3RH0A

Corynebacterium glutamicum mycothiol/mycoredoxin1-dependent arsenate reductase cg_arsc2
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
128
structure length
127
Chain Sequence
b'MKSVLFVVGNGGKSQMAAALAQKYASDSVEIHSAGTKPAQGLNQLSVESIAEVGADMSQGIPKAIDPELLRTVDRVVILGDDAQVDMPESAQGALERWSIEEPDAQGMERMRIVRDQIDNRVQALLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARSENATE REDUCTASE
publication title Corynebacterium glutamicum survives arsenic stress with arsenate reductases coupled to two distinct redox mechanisms
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Oxidoreductase
total genus 41
structure length 127
sequence length 128
chains with identical sequence B
ec nomenclature ec 2.8.4.2: Arsenate-mycothiol transferase.
pdb deposition date 2011-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rh0A00
4OLAA 2MSKA 1QQAA 1DJMA 5TPWA 4Z99A 2FEPA 4GNRA 2DRIA 2PE5A 3URMA 2NUBA 3H5WA 1QMPA 1MB0A 1JX6A 4MS3B 5E3JA 1Z2DA 3QX9A 3LKVA 4JB2A 4CBVA 4MRMB 3EQ2A 2FEKA 2L17A 4W5NA 1E6KA 4RK4A 2PKXA 3HDVA 3OM0A 2HPHA 2R25B 4MS1A 1MB3A 4N41A 5KQGA 4KK3A 3HEBA 4RU1A 2HQOA 4KQ9A 2P9HA 2MYTA 2FTKE 5EWLB 3TD9A 1P8AA 2VK2A 2L18A 2QXYA 2NZUG 3QELB 1DC7A 4OBBA 5CNIA 5HM6A 4XXHA 1LBHA 5I4CA 3HVRA 3QLVC 2WMYA 2IPMA 3CG4A 2QR3A 2FQWA 3N8IA 1JDPA 1XHEA 4EYQA 4Z4CA 4UHJA 2J48A 5C5EA 3OQMA 2FLWA 1A04A 1GUBA 2CHEA 1RZRA 2NT4A 4WWHA 4E7OA 4RSMA 5KQLA 4G0YA 2E4YA 5IEJA 3KYJB 4O1HA 5KQPA 3N0RA 3QLVA 1XHFA 3KLNA 2F8SA 1F51E 3A3KA 3I42A 2XDYA 4Q6BA 5KC9A 4XLTA 3N6VA 3ILYA 1FSPA 7ABPA 5HKOA 4KNYA 1RXIA 2PUDA 3BRSA 2A9PA 2HSGA 2WJAA 2CD7A 1ISSA 4WXEA 3LKBA 2F8TA 2H3HA 1NATA 3I45A 3IPCA 4G0PA 4MAAA 4RKRA 3RVNA 4OG2A 3HZHA 3HV2A 1GLGA 3EAFA 4W5RA 2ZAYA 3K9CA 3E3MA 4HNQA 3N75A 2WJWA 4KK4A 4QICA 2MYUA 4YP9A 4F8JA 1VPWA 4G0MA 1E6LA 3HUTA 4KQCA 3GL9A 4RK1A 2GX6A 1U04A 2ID7A 5T7BA 2JVJA 3OO1A 2JBAB 3SQNA 1T34A 4YWHA 4RK6A 3GBPA 5PNTA 4G97A 2CWDA 1PEYA 4EYKA 5IULC 4MS3A 3CG0A 3LUAA 5IBQA 2FMFA 4KMRA 4MRMA 4KVFA 5KWSA 1E2BA 1NTRA 4Y9TA 1AB5A 3CRNA 5FWYA 2KYRA 3JS5A 3M6MD 2MYNA 3H5TA 4WT7A 6CHYA 3FFTA 4E7PA 5EWLA 5BR1A 3TB6A 3JTEA 1VRVA 1SRRA 1NXXA 3ROTA 3IPAA 3NNNA 3QELA 3RVMA 4D74A 4KPYA 3CU5A 4MLDA 3GBVA 3O2SB 5B3JA 2FQXA 1TVMA 1QQBA 4YCSA 3BBLA 3DBIA 4JB0A 6ABPA 2ZWMA 1Z12A 4KZKA 4MQEB 2VUHB 3CS3A 3N0WA 3QEMB 2W42A 3EQZA 1KRWA 2RJOA 3H75A 2PUFA 1A0OA 5TPZA 4H3HB 1D5WA 1APBA 1Z17A 2BGGA 1TLFA 1OXBB 3S99A 4NCAA 1BAPA 3IP5A 1JLKA 3OLWA 5FWXB 1D4ZA 3OLVA 5TQ0B 1DP4A 3H6HA 4FE7A 4PICA 1LJUA 1QO0D 1K66A 3P9YA 2WWVD 1WETA 2M98A 3KYIB 4WZZA 3GA5A 2GWRA 2V0NA 3FGZA 5IUNC 4RY0A 5JNRA 1EHCA 2RJNA 3H1GA 3MF4A 1TMYA 3MQ4A 1OXKB 5KC8A 2PLNA 4G0OA 2JBAA 4N76A 2L2QA 3QEKA 3NNSA 4LDAA 3CTPA 1NXWA 3HM9A 4HYEA 2MYPA 4MGEA 3RQIA 4RXMA 3KG2A 1LK0A 4JOQA 2HQBA 2FW0A 1KGSA 2IPNA 1D1QA 4PZ0A 3UK0A 2PUBA 3Q7SA 3HXMA 1NXVA 4Z4IA 4RK0A 1SXGA 1P6QA 3QK7A 1YMVA 4D6XA 1BDJA 3C3KA 4OTZA 2B4AA 3A0UA 3CNBA 2FQYA 2LP4Y 3D02A 4OLBA 3TMYA 5FBKA 4KRFA 4TN5A 1Y1LA 5CNKA 3IDOA 4LE1A 1ABFA 4W5QA 4LE0A 9ABPA 1SXHA 5GQSA 1IIBA 1JYFA 4N47A 4NQRA 2MSLA 2PAFA 3L49A 3O1JC 3SY8A 1YTUA 1TM2A 3OMXA 4PEVA 1JYEA 2RGYA 3C97A 4H3KB 4DADA 4EVQA 1ZGGA 5IX8A 4ETMA 3RVOA 2R48A 4PYRA 4IMJB 4MQEA 2E4ZA 5ABPA 1EWVA 3QEMA 4ML3A 1M2EA 3HDGA 2FN9A 1PNRA 3RVJA 4KV7A 4LZLA 4QPJC 4W5TA 4ZPJA 1BVHA 4JASB 2PUEA 1MIHA 2E4XA 4MR7B 1RNLA 1YS6A 3CLKA 3H5LA 5JNWA 5JNTA 1ABEA 3NNDA 4P98A 5FWXA 1U2QA 2A9RA 1SD5A 1EFAA 5TQ0A 3N53A 1ZY2A 5EWMB 1JWLA 4JP1A 4W5OA 2HQRA 2M1ZA 4NICA 3RVKA 2IPAB 3KS9A 2PUGA 3H5IA 3SG0A 3K4HA 5BRJA 5C5CA 4NCBA 2WRZA 2P4UA 1LJLA 3F6CA 4LDZA 3Q9SA 3KKEA 4NV3A 3KSMA 4OATA 4QYWA 2QVGA 2IYNA 2QU7A 2R4QA 3O21A 4F3TA 4LX8A 4TMYA 3HSYA 2LUOA 4Q7EA 3RVLA 1W9HA 3EJWA 3FDFA 5DTEA 1CEYA 2YHAA 2O20A 2E4UA 1F4VA 3SM9A 1QP7A 3JPWA 1PEAA 4IGAA 1CHNA 3Q7RA 4RK5A 1ZN2A 4XFKA 1JFVA 2Q5CA 4YO7A 1YIOA 3A10A 3FFXA 2LIVA 3CZCA 5D2CA 1ZH2A 1VKRA 3LFTA 3CFYA 1L5ZA 1JH9A 1L5YA 2LPMA 1NXOA 4IMIB 4ZYLA 1YMUA 2JVIA 5F64A 4EY3A 1K68A 4IRXA 4RDCA 1USKA 3O2JA 5BQ3A 4XASA 1ZGZA 5DKFA 4N0QA 5HQJA 4Z0NA 3RVQA 3KTOA 4B09A 4F12A 3RVRA 4S05A 4XARA 2AYZA 5KI6A 1ZESA 2R47A 1DRJA 3JVIA 3LUCA 3JVDA 1C4WA 2FXIA 1QP0A 3OLYA 2A9OA 2ID9A 4YGXB 5IUJC 3O1IC 1C0EA 1ZH4A 5EWMA 4DQDA 2PUAA 3MMNA 4YLEA 5TQ2B 3IP7A 2GKGA 3M9XA 1W25A 2QVCA 5TE9A 3N0XA 1KMIY 1J56A 1DCKA 3W9SA 3O75A 4O1IA 1DCFA 3QLUC 4TLLB 1JFTA 3SNKA 4FB4A 4IILA 1ZAYA 1BA2A 2FMIA 4MYRA 4ZJPA 3HO1A 1CYEA 1USGA 4PE5B 5TQJA 3RVSA 3OQNA 4S04A 3BREA 4XAQA 2AYXA 2GBPA 1DG9A 1SXIA 4RS3A 4WUTA 1M5UA 3GV0A 1Z26A 3OO0A 5HSGA 3OQOA 4JAVC 3FFWA 1KRXA 2QV0A 2I6FA 1PHRA 4RY8A 5CNJA 3TO5A 1Z16A 4RXTA 1Z13A 5ED4A 3KJXA 1JFSA 4M88A 1NXPA 1YS7A 1ZITA 1JHZA 4ETNA 1FFWA 1A2OA 2NT3A 1DBWA 3TX6A 3B2NA 1GCAA 1U8TA 4MS4B 1URPA 2FMHA 4KREA 1Z2EA 1YVUA 5IEBA 1MVOA 3Q41A 3NBMA 4RWEA 3T95A 3DGFC 4RY9A 3O2QB 3H6GA 1USIA 3GYBA 4MR8B 5BRAA 3DLBA 1YK1A 2X7XA 3G1WA 1BDIA 3CHYA 2E4VA 1QKKA 5EWJB 2PMCA 2VUIB 5KQMA 2CHFA 3I09A 1P6UA 1R8JA 4YS6A 4N0PA 4RKQA 1E6MA 1YK0A 3T38A 3G85A 3LUGA 5FWYB 2JB9A 1DZ3A 4HNRA 1D2AA 3C6QA 2FMKA 3F7NA 4IF4A 4F11A 3DLHA 3C3MA 4L4UA 1VLZA 4EVRA 1JF8A 3IP6A 1RXEA 1Z25A 4EVSA 4YRZA 5JNVA 3A0RB 3OM1A 1QO0A 1M5TA 3GRCA 4GPAA 1Z18A 3OLZA 1DCMA 3F73A 1D1PA 1JL3A 4MQFB 1ZDMA 4N03A 1PUXA 1U0SY 1NXTA 1JBEA 3T8YA 5DCLA 1DBPA 3LUHA 3EULA 4L85A 3LUFA 5IC5A 5TQ2A 3MM4A 3NHMA 2FLKA 3EODA 2PUCA 3MA0A 3HCWA 1PNTA 3HK2A 2MSWA 4JA2A 3NHZA 4G0QA 5DGCA 5JNUA 1RPJA 3DGEC 1NXSA 2FSPA 2PJUA 3D8UA 3H1FA 5TPZD 3F6PA 1U2PA 1AB6A 3RVPA 4KFCA 2VYCA 4MR9B 1ISRA 4RV5A 4Z4HA 3QX8A 4ETIA 2HJ9A 2A9QA 1MAVA 3FMVA 3HJFA 4G86A 4RZSA 4P1ZA 4UHKA 4Z9AA 5CHYA 4YV7A 4LE2A 1QPZA 4D6YA 2QW1A 3BRQA 4MS4A 1I3CA 4Z9BA 1LBIA 1B00A 4EYGA 2H0AA 3OMWA 4ZMRA 4QYMA 3ILHA 5TPWB 3C3WA 1FFSA 3ROFA 4WXMA 3Q7TA 3LUDA 1M2FA 4MR8A 2PL9A 3MIZA 4RXUA 4EGSA 2TMYA 8ABPA 3I5AA 3E61A 5JNSA 5DLEA 5EWJA 2IDMA 2GI4A 2LBPA 3OLXA 1HEYA 4MS1B 5GOTA 2IPLA 3GT7A 3Q15C 3IP9A 5B3JC 1S8NA 2OENG 3HS3A 4EUKA 3L6UA 3O74A 3KLOA 4Z4FA 2E4WA 4MLCA 2YHBA 3H5OA 3LOPA 4Z4EA 2JCGA 2FKAA 4MR7A 1DC8A 2IKSA 1DBQA 1BDHA 4Z4GA 3KHTA 1NY5A 4ZMSA 3QLTA 3VNAA 4HNSA 3VNBA 4F06A 3LUJA 4MQFA 3UKJA 1Z15A 2N9UA 1TJYA 4EYOA 1DRKA 3JPYA 2FN8A 3JY6A 3LMKA 1GCGA 1ZHHA 2FEWB 2JK1A 4MPTA 4RK7A 5JS1A 2PL1A 3DZDA 2L19A 4LRQA 5FBHA 4DN6A 3CKMA 1EWTA 1JDNA 3EGCA 1XWWA 3SAJA 1FFGA 3LUKA 1RZRD 3EDCA 4YR7A 4H60A 4TLMB 5CNMA 2OQRA 4G0XA 3RH0A 5T3YA 4Q6WA 1H9CA 1QNLA 3HUUA 2B1JA 3LTEA 3KCNA 1P2FA 1EWKA 2NZVG 3MYYA 4O5AA 1EAYA 2QSJA 3O1HB 1ZVVA 2FVYA 3GWGA 3M9WA 4MR9A 2WY2D 3QLUA 2RDMA 3CZ5A 1FQWA 5JS2A 3H1EA 2IOYA 2WB4A 2JVKA 1UDRA 2QZJA 4G0ZA 3BILA 3T6KA 4FE4A 5IUKC 1GUDA 3UUGA 1QP4A 2JRLA 3R0JA 3H5VA
chains in the Genus database with same CATH superfamily
5B64A 2BFBB 1QQAA 1X1BA 1R37A 2GHRA 4I9NA 1W7AA 4OCZA 2HV8A 1YFKA 2B1QA 1GSHA 2H0QA 1IEQA 3TBHA 1GZDA 1YKGA 4J16C 3GRZA 2PSFA 2ZR8A 3AUUA 1PDOA 3AHEA 4QAQA 3QI2A 3WRYA 1CQXA 4A8JA 4MS3B 1QXSA 3Q98A 3I2HA 1V5GA 5IXJA 1A9ZA 3CRVA 3OVMA 1XTRA 1O96B 3ND7A 4ILEA 3ZV6A 3H13A 4FMBB 4WLFA 1F0YA 2OC9A 1E9BA 2OK7A 4K88A 4KPFC 1E5XA 2VSFA 4UUMA 5GV8A 1L5HA 3TLBA 3O03A 2JH8A 3WAKA 3O31A 3PBKA 4IQ0A 4ZCPA 3ZI0A 1US8B 3UATA 1PV4A 3AXTA 1DAPA 3D4BA 1W4CA 4XDHA 2P2ZA 4B2PA 5EHQA 2QXYA 4CIWA 1MPTA 1DC7A 1RVV1 4K3UA 3SQXA 3W4IA 5EIBC 3THSA 1A5TA 1XKTA 4I99A 4MGIR 3G0IA 3ZHUA 4LTMA 4K0KB 1WCIA 1OWPA 1Y33E 5FLEX 3FPJA 3AQIA 1KK1A 3LP8A 5I45A 1VPDA 2J48A 1ZLXA 3OQMA 2XZDA 4XGQA 3IAS1 3V9PA 2NT4A 3PX2A 2XF2A 1Q0UA 1Z39A 2HK7A 1JEYB 5EMKA 2VPQA 1ZM2A 3LDGA 3ZVNA 1C1DB 3U6BA 3QLVA 3WSVA 3KLNA 3PGXA 2GZSA 4OB6A 1DX4A 1F51E 1KSFX 2CXQA 3AHJA 3BSFA 4X9XA 2JGRA 5KNBH 1EI9A 1T2FA 3WBKA 5JECA 3EEIA 2W2MA 4FYKA 3O38A 1FSPA 2WDPA 5ARBA 2WLSA 4HFJA 4CIVA 3K35A 3WGOA 5AM1A 3DYIA 2FPPB 4YEDA 1LK5A 1H2RS 1T9DA 4AZTA 3SDBA 3GT4A 1NUQA 1FTWA 2YJZA 1M34B 3KHKA 2AV6A 5BSVA 4YXFA 2IHVA 2I71A 2X41A 4NZMA 5KS2A 3IVRA 3VMMA 5I4KA 3V33A 1RBQA 2XWQA 3ADOA 4RZIA 2I7CA 4CKWA 3NHLA 2F3PA 3Q12A 2OZLA 2JVJA 4EG0A 3UJHA 3QF4B 2B61A 4YY3B 3T4EA 4I7EA 3CE6A 2Q8QA 3TCXB 4BNHA 1AQJA 1RC0A 4GKJB 1GKYA 2C03A 5IK2A 4ND3A 4AWBA 3E2IA 4LNAA 2AZXA 3BCHA 3ELYA 1KJJA 3V6MA 1QIGA 4LJSA 1KAOA 4I36A 2I29A 3C24A 4CF7A 5KYXB 1ULHA 5DWQA 1JI0A 6Q21A 1USVA 1DJOA 1RYBA 4XIFA 4EO7A 3O8RA 1LPOA 2BOVA 3OPYA 1TA4A 4RLQA 2KJQA 3NCTA 2H11A 3NBXX 3ND5A 4Q05A 1LKZA 3FCCA 3FR7A 3CH6A 1LH0A 1JXQA 3OAAD 5C8XA 1XPRA 1FUKA 4FHEA 3T35A 2AKAB 3FE2A 4MW4A 1XPOA 1MENA 1L1RA 4QM7A 4DJDC 2VHJA 4PYNA 2VLIA 2FFJA 5G3ZA 3HHEA 6ABPA 1LCIA 4MQMA 1UMDB 2AC7A 1EP2B 3AFMA 1RAIA 2DTDA 3CS3A 1G6OA 3LCCA 2B3TA 4U7DA 4DIKA 1X9GA 3FWPA 4J0IA 3T3HA 5LXTB 5GVSA 3J7TA 4BXOA 4HH0A 2YV4A 2DPGA 3ZWVA 1Z47A 3GAFA 5EQTA 1I4WA 1WMDA 1Z17A 1FCJA 2C8JA 3WQHA 2PJZA 2Q4OA 2RCNA 4LFCB 2RGDA 3MBOA 4BPRA 2I1LA 2Z4SA 4D4HA 4DLNA 2B37A 1CQIA 3D54D 1B23P 5I8ZA 4KR3A 2FYTA 1VIMA 1NY6A 3WGQA 3RYHB 4JLVA 3VDMA 1CZNA 1R4ZA 2ALJA 4IZIA 4MTLA 5JUWA 1PSZA 2GD2A 3W8DA 4QYSA 3U44A 2X76A 4J94A 1OVGA 4HDAA 2H7XA 4BV8A 3WZMA 1GTSA 1FJGB 2H00A 2VLBA 4GPIB 2WOOA 1DUIA 5G0SA 1U9IC 3O8DA 5CLJA 1VKZA 3W2HA 1AGXA 5JNRA 2RJNA 3R74A 2QPAA 1QYXA 1NR5A 3LPNA 1YR8A 4UEQA 4UUQA 2M6SA 1KI9A 5CDTA 3NU1A 4HBGA 4L75A 1KPIA 2BEUB 2ZQYA 5HCNA 2H4WA 5KC8A 1GL9B 1O1YA 2QROA 5CM9C 3ER6A 1XVVA 3NBQA 4ANFA 4UTRA 4LDAA 4XB2A 4MVJA 3AOEC 5FT9A 2WKPA 2IK8A 1LLUA 4BO2A 1YFJA 2WQ6A 1UM9B 1M2WA 1CUCA 1SK8A 1D1QA 3D7SA 2JH9A 2GN1A 1Z45A 2XW6A 4TV8B 1SXGA 2HGSA 3LLVA 1MFZA 1RLUA 3S8YA 1D0SA 1C9JA 4FCCA 3R2JA 5JROA 3ZE7A 5FUXA 1NSTA 4RAQA 1IUPA 5JJCA 4BLSA 2WWYA 5BW8A 1AZWA 1K63A 1XA3A 3C43A 4RKFA 1S7GA 1K88A 5HEKA 5LBUA 4KR6A 1OX5A 1LBSA 2Q4RA 5KUTA 2IEDA 4G4IA 1EGMB 3ROGA 4PIPA 3SPXA 1ZINA 2A3RA 3LQQA 3BWMA 3Q3IA 3OMXA 4LYJA 1JRLA 1PL8A 1PZHA 4RX1A 1XKXA 1KJNA 3MCTA 2D13A 4FR0A 3KD3A 2R48A 4D3FA 2ZETA 4HFMA 2Z1DA 3QUCA 2UYCA 2JIRA 5IAKA 2F4NA 5LA6B 2NQ2C 3K16A 3F1LA 3WOHA 1G18A 2WABA 4CEIB 4NMMA 1ZPDA 2JJ2D 1NG1A 4MR7B 3WVNA 3M1YA 3RIGA 1TZKA 2V6IA 1G8MA 1P7PA 5JCOC 1BEEA 2JAUA 1V0JA 2PU5A 2DR0A 3K1YA 4L16A 4PZYA 3RABA 5IJ9B 4JROA 4ALNA 3LUBA 5GWXA 4RVHA 1JJAA 4KXMA 5KDLA 2P9QA 3N53A 4OJNA 3TJRA 5NLLA 3HJHA 1EXVA 3DZCA 1T2VA 4MMXB 3OT5A 3TXAA 4AWAA 4QBHA 1AVTA 1C3JA 5IXYA 2KMLA 1A4IA 1KL7A 4N6OA 4QXMA 1TZBA 5TARA 1CNFA 1SUAA 3FDZB 2FOIA 4OFZA 2R5NA 1OXUA 4MUMA 3INRA 4QPCA 1VG9B 5TY0A 5K0SA 1IM2A 3TF5A 4NV3A 4W63A 4FEGA 5AKJA 1CQPA 2IYNA 3WSWA 1N5JA 1Y0BA 1UJNA 4O4IF 4R0NA 3R23A 4J1TA 1YDEA 1LPNA 4QGAA 4AY3A 1EFVA 3N2YA 4TKZA 3KK0A 1SQFA 5T4HA 5FFNA 5ALDA 1HG0A 3QTBA 1ZNQO 4UHEA 4S0ZA 3EJWA 3SKVA 4K0RA 4KITB 1SNYA 2PZBA 2XKBA 3D3JA 2XEXA 4OU4A 1EDDA 2EHDA 3IMKA 2OCKA 3DW3X 4QO8A 4EZBA 2FQ1A 4HGYA 4LNUA 5F3RA 1L3IA 1YB1A 2RB4A 4EFKA 2XQIA 2OD2A 1TECE 3CGGA 4Y9DA 2ATVA 3FFXA 2LIVA 3AI1A 4B3FX 3ID6C 3NJRA 3TFWA 2FFQA 5LLDA 4JBGA 1NXOA 4WKPA 2X5OA 1DCTA 4NJMB 4W9RA 1E3LA 3KYDA 4E21A 3FWKA 1QUEA 4KR9A 3QSYA 3ED1A 3HVIA 3HYTA 3C7DB 4CG1A 3NUZA 1AXRA 2P9GA 1JHYA 1M2OA 2VUUA 3ZWOA 1E3DA 1Z4LA 3E8XA 3RRJA 5ITVA 2Z4TA 5LP6F 1XUOA 1XRRA 1CB7A 3BF8A 3UC9A 5JBIA 3ZKWB 3EDQA 1N6IA 1HNNA 3M4XA 4WOPA 4LPKA 1GDHA 1BXRB 5FPSA 2XT9A 3WNZA 4F12A 5C1PA 5LQDA 1KFKB 1TKRA 2I4MA 3KJGA 3VFDA 2M32A 2UXDB 2D8AA 5JTUA 1QB8A 2ZB7A 1JAIA 4CBVA 3H9GA 2H7CA 3K0CA 1Y9EA 1ACJA 5COAA 3K0KA 3BWVA 4JCOA 5ECYA 4JXXA 1HTWA 3PIIA 4BGVA 4UBKA 4WPGA 3ZUPA 4O2AA 1TM4E 1W85A 1C0EA 3A8TA 2WA2A 5EXDA 2IDKA 4I5EA 5EZSA 1GU7A 4RA6B 1XEWY 5A9SA 1SGWA 1YRHA 3ONFA 4N3CA 5LYJF 2JGMA 4MQBA 1KIAA 2OOSA 1XRNA 4KXYA 4PYOA 5GGXA 5I3ZA 3UCEA 3OE4A 4K28A 2PGAA 5ALIA 4MYRA 1RRVA 1T9HA 4YXWA 4HS4A 2DUJA 1YASA 4OAOA 3RS5A 2X7JA 2YCLA 1NVWQ 2V4MA 4NONA 3FB1A 4XVHA 1PFUA 3UJBA 1DELA 1G3IA 3UXEA 3ZIAD 1ZJWA 3LBYA 4U5XA 5SYNA 4A92A 3HL0A 1CB0A 3LL4A 4FBMA 3PIRA 5C3MA 1KZ9A 1SOMA 1PTJC 2OBMA 1NPYA 4TKLA 1AKWA 3PQ2A 1TQ2A 3T9BA 3VZSA 4HGOA 3W2FA 4EDHA 1L7RA 4FFPA 5FTKA 3R20A 3H2IA 3U4CA 2XQFA 4BVAA 3LSYA 2ZR9A 4D0NA 1KFCB 2A5FA 2JJYA 2ORVA 1GZ6A 1LNSA 1OFUX 1YHYA 2VEOA 2ZIUB 1KJIA 5DTRA 3U3JA 4U3JB 4Q4AB 1MT0A 4R8MA 2ZZMA 1RQNA 3OFVA 1K27A 3OPNA 3TR6A 3V2HA 3P9XA 3ZJUA 1E0JA 1KJ9A 3K6SB 2TMKA 5COQA 5FP0A 1EDBA 1H5QA 3D64A 1NTOA 2QLBA 2VUIB 2X1VA 4MB6A 5E3HA 2G06A 4RZXA 1OI7A 3EGWA 4DKJA 1A98A 1OT5A 1UT5A 4MCJA 5H4HA 2G5GX 1DO2A 4JKYA 3NTRA 5FWYB 4BQIA 3ZU6A 3MTBA 4G9EA 1RT9A 2JARA 5LZ7A 1EK1A 1M76A 2XR1A 4G1EB 4KNVA 2J87A 1K3FA 1SXJA 2Q6VA 2YWHA 3EXHA 5M5BA 4FD2A 4JUIA 4RJKA 2O7SA 2ZLBA 2ZRNA 3KVOA 5E2IA 3SXUB 4US2R 5DBOA 1M8KA 1AZLA 1E77A 2YHIA 3TQRA 5K03A 1TM7E 2IZOA 4KIGA 4WNCA 5J2UA 2PKQP 2R6GA 4Y30A 2KW5A 2RGUA 4AP6A 1RFGE 5M29A 2A84A 2E2WA 3KOZA 1MTZA 2WUFA 1YRWA 2Y92A 3QMPA 2BLNA 3IHTA 4MPDA 1I0LA 2G1KA 1M2VB 2QN9A 3RYIB 5LMZA 4AQYB 1QOZA 4Y1GA 3VNUA 1CC1S 2W7TA 4PRYA 4WDRA 5E38A 2HQSA 3L1VA 4BDTA 2OD9A 3RUHA 4JX8A 1NM5C 1GL7A 4B7XA 2P3QA 5B58T 1Y8CA 4MNTA 4BKOA 4CDMA 1ZW6A 1WXGA 3LC1O 1PDVA 4HWPA 2ODAA 3H1FA 2F1HA 4R1OA 3RSHA 5LQCA 4TLDA 4FLMA 5MFZA 2OA0A 3NHFA 3QPAA 4FGUA 3VNQA 3G89A 1JEDA 4YUVA 4HN9A 1DAKA 3QYPA 2O19A 2Z5GA 2V7UA 5FL7D 3RC9A 5EE5B 2IY8A 4BNGA 4PGGA 5KCMA 2IC5A 4OSPA 4ZQIA 4HFRA 2AZDA 2ZSAA 4IGKA 2QVXX 5HVNA 5CLIA 1T5SA 3TDKA 4ZQFA 4G86A 2AE2A 4KPEC 3PTAA 3D8RA 1Z29A 3ZJ5A 4C1BA 4IV0A 2IBTA 3RRBA 2B25A 2VNSA 4Z9BA 2ZYAA 1KF0A 3THXB 2XQVA 4ZU3A 4N5DA 3R7DA 1OH7A 2CNWA 3WWOA 2R1VA 1UKBA 4UFOA 3TSZA 4WXMA 3WA7A 4PGMA 3BE5A 2P9TA 2Q5LA 4CRWB 1GQ2A 2E6KA 4RXUA 2YHSA 3NHYA 3DAHA 1KJQA 3LKDA 2I76A 3GT0A 1XAIA 2BP7A 1DT5A 1KR2A 1FLVA 1Z4JA 3OZCA 2ZE5A 1XD2B 3DE0X 1SK9A 5B3JC 3F6YA 4I50B 5AVWA 3ZU2A 1XEXA 1WABA 4Z4FA 1G16A 4AG5A 3VO9A 3AVXA 2ASEA 5JAIA 1X6VA 3FDIA 1UBUS 3MD0A 1DC8A 1Q95A 4A5SA 4AI6A 2QYTA 3U7GA 3Q7PA 5CAEA 3B89A 2YUTA 4BCCA 1QHGA 4RTNA 3HFRA 2AOXA 3TG8A 1HE5A 2GCOA 4H7FA 4AMGA 1OROA 5I7WA 3DONA 4RZQA 4XM1A 2QN3A 4YCAA 1KDOA 2GNPA 4BQQA 4B45A 1AHHA 4MGKR 4WCFB 1JLLB 1NQTA 4LRQA 5DI3A 2CXXA 3FUCA 5KTOA 7AT1A 3OFSA 1ND6A 1GARA 4C2BA 3FB4A 3RT9A 3DBLA 2EG9A 3EGCA 4G9GA 3WWEA 4AJ2A 4YPOA 5A9RA 3WGYA 1IMJA 1R74A 3NWPA 1NF3A 3IH5A 3R0IA 2G77B 3AEXA 4HDMB 3FFBA 1EXNA 5KKNB 3CJTA 4LQCA 4ES6A 3UT0A 2K7FA 1KHTA 3VX4A 3RK0A 2A86A 1AS2A 3FRHA 4TV9F 5IBPA 1G5RA 3MQ2A 1IZYA 5AVVA 2J8ZA 2D2FA 2G1UA 5K8VA 2IIQA 2DWQA 2GXUA 3BK7A 1PT8A 7YASA 4WH0A 3PP8A 4EPTA 1B1CA 1VE6A 2VP0A 3H1EA 5AK6A 5B7NA 4NXMB 1RIIA 5LQKA 2RHBA 5CURA 4HQLA 2ODNA 2RI1A 1FFEA 2ZZKA 5CPFA 4Q9JA 2Q5HA 1P0FA 4D8TA 1B3RA 3LPLA 3ER8A 2QR5A 2RGBA 3R6TA 1E9DA 5JAQA 1X1AA 4XPZA 4NHEA 3W6PA 3IE0A 3RB8A 4MV0A 4E5DA 1DHRA 2P41A 1JKIA 3JVVA 4U5QA 5D3KA 3URMA 3VBCA 2NUBA 2WM3A 4RH3A 4OQXA 4DAEA 1UXOA 4XVUA 3H5WA 4TT3D 5AI9A 2IEYA 1DJMA 1ZJYA 4JBHA 3HBMA 1K4KA 2L17A 2PSJA 3H2JA 3FPFA 1E6KA 1YBHA 3H8SA 3Q8MA 1KOJA 3HDVA 3OM0A 4MS1A 1W0KD 2E7ZA 4R3WA 4OHZA 1AK1A 3UMGA 3CURA 1DT3A 4B5LA 3DH0A 1QF6A 3T9AA 4L5JA 2C84A 3W8NA 3VR6H 3MNFA 3ABQB 3L0ZA 3D8HA 3BKWA 4WCFC 3P20A 1WXDA 3GRKA 3A1FA 2Z5LA 2ZVQX 1UUFA 4BVBA 3LK6A 1JHDA 2D8MA 2XCIA 3KPJA 2W5UA 2IPMA 2W2XA 1V95A 3O47A 4HG2A 2MWMA 3ZR4B 1FVXA 1XNRB 1V43A 1O6FA 1XTIA 4Q4LA 1QH0A 4N48A 1B8NA 1F5NA 3U0VA 3VZDA 3JCZA 2V9ZA 1FNNA 3VU9B 4J8PA 3AEQA 3PS9A 1VBNA 1DB3A 1X8JA 4O1HA 3M83A 4BGUA 2UZ4A 2CJFA 3ILVA 1I9CA 2JBHA 4RDHA 4BE4A 4A0SA 5K8IA 2F8SA 4RHYA 1CUHA 3WG9A 4BFTA 5K8TA 3IMCA 4IO0A 1QIDA 3HYSA 3IAM1 4IINA 3MSXA 4ZO8A 4EHAA 4O3MA 3NG1A 3WLAA 2IYFA 5AKYA 4JJFA 1N2OA 3X1WA 1MDFA 1MC8A 2BGNA 3AY6A 3EIHA 4MAAA 4G01B 3TNJA 4BNNA 3HZHA 3HV2A 4GVPA 3C85A 1EK5A 4ENRA 2IH5A 1F17A 1N2JA 3E3MA 1X7YB 4XW2A 1RM0A 3IUSA 4QSMA 4DUGA 5H5JA 1O08A 3VYTB 3A4IA 1PQYA 4G4SO 4AG3A 1PJQA 3WI7A 4C5AA 2NXEA 1BS2A 3C3XA 1UODA 2QLFA 3M3HA 4PG6A 3TH5A 2HLDD 2DH6A 3SQNA 3AESB 1EAMA 4JGIA 4X84A 3GBPA 1QFYA 2WYVA 3JQFC 1KZ4A 1YKFA 2CWDA 4G97A 4NKRA 3MWEB 1A1SA 4HVTA 5FQOA 3ZIDA 1YVPA 1AM4D 3PNQA 1NPTO 1ULSA 1MVNA 4OQZA 4RVNA 1UFRA 5HYVA 4JJAA 5JY1A 1W49A 5F1OA 3T5CA 2C7GA 3GFQA 3SR3A 5BVGB 1B14A 3AEZA 8GPBA 4CR7A 2GWHA 2R2AA 2P1DA 1VI6A 4UVGA 4Z0HO 4CGZA 3OZVA 2WUVA 5A9TA 1JFFB 4OQLA 5AI5A 1HE4A 2NN3C 2JHFA 1JIXA 1AO3A 4U7FA 4DNFA 3NHSA 2Q8PA 1SXJE 5D86A 2QRQA 5TRTA 3UWPA 4G1MB 2PH3A 5C7IO 5MN4A 1XJWA 2G88A 2YFKA 3E82A 3DT8A 4FDAA 4TYQA 4H6WA 4QRHA 3EGOA 5EPUA 4C14A 5IM4A 4F72A 1M2NA 1T0UA 1TVMA 2CL7X 2NV0A 3CRRA 4OHOA 5ES3A 2PQ0A 5TNXA 4CMIA 3CMCO 3PU6A 4GQIA 2C8VA 1W5EA 5EJ5A 4JOCA 3P8ZA 1TUBB 1WE2A 1SUCA 1VL1A 2J7KA 4ZIRB 1TYCA 2BKXA 1LLCA 3GFVA 3PHBE 1AZTA 2PUFA 4H3HB 4D02A 2XYGA 4NBVA 3DLCA 3DV0A 2O8CB 1R4MA 4J2HA 4UU8A 1ECCA 2IEZA 5T6MA 3S99A 1JG1A 4NATA 1ZIXA 4TTPA 2OXRA 1XNGA 4L1KA 5CIWA 1XZHA 3CLTD 3T3GA 4AJ4A 4XH9B 4IGEA 4OYHA 1EBUA 3ZCTA 5HF6A 1QZXA 2VYQA 4JUDX 4EBFA 4B3HA 2YY6A 4KN8A 4I1UA 2OE2A 4M60A 2B30A 3OD5A 5DX8A 2YV1A 4EKNB 1J5XA 1FSFA 1ACLA 3BD7A 1GU0A 2GWRA 3PIDA 5IUNC 5CVTA 1QO9A 5J58A 4MHTA 2YFYA 1ZGCA 3NB0A 2EJUA 3REGA 1EUCB 1UDCA 1WF6A 4UE6A 5K3CA 2XHZA 2VF4X 4BNIA 2D1QA 3LPMA 3FZYA 1FQJA 3CLUD 1UMCB 5D00A 5BV0A 1JDZA 2AA3A 4L57A 1M66A 4HZUA 1KO7A 4E1BA 4BNZA 3GPCA 5CDFA 1KIMA 2WYUA 2OVBA 1CK4A 1UOQA 3KG2A 3IJPA 1Z5ZA 2JKYA 3RFCA 1HE1C 1NW3A 2NIPA 2PTGA 3PC8C 1FTYA 1QYVA 4QC2A 3PQ5A 3T5BA 4H6XA 3WMGA 3RHSA 4RTRA 1Z5WA 2FFRA 4RYLA 1A4RA 2FJPA 2ZBPA 3QK7A 4D9IA 5FNVA 3QV1A 4OTZA 3G2MA 4W8OA 3QEBZ 1TO2E 1SBHA 3D0RA 1DIAA 2BMVA 4DLZA 4ENSA 1Y1TA 3I37X 4ISCA 5JVDB 4CETA 2GJ4A 4JL6A 2ZDGA 2I4IA 4ZVRA 1R4AA 1DINA 1F12A 1F48A 9ABPA 4CLDA 2WHPB 4G5YA 4P4LA 4Q03A 5AJTA 3E9CA 4NQRA 4C2UA 2ASVA 1JHXA 3NAZA 5BMOA 4NU8X 4RV4A 3DQQA 1VYVA 1JDSA 1GZ4A 3JATB 5CLQA 5IX8A 4BMDA 3STUA 4BGDA 2ZTMA 4OHXA 2VXYA 1RI1A 5CB0A 2CL6X 2F9LA 5I4IA 3ETCA 3BULA 2Y76A 4PPFA 3SVTA 3ZOKA 1JPJA 4AJPA 3NALA 4LZLA 1X1RA 1LS6A 4MITA 3QU7A 3FOCA 4AY5A 3NC1C 3LHDA 4MI1A 2FW1A 4HWOA 4QUDA 2MDTA 1V5IA 1PFVA 2I99A 3IEKA 4MVJP 4HUQA 8ADHA 5ITZA 2R6ZA 3IBFA 1SXQA 2XAUA 4FWIB 4M6WA 3RJ5A 4YJ2A 4LG1A 1QU3A 5FWXA 1G64A 2I2CA 1L4MA 4Q4JA 1W6RA 4B32A 4JLAA 3O3MB 4Q1FA 1IB0A 1JT9A 1N9GA 3JQQA 3KQHA 3AB7A 2ERCA 2PGIA 4JP1A 1BWPA 4TL8A 2M1ZA 2BJHA 2FEXA 2ZITA 3FPHA 3GVIA 3L4BA 4JC5A 4PRLA 3UK7A 4F85A 3OESA 2A35A 2WHQA 5JISA 3SG0A 1M33A 4J76A 4NIMA 1R64A 1L7EA 1S2LA 5BSMA 2QRVA 2NAPA 3WICA 2FZKA 3J80A 3ZLBA 3RAEC 1NAIA 2W2KB 3KO8A 3KYCA 3K0FB 1H6DA 5I7FA 1II0A 4E2FA 1TTPB 1II8B 1XTPA 4EI7A 4C3UA 5C37A 2C57A 1MO2A 3H1PA 3EMVA 3NHPA 2XJ4A 5CVEA 4ZCMA 4MJ7A 1EX1A 2CT8A 1PLJA 1VG1A 4PM4A 4TMYA 4BO3A 5M3BA 4Q7EA 3RUIA 2ZRFA 5FA8A 3UGQA 1AH2A 1KXJA 4YPFA 1NV9A 4DCOA 2JLXA 2VDWA 1QIKA 4LISA 2AX3A 1UDXA 2JIZD 5L4SA 3L0BA 3ZU4A 3JPWA 1PEAA 3BICA 5JSUA 1SG0A 4G65A 2HO5A 4C6TA 2GO7A 5L3SB 2QX9A 1RBMA 3E5HA 3OQJA 1SOWA 1TI7A 4ZVUA 4YO7A 3PFBA 2RH9B 4RTMA 4LYYA 4ZVQA 1PVVA 1ZH2A 3JRWA 3PVCA 4PR0A 4A9AA 1L5YA 1XQWA 1RWOA 1TJ3A 2I2AA 3AR5A 1OXMA 3BL5A 3OC6A 4I66A 1IXRC 3I6QA 1K68A 1JIVA 2J5XA 2YOGA 3ESDA 1D4FA 4GRAA 4RDCA 5CA0A 4F4UA 1TMOA 2AXEA 1LZKA 1NJ6A 5LFAA 3OJXA 1Z4NA 3GEIA 4DR1B 1P8JA 3ODPA 1ZSYA 4BO0A 5AESA 2ZRGA 4EPWA 5ADWA 1DAGA 1IC6A 2PH1A 3IP1A 4KWEA 3ZBUA 3PFWO 3JQ9A 2ZJAA 2VP3A 3ONDA 4HH3C 4PBRA 3RC3A 2ZANA 2BSXA 4HXEB 4WGGA 2JAOA 3Q0TA 5JD3A 4HNUA 3KJEA 3D9QX 3VO1A 1N6KA 4NS4A 1ZESA 2ZI7A 2Y0CA 2A7QA 1KPGA 1S1CA 1QVVA 2NPIA 4IUDS 1IXZA 1SKUA 2YXPX 3C1TA 3OZ7A 5CB4B 1VJDA 3G49A 4GZ6A 4ZHQB 2OGUA 4Y2UA 3F5SA 4AF8A 1S4MA 2HDWA 4Q7KA 3RJZA 4DQDA 1X70A 1Z75A 3AUKA 1DWPA 5EE1A 1EQ2A 2I62A 1FC0A 1INLA 1E8DA 2JGDB 3JR7A 5DNVA 2ZAIA 4MWCA 3WK6A 1DCFA 1MNQA 2GESA 5L3RA 1T91A 3PUVA 4RVCA 2A0KA 2BT4A 5FOQA 2XCSB 3OEHA 4UAVA 3IUQA 1DG9A 5D84A 2FN4A 3O90A 4RF4A 2PWPA 2IDZA 4HYQA 1O8CA 2DKNA 1O03A 4PFKA 3ANTA 4G24A 2A0FA 1WMSA 3I76A 3F8WA 5EIEA 1YFLA 3B36A 2CK3D 2I6QA 1OSNA 1VMIA 2WU3A 3AHCA 4UXHA 4XX0B 5H3LA 2QIPA 1B6SA 4W9MC 2AFIB 1CJVC 4K6HA 3HXQA 3TX6A 4FB5A 1OWOA 3BXOA 2QZZA 1M2JA 2QJWA 2IP2A 4FWBA 4M1QA 3W8RA 1NWCA 4KQXA 5IF3A 4WKBA 4CTNA 4FHDA 1MVOA 4ER6A 1R6AA 5BN1A 3PHIA 5FBVB 1E4VA 1I3NA 4X20B 4UHDA 1PCXA 3TOSA 1IQ0A 1Y5RA 1YK1A 3QPUA 4R8RA 3GPDG 1WXFA 1BDIA 3EQ6A 3PNSA 2WJHA 4R69A 4FZ5A 4TTSA 1FQOA 2JK0A 5FLYA 3UV3A 1VL8A 2GYWA 3V1NA 4A0HA 1TCVA 3EZ9A 3DE5X 1P2TA 1XTBA 4E1AA 1GL6A 4Z8XA 1VB3A 4LGVA 2D0OB 4WN9A 1S5PA 1NXQA 4G5QA 2F6RA 2FWBA 1ENOA 1EDZA 4UNSA 4EF4A 1DIGA 2IZ6A 4NI5A 4EVSA 5D3ZA 1MEJA 3RFUA 3MWJA 4CV1A 3L01A 9GPBA 4D8WA 1I32A 3R3UA 5AW8A 1YONA 1Z18A 1DCMA 1UBEA 1ONNA 2DECA 2KI5A 4KLRA 3SJBA 1PT9A 1QZ3A 2QZPA 3W7BA 4YV0A 3QFCA 4J0JA 3CT6A 4H1WA 1A69A 1SIBE 3LUHA 4G63A 3EULA 3IE2A 3CBQA 5DNCA 6LDHA 2X9VA 3PQDA 5CCXA 1T2EA 2QVYX 4P93A 3DNFA 4B85A 1DZIA 5KHAA 3MA0A 1U0EA 3BG5A 5I51A 3OZWA 4PZPA 2MSWA 3DZBA 2BCEA 3LLCA 3HBAA 1PLKA 4GNKA 5HQ3A 1EH5A 3KB2A 5JYBA 1H1TA 3FYSA 3ZQJA 1X9HA 2AMVA 2W2VA 3IBTA 3QVKA 1MH9A 1J9ZA 3QVGA 1UKAA 3H0CA 4UHCA 4DLRA 4BWFB 1BX1A 1U2PA 4DMRA 3Q40A 5A2QA 5ARDA 5CDFE 2XUQA 4BLQA 3L8FA 5LMCA 1QGUB 2VDUE 4X7BA 5JQGF 3EVDA 5KMGA 1XEFA 2C5HA 4WI1A 3ZDDA 3JARB 4Q3DA 3ENZA 4GOKA 1BRTA 1AQ6A 2FZVA 3GFTA 1UK8A 2ECOA 2P8JA 2VDPB 5ALHA 4YP6A 4DJJA 3CWCA 3ZS8A 2QW1A 4IIJA 3WL7A 2PJRA 1PVOA 2C2KA 1GV1A 3UMYA 1NVUQ 1QQ5A 2Z5FA 3G02A 4PYIA 3VR6A 1NYLA 3NDRA 1ID8A 1SZCA 4YRGA 1X7HA 4JL8A 3GGOA 1J9GA 4MXDA 3LUDA 4YNBA 1EYZA 2P9BA 4H31A 5KU1A 3ERCA 3DDNA 5ENDA 1E7RA 3JQ8A 3WL3A 1RWVA 3VH3A 2O0JA 4A7PA 3SS7X 4JDPA 4C7BA 4E51A 1P1BA 4DIEA 4CMKA 4LHXA 5L3ZA 3ZPXA 2GBLA 4YV2A 1TF5A 5EZ6B 5FEUA 1KZYC 1GTMA 2FZEA 4YCCA 1CJMA 1YKSA 2E4WA 2M9MA 2O7RA 2FDXA 2V4UA 2Z9DA 3PUWA 4LJ4A 2I5PO 5JR3A 1GL3A 1VJ1A 3LOPA 4MINA 4DHEA 4DUYB 1CRPA 2DOKA 4LQ4A 4FFOA 6ADHA 3BHNA 4DIMA 1PUJA 1ETUA 4XI9A 3NDIA 4O0MA 4LDPA 4XOIA 4DQ0A 1I6LA 3L2OB 1E3JA 3A4TA 1BQ4A 5TQVA 1OJLA 4RQUA 3ZHVA 1TC1A 4ECEA 5JD5A 4HDKA 1GCGA 5JS1A 4JBNA 3WSTA 4BWYA 1SU6A 2X58A 5FBHA 2RG7A 2G04A 2HF7A 4KUGA 2EEPA 5CXSA 2ODTX 3AXSA 1PJAA 4S12A 4XUCA 3AUYA 1KDZA 2VJMB 4EUSA 4YJHA 4DNXA 2B69A 3LUKA 3PE6A 4Z54A 3FR8A 1MC4A 2E82A 2WC1A 3Q11A 3ZWPA 4BHTA 1DTEA 3WC4A 3SZOA 3CKYA 5JRZA 4CQLB 4F5WA 2HMVA 3HR4A 1LB1B 3EZFA 3OFND 5EZYB 1V1JA 3EG9B 4G2TA 4UATA 3NHJA 3I30X 5K1ZA 3VXKA 1R9NA 1E9EA 4YQFA 3ILXA 4FYPA 3L0PA 2AE1A 3O9VA 3M9WA 621PA 2YASA 2WF9A 4O3FA 4ZV7A 4NPHA 1CETA 3EVGA 1RVDA 2WHYA 4Z9YA 2AMFA 3JRXA 1XCOA 1NYTA 3GFSA 1P80A 4EHIA 3PUXA 1WB6A 2ZE8A 2J32A 1OLUB 4IW3B 4TM7A 2GF2A 3KE9A 2E6UX 2O2JA 4ND4A 1LX6A 4EJSC 1AOXA 1LJ8A 2IEGA 2UUPA 4K5QA 4KZPA 1P7CA 4IJ5A 2OPBA 4RZ3A 2RGGA 2K7ZA 1XJCA 3DM9B 1E7MA 2XUIA 4RHFA 1WLYA 4G4GA 4Z99A 4TKUB 1MF7A 3F9IA 1P0PA 1NHGA 1J42A 2WZCA 1CZKA 2JZOA 2OTCA 2ZJ7A 3QY9A 2XF8A 4G85A 4HO1X 3DQZA 4I9FA 1Z2DA 4R2LA 1GADO 4WBSA 4B6GA 4W9NA 1E79D 3QNWA 3GLVA 1KZ7B 1KZ6A 1S3SA 1YRYE 3IILA 3OWXA 2PFSA 2QSYA 3O7WA 4TUYF 4EKDA 1KJWA 5INTA 3L41A 5E6RB 1MOZA 3UCFA 3E22A 4TN1A 2HI0A 3ZHOA 1F2UA 5F3DA 3KQKA 3W6NA 1DC5A 1B3BA 2NZUG 4LI0A 1J09A 3ZJVA 1ST2A 1LBHA 3HVRA 3A2MA 3GFBA 3VNVA 1ZI8A 2F43B 3AJ8A 4FYJA 2F3RA 4UE3S 4RCZA 5AW2A 1USWA 3LK7A 4RTSA 1Q5PA 4JZYA 1JH8A 1KRHA 3SYKA 3P9ZA 4N0DA 3D2LA 5A3QA 1N78A 3FYCA 2CKDA 3WK7A 3WLEA 1Z5OA 3BAFA 3C8HA 3OUUA 4HXGA 4X8OA 1WV0A 2P6RA 1SCJA 1P1KA 2H18A 1RXVA 1AUVA 1OIWA 1U0FA 5EIWA 5KC9A 4MEBA 1QB7A 1OE0A 4JA0A 2XADA 3O3CA 1NC1A 3JQRA 5JZBA 3CUVA 1VSVA 5BWMA 2HSGA 3AETA 4R2WA 1A9XA 2G1AA 2H3HA 3ZDQA 2F8TA 1EA7A 5REQA 3OOSA 1J90A 2C54A 2CXOA 2ESRA 3EIFA 4I14A 1JXOA 1W4BA 1ZVKA 2ZIXA 1E5LA 1IEWA 4MUIA 1NA5A 1EFTA 3AKYA 2IVZA 3BSWA 4CFSA 4G0MA 5A4MS 4CT0A 2A1IA 3AKZA 2NZ8A 3A3OA 2DB3A 3M2TA 2GD1O 2GX6A 2OVFA 3PEFA 5DCYA 1GPJA 1YAJA 3DXXA 3KSRA 4R84A 2WHXA 2CFTA 2GM4A 3TTXA 2Q28A 3ML1A 3GMDA 3OO1A 1XTTA 2G4VA 2JBAB 2FPXA 2B92A 4G0NA 4B6PA 4YWHA 4BB6A 1HK7A 4BVKA 1T1GA 2PS9A 1OBVA 3CLSC 2GOYA 3GQBA 3NX4A 3FBWA 1PJ8A 1X2EA 2PDAA 1LA2A 3CG0A 2NO9A 3NTQA 4YALA 4KMRA 3VKHA 4MYTA 4BNKA 5BMVA 4HDRA 1SJ9A 4WASA 2AI1A 3DE3X 3ZWQA 4BS9A 2E37A 1UINA 1ZIOA 3TE7A 2R1TA 1BS1A 1NP7A 2BKAA 3M6MD 1TAUA 3A1SA 4PZCA 2QJFA 3B3JA 1SO8A 1T1SA 4MP3A 1QZTA 4NBRA 1PR1A 4GEKA 4V0LA 3V80A 1Z8HA 3KQQA 3WRWA 3EH2A 2H5IA 2IHZA 3DE2X 1A8HA 1NXXA 1DRVA 3FKSD 1VE3A 4L73A 2EERA 5FTJA 5ADVA 3HYCA 4LECA 4D8YA 5DV9A 3R7WA 3NBKA 2N46A 1QFSA 3ELUA 3DAOA 4F2HA 3A32A 1JAZA 5B4UA 3OKPA 2QTRA 4CUKA 1Z3CA 4OUDA 3UCXA 1G2PA 1Z8NA 3GJ0A 1KK2A 4JVLA 1KHHA 4B7AA 4BUJA 4LFAB 4P0QB 1FL9A 1KFJB 2X5NA 2VUHB 3UAZA 4OHMA 4A6XA 4DCNA 4X41A 1QRRA 2M1XA 3DBVO 2IYSA 5EFZA 1QUFA 3F2IA 2CVPA 1ZQ9A 2DTXA 3B2EA 1IN6A 1U3FA 4PNZA 4KIWA 3RU7A 2ZWOA 3CO5A 4OJQA 2X0NA 4F5YA 5ITWA 2BGGA 1DI0A 4KXLA 4DRZA 2I7VA 5CYPA 1ZD3A 4DM3A 3CM0A 3EYWA 2SKDA 4DDMA 2CXPA 4P5EA 3SXPA 4PCAA 3ENKA 3K31A 2I3DA 3F98A 5ALRA 1DGQA 3CE9A 5AT1A 2PYDA 3ITDA 3ZW8A 3CUSA 2VWPA 3K4QA 2WIBA 3IAS6 4PNEA 4EPRA 2NP6A 4I4LA 3L8EA 2AWOA 5J4LA 1IN5A 2RARA 5EIXA 4XQCA 1UL1X 5AJHA 2J1LA 4M7RA 4PZEA 4UZFA 3RSSA 1P5HA 3UHOA 3ANNA 2IODA 2Q3EA 4Q9NA 1U1DA 3BXGA 4RVGA 4NOKA 1GZ7A 2ENWA 4EB6A 4AO8A 1RAEA 2DUNA 2NLOA 2VR1A 2ZB4A 1ZOOA 1NXWA 1CULC 2HA4A 3A9TA 3JD3A 4NDZA 4UHFA 4A0FA 4AMUA 3GZNA 2AS0A 4H18A 3NBZC 3TECE 1X7ZB 2VJQA 1LPAB 4L6CA 4PZ0A 2V9PA 4EAQA 3EPKA 1AV6A 1WPXA 2WIGA 1CS4C 3BCSA 3IA2A 2W2NA 2QLMA 4MAMA 4QU9A 1KNXA 2WTMA 5LLSA 1K7FB 1GQRA 3LFUA 4J16A 4QRIA 3DAFA 4TLAA 5LLTA 4DBZA 3G8AA 3I2KA 1WU7A 1GN9A 1FS4A 3ZBPA 1RADA 4LGMA 1SUEA 1QTNA 3I9KA 4NBKA 5I8PA 1PK9A 3EVCA 3X1MA 3UAVA 2NXWA 4OFWA 2VVTA 2WYWA 4PLZA 3MPOA 5KTPA 3K0EA 2W6PA 2Y9MB 3SY8A 1HSZA 2FFBA 4M8IA 2E48A 2Z57A 1P2SA 4AM8A 3L8MA 3RVOA 3SGLA 4FIZA 2RHOA 3MQFA 2DPYA 3E35A 3CISA 1ACMA 1MA3A 2OXFA 4KFTA 4IY1A 2YQ5A 2Z83A 3RVJA 2R00C 4G5RA 1EFHA 2G7MC 2QSUA 1H94A 3LC0A 4YH1A 1YA8A 4JLKA 1P2VA 1NI4B 4G56A 3NFRA 4DMFA 1MIHA 2HIGA 2WIAA 2QPTA 4WZBA 4FFVA 1FP4A 3DEFA 3CNEA 2WYOA 4UEWA 3GP8A 1XTKA 4QFBA 5U4QA 3SS9X 4BBJA 1FRQA 2PVCA 3DUFA 4UMEA 5KJFA 1X8XA 2LIPA 3BMCB 1PQWA 4KO8A 4JU8A 4XD2A 4EHKA 4IXDA 3UAXA 4KJXA 1X39A 2UVPA 4DWWA 3GCDA 1CUGA 4MV7A 1Q3TA 1GJRA 4GYWA 3UJ3X 3OLCX 1LC3A 3WMWA 2E5WA 2ZBQA 2QN8A 1FU7A 1J5PA 1K6MA 2Q49A 2ZWAA 4J0CA 4JEHA 4UNNA 5F51A 5AWFC 2C4MA 3OZXA 2R9VA 4LMBA 3IRUA 3UJPA 2GEDA 1RWKA 2PGXA 4TS9A 4JH0A 4TX1A 3GIWA 4UCQA 2P67A 1QTIA 4JN6B 2BFBA 2VQDA 3M6LA 4ER0A 3CTMA 3A9SA 3IC5A 5PGMA 4DHWA 2D7DA 1DKOA 3MT0A 4KAJA 5KKAA 4CL8A 1AO0A 2HHJA 2Q2OA 3KUXA 3W2GA 1PR0A 2DFPA 4KPUB 1FPQA 5JWRA 3EX7C 1PK7A 1DV1A 5I7EA 5SY4A 1DTSA 2Q1UA 2WFZA 3RVLA 1DFGA 3NP7A 1DOHA 5CR9A 1QP7A 4ZTUB 1XT6A 5AMXA 4J6EA 4MQ5A 1JQJC 1JE1A 4E32A 4R2HA 2NAFA 3UT6A 1U2TA 3HJUA 4Z1MA 3TLGB 1US8A 2I91A 1KMQA 4QJIA 4MH0R 4KKXB 2QBYB 4E4TA 1N6LA 2CEKA 1MUUA 3S70A 2PX3A 1UBOS 4A6PA 3QFRA 1D0VA 3O2JA 3I6BA 3Q2IA 2PK3A 3LNCA 2EBHX 2X13A 3D3WB 4TKVB 4TQ9A 1SBIA 1IOLA 5DTQA 1WMFA 1P1JA 1W30A 3ZW7A 1SMKA 2XUJA 2XDWA 2BISA 2BIFA 4RTLA 1R0ZA 1JEYA 1AURA 2F67A 3KTOA 4Y6SA 4RGVA 2Q07A 2B21A 3TTVA 2F8MA 2PD4A 3I12A 1QS0B 3UMSA 3H99A 3FNGA 4GICA 4BP8A 3JD1A 3ESYA 2FSVC 1RJWA 3JVDA 1YUNA 1UAAA 1QP0A 3AEUA 3BN3A 3CVVA 2P1RA 2DY1A 4RH0A 3O1IC 4DDUA 3NTLA 3P45A 3PSHA 4JEUA 3E6AA 2A78A 3ITNA 3M2PA 5KYYB 1JEAA 1C3OB 2DFNA 4PIMA 2GKGA 4R8VA 3TSYA 1P9OA 1XDSA 1Z7GA 5K0LA 3PHCA 5HJ5A 1TZCA 4O4LF 1G8SA 2KM1A 4E30A 4CTMA 5H3HA 1F7UA 1RYNA 5AM0A 2FG6C 3DL0A 2O5EA 3Q8LA 1RAHA 5CG1A 2GXAA 2AKYA 3GFFA 4R01A 1M2GA 4BRZA 3C3PA 4U4AA 1U2DA 2TRSB 3ND6A 2AYXA 2GBPA 4ZQEA 5AXDA 3OWHA 3OO0A 2C5EA 1NW6A 2GNOA 2GD6A 4GMFA 4M0UA 1W2HA 5CBKA 1UC4B 1AKMA 1YDWA 3AWDA 1U9IA 3FCOA 1YC5A 4DLXA 2QRUA 1G6KA 3LWNA 4MX8A 3FAKA 5CGZA 4YIHA 1DQRA 1U6IA 1CUFA 2IDJA 3B3AA 2W2PA 3K6KA 1FFWA 3HJCA 2D0IA 2NT3A 3GLKA 1S96A 2CL5A 1CT9A 5LZ8A 3AL3A 4NY1A 4XQ0A 1X3SA 2QTGA 3B3FA 1VIVA 3GG9A 4Z4QA 1LW7A 4FGJA 2AHOA 2CNKA 3GF4A 4ZYUA 1YQQA 1XGKA 3GCZA 2DHDA 4L8FA 4OH7A 4WXPA 3T3MB 1XCBA 2O05A 4N4AA 3GYBA 4HAWA 2X7XA 3KQVA 4XGIA 1YDHA 3MG9A 2BUAA 5CX4A 1EXMA 2YNMA 4TSFA 2VRWA 3MS2A 3QXJA 5CT5A 1QIHA 3WQQA 3VO2A 3ASYA 4FW9A 2P0EA 3NW9A 2IKQA 5FBZA 3THOA 4YJFA 5H70A 5IK2D 1QE0A 4RYDA 1DNPA 1VHJA 1I3MA 3TBFA 2QTZA 5BN4B 4JT8A 4C78A 4HWTA 3TG2A 1G5HA 4KMMA 2XY4A 4RA9B 4B76A 5ICMA 1NSFA 4AECA 5AICA 3TLZA 4YIKA 5CDHA 4DTCA 3B7WA 4WD3A 1NVKA 1QO0A 3RS2A 8MHTA 3GN2A 3OLZA 1N2BA 4UXJA 4DJFC 2O8VA 3ON5A 4KXWA 3ROQA 4TS3A 1EESA 3I0MA 3DHVA 2AC4A 3MMXA 4KWCA 4TPKA 4RDXA 3VHLB 4CKEA 1JNYA 1FUYB 3LUFA 2WZBA 2W37A 3LCRA 2ZIAA 4UD6A 5EL0A 4LKRA 4C2AA 1YRBA 2DT8A 1H9BA 3OOEA 3HU5A 5EN4A 4BAUA 3GRAA 3HK2A 2O23A 3GDFA 4GYJA 5JCOA 5K6TA 3E9DA 5ERYA 1WTAA 4REOA 4FYWA 4TMTA 2AEJA 3CIOA 1L8QA 5KAPA 3J81k 4ZRDA 3O3OB 3NI2A 1PQPA 3KR1A 3OU7A 4IUYA 4JL5A 2VAMA 4UNPA 3S2YA 3D7RA 2REBA 3P9QA 4MYDA 2C8KA 1PWZA 3DCNA 2B8NA 3U2QA 2PQ2A 1XKQA 5J47A 5LU9A 3UMMA 4RO0A 4BFWA 3PLRA 3GLHB 1BJRE 2AEFA 2A7XA 2IZ0A 3QX8A 3SBEA 3WTCA 4EFMA 5LJIA 3KX2A 2HF8A 4N3BA 4TV8A 4Z9AA 3WIVA 4EO4A 1SULA 4D6YA 3RVBA 3B9BA 3EWNA 4HDOB 4OSOA 2DGDA 4HL6A 1B00A 5K0NA 3T7JA 4CEHA 1UM8A 1IM8A 2ZUCA 4TZTA 2Z2KA 3C3WA 4RLSA 4HQ6A 4NU6A 1N6OA 4C0KA 1O97C 2CDAA 1CDEA 2R7MA 4CMGA 1VZ2A 3PC7A 2Q7OE 4UCXA 4P3YA 2BFDB 2HK8A 3M4NA 2TMYA 3LT0A 3LY7A 3KJNA 1OU4A 4FE3A 5C8VA 1T25A 4P6VF 3LX5A 3TLMA 4F3KA 1NUTA 3FCUB 4LRXA 5BVHA 2QQGA 1HM5A 2YDXA 4MVJD 2GI4A 1EEHA 1EZ4A 5GOTA 1G38A 2QZSA 5LKRA 2R2GA 2FSFA 2W6MA 5GZ3A 4KH0A 4GPZA 2HR1A 2OBXA 2R7AA 3JQGB 5AFSA 3ZWYA 1FRZA 3ZXUB 2JA1A 3OTIA 4B47A 2KLBA 3ONNA 4MR7A 4KXXA 4MVYA 4Z4EA 2CKMA 4IX1A 1C81A 2R6DA 1I7LA 1R8YA 1EUQA 2HYIC 5DSTA 1OI4A 4HMQA 4CQNA 1ZOLA 3VNBA 4EGAA 1IJFA 3S6JA 5B2ZA 2N9UA 3ITEA 3DD1A 3KU4A 1FDTA 1BCRB 2H3EA 4RSGA 1E2BA 2RGCA 1V96A 4MPTA 3WBBA 1U4SA 2QL9A 4CT5A 1NVBA 1MR3F 1SVMA 3DDCA 5B6JA 2XNJA 3KPUA 5IKXA 3NH9A 2YVUA 1I3LA 2FOXA 4ZVLA 4RELA 3VC3A 2K87A 4FDVA 5JCPA 2IHNA 2QAGA 2V1UA 3MJVA 4L8YA 5IN4A 2B8WA 5AJZA 2O2GA 4V3BA 2ZVJA 2D7CA 3IXQA 3S29A 3ZZUA 3B6EA 3VYVA 2BFWA 5JS6A 9MHTA 2A5LA 2PGJA 4M1SA 4DJAA 4W5WA 4AZVA 1P2FA 3MAAC 4UQPA 4BNTA 5A5EA 1AKUA 1ZQ1A 2GBFA 2NGRA 4HRYA 4Q4DA 5IDVA 3QOYA 2CB9A 3GCXA 4QATA 5HRAA 5HWSA 2I8CA 3OJEA 3IMEA 3PK0A 3RIEA 1AKQA 3RANA 5KOHB 3BB3A 3JQPA 3FWNA 1J8YF 2WB4A 1Y3IA 3IB6A 3TQSA 2JVKA 3A1NA 3KAJA 4GHWA 5JU6A 1AT1A 5IUKC 3EXFA 4B4WA 1A82A 1CUXA 2O0HA 2FW7A 5IASA 3NVMB 1ZUWA 1HR0B 3WGMA 4O4HF 4F45A 5JDIA 4BNDB 5JIBA 1W1WA 5JY6A 4FQ7A 1U0BB 1CD5A 1WWKA 2ACKA 2MHCA 4NJMA 4UTPA 4OP2A 4AMBA 1IEVA 3BWCA 4BX3A 1BCSA 4EW2A 5A1JA 3BGWA 1ENZA 1WMEA 2ZYGA 2IU6A 3QX9A 4NQZA 4EHJA 1JB1A 5E9WA 4M1YA 1UT6A 1JWBB 1F1BA 2HSDA 2XDQB 1QCYA 3BWBA 4Y7CA 2PNJA 2HCBA 3C5WP 4P92A 4W5NA 2FX3A 5CT6A 1XRQA 2JLAA 3BMNB 3QW4B 4AN1A 5KSYA 4A1FA 3BYZA 3DDHA 1XZIA 2Z6UA 4H2DA 3C48A 2OHIA 4UDXX 4TLCA 5J1SB 3FZNA 3JQ7B 1GQSA 3DE4X 1HRKA 5IDQA 3V34A 3AIOA 4RJIA 3VGJA 4Y67A 1FVFA 4JVNA 3ZDXB 4P3KA 3WL4A 1MRZA 1P1HA 1G7RA 4JLSA 4NJEB 2Z3VA 3TSWA 3V8RA 4KQMA 1KVRA 4Q9AA 4ER7A 1P5ZB 1NBMA 4GI3A 5U4XA 4ZJYA 2FQWA 5JZ9A 3COVA 2ZBFA 2NTEA 5JXJA 3NVKI 4XTCS 1R0YA 4CKCB 2REQB 2IXBA 1UZUA 2CHEA 1U8CB 5EJGA 1MC5A 1JQEA 4GZLA 5IEJA 2NUAA 2ADOA 1A97A 3HDJA 1NRIA 1T9GS 3KWLA 5KQPA 3BQNB 3NTOA 3W78A 2O5VA 3ECSA 3LD9A 5IYZB 5LDHA 4BP1A 3WP1B 1FFAA 3EXEA 2FPIB 1L6IA 3OA2A 3PUHA 5C81A 1BYIA 2HN9A 3OZAA 4D3DA 3JZDA 4NFHA 4ZEXA 4AYWA 1C8LA 4JS0A 1D2HA 4WK4B 2ZZNA 2VT2A 1F9EA 3PTZA 2WJAA 5F1PA 4WXEA 3CNQS 2JDIA 1OV4A 5JXHA 4JP2A 4X7RA 4FDMA 2O1SA 4UEJA 3WL5A 1NM5A 2QTTA 4AW9A 3N2GB 3E3LA 2X0FA 1UCFA 4MSUA 2EF1A 3AGQA 1R27A 4EELA 4LMRA 3DZIA 3TFQA 3WHLA 5LWHA 3CSDA 3PPIA 4XOUA 3S81A 2B4TO 2IYTA 2QMUA 1O4WA 4J4BA 4QEDA 2BYTA 3IYLW 4RWZA 3IHKA 1YTUA 2MMCA 5ESWA 3V9AA 3DTVB 3VR4A 4Q3LA 3BXFA 3ZV5A 2VSXA 1T8WA 2H1CA 4XPIA 5PNTA 5AIAA 2IUFA 5DHSA 4YXWD 4EG3A 1IBKB 2WTAA 3IVCA 3THRA 2JJ1A 3GFPA 3G2LA 5AW0A 4H6PA 2H17A 1YT5A 2FMFA 3NEJA 3RC8A 4KDFA 1TMKA 2FWJA 2KSQA 1ATZA 2HT6A 5EJMA 4GSYA 2VHZA 1Z7YA 2UUAB 2OGZA 2ZRJA 4H7PA 4REQA 1CE8B 1N25A 3ESXA 1U7PA 4WT7A 3EUWA 2J9FA 3ZD6A 4J1NA 5I4BA 5J2TA 4GS5A 3KKQA 5ALGA 1Q16A 4GP7A 3D6MA 2C88A 3IT3A 3QPBA 3KUDA 1TC2A 3AUTA 1H85A 2R1UA 1OA0A 3AERA 1A5AB 2I78A 2J7PA 5H4GA 1YGYA 4D74A 3UG7A 2DULA 5B3JA 5IVDA 2RGRA 2WPDA 4P3XA 2HBZA 3DCYA 4HDSB 4YMHA 1QQBA 1ONSA 1Z4MA 1FXUA 2IL1A 1E2IA 4UHHA 2BBWA 2WJVA 4P33A 4A03A 4IVRA 3EQ9A 5JBNA 3NOXA 3EW7A 3N0WA 4RFLA 3RYIA 1KMHA 3R40A 5I9SA 4CMEC 1JEQA 1H9AA 2F48A 3M1AA 4C7KA 3K73O 4J49A 4JJ4A 1A0OA 4EG7A 1XVIA 3M5PA 3N76A 1DARA 3P9KA 2ZVPX 1S3IA 4DLLA 1FVOA 1TLFA 4YROA 2B4YA 1WPQA 1LRKA 4Q12A 3ZY5A 1XZJA 5HIJA 1FJXA 3OECA 1ZFNA 1SXJD 3GGJA 3ZDBA 2PL5A 4G1CA 4CM5A 4DR4B 3MIIA 4LY6A 3JQ6A 2PRYA 1GGHA 3H6HA 4FE7A 4HWRA 1Y42X 4JBLA 2F3UA 1QPBA 1P19A 2QVZX 4QJBA 4BQPA 1WETA 1QYCA 3BMQB 3N28A 3R5TA 5J63A 2VPWA 4ARVA 2UZ1A 2EATA 5K8CA 5GGYA 4EUHA 3OIGA 1MABA 1EHCA 1YV9A 3DPUA 1RKVA 1VE9A 2G5TA 2IXTA 4C0WA 5AW3A 3IAM6 4N0MA 2JLRA 4A8HA 3LOQA 2Z8YA 3O4HA 3WA6A 3NV9A 2P4SA 3CTPA 2LCFA 5DM1A 2P6MA 2ZUTA 3BJEA 3CV3A 4II3A 5EQJB 3QOXA 3SFTA 3ENQA 3UK0A 3WZ2A 2BGWA 3ANYB 4RMGA 2J9YB 1OGJA 4AVYA 3VU1A 1VP9A 2FXVA 4BNFA 3VNSA 3WKAA 1HLFA 1QYRA 1T3TA 4FGLA 3SOPA 5KJ1A 3QBEA 1MEOA 1NGSA 3CNOA 4GI7A 5JMPA 3TLEA 4IIXA 3N8GA 3RYTC 4TSRA 1G7CA 2GZDA 2WP0A 2HMYB 4O4JB 4WLOA 3QVTA 1P9WA 2ZSEA 2XNHA 3L9WA 4RULA 4KV9A 1NN5A 1H4QA 2A4KA 2BAGA 1QF7A 4AY6A 1JQBA 1JYFA 1NKVA 1LGYA 3K9WA 1GNRA 5FOXA 5WRFA 2CNWD 2EFYA 1T0IA 5SYMA 4F5DA 2CFIA 2D00A 2HGZA 4KSCA 3EBOA 3U31A 5E7QA 2JH3A 4MQEA 3JYNA 5I8WA 3QEMA 1U0RA 2NYVA 3NASA 3TR5A 3VR3A 4G9BA 4W5TA 3U7FB 4PWYA 4R5HA 3MS7A 3VA7A 1UBLS 4A6DA 2J45A 3K4PA 4BQEA 1XCGB 1RWWA 4FDTA 1XXHA 3MWDB 4O2LA 2YZKA 1UBNA 4BN0A 3USCS 3DTNA 4R1NA 1V4VA 3GLQA 5EZ5A 3QWHA 5CW1A 2Q9BA 2B9VA 1T5IA 4F0JA 5KNBD 4L15A 4PW0A 1Z56C 1ZGJA 4YRAA 3U4QA 3JU3A 3HACA 4DARA 2IPAB 1JQDA 3PWSA 4ID3A 3PR2B 4BTVA 2ONCA 3MWLA 1HETA 3II6X 3Q7EA 4PG5A 3BWYA 3DLPX 1TUIA 1ZN7A 2Q2VA 2AFHB 5DW3A 2XE4A 3KEQA 1H0KA 3OM8A 1MN6A 1CSEE 5BV2P 2JFYA 5UKDA 3GROA 3NHRA 4FSDA 3RSGA 5A4DA 3F96A 2JNWA 3F5DA 3KVNA 4UU0A 3VYRB 4HLUA 4LWQA 4F3TA 1E1KA 3VYWA 1YBVA 5DM70 3MUOA 1VDMA 2BM8A 1ZUNB 2YIVX 1IXYA 3DFZA 1M1YA 4BO7A 4S1PA 2QYHA 1I1HA 2X4IA 1RYZA 1KEWA 4CTJA 4ZYZA 2IYEA 1E2MA 3RG2A 4YRKA 4YRSA 2Q5CA 3K5WA 3X0DA 2W2QA 3JQFA 5HIMA 1FSGA 1Q0TA 3VJRA 3SHFA 1K8RA 4XQ9A 2AF4C 4HT3B 1JH9A 2BGTA 1EFPB 4X6YA 2Y77A 2ZQ5A 2Z6AA 4MW9A 5MN5A 3COSA 2B94A 4YK7A 4DF3A 4I19A 1NBME 1A5BB 1P3DA 3STYA 2EJBA 4CLXA 2EZTA 3TSAA 1OCEA 2NTYC 3PRJA 1NMXA 5K0FA 1NQAO 1FA9A 4RJJA 3ZX5A 4C03A 2AYYA 5BV1A 3QUSA 1U7OA 5CD1A 1H4SA 3NYRA 2YVKA 3GJYA 3MRXA 1Z4KA 1JIKA 2ADFA 3LY9A 4NR0A 1J5EB 3FHLA 1QIEA 1W59A 5AP9A 4J07A 1X7XB 1T5BA 3D1VA 1R88A 3RLIA 1UK9A 4EGQA 3E8SA 1THGA 1R5BA 2JFXA 3LXXA 5JFOA 5AK0A 4V03A 1PUIA 4BFCA 3F47A 3R3ZA 4P0TA 5CH8A 3RODA 5CYGA 4C4RA 5C2JB 1U8AA 1UH5A 2YZGA 4UAUA 1W5SA 1YVRA 4XD7D 3T7IA 1E2LA 5AVSA 5JC1A 3IQEA 1DIRA 1WCV1 4M0DA 5IDYA 4C22A 1JR4A 4OHPA 1VG8A 1J8FA 1MJ5A 3MTEA 3QVWA 1GAXA 3E5MA 3AY7A 2QRPA 3V8NA 3ZWXA 1LLQA 2VZLA 3G0DA 3JWJA 1JFTA 4V24A 4S2EA 4IILA 5BR8B 3IDZA 2IYUA 2RC5A 3UMBA 4NYMR 1RIFA 1USGA 3LC7O 5EFOA 5BNWA 1JP7A 2D2EA 2V58A 4K9NA 3I8XA 4BQSA 3U3DA 3OP1A 3JVEA 3FFWA 4JAVC 4L08A 4O4IB 3TL3A 4C21A 4LZOA 2JD2A 4E94A 4G5OA 3B6KA 1FYXA 4Z3OA 2W2LA 1CY1A 4UM7A 3TO5A 2XLCA 1OC4A 2CLKB 4G8CA 2EWVA 1Z0IA 3DS8A 1M73E 5DIFA 2I4LA 1FLDA 4GXNA 4X0EA 3FLEA 2X3UA 3WX0A 1KH3A 3QVSA 1HEUA 4MS4B 5SYAA 3LF2A 2R11A 4JJ8A 2BBSA 2A94A 5ADHA 1XLWA 2GBIA 2WE8A 3PUZA 4BLPA 2GPTA 2O6HA 5IEBA 4BUZA 4WECA 4DUGD 2AH5A 3ZDYB 1MGPA 2C1ZA 3DVAB 1OLXA 3S7ZA 3GA0A 1X1SA 1JG6A 4R9UC 3W6ZA 3QI7A 5K6RA 2E4VA 1NMEA 3W8EA 5EWJB 3I52A 1XEWX 4AFNA 1R8JA 4YS6A 3CVWA 4GBED 3MXTA 1QFJA 5HKOA 3DSRA 3LUGA 2I4RA 1DPFA 2Z2YA 1BVYF 2R3SA 3OTGA 4WOBA 2FE4A 1GPKA 3GH1A 4F11A 1H2FA 4G1BA 5EXSA 4QWWA 4Y0VA 5AKLA 4MULA 4FFWA 5TLSA 3HB5X 5HKKA 3IUJA 4GAEA 1Z73A 4B46A 4FGZA 1HL3A 4PO3X 1XCPA 3RASA 2AOTB 4GE3A 3U7RA 4B8YA 4CR8A 4YX9A 3OTOB 3TL2A 2HZBA 2PRZA 1BX3A 3DMPA 3I58A 2I54A 2WKWA 1E3MA 3ZWAA 1ZA2A 3AG6A 3VH4A 1AN9A 2NO0A 1JQLB 3EFOB 2FRDA 3OHPA 5LYJB 5HCUA 3EXIA 2WYHA 5LU8A 1X7GA 2JD1A 1RHMA 1PP4A 5ALYA 3DGEC 3W6OA 1BMTA 4ZEMA 5HGXA 1IVSA 2X0KA 1LF0A 2PUWA 2CZGA 2GZ1A 2XUAA 1WZCA 5F77A 3QYAA 4S1NA 3F3KA 4OIMA 4AMZA 4B7ZA 4CMCA 5CFZA 1M3SA 4QGFA 3GH3A 4CV2A 4P7FA 1JSLA 3CXRA 3LHKA 4KGDA 4ZOCA 1NOJA 3OPXA 2O1EA 1B16A 1PU2A 2DLCX 3G0OA 2MSNA 1V3QE 4D9JA 2ZYHA 1MAVA 4BTLA 2P9EA 4DY4A 5JATA 5K0TA 1G41A 4JK3A 1BDMA 4Q0MA 1D04A 4HATA 2CCJA 4BC1A 2ATIA 4D3XA 2NU9A 3C5CA 3G7NA 4W5JA 4D0RA 1UJ6A 2B5VA 13PKA 821PA 1QPZA 2F8LA 1FDSA 4QJ4A 6AT1A 1PR9A 5DYNA 2ES4A 1SKBA 3L1HA 3FX2A 1FK8A 1PK8A 3QVXA 1PWXA 5LP6C 1XWIA 3UGTA 4BE9A 3A1WA 5IVPA 2Q50A 4YDHB 2O8DB 2PWZA 2HHCA 2Q21A 1PIWA 1VIDA 2JI8A 3DFKA 3KBOA 1ZJ6A 2OYRA 1H2HA 1U2ZA 3O94A 4V02A 2D1RA 4GOJA 5G02A 3G2QA 3Q10A 2Q46A 1KARA 5K9ZA 1XALA 1UOPA 1Z08A 3E7PA 3KHUA 1QRAA 3IAXA 1Q7BA 3MCAA 4ZDJA 4D25A 1FW8A 4QDUA 4HEA1 1H6AA 4V0MA 4YBRA 4HADA 2GZ3A 4HD8A 2G70A 3R0XA 2FP3A 3GGCA 4G8DA 3TW0A 3AWIA 4CL0A 2R8RA 1XXHE 1JV2B 3KHTA 3IV6A 3EK2A 1JLRA 4HNSA 2AR9A 4JP8A 1DEHA 5ALXA 4RJLA 5EMNA 2BUBA 2PFKA 1CJTC 2B82A 1RZVA 3NGLA 1XNJA 5F4ZA 2FN8A 5BNIA 5KINB 5ERGB 1IQUA 2ZJZA 3TRIA 4FFLA 4ZI2A 5A04A 2GM5A 1A88A 1E66A 1X1QA 1UXGA 4NL4H 2AB0A 4JJ7A 3WHPA 3H11A 2M6RA 1KETA 1MQ8B 1HPLA 2I3BA 1F8GA 5HFNA 1K08A 1C2YA 1NYRA 4F3CA 4F4FA 2YV5A 3ENNA 4R9NA 4X85A 2RH5A 1UANA 2W2KA 3TQQA 4NZ9A 2A1UA 3DKRA 3W06A 1WSBA 1N1EA 1II8A 4QQFA 4L07A 1NVMB 5ELMA 5BQOA 3NT5A 1NRWA 3BD9A 4U2GA 1FRVA 4Z3KA 3RUDA 7GPBA 4HB3A 4OQMA 4HV4A 3HN6A 4AX4A 1QO7A 4KQ6A 4N8SA 4DLSA 1Q3KA 1M1YE 2PRJA 2KBFA 6YASA 1T13A 1CWUA 3C6XA 1HSOA 3K05A 4EA9A 3T4UA 2Q3DA 5G1NA 1OXVA 4GI2A 2OCAA 3FRIA 2FDCA 1RI2A 4XGRA 4TSKA 3KWJA 3S2IA 2VOEA 3N6XA 4BNWA 1BH2A 4HTFB 4BVJA 4G0WA 3E1KA 2A1TR 3ZN2A 1M1XB 4R1TA 3FNFA 2X2OA 3E27A 4EGFA 1SVOA 4YRPA 1CQJA 3RD5A 4MO9A 5B6PA 3CR8A 5AM3A 1NASA 5FB3A 2DUWA 1U0JA 1MRNA 4KG7A 2BF7A 4WJKB 4FLEA 4RPCA 4DE5A 1GTRA 1ZJ4A 2PKXA 2Z8XA 4ARZB 1NIJA 4OPMA 4XIYA 2V6MA 2FWNA 3QENA 1NFQA 4JLWA 3S40A 3C1OA 1Y3AA 4ND1A 2HOQA 2G8LA 2C0QA 3MGKA 4OAPA 2XD9A 3CB4A 4ZGWA 2I7DA 2HBRA 3V32A 1X14A 4NHOA 2GFHA 3C3DA 1CUBA 1EFLA 1TTHA 4TMXA 2C7QA 5BT9A 1U9CA 3IQFA 2RHTA 1CUSA 3OQ6A 3HRKA 4FR2A 3GB9A 4WZAA 1E5QA 1VDZA 1XCLA 3HUFA 3NOQA 5LYYA 2DTEA 2ORYA 3KVYA 1W1IA 3V4FA 4ZDWA 2P77A 5JSZB 2FLWA 3BK1A 3CVYA 1RZRA 3C3EA 3C8ZA 2XGSA 4MVWA 1P31A 2LWIA 2ZOSA 2VQEB 2C2BA 1S3FA 2XVYA 2Y3IA 4EFLA 3A2KA 2BFFB 2E0IA 1B73A 1PJ4A 1SHUX 3IUBA 3N0RA 1KTVA 2PV0A 3CUKA 4G1VA 1XVLA 4AJLA 4DQKA 5KOYA 3O7MA 5ALQA 3O83A 4EENA 4B74A 1P74A 4TRJA 4OHBA 4GH5A 1G5IA 3K0BA 3WLHA 4TV9B 2X8WA 4QD3A 2OAQ1 1B76A 4D98A 4UBIA 1LBQA 1X1DA 1Z6XA 2WLTA 1T8SA 2YN4A 4H7EA 5I9LA 1VSUA 5K20A 2O8FB 3BEDA 1NJ8A 2QTFA 2WF6A 3MRTA 3RVNA 1O77A 2Z95A 4OI4A 4E33A 1NVVQ 2RIRA 2C4UA 2CNBA 3K9CA 1RXUA 4W1PA 1JA0A 3N75A 4DCTA 4ND6A 4XDZA 1V8FA 1D7OA 1I1NA 4PHCA 1RD4A 2OZVA 2QWXA 1YJ8A 4DFDA 1T4CB 2QMHA 3R6DA 1CERA 1OHHA 2CC2A 3JASA 2ZM5A 3F97A 4KI0A 1QGYA 3I8OA 1IY9A 3UJ6A 3IEXA 4WVFA 4RH1A 2LXNA 3Q85A 5D6OA 3DMYA 3MGCA 3OEHD 4NFSA 4L0CA 3LQ4A 1U3GA 2JCBA 2P2LA 1YUBA 1FF9A 2N1BA 4N5HX 2AIRA 3P2EA 3RF6A 4E70A 4ZT2A 5C0OE 5ICEA 1OJ7A 4O5OA 4PGHA 2H08A 3VPAA 1T1RA 1TU0A 4X93A 2ET6A 1HYHA 2IE0A 3C3AA 3PX3A 3R8FA 2Q4DA 3B1FA 4DNOA 2MYNA 6CHYA 1E3WB 1WUYA 1WU8A 3FFTA 4IICA 1Y8ZA 5E9QA 2O14A 3KAQA 1Z74A 2V3CC 5DK4A 4ED9A 1FYEA 1XRSB 4MYUA 3QELA 4UQLA 1XDWA 1FXSA 2GN6A 3BE8A 5DULA 1O0BA 1T5DX 3I5XA 1SOAA 1KE2A 4DV4B 1TEXA 3H84A 5DWVA 1U8EA 2HRQA 2XZLA 1UBFA 4FR5A 2EZUA 5CCEA 4LF8B 4C76A 3F1KA 2ABWA 2WTNA 3AZPA 4K7JA 1A8IA 2CZCA 1YQXA 2PHZA 4NESA 5EXPA 1U02A 2W42A 3EEYA 4BPBA 1L8OA 5E6SA 5DBHX 3WB9A 1MD9A 4ESVA 3O2NA 1R00A 1XJ5A 5FJIA 4H7KA 1YS4A 4KLAA 1DU4A 4XYBA 5FBQB 1ULZA 4DA7A 1P6XA 4KWIA 1EFCA 1MAUA 1L7PA 3GFGA 1ZHOA 3PKJA 1W35A 2QS9A 3ST7A 5AVZA 1QRSA 3D5QA 1HDXA 3CQ9A 3IX7A 1HY3A 4L8GA 2BHRA 2JCVA 2PKCA 1EM8B 3D8NA 2PCJA 3G59A 3HB7A 2RK4A 2BVNA 5BPFA 3EPPA 4KWTA 4YJGB 5JSKA 2FSIA 1XU7A 2QGFA 3F4KA 2HMSA 3GA5A 1W4LA 4GI5A 4MHOA 3UA4A 4BO8A 1FFCA 3WWYA 1X80B 3JARA 3HPRA 3WK9A 3F46A 3K6JA 1WTCA 2C77A 3R7BA 4P5PA 3WLLA 2CXHA 3UW3A 2PS1A 2Q5EA 1MJGM 1V71A 3A4VA 3HCDA 5CCBA 3T0IA 4KQ2A 4LY0A 3R9KA 1BN7A 3LWBA 4IG9A 4JQOA 1QH8A 1XZMA 2YIDA 3COYA 3NNSA 3UJ9A 1PTKA 2ZJOA 3SFZA 5BPHA 5FWNA 4YJDA 3SZ3A 5H9VA 5JQWA 1WEHA 3BRWA 5F2KA 5TMBA 5KTTA 2Z6VA 4HPXB 3AF3A 4M2LA 1SUDA 4EJSA 3CZ9A 5LZ5A 3ICEA 1H2ZA 3C14C 1YMVA 3EOZA 2XMRA 1BDJA 2HEGA 3C8UA 4ZA2A 3OAAA 3M1IA 3V7UA 4V0ME 5FBLB 3F6BX 2WD7A 1QFZA 1E0KA 4GMXA 4GM4A 2YKGA 1JHAA 1VPTA 1V4NA 1ZXBA 2PIAA 3L6OO 4L28A 4AK9A 1SXHA 3GR6A 3VR6D 1B26A 5TR9A 1QCCA 2JLZA 3V00A 2DPHA 2EW1A 4LYGA 4DADA 5C8DA 3P4YA 4UEKA 2AVDA 4OA8A 3EFHA 2DWUA 4IH4A 5D87A 2B78A 2SCUB 2YWDA 1B0AA 4I50F 5FOVA 4BZWA 1BVRA 1JPVA 2NACA 4GDFA 3C6BA 1PNRA 1N2GA 4JI5B 5FULA 2PIDA 2VJMA 3TTWA 5C1OA 1V1MA 4OMUA 4JASB 4Q4HB 2VHTA 3SJCA 5IF9A 3TQFA 1PX0A 5HILA 1O4VA 1XZQA 3ZNPA 2ORWA 2WYIA 3QBDA 5JNWA 2GAIA 5JNTA 2P69A 4XWYA 3B12A 2QMEA 1DC4A 3IMFA 3PHLA 3G2OA 2F1OA 5EZYA 3UOGA 2Q1YA 5TQ0A 2I65A 3LO5A 3TZKA 2ZT5A 2HMTA 3OJOA 3RSZA 3TOVA 2C7BA 2FA9A 4FZRA 3HA7A 2C2HA 2AKEA 4CCYA 3QEOA 2H5LA 1NNI1 4RENA 1UAGA 1R10A 4NBSA 1JNXX 1EZZA 1AUQA 1D1SA 2V7QD 2ZS8A 3ZZTA 4BNXA 4C7JA 2LVBA 4NDNE 4RVSA 1K8XB 2B3DA 5EP2A 5AQ1A 1G5TA 1OBHA 3EVTA 4YAOA 3CKKA 3SIPA 3QITA 3W1WA 1L4GA 2BMJA 1Y5NA 3BIWA 3LGXA 1MW9X 3Q6MA 3SLGA 4UCFA 4B3CA <