HLGA 2FZVA 2QD4A 4DUPA 5JXWA 4MUHA 4IAOA 3ZVMA 1EVIA 1MFZA 3M9LA 4G8DA 1CQJB 3B5JA 1FQOA 1EA5A 1R8QA 2E2WA 3GL9A 3L0DA 2W2PA 4PGGA 5H9WA 3K6SA 3OFJA 4ZVRA 4F71A 3AHEA 3V97A 2VHTA 1PR3A 4B76A 4X90A 3LG2A 3N07A 2ZZMA 2WM3A 1Q0TA 1FX0A 1L8QA 1RAHA 1MAWA 1SJ9A 4I4CA 4RSGA 3CJQA 5TQ0A 3ZV3A 2VQ3A 1N33B 1UL1X 2DFDA 4P7JA 3LGXA 1R15A 3G6KA 4LUCA 2WY2D 3S2YA 4NAUA 4C03A 3BJEA 2W6JA 4MRMA 3UTCA 1P9WA 3GBPA 3HU1A 4BLOA 2QLTA 3BTUA 1FA9A 3GZJA 1GO2A 4HEA6 4Z51A 1Y3HA 3NOXA 4TYNA 3NHMA 3RASA 4O5OA 3DEHA 1KDOA 1XG5A 4C4YA 3I6YA 2PMFA 2BR5A 2ZCUA 3MQ2A 5KDDA 4M3NA 5KOJA 3AT1A 1BYUA 1XTRA 2P2ZA 4CIDA 2VTBA 3V1YA 2Y4OA 1ZX1A 1DG1G 1S6YA 4YJ2F 2FZKA 4Z2AA 3TSAA 1TFRA 1DG3A 1P4AA 3DZFA 5FOUA 1T9CA 3NTOA 1RLIA 1KEWA 3T5CA 2PX2A 4ABTA 2HA4A 1QZXA 4ZO6A 4H77A 1D9ZA 3KZVA 1F17A 1PWXA 5JD3A 1GV0A 3ITNA 5H81A 1U2DC 2HIGA 3I5MA 4DMRA 3U16A 4QXMA 4LRYA 4ZVOA 2P8JA 4QUGA 1YZQA 1EFVB 3HCOA 3QWIA 4CMBA 1O9BA 1E4EA 2O2DA 3EFOB 7ADHA 3D3WB 5LP6F 3ILXA 3ANSA 4OXKA 3OE5A 4EMBA 5GVRA 4YR7A 1IY1A 2V4UA 3WYEA 4L22A 5IAOA 1Y42X 4DWWA 2QK4A 1CF2O 2HMAA 4GOLD 3QW2A 4X1OA 3ROTA 4GRDA 1M1NA 2I80A 3QPAA 3VR2D 3NHSA 4U5XA 1DAFA 3ZHOA 4BO6A 4DE5A 2JW5A 1PTJC 4N3NA 1X3SA 1QUFA 3KXLA 2AV6A 4K28A 4B3IA 5JARA 5L6LB 5GOTA 3P4UA 2NGRA 4FFVA 4I46A 1C7EA 4KQWA 1JLLA 4RPLA 3P45A 2OZLA 3EFEA 2P5YA 3N8NA 1O9GA 5IEJA 2DRIA 2X4DA 1HDZA 2Y1WA 1VL0A 3AO0B 1NLYA 4IGIA 1P5RA 3FA2A 3ZE8A 1MIHA 4YXWD 1QRDA 3F8SA 1ODLA 1Z4JA 3MWJA 3OHPA 4MR9B 3ZD6A 3UATA 5ITSA 3LZ6A 3A36A 1YD7A 2W71A 4PZZA 5DZSA 5LZ8A 1T6XA 1T8TA 3CW8X 1NNSA 1MMFB 2PD4A 5CH5A 3D6VA 3NFYA 4MITA 4JP1A 3IEMA 5I45A 2XZOA 5IMSA 2ACEA 4ZARA 2C84A 3PUIA 4BMSA 2QRJA 2AFIE 4RVSA 2M6LA 3WNQA 1M34A 1TVMA 4MI3A 5FRDA 3TS1A 2H4FA 4ZT6A 3IVRA 3JQEA 5GPBA 1COWD 2EZ8A 2HWKA 1A9PA 4WGFA 2BKLA 2GCOA 2WU8A 4ZAGA 1AKUA 3WGUA 2G83A 1U7HA 1XK7A 2ATIA 4NBKA 4R1PA 5CDYA 2Y0EA 1FYVA 1CCWA 4OUKX 1QHHB 3WL3A 1AZLA 2YHSA 2H07A 3M6XA 2EAUA 1B76A 2J32A 3I04M 2A9PA 2WJWA 2GX6A 2YUTA 3LD9A 1VJTA 3OTIA 2WE8A 4X61A 2PH5A 1HTWA 3CLRC 4TL9A 4UTNA 3LL7A 2E4VA 4KH0A 1ZIPA 2AL7A 1K5PA 2IZOA 2ZRGA 3H6GA 4FD3A 4LXTA 3SYMA 1QCZA 3VXKA 3WYAA 3FPGA 2JASA 3JR7A 1SU4A 3DM9B 4U7WA 3KB8A 5GM1A 2W43A 2W6JD 1G42A 4WINA 1NDUA 1R0KA 4IDGA 5CA0F 1Z0ZA 4XIIA 3ZCVA 1UDRA 3QKRA 1V7PC 1Y7PA 5DBOA 4O29A 1QV6A 1N92A 1I7PA 2Y6VA 2WTAA 3B13B 3IUBA 3PKZA 4RESA 2G1UA 4PZAA 3T41A 1ZU5A 3MJDA 3E23A 4M0LA 1T13A 4BGVA 5K8TA 1P0FA 3OM8A 2ZLBA 4UTOA 5F7JA 5J5VA 3S2FA 2NU6A 2ID4A 2HK8A 1EUDB 4RO0A 1MH1A 4Y18A 5FWAA 4TVSA 4LEIA 1B23P 4JUIA 2REQB 1OWLA 2XUIA 5BQOA 1JR4A 3A27A 4ZT7A 4RADA 4FHFA 3UENA 3ZVLA 2CMDA 5FNVB 4PYJA 1Q1QA 5IT9A 4DV6B 5L45A 1VMIA 3L8FA 4IYRA 4W8GA 1QDUA 4BNDB 1GM5A 4EG5A 2EQ5A 5FBZA 1UJNA 1ZM7A 1L5VA 1SIBE 1SQGA 2ODNA 1KY3A 3EH2A 4DV4B 2RJOA 3RSHA 3GFRA 3WLSA 1ZC4A 3ZWBA 4QXOA 2V0GA 1Z0KA 1VA4A 3EASA 2FR8C 5A7GA 4NV3A 4P35A 2IXEA 4UW9A 3TUJC 2F43A 2GAIA 3MTDA 4AP9A 3U61B 1WMFA 2PUEA 1KEVA 1M1YE 4C7KA 3O4GA 1E3SA 5C53B 5CCEA 4RTRA 2BDTA 3QEMB 2AEFA 5CT6A 2W2XA 3PD0A 4LWPA 1FTQA 2O7QA 2DPMA 1YRBA 4XXHA 1XPRA 1QE5A 2B20A 5E9QA 5E7IA 3V8NA 4K0RA 2HLPA 4I8XA 3EAQA 6GPBA 1NFQA 1ZXLA 3FKSA 3OSZA 4NIMA 3HU2A 4F38A 2H7YA 3UAGA 5EQJB 1CJMA 2B4TO 3DMFA 4K6HA 4C3VA 2RGDA 1J99A 3AX6A 3P5SA 2I2CA 5DYWA 5I9TA 3RQSA 1LGYA 1M5TA 2GFQA 1PI3A 4L76A 1Y5LA 3BFKA 1IXSB 3LVQE 1D7OA 1PK8A 2FX3A 1TYEB 5CT8A 2YS7A 3OO1A 4RTMA 4XD2A 1NE2A 4TTTS 5K0TA 5AKGA 1EK1A 3AHHA 5J2UB 1AC5A 3B20A 2Y0BA 2HCRA 3AW9A 3E15A 4ID9A 4XCVA 4UU8A 3R41A 3DLCA 1A04A 1OA0A 4GLOA 4JYPA 3HM9A 2XNCA 1EI9A 2YXBA 2VPIA 4KVAA 3TYXA 4EIWA 3COJA 1P81A 1W30A 1R5NA 4KIJA 1E0JA 1Q1BA 2GD0A 3IT2A 4I9NA 4XGKA 1PS9A 4DA8A 4G25A 1ATIA 4IDPA 4IQ0A 4OYRA 4RNDB 2B6NA 1PJ8A 2Q1WA 4OAOA 4RLQA 3H83A 4NV1A 4IDCA 3A2KA 4WN9A 3NC0C 4YLEA 3SICE 3EEQA 2VSOA 4RA9A 3VNSA 1T24A 1YULA 2G70A 1ULSA 4E4TA 2PKRA 1H0RA 5CCXA 2JATA 1PTKA 2PXAA 3CPSA 1YH3A 5KNBH 2QZ9A 4MW5A 1K7SN 2W11A 2YS6A 3EQ6A 3O74A 2C29D 1VMAA 1ZEMA 3KLNA 2VPXA 4MIYA 4W1PA 1KP9A 2I3DA 3GU3A 3I6BA 2G72A 2NQ2C 3A4TA 3D2BA 3N05A 4R7TA 2XBMA 1QZUA 4O2AB 4W6ZA 1PLKA 1QM5A 2GEKA 4KYUA 2CLMB 3B89A 3OE1A 3QUTA 2RGRA 2ROQA 3DBVO 1ZD5A 5FOVA 2JIOA 2VP0A 3HR4A 1TUIA 3ZDEA 3V7WA 4MDFA 3OIDA 1W8IA 5J4HA 5JHHB 2ZRMA 3F46A 3GFPA 2QRZA 2K87A 3FKQA 2FOLA 2O2GA 2GBGA 3GVXA 1F5NA 4FIZA 4XE5A 2M6KA 4G6ZA 5ALYA 4ETIA 2A0XA 2QJRA 4ZDJA 3OC6A 1ORVA 4I5GA 3GGPA 4EWLA 1K7EB 4PAGA 4F5YA 1E3JA 4PNEA 6REQB 1YRLA 2XTMA 1CERA 2RHTA 3DBLB 3G0DA 3GZNB 3N9IA 4FQ8A 3ILHA 4L3VA 4XEHA 2OCBA 4CKEB 5L40A 1KDZA 2NAFA 5LXTA 2WQ6A 2E55A 4N6GA 4NR0A 1LPBB 4W8HA 2UVPA 5CVEA 4B7ZA 2JJQA 5FPTA 1ARZA 2GO1A 4KQCA 5K3OA 3NX4A 1F0NA 2G0NA 1BS1A 2OO3A 2D4AA 3G0BA 3ZWNA 1TADA 3RHFA 3UHAA 1J2JA 1XDSA 4M7PA 4NZMA 4B87A 2JG3A 2WHYA 1O6GA 4RF3A 3K1ZA 3SSNA 1GGMA 1MKYA 3BCUA 3UJAA 1PFVA 3EXIA 5K4HA 1N5OX 3KOUA 3N2LA 3X3HA 4E5VA 3NKVA 4UBJA 2CNBA 4JOQA 4K6OA 4MW6A 1PTJA 3PSHA 4UMEA 2XQGA 2IPLA 3O83A 4BHTA 1SRQA 1WDMA 3B7GA 4QQFA 4FM9A 5DM1A 5C1BA 2L0XA 4MWTA 2RD2A 4YDRA 1YRYE 2Q2NA 3O0DA 4JKOA 4X1KA 1WCIA 2GVZC 3FYSA 3WX0A 4AB1A 2JLXA 1D1PA 4P0QB 3R8CA 4R0NA 3V3TA 1QOZA 3WBBA 3G5MA 3K35A 5KS2A 5KSWB 5M5BA 3L77A 5E0OA 4AY4A 2NVWA 5B3LA 3EUEA 3P0FA 1T29A 3M6LA 3QXHA 5IC6A 1J9GA 2CF5A 4JI6B 3TPZA 4QJ3A 5JZSA 3KKMA 4MXDA 3BILA 4D8TA 3PXUA 1YVRA 3UQYS 1IN8A 3PF9A 4JCCA 3K9HA 1SEVA 3IP7A 3NP7A 4ZPXA 1KP2A 3IUEA 5JCOC 1P5JA 3AZQA 4JUBA 2C3YA 3TMAA 1PQYA 1ZOIA 4TXMA 5AVVA 4UEQA 5H3LA 2Z58A 3D6NB 4UTZA 4LCBA 6YASA 4OLJA 4KR7A 1NW6A 5DN6A 5DRYA 4HNQA 2IHYA 3OBBA 4RZIA 1CS0A 2I7TA 2WSBA 1GSAA 2CVOA 1LF0A 1TTHA 2VJDA 4YCBA 1KVSA 2B92A 1VJCA 2ONKA 2OVBA 2EQBA 3MOGA 4BKPA 3QTLA 4M0CA 3AJAA 1ADFA 3LPDA 5EINA 2JFVA 3JD1A 3THYA 5AO9A 3EZ6A 2XUDA 1H2WA 4FU0A 2Q5LA 3Q7PA 4GXRA 3M7IA 5KTRA 5D1NA 2FPLA 3GUUA 2VNAA 5AM5A 1GDDA 4B3CA 3KU4A 1LZLA 1N7HA 1NR1A 4GICA 5CVJA 5D3MB 4CCYB 5A62A 2I6GA 4MDEA 2R6HA 5HKLA 2IS6A 2Y8EA 5CLGA 2OO7A 3SXPA 2JIPA 4JJ7A 2VP5A 4WZAA 5EEGA 3T0FA 4F06A 2JCGA 1O87A 3NCHA 4PTYA 4RA9B 3VHXA 5KX5B 3GZ4A 2EWVA 4HUTA 2VUUA 3QM1A 5BRAA 1SKQA 4IXNA 5B3JA 4ENPA 2A78A 5THQA 2FJPA 3LOPA 3DEFA 5CYOA 1HC7A 3V8QA 3E9RA 3GEBA 3HRIA 4LJSA 2DF8A 1TJYA 3HCPA 3G7SA 1IHDA 2GKGA 4J0CA 4OHUA 3WBKA 2WRZA 1KJIA 1W2GA 3GFOA 3GF4A 4MQEB 5BWOA 1P72A 4YQYA 4RULA 4ZYXA 4RL6A 3BWEA 4DLBA 5BMVF 3HL4A 5KOIA 5JAIA 4EHFA 4A2CA 3BCSA 3GEEA 1BGWA 5EVCA 2B78A 1DWUA 2A0KA 2X8JA 3EXHB 3ROGA 3X1DA 5EWMB 1IY9A 3JQ7B 3ZYZA 5IU6A 1TAQA 4U7HA 3KR1A 2ID7A 3I2GA 4E5UA 5AW9A 2ZIVB 4TT3A 3TI9A 1B8OA 1HQCA 3KQMA 1EE9A 3SR3A 1V1RA 2Y68A 5IDVA 3T99A 5BV7A 1UKZA 4K5QA 3B7WA 4EPVA 3I5XA 1H93A 2I6SA 3ESDA 1O6CA 3FAKA 3CV3A 4WLNA 2QORA 2ZVDA 1BWSA 1JLSA 4RH1A 5EIFA 3BDVA 5BWCA 1G3MA 1XNJA 1BW9A 1YE8A 3GUVA 4IMRA 4PSCA 1KPGA 3X1YA 4AJKA 5KYUB 1NFRA 1EQAA 3I9V1 2MT9A 4ND5A 4U7TB 3RFTA 5B1SA 4MMXB 3WNCA 1DXYA 4KBFA 1YGPA 5L53A 2IUFA 4MWBA 4NOJA 4Y2QA 1DEXA 1A98A 4DCJA 3U3OA 1XEWX 4D96A 1X86B 3GLGA 3TZ6A 5IUKC 3GT4A 4C88A 1AGRA 3HKBB 1OMOA 3F1KA 4G4GA 2O3TA 3U17A 2QYTA 4CI9A 5FUXA 3V2GA 2XB8A 1OTYA 3P2KA 5AVOA 3RCBA 2Q28A 5DI3B 2XB4A 3PS9A 3HXLA 3ZE0B 1PL7A 4EY4A 2BE9A 1Q1NA 4TVKA 4RFLA 5H70A 3IHLA 4R9RA 2QBYB 2H2WA 2BEKA 3VKWA 2ZRNA 1A27A 2PN1A 3PFCA 2X8LA 5E4JA 3K96A 2ZRDA 3AF6A 5CFZA 2BONA 1X87A 2C3OA 2G67A 2JS7A 2QZPA 3EH1A 2OZKA 3EWNA 2P8SA 4DV0B 4JJEA 2H31A 1G60A 1J0BA 2I0FA 5DM70 1WF6A 4K6CA 3M34A 3PXEA 5LQJA 4R6WA 3H9JA 1O9HA 2J59A 2XUKA 3K72B 4ZT3A 3LHKA 3Q9SA 2GGSA 7MDHA 2G9NA 1J06A 2C97A 2N75A 1VYTA 3OQ1A 2NU8B 3K0SA 1ZH8A 4CU2A 3MXTA 1TFUA 1ECGA 3JASB 2D5LA 1IEXA 1FX1A 1XVUA 3HEMA 4KYVA 4YRLA 5A05A 3TW8B 3UBMA 4CT0A 5AD1A 1W5FA 1QR6A 3H8VA 2HF8A 3DOIA 3D3JA 5DTIA 4Z7QB 2H4JA 4M2LA 4E6EA 2W8BA 1AX9A 4JZKA 1LPOA 3KWJA 4WKGA 3UW1A 3C97A 4D81A 4OJQA 3NFRA 4BFVA 521PA 2B61A 4PPGA 3INYA 1LJUA 5IFLA 5C4IA 4BBJA 5E6UB 3DLTA 3JAKB 5P21A 1BCRA 4AN0A 1P31A 4FWIB 4V0SA 5I5GA 3VZSA 3WZMA 2FWMX 4F3YA 1Z73A 4BMYA 4DDVA 1R00A 1UDCA 4WLVA 1M34B 3G13A 3UH1A 1C1XA 5FQOA 1DCMA 1JAYA 1ECLA 1HYEA 3HMKA 5KPDA 3QVKA 1W46A 3OPQA 2AFHA 4JENA 4P33A 3RJTA 3IDZA 1YVEI 1Q57A 1J9EA 4TN1A 5B7NA 3V48A 3MA0A 4ZWNA 1T6BY 1V9CA 1DPFA 1U2TA 4AF7A 3F78A 2FN7A 3FKSD 1X15A 3WGNA 1Z9BA 1ZGBA 3DKIA 3Q8KA 3VNVA 4TKUB 2X5KO 1JLLB 3VUFA 2H0RA 1FYDA 1DP4A 4R6XA 3RVOA 3L0CA 2GN0A 1P74A 3A4LA 4Z9AA 1WOYA 4KB5A 1VC2A 1ECCA 2X7XA 1G5PA 4KQHA 4HF7A 4KXYA 3BRSA 3I12A 3NV7A 4RHUA 1U5BB 1MV5A 2C9CA 5J40A 3MCZA 4DMGA 1ZGJA 1K7FB 1KNXA 3EQ7A 3LC2O 1TO6A 3N8HA 3OLCX 2NPOA 4UVEA 3U4HA 1VKJA 3S6JA 4LK3A 3LKBA 3S2GA 3UUWA 1TYCA 5EJ9A 3RWBA 2FW6A 3AFOA 5CM9C 2QRVA 4PSDA 3O4JA 5FBQB 2Q3MA 5KTYA 1WZIA 4LKOA 4HPJB 3WDMA 1TUEA 4I6EA 1H8ED 4M55A 2QUKA 4C5AA 2G4LA 1DKOA 2HB6A 5BV8A 4NU0A 3ASZA 1EJ0A 1K3TA 1TL7C 1SVOA 2O5CA 3E5HA 5KYWA 1PWEA 3NCTA 2P1DA 3CLKA 1P45A 2V7VA 2XRMA 1LTKA 4Q6WA 4MQFB 5FPPA 4AJ9A 1T8RA 1FS4A 4ROSA 1L4YA 2LDXA 4XFDA 4HB2A 4KQ1A 2OD7A 4IJKA 4QDKA 1RMQA 5K2MA 3RFUA 2DWQA 1EUCA 1ULHA 3ZN2A 2OK7A 3CH6A 2ZUCA 4OHFA 1KZ7B 1E1DA 3MRSA 4GLLA 1IN5A 1FIUA 2ERXA 5IW8A 1A9TA 2C78A 1KZYC 4I3HA 3TQQA 5AUOB 1OLXB 3PC8C 4NZPA 1H69A 1T9ZA 2UUOA 5AM0A 3RAGA 4EPYA 1JHRA 5KYXA 1FP7A 1H66A 1ZMTA 2VJLA 2V7TA 3E5MA 5CT5A 5JD5A 4YALA 5DNUA 2VTBB 3R4CA 2GN2A 1U0OC 2ZRKA 1DX4A 4CMIB 4LF5B 4TQ9A 5A04A 4FN5A 1E3TA 2PTHA 3W2FA 2GKOA 3HYSA 5AM4A 4G8CA 3TD6A 2YVAA 3AB7A 3RVQA 4A8HA 3A2NA 1XROA 1E7WA 2Y1KA 5CB4A 1BKDR 2F4VB 1K0UA 3W1EA 5INTA 1I3MA 2BMJA 1X8XA 1QU2A 5IS2A 3SE0A 4KDEA 2Z04A 4A4DA 3AF4A 1QAMA 1N1EA 5FCDA 1HWYA 1ZIOA 2WG1A 1ZJ5A 3R4VA 1QFYA 4C7BA 3CZ5A 4JC8A 2LBPA 4DG8A 3DMTA 4X0EA 4RELA 1OHHD 5BY2A 3DL7A 4Q6BA 1DXQA 2PO5A 3WL8A 4PX9A 1T4MA 5D3QA 1RXIA 4C1BA 4ZZ3A 1PWYE 1H94A 3FZYA 4B6JA 4QEDA 3U4QA 2UZ4A 1C30A 2Y0PA 3LDAA 3G9XA 4IOLA 2DUNA 1APBA 1UMDB 4WUTA 3NHWA 2ODTX 1DGQA 4B31A 4WUVA 1RHUA 1UF9A 1QG6A 4I8DA 1OLSB 4QEKA 5TPWB 2WP8J 3DWEX 2FP3A 4L78A 3OLWA 4N6NA 2JBWA 4MZDA 4P4SA 4NBTA 2D7CA 4FDLA 2CXHA 1QVRA 2RGNC 3M4NA 3WFJA 2DWCA 4E70A 5DNCA 1RZUA 4AZ3B 1F9AA 2EJCA 2CJFA 3AUFA 4PYRA 1SXJA 5KMGB 2ZUVA 3N58A 3IV7A 3ZEIA 4W63A 2XYGA 3IV6A 3KM0A 1RI4A 3LXRA 1GEEA 4RVDA 5A3JA 3IDQA 1QP7A 3OG9A 3UAOA 1I13A 3DUFB 2FVXA 1ISMA 4B7XA 1P2VA 2HREA 4KQEA 4OQFA 2QY9A 1B00A 2Q3EA 2YZKA 3HR7A 3NAQA 5EYPA 5FYDA 4OYHA 5IJ0A 2PR2A 4YRRA 3A1TA 1W5SA 1Z8DA 3KJNA 3QUBA 3OX2A 5JWOA 5MF6A 4RSMA 1PL0A 4WK0B 1W93A 2XVZA 3ZBUA 4MQ5A 1DAOA 2OQIA 3H1PA 3W7BA 2BGWA 5COQA 4US1R 1RE1A 5LBUA 4X3CA 2G7ZA 2FB9A 2CNWD 2JAQA 4GKBA 1ODIA 5IDWA 4X1IA 5KBYA 1SAYA 3UV3A 1UJ6A 1NNEA 4ILKA 3VYVA 1QFJA 1W59A 1IAQA 2O07A 3IMEA 1EWKA 1L5MA 3LVRE 1SU8A 1LBTA 1RQXA 4OK5A 5EKDA 2W98A 2Y6UA 3EUFA 4YDQA 5ALNA 3SIXA 2BKUA 2JA1A 4TYMA 1AURA 4BASA 2PD3A 2DHCA 4MYHA 5CUQA 1RI1A 3W9UA 4MQ6A 5IC4A 2E1PA 4HT3B 4YMSA 3DB1A 3I53A 2F3QA 2F3UA 2P62A 1T3HA 3GWZA 3MGAA 4DJEC 3OEHA 3FCUB 2FWAA 1ZA2A 1TMOA 4IBOA 3AM5A 1G8FA 4F4CA 1O89A 4I08A 2YIMA 1XD2B 3FRHA 4NNJA 3WS7A 2HMTA 2VJKA 3QWFA 2R8OA 4HRXA 2P2CA 3ET4A 3GLTA 2IXBA 2F1RA 2WJPA 2E4XA 5SZHB 1F12A 1DARA 2ZRAA 2PGDA 2WWYA 1SC4A 2RH5A 3BA6A 3VR6D 1M34E 4IGEA 1R27A 3C74A 4EM6A 1WNFA 3P2YA 4EUKA 1OF1A 2BR3A 2TRSB 4YT2A 1HT2E 3V8MA 1K4KA 3GMSA 4MEBA 5EMNA 2Z5VA 3H3JA 3K0CC 2G9ZA 3OZEA 3HCCA 5HCUA 1YJXA 3C0KA 4CF3A 4W5HA 5AI4A 2A2ZA 4CDGA 2G76A 2OY0A 1P4HA 4C0LA 4PZEA 1RYFA 1SCIA 1V7ZA 3VZPA 4J29A 4N47A 4IIGA 1XE3A 1VPVA 3RSFA 1XQXA 3S1AA 4R8KA 5BRJA 3EA4A 3HZOA 1OHHA 2VRNA 4Q9AA 4AXXA 4Y67A 4CQNA 3F8TA 3M5DA 4KX5A 4DXAA 1U1CA 1GZUA 4RK4A 1HXHA 4AY5A 2ZITA 1L5OA 4GSKA 3VO9A 4K40A 4UNIA 1CNFA 1SBHA 3T4EA 2XKBA 4UOZA 5DBIA 2L82A 1Q7GA 4EZBA 3KZ1E 2AUMA 4RH0A 4Z7OB 4EEKA 3I1FA 1KEEA 3DE1X 1ZR2A 5GV8A 4GXNA 4YFVA 1MHTA 3LT2A 3GEHA 1GARA 1RKUA 4GMDA 4Z0NA 4AG5A 4PIVA 4B74A 5CXXA 1XR3A 2VBFA 3O4FA 4X44A 5DTMA 3TI7A 3HVKA 5L51A 3EAGA 4XCQA 1M67A 1VI6A 5JDCC 1G9SA 3SS9X 2OQVA 4FW9A 5GGYA 2VI5A 5DK4A 2B8EA 1CEXA 4DT1B 2P3OA 5I51A 1D2MA 3AM1A 1GZVA 4O2BA 4KIFA 5AHOA 3V4LA 4AUMA 4BNHA 3G9ZA 1EEHA 1K2WA 2ZIAA 4PU0A 1NAHA 3A4VA 1JJAA 3L6OO 3HSSA 2O5RA 2B5OA 4D0NA 3LDGA 4EITA 4MWEA 4H3KB 4P4NA 1O95D 4D5GA 3FPLA 5J2TB 1BMDA 4BGIA 2CT8A 1N36B 2ZRLA 4QYMA 1QK5A 1ZNQO 1N78A 3BJIC 4NYIQ 5FPHA 1PDVA 3LSYA 4EBBA 2GEDA 3N5KA 3OTWA 3WL4A 2VA9A 1ZGHA 4FXOA 1GRVA 2JFWA 3Q1KA 1T8WA 2UVQA 5DV9A 2VDOB 4X8HA 3TQRA 1G0NA 1ZHHA 2WSSA 4QA9A 3PEUA 4DNOA 5T8KA 1JFVA 4RKWA 2CE7A 5HBRA 5FA5A 2NZJA 3U7FB 1RXUA 1GN8A 4K6MA 1QGOA 1R74A 4A15A 4OQDA 3FGOA 3NM4A 1QVWA 4DCVA 5KYNA 2YASA 3R7WA 2IKQA 2I3ZA 4HLNA 3CR3C 3UC5A 3DLHA 1PQ4A 4C21A 5FA8A 4I0WB 4KQMA 1BDBA 4NMHA 5JS1A 3KB1A 1KTVA 1BEZA 2PMBA 3GVHA 4G2NA 1OW3B 2BGMA 1OT3A 1DCFA 1TM4E 3C3DA 3M5PA 4TUYB 2OA0A 1XVIA 2DG2A 2QMUA 4DLNA 1EFRD 2PQMA 4R71A 2H9IA 4O2AF 5HIJA 1XWFA 3DDCA 1EX9A 4R9SA 2UXBB 1N2EA 3WRXC 5FOTA 3CO0S 2DPXA 3E7PA 2ORWA 1OV6A 2GK3A 4UBMA 1GVNB 2GJ4A 1XVTA 5DNEA 2A9OA 3SSOA 2VJBA 1X7ZA 4OQQA 5EKTA 2NO6A 4W5RA 4ZI2A 3IH5A 3WTCA 2B4YA 5DI9A 3OHMA 4K9NA 2GYVA 5IM5A 4BX9A 4DLLA 1KZ4A 3K4PA 4MV3A 4WERA 5HMMA 3EXHA 5GONF 3IUJA 3SYLA 1G3RA 1AOXA 2L2QA 1NXOA 3JVVA 3B9BA 4E46A 2RHGB 3SK0A 1N2CA 3C8HA 3I62A 2FSVC 4YCAA 3TQTA 1VHLA 3ZNOA 1W5BA 5H59A 5L8VA 3NYQA 2CGEA 2PQ0A 3B48A 2FQWA 3RC9A 4I4IA 4JEUA 5HF9A 1USWA 5EJEA 1YRWA 1BKYA 4RPGA 4R2MA 1ZINA 3I0ZA 3ILVA 3T3EA 3B5EA 4C0HA 1K0FA 1NBOA 2FUNB 1IWPB 5EHXA 4PINA 1Z0JA 1GGNA 3THWB 4FFNA 2ORIA 2P75A 4S0XA 5LYJF 4LK2A 4X97A 5IKXA 1TM7E 4X3OA 3WK4A 3RU7A 4ZPJA 1QE0A 4XUEA 3KT8A 3C6ZA 2ZEJA 5BUQA 2HA3A 2RHLA 4DQXA 3DF7A 4JEIA 3GRFA 1GNSA 2X8WA 5EFZA 2IHUA 3OU6A 1K9VF 3EXAA 3VHQA 1H6AA 3FVWA 3FSGD 4YLYA 2CHGA 1T2NA 2I8LA 1BE1A 3EEOA 3CX7A 4PLTA 3FVVA 1SXJC 1X1RA 2PNFA 1WCWA 2A9QA 2G80A 1ADJA 4HDAA 4E88A 4ERXA 1B2LA 3EQZA 3MILA 1FFWA 1WXIA 3LUJA 4GX2A 4P86A 3RYCB 3PDJA 4OHMA 4IEIA 4NKRA 3AB8A 4M1YA 3RLFA 4K0KB 4RXTA 2AG1A 4ZJYA 1E0SA 3SHOA 4P4TA 2Q5CA 2NUTA 4RHFA 5HS4A 4KR2A 1FPQA 4HGZA 4X7MA 1QH1A 3BCHA 3HYLA 4R7GA 2YYSA 3INRA 5JTUA 2C4WA 3DPUA 3LX6A 2IL1A 1E1LA 4FLEA 4RL4A 3M3DA 1OOEA 3HCEA 2EKBA 4CEIA 2GAAA 1IHXA 3LLCA 3O5AA 1VZ2A 3AHFA 1SVIA 4M8NE 4P3OA 1XN4A 3EWSA 4IV8A 2V3VA 1JEOA 1NKTA 2L42A 2ZSIA 3VR5A 1NQWA 1Q95A 4DDTA 1W75A 1VLQA 2JGKA 2JI9A 3EGDB 5ALSA 1I8TA 5GJBA 1W4RA 1G18A 1WTAA 1XI2A 3EMBA 1NAIA 1RWNA 2BI4A 3H99A 4AMYA 1EFPB 1EDEA 2L17A 4HY3A 2QSZA 4JP2A 5C4GB 3VZRA 2A57A 4BWYA 3MRVA 1E63A 4BYMA 3Q0TA 3F7TA 2NPFA 1SURA 1WB4A 2H59A 3ADPA 3Q6NA 4CLOA 1CEEA 5KKAA 3H5IA 3KKEA 3ROQA 4I8IA 4GM4A 3HDQA 1BA3A 1SVSA 4F1KA 1QK4A 1N6IA 2WAMA 3P4XA 2QMZA 1IBCA 1ZL2A 2AMJA 4UASA 3RJMA 4LDPA 5K4GA 2Q6VA 3OVMA 3D7RA 4NFSA 4CBVA 5JS8A 4MW9A 4E4YA 1VI2A 3L8YA 4B84A 2J08A 3ZXYA 2CLFB 3E84A 3P0IA 4N0EA 4NOMA 5HCNA 2ZUDA 2VAPA 3QJYA 1AMNA 4OAPA 1XLTA 4G63A 5KX5F 1LQ2A 1CUAA 1NJ5A 4NHEA 2E0IA 4TTQA 1FMTA 3H11B 3JQGB 1DPGA 3HHEA 3K9LA 4O4JF 5TMDA 2I5PO 2AW5A 2HRQA 2I71A 2BFAA 4YGXB 4B48A 3H2SA 1L4FA 4CMGA 4UM9B 5I7HA 4J7UA 1U8YA 2P78A 3WBJA 5GIPE 2WUEA 3QE2A 3LUGA 1V48A 1KH2A 2GM3A 4A82A 1ZK3A 3GPBA 1UJMA 4WKBA 2YN4A 4BQQA 2OXIA 4RDXA 1Y1KE 2PHZA 5B30A 4DV2B 5EESA 1TT7A 2J3EA 3GZNA 3AJEA 3IC5A 4CKEA 4DF3A 5A0VA 3EF3A 1OD6A 1TLFA 1U3FA 2ZJFA 2AUTA 4OKSA 2W9XA 3GFBA 1I4EB 4IHJA 1KVRA 2BFFA 2Q3FA 2YWGA 4G81A 1OX5A 3H8JA 4B0OA 2CL0X 4EVIA 3THXB 3GRRA 2I67A 5DSTA 3GCGA 4QUKA 3FE2A 2JJMA 4M7RA 1S1CA 5LN1A 1UPBA 1ZJZA 4IJVA 4B3SB 4BB6A 1OAOA 1GTRA 1KAHA 3D0OA 4QL3A 4QYTA 3FOZA 1ZDMA 1C7FA 1EP2B 3GUHA 4P31A 3UMSA 3UXYA 3U44A 3SIWA 3NPMA 2YFKA 3I04A 1RZVA 3SQWA 3C14C 2IH2A 2YWBA 4YCSA 2EF1A 2WJYA 3VU9A 3ADKA 3PC6A 2R8PA 1I7SB 1XRQA 4X41A 3NIDB 2B1IA 4B2YA 4LRSB 3UV7A 1IXRC 2CMKA 2QRMA 4PIMA 5KZMB 1OASA 1TT5B 3ZIUA 3FPBA 1U98A 1UADA 2OSVA 4MUJA 3N7AA 1R0SA 3ZU3A 4EECA 1JHPA 2ZYWX 1NQVA 5KTNA 2H9AA 2Q4OA 3K0AA 5DO9A 3CRRA 3I2YX 5SY9A 2WF5A 5JBIA 3TL2A 3OOHA 1RQLA 4Q1AA 1X92A 4QNRA 2FQXA 2EFYA 1XF9A 1H4SA 4MPPA 3NT2A 3RUCA 1RBYA 2O7NA 4H7KA 4S05A 3LW8A 1XAJA 3TIIA 3KQTA 1IVSA 4IKEA 1NW8A 5A03A 3OZXA 4W5WA 4GWLA 1UIMA 3GH1A 3PR1A 4IEEA 1CZOA 3E3MA 2YWFA 3H7AA 4EPRA 4DR5B 2RH8A 1VYVA 2OBYA 3KDSE 3HDJA 1T2EA 3EC2A 2EWWA 4Q3NA 3DGEC 2Z2XA 3A1UA 4NJEB 1WD7A 2A1TR 1XMSA 3HFRA 2IHTA 2EX1A 3EFHA 3EXFA 3KVNA 4K05A 4U4AA 2ZUBA 3Q6IA 4UUPA 1IK6A 3ZWQA 2IPXA 2PV7A 3CX3A 2IEGA 4HTAA 4EA8A 5AIBA 3E1SA 4URUR 4UXHA 3KYIB 2HRDA 1PBTA 2X5OA 5AKXA 4Y0NA 3LSTA 2C92A 1DV2A 3NJ8A 5F12A 4X84A 3MTIA 3IPYA 2EP8A 3FNGA 3UFBA 3UMCA 5AVUA 2W2NA 1PEKE 3NOQA 1X8KA 3Q11A 2O3SA 3WIEA 4MINA 4KXMA 1AY0A 2DBYA 3R5SA 4Q7EA 3WHLA 1AF4A 1MQ8B 2EX4A 5ALLA 5CFRA 2Z6VA 2PX3A 5JC1A 3HCNA 1V7QA 2QRNA 4KHZA 4PZPA 1SD2A 1G59A 4JLKA 3E3LA 4OO3A 4ZQCB 4DUYB 4K1XA 4PN3A 2WM8A 4DBVO 2ZSBA 3JATB 4PCVA 4QOEA 1IG3A 2QWXA 3NH9A 2IELA 2P2NA 3RSQA 1G21A 2PMEA 1E8DA 5JH7B 3LRXA 2W48A 3J81k 2F43B 4LYAA 4YR9A 1FMJA 1IHOA 4BVAA 4UEKA 2WT4A 1P1JA 5JO0A 4OBXA 1QS0A 4JI8B 2PUTA 4G67A 5LBTA 1K4YA 2I4RA 3L8MA 3DCJA 3E9EA 3VSBA 2IYUA 2JH9A 3MMPA 3ELWA 3PQEA 5DLPA 1U0SY 4ER6A 3ZDDA 1U6IA 2FPWA 5THKA 4DREA 1SUBA 3KUUA 3FRIA 4IS3A 1E2NA 3DE0X 1A8QA 3H1TA 4OYLA 3LBHA 4NCIA 2IE0A 4JAVC 4AW9A 1F38A 4Q3OA 5DWQA 1B0AA 4NFLA 2OAGA 4JVSB 2JBHA 4MLPA 4EY3A 1I3NA 4K3UA 4YRCA 1L7BA 1QRTA 3FNEA 1Q50A 4RK5A 1TO2E 1AKVA 3HN6A 3U3JA 5LMUB 2XW6A 3BJZA 2DGDA 1GT91 1KFBB 2JI4A 3EVGA 1P5ZB 1OX4A 3O8QB 3EMDA 4H6XA 3L6EA 3BIWA 4L5JA 3UK2A 1NNI1 4BZQA 3RHSA 2P9BA 3GXOA 3T7DA 5KKNB 1NJ1A 5E7MA 1WZNA 1Z74A 3PXCX 2WTUA 5TC4A 2FE1A 3EVCA 2FUCA 3ABOB 2RI1A 3BWVA 2CK3D 4XD7A 3L3BA 3RI3A 4EUNA 3NXKA 3Q8MA 3R9XB 2HXGA 4B09A 4A9AA 1SOMA 1JHYA 1VL8A 2OE2A 2OB2A 1HDXA 4ZEXA 3R9WA 2IPMA 1B4DA 1ZCZA 2YJNA 3EK2A 3KNZA 3B1WA 4I19A 3CNOA 2JEZA 2VBGA 2VN8A 4YACA 5HF8A 5JCZA 3SBDA 5JHGB 3WL5A 4YJ3B 2J3MA 3OA2A 3PJGA 5IEBA 3CNLA 2Q8QA 3MFYA 3WIUA 2XB6A 1JLMA 3IDFA 1MO2A 4C1NA 3ORSA 3QU2A 4P4SB 2KBFA 1FL9A 1U3GA 1Y1QA 4MDYA 4EX6A 1I30A 3JZDA 2I4MA 3WWEA 2AOVA 1T0HB 4QGAA 1OKKD 3O3MB 2BGKA 4P83A 1FSPA 4DBZA 4MHOA 2FY8A 4R69A 5HIIA 1JFFA 5JCJA 3UAWA 3IIKA 4YK7A 3L41A 1JF8A 1UR5A 1Y9ZA 4QRDA 5AKJA 1FYWA 2QW1A 1JKMA 4EZEA 4W5JA 1KI9A 2BFMA 5ESDA 3PQDA 4BNJA 1UPUA 1O0BA 1CF9A 4MICA 5B58T 5M2QA 1BRTA 4OMFG 4OCZA 5F4BA 4ND7A 1DSSG 4WXYB 5TIIA 1PV2A 5ICFA 2C7QA 4YYEA 4CQMB 3WTBA 1USIA 4D8UA 1O3YA 3W3ZB 5CB4B 2EJUA 2GBLC 4EA7A 4Z9XA 2VCHA 5DMXA 2R1UA 1W7AA 1F7VA 3A9VA 3FPEA 3KK0A 5CR9A 1LC3A 2PL3A 3U3DA 3IUMA 5KTTA 5CCBA 4CMIA 2IZZA 3I4CA 3V2IA 2IY7A 2FGJA 4DA4A 4X6LA 1C9MA 1TJ5A 1FXWF 2VLBA 1JB1A 5DWDA 5EMJA 5CEEA 3AP2A 3EZ9A 4GNKA 1Q7TA 4XVHA 4MI9A 1AMUA 2ZJ3A 1U4OA 2GUWA 2WD7A 4R83A 5KYVA 5ESWA 1E3IA 2MSNA 1VHJA 2CXOA 1T6ZA 3K8OE 4AAYA 5JNUA 1PZHA 2CB9A 2HWYA 4QWMA 3BZBA 1QH8B 1KNQA 3EFOA 3P52A 5IHPA 3BK7A 2FGKA 1VKOA 1OZ0A 1HT0A 4NCXA 4NDAA 3THOA 5CA0A 4JB3A 3V1LA 4DJDC 2XXBA 3N0TA 5DLQC 1RPAA 3GIDA 4ED9A 1QP8A 4W7HA 3ZZTA 1EFLA 1NW3A 1OY1A 2CVQA 4M8KA 2WHQA 1GVHA 3MFQA 2YHIA 1EG7A 1WUTA 4UDOA 1NI4B 4BNIA 1SD5A 3K2BA 1YCFA 5C35A 3N3AC 1DFIA 5CDFA 2DLCX 1MJHA 2GR9A 1V5GA 2VDLB 3BMQA 5H3HA 1LI5A 2BF7A 3OJCA 1XMQB 1RC1A 2QRVB 1BWPA 2CLSA 2GYWA 4K86A 3GEMA 3ZK7A 2BP7A 2XKJE 2C2WA 3B53X 2J3HA 4RIEA 5IT5A 2QN6A 1ZK1A 4H1HA 5HTKA 4W9NC 3UUGA 1XXHA 1HFEL 5JCJD 1CY4A 5IBQA 4BFXA 4BVHA 2O3QA 4KSBA 1P1BA 3O93A 3OPYI 4Q1FA 3A9WA 1DCTA 4GBMA 2WTBA 4DCGA 1OX6A 2QXYA 5DCWA 3HA3A 3T3GA 5ECGC 1I0IA 2IU4A 4RY9A 4EFDA 1AK1A 5LQRA 1XOIA 1D6NA 3MT0A 3WAKA 4ARVA 1L4MA 1ZYUA 4YCJA 5F23A 1WS6A 4H35A 3AIKA 4G5RA 3SVZA 5E3JA 3UCFA 1O57A 1GZHB 3BJRA 4ZN6A 3X2EA 4U9UA 1II8A 1FDWA 2BWJA 1O97C 3MWKA 5CM8B 3I52A 1N2GA 1C8LA 3HUEA 4KPUA 1DC5A 1LDEA 2J0VA 2E6KA 2QMHA 2V03A 3A6EA 5H4HA 1KC3A 4JB0A 2H1RA 4LXXA 3GRYA 1FSGA 5TX7A 2ZJ5A 4EKDA 1PNTA 1XZCA 2VJOA 1RM4A 3KR9A 4Y1GA 4DMKA 1Z6PA 3IDSA 5ALWA 3RU9A 5BSVA 1LRLA 2H1CA 2X1MA 3E3NA 3M1LA 1MQAA 3N28A 1E3QA 4L95C 2DUMA 2P4QA 1W4AA 1HV8A 4ZOLF 4UD6A 3AM3A 4Z8YA 1JHOA 4WNYA 4DIKA 4K8OA 3I5AA 4YXWA 3TBHA 3VO2A 3AR9A 3VOBA 4CM6A 4MVJF 4FDAA 2H08A 4YRGA 3H5VA 4GP7A 4NOLA 4DFDA 4PBTA 4ID3A 4OK6A 3QW4B 4FQ7A 2JBAB 4J49A 2Z43A 4KO2S 5BSUA 1JTFA 5L9AA 2PUWA 3U81A 4DWJA 2XCTB 1EK0A 1SXJD 1QPGA 1FNNA 2QG9A 3PBKA 4NJOA 3H16A 4BV8A 2J07A 3ICOA 1T3SA 2PJUA 4BKRA 1HZZA 1JECA 3HA7A 4TWJA 4LYFA 1N5KA 2Z2JA 3FHOA 1ODSA 3G0OA 3IQEA 2CJWA 2EBWA 4U7PB 1RYYA 3WIVA 2I54A 1ES9A 3UAZA 1JX6A 1DBSA 4IXWA 4AZ0B 1RXVA 3A9TA 2AOTA 3T7SA 4CU5A 3V80A 1UFVA 2R2AA 5IK2A 1LK0A 1VTKA 5IBCA 2DLNA 4H6PA 1II9A 4CMEA 3S0JA 2DJIA 3I32A 1AU9A 2FW1A 4HEA1 3ZWAA 1QP0A 4GP9A 4HNRA 3F3MA 3HZZA 4HWPA 5DBHX 1QO9A 4KGDA 1T9GS 5FBVB 3K6RA 4BAUA 1KWGA 5IYZF 2Q8PA 1UDXA 3CWQA 1AO3A 4LF7B 1ST3A 2AFIA 4MR7B 1E96A 3D8NA 5F52A 5TPZA 4RJ2A 4ZOLA 3V00A 1TMGE 1OZAA 4FFSA 4MMYB 3EY9A 2ZIZA 2C5SA 3PA8A 1Q2XA 4KAFA 1BMTA 4WQMA 3JQ6A 5DEIA 3PJRA 4GVLA 3D7MA 2OHOA 2JIZD 2D1TA 1F0KA 1A88A 1JDJA 2OHVA 1RIFA 5J4KA 3N2ZB 5CLJA 1QTIA 5KTMA 1RHQA 3CIOA 4B9AA 4O25A 4FEGA 4H6WA<