4X90A

Crystal structure of lysosomal phospholipase a2
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
376
structure length
376
Chain Sequence
HPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Group XV phospholipase A2
publication title Structure and function of lysosomal phospholipase A2 and lecithin:cholesterol acyltransferase.
pubmed doi rcsb
source organism Homo sapiens
total genus 139
structure length 376
sequence length 376
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02450 LCAT Lecithin:cholesterol acyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4x90A01
3WLAA 1QFSA 2QT9A 3BWXA 3GBSA 4RE5A 2WJ6A 1M33A 4KE8A 1TCAA 4MQLA 2FX5A 4J0CA 1E8DA 1E89A 2GBCA 3WL6A 5A7HA 3LLCA 5AICA 2BUCA 1DINA 3DEAA 4Q34A 2VJDA 3D2CA 5AK5A 3A6ZA 3ED1A 3L1HA 3STTA 4PSCA 2BGRA 2XQFA 3I28A 4M0MA 4OYLA 1KEZA 1YB7A 3O4GA 3DNMA 3FCYA 4G5XA 2D5LA 5AKJA 4BAGA 4X94A 1NX9A 4CI9A 4WFIA 3H19A 2WIFA 2W22A 4QDTA 2WHQA 2WM2A 2VSQA 1K4YA 5KWJA 1QGED 4L72A 2V98A 4NMWA 2XUDA 4KR0A 1PV1A 4G8BA 3KXPA 4O08A 3R3VA 3HXKA 1QIHA 1X2EA 2CKMA 2Z8XA 1K6EA 1H2YA 5LKAA 2CZQA 2QXTA 4AO6A 4EY5A 1BEZA 5ESRA 1QIDA 1LGYA 3DL7A 4M0FA 5AOBA 3ZV7A 1QO7A 5DYWA 3I1IA 4C01A 5DTJA 2NW6A 4P9NA 5A71A 2OGZA 4UBNA 4BRZA 3WJ1A 4UHBA 1VE7A 4B82A 1ZOIA 4Y2VA 4H7DA 4P92A 3W06A 1K8QA 2GZSA 1UXOA 5IVHA 4EUSA 5CT8A 2JGJA 3STXA 5EIAA 4OB8A 4QNNA 3IB3A 1R88A 4EY4A 4IO0A 3VJKA 5D3KA 1CR6A 1TCCA 3FYTA 1G66A 3SC2A 3LIIA 1XZEA 4C88A 2DHEA 3E3AA 3F9CA 3BL8A 5ALXA 1N8SA 2WUFA 1F8UA 4KAJA 5AM5A 4MJ3A 4DTCA 1BS9A 5CRIA 5AI4A 5FP0A 2AJDA 3AINA 3ESBA 5BWBA 3PUIA 1UK9A 3DJYA 1UT6A 2QZPA 2DR0A 4J0DA 4ZWNA 4X97A 3DKRA 1E8MA 2VAVA 1LPNA 4C6HA 1ZJ5A 1CUGA 1YA4A 1GPNA 2HM7A 4G9EA 5C8ZA 4XVCA 4B6GA 3WKCA 5AP9A 2XQJA 1EK1A 2CBGA 1WHTA 1YB6A 2PVSA 5K3EA 2HFKA 2HL6A 5C8XA 4QWWA 3ZLUA 4JEIA 2G63A 2JGIA 4HRXA 3FVRA 1YA8A 1Z68A 4C4ZA 2XUIA 4BDSA 3HLKA 1JMKC 3ICVA 5CBKA 1U65A 2ZYIA 1O6FA 4DNOA 3VJLA 2FUKA 2O2GA 4FTWA 4DSZA 4N5HX 1JT2A 3BF7A 2C58A 4H77A 3WIBA 4AO7A 2QTBA 3DL4A 1CUBA 3GUUA 3VVLA 3O4IA 2QXUA 1ZD2P 2VF2A 4G9GA 1QIFA 1RYYA 3AIMA 4DNPA 4QDOA 2ROQA 4B83A 2OQVA 4DIUA 1JJIA 2JEZA 3A2LA 1VE6A 1XROA 3AILA 2WIJA 4G8CA 2OPHA 1EK2A 4UUQA 5I7UA 3QITA 5IVIA 4MQMA 3H18A 2VQ6A 2XMGA 3HSSA 4X85A 2RAUA 1FSSA 5HK8A 1AMNA 4GXNA 2BJHA 3IULA 3EQ9A 2HRQA 4U2EA 2QKYA 3H0CA 3EQ7A 4X3CA 5AI8A 4DMKA 4X00A 3AFIA 5K3DA 4EY8A 4NZZA 4BTVA 1QIIA 2XLCA 3T52A 1XZAA 5T4BA 4FLEA 5JZ9A 4BC0A 3C6YA 5JALA 1ACJA 4HXFB 5DWDA 1LNSA 2RHWA 3LP5A 4I19A 3OPMA 1A7UA 2HADA 2XUOA 4UBIA 3B12A 3M3DA 4BZZA 1E3QA 4HXGA 1FFCA 2G5PA 5CT5A 1GKKA 1UKAA 1LPBB 4UBOA 5DNWA 3NGMA 4ARAA 3R3YA 2JEYA 1BCSA 5ALRA 1IMJA 1UK7A 2PL5A 1MAAA 4UHFA 4Q05A 2V9ZA 5AIAA 4B9EA 3BDIA 5FPPA 4BTLA 1Y7IA 5EIHA 1BCRA 1GT6A 4CG1A 1EVQA 3TRDA 3G9ZA 5FKJA 2WG0A 3FCXA 1DX6A 2VJBA 2XUKA 3A2NA 3RKSA 4BP9A 1XKTA 5A7GA 2XUFA 1W4LA 4S0XA 3GFFA 1QFMA 2GYUA 2XMBA 4YK7A 4CCYB 4WY8A 4DMHA 4FDMA 1WOMA 5ISMA 3G9UA 5EHNA 5FDFA 5JAPA 4K6KA 2ACKA 4FFWA 4N8DA 4BDTA 1CUWA 3AZQA 2C5FA 1GPKA 4ZRDA 1UOQA 3B5EA 1W75A 1SCKA 3PF9A 2PSJA 3FYUB 5A6VA 5D3ZA 4BVJA 2QUAA 3DKKA 1AC5A 2ZJFA 5LKRA 3W9BA 4UBJA 1TK3A 2HA0A 4U2CA 4BVKA 4YPVA 4AMYA 1XFDA 2BCEA 1IVYA 5E4TA 1CUUA 3O4HA 1MTZA 2CMFA 2QRUA 3ZPXA 5CXXA 3BE8A 4H0CA 2OCLA 5HFNA 3C6ZA 2H9YA 1B6GA 1F0PA 1GGVA 3O9MA 4GDMA 1MNAA 3C5VA 1HPLA 1ZD4A 4I4CA 1DWQA 3WI7A 5AKGA 4J03A 2LIPA 4DM7A 1S8OA 2IITA 4UBLA 1X2BA 3M82A 4FNGA 1O6GA 2VT6A 5K3CA 2HIHA 4Y2UA 5BV7A 1AQLA 3VJMA 5I9IA 3R3WA 5JARA 2AJ8A 3OM8A 4X90A 2ZJ6A 5FV4A 4W1RA 1XZKA 3AZPA 3IDAA 3O0DA 5AKIA 1H2XA 4QDZA 4Q1VA 3BF8A 4MEAA 2Y6VA 4JYMA 1HDEA 3C6BA 4L3WA 1QIEA 4H7KA 5KWIA 3H04A 1TQHA 5ALLA 2J3QA 2EDAA 2XMRA 2BGNA 4CCYA 1ZI8A 3FLBA 3ESCA 5AJHA 5AM2A 1VXRA 1QZ3A 2UZ0A 1GPLA 5EHZA 2D0DA 2Y2UA 3ANSA 2VA9A 3D7RA 2HU8A 2XMCA 1P0MA 3IUMA 1UFOA 4KEAA 3N2ZB 1VZ2A 1H22A 4RE6A 4HRYA 3FYUA 5JAHA 1AUOA 3QMWA 2QJRA 3AIKA 1BN6A 4MWSA 4UBMA 1RP1A 3OC0A 2ZJ7A 5CT9A 2J4CA 4HZGA 1ZI6A 5C81A 2CEKA 2ZYHA 4BATA 4AXBA 3WWEA 1L7AA 1ZI9A 4F21A 1XRRA 5FUMA 5AM3A 4J0GA 3H2HA 1CQWA 1MX5A 5EHQA 3DYIA 1JU4A 4K5QA 1JKMA 2BAGA 4G4JA 1QTRA 3O95A 2WU4A 4U2FA 4KJXA 4LXIA 2X5XA 2J3DA 4N8EA 4X6UA 4Q3LA 2AXEA 2OCGA 3I2HA 3HRHA 4BZWA 4UHHA 1XRPA 1XZIA 3LCRA 3HYSA 1IUOA 4UFNA 1XRQA 4ZREA 5BWCA 3LIPA 3ZWQA 4B0PA 4XJVA 1BEEA 1LPAB 4TVKA 1U2EA 3R3XA 2QVBA 4GW3A 2XUQA 3G0BA 1JMYA 1WPXA 2PPLA 3I6MA 2WSLA 4KE7A 5LLSA 1TCBA 4KAFA 5AM0A 4AX4A 1K63A 3PI6A 1CUIA 5YASA 3W05A 3DCNA 4CG3A 1FFBA 4BB0A 5HKBA 4H18A 3WL7A 5DNUA 4HTAA 3IIIA 4D9JA 1J1IA 2Y2VA 4LXHA 1C4XA 3D0KA 4LKOA 3QM1A 2HDWA 1CUYA 3H2KA 3JWEA 4E15A 3FYUC 1W6RA 3UMJA 4QWMA 3ANTA 1ETHA 5JD6A 4LXGA 3TGLA 1R50A 2HU5A 1MJ5A 4X91A 4PSUA 2WHPB 5HF8A 3WL5A 4U2GA 4X71A 5CURA 3BJRA 1PJAA 1XQXA 1GQRA 2OAEA 1I6WA 3I2GA 4TGLA 3BJMA 3WJ2A 4BE4A 1ZJ4A 4EB0A 2PUJA 1XRMA 3MUOA 4OU4A 4DNFA 1W1IA 4Y2TA 5JADA 4A5SA 4PO3X 4PNZA 4G4GA 3CCCA 4K6GA 1ODTC 2GBGA 2WJ4A 2DSNA 3X3HA 4B85A 1AZWA 2DCMA 3FVTA 3TEJA 2CB9A 1WHSA 4LYEA 1BRTA 3DLTA 4KAAA 2VATA 5LZ2A 1QIKA 1CEXA 2ORYA 3KDAA 4X6YA 2XB6A 3FAKA 5CT4A 1YAJA 2E3JA 2XMQA 5JD4A 3GZJA 2G4LA 5AK4A 4BAZA 1XZMA 4JH0A 2ZYSA 2C0PA 2QUBA 4BYMA 2Z3ZA 1C7JA 1EDDA 4KE6A 2Y6UA 3S8YA 1CV2A 5AKXA 4Y2RA 3D2AA 4MYDA 3WK7A 1MT3A 3QBJA 1OXMA 4Y2SA 3V1MA 3WK9A 2HFJA 2R8BA 4WFJA 5AOCA 2XI4A 1QIMA 3G0DA 2QJWA 4KACA 2PSFA 1LZKA 1WPRA 3D4LA 4OU5A 1T2NA 3QZUA 2HRRA 2AJCA 1UKBA 3STUA 4FBLA 4B7ZA 3I1YA 1EH5A 2XQGA 3STYA 2V96A 3D2BA 5HF5A 2WIDA 1FFDA 5ALDA 5A7FA 1EB9A 2WHPA 4G1FA 1BU8A 1UK6A 2R11A 5LZ7A 2DHCA 1XLWA 1QJ4A 1YAHA 2PUHA 5HQ3B 5ALIA 4WDQA 2XDWA 3WA6A 4YASA 3D59A 3K9BA 4BCDA 1OILA 5ALVA 2VEOA 1CUHA 4FKBA 2OLEA 2HA2A 1EVEA 2IIVA 3P2MA 2DFPA 2B20A 3OG9A 3V9AA 1GKLA 4ZV9A 2VJAA 5T4HA 4QE3A 3ICWA 2I78A 2Z3WA 3HI4A 1GXSA 4BE9A 4GHWA 3ZLVA 3GELA 5ALEA 2PSDA 5ALYA 5AM1A 4U2BA 3CXUA 5AKYA 5DYYA 3DQZA 1F0NA 4BVLA 3PFBA 3QPCA 3NUZA 5DJ5A 2B9VA 3W2TA 2XUGA 3FWHA 4EY7A 2QMQA 3QPAA 2EEPA 2WUEA 2HU7A 1ZGBA 1XZBA 2WQZA 3Q0TA 1EINA 4AQDA 3H1BA 1P0IA 1W76A 3WQHA 5JD5A 3RM3A 2PM8A 1ZIXA 2G5TA 4WFKA 2B61A 3E4DA 3QH4A 1ZICA 1CRLA 2ES4A 3HZOA 2HA5A 3IUQA 4LIPD 3G0CA 5K3AA 4JUIA 4L0CA 4UHCA 1G4HA 1JU3A 4C4YA 2YYSA 3NWOA 4ARBA 4B81A 1XZHA 4LYDA 2ONCA 1FFEA 5IKXA 2AJLI 5LZ4A 3WK5A 1CLEA 3CN7A 3ZI7A 4Y2PA 2XMDA 2Z5GA 3A70A 2BFNA 3R41A 5J3JA 4Y2QA 1QIGA 1XLUA 2JGLA 4KRXA 4XX1A 5IH7A 5JAUA 5K3FB 5HQ3A 1LZLA 4DYHA 2C5GA 5SYMA 3IURA 4MEBA 4Y9SA 2Y1KA 1WCYA 5AI6A 1UKCA 3DS8A 5AKKA 4W1SA 2XUAA 2WLSA 4HAIA 4UFPA 2WFZA 5CH3A 3G0GA 3O4JA 5EIEA 1DTEA 4QA9A 6YASA 4WJLA 4B84A 1BN7A 1Y37A 3MGAA 4GEGA 3WZMA 1HKHA 1EHYA 1R9NA 1WB6A 5ALOA 1MN6A 5HCUA 1AGYA 1H2WA 3IUJA 5DYTA 1N5MA 3C45A 2JGMA 4OYYA 4Y2JA 4MYSA 4GI1A 4RGYA 2VAXA 3PE6A 4BRSA 1IUNA 5AI5A 1U8EA 1BE0A 4DNQA 5EGNA 4ETWA 3PICA 2JGKA 4HVTA 5F4ZA 2PKYX 3V1LA 2WFMA 2YH2A 4UFOA 5HF9A 1ZD5A 4L9AA 2J4FA 5A62A 3VDXA 3VVMA 4JYPA 5K5EA 4I3FA 1N5RA 2XMZA 1IUPA 2XUJA 1YS1X 2OQIA 3WWDA 1CVLA 3F67A 5AI0A 3WA7A 4JNCA 2Q0XA 3OURA 5IVKA 4AB1A 4H7HA 1SOMA 2O2HA 3AZOA 3SX4A 5ALKA 5CW2A 1QE3A 3K2IA 2O7RA 1LLFA 1CUEA 2X76A 3SWWA 4X92A 5CH5A 5ALNA 3KWFA 4EHBA 3WK4A 5AOAA 1CUJA 1U4NA 2DHDA 2VT7A 3WKAA 1B41A 1QO9A 4EZIA 5LZ9A 3I2IA 1PFQA 3D3NA 3M83A 1HQDA 4FNMA 2H7CA 4X95A 4F60A 5K3FA 1XZDA 3CCBA 1CUVA 1THGA 5EI5A 1VKHA 1A8QA 1P0PA 4OB7A 4B0OA 2AJBA 4NVRA 4C4XA 2PU7A 3I6YA 5AH0A 4KRYA 1Y7HA 3IBTA 2C0QA 3U1TA 4HXEB 5ALMA 3S2ZA 3YASA 1CUFA 4PF1A 3I2JA 1LPSA 2GBIA 5JZBA 2HA3A 3H2IA 4RPCA 1MO2A 1YASA 3DDUA 1G5FA 3UUFA 2XQIA 1JJFA 1A8SA 4QDXA 4F5ZA 3PUHA 1R4ZA 4QLAA 2P8SA 4FFVA 4BCCA 1VA4A 3V48A 1FFAA 1CIJA 1QOZA 4DLNA 1TKRA 4KYVA 2JIDA 3QVMA 1XZFA 2DQYA 3LS2A 4GLBA 2YASA 1E5TA 4QEKA 2ZVDA 3N0TA 5LZ5A 5SYNA 2BUAA 1RWQA 1CPYA 3EQ8A 2RHTA 2HHAA 3G0IA 4W9RA 3G02A 4ZV7A 1A88A 3F98A 1QTIA 3W04A 1NU8A 2HA4A 3KD2A 1WB5A 2WHRA 3WYNA 5LP1A 4W1PA 5AI9A 4XIIA 3EIOA 3RLIA 4J0IA 3L1JA 3OTQA 3WWPA 1OCEA 4PW0A 2OCKA 3HABA 2C7BA 1YS2X 2EDCA 4OPMA 3BDVA 2VJCA 4OCZA 2WJ3A 4DMCA 2O7VA 1DWOA 1VXOA 3STWA 3QMVA 4OSEA 1QLWA 2PX6A 1DQYA 3VKFA 4CFSA 4UPDA 2WU3A 5K3BA 1THTA 4OB6A 4E14A 2I3ZA 5D7BA 1XKLA 3WWOA 3R3ZA 2OG1A 1VJ5A 4G8DA 3H2GA 1XZCA 3QPDA 3H2JA 3C70A 3ESDA 3ZLTA 1QONA 1EDEA 1ZD3A 5FPQA 4Q3OA 1MAHA 1JI3A 2H1IA 2XUHA 3FNBA 4PSDA 1JFRA 1FJ2A 5T4EA 2RIPA 1SCIA 3DD5A 5ALSA 5AKEA 3FLEA 3I2FA 4RNCA 5BOVA 2WUGA 2ECFA 1CUDA 5ALGA 2WTNA 1MX9A 3G8YA 3R40A 5C7YA 3WIOA 1J06A 3UUEA 2B4KA 2WIKA 4WY5A 4BC1A 4LHEA 4IH9A 1UOOA 4WDRA 4C87A 5AO9A 1H23A 2XLBA 4UHEA 3ILSA 3DYVA 1MX1A 1TIBA 3FSGA 3MVEA 4U2DA 2XT0A 2PSEA 3TJMA 3V1KA 5E4JA 4QDUA 1KU6A 5ALWA 3U0VA 2QR5A 1XZJA 4X6XA 3KWJA 4FLFA 3HJUA 5HKAA 5CMLA 4H7EA 1MNQA 4Y2XA 3DOIA 1CUAA 4B80A 2GYVA 2HA7A 2ACEA 3QYJA 1GZ7A 4J0KA 2V97A 1LBTA 1E66A 2HA6A 2I3DA 1QIJA 3C43A 5AKHA 1CUZA 4F0JA 4ZGBA 2OGTA 3G7NA 4DSAA 3B3QA 1W52X 2WIGA 5LIPA 4AMZA 4K6HA 4XWGA 3RK4A 4Y2YA 5DTIA 1NU6A 5ALFA 1JJBA 5DNVA 2FJPA 4EBBA 3QMMA 4E11A 2CUTA 1UOPA 5ALPA 4CIAA 1ZGCA 3EBLA 3GA7A 2PBLA 5EHXA 3I6ZA 1XZGA 5HFAA 1Q0RA 2X8BA 3R3UA 5AM4A 1EI9A 4CIBA 3M81A 2WUDA 2XE4A 2GBFA 4TPKA 1ZIYA 1T4MA 2ZYRA 4A16A 3H1AA 1J2EA 4X7BA 5JAOA 3WKEA 1EX9A 2QOEA 1HL7A 3STVA 1LBSA 4FMPA 5ALHA 1L7RA 2WFLB 5ALUA 4BP8A 3D5EA 4ZI5A 1D07A 1CQZA 3FSGD 4IHAA 4DMFA 1CUCA 1MPXA 1J07A 3CN9A 5D6OA 3HACA 1AKNA 5CTAA 1SFRA 1Q0ZA 3F96A 4W1QA 5JYCA 4ZXFA 5AHXA 2GYWA 5CH8A 3EF3A 4MWTA 2WG1A 3A2MA 3WWCA 1XQYA 4C89A 2WILA 5DLPA 5AKZA 3AIOA 1WM1A 2RI6A 4ITVA 3G9TA 3WKBA 4J0JA 1R1DA 5KBYA 4FWBA 4DGQA 4H7IA 3VXKA 4FLMA 1HLGA 4M0EA 4AN0A 1CUSA 1CUXA 1HBJA 5AK3A 1YR2A 5AK6A 5FRDA 5FLKA 5JATA 3PDCA 4CCWA 2IX9A 1DX4A 1E8NA 4BCBA 3BIWA 1EXWA 2XQKA 1DT5A 1UZAA 3FOBA 4Y7DA 4FBMA 2H7YA 2I03A 1AX9A 1IZ8A 4AZ3A 4UHDA 3HC7A 1VLQA 1XQVA 2OCIA 5CT6A 1ORVA 3IA2A 3C6XA 2BUBA 3FBWA 5E2IA 5HZGA 1AURA 2Z8ZA 5HK9A 1TAHA 3C8HA 4J0HA 1R9MA 7YASA 3BIXA 3WL8A 4Z49A 1WB4A 1DU4A 1C7IA 1EB8A 4HS9A 3WK6A 1DQZA 4PV7A 2JGEA 4OUKX 1IZ7A 1EDBA 4B9AA 4IH1A 4UBKA 1LPOA 3F97A 3IUNA 2QS9A 4BBZA 1UWCA 4H35A 3BXPA 2K2QB 1YSCA 4ROTA 4A23A 2WFLA 2PSHA 2XUPA 3O9VA 1YCDA 1XRNA 4BAUA 5C8VA 3V1NA 3JW8A 4AZ0A 3NOXA 2WG2A 4EY6A 3ESAA 4IH4A 5T4FA 4V2IA 3OOSA 4QZVA 1XZLA 2VTVA 4MXDA 5LYYA 1VA5A 3JYHA 2JGFA 2RGUA 5HF6A 2BKLA 3GROA 3WK8A 2ZSIA 3AJAA 2JF0A 1F6WA 4WCVA 5KREA 4GWLA 1GQSA 2YXPX 1LPMA 5ALJA 1ACLA 1ORWA 1SC9A 4GECA 5A2GA 5JZSA 5LZ8A 3C87A 3DOHA 1ODCA 3KSRA 1TRHA 3KOOA 1X70A 3E1GA 1USWA 4AO8A 1Q84A 3AUKA 4CG2A 1LPPA 1DWPA 4YX9A 4Q82A 3C8DA 3Q8WA 3E0XA 1A8UA 3C5WP 3PFCA 1EA5A 4H7FA 1KU0A 1L7QA 5FXMA 2CJPA 5CXUA 4G4IA 1G42A 3SK0A 1ISPA 2C4HA 4PQEA 5JIBA 1XLVA 2WTMA 5ALTA 2RONA 4QLOA 2PU5A 5AKLA 2H7XA 4X93A 5EFZA 5H3HA 1P0QA 3HEAA 4GBGA 4E46A 4INZA 4OD0A 2QM0A 4H7JA 1UK8A 4J3JA 1XQWA 3WKDA 2WKWA 3H17A 4N8SA 3VISA 2OGSA 1ODSA 5FOQA 5IVDA 3F8SA 3R0VA 5JASA 4P08A 2W6CX 1VZ3A 2GZRA 4W63A 4FOLA 3G9XA 3WZLA 2OXEA 1MU0A 1DT3A 3L1IA 4NS4A 3RARA 3WYDA 4FHZA 4KE9A 4K2AA 3T4UA 2ZSHA 5JANA 2XMSA 4J7AA 1BROA 1XRLA 1SCQA 4Q3KA 5E4YA 3IVMA 5ALQA 4IQ4A 2O2IA 2JBWA 3K6KA 4EA6A 1VOTA 3I2KA 2FJ0A 2OAGA 2DQZA 3FLAA 3W9UA 5I8PA 4AN1A 4P93A 1K5PA 1H2ZA 1Q83A 3MUNA 1R3DA 3PF8A 5ALZA 3WMRA 1N1MA 1CFJA 5AIBA 4N5IX
chains in the Genus database with same CATH superfamily
2CW5A 4URZR 1QFSA 3WLAA 1YL7A 3SC2B 2R2GA 4LWOA 4ZQGA 2JLWA 2EZ8A 2QT9A 5E6SB 3GBSA 4KE8A 4DL9A 1IUKA 1WCXA 3Q3JB 1KZ9A 2ZR9A 2FX5A 3S8MA 4D9HA 5HWSA 4FYVA 4FYWA 3I0MA 1E89A 1G1AA 1JIVA 2N1BA 4UE3S 5FBWB 5GONF 3W5IA 4DJFC 3GRYA 3R5TA 4FDLA 5FL7D 1UC8A 1L7DA 1VHLA 3LLCA 4LJYA 5AICA 4PS1A 5HOQA 1KVSA 2R68A 1RZUA 1P81A 3L7MA 3NBXX 4ARIA 4V1CI 1IOZA 4IZHA 3SPXA 4CF5A 1S9HA 1FQJA 1QO0A 2VJDA 5JS2A 4YPOA 1I5RA 1YDWA 1L4MA 2HWKA 3LDHA 5FFFA 1JWAB 1AGNA 1MVLA 1ZD9A 4YGXB 3AUUA 4MB6A 3A6ZA 5G0VA 3UT0A 2XCLA 2C84A 3SHOA 3TH5A 1E7QA 1R8SA 4K9DA 2R1VB 3L1HA 3STTA 2QRQA 3LWZA 3ICQB 2BGRA 3CUVA 2XQFA 2VJMB 4LJSA 1GLGA 4M55A 2H1VA 3DNMA 1XNGA 4BXOB 2YWBA 1YI8A 4WY2A 5CAEB 4PO1A 1IAQA 4KTTE 3RAPR 3ZHVA 2GBPA 2W4QA 2ZRMA 3CLVA 1NX9A 3EUWA 1E20A 1ZMOA 3AJ9A 4INAA 1PD0A 4MRRA 4TWZA 3H19A 1ISFA 4WFIA 2BIFA 5FADA 3RRFA 2FSSA 1QE0A 2JKYA 3HPQA 2BZGA 4QDTA 2WHQA 3EQ2A 4V24A 3R7WA 4EVQA 3ENWA 3F73A 3ZYCA 1LLUA 1FPMA 1QGED 2AJTA 4L72A 2V98A 3DDNA 4UAGA 1WHTB 2V59A 4NMWA 3RAGA 4KR0A 3SDSA 1P2VA 1RQGA 1NKSA 3EIFA 2Q5LA 2GFIA 1FTYA 2CCJA 3D3EA 3GJXC 4I9UA 1X2EA 4IIHA 4V0NA 4CU2A 1E4YA 3BXGA 4M7PA 2AD5A 4HT3B 5KX5B 4E4YA 3UMYA 2PMKA 4OGLA 1Q1EA 4XFDA 1Q92A 3VA7A 4G5FA 2Z30A 3GLUA 3ZWWA 5CU7A 4XI9A 1Q7EA 4E33A 3CW2A 4ENPA 1H8HA 4FCWA 4WXMA 3AUXA 2EFGA 2IC5A 1FVOA 3V80A 3D2LA 5LWQA 3VO2A 1CZNA 1IN7A 1DPGA 1B76A 2IVFA 3CLKA 3W5CA 3GPLA 3G68A 3JTEA 3T5AA 4C0AC 1KYQA 4HNAA 3AL3A 3TQOA 1QLJA 3P9PA 4C0SA 1U5AA 4D97A 3HV0A 4YUVA 1QH8B 2X6QA 1DOZA 1WDMA 1ZVQA 2PZAA 4MVCA 5KQLA 5H3LA 1I2ZA 4WBXC 4BKMA 1I36A 1YR7A 2WHXA 3ZV7A 5A9SB 1E3WA 3NV7A 4MICA 1R8XA 4BE7B 5DYWA 1TVMA 1GL6A 3C3PA 3I1IA 3N75A 3OFVA 3P0IA 3KPWA 4P9NA 2CV0A 3MJEA 1WNFA 3FVQA 5TT0A 4QC2A 3RC2A 3A26A 5B53A 3A9SA 5A71A 4LJ9A 4BHTA 4BO7A 3THWA 4FGKA 4XARA 2IEZA 1CQIB 1DJOA 3WJ1A 4F6LA 3O7WA 1T26A 2WTAA 1OGJA 4FR2A 4GR9A 1NN1A 2LV8A 4B82A 1D4OA 2HJRA 1V8OA 4XCQA 3Q0EA 1G4AE 4X1YA 2JFVA 5FWNA 2DPHA 4TTJA 2HR1A 2BTQB 4X8HA 3HKDB 4H7DA 5A5EA 4L8FA 2NV6A 5I5EA 2XYGA 4C20A 1QYCA 1N4AA 5IDXA 1UXOA 3CVUA 3MBKA 1WQ3A 1U3WA 3PXBA 5C52B 5IAKA 2INGX 2ZYDA 3LI2A 4KQIA 1I7NA 4WLFA 2C98A 2W5UA 4W6ZA 5L3SB 2AZDA 1E2HA 4A8JC 4EYOA 2PNJA 5CDHA 2PANA 3TQRA 3QMPA 5KNCH 4EY4A 1P60A 1G21B 4FP9A 4PAQA 2UUBB 3QLVA 4C04A 2E4XA 4YDHB 2XTMA 2EF1A 3TEFA 2CL5A 2BLLA 3CW9A 3MK31 1G3UA 4P4UA 5D3KA 4TLEA 4MDHA 3NM5A 4G67A 2OV6A 1HQKA 4DDKA 2VDJA 4YCJA 1Y4ZA 1JQBA 3WHLA 2DHEA 4KXXA 5I9LA 3BL8A 2B4RO 3NBAA 4O3FA 4CJXA 1LLQA 4I1IA 3K0FB 1T9GR 5DLDA 3GLRA 4XWTA 1TJ5A 2B4AA 1UC9A 5DK4A 4BEBA 2VJLA 4H1WA 1E9VA 2ENWA 4F93B 1M8PA 1PTJA 4JI8B 6REQB 2KPOA 3LXMA 4O4JA 1C0IA 3H11B 4LJ5A 1KOJA 1P3Y1 2WWGA 4MJ3A 2W2QA 1C4WA 5CRIA 3IRUA 4N3BA 2VP5A 3L4BC 4E5PA 2OO7A 5FP0A 1R6XA 1KRWA 1DBWA 4DV1B 1Y0BA 4L22A 2AG5A 3DJYA 1CDZA 1Q22A 2VHQA 4R81A 2ZBPA 3C1OA 3OEED 3UJ8A 5EQDA 1YE8A 3Q7EA 4J0DA 3GR6A 4QQKA 3RVKA 3DE0X 3AEZA 3LBHA 4WA8A 2VP3A 2WWXA 1E8MA 3GJYA 2VAVA 3TIFA 4JOBA 2XB2A 1K92A 2JD1A 3O75A 2V4ZA 4DY6A 1P3DA 4C6HA 1LQTA 5L3QA 1YA4A 3B60A 2LWIA 1SCDA 3P26A 4RC9A 2GKOA 4MARA 3VDNB 2AOTA 4B6GA 3TPFA 2P9JA 5AP9A 1BHQ1 1GZ6A 3LT0A 4KGXA 2C31A 1DC7A 1SR8A 3QVWA 1YU9A 3Q1KA 1JLRA 4PRZA 1VSBA 1EK1A 1Y42X 2OMKA 4RIEA 4BLWA 2PVSA 2YXLA 4HDSA 2HL6A 4BN5A 5C8XA 2IYVA 4JEIA 1U2GC 4OQFA 4K9NA 4OX9Y 3LHIA 3IE2A 5KYYA 3L8CA 2B83A 5CCDA 1LDEA 4G24A 3LAWA 2XWSA 1L8XA 3MOIA 3PVSA 4XW2A 4TOIA 3I5UA 2ZETA 1SRRA 3PWTA 1AMUA 3ANNA 2VPQA 5ICEA 3QFSA 1DTWA 4E2XA 3ZQ6A 2PUBA 5E6RA 5JSFA 1SVSA 3M6AA 4FNOA 5AVUA 1VHDA 3TG8A 3BIOA 4ZVPA 4RD6A 5B4TA 5CBKA 3EAFA 1J7JA 5JJ5A 4WNAA 3HTXA 2P6MA 3K20A 1BCSB 3OIDA 3VDQA 5A03A 2FOXA 5A9TA 3I6BA 1ODLA 3ZV4A 4F3CA 1A97A 2VPWA 4OBEA 5DVZA 1TEZA 4L57A 1GTMA 4UQOA 2ZK7A 3TXYA 3X2SA 2NTVA 4DSZA 2LTAA 2WTXA 3OT4A 2ZJOA 1JT2A 2C58A 2QVCA 3IQEA 4H77A 4K9SA 4BBAA 3GFOA 2YXNA 2FE1A 2P6UA 4Y3UA 3DL4A 1QYXA 1RRFA 4IHKA 1L5MA 2DERA 2QXUA 1ONBA 4R0NA 1KYIA 1S4MA 1ZD2P 4EPRA 1P2FA 2VL7A 4G9GA 1NUPA 5KOYA 4EG3A 1RYYA 4DJAA 2IHTA 4ND4A 1BVUA 1YMVA 3G1UA 4DNPA 3T34A 2F3SA 2ROQA 4EG7A 4JX8A 3DF9A 4B2LA 1CSEE 1HE3A 4B83A 4DEYA 3TZ6A 1KYZA 3E3NA 2OAQ1 4LECA 5GOTA 3JAMA 2CLFB 1BS1A 3J7AC 1RQ7A 2R1TA 3KQPA 4O8ZA 3UKOA 1VE6A 2O5VA 1O6ZA 3FVWA 4M7OA 3FPHA 4NYMQ 1XROA 3JALB 3RT9A 1GDDA 2JIMA 3MAGA 1ZH0A 5IZCC 1EK2A 2GN0A 2Y71A 3WQQA 3IESA 2UXBB 1O96B 2IPMA 1RIFA 1JEJA 5IVIA 4MKZA 1HEUA 3OX4A 2OC9A 1RWNA 3F6SA 1JSZA 4WLUA 4G4SP 4GVLA 3HSSA 1VCMA 3OZRA 1DSSG 1DAEA 1U1CA 5KSWB 4P7JA 1G64A 4LE0A 2BJHA 1SU6A 2HREA 4Q4JA 4R6XA 4KPGA 3RE1A 1ULZA 3CEMA 3IULA 2RC6A 5B37A 1F4VA 5EJ5A 3I61A 2HRQA 4MUBA 4U2EA 3ETCA 1KMHA 2JFQA 2FWNA 3IVAA 4LFCB 4LY6A 3TQFA 2OV3A 1CBUA 1JDTA 1V45E 3Q7SA 2WSSA 4HFMA 5MN4A 3BL5A 4X00A 3AO0B 5A6SB 1MHTA 3H2ZA 3F4BA 4MV7A 3T7IA 1XDUA 2WV7A 3QIAA 5K3DA 2QMUA 4DUGA 1GGKA 5IT0A 3TRHA 5IDQA 5HW0A 3R9XB 3GAMA 4B2PA 1DJMA 4KUEA 3C7DB 1ODIA 1XZQA 3IJEB 1VIAA 4HGYA 3DW1X 3IYLW 4HK4A 3MWDA 3TFOA 1Z45A 3SIWA 5IZ4A 3SF0A 2GHQA 1JQLB 1ATZA 2WU0A 5FI5A 2Z04A 1X42A 4XEUA 2ERXA 2YN0A 3MTJA 4BO5A 2CNBA 1SUIA 3H5IA 4JU9A 2EBWA 4WEQA 3IQWA 2EIHA 2EXXA 1ACJA 3PD7A 3QVXA 3ND9A 3QG5A 4I19A 4PYQA 4E5YA 1MOZA 3DWEX 1ZA2A 1A7UA 3H9EO 1E5XA 2HADA 3HUEA 3KXKA 4PX9A 2OESA 3CRZA 4MWZA 3PVCA 4C6RA 2Q1SA 3QVLA 4S1WA 4TWRA 1QPZA 4UEWA 2HRZA 4NDNE 1DO0A 1KDPA 3WYCA 1E94E 1TKBA 1YKGA 3VKHA 4G0NA 4N5LA 3ED5A 4EF5A 1AB5A 1OA1A 4DV3B 3H65A 1A2BA 3RYFB 2DBRA 3FUVA 3ZZNA 3ANMA 5H02A 1WTAA 1VPLA 2L19A 2PRJA 1TW3A 4EJFA 1GA1A 3S5JA 4DIOA 3EVFA 6NULA 2VK8A 2ZI3A 4KB5A 4MHSA 3FMFA 2MSWA 2F9LA 3CZQA 3NIDB 5KC9A 1NT4A 4PSVA 4D44A 2JKVA 1T4CA 4REMA 1NXTA 1DAOA 1SKUA 1RU3A 1CDOA 2UZ1B 2XYPA 3Q2IA 4I6EA 1GU1A 4E22A 3JZIA 1HFWA 1A1SA 1KGSA 3L49A 3C6MA 5ALRA 3IAEA 3LX6A 5CW1A 1CY6A 1JR6A 3NS7A 2H7VA 1AO3A 3PNMA 2R85A 2K4MA 3K9WA 2UYCA 1MAAA 3FOWA 3NHMA 4P7FA 2QTLA 4KXVA 4OHBA 4YLGA 1YTUA 4JVNA 5DZSA 2V9ZA 5DNEA 3QKRB 4HAWA 3MA0A 2ZUTA 2P91A 1JR4A 1RJDA 3RAEC 8AT1A 2HEGA 4P4SA 4CKWB 3AEUB 1FDWA 1Q7BA 2JFFA 4KBGA 4R9NA 2VA8A 4FVTA 4CG1A 2GPAA 3E18A 1AS2A 3P2IA 3R5SA 3OOJA 3ZLBA 1FNSA 4GLLA 4TSRA 3FCXA 4RZXA 1N0IA 5DI3A 1N1DA 4WKCA 3RTGA 2R2AA 2VJBA 1ZMTA 3NXSA 3OZUA 4FHGA 4GIBA 1SC3A 4MUNA 3RKSA 1E9SA 3BL6A 4B73A 2FAXA 2CL6X 3FR8A 4Q1FA 5HM8A 3L84A 3KIPA 2P6OA 3VHLB 1P2GA 1FTGA 1PGJA 1KSJA 2OCBA 4JT8A 4NXMB 3EJWA 3U3RA 3ER8A 1CR2A 3LUKA 3OQIA 3ZK8A 3R74A 3A31A 2XMBA 4CCYB 4OV6B 1FJHA 2D1TA 4WY8A 1T6BY 2IYPA 5EE5B 4FDMA 2FMHA 1UKZA 1ECBA 5FPKA 3LCVB 3PHJA 4YMTA 1AS3A 1KY2A 1IK6A 1S7CA 4DA7A 5JAPA 2QNBA 1G17A 1PS8A 1QK5A 1HE5A 2IHYA 2FUG6 2JA2A 2NZ8A 3PNSA 1NTOA 3BG5A 4FFWA 4K87A 4EL0A 1CUWA 4JFRA 5BOSB 1BMTA 2I2XB 2Q6IA 2ZP1A 3BXXA 4TLMB 2ASEA 2GDZA 5KCZA 3OZAA 2CE7A 1GPKA 2EKZA 1X7XA 1MJHA 2ADFA 4RVDA 3NAZA 4C0XA 1R9GA 2VDKB 2GNAA 1IM2A 2FY8A 3QU9A 3QUCA 4ZRDA 3UEOA 4GM4A 3W7BA 4CIXA 4QM7A 4EGFA 4RTNA 1YWGO 4Y9TA 2ABWA 3ZK7A 1V3VA 2DG2A 3B5EA 4GX2A 1W75A 3NV9A 1XTPA 4NBTA 1HNXB 1FSPA 4I55A 4DRXA 4HX5A 1G3IA 2EP5A 4PCLA 4YY3B 1RYZA 2OFPA 3DKKA 3GCZA 5IJWA 2E85A 1A8HA 1E6LA 2G67A 3G5MA 4AIIA 3G8CA 1TA9A 4ZO9A 4B4OA 4FOOA 3GCWA 5LKRA 5JVDA 1NVDA 3RJ9A 5I51A 5LP6A 1EP3B 1W8DA 1TZ2A 2BGTA 2HA0A 3O84A 3IJPA 4ZDKA 3AOGA 3CLHA 4AMYA 1KI4A 2ORIA 1QYDA 5GP1A 3HYLA 2Y67A 2GPWA 4MULA 2QIOA 2Q27A 5AJYA 4JLBA 1CUUA 2CUNA 1OUMA 4EHNA 2PH3A 3KE9A 3ZPXA 5TIIA 1QZUA 4L0QA 2CL7X 3GLGB 2Q5OA 3C6ZA 1B6GA 1F0PA 1RBMA 2PEYA 4JK3A 1T3TA 1TUEA 4QOHA 1BU5A 2YYAA 4CMBA 2YJTD 4TTPA 4OM8A 2FQQA 4RM2A 2OB1A 5CB4F 3MS7A 1WXQA 2V7QA 4DV2B 2O54A 2L82A 1SHUX 3O9MA 1KIFA 3QOFA 1J99A 3V34A 2WYHA 2YJGA 3AF1A 4PFQA 4GDMA 4L5JA 2YRXA 4MYCA 3SXUB 2UV8A 5K8IA 4P0TA 2PK3A 4ZO7A 3HO6A 5KDLA 2ZAYA 3KSZO 2GZ2A 4O4LA 1JECA 1GPDG 1G4UR 2OKCA 4NH0A 4YP9A 3A7DA 1GYPA 2PGDA 2LIPA 3QELA 1ZUIA 4KX3A 2FH5B 2NUTA 4TTSA 4DM7A 1SOWA 3G49A 4KMRA 4DC1A 3L7BA 3NWPA 2ONKA 3L7DA 1CB0A 2PD4A 3VSBA 4EPWA 2WUVA 4RV5A 3FNIA 1FDOA 2O4CA 4FNGA 3U1BA 2GS9A 5I7RA 3WB0A 5JNUA 3SVLA 5K3CA 2GZ3A 4DC0A 4HYQA 4I1RA 3FIUA 4H3HB 1NQTA 3WLMA 2HWUA 1AQLA 1KFBB 4QOSA 3OP1A 3N0VA 4YNBA 2AWNA 2ZRBA 2YY6A 2PAFA 1PDVA 4FNAA 4NSNA 1Y5NA 4NYIQ 5JARA 4X90A 2NX2A 3TTWA 3GZ4A 1PT9A 4ND2A 1MIHA 5HDBB 4W8OA 1UADA 4UE6A 3LZDA 3IDAA 3O0DA 4U0KA 4WEOA 4J1NA 3AI3A 2E6KA 1DXOA 2VDQB 3K5PA 1JHXA 1R0LA 1VBKA 3Q88A 5AKIA 3RBAA 3SIPA 4PYJA 4M7RA 4QDZA 3BMCB 4C4OA 1EUZA 2WFAA 2CJWB 4D26A 4NHOA 1WV0A 3O92A 4Y1GA 4I2NA 4MQBA 4U3JB 5H68A 4TRRA 1NF9A 4XVHA 4EJSA 4D3XA 2Y6VA 3HSKA 5ABPA 3QYPA 5F78A 5LYJB 1IJEA 1HDEA 3CJQA 5LDHA 1WEKA 3H87A 4II7A 3GXBA 2Z6QA 1ZCZA 3CEJA 1A71A 1BWPA 1W49A 2J3QA 2XMRA 2BGNA 1XR3A 4BMYA 3W90A 5KHLB 4IIGA 1ZI8A 1U8XX 4NR0A 3UOAB 4JGBA 4HAYA 5K20A 2A78A 3USCS 2I1WA 2OVBA 4JP5A 1QZ3A 3AHIA 2UZ0A 4QXMA 2NXEA 3WP1B 3IEIA 4YXWA 4OLBA 4IJ6A 3OT1A 3DPIA 2D0DA 3HUDA 2O3UA 3CLTD 4D42A 4OGFA 1GG5A 3W78A 4BFZA 3S68A 5ITZA 4HB3A 3PPXA 1PFVA 1XJ5A 4PHTA 2H2FA 1HYQA 5DBHX 1OQAA 3VC2A 4Q48A 5IP5A 2IUFA 3UT6A 1VZ2A 3FZNA 5D3MA 1U0EA 4Z51A 4OAPA 2ADMA 1H22A 3K4PA 5TSDA 1W96A 3N6RA 2KE5A 5B2FA 5LLTA 2AKYA 2VTEA 5TQ0A 1SVOA 1EHCA 1PEKE 2BFEA 1PUJA 5IBCA 2C1ZA 4Z53A 2KHZA 3G2LA 1LBEA 2JZOA 4EW1A 2X23A 3JPWA 1AUOA 2W8ZA 4CMEA 4ZEOA 5IRCD 2PO5A 2IOFK 4AZTA 4NU0A 2QJRA 3WLHA 2F48A 3IAS1 3C98A 5IFKA 1NJ5A 3LPCA 1HZJA 1C9EA 1G16A 3F5DA 2P1ZA 2XVYA 5D6NA 1IBKB 3CLTC 4URUR 4UBMA 1RC1A 1RP1A 4D4JA 4BLSA 5M29A 4QL3A 4MR7B 4YRQA 1HT0A 4RZIA 4DVGA 1CIPA 2J4CA 3LHFA 4IMRA 3L05A 3M1YA 3MG9A 1BXGA 3ZR4B 4BV9A 3FFAA 1A5TA 1J70A 1KO5A 1RKBA 2N42A 3IMKA 3T54A 4CXMA 4JBNA 2J5RA 4EMSA 1Y1PA 2BFAA 4HMQA 1SIUA 4P53A 4Q66C 1HETA 5CYPA 1U7HA 4DB4A 2D59A 2ZBEA 3KEGA 4GQAA 2IW3A 4HB4A 4QFCA 1WMDA 1Y1RA 2PL3A 4GQIA 1VLMA 3FUWA 4MYRA 4WNCA 3T4XA 4H4DA 2FFAA 4EKYA 1RVDA 4U5QA 1KYTA 4PCAA 2P7HA 1ZUD1 4ACBA 2VSFA 3U7JA 4OLFA 1E9FA 3OQVA 1MQSA 4XSHA 4F21A 3CB2A 1R0WA 4IDDA 4US1R 3RS7A 3PYLA 4AY3A 1OPXA 1NL3A 3ZEIA 2JIQA 4PLYA 1II0A 4BNWA 2JRCA 4DSOA 5AM3A 2RFLA 5FNVF 3MT8A 1H5QA 1L7XA 2EX1A 2PHZA 3VV2A 2P3QA 1Q50A 1YB5A 2B5WA 3I64A 4JQOA 5L3ZA 1GCGA 2C97A 2QLNA 2BGLA 2VTDA 3OD1A 1O97D 4YP0A 4ZOEA 1JU4A 3BCSA 4LQCA 1NYTA 2IZ5A 1JKMA 1G98A 1GGJA 3SS8A 3DB2A 2QNIA 2WY2D 2QRLA 3T1HB 4CFZA 5JISA 5HCIA 5A4MS 1AK9A 2HTEA 3N58A 1LI5A 5F1PA 4CLHA 3CBGA 4HOYA 4LNAA 4UZSA 2BM1A 1MBZA 1OYWA 5AYVA 4CKEA 1W48A 2Z1MA 4PE5B 1OKKA 5CFLA 3NJ8A 3Q9SA 2BDEA 4OHMA 4W82A 3RVSA 1K68A 5A3RA 3O95A 2E55A 1N6IA 4MRAA 4O2AF 4V3CA 1KDZA 3VU1A 5LVAA 3DT8A 3LSTA 1DC6A 4B4VA 5P8WA 4QTXA 1KK3A 4LXIA 2D4HA 1WY7A 4QRHA 4HX2A 5FUYA 1OTYA 4MKIA 3R8CA 5EJEA 1XVIA 2FLWA 2QMEA 5FI0B 1P1KA 3R77A 5H7XA 1KJWA 1XJ0A 2QV7A 4D5EA 2QAGB 4N8EA 3FZGA 1RZVA 3STHA 4EB6A 2Z2YA 4KQGA 5AVXA 1O97C 2AXEA 2C5SA 1T5SA 1O8CA 5JS8A 2GWRA 2ZR8A 4JP1A 4QFMA 3G13A 3GF4A 2HOQA 4PVDA 3LCRA 4KUHA 3DR3A 2UZ4A 3FHTA 1JIJA 3LD9A 5EE0A 1TPYA 2G3YA 3FWYA 1RI4A 2O6HA 2SICE 3O8QB 1HYGA 4E3ZA 1NLYA 3VJRA 4U02A 4OI1A 3WGGA 5ICMA 3OMLA 4LY3A 3ND5A 1GY8A 3KZCA 2C4VA 4B0PA 3HYCA 1KFKB 3REFA 1JFSA 3RSQA 3I5AA 5TLSA 4FIDA 4LGCA 2MSDB 5TMPA 2QGFA 3RGGA 1FYEA 4C5BA 4CL0A 1SQSA 3KOUA 1VLJA 4KK4A 3UFXB 3G85A 3KSMA 4L0DA 5EWMA 2DT5A 3G0BA 1JMYA 4HNRA 1TJ3A 4BN4A 4DIEA 3IAAA 1JG3A 3ZBQA 3LHSA 4PS0A 3G5UA 4U7JA 5JPIA 2NSJA 2V54A 5BSFA 2ZIWB 3I6MA 4BJ5A 1W46A 4KE7A 4HDCA 4KG7A 4MCJA 3KLOA 4QUAA 2J9YB 4G85A 1GGFA 2EYQA 1TIPA 3EAQA 3Q72A 4KAFA 4RCVA 5J5AA 5EERA 3FNGA 1MLDA 3TNDA 2BFWA 4M3NA 1JBKA 4PC6A 5AW0A 3LF2A 1DGQA 1RQXA 2BFFA 1I7PA 3N28A 4EG4A 3H6KA 1E2GA 3DCNA 1Z7EA 2Y0BA 2ORED 4BB0A 1P4SA 1YS6A 2IXAA 2R7KA 2BCJQ 1NY6A 2VUTA 4H18A 3RU7A 4KO4S 3E23A 4HTAA 3IIIA 1UFQA 4D9JA 1DXQA 3TRKA 1J1IA 1B7GO 4DCSA 1OXVA 3D0KA 2V0GA 3QM1A 3QEMA 4UCXA 3JQ7B 3LXXA 2I67A 4ETIA 3LLMA 4PQGA 5CEEA 1TJNA 2PZMA 4L4RA 3ROEA 4P3XA 2H8KA 5IABA 1TZCA 3VYWA 3CONA 3T3HA 4B4UA 2GEJA 1UR5A 4M0CA 3U81A 3JWEA 4NONA 3H8VA 4H3KB 5C9ZA 5H83A 4MMXB 3TQTA 3UMJA 2D06A 4C08A 1SUBA 2FZWA 3DZFA 1Q12A 1Q7RA 3GJ5A 5JE8A 1U1FA 4BEJA 1O6BA 5JD6A 2AC7A 1M8FA 3VNRA 3KAPA 1NN3A 4LOJA 7REQB 4HH1A 3WGQA 5J4VA 1TKCA 4GMHA 1G8HA 3HMKA 4IDOA 5KZMB 1RI5A 2E37A 4I4TB 4S1VA 1FRVA 2C2WA 1Z16A 1QH1A 5CNIA 2FX2A 5TXGA 4PSUA 1V5WA 1Y9EA 1G8FA 5HF8A 5HJ2A 5CDFA 3DFFA 4BFSA 2IXDA 1VKNA 4YALA 3KDSE 5TJHA 3OO1A 1PR0A 5EMHA 2D1RA 2PH5A 4U2GA 1R4AA 3NUQA 1SQ6A 3BJRA 4IV8A 2WUWE 1WV1A 4DLAA 4IPTA 4NJMB 1OWNA 4RUKA 1GQRA 2OXRA 4B79A 5B4UA 4RA6A 1FFYA 3E3MA 1DV1A 3WB9A 1I6WA 3I2GA 4WAUA 2VQEB 3Q11A 2NTNA 4BE4A 1QPGA 5SICE 4EB0A 2PX0A 2HNAA 1CXZA 1EUDB 1R64A 3PNLA 2ZR0A 5JR3A 4DCGA 5L4NA 1OH6A 1H93A 3EB9A 4OU4A 2I4IA 1VSUA 2PYIA 4RMGA 1IM5A 1ORIA 1L5LA 4XRGA 1JDUA 2XAAA 2JLUA 2AVNA 3IUBA 3CF0A 1EEXB 1WUHS 1X6VA 2BEUA 4NNJA 3UK7A 4S1OA 2Q8NA 2ERCA 3FYSA 2I2CA 4QUKA 4Q24A 4TYQA 4LZPA 3V1TC 4BNUA 5ED4A 3B6ZA 4K6GA 1SGWA 4RTJA 1KK1A 2GBGA 2DSNA 4OJMX 3X3HA 2DAPA 4B85A 4PZAA 3C5HA 2DMRA 3MAAC 1QCYA 3M5CA 2AFVA 1X7ZA 3AF2A 5HEKA 1RXUA 3NATA 2I6FA 4PBTA 5E8RA 2D1SA 2MU1A 4MS1A 3I30X 3P0JA 5LQKA 2AX4A 1IQPA 1JHZA 5FPYA 1L2TA 1JG6A 2XB9A 2V7TA 3DEZA 2CB9A 4OHVA 2FDXA 5E1BA 3X1YA 1JB1A 4J2TA 1BRTA 4LYEA 1GXSB 5TC4A 2XD4A 6PFKA 1ZGJA 1NYQA 2ZPTX 1P44A 3M33A 4JUAA 4D92A 3LK6A 3QXJA 4HYYA 1QOPB 1CEXA 1PR9A 3E9RA 4PEVA 3WVNA 4X6YA 1CRWG 1N7HA 1PHRA 3FAKA 1F5NA 2F3UA 3BB4A 5D5PA 4LF8B 1ZHHA 4KW7A 1DVRA 2EHJA 1ORHA 4W6QA 5JSZA 1J42A 2WTUA 2W6ID 3VR4A 1D4ZA 5CP8A 2GTPA 5F1YA 2P78A 2C0PA 2WKQA 2X5KO 4N6OA 4C4SA 4LCEA 4D46A 3GZNA 2NU6B 3MWKA 3QFRA 1RKVA 1RPNA 3I45A 1BS2A 2HU2A 3IAFA 4TL8A 1T6YA 3QV2A 1CV2A 1QP0A 1MO6A 2DWCA 1KKMA 3NC4A 4GPAA 4CLOB 5CG1A 1MAVA 4H27A 1DBIA 1YI1A 3PPVA 3ZE9A 3LY7A 1QU2A 1HE8B 1BXKA 1RYFA 5T64A 3ZKWB 1A8PA 4PG4A 1MDBA 2G6TA 3IVXA 1WG8A 5BMVF 3IKTA 2EW8A 5BSKA 5D84A 3ROPA 3DTYA 2Q5IA 3DNFA 3ABRB 2FOIA 3HJTA 3JQFC 3E7FA 4O29A 1KJNA 4JJ7A 5CDUA 4ZEMA 1D2AA 2FWIA 2C4UA 1YDEA 4KWIA 1R18A 4YECA 3R5JA 4YRKA 1SXQA 4F3RA 2AZMA 2PSFA 2XDYA 4R1TA 1A27A 1T2NA 1YCFA 1QGOA 3UCXA 5SZKB 3C48A 2C2OA 3KQQA 1V1MB 3QZUA 4J2HA 1B26A 3TDMA 1EX6A 4X60A 1NKVA 5JYEA 1KZYC 2CD7A 2DWPA 3DAYA 4HQLA 4UNPA 2X0DA 3MWGA 3ENZA 3PC8A 4X1OA 1ZRMA 5CHYA 4ZAWA 4B7ZA 5B6JA 3Q8KA 3S2FA 1SIBE 1IOLA 2DUJA 2CB0A 2FTKE 1Q3KA 4HD8A 3HSYA 4B48A 8LDHA 5JFGA 1G2OA 5K1ZA 3KQWA 3L6BA 3E7DA 2XQGA 3ZVNA 3I3SR 2ATIA 4KBYA 4ED9A 1NQOA 2QX9A 4RELA 3BXZA 1CG6A 5L6LB 1QHNA 3O93A 1P1RA 1IPEA 1P9WA 1VECA 4IXDA 1ND5A 3AR9A 4BZPA 1E2DA 2FSUA 3DHVA 1MC8A 2RG1A 1S2OA 1WULS 4MX8A 3PHCA 4G1FA 4WESA 1Y1TA 4BUCA 4E4TA 4ENTA 4P7GA 1AF4A 1JZQA 2OORC 3KQUA 1PL7A 3THRA 4NTZA 1BD3A 3IOEA 4NCHA 4P82A 5LZ7A 4NFYA 5COQA 4HLUA 1YAHA 1XEXA 4PWYA 4GI5A 1M3SA 1P72A 1FQWA 1TO6A 5HQ3B 1NJGA 1YHZA 4LYHA 5K0EA 1MFZA 1OW3B 3B6IA 3ZE1B 4P5PA 1LVHA 5DO9A 2PO7A 2YOHA 2XDWA 1U0HC 3PBKA 4I9GA 4J9VA 3SMVA 3OQ6A 3D59A 1YQTA 4A15A 1OBCA 1KC1A 1OIXA 4ZVVA 3T5TA 1T5HX 5K8CA 5KNBA 1AUQA 5JCPA 1G63A 3FTNA 3DO6A 1ZH4A 2O57A 3PIIA 1TVKB 1XDGA 1NI4A 3NP7A 1GPAA 2H1LA 2P1DA 3QLUC 2ZDGA 2A0UA 1EVZA 5IBRA 2AXPA 4CV1A 3BCHA 3N2IA 2HA2A 4I14A 4MITA 4YH1A 3QVTA 4EG0A 3RYIA 3OIGA 2QD4A 5MFZA 1UAGA 3R9KA 3O8DA 3IAHA 4C7JA 3JARA 4DXHA 5IWAB 1RFGE 1N3IA 1I24A 2B2CA 4YMWA 1X1TA 3DKVA 5EP2A 4ZV9A 1T10A 6AT1A 1C9DB 2FUCA 2VJAA 1A50B 1JILA 3DMDA 5JO0A 3GJ3A 1TD9A 3KXIA 5FIUA 1NSTA 4NAUA 2PKEA 3NYIA 3N8KA 2JCSA 2Q2OA 2XF2A 3ZKAA 1KE2A 3ABOB 2JLAA 2QLLA 3PNQA 2OC4A 4TT3A 1OAKA 3FPEA 1JSLA 3HI4A 1RHJA 3FGNA 3FCSB 1V95A 2O14A 1NXPA 1FDIA 3GELA 4F84A 3IOCA 5KYTA 2PSDA 5ALYA 1TQ6A 2C9MA 3K96A 4U2BA 4Q02A 2OBXA 3N2EA 1SQGA 5AKYA 3IUPA 5EEHA 1F2DA 4LTNA 4XOIA 4TTAA 2P9GA 4YJFA 5P21A 4BNJA 5KKNB 3RIEA 2QAGC 2UYQA 3P2YA 2C04A 3U7HB 1QP4A 1ECPA 1IPFA 1H4VB 1WMBA 2RGXA 2V4UA 3O8NA 3QQ5A 2B9VA 4IWXA 5DJ5A 4C4TA 1R2QA 1V41E 5BR7A 2CLEB 5M04A 1L7EA 4QREA 4YVFA 5REQA 3W2TA 3F5MA 3SOPA 3COWA 4ZDWA 3X1JA 1XU9A 1C29B 3K30A 3RIHA 4DEXA 1EKXA 2Z3VA 2IS4A 1TM3E 1UWKA 5B7PA 3FI0A 1N0VC 5LBUA 2EJVA 4MHOA 4ZN6A 5EJ4A 1XZBA 2WQZA 5KTRA 4IG9A 1S02A 1TGVA 3CX7A 1FOEB 3ZD8A 1NJ6A 4M49A 3SM3A 5JXGA 2VJPA 5CB6A 5LA6A 8ADHA 1B8PA 1Z62A 3UKJA 3B6KA 3BILA 2Q2VA 1E1RA 3HDYA 4FT4A 2QN1A 3BMQB 2J33A 3JRWA 3PEEA 4K40A 5FI3A 3WQHA 4F45A 2JFXA 4FDVA 1HTWA 5JD5A 5F9HA 1AMOA 1SHLA 2BFCA 2NSDA 2C9OA 2PRYA 2ZSKA 3HH8A 3LQKA 3T7KA 5HE8A 4P7KA 5IUNC 3W5JA 4ZYZA 4LJ6A 2B61A 3E4DA 3IUSA 3QH4A 2I4TA 2ZRPA 2HA5A 1NVXQ 4ZT4A 4DLXA 4CWAA 3IUQA 4CKBB 5A0VA 4KR2A 5ILGA 3TLBA 2MSEB 1D6NA 4RKYA 1J97A 2C1EA 3G0CA 3VTAA 4JUIA 3E27A 2V8OA 2X77A 2BY4A 4MUGA 1NMQA 4N1AA 4NZNA 4UHCA 4BS9A 3L0ZA 1U3TA 1CJUC 1GCIA 1JU3A 1P1BA 1V39A 4HQKA 4BMVA 1S0UA 5B58C 1ESZA 2AF4C 4WXHA 5BUQA 1OFTA 4YFVA 1XZHA 3DDSA 3SR0A 1L1QA 4LYDA 3V4LA 1PQUA 2ZS7A 5DIFA 4LF5B 2O2YA 2NU7A 4XRRA 4ZK6A 1RHUA 5IHXA 1SUSA 4CEIB 3KXDA 4PHGA 3AX6A 1HH4A 1RE1A 1CLEA 3HB0A 2WU1A 4DVJA 1J22A 2ZS9A 4CBVA 2LBPA 3DKIA 2YZNA 2Z5GA 4MV1A 1OFIA 5JMOA 3A70A 3KTFA 4BNYA 5FWXB 4WASA 4QBGB 5NLLA 5A2QA 3OHMA 2OZLB 4RCYA 4XGRA 4DLWA 3SN6A 3MWEA 4FD2A 2XNJA 1T35A 2W7TA 4KRXA 5IH7A 2R0QC 2ZXFA 3OPQA 4BNXA 2AMVA 3V8RA 1E3DA 1NZJA 2VNJA 1E1LA 4XM2A 4GBED 1PKEA 4JUBA 4ZT2A 4DYHA 1P33A 2FPIB 3KSDO 3IURA 5D87A 3L8EA 1F9AA 4MKRA 4TV8B 1KAQA 5CBPB 1C9JA 1XK7A 2P40A 2Y1KA 1C4OA 2C5HA 4KGVA 3P19A 4RX1A 4V0OA 1A2OA 2HNBA 3UWOA 5HR5A 5COBA 4X9XA 3DE6X 1VJRA 1P39A 1LI4A 4DCCA 2HLHA 2AG1A 3GT0A 4TLDA 3WO0A 1C4KA 1YZQA 3GARA 2G5CA 5AHKA 5C4GB 4E0BA 3COJA 3SJCA 1BQEA 1IIBA 2C8JA 4K1LA 4W9NA 3GP3A 1HURA 1TT5A 4YP7A 3TTSA 5JQGA 1DRWA 3V8QA 4NCXA 2H0RA 2FQYA 1G6OA 1TW2A 1L5ZA 1PE0A 2IYAA 3EFBA 3K5WA 1OYVA 2GXQA 2X3FA 4JAVC 1A7KA 2NYUA 1CZKA 4LCJA 3TAUA 4B84A 2A1TR 5GADl 2JAUA 4M46A 3DH0A 5G0TA 3DAHA 3OZXA 4XDGA 5GGXA 1H1DA 5EJIA 5FPHA 2VYFA 4GEGA 4OQZA 1OXKB 1VRWA 3NIBA 4GKKB 2CSUA 2R87A 3KXLA 5D5QA 1VJ0A 5C37A 1WB6A 2YL2A 5KTOA 4KRFA 2SKEA 1X15A 3V8MA 5J2TB 1MN6A 4Q4LA 5TPZA 1K89A 3EQZA 5ESDA 3MTDA 3IP1A 1Q0SA 3WJAA 1D3AA 3GH1A 4URXR 2JIZD 4G1CA 5GMOA 3IELA 1FPQA 4NHEA 3WQRA 4DQXA 4EX6A 4YRLA 1PO7A 2GD1O 4P4LA 1C30A 4EG6A 1KY3A 3ZGXA 3BD9A 1QFYA 3N3AC 4I08A 5ITWA 3SX0A 4OYYA 1PU2A 2I9PA 4Y2JA 5MFPA 3AL0C 4K8OA 4MA5A 2VTKA 4RGYA 1V4BA 3RH0A 3L43A 2BRUC 4MVJA 2Q0SA 2GK4A 4TMVA 4XD7A 5MF6A 3B6JA 4FU0A 3N2LA 5A02A 5IJ9A 3IMGA 5KYXA 1R4NB 1HX7A 2VCEA 4N6NA 1RRKA 3QU2A 1NOIA 3PICA 1MRNA 1IRXA 2Q1UA 4IFBA 5FF9A 2P9YA 4JB3A 5F4ZA 2H5LA 3O8OB 1XTVA 3MM4A 3V1LA 3WFIA 2IEGA 1MO5A 1T4DA 3AJDA 4XA8A 1RLMA 3I9FA 2C9ZA 2OENG 3NTOA 4U63A 4C6SA 4N0EA 2PMDA 3AQIA 3NTQA 5JTUA 4ENVA 1WE2A 1KH3A 2J4FA 2WEKA 1QX4A 4Q19A 3RRYA 3VDXA 1PWZA 3R44A 1N4DA 1J33A 1TF5A 3K7EA 1JZSA 3CPSA 3KQVA 1BH6A 2OQIA 1Y6JA 4U2KA 1CVLA 2O2DA 1YJQA 3PNVA 4JBHA 3MCTA 5DMHA 2LCIA 2DFKB 2O0LA 1ZLYA 4KO2S 2HRCA 2Q0XA 4D8XA 3SJUA 3D7SA 2CBZA 4FFMA 4X8MA 2XHZA 5IVKA 2OAP1 5AT1A 5A0TA 1FJXA 1NMYA 2ZM6B 1KL7A 4H7HA 2JFNA 4YJKA 1MVOA 4KODA 1U2SA 2VO1A 5J43A 2CUKA 3HFGA 4UDXX 1ZXBA 2TYSB 1PRYA 4KV9A 3NEAA 2Q3HA 4XIGS 5ALKA 1UMBA 4EEZA 3LFTA 5CW2A 4MV9A 1XLTC 3VDRA 4D41A 2P9CA 4MVXA 4E2ZA 4EDHA 4D9FA 2FDCA 1P2TA 3DP9A 3T7TA 1CUEA 3I1JA 5GQSA 1V47A 1TM1E 1C7FA 4TUYF 4DPLA 3A3KA 4YRCA 2F17A 4JR1A 5ALNA 3GH3A 1O89A 5DB4A 1RVV1 1UPCA 2G8LA 4EHBA 3WK4A 3OFND 3TRFA 4CF7A 1U4NA 4X1IA 3AFNA 4OUDA 3WISA 1VL6A 1TAUA 4Q93A 2EQBA 2OK8A 4LVUA 3DUFA 4QU0A 5U9CA 1CF4A 4QTZA 3BGWA 1A2KC 4YAWA 2BOVA 4TRMA 5ECYA 3ZXSA 3F3MA 2FUG1 1LBIA 1LQ2A 2ZRIA 4M88A 3L46A 1YIDA 2R5FA 5ENDA 5EUCA 1PN3A 3FDFA 1HQDA 4FNMA 4X95A 3UXHA 1X7HA 3FNQA 1XZDA 2QJTA 3WDKA 1EXVA 3W4JA 2XTAA 3GRRA 3FMVA 1X0XA 3L4EA 3A9RA 3VSAA 4AJNA 2ZAOA 5CFRA 1QP7A 1V7CA 1UIMA 3W1VA 5EI5A 1VKHA 4R2KA 3RADC 5C1OA 3VKUA 5KTPA 1YZNA 4KFUA 1D1TA 4OB7A 3WIDA 2HMSA 1RZ3A 2PU7A 4BB9A 3QSYA 5AH0A 1Z35A 3G6WA 3PVZA 1GAQA 3IBTA 2O8DB 4WIAA 2C0QA 3U1TA 3COZA 1WCIB 3TI9A 4L3OA 3S2ZA 4HNAB 3QBDA 4RM3A 3RO7A 5B7NA 5F23A 4BX8A 3VKVA 3FM9A 4IUCS 1IN5A 2PIDA 1G3RA 2BHLA 3FMGA 2B82A 1UJNA 3X43A 4PGGA 1NNSA 2AK3A 1EFRA 4KVZA 3HQ4O 4DA8A 3D6MA 1XCLA 1U63A 1R4MA 4CKYA 1E3WB 4QM6A 4EO9A 4IFIA 4N7JA 4BQSA 1Z73A 4CT5A 3S2YA 4BFCA 4ON9A 4Q7LA 5DLQC 2JHCA 3RFXA 1WSWA 1XAHA 2O8CA 4O63O 3U4CA 1BE1A 4FOSA 3NIWA 5BN4A 4HXYA 3C6QA 4HS4A 4XLLA 5HVNA 3THSA 2WT9A 1PDOA 1R4ZA 1DKUA 4N0DA 3ZUPA 2FN7A 3SJ7A 4KIJA 3WLSA 4HTFA 1YE5A 2FCRA 2C5LA 3ABZA 3WLOA 3UHJA 1J8MF 4QPJC 4MWGA 2YNMA 4QLAA 4X1YB 2WKPA 2P8SA 1JNXX 4L2IB 5CA1B 2AMJA 2OMEA 8GPBA 5CFZA 3P9SA 1RWMA 1H2AS 1FFAA 2I1LA 1CIJA 3F7OA 3LYLA 4IZOA 3EISA 4DLNA 5B6PA 1TKRA 1PP4A 2R1UA 2VH2A 3MSXA 3P96A 3AY6A 2J5QA 1L9XA 3VAYA 4BECA 5C8YB 4M0UA 3R7DA 3QVMA 2QENA 5DBEX 1W2WB 4IZIA 3VPXA 2FPWA 2Q1WA 3MXTA 3JWJA 1ILEA 2PUAA 1WUJS 2JVJA 4JXKA 1U2QA 1JIIA 4GLBA 2YMLA 4L5YA 1I3OA 2YASA 1E5TA 3PC4A 4QEKA 3N0TA 4JB2A 1AM4D 4UHJA 3WMXA 1ZAYA 4KXYA 4EP1A 3U80A 3I9JA 4PRKA 4LYJA 2BUAA 4Z3OA 3UWKA 4TQ9A 4WXRA 3WOVA 3HJNA 4FMBB 5E2BA 4NIMA 3PC2A 4ARZB 1BMFA 4W9RA 4ZIRB 2J0SA 1L4EA 2EKQA 2P5TB 1TJ4A 4JLJA 1P4GA 4ZV7A 3RSGA 3F98A 1QTIA 2UYYA 3P1JA 3QQPA 3JZMA 1P19A 3MJSA 1UM9A 1WB5A 1XMSA 3E9CA 3F6CA 2HF9A 3KD2A 3GAFA 4P83A 3UAVA 4CUZA 4P36A 4FB4A 2WHRA 2G80A 3OZWA 2AXNA 1Z0FA 1ZK1A 2H65A 4QYTA 5DX1A 1Z0JA 2X3UA 1S6YA 2FFBA 2BMJA 1LWNA 4MNTA 4KR9A 3W9SA 5F7JA 3O1HB 2ACVA 4OA8A 3RLIA 1ZXLA 1CRPA 4MKHA 4IDAA 1MA0A 1XTUA 1Q0HA 2BE9A 2VHCA 3BHIA 1FYFA 4YXFA 5I4IA 4L02A 4RVOA 4IHJA 4EB8A 5HRUA 3EFHA 5LSAA 3N0RA 1OCEA 1Z07A 4PW0A 2OCKA 3E7PA 3GUVA 3HABA 4LQDA 4UM8B 5EIFA 1KPGA 3VMFA 4JCOA 2EDCA 2QW8A 1XG5A 3BDVA 2P2YA 5H59A 5CLLA 3WRXA 4BNHA 3E1SA 4FIZA 3T5PA 4H0FA 1PZMA 2OFFA 4IXWA 4DMCA 3FGZA 2CK3D 1L5QA 4P35A 4QNMA 4V0LA 4LYYA 5AJVB 2C77A 2GI4A 5DYGA 2NZXA 2RGAA 3LUJA 4JP2A 1SXHA 1WXGA 3CZMA 3DMFA 3PGA1 1FSGA 3K09A 4M7WA 5IXYA 2GEBA 2GDJA 1YVPA 2V1XA 4HFJA 5KEIA 3RI3A 1QLWA 1GU7A 3DMTC 2XCQA 3QVOA 2YV3A 1KQ3A 1NVVQ 3DTTA 2PX6A 1DQYA 3GGSA 2VAMA 3V32A 3ZNQA 4CFSA 4Z6KA 5JWOA 1GVHA 3UWDA 1VYTA 3FI9A 1ZGZA 2H00A 3CV3A 3OWHA 1EP1B 1T5TA 4E14A 1EG2A 1JLKA 5EPEA 4XFKA 3FFTA 1E6KA 1XKLA 1DTWB 4P4TA 3WWOA 3X1DA 2Y1GA 5EMNA 5HUQA 2GD0A 4CW7A 5E6RB 5KYWB 1XU4A 3N76A 4U8HA 1B1CA 3SFZA 4OA5A 3T94A 1GZ4A 4OQXA 4ZVOA 1RC8A 1E77A 3ZEAA 1XZCA 1UFRA 5CDFE 1UBSB 1JRLA 1QONA 2Q50A 3KUCA 1EDEA 5FPQA 3G7UA 2ATEA 2IYXA 3D6TB 4EW2A 1ZNYA 2QW1A 2F8MA 1SVWA 2YS6A 3K94A 1M1YA 5CA1F 1MAHA 1L5VA 2CLKB 2H1IA 3CG0A 3CZAA 4UD6A 5CLQA 2EFDB 2YTZA 3L7IA 4O4IF 3KKOA 1T8TA 2BKAA 2F59A 2IHUA 3DOEA 2DEUA 1VJGA 2N0SA 3N7AA 1T91A 1X80B 4Z3KA 2BMAA 1HL3A 3ZWAA 2PGIA 5C8YF 1WSBA 3X1MA 1DRVA 1VHQA 4FEEA 4MGYR 1MO3A 2BCGY 2Z0MA 3TOXA 5JPDA 1TYAE 3ADDA 4X7MA 2DZDA 3L01A 5IM4A 3W8EA 2F1OA 4CQNA 1QHHB 2VNAA 1FVHA 1EGQA 4M83A 2N3ZA 3QFCA 4OHFA 5EXXA 2IKSA 3P2EA 1VLZA 2ZSJA 1DZIA 1RZRA 4KSCA 1NR7A 3C4QA 3SXPA 5BOVA 4RJIA 4JU8A 4AF7A 2ECFA 3EH1A 1CUDA 2QL6A 5ALGA 1PJQA 5SY6A 3RTBA 5CA0A 1J9EA 3W77A 2C57A 2GAFA 1U0RA 3TZHA 2GN2A 3WIOA 4F4HA 1BEUB 1J06A 2OGUA 1Y9AA 3UUEA 4AUKA 2HO4A 2FFRA 4WY5A 1KA9H 3B48A 3G8AA 4NFLA 4BVEA 1TI7A 5EJ2A 4Z1OA 1UCFA 1D2RA 3ZK9A 2PXAA 1KKUA 1P62B 3EOBI 3NM4A 1W85A 2IDMA 3P4YA 4LHEA 4WRRA 4CMIA 1B43A 3KOMA 4WDRA 5JSYA 1U9JA 1RM5A 4DWJA 1V7ZA 1DC8A 3F1KA 1I94B 2YV1A 1T2EA 2FPGA 3DXZA 3P9NA 1UXIA 2GCGA 1XCJA 4UHEA 1EYZA 1J8FA 1SVIA 3I4LA 3DYVA 1V5IA 1MX1A 3BD6A 3ME5A 5T8KA 1WMEA 4DYVA 1TIBA 2I2DA 4G4SO 1URPA 3BSFA 3D0QA 3L7YA 3HKCA 5GVSA 2PTHA 3FSGA 3HBNA 5LD2B 5FLXA 4RZSA 5A3SA 1DG9A 3HCPA 2FW1A 4ASUA 1T3ZA 3GDHA 3MTQA 4L8WB 1QO0D 4TXJA 2OFOA 1F12A 3AL2A 4JDPA 3IBGA 2IU0A 2AEMA 3FDZA 3JAKB 3QU5A 1VG8A 4LV5B 5ALWA 1QF7A 3PEVA 2J08A 4HR7A 5A5DA 1EAMA 3GDOA 3T5CA 4DIKA 3WWYA 4W5NA 1ABFA 3URMA 4NC9A 2B2XA 1NQAO 3LECA 3RT1A 5ENVA 3PGLA 2RK3A 621PA 3GL9A 2J3MA 1O3YA 2FMIA 4BKUA 2Y27A 5HKAA 1T0BA 2YHUA 1HM5A 2CVZA 1KORA 5CMLA 1IBMB 1AK2A 2IGBA 4K46A 4Q1EA 1MC4A 5BW6B 2NUBA 1DAIA 1Y7LA 2WM8A 3MWDB 2OVFA 4AW9A 3G59A 2O1EA 2P2ZA 2GYVA 1PJBA 4FMCB 5FBVB 3TFQA 4FZ3A 2PKQO 1GZ7A 1HE2A 3B52X 2XH8A 3FDIA 4WD3A 1Z4LA 1UBEA 2H4ZA 3KX2A 2VP4A 4IW3B 4NOJA 4NI5A 5C3UA 3ETEA 3AG6A 3DHEA 3RHSA 5I01A 3DZHA 1GVNB 3U48A 1YIAA 5KYKA 4DCNA 2RD2A 1E66A 1ADFA 1FFWA 2HA6A 2NXWA 2IWHA 4CF3A 3TMKA 3ELYA 3WBBA 1QIJA 1OR8A 2FQWA 4BEWA 2YHIB 5DLEA 5JAMA 2F00A 3T1QA 4F0JA 2EZ9A 1GT91 1Y8RA 1XYYA 3A4NA 3GVCA 1SVKA 2AUTA 2DBZA 1BHJA 3HO1A 1VJCA 1H8HD 1ZBQA 3LGAA 2J3HA 3JATB 1W52X 1I2CA 2IRWA 3SS7X 2PA3A 2GCPA 2WIGA 3KBBA 2QW0X 5CDGA 5I7EA 5LIPA 3U4IA 1Y6GA 4QQFA 4NE7A 1KDYA 3QW2A 4FSDA 1YDGA 3OD5A 5KC8A 1WQ4A 4G37A 4HGPA 5LQAA 2P0EA 4WVFA 3OLQA 3QTTA 3DBRA 4MTLA 4HC4A 4J07A 1W1UA 2P2SA 3IOYA 4UATA 2G9VA 3GCXA 3KB6A 2W42A 3PTZA 4RJ2A 1C7ZA 1IVSA 2Q3CA 5AVOA 3VPFA 1IU9A 1EVJA 2FPLA 2WZBA 3EW7A 3L6UA 3G2KA 1E3EA 1YB2A 4B6SA 3PUZA 2RBEA 4YRGA 3QI7A 4Z54A 1WNTA 2E1RA 3C14C 3A58B 3DFKA 1RJ9A 3LPAA 1IM8A 1XKQA 2NP6A 4P4SB 1J0AA 1IIRA 2EJUA 3R3UA 1N2IA 3C4JA 5AM4A 4E2YA 4K9QA 4OOEA 4EJMA 1NE7A 1RCTE 4LTDA 3OQMA 2XE4A 1WVIA 3RV3A 4JL8A 4YCBA 3B3JA 4FS8A 4P8RA 3T0FA 1B3RA 4BMPB 4K0RA 1SO8A 1C8VB 4ZOLA 3R9WA 2D2VA 3TYXA 5KYUA 3B3FA 1QHFA 4GOJA 2QUKA 5AVVA 1H6BA 3RVPA 4JHLA 3GPCA 2ZATA 2ZBUA 3HB5X 5BT9A 3HY4A 1TAQA 3S28A 1R8YA 5LMUB 2XXAA 2XSZD 3OQIB 4FYJA 4IJ5A 4EYEA 2PQ6A 3A6GA 3EVZA 1AKYA 1D03A 2AOUB 2Q5JA 3H2BA 4Y6OA 2X0FA 1UBUS 2HO5A 4UMEA 4GVXA 3NW9A 4ZI5A 5A4IS 1TCVA 1GL7A 3S2EA 2YFQA 4IHAA 4MQ6A 2QYOA 1T9CA 1BTOA 1NUAA 2GZHA 2HGSA 3FNRA 3ITDA 3KE8A 4YAOA 3T95A 2CNWA 4N5NA 1C80A 5BSTA 4AZ0B 1JB9A 2Q28A 1NBAA 2OD2A 1QGUA 1IATA 5CPFA 4EPVA 4CUJA 4X62B 1M66A 4H16A 4FMCF 4DIBA 1OX4A 5FBZA 5D6OA 1X7XB 3ZWMA 1US8B 4MW6A 5C2JB 4ZT6A 2VHVA 5AVKA 4D99A 1JKFA 1A9XB 1YUBA 2E0IA 1TE2A 1W2HA 1SFRA 2RB5A 3F96A 4V02A 1C1DB 4W1QA 4X8LA 2ZYWX 5AHXA 2EGHA 5EXDA 1DAKA 3UV6A 3CSUA 5KQRA 1IFXA 5IAGA 4FYHA 4DSNA 4G56A 1RAEA 3Q3EA 2A4MA 4Z4IA 1M2FA 3EF3A 1YE3A 3A2MA 5J59A 2JFBA 1FYVA 2WILA 2WPDA 2Z2JA 3KL4A 4YRAA 1W34A 5JYDA 1WDLA 4Y6PA 1SPBS 2H3EA 2WF9A 4G9BA 3AIOA 4DA0A 5JDCA 1Q1QA 2PLAA 2PZLA 5DM1A 3UMGA 4E07A 1I0ZA 6GPBA 5LP6B 2MSKA 2B78A 4TL6A 4RULA 4PZCA 4ZHQB 3I1FA 4X84A 3V8VA 4DGQA 4JXJA 5AXDA 3VR2A 1BG6A 4H7IA 3ZY5A 1O9GA 4D98A 4CODB 4KO3S 1J00A 2ODNA 2VS1A 1VI6A 3ETJA 5AHWA 5EHGA 1T5LA 4JJGA 1DXHA 5EA2A 4B3TB 3Q3HA 1CUXA 1HBJA 2UUCB 2OZVA 4OL9A 1ENZA 1YR2A 2YZ7A 1I9CA 3N39C 5FRDA 1RABA 4YP6A 4XVQA 2HF7A 2I8LA 2YY5A 2GN4A 5M3BA 1J49A 4RSMA 3GP8A 1O4VA 5CB8A 1GSOA 3EYWA 4JVOA 1E5DA 1M2VB 4WE3A 1NE2A 3UHFA 2P2DA 3WSWA 4JYAB 4CCWA 1X7DA 1YVUA 1TZBA 1DX4A 4ME6A 1EXWA 2XQKA 2ZI4A 1UZAA 1GU0A 1UWLA 3TTXA 1ORRA 3JQGB 4I9FA 3P32A 4DPMA 3QBEA 1Y9ZA 1G7TA 1NURA 2W2NA 1ML4A 1L4HA 2YC2C 2NUTB 3PEFA 3OPYA 3TUZC 2Q5FA 4RTRA 3JYOA 1WTCA 2A2ZA 4UHDA 4EKGA 2B36A 4PR3A 3HC7A 3ZDEA 5E3HA 5EQJB 1VLQA 2JCXA 2OCIA 3P2KA 3REQA 2IY7A 3UAOA 1ESDA 2QG9A 1JWLA 1DCMA 4FGWA 2QGNA 3DV0B 4KDFA 1JXQA 3FBWA 3GP5A 3HKEA 4FZJA 2QTVB 3RU9A 3ZDFA 1Q15A 1JPVA 2A58A 3R9IA 2BSXA 1AURA 3GLHA 1UXKA 1PJCA 4CLOA 1KYXA 5LQCA 1TAHA 4O6VA 5IJ0A 4C2BA 4D9EA 2I8CA 1R9MA 4J0HA 4EAAA 2AXQA 1BAPA 1XDSA 4G41A 5EKDA 2UXCB 3EXAA 5K0CA 4M9RA 1EHIA 2IQIA 5BO5A 1A98A 1U04A 4QAJA 4FI3F 1EFPA 4OKIA 3WRYA 1FS5A 3WL8A 1D0IA 1P5RA 1WB4A 3WXBA 3A9VA 3ZU2A 3A1CA 4Z49A 1NRIA 1E1NA 1O9HA 4ZGGA 4HNTA 2N46A 3W1EA 1HLDA 1ULTA 3WK6A 4QD3A 3SQMA 5J2UB 2V6JA 2IZ0A 1YRBA 2JGEA 3WB1A 2JBHA 5MGNA 1FY2A 1XYGA 4JC5A 1YF3A 1IZ7A 3EC2A 5IJAA 3A8TA 4B71A 3CCFA 1VCIA 3NOVA 5I7WA 4AYXA 1Q1ZA 3HCEA 4FILA 1D09A 4NCNA 2GPBA 1YHNA 3GAZA 3AF5A 3O6VA 5F2KA 1UWCA 4J7UA 2K2QB 2OBMA 4M9XA 2PSHA 1F8XA 1P77A 1RFLA 2FFHA 3AXTA 2XUPA 1OXSC 3D0OA 3QKSA 3DULA 3O9VA 4M1ZA 4L4ZA 1G41A 2ZJYA 4DN6A 4OATA 1TU0A 4FW8A 1GR0A 1D8AA 1ZNZA 3OCWA 4FDTA 1OLOA 1I4WA 1KNXA 4HDAA 3BWYA 2WG2A 1SG6A 3ESAA 3IQHX 2GQ0A 4Q9IA 4E51A 1R8JA 1BE6A 3ZDYB 5C34B 3D3JA 4ZHQF 2BMVA 1LUAA 2GPJA 1WIWA 2WSSD 2XNDD 1T5OA 5G41A 3FKSA 5KTNA 1X86B 5JROA 2CXQA 4B6RA 2CL0X 2VTVA 3CPJB 4AXXA 2FW0A 3WGKA 1I9GA 4DUGD 2OFXA 1C50A 4KIUA 2IEBA 4MVJE 2GJ9A 4YQYA 2Z95A 5DBOA 5TQ0B 4Z4QA 4LF6B 3UJNA 3H3JA 3OTHA 1S89A 1LSJA 1I7SB 2PJUA 3CNNA 2FOLA 3NH9A 1NVWQ 1JHVA 2ZWPA 1GQSA 5IFLA 3GT7A 2PH7A 3IS3A 2B99A 4L85A 5D1HA 4B7UA 5LD2C 5AXAA 1V8PA 4R3UC 1LPMA 3LL4A 3B2QA 4ILEA 2M98A 4J16A 5LMZA 2DLCX 2X4DA 5A2GA 1Y6RA 2ZREA 3A7EA 3GRFA 4G2TA 1OF1A 5CLGA 5LZ8A 3SE7A 2B5VA 4RKRA 4HEHA 4Z1MA 1ODCA 3UJ7A 4B6EA 5HKOA 1XP8A 3KSRA 3FKJA 5CM8B 4S1PA 5FWYB 1Z6PA 2GNPA 4ND6A 1X70A 5DKFA 4HB0A 2DPXA 1USWA 1A4IA 1HDOA 4NEHB 4TM7A 4AJOA 2X86A 1PHPA 2I29A 3L1UA 4N39A 3HU5A 2FPMA 4RJLA 5F64A 5EWLB 2RIRA 4WXYB 4C1NA 2AN3A 1L8OA 3C5WP 1N2SA 3P52A 1QGAA 3PFCA 4H7FA 4J1QA 1I4TD 4E94A 3TQCA 1OBVA 2XKAA 4UUAA 5BYAA 4A0GA 4C7KA 4BVGA 5MN6A 2AF3C 1L7QA 3RSZA 1QRAA 5FA5A 1H8EA 4J75A 3ZWOA 4WH0A 3U4AA 4NBNA 4FOPA 5M2QA 2HPZA 1Z28A 3R20A 3SK0A 2TMGA 2K6GA 3FSJX 3N5CA 1EFCA 3NT2A 2Q1YA 2VNKA 3WYFA 3RGWS 3N3BC 1E0SA 521PA 2BTEA 1ATIA 1ISPA 2C4HA 3OHPA 3G7SA 4KIGA 3EF1A 2QPLA 1UPFA 2VDRB 3JQ6A 2HMUA 4HFNA 4MWBA 5J2UF 1XALA 3HVKA 5FL7A 1P6QA 1U5CA 4QT4A 5C53B 2PU5A 5JJKA 4R9RA 1J7KA 1XHFA 5GV8A 4JT2A 4M9QA 5AKLA 4P3YA 3ROXA 5HZKA 4IDEA 2GCOA 2R8YA 5FCDA 4GLFA 2UXDB 1OZFA 3IT2A 2BGMA 4E46A 4CLRB 1DB3A 3KYCA 1J8DA 1N2CB 2JLRA 4KMMA 1IH8A 4F9FA 1ISIA 3W3ZB 4J3JA 5DHFA 3MYRA 4FDAA 4L73A 4GAEA 1IJFA 4IAOA 4LZZA 3TLAA 3WKDA 3R76A 4AQ7A 5U4XA 4WZAE 1CERA 3BK2A 4N8SA 3W4IA 2BR5A 1Y8QA 1UBJS 3VISA 2OGSA 4AICA 4BFYA 4EB6B 3FF1A 1K6XA 1U1EA 1BZYA 1WBJB 2Y8EA 2ZB4A 2DKNA 3F8SA 3CNLA 4RD3A 5CIWA 3RVOA 4OJYA 1E2QA 2PRZA 1DKMA 2HHLA 3R0VA 1S96A 1V5FA 3WMWA 1L7BA 5F3DA 4U8GA 1HO3A 1RXCA 4IG4A 2QL9A 2PR2A 1SNYA 3GJTA 5JASA 3A05A 4QUBA 1FDUA 3AHDA 5EMLA 5B3JA 4BFTA 1E2NA 2Y4OA 5HP4A 2EHDA 3SLGA 4JJFA 5C51B 3LP6A 3R3JA 1V6AA 3K9FC 2KSQA 2BC9A 2GZRA 3H5RA 3LWBA 3IE0A 3IT1A 421PA 3WZLA 4OHUA 4B8ZA 3TO5A 1S3GA 4GPBA 4E6PA 4JLPA 3KTAA 1YVRA 3O4RA 1MGPA 1Y1KE 1C3OB 3L1IA 2ZYGA 1CY7A 3B9PA