3RH0A

Corynebacterium glutamicum mycothiol/mycoredoxin1-dependent arsenate reductase cg_arsc2
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
128
structure length
127
Chain Sequence
MKSVLFVVGNGGKSQMAAALAQKYASDSVEIHSAGTKPAQGLNQLSVESIAEVGADMSQGIPKAIDPELLRTVDRVVILGDDAQVDMPESAQGALERWSIEEPDAQGMERMRIVRDQIDNRVQALLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ARSENATE REDUCTASE
publication title Corynebacterium glutamicum survives arsenic stress with arsenate reductases coupled to two distinct redox mechanisms
pubmed doi rcsb
source organism Corynebacterium glutamicum
total genus 41
structure length 127
sequence length 128
chains with identical sequence B
ec nomenclature ec 2.8.4.2: Arsenate-mycothiol transferase.
pdb deposition date 2011-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rh0A00
1M5TA 3RVJA 1CHNA 2HQOA 4ETNA 2P4UA 1J56A 4MQEB 1QP7A 3QLUC 4Z99A 4G0PA 4PEVA 1YMUA 2FEPA 1YK0A 2E4UA 3SY8A 4LZLA 4EYKA 3N0RA 5JNVA 3Q15C 4YRZA 1PEYA 2QV0A 4ML3A 4RK5A 3H5VA 5C5CA 3GL9A 3W9SA 4OTZA 3SNKA 3EAFA 1FFWA 4QYMA 1S8NA 2OQRA 2QXYA 5TQ0A 3RVNA 1EWKA 1ABEA 2FSPA 1BDJA 1E6KA 2PKXA 4G86A 5TPZA 2NUBA 4KRFA 1ABFA 1GLGA 3EULA 4RV5A 4W5OA 2R25B 3FMVA 2HQBA 5KI6A 3QELB 1EWTA 4XARA 2FMKA 1YTUA 4HNSA 2FN8A 2FLWA 4ETMA 2NZVG 3VNBA 3GBPA 3RH0A 3A3KA 2GI4A 4QICA 3LTEA 2FQWA 4MR7A 4MYRA 5EWJB 4YCSA 1A2OA 4WUTA 5ED4A 3LFTA 1JLKA 4KMRA 1KRWA 2MSKA 3CG4A 3HDGA 3OLXA 3RVKA 5IULC 3CS3A 5JNRA 2WB4A 2L18A 4PZ0A 5TPWA 3FGZA 1HEYA 3MYYA 5EWLA 1D2AA 4MQEA 2H0AA 4Z4CA 4RXUA 4ETIA 3VNAA 1NXTA 2VUIB 3OLVA 1EAYA 4KZKA 1A0OA 1QKKA 4IF4A 1F4VA 1BDHA 5DGCA 3DLBA 4F11A 4Y9TA 5BRJA 4G0ZA 5C5EA 1DBPA 4RZSA 4Q6BA 3H1EA 2PLNA 4JAVC 1M5UA 1USGA 1C0EA 1QMPA 3QELA 3F7NA 4ZMSA 1MVOA 5BQ3A 4NICA 2ZAYA 5DTEA 3I5AA 3CRNA 4JB2A 4KQ9A 4MR9B 4YLEA 4HNQA 3KJXA 3OM1A 4EGSA 2LBPA 4RU1A 3KYJB 2FMIA 1BAPA 4NQRA 2PUCA 4RXTA 2E4YA 5IC5A 5B3JC 1Y1LA 1U8TA 1JHZA 2IPAB 3KSMA 1ZVVA 1Z15A 3ROTA 4W5NA 3OLYA 4KQCA 4LX8A 1QP0A 2PL1A 3N53A 2HJ9A 4H3KB 1FQWA 1TJYA 3GT7A 4KVFA 3FFXA 4D6YA 5KQPA 1ISRA 1EHCA 4KV7A 3CZCA 3UKJA 2BGGA 1U2QA 4H3HB 4P1ZA 4S05A 3LUGA 2JCGA 4MRMA 2O20A 3O75A 3CTPA 5IUKC 1A04A 3HDVA 4EYQA 4N41A 2FTKE 3LUCA 5KWSA 2FN9A 2WJAA 2NT4A 3HV2A 3NNSA 3E3MA 1F51E 2QR3A 5IUJC 5KC9A 1ISSA 5JS2A 2AYZA 1VPWA 5HQJA 3QLTA 4F8JA 3HEBA 2L2QA 1DBWA 4RDCA 1YK1A 4WWHA 3OO0A 4GPAA 3GA5A 3C3WA 2IKSA 2JVJA 4O5AA 1JWLA 1E6LA 1OXBB 1SXIA 1DCFA 1Z2DA 3M9WA 3OMWA 4MS1A 3OMXA 1B00A 3TB6A 2B4AA 1E2BA 2MSWA 2HQRA 2RGYA 3RQIA 1XHFA 1JYFA 5KQGA 2PUBA 3KCNA 4MS4A 4MQFA 1NXWA 3BREA 2CD7A 4H60A 2A9OA 4PICA 5I4CA 4Z0NA 1ZDMA 1I3CA 4MR8A 4RY9A 2QVCA 1GCGA 1P6QA 3CLKA 4EVQA 3C97A 1KMIY 2FEWB 1JFSA 5BRAA 3P9YA 1RZRD 5T7BA 4Z4IA 6CHYA 4JOQA 3HM9A 3DGFC 4Z4FA 1NATA 1NXVA 3N6VA 2RJOA 4RK4A 2GBPA 3SAJA 2IYNA 3LKBA 1DG9A 2ID9A 3KKEA 3TO5A 2QW1A 4W5TA 3R0JA 3NHMA 3HZHA 5DLEA 2PUAA 4RK7A 2PL9A 3UUGA 3EDCA 1QP4A 2ID7A 2VUHB 1D5WA 3IP7A 4Q7EA 1U2PA 1U04A 1USIA 3OLWA 1Z25A 3A0RB 2YHAA 3CHYA 4F3TA 3JPYA 4Q6WA 1Z26A 2WRZA 4PE5B 2GWRA 5D2CA 2E4VA 1VKRA 2GX6A 2A9RA 1AB6A 5FWXA 3MM4A 4PYRA 4UHKA 3IPAA 3URMA 5BR1A 1JFVA 2JB9A 3DGEC 1UDRA 2W42A 3HXMA 5FWYB 3KG2A 2LIVA 2FW0A 1LJUA 3T95A 1P6UA 2A9PA 2RJNA 5IUNC 3Q9SA 3NNDA 1MB0A 4RY0A 1P2FA 1MB3A 4MS3B 4N0PA 4XASA 3G1WA 4QPJC 3RVLA 3JVDA 4NV3A 1ZH2A 4KK4A 4EYGA 2LP4Y 5TPZD 4N76A 5FBKA 1ZN2A 3A10A 3O2SB 3N75A 3Q7RA 4D74A 2FXIA 4TMYA 1IIBA 3SM9A 1SD5A 3O1HB 2JRLA 4OATA 1NXOA 1URPA 1M2FA 3QX9A 1PEAA 2PJUA 4KREA 2YHBA 5EWMB 1ZHHA 4MAAA 1DRKA 5E3JA 2P9HA 3N8IA 2PAFA 3H1FA 3I45A 4B09A 4LE0A 1K68A 3NNNA 3QK7A 4KNYA 1JL3A 1VLZA 3QX8A 2IDMA 3QEMB 4LE1A 4GNRA 1MIHA 2QU7A 3CNBA 1QO0A 2LPMA 4MLCA 2WY2D 4Z9BA 1TLFA 2FVYA 4OLBA 1ZESA 5JNWA 3RVMA 4IMJB 3RVOA 4IGAA 5FWYA 5EWJA 3MQ4A 1Z12A 3H1GA 3IP5A 5JNUA 5TQ2B 4W5QA 1RZRA 4D6XA 2ZWMA 3LOPA 5ABPA 3I42A 4TLLB 3DBIA 1MAVA 2B1JA 2FKAA 4MS3A 2E4WA 2JK1A 4OBBA 4W5RA 4LDZA 1K66A 3GYBA 3T8YA 2E4ZA 2JBAB 3HUTA 1SXHA 3A0UA 1D1PA 2IOYA 3IP6A 3OO1A 2JVKA 5FBHA 3H5OA 2PUDA 1DCMA 3O21A 1CEYA 3QEKA 4RKRA 1T34A 1D4ZA 1JBEA 1M2EA 4OLAA 3EQZA 3L6UA 2MSLA 1Z2EA 5JNTA 3DLHA 2KYRA 3D02A 4O1IA 3JTEA 1DP4A 4M88A 2WWVD 3HVRA 1QQAA 1DJMA 1KRXA 4FE7A 1TM2A 3IP9A 3M6MD 3EODA 1QQBA 3HS3A 3NHZA 4G0MA 1YMVA 4WXEA 2QZJA 3QEMA 5HSGA 3SG0A 1TMYA 4QYWA 3HO1A 1ZGZA 4KPYA 2HPHA 1JH9A 1DC7A 5CHYA 1NXPA 4MR9A 1LBIA 2PE5A 1PNRA 5TQ0B 3H6HA 2NT3A 4ZJPA 4N47A 4DQDA 3F6CA 5TQ2A 2H3HA 3OQOA 3S99A 3NBMA 3LUFA 2RDMA 3ILHA 4IRXA 5PNTA 1R8JA 4Z9AA 4XFKA 4ZYLA 4XXHA 3GWGA 3HJFA 3KLNA 2L17A 2JBAA 1JFTA 2N9UA 1AB5A 3O2QB 1DC8A 3H6GA 4XLTA 4G0OA 2R47A 1Z13A 2V0NA 2R48A 4EY3A 2I6FA 1VRVA 1PNTA 2LUOA 4MR7B 4YGXB 3OQNA 1WETA 5GQSA 1NXSA 4NCAA 2FEKA 4WT7A 3TX6A 1ZY2A 2VYCA 4HYEA 3B2NA 4HNRA 4Z4HA 3UK0A 2J48A 3HSYA 3O74A 3EQ2A 3O1IC 5TPWB 4N03A 3BRQA 3C3KA 5EWLB 5TQJA 5KQMA 4G0QA 2MYNA 7ABPA 1JF8A 3OLZA 3LUAA 1W25A 3MA0A 3QLUA 4DADA 1APBA 3SQNA 4YWHA 3GRCA 3TD9A 1Z16A 2IPLA 2DRIA 2XDYA 4KFCA 4IILA 1EWVA 3T6KA 2HSGA 3E61A 4RWEA 2R4QA 3Q7TA 3RVPA 3KLOA 5IBQA 5HM6A 1RXIA 1BA2A 1USKA 2F8SA 2Q5CA 3IPCA 4RK0A 1FFGA 3L49A 3H5WA 3FFWA 5CNJA 2MYUA 3HUUA 4E7OA 4Z4GA 1ZGGA 3O1JC 5JNSA 3BBLA 4RK6A 5KC8A 5HKOA 1CYEA 4FE4A 3LUJA 2M98A 3N0WA 4TN5A 4ZPJA 1JYEA 1YVUA 6ABPA 2PUEA 2PMCA 3LMKA 1LK0A 4DN6A 5CNIA 1PHRA 3LKVA 1DZ3A 1RNLA 1JDPA 2CHEA 2FQYA 3CKMA 3QLVC 1DCKA 2IPMA 1SRRA 2NZUG 3K9CA 3T38A 4L85A 2WMYA 4G0YA 1KGSA 1PUXA 5TE9A 2FLKA 3KYIB 3FDFA 1Z18A 3H5IA 3QLVA 4MLDA 3EJWA 4EVSA 3EGCA 3DZDA 3KHTA 1C4WA 2FMFA 2FQXA 4MRMB 3KTOA 3LUDA 4S04A 3BRSA 3GBVA 3Q7SA 2GKGA 2OENG 1XWWA 3GV0A 1LBHA 3K4HA 4O1HA 4RKQA 4LDAA 1ZITA 1P8AA 2JVIA 4EUKA 2F8TA 1RXEA 3OQMA 4JB0A 1ZH4A 5IX8A 1FSPA 4KK3A 4FB4A 3TMYA 3M9XA 3LUHA 4OG2A 4WXMA 2QSJA 3JY6A 1LJLA 1TVMA 3MF4A 3RVQA 4JA2A 4XAQA 1NXXA 3H75A 3IDOA 1Z17A 3CU5A 3I09A 1H9CA 3O2JA 4ZMRA 4F12A 4MS1B 1XHEA 3C6QA 3JPWA 1NY5A 3H5TA 9ABPA 4RXMA 4MS4B 5CNMA 3RVRA 4MQFB 4LRQA 4G97A 5KQLA 1YS7A 1D1QA 4YS6A 3RVSA 1QPZA 3CG0A 5CNKA 2M1ZA 3D8UA 2MYTA 3CZ5A 3LUKA 4MR8B 1GUBA 5EWMA 1L5ZA 5F64A 4JP1A 1JDNA 4RSMA 4CBVA 1BDIA 4G0XA 4IMIB 1EFAA 2PUGA 1E6MA 4TLMB 1JX6A 1SXGA 5B3JA 4N0QA 1OXKB 3BILA 1L5YA 4RY8A 4RS3A 4UHJA 1ZAYA 3N0XA 3Q41A 2FMHA 1NTRA 2WJWA 1FFSA 2MYPA 3MMNA 1DBQA 3MIZA 4YO7A 2AYXA 3JVIA 2CWDA 4L4UA 3F6PA 1DRJA 3CFYA 2E4XA 2PUFA 3F73A 4YR7A 4LE2A 2A9QA 3G85A 4EYOA 4F06A 8ABPA 2TMYA 3HCWA 1U0SY 1QNLA 4JASB 4MPTA 4YP9A 3FFTA 1YS6A 4Z4EA 5JS1A 5DKFA 5IEJA 4P98A 5FWXB 3JS5A 4EVRA 1RPJA 1BVHA 3ROFA 2L19A 1W9HA 2IPNA 5DCLA 4E7PA 3HK2A 5T3YA 2X7XA 5GOTA 1QO0D 3C3MA 1GCAA 3H5LA 4YV7A 4RK1A 1GUDA 2QVGA 4NCBA 3ILYA 3KS9A 5IEBA 2VK2A 1YIOA 2CHFA 4MGEA 4WZZA 3OM0A
chains in the Genus database with same CATH superfamily
1BHO1 3ET4A 4G5OA 2XYQA 4MEBA 4OFZA 4NZNA 4GQAA 1QKJA 1I94B 1EVZA 3CRMA 2BKEA 2PUJA 1UR5A 4WN9A 4GKJB 4C05A 1U3TA 2PQ0A 1D09A 4EUHA 3OIVA 1AV7A 5AM1A 3UWMA 4IFEA 2IZ7A 3UV6A 1RKBA 4IZ6A 3KQHA 3F4BA 2W48A 4XCQA 3WLHA 1YF3A 1AU9A 2ZJAA 3Q3EA 2CLDX 2BZ1A 3IEXA 4HEA6 4K2AA 4PZEA 4B3DA 2AOTA 5TPZA 1CZOA 3N2YA 1YNOA 3BF7A 3D8HA 5I51A 3PPWA 4MP3A 4E08A 4FCVA 5CBPB 1V39A 4JLDA 5E9AA 3HY6A 1UM8A 4JVOA 1G3IA 4RPGA 1L4NA 1ZEJA 2ZDQA 4Z9XA 2I4LA 3RHZA 1RAIA 4H4DA 4F85A 1YVRA 2HRDA 5H7XA 4YAGA 1R74A 3U4QA 1CUHA 1SBYA 3I53A 4CEJA 2FN8A 2R1VB 3CVUA 1Z38A 3NXSA 3GHYA 4HQOA 3TBFA 1CP3A 1GQ2A 4JUDX 4JD5A 3NALA 3BD6A 2NP7A 1T8YA 1PRYA 4ZZ1A 4YCSA 5HNKA 4YB8A 2D1QA 4EUNA 5HIKA 3VZRA 2O3RA 3D81A 1V11B 4FOTA 1F06A 3ZQUA 4RA6B 3X1ZA 3C15C 4BQFA 1QTRA 4OHXA 1W49A 1EM6A 4CIDA 4LXTA 4MKRA 2CSXA 2EZ8A 1VGQA 1D0SA 1VLLA 5A71A 1SC3A 1JA1A 1LSJA 4HAOA 5B4UA 3SGLA 2YWCA 3D7LA 3H16A 1QB8A 1XMIA 2O1WA 3PFBA 3IA7A 3A7EA 5KKNB 2XAAA 3JQ9C 3DBVO 2B92A 3BWCA 3W8DA 8GPBA 3AP2A 1DUSA 1O0SA 5CB4A 1H0RA 1JT9A 2BZSA 4BFYA 3TD2A 3FIUA 4BE4A 2ZZMA 1VRWA 3W0LB 5KMGA 2AN5A 2CNLA 4X1OA 3K70C 5JVDA 5J5VA 4YRDA 2IZ0A 2RHHA 5BRJA 4C2BA 4F2GA 5JTTA 3KYDA 3UATA 5DNUA 3QG5A 2PLNA 3G9QA 1KZ1A 4Z3DA 1O96A 4BVEA 3L7DA 5D3MA 2ZCJA 1GARA 1V9SA 3QKWA 1YJBA 1NG9A 2G0NA 5I8ZA 2IY7A 2QQFA 2VXOA 2YXPX 3K0FA 2H0QA 1Z5UA 3MAGA 5DTEA 2DPXA 4G6ZA 3RYHA 1W5AA 5E2IA 3KQLA 4HDKA 4NAUA 1JQBA 4ZJYA 5EEHA 3AF1A 3CMCO 1L4YA 3ACDA 3G2JA 2HSEA 3RUEA 1GCUA 3IYLW 4G8JA 621PA 4RJTA 4FIDA 1PR1A 1B93A 1O95D 1PL0A 4IIBA 4OMUA 4XIIA 1SO8A 1BKSB 1NFFA 2VJBA 3ROTA 5KJEA 1WCIA 3VTKA 1FQWA 2A94A 5ITVA 2Z6UA 3W3ZB 4ADSG 1E3LA 13PKA 2AC4A 3C2QA 3GRFA 1NUQA 2J7KA 1JIXA 1TMKA 3CX6A 1ZH6A 2Z1MA 1M2JA 1Y3HA 1E8MA 3GQBB 4LI3X 5L3RA 1LXCA 3H2GA 3I4FA 1X19A 3AESA 4M1MA 4MVJI 1V47A 5KYYB 1CUXA 1GSHA 2GBFA 4AUMA 5J2UF 2BEJA 3EG9B 1VSUA 3BJMA 5IUJC 2XXAA 3VC3A 4K3UA 3RK0A 4PXSA 5DM70 2PEZA 2PRIA 4LF4B 3RSCA 1Z0DA 3AR3A 4UM5A 5EERA 1W1UA 4S12A 4ZU1X 3CLVA 4UU8A 1YK1A 3PL1A 2REQB 1W6UA 2AYYA 2VF7A 3OO0A 4XVCA 4GR5A 4FT4A 5CA1F 2NVOA 4QJ4A 1J7JA 1NUUA 3TB6A 3DTNA 4JHLA 5C8YF 2ZRHA 1YAHA 2RGYA 3RTCA 1XHFA 2IYFA 1UDBA 4C5BA 1ZR4A 5I9NA 3WB9A 1QUFA 1P7CA 1DUIA 1I4LD 1K3FA 2VVTA 3DVAB 3Q98A 3ZTYA 5KJFA 3BREA 4DR2B 1QYRA 2A84A 2CD7A 5CDFA 3DE1X 3O0DA 1NBMA 1YV9A 4H7DA 4RY9A 4L5BA 3RF7A 4BVAA 5KWIA 1TK9A 4M3NA 1E1DA 3UT5A 3UG7A 2XA1A 3D6JA 1LLUA 2FPGB 1UJBA 2OESA 2YW9A 4BTLA 4LJ8A 4GXQA 2ATEA 5AM3A 4ITVA 3FMPB 6CHYA 4D57A 1W36C 1OLUB 4EF6A 3R4CA 5ALVA 3N6VA 5H3HA 4RZHA 4IIUA 3SBEA 4HMQA 3TK1A 1NVUQ 4DLBA 1XQ9A 2B3TA 4J2OA 4GL4A 1VSQA 4GL2A 1T3HA 2Q3EA 4XR4A 4BAUA 4Y2TA 2J09A 2BMAA 4YP5A 1VSVA 3B48A 3W9SA 2BSQA 1EXDA 3HZHA 2P9YA 2C8VA 2JFOA 1TVCA 4QOSA 2O52A 4XX0A 4JDUA 2O57A 5JD4A 1IONA 1R3DA 3C3CA 3OG9A 5BNFA 3M49A 1PW7A 2R1TA 3CE9A 2DP4E 4FDTA 3RJZA 5THKA 4IFBA 4WCVA 1CQIB 1QZTA 4DLYA 3UWOA 1QK5A 4Y67A 2VP0A 4E22A 2IU4A 5JUWA 3R76A 1I5OA 1EP3B 1QZ3A 2Q3JA 2XZPA 3BDVA 1RJFA 3OUUA 1ML3A 3EEIA 3IPAA 1XB2A 4G63A 4OHMA 1FU7A 2OSVA 3H4MA 3L5KA 3TTXA 3PGLA 5FP0A 2OLEA 4AP9A 2LIVA 3FWPA 2AF3C 2BGMA 4C87A 3CZMA 4EJSA 2RJNA 3N7UA 5JBIA 1E4EA 1MB3A 5IAOA 3TIXB 2FPSA 1A8SA 2FP3A 3CINA 4JQCA 1VPEA 4WNIA 4J0KA 4QPJC 1G3MA 1O6GA 1EVKA 2VKQA 3N87A 1ZH2A 4QOGA 2Z6AA 4G5QA 5EJEA 1K4KA 3DR3A 4QGFA 1ZUIA 1PZGA 4R1UA 2BFPA 4ZANA 3WFZA 5CX1B 1QVAA 1U2SA 3EWIA 3IALA 2A14A 3SM9A 1JG1A 4BNJA 3DB2A 4OATA 1M74A 4DMHA 4EI9A 2QM8A 4FD2A 1YONA 1T9ZA 4HDQB 3OOHA 4QD3A 4YRMA 3ONEA 4LUCA 3P9NA 2LW7A 4XQGA 3TVYA 5IKPA 5IWAB 5E3JA 3N8IA 3GCZA 3NAMA 2QMQA 3G9XA 1PJ3A 3I45A 3FCYA 2A0XA 4FQ7A 4YDSA 3QK7A 3E22A 5A1JA 3VSCA 1F3LA 4HDRA 3LWBA 4KQ2A 5AJWA 4YJGB 4BVGA 3CNBA 2QS9A 1JG2A 4QGSA 4F04A 3HCBA 1O9HA 4PU0A 1KZGB 3OJEA 1DJPA 3PE4A 3JCZA 4J2TA 3SXPA 1TCUA 1TL7C 2QN8A 4OI2A 2W4MA 1L7PA 1C81A 2JZNA 2N75A 2CLFB 4IOJA 4R8RA 4BVBA 3EUFA 1T4MA 5DO9A 1OWPA 3C7DB 1GZDA 4KGXA 1RQLA 4BMXA 5CIYA 1TZBA 3LOPA 1PFWA 4MVJG 2XUQA 1E2DA 4TLLB 4J4BA 2Z8XA 1H8HD 3SKYA 3FJYA 3Q11A 1AQIA 3MC1A 4UATA 3F2VA 4LMPA 1ECJA 4DBVO 1ZZGA 2JIRA 4DS3A 4G26A 3ICWA 3G8AA 5K4GA 2I91A 2AVDA 2RK4A 4UU1A 1Q17A 2JVKA 2QR2A 4QA9A 1UKEA 1GA6A 5TEVA 1CHDA 3VX3A 1CLEA 3PHCA 2O0KA 3EMDA 3QE4A 4GMGA 2I8LA 5AI4A 4DPKA 3DFKA 1Z2EA 1MC5A 5JNTA 2QTMA 3W8EA 3W7AA 2DKFA 1OCEA 1W581 4URWR 4O1IA 2FFBA 4RFVA 3HVRA 2AHOA 4UTVA 1MGOA 4QELA 1CDZA 5FV4A 1W73A 3NTXA 4DA9A 5HRAA 4D0NA 3ZD6A 4RIFA 3M6MD 1HDGO 1ZISA 3G2HA 1TGVA 4XM0A 3OY7A 1QFSA 2CEAA 3DBRA 4R81A 3WWDA 2XGGA 3A3OA 1TMYA 2HT1A 3L1VA 1HRKA 1XCBA 3AVTA 3O4GA 4INZA 2Q29A 3HBFA 1PNRA 1N9ZA 3CH7A 1VE1A 2CHQA 4L6IA 4NAHA 2X2FA 4DIFA 4H9GA 1SQ5A 1DOHA 4H1UA 5KTNA 2GM5A 5FEUA 2HA6A 2J0EA 3HA2A 2ATXA 4HZUA 1S2NA 4M54A 3HI4A 4XE5A 2H3HA 3TIFA 5AP9A 3S99A 1VPVA 2ZIWB 3UO8B 4R6XA 2DQ4A 2WT9A 2G7MC 3KL4A 1SCQA 4OJTA 3IAAA 4HTAA 1THZA 2UKDA 4C7JA 5BR7A 5KVVA 2BL4A 5ALSA 1BE8A 4QDOA 2ZS7A 3RROA 3QA3E 1JEOA 2ECFA 2I6XA 3F6RA 3WTCA 1G7TA 5KNBH 1KEEB 4FFPA 2IV2X 2EHDA 2QJOA 1V5FA 2WMDA 2JNWA 3OD1A 1OH7A 4BEJA 3SICE 5GZ3A 3IJRA 1EX1A 4JHXA 4FINA 1PNTA 5BSWA 4OHZA 1UKZA 1ZRMA 4CM1A 2ASVA 3G3EA 1BWSA 2YHUA 3TX6A 4E4YA 1U8XX 1ZIPA 4IDEA 3D31A 4QX6A 1G7CA 2PRYA 3PPIA 1WBJB 3GDOA 4GPIB 1ISIA 2DKOA 4POOA 1DAEA 1ZLXA 5L3VA 1E3WA 4EB3A 2GF0A 4MNTA 1QIKA 3EYAA 4BMNA 2VTKA 1O95C 5EJ9A 1YBAA 4JJFA 4I81A 4K8RB 4MK4A 4Q3OA 1KZ4A 2GEDA 1FJXA 3WYFA 2ZJ7A 4K6OA 2ZYGA 2OZLB 1AHIA 3QWAA 1GA4A 1QF6A 3G82C 3EW7A 3IQGX 2NQ8A 3JAWB 1N5DA 4PC7A 3STUA 4D3SA 2G1AA 4YWHA 5BNIA 4L76A 2EDAA 4IDDA 1NW7A 5FUWA 2GM9A 4AJ9A 2UUBB 1EWVA 4TWRA 2HSGA 4YBZA 3HVJA 3Q7TA 3PC6A 1V5EA 3MJEA 1YUMA 3GLVA 4WFIA 5D6NA 4WZ6A 1IULA 3R7FA 1FXWA 3WI7A 4EGAA 1XCMA 3MTBA 4JH0A 2AZ4A 4LNUA 3PF8A 5J58A 2JLAA 3GC6A 2FRDA 2X5OA 4COKA 2P2SA 1UXGA 1T9CA 3NH9A 2QM0A 1RD4A 1U98A 3ZZ1A 4N7JA 3AH8A 3P7MA 4RF4A 4TN5A 2QL5A 2QT9A 4RH3A 2NU9B 3S1AA 3DAFA 5JWOA 3VO1A 1XNQB 3QXXA 5IAAA 1MC4A 4JGIA 4LHYA 1WA5A 2QRGA 3KJEA 1S4QA 2YIJA 3RLIA 6Q21A 1DZ3A 2NX2A 3MNFA 3PHIA 4CNQA 1MNAA 4G23A 5AM2A 2OLKA 2WVAA 4DCVA 4DIOA 1ZSVA 2CDBA 4H7HA 1CX9B 1TA0A 5DFAA 421PA 4QTXA 4ZCQA 2QL7A 5TE9A 3WMGA 3QKRB 5GMOA 3RC2A 2PM8A 1U8CB 2GJ4A 5CJJA 1UDWA 1I9GA 1Z4JA 4N5IX 2A1UA 2QD1A 5AW5A 3WK6A 1LS1A 1XV5A 3EZ6A 2DGDA 2JAXA 4G1CA 1F8YA 2PO5A 1UKAA 1XWWA 1WHSA 4JCOA 5AR1A 2NUAB 1DPGA 3BB1A 4O4HB 2GNPA 4Q16A 2GZRA 2PNJA 1ZD1A 2H92A 3HG7A 3T52A 4KCGA 3K1YA 3HKBB 4ZODA 3UT6A 1U0GA 3NHFA 4NBUA 2DUJA 5EOVA 2I7DA 2CKDA 5F1YA 3C48A 4YRPA 3ZD7A 3IDOA 4D0SA 1O6BA 3CU5A 4M6WB 3G8YA 5HF5A 1VCNA 2Q0XA 2XEXA 3KVOA 4N54A 2FX5A 4RHEA 4XVRA 3OQIA 1IN8A 1VE6A 2DR3A 2WUVA 1U28C 2VEDA 4L2IA 4R0MA 4AZ0B 9ABPA 1HE4A 3SR3A 3A1CA 1TNDA 4E6PA 3N28A 4G97A 2EKBA 3WHIA 2FUG6 1WXHA 3L8EA 2IXDA 2OCGA 1ECCA 5DVZA 3OCUA 4TX1A 2C07A 4AQDA 4HRAA 4N8SA 3KLBA 2WWHA 3FHLA 1LNSA 3ZWWA 2RGXA 2CFIA 2MIIA 2Z4TA 3NVKI 3MT8A 4O33A 1T1GA 3R7DA 4CV0A 1KZYC 2XQVA 3WGMA 1AK9A 1CE8B 1Z7WA 2CV2A 3FSEA 5IZ4A 3FJOA 1A1SA 1DU4A 2CN1A 2PYZA 2PYIA 4ZWNA 2FW6A 3I5MA 4LFAB 4QTUB 3EOZA 3H19A 4UMVA 4BP1A 1WPRA 3WBJA 4BMZA 1SUSA 4Y2XA 2PXAA 2AYXA 1NC3A 4R1SA 4G1VA 2IZOA 4KXQA 1OLOA 1DRJA 1OHHD 2DTEA 2X8BA 3ROMA 1K5DA 2UZ0A 4LE2A 1L7AA 2OQIA 1V8OA 5FR2A 1ZH8A 2BDUA 2YXEA 4K46A 1NWCA 4F9GA 2R86A 5GPBA 1DFHA 3ZCVA 3T5CA 2I3AA 2VPZA 1O7JA 1QK3A 1S2IA 1GLVA 1NW8A 3EW9A 4LPKA 1NG1A 3BC1A 4RGBA 2IEDA 4RL4A 3P97A 5AQEA 2WJPA 3O73A 1QYDA 2I7CA 4NU5A 5KWJA 5BVHA 2JGRA 4XI9A 2P9FA 1MLDA 4H16A 4RESA 5TGZA 3H9JA 1EUYA 3K15A 3BK2A 4C6RA 1ITZA 2IEZA 5JCZA 4II2A 3WKCA 4O59O 4YV7A 2PWBA 3PXEA 2R8XA 1S2GA 1BKDR 1B42A 3FY4A 3UJDA 3CT6A 5HQ3B 1N5LA 1ILEA 5IJ0B 4GZMA 4BQPA 1FRQA 2W5UA 3AM5A 3G2NA 4TQ9A 4TS9A 4Z99A 3IIJA 5BOVA 4PEVA 4HWKA 1T2AA 4GYKA 1MJNA 4EYKA 1RM3A 2X3UA 4LX0A 4YT5A 2OM6A 1QGZA 4JI7B 5EMJA 4O2BA 2J3KA 3TNYA 2H1CA 2AEMA 5BN3A 4UM7A 4ND2A 4PZUA 3GROA 1ZCJA 4ZVTA 221PA 3NRJA 3RW9A 1DAFA 2DPLA 4QQRA 2NXNA 3GBSA 1VE5A 2FNAA 3K05A 2ZVDA 2I2WA 4WH0A 2B7BA 4M0LA 2EP7A 1ISHA 2VS1A 2FEAA 2QM7A 3PNBA 1ZP6A 3B13B 1R27A 4GGMX 4OUKX 2CBGA 1EI9A 4P3PA 2WU0A 4HAXA 3W5CA 5K45A 1LGYA 2XUHA 4DVJA 3E2PA 3GMDA 3U7EB 4PY2A 3MWYW 3QWFA 1HQYE 1I10A 3TLZA 5IVPA 3OJLA 1BX3A 2YJ6A 3RI3A 3GIDA 1Z4NA 2FQWA 3ZNNA 4RJLA 3DZHA 3DYIA 3U7HB 1G3RA 3UMBA 4ID9A 4OP1A 3RR2A 1KK1A 2MSKA 3O8NA 4NBLA 4LZOA 4NEGA 3P9SA 4Q48A 3FCOA 1WDTA 3E7PA 4NG5A 4OHFA 3FGZA 4MVYA 3ZWOA 3ZCSA 2C3YA 3E0XA 4YUAA 2JI9A 3OX4A 3EZGA 1NBMD 1OYOA 1NE7A 1VIMA 1VE7A 3DQZA 2VZ0A 4J94A 4O4JA 5KYUA 4ZK6A 3OLVA 1KYYA 2WHYA 4M9QA 1UJ2A 3SCZA 4GPD1 1FFXA 1KEUA 4XPZA 3ZXSA 1QKKA 3B9BA 3DVRX 2JEOA 3BIFA 1ISJA 3PC7A 2DG2A 1LA2A 4X84A 1TQ4A 4QUHA 1QGUA 3RU9A 4CIXA 3EXG2 2D5BA 4F11A 5AICA 2E37A 4G0ZA 3UC9A 5L95A 4N3CA 4BMYA 4GAEA 1AM4D 4HQKA 3REGA 4PX3A 3INTA 5JASA 3JARA 3H1EA 3SC4A 5KQSA 1DX6A 1C1XB 2ZJ6A 5EXXA 1PFVA 3RSLA 3COWA 3VPBA 1YGPA 4MARA 1Y3BE 3BSYA 2IYEA 4FFVA 2NPIA 3NB0A 3CRRA 4QPNA 1BWQA 1MVOA 4ME6A 1VFNA 1SCJA 4Y1GA 4YR9A 4Y6LA 1AKYA 2O2YA 2CLHB 3KJNA 3NFYA 2HI0A 1WMFA 3Q3VA 5DYTA 4ZEVA 2CHUA 2CXRA 4XGKA 2C3UA 2W7TA 3QW4B 2APJA 1JE1A 1KR5A 2JJMA 1I2BA 2PUCA 4YJHA 3PD1A 3SQLA 5JSQA 1XF9A 4E2ZA 1FP6A 3GMTA 1EFHA 1XZLA 1E1MA 4I55F 3O9ZA 3CPSA 4LGVA 4DNQA 4ZMBA 5K8LA 1BXGA 2IYOA 4RKYA 2YOHA 4H3KB 3AXSA 3LX5A 2X1VA 1N2OA 5AI9A 4P4LA 5KQRA 4IV8A 3R3HA 1T8WA 3HH8A 3NT2A 1BTOA 4GF5A 1NVAA 3UKJA 121PA 2GAIA 2ODQA 1HFJA 4NNJA 1ZM2A 4CODB 4UQOA 4Y1RB 4DY6A 2PKQP 2GHRA 1XQVA 1L8OA 3DZ8A 3O95A 3Q9UA 4UDNA 4J0JA 5LUBA 3W7VA 5ICGA 1GKIA 3V1TC 2FN9A 1U2TA 3PB3A 5I7AA 3GLHA 2NT4A 2DTDA 2ODWA 3OE4A 5FFMA 2C2ZA 3BFPA 3IPXA 1NJ5A 3TCKA 3M4NA 3NBUA 1Z0KA 4J1QA 4O29A 5J3JA 2JGNA 4MW4A 5BURA 3AILA 3QLTA 4F8JA 2P30A 3VQTA 1II8A 1LI5A 1T43A 2BFDA 5BW6B 2IKSA 3IGFA 1T2DA 3IUMA 4FUTA 4QYIA 5KNDA 2ZSIA 4S3MA 3UJBA 4DOMA 4KITB 4W9MC 3QVVA 3EXIB 4RV4A 4FBMA 4ZAXA 2XVMA 2H11A 3PQ8A 1N2SA 4ISCA 3R9XA 2QX6A 4Y7CA 2V5UA 1RBYA 2XV1A 4IEEA 2VRNA 2JAOA 2GBIA 1XVLA 4Q9NA 3UMRA 5B7PA 5F1OA 1DEHA 2QZ4A 2X2OA 4IMPA 4FDMA 1P6QA 1USVA 3FAKA 3H04A 4JOSA 2HIMA 3R8CA 4NOKA 3TAHA 4BN5A 5GVSA 2XE7A 5ILGA 1Q1NA 3HNPA 1NYLA 4AROA 3QENA 4P3OA 1RXSA 4RLFA 1E7MA 4J3JA 1EK6A 3FOCA 3G5LA 4CG0A 4M76B 1ZU4A 2A6PA 4UNIA 5AKXA 5KSOA 4RFSA 1PKXA 4CVNA 1U4NA 4H6XA 4ZVVA 3R0JA 3NHMA 4INJA 1ZJZA 4IO0A 1T8PA 4AZTA 5HOEA 3EDCA 3ILSA 5GV8A 1K2WA 1T15A 4S1PA 3QW2A 1TMGE 4MIKA 3B9QA 2BJVA 3T35A 2QTVB 2VUHB 5EP3A 2Y92A 5IHXA 2BKUA 2W43A 3KEOA 5B2EA 1SCKA 2C31A 2YHAA 4CPDA 2CT8A 3TVDA 1OH6A 4YFYA 4X1YA 2E4VA 1Q84A 2R7MA 3RUCA 2XMCA 2Q4TA 2ZT6A 5AI0A 3MM4A 4IV0A 4JXKA 3AF6A 1IY9A 2EF0A 1AT1A 3LWZA 2H9YA 1GOTA 1UOOA 3QFSA 3KCQA 2QTFA 5C53B 2EDCA 1TKRA 3ZU5A 1NKSA 1GQFA 3ZCXA 2A9PA 1E60A 3W3AD 1XHLA 1QLJA 4PO3X 3UK2A 4FYWA 2IHTA 3W2TA 4F6CA 5BYKA 4BY9E 2I8CA 2Z83A 4J16A 4CUJA 5AVRA 2I34A 5EI5A 2Q5JA 3G0GA 4PYMA 5BNZA 2RCNA 1DNPA 1OLXA 1NUAA 5IU6A 4NJOA 3VI4B 2P3QA 2WEKA 1W9MA 3AVPA 3HSSA 4HP8A 3KSRA 1XVUA 1XZHA 3P4XA 4DRZA 4UE2A 4Z8XA 4F4DA 2GRAA 1Y34E 4WBXC 1L9XA 1SD5A 1G9TA 2Q7DA 4KSYA 2BFBA 2E87A 1URPA 2QP3A 5CCDA 1HG0A 2G76A 4QGHA 1UZNA 5A03A 5SY9A 4I4CA 4OBWA 5L7WA 4KYVA 2JFFA 4W5WA 5IG2A 1VECA 3QXCA 3AHEA 3WRVA 1CR0A 4HDCA 3OZEA 4B09A 2ZE8A 3ZHBA 3OIYA 4JYCA 4PLVA 1JL3A 1NLFA 2GO7A 4ND6A 1Y0BA 2AMFA 4MLCA 3LC0A 3KO8A 4PZYA 2R6AA 1ZESA 5JNWA 3U7JA 3YASA 1AMUA 4NJMB 3GEEA 3PEUA 2QVYX 2EW8A 3Q9NA 4HH4A 4YLGA 4JUAA 1E7QA 4AX8A 4B4WA 1MPTA 1M9NA 3RSSA 4BWVA 1W48A 1ZKMA 1P33A 2QNBA 4B8WA 1B4DA 3ZDRA 2CVHA 6LDHA 3ZWXA 1JLRA 3PE3A 4E0BA 1NMSA 4EKDA 4DWJA 4XVUA 3VR2D 3F7MA 1U4SA 1RKUA 2JJ2A 1K66A 5FI5A 1L7DA 4NFYA 4U7WA 3HUTA 1JDBB 3HQ4O 4X3PA 3QHQA 2Y1LA 3E58A 4MEAA 4CKYA 1U0LA 3LCVB 2J32A 3T3EA 4CQNA 1SXJD 1F2TA 4LGCA 3MT0A 3AMVA 3FR7A 4I4IA 4OQYA 4RF5A 4JLSA 4MJLA 1NN3A 1AE1A 3RG2A 3UAWA 3V46A 2G5PA 2WIAA 3QX3A 1JH8A 2YQZA 4L5JA 3B5IA 4B3GA 1A9RA 3FCSB 4JDPA 4WAUA 5ETJA 1KSHA 4LYDA 4HLCA 2WAYA 3JQAA 2QXUA 4I19A 4K9QA 5I7RA 2NZ8A 2Y05A 2JIMA 1UT8A 4G5XA 4KXWA 4MPDA 1D04A 1VXRA 1XKTA 1AS2A 4IG9A 4R1TA 4RAOA 1LX6A 1UK8A 3V2IA 2VWPA 4LOIA 2R0QC 1ZNWA 2JLBA 2PKQO 4E33A 3KOMA 5EA2A 2XKAA 3MTDA 4OHVA 2EU8A 4EFKA 2BF7A 3A4TA 3OQBA 4MWZA 1QYWA 2DHRA 1AQUA 2XPCA 1H6DA 1PJ2A 1ZQ1A 2H51A 4L4RA 4ZJPA 1E3DA 3F6CA 3LDUA 3ON5A 1AQNA 5ARBA 4JSTA 2WWGA 3OQOA 1TTTA 4I4NA 1I2AA 4HVAA 3OF3A 3LUFA 1T9GR 4NF2A 4QECA 4RA9B 1CVRA 2PX2A 2NQ2C 3C3EA 4MKHA 3ETHA 1I0IA 2G25A 4A0FA 5JXIA 2NSHA 4H4CA 5BN4B 4YACA 3RAJA 1JFTA 1JZTA 1OAAA 5AFSA 2P6NA 3U44B 1Z5OA 2ZI6A 4REQB 4Y1EA 3TZQA 4B74A 3T41A 5K01A 3O8CA 2CV0A 4YY3B 1DKNA 4QUGA 5K8UA 1NQUA 2BFNA 3AR4A 2HT6A 4WL0A 1GPMA 1Z34A 2Q3FA 1CD5A 4G2NA 3UK0A 3KWLA 3KVYA 1L3CA 2EWVA 3GK3A 1KAOA 1E0DA 4WFKA 5HUQA 3NHRA 5DLQC 2XYVA 2BHRA 1VL6A 1WU7A 5KQMA 1LF5A 2GCOB 4FFRA 3NLLA 4PYKA 1UJ5A 2H4JA 1UPAA 1JEAA 2ZYSA 2VOEA 4PS1A 4P7GA 3TN7A 4A8JC 3WA6A 3PEWA 4IVPA 4PSDA 5AIAA 3ZY2A 2GN8A 3QLUA 4P2BA 5DMHA 3SQOA 2ZSBA 4N3GA 4URYR 4EJSC 4JWKA 3WK9A 1ORHA 2I1QA 5CA0B 2YVAA 4GFDA 2V6BA 3WNVA 3ZLTA 3FVVA 3QGMA 4X9XA 1KJJA 1RWQA 1YS1X 1JU3A 1GPNA 5FB3A 3SZGA 4F93B 1RXIA 2PZGA 3BAZA 3D54D 2OVBA 4H7KA 1H2YA 1HDEA 2Q5CA 3IVCA 4LWZA 5TGTA 3W5DA 2FG7C 2QG4A 4HGQA 2VSNA 3DSRA 4XB1A 4AO8A 4E4RA 4HYYA 5DI3B 3AJAA 3FOZA 1ND5A 3B70A 3OE7D 1IATA 3A6EA 4PTLA 5C37A 1HLPA 1UKYA 4LAFA 3AEUB 3LVBA 1M0TA 4RJJA 1YFJA 2C00A 4MRSA 5HJ7A 5I8PA 1V7PC 4U1RA 1CFZA 2D8MA 3FTCA 3HDQA 4L51A 5KYXA 5ALEA 2A0WA 2DT5A 1FXUA 1JPNA 4H6VA 1E96A 5F7JA 4BNDB 4ZAGA 5GJWC 1DXYA 4CKBB 3UW3A 2PX4A 4LOKA 1XDUA 3KYCA 2QMHA 4NENB 4NL4H 1FTWA 2P11A 4C4PA 1GPWB 3ZS8A 1NBAA 3NJ8A 4S1NA 2V54A 4QU9A 1R88A 1T5DX 2VQ6A 3W06A 1NVMB 5KBYA 1ADYA 3QUSA 3TSAA 5BV1A 1YVDA 4MRMB 3KTOA 4DGSA 2Y8EA 3OP1A 3WWYA 1GP2A 1GEGA 2PBLA 2HHJA 4WKCA 4DNOA 4JJ6A 1PJRA 2D13A 1D8AA 1KO7A 2DBVO 2AQIA 4G4GA 4YROA 2V4UA 4UBNA 2H1VA 5T8KA 4HUJA 1QFXA 2JVIA 3QUBA 4O2AA 3O4IA 4JB8A 5JYDA 1S89A 5IX8A 4IXWA 4EGCB 1OBFO 1AG9A 1T24A 3KJHA 2WKQA 1GZ3A 1E92A 2YWHA 1VGVA 2CMGA 5YASA 1GAWA 1G17A 2C5GA 4G5HA 4H31A 1GKKA 1SKYB 2OXTA 1OXTA 3I09A 4A03A 4IHJF 3O2JA 2B99A 1KY4A 1IC6A 5TF0A 2CXQA 4GECA 3STVA 1KPGA 1QRSA 1Q74A 1WHTB 2YMMA 3MLAA 3GELA 4HEQA 5G0VA 1A9PA 2A8YA 4R9SA 5B5SA 4WOKA 2FCAA 5LP6B 1YC2A 1DEKA 3ZI0A 1WMSA 1YI8A 3C1OA 2ATCA 1TEHA 1X3SA 2YWRA 3RS2A 5AUNB 4ZRDA 3KQOA 1ZXBA 3OQJA 1N6OA 5AKJA 5DM1A 1ZK0A 2Z04A 5LXTA 1EFAA 4FD3A 5C7LO 1RRCA 1GGVA 2A88A 4AIIA 2REOA 3IOYA 4Q66C 1T4CB 4DNFA 4I1RA 5EUBA 1OF1A 2NSJA 4RS3A 5JARA 3S8MA 1OMOA 4ZDJA 2FMHA 2X14A 4U7FA 5KSPA 4E5MA 1W6RA 2GARA 4A2WA 1U6IA 1VKZA 1OQAA 2IWHA 1O2DA 4QFMA 4XJTA 3LF1A 4A4DA 3ZH9B 3KKOA 1C8KA 1UZAA 4L8FA 4RQUA 1QRAA 1T3GA 4O08A 3AV0B 5GOZA 4MDFA 1SWVA 2ZUVA 3NRCA 4AD8A 1C9JA 2IFTA 1Z56C 2G4VA 2X86A 1AURA 1O94A 5BT9A 4BKRA 3VC7A 4JASB 1H1TA 3ZUPA 1QLHA 2Q5LA 3TKLA 2Y3IA 1US8B 5IH3A 4NMLA 1P45A 2Z5FA 1GNLA 2DFPA 3AHGA 2I6TA 4TQGA 3FLEA 5FWXB 1MU0A 5GIOE 4N9QA 3U61B 1EJ2A 5E9WA 4E1AA 1DIRA 2QW0X 2X7XA 3EGOA 1U3VA 3ABSB 1D2MA 5HFJA 3I0ZA 3G13A 4RK1A 3GUYA 4DM4A 4L6CA 1N5IA 3KS9A 3O21A 4KKVA 3A3PA 2HQOA 1RLTA 1PR6A 2XIJA 3T5GA 2HK9A 2P4UA 4OKNA 4DRXA 1J8YF 2O5EA 1C7IA 4IOKA 1INLA 3QFFA 3HBLA 4YMLA 4PR0A 5EHXA 1RLJA 4CCSA 2P6MA 3WYCA 2QRQA 3REQA 3ISJA 2C4VA 1M0EA 1GHTA 2P6UA 1YRBA 2YC4C 3CGGA 4DDMA 4E2WA 2JATA 3HFJA 3P52A 1C3LA 1KBQA 3U5TA 3NDPA 5EINA 4Q37A 3GL9A 3F49S 4OTZA 3HWWA 4V0OA 5FTWA 1UFVA 3HYTA 4X71A 5HEKA 3GGSA 5B4TA 1YRLA 4Y2YA 1SXJC 1UBUS 4F4JA 2O8CB 2FRDC 4KU4A 3UJPA 3PQ6A 1IOWA 2WWXA 4QKQA 1AKEA 4CM9A 4D9HA 4JBLA 1Z4MA 2WYHA 4KXUA 1FLNA 4N49A 4P5PA 5ADUS 3IILA 4W5OA 1Z75A 1CYDA 5KI6A 5I01A 2VDNB 2WJ3A 4FFDA 4ARZA 3BIOA 5EIWA 3MGGA 4XARA 2FMKA 1RWBA 3THYB 3L0YA 2Z09A 1SVKA 4BIIA 3EISA 4D4HA 3NFRA 2NZVG 4KAAA 3EXEB 3KOXA 3NKFA 1ISMA 1ZHOA 1XA4A 5ICFA 4EKGA 3E1SA 4WZAA 3TIGA 2Q50A 4JN6B 4MYRA 4MHSA 4PRYA 3WL4A 2Q0QA 5KNDD 4I1PA 1BOOA 3LFTA 4YCCA 5PGMA 2C78A 3I6MA 1VCOA 2FF7A 3TAXA 1T6XA 4MCJA 3R2JA 4Y2PA 4TKVA 4MOWA 2VYVD 3S2ZA 3AF3A 1EUQA 2IP2A 1RWWA 1CY7A 2V9ZA 4PZ0A 5C3UA 1KZ7B 4NFSA 1GFWA 1VL8A 4QJ5A 4YMIA 4CGZA 4I1VA 1G9XA 1NUHA 1F20A 5ALLA 1K7YA 3KSAC 4BGIA 3L1IA 4K88A 2JCSA 5E1BA 3TTTA 4OQXA 5A9TA 3K53A 3QVJA 4D9MA 4E32A 1A0OA 3RC1A 3X1KA 1W52X 1Y33E 5AVZA 2PGOA 3DE4X 1GJRA 1NJ2A 3B2EA 1VG9B 5DXFA 2HMAA 1UXHA 2WYWA 4EMTA 1N5KA 2TSYB 2TYSB 4YP7A 1SCDA 2I2FA 3MHTA 2VT7A 1CVLA 4M8IA 4F86A 4OHWA 2Z43A 5TLSA 1P31A 1FDSA 4RMNA 1ZGHA 1JDZA 2UDPA 2O0HA 4CR6A 4HVCA 1RI2A 4GPZA 4MGIR 3O8QB 4B8YA 3U4HA 1XEFA 1R7RA 3R23A 4Z9FA 3OCJA 1EVLA 3ZWCA 4NICA 1MF7A 1R8YA 2UUOA 1DELA 1UP4A 5F51A 3GLQA 2R1VA 2FWRA 5DBIA 1E6CA 2A9FA 4IUCS 4KQ9A 4NZMA 4YDRA 3EPKA 3FNBA 1E2BA 4NCKA 3H84A 3LDHA 2OG1A 3PHJA 5JYBA 4NYJQ 3GJ6A 2XJ4A 3LP5A 3VTAA 3FOEC 2PJRA 4ACAA 3R41A 3VDQA 4YECA 1V11A 2G4CA 5JSFA 4IHAA 3VR4A 4GLJA 2EG9A 4OP3A 4KQCA 3P0EA 3TLMA 1B0PA 3ANYB 1V4VA 3BFKA 3I30X 4DLLA 3CKKA 2YINC 1Y3CE 1YQWA 2FFRA 2GPYA 1OTHA 3HZZA 5HK8A 4AS2A 4JYPA 1RRKA 2VNKA 4LC9A 1CQJA 3L0ZA 1SBQA 3AUXA 4QREA 3WYBA 3ZE7A 4RD6A 5BSUA 4HMOA 4IX1A 1Y5LA 2FTKE 4QQKA 5KWSA 3E1KA 1OPRA 2YS6A 1ZG3A 2FU5C 3E3MA 4RELA 5DNYB 1C1DA 2I76A 3UAOA 2QLTA 4CQMA 5FR1A 1M2OB 4NY1A 1XMQB 1A77A 3DO8A 1ORDA 2G06A 4I50F 4M9CA 4R54A 3IQHX 2ZJ5A 1YRQA 2FW1A 4UMEA 3RQSA 2JAWA 4CKXA 1JWLA 2B94A 1H42A 3D3JA 4PHHA 1QIJA 1NMEA 5CM8B 3IT0A 1GM5A 2XD4A 1E9AA 3ZHTA 4XUDA 3OFNA 4IYJA 2HB6A 3ZWNA 2PUBA 4ROSA 2FZWA 3T4XA 2X4GA 3IOCA 2B6NA 2R7KA 1XCGB 1L5SA 1M2KA 1A5TA 3Q6NA 4Z0NA 4M7OA 2I03A 3D43A 4AP6A 4E12A 1TQHA 3RO7A 1V4BA 4ZEXA 2JBWA 1P60A 3CLKA 3LQKA 1SKBA 4NESA 1UBSB 2QSZA 1J2RA 1RQNA 3C0KA 3CSSA 3P9YA 4ZKEA 3HFGA 2R8EA 2XT0A 2EKLA 2V4MA 5CDTA 1WCYA 4B76A 1ONOA 3GQBA 5DEOA 3RD5A 5L3ZA 4PZZA 1WW3A 3MBOA 4M8NE 4BQSA 1A5BB 4D1YA 4ENSA 1FL9A 1NR1A 3E4CA 1IJKA 2WB2A 1I5EA 4DYVA 1W1WA 4YCJA 2XGSA 2XLCA 4YNBA 3A9WA 5CLGA 1GSIA 4P86A 3B3GA 2PPLA 3DT8A 3LO8A 3LPMA 3CEAA 4G01B 2AJCA 2JLCA 3EG9A 3F46A 4MW6A 5JCJA 3ZZ0A 4CV2A 2VBCA 1CULC 1JMVA 1GPAA 3BGOS 2EL7A 1D5WA 3IULA 2X0DA 3TBKA 4DLTA 4WBNF 1YO6A 3JW8A 1R4ZA 3OLWA 5IDXA 4ESVA 1SK9A 3ZJTA 3FKJA 4BKMA 3NBYC 5D01A 3DHEA 2XCRB 1N77A 3P94A 2WAMA 4OHBA 4X93A 3SF8B 4OX9Y 4I66A 4LBYA 3TSZA 1HR0B 2RHDA 5DHRA 3U4AA 3IEKA 3ZVRA 1LBSA 1CY2A 1ADGA 3JQAD 3URMA 1ZM7A 2JB9A 2V0CA 3L9WA 5G4KB 5SZJA 5L53A 5B6IA 1EEHA 4JELA 3W04A 1TKAA 3AR2A 5WRFA 3TF5A 4OK5A 7YASA 4N3AA 1ZM9A 2MMCA 4QDZA 5JXHA 4KOEC 1OAOA 1VSBA 5AOCA 1DS6A 1NHGA 3HVHA 4FOOA 3WQQA 5FTLA 3G79A 3I01A 2IXEA 4RE5A 1PWHA 2VJMB 1PZEA 2VWHA 3TQTA 5DX1A 2FPGA 5JCPA 3BXHA 2E3JA 1ORWA 2FWPA 3NYWA 3I01M 1CY1A 1PN3A 3Q5DA 1A9YA 1IM5A 1UP7A 2BPOA 2I4RA 4EPXA 4HSEA 5K99A 1HY3A 1IIBA 2VLBA 1XNJA 2H9IA 5LD2B 4RJIA 4XFJA 1M2FA 1ZM4A 3KKKA 3OJXA 4IH1A 3TKAA 1IWBB 2QRHA 1X86B 2QNIA 2XEDA 1KY3A 2JFUA 1DO0A 1IN7A 3O90A 3GUVA 1XDSA 3O9MA 5CVVA 4QTYA 1Y8QB 2G6TA 4CW7A 1XI2A 3OC6A 5F2OA 3TNDA 3EBOA 4EEZA 4FGLA 4MI3A 5CBKA 1I2ZA 4QXPA 2ZSJA 3TI7A 1CQIA 1K8YB 1CR1A 5CLIA 3A31A 1TYCA 4MA4A 2OCXA 5KTYA 1WUYA 4M0EA 3E3NA 1VA5A 3BTSA 4QVGA 1H1LB 2RHTA 4JXXA 1TCAA 4Q15A 3VOSA 2XT6A 3P71T 1G19A 3TOZA 4UM9B 2Z08A 4BTVA 3RODA 3S44A 4MW7A 1C9DB 1X7WB 3IEMA 2J4CA 1I7DA 2J0UB 2AMLA 2QN2A 1IG0A 3KAQA 5EWJA 2H16A 3GGGA 1FRZA 4N01A 1FS6A 5BYAA 1TC1A 3DE5X 3QOYA 2Q45A 2XSZA 3AYZB 3Q0TA 2C9YA 3SFZA 4AT1A 5BXQC 5C31A 1SCBA 2QAGA 1ZHFA 2IPOA 2PXCA 1N6RA 2QAJA 3KQTA 2PHZA 3OZUA 4I5GA 2KLHA 5JC8A 2VP6A 1BCSB 4R6WA 3ADCA 2DERA 4GYWA 5FBHA 2F1IA 2C4KA 2RH5A 3ONWA 4U6SA 2H7CA 4ER7A 4Z54A 4XW2A 5E4YA 2ZB4A 2FQQA 2GBLA 3KEGA 4RKRA 3PDIB 2PLFA 4EG6A 5L4SA 2EXXA 1U9JA 4GLFA 4CLEA 2OCKA 1NP6A 2GHTA 5EEGA 3JX9A 4LBWA 3I64A 2PGNA 3FAZA 1SOVA 2ZIEA 2QOEA 4ZJZA 3KFLA 3NVDA 1S9DA 2XWPA 1JKMA 3ZLBA 4FE7A 2C20A 1J8DA 3E70C 1T2EA 3INYA 2MSDB 3HCEA 4LVUA 4OREX 3U31A 3HS3A 3Q2IA 2GJ9A 4ARVA 1B43A 4YV0A 1PR4A 4OOEA 1V8ZA 4FE3A 4G56A 1BKYA 4S2UA 1ZYUA 1ID8A 3OX3A 2FFHA 2WSSD 3D1LA 1YOVB 1EBFA 1XQ1A 1FP1D 1JIQA 1OR8A 1VA4A 4QYWA 2OB1A 4TLEA 2Z2JA 4X1KB 4XPIB 1YKGA 4PO1A 1ZD4A 3TLAA 4TQUS 2UVDA 5SV2A 1RWKA 1V1MB 2OMKA 3NBFA 3PC3A 2P69A 3ZI4A 4CCYB 1T9BA 3HADA 1CWUA 2NV0A 3KZKA 3OFJA 3VH1A 4P32A 1VXOA 3ILVA 4PC1A 1OC2A 3VR5A 4OAOA 5I9IA 5C46F 3R6DA 1L4GA 4BVFA 3ZUGA 3DPIA 4RDIA 1A9QA 1GSAA 2M6RA 3GPIA 1IK6A 1ZA1A 5JZMA 2XUGA 4GM4A 2P3SA 2E1RA 3DH0A 3N05A 3GX1A 1SBNE 1T8TA 2HSZA 1P0IA 2NU8B 3DULA 3TLGB 2WM2A 3QSYA 2G77B 1FDWA 4ZPXA 4FJ0A 2RHCA 1LTQA 2BMDA 3KLNA 1C8LA 3LDGA 5HFAA 2L17A 1ZIYA 4DHEA 4XYMA 4EG4A 3W8RA 4JI0B 1JVBA 3SJZA 4LTMA 5FJJA 3B6KA 2JIQA 5FBWB 1BE6A 4O4IF 3CZ4A 4U8GA 2FEKA 2V3CC 4IIEA 4Q4HB 2ATIA 2CVPA 3FKSD 2P9JA 3BKXA 521PA 1B15A 1VI6A 1HQDA 3KWJA 2PZLA 1WVGA 1G7RA 2M2IA 2M6KA 3C7TA 4LZPA 1H65A 1AGXA 5ER9A 1SA0A 4OQLA 1ZFNA 4FGWA 1BGXT 2CLKB 3FTPA 3VH3A 1C1YA 2AXEA 1P2DA 3EXFA 1EE2A 3ABOB 5EMMA 3TD9A 5JO0A 1Q6ZA 3U1BA 1E77A 1ZN8A 1SOUA 1TJ4A 2HRZA 1D2CA 3GU3A 2WW8A 1XRLA 4R2IA 2OYCA 1BHJA 2JEYA 2QI9F 3D0OA 4FHDA 5ECDA 4YONB 2YMLA 3RVPA 3V3KA 1GAEO 2C29D 4F6LA 5EJ7A 5KCZA 1P18A 3IPRA 3BRWA 4BZZA 5CRIA 1DBVO 5DYGA 5FYDA 2ODNA 2NTJA 1FFGA 4CG1A 3PRHA 1G8JA 5KVQA 1GGHA 1E9VA 3FFWA 5ENVA 3LW8A 4E7OA 1KDTA 1SELA 2RHRA 4UDXX 4JC0A 2C9DA 3N2IA 4J4HA 4JQOA 1V2GA 2WD7B 3LZ6A 4KN8A 3K70D 1CYEA 1JYSA 2FWNA 2IEBA 1AA9A 5H70A 1CDDA 1GTVA 2ILVA 3GH1A 1KI6A 2WG0A 4X7MA 3CUTA 3QRWA 4FNGA 1U3FA 4NDNE 3TSOA 3U4CA 3PLAE 4YQYA 1MD9A 3P2EA 5E6UA 3WNDA 3VR0A 2FQYA 2WWFA 3A70A 3PVSA 3SDZA 4NSNA 2ZDHA 1ODIA 5BQOA 1JJAA 5H59A 3V7NA 3W3AH 2CXOA 4BO5A 3A36A 5EIXA 3T38A 1EP9A 2JFPA 2GTIA 2HF9A 4I8IA 4Q7QA 4ZZ3A 1QHHB 2H5LA 4W8HA 1Z18A 4HQ0A 2OZLA 3DZDA 4J4TA 5AK3A 1Z07A 2FUEA 2FZCA 3JAWA 3LUDA 3TDMA 3ZE2B 2GVZC 4ARIA 1HZJA 4IJVA 1NNEA 3EVGA 3IQZA 4TUYF 3DO5A 1HE5A 1M34A 4EAAA 1WLYA 4ZYXA 3QVGA 2BSAA 3C14C 1R6TA 4R40A 1FSPA 4WXMA 2CLOB 1RQPA 3AK4A 4OG2A 2QSJA 4OP2A 4OL9A 4CMGA 2QENA 2OBXA 2O8VA 4YRKA 4QXOA 1H0SA 1UMBB 2AD5A 3KRTA 1RRPA 4KWTA 4TGLA 4PYQA 3D0KA 4PV7A 1EFDN 1D0VA 2GCEA 1XHEA 3E81A 3C6QA 4YP0A 3N76A 1SVMA 3UA4A 1NBWB 4E1VA 4E5VA 4RXMA 4EYSA 3UV7A 2QTHA 3RVRA 1VP3A 1BRMA 1OASA 3JQ6A 5JQGB 2FXVA 1FDUA 2C58A 5LOVF 1D1QA 3KSBC 2DPGA 1HL7A 1W35A 3AUAA 3T9CA 4S1TA 3QMMA 2M1ZA 4AF7A 3EZLA 3PUJA 1E0KA 1UMDB 5EWMA 3R20A 1TU0A 3R9WA 3PGA1 3CNOA 1JKJB 1VL2A 1YBFA 4WLUA 2DFDA 1L5QA 3BGWA 5B3JA 3UOAB 5ALYA 5K2OA 3RT7A 4R16A 3EGVA 3GFRA 4IWNA 2C1ZA 4B4KA 2Z3VA 2NUPA 2IYLD 1FFSA 1R0XA 2R7AA 2P6OA 2YY5A 4C0BA 2WTAA 3IUJA 3AY6A 3QPVA 5ESWA 5AW1A 1X1SA 3B51X 3I0MA 2RAUA 2BFEB 4U39A 1P3DA 1BVUA 5DGTA 2B9VA 3S1SA 1EDEA 3WLQA 4BAZA 3FJ1A 3LIPA 2ZI3A 5K4HA 4XDYA 2GASA 2ZB2A 2CXUA 3HJBA 5AK6A 1L1EA 3JVVA 5FPYA 4ZD6A 4CHTA 8ABPA 3VYTB 1DTWB 3EQ7A 4F2PA 3BA6A 1Z6XA 2UYCA 1U1FA 3WKEA 1JDVA 4Z0TA 5KPDA 5JS1A 2QJRA 1D1TA 1XZPA 3ZBTA 1HETA 1GGEA 4BE9A 1E3SA 2ZK7A 1DV2A 1NF3A 5BQPA 2ZSAA 3UHOA 1LB1B 1OOEA 3E5NA 5EZ6B 1DG3A 4AZ0A 2JHAA 1JQLB 1NFRA 3NAQA 3ESYA 5DCLA 3C6YA 2QZZA 1FXSA 2OO5A 2BYTA 3C3MA 3H5LA 2OP0A 4NMXB 1TJ3A 4P4SB 1GUDA 3HHEA 4M21A 3ILYA 4CT5A 5I7VA 5A5FA 2R6CA 3B1FA 3DXXA 1JIKA 3TQRA 1M5TA 3DZGA 2MU1A 2WJGA 1N7IA 3IXLA 1XT6A 4UZEA 4ZZ0A 1G8KA 3QLUC 1KTVA 1OFGA 3AP3A 1X92A 1J22A 2FEPA 8OHMA 1I36A 5FI1B 3VSDA 1ENZA 5JAUA 1NZFA 2F1HA 2HK7A 5KWEA 1ZAKA 3SP1A 2EOAA 2FMTA 2QV0A 1GG9A 5BWLA 4OV6B 3ENWA 2NTVA 3OCCA 3AOEC 3HCOA 1ZPDA 5F3DA 1QV6A 2M9MA 3FUWA 2J9RA 1T6YA 1V3TA 2ONCA 5TQ0A 2Y9MB 3LNCA 3FUTA 1QG0A 4MDEA 2I1WA 3GZTB 2B5VA 3MMSA 4EPVA 1RI1A 4O4LF 4DQUA 3SDSA 1I3KA 4AKEA 2Q5OA 1YTLA 1EWTA 1W75A 2F1RA 2AEJA 2ZYIA 3G8BA 3K9BA 4CQMD 3FIJA 1QANA 1HBJA 1LBTA 3GUCA 5B1HA 4ENUA 1VHQA 1HEUA 3EGIA 3MQ2A 3RF6A 3ORFA 3CRZA 1RXYA 3LSYA 1UPFA 3GBPA 4H1TA 5THQA 4AY3A 3HKDA 4G67A 3QKSB 1K9VF 2IXTA 3FCXA 4JA0A 4CMIA 3A7DA 1MENA 2FSVC 3OIFA 2RK3A 4DR5B 3OFND 2GLUA 5LMUB 5AM4A 2JIZD 5K8JB 5IJ0A 2BDTA 2CCKA 4GI5A 1E8NA 3NKVA 3ZHUA 2O2JA 5BWNA 1D2AA 1GZSA 2XODA 4FMCF 4HQLA 4JBIA 3V8NA 4G89A 1I2MA 4BNNA 2BLLA 4DQKA 5ARDA 1U31A 2HLPA 5G0TA 3TRFA 2G9VA 1XQYA 5FAXA 3E9NA 1GA1A 4J0EA 4C0SA 3AHIA 1ZH0A 4FBGA 4D8UA 2FPOA 2KW5A 4Y2VA 1CZUA 1VGRA 1TZJA 1G20A 1SCUA 4LHWA 3HV0A 1EFRA 1DIAA 1ST3A 1N2HA 1H4SA 2DJIA 3C3PA 3TCXB 3GLFA 4WOJA 5C5EA 1NRJB 1A71A 3NXKA 2H2FA 3U60B 2PZ8A 1JU4A 4XRRA 3ZCTA 2FFJA 4UKDA 3FBTA 1UZMA 3HBJA 3L0OA 1E1KA 1UAGA 3LT4A 2ANCA 2NVUA 4X61A 1Q95A 2XKJE 4Z2YA 1T4DA 2GPTA 2ETXA 1CUBA 1QYCA 5BQ3A 2HF7A 2Z2YA 4KQFA 3EBLA 1K5HA 2D1SA 1WL8A 1C9NA 3AY7A 5AKLA 5FEMA 3OQNA 3OEWA 3GJ4A 4HNQA 5KX5F 1C3VA 1QCZA 2EWWA 3RJMA 4NQRA 2FMIA 1A69A 1X80A 3RTEA 1IZ9A 2A0YA 1UCFA 4E5KA 4ZCRA 1NW4A 2XE6A 3CUKA 4RTQA 2JA2A 2OD2A 2FSIA 4XQCA 3PJGA 4AYTA 3GA7A 5AVOA 3NDJA 5JT1A 1L1RA 1TW3A 2P7HA 1WSWA 1Z36A 2HJ9A 2CY0A 3ELBA 4GSLA 3TZLA 4DLPA 1ES9A 2CK3D 1T2UA 1DSSG 3L8GA 1KL7A 4YQZA 3ZVLA 1EHCA 3MS2A 2CVZA 3I05A 2OGWA 3EIEA 3GFQA 3ZWAA 2GD1O 2C5AA 3HDYA 4KIGA 4TYMA 1R5OA 3V8MA 3ZE1B 4J29A 1V2HE 3WO0A 4PCLA 1KFJB 1TM7E 1FCJA 1A4RA 2QEQA 5DWDA 5IUKC 1PUJA 1SBHA 1KWKA 1ETHA 2EBUA 2H5JA 2O4CA 3A1EA 2GD6A 4UPVA 2AOUA 3E9CA 3NNSA 3OWXA 1OZGA 5F2KA 1N2CE 4B9EA 1CIVA 1R50A 4TLDA 3ZGLA 4S24A 1IVSA 2C7GA 3E18A 3KFVA 5D1NA 2O06A 3ZGZA 1EWYA 5LBTA 5HHTA 2PPVA 1G5TA 3OQ6A 5DP2A 3HB5X 1KZ9A 1ZOPA 4O5AA 1J2TA 5GM1A 3VAAA 1G4UR 2IYTA 3IODA 3INRA 4KUGA 4EUFA 5C4IA 4QDUA 2G80A 1LBQA 3RRNA 3SFVA 1OB2A 3AM3A 3Q85A 4M8KA 4M83A 3V6LA 2Q49A 3NWBA 3KKMA 3RSOA 1XTRA 4IKEA 2GRUA 5BV0A 1NP3A 1R37A 1B41A 2OWEA 5JZ9A 4F5YA 3EZ7A 1XMJA 1ZICA 2ZQ5A 3JYQA 1Z0AA 4BNLA 1XNRB 5CFMA 1YS2X 3L6RA 4J03A 7GPBA 4LMBA 3SC2A 3J7TA 2ARKA 5K0EA 2YZGA 4DCCA 3DBLB 5NLLA 4JOQA 3VMMA 4AO7A 2QDXA 3B85A 4NOJA 4BMCA 4DDUA 2DHCA 4NLLA 1YBVA 1IL0A 1T5OA 4P83A 3M70A 4ZV9A 3A1NA 5B1IA 1IZ7A 4Q1VA 5D7NA 2VQ3A 1BHSA 2I3ZA 3AR9A 1JIIA 3WHLA 1DQPA 5J9FA 5BN5B 4URXR 5J2TA 5BUQA 4ZTZB 1P19A 4GOKA 2OILA 2PZEA 4D9GA 1BU5A 1BMQA 1K08A 4LEIA 1QP4A 5FTMA 3FOBA 4GOMD 1RI3A 4PLTA 4Q1AA 1CG6A 3H8WA 3G9TA 4ESEA 2FAXA 3TSCA 4I4TA 1WWKA 3SEZA 4RTLA 3HJRA 5G3ZA 2DR0A 2ZRJA 5I4BA 5CH5A 4CLOA 2XYGA 3FCCA 1R0YA 4R8LA 3BB4A 1IZYA 4PBRA 2FWBA 4XWWA 2EP5A 3ENVA 4M9RA 4KLCA 4Q7JB 4K9OA 2W42A 3JQGB 2FB9A 3C1TA 4OVKA 4Q9KA 3RAEC 5AXDA 1JECA 4A10A 3F0TA 2MT9A 3ESCA 3WLTA 1BN6A 3V97A 2WD9A 4U2EA 1RXVA 5C1OA 2QYTA 1WNTA 3GGJA 2X19A 1SOAA 2W9XA 1IN4A 3JWPA 1KO4A 1RBQA 4NIMA 3G1WA 3GZJA 1QPGA 2NO1A 4DZTA 4QPDA 3E53A 4OQQA 1Y7HA 3CZPA 1V3QE 4EYGA 1OWOA 1PO7A 3NX4A 2CB9A 4D4JA 1GRRA 1FDTA 2KB0A 1JVSA 2OORA 2ZSEA 5BQ5A 2IXBA 5EZ5A 4BB5A 4BU1A 1FBNA 3N7AA 3DFIA 5J43A 3PQ7A 4U4AA 4L8GA 5KNDH 3BB3A 1Q12A 2YHBA 3CLTD 4Y0VA 4BKPA 4N82A 1U5BB 5FCDA 1GU7A 4B3FX 3OQPA 2GRJA 3CSUA 1REQA 3D8NA 2QTVA 5JU6A 4N40A 2IIVA 3B9PA 1X7XA 2Q1WA 5A9SA 3A2KA 1OI3A 3FNIA 2ZIGA 3NJRA 2CC2A 1D8TA 1NVXQ 5DTJA 5G41A 3TJZA 1AHNA 5C9ZA 4GI7A 4U02A 2WG1A 2H4XA 4JZKA 2WY2D 1U8FO 3JQ7B 4LCEA 2WZCA 4MLPA 4GMXA 3U3DA 4CT4B 2PSFA 2WG2A 4FJ2A 1D9XA 1N3IA 1CS0A 3T3HA 5LQKA 3ENKA 2OWDA 2DBQA 1VKOA 1NVDA 1UADA 1O8CA 3AF4A 2X0JA 3E35A 4WRRA 1N5MA 3ISVA 5GM2A 3PEFA 1A4IA 4QOHA 3OCVA 4WW0A 3MXOA 5E6SB 5EJGA 3PJFA 1Y4UA 4KP7A 2FPXA 4EY6A 1EFCA 2QX9A 4MUEA 2PUDA 1D1PA 1YB7A 1EQ2A 2P1DA 4K8OA 3BRWD 1DQNA 1L5KA 3O8OB 4B5LA 1DLIA 2H4FA 5CDYA 2ZE6A 3EDOA 4BB6A 4OLAA 3CNQS 2VA8A 5AI6A 2VYNA 2RI6A 4OLFA 2V7VA 3A3YA 2IPXA 2YIDA 3L7OA 3O83A 5EVJA 4Z3OA 1DAPA 2NG1A 2VOJA 4MQBA 5EC8A 1YA6A 1KRHA 3WGNA 1RWMA 4HNUA 3IP9A 4FDUA 2I2AA 4JEUA 5ALZA 4MUXA 4B4UA 4D3FA 4EDHA 3NHZA 2NYAA 4YJKA 1RCTE 2HK6A 2Z30A 3DXYA 1A1VA 2WIBA 2WTMA 2QN6A 5IMBA 4WN3A 4KO1S 4DLVA 4RZUA 1H85A 1T3LA 4QWMA 4KPYA 4CM8B 2R8BA 1IAVA 1JDJA 5AXBA 5BWBA 1PS8A 2F9FA 3OCWA 4L5IA 2O9JA 1ZONA 4QUKA 5FORA 1QIIA 3R7WB 1NQTA 1R6UA 1UFRA 1RWPA 1VJTA 2OVFA 1VLJA 1Z8HA 2ADOA 4MO2A 4NJMA 3EARA 1GGJA 2PRKA 1XMPA 3T4PA 4DAOA 3SPXA 4CU2A 5KJ6A 1RW4A 4FZJA 4N47A 1VYHA 2AN9A 2ZPUA 3BK1A 3L8DA 3QYJA 2GSWA 1SPBS 3B1ZA 3PNOA 2C9BA 3IUYA 2E82A 3EFHA 4Y2SA 2P5UA 3HXTA 3N2GB 3RUAA 1IBRA 2GYUA 2J3QA 2VG8A 2P40A 3B3FA 5ILQA 1RCFA 1AB5A 4K9RA 5GP1A 2V0GA 1DRUA 2IXAA 3LYUA 2QBYB 1L5FA 1XL0A 1KNQA 4I9HA 1RI5A 1YB5A 3PICA 1SIBE 4MHOA 4RS4A 1GL6A 2GN9A 2HREA 3GFFA 1KJQA 3RRMA 3LXMA 2Q3HA 2UZ4A 3LTNC 3THWA 3NWOA 3KE9A 4HYEA 2JEZA 4L7VA 4DL9A 3BH0A 2YYZA 1PE0A 1HDCA 3BL8A 2JJ8A 2Q2VA 4LBZA 4W1PA 1PSDA 1M8PA 3AWDA 3GGPA 3HGTA 3T9EA 1PFYA 1Z7BA 2XDQB 4D8WA 1R12A 2P0AA 2R11A 3K94A 4KAXA 3SZRA 1GTZA 3K9WA 1FMFA 2P9GA 1EX7A 2R8ZA 3SHVA 1DT3A 2BSXA 3AFIA 4TV9B 4AZVA 2OKGA 1MAUA 5FPKA 3UBMA 5KOHA 1X2EA 1LBEA 4KDEA 3W5AA 4AB1A 1DKMA 1YWGO 4BN0A 1V45E 2PVCA 1E2JA 2ZI4A 4PBTA 1Z39A 4ZA2A 1YZUA 3W5UA 5SY4A 2GM4A 3P2YA 3T6KA 5M5BA 2A4MA 1P62B 2ZW9A 4M7RA 3OU2A 2HLHA 4CF4A 5T4FA 3ILXA 1GILA 4KQ1A 4ASUD 5HZGA 2JFGA 3GRVA 3KOUA 4RK0A 2CL7X 2Z57A 3WIBA 4LYEA 3E8MA 1DQZA 4DQ0A 1EFKA 3ZV6A 5KVAA 3K1TA 3NHKA 5K6RA 1E2IA 2X8LA 2ZRIA 1E2FA 2OK8A 4KQIA 1G8GA 4JS0A 1OZAA 3LUJA 2M98A 1M7BA 3K0BA 4IDBA 5CLJA 4KPEC 4JBNA 1YCFA 4QHTA 4URZR 5DPMA 4IWXA 4MCHA 2X5KO 3D4NA 5EMHA 5JW6A 3BHMA 4PONA 2ZYVX 3DM9B 3FTDA 2DHEA 4YDHB 3VJLA 2VTVA 4AAYA 1SY7A 1CXZA 1E9CA 3COZA 5DNEA 4EG8A 4OMFG 5KNCD 2AR9A 1DMRA 2PKCA 2RH9B 3GFVA 4OQNA 1KQOA 2A9JA 1N2XA 4LXHA 5T6BA 4N7BA 3WGIA 4B8ZA 2G9QA 3PA8A 1PR5A 2WMYA 3H1AA 3MJ4A 3SLRA 2DH5A 1QGOA 2ZB7A 2BOVA 3EY9A 1LW6E 4MV7A 3W7BA 2CDRA 4EEKA 1QU3A 2G71A 1OX4B 2HV9A 4NCNA 4XUGB 1MRSA 4P5EA 3EUEA 4PTYA 1JWAB 1SHKA 4BS9A 2YW2A 2JI7A 3EYWA 2ZBVA 2WVHA 4PLPA 5LA6F 2CNKA 5A06A 2YJGA 1QORA 1P3Y1 1V1JA 1BE0A 1YDMA 2VHQA 2IITA 2G4LA 5L4NA 2F17A 3SJ7A 5K3OA 1VLHA 3RVQA 4JA2A 1TUGA 5DI3A 1M66A 5BR8B 2RC5A 4I8DA 4M9ZA 3KV3O 4KSCA 5DHSA 2NZXA 2P79A 2FPRA 3L7KA 1EFTA 1THGA 4GU5A 4ND1A 1LLQA 4XQ0A 3F6BX 4Y30A 1KZ6A 2ESRA 3GEHA 3MOGA 4JVSB 4PQRA 1W0JA 2FX2A 3LT0A 3OEEA 3EXG1 5J4YA 3LYHA 4GGPA 3BORA 2JFNA 1K98A 3OJCA 4K6GA 2ENUA 2NO7A 2XNDA 2CEKA 5IVHA 3CJRA 2H07A 5CNKA 2YV2A 3LLVA 3A2MA 4BNDA 4QQFA 5F64A 5IF3A 4LIPD 5L3SB 5CT8A 1NFQA 5DHUA 2AZXA 3TVTA 4HMPA 3GOHA 2E89A 3IDZA 2J9GA 3HU3A 3LHDA 4PWZA 4BB9A 3AQIA 3PEYA 1OW3B 2J59A 1T1EA 4FYXA 1BE1A 2HU8A 3U49A 1JMKC 3CO0S 3EVEA 1E59A 4YREA 3QH4A 4KFTA 3HYRA 1E3JA 3ICOA 1BO6A 5AJUA 3R9XB 1J1IA 2FZEA 2OTCA 2QX7A 3RKRA 3OFVA 5ALWA 3VU0A 3RWBA 1PG2A 3TFQA 1XRNA 2ZRLA 3AU8A 2RAFA 2ZR0A 3OKPA 2YC2C 4HQRA 4ZOLB 3SZMA 3V00A 2A9QA 3F73A 1DQSA 1V8DA 5AKZA 3EIOA 4B17A 2QY9A 4CIYA 1RXUA 1X1BA 1WKBA 2BGTA 2DFVA 4OKSA 3ES9A 2WTEA 3CLTC 1SURA 3TE7A 3WJ7A 4IVQA 1B6GA 4ZAWA 4C14A 4ZCTA 2FDXA 1L7QA 2JD2A 2H2AA 3FTQA 4YP9A 4B35A 2YDYA 5K0ZA 3DDZX 1SGWA 4EPWA 3ABZA 1KXJA 3E9RA 5DISB 2QLFA 1SG0A 2KM1A 2I8AA 4Q3LA 4F5DA 4DLZA 1Q7RA 4F91B 5M2QA 3NETA 1CR2A 3NT4A 4KLZA 1MH9A 3AERB 2V7GA 4QUJA 1JIUA 2CHFA 3F8WA 2HWUA 3GP5A 2FX3A 2EEPA 3OZVA 4D56A 5L6MB 2FPUA 1NUSA 1VHWA 1YA8A 1KYZA 1FSZA 2AZMA 1S3FA 2HQ1A 1DO8A 1YMUA 2CLLB 3OEHA 5GIPE 4EO4A 4LJAA 3IUQA 1XTVA 1E79A 1JEQB 3ML1A 3BHNA 1MKYA 1Q7TA 4HXYA 3IC5A 4ZAZA 1N0WA 1M6NA 1D6NA 2DFNA 3K1JA 4TTIA 1NSFA 1N25A 1V5WA 2PIDA 1SZJG 2Z2IA 3MFYA 5C5CA 3T7SA 4YIHA 1G21E 3PNPA 3FSRA 4QYMA 3UK1A 4UBJA 2QXYA 3WL6A 3RVNA 3SE0A 5J4LA 4C2UA 2ECKA 1QPBA 5G0SA 3RRBA 2ZJ4A 1V6SA 3S70A 2DBRA 3NP7A 5G1PA 4BO3A 5CGZA 1AMOA 1AKQA 2VRBA 1WB9A 4HH0A 4BV3A 3LX4A 5AUPB 4BNHA 2YMQA 1VBKA 2HFJA 4OL0A 2DAPA 2I2XB 3UUFA 1PR0A 1NAIA 4I55B 2FLWA 1NUPA 3D8BA 1G6Q1 2FFAA 1MB9A 3WYGA 1OH5A 3GJRA 2ZI5A 3KKLA 3DYVA 3MCTA 5JPCA 5LL6P 3EWNA 4CTKA 3LK6A 4KRXA 3GQVA 1V26A 2WYUA 1Z06A 2AG1A 3FRJA 2NO6A 4I36A 2H1HA 4IF6A 4RY2A 3VU8A 4AZSA 3UJ9A 2QG6A 4CFZA 2J6IA 3ORYA 3QHAA 4DIKA 3BCHA 1DXHA 2JLRA 3RVKA 4II3A 1E2QA 2CXXA 3K16A 3PC8A 5HDBB 1YSCA 4TSFD 4OCZA 4DUZB 1QHYA 3NWJA 4RM2A 5BN1A 4DWOA 1QIFA 4K1LA 3VOAA 4ID3A 1AHHA 2WKSA 1PQPA 1IY0A 3CCFA 4V2IA 2C2GA 1NXTA 1P61B 3ZC3A 2LR0A 1EAYA 2PS9A 4FTWA 3USES 1YS4A 3DQQA 1UC9A 5LQAA 1RHMA 5D87A 5FO0A 4CKCB 2AR0A 4Y9TA 1QK4A 1S6YA 2ZIVB 4TKZA 2NSYA 1DPFA 1Z8DA 4RH1A 4EP1A 2W2KA 1U7HA 3BS4A 1FFDA 3WZLA 4BP9A 3EPLA 1FUUA 3KPUA 3A4MA 5H9WA 1ZUHA 4UJ3A 3UXHA 1QTIA 3PFCA 2Y1CA 5DNCA 2JLUA 1RYYA 2O8DB 2G67A 1N3LA 3PZBA 3L5OA 2GAAA 1MXFA 5JAMA 3H2BA 4GPEA 4BPRA 2JGLA 3FWHA 2PX8A 4WDQA 4WZBB 4AECA 1GPYA 3T1TA 3KQYA 2YNMD 1E6EA 4A92A 3HKCB 4E5NA 1VLMA 1UJMA 1NJFA 2Y1WA 2DBZA 3TYXA 4HDAA 3IJ5A 4GX2A 1P3JA 4KLNA 2VCEA 1C7RA 2C8LA 2VJPA 2Y0PA 3ZEAA 3LLCA 1LQTA 1R15A 2E4YA 2NU7B 5AXCA 4EFLA 3CF2A 5B3JC 1U8TA 1JHZA 1YD7A 4F56A 1WV1A 1MX3A 4LA4A 3VH4A 4AXBA 4DT1B 4F6RB 1XZJA 1KKMA 3KOZA 4D97A 1KVUA 1AQ6A 4FLFA 3WL5A 1UIMA 2W2PA 1USWA 2POQX 1C4OA 3FPLA 4UC0A 4HB2A 5HIMA 3K0CA 3VYWA 2BGGA 1FTNA 1HE1C 1FBTA 2WOJA 4RVUA 3CLRD 3NO4A 3I61A 3O75A 3EASA 3ENNA 1CC1S 1JG7A 3WMWA 4FI3F 5IJ9B 5FOVA 4Z49A 3VA7A 2E0IA 3QUQA 1RJWA 1W4RA 3D4OA 3GEPA 4ZVQA 3ZY3A 3DWFA 3K6RA 3RS7A 1KETA 2PV7A 2WHPA 1G3QA 2PLAA 5IM5A 4Y6PA 4ERXA 3ZXIA 1MJGA 1WOMA 2YICA 5EIHA 4EI7A 3KVRA 4NAVA 4IEFB 3B9RA 3O8QA 3KHKA 2ETVA 3AHDA 1ZIOA 3BH7A 1YASA 1H4TA 5HCUA 1MJGM 2OO5C 1HXHA 1B00A 1M2VA 2AEEA 1TJPB 3CRW1 2BH9A 1V7ZA 2HQRA 3DDOA 3ED1A 4H08A 1Y8CA 2NU6B 1P0PA 4IW3B 4LSWA 3EH2A 5KIAA 2ZDGA 3RYCB 4L75A 4EF4A 4C22A 3M3HA 3KUKA 5TY0A 4OXXA 2GDJA 1VCIA 2IQ5A 4Z1MA 1OFVA 3EXHB 4HPWA 2VTBB 4MW2A 2OHJA 3O3CA 2QGNA 3LBAA 5BYJA 4P9NA 3ZDBA 2ZLBA 3PLRA 4JR1A 2MTBA 3BL5A 4HDNA 3B1KA 2VNHA 3GF4A 4OXIA 4C7BA 2XHZA 3ZY6A 1Z5VA 1UK7A 3UGJA 1ORIA 2IKQA 2OD7A 3L7JA 4KXYA 3UMSA 3NDBB 3S40A 2FOIA 1DC3A 1Z4PX 3NHBA 5DYWA 3IO3A 4BUZA 1MEEA 4AYXA 4BO1A 5H4HA 1T1SA 2R7LA 1GDHA 6GPBA 2XRFA 2ZXFA 2VDOB 5T4BA 3SAJA 3WP0A 5K8IA 4EG3A 2BH2A 3IHKA 3OFKA 3FUCA 1BXKA 3DW1X 2Y0EA 4N65A 1GV0A 1P4HA 4W5TA 2R7NA 2I2CA 3VR1A 5C34B 2HF2A 4BEWA 3F3MA 5FH9A 1Y1SA 5JBQA 1K8XB 3DT6A 1TPYA 4OUDB 4JXZA 1MC8A 1CUWA 4Y0NA 4XCXA 1Q3TA 3STYA 2WVGA 3JPYA 2HYIC 2ZR8A 1B76A 1I3NA 3HNOA 4PE5B 3KJQA 1Q1QA 4DBLC 3PKIA 4Q1CA 1BYUA 1MGPA 2P5TB 2XMGA 4GRAA 4LYJA 2QD4A 4M60A 4PZ9A 3U7IA 4EAQA 1C0PA 5C5IA 3PQ3A 1JFVA 4ZHSA 2JFXA 3MB8A 2W6JD 5JLAA 3BJRA 3KG2A 3R7LA 3LYLA 5JWRA 2B8WA 5CTAA 821PA 4TN1A 1Y5NA 5ECYA 1UBTS 3MJRA 1EQUA 4YJ2F 2QMYA 1FP2A 1LPAB 4H18A 3AFOA 1SCAA 5SZHB 3PA6A 1X38A 4YJ3F 4ZEMA 5JRZA 1X7ZB 2H4YA 2FPPB 4DJ5X 4LVOA 4V38A 2G5TA 2IE8A 4WLNA 1MJHA 2YHIB 4UXIA 1C41A 1Q7BA 3PCXA 4N76A 2D5AA 1U2EA 1KNXA 2TMDA 4IRUB 3DV9A 4C9BA 3A1VA 1N32B 3TFWA 3AJRA 5BSKA 4GGOA 4K9SA 4EGJA 1MBZA 1AMNA 2BISA 3AZOA 1C4KA 1ZUNB 3AP1A 3DC2A 3S2IA 4BLOA 4EB6B 3TQCA 2IQIA 3VR3A 3WQRA 2V7QA 2ZYWX 1LWNA 1NNUA 1DRKA 2Q5QA 2VFAA 4R2XA 3B38A 2PAFA 3S8EA 3QFTA 2HSWA 4LV6A 4AWXA 4D46A 1LQ2A 5JVDF 1OTXA 1ZBQA 1ICEA 1EGQA 3WYEA 4LE1A 3DCNA 1YJ8A 2FSUA 1F0NA 2WK1A 3F6YA 2OHIA 3H5RA