3RH0A

Corynebacterium glutamicum mycothiol/mycoredoxin1-dependent arsenate reductase cg_arsc2
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
128
structure length
127
Chain Sequence
MKSVLFVVGNGGKSQMAAALAQKYASDSVEIHSAGTKPAQGLNQLSVESIAEVGADMSQGIPKAIDPELLRTVDRVVILGDDAQVDMPESAQGALERWSIEEPDAQGMERMRIVRDQIDNRVQALLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARSENATE REDUCTASE
publication title Corynebacterium glutamicum survives arsenic stress with arsenate reductases coupled to two distinct redox mechanisms
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Oxidoreductase
total genus 41
structure length 127
sequence length 128
chains with identical sequence B
ec nomenclature ec 2.8.4.2: Arsenate-mycothiol transferase.
pdb deposition date 2011-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rh0A00
1MB3A 3KKEA 4MS3A 3JTEA 1QO0A 1DCMA 1LJLA 5FBKA 2YHAA 1NXSA 1DZ3A 5TPWB 3DZDA 1EHCA 1FFGA 4MS4B 3C3MA 3DGEC 2FN9A 2PUGA 5ED4A 2WWVD 5CNKA 3W9SA 2W42A 1URPA 4MR7B 3DLHA 4N41A 5EWJB 1ISRA 3QEMB 4MQFB 4N0QA 2JVIA 4Z9BA 1C4WA 1RZRD 4F06A 1Z17A 3K4HA 2QU7A 3SAJA 3H5LA 1Z26A 1JFTA 4NCAA 3MIZA 1SXGA 1U0SY 1YK1A 3OM1A 2PE5A 2E4YA 1JWLA 1PNRA 3MYYA 4MRMA 4MR9B 1E6MA 4DQDA 2R4QA 4LDAA 3RQIA 3H1EA 4G0XA 5HQJA 4G0MA 3ROTA 3JPYA 3C6QA 4JASB 4XARA 3RH0A 3H5IA 3EODA 4LE2A 5KQMA 3CNBA 2P4UA 5JNRA 2L2QA 2F8SA 3N8IA 1QP4A 3O2SB 2OQRA 1PHRA 3QEKA 3QLUC 4D6XA 4FB4A 1U2QA 3H75A 2PUAA 1DBQA 4E7PA 4KREA 1ZHHA 4WXEA 2A9PA 3GBVA 4KK4A 4XXHA 3H1GA 5C5EA 1KRWA 5GOTA 4PE5B 1EWKA 1TJYA 3HSYA 1R8JA 5T3YA 1Z15A 3EAFA 2A9OA 3E3MA 1DC7A 3SNKA 1PUXA 1USKA 2PJUA 2IPNA 2FQWA 4TLLB 1JYEA 4MLDA 4OLBA 1ABEA 2MYTA 5EWMB 3LMKA 2FSPA 2RGYA 4RSMA 5BRAA 3Q15C 3OLYA 1CEYA 3H5OA 1EFAA 2CHEA 4O1IA 4RY0A 3JVDA 1SD5A 5IEJA 4P98A 2LIVA 4RWEA 1VPWA 1TVMA 1EAYA 5TQ2A 1D1PA 3HJFA 1P6UA 4S05A 2GBPA 1EWVA 3IP6A 3IP7A 3Q7TA 1JDPA 5TE9A 4NQRA 4H60A 4WWHA 3DLBA 1YTUA 1DJMA 2F8TA 2VK2A 3BILA 3D8UA 3FFTA 2WMYA 2QR3A 1A0OA 4HNSA 1W25A 4D74A 2FEPA 4JA2A 4RXMA 1A2OA 5EWLA 3ILYA 5IUJC 2M1ZA 4L85A 3RVPA 2PUCA 3D02A 4IF4A 2FLWA 5IULC 4XFKA 4MS1B 4PEVA 3UUGA 1ZGGA 4KFCA 1M2FA 1VKRA 3IPCA 3T38A 4HYEA 3MA0A 4RZSA 4KRFA 3KLNA 1SXHA 3CG0A 2FEWB 2PKXA 5B3JA 3T95A 2FTKE 5DGCA 8ABPA 3DGFC 2MYUA 4RK4A 4XLTA 4EGSA 4OTZA 1RPJA 2H3HA 4RDCA 4GPAA 4YGXB 1DP4A 1DRKA 4JB2A 1ZDMA 4Z4HA 2BGGA 1VLZA 3GYBA 2QW1A 1Y1LA 5TPZD 3A10A 4DN6A 2MSWA 3QK7A 4W5RA 2R47A 3GT7A 4MAAA 3O75A 3HO1A 1U04A 2RDMA 1KGSA 5B3JC 1RXIA 1NATA 3CG4A 2ZAYA 3UK0A 3CZCA 2E4VA 1T34A 3LUGA 3QELB 2FN8A 4MLCA 1NXWA 4D6YA 1U2PA 3JVIA 3K9CA 1P8AA 4IGAA 3NHMA 3LKBA 3I42A 3NNNA 4EY3A 1FSPA 1E6KA 3OLVA 5KI6A 2J48A 1Z16A 1DBPA 1KRXA 5GQSA 2HSGA 2AYZA 3O1IC 3BRQA 3H5WA 3LKVA 3QX8A 4KQCA 3Q41A 1XHFA 2MYNA 5T7BA 1YVUA 2YHBA 3H5VA 2JRLA 3KJXA 2HJ9A 3OO0A 5I4CA 1NXPA 4HNRA 1BAPA 3M6MD 4NICA 1Z2EA 3KSMA 3N53A 3O1HB 3Q7RA 1KMIY 5ABPA 3FGZA 5TQ0A 2MSLA 4Z4GA 5IEBA 1RZRA 1DCKA 4Q6BA 6ABPA 3T8YA 3A0RB 3RVQA 3FDFA 3RVJA 4TMYA 3CFYA 1PNTA 3GBPA 6CHYA 1QPZA 2RJOA 1APBA 3G1WA 2N9UA 3MMNA 3JY6A 2FMHA 5JS2A 2IYNA 1DBWA 1FFWA 4LDZA 1L5ZA 3G85A 4IMJB 4G0YA 2AYXA 2RJNA 3A0UA 3CZ5A 3OQMA 4ZPJA 1J56A 1XWWA 3DBIA 3MM4A 5FBHA 5FWXB 4NCBA 1IIBA 1BDIA 3LFTA 3CRNA 2XDYA 4ETNA 3GV0A 1MAVA 3LTEA 3E61A 1JLKA 1MB0A 1EWTA 1LBHA 2E4WA 3M9WA 2VUIB 3L49A 4MS3B 4JAVC 1TMYA 2QZJA 4Z4FA 5DCLA 4LE0A 1NXVA 5JNWA 1QQBA 4EVSA 1ZN2A 5HSGA 3OQNA 1NTRA 2TMYA 1B00A 5JS1A 1MVOA 5KQLA 3UKJA 1JBEA 4W5NA 4PICA 5IC5A 5E3JA 5TQJA 4IILA 4Q6WA 3BRSA 2A9RA 1OXBB 1ABFA 4L4UA 1YMVA 3N6VA 4RV5A 4OBBA 3N0XA 5BRJA 3EJWA 4PYRA 9ABPA 4IRXA 1TM2A 4MQEA 3S99A 3N0WA 4TN5A 3HXMA 3KHTA 2WY2D 3KYJB 2JB9A 3RVOA 1L5YA 3SQNA 1C0EA 4Y9TA 3URMA 4O1HA 3FMVA 5CHYA 3I5AA 3KS9A 4MRMB 1JFSA 2E4XA 1BVHA 3RVRA 5DLEA 1ZH2A 4E7OA 4ZMRA 1A04A 2GWRA 4RY9A 1ZITA 3CHYA 3TD9A 3QLVA 4QYMA 3HS3A 1SRRA 4ETMA 3LUFA 3I45A 3BREA 4QPJC 1PEAA 3M9XA 1Z25A 4XASA 5JNSA 2HQRA 1AB5A 4RXTA 3HVRA 3VNAA 4TLMB 1JHZA 2PUEA 5KQGA 2ID9A 2M98A 4OLAA 2PLNA 4WUTA 2KYRA 1D1QA 1FQWA 2QV0A 3KCNA 5CNJA 4EVQA 2E4ZA 2WJWA 2ZWMA 1LBIA 3KYIB 3QLVC 4LE1A 1JX6A 1YIOA 1Z12A 3F7NA 1K68A 2CWDA 3VNBA 5JNVA 3HDGA 2JVJA 4EYQA 1NXOA 1SXIA 2P9HA 2PL1A 3N0RA 4G0QA 3RVNA 1CYEA 5TPZA 3LUDA 3QX9A 2LP4Y 2FKAA 1MIHA 3GL9A 4MQEB 4RKRA 2Q5CA 5TPWA 3O2QB 5TQ2B 1YK0A 3F73A 4ML3A 1CHNA 2PUBA 2WB4A 2JVKA 4MS4A 4LZLA 2IPLA 4EYGA 1P6QA 2MYPA 3H1FA 4MR7A 4KNYA 5EWJA 1RNLA 2GI4A 2QSJA 3QEMA 4MQFA 1U8TA 3GWGA 5JNUA 3LUKA 4YO7A 7ABPA 1HEYA 4FE4A 3IPAA 3SY8A 4YR7A 3CLKA 4RK1A 1D2AA 2CD7A 3NBMA 5EWLB 2HQBA 3SG0A 3NHZA 4F12A 1F51E 2MSKA 2FLKA 2L18A 4Z4EA 3H6HA 3OLXA 2E4UA 4MYRA 4WT7A 4S04A 1ZVVA 3O2JA 2R25B 5HM6A 2FMFA 1W9HA 4MR9A 4Z4IA 3RVSA 3LUJA 2JK1A 5JNTA 4KPYA 2B1JA 1JH9A 1Z2DA 1NY5A 4B09A 2NZUG 5KQPA 1UDRA 4YV7A 4YP9A 1M5TA 2GX6A 3RVLA 3LOPA 3OM0A 2NUBA 2X7XA 4KMRA 1BDHA 1QO0D 2GKGA 3KG2A 1JL3A 4PZ0A 3Q9SA 4RKQA 2B4AA 2FXIA 1I3CA 1PEYA 4ZMSA 1JYFA 1D4ZA 2FQXA 3FFWA 2IPAB 1ZAYA 4RK7A 4KZKA 4F3TA 1TLFA 3HCWA 3A3KA 2QXYA 2H0AA 1ZY2A 2PL9A 2ID7A 3JPWA 4QICA 5EWMA 5IX8A 3BBLA 5BR1A 2FVYA 3C3WA 3IDOA 4KK3A 1DRJA 1LJUA 1ZGZA 2QVGA 4MR8A 4N47A 5IUKC 1M2EA 1QNLA 1YS6A 1K66A 3F6CA 3QLUA 2WRZA 4HNQA 4RK0A 2OENG 1F4VA 3LUHA 2V0NA 3OLWA 2PMCA 2HPHA 1E2BA 4Z0NA 4WXMA 1BDJA 2FMIA 4W5OA 4GNRA 4FE7A 4YS6A 3OMXA 3QLTA 3TO5A 1DC8A 4RY8A 5CNMA 4YWHA 1QP0A 4OATA 5DKFA 5C5CA 3GA5A 1LK0A 2R48A 2L17A 2NT3A 4RS3A 4YCSA 1GCAA 2NT4A 1NXTA 5CNIA 2IDMA 4LX8A 3CKMA 4N03A 4ZYLA 1GCGA 3CTPA 4MS1A 5TQ0B 4EVRA 4Q7EA 1RXEA 3T6KA 2FEKA 5BQ3A 2PAFA 1DG9A 4OG2A 3JS5A 4Z9AA 1OXKB 2O20A 4M88A 2CHFA 4ETIA 5HKOA 3EGCA 4KVFA 4XAQA 3KTOA 4RK6A 4UHKA 1ZESA 1Z18A 4RK5A 3OQOA 1YMUA 4EUKA 5KC8A 4WZZA 3OMWA 2LPMA 3HUTA 4G0ZA 4G97A 3TB6A 1AB6A 5KC9A 4G0OA 3EDCA 3FFXA 2VYCA 3IP5A 4MR8B 2NZVG 3N75A 4JB0A 3OLZA 4G0PA 4P1ZA 4MPTA 2PUFA 2JBAA 4Z99A 3NNDA 3ILHA 1E6LA 1QKKA 1P2FA 4H3HB 2JCGA 3EQZA 3OO1A 3EQ2A 3CS3A 4N0PA 1XHEA 5DTEA 3EULA 3TMYA 1S8NA 2IOYA 3LUCA 1FFSA 1QQAA 1ZH4A 3QELA 1NXXA 3GRCA 3HEBA 4MGEA 3MF4A 4YLEA 5FWYA 3HK2A 4KV7A 3I09A 1Z13A 1D5WA 4NV3A 2L19A 4F11A 2LUOA 3HV2A 2I6FA 1USIA 2A9QA 4DADA 1QMPA 4W5TA 5PNTA 1GLGA 1GUBA 2VUHB 5IUNC 3O74A 1GUDA 3B2NA 1JFVA 4F8JA 4ZJPA 4W5QA 2IKSA 3C3KA 1JDNA 3HZHA 3P9YA 3KLOA 3SM9A 4RU1A 2HQOA 2WJAA 3CU5A 1ISSA 3MQ4A 3NNSA 5D2CA 3Q7SA 4G86A 3HM9A 4EYOA 1WETA 3O21A 5IBQA 4N76A 3LUAA 2JBAB 4Z4CA 4IMIB 3RVMA 2FMKA 1JF8A 4YRZA 3L6UA 4UHJA 4EYKA 3HUUA 3TX6A 2DRIA 3ROFA 1USGA 2QVCA 2FQYA 4QYWA 1DCFA 3HDVA 3H6GA 5FWXA 4O5AA 2LBPA 3O1JC 3H5TA 3R0JA 5F64A 1VRVA 3IP9A 4H3KB 2FW0A 3C97A 3F6PA 1BA2A 4KQ9A 5KWSA 5FWYB 2PUDA 1H9CA 4JP1A 3RVKA 4JOQA 1M5UA 4RXUA 1QP7A 1YS7A 4LRQA 2IPMA 4CBVA
chains in the Genus database with same CATH superfamily
1MB3A 4MS3A 3S2SA 2HRQA 5C9ZA 2OA0A 3I12A 4DRXB 3QOWA 3DHEA 1Z73A 2XRFA 4BFLA 3GLFE 3PQ6A 3BMCA 2IV7A 2JJYA 1JLSA 1XCLA 3A9SA 5B6JA 4X62B 1U3GA 3EXFB 4QWMA 3HCDA 1O57A 1SMKA 1II9A 2MINA 5JUWA 3EA4A 1VYUA 2OZLB 1QK4A 5D8DA 2FSSA 1EBBA 4JB3A 4E3ZA 1RZRD 1EIZA 1RKVA 3ZK8A 3OJ0A 2BTQB 2K2QB 2TMDA 2XJ9A 3PC7A 4Y6OA 1JBQA 5HF6A 3BDAA 2CE7A 3TBKA 4HDRB 3IVMA 1N2IA 1TT5A 4ESHA 4TL8A 1J6UA 3A2KA 2G0TA 4H0CA 1OZHA 4NLLA 1P1HA 4RJLA 5JCOC 4GI2A 1NDQA 1FUYB 3TIXB 3WO1A 4JEIA 1JMVA 3E22B 2NZYA 4OMUA 3ELYA 1SN7A 3KR0A 5AXBA 2ZE6A 5EHGA 1OFIA 3JPYA 4TV8A 3TXXA 5BYAA 1QIKA 3OPXA 1AGYA 3JQ6A 2I4LA 3RNLA 4XWAA 3NOQA 2EJTA 3K72B 1VPTA 1G7TA 1OFTA 1QHFA 1CV2A 1VBNA 5T5QA 3A4MA 2WZQA 4IICA 3II6X 4KREA 3I6BA 5EZSA 3QKUA 1QIEA 2WK1A 4FOSA 5D5PA 1N0IA 2FJ0A 2RKBA 2QGZA 5TB5A 1R8JA 3ZDYB 4LUCA 2NXNA 4GQIA 2CKMA 1N2CE 3B3GA 3K1TA 5U4XA 3BXOA 5IABA 5JHGB 5FAXA 3VR2D 5M7EA 3AILA 5T6BA 1R0BA 1RWBA 4MYHA 4IXNA 4RF3A 1PSZA 1PZHA 1Y1RA 1YA4A 1R50A 1V3TA 3DE3X 5BRAA 4R7ZA 1QHHA 3A1NA 3A9CA 4G8DA 2ZJ1A 4Q3BA 1NSYA 1WXFA 1CY4A 2R6HA 4KCGA 3RJ9A 4XOIA 2QE6A 2C8VA 3H9UA 4Q1DA 5AI6A 3V8VA 4ZMBA 4XYMA 3AZQA 1B15A 3BULA 3I1YA 1JJ7A 3TUIC 3WP0A 1I2CA 1CVRA 4EYSA 1JIQA 4F84A 2WZBA 2DVMA 5AJHA 4GLBA 4TMWA 1JDPA 4UXHA 1LK5A 1WP9A 1NIPA 1DJMA 4G01B 1VE1A 4E30A 3EPJA 5CFMA 1I0IA 2FMUA 4BRWA 3B1KA 4NONA 1BGXT 4P3KA 4PGGA 3NUQA 4BU1A 1U1EA 2BGNA 4A7PA 1J5PA 1G8FA 5FEMA 2YC2C 2P8SA 4M22A 5TT1A 3FZEA 5ALVA 4I6EA 4QVIA 3BAFA 5LP6F 1V11B 3IEXA 2BMWA 3PHLA 3AEXA 1RHKA 1N2OA 1UXHA 4IV5A 2RCYA 2NUTA 2HMVA 4P4SB 2O48X 1I7PA 5FOSA 4FSHA 1A72A 4KGVA 2QUJA 3PSHA 2TMGA 1LK7A 1CIVA 4N39A 3AL0C 3FKSD 2AI1A 3K0SA 3AR3A 1W88A 1XD2B 1Q7TA 1QF9A 3SR0A 4BX2A 3WXMA 5LBUA 3HCRA 4EW6A 4EG3A 4HUQA 4KKVA 1FRNA 1ZXLA 4M6WA 4OTZA 5DLQC 5HMMA 5BQPA 3RIEA 1UPXA 3SJZA 1AQLA 4DC0A 4CLXA 2E9SA 2DERA 4X71A 5LMNB 3UGJA 2ODWA 5D87A 4CMKA 1PT9A 1ZC3A 1G66A 2VNKA 3E9NA 2BDTA 1MC5A 5B12A 4MGKR 4QARA 2R47A 2G6TA 2F9FA 4A5SA 5BY2A 3NH6A 2NV6A 3C5EA 5ADVA 4BB0A 5LLSA 1Z4LA 4TSFD 3FWYA 4UCXA 2B1GA 2LDXA 5DNWA 3VVMA 1DEHA 1H0RA 3GEHA 4M1WA 3PR1A 5A2GA 4WH0A 4EUSA 2WEKA 4FUQA 1E0AA 3GZNA 3SVTA 4RCYA 2HSJA 2H2AA 4PLGA 3W2FA 13PKA 2GB4A 3IBYA 2AZTA 5TT0A 3FWZA 2EAUA 4D6YA 2HIHA 3G9QA 5FHRA 4OB8A 5L3RA 4GFDA 5CR9A 5E6UA 1GG8A 3WE7A 1F48A 3FOWA 1CLEA 3M34A 4BWFB 3ME5A 4GBGA 4LZJA 4JBYA 3S1LA 1EBUA 1NN5A 2Y0CA 2PT6A 2X2OA 3QJ5A 1VHWA 4Y2QA 5FIUA 2QV7A 4PYOA 3T5MA 1KRXA 4IIVA 2VH2A 1M1XB 1FJXA 1AGRA 4Q1AA 1GR0A 1Z4QA 3FUTA 5BP7A 4R0NA 3CONA 3I8SA 2F17A 3WX0A 2C4HA 3QXSA 1I10A 4BLSA 3R3JA 1PD0A 4PZZA 4OD0A 3TRHA 1XNJA 4EGFA 3GB9A 4YRAA 1FP4B 2I66A 2ZWOA 4YT4A 5SY4A 4YMLA 4E31A 4TV9F 4MVYA 4XLLA 4OGFA 3FH0A 2DJ5A 2XVXA 3OOYA 3MWEA 3K70D 3U3RA 4HLDA 4D3DA 5B55A 1TLTA 1U81A 4YDSA 3B6KA 2ARKA 3KETA 1IOLA 4WNCA 2IUUA 2FMHA 2ZEJA 1HM5A 2EG5A 3HUFA 3OCZA 1L5ZA 3CLUD 3GYGA 1JQAA 3EGDA 1E1CB 1XL0A 1NYTA 5FPQA 4TKZA 1Z5VA 1Z2NX 2QS9A 1CB7A 3DBIA 1XF9A 3S8YA 3R7WA 1C7QA 1P1RA 1YCFA 3QOFA 3ZCVA 1DBSA 3C43A 1Z2CA 5FUVA 2EX0A 1VKHA 2YJ6A 3W78A 2OQVA 3EZ9A 4ETNA 1MAVA 3BTVA 1QC5A 3QVOA 3KYBA 4G0NA 2FMTA 3RC1A 4AD8A 1DJPA 1PJSA 1T3GA 1W0KA 1CUIA 4HN4B 1PTJA 2PD6A 1VE6A 5EXPA 4G9BA 4BLRA 2W2QA 3QKSA 3E3AA 2WIBA 2YYAA 1KMHA 3FPEA 4YAWA 2C0QA 5KTKA 1ND5A 3OQBA 1II8B 2I2BA 2RGWA 4EB8A 3AT1A 2JH3A 5EVJA 1E7SA 1Y3HA 1VSBA 4KQJA 3RYIA 2R8XA 1MT3A 4M0UA 5E0KB 4C7OA 5G2OA 1OKKA 2AL7A 2IY9A 1N0UA 4YP6A 4OQEA 1H4QA 3ABQB 2W2PA 1OXBB 4YRNA 3LKDA 2ZYHA 2EJUA 1ISJA 3OURA 1CFZA 1E1RD 1MX1A 1NBMA 1YUMA 3N6VA 4I3FA 4W63A 3RRNA 1SKMA 3N8DA 3DP7A 5B2EA 4JZKA 3SJ7A 2GQ0A 4C7VA 4TN5A 2WU3A 1QAQA 4LWQA 1DAOA 3DAOA 4MPRA 1PTJC 4Z8YA 3ROMA 3RS0A 3UYLA 3DULA 5CYOA 2EJCA 3SX4A 2H4HA 5A6SB 1EHYA 2OZKA 4YRLA 4TTVA 5FOTA 4E12A 2CZQA 2K87A 2RC5A 3URKA 1V9SA 4EITA 4V1CB 1I7NA 3DDZX 4D82A 3A58B 4X85A 2IUTA 2JHFA 3B2EA 2YNMA 1H05A 3A9WA 1SAYA 1NUHA 2HCJB 4FGLA 4HFMA 3DONA 4PTZA 4JLMA 1PS0A 1RWWA 3PX3A 3QBJA 3EG5A 2OFOA 3R9XB 1BQ3A 1QRRA 4OMDA 4Q1VA 1Y3IA 1PV2A 3T7JA 2HSZA 1Y4DE 4ABYA 4BN4A 4XASA 1ZVKA 3VNSA 3Q3CA 1EP1B 2QQ0A 4LYGA 2R60A 3Q12A 2I7TA 1HNNA 4MHOA 4Q37A 4Z3KA 4EPYA 4ZEXA 4BEWA 4B3GA 2PUEA 3KTAA 4GKAA 5DT2A 5JV5A 4TS9A 4FBMA 1RXWA 4OLAA 2JFUA 1N9GA 1V47A 3FPFA 2RB5A 3NT2A 2YNMC 1M1NA 4R8KA 1D1QA 1G8HA 1NVFA 1PQ4A 1VJ1A 1MJFA 3PQ3A 2ET6A 2GERA 2II6A 1IXYA 3ABSB 1Z82A 3H5RA 3G8BA 3GOHA 4UAGA 4HEA6 3JYHA 4IUCS 4EYQA 5F21A 5JJLA 5KNCD 4LOLA 3LGAA 3PUKA 2P6OA 3KBOA 2P2YA 1IM2A 1R6BX 4UU8A 4A36A 1LQTA 4PAGA 4PZUA 5J4KA 2XMSA 2UYGA 4F2GA 4IIFA 3DDOA 4LCBA 3SDBA 4ASUD 4BLQA 3K1JA 2IYSA 1VGRA 2BFEB 4UQLA 2QR2A 5JAMA 1RWVA 1V37A 1KJWA 4HB0A 2PYDA 1IHPA 1OSNA 3BICA 3JAWB 3HXLA 4DV4B 4BLTA 4E0BA 3GPBA 5BSTA 4FE4A 3DMFA 4RF4A 5DLDA 1JZSA 3VNUA 1XPJA 1BU8A 2Q0HA 4RAQA 4WXHA 5BYKA 1DL5A 3LS2A 1QONA 1QH9A 2XMBA 4RMJA 1BIFA 2MSKA 5AIAA 2AG8A 2A4MA 2FG7C 2H08A 5EIAA 5EQTA 2VPPA 1X1AA 3ZDBA 3JQ7A 1JTEA 2CL5A 2ZRCA 1VHJA 3NGXA 1MTZA 5C1PA 2F3RA 3EXAA 3R9IA 4NZYA 3SHTA 1GQQA 2HM7A 5DWQA 4DTCA 1HNZB 1GPKA 3BD7A 3OZIA 3STTA 1ZGJA 3DWGA 4DQLA 4KR9A 3LUJA 3TOXA 1NNEA 5B7QA 3H2SA 1WKVA 4C9BA 4WK4B 4JBHA 3MSCA 1MX9A 3K3PA 1WPQA 3TZLA 4GMDA 4B09A 1DXOA 1N7GA 3COVA 4NYJQ 2W6JA 1M5TA 2PV0A 3W90A 5LL6P 1PQYA 1GN9A 2PLWA 1P80A 4FYJA 5IG2A 3PFCA 1QIGA 2Q28A 2Q4OA 3ACCA 4PZ0A 4QHYA 1H2YA 2Y4NA 3TLGB 2NU7A 4C7BA 2YIDA 5IPFA 1D6NA 4KSYA 1Y7HA 2XGOA 4M2LA 2ONYA 4PYMA 1M34A 4JCCA 2ONZA 1UR5A 2P41A 1QGUA 3DD1A 3SHQA 3WSVA 3JPWA 4Q3NA 5K8IA 3ON5A 2HY7A 5LQUA 1NW4A 3M6LA 3VHQA 2IS2A 5CX1A 1ZGZA 4M0DA 4RTJA 1EM8A 1EVZA 3VR4A 4MMXB 3NWPA 1F38A 1SHTX 1F1BA 3CMCO 1SZCA 2IYWA 3RS3A 1SBTA 2AEFA 4PGHA 1NUUA 3SZOA 1V3UA 1D1SA 1AKRA 1K06A 1QHEA 3LUHA 4HQNA 5DTJA 1E9DA 4D4LA 3OLWA 4EB6A 5HZKA 3TZQA 3OE5A 1R5OA 2NXEA 1ZOPA 3CW2A 2YICA 4GNRA 4JT9A 1I2BA 2GPAA 3DPUA 3KYDB 1MNAA 4NWIA 3M9LA 5K09A 4ITUA 4MQ4A 5DKFA 2BJHA 2ZI6A 1I5EA 5IDWA 1YR7A 5KSZA 1YQTA 3QVGA 5SYAA 4AICA 1HE1C 1REQA 5JZVA 1U3TA 2VZ8A 3IESA 3OZWA 4ISBA 1F7UA 2LCQA 3ZHTA 3FHTA 1OR8A 5D3MA 2QRHA 4M1YA 4RFSB 5IAAA 4DUGA 1TPZA 1CD5A 1C3JA 3UQZA 1ZM2A 2Q29A 3T7KA 1ZD9A 3FFAA 4CG0A 2J3HA 1MG5A 2W98A 3BSWA 5TQVA 3S68A 2FEKA 1G20B 3C87A 2HWUA 4LRYA 4IUBS 4PYLA 2IIQA 3ND5A 4PHGA 2AN3A 5AVXA 1LDGA 2HA2A 2NN3C 4YHHB 3EVCA 3IPLA 1BS9A 3GG9A 4J7AA 3ZTYA 1XZ8A 2Z98A 1E4EB 2WUDA 3BCUA 3QFTA 3DAHA 3UIEA 1Y33E 4NDNE 3USZA 4GMHA 3TSZA 2O7RA 1NPTO 2C2WA 1NW7A 3MW8A 4FFWA 3VZBA 4Y2RA 4C0JA 1CNFA 1N25A 2PGLA 2NZVG 3PKJA 4GECA 3PNSA 4EMSA 1DI0A 3L1JA 3ONWA 3TRJA 3TL6A 3C3EA 1RTKA 2PUFA 4Z99A 4MWZA 4QOEA 2GEKA 2X40A 4UU0A 1DRWA 2IHZA 4C7MA 1P0CA 4DLKA 5AR1A 3K8OE 3A1TA 1Z07A 3W5AA 2WOJA 1OHHA 4OV6B 4BMXA 5JXGA 2WP8J 3R23A 5LOVB 1FFXA 1RCTE 1S8NA 3EWIA 2UAGA 2CNBA 5TMEA 4OHOA 3I1FA 3HEBA 5F2EA 3ZE0B 2GYWA 3U09A 1TADA 3I52A 1K89A 2HH9A 5HILA 5LUAA 3A4IA 4KV7A 4M0FA 4TTJA 5CB8A 4EI2A 3IMFA 1ZJ5A 2B98A 2OV4A 4NV3A 1I7LA 4UJ3A 4C0HA 1NIJA 1DXQA 4LFCB 4EG4A 4G0WA 1OCEA 1XVLA 2GM3A 5FL7D 1P5ZB 3NYRA 4R41A 4RVOA 5CLGA 5ITVA 4HYYA 4IF6A 3N7AA 1P1CA 3AUSA 1OASA 1T0PA 2GASA 3E3OA 2OO3A 3O74A 4ZT5A 3V34A 3D7NA 2HYDA 3P9YA 1EFPB 2QU8A 3FDZA 5IJ0B 5CTJA 1C5KA 2HQOA 1H4SA 4C0XA 1ECFA 4BLOA 4IIJF 3X1MA 2PWZA 3ZJYA 4RJJA 4HG2A 5J4LA 5GONA 3V00A 3SEZA 2A0WA 2EJWA 2Q3MA 1ODIA 1DTEA 1JPNA 4A8HA 1WETA 2ZANA 2C4TA 1OX6A 4EI9A 1YJCA 3LUAA 4BVKA 4TRMA 2EQBA 2I4MA 2DFPA 2D74A 2I7CA 4UHJA 5IDXA 2PG3A 3DV2A 4OPMA 4D26A 1NBEA 1B8PA 3I6MA 1BTOA 2H2HA 2JCBA 4AL4A 3D8RA 1XTPA 3EVFA 1G63A 1V6CA 3AP3A 1O9GA 4QVKA 1P7ZA 1FP1D 2WMDA 3HDVA 2XI4A 3LQRA 1NQTA 1M67A 1W48A 5FWXA 2QN9A 1AMUA 3VZRA 3I2FA 5LN1A 2J41A 1VRVA 3E8XA 3O5AA 5I48A 5KYUA 2C9BA 2X15A 5EHIA 1WHSA 1Z2OX 4EZBA 3OJEA 5ADWA 2JIDA 2X13A 1WDWB 4J1NA 3KKEA 4OQ4A 4B2LA 2I4IA 1OB5A 1K6MA 4JI1B 3L6RA 5BVGA 2IWRA 1ONNA 2BMVA 4IJ5A 4LS3A 3WBBA 4KR2A 3FE2A 4MVJH 1Z83A 4IZ6A 1DAFA 4FOOA 2J7PD 2PX8A 2VATA 4OQLA 5AUQA 3JAKB 1NQVA 1YRHA 3Q8MA 4AKSA 3KAQA 4G8BA 2W83A 3GLFA 1YFJA 1QYWA 1SOMA 3OP4A 5SICE 1C4WA 3KDPA 3TR0A 4N6GA 1ZMOA 3LL4A 1JLRA 2I7DA 4J16A 5JANA 4YVFA 3GLIB 1KDYA 5E9WA 4R2HA 1DE0A 1E0KA 4AUMA 2J5KA 5AUPB 2HK7A 1P0IA 2HDOA 1FX0B 4H4EA 1TU0A 4CIBA 1YZGA 4R69A 2PZAA 1L5HA 2J45A 4MRMA 2CNKA 1KZ1A 4Q1FA 3ZY3A 4DQDA 2P65A 2NMVA 3AGPA 1P61B 4M8NE 1GA4A 4D46A 2VA8A 2X5XA 3LAWA 4JASB 3SS7X 3RH0A 1G291 1PQUA 3JD4A 2P2LA 3K92A 3L1KA 4YREA 1KMQA 2YWEA 4XR9A 4ERNA 3E7XA 1S8AA 5EIBC 5LXTB 3ZNOA 3KB1A 1GL3A 3IHKA 2AOTB 4BPBA 2C9DA 4FFSA 5JASA 3SICE 2A1UA 1JI3A 2B5VA 5T3YA 4FLMA 3PEWA 2JF0A 3AUAA 3THYA 2Q45A 3OX4A 2CC2A 2NPIA 3NU1A 1GG5A 4HWTA 3V3KA 5A62A 1NF8A 4K81B 4M7RA 2M2IA 5J1TB 1NZFA 4BB9A 2VTEA 3O8CA 1GAWA 1QV7A 3V8NA 3FYUB 1Z38A 1N2CA 1DTSA 1RYDA 1X1RA 1IOVA 1YJXA 3ZH2A 2HJVA 3H5OA 4FN4A 1PL7A 3Q6IA 4QGAA 4NS4A 2VP6A 4PVCA 1GU1A 3BERA 4WLOA 4E6PA 2CHUA 5K03A 1ID8A 1ZR4A 3JVDA 4GZ6A 5JD3A 4KXWA 4ZAGA 2V3CC 3K9WA 4ZJYA 3NPAA 3KWFA 5I9TA 4EHNA 1EAYA 2EV9A 4NOJA 4ADSG 1HLFA 2VDQB 1KDZA 2NPFA 1NHWA 3ORRA 3E9RA 4HB4A 4O4LA 5EIHA 2QJTA 3D3JA 4M0LA 4WWHA 1CF4A 2REQB 3OE7A 2DAPA 1G21E 2H48A 2O3JA 1DQRA 2IUEA 2WMYA 1PJ3A 1V7CA 2Y1XA 2VP4A 2VS1A 3BXXA 3KWMA 3M1AA 4J1TC 4KXXA 2DUMA 4R98A 4KGDA 1JHDA 4ARAA 1H6CA 2RGDA 4X1KB 1SOAA 3JR7A 3ZHZA 3Q0TA 4F1WA 3INRA 4UVDA 4V24A 2P9FA 2JIBA 4FK8A 4F45A 1Z3CA 4RNCA 5GPBA 3SKYA 1M2FA 3PDUA 3RBXA 1W59A 4DLUA 1ZONA 1V7ZA 5H83A 4KO2S 4JLWA 5KIAA 4FFOA 1GNTA 4HQFA 1O0CA 3OEYA 4LF5B 3A9VA 3L0DA 4RFVA 2FPKA 4MKIA 4GR5A 4Y2XA 1SCUA 1NF2A 4RK4A 2XQVA 3MFQA 3CNLA 3UOAB 4QWWA 4FYYA 5AJUA 5IJXA 3TI7A 5DNEA 2VXYA 1FVXA 4YI3A 3F71A 5JXJA 1LV7A 3DFZA 3EF0A 2PT5A 3K20A 4DYDA 3QK7A 1C81A 1UBJS 1QZXA 5HW0A 5IJAA 1YRWA 2UYOA 3IX7A 5DBFA 4H18A 3TTVA 3O3MB 3ZIAD 2RDMA 4QUBA 3LT4A 1P2UA 2BH2A 2X3YA 4MJ7A 1EWQA 2P2CA 4DDWA 2NYVA 1RQNA 2HPVA 3F67A 1AS0A 2XZDA 3SLKA 3AKYA 3O8OB 4BO0A 4CT5A 3VX4A 3WHKA 1QH1B 4ZHQF 2WYHA 3VDRA 1EPUA 4I9UA 4XPZA 3A9TA 1US8A 2W6IA 1HZZA 2MHCA 2YS7A 1WULS 4ZVUA 3RU3A 2JLZA 2VDLB 3TFOA 2P3OA 3GXBA 1I2ZA 3HQ4O 4EH1A 5HX7A 4D4IA 5JMOA 2V6GA 3NNNA 5FHQA 2OXEA 4EY3A 4DA8A 1PT5A 4Z9YA 2GETA 3NZEA 1SC4A 1Z16A 3ECCA 1W93A 2VPQA 4Q3OA 4Z0HO 2OBXA 1RWKA 3MRSA 1UWKA 3RPEA 2CUTA 4RIIA 4DG9A 2J3KA 5A5DA 3V46A 1YE8A 2A5GA 2GARA 2G06A 2QRMA 2WF6A 3EZGA 3KLBA 5JSYA 2ONJA 3RQSA 4NU5A 4M1MA 4LZWA 3WGZA 2ZJBA 4U7FA 2TRSB 5DI3A 3VJMA 1VMEA 2EFYA 1RMTA 4RULA 3T3PB 1YAHA 3WRYA 1Y34E 1NTOA 1E9VA 4ZRNA 1HZZC 4C3VA 3ZWAA 4KXVA 4B7CA 4D42A 1BW9B 5FR2A 1CDEA 5I9MA 2AOVA 3KNZA 3MQFA 1A4UA 2GPBA 1WPXA 4WW0A 1DWQA 1L4UA 2OESA 1NVVR 3PJGA 4XR4A 4XM0A 3KE8A 4ZQBA 1F0YA 1XGKA 5JZBA 3AHDA 1Z5PA 4LDZA 3DF7A 3MG9A 3AINA 4G85A 1V9LA 2B7LA 2CJPA 2EFEB 1OA0A 5CH5A 3RUAA 3TG2A 1TCVA 3NHWA 3NATA 1BE6A 4JU9A 3L40A 2ODAA 3WRYC 2C5AA 3WYNA 3U4QA 3VNVA 4WZ6A 2WJZB 4W5QA 2YXBA 1WD7A 3NOVA 4MYSA 5BQ5A 3TTUA 5EXSA 3EZNA 4BATA 3TRKA 4C05A 1ZX1A 1YU9A 1SIOA 1GPUA 1V35A 3E61A 3IT3A 3ENKA 4MLPA 5ADHA 5KJ6A 2AOWA 2Y4OA 3WB2A 1KJIA 1YC5A 1W6UA 2CBGA 3I9LA 1HOTA 4LE0A 1E6CA 1VL5A 3IR5A 1U80A 3AK4A 4EAQA 2AZXA 4ZIRB 2ZM5A 2ECOA 1PL0A 3EB9A 1YCHA 3NHYA 2B92A 1GGJA 1B00A 1UMKA 2O2YA 4HSGA 4MV6A 4RORA 1KYZA 3TQHA 1TIKA 2B1RA 4EKIA 3AWDA 4N5LA 4ZZ3A 5I9SA 3UWDA 3SIPA 3EGXA 3JZFA 7ADHA 1TQ8A 1AF7A 1JALA 2HCBA 3W7VA 4XGRA 3WGMA 2YHIA 2J0EA 3KUDA 3N0XA 4OQDA 4CIWA 5KYWB 2RK6A 4HDQB 4E2WA 4B74A 4RHCA 1TM2A 2ZS9A 1J2RA 1M8PA 1RQ7A 3AXTA 1VC2A 3HABA 1K98A 3GA0A 4IDQA 1KS2A 3FA2A 1FSFA 4X20B 4FT4A 4F4FA 1XIVA 2O0LA 1L5YA 2EW8A 2HNAA 3I73A 1DOAA 3MMSA 2FR1A 2DPLA 3ORHA 3PNLA 4XCQA 3ZD7A 1M9NA 1U5CA 1WDKA 2EXXA 8AT1A 3PJEA 3E0XA 3WR5A 2P1RA 2LXNA 1H3FA 4LGVA 1E5XA 1MV8A 3D6JA 1PT8A 1RZVA 3H4TA 2WAAA 3CPJB 1KAQA 4OQZA 4IIEA 3RG8A 5H1YA 2QNBA 2AHOA 2D7JA 3AI2A 4WEQA 4GE3A 3OT1A 4JQOA 1Y98A 4KI0A 3DJFA 1YKFA 2P9TA 4EI7A 4F46A 1AURA 3NHFA 1Z08A 4QU5A 1NVAA 1PWZA 3TVYA 1AB5A 3L0CA 4QBHA 2J30A 2M6RA 2QRVB 4TL6A 3ANLA 3QBEA 3QGMA 5JPDA 2ZBPA 3ESZA 2R84A 2FZGA 3OEHD 5EJ8A 3DEIA 3QUBA 4AUEA 3F5MA 1N0HA 3C8HA 3INNA 3QU4A 5DISB 4F4DA 2WF9A 2Z1DA 3V4VB 5JSZA 2VHXA 2R1TA 2WJWA 5AW0A 1A69A 3R40A 2ZE8A 4JYMA 5DM70 1EU1A 1LSUA 3QHAA 1FFDA 1NBOA 3WIDA 4U8GA 2V7XA 1XEWY 5DJ5A 2AUNA 1TTHA 4H6PA 1VSVA 4MV0A 5FL3A 2Y6VA 1KDPA 1TKRA 4XSHA 3F3MA 4BVEA 2QZ4A 3LUPA 2I2CA 3M49A 2B69A 4K87A 1SA0A 3QEBZ 2IHUA 4PWYA 1ECGA 1QVRA 5CT8A 3I61A 2EHDA 1FBTA 1MU0A 1XDGA 4L8GA 2QSJA 2B4QA 4MQFA 5C81A 1RP1A 3ER9A 7ABPA 1RRMA 3OBBA 4MX8A 2CB9A 1U0FA 4BBZA 2CXNA 1A5ZA 4YUWA 2RH8A 1Q57A 2O8NA 2QI9F 5EWLB 3GJ6A 3TGWA 4CM6A 1JLLA 2E49A 3PE3A 3BMOA 2HQSA 1XQXA 1GZ3A 3LRPA 2E85A 4N4AA 3TAXA 3H6HA 1AHHA 2HBQA 3T3HA 1ADFA 3PIRA 3MWLA 1E2DA 2Z0MA 4TMKA 4YMWA 3DWIA 5KTYA 1VHQA 5AK6A 1USWA 2JEZA 3HWSA 2HK8A 1ZICA 3JALB 4XFDA 2CJYA 1HXHA 1KPIA 2A92A 2EZ8A 5HUHA 5MF6A 2EWWA 3ZHQA 1EUCB 1C4KA 4D6PA 2BCGY 4MDFA 2ZUVA 1P9WA 2O3TA 4ZOAA 4DQVA 1KNQA 4N9WA 3ZH9B 3H8VA 1O3YA 3BDIA 4JIMA 1E9BA 5FTKA 3ITKA 3LF1A 4YP9A 1IIRA 3IERA 1EESA 3GH3A 4K0RA 4O4JA 4RV4A 4X6YA 2QVXX 5C32A 5LA6F 2GKGA 2WAYA 3KAJA 5K3DA 2XLCA 3H4IA 5DRYA 3LPNA 3EF3A 1QANA 2IZZA 3PLNA 4AIRA 1IJBA 1KJ9A 2AMFA 4ICIA 5C8ZA 3MELA 2J0UB 2Z08A 2JIZD 5TNXA 1Z0ZA 4NS1A 1PLLA 2ZI9A 1E89A 4I9HA 1KZ9A 2BISA 3G79A 4TMVA 5F35A 4DWJA 1Q2UA 3G3EA 2PKQO 3U40A 3V6MA 4AFNA 4YI5A 4HPXB 2JGFA 1M74A 3ANNA 3G5UA 5G41A 1NMZA 3RE1A 2R8BA 3TPFA 2H1OA 4KK3A 3LO8A 4DR1B 2JDID 4MR8A 3PXDA 5CPBA 2CF6A 4RHYA 4B83A 1JXMA 1Y80A 3M1YA 2I9KA 2VSFA 5HE9A 4ZFNA 3RRJA 2WYWA 1E9SA 3CEPB 4Y67A 4Q1BA 1E77A 1VCMA 4GEKA 5EE1A 5KREA 2HPHA 1OH8A 4L8FA 3F7MA 1E9EA 2GLTA 1AV7A 3DS8A 4URWR 3VR1A 1KARA 4YS6A 3G0OA 4BO7A 2OFXA 4JYCA 4BJ5A 1JHAA 2BFBA 5CUQA 5KO2A 4DLSA 1L8QA 3CH4B 1K75A 1PT7A 1GGVA 4WFKA 3VH1A 3NRBA 2ZSHA 1IQUA 1ENOA 1LXCA 1V5WA 2ZQYA 4PSDA 4REOA 3TQOA 1KJZA 3I04M 2SBTA 3V55A 4CV3A 1I36A 2E18A 1ZEMA 2ZE7A 4MI9A 1CJUC 2XYGA 1OBOA 3BK2A 1M2KA 2NTYC 4Q7LA 1EJBA 3OJCA 4LKOA 1NXQA 1Z0DA 2G4LA 3WIBA 3PLAE 3HLYA 5JIBA 2FAXA 2GYVA 2Y1WA 2YYSA 3FUWA 3GROA 4ETIA 3ZBTA 2ANBA 4FFRA 5CITA 4J0HA 1WV0A 3PHBE 3U17A 2QLJA 3GJTA 3VOBA 4EM6A 2RGCA 3OMWA 4QJ5A 5GJVC 1J2UA 1YOBA 2AE1A 4ID9A 4D43A 3CX7A 1CEEA 1TZJA 3R09A 3UNXA 3FUUA 5FT9A 1TGVA 1THZA 2ZBQA 3A2NA 3TRFA 1V8FA 2ID8A 2Q2WA 3LD9A 3V4PB 1KEEA 3KQLA 1O87A 2J3DA 3E58A 4PAOA 1E9CA 3ZXUB 4YLYA 3QX3A 1ICIA 5DCYA 5LQSA 1Y6FA 1CE8B 5D3KA 4GYJA 1P7PA 1J70A 4NECA 2AWOA 1CG6A 1GL7A 3ICCA 4ZOLA 3RIXA 4YXFA 2PGIA 2IY7A 4LV5B 4MO2A 3ZI0A 3NKFA 4RGBA 2EL7A 2XUZA 2W2KA 3MS2A 1D7AA 3LP6A 1BGWA 4JJFA 1YQWA 2ZJ5A 4TZ6A 3FROA 2DECA 4EW2A 2EP7A 1JVBA 4QXPA 3PFHA 3ZIDA 3U4GA 1IMOA 5I7UA 5C34B 1RXYA 1VSUA 2OV3A 4X8MA 3CZQA 4TYNA 4JBXA 2ZYGA 1RHQA 4PLHA 1R0SA 4GE0A 3OBIA 1SU7A 1VRWA 2WIGA 1NP7A 2QUAA 1CQPA 2WPDD 3DL0A 1KQGA 4RMGA 5AVRA 1QX3A 1QMPA 1GGEA 5CVUA 4JXZA 4JI6B 3QG5A 2XMRA 5HWSA 3JQAD 1KEPA 5IUNC 3L6BA 2YUIA 2IW1A 3HV0A 4MUHA 1AUVA 4IM7A 4PQGA 4A2PA 5BR8B 1O54A 3VR0A 1UMBA 3LQQA 3WGQA 3UWPA 2EBUA 2BE9A 3MQ4A 1XZPA 4BGUA 1DXYA 3L82B 4LBYA 4X9XA 4B8WA 1TAQA 3HFJA 4HQKA 4H3VA 1Q0PA 5K20A 4Z4CA 4F4JA 2ZLBA 1F20A 2DT8A 1ZCZA 4YRZA 3OKFA 4J4HA 5I6DA 3M5CA 3DP9A 3NBKA 4GVXA 3MFYA 1E2PA 5LYYA 3TF5A 3EWNA 1P75A 3IP1A 4EO4A 5KOHB 1BHJA 4LHXA 1IBCA 2HB6A 2PGOA 1QGAA 2QVCA 2RGNA 3QVJA 1UZMA 4KNVA 4YBZA 3BS4A 4J3FA 4PBSA 2P2ZA 1T5LA 2QJFA 1UOOA 4LRSB 1WABA 1EVQA 1WXHA 4ZO7A 1KAGA 1QJ4A 2EZ4A 2VKQA 1GITA 5AICA 5C8YA 5CB4A 1SBZA 4IIXA 2Z6UA 5HFAA 3DOFA 3CTMA 3EXEA 3AETB 2FZEA 2ZU0C 2Z2ZA 1U2GA 3AFGA 1OYYA 1K0FA 1E3QA 1XPUA 2P78A 4RSRA 2OUKA 3LX8A 4YHBA 2H8GA 5DYNA 4PG8A 4H7JA 1SXJD 1QVAA 3OFVA 1U2DA 3UGKA 4G4SO 2RGNC 4G89A 2FPUA 3C98A 4NBUA 1U7OA 1NU6A 4ZVMA 5A05A 5IS2A 2VL7A 2V5VA 4MR7B 4DL9A 5EIFA 4PN3A 4CLOA 2NU8A 2PCJA 4D92A 4WCFA 1F2UB 3U3ZA 1BMDA 2QT0A 1OIXA 4RPCA 4Z9BA 1EDZA 5HBRA 1LQUA 1C9YA 1RCUA 2GVDC 2BTEA 1JZQA 2Q2VA 1R0YA 4DARA 2ZQ5A 3P1JA 1NI4A 1JFTA 2X1HA 1S3SA 1U2GC 1ADCA 3P9KA 5KBYA 2ZI3A 3KEOA 1CDZA 2ACWA 2WHYA 1ULTA 2RSLA 1J1UA 1U2DC 2ZBGA 5H4GA 2BCEA 4MZDA 4AZ0A 1XJ5A 2FDXA 2AJBA 1LF0A 3HY3A 4Y6QA 5BSVA 5IKPA 4B2IA 2R1VA 4NJMB 4R9VA 2C9ZA 3UT0A 2XD9A 5DEOA 3AF2A 4XJSA 2E21A 1UFKA 4WCFC 5I7OA 3UMMA 1KZ4A 4GG1A 1N1DA 2P6NA 2L2QA 3LVQE 3B1JA 3HR7A 3SC2A 4UBNA 3DCJA 2Q8QA 1YCDA 2C9YA 2ZYAA 3ACDA 2WJGA 4KX5A 1QGYA 4CV1A 2J08A 2Q3LA 4YIKA 4Q4DA 2BKUA 3EFEA 1LF5A 4X95A 1QGED 5BV0A 4NENB 2BFFA 3HHPA 3TMKA 1ENYA 1SKUA 3E3MA 3CE6A 3VXKA 3ZWPA 2G1UA 3CX6A 4IDPA 3R7BA 5LQDA 1K6EA 2LRHA 1FYDA 1Z74A 5LWQA 2XVMA 1T3HA 1CY0A 1VYHA 3LMKA 3H05A 5I01A 2I1LA 3SXPA 4B3BA 1H2XA 4MRAA 3LBHA 4JLPA 1CK4A 2ZIXA 5F73A 3TWOA 4BX8A 4M7WA 3UBTA 4QDKA 2CHEA 2IBMA 4X1IB 4BNLA 3WGUA 3CISA 2PV7A 1UBOS 4ND3A 4ENPA 3JRXA 2AN1A 4L75A 3DZIA 1U5AA 3N0VA 3NTVA 3HJFA 3MMXA 4RQTA 2NP6A 2GBPA 5CFLA 3QFCA 1P74A 1EE2A 3TNFA 1YTUA 1SBHA 3AI3A 2A3RA 2VK2A 4I7EA 3ESAA 2XUIA 4WAUA 2OBBA 5CXXA 4N48A 4GC5A 4DA9A 3MINB 4PR3A 1NQAO 2EF0A 4Q24A 4QOJA 4NVRA 3QXJA 2QVYX 1H6BA 2OK7A 2E6KA 4RABA 3G2KA 3SBEA 5KX5A 4AY2A 1G21A 1DEXA 3OF5A 5HFJA 1F8YA 2PKEA 4I2NA 3DE5X 4MRVA 4DIBA 4IGFA 2DY1A 4KFCA 2ZETA 3N59A 1S0UA 4NPAA 4X66B 3HU3A 1ML4A 3OEEA 3NKVA 3CRRA 4RZSA 4EF6A 4F2HA 3FJOA 3KLNA 2P4EA 5L6MB 2FEWB 3KPYA 1JR2A 4RBNA 2P9EA 5DGCA 3WJ7A 4CM8A 5JQGA 2R8ZA 3HL0A 1DIOB 2H9YA 4BCDA 3IAM6 4EGSA 1FEZA 1BJTA 1C80A 5KNBD 1IRXA 1V7QA 4YT8A 3WNZA 4C0SA 4DCCA 2IXTA 3FR7A 2V9CA 2WHXA 3CUSA 1Y1LA 2AOUB 3PB3A 4Y6GB 4C4YA 2V65A 5KDOA 3GFOA 4TX1A 3GEBA 1GRCA 4BZWA 4KWTA 4C5CA 3SZGA 4UNIA 5FLXA 3EXG1 4B3SB 5HIJA 1FMCA 1I3NA 3GLGB 4DBLE 2BP7B 3MPOA 2CLOB 1N7HA 2AG0A 4P08A 3K5WA 4WKNA 1KGSA 5IZ4A 2CLDX 1SCJA 2BM8A 4UHEA 5AQ1A 2ZAYA 1W0JD 3QXHA 5K3CA 4KLRA 3PD0A 1P1KA 1JNXX 2G9UA 3A6DA 2D1QA 4MB0A 2BEJA 1M0WA 1O97D 3LHSA 1R6TA 2CF5A 3CEHA 3IQWA 4OO3A 3GLQA 5CK4A 1ESZA 4BMYA 7REQB 1WHTB 5TS2A 3W8NA 1ZK1A 4O0MA 1L7MA 4UEKA 2DT5A 2UDPA 2E55A 1Q7EA 1JFRA 2G1PA 1YOVB 4IIYA 2YJ3A 2AJLI 5BVHB 1Y3DE 1WSBA 1N77A 1QVVA 1ZN7A 3NWBA 3QX8A 3QBDA 3WYBA 3F47A 2I6XA 3EBOA 4FYHA 3BZBA 3V8PA 1X14A 1WD5A 1JT9A 1ZD3A 3RSHA 4GLFA 1A76A 4KIJA 1W36C 4DJDC 3IUNA 2Y93A 2YYZA 3JWHA 1MVNA 4HFRA 1LWNA 2X3UA 3GLSA 4MCAA 4RH1A 5G1OA 4YX9A 3WLTA 4U1RA 1RYNA 4IVPA 4XYEA 3Q7RA 3W5SA 1JH8A 1H6DA 3KKOA 4EFDA 2MSDB 1VP3A 2ZI4A 3QWAA 3TIFA 4A8JA 3T8YA 5JI3E 3RVQA 5JXHA 5IJWA 1P2VA 4CMJA 3AVOA 2GZ3A 4LJYA 4EO9A 2A0UA 5IMBA 3FPAA 1UBHS 3CCCA 1BX0A 3OC6A 3IURA 4E07A 3EAQA 3IUYA 1KHHA 3DLCA 4G0YA 4IMJB 3GA7A 4FINA 3NWJA 1EQAA 4ZC1A 2QTZA 1FVHA 1S8OA 1XTIA 1J56A 2BAGA 4JS0A 3VSEA 3W6NA 1Q17A 4N40A 2B4RO 3CRZA 4GL2A 3B6ZA 3MJDA 3QSYA 2GA8A 3GDFA 3RGGA 1EGAA 2HHAA 3BH0A 1P7WA 4A8JC 3RAEC 4GKJB 2N47A 1EX9A 4WNYA 5AM5A 4CW7A 5FBWB 1AZWA 1IM8A 4LPSA 2W90A 1Y9EA 1T5OA 3HBLA 2W2VA 4D02A 4MS3B 5A7HA 4GH5A 1N8NA 5DGTA 3CH7A 4Q15A 1K7CA 3ZX5A 3L0BA 4OLFA 5HSGA 3OQNA 1E1QD 3BMCB 3EZYA 1KGDA 1W4AA 2NU9A 3TZCA 1SBQA 2PT9A 4EUHA 5CXQA 1WV1A 3RU2A 5DBOA 4OEHA 2QM7A 3AM5A 3T1YB 4NV0A 2JLUA 2MINB 1SUIA 1X94A 3R7NA 3H0CA 1IWBB 4AURA 1EG7A 4LRXA 3K9LA 3HGTA 5AHWA 1L1RA 4GOND 1GTMA 3WMXA 1E2FA 4DAEA 2R44A 2AHRA 3GLHE 1PK8A 1ZMXA 4KO8A 1TT5B 3GJZA 4QHSA 1DBVO 4RZHA 1XTVA 1NLMA 2Y1FA 3K6SA 2PUWA 3QMWA 5L51A 1LS6A 2EQAA 4BNXA 5CHYA 3IFSA 5BWLA 3AVXA 1KFEB 2JFWA 5JFTA 1K8ZB 3GIDA 3R3HA 5AKYA 2ZU6A 2C1EA 3HNOA 3QFHA 5DM2A 5B2ZA 1UFOA 1G41A 2OCIA 4P80A 4QL3A 4TV8B 4EMBA 1LVHA 5IYZB 2INGX 1PEAA 4AAYA 1UPAA 2HSEA 3CO0S 5JNSA 1JHUA 2C9OA 4AMBA 5ICCA 4G1MB 3EPLA 1HFEL 3KWLA 1MB2A 1YQEA 2ZZKA 4JGIA 4TLMB 2FPLA 1LUAA 2M98A 2VG8A 5LIPA 2GHIA 4UHBA 4EFMA 1D0VA 5A5FA 2WNSA 4FEYA 3C16C 4MKRA 4GOXA 2HXGA 5GGYA 4BFYA 2XUOA 3NM5A 4WLNA 2VTBA 1QHHB 5EXEA 3T0GA 4Z7NB 3K0HA 2JVJA 3CRMA 2X0FA 1F8UA 3LUDA 1P4RA 1T5IA 4YP7A 1E32A 1JN0A 2LP4Y 3NEYA 3H8JA 5IVIA 1TVCA 3H86A 4D8TA 2P5YA 1YT5A 3WKCA 1YBAA 5TPWA 3AHIA 2JFFA 2Y92A 4GO1A 2WHPA 4IWXA 4GBED 1E99A 3GUVA 1Q0SA 1FBNA 4NESA 3U9TA 2JCXA 1RNLA 1UKEA 2VBIA 3OCXA 3TE7A 4BPRA 4R7TA 1QR6A 1ZN9A 2H11A 3LUKA 4YO7A 2BPOA 5DTQA 4RO0A 5JNUA 4KWCA 1AQIA 1NI3A 4N8EA 3CLKA 1QYDA 3TQRA 1ZUD1 3LBYA 4JWKA 5AHOA 3TAUA 5CAEA 1RCFA 4LK2A 5AKJA 3SMQA 1B3BA 1WUJS 4E51A 4F93B 4ZA2A 1QM5A 2NUTB 2QZSA 4FP9A 4POAA 3IB3A 4YFYA 3TTTA 4CF6A 4F92B 1NY6A 5LQCA 2ANCA 4MR9A 1QOQB 3U26A 1GUAA 3R74A 1UP4A 3L6OO 1Q6YA 2Q5LA 3W05A 1RSZA 5BWCA 4X84A 3BE5A 3V42A 4OB7A 1W88B 3AR6A 5JEEA 4TV9A 1KDVA 3IR7A 1WY5A 1RQLA 3T15A 1E3JA 3OA0A 5AXDA 3BB4A 2I71A 2CFIA 3KSRA 4M6WB 3Q0IA 1Z2AA 2PEYA 2R00A 2BGJA 2EGGA 2JZCA 2R96A 1KI3A 2V9PA 1IUNA 5FYQA 2IU6A 1RBMA 3T7CA 4B4WA 5HRCA 2CYAA 5K3EA 3PUZA 3QSGA 1EE1A 1PTKA 1R6VA 4P5EA 2YVAA 3T1QA 4DVJA 3QOXA 3TZEA 1IZYA 3A6ZA 2BGUA 1MN6A 4CNQA 2A35A 2FQXA 4JKOA 4ND2A 2BVNA 3DUFA 5JSUA 2I4TA 3OE4A 3DEJA 3B1ZA 4P35A 5CVEA 4US0R 3UK1A 3GZNB 1VQ1A 2FVYA 3PF8A 3DTVD 2GAOA 3BC1A 4XGQA 4XVRA 5EN4A 3ASZA 4K40A 1CR2A 5FPSA 2PX3A 4D56A 2R00C 3QF4A 4N47A 1UIRA 1RAHA 3DE1X 1P31A 3B9BA 1JDUA 2AW5A 2XNSA 3O3CA 3STVA 2FSFA 4HNQA 4IX9A 5E6UB 5IARA 4DR7B 1ZIPA 2QQFA 4HDNA 3ND8A 3FVWA 3OESA 4RHFA 1KO4A 4F96A 4D0RA 3QXGA 1RD4A 3BIXA 3B51X 5H16A 3ZU4A 5C18A 1SEVA 1FFCA 4DNQA 4JY7A 3C45A 4G4GA 1LDMA 3TLJA 1FX1A 1CJSA 1YQQA 3TQSA 5KJCA 3C7AA 3T9CA 3QFSA 3OD1A 5EJ9A 3BB1A 3BWEA 3GQBB 2PH3A 4N03A 3CKMA 3KKPA 4RFLA 3HHEA 1YKSA 2ZBRA 3PQ4A 3MWEB 4CTNA 2ZBEA 3O9MA 3ZEIA 4H9GA 4ZPXA 3KT3A 2A33A 5DHTA 4MO9A 5EP2A 1DARA 2B8WA 3MJTA 1UFQA 1DG9A 1ZK4A 4BE4A 2O20A 1T2AA 4NYIR 2NAPA 2PDAA 4I08A 3EGCA 4LRUA 5ERGB 5TARA 4ZYTA 4ROTA 5LKRA 3CVVA 3B1XA 4M21A 4B2YA 3HEAA 3D7KA 4KIWA 4B87A 3B13B 4NF2A 3D4BA 3DMPA 1JQDA 5LOVF 2Q5OA 2X14A 3ZQJA 4G97A 1I3KA 3R7WB 3PT9A 3WO0A 5B6PA 3N75A 4DLBA 1WO8A 2BMFA 2D5LA 1FUIA 2ECFA 4Q3KA 3DXZA 1QC5B 2A1IA 1SOUA 1SCIA 4CZ2A 3QBTA 2P1DA 2PPVA 1LDYA 1L5RA 2KLHA 3HU1A 3OWOA 4C4PA 3I72A 2CXRA 3FDJA 1KMHB 3PEFA 1MBZA 4US2R 1JJFA 3EZ7A 2A14A 4QC2A 2VNHA 4KN6A 4RPLA 4DW8A 4J43A 3LUCA 2OD7A 1CC1S 3QELA 3ZQKA 1UQRA 4C7OB 2O1SA 3TOCA 3EZXA 3ZXSA 4F3CA 3GDGA 2WWXA 3D4OA 4DMFA 3P97A 4X45A 4OM7A 5I4KA 4AX4A 1D5WA 5LSAA 1Y7TA 4Q4AA 5ISMA 4HH3C 2MCFA 1MPXA 3W5UA 2VH5R 1A8PA 4GF5A 2NZJA 3STYA 3T9AA 1USIA 4LGMA 3NANA 2QM8A 2VP0A 4HQ0A 3Q2OA 4OQXA 2DETA 5AM3A 5AKXA 3W5HA 2X8LA 4RTSA 1H0HA 4PNZA 3WB0A 4DQKA 4YP1A 4RY2A 4ACAA 1GLGA 1GUBA 4AI6A 1OUMA 1SKYB 2XTJA 2XVZA 4JVSB 4ARBA 3N2GA 2J32A 1G5IA 4YCDA 1ZNQO 4Z5XA 5JPIA 3M5WA 1J09A 1R8QA 1X7YA 1QBGA 3B1VA 3C3KA 3FDIA 4CTOA 2WSIA 3IO5A 3OY2A 1OZFA 4FMPA 3ZWXA 4EKYA 3LA8A 1N1MA 4MVJE 4II7A 2KJQA 1DMSA 1E3IA 3F49S 1SHLA 1W4ZA 2PKCA 3G89A 2OC9A 3CPSA 4YRFA 4ZT7A 3EOAI 3U1BA 1CUBA 5IBQA 3RT1A 3LDHA 4RKYA 4QEDA 3VVLA 1GTSA 1IUOA 3KJNA 1B41A 1XDBA 2QT9A 2EWMA 1MORA 1UZUA 3BIFA 4I9FA 4PQEA 5EJ2A 2V7QD 1QXSA 1RRKA 3KTAB 3NB0A 3ZLUA 4P0QB 2GM9A 3EWSA 4KVGA 3ZWOA 4EPRA 3H6GA 5EJ4A 4CIVA 2WYOA 3GNQA 2Z04A 3GLUA 3H5TA 2D1TA 2RGGA 4LWPA 1L5FA 3O0DA 3WGJA 3RVKA 5LQMA 1O0BA 1GSIA 1NPYA 3W9BA 4ZGGA 2L0XA 3FMIA 3NBUA 4FFNA 1JR3D 2BJWA 1IONA 1DCMA 4ZT4A 2HMSA 2C82A 1V5IA 4GKKB 1L4NA 3C7KA 3DOUA 5CB0A 1E2JA 1GD1O 1YBMA 4R2KA 9GPBA 2XCUA 4URZR 3ZV5A 4EHKA 4FFLA 5DHSA 5FPYA 5DSXA 1ZH8A 1NL3A 1PNQA 3AV3A 4H7FA 1O94A 3NFYA 3UJ7A 2PKRA 4N6NA 1T1GA 4YJGA 2ZPAA 5FR1A 3JVUA 4MUBA 1RADA 1JAHA 3DMGA 4EATA 2OYRA 3K4HA 3RS4A 2Y6UA 5LXTF 1ZWKA 2RBGA 3IUPA 3G9XA 4KQHA 2OTCA 3I4CA 3I2YX 3RCBA 2C98A 3CE9A 3QE3A 3C48A 3Q6NA 4GOKA 3JQ7B 3STUA 1LV8A 1FRQA 2GEJA 2AC2A 3OM1A 5MFZA 1Y4AE 1GL6A 3NT5A 3W1EA 3CLUC 4IXMA 1HDGO 4RCZA 2Q1SA 1X87A 3BM5A 1Y6QA 1NRJB 2ODPA 3DVQX 3ESBA 1O94C 4IDDA 4XSGA 3NHBA 2OB2A 3EGVA 2X0KA 3H5IA 1NOIA 3EODA 2ST1A 4HAYA 1HBJA 5C31A 5KQMA 1G16A 3GLTA 5HKAA 2B21A 4XD7A 1I6KA 2OQRA 3FNIA 3RSFA 2JFYA 2ZKLA 3NDRA 4AMYA 1FDUA 4O33A 4QPNA 1KBOA 1T3LA 3O4JA 4L5AA 3IYLW 4EO7A 2XAUA 2WZCA 3LX6A 4ENTA 5AVQA 2NU7B 1UBFA 1DPGA 1HORA 2E82A 2GBCA 3VZSA 4G2NA 1UFRA 1PUXA 1M34B 1Q0ZA 1W2WB 2IPNA 3EVZA 3UGTA 2JHAA 5IC6A 4B3FX 1ABEA 2DG2A 3Q1LA 1N6PA 1QGUB 4A91A 1SXPA 2C3UA 3I1JA 5HTOA 2CT8A 4RVSA 1L4GA 2DBVO 2J5QA 1ZJJA 1Y5IA 3IUSA 4K03A 1U7ZA 3ABRB 4RKEA 3ZDDA 2JK0A 4K3VA 2JIMA 2GCOA 3V4LA 2H1LA 5CX1B 2OBNA 2GO1A 4DT1A 1EM8B 5ITSA 2B25A 5F2OA 8GPBA 2VP9A 1OX4A 3HKBA 2GZSA 2GF0A 1VI2A 1ESEA 4KVZA 4L9WA 4KR6A 3H3JA 1BCRA 3BFKA 3MHPA 1HDOA 4EB6B 4EG7A 1YACA 4MRSA 1M0EA 5K6RA 4RIGA 1Y7PA 2Q6LA 2J9GA 4RCVA 4XLZA 3L7NA 1C7FA 5D84A 2GK4A 5DB4A 7MDHA 1RTTA 5KZMB 1B73A 3S4YA 3VHXA 4YV2A 3QVGB 3GDWA 1TAHA 3CF0A 2XYPA 2PMKA 1HG0A 1REQB 3KOWA 2M1ZA 4LQLA 5CDSA 2Q9AA 1CT9A 1T8SA 5D3MB 2VDVE 3TBHA 4EJSC 2CKDA 3LBNA 2GXAA 2FLWA 1A4IA 1XAHA 4RYDA 2HYIC 3O2NA 2Q5EA 2ZRMA 5EI5A 1MQAA 4MIKA 2ZRNA 1PD1A 4YJ3A 1FE8A 2QAGA 4ENVA 5E1DA 2YN0A 3RIGA 4B76A 1JVNA 1Q3KA 3TIVA 2FTKE 3PHGA 4HEA1 1D07A 2DE0X 3UATA 3RV4A 5EG5A 5I9NA 3OG9A 2I76A 3D4NA 4UU7A 1P5JA 4HHEA 1CHDA 4H16A 3B7GA 3IEUA 3BL5A 2BGGA 1JEDA 2RGXA 2XB8A 1JJBA 1I30A 4J0KA 4JJ8A 4LVUA 4TMZA 4G5RA 4GEGA 3SSMA 1D1TA 1Q1AA 4CMIA 3VBCA 2FPPA 5ER9A 1QLWA 3IE2A 4REQA 4G1BA 3CA8A 4NZNA 1P7VA 4Z51A 4ZEMA 3VYSB 3KUXA 5JSFA 2C77A 3A8TA 1A88A 2CUKA 2FOXA 4RANA 3PUIA 3T5GA 1I1OA 3Q7QA 1N3LA 2KB0A 3WTCA 3L4SO 2Q4BA 2CDBA 2EP5A 1FFXB 3IEVA 3L0YA 3WBJA 2IXAA 4MLCA 3RJTA 4JEUA 2QTFA 1FC0A 5EKSA 1R9MA 1TMKA 4C4RA 1EK1A 3RG2A 3TLBA 2YRFA 4G4JA 2PY6A 3NHUA 2OMEA 5FUYA 1ZISA 1DBPA 3UJPA 1VA4A 3W5DA 1YL7A 2HSGA 2BZGA 1GFWA 3WFZA 3HMKA 3DMNA 2R66A 3JQ9A 4XTCS 3V7WA 3X2EA 3A2LA 2IBSA 2JI4A 3N1UA 3O84A 3WB9A 2AQ8A 3JZIA 4GKBA 2AG1A 2O2IA 2YHBA 4QEZA 4D9CA 4DBLC 4K9LA 4GP6A 4J2HA 2EKQA 2XCLA 4KXUA 1JEYA 5BQOA 1C0IA 1C7RA 1XG5A 3F78A 2VUSA 1XF1A 3FDZB 3HE3A 4TSRA 2Y66A 4TN1A 4OUKX 1NA5A 3V7FA 3QI2A 4OHWA 3MEQA 3QE2A 5G02A 1A9ZA 1W4BA 2OBYA 4UNPA 1PX0A 4MITA 1FU7A 2FZKA 3I4LA 5GONB 1Q1NA 1A9RA 1PZMA 2I22A 1YR9A 6CHYA 3T3MB 2X42A 3DVLA 1FB5A 3G1WA 3QRWA 4Y30A 2IYVA 3MHTA 2IYNA 3LYAA 4JQCA 3RRBA 3L6CA 3TDMA 2J6CA 3TSCA 1T1JA 3A0UA 4ZPJA 3K0BA 5AESA 4XWTA 2J3JA 1FDWA 3TM4A 5FBHA 4MA5A 1CU1A 3TTWA 5FWXB 4PC6A 5EJIA 3HO6A 1EXVA 1I0ZA 4OHCA 4FDAA 1OFHA 2H29A 2VNJA 2YZKA 3LLMA 4RS4A 5KYUB 2Y9PB 2FEXA 1JQBA 2UYHA 3VU0A 1P3DA 1UBTS 3IULA 2I6SA 1MIOA 2VA9A 5EE9A 3GVCA 4HEJA 1JSRA 4C0WA 3GGPA 4E4YA 2IHVA 5DU2A 5F3DA 1GFSA 2B0CA 1XKQA 5HA5A 4PU0A 4Q3CA 5FO0A 4QBIA 4YACA 4LJ8A 1W35A 2H4ZA 3C3XA 3K31A 2XIJA 1NLUA 2YWRA 3NAMA 1SVIA 2Y0DA 3HCEA 1YULA 1OWOA 2O2SA 2YW9A 3GMIA 4K1LA 5IC5A 3GLFB 2VTBB 1A8UA 1ABFA 2W2NA 2PAAA 1N5IA 4H27A 1JAZA 1YMVA 2PGJA 2XWJI 5BRJA 3OIYA 3EJWA 1EA5A 1SC6A 5G0TA 3CH5A 1Q83A 3S99A 2LD4A 4IQGA 5JAZA 4RPGA 3CBQA 2HQ1A 2WY2D 3WLKX 2DGDA 2XUDA 3HEMA 4IMRA 4N7MA 4QDJA 4PX5A 4ER0A 3PUVA 4RDXA 5JD4A 5KVAA 1RHRA 4I46A 1ZOOA 4HWOA 3W4KA 2H52A 3FI0A 4FGSA 4NNJA 1TK9A 4MRMB 4E46A 3ZG6A 3GLHA 5CVJA 5E4JA 1E1DA 3Q85A 1H2BA 1CBUA 1ZM9A 2AJTA 2ZSJA 1QUFA 1RFLA 1U8ZA 1A04A 2D54A 3G8YA 2ACVA 4G5FA 3L04A 3ANSA 4OHXA 1JFLA 2HZ7A 1M8KA 1PJAA 3R20A 3CJRA 1B6SA 1GSAA 2ZSIA 3FTCA 4E1AA 3KKQA 4WFIA 4XUEA 4HN2A 4LOIA 1PBTA 2HQRA 3ELUA 2A1UB 4XB1A 3TTYA 1RKXA 1ZJZA 2J67A 4C01A 3ONFA 3HVRA 2X4LA 5EZQA 5JSZB 4C2TA 4EKNB 2WWHA 2WKRA 4RTKA 1UOPA 3NH9A 4AROA 4NOLA 1UDCA 3EXIB 1IQRA 5CM9C 3LFHA 4DV6B 2QV0A 2EU8A 4M1SA 1DIGA 5LU9A 3KYIB 3FUCA 5I8WA 1N2CB 1OWMA 3F7OA 2WF5A 4R2LA 2YASA 1ST2A 4NTZA 4EEXA 3JQRA 1UPBA 1SXIA 1K63A 5CH3A 3RVNA 3O92A 5CB4F 2Z2IA 1HE5A 3GJ7A 4OJMX 2JLYA 1QG2A 1RJ9B 2BW0A 3LWBA 1Z8NA 3GMDA 3NALA 3OUZA 1YK0A 2I3DA 4DA7A 3IQXA 3LC0A 2JIPA 2O7NA 3TL2A 1FLNA 521PA 4O4LB 4BQQA 3ED1A 4J7UA 1G9TA 4QQ8A 1DG1G 2I29A 2XF2A 3U2QA 1X38A 4OXXA 1TYZA 1FYWA 4FONA 3WYFA 1U0BB 4FYVA 3O31A 4C5BA 2NO5A 3KELA 4O4IA 1IEVA 3L41A 1OLOA 3GARA 3SQDA 1Z4PX 2WWFA 2ZT8A 4UHCA 1SOVA 2C03A 2FDRA 221PA 2R25B 1I6WA 3M6IA 3PA8A 3PEUA 3ADCA 2B36A 1Z6QA 3WIOA 1VKOA 1L8OA 4PC7A 4EW3A 1BA3A 1C2YA 1F0NA 1QB8A 2P4HX 3HBFA 1TA4A 1OU0A 3HB9A 4KPUB 4DBZA 1VYVA 1B42A 3TW6A 2P2DA 2MMGA 1YS4A 4YRGA 1EA7A 2ZJ6A 4X8HA 4NEQA 1CJTC 1U4OA 1GZVA 2Q0XA 2ASVA 2HAEA 1SCUB 3MTIA 3NIGB 3EVNA 1VHTA 4KTVE 5L3ZA 3REQA 3ZNNA 4CCYA 1T5HX 4DMKA 2O8CA 3RVLA 4C4ZA 1UAGA 1T1RA 3ZU2A 4B5KA 4FZJA 1BDHA 4KMRA 3KG2A 4TUYF 1JL3A 1T0HB 3L1VA 2PRSA 4M1ZA 3RWMB 2XGSA 2FXIA 2WJYA 1WQ1R 1PEYA 3ND7A 4JSTA 4V0ME 3R7LA 2B0JA 3ZGVA 4OQNA 3SIRA 4KUHA 4CL8A 2GN9A 4FT2A 4EQZA 4JD5A 4AF8A 1DX6A 2BE7A 3B5EA 2QN6A 3MOGA 4OK6A 3DFKA 2H0AA 5AK4A 1S3IA 4HEQA 4XH9B 3G5LA 3T61A 3ZQ4A 4L6AA 3N28A 1PYGA 3F6YA 4IIHA 2HA5A 3NETA 1BE8A 1CS0A 1QNLA 2H4YA 5CLIA 3QLUA 5CJ2A 2HMWA 4HX5A 4OAOA 5FYDA 4KR0A 1ETHA 3DHYA 3RSZA 3VVCA 1XA4A 1W19A 2JFNA 4FD3A 1S2LA 3WWEA 1W85A 3EHDA 3ZVKA 1ZNYA 2VJMB 2FK7A 2TYSB 2FMIA 2PX4A 1FNCA 1O95D 1ZK3A 2D7CA 3AHFA 1WQ4A 4RY8A 1A95A 3JQCA 1H85A 2DKNA 4JLSA 5DI3B 1JUDA 4ZEOA 2PSFA 3WL4A 3L8ZA 4OHBA 1KSFX 2L17A 1D2GA 2NT3A 4ZO9A 5HIMA 3RYHA 4G81A 1ZOIA 1MG0A 2QX9A 2G09A 5A7FA 4HDMB 1TQ6A 1G6KA 3EZ6A 3G0DA 3RU9A 2UXBB 2BMEA 4MV8A 1IYZA 3QTBA 2BMAA 3BWVA 4H0FA 1IBKB 4D1YA 4D9NA 4TS4A 3QWHA 2I3GA 4II3A 1DDGA 4CM9A 4HYTA 3H7AA 2C8LA 1PJ2A 3TIGA 2RHBA 2CNDA 1WZUA 4M88A 1KOFA 3UMBA 1N34B 3RWOA 1FIUA 1B26A 1S6YA 2I65A 2GWHA 2QP9X 1E6EA 3OFJA 3EUEA 1XCPA 5F4ZA 4NZMA 3QNWA 2OZEA 3AP1A 2PS1A 5DTMA 3U4QB 2BM1A 2GN8A 3HXOA 3I53A 5BT9A 3FFXA 2VYCA 3EXHA 1N6LA 1RYZA 4RE5A 4DZRA 2W6OA 1IVSA 4OFBA 1VP9A 3VRHA 1U99A 3NNDA 3CCBA 1HUQA 3BRCA 4LHYA 3P9NA 8MHTA 3DO6A 1P2FA 4H3HB 4BEJA 2ZWVA 3THXB 2ZZNA 1Q14A 4B7UA 1XCOA 3IIIA 4KOEC 8LDHA 1OV4A 4OLHA 5IM4F 1YA6A 1FU8A 4QPZA 3SZ3A 1WBDA 2YBEA 1XZEA 4UM9B 1DXHA 5EIXA 1YMQA 3PI7A 1NVUQ 1FFSA 2WIAA 3HZOA 1FNDA 1XXLA 2F8MA 2G1JA 2WWRA 1PGJA 2EQ5A 1YO6A 3FLEA 4YLEA 3EGXB 2QJRA 3EXHC 4Q1EA 5CBKA 1M73E 5ANRB 3OU6A 2YHIB 4K8RB 4F11A 1RHUA 5FUWA 1A5TA 2CE2X 2HRDA 2VAWA 2HGSA 4D7AA 2VHQA 1K92A 3AEUA 1RU3A 4TLAA 4MVJM 3ZZ1A 2GM4A 1NSTA 4M0CA 4MV3A 1HT1E 3G6KA 3ONDA 3GD7A 4MV4A 3U7FB 2P6RA 1G8PA 1KYWA 1XJWA 1XTKA 4HQ6A 4F4IA 1IJFA 3U7HB 1PWXA 3EMDA 4HWSA 4KIGA 3RB8A 5IK2D 4N3GA 3TOSA 3ADPA 2BBSA 3U7RA 4C06A 2C84A 2OECA 3C74A 3PD1A 2VTDA 1UANA 5U4QA 3GPLA 2ZR0A 3I83A 2XECA 1YI0A 5D2CA 3LX5A 3VPXA 5TEWA 1ONPA 3JYNA 2HT6A 3OT1B 3VTKA 4Y2HA 2RMKA 2G63A 3BFVA 2V7WA 3NTLA 3RANA 3GMSA 3KEGA 4IMIB 4I1IA 4KDFA 4MVJA 5FOWA 1UM9B 2VPIA 1TK2A 3N0TA 2C78A 4EYKA 4EF4A 3GN2A 1GJRA 4CF3A 3CVOA 2VP3A 3WLRA 2PBZA 2JBHA 3A1EA 4CQLA 2ES4A 1WDMA 2OVBA 5COBA 4C2AA 3C3CA 3QBVA 4PHCA 1XR3A 1ZINA 1IMJA 2QN7A 1ECLA 2EX1A 2K5UA 3KHSA 3O1JC 2FW0A 2R1TB 3DD5A 3FX2A 3QWFA 4RA6A 5LA6A 3SZLA 3AJ8A 4FEGA 3VI4B 3WXBA 4A8TA 3GNLA 1PSDA 1JH9A 2FN4A 5CCEA 1IZ7A 2V74B 5HG0A 1T43A 1NW6A 3RFXA 5HYVA 3NVMB 3OMLA 2VDWB 3SHOA 4HAZA 4TT3D 4ZQHA 5FTMA 1UJCA 3QJGA 3EIUA 3FXAA 1LW7A 5FBKA 2WNIA 3TG8A 4X61A 3WP1B 2XYHA 1Y4ZA 2GLUA 4LCEA 3T4XA 3NOOA 4MQ6A 1A7JA 6Q21A 3CVXA 3DZBA 2FRDA 4L4RA 4HNAA 4AF7A 5MFPA 5IN4A 4CHGA 4JJEA 1U8CB 2A9FA 4Y7CA 4M83A 4MQFB 5FWDA 1F8FA 4DIEA 1TVKA 4MI1A 1XXHA 1KVQA 1Z17A 3R44A 4QSMA 5DN9A 3SYTA 3F7TA 5AJWA 2PQ0A 4ZGWA 2VPYA 2V8OA 4CETA 1JLLB 1XUOA 3OJWA 3FHJA 1A2QA 2P6PA 2ZE5A 3A2MA 3BMOB 1B2RA 2P8JA 4I55A 4X64B 3N5CA 2C07A 1HMYA 1YK1A 2CK3D 4JLUA 3UA3A 3ZYCA 3RM3A 1AGNA 2ZAOA 3D3QA 4EJMA 2I2XB 5J58A 2FRDC 4GXNA 4AS1A 4JBNA 4KDEA 4DJJA 1HH4A 1U0OC 2V7EA 2PD4A 3EX7C 3FRJA 1WMSA 2E4AA 5JJBA 5JXWA 1GT6A 3B48A 3FW1A 2JFQA 3RUEA 1EUYA 3KL4A 1CERA 3BJEA 1YRYE 3N8IA 3QEKA 2XJ4A 3NAGA 4WZAE 5HCNA 2OUIA 4LXUA 3T7SA 1WB4A 4QDTA 1VE9A 2VJKA 4XGNA 4ZQCB 2AN5A 3IQIX 4PRKA 2Z5GA 4Q0MA 4XTRA 2IV3A 1SH7A 3VGPA 4LI3X 5DO9A 3H4VA 4R1PA 4U7PB 3AEKA 3BKXA 1I2MA 4MSUA 1CLUA 1RZUA 2IELA 2GNOA 5IM5A 4BRSA 2BEUA 3RRYA 4CIDA 4ENUA 5ADUS 1KU0A 2DLDA 2FQWA 5GWXA 3SLGA 1P5RA 3ONVA 1EUQA 1SB9A 1V5EA 4IVQA 2G0NA 1YS9A 3K0AA 1P2TA 2RHHA 4D44A 4M9XA 2W58A 2D5BA 2Z2YA 4PLWA 3PJRA 1LLCA 4O1IA 3ZKWA 5HGXA 4M76B 3UXHA 2LIVA 1TD9A 2ZSDA 3WLNA 4XB6B 4L15A 3Q5GA 3VR6D 5JDCC 4BEBA 4X41A 2ZDQA 1HE2A 4ZAXA 1GTG1 2BKVA 3C85A 4C0BA 2JLWA 1FVFA 4RELA 1NW5A 2HPZA 2J9FA 3QVSA 1T2DA 3OQ1A 4M0EA 2BFBB 1QJCA 3HYSA 4R4JA 2HSWA 1YDEA 3AVYA 2WU4A 4P84A 1QRAA 1XRMA 1Q84A 2WFZA 1PGOA 3C1OA 1U9YA 1HTTA 3ISTA 3NQ41 3OU2A 3BGDA 1DRUA 5KNDH 1WU8A 3BFXA 3AHEA 2OLEA 1Y9ZA 4XDHA 1ZVVA 1VIMA 2JJQA 1Y42X 4LC0A 3D1VA 4KN5A 1A5BB 1N6NA 1T2FA 2O7SA 4JR1A 3LDFA 4Q9LA 3MS4A 4AKTA 1OXVA 4P7GA 1DUSA 4EL5A 1RI5A 2X8JA 4R2MA 5IW8A 4ZKEA 2GN0A 1E5TA 1RI2A 1Z7YA 5DLPA 3LQKA 3VMMA 3PXCX 4GI1A 5KVSA 1RMQA 1RW4A 1U8EA 3DKKA 3G68A 3NJ4A 4Q3LA 4RDCA 5JO9A 4KVAA 4QO7A 1Z5GA 1H0KA 2ZB2A 4A5OA 2OSVA 3GYBA 3P9QA 1ISPA 1RR6A 1WOYA 4W9NA 5TPZD 2OCDA 4UMVA 4I5EA 4EW1A 5JJKA 5ALWA 4CGZA 3IBSA 5AJTA 3GJRA 3PDWA 1KEEB 4N82A 2C31A 2VWPA 1MGOA 5C3UA 2ZSAA 3K09A 4EPWA 5KOYA 3FOZA 2CEKA 2GD1O 3CEJA 4I4LA 1T2UA 1XDSA 5B57C 1OI4A 5IT5A 2PA0A 2NACA 4ZOLB 1ISHA 3TUZC 4MQLA 1VGVA 2G9QA 3OJFA 4P5DA 1IATA 4GL4A 3IUQA 4PYRA 4W9NC 5IASA 2W70A 3HJUA 2OOSA 3E81A 4FYXA 5BN4A 4IGAA 2O2CA 2CBZA 1F2DA 2OP1A 2ZBVA 4Q9NA 1KY2A 1N1GA 1RWPA 5DN6A 4L5YA 4IVRA 4LYEA 3K09C 3RSGA 1K5HA 3JARA 1NJGA 4EKGA 4UZEA 1ZI6A 2QSYA 1QZTA 4Z1OA 2H7CA 2JIZA 4AULA 2GXSA 2RJ3A 1XZLA 3HKEA 2HU2A 5ES3A 1O8BA 2PVSA 3M6MD 4X65B 4LJRA 3MERA 1PR3A 2ATCA 1YL6A 3GRRA 4HMPA 1EK5A 1LPOA 1UMBB 2ISQA 1W2GA 2B37A 2JDIA 3AR7A 4QTYA 3FOEC 3RC9A 4C1BA 1D4FA 2HFJA 2QORA 4PHHA 3LRXA 4I6GA 2XZOA 1PNTA 2OV8A 4IDEA 3ZCSA 2FH5B 5IF3A 4UMFA 2PSHA 2OZPA 5IAGA 3AHJA 2NTVA 4CN9A 5DULA 2DFVA 3E84A 3K0CA 4RF2A 1TXGA 4ZAYA 3ZDQA 4BRUA 2AYXA 2H2DA 3EFHA 3PFIA 4Y2GA 2E5LB 1D6JA 4W1QA 4AWXA 2AMYA 1PK9A 1OQAA 4HDKA 2R7MA 4ZEVA 2WM8A 1H5QA 2Y71A 6YASA 3O4RA 2IUFA 4JC4A 4YAIA 3DPIA 2GTIA 2OM2A 3SF8A 2P4SA 2JGNA 2UZ3A 4M1OA 4NK5A 3RRZA 5DYTA 1EWTA 4EPTA 1FSSA 3M9WA 4D9JA 5C8YB 5CB4B 3EXEB 4HAVA 1JEAA 1Q1ZA 1IU9A 2FP4A 2FFAA 5AYVA 1OF1A 2AGVA 1K8YB 3K0CC 3O90A 3SS8A 3UXEA 4P8RA 5LMCA 3HLTA 5DNCA 1E2KA 4H7EA 3HG7A 1EFVA 2FPMA 3AR4A 5ESDA 2X0DA 1CR0A 2OE2A 3IAEA 4IRUB 4FHEA 1G64A 2X6TA 4CLOB 2NU8B 4DA4A 2CSXA 1O6GA 2HTFA 4DR4B 3ICPA 3MBOA 3NHJA 4TV8F 2YTZA 4JL8A 3KZOA 1YI8A 4RV5A 3T0IA 3U7JA 4TPKA 3VDMA 3WLAA 4E5PA 1XKTA 3ORYA 3FYDA 3PUWA 1IXRC 3ZW8A 5HOQA 1NI4B 1E2IA 2XA2A 4XSVA 5D5HA 4GPTA 4WKGA 5GAJA 1OLXA 4NXMB 1RLJA 2OEPA 3I5AA 1V3VA 1UXOA 2PGDA 2Z3ZA 5FBRB 4FSDA 2E4XA 3AF4A 3AZPA 4IGKA 5CFNA 1E7WA 2GBLA 4D3SA 4HL6A 4XWOA 3VYTB 2R1VB 4UE3S 3CY6A 3KVVA 1ZITA 2G77B 3Q7EA 4HDOB 2YVQA 4K9DA 4R40A 3QLVA 1U3FA 4B1FA 3PDHA 5A04A 1DKMA 1FVOA 2VDMB 3HYRA 3FYCA 3PRHA 3SC2B 3WGOA 1QCYA 2LNDA 2GN2A 3EYAA 5DCUA 3WDLA 4PG4A 4Z0PA 3IOYA 3QY9A 3EG9A 4OI4A 3INTA 3KWJA 1W46A 1P77A 1YC2A 3S28A 2JAOA 4XYLA 2BFFB 3A1SA 4TM7A 3TNJA 4AJ9A 1IBRA 2Q5FA 2OM6A 2O2HA 1NMEA 2GBLC 2PLNA 2RAUA 4ZYXA 1GRVA