4X90A

Crystal structure of lysosomal phospholipase a2
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
376
structure length
376
Chain Sequence
b'HPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Group XV phospholipase A2
molecule tags Transferase
source organism Homo sapiens
publication title Structure and function of lysosomal phospholipase A2 and lecithin:cholesterol acyltransferase.
pubmed doi rcsb
total genus 139
structure length 376
sequence length 376
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02450 LCAT Lecithin:cholesterol acyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4x90A01
4XIIA 4N5IX 2DQZA 5AM5A 4JYMA 3WI7A 5CURA 3NOXA 2C4HA 3IVMA 2WIJA 2PKYX 3AIMA 1CIJA 2DHDA 5JADA 1OILA 4PQEA 3ZLUA 4HRXA 3VJLA 3WJ2A 3WIBA 4K6KA 1JJBA 4E11A 2DSNA 2ZSIA 2CEKA 2PUJA 4TVKA 4I3FA 5AJHA 5DYYA 3WA7A 3G02A 4UBKA 3WA6A 1LLFA 3R3WA 4KRYA 4Y2QA 4B84A 5ALKA 3HSSA 4FBMA 4PSCA 5CH5A 3D2BA 2DHCA 2W22A 4BE4A 3VXKA 3FLAA 2VJAA 4B83A 5IVHA 5ALXA 3QM1A 3C6ZA 5DNUA 1XZBA 4PV7A 4BVKA 3DOHA 3HXKA 5A7GA 1UK6A 1VXRA 5EHZA 4LXGA 4C87A 2PSHA 5ALOA 4X93A 1VZ3A 4JUIA 4AQDA 1HPLA 2WJ3A 2PU5A 4BZWA 1GGVA 2VATA 3WKAA 3KSRA 1UXOA 1AQLA 2ZJFA 1CVLA 1ISPA 1ZI9A 3E3AA 1DWPA 4BP8A 2NW6A 3WL7A 2PBLA 3STWA 2C0QA 1FSSA 4BCDA 1THGA 2WJ4A 5CRIA 5DYWA 4W63A 1BCRA 3WKBA 4F5ZA 3EBLA 4DMCA 5AK4A 1EHYA 1DX6A 3QPDA 1QIJA 4P08A 2WTMA 4X95A 1MO2A 4Y2XA 1XLVA 1XZHA 2WTNA 4H35A 3BXPA 4HRYA 1SOMA 3FSGA 1BEZA 4J0JA 3D7RA 3IUQA 1QIHA 5T4HA 1CUCA 4UHBA 5ALNA 4DTCA 2OCLA 1R9NA 4FFWA 4U2GA 4UHCA 2G5PA 2QTBA 2JGKA 4KRXA 1CUYA 1U65A 3ZI7A 3PE6A 1G42A 3T4UA 3JW8A 2XMDA 1CQZA 1A7UA 4WFIA 2HU8A 4DNFA 2V9ZA 5IVDA 2HADA 2OAGA 1ZI8A 3FBWA 2QT9A 2OPHA 1XZIA 4ZI5A 5HF8A 2QS9A 5J3JA 3DKRA 4LYDA 1NX9A 1P0QA 1SCKA 2WU3A 4MEAA 4X7BA 2AJCA 3UMJA 4Y2PA 5BWBA 1N5MA 5A62A 2YYSA 5AICA 5ALSA 4CCYB 4KJXA 4AMYA 2OXEA 1EX9A 4LHEA 4BTVA 5K3EA 3GFFA 1QFSA 1LBSA 3GUUA 3ICWA 4DM7A 1MU0A 1EA5A 2WUDA 5C8ZA 1PV1A 1IVYA 4QE3A 4H7HA 2GZRA 1W75A 1ZOIA 2CJPA 1USWA 4M0EA 4DSAA 4O08A 3MUNA 1CR6A 2XQKA 5ALMA 1DINA 3PUHA 3QPCA 4QEKA 2X76A 1BROA 2QR5A 2Y1KA 5AKIA 4I19A 2PM8A 1CUAA 2OGZA 3C45A 4KAJA 4WDRA 1K8QA 3HZOA 1YSCA 5AM4A 1KU0A 2RAUA 1DU4A 2OQVA 1JJFA 2XUJA 4H7DA 5AK5A 1UOPA 2WIDA 4X92A 2XQFA 4K6GA 1HDEA 3GZJA 3DYIA 5LZ8A 1CRLA 4M0MA 5AM0A 5JARA 1A8SA 5HF6A 2QOEA 4KE6A 2AJLI 2B9VA 2XMQA 4Q34A 4N8SA 4GLBA 4Y2VA 4W1RA 3R3XA 5ALYA 2C7BA 4B7ZA 1B6GA 3R3ZA 1LNSA 1G66A 1FFEA 4Y7DA 4G1FA 1UK9A 2WFMA 4G8BA 4HS9A 3O9MA 3WZMA 3DKKA 5AOAA 3MGAA 1UKBA 5AKKA 4H7EA 2WIFA 5AI9A 2V96A 5JD4A 2HHAA 3F67A 2XUDA 4OCZA 2WFLA 1AX9A 4J0CA 1ZIYA 5D7BA 2DR0A 3BJMA 1ORWA 4K2AA 4KEAA 4OYLA 2VJBA 2CUTA 2G4LA 3I6ZA 4X91A 4Y2RA 5DNVA 1WM1A 3F8SA 1YA8A 4GDMA 3KXPA 5DTIA 1QIGA 5D3ZA 2WHPA 1UKCA 2OGSA 5KBYA 3VISA 3STTA 1PFQA 3NUZA 1HQDA 5EHXA 5LZ5A 5A7HA 5AKHA 4E15A 1XZAA 3C6XA 4MJ3A 5AI6A 2O2GA 3F97A 1X2EA 1LGYA 2CBGA 2RGUA 2DQYA 3H1AA 2AJBA 2BGRA 5T4FA 2B61A 1EI9A 1K6EA 2WG1A 4Q3LA 3U0VA 4FBLA 3E0XA 1ODTC 5ALPA 1Q83A 4Y2TA 3C43A 4YK7A 5CT5A 4BVJA 4U2BA 2XMBA 5AM3A 2BUCA 1O6GA 1HKHA 4C4ZA 4IQ4A 3W9BA 1EB9A 2Y2UA 2JEYA 5EGNA 1C7IA 5CT9A 1MNAA 4EZIA 3F9CA 2IITA 3HI4A 5EIEA 2YH2A 1GKKA 4FWBA 5CMLA 3FCXA 3TGLA 1ZJ4A 3WJ1A 4BRZA 2WU4A 5CXXA 1GZ7A 3I2KA 2JIDA 2HA6A 3LIPA 3WWEA 2WHQA 5HFAA 1J06A 1QTRA 1WPRA 3L1HA 2XMCA 4F60A 1BRTA 5K3CA 3WK6A 2R11A 2QXTA 5JAOA 3R40A 3PI6A 1YB7A 4NS4A 2RHWA 4KE9A 3VVMA 3TEJA 2ZSHA 4OD0A 1VLQA 4JYPA 3I28A 1F6WA 3G0CA 3QMWA 2XUAA 5D3KA 2H7CA 1LBTA 4DNOA 4ARAA 2R8BA 4MYSA 1MX5A 1P0MA 3CCCA 5AOBA 1ZICA 5ALGA 4QLOA 4AO7A 4KACA 5CT8A 3OURA 3DYVA 4UBIA 1IUNA 5CTAA 3DL4A 4QDZA 3R0VA 5SYNA 4G5XA 5HF5A 3WWOA 5CW2A 4J7AA 3W05A 3A6ZA 1WB6A 3FVTA 1W4LA 5I8PA 4FNGA 1UK7A 3FLEA 1QLWA 2XUHA 3KDAA 3C5VA 4U2EA 3H2HA 1G5FA 4QDUA 5KREA 4BAUA 5AOCA 3VVLA 4N8DA 5C8VA 1EH5A 3U1TA 1ETHA 2WKWA 3KWJA 4WY8A 1RWQA 1TCAA 2Y6UA 4BTLA 1CUZA 3V9AA 1IZ8A 3QVMA 5D6OA 2XI4A 3GROA 5AK3A 4EHBA 5E4JA 3X3HA 2VA9A 5AKEA 3PF8A 2YXPX 2B20A 1CUXA 1IZ7A 5AI8A 3IB3A 3AILA 4CCWA 3FYUC 4J0GA 2VTVA 4MWSA 1JKMA 1EDEA 5IVIA 3VJKA 2VT6A 3WMRA 1A8UA 4U2FA 4WFKA 4OPMA 2C5GA 1LPNA 1BS9A 4BAZA 4E46A 3F98A 4Q05A 1J07A 4PSUA 1E3QA 5EIAA 5IH7A 2WQZA 4X85A 1W6RA 4A16A 2OG1A 2Z3ZA 1N1MA 3AFIA 3WIOA 5FDFA 3OTQA 3M82A 2H7XA 2HA5A 3W2TA 5ALJA 5FKJA 4P9NA 3WKCA 7YASA 2WG0A 4XX1A 4UUQA 1QOZA 4RE5A 3QITA 1CUHA 4BDTA 4LKOA 4FHZA 4Q3KA 3ESCA 2LIPA 5AKLA 2VJDA 1XLWA 1XQYA 2HA7A 4A23A 3DEAA 5FLKA 1XZKA 3EQ8A 3F96A 3EIOA 1VE7A 4OB8A 2G5TA 3FOBA 4H18A 4Y2SA 2O7RA 5ALTA 4BYMA 1EK1A 5AM2A 4AO8A 2VQ6A 2ZJ7A 2GZSA 1NU8A 4PNZA 4EY6A 2XUKA 3CN7A 2PPLA 3DDUA 1FFCA 1E66A 4GHWA 1ZI6A 1XZCA 1XKTA 1WB5A 2XMRA 3IIIA 5K3FA 1ZJ5A 2CB9A 4IH4A 1EVEA 3H17A 2C0PA 3HEAA 2HU5A 4G9EA 2FX5A 3O95A 4AMZA 5ISMA 1QO9A 3GA7A 3O4JA 2DCMA 5C7YA 4BC1A 2WFLB 1QZ3A 1T4MA 4EY7A 5SYMA 4CIAA 1AC5A 1BCSA 1OCEA 5ALVA 4FKBA 3V1NA 4JNCA 1OXMA 1YCDA 3G0GA 4XVCA 3BL8A 2WSLA 4AXBA 4AN0A 5C8XA 3PDCA 4OU5A 3P2MA 3FCYA 4UBOA 3V1LA 5FXMA 1RYYA 5CH3A 4EBBA 2XUIA 4LYEA 3W04A 3G9ZA 1T2NA 5AP9A 5AIBA 4UBMA 1BEEA 1YASA 3WK8A 5JD6A 4UPDA 4CCYA 1E89A 3TRDA 3WK4A 4GW3A 1AKNA 3ICVA 1YS2X 3N2ZB 2PSDA 3ESAA 3ZWQA 3AZOA 1YA4A 4M0FA 1CFJA 3ILSA 5C81A 5JANA 3QH4A 3G0DA 1XZFA 1H2XA 3IULA 2XMSA 1E5TA 2BFNA 5AM1A 1VZ2A 1IUOA 3DJYA 4G4JA 4DNQA 3STVA 1QIEA 2OCIA 4X71A 4E14A 3H19A 2IIVA 1SCQA 3BF8A 4YX9A 1UOQA 3FAKA 4HXEB 4KR0A 4J0KA 4C4YA 1N8SA 1WB4A 3BE8A 3V1MA 4KAFA 4RGYA 2JGEA 1MN6A 4MEBA 1CUSA 5HKAA 2E3JA 5JASA 2BUAA 1JT2A 2B4KA 4ZV9A 1LPOA 1H23A 1AZWA 1CQWA 1XZGA 3PFCA 5LKAA 5DTJA 4ROTA 1E8MA 3WYDA 3FWHA 4FFVA 3O4IA 4H7KA 1TRHA 3R3UA 1QE3A 4WJLA 2D0DA 4OSEA 5EI5A 3BIWA 5EHQA 3IUJA 3AZQA 3G0BA 5ALRA 1R4ZA 5ALLA 5K3FB 4C01A 2H7YA 4GECA 4I4CA 4PF1A 1BN6A 2XB6A 1Q84A 1VA4A 1XFDA 4BCCA 2GBGA 2C5FA 4CIBA 3Q0TA 3IA2A 4BATA 4B0OA 1U8EA 4D9JA 4QNNA 2XUQA 4H0CA 3M83A 3E1GA 3QYJA 4MXDA 1JMYA 1XQWA 2BJHA 2HFKA 3H2KA 4AZ3A 5AI0A 3W06A 1KU6A 4RNCA 5E4YA 1K4YA 2XE4A 3FLBA 3D2CA 4PW0A 5JZSA 3EF3A 4XWGA 1XQVA 4OU4A 4QDXA 3WWDA 1ZIXA 4NMWA 1KEZA 5T4BA 4QWMA 4QDOA 5CT6A 4Y2YA 5F4ZA 3NGMA 4X6UA 1MX1A 5CH8A 3JYHA 4X00A 5A2GA 3HLKA 4ZV7A 1GQRA 3K6KA 2HRQA 3V48A 4OUKX 3G0IA 4Q82A 1RP1A 4TGLA 1A8QA 1ZD5A 1QGED 4B85A 4DNPA 1R1DA 2X8BA 3C70A 5AKJA 2PL5A 3VKFA 2ZYHA 4HVTA 4BRSA 2JGLA 3H04A 4KE8A 3K2IA 4GBGA 1TQHA 4U2CA 1UT6A 2ECFA 1XRPA 2YASA 2ACEA 1LPBB 2O2HA 3NWOA 3WLAA 1CUGA 2XLCA 3ESDA 4CG2A 4UBJA 3UUFA 3ZPXA 2CKMA 2HM7A 2PX6A 1XLUA 2XT0A 2V98A 5AKGA 4S0XA 3R41A 3M81A 2FJPA 2DFPA 1XZLA 1UK8A 1R88A 5HF9A 1X2BA 5AK6A 1U2EA 3BJRA 4CI9A 5FOQA 5ALZA 1Y7IA 1CUBA 1CUEA 4OYYA 2HA2A 5HKBA 1CUWA 2QJRA 1WPXA 4FLFA 3VJMA 4OB6A 1JMKC 1QO7A 3KOOA 1FFDA 4TPKA 5AI4A 2O7VA 2Q0XA 5AH0A 2HDWA 4UHHA 3STYA 2FUKA 3H2IA 1YS1X 5HK9A 3VDXA 1EVQA 1QTIA 4A5SA 5FV4A 4IH9A 2JGMA 4UFNA 1TKRA 4BCBA 5DLPA 1HBJA 5HK8A 3TJMA 4WDQA 2K2QB 2PU7A 1MTZA 3RM3A 2D5LA 5HCUA 2WUFA 3DCNA 2OGTA 2EDAA 4UFPA 4ZREA 1BE0A 1YAJA 2ZYIA 3I1IA 2VF2A 3L1IA 1GT6A 4J0HA 5JALA 1DWOA 5HFNA 1IUPA 4UHFA 2PVSA 2CMFA 2VSQA 1DQYA 3A2LA 1K63A 3R3VA 3S2ZA 1Q0ZA 3H0CA 4DGQA 1XRLA 2QXUA 4CG3A 3H1BA 5CXUA 1UZAA 5DWDA 4QZVA 1XZDA 5BWCA 1R9MA 5DJ5A 2HA0A 1DWQA 5YASA 4DLNA 1P0IA 5JD5A 2P8SA 3I2HA 4G8DA 1M33A 1LPAB 2WLSA 2OAEA 4Q1VA 4FOLA 1J1IA 4C89A 4Y2JA 4G8CA 3WL5A 1EINA 3I2IA 1JU3A 3WL8A 4ARBA 5AO9A 1CUVA 4V2IA 4LIPD 4AN1A 3LIIA 3KD2A 5DYTA 4C4XA 3LCRA 2Z8ZA 1Z68A 3E4DA 3GELA 1YAHA 2J4FA 4L9AA 2EEPA 1YR2A 1HLGA 3H2JA 3HC7A 3N0TA 4N8EA 4DMHA 3BDIA 4B80A 5LZ2A 3ANSA 1TCCA 1XRQA 3R3YA 2PUHA 6YASA 4LXHA 4WFJA 4UHEA 1R3DA 4FLMA 4H7FA 2GBFA 1X70A 2JGFA 5CBKA 2PSEA 1LPPA 3KWFA 1QONA 3B3QA 1LZLA 4CG1A 1FFBA 4X94A 2HRRA 4FMPA 1VJ5A 3G9XA 4K5QA 2OLEA 3OPMA 3HYSA 3AJAA 4F0JA 3ZLTA 1S8OA 5AKZA 2I3DA 1GQSA 4RPCA 1XRRA 4ZRDA 2X5XA 1DX4A 4Y9SA 5KWIA 4INZA 2RI6A 4KE7A 4B9EA 4YPVA 2O2IA 1JJIA 3WZLA 2VJCA 4EB0A 4X3CA 1O6FA 4FNMA 2RHTA 1XROA 4B0PA 4B81A 2BCEA 3QPAA 4HAIA 3O0DA 1MPXA 1VKHA 1SC9A 3FVRA 2ZVDA 1Q0RA 3WKEA 4JEIA 1Y37A 1GPNA 1CV2A 3DNMA 2HU7A 2H9YA 3DQZA 1QIMA 1W52X 3BIXA 1WOMA 1AURA 1YB6A 3AUKA 1ODSA 4L0CA 3A70A 1JFRA 2WFZA 4CFSA 5JIBA 4FLEA 4FTWA 4GEGA 1VXOA 4IO0A 2GYWA 5A6VA 3RLIA 4EY4A 2ZJ6A 2JBWA 1EK2A 3G8YA 3PF9A 3QBJA 1XZJA 1MAAA 2JF0A 4ITVA 4BP9A 5ALFA 2W6CX 2HA3A 1EXWA 5FUMA 2BAGA 2OCKA 4MQLA 4W1SA 3C6YA 2QM0A 2ROQA 3IURA 1FFAA 3I2FA 1QFMA 1TAHA 4X6XA 3QMVA 2QKYA 2ZYRA 4H7IA 1EDBA 2XQGA 3AIKA 3A2NA 5JZBA 3DL7A 4IH1A 5DNWA 2XUPA 1F0NA 1JI3A 3C8HA 5EFZA 1CUIA 4DIUA 3LS2A 3RKSA 3ZV7A 3FNBA 1CUDA 2PSJA 4KAAA 3D4LA 2WUEA 3W9UA 5K3DA 3D5EA 1W1IA 4HTAA 1B41A 3OM8A 1ZD4A 2ORYA 3PUIA 2XQJA 4G4IA 4H77A 2VAVA 1SCIA 5KWJA 5H3HA 1WHTA 5T4EA 3FYTA 1Y7HA 4GI1A 5IVKA 3RARA 2VT7A 2I3ZA 1IMJA 3BF7A 2PSFA 3SK0A 3WYNA 2BKLA 2ACKA 2HA4A 5LKRA 4B9AA 4BAGA 3H2GA 2ES4A 2I78A 5E2IA 1CUFA 1QIDA 1HL7A 5LZ7A 1R50A 5E4TA 1CUJA 3S8YA 2QUBA 4XJVA 4QDTA 3PFBA 3A2MA 1AMNA 2HL6A 2GBCA 1BU8A 1H2ZA 1UOOA 3AIOA 5HZGA 3IUMA 4B6GA 2I03A 1E8DA 1QIKA 4MYDA 3HJUA 1L7AA 3FYUB 4OB7A 4P93A 5ALQA 4IHAA 1JU4A 1L7RA 4N5HX 1XKLA 2G63A 4K6HA 4X97A 3QZUA 3IUNA 1PJAA 3GBSA 3LLCA 5AI5A 4YASA 5JZ9A 1CUUA 1SFRA 2WIKA 2HFJA 4FDMA 1E8NA 4BVLA 3I6MA 2JGJA 5K3AA 5EIHA 5ALEA 4EY5A 3CCBA 2Y2VA 2XUGA 4X90A 5JATA 4AO6A 2WIGA 3I1YA 1TCBA 1F0PA 3HRHA 4W1QA 1LPSA 2WHPB 1GKLA 3D0KA 3OOSA 1EDDA 2XMGA 1ACJA 3O4GA 1UFOA 4EA6A 1U4NA 1ODCA 1ORVA 3B12A 4UBNA 1DT3A 3ANTA 3DOIA 4ZXFA 1MNQA 2UZ0A 4G9GA 5ALIA 3UUEA 4J3JA 3C6BA 1H2YA 1XZEA 5CT4A 1XZMA 5ALWA 4BC0A 4ZGBA 4HXFB 3SWWA 4G4GA 3AINA 5JAPA 5K5EA 4Z49A 3WWCA 4HXGA 1DTEA 5ALDA 5K3BA 2QMQA 1GXSA 2ZYSA 4KYVA 1BN7A 2OQIA 3DD5A 3DS8A 1EB8A 1NU6A 1ZGBA 1XRNA 4BB0A 2WUGA 2XLBA 4J0DA 4JH0A 2H1IA 4EUSA 3G9UA 5LLSA 1ZD3A 3HACA 2AJ8A 4W9RA 4QWWA 3MUOA 3EQ9A 1A88A 3BDVA 1N5RA 3I2GA 4L72A 2JEZA 4NZZA 2XMZA 2RIPA 2QUAA 3G7NA 5LP1A 5ESRA 5I9IA 2BGNA 1LPMA 3CXUA 2VAXA 1QIFA 3B5EA 1J2EA 2WM2A 1ZD2P 4J0IA 3SX4A 1L7QA 2GYVA 1C4XA 2GBIA 1AGYA 5AKXA 3RK4A 3JWEA 4UBLA 2J3QA 4BBZA 2AJDA 2QJWA 4Y2UA 4DMFA 2J4CA 3OG9A 3D59A 3O9VA 3STUA 3D3NA 1W76A 1C7JA 5EHNA 4HZGA 4MWTA 4WY5A 3Q8WA 4DYHA 1VE6A 2AXEA 3L1JA 5AHXA 3WK5A 3OC0A 3O4HA 1WHSA 2Z8XA 5FPQA 4AX4A 5JAHA 3LP5A 3HABA 2QRUA 1MJ5A 4GXNA 1MAHA 4PO3X 2VEOA 3FYUA 3FSGD 3WK9A 5LZ9A 1QIIA 3PICA 1FJ2A 2HIHA 5ALHA 2OCGA 5BV7A 3WL6A 5AKYA 2FJ0A 1GPLA 3H18A 3C5WP 3V1KA 1GPKA 3AZPA 3ZLVA 4UFOA 5IKXA 1I6WA 5BOVA 2V97A 1MX9A 3SC2A 3I6YA 4UHDA 4W1PA 1TIBA 2WG2A 5A7FA 3STXA 1VA5A 1CEXA 3IBTA 2Z3WA 4MQMA 1XRMA 1LZKA 4NVRA 2IX9A 4PSDA 1QJ4A 1P0PA 2BUBA 1VOTA 2XUFA 4U2DA 5FP0A 4DMKA 2XDWA 3EQ7A 4AB1A 4EY8A 3ED1A 3CN9A 5I7UA 3M3DA 2WHRA 3IDAA 4P92A 2RONA 2J3DA 2EDCA 1K5PA 2QVBA 1H22A 3C8DA 1DQZA 4QLAA 4C88A 4L3WA 4RE6A 5FRDA 2WILA 1WCYA 1AUOA 2C58A 3D2AA 4QA9A 1XQXA 5LZ4A 4ZWNA 1F8UA 4WCVA 2DHEA 4BDSA 4X6YA 3K9BA 3T52A 4BZZA 5JAUA 1DT5A 5LIPA 2Z5GA 4AZ0A 5ALUA 3WQHA 3MVEA 5A71A 4Q3OA 1CLEA 1ZGCA 1THTA 2CZQA 5JYCA 3WK7A 1MT3A 1ACLA 4C6HA 4BE9A 1CPYA 3I2JA 4LXIA 4DSZA 2XUOA 3QMMA 2WJ6A 2Y6VA 4GWLA 4J03A 2ONCA 2QZPA 2JGIA 1G4HA 4F21A 1UKAA 4H7JA 1TK3A 3DLTA 3BWXA 1UWCA 3G9TA 3WKDA 5HQ3B 2XQIA 3C87A 3ESBA 4B82A 4ETWA 5AIAA 5FPPA 3YASA 1D07A 5LYYA 3WWPA 2GYUA 5HQ3A 1H2WA
chains in the Genus database with same CATH superfamily
3B1YA 1KFKB 1UDCA 4N5IX 1KEEB 5AM5A 1U8YA 3GRYA 4ER7A 1YQUA 4ND1A 3WI7A 3B8HA 4EEKA 5F5NA 5CBPA 5DSZA 4LEIA 5AJVB 5ITZA 4D0NA 3TS1A 1GGHA 2C9DA 5CURA 4ZQBA 4CMKA 3NOXA 2YHUA 2C4HA 5DE3A 2EP8A 4GYWA 2YJ4A 1JMVA 2DLDA 3FCUB 3IVMA 1T3TA 1GUBA 1LX6A 1YZYA 4KBGA 1YOVA 2N3ZA 1CIJA 3JQAD 4WZAB 5FBWB 4HAXA 5JADA 5KQGA 4WOPA 1REQB 1XDZA 2G5CA 2J7PA 2ECPA 5AJYA 2NMVA 1S0UA 2PGDA 3HBLA 4LK3A 1ZH0A 5THKA 5EZQA 1SBIA 2ZWMA 2BY4A 1T2EA 2JKYA 1T34A 4MUYA 3EVAA 4YN3A 2EOAA 4H6XA 1B42A 1U2GA 2EX0A 2Z2KA 4KLAA 3OESA 3K73O 2G1AA 3MIZA 1M1YE 3HU2A 2Y1WA 4LNUA 4F5WA 4N41A 2BWJA 2QV7A 4MS4A 1C7FA 1NVMB 4I55A 1L8OA 1N75A 1UBGA 4HEA6 4IJKA 2GD2A 2HBZA 2A0XA 3IT3A 4D9EA 4DSTA 4F5YA 3MD9A 2GZHA 1DNPA 3TNFA 2SKEA 3DL0A 1XK7A 4UBKA 1GNRA 3TF5A 1V1RB 5HVNA 1IU9A 3W6ZA 1MPTA 4TL7A 1NUQA 2Z9CA 3ENNA 4B84A 3HSSA 1PWHA 2QRGA 4D9FA 4MYHA 3ZI4A 4EB6A 1P7VA 5CH5A 3ZQJA 3MWDA 1B23P 1ZGAA 3K2BA 3SYLA 3WB2A 3FBTA 5F21A 1PT8A 5E1BA 4L5YA 3A9UA 4BE4A 1PL6A 1G3UA 2FEMA 1GLNA 1ZFNA 3BXGA 2VJAA 3EXEB 3KCNA 2P62A 3WL3A 3ZUPA 1QWSA 2Z0MA 3AF2A 4I0WB 5KU7A 1N8KA 1L5RA 2D1FA 1P18A 1J8FA 1E7YA 1NGSA 2MHCA 2UZ3A 3EF0A 3P4UA 4ITUA 1BX0A 4O4LB 4A8TA 5C8YF 3R5TA 1V3QE 4I8IA 4KWTA 1APBA 2HT6A 1EHIA 4U5QA 2A92A 3JAMA 3EXIB 1NYQA 1A9XB 3HXKA 4I1RA 3DP9A 5EWMB 4M3NA 4BQPA 2J3HA 4M8KA 3FR7A 2C42A 4PTYA 4KMRA 4NYIR 4B8YA 2QBYA 1SVKA 2FSUA 4OHFA 2H57A 3N86A 3OI7A 4IQ8A 3NM5A 1CIPA 4IOLA 4LXGA 5EMKA 4A1FA 4X93A 1VIDA 3ZV6A 3OPYB 1VZ3A 5JTTA 1U8FO 4JUIA 3VPHA 3R6LA 1Z5GA 4G23A 8AT1A 1I94B 5FBLB 5JDIC 1SG9A 2JA1A 4RMGA 3UXEA 4AQDA 1I8TA 4QYXA 2IYOA 2P1RA 3F2VA 2PLWA 3TN7A 5FUQA 3SYNA 2PAFA 1B43A 3T4EA 3ZE0B 1H3FA 1HPLA 2NZVG 3R09A 2WMNB 3VNAA 4DZZA 1E9RA 1FUIA 1JZSA 2J3KA 4AG3A 4I14A 3ROEA 5A05A 5DBFA 1YK1A 2NO0A 2PU5A 3WGVA 2VATA 4UVHA 2XGSA 2KWIA 3KSRA 2H5JA 2Q8PA 1T8RA 4NDAA 2R6ZA 3GDGA 1J33A 2OXFA 4PPQA 2ZJFA 3FPSA 3MMNA 3MINB 1XYGA 4KQCA 5GM1A 5HBRA 5K5EA 1DAMA 1GA4A 4JIMA 1K2VN 1IBMB 5CLIA 3OWXA 4K9NA 3HCOA 5DASA 5FTWA 2I7DA 4OGLA 1L7OA 1SUSA 1UZMA 2H52A 1FNNA 3NM6B 5FHRA 2W2XA 4YMVA 4YA6A 1XRSB 2CVQA 4R40A 1ZK0A 1ATZA 4GMDA 4BCDA 5IFLA 3PWSA 5G3ZA 3KQUA 3V2UA 3CH6A 3BGIA 4EFDA 4BLTA 1FXUA 3OAAD 4G0PA 5CRIA 5KHAA 2OILA 2ZIGA 4GC9A 1N34B 4PNPA 5AVKA 1LU9A 3MRSA 3WKBA 2AYXA 1L5KA 1UJ4A 1K8ZB 2CLKB 3KZMA 4OQ4A 1XEXA 1HQKA 1QH0A 3OD1A 4DCOA 4IX9A 5JQGA 1XQ1A 1XIVA 2O2YA 1CY8A 2OHVA 3EH2A 5E7MA 1V4BA 4RV9A 5LD2B 2QD2A 1E2QA 4DN6A 2I4NA 1MO2A 3CLSC 4CNQA 4Y2XA 5DYGA 3E70C 4QUKA 16PKA 1YFLA 1XZHA 2WTNA 1VJGA 3I12A 1TECE 3NXKA 2HI0A 1H8ED 4H35A 1B3BA 3FVQA 2CHUA 4YQYA 5EUCA 1SOMA 2FQXA 1MZVA 2OC9A 3TEMA 5IPFA 2BH9A 1LLDA 1PR3A 2Y1DA 3BB4A 2Q3EA 4O2BB 1U9IA 4J0JA 2NPFA 3N58A 1QIHA 3NYRA 4B3IA 2IVFA 2O6LA 5FNZA 3RYCA 1IYZA 2P1ZA 1OFUX 5AT1A 1VGVA 4YXWA 2VHQA 5FOXA 5ALNA 3WADA 1RHMA 5KKNB 4M98A 2G80A 2OCLA 5AXDA 4HX9A 1G16A 1QYWA 3WLMA 5C1PA 1V96A 2WRZA 2VXOA 4NBVA 5EJ8A 5IXSA 1VPEA 3ESXA 1I2AA 1JVSA 4QARA 1FS5A 3HA3A 4NV1A 4X9XA 3ZI7A 1GZHB 4ZDJA 5J2TF 4W5WA 2ISCA 2W83A 2R8XA 3KK0A 1CXZA 1WTAA 4MRMB 3WSWA 2FEKA 4U63A 4WPGA 4LS3A 5CLFA 1QR2A 5ECWA 3H9QA 2QF7A 1EIZA 3EPHA 3MAGA 2XMDA 4MPDA 1W4RA 2Q1WA 2ID4A 4EYGA 3K0FA 1X14A 2HU8A 1KY3A 1UKEA 2C3OA 2WTUA 5FFFA 4CN8A 5K6AC 5KC9A 4FYKA 1YE8A 2OAGA 3FBWA 2GVDC 3UN1A 1RMTA 1GCUA 1KK0A 4ENUA 4CGYA 4WGGA 1GPDG 3ZE1B 2C2MA 5G0WA 1NXSA 4OFZA 2ZRDA 3OZTA 3CE9A 3CMMA 3H8WA 3VBCA 4J6FA 1PT9A 1XMXA 2QS9A 5JSUA 3BQNB 3M3PA 2B2XA 3ABOB 4FFPA 2F43B 3FNQA 3RTGA 3T8YA 5HRCA 2WICA 1NX9A 4XYMA 7MHTA 1R5NA 1N3YA 2ZSBA 1UDRA 5JE8A 4A91A 2X22A 3FIJA 1GNTA 1MO3A 1WD5A 1YFZA 1YZTA 5K0FA 3ZQ4A 2JHFA 2AJCA 3UMJA 4ND5A 5LMCA 5KTTA 2PG3A 4OG2A 1Y0BA 4RLSA 3HZRA 5ED4A 3IJRA 1KZ9A 3AM5A 3V34A 1FS6A 1Y1RA 2GJKA 3J7TA 5BWBA 4Q9NA 1L9KA 3SFVA 3RC8A 1SQFA 3HDYA 3RW9A 1U7PA 1YI1A 2BMWA 4PWZA 5ALSA 2HV9A 1M1XB 3K5WA 3TL3A 2I99A 3HP7A 4KR2A 4I46A 5KSYA 5B3LA 4RENA 3Q87B 5KUTA 1Z8DA 2VTDA 3D9QX 3GFFA 4PYIA 4Y6QA 2CEAA 5CB6A 4WQMA 3ML1A 1R00A 4IVPA 4K9PA 4X8LA 5TQ2A 2XYRA 2AEFA 5EUBA 4CZ2A 1WIWA 1XWWA 1Y1PA 2R2AA 5BYAA 2CDBA 2IEYA 4MPJA 2POCA 4NEHB 1MQ8B 2PL9A 5ERYA 3VSDA 1DG9A 4LYGA 4RDIA 1TI7A 3GJ0A 2X0IA 3L7JA 4GMGA 2JVKA 4GSKA 2XBLA 4H7HA 5CJ2A 4ENRA 3VTKA 1ZN8A 2BEWA 3K70B 3I3OA 1QANA 1USWA 4BV9A 5BN5A 1U0BB 1KIMA 1J0CA 5AVXA 1D1TA 3E9ZA 3THSA 2DQ4A 4EFMA 5AFSA 5ALMA 4CGZA 1DINA 2HU2A 3CX4A 3PUHA 3QPCA 5CP8A 3CLRD 2UDPA 1NQTA 4X61A 1I1QB 5I9TA 2JKZA 5CLQA 5B6PA 2C2ZA 4MLPA 1O95D 1U8ZA 2P77A 4GRIA 5E0KB 2IPXA 5SY6A 4MX8A 3G2MA 4FNAA 4L2IB 4P34A 2OCYC 4G89A 2CHQA 1OZHA 2PM8A 1OBOA 5TIIA 3E6AA 4F2PA 2GILA 1COZA 1J7KA 4RO0A 4P7FA 3C45A 2X0DA 1Z16A 3HDJA 1CQPA 4KAJA 1L7XA 1K8QA 1B8OA 1Q19A 2Q0SA 3HZOA 4FE3A 3R6WA 4ND6A 1KK3A 3Q9LA 1P0CA 5AM4A 3LF2A 4DJEC 1HK7A 1I0ZA 3D6AA 4L6CA 2OGUA 4PANA 3RKRA 3U49A 1FUKA 3QU7A 4C43A 1W6UA 4WK0B 3TLKA 4WHMA 2XQFA 3SY8A 5ESWA 1MG0A 5EN4A 3X0DA 3KRTA 3DJFA 1DQNA 4RK6A 2OO7A 2JIMA 1CVRA 1XTIA 1M2JA 1PW5A 2PWBA 2XGJA 3GZJA 3AVUA 2BCGY 3W3AH 1G6HA 2C5BA 4QXMA 4R1MA 3KFVA 2O8FA 3Q72A 2BVNA 5LZ8A 1XA3A 3CNEA 5I3CA 5BNIA 4B09A 3D7NA 1TO2E 5JARA 2GESA 1WMBA 4A3SA 4OBBA 3RUPA 2OUKA 5JLAA 2BELA 3GT7A 4ZU6X 3TIVA 3QENA 1TTTA 1DAIA 1DIOB 5HF6A 3KJQA 4UPEA 1SR8A 3GC6A 4JSTA 4XJSA 1G59A 1NFFA 3ANYB 2CHFA 2W98A 5LQJA 1P5ZB 1Z6AA 2B9VA 2G06A 4KE6A 3UTDA 4GI7A 3ZK9A 3R3XA 5LR6A 4NYJR 4IG9A 4CMEC 3R4CA 2BGTA 5ALYA 3P71T 1UDXA 2H8GA 2FRXA 3DEFA 3O2NA 2YZMA 4B7ZA 5IVPA 1V39A 2X6RA 3FDZA 3OHMA 4YRDA 1N2OA 1OLSA 5J4VA 1N0HA 1PV2A 3ENKA 1V37A 4MUHA 4S35A 2J0VA 2J8ZA 3G5AA 3IPAA 3LVBA 1X7HA 2UVDA 1HX7A 4AZSA 1DTWB 3F47A 2BZSA 3V2GA 2I62A 2FW1A 4WOJA 1B1AA 1F4PA 4K1LA 4J1SA 1JJVA 1KL7A 1Q6YA 5JNLA 2IIPA 2FPKA 2P67A 3FYCA 4TLDA 4BQOA 1S1MA 2EGGA 2FSHA 2PGOA 2X4IA 4G1FA 2D6FA 1TX4B 4QYIA 3BBLA 1UPAA 3N2LA 1ZSYA 2OHXA 3NLLA 3QJ5A 3RYFA 2C1ZA 3P9CA 5I7EA 3ZE8A 3O9MA 5EINA 1XUOA 1T91A 1RXSA 3C48A 4DJFC 3MGAA 2M9MA 5IUJC 1UKBA 2P6MA 2ZSJA 4QJ5A 4TYPA 3GLGA 2WIFA 4MP8A 1SJ9A 4DA7A 5JD4A 2GKSA 1BFKA 2BF4A 3PB3A 3QYFA 2NO6A 1WWKA 2XUDA 4PC7A 5G40A 3UJBA 1MLDA 1RBYA 3T7RA 1ZO8A 2W2MA 1SBNE 4XI9A 2Z04A 3H1GA 4ZRNA 2B37A 5LQSA 4D42A 1ZIYA 2AT1A 5I9NA 1VFNA 1D1QA 3R0IA 5A0VA 4XFKA 3LPNA 1MORA 2HREA 4ALMA 3GRCA 1C3JA 2DR0A 2RBEA 1QF6A 1ORWA 3F5SA 1K6JA 2P9FA 3S1AA 4C21A 4LJKA 2IW3A 2J9XB 3ILVA 1MXFA 4Q1CA 4N65A 2C3UA 3JTEA 3TZCA 1JHZA 2BP7B 3QEKA 2JNWA 2Y8EA 1G3IA 2G4LA 4Q15A 3OIFA 4XE5A 1A04A 1OYYA 2E89A 2F7SA 4J07A 4QECA 4Y2RA 3B60A 5CX4A 1WM1A 3TL2A 4BMSA 1JLKA 3CTPA 1YA8A 5AUPB 2QMOA 3DF9A 4IS3A 4GDMA 2PMKA 3BZWA 1QIGA 2J85A 3LUHA 2A84A 3NXSA 4BJHB 1JEAA 3I04A 4LRSB 2YQ5A 4RHTA 4BO5A 2WHPA 4D9KA 3BM5A 3GLFA 2ZCVA 2IYFA 2OGSA 3WQRA 4BMPB 2SICE 1XD2A 2EVWX 4EYOA 3I76A 5C4IA 2VSFA 3VISA 2J41A 3GQVA 3STTA 1J0XO 3IPXA 4NX2A 5DGCA 3U48A 5E3HA 3GLHE 2H2AA 3RVBA 3IEXA 4TL9A 3V6LA 2XNJA 1FFXB 1XNJA 1GSIA 1Z88A 2GCOA 2J5RA 4D97A 5KAMA 2C5LA 2C2HA 2IYXA 4E15A 2YZKA 2VYVA 4PC1A 1ZS9A 2R97A 4ZZ2A 1ZRMA 3F5DA 5H0IA 4IHJB 4LJ8A 4PG8A 1H2BA 2DPLA 4OH7A 3C6XA 3KKMA 4LYAA 1C0LA 2D1TA 1RAEA 1B2LA 2I6XA 3F97A 4EQZA 1U3GA 1WMDA 4O2AF 2D1SA 3H1AA 1W581 4NWIA 1Q1BA 2AJBA 3BILA 3HFRA 2ET6A 1MENA 3CT4A 5T4FA 1K6EA 2XOEA 5JEDA 4NAUA 1VE3A 5JW6A 4RW0A 5DM4A 1OWNA 2PT9A 2BTQB 3L4SO 3NAZA 4JQOA 4RAOA 5JMOA 3RVMA 2GCPA 1R10A 1Q83A 3VKHA 4KQWA 2X1MA 1C30A 1AS0A 4B1FA 2JHGA 1N6LA 1UPCA 4QRDA 1LA2A 1O9GA 3QOFA 3IAUA 5CT5A 3PEWA 5JVDF 1ZITA 4MAAA 1I2ZA 1I32A 1XCMA 4ON9A 1HKHA 6NULA 1II8B 1EUYA 3BFPA 1M6VB 3SMVA 2Y2UA 1O54A 5CFLA 1Q11A 3S68A 5CXSA 1XZQA 3H1TA 4UUAA 5EGNA 4GDFA 1K8XB 1M8GA 4PZZA 5I9LA 4HSGA 4EZIA 1PT5A 1GRCA 3QVGA 3F9CA 1OI4A 3DOOA 3JQ9A 5IX8A 1U7HA 2YH2A 1GNSA 1HWYA 5CA0B 5EIEA 5KQRA 5AJWA 1PCXA 3COPA 3SC3A 3UYLA 2UZ4A 3L6DA 5CMLA 3NONA 2FFRA 2P40A 3WJ1A 4BRZA 1T9KA 1H4QA 1GZ7A 3P2KA 2PUTA 1OPRA 2WF9A 3FOFC 3R1IA 1FP6A 1KK1A 2IY7A 2XE7A 4HDRA 1HUQA 2BHTA 4RKWA 2HA6A 4K9RA 2H1SA 1XCJA 4BXOB 3VOBA 5KZMB 5KYTA 4JITA 4H1TA 3AH8A 3ITEA 5AMXA 1J06A 1HTWA 1WPRA 2ZUDA 3K6JA 1LJLA 3MRXA 2CLMB 4F60A 1Y5MA 1U0OC 3RUAA 3WJ7A 2C97A 5K3CA 2IH2A 2QXTA 4BNUA 5JAOA 5CDHA 4FYWA 4O02B 1WQ3A 4M9SA 4ALLA 1THMA 3LHDA 1V8DA 1YB7A 1ZBQA 4NZ9A 5COBA 4BLOA 2RHWA 3H4VA 4G81A 4KE9A 1QZXA 2ZBEA 1M6WA 1QRRA 5HUJA 2FWPA 3S3TA 2ZI4A 3KSZO 3GEIA 2AMFA 2D8AA 5JZVA 3A4MA 3QTBA 5AJXA 3TLCA 2EKQA 3OWOA 2Q99A 1PU2A 2BHLA 3IUYA 3HB9A 3BICA 3QXCA 4IILA 3MCVA 4IJQA 5TT0A 1X8LA 1F6WA 2X3FA 5KAPA 3VHXA 4CL8A 2DFLA 1U5CA 2QEQA 3G0CA 1P1KA 3NP9A 2JFPA 4R2WA 5CFMA 3I1FA 5J40A 4IV0A 5BNWA 2PHZA 2XUAA 4Y9UA 2H7CA 5D3KA 3FMVA 4AY6A 2H4JA 2NVUA 1G20B 3Q88A 2JJ1A 3QWIA 4Y9TA 4YONB 4MRAA 4ARAA 4YO7A 1LK7A 5B64A 2I4TA 4V0OA 2JD2A 3MJRA 2JCBA 3AR8A 2ADFA 3A7EA 1T3ZA 2Z30A 4D3XA 4NR0A 3FJOA 2XCIA 3C3WA 5AOBA 3H4TA 4QLOA 4AO7A 1E3WB 1RRPA 4KACA 2XEXA 4IV8A 5HR5A 3OBIA 4YROA 3WDSA 3DYVA 4I9UA 3VBEA 2A9FA 4Q4JB 4D46A 3DFUA 2DERA 1W0KD 2VNHA 2J0SA 1KH1A 5TVKA 5AI0A 3J80A 2FRDC 4LYJA 4QDZA 1T9ZA 3LGAA 2YWDA 4NEQA 3PXXA 3KWMA 4W82A 4V3CA 5JI2E 4E5PA 1UXHA 4GPTA 2QL6A 4NDNE 1COWA 2DTXA 3HS3A 1BVRA 5SYNA 3GHYA 2BSXA 3DUFA 3WRVA 1R6XA 5AJUA 4GOLD 1ZU5A 1Z7BA 1X8KA 1DFGA 4YAJA 3W05A 1TM1E 2QI9C 4C4TA 3V55A 1HTBA 3B1FA 1JHVA 3FVTA 2R7AA 3I72A 5DHUA 2AQKA 3W2FA 5I8PA 1QE0A 1M74A 4E2YA 4GGPA 1O94A 2XZLA 3ZX5A 1PGOA 3UMFA 2AFHA 3H4IA 1ORRA 1S9HA 3NIFB 2XUHA 3QVSA 4IY1A 4NBNA 4BFYA 1T9CA 2UAGA 5JU6A 3QG5A 3P0IA 3NBUA 3SBOA 3VR3D 2BP7A 1FX0B 2JLCA 2Y67A 4BAUA 1UC8A 5AOCA 1QS0A 1RQRA 4N8DA 2RK3A 5D3QA 3N39C 3R0JA 3QE9Y 1NRJB 2WB4A 2OWDA 3V6MA 4FPXA 2PJDA 3U1TA 1JWLA 1OU0A 1SXJE 1E7WA 1H8HA 1FBNA 3C3PA 3D54D 1FTNA 3L8EA 1SXHA 3TCNA 2Y1CA 3NZEA 4F2DA 3FDJA 2BEKA 1SUIA 4Z4CA 1NNSA 3DLHA 4IUDS 1GO2A 2GFIA 2ORED 3X2FA 2PJRA 2ZZNA 2X1LA 4HS4A 1U3UA 1TCAA 1V8BA 2A67A 5K0GA 3DR3A 3UAYA 4I99A 1CUZA 2YN2A 1T4GA 4KBFA 5A4IS 3QVMA 3RS8A 2EKBA 2FDRA 2O5VA 5D6OA 1OKKD 1NVUQ 3LPDA 3AR2A 4A6EA 2Q7XA 3KS9A 1RKVA 2YY6A 1LDEA 4TYMA 5EIWA 1XFAA 2OFOA 1UZUA 5E4JA 1U6IA 2EGHA 3TG2A 4H6WA 4IHQA 4CQMA 2GN4A 4DIOA 1IAVA 5DTMA 5FCDA 1RD4A 4E1AA 1GTJ1 2YXPX 4M8NE 1ULTA 5DVZA 3U7QB 3ZJTA 1CUXA 3GIWA 4Z3OA 2FF7A 1BD4A 2EWMA 4H1HA 4ZQFA 3BTSA 2QV0A 3PYXA 5EJ2A 3SBEA 2VTVA 2WM3A 1QVVA 1NT2A 1F2TB 2OC4A 1C9NA 3QW2A 4QVGA 1DTWA 1IPHA 2HMYB 3KNZA 3VJKA 2NXEA 2W6PA 1R4MA 3DT8A 4KQGA 1B3RA 1A8UA 3BXXA 5D01A 3RRXA 1FBTA 3D3WB 4RX1A 4U2FA 5J4YA 4OPMA 4CKEA 4EMBA 5DGDA 2V4MA 2YQ4A 2F55A 1LC0A 3F3YA 3H1FA 2PMDA 2IWRA 4E46A 4Z7OB 2FZKA 1V3VA 3F98A 4Q05A 4L5JA 2ZDQA 2ZUVA 4UE6A 2RI1A 3MD0A 4L7VA 1E3QA 5IH7A 3OJFA 2OECA 1A4UA 4Q4JA 4NOMA 1E5DA 3SHTA 3ZVNA 4HPXB 3TNLA 1ZCFA 3GG2A 4P84A 3CRRA 2HWXA 2O5CA 2RJNA 3MQ2A 4JT4A 1XAHA 3NHZA 4KPUB 1XL0A 1TM5E 2YVUA 3I8SA 3WIOA 3PGJA 4EFKA 4PPGA 4BEVA 2AF4C 4D6YA 1OMOA 3GAZA 3BVPA 3TCKA 5DLQC 1OREA 5CVVA 3U6BA 1BA3A 1Y98A 3JWJA 4ERXA 4AYXA 3HZHA 5FKJA 4CEJA 1CY4A 7YASA 3FTQA 4XX1A 3A6DA 3VDNB 4AMGA 2VYQA 1XB2A 1LF5A 2O0KA 2ZRKA 4J4TA 2FV8A 1G5RA 1CJTC 4RDCA 4HLDA 4XRRA 1B6TA 3MOGA 4RE5A 4ZVLA 4C0KA 2LDBA 4GL2A 4TS4A 2VN8A 4LKOA 4K3UA 1V2GA 1Z4MA 3FFAA 3D4OA 4DAOA 5GY7A 5A4FS 1DJQA 4RVNA 4DLTA 5AHRA 1E4VA 1DIBA 1ZJZA 1SKBA 2P91A 2W4IA 3HRIA 4ZVKA 3WTBA 1BMDA 3TYXA 2B35A 3ZG6A 1NP3A 2ZTUA 4OIFA 3ANLA 2BFOA 2FW7A 2AGVA 5B4TA 4O25A 1XEWY 1KEKA 5C7OO 3ZGXA 4HNAA 5BUZA 4I2NA 1AY0A 1R6VA 3Q1KA 3ZGZA 1E0DA 3OIDA 3UWSA 2ZB8A 3ISTA 4A23A 1ESEA 3PV0A 2J7KA 2FETA 4LK2A 2EZ8A 4FYIA 3FOBA 4GPZA 4MSUA 4Y2SA 4EPTA 4M7RA 4MUIA 3KUXA 1TUBB 4LF6B 3LA8A 1VBMA 2OBNA 1A9SA 2QVYX 1EUCB 4HPJB 2AOUA 1EK1A 3DF7A 5C1IA 3TJZA 2ZPTX 3ETCA 4LQDA 3I5YA 2ZJ7A 4UCQA 4DRXA 1GDDA 3UK7A 5JJLA 4RV5A 5B55A 2KBFA 2RG7A 3UF0A 4BNYA 4D02A 4PNZA 3JQBA 4R2KA 5K8VA 4W5NA 4UU0A 3OCJA 1E9EA 1SUFA 3CN7A 3IAS6 1N7IA 1ZUNA 5A1TA 3SYKA 5B7PA 2J7PD 2OUIA 3RNLA 3AUSA 2JAUA 3A6EA 3Q15C 2QQ5A 4Q6WA 1DKUA 4M76B 4DV4B 3LRXA 2I9PA 3V00A 2IU6A 1CYEA 5H5JA 2EFDB 3FOCA 2IUSA 1C0EA 2C3YA 2ODQA 3TLXA 3ZH9B 3DZIA 3AHEA 2IPLA 3FNIA 2V4UA 2V59A 2WYHA 1P8JA 3BB1A 3KYJB 3CVYA 3DA8A 2VJMB 2J5BA 2YXNA 5JROA 5JRDS 1VMDA 1R27A 3JD3A 3GUZA 4LPKA 1RMQA 1RWVA 2PGIA 4MWOA 1KS9A 1YWGO 5DYIA 4ER5A 2CB9A 5LQRA 4V0QA 4F3TA 3CLSD 3CRQA 3HKCA 1YTUA 4JVLA 4N0EA 1RJ9B 3SHFA 3WRYC 4IH4A 1T3SA 2LRHA 3DBVO 1M1NB 4QULA 2HLPA 5EAIA 3TRFA 1OXVA 1QCZA 2C0PA 1Q3TA 2OK8A 3NTOA 3GWZA 3KTOA 3BQ9A 4I7EA 3SEQA 4TXNA 3VH1A 3WIUA 2O8BA 3QPUA 4J3FA 3HEAA 2XITA 1QDUA 1W88B 2HU5A 2YWHA 1U2QA 1WF6A 3M2TA 3WLFA 3ZDEA 1G9TA 4NCNA 4B4DA 5F3DA 5JXJA 3AEUB 4RVFA 4JI8B 2P9JA 3U3XA 4NECA 4O4LF 2WVAA 3O4JA 3RGWS 3UJCA 3SE7A 4O2RA 3UB4A 5JNSA 2WFLB 1NI4A 4CLXA 2EYUA 4IICA 3U81A 5LJLA 1PDWA 1T4MA 1VG9B 1TAQA 1QH8B 3AP2A 1DRUA 1B6SA 2QX7A 5IBQA 4EB8A 2X8JB 1I14A 1MJFA 2X1VA 3EDOA 4CIAA 2Q45A 2REQB 2WIAA 1OCEA 2IIBA 4NS1A 2O1WA 5ITSA 3T1TA 2BN4A 4N6GA 3G0GA 4KIFA 5G3YA 2FUNB 3BL8A 3K0AA 3OEHD 1YOVB 3PWZA 4MCAA 3ZIAD 5LWHA 3I5AA 2CJFA 2HWWA 4ALJA 2ZE6A 3MFQA 2J6BA 4R3WA 3ZWBA 3O8QB 4K3VA 2CKDA 4D0LB 1DC7A 2AD1A 3A4NA 1OXXK 3BERA 3C7KA 1L7MA 2AOTA 2HF9A 3P2MA 4S12A 4CUKA 4TYWA 2Q6OA 5FXMA 2HTEA 4YAKA 1H2AS 1X0XA 1KI6B 2XUIA 3NDJA 1GDHA 4LYEA 4WEOA 3W0LB 1FUYB 3OF3A 4QTYA 5LYJB 3I9V6 1RVV1 5AP9A 1EHCA 1RACA 1LK0A 2IGBA 3GCZA 5JD6A 1A9PA 2AOUB 4UPDA 1OY1A 4MWCA 1C2YA 5DHAA 4MS1A 5TV2A 4ZT2A 4WESA 3EASA 4PZYA 2YIDA 4RKEA 4BV2A 1YKSA 1JH9A 4YRRA 1EX6A 1UL1X 2D1YA 4G0UA 3Q3CA 1JA9A 4O3FA 1YHZA 3N2ZB 3O82A 4PO8A 1JPJA 1JAXA 3LLMA 4XVHA 1FRZA 2VAWA 3AQ4A 3ZZUA 4DLLA 5A4DA 5BQ5A 1Z7EA 3DDWA 3GCXA 3F73A 3ESAA 3TZQA 4C7XA 2A30A 1YA4A 2D1RA 4ZEXA 4RKQA 1P74A 1NVGA 4X62B 4H17A 3O31A 4XWOA 4AWAA 4YMSA 5TQ0B 3KYDA 2L82A 3QH4A 3BL6A 3DKVA 4LYFA 4BNMA 4TMWA 3DVAA 4BQFA 1FZQA 4OLAA 1OHHA 5J23A 2BH2A 1H2XA 2OBXA 2WKPA 2OY0A 1L5HB 1UBHS 2G72A 1G8FA 3DZFA 2A5JA 5BMVF 4MVCA 4M9QA 4MUXA 9MHTA 3BRQA 3ANXA 1PX2A 4OGGA 1ZH8A 2ZI9A 2UZ1B 3N5CA 1Y3BE 3B8EA 4BVFA 1YR1A 2NXWA 5FFNA 4IWYA 3E9EA 3O75A 3N7TA 3LQYA 4DNQA 4DMUB 3WGOA 1NOJA 1M2EA 3M2PA 1MCZA 4X71A 3RIXA 5BT8A 2C92A 3PRYA 1P62B 1G3RA 4TUYA 2XVAA 5GONB 1EG2A 5K51A 5TMBA 2IIVA 1SCQA 3BF8A 5TY0A 1RE0A 3CC8A 4YX9A 4V0SA 1V7CA 4D4MA 2F1HA 3OE1A 3FAKA 2JS7A 3PGXA 1DZ3A 4JZYA 4C2AA 4BO7A 4L22A 3KQNA 2TMYA 3DT9A 3FSJX 1GNVA 1HORA 1N0IA 1KTVA 3FKJA 2HF7A 2HJHA 4I50F 3EVTA 1JSRA 4YXWD 1KERA 3HPQA 3VR5D 4B4UA 2J32A 4YWJA 2V65A 3WGGA 1WCIA 3I01M 5IARA 2WMYA 4RSMA 3RUIA 1P6QA 1MN6A 3CJQA 3WQSB 3X1JA 1CR0A 1CZLA 4D96A 5C52B 3MC1A 1Z63A 2IU4A 4Q4DA 3A4VA 1QAQA 3N59A 4FZRA 2PEZA 4ZV4A 4MICA 5EJ7A 3HBFA 1TA9A 1RAHA 3D6TB 4P4SB 4OP3A 2E3JA 3DBLB 3HCWA 1QG4A 3PT5A 2F6RA 3IIMA 4HFNA 4JYBA 4MOWA 2ZBVA 2BUAA 4TTJA 1ONSA 3LUBA 2JI8A 4L8VA 4W8OA 3IVAA 4G0VA 3SZUA 4QUBA 1LPOA 4BX9A 1FJXA 1K5GA 2IUUA 1MIOB 3GRAA 3CZQA 3WP0A 1JSXA 1B0ZA 3RRJA 4BWFB 4IEEA 4R9VA 2G9ZA 4BTEA 1YGYA 5DTJA 5LKAA 3JQQA 3W9YA 1J20A 4C78A 1VSTA 1MB2A 5EIBD 1S3FA 3MWDB 1C4OA 1QAMA 1S01A 1Z36A 5FFMA 3U9LA 2HWKA 4Z4HA 4XWKA 1RAFA 2CXUA 2BFMA 3FWHA 2EZ4A 1R8JA 1N2ZA 5JPCA 3GJ6A 4JLWA 4UOQA 1TJ3A 2IYUA 4FFVA 2ZRBA 1SBQA 3RBAA 3R3UA 3R76A 5CCBA 4EW1A 1XAJA 3OQJA 1UJ6A 1Q92A 4IMIB 2VBIA 4HX2A 4YFYA 2GO1A 3KP1A 3OM9A 2QN7A 2PANA 3A9RA 4MQEA 1AG9A 5DMXA 3ZHSA 3N70A 3OCXA 1CDEA 4DIBA 1EBBA 2A33A 4RGVA 4JLAA 1BJKA 2NO4A 5I9SA 1CR1A 6REQA 2HJ9A 1INLA 1A5SB 1ZN2A 2H7YA 5EESA 4DMLA 4FFLA 4KL8S 3VV2A 5EJFA 2XT6A 4MGHA 5D87A 4ZCQA 2XCTB 1EFPA 4PF1A 3R9XB 3W2EA 4GRDA 4YP1A 1OX4B 1K6MA 2GBGA 4HWKA 4IDOA 4RZXA 1RAIA 4WINA 5ENVA 4G37A 4MVWA 1YHNA 3K1ZA 3AEQB 3Q0TA 3N0RA 4JSRA 5BSTA 3UFXA 4MB0A 4B0OA 2WE8A 4BATA 2JVJA 1HGXA 4K87A 1PJCA 3CVUA 3EDMA 1SA0A 3CSDA 4X65B 3BULA 1HE5A 2C54A 1U8TA 2OM2A 3MJSA 1VIVA 3LXXA 4D4LA 3TMKA 1R0XA 3QYJA 2VYFA 4RELA 5L3QB 1KMIY 3TLJA 3UY4A 4LYHA 2PJZA 3HA7A 3UHPA 5L95A 2D00A 4P0PB 1HE2A 2AR9A 1ULZA 4Z0NA 2FXVA 1UMBB 1LV7A 3SE0A 4TLMB 2PGLA 4C07A 4BU1A 2CNLA 4LWPA 3HKEB 4DQUA 3PNPA 5AQ1A 3RC2A 4IZOA 5E4YA 4B32A 4G0MA 4IIJA 1VHTA 1X1TA 2VEDA 1Z8NA 1VHJA 2I55A 1KF0A 3NYQA 4N40A 4Q4LA 4CMJA 4YRNA 1W4CA 5EMNA 4CCAA 3EOBI 3K30A 1F8FA 2P6OA 2YRWA 4O0LA 5AXAA 1DDGA 3DBLA 4KSYA 3ZY5A 5FEMA 1NW7A 2VQDA 1GZ6A 3A1VA 4FHEA 4B46A 2GF9A 2RKBA 1N0VC 2C61A 3GEDA 4JN6B 2QENA 4OVKA 1XQVA 3TDMA 4BS9A 5K0CA 3U3ZA 5IJ0B 3ICOA 4PCAA 2PSSA 2PNFA 3FETA 3U17A 4UKDA 2E85A 4LDJA 4TYNA 2NZUG 5B2FA 4YACA 5TB5A 2G17A 4QDOA 3GEMA 1WDLA 4JX8A 5T4BA 5JRJA 2FEWB 2PGXA 5HTOA 1T5HX 3DKPA 3NGMA 3RGGA 1DRKA 4DG9A 4GKVA 1RZUA 1CQIB 2DY0A 1OA0A 4J7CA 1X38A 2P27A 1TLFA 2WUVA 2AOTB 3HLKA 4GMHA 1YA6A 4KDEA 3L1KA 1G21A 1GQRA 2NVOA 3EE6A 4HDSA 3A6KA 2YZ2A 4LWQA 5G0VA 4ZAVA 4CMIA 1YVPA 2QVGA 2HRQA 4NH0A 2PZKA 3IDZA 2X0NA 2XODA 2ZQYA 3ON5A 4JP3A 1KEPA 4WAUA 4JQSA 3G0IA 1EUQA 4TXJA 4E2FA 5NLLA 4ZDWA 3ROMA 4AP6A 1PD0A 4MHOA 3PXDA 4DNPA 1IRXA 5C4MA 1J4AA 1EWRA 1QHXA 4XVRA 2ZT8A 4FUQA 2I6TA 1J22A 4IJUA 3U4CA 2X6QA 5HTKA 4RSRA 2ZYHA 2BFWA 4JWTA 1QQBA 1TE2A 4HVTA 4XQGA 4RD1A 3TE6A 4OYRA 3VYSB 4BRSA 1UAAA 2JGLA 2P6NA 2QMZA 2C94A 3WGZA 3K2IA 2YUTA 3S2EA 4I1UA 3JQFA 1TQHA 4U2CA 4ZCMA 1LRJA 2ZSFA 3KAKA 5MHTA 2ECFA 1N1EA 1XRPA 3MJEA 4XFJA 3O8LA 3IP6A 1HA3A 1K68A 3W2IA 4LF5B 1PTKA 3PD1A 3NATA 5LPNA 3K6SB 2J45A 1QMGA 1NBAA 4IDQA 3TO5A 1VJ0A 1BVUA 1NVBA 2J3EA 3HR8A 1UDBA 2V55B 1CUGA 2LR0A 3IESA 5JS2A 1I30A 1FP4A 2F48A 3AUTA 4CG2A 3IOYA 2EBHX 2QP4A 1S2DA 1TYDE 2JLAA 2V7XA 3NHSA 4PTLA 1QVZA 1TPYA 2H0QA 3JZFA 5BXQC 2BKAA 1FDIA 2DB3A 2Z8YM 3H9EO 4WD3A 1QU2A 4ER3A 2HM7A 1KJ9A 1UIMA 3QHAA 4XB6B 5DZSA 4V0KA 2GUGA 2AN3A 5FOQA 1G0NA 2CZCA 5BSFA 1SC4A 3THOA 2ZIFA 4YRKA 4OK6A 2EWVA 3HBMA 3NOQA 4S0XA 1LJUA 4FOTA 1U6KA 3R41A 1A97A 4H6VA 1A4XA 3V2HA 1B8NA 3UVEA 4YCCA 3ESZA 2IYVA 1Y48E 3VRHA 2QTWB 3S7ZA 3DDZX 4KHPB 2GN9A 5C18A 2PH5A 3NC4A 1YH3A 1T1RA 3BHIA 3K09A 3MFYA 4R1QA 1NN5A 5G2OA 2IF0A 2VAMA 4GWGA 4X20B 4XM1A 4IF6A 4AJ9A 3BJRA 4CI9A 1Y7IA 3L7BA 1SEVA 3UV6A 3WFZA 2IXDA 2FE4A 4HWGA 2WW8A 1VG8A 4J9VA 5HZHA 4IHJF 5HKBA 1EM8A 4DLZA 1Y8CA 4L57A 2QJRA 5GZ6A 4NY1A 4DBLE 1WPXA 2DPYA 2DU8A 2XADA 4LJSA 1C9EA 5DM1A 3PCXA 1LS1A 3VJMA 5K8UA 4G1UC 1XVIA 4MIYA 2GZAA 3VNQA 5GOTA 4FD3A 1U0EA 3TVTA 4TPKA 5AI4A 3ZY2A 1H6BA 1KZ6A 1Z5UA 3Q40A 3S4YA 5AW1A 2IKSA 1KO7A 2Y4OA 4H16A 4XUEA 2HEGA 3O8OB 2HDWA 5AUOB 4UHHA 5DEOA 3STYA 3SVTA 1QBGA 2YYZA 3K70C 1W36D 3E81A 2QZ9A 1WUHS 3VDXA 1YV9A 2HIMA 1WDKA 3W1VA 4WKCA 4A5SA 4L9SA 3TQOA 5FV4A 4IH9A 5TPWA 2PKXA 4UFNA 3I9V1 2CXNA 4DCCA 1YO6A 3BIJA 5DLPA 3ZWKA 2XSZD 4DEYA 1NQXA 1S2IA 5LU9A 3IC5A 1UJMA 2R68A 4R1OA 3SF0A 3S8EA 1V3TA 3HO8A 3UK0A 4NKRA 2EWWA 2BHSA 3QU9A 2VYNA 4AJ2A 4OBXA 4GVLA 2XCRB 4G0WA 4WZBE 5CM9C 2EBUA 5C46F 3DCNA 4QXPA 5JSZA 1T0IA 3BJIC 1JEOA 3OO1A 1BE0A 1JSLA 2QTGA 1Z38A 4LQLA 1MO4A 3L0OA 2AMJA 3FF1A 3MHPA 4H59A 5AXBA 2X19A 2HY7A 3VX4A 2VF2A 3BS4A 2Q3JA 1RPAA 5ECGC 4Q3AA 1IXZA 1V5IA 1RPTA 1WUTA 3GLGB 2YRFA 4G6ZA 3SP1A 3CZCA 4TX1A 3LX6A 5JALA 3IDFA 3IXMA 3CEMA 3KELA 3QP9A 4AYTA 1IUPA 2Q5FA 4JAVC 1C1HA 3OIYA 2PVSA 1WHTB 1PD1A 4HFJA 3UHOA 1CB0A 2CMFA 3C24A 3D8RA 3QXHA 1BHQ1 2VSQA 4TS1A 5HCIA 3U7EB 1QO0A 2Z1MA 3A2LA 1I2BA 1K63A 2C2XA 3EPPA 4KHZA 1Q0ZA 4CM8A 1AQNA 3IUEA 2G9VA 5GGXA 2QZZA 3I1JA 4FGJA 4EMUA 5HMLA 3UPTA 2A0KA 3CLUC 4ETIA 1G1AA 4PG6A 2QXUA 3R5SA 4WCFA 4CG3A 4PNEA 5CXUA 1XTTA 3D7LA 1DKLA 2AVNA 1JE1A 4M21A 3VDQA 1HDZA 3URMA 2JAPA 1UZAA 3BE5A 5DWDA 4QZVA 5LDGA 1GTSA 3T9FA 5BWCA 4HNAB 3CFYA 4P1ZA 4AKTA 2FZGA 3Q2OA 1RTTA 5DJ5A 4HN2A 1I10A 5F2KA 3K72B 2VDWB 2QVLA 4B3JA 1E2NA 1P1FA 2CGEA 1Q0SA 3P9ZA 2RH5A 5CDGA 4FM9A 3KYIB 5DULA 1TVKA 4MGKR 1FSPA 1HT1E 4WASA 3U9TA 1J25A 4Q12A 2P8SA 5ERGB 3I2HA 3TL6A 4Q39A 5LP6C 1HSZA 2VWGA 4HDCA 3I5XA 4G8DA 1N7GA 3DAGA 4C04A 1BTOA 4RACA 5JQGB 3ENZA 3EB9A 3ZIUA 3QLVC 4P32A 2H06A 1FFWA 1QKKA 2G83A 4HEA1 2BHNA 3TXAA 1ZHFA 1WU7A 4DIDA 1ZQ9A 2OOKA 3QBVA 2I54A 2G28A 4DHWA 4AYWA 5A03A 2BT4A 1JU3A 4ARBA 5AO9A 1YZQA 3I61A 5KKCA 4TMXA 1Q1ZA 4V2IA 3X1MA 1AE1A 4U7JA 1LTHR 2H2FA 4KRGA 3KD2A 5KVVA 1M1NA 4ISCA 2I1VB 4E09A 1UFQA 3F7TA 4EO9A 1M6VA 1W30A 4K9MA 4ZMRA 5LQUA 1S3IA 2FQYA 2V3CC 4Z53A 3SX2A 3E4DA 3DD1A 5DCLA 4DLVA 2QJFA 3GGJA 5AK0A 1Z2PX 4DWVA 1RHQA 4ZGGA 2D7JA 4ALKA 2EEPA 4ZPXA 4LZAA 1YR2A 3LHFA 2PBFA 3DVAB 1JG2A 4XSHA 1T8YA 3NDRA 2X9NA 4CFYA 1H2EA 3MJ4A 3QIAA 3HC7A 1TZ2A 4IR7A 5DRTA 1XMIA 3IJEB 3LPMA 1C3EA 2FN3A 3A6PC 4A15A 1XRQA 3B6ZA 4LZPA 1VJCA 4YEDA 2N1BA 3EJ6A 4W5JA 3RIEA 4N12A 4QYWA 4B71A 4QKQA 1TLLA 1ZRNA 1JYFA 3EOAI 4QATA 5LQDA 1RPZA 2FY8A 3MQ4A 2FZCA 1DXHA 3GOQA 1RBZA 3ZDAA 1UFKA 1Z4LA 1C3OA 2H4XA 2JD1A 2NU8B 2C29D 1ODFA 5LU8A 2BZ1A 2HCFA 1M0TA 4ZT7A 4OXYA 2JGFA 4W6QA 3HXQA 1LPPA 4LF7B 2ZRMA 3OT1A 1N77A 3A3PA 1MH1A 2IXGA 1Y42X 2JI4A 2P4EA 2QD5A 4WTOA 4YV2A 4MB6A 5H8WA 2ATXA 3ZDDA 4CG1A 2XX3A 5CD1A 1DKQA 3REQB 2HPAA 3NHJA 2BGGA 1QB8A 4OI1A 2Q5HA 5CXQA 1A9OA 3QQ5A 1FF9A 1Y3HA 3PUJA 1VJ5A 4M86A 1N2GA 3DEZA 3LUJA 1WZUA 2OLEA 2HZBA 1SCBA 5D51S 4F5EA 5JDIA 4PIVA 4BV3A 3Q12A 3AJAA 4QODA 2QZ4A 3ZLTA 1U9ZA 4BO3A 2Q50A 3ZEAA 3EDYA 3WMGA 5KDDA 3HP4A 1Y6JA 2WF5A 2YY5A 4RBNA 4PHGA 4RPCA 4X1YB 3BHJA 2DWQA 2FJUA 1ZJJA 3OT4A 1NN1A 1YR9A 4GH5A 4CQJA 2ODEA 1J42A 1L1RA 3T41A 1OGJA 1GAQA 1IEVA 1UMKA 2I7CA 2O14A 3FH0A 4IIYA 4RJTA 5CIYA 1FEZA 3B51X 1PQWA 3TUIC 3SIRA 4HB3A 3KYDB 1VJRA 2XTMA 3LUDA 2O2IA 3RAPR 4CBVA 3OIUA 2Q5QA 5HP4A 1AIPA 3O84A 4KVGA 4YYEA 4PS0A 1POXA 2YJGA 2XDAA 3OFJA 3K7EA 3PHHA 3DG9A 3ZU3A 5JZMA 5IYZF 4RJ2A 4TQAA 3SQXA 3K0SA 4FNMA 3OLWA 1ZKMA 3VC2A 1KORA 1Z0FA 4NCHA 1L1FA 1TQ6A 4RY8A 1UBMS 2MSLA 2OM6A 1XROA 3AFOA 3PGKA 3W5DA 1ZGJA 3L0ZA 2Z56A 3G1WA 1OC4A 4B0PA 4CKZA 4AS3A 1Z35A 4EHJA 5BR7A 4AWXA 1K4MA 5B7GA 5CG1A 1XDBA 3FFTA 2Q49A 3QPAA 1QRUA 2ZJ5A 3KZ1E 5DISB 1K7CA 1S6YA 4DSNA 3B3AA 3O0DA 1N5OX 1SVWA 1VKHA 1OLUA 3FVRA 3PQ3A 2ZVDA 1H3EA 1PJQA 2IEAA 1QFXA 3G59A 3PTAA 3BXOA 1I3MA 4NAHA 1YRWA 4L02A 1N6IA 5JYEA 1NFRA 4L9RA 2EYQA 4N3NA 1SCNE 1GPNA 5EWMA 5AVZA 5IN4A 2CFOA 2CK3A 3N8IA 3DNMA 5CBPB 3T38A 4M6WA 1NWCA 2C4UA 1C80A 1Q7CA 2FDXA 2W7TA 4MYCA 4C0AC 1Q1GA 1ZAKA 2VP6A 2H3HA 5EIFA 3RU9A 4DR7B 4QBGB 2VZLA 1PI3A 3NDBB 4WI1A 1W52X 2ODAA 3BIXA 4M37A 2I9KA 1G5QA 3RUCA 2Y92A 4G3XA 4G86A 4KQ6A 1I7QB 1G55A 3IV9A 3LZDA 1JEDA 4LXYA 4FE4A 1U8AA 521PA 4NCBA 1OIXA 4RHXA 2WIBA 5GGYA 3A70A 4CFSA 3VA7A 1C8BA 4DRZA 1WD7A 4QGGA 5LVAA 4RYDA 1C1DA 3MLBA 4FLEA 3R20A 3FUXA 2E82A 5L53A 3CUEF 3KAQA 4UVGA 1KQOA 2ZYDA 5LMZA 1KXJA 1YQQA 2YXLA 3DE0X 3LWNA 3A4TA 1OI3A 1JBKA 4R51A 1N78A 4F2GA 1O77A 1WZ2A 5A6VA 3RLIA 1RHRA 2ZU0C 1DE0A 1G64A 5FOVA 1JH8A 4EY4A 4U39A 4N7BA 2JB9A 3ONWA 3M70A 2SKDA 2HWUA 4N7MA 1KR2A 2APJA 4KQ2A 5F77A 4BP9A 2XNDD 1FMCA 5F4BA 5M29A 1SU8A 4FMDB 4PLZA 4GKKB 1PP4A 3MELA 2J0UB 1TK2A 2L2QA 3I3SR 1M2VB 3I4LA 3IURA 1R8QA 5CGZA 4RXUA 3JD4A 4KQHA 4OI4A 3FTCA 1Z2DA 3CG0A 1NN0A 4X6XA 3NBAA 3CW8X 5KB3A 2ST1A 3WHLA 1Z6QA 3CONA 3G79A 1Y8RB 1L7PA 4GUDA 2ZYRA 4H7IA 4M22A 4JI6B 3VQTA 1EDBA 1D8TA 1HYQA 1MHPA 1P3Y1 1VHQA 2C2GA 2XQGA 2H8KA 2F8MA 3AIKA 2WJYA 3DL7A 3NETA 4LQ4A 4TS9A 2VJPA 1GCAA 2AHRA 1OC2A 5DBIA 5DNWA 4IOJA 4C03A 1GN9A 2XUPA 4GWKA 4QIHA 3QI7A 1JDSA 2WOJA 1DJNA 2D5IA 4WLFA 8LDHA 3TOXA 4L15A 3BC1A 2FWNA 1SOAA 2N46A 4EJ2A 1YNSA 3LS2A 3RKSA 4R71A 2OVBA 3AEKB 1F1BA 1TM3E 2OHJA 4MQEB 1Z4IA 4YDSA 1EVIA 2B8TA 1O8BA 1E9AA 1PQUA 1A9QA 3KPJA 3M5PA 4N01A 2HQ1A 4TWAA 5ICCA 2OWEA 4ZIRA 4U9UA 2Q4BA 1P2TA 5ICSA 2VDRB 4F7DA 2HIGA 3OJEA 3VR5H 5B1YA 5K3DA 2FU5C 1M34A 3LUPA 3Q6IA 4FYVA 1NX6A 3L9XA 2XYPA 4OQEA 5FORA 4A27A 1NVAA 1SQGA 2P8JA 3I23A 2E48A 1B41A 1ICEA 5EVJA 3SN6A 4G5FA 4PLVA 4C0WA 2NXNA 3HN2A 2ORYA 3PUIA 2W2KA 1WSAA 1D6SA 2JL1A 4H77A 5B3KA 1CU1A 5DX1A 4ZREA 4LVUA 3T7JA 3D4BA 3ILXA 2WABA 1A7KA 1R0LA 5DW0A 4E22A 1KJNA 1SD1A 3H2SA 3HCFA 3FYTA 2H1HA 1IY0A 2B1GA 1SEPA 3CHYA 3RE1A 1A2BA 3A6FA 1OX5A 4I6GA 2HH9A 1NBOA 2OCAA 3H4MA 2DM6A 3LBAA 1O2DA 1OT3A 1GKUB 1KEWA 3D6HA 4UCFA 4PX5A 1L5WA 3BF7A 4FIDA 5IJZA 4RZHA 4JBIA 2RGRA 3WYNA 1A76A 1JLLA 1ZESA 3KE8A 4LFAB 4V03A 4PICA 4OQDA 5DF1A 1WG8A 4P4SA 2PX0A 2Z2XA 2I78A 3F3MA 4GPEA 1VJ1A 3QFTA 4AS1A 1NBIA 2B1JA 2WTBA 1JNYA 2VK2A 1Q74A 4NP6A 5IAAA 5LZ7A 4MHSA 5E4TA 1DQRA 5FYDA 2C7RA 1DIHA 2LGJA 3R7BA 1Q3HA 1XLTA 2PLAA 4JJAA 1XAGA 2RB5A 1NR1A 4QDTA 3FBGA 1KO5A 2B83A 2H4HA 1F0KA 3OQPA 1QX3A 1AMNA 1MC8A 1HDYA 2XZPA 1ZIOA 1U02A 3C7DB 1H2ZA 1P4RA 3PS9A 4DIEA 1A4IA 4QBHA 1O95C 3LQ1A 5AVRA 4YJFA 2P2GA 3AUYA 1PL0A 1UOOA 1KOJA 1LY1A 4NU6A 4RIFA 1J0BA 1GRQA 2FGKA 3PKZA 4WLEA 4XQEA 5KSPA 2XTAA 3TPCA 4C6RA 4EABA 1YB5A 4TN5A 1LX7A 1E8DA 1K1EA 2ZIZA 1U28A 3TTWA 1AV7A 4QFBA 3OCYA 3SI7A 4KIWA 1YE5A 3GDFA 4QREA 1QZTA 2UZ1A 3IMCA 2GHIA 2P9YA 3DE2X 3FYUB 3PFHA 4ZD6A 4BHTA 1ZEMA 7ADHA 1DC5A 1DAGA 2CMGA 2CJWA 3B1WA 5BNZA 1QXSA 5D3MA 1JG7A 2ZI5A 4H15A 3K9WA 1XKLA 1EVKA 4E5KA 1N5KA 4H0NA 4X97A 1KQ3A 4MR7A 3GBSA 2ZUFA 3DZDA 1SKUA 4YRZA 4XYLA 3BKXA 4G26A 5AI5A 3AF3A 2AEEA 5JZ9A 2I80A 1BH2A 3O94A 3CWZA 3UNXA 4D8UA 2WQ7A 1BJRE 4CPDA 1E8NA 4RAQA 5F7ZA 2GXAA 1E96A 1ESMA 2E2WA 3OKAA 3I6MA 5CU7A 4L74A 2QRPA 4L5AA 3PJGA 3AP3A 1VHDA 3EGVA 4IRXA 4R3NA 3R24A 4U8HA 3C3CA 3CKYA 2JGJA 4CIXA 4O29A 2IV3A 5ALEA 4EY5A 4PFJA 3NEYA 3SXJA 1WKCA 1EAMA 2AV6A 2PZMA 4BNZA 3QHQA 2C99A 1Q3KA 1XXHB 4MPPA 2QY6A 4DDTA 3DGEC 3O4RA 5EERA 2QP3A 4INPA 2XUGA 2B9EA 3KOWA 3NTLA 3TEFA 4RLQA 3WB9A 5JNVA 4MUKA 3IDOA 5KTSA 3DTVD 3AVOA 2QDXA 2VKQA 5JNUA 5L4SA 2YVQA 3FCEA 1V47A 3MBIA 4DDUA 4W1QA 1LPSA 2WHPB 4ENSA 1GPYA 3GZ4A 1GKLA 3IOBA 4C3OB 3FOEC 3BRCA 5BOSB 6LDHA 5LNK6 4CTJA 3LQ2A 1T5IA 1VRCA 2FR1A 1VYTA 4FZ3A 2QRHA 2V7BA 4TV9A 4Z99A 3K4QA 2IJGX 3VR5A 4PXSA 1NVTA 4XEUA 4CMIB 3B12A 4G36A 3JALB 3L41A 4CF4A 3MTEA 3V7UA 1P5HA 3M6MD 1F6BA 2BHRA 4HT3B 1HXHA 2UZ0A 4YRTA 5ES4B 3CS3A 4G9GA 3BRWA 3H3JA 1N6NA 4F1WA 1DDIA 4JP2A 2VAPA 3WQQA 1LBQA 3T1NA 3MTQA 2XJ4A 3INRA 2PUDA 1PZHA 4HLUC 1OA1A 2B21A 2Q6KA 2D5BA 3C6BA 1H2YA 3JQDA 3M49A 1GFWA 2GCGA 4XWYA 1W7AA 3T7IA 1CP2A 1J2UA 1YR8A 3CLTD 3HA5A 3IPYA 3N2GB 3PHJA 3QA9A 3WHIA 5T57A 4G4GA 2FUG1 4UM9B 4U2KA 3AINA 3W7BA 1QGYA 3R8XA 4AY2A 2Q41A 4KDFA 4WLVA 3ONNA 3PBKA 4NESA 3KZVA 1ZHOA 1CBUA 5HJ2A 4CMCA 4N5DA 3SDSA 1Z56C 2O48X 3FOAA 4IIXA 4XCVA 1C9YA 1Z12A 5K3BA 2QMQA 4N3GA 1VFPA 4PLHA 3F0TA 3E27A 4W8GA 2ZYSA 5FL7A 5HEKA 3O2JA 5GJWC 1I1NA 2EQAA 4L0DA 4HQOA 2QLBA 4QASA 3ZDQA 4TSFA 4IZIA 4W99A 4II3A 2EARA 1FE8A 2BKXA 1I3LA 1N6PA 2Q07A 4NBUA 4OL9A 2GK6A 4FFBA 2H31A 1E0KA 4EI7A 1T2UA 3ZC3A 5FX2A 3T3PB 1MAUA 5ILQA 3L4BC 4J0DA 5L3QA 2D54A 3F7OA 1YR3A 4P3KA 4YRJA 4E5UA 5BUCA 3N2KB 3K16A 4MR9B 5L3VA 1SULA 5BN4B 1V9LA 4TSFD 1SA0B 1ZD3A 3HACA 2AJ8A 3MWGA 4RDHA 4QWWA 4HNHA 3P4YA 5B4UA 4QQFA 4Y6RA 2DFTA 3MUOA 4ID3A 2V7QA 4KXXA 3BDVA 4BGDA 2X3YA 3HKEA 3VTAA 3MUEA 3HVRA 3ZKWA 3CPJB 1N5RA 2XRFA 2AUTA 2V9CA 5TDHA 3TBHA 2BV3A 2HMVA 4KOEC 2XMZA 1BW9B 1K5DA 4XX0A 3DBIA 4XTCS 3TB6A 3FFWA 2FFQA 3TDKA 5J4HA 1UXJA 4ALNA 2QN6A 2GI4A 2REQA 2YINC 4W5QA 5DU2A 4OMUA 5I7AA 2E9SA 2J87A 3R5JA 3SQLA 1VPTA 2ZK7A 3GFQA 4B3CA 1GAEO 2BGNA 1RLJA 2FPXA 1JLSA 1T13A 2Q1XA 1ADGA 3HUFA 2OHHA 3VR2A 2O8FB 4QAQA 1KHHA 2MYNA 3SX4A 3TIGA 1L7QA 2VDWA 1T2VA 2GYVA 3ND8A 1NF3A 3LGSA 1XN1A 1U7XA 1VL8A 2IT1A 1WMAA 2VVTA 3D02A 5AKXA 5JT1A 1SB9A 5LOVF 1NBMD 1FTGA 2GZMA 3IV7A 5GM2A 3JWEA 3LFHA 1DEHA 2FR8C 3KQVA 4YAWA 1NKVA 4AJ1A 4EY3A 1BXRA 3S44A 4D3DA 1AKMA 1TIKA 2AJDA 2XOXA 2IUYA 3BXZA 2CXXA 5HILA 5K4AA 3TKYA 3WSTA 4DMFA 2J4CA 5EJ9A 4PG5A 4BB6A 4RKFA 3SCZA 3ABIA 5CJPA 3ABRB 3D59A 3SHQA 3O9VA 5JCOA 1RQ7A 3D3NA 1NW4A 3LT4A 1OXKB 1NQUA 5BO5A 1T2DA 1MEJA 5DEIA 5LA6F 4G25A 1OPXA 1K7XB 2DC1A 2ZBUA 3OY2A 5EHNA 4MVJF 5KJEA 3ZZ1A 1NG9A 3LL7A 4MWTA 3ZCTA 5LCXA 3WBBA 1K6XA 2WJWA 5BSVA 4P58A 2P41A 2B82A 3L1JA 5AHXA 3WK5A 1NP7A 4OLFA 1T6YA 3OC0A 2UUAB 5F23A 3O4HA 3S6JA 3WOHA 2WNHA 1JDBB 4WNAA 1OI7A 1G7TA 1FTSA 3HCAA 1DBRA 2ZWOA 3BMNB 3BUSA 3CLUD 1XVVA 3OC6A 4HGZA 1U0HC 5F98A 2OOSA 5FPQA 1K08A 5KYVA 1ZEJA 2WT8A 4X1KA 2BDEA 3IFSA 2I2AA 3K71B 1ZAYA 4K6OA 3LLVA 2KBEA 5E9AA 4MVJH 2BFBB 3PPIA 1BWRA 4JKOA 3RJZA 5CM8B 4CV1A 4OOEA 2ZW9A 4EW2A 2WVJA 5J1TB 4D92A 1SHKA 3AW9A 1MJ5A 4GXNA 1QK4A 3W9SA 4D4GA 2WLTA 3GJYA 4KDRA 4BMDA 3BH6A 1LSJA 2WSBA 4PO3X 1H94A 2JW5A 1RSZA 3L4JA 5EE5B 3FYUA 2HCRA 5DSTA 2UYQA 1G8SA 1DDOA 3O92A 1RXYA 4BNNA 3SF8B 2J9YB 3UOAB 4UMFA 3OZEA 5IF3A 4F46A 4A8JB 4KFUA 1R0ZA 1FYXA 4OBWA 1SU4A 2DWCA 2P6UA 1FJ2A 2R96A 3B7WA 3L77A 4QOIA 4TUYB 1FRNA 4WLUA 2BBSA 4YGYA 5ES3A 1EE1A 4G0NA 5AKYA 3DZCA 3LAWA 1NPYA 3ZD9A 5BPHA 2P90A 1GPLA 2RKWA 1PV4A 2FLWA 3AIIA 3BSSA 4M0LA 5IXJA 1JQKA 2WZCA 3Q7IA 4N0DA 1QV9A 4LZJA 3L04A 3O0TA 4BIMA 3IVXA 3V1KA 2O7QA 3GG9A 3PL1A 1R8YA 4UAVA 2IWHA 1D04A 2WTXA 4DDKA 2ATIA 4MNTA 1M54A 2BLLA 4FOOA 4D4IA 1M0EA 3TW0A 4BFUA 1L3BA 4BUZA 3KKQA 4L51A 1NMXA 5BOVA 1HEYA 2EIXA 3M5WA 4PU0A 2JLUA 1USKA 3DO6A 1ODIA 4UHDA 3U7RA 1E5XA 1KVQA 1UF9A 4YRFA 3A4YA 2ZTVA 3CLHA 3DZGA 1DBIA 3FUTA 3K15A 4PEVA 4UQPA 3MSXA 2K5UA 3ABZA 1RXIA 3UQYS 2R7MA 1CEXA 1V16A 2A9RA 2I67A 4Q19A 3U0BA 2Z3WA 1TVMA 1O0CA 1LWOA 1KOFA 1XE3A 1GRVA 4RZ3A 4DJDC 4WOBA 4JHXA 3BEOA 5F52A 3OPYA 4CI0B 1PFWA 2HYIC 3KKEA 2NT4A 3PKIA 1QHIA 3KHUA 3T5DA 1TYCA 1TRKA 1YB4A 1UBUS 2XDWA 2O2XA 3NBKA 3QKSA 3GVCA 1MJNA 1P1JA 3LY7A 1LVUA 4ZCPA 3KTFA 2KX7A 4RORA 1VP9A 2P35A 1EU1A 2QIOA 2R1UA 3CN9A 4UW9A 4XQCA 3F7NA 4FS3A 4AT1A 4BNDB 3M3DA 2VXCA 1A9XA 4QX6A 2JHCA 4LC9A 4DC1A 3O47A 2VQFB 2WHRA 4JS0A 1ZUNB 3LQ4A 4BVEA 3IDAA 4OXKA 1JBQA 2PO5A 1Z06A 4I1YA 3M6IA 5H9WA 3FWKA 2CJXA 1SD2A 2JIPA 2PD6A 4X8OA 2WSYB 1MB4A 3WGQA 2ZFUA 3DPIA 3W90A 3BBPA 4EGSA 4X60A 4IVRA 3HCPA 4MWDA 1FNSA 4AL4A 2BONA 3AI3A 4D5GA 1RQLA 2W6OA 2J3IA 2MSWA 2SCUB 3QY9A 5FB3A 3VNVA 3F6RA 1PEYA 1Q20A 2R7KA 1AUOA 2GEUA 2Q4DA 4JSYA 4XGKA 5FA6A 5KDLA 4CQMD 4I36A 3F5FA 1SVOA 3LH5A 4D9HA 4RM3A 2A1UB 2B6HA 1NLUA 3UWPA 3GT4A 4AMUA 4JI7B 2CSXA 5DN6A 1PYOA 4BFVA 2ACVA 2PAAA 5EL0A 5F33A 2IOFK 2ZI7A 2GGSA 4WCVA 3UFXB 3NAMA 4Q9KA 2MYPA 2DHEA 4BDSA 5HYVA 4X6YA 3Q5GA 3SLRA 2BR3A